3P14A

Crystal structure of l-rhamnose isomerase with a novel high thermo-stability from bacillus halodurans
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
414
structure length
402
Chain Sequence
KSQFERAKIEYGQWGIDVEEALERLKQVPISIHCWQGDDVGGFELGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 151
structure length 402
sequence length 414
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3p14A00
2GLKA 3P6LA 4HHMA 3AYVA 4J4KA 1DIDA 3VNLA 4YTTA 2NQ9A 4G56A 3TC3A 4ZB2A 4HNOA 2ZDSA 1I60A 1I6NA 4X61A 5FA5A 4GQBA 3BZGA 2HK1A 1XP3A 4QE4A 1XINA 2ZVRA 3KBJA 5XIAA 3KBSA 1DE5A 4QE1A 3ITYA 1XLLA 3AYTA 3CQIA 3XINA 4Q7IA 3L23A 1O1HA 3U3HA 3ITXA 3M0XA 4GJIA 3XISA 1XIIA 2GUBA 5AVNA 4QEHA 4US6A 1XLGA 5H1WA 3OBEA 4DUOA 2HK0A 5EMJA 3UA4A 2X7WA 5H6HA 1TZ9A 1XIMA 4A8NA 3KBVA 3VNJA 3M0VA 1XLAA 1A0CA 1XLJA 6XIMA 5XIMA 1DXIA 3AAMA 1A0DA 2QW5A 1XYAA 1XIHA 2NQJA 2QULA 3QXBA 3QZAA 1OADA 3DX5A 3P14A 5I7GA 5XINA 1A0EA 1BXCA 3M0HA 3UXIA 3IUDA 4QEEA 1GW9A 4A8RA 4W4QA 1S5NA 1XLCA 1XYMA 2QUNA 3FVMA 3NGFA 4KW2A 3GNXA 3XIMA 1XIEA 3VNKA 4HGXA 3QYSA 1XLKA 3IUIA 1QUMA 1XICA 5EMKA 3AALA 4E3VA 2NQHA 3VNMA 4PFHA 2GYIA 2QUMA 1XYCA 4YTUA 1DE6A 1XLFA 3VNIA 1XLDA 4EACA 4XKMA 1D8WA 2XINA 3BANA 3M0YA 2X7VA 1XYLA 2G0WA 2GVEA 3BWWA 3M0MA 6XIAA 3WQOA 4X60A 4QDWA 3C0SA 7XIMA 5EMMA 4XSLA 1XYBA 3KBMA 4XSMA 3N4AA 4HHLA 1XIGA 4ZB5A 1XIFA 3UA3A 4A8LA 3ITLA 3LMZA 3ITOA 5B80A 3VYLA 3C0LA 5TNVA 3CWHA 2OU4A 5J8LA 3KWSA 1XISA 3KTCA 4EAYA 1MUWA 2HCVA 1XLBA 1CLKA 4YTQA 1BXBA 1XIBA 3ITTA 4GLEA 4GJJA 1K77A 4K3ZA 5B7ZA 4LNCA 4K1GA 3CQHA 4YTRA 2Q02A 4QE5A 5AVHA 2I56A 3DBNA 3BDKA 4PGLA 3KBWA 3CQJA 2G4JA 2XIMA 3UU0A 1YX1A 3CQKA 3IUHA 1XLEA 8XIAA 1XLIA 1XIDA 1XLHA 3C0QA 3KCLA 3M0LA 4X63A 3U0HA 5C9ZA 4XISA 3CNYA 3TVAA 3ITVA 4XIMA 1XIJA 1DIEA 2J6VA 1QT1A 3UVAA 4A8IA 2XISA 3KCOA 3KCJA 1XLMA 4YTSA 5B7YA 4XIAA 3JU2A 9XIAA 4QDPA 1S5MA 4DVOA 3KBNA 8XIMA 1MNZA 3QC0A 4ZBCA 9XIMA 1QTWA 4OVXA 5EMLA 3BZJA 2I57A 4ZB0A
