3P14A

Crystal structure of l-rhamnose isomerase with a novel high thermo-stability from bacillus halodurans
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
414
structure length
402
Chain Sequence
b'KSQFERAKIEYGQWGIDVEEALERLKQVPISIHCWQGDDVGGFELGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Isomerase
total genus 151
structure length 402
sequence length 414
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3p14A00
2NQJA 1S5MA 3U0HA 2OU4A 1XIFA 4GJIA 4A8IA 1XLFA 3OBEA 4X61A 6XIAA 4J4KA 5EMKA 4OVXA 3VNLA 1XLGA 4K1GA 3IUHA 3UA3A 3M0MA 2Q02A 3CQIA 4E3VA 1XIGA 1QTWA 3AYVA 3QZAA 4HHMA 3C0SA 1O1HA 3BZJA 1XIBA 3XISA 3C0QA 1DXIA 2GUBA 3M0HA 1XLJA 1A0EA 2G4JA 5EMMA 1XIHA 8XIAA 1A0CA 3KBMA 3KCLA 2NQHA 1GW9A 1XIIA 3AAMA 9XIMA 4QE5A 2XINA 3N4AA 5EMJA 4ZBCA 1XLLA 3LMZA 4QE1A 4QDPA 4GJJA 2QULA 5TNVA 3TVAA 4XISA 5XIMA 4XSLA 4KW2A 1XIMA 3AALA 3VNJA 3QYSA 1XLEA 5EMLA 3UU0A 4A8LA 4A8NA 4ZB2A 3VNIA 5H6HA 4GLEA 2XIMA 3XIMA 4QE4A 3U3HA 4X63A 7XIMA 1YX1A 4YTRA 4ZB0A 4GQBA 3AYTA 3BANA 2I56A 1K77A 2NQ9A 1OADA 2GVEA 5J8LA 2G0WA 2GYIA 3BDKA 3KWSA 3M0XA 3KCJA 3BZGA 3ITLA 4X60A 3UA4A 1BXBA 4W4QA 3KBNA 3ITXA 4EAYA 1XP3A 1XIJA 1CLKA 3CQKA 3IUIA 4EACA 3CNYA 4QDWA 5AVHA 5FA5A 3VNMA 2HK1A 1QUMA 3JU2A 3ITVA 4Q7IA 5B7ZA 1XLHA 1XLBA 5XINA 4K3ZA 4XKMA 4XSMA 1I60A 3NGFA 1TZ9A 2HCVA 4HNOA 1BXCA 4YTQA 2ZVRA 4G56A 1XLIA 3TC3A 1XYAA 1XYCA 3C0LA 2X7WA 3M0YA 4QEEA 4YTTA 8XIMA 4PGLA 4XIAA 1MUWA 3BWWA 3FVMA 3IUDA 3UVAA 3ITTA 1DIDA 1QT1A 4A8RA 4DUOA 1XLKA 1XICA 3XINA 3UXIA 1XLMA 2QUMA 1XISA 1I6NA 2J6VA 4YTSA 9XIAA 3CWHA 4PFHA 5C9ZA 4QEHA 3KBSA 4DVOA 1XYMA 3QC0A 2I57A 2ZDSA 4YTUA 1XYLA 2QW5A 5I7GA 1XIEA 3KTCA 1XLDA 5AVNA 3VNKA 3WQOA 3ITYA 3KCOA 5B80A 6XIMA 1DE6A 3ITOA 4US6A 4HGXA 3CQHA 3DX5A 3DBNA 5B7YA 4LNCA 3GNXA 3L23A 4ZB5A 4HHLA 3CQJA 3KBJA 1MNZA 3KBWA 1XYBA 1D8WA 1XLAA 3M0VA 3P6LA 1DE5A 5XIAA 1DIEA 1XIDA 3KBVA 2XISA 1S5NA 2X7VA 5H1WA 1XINA 1XLCA 3VYLA 1A0DA 2GLKA 3P14A 4XIMA 3M0LA 2QUNA 2HK0A 3QXBA
chains in the Genus database with same CATH superfamily
4FLQA 4JOMA 3IV3A 2PLKA 1XH0A 4B16A 2OGJA 1P0BA 3FEQA 1OQFA 2Q02A 3BGGA 4KEZA 4FI4A 1QNRA 1TWZA 4TMCA 2E67A 1BVZA 1EQPA 5FAJA 5IXEA 4FLOA 1ECEA 2JK2A 3VKDA 1MXSA 4NAEB 3BOXA 4H9VA 1CXEA 3SJ3A 7REQA 5XIMA 3RM8A 1R3RA 1E0TA 1VYPX 1X8CA 2Z25A 1KO0A 4J7RA 4A8NA 3TONA 2GOUA 1J2WA 1POKA 3BQ5A 2C8NA 1GEHA 3VIOA 5C7HA 2E7FA 2HBVA 1DJIA 3SCTA 3B0UX 1LRQA 3KBNA 3R1ZA 3MY9A 4NNBA 3QPEA 1FOBA 4Z2IA 4EF9A 1KFWA 3L68A 3N14A 5DMYA 1TJ2A 3RX4A 3E49A 3N9KA 1ADSA 2VELA 2PRHA 2WOQA 2C18A 1QU4A 4IFKB 4WSJA 2O4MA 2VQTA 4DNMA 1H7WA 1XICA 3SQLA 3SRHA 3CWHA 4MIMA 5HJXA 3HMJG 3TW7A 3G1AA 1QHOA 4D1JA 3CUXA 3MP5A 4AC1X 1XLDA 4QDMA 4GQRA 3UWWA 5HAOA 1MNZA 1GT8A 1SFTA 1E73M 1F4HA 1PIFA 4GUFA 2C7FA 3MBDA 2ZE0A 4O19A 2FPVA 3STCA 4XAFA 4PRRA 5M5DA 1C8YA 1CGWA 1HKIA 1L8NA 2O92A 5DCBA 4YWIA 3MI6A 1SR9A 3DZ1A 3WN6A 4DLFA 2XU2A 1WV2A 4QTGA 3LG3A 3SUVA 2A4AA 4LBSA 2G3NA 4CCCA 5K7JA 3EOEA 4YNGA 4RNFA 1DQUA 4OV4A 4LEQA 1C29A 2BOGX 2O9TA 4RZ5A 4ZSTA 3U7VA 1V7AA 2J9XA 2ZA2A 4LYRA 3CV2A 4YCPA 4UNKA 4H3DA 1OCQA 5BOFA 4CQAA 1OT1A 4W4QA 3W0KA 2VGGA 2DT0A 1EIBA 2ASHA 2P0IA 3LK6A 4UTIA 3NZ1A 1OABA 3E2RA 1J0HA 2Y4SA 1D3CA 1I60A 1AH0A 1QNSA 1UWRA 3AS1A 1BPLB 1WP6A 3BLPX 4JN8A 2JQXA 2A85A 2G3JA 4MPQA 2DZAA 4RV3A 4FR6A 3UWZA 3FSTA 3A4XA 5G5IA 2FB2A 2ZQ0A 4URIA 3H53A 4GNVA 2J24A 4WGHA 1A49A 4ZZ9A 3N17A 4A35A 1RJPA 4WSHA 1GCYA 3G8EA 3P0XA 4EPDC 5XIAA 1LUCA 1XFCA 3OVPA 4AIBA 4L80A 3W02A 4GGBA 1FUYA 1YBQA 3TTSA 3SECA 3V3WA 4KFNA 2REQA 4Y8EA 2DZXA 4ECLA 1WKYA 4UQDA 1RJRA 3LBMA 3B97A 1FY6A 3UESA 3MMTA 1W1PA 3IIXA 1W17A 3GQYA 1AVAA 1MQQA 4R9XA 1F73A 2GGGA 2BASA 4K39A 1N8FA 2XINA 2JBMA 3K1GA 4Y9OA 1E6NA 4EXBA 1RJQA 2EXOA 3ES8A 3MHFA 4WOZA 5D9NA 3RDKA 3BPWA 1HKJA 2V3EA 3GDKA 3ZFHA 3WLJA 1FDYA 3DYOA 1P0EA 1QPQA 2W62A 5A8OA 4F0HA 3G1HA 4JIIX 4MG4A 4JNZA 1ONEA 1DJQA 3UPWA 3CPUA 2AL2B 4ZFCA 2DORA 3P0WA 4N02A 3TN4A 1QW7A 1ZALA 3EX2A 1FWGC 4GKTA 2D22A 4O53A 4NJGA 3H22A 4CUCA 2ZYFA 2PWGA 2G95A 4HU3A 2CZVA 1TRDA 1U83A 3GU1A 2XGZA 1JDFA 4LS2A 3AXKA 4P7QA 5A8PA 5I3GA 4AWTA 3CUZA 3TMLA 1A3HA 3LCIA 2C1GA 2BB0A 3ITGA 3OGSA 1KM1A 2YR1A 1ISVA 1QHZA 1DWJM 5HJLA 5FIPA 3C2EA 1XYBA 3KAOA 5CPQA 3E3HA 4FR1A 2ISVA 1OJXA 3VPLA 4Y90A 4J9JA 1PX4A 4MJZA 4GUIA 2ISDA 1DPMA 5HQMA 4K1GA 3TSMA 1JDDA 4NIRA 5A8NA 4NI8A 4Q8MA 1TWWA 4NAFA 4DPQA 4CNNA 4C90A 3EOUA 2J7DA 3MZ2A 3W1QA 3RHGA 2WNNA 2FFIA 3WJWA 4F8XA 1WXYA 2UWFA 1IV8A 1EP3A 1U1HA 1XUZA 4N9EA 1J79A 3IVUA 4TV5A 1HJVA 1VF8A 3TP4A 1ZAIA 4HMDA 2VUNA 3WJYA 5G1MA 2PURA 1VFTA 1W2PA 4DLMA 5JBEA 2MUCA 1PB0A 2C71A 4O4WA 2Z1VA 5FKYA 3OQ8A 1VBGA 4K8HA 4UWMA 2BY1A 3JS3A 3MP3A 1V03A 3FHAA 1A3WA 4XKMA 4L6OA 3KW3A 3MKVA 4OIFA 4NJIA 1DL3A 4N9BA 2ZUUA 3H7UA 3KTXA 1UPMB 2E4TA 2C15A 2HSAA 2QQ6A 3CAKA 3UWQA 4RXGA 1TV5A 2R1MA 2QAFA 1IE7C 2DVXA 1LBMA 5K9DA 1VCFA 4FIQA 3MW7A 3DGBA 3GVQA 2WVTA 4HIBA 4DO6A 3F4CA 5JVLA 3LPFA 3N6HA 4UTWC 2QDGA 4M5PA 4PTWA 1XBVA 2O55A 1BTCA 1GQJA 2ZWYA 3WD4A 3P80A 1K1DA 3EZ4A 1X7FA 2VRQA 1C8QA 1KCZA 4DY1A 2FGZA 4I5UA 2Y24A 