chains in the Genus database with same CATH superfamily
2VZVA 2WJDA 3N18A 1OHLA 1XRFA 3LM7A 1B4EA 5CPNA 3WLLA 4J1OA 4OZOA 2PZNA 1A5CA 5G2WA 4PMDA 4AD4A 3VGHA 3M5ZA 1ZALA 4DO5A 1KBIA 2D73A 4AZCA 1FWIC 1UH3A 2PLMA 2ISSA 2ABBA 3UY8A 1WBJA 3VABA 1SR0A 3LCFA 1I75A 1MYRA 1BXCA 2WC3A 3GC2A 2ZXQA 4O1EA 1V02A 4FHAA 1Q85A 1VBUA 1A5AA 4C6KA 4PFHA 4UUIA 4ADTA 2BWGA 3CV2A 3M9YA 1KWGA 3GU2A 1FWJC 5DY3A 3H70A 2CKRA 2BMBA 4AXNA 4JTLA 4BF9A 1Q4WA 1OC5A 1EKOA 3GW3A 3BLIA 4JNZA 1X7FA 5FKYA 1Z8AA 1XW8A 4MSSA 3KWSA 1BXBA 2W63A 3AI0A 4OBRA 5DCEA 3V16A 4US5A 1B9ZA 1KCXA 3M47A 4JTRA 3G1XA 3MP5A 1IEVA 1X6UA 1CENA 3DDMA 3TN4A 3V0TA 3E12A 3EXSA 1E6SM 4YTTA 3OJGA 3C2EA 4O50A 3W83A 3EWBX 3EZ4A 4ZO7A 4W86A 3WL1A 4H1ZA 5DMNA 2D69A 4ACZA 4UQDA 4GUJA 3SRKA 2V2CA 3AU6A 5L6UA 1OYBA 1HKJA 1T7LA 2D2JA 1GQLA 4O18A 1K8CA 4IUGA 1J4EA 3P61A 1S2CA 3BSMA 3E5PA 1CXLA 1CGUA 4OU1A 4HU3A 4XAYA 4FNQA 3KRSA 1EOKA 3THDA 5E9XA 3O07A 4JFUA 4WUIA 3WK3A 1K1DA 2VX7A 3G24A 1UCWA 3CZGA 1LDCA 5DF0A 3WNMA 1H0GA 3KHJA 5J04A 2QIWA 1LL6A 1L8NA 4HMCA 2ZX9A 3HQNA 1T99A 1R47A 2GWGA 3B0YA 3W7EA 1KM1A 2VMFA 4NI3A 1DTUA 2ZUVA 4XZNX 3ZT5A 1RAKA 3BLFA 5LSMA 3W3OA 1YXYA 4YU1A 5IFPA 3VDGA 1I2PA 3RCMA 1J0YA 1GHRA 5EU9A 5E0CA 3DKLA 3DFQA 3VK5A 2Z1SA 3LBMA 2YL6A 3K8MA 1ZGDA 5H2ZA 4MNLA 3LHYA 4P5UA 4C91A 3QQWA 4QLLA 3RMJA 3B9AA 5EMLA 1EEXA 1UIPA 5C9WA 2PCQA 1UR0A 1MVYA 2YFOA 2BOFX 4C65A 5FA5A 4KCWA 3CZKA 3KBJA 2WKGA 1LYXA 4GJIA 2A3CA 1QI3A 3E96A 4KKXA 1NTHA 4EXAA 4WCJA 2VHLA 4Q7NA 2FHCA 3JVAA 3RRAA 3LV6A 1R5YA 2IPFA 4GY1A 1SYTA 4JBRA 1PWMA 4K8HA 2QUNA 3IK2A 4DYEA 2FZ9A 2XTKA 2QJHA 5A94A 4DBDA 1OB0A 4K7YA 3AALA 3ITGA 2VFEA 4ADUA 2IKJA 1TIMA 3C56A 2XHYA 4JIIX 5EFFA 1B30A 2YGYA 4C1KA 2C15A 3A22A 1WDPA 4DBUA 3ATYA 3I7SA 2PWEA 5CPLA 4X3ZA 1YDVA 4OWGA 4P8XA 3KVJA 1TJ2A 1YLVA 2V2DA 2X16A 2XVKA 3PFMA 1K7XA 1HKKA 4M24A 4AY7A 2OR2A 4G7FA 4CQ8A 8TIMA 4IGNA 3R11A 1DKWA 1Y5WA 2BXYA 3CUXA 3CMJA 3MBDA 1XLIA 4UTUA 2DFAA 4GQGA 3N11A 1BAGA 4XIMA 4HQVA 4CD4A 1QR7A 3I4KA 3EPOA 2RUSA 2W6RA 2QDGA 3V4BA 4WSKA 1ZUAX 1MW3A 2ZADA 4S39A 2HVOA 3IIVA 5JBFA 1ISZA 2QJNA 3OBKA 4FR1A 3AS1A 3N2BA 3RF9A 4BHYA 2YIHA 3V3WA 2HK0A 4LS0A 4MKNA 1GOQA 4UCGA 3ARYA 1JDFA 1UPMB 3MV11 5FF3A 4LPCA 5BW6A 3N6HA 4AWSA 2BFGA 2H8XA 2DJXA 3HFYA 3LTYA 5CC7A 4IMDA 3HV9A 1JPHA 3UGVA 4MWAB 2IXUA 4NZ1A 2CBJA 1K8XA 2PP0A 4YPJA 5C2CA 4H6EA 3EDJA 4QAWA 5G1MA 4C6DA 2BVTA 3W7LA 2X0HA 3T8QA 3ZFHA 2X7VA 5KSWA 5IFTA 2OT1A 5HR7A 4QDWA 4KEMA 3SGUA 3N4AA 3WQ4A 4LAZA 1KBBA 5FESA 3NTYA 1RHCA 3H22A 4H2HA 4H9VA 1C8XA 2VX6A 5A2BA 2IPWA 2PLCA 4B5WA 3G2GA 3AU2A 3WQVA 1BKHA 1RJPA 3IUHA 1ZL1A 5AC8A 3HB9A 3K4AA 2VO5A 1WBHA 3W38A 4TVUA 3HQOA 1E6ZA 4TMCA 1TPEA 4AZCB 3E0WA 1OZQA 3CBWA 4JY8A 4S2BA 4JFVA 3AQUA 4RL3A 3OW1A 3W53A 2BVYA 4I7UA 4E2OA 3MWCA 4N9DA 4D1IA 2NSXA 4XUYA 1V6VA 2CLLA 2VC6A 4LBRA 4QITA 3VCNA 1E6QM 5KINA 3LXBA 4DO4A 4QG6A 3UXAA 3KOYA 5CZSA 5I03A 3GXMA 4QJ3B 3DBPA 3LYEA 3L2MA 2I5GA 3BVJA 1K9DA 4ICNA 1SZGA 3NWRA 3UQNA 3KXQA 2YCEA 2YB4A 4Z2GA 2X41A 1B5TA 1PKNA 1ZTVA 1FVPA 4WHBA 2FTWA 3WQ6A 1MQRA 4D8AA 1HP5A 1VYRA 3WDJA 1XDJA 5U7SA 3ZSTA 3E2RA 3Q58A 1V3KA 1XGDA 3ANUA 3OVGA 1G01A 2R9RA 5E0FA 2CWXA 3ELFA 2O4QA 2B31A 3VX1A 3DG7A 4TXEA 3RPTA 3GZAA 4UC5A 1L6GA 3DFOA 3SUWA 5I23A 1HX0A 2B4GA 4ACZB 2IMRA 1AK5A 2V67A 3VM5A 1K7EA 1L6YA 1ZLPA 4PCSA 2X05A 4C90A 4RNFA 1OFDA 1H5YA 4IL0A 1UWTA 3B8UA 3UWUA 2EXOA 1ONXA 2YSWA 4NYUA 1X6NA 3PG8A 1PX8A 2POZA 2WVUA 3CZJA 1OX4A 3VNYA 3W28A 1QCWA 3MANA 1VFTA 3V35A 3ZLFA 3VNJA 1LF1A 2ZUWA 1DXIA 5I02A 4H6RA 2VRQA 3A23A 5DFAA 1CXEA 2EG7A 3SRFA 3LEPA 3LCHA 1DP0A 3NGFA 4NT0A 1F3WA 3T42A 3W27A 4RPQA 2ZQ0A 3SQMA 1C8QA 3WLTA 3QSRA 4PUUA 4RNHA 4LNYA 4C6EA 3CUJA 4GIRA 4UQAA 1GKPA 3PTKA 4WX2A 2EQDA 3OLIA 2UY5A 5C2GA 5DCDA 4NXSA 3V0SA 3PANA 1LBFA 