3ISIX 3HV8A 2PPGA 3S5NA 1OX5A 2PA6A 1VD6A 3HBLA 1GJWA 3E0IA 2PWVA 1RCXB 5DXXA 2RAGA 1IEQA 2ZZ4A 4WDWA 5M03A 4HKPA 2EEXA 3W7DA 4PTDA 5CC7A 4BQ3A 1MYRA 4GISA 1OFDA 1EIXA 1F3EA 4GI6A 1W9PA 1J93A 4M0XA 4H4IA 3P61A 1ONWA 3VMOA 2F61A 1XD1A 3V7PA 2HQAA 3JU2A 3ZQ9A 4ADUA 4IFOA 1FP8A 1FKXA 1W9UA 5DO8A 4UTWA 4YTTA 3ZT7A 3I6EA 4O11A 4DUXA 4YS1A 1MW0A 1KBBA 2QCDB 3QFWA 4XZ9A 4CN4A 4MJ2A 3P74A 3KTCA 4FP1A 4M29A 1J5SA 1GOIA 4AF0B 4DHGA 1E1CB 1F61A 1E1FA 1JUBA 4MNMA 1ZU8A 5AC5A 1OC5A 1IEWA 4D6EA 3HV9A 2BFGA 4WIWA 1G4SA 3TQ0A 3NOEA 1Q6GA 4PSPA 1CNVA 1JZ5A 4NP7A 3VOIA 4LRSA 1WPCA 2V0TA 3TC6A 3PUEA 4FOJA 1JCNA 1H3GA 4ACZB 5DBTA 5ENLA 3BMXA 2ZRVA 4M6UA 3SN1A 1OFBA 1K02A 5I77A 2P8CA 1Q6RA 3O2LA 3PUOA 1AH4A 4IG2B 3S1UA 1J11A 1U30A 1QW9A 3NSNA 4B3LA 1XD0A 3OO2A 3IARA 2X1UA 3NXFA 5H91A 4HU8A 1HP4A 1A5UA 1TTPA 4AH7A 4D8ZA 4NJJA 4LXFA 1L9WA 1XBYA 4ZE5A 3IANA 1BSLA 2VFIA 2NSOA 3URQA 1W3NA 2RDUA 2IMRA 3FX4A 2PDIA 4GJ1A 1XLHA 3WK2A 3G0UA 5CPTA 2HS8A 3FA4A 2IUZA 3S1GA 4QJ5B 3ALFA 1XYCA 3DG6A 2J7GA 4Z1YA 1XF0A 1KB3A 1DIDA 4U3CA 4MM1A 3VIHA 4IP5A 1ZB5A 2X1SA 1PZ0A 1IZJA 5C9UA 4IOTA 1L6GA 3WNKA 3U9IA 1OG0A 3CUGA 4I9JA 4PTXA 4WUIA 3TR9A 2Z2AA 1D9EA 4I5XA 2QUNA 3CH9A 1TTQA 1RY0A 4H1ZA 2H8XA 3S1VA 4JKKA 2OZ0A 4Q32A 2ZX9A 3PJXA 1I75A 4HHMA 3L5AA 5K4ZA 4UR9A 3P84A 1VHCA 1A0CA 2AAAA 2OEKA 3Q58A 2B7OA 3F1QA 1TV3A 1KBJA 2Y0FA 3VNJA 3OZPA 1AQHA 1JRBA 1CWYA 3CTLA 1RBLA 3E02A 3KRUA 2EPKX 5J8LA 3VD5A 5A94A 2VEIA 1TTJA 5HWJA 2YFOA 4Z1AA 3GDMA 3GTXA 1H4PA 3C86A 2NSXA 5EL1A 3IIVA 2A6LA 1VAHA 4JYEA 4W84A 3CJPA 3ITTA 5FSEC 1ZJIA 2BVWA 3GC2A 1T7LA 4PMZA 3L4TA 1AD1A 3SCWA 1PDYA 4TR9A 1NH6A 1IEIA 2YLAA 3VKCA 2E3ZA 1XDLA 4KCTA 1MVYA 3W7PA 4GFSA 1PBGA 2GQAA 2JEQA 4JTIA 5DY2A 1K8CA 4HHLA 4AYGA 4IQJA 1F9CA 1BD0A 3KP1A 2FZMA 4Q22A 1XINA 4B2DD 3RG6A 3M0LA 1KBIA 2WMIB 3MP4A 1EHNA 1VS1A 3L2LA 4F0RA 1XUUA 2I9EA 1PX3A 4N42A 3G18A 1UH3A 1TRIA 4KGLA 3HQNA 5CC6A 4QJ4B 4AC7C 5JBDA 2X05A 3SJNA 2X0YA 3D46A 3GDLA 1FWIC 3VDBA 3G1YA 3A64A 1DOSA 4PCPA 3R94A 1FWCC 3PTQA 4ZVJA 1PSCA 1PWMA 2YXXA 3GU9A 5J5RA 4DNHA 1KRCC 1V02A 3AC0A 5IHSA 2VZOA 2PWHA 3TNOA 4HZ7A 4KIEA 3NXLA 2XHYA 3B0VC 1EGMA 2YCLB 4UTKA 1HL2A 3H2EA 5L6UA 2WXDM 1ITCA 3VIJA 2Q01A 2VGFA 4CGTA 4RW5A 3MVIA 1WKEA 1VP5A 2DDXA 3VZZA 3BTNA 4LUSA 1S2AA 3PY2A 1W37A 5IFPA 1SSDA 3KVLA 4JN7A 1ZNNA 5BMWA 4GIAA 4CNUA 5A6BD 4JAWA 4BA0A 3LBCA 4H9MA 3QQ1A 3W1PA 5I09A 2WPBA 2H9AB 1QBBA 3OZYA 4NJKA 3CQIA 3L66A 4BQ5A 2Q71A 5LIWX 2QF7A 2Q8XA 3FKKA 1PO9A 3SUUA 4EPEC 1M04A 5FJOA 1CDGA 3CO8A 2XN2A 4FXFA 3E1F1 3NO3A 4LY8A 1DJNA 3E0VA 3VM5A 1OK6A 3QYSA 3SIZA 3QR0A 4FS9A 1P4CA 4RUBA 7XIMA 1HJUA 1GVQA 4UQAA 3NNTA 3S9ZA 1UHVA 1O6IA 3T05A 5CJNA 7ODCA 2GGJA 3AMDA 1EKOA 3DECA 3E0WA 3WX7A 2C0AA 1XIJA 1PJ9A 4CD8A 3GDRA 1W5QA 5C8BB 3VNMA 1UROA 2HK1A 3W76A 3W81A 3PZVA 4NZ3A 1QW8A 4CKQA 1VENA 5GVJA 3AXMA 3DCPA 2J62A 4Z0SA 4IMAA 2BV9A 5AZ1A 1SJDA 1N8IA 1F8MA 2ZDSA 4Q8NA 2VVNA 3NQMA 3U2OA 4K7YA 1AZ1A 3MANA 3S2CA 3VXGA 3PNUA 4MJ4A 4LNCA 5D05A 1VEPA 4MVAA 3WO8A 1R38A 2NXIA 4WGXA 4ZMGA 2NWSA 3LGGA 3WJZA 3R4IA 1ISWA 1SO5A 2TSYA 1MXDA 3T0BA 2DSZA 3W6YA 4LEFA 4NZCA 1Q5MA 3WF1A 5HXMA 1L2QA 3A4JA 3BCJA 3SO7A 4FIRA 4HJFA 2C79A 1XLLA 1RPXA 3W01A 4LCSA 4RDWA 2UY4A 4KW2A 1WDSA 3BLDA 1GZJA 5DBUA 2X1TA 4DWSC 1R7AA 3S46A 4GYJA 3OW1A 1PWLA 4PMUA 5MKGB 1OYBA 4DJDC 3WEZA 1JZ2A 3ARPA 3OB8A 1SW3A 3WD3A 4FNTA 1KFCA 4NX5A 3N2TA 3UFYA 4EVZA 1R3SA 3P7YA 4O8RA 2XJ7A 3W85A 2F9RA 2WANA 4XTDA 2EPLX 3EAUA 4QJ3B 1PKNA 3INPA 3P2VA 4CQ9A 3EEZA 3KHDA 4JEJA 2WNQA 3C2YA 3GTHA 1HVQA 2Y8VA 3GX9A 1V6WA 1FA2A 4O0QA 4YTSA 4IPIA 1O68A 2WVVB 4MMWA 4UTUA 2ZX8A 2XDFA 3EX3A 1RP9A 5CJMA 3Q4DA 3G3DA 2GLKA 4UMAA 1UJPA 2CITA 4Q7BA 3GYCA 1XLFA 1CZ1A 3VKBA 3A9BA 3FFSA 1GG1A 3B0PA 1Z41A 4RJEA 4EF8A 1LF1A 3GG7A 2OWCA 1KFEA 4DWSA 5BRBA 1MFVA 2FMNA 4HOXA 1LORA 3GR8A 4F0SA 2PRLA 3NEHA 4DJDA 1A5NC 3AU6A 1THFD 2FPTA 1XI3A 4BFAA 4C7DA 3JZEA 1Q7ZA 3T0TA 1GKRA 2YPIA 4C6MA 1W1TA 1DQXA 4Q7NA 1NWTA 4H9XA 2WNZA 3QPZA 4RZ4A 5EY5A 3GNRA 4WY0B 3W3OA 1YTKA 3CUFA 4IIBA 1IT8A 1TR9A 4LVFA 4A2SA 1NTHA 3K46A 3AS3A 2B31A 3PG9A 1VBJA 4XAYA 2GJRA 4JTRA 3VIIA 3VD9A 3GO2A 3QHNA 5L9FA 4WZHA 3UY7A 5FAGA 3N04A 5I6SA 2C6QA 3LCWA 3POHA 2QCGA 3WLPA 2I57A 1HW6A 1UR2A 5GQBA 5FACA 3B9AA 3APYA 4O15A 4IZGA 4LY4A 1MEIA 1IEVA 3CQHA 4J3SA 1R0MA 4KETA 1GQKA 3UZZA 4UB9A 1LTDA 1SPQA 5BNKA 1KA9F 3CUHA 4FSAA 5EU9A 3F5LA 5HULA 3ZSTA 2PCQA 3N2MA 5FF7A 2VWTA 1PX8A 1JFXA 2YGYA 2R14A 2FFCA 1BGAA 2DH3A 3KL0A 2GUBA 1A0EA 4GFIA 1UZ4A 3IGXA 1WKDA 3MVTA 1BXNA 3RRAA 1IZKA 2ADAA 3SRKA 4ML4A 3WH7A 2O7SA 2J8FA 3BC9A 2ATMA 3WBWA 2OPJA 1UQZA 1J4EA 1W0MA 4Q8WA 3V18A 4BZYA 1FWNA 2DY3A 3LCGA 4MY8A 2C14A 1JPDX 1O5RA 2CW6A 1XR2A 2HE5A 3GTIA 2YZRA 4Q4KA 3W88A 1Q8JA 3O6CA 2Y5EA 4GY1A 3PBYA 3AXIA 3IS4A 2R8WA 4Y9PA 3EMQA 5HWMA 1HJSA 3AWNA 2V2HA 2WJFA 1UW9A 4IGSA 3B03A 3UXLA 1J0ZA 2AAMA 3LDVA 1DXFA 3UWYA 3PANA 2PLMA 1MZRA 3V16A 1FBAA 4ERIA 4F40A 3L0NA 8XIMA 3QTGA 4QHRA 5C0QA 4O18A 1E6QM 5C2CA 1GQNA 2BGSA 1FDZA 4GE8A 3M7WA 1VQTA 4M51A 1XCWA 1XC6A 3W25A 1SZNA 1Z32X 1O1ZA 3T08A 2D1ZA 