4EAYA 5HULA 1ONEA 4BS0A 2PTZA 3KLKA 4LNCA 1JIBA 3TV8A 3B8IA 1R3WA 4DXVA 3TTSA 1FFRA 2H3DA 1ITXA 3P0XA 3GM8A 3C0QA 1XGEA 2J13A 4X63A 2WJFA 4HN8A 3QFEA 3ZO9A 2HSAA 1C90A 5CZTA 4GG9A 3W74A 3KBNA 2VFDA 3ID7A 1AH0A 2F84A 2WAGA 3BJSA 1JNEA 1WAUA 1GVRA 4D71A 2PS2A 3U3HA 1I1WA 4DXXA 4QEHA 2CZVA 3MDWA 2NW0A 1X1NA 4FI4A 2OJPA 4IIBA 3VKDA 3TAKA 3C3UA 5DMLA 3N9KA 1AZ2A 2WHMA 3T0BA 2A3BA 4N9EA 3IK4A 3P62A 1W8SA 5EGRA 1EXPA 1D8CA 3QGAC 5C6MA 3BUVA 2ZDRA 5AHFA 1JNDA 1F05A 3H26A 3RX4A 4GBUA 3N15A 4XSMA 3SIZA 2YR1A 1SJBA 4H9XA 1BF2A 1PYMA 1AZ1A 3BO9A 3CIWA 1WYIA 1PO9A 3WK2A 4J9JA 2F7FA 4X2RA 1V3HA 2JKAA 4HOXA 2VVNA 3CB3A 3KBWA 2YBVA 4N02A 2VKZG 2WBGA 4FNTA 2ZX8A 3OVRA 1E43A 1V6WA 3CQ0A 4WY0F 3F1QA 1I4NA 3MI2A 1VR6A 1UOZA 3BLEA 2V2HA 2ZE0A 4GUIA 4GQQA 4O1AA 2PDPA 5DT5A 4GIYA 3GIYA 5LNUA 4AQLA 2LLEA 4M82A 1T40A 4KQNA 4A2RA 4BZYA 1G67A 2P0OA 1QBBA 2C91A 3LGDA 4AD0A 3CXOA 3KOWA 1UBPC 3A9IA 3HPSA 3QZAA 2W27A 1D3HA 1UR1A 5BMWA 1RZMA 2FVLA 3MUY1 1EQPA 1UWAA 1WUEA 2DZXA 3OVQA 4ZOAA 1K3UA 4XAFA 1RD5A 4GYPA 1H61A 2JEPA 1PIIA 4H9MA 4MJ4A 1XIGA 3PAJA 2DSUA 1IEXA 2PGEA 2O92A 3L68A 4TVCA 3FYOA 1G69A 5D02A 3VU2A 1NP0A 4M6UA 3MMUA 2BY3A 4JNYA 2ZE3A 1H7WA 2VWTA 3O6YX 1QPQA 4FOJA 1V3MA 3GXNA 4Q8TA 3KL0A 4TR9A 1TMQA 1A5SA 5LXEA 3M0LA 3UCDA 1CT5A 3VGEA 4FO4A 4JIPA 5AC7A 3F03K 1GQNA 1FH8A 4AIEA 3ENLA 1D9EA 4JKMA 2REQA 3F4WA 2CXGA 3QLLA 1KGUA 1KNWA 3SCRA 3IS4A 1GQJA 4DXKA 3LCGA 2PWUA 4JPGA 1SJAA 2E8ZA 1NU5A 4J3XA 3LLXA 3UVIA 4US6A 4IFOA 3H53A 3L0KA 3MKCA 2VZOA 4DPQA 3HN3A 3V0UA 3LHUA 5A8NA 5FF0A 4OQVA 5I0DA 1FCBA 4IISA 1XRVA 3PNUA 1UW9A 3LHZA 4A4AA 4EOUA 4A8RA 2IPJA 2NVAA 2X42A 3WLKX 1XM3A 1GVQA 2AL1A 3W2MA 4E8DA 4UTKA 2NQHA 4IUOA 3VDAA 3CIVA 2UY2A 1MZRA 1H7OA 3DECA 4PFMA 5GJMA 4H9UA 1J93A 1Q7MA 4G1KA 4HNCA 3H12A 3N34A 3CL7A 3W6YA 1GCYA 2EEXA 3VOFA 3EOEA 1AFSA 4UTFA 3L4VA 5JH2A 1OGSA 2JIEA 4GNVA 4ZO8A 5FJUA 3VCCA 5FACA 2BV9A 