2Y89A 1GOWA 4Y96A 1ZP3A 3F5KA 4C6FA 4NZ5A 1TE1A 3B3DA 3OYZA 1G0CA 3FOKA 4IT1A 3ITCA 4A3RA 4QP0A 1TMQA 3M5ZA 3HQ1A 1EJWC 3PZMA 3VX0A 3WL1A 5E9AA 2GJNA 3PR2A 5A2CA 1SW0A 4XD3A 3QZ6A 5REQB 5HR6A 3R2GA 1O5QA 1A4LA 1JCXA 3WDIA 3MBFA 2JIEA 3DESA 3N4AA 2PU0A 1LG2A 3MPGA 4DJFD 5BMXA 1FWHC 1HUVA 1TREA 5EMLA 1Q6LA 1TUFA 1JZ4A 5FOOA 2WK2A 3OP2A 4JTTA 2FZDA 2ZKMX 2X1IA 3H70A 3BV4A 4YN5A 3NQEA 4JDBA 1BYAA 1V3IA 1S2CA 1HF6A 4RE3A 4ZOAA 5HATA 1WKFA 2VWSA 4P8UA 3APTA 4H9ZA 5A95A 1JYNA 1LYXA 4LCRA 3E9AA 3W2JA 4IQDA 3UP8A 3IUDA 4S2BA 3GFZA 3SCUA 4CCDA 3W38A 3P81A 1WCGA 2YCIX 3NPXA 4AW7A 5AC6A 3QHMA 4KQNA 2QCNA 5A8MA 3RCYA 3HTWA 3LERA 2YYUA 1AW5A 3W7NA 5LXEA 4B5TA 3VGBA 1HO4A 3I6TA 4ATDA 2P3EA 3AIVA 1PZ3A 3QYQA 3N19B 4AMCA 4FX8A 1TIWA 3VKAA 1VJSA 5CG0A 7PTDA 3BXWA 4WK9A 1OD8A 4J3VA 2QV4A 4PMNA 1N7KA 5D03A 3NM3A 4P7OA 4D8LA 3DUGA 3WUBA 4BR1A 4AEOA 5C54A 4LW7A 3N9RA 5AZ0A 2XH4A 1HJQA 2E77A 4QM1A 3THAA 5DMNA 5A6SA 3GUWA 3SSJA 2Q6ZA 1C90A 4QG9A 4ZXOA 2ACRA 1F3WA 3MT1A 6REQA 2OODA 3PUGA 3UJSA 4W5UA 1NF7A 1OD0A 5CH9A 4J28A 2X0HA 5J04A 4FMVA 3FLUA 3P5ZA 3D47A 3MUIA 2OSWA 1ME9A 3CHCA 3MCMA 1XQLA 2E8YA 3NG3A 3LENA 3Q67A 5A69A 1MUWA 4LGXA 3W24A 4JFTA 1ODZA 1I1WA 3OYXA 2CLIA 3KOXA 3OVQA 1ZJHA 4W9TA 4I5RA 3BCFA 3GW0A 4QFUA 3SQSA 2PDBA 4AFYA 5CZKA 3VGDA 1VJIA 1PVNA 1YLVA 4GX8A 1XIFA 1UUQA 3BJTA 3EEGA 4PC8A 1XIGA 3ARQA 4KEMA 3OHMB 4LV4A 2YKKA 3O0FA 5IHRA 4MKVA 4O13A 3DAQA 3IJDA 1OGSA 4K36A 1Q8AA 3VOCA 4L4OA 4IIDA 3R7MA 2RDWA 1LL7A 4UFJA 4I7WA 2QPXA 4MB5A 4ZQNA 3MYOA 2RDXA 3W6MA 2ZZ5A 2EBNA 2I17A 3NQ6A 4CCEA 3MQTA 2I5IA 1U2YA 4ZSUA 1XRFA 3L9CA 4IXHA 3G1RA 3FDGA 4NAEA 1NFGA 3AISA 3PPGA 3WBEA 4ORIA 6ENLA 1ZAHA 1XSKA 1KXTA 4GCXA 2WMHA 2JALA 3VC6A 1TV2A 3CYVA 1ITUA 2C13A 4WX2A 5FI8A 1KWGA 4QSFA 3H2FA 1WZLA 4YJ5A 4H41A 1BG4A 4WKFA 3TTQA 3SI9A 1DJZA 1SZEA 3DG3A 1I2RA 4AISA 2H8ZA 4GVGA 4P2VA 4U28A 3BW2A 1NDYA 2ZXBA 4IFKA 3B9DA 1X1NA 1JULA 3U0HA 3T8LA 4IXXA 4AD0A 1X1OA 1CLXA 3ORWA 5C2GA 2AKMA 4FF5A 4L1XA 2DJXA 3MC5A 1G7UA 3A23A 4UTJA 1SO6A 3HO8A 3BV7A 4HHHA 3GS6A 1GTEA 3N29A 4GG9A 1PXGA 4FX7A 1EYWA 3VGGA 3I7QA 3QV7A 4DF0A 5CGMA 3PZNA 4HHPA 2EKCA 3P5YA 2VD9A 4A8LA 5BXPA 4GACA 4Q8QA 1JYXA 2VOMA 5I78A 4Y9AA 1J2BA 4F48A 1DTUA 1PHWA 3DFNA 3M64A 1T8QA 2PDUA 1KD0A 5KEZA 5D37A 1TQXA 5JQ9A 3S5OA 7A3HA 5LHFA 1V0NA 2CLOA 1E40A 3IGSA 3NGJA 1WZKA 3G0XA 3H4XA 2WKJA 4U3AA 4UQCA 2PZNA 4XKYA 3HMCA 3OBAA 3KM8A 4NAFB 4GH1A 4Y6GA 3B8UA 3DBPA 4C6IA 1M9HA 4NILA 1WB0A 4TMBA 1LOSA 4KF1A 2VX7A 1CB2A 3I6RA 4XZIA 3MTWA 2QW5A 2X2YA 6ALDA 2D23A 3NQ2A 3N4FA 3TK7A 1E0WA 1PL9A 3U4FA 1U5VA 4DUWA 1FP9A 4L1WA 1DWIM 3PS7A 2Z1BA 3QSTA 3OBEA 1MXGA 2NW0A 3HG4A 1VBHA 2A79A 1NVMA 2G3IA 3STEA 1QDSA 2QJJA 1EO7A 1SUXA 3WQ5A 5LXXA 1VBRA 1ISXA 3UY8A 2ONEA 4ALDA 2IKGA 4WDTA 3O15A 4CD7A 5LGZA 1R85A 3R89A 3K4AA 2WJEA 1V3MA 5LKYA 3UXKA 1YTDA 3M43A 3GW3A 1QPNA 1M53A 5TAOA 1JQVA 5HNNA 3ZJ6A 8TIMA 5E5CA 1WAWA 2EAWA 1FVPA 2E9LA 5M2FX 1XPGA 1XQKA 3C61A 1NF0A 2WZHA 4RLIA 3L2IA 4PULA 2YL8A 2XFFA 3QMSA 4Z1DA 3WNMA 1DEDA 3POCA 1JG9A 4CQCA 2VGIA 3OHIA 5CLWA 2ZXQA 3V5FA 1XIEA 3VNDA 1HP5A 2WC3A 4DBUA 3TQKA 2G50A 4X2PA 4IUOA 3MWCA 2CEQA 4UFIA 5GNXA 1O7AA 4NL1A 3LRLA 2NT1A 5CZJA 1JUEA 5K9XA 2HK0A 3RNDA 1VFOA 4JHZA 3FS2A 4HCDA 3S1WA 4L5ZA 4RZBA 2HS6A 4U10A 2PGEA 3U8GA 4M8UA 3AYVA 1P1XA 4NKCA 2WSYA 1E4LA 4PCTA 1CECA 3KFTA 4CU6A 3GC5A 2WPGA 8XIAA 1Y8BA 5D2YA 2BLEA 4KRZA 4UIOA 3QW4B 3W7EA 2FIQA 2D20A 4WDXA 1EJSC 3UJRA 4ACYA 1TA3B 3NEVA 3NPWA 1P48A 2WSPA 3S4TA 4EKJA 2CLEA 4HVXA 3B0XA 5EMYA 3KVJA 3TYUA 1TWDA 1QI0A 1TCDA 1IR2A 1FCBA 4GYKA 1O4UA 4LC6A 1QOQA 4UZUA 2BOFX 2J7BA 3NZGA 4FALA 3TKFA 4K3ZA 1N2VA 5LGXA 4B90A 3O8AA 1R3YA 5TQLA 4M6VA 4WR3A 3WUGA 4IP4A 4ORMA 4OBSA 1XCXA 4GXWA 4OZOA 4EXQA 1MNSA 2INEA 5FEZA 4C6PA 1V6XA 2E6AA 2I16A 1WAUA 4HK6A 3UWEA 4ATWA 3W7IA 3I4KA 2J8TA 1VB9A 5T91A 1XDMA 2Y6ZA 4UCGA 1FHLA 3W27A 3UNTA 1Q45A 1YE6A 3NQBA 2Y7FA 3B8IA 5EKYA 4LX4A 2GSEA 1BTMA 3KHJA 1TVPA 1QPRA 3HG5A 1GVRA 1CXFA 1JCTA 2F84A 2RFGA 4GGHA 2C91A 4OHQA 1NAL1 4E8DA 2PS2A 2PF8A 1MEWA 3NOYA 4JCLA 5TF0A 3G24A 2OZTA 3N1AA 5D09A 1DTNA 3V0TA 2DH2A 1XYZA 1EB3A 3CAVA 2QCLA 4KFOA 3W1NA 3HQOA 4TVUA 1ONXA 1ZCCA 5CSUA 4GUJA 3BICA 3BDKA 2W0UA 2ISWA 1NJJA 3ES7A 3UZYA 1JDAA 1I45A 1CLKA 4ZQCA 1KXQA 4BQ4A 3TZFA 2DT2A 3FKRA 3NCOA 3EDFA 1B30A 3FYOA 3ZMRA 1F3XA 1HGYA 5DANA 1SYTA 1S5TA 2YW4A 4PA8A 2WZMA 4WF7A 3XINA 2NVDA 2PTXA 4D6JA 5FJUA 4OV9A 3B40A 3SQMA 4QEHA 1QK2A 3DENA 1R3VA 4DRSA 1OIMA 4O1FA 2Z1KA 3GY1A 3SGZA 5E9XA 4AEFA 3BLLA 3OG2A 2PBGA 4HMNA 1GVYA 4P8WA 3AI0A 3FN9A 3R79A 2Z2BA 5HUPA 2QCDA 2OG9A 5G2WA 3GYEA 4IJBA 4IPNB 3WD2A 4H6EA 5EGRA 3UPMA 3TOYA 5I3FA 4I7VA 1E1CA 3UG8A 1NEYA 4HB7A 4HN8A 3NIYA 2NLIA 2XN1A 4B4HA 2JF6A 4QS6A 2OYKA 3F7JA 4JCMA 2D2HA 2WWCA 3BLKA 3WBYA 4QISA 4HP5A 1W1B1 3S6DA 4L1GA 4PMVA 1KRAC 2E68A 3AUOA 1NDZA 2PWDA 3EA1A 1HJWA 1KRBC 2XIMA 2XYLA 4NQ1A 3VNYA 1O12A 3MZNA 3CIWA 2NLYA 4JQAA 2DUAA 4L61A 4JIQA 4GQ0A 1EOMA 2WVSA 4FOKA 2V6AA 3CNYA 3M0ZA 4L65A 1US3A 4IG2A 3RX3A 2GVYA 3NUKA 4R33A 1IWAA 3UXIA 2G8ZA 2G3MA 2JIWA 1O5KA 2DZVA 5G4HC 1OB0A 2ZXDA 1QXLA 1FKWA 2VQUA 1X6LA 3KWXA 2X40A 1KGUA 4ZR8A 1WOBA 2VGBA 1W32A 5I3JA 4UMBA 3CTTA 5CXPA 4IWWA 3P93A 3F2BA 1JPKA 3LPOA 3PZOA 2ZWZA 3FXGA 4F0MA 2OEJA 4S1FA 3CMGA 3WH9A 2YJQA 1V5XA 1OX4A 3U6WA 3C0QA 4MWAC 3W7RA 2NUXA 3KS6A 3PWGA 5EMMA 1T41A 4PCNA 3MA8A 5HMDA 3LN3A 1UC4A 1RVGA 1ICPA 1OY0A 1AK5A 3LNMA 4DXKA 5LIUX 3WJSA 3W23A 4PFMA 3OLIA 2PDXA 4DAFA 3DFTA 1TE6A 1OADA 4YPJA 1HQTA 4O1CA 2H90A 2O9PA 5BROA 4AIEA 3B04A 4GQQA 1OCBA 4GY0A 4R85A 3D6NA 1IZCA 1Q6CA 1C9WA 1QAPA 2WQPA 2F2KA 1UIPA 1Q7MA 4QS5A 3QR1A 1H7RA 1KXHA 4BQ2A 3SGUA 1NDVA 3G1FA 3HU7A 4UFLA 1RQHA 2F7FA 3DFPA 2BS9A 2DPEA 1HL9A 5KSWA 1G4EA 2FH6A 3F4NA 3M7SA 3TEVA 1AQMA 1KV8A 4Y8FA 2VOTA 3ITOA 2EHHA 3KBWA 3M0VA 4AZBA 1W5MA 3T81A 1OFRA 4FB7A 1VFSA 3N13A 1SJCA 3W2KA 4V27A 1T0OA 3PF3A 3L2MA 3WQ4A 4V15A 3PTKA 2V5KA 4R9OA 3A4AA 3WNLA 3ANYA 1MW2A 3LBOA 1EF3A 1TSIA 3IVSA 2BP1A 1JPHA 1U5JA 1F5ZA 3GIQA 3KBMA 1YTEA 2X8RA 3WH8A 1V02E 3MSDA 1SMAA 4OOUA 1A5LC 3W2MA 1GHSA 2WMIA 1YADA 4TU1A 1I0BA 4GH3A 3VDCA 2G97A 1Q13A 3TMQA 4Q33A 2PRMA 3OA3A 4RW3A 1RA5A 1W5OA 2Q09A 1Q6OA 4D8AA 1PKLA 1A5CA 3IRSA 1FCVA 2Y63A 4JIHA 2UY3A 2PDHA 1ELSA 2CETA 1Q2RA 1E55A 4R88A 3DOPA 3LHTA 3CMJA 3OPSA 4JFSA 3ZT6A 1QUMA 3TROA 3AHXA 2HCVA 4AWSA 3MHUA 2BXVA 1MWOA 3FHQA 4YVPA 1M68A 2PDPA 4AIOA 4E38A 5H8UA 4V1XA 3NZPA 4E5TA 5DQPA 1XISA 4PB4A 3QZEA 3KBSA 4PL1A 3DDMA 2QNEA 4A3UA 1MI3A 3B9EA 3LRKA 3FY1A 3MV01 4PTVA 1VLIA 1BQCA 1BSIA 2YCLA 5AHMA 1K4GA 3BARA 4IFRA 4ZB5A 2WO5A 4X2RA 4A3HA 3LXCA 2PMQA 1O95A 3SRFA 3BGJA 2PTYA 1J5TA 5E70A 4MSSA 3C3UA 4R7JA 1TFVA 2XVGA 4KGJA 1W1VA 1ZAJA 4PBGA 2CC0A 4I9MA 2XG9A 4BWLA 1C93A 1O1HA 4O4VA 1CPUA 1XH1A 4AVFA 4MADA 1BFNA 3VAVA 4N6FA 4Y7EA 3AIQA 3VOFA 2H9AA 1P6BA 3BG9A 2CLFA 3DHDA 1R3WA 4CD5A 3W1XA 2X41A 2FB3A 4Q4MA 3E96A 2Y62A 2YZ5A 4OFCA 5CPMA 1H0IA 1E72M 4EAYA 3IUIA 3E5BA 3U5YA 1FFRA 1ZSXA 1SGJA 5PTDA 3RUBL 3OLGA 3WQPA 4TX9A 3NGFA 4XO6A 3LY0A 4QJ1A 4C7GA 4H7VA 1E9YB 3BAKA 2I1OA 3GKFA 3EWYA 1TJ1A 3DFSA 5FL0A 1WBJA 3G5EA 5FJRA 1KKRA 3S2MA 2EJ1A 4RE4A 3SM0A 3FJLA 1Z48A 4JGDA 1S3TC 3EA2A 3D0CA 3HURA 3GZAA 3WQOA 2G4FA 3PM6A 3BE7A 4R7WA 4TQTA 5AY7A 1RBAA 1QJWA 4U33A 5HNRA 1DE5A 2FLIA 4H04A 3TJXA 4XZLX 3TFCA 5ABEA 1AW1A 4KWVA 2P53A 3F4DA 5G2HA 3V4BA 4JHMA 3T4WA 3BH4A 4KS0A 4X61A 3CUIA 4HSNA 1F7BA 1JNDA 2P8BA 1AW2A 2Z27A 1KM2A 3DYPA 3QZAA 4QX4A 1RD5A 2QIIA 3V1PA 4GHRA 4DI9A 1GOOA 1W9XA 2RJGA 3WCZA 4LBRA 2NQLA 2OWWA 1AQFA 5KZEA 1MSSA 3TE9A 4HZ6A 2LLEA 2B4GA 5TD4A 4FNRA 4M1BA 4RPQA 3R8RA 3FAWA 3S2JA 3OGRA 2VUYA 1R9ZA 3KRSA 3B8DA 1AA1B 3VNZA 3WYZA 2ZX6A 4CEUC 1GZGA 2ABAA 3SFKA 3VD7A 3SUSA 4I9AA 4E2OA 1B2YA 2Q3OA 3O16A 2VFHA 3ABZA 2OQLA 2QCCA 3M0YA 2VDIA 3ONBA 3AMLA 1LRNA 3GD6A 3DFOA 3OQEA 4AHOA 1CGXA 4LAMA 3VCRA 2Y70A 3DKJA 2XGBA 1DIKA 4INFA 3CQJA 2IPJA 3EMZA 1WBHA 4JNMA 3MWAA 4PMRA 4XZNX 1XRSA 2XSXA 1EPXA 2QJIA 2BVYA 1DKWA 1LP6A 4GZJA 3TAOA 1TMHA 3W1MA 4Z0JA 2FGBA 2WVVA 2VFEA 4MYXA 4AX6A 3H24A 5AYXA 4GUGA 4OTKA 2CYGA 4S3BA 2ZUTA 3G22A 1E6RA 4CLMA 3SCOA 4V1YA 1WDWA 3TA6A 4HTBA 2G3FA 3VIPA 5HANA 2ZC1A 4MB4A 4C6KA 4GXMA 2PDWA 2G41A 3DHPA 4C6NA 3T78A 1BQGA 2B7PA 4RL3A 4EP8C 3U3HA 5A1AA 4GIRA 4UOZA 2RHGA 1VZWA 4E8GA 2W61A 1W1ZA 4YLWA 1HGWA 5F2LA 2ZADA 1C91A 1QMLA 1QHPA 4JTEA 3EB4A 3W7CA 2W4XA 4MNKA 2EPMX 4O8AA 3GNNA 2DZUA 1H50A 1EJVC 1FWSA 3BK0A 1BGGA 1UD6A 5DY3A 3ZIZA 4GWEA 3HB9A 4MHBA 1EZ2A 1H5YA 4JTCA 2GSHA 3D3AA 3KTSA 4R27A 5LIYX 2AL1A 4WSKA 4NYUA 5A8GA 3KBVA 3H2NA 3DN5A 1XFBA 4Q4OA 2XN0A 6TAAA 1AL8A 5AN7A 3ARTA 5F1UA 3IUHA 3R8HA 1UR4A 4AEEA 1QI4A 3EKLA 2D0FA 2DIEA 2VTFA 3VUSA 3VIMA 2UZ9A 3N11A 3N3TA 1V79A 4C5YA 2H3BA 1ITQA 3LCFA 3MSRA 4S3AA 4ZOEA 6CGTA 3MCOA 2GJXB 5CPNA 5CCZA 2PAJA 1SVDA 4BS0A 3EOOA 1QI3A 3ZJ8A 4JNYA 4HYVA 2WC4A 3SSZA 1GYNA 4ZE4A 1GTHA 4IPLA 2ZUMA 4B9ZA 5LIXX 4IL0A 1ZL1A 4LVAA 4R53A 1W5NA 3BW3A 4XBSA 4EACA 4FZIA 3SN4A 3SGGA 1Z9AA 1QPOA 3CWOX 1Q3NA 2WMJA 1JD9A 1O60A 3AXXA 3MMDA 3S42A 2XM2A 5HPCA 4DF1A 4JX6A 4YMZA 2J8GA 2GVJA 1Z44A 2ZDRA 4BF7A 1K6AA 3IGUA 2JGYA 3THDA 5HMFA 2WCSA 1TPDA 5I7GA 1YNYA 4US5D 2DUXA 1EPVA 1E9LA 2W9MA 2DIKA 3B06A 2J47A 1XH2A 2A7NA 1FWTA 3CC1A 4NI3A 4JFWA 1MDRA 4ICMA 4M56A 1C3FA 4JTKA 3MKCA 3W37A 1TCMA 2EQDA 2CLHA 3DU0A 2WCGA 3PPCA 2KAUC 2Z7KA 4I6KA 4PZVA 3RJYA 1YPIA 4D72A 1KLZA 1TELA 3MO7A 1V51A 3I65A 3ARSA 3R11A 5DMMA 2YX0A 2DU2A 1K3UA 1R30A 4J1OA 4NZ1A 1LM1A 4D6HA 2A3HA 1SO3A 1TPWA 2J75A 3GVWA 3GWQA 2C19A 1IWBA 1F8IA 1TPC1 3ARUA 3LMYA 1CXHA 5AHFA 2NQ9A 5REQA 5C70A 1EDGA 3W7MA 4R34A 1AG1O 3CEUA 3EDEA 1HKWA 4CD4A 3ITVA 5A6LA 1K8ZA 3AWOA 4HNOA 3ZJKA 1AL7A 1LDCA 3FVDA 2QUVA 1L0PA 4O52A 4DUVA 4XZBA 2VZUA 2G96A 4OUIA 4DAIA 3P3BA 4NVTA 2YA1A 3WLMA 2OX1A 3C56A 1NELA 5EYWA 2YBTA 1XM3A 2A5HA 2V81A 4Q4SA 1S2TA 4IJCA 1TJRA 1LL6A 1XJBA 3PB2A 1WA3A 3ZWTA 5G1YA 1Q65A 3I7RA 2GK1B 4PUMA 1B9BA 1M41A 5D8WA 2ZC8A 2NX3A 4G7FA 2YXOA 2J25A 2PDKA 1M7JA 1UKPA 4H8HA 2BMBA 4XAPA 2QV5A 1XLGA 3W07A 3VM7A 1ONRA 1R6WA 3UA3A 1PYMA 4JDYA 4RXFA 4E4FA 3ZVIA 4ICNA 2V67A 1NU5A 1EA0A 3DXIA 4MWAD 4DWDA 1ZS2A 4GKLA 4ENLA 3I7SA 2GOKA 3DC8A 4LPCA 5C55A 4RDVA 3R0UA 