5J5RA 1LT7A 3B40A 3F4CA 3CT2A 3I6RA 5SWUA 4NNBA 3HZ3A 2GDQA 3T6CA 4YJ5A 4H19A 2NX3A 3SN0A 1GNXA 3BCJA 4GHRA 3DGRA 3QZEA 3B9EA 2G4FA 5HNRA 1OFAA 4FALA 3GTFA 4C6BA 3AWNA 2TRSA 1EDTA 1W1VA 4EX4A 4LUSA 3TXZA 3W87A 4PUDA 2X40A 3AZTA 3DGBA 4GZIA 4PB3A 4Z2IA 1Z3NA 1RPKA 1GVFA 5BROA 1VBJA 1AH3A 1JPMA 1HJVA 3AYTA 4FX7A 3L23A 2A2IA 2RAGA 3GE7A 1SR9A 2JF6A 4IPIA 4WIWA 3W02A 1LQAA 4QP0A 4YLWA 6TAAA 3UYCA 2CLHA 4HU8A 5FEWA 3UBPC 1TJ1A 4F0MA 4Q4KA 2E6YA 1NELA 1OCBA 3FN9A 2BBFA 2E25A 4EPKA 3S2CA 1C8VA 1C29A 1V93A 1BYAA 3BOLA 4M81A 2Z24A 4W4QA 1XYMA 4EANA 2E5CA 4O1DA 4V15A 1CTNA 3UJFA 1EC9A 1MFVA 3WH7A 1LORA 4S3FA 1O7AA 3BJFA 7TIMA 4YMZA 2A3EA 4IGSA 4PMUA 2O55A 5CPTA 3ZSSA 1G7UA 2B7OA 1UKTA 3TN3A 3VYLA 4KPLA 3FA3A 1GEQA 3LERA 5LHFA 4IFKA 1OWQA 2H90A 3O63A 3W70A 2VD9A 1KBLA 5PTDA 2PDUA 2VC9A 1EJXC 3TA6A 4GC4A 1LLOA 3LDVA 1C7SA 4MUPA 2JGQA 3CHFA 1MEIA 1TUFA 3TR9A 4DF0A 2IQ0A 2OGYA 1SO5A 2BS9A 4RZ4A 1GQIA 4KIEA 2OLAA 1IXQA 3JU2A 9XIAA 3T7VA 1XD1A 3W6LA 2VDGA 4W5ZA 2ZVIA 3WLSA 1P0BA 2ZA2A 5TQLA 2PTWA 3SZ8A 4TTGA 3UEQA 4QJ5B 1Q6DA 3RMEA 1XF0A 1B3ZA 3NIYA 1KQZA 1G4TA 1DIOA 2FH6A 2G96A 3PPHA 2OPJA 3NQMA 3M4HA 1EBGA 3BSGA 3A4XA 5CSRA 1EPXA 1OY0A 2XFYA 4GO9A 4FZIA 1CB7B 3GU9A 3OLGA 3WQEA 4IX2A 4O8AA 3W71A 3HGOA 4FF7A 2J7GA 2WMJA 3DHPA 3XIMA 1Q13A 4RJEA 5I3IA 1Z89A 1GVOA 2CHNA 2GVGA 3TTQA 3TZNA 2NUXA 4CD6A 5I3HA 3M0YA 4H6KA 1NJJA 1GKRA 3K1GA 2PCEA 3T4CA 1HW6A 1TVLA 2Y4SA 5EL1A 3SGGA 1ML1A 4DJDC 2HNHA 4J2MA 1EIBA 1Q2RA 2J77A 3IPWA 5ABFB 1Q6OA 5BNKA 3U48A 4KEUA 2VDHA 4GA8A 1UWRA 1A49A 5ABTA 3MQTA 1TFVA 4L4LA 5DT7A 3L4XA 2PWHA 2D0HA 1ZCCA 3DG3A 3CUIA 1TZZA 2J79A 1J2WA 1A4MA 3W1AA 2VEFA 4GJ1A 1TJRA 2VUYA 3NG3A 1JZ2A 1FWSA 2Y5EA 1VD6A 3CZLA 3AYVA 4ERIA 1OABA 3EOSA 3SCNA 1TTIA 3KHDA 3EXTA 4U3AA 1FHVA 3JRKA 4NJGA 4PH6A 5MKGA 1A47A 3FXYA 4Q22A 3SDOA 5I3DA 1XLGA 4PMNA 1TYGA 2PDHA 1B3WA 2RDWA 5A6SA 1T96A 4PR4A 1KCKA 1NVMA 1ZRQA 1TELA 1JYVA 4N4PA 2WMFA 2OWXA 3KS5A 4E4PA 1PKLA 3W1LA 1K9TA 3WCZA 1UD5A 3GNXA 4PTVA 4U10A 3W76A 3LB0A 4H9ZA 5DQPA 4HSNA 2J7HA 2V30A 2FZ8A 4IH3A 3SUUA 3GXDA 4M29A 3GXPA 1YBQA 1ISYA 2W92A 4OT7A 5I5RA 3UG3A 1NFGA 3R25A 4CNSA 3AS3A 3P5ZA 4HT3A 3TKFA 1P1MA 1DBTA 4Q8QA 1M7OA 4ILSA 2REQB 4D1JA 4IM4A 5CC6A 2BG5A 2WV8A 5A95A 3W7HA 3VZYA 3ERPA 3D6NA 3TVAA 3ZR5A 4GZJA 5G2IA 2O9RA 1JPDX 1S39A 4GZ7A 2HS8A 4CQ9A 5FL0A 1MEHA 4LYPA 2JQXA 1UB3A 5CXPA 2G3MA 2YPIA 1UWSA 3GR7A 5F4XA 4JIRA 4JIEA 2YBUA 3RYSA 5G1TA 1NWUA 3SFWA 1LM1A 3AHTA 1JI2A 2F6XA 1LWHA 1IWBA 4OKDA 1P0KA 3F2BA 1B4KA 4HK6A 2PMQA 4KGJA 3TW9A 4CNNA 3TC7A 2AOSA 2NLIA 4NAEA 5H6HA 1W9BM 1VIZA 4AWEA 3KBVA 3IVTA 1S46A 3H7UA 2QUTA 1J6PA 3CZ8A 3REQA 3WUBA 3IACA 1OADA 1KV8A 2CW6A 4CCDA 3ISIX 3WELA 4C6JA 3ABRA 3RLHA 3S2MA 2Y5SA 3PP7A 1E72M 4H9TA 4LUTA 3LHTA 3TQKA 2O9PA 4WJXA 1DE6A 1EL3A 5LHEA 1QHZA 4KEVA 3C52A 1F5ZA 1OD0A 1W1PA 2G0WA 4PMOA 3J7HA 5FOOA 3OZPA 4CLMA 2Z27A 3SADA 1EYEA 1HL8A 4FOUA 4L4PA 4NQ1A 1WZMA 3LPOA 3WNLA 4L1XA 4OFCA 3UJ2A 4RR4A 1MUWA 3M44A 5CGQA 3AROA 5JUVA 3UWZA 1DJWA 1ODUA 3T0TA 2V6AA 3M0ZA 4YHGA 4LAOA 2ALRA 3MI6A 3L67A 3WQDA 3QYQA 2BOGX 4KWWA 3U2ZA 2NT0A 4DO7A 4XD5A 1H2JA 3NQDA 1DEDA 1E6PA 1G6CA 1OFPA 1VFOA 2HXUA 4A29A 3EYPA 1UZ4A 1DJZA 3VKAA 4QS6A 3TROA 3M41A 5H8PA 3SO7A 3TW7A 1VF8A 4FLQA 4HNOA 3COTA 3LPGA 3UR5A 3SJNA 4I90A 1HVQA 3GR4A 3B06A 2WO5A 1VAHA 3OBEA 1V77A 2HVMA 3T2PA 4D6EA 1OD8A 4Q8OA 1Z41A 4V27A 1A0DA 3W24A 4H2CA 1V7AA 1UD4A 4WDUA 3N2CA 3M43A 3PVFA 2VR2A 4PULA 4ZTYA 3H54A 3GFXA 1S5NA 3MMTA 1FUYA 3OLEA 2XFWA 5EMKA 1CGTA 3HG4A 3NQBA 2NV9A 3THCA 4IFKB 1R46A 5A5WA 1JUBA 2V5CA 1OEPA 3M0JA 8RUCA 3VI2A 3G22A 3FSTA 4Y9PA 4F4RA 1C7TA 3LMZA 2PDBA 3W1TA 3SB0A 2Q09A 3FKKA 3ZIZA 4AVOA 4W88A 1Q2SA 1PKYA 5HQLA 1KFLA 3SM0A 4LV9A 3GB6A 2CHOA 1CYGA 5AYIA 5C9UA 2DIEA 5FL1A 4KCVA 1EHNA 2VR4A 4XZWA 2C19A 1R2TA 1J9YA 4DI9A 1WKYA 1XLMA 1XC6A 