1D3HA 1K6WA 3M5VA 3SZ8A 4QAIA 5D38A 1KV5A 5F2MA 2CKRA 3WDJA 3SN0A 4Z42C 1VFLA 4U5KA 1R87A 3UWUA 3RCNA 4RZ6A 4B2DA 3YPIA 2FGLA 1NOFA 3NWRA 5A6TC 1KCLA 4JHOA 4KEVA 4KIRA 3OODA 5MF5A 3B8SA 2ZBTA 4GVIA 1ADOA 4W89A 3K4WA 4M82A 3C0LA 3LA4A 1BF6A 4TXEA 2V63A 4HPXA 1L6SA 3MO4A 2Z1WA 3L67A 1DIOA 2QUTA 3TA9A 1B5TA 3AQUA 5D2WA 1SO4A 3QGAC 3UF9A 1RLCL 5GPRA 3E0FA 4CCZA 3A6OA 2VM8A 3W1LA 3WQ6A 4LRTA 1A3XA 1HX0A 1A5AA 3RX2A 5AHNA 4B91A 4IGNA 2OU4A 1M7XA 3CL6A 2WV8A 1PYFA 4AZGA 4HPGA 1FCQA 2XVLA 4Q8OA 4U2YA 1V3JA 3C6CA 1BG9A 3TN6A 1UP3A 4GO9A 3LS9A 5C9XA 4XKYB 3F4VA 4ES4A 4UMCA 1OZMA 7TIMA 5F4XA 3SY5A 3N9SA 1X6NA 4FF7A 4MTVA 3WMCA 4E8CA 3LEPA 2CHRA 5BCAA 2V5CA 4W93A 3M07A 1ZHAA 2PEVA 5ABFA 4U4MA 4W85A 3TFXA 2F2HA 3M44A 1VKFA 4JKMA 3CZGA 1A5OC 1Q85A 2CLLA 3UG4A 3LM3A 1VEMA 4NXKA 5CPSA 4PYSA 3PP7A 2DT1A 5A6BA 4XD6A 4DBWA 2VC9A 4JZ5A 2TAAA 1SW7A 2PDMA 4TUFA 3NAVA 1F6YA 4CN1A 2WZTA 1ZBCA 5AHIA 4AQLA 3M6DA 1XLIA 3EX6A 3ZR5A 1UUMA 2ON3A 1X38A 3HGJA 3LHZA 2E5DA 4HMEA 1Y0EA 4AD5A 2DZWA 2J27A 2QCEA 4JX4A 3PZIA 4HA0A 3CPRA 3H8AA 4WRHA 1ME7A 4K6AA 1H2JA 2PWFA 1D8WA 1BYDA 4HU0A 2H6RA 3RPDA 4K1WA 4ZO8A 1JCMP 4UR7A 2GDVA 2WM0A 1E1EA 1QRQA 2BOEX 2GGEA 3KLKA 4YXGA 2HISA 2V30A 5JXQA 2EGZA 4XBKA 4C60A 4BI7A 1JI2A 4OOZA 2YB1A 3NQCA 4DO7A 2ZRYA 4KCWA 3IWPA 4X9YA 2EJAA 2AMGA 4N4PA 3WF4A 2J74A 4P7LA 4RE2A 3MUAA 3EWDA 1YPFA 2A0NA 2J77A 2BG5A 3QOMA 1LOQA 5GNZA 1NQ6A 1Z89A 3VNIA 2IPFA 4IM4A 1QR7A 1DORA 3R6IA 4H7ZA 1A53A 1H61A 2FDMA 4S3EA 1ZBVA 2OO6A 3ITXA 4XZWA 1RBOB 1KWKA 1KM0A 3IIOA 5T9CE 1EGVA 1UD4A 1XLBA 4L7ZA 1AJ2A 4RR4A 4GIYA 4O1AA 4I3GA 2X7WA 4X9SA 5FJIA 1I4NA 2XSBA 3NDZA 2F8QA 4A3YA 1PZ1A 3N2BA 5C7VA 2XZ7A 2INZA 1SMDA 3BGAA 4JTGA 2BBFA 5BXSA 1YMYA 1H51A 2XISA 4IMGA 4E2VA 3R13A 4NG3A 4NNCA 1V8EA 1OSEA 4LTSA 2YB4A 2DZSA 3AXHA 3KE0A 4ASTA 4FHAA 2HMCA 5CZ0A 5T8GA 3SCRA 2PGFA 2QMJA 1JNEA 4MLRA 3VDAA 1TPH1 3VE7A 1EF2A 1S2WA 3GDTA 1H1ZA 1H7PA 1UR0A 3ABSA 4EXAA 2VCAA 2W79A 4I90A 4O17A 4DELA 2V38A 4BEUA 3OA5A 1IT7A 3IJ8A 2B7NA 2OTDA 2ZIDA 3T2QA 3SCNA 2FZ8A 2EF9A 4A21A 5CSYA 2RGLA 5BWFA 4IMEA 1M7OA 3LCLA 3CQKA 3RAOA 1QI2A 1CX9A 3NDYA 4J3WA 1B3WA 5HWNA 1S3HA 4Q7IA 2C3ZA 3CHEA 4WEVX 4AWUA 1QWGA 5HNTA 4LF2A 4UC5A 3SADA 2FDSA 2ATSA 2OKTA 1QVBA 2OSYA 3JVAA 5D33A 3TN3A 4KEUA 1ODUA 3QV9A 1ECQA 1RY8A 3UZXA 3IACA 3GXPA 1IXOA 1JAEA 1G4PA 1RA0A 4PUNA 1T5AA 4DB7A 1QATA 4JYDA 3W7JA 4LQ1A 4MAZA 5E93A 3KBJA 3T55A 2HXUA 2Z29A 2Z24A 1JDCA 1UWAA 4MLJA 4MB1A 3CZEA 3VZYA 3VOHA 1OT2A 5LNUA 1W56A 1CENA 2RDTA 4HZ8A 4KWOA 1H62A 5FF4A 1XLJA 3GC4A 1V93A 2ABBA 4QLJA 1MUCA 4LS1A 3H6OA 4H8NA 4J3XA 2SFPA 2B81A 3FV9A 7TAAA 3EGJA 2EG8A 3CL7A 1OINA 1KGXA 3STPA 3S1XA 1REQB 2CZEA 1KFLA 1P0KA 4R5EA 3WMLA 2NQZA 4LUYA 3UJEA 5BRQA 1R7OA 1CGUA 1UBSA 4DM1A 1T99A 1BXBA 3GXMA 3N34A 1GOMA 3PVFA 2EG7A 5I00A 1TA3A 1SZFA 4WLCA 4HT3A 4ZQRA 3NVDA 3O1NA 1SFSA 3H2MA 3FEMA 2DZPA 3W87A 3VC5A 2VCBA 1GYLA 3NQ7A 3QH2A 4AHPA 5CC5A 3BMVA 1UYQA 1X1ZA 4JKLA 4GO8A 4PFHA 2P10A 1FWFC 3ARZA 1NWRA 5I3KA 2NVAA 4WKHA 2INFA 3H4GA 5DX7A 1RVKA 3UR5A 4LJ3A 4MFEA 1EBGA 3CU2A 4UTTC 4F2UA 3QFEA 5G4EA 4Z2KA 3NL2A 4H9UA 4J40A 4CU7A 2VT0A 3AZTA 4DJFC 3A5VA 3W86A 3OIXA 1RK6A 2VCCA 2OO0A 1UBPC 2XH0A 1TVNA 4HYRA 2V5JA 3RMJA 1UWIA 1TB3A 1TVLA 3VK5A 1LT7A 3IAPA 1XIHA 3GHRA 3W28A 4JL2A 1VGAA 4AYSA 3QKEA 3BJSA 1IR1A 1BWKA 3EDKA 1ICQA 4W7VA 2X09A 3WQDA 2HPIA 2QF8A 1YDNA 2A3CA 5C6MA 1CGTA 1JPMA 1TJPA 4QE4A 3T8QA 4N0RA 2IQDA 1DJGA 2GVEA 4PUDA 4H2CA 4B5NA 4WJEA 1UJQA 2W67A 3QV6A 4QDWA 4JTDA 5HPOA 1OX4B 2E5CA 2NUWA 4LYPA 4RE0A 3T44A 4H7CA 2VZSA 1I2NA 4C6QA 2XIJA 4QNEA 2OYLA 1B3VA 4DXXA 5FCZA 1B90A 1OF6A 3CL8A 3F03K 2OWXA 5C9ZA 3URBA 4DJFA 1ZP4A 1JZ8A 1DYSA 1G1YA 5D8ZA 2Y61A 1V0LA 2DT3A 3A3WA 3NFUA 1LCOA 3MHGA 1UZ1A 1XLAA 1H09A 3MSYA 3UZJA 3WFZA 5FF3A 5BWAA 4HSOA 1KCKA 3MI2A 4L64A 4EAMA 3CH0A 3B9NA 4RDZA 3PPFA 3WLOA 4CVWA 1ITXA 1HO1A 4TVCA 3CK5A 4WDUA 4HOZA 2TMDA 4B15A 4GVHA 4KCVA 3LNPA 4F66A 3DI0A 1RK5A 3GTFA 2GDQA 4O50A 3GIPA 3NZQA 4EPBC 2AQWA 2QULA 4PUJA 3W1TA 3NQDA 1GJUA 2F6UA 1JGIA 1WDDA 3Q45A 4XG1A 1FWRA 1KW1A 4AD4A 5EBUA 4JPGA 4HPNA 4RNJA 3LHWA 2IS7A 5H6HA 1QNOA 4JTUA 1WE5A 4X63A 3CQ0A 3W2NA 4LV9A 4MWAB 4UBPC 4UQEA 1EC7A 3EWBX 1I0DA 1RAKA 2QZRA 2WMFA 4KWSA 5KTLA 4XUGA 3MS8A 2QUUA 2PSNA 3W74A 2VYOA 5FEXA 4AAJA 2BX7A 1K9EA 1V6TA 4XVEA 2JF7A 1D2KA 4JFUA 4TVDA 4WJ8A 1XRVA 1TPB1 2W3ZA 3WDHA 1EJTC 4J5NA 2YL5A 1IXQA 6XIMA 4HGXA 4W7WA 4LSBA 4GYFA 2O4QA 3DBNA 1QCWA 1AQ0A 3CHVA 4K7VA 1EFZA 1GPFA 1XRTA 5A5WA 3WZ0E 3QW3A 3BW4A 3DFYA 4HCLA 4IICA 3SCSA 2BVDA 4TO8A 2P50A 1IQ8A 5I3IA 3TYZA 3PJUA 3HM7A 3SW6A 4L9XA 1PZ2A 4MZ8A 4Q8UA 4PL2A 4NRRA 3WQWA 3BURA 1DJYA 3GFYA 3W75A 1IT0A 4QE1A 1XDJA 2GL5A 1OIFA 3ENLA 4G8TA 4NU7A 3CWNA 4DJED 4DXVA 2Z00A 1N8WA 5CGTA 4S3KA 1Q6DA 3VFLA 2P1FA 3LZ3A 4AWEA 3WLIA 6TIMA 5BZAA 2QMKA 1LWIA 3ZR4A 1GW1A 3K5XA 2EPOA 3PWIA 2NV2A 2D3NA 1UA3A 3DKLA 5D2VA 5HINA 4M81A 3R8GA 2EKGA 3LHYA 2DFAA 3E12A 2OXNA 1OG6A 1PCWA 1MMFA 1OBAA 4FK9A 1A5SA 3FVMA 3GVVA 3L4YA 1J10A 4A8RA 4N9DA 1FHVA 1UQYA 3G6LA 4UR8A 4MWAE 2I9UA 4IIEA 3V0SA 1WUEA 