2YZ5A 3TJLA 6TIMA 1TE6A 2SFPA 5E6ZA 2A6NA 5A6MA 1OYCA 2ATMA 4H8VA 4P7OA 2PLJA 1LRNA 2WNQA 4LS1A 3NAVA 4GO8A 3VD5A 3CUZA 3V5CA 2PDWA 4UTIA 1CGYA 3KBSA 3QM3A 4TV5A 4DUXA 4LX4A 3DIPA 3GNNA 1YDOA 1RP9A 4QR6A 4ZR8A 3W1NA 1US3A 3U5YA 3IJ6A 4A8NA 4WVXA 1UG6A 1UKQA 4AD5A 3VIOA 3PZOA 3KVMA 1HVXA 1LJYA 3RO8A 4LCQA 4B3LA 2OZ8A 2IKHA 3MO7A 2DSVA 3PBVA 4WY0A 3FJNA 1J0KA 1NSJA 3IIPA 4GUFA 2PODA 4MJZA 1FWHC 1FFQA 1U1JA 1QWKA 5LNWA 4TV6A 4IX0A 2NWSA 4QROA 3OOQA 4X0VA 5DBUA 2VGFA 3TN5A 3TNOA 3W01A 3SY8A 3H2CA 3RLVA 3VGBA 3OYXA 1DJHA 4BKNA 2FGBA 4Q4QA 1UUQA 3C2VA 3AISA 5G2HA 1W2PA 3TTOA 2CERA 2X2GA 4I9MA 3N4FA 1RK6A 3FA4A 4ZTXA 4BEUA 3E0IA 1YADA 4BQ4A 3B8WA 3E49A 1HO4A 4OBSA 4I7WA 4DZ5A 1EJRC 2QXWA 3B05A 2Q8XA 1K7FA 2ZRUA 8XIMA 4ZBCA 2BB0A 3IJIA 3U4AA 4XZLX 4ZB2A 3TQ0A 1DHKA 1PCKA 4JYDA 4LJ3A 2PP3A 4JQ3A 4JCMA 2FKPA 3F2CA 2PD9A 3F4NA 1AUSL 2INEA 2J62A 1OC7A 2ZZ7A 3BGJA 4IIGA 1BFNA 1KRBC 3MUXA 4RPPA 4JYEA 4RLIA 3W1XA 3Q45A 3UNTA 1YBQB 3IUDA 1EFZA 3EDDA 3D5HA 3DAQA 3VNKA 3V75A 4PUWA 4JQ1A 1KLZA 4YVPA 1XC4A 4IT1A 3GHRA 3BAYA 4HNUA 3WD4A 1SO4A 5A6BD 2HEJA 1HKVA 3URAA 4JX5A 1W5NA 3M0MA 4CQDA 2QAFA 4CCEA 4EF8A 1PTDA 2FLIA 2OU4A 1UIOA 1PB0A 4UOJA 3W7DA 5BRQA 5F2GA 3NQAA 3FDGA 3CHDA 1WDDA 1YX1A 3WK1A 3BURA 2BY0A 2PEVA 5EB8A 4C6IA 2PTDA 2ZWYA 3VOCA 4PUJA 3OVPA 3WF2A 3FXGA 1MDRA 4NAEB 1QTWA 4GY0A 3VXGA 4JQ4A 4F9JA 3ITCA 3W7JA 1C91A 2QZRA 1YW1A 3KUMA 4QCEA 1FCUA 4O17A 4JNMA 1GT8A 4V33A 3REQB 2X0YA 5XIAA 1EJVC 3W2JA 5HK4A 4JTGA 4XO6A 3ZS4A 1KR0A 2W5FA 1GG1A 2BTMA 3LSBA 4LUTB 4JZ5A 3PBWA 4AISA 1A5UA 3TCEA 1RVKA 2QW5A 4ML4A 5LNVA 4WRHA 2OYKA 3ZVIA 1QNRA 3GU1A 3W37A 2NQLA 1VFLA 3L5MA 3GG8A 4Y9OA 3N73A 2QJJA 2ZTJA 4D6DA 2E28A 2ZRWA 3IAQA 1PAMA 4NVTA 1D8WA 4B5SA 4PCPA 3WLQA 3CWNA 3WQGA 4L1WA 1XYBA 3MSRA 1M5WA 3GVGA 4BA0A 4L65A 3DFNA 1EO7A 5A1AA 1LROA 3ZJ6A 2E9MA 2XGBA 3W84A 3B8TA 5LIXX 4MZYA 1VFHA 4O57A 4Q6XA 4Y9MA 5CGTA 