3AHZA 2FMOA 1XGEA 2CXEA 2XVKA 1CYGA 3AHTA 2Q8ZA 4KWUA 4QIUA 1H0GA 3PJTA 1QNPA 3C0JA 2XPKA 1IF2A 1TO3A 5CC3A 1MEHA 3ZT5A 5CLTA 1A0DA 4MJMA 2POTA 4S3CA 3NM1A 4Q8PA 2NQJA 2R94A 4Q8VA 2JE8A 2OGYA 1QK0A 3ZLFA 2OQYA 3DHFA 1NOUA 4M24A 1WO2A 1A50A 2O9OA 2XIOA 3TTOA 3UCQA 3F2CA 1I2OA 1E4IA 2PDJA 1LWHA 3BZJA 4D71A 3GNDA 5CSSA 4E4UA 3GZ3A 2OSXA 3CMFA 1SQ7A 2PBOA 3TYEA 3KXQA 1QOXA 2BHZA 1RUSA 4M7TA 3EKGA 1WUFA 4D6GA 2Z4GA 2PTWA 2E9MA 4FPSA 5M1TA 3T07A 3J7HA 3EBVA 4DX3A 3ZWSA 3NZRA 3UVIA 2WKGA 2CKSA 1EJ7L 4GMEA 2X1RA 1VPYA 2Y2WA 1OGGA 1LLWA 3U57A 4JIPA 1E15A 2DV0A 3LGEA 2W91A 2DW6A 4GBDA 4G2DA 4X0VA 4JTFA 4JIEA 3BLOA 3RM9A 3DH7A 3UERA 2VDGA 1QASA 2D24A 4DYEA 3P6LA 4PB3A 1V3KA 2VRKA 1BWVA 1V4YA 1S5VA 1TWIA 1UPPA 1OFPA 1IXNA 2OZ8A 1QOPA 2PWUA 3BVJA 4A2RA 4ZOCA 4BI5A 3DG7A 3RXZA 1WZMA 5SWUA 4HNUA 4PUEA 3PBUA 4J2MA 3LU2A 3HFYA 4MY9A 4W8AA 1OFOA 2BXZA 2WAGA 3ECQA 4XAZA 5LA2A 4GRSA 1JZ6A 1H7OA 1MW1A 3M1ZA 4PE8A 3AOFA 4H9YA 4XK2A 3BQ6A 1OC6A 1VJZA 2ZZ1A 1RPKA 3F5JA 1BRLA 3U2EA 6PTDA 4LH8A 3CV6A 4ZO6A 5D02A 3BAJA 3PNZA 5M3WA 3BOFA 1UD8A 3BSGA 4NZFA 4BI6A 3EXSA 4JD4A 3FJ4A 1IGSA 4C1NA 2AQOA 3KVKA 4YL2A 5HMSA 2XIIA 3DYMA 4B4FA 1GVIA 3GXTA 4QXIA 4EE9A 3I4EA 3W00A 4UTFA 3M41A 4ONVA 3LCXA 4K8EA 4S38A 3TLQA 1EC8A 4BK9A 1LLZA 1IIGA 3UNDA 2E09A 3KZSA 1B1YA 4Q4QA 2JGQA 1XHGA 2RGMA 2VR2A 4NZ4A 4NASA 1V3LA 1E6SM 4QGCA 4O1DA 2W5FA 3EYPA 4A4AA 1D8CA 3E2QA 4IX2A 5I0DA 2V69A 5GJPA 4U31A 3BAYA 3S5YA 4V33A 3LD5A 2QT3A 2GWGA 4GY7A 3PG8A 2XZ9A 3WLNA 1AJZA 1OYCA 3PBVA 2GUYA 2OT0A 1SJBA 1FH9A 3H23A 3LI0A 4GA8A 1K9TA 3CPGA 3RLGA 2ODOA 1PS9A 5AYIA 3CEPA 1NP0A 5LYRA 2A3AA 1JI1A 4P8XA 2XUCA 4ZB2A 1T8XA 2Z1SA 4LU0A 1LLOA 1VPQA 1EWDA 1HIZA 2GYIA 1L6WA 2X0SA 4X60A 3RPMA 5CEWA 3PBMA 3RGTA 5D9MA 3L21A 4KWWA 1XBXA 3GK0A 3OIHA 3S9YA 2FZNA 5JBFA 5CBJA 1OEPA 1FQ0A 1V77A 1XC4A 2ZRZA 5D9OA 3WUFA 3SIMA 1CGVA 4ZXLA 3TSDA 4PGLA 5IOBA 4DPPA 3RR4A 4POCA 3RPTA 3W71A 3HPFA 2PCEA 4JTJA 3S6OA 4ZCWA 1YDVA 5I07A 4Z2GA 4Y9MA 1NDWA 4N7QA 1NOWA 4AG0A 2D2JA 1E0XA 4KKXA 5TBOA 1E4MM 3O05A 3PTDA 2CZFA 3WDPP 2OX4A 4BEQA 1ZPTA 1LBFA 1PUDA 3W1RA 5IDZA 1CIUA 3W7HA 2HJPA 3UGRA 4R3UA 5FJJA 4ZL1A 2ALDA 3TWAA 4PCSA 4I6VA 4LF1A 3W2UA 4ZA0A 2Q3RA 2PU1A 5CG7A 5LSMA 4GJJA 4DI8A 4H83A 3VCNA 1TPUA 4W5ZA 1F3TA 3L4VA 4A29A 3ABRA 1OC7A 5MHBA 5E1QA 2OB3A 3W7QA 5KMYA 3BL3A 3PZGA 3KDNA 2GQ9A 3G1XA 3R0KA 3RITA 2VP8A 1AJ0A 1NWSA 3L4XA 3IJ7A 4IH3A 1Q7QA 3G6MA 4L4MA 2G5WA 1BXCA 3ARWA 4MZ1A 2POZA 1RALA 3W7KA 2VC5A 2PTZA 3ME3A 1QWKA 1KR0A 1KFKA 3IVTA 3WNPA 5E0FA 4ZOBA 2Y5SA 1E9IA 4GZ7A 2PD9A 4M6PA 2X2GA 3UYIA 4CNSA 1GQLA 3JZUA 5FSDC 4F0KA 4MY1A 3FJNA 3MKKA 2YCJA 3Q37A 4GJIA 1VYRA 2V5DA 3IJQA 3VDHA 1PDZA 1C7SA 3S5SA 4MYAA 2EO7A 1JXKA 4QLLA 4J3TA 3EPNA 4G9PA 3IPWA 4AXKA 5E6ZA 5E0KA 3GFXA 3WNNA 1W2VA 2A21A 4L4LA 1R2TA 1PV8A 2NQHA 3TJLA 1RCOB 1K03A 4CQDA 3KEHA 4KRTA 2WHKA 3IJIA 4WOQA 2ZRUA 4B5WA 3C2FA 3VKJA 2C16A 2QR6A 3PFRA 2E28A 2QVNA 4Z2JA 4Q8TA 3G77A 3EX4A 5C9WA 4S3FA 2DJLA 1DJHA 1CT5A 2VO5A 2PC8A 5D04C 4NZJA 2OLHA 1ZLPA 2HVNA 3QV8A 4Z1CA 3QKZA 5M17A 1UOKA 3KUMA 3VX1A 2GJXA 3VTRA 2E9BA 3S2NA 3QPYA 4LANA 4QBXA 5D4YA 4GXPA 3L4UA 1EJRC 5AHEA 2DVTA 1AMKA 2E8ZA 3RFAA 1FH8A 3SEPA 4NX0A 3TWBA 1JCJA 3I3BA 1S39A 4C1LA 4HA1A 4MUZA 4QSHA 1VFFA 1XYMA 2D3LA 5LNWA 3MMUA 4TTUA 4LUTB 3C2OA 4ADSA 5F7UA 2O9RA 3OVRA 1GG0A 4JN6A 2Z28A 5ECVA 5HOSA 2Y7EA 3O07A 4I8YA 1T40A 4JY8A 4AZHA 1S5WA 3QMRA 4LOCA 4OECA 4HN4A 3VMNA 1E5JA 3RILA 4E6MA 2BDQA 3URNA 2BHYA 3A3XA 4QRNA 1IEXA 4W87A 4L6DA 1RXOB 4OBRA 3S47A 1IIHA 3TYDA 1W54A 1GOXA 3RO6A 2W63A 1Q6EA 3PTMA 4LAUA 3GHTA 4XWUA 1DJXA 1EX5A 3VIFA 3MUY1 1C7TA 4ERGA 2ACQA 1W3JA 4FNUA 1F76A 1P7TB 4B5VA 3CHDA 3L4WA 1XIMA 4TOQA 4TV6A 1K7EA 1UR9A 2WHJA 3G0SA 4GNKB 1A47A 2PP1A 4JYFA 4YVXA 1WNOA 3A24A 1UP0A 5IBXC 2CERA 3PPHA 1ISYA 4IPJA 3IIZA 2NXGA 3QY6A 4M80A 1FTXA 2A1YA 1ENUA 4TIMA 1W3TA 3UQNA 3CZJA 3E6EA 3AYSA 3UXAA 4M19A 4C5ZA 1GYMA 3LTPA 4OGZA 1RD6A 1W1YA 3REQB 4Z1BA 3WEOA 4NNAA 1POJA 4W7UA 4DIAA 4CU8A 2XIBA 4O28A 3CGTA 4IJRA 4PEEA 4HJWA 5ECUA 2CESA 1EUNA 4HA3A 5ABFB 3V5CA 2P3ZA 1JYWA 2DGAA 2ZZ3A 1KKOA 1D3GA 4L56A 4X22A 4RK8A 3H4WA 1RHCA 3WH5A 4AMAA 1L8PA 4ML9A 3CM4A 5T26A 3WLKX 2IKHA 2VR4A 2YL9A 4A6GA 2GQ3A 3W29A 5G1TA 3KOWA 4Q4RA 3UJ2A 4FEZA 4PTMA 3FAXA 4AZIA 3QM3A 3VNLA 4YYFA 1B9ZA 1LRTA 2Z6IA 8RUCA 5ABHA 4LAOA 4IQLA 2CBVA 5C2XA 4EX4A 3UZ5A 2PDQA 1TTIA 2G4JA 3E74A 2GK1A 4J35A 1UIOA 5IBXA 5C9RA 3UD6A 3TW9A 2YL6A 3VA8A 1UC5A 2A3BA 1SFLA 1BKSA 1P0NA 3ANVA 3L0KA 5FF0A 2ACSA 3HGRA 2WMKA 4GQGA 3TLLA 3Q65A 2VX6A 3P8JA 3A13A 3AZRA 1HXJA 3O63A 3XIMA 4W8BA 3NQ8A 3VI2A 4IPPA 2G37A 3FCPA 2XVPA 4PBFA 2WC7A 5IRPA 1E56A 2VURA 3TW6A 2WW5A 4OWGA 3V1HA 3W22A 1VFHA 2V5BA 2X30A 1YW1A 3ARRA 2QDEA 3OTRA 4AX7A 4GX9A 5G2IA 1H1YA 2HE8A 3TC3A 1VIWA 2PUZA 4FXRA 3VU2A 3WQ8A 3I3DA 3GR4A 3K8KA 3W7GA 2MANA 4GABA 1J0YA 5E09A 1ZFJA 3T0CA 3BLIA 4H00A 3U48A 1VIZA 1W9VA 4US6A 1WDRA 4EIVA 3CO4A 1ZCOA 4P7RA 3WQVA 1I1XA 4DYJA 1WX0A 1TX0A 1VLWA 4OJYA 3WF0A 1K4HA 1GKQA 1FXQA 1O94A 4IUGA 4PUUA 4BCEA 1SZGA 2F6KA 3QBUA 3QJAA 1UH2A 2XSAA 2HVMA 4UNLA 1U22A 4IIFA 3B4UA 2GJLA 1GHRA 1J6OA 2D2GA 3OGVA 2E1WA 4P7NA 3PN8A 1WZAA 1WXZA 1CGYA 1KNWA 4UOJA 3M5YA 4ERAA 3A47A 3DFHA 4KCUA 4PEKA 1LROA 1G94A 3PB0A 1GPWA 1ZTVA 2OFJA 3SY1A 2J66A 4F4RA 4IIGA 3S5ZA 3IK4A 2XGIA 4CQBA 1J18A 1IWPA 4MNJA 5AYBA 5CSRA 1CCWB 4RNIA 5XINA 1EP2A 1L2UA 1E43A 2FKPA 2FZ9A 3VIGA 1DP0A 3W72A 1F4AA 4PBEA 4XIAA 1Z8AA 2J6XA 4O12A 2KZHA 5FESA 2E25A 1Z6KA 5A8QA 2J6VA 3VGFA 4L9ZA 2V68A 1BWLA 3IJ9A 2J88A 4L9YA 1NWUA 3E5PA 3UR2A 3BG3A 3TTYA 1OK4A 2JFEX 1W3KA 1UA7A 2OOGA 3NTYA 1OFQA 4EWND 1EP1A 4CN6A 4NT0A 3MSGA 2WBGA 2Y7DA 4TTGA 2XM1A 2R24A 3RJXA 3UBPC 3AJ7A 3QY8A 1LG1A 3W82A 3MB9A 4PSRA 4UZSA 3O9NA 2WJZA 1PAMA 2KX9A 2D2OA 4ATLA 5AKQA 3WLSA 8A3HA 3U2ZA 3D5HA 3AIEA 1R47A 2R9RA 3M16A 3P8IA 4N9CA 4M3PA 3CT2A 4O1BA 2V3GA 4GOAA 3RLVA 1PKMA 3KCJA 1Y7VA 3ERPA 4AUBA 2PDLA 2CLKA 3F2DA 4N4QA 1R2SA 1KTBA 3TIMA 2GJPA 2P76A 1NP2A 3W7LA 1F05A 3N18A 4ILSA 2ZZ2A 3KS5A 5KETA 1LT8A 3I10A 4E0CA 1XLKA 4HNCA 1KM3A 4H8VA 1OWQA 2ISSA 1E6ZA 3DERA 1KR1A 2Y88A 5BRPA 5I24A 3LXAA 2WZEA 2D73A 1DWFM 1NFPA 3KCOA 2DSWA 3ABXA 3BMWA 1Q2SA 2GWNA 1WDPA 1EQCA 2XFWA 4JQ2A 1RQBA 5DMLA 3FXYA 3M6YA 4GINA 4IGMA 1JUKA 3QQWA 5LNRA 5E0CA 3VMPA 2R1LA 2VFFA 1B57A 2P0OA 2QCHA 1H7NA 3H7VA 4M7SA 4QLKA 1DV7A 2C1IA 1W3LA 4PMJA 3AS2A 3WQFA 4GC4A 1E3XA 1LJYA 9XIMA 4N2YA 2QGHA 4CNOA 2GDUA 2I7GA 3ABOA 3TVAA 1A80A 1J8VA 4YHEA 1MRAA 5JUVA 1QBAA 2HBXA 4GLEA 4Y9NA 4YWSA 1PEZA 4YTRA 3MJYA 4NSBA 1VHNA 4HZMA 4X0NA 3KWSA 1B3YA 4JY9A 1EJXC 1MRQA 1P5BA 2RUSA 3UR8A 4XX6A 1CLVA 5CGQA 1DQWA 2UY5A 1YXCA 4O57A 4KERA 2J4GA 1VEOA 2IPWA 4HNVA 4O14A 3RCMA 3NA8A 2BHUA 3DC0A 2ZTKA 2Y7GA 2ZA3A 5AFDA 4FNQA 5LIKX 1P6CA 4DZIA 4G7EA 1OCJA 4AD2A 4QQUA 3H12A 2QUMA 1VH7A 1TG7A 2VX5A 2GPTA 1TUXA 2V5LA 2XFYA 3WIJA 2WHMA 1QO5A 2Z6JA 3TQPA 2VNCA 4HBKA 4JQ1A 3BG5A 2J78A 4L4PA 5HUOA 1UMLA 1FH7A 1Q63A 5LZLA 1X97A 3P14A 4HSHA 4ZQMA 1F07A 4J4KA 5U7SA 1C8VA 1UG6A 2WLZA 5HQLA 2DZBA 2J79A 5DFAA 2QVHA 3LSCA 1RCQA 3SBFA 4EWJA 3AIWA 3M0HA 2CZDA 4YCOA 1E6PA 3LB0A 3I68A 5IDIA 1ZENA 5HJYA 5CBBA 3E38A 3AIRA 5A3HA 2OCZA 1DWHM 4GK8A 1EYEA 1VR6A 3EDDA 3WLQA 1ZZMA 1VFUA 3PSWA 2VFGA 4G1KA 2NV1A 4B3ZA 3M5XA 1H63A 5DRCA 4FX6M 4CVUA 4PTNA 1P1MA 1YIXA 2B7QA 3PBGA 3QGVA 5A6JA 4A3QA 1MDLA 2WKLA 2P5NA 3FYPA 5DF0A 1REQA 1T6MA 4QNWA 3V36A 4O54A 1NQKA 1OFAA 3HPXA 4AHQA 2BXYA 3HG2A 1YXDA 1JXJA 4JTQA 1R8LA 4C65A 1LWJA 3CLMA 3BCDA 1WXJA 3TYCA 1RH9A 3AIBA 4OKDA 3VABA 4HNNA 3W53A 4F3HA 4U2ZA 3FA3A 2FTWA 3GH7A 4Q4PA 1JJKA 3AO0A 2DQWA 4UOQA 3KVMA 1XLCA 4LB4A 3E0LA 5I02A 3OOQA 5CQ1A 5IM51 2B0MA 3JRKA 3DGRA 1J96A 4GVFA 4O10A 3UJFA 1WQ5A 3A3HA 1HN1A 1ME8A 1XPYA 1GWJA 1ESWA 1X96A 3QRHA 1TR1A 3K4DA 4Q3MA 4NRSA 2DUZA 3KZPA 2IKJA 2NVCA 3SUTA 2AGKA 2ZRXA 4X3ZA 3ARXA 3WQGA 4QCEA 4US5A 3LM7A 2A7RA 3GR7A 1EL3A 3CT7A 4EPKA 3MI3A 1FWWA 5I2UA 3CIXA 3PAOA 5A2AA 2PD5A 1G67A 5CPLA 2ZTJA 4GZIA 1UZHA 3C5QA 2Y85A 5HDRA 3S8HA 3IJLA 2WVUA 5E6YA 1TZZA 2QXWA 4H9TA 1HNYA 5I3DA 3UCCA 1DXEA 5FEPA 1EUAA 3CASA 2W6RA 4AZ7A 2FH8A 1V08A 4HPJA 1QT1A 1RZMA 3JUGA 4GD0A 3U5UA 2NXHA 2VRJA 3GB6A 3WG6A 1RP8A 2GVGA 1HKMA 3NL5A 1DE6A 3HFTA 4IL2A 3O0KA 2ZOXA 3KLLA 4CNTA 1DIEA 1GOKA 1BVWA 3TX9A 1SSGA 2AMXA 3HPAA 4KRUA 2VC6A 4ZO9A 1KBKA 1MO0A 2YXGA 3GHSA 2JKPA 2CFFA 4H6KA 3MMWA 2DSVA 4GI4A 5EPDA 3W2LA 2A2IA 2I5GA 4DO5A 1DXIA 2PODA 4JTLA 1R86A 3KCLA 1GW9A 4LUIA 1DVJA 4ZBCA 2OZ3A 2AGTA 4QDPA 3OJGA 4XISA 3CZ8A 3QMTA 3EOSA 3C4UA 3UU0A 2WM1A 2ZE3A 3TZNA 3B8VA 2QPSA 2R1PA 4QQ3A 5HA7A 5BYWA 4KMQA 1OF8A 1KRMA 1K77A 1K8YA 2VEKA 3W83A 2ALRA 1KFJA 3DI1A 1GVSA 1E3ZA 2F38A 1TWSA 2QDHA 3KRBA 3T9PA 4PRTA 3HIJA 2VDHA 2BTMA 3U7BA 2GVLA 2FHFA 5FF2A 3SDOA 4YYCA 2FQIA 4A22A 4MWAA 4AZCB 4MKNA 9XIAA 4IMCA 1EEPA 4WD0A 5FEWA 3QC3A 2HDJA 1HT6A 4UQ9A 5BXTA 4QROA 4DZAA 2NT0A 4HNTA 1VRDA 3S83A 5CAKA 5A6AA 1YNQA 3EB3A 5CKSA 3RU6A 3WH6A 5H1WA 4FNSA 3BO9A 4XIMA 1M7PA 3FGCB 3LSBA 2Y8UA 2QCFA 2A6NA 4IGHA 3F4WA 3L0GA 4Z17A 5BW6A 1PCKA 4LVBA 3A21A 3KX6A 4FO4A 1KC7A 1YDYA 4JEQA 2DW7A 3LPPA 3ARVA 3WD1A 3UW6A 2FJUB 3I3EA 1L6YA 3EX1A 3LLDA 1LL4A 5TNVA 4AD3A 2OELA 1X6UA 5I79A 4JTAA 4I9TA 3MUCA 1EC9A 1EXBA 1XL9A 1PIGA 4HQVA 1GNXA 2CBUA 3S3GA 2DP3A 2OT1A 3KRZA 2WWDA 2CHOA 3N25A 4KESA 2VEGA 3H55A 4W86A 4MFDA 2WSKA 3ICJA 2AKZA 1P43A 1HJXA 3PHAA 2XTKA 2ICSA 3CZLA 5BOEA 3MV11 1TZ7A 3VOGA 3EMCA 1C9DA 1N55A 1TX2A 1EO5A 4MNLA 2PDYA 3PJWA 3T09A 1Z7AA 3WY1A 1E70M 3C2RA 3EWXA 4PMQA 1AH3A 1V7YA 3QXBA 1DBTA 1BRLB 3QHOA 1Q6FA 1EWEA 1E9ZB 3ATYA 6XIAA 4HCHA 1TV7A 4EANA 4PRWA 3WEMA 1B3ZA 3ATZA 1VCVA 5CJ5A 3GRIA 3IV8A 2WSRA 4ZODA 4C1NB 4HYWA 1XG4A 3XISA 1O5XA 4D6CA 2NX9A 2ZX7A 4LNYA 3SURA 1XIIA 3L7RA 2E40A 1QNVA 4UCFA 2PDCA 9CGTA 5ABGA 1OZQA 4U5IA 4GI9A 3AALA 3U4AA 2FVMA 1JFHA 1S38A 2FYMA 3H21A 3AHYA 1KTNA 3N2CA 1PPIA 3NVTA 3GG1A 1VPXA 2WMGA 1EXPA 3LLFA 4LUJA 4WHBA 4ZQPA 3ITLA 2ZXAA 2OLSA 5F2IA 2GZXA 1X7IA 3VIKA 1JIBA 3SCPA 5JIWA 1XYFA 2A7PA 4K37A 1QI5A 1AUSL 2D0HA 4XSMA 3SCQA 3QTPA 2YDSA 2OYMA 4K68A 3AROA 3CB8A 3DIPA 4MGGA 3M0IA 2A3LA 2VVSA 5ABTA 1TPEA 5AECA 1KXVA 3FNDA 1AMYA 1OYAA 4J3UA 1U33A 1J9YA 1E51A 3DEQA 2BSLA 3TJIA 2BNJA 1UWSA 4G6CA 1OCNA 1D7FA 4XV0A 3L23A 1M65A 3WF3A 1S2UA 4S3JA 1S5NA 3HQPA 1ISZA 4Q6JA 3LYEA 7REQB 2XWEA 3WQEA 3KOZA 4RKAA 1PTAA 1E4NA 3ZVHA 2PB1A 4UUIA 4Z2LA 4PCFA 1X8FA 1P0DA 1G01A 2RKXA 1EDQA 4H6QA 3RO8A 3BAIA 3TC7A 3TJ4A 3RK8A 4OUEA 1A4MA 1KGWA 2QJNA 1UWTA 2WYSA 4QITA 4AZ5A 3HN3A 2DSUA 3L5MA 4K2SA 4JXCA 1WYIA 3UT0A 5FJTA 4QR6A 4H01A 1K7FA 4D6FA 3SY8A 4KPLA 4S2CA 4H6RA 2YDQA 3RR1A 1E0UA 4NHVA 4REQA 2QEZA 3M0XA 1XW8A 3QVQA 4ZTXA 1PIIA 3MU7A 3K30A 1NARA 3EWZA 4AY1A 1LOLA 3N4EA 4GNJA 1ML1A 2CU0A 2OQHA 1O66A 2O0TA 3OBKA 2J7FA 1W8GA 2ZZ6A 3ALGA 2C1HA 5AC4A 1PTDA 5HNUA 3RMEA 3SUWA 3MJMA 3PULA 1XGZA 4FLSA 2HNHA 3GM8A 1QO2A 2ZUWA 2NQ5A 6A3HA 1BLIA 4GCAA 2WSQA 4I8DA 4BKNA 4P8VA 3C3NA 4IISA 1RQEA 4JIRA 3TTEA 4HD5A 1EJUC 1UKTA 3LQGA 2VEMA 2EPNA 3APGA 1SFJA 4J3ZA 1GQIA 4KFPA 1ZRQA 1GVFA 1TV8A 1QPKA 1AODA 2HZGA 4N6EA 1YYAA 5D32A 5EB8A 2TRSA 1Z3NA 1FWDC 3VCCA 4QG6A 1CI1A 1JPIA 3A5FA 4R7OA 2R1KA 3UWVA 3W73A 3ANUA 1HKVA 1JD7A 3CS2A 4CQ8A 5FJPA 2Y1HA 2VR5A 5F1VA 2BODX 1B4EA 3FJ6A 1BYBA 5KZ6A 4LYQA 3UG3A 3EXTA 3N15A 4DQWA 1G69A 1UKQA 4MZYA 4GC3A 3GVGA 4L6HA 1DHPA 4DBEA 1X98A 5CZSA 5AC8A 2ESCA 1UP2A 1VRXA 4OBTA 3QLLA 5DLCA 5I03A 3HGOA 3THCA 5FA5A 4Z08A 3UR7A 4F9DA 3LGDA 1EGZA 4OE7A 4CD6A 1H1NA 1LUCB 3VD4A 3E2VA 1TYGA 1ADDA 1YBQB 1KTCA 1B3XA 3QN3A 2REQB 7ENLA 5D9PA 2ZRWA 2WB5A 1BAGA 1US0A 1CB7B 1JZ7A 3ITYA 1VYSX 2E6YA 3H54A 3GNXA 3STFA 2ZCGA 2QDDA 3K13A 1HFBA 3GUGA 3MCNA 2DZTA 2CCRA 3THUA 4LCQA 1JCLA 1EZWA 1YQ2A 1XKJA 1S5MA 3AMKA 2QJMA 4RCXA 1TKKA 3L65A 2YLLA 2YBUA 1CXKA 1JCYA 2OLAA 3ZSSA 2BGQA 4DF2A 1QTWA 3O6AA 3AZSA 5KITA 1CW2A 4V2XA 2PDFA 4AIUA 4V28A 3JR2A 2BGNE 4LS0A 4K38A 2HPMA 1B54A 3LMZA 3ID7A 3EKZA 1XG3A 3AFBA 1W3HA 1C8XA 2ZZ7A 3AMCA 3UZWA 2V2CA 1K8XA 3WLLA 4XZHA 1IYXA 1R5YA 1M1BA 3PZQA 5HQEA 2QKFA 2J7CA 3HGSA 3PAJA 2E0PA 3HG3A 1US2A 3W9ZA 2GUUA 2JKAA 1CEOA 1S1PA 3K2GA 2BVTA 2YCKX 3EPMA 1S2VA 3S9IA 3T1GA 3GBDA 4IQEA 3WLTA 2AOSA 4ICCX 1SU5A 3MUZ1 2YA2A 4F0LA 1SM9A 1TJ0A 1OFEA 3CZKA 4LVDA 2HWGA 3A22A 5DCDA 3K8MA 4C6CA 3W26A 2OVLA 3QR3A 4PMYA 2ZICA 4BF5A 5A6KA 3GXIA 3T40A 4UQBA 2QS8A 1ZY9A 3ZS4A 1FFQA 3LOTA 5JIPA 3WDQA 1Q6QA 2BY3A 5FD0A 2UBPC 4AD1A 2HEJA 2WZIA 2IPGA 2FHBA 2NZLA 2AQVA 4QCFA 3CHFA 2D69A 5EFDA 3P60A 4AY8A 1PTGA 3BJFA 4MUPA 4QE5A 4AZ6A 3TNBA 1W9DM 4XZMX 1X39A 2E5BA 4HOWA 2TPSA 3NPUA 3VGHA 1JYVA 1KBLA 4ROQA 3RF9A 2W92A 4ZENA 2G0WA 3R58A 2GSJA 5DEZA 5F4WA 3HOJA 3M0KA 2NWRA 1AFSA 1JAKA 3UYCA 2YA0A 5KZMA 1K9DA 4HPHA 2E6FA 4PN2A 4DWSD 3NO1A 3OEXA 2IXVA 5K9CA 2JEPA 3B8WA 4H19A 4HK7A 4MKSA 4DJDD 1I8JA 2E6DA 5DT5A 4AVOA 1CXLA 1XLMA 3KL5A 5F4SA 4CEXC 3ZOAA 3OLDA 1LQAA 3BOLA 2XH2A 3VNKA 3CLWA 3USZA 5H2ZA 3VD3A 4WQ6A 3SB0A 3GG0A 2ZVIA 1S1RA 1PHQA 4FXSA 3M9YA 1HZYA 3GLCA 2HVOA 4JBRA 5JH2A 4PMXA 9RUBA 5HK4A 4XTIA 3IRDA 4DJEC 1MUMA 2AL2A 4EOUA 1GZ1A 5J5DA 3OU8A 3FA5A 3VDGA 1N82A 4S23A 1M01A 3SAZA 4LUTA 1GVEA 3A4WA 1XXXA 2QAPA 1WDQA 2ANUA 2XH7A 3C0SA 2C0HA 3USBA 1KQZA 1EBHA 3TH6A 1TPFA 2XIQA 3RU8X 2OR2A 2BWGA 3GNPA 4FLRA 3DFQA 4ZO7A 4MAVA 3T0DA 1MQPA 4XO7A 1HL8A 2DEPA 4XSLA 3TXVA 4JFVA 3LQLA 2PLJA 2HXTA 5HBFA 4C91A 1H60A 1YNPA 2I56A 3D3FA 4LVGA 4Y2WA 3AHVA 2VL4A 4TX8A 3G1SA 4C6BA 1YRRA 3QSRA 4D9PA 1P7TA 2PE4A 4QG8A 1V0KA 5DCEA 4W8LA 1MQRA 4G56A 3GBEA 2V2DA 5HR7A 1H49A 2DIJA 2OEMA 3MDWA 4J27A 3BWWA 1GONA 3ZLGA 3G8RA 2IQ0A 2WJDA 3BAXA 4MOZA 1BYCA 1EDTA 3WENA 4IIHA 2V9DA 3M47A 3AU2A 4J2PA 1B3OA 4DJEA 1ZBWA 1UZDA 4DYKA 2J13A 5B80A 4DN1A 3BAWA 3CB3A 2DQXA 3REQA 2VHLA 5K4XA 3IEBA 4FXJA 5I5RA 3UG5A 2QCMA 2F6XA 2PFHA 3V5OA 4GYPC 3T4CA 5HMEA 2V8ZA 2Z0IA 3R10A 4UNIA 1BVNP 4S3GA 1DWGM 2VX4A 2VENA 3GNOA 3NQFA 2OMAA 4LFYA 3AAMA 2VZTA 5EMJA 4B92A 2X42A 3TDFA 4JL1A 3AUJA 2ZX5A 3T0AA 1FX6A 1VFMA 1MFUA 4E4PA 1R2RA 2YIHA 4YU1A 4E3TA 2CPUA 3E2SA 5AB3A 5BXRA 2ZUVA 4YHGA 1LQ0A 4PUKA 4WXZA 5LA0A 4IX0A 1M3UA 5C71A 5DN1A 1ZGDA 4IHCA 3HJZA 3NR0A 5B7ZA 2UY2A 2WBKA 1KCXA 4P61A 4XVDA 2RJHA 3NSXA 1RLDA 1XYAA 1CBGA 2PF0A 3LTYA 1XWYA 4WXYA 3O3RA 1I6NA 3P62A 3PFMA 4EK7A 1JF5A 1W5PA 1JZ3A 1BHGA 3NYZA 2VKZG 1W8SA 2GFTA 3IGHX 3TQVA 3WLHA 3ARYA 3L5LA 4GYPA 1JVNA 3L12A 3FW6A 4CNPA 3GVRA 1EEXA 3K1DA 4QAWA 3DHUA 4A8IA 5CBIA 2PTDA 4GPNA 2TYSA 3OG3A 3W1UA 3BUVA 3ZYZA 3RYSA 1UWQA 1TPVA 3R5EA 4PMOA 1XV8A 1F6KA 2CWXA 4KH2A 4UFMA 2IQTA 3K8LA 3T7VA 2CLPA 3PC0A 1DJWA 3FDKA 2FVLA 1LBLA 1W1IE 1FHDA 5TIMA 1XSIA 3IIPA 2TODA 1CXIA 4TX6A 3ZLHA 2X16A 4AF0A 4ZB0A 3AYTA 5JMUA 1NIUA 3U2CA 3BZGA 3TAKA 2PI6A 3WF2A 3ELFA 2R6OA 2YW3A 1XP3A 3VZXA 3G1DA 2YDAA 1JRCA 3WK0A 3B4YA 1G6CA 1D7KA 2QIWA 1TZ9A 1XBZA 3FK4A 2ZVRA 2YCEA 5LNVA 1Y5WA 2DVUA 2NV9A 3EDJA 2CHNA 4ACZA 4RV8A 5EMUA 4LB3A 4YIWA 4NXSA 5BU6A 2WQDA 1OX6A 2VI0A 1K70A 1IHIA 3GAYA 5A2BA 3H2OA 3C8FA 1E71M 2FTPA 2VJXA 4S3DA 3RIKA 2HROA 5AYZA 1GK8A 3GKAA 4LAZA 1A5MC 1GKPA 3WLRA 3VUPA 3UETA 4XUYA 2EG6A 4OVXA 4K8GA 3SRDA 3M0MA 2BZNA 3WKZA 4E3VA 3AJXA 4AU0A 3NQVA 5DXYA 5KINA 5BU9A 2QYGA 3EWCA 4G7EB 2GQ8A 3THQA 3QEZA 1I2QA 1XCFA 1B0IA 4GBUA 1UD5A 3WJXA 1VBUA 4S39A 4PB5A 3CIVA 3H7RA 5AHLA 1ZJBA 4A05A 1DWAM 3GXNA 4GQBA 3BANA 3KOFA