1XRSA 2E3ZA 2X30A 4I6VA 1XIJA 1MQPA 2I9UA 3S6TA 1LL4A 2P76A 3WMSA 4CNPA 5C2XA 1B3XA 4WEVX 1MNZA 3QY8A 1E0VA 4B2DA 3LPFA 2R1PA 4J3VA 1CGVA 1IWAA 2YA0A 2I1OA 1JJKA 2R14A 3YPIA 5KZ6A 4TX6A 1QNOA 2MANA 2FMNA 2V63A 2WM0A 2AQOA 4GVGA 2OLSA 5HPOA 3GUGA 3NYZA 3P2VA 3W7PA 2DH3A 5T26A 1U83A 4IPNB 3ARRA 1E71M 2FTPA 1KFCA 2DT1A 3LCIA 4EWJA 1DIKA 1E9ZB 2QCNA 3O15A 3ONBA 4AVFA 3BPWA 3I10A 2WVTA 2DW7A 3LUTA 4A3UA 3G1YA 1IYXA 4QHRA 3L4ZA 4V1XA 3B9NA 3M46A 3BGGA 4O0QA 4N42A 1B31A 2VFIA 3QW3A 4GIAA 4ALDA 4RXFA 4JCLA 1FHLA 2EJAA 3RPMA 5CAKA 1E9IA 4P8WA 1W3KA 1OF6A 1JI1A 1H7RA 4XVEA 4NZ5A 3S9ZA 1EA0A 3FAWA 1TPFA 1W17A 3WQPA 3CT7A 3HFTA 2I9EA 2YXXA 1Q65A 2ZZ3A 1QT1A 1VPXA 4MZ1A 3LN3A 1ISVA 1U33A 4MWAD 2Y88A 4PEKA 3LCWA 5HA7A 2C6QA 4M1BA 1XPYA 2C7FA 1K4HA 4AH7A 2I57A 3GVRA 5FAGA 1BRLA 1ZJAA 3F5KA 1QFEA 4M5PA 1JAEA 2OQHA 3E0LA 3ITXA 4CU6A 4WY0B 1NDYA 1F7BA 3EOUA 1ICPA 3B4UA 5RUBA 4GKTA 4H01A 3QZ6A 2QKFA 4QSFA 4AZ6A 1OG0A 2EHHA 3NXLA 4NYYA 1GKQA 2WW5A 2Y70A 5GVJA 4HHPA 1KM4A 3TYAA 3VFLA 2O0TA 3OGRA 4N6FA 3DESA 2R8WA 4RDWA 3AUJA 5D2VA 3VDHA 1BPLB 1PVNA 4AWUA 1AW2A 1AQ0A 2W4XA 2F6UA 2Z2BA 3ARWA 3Q67A 3RN6A 2GVYA 3F2DA 4LVDA 1UKOA 4IFRA 3CAWA 3G5EA 3IV3A 3R4IA 1FWRA 4P7QA 1TMHA 2BHUA 1RCQA 3R94A 4JKKA 2Z4GA 2PSNA 3GHSA 5FSEC 4QLJA 4V2XA 1TSIA 4DVOA 5CPOA 4JTIA 4GZEA 3BZJA 1OINA 4LOCA 1L8PA 4O4VA 2ATSA 4US5D 5M17A 3LHVA 3ZWTA 1WXYA 4KWSA 2NXIA 4ECLA 3QV8A 3R6IA 3HU7A 4R5EA 4DJFD 2GL5A 3M0VA 1QPOA 3BH4A 1QOQA 3BQ6A 4G2DA 3OGVA 2DZWA 1QBAA 3MUCA 3B8SA 2XWEA 3GHTA 1T41A 4ZVJA 3RLGA 3QHOA 3TTYA 1XYFA 4HGXA 4B9ZA 3NSNA 1AL8A 3IGSA 1KB3A 1R0MA 1MWOA 3I3BA 3I3EA 4AU0A 1VGAA 4K8EA 1GOMA 3GG1A 1CPUA 1RY0A 1UP3A 5EMMA 3O6CA 5F7UA 3KZPA 4DYJA 3TYZA 4HMNA 3BAKA 2WVVA 2VX5A 3P3BA 2V5KA 1ZBWA 4MNKA 1BHGA 1H51A 3OQ8A 3WJWA 1FWEC 3FW6A 1E73M 4QE5A 5EA9A 4LWWA 5EFDA 4PGLA 1YE4A 1TTPA 3TU9A 3ARTA 4H7ZA 1H50A 1XBZA 3ES7A 1EUAA 3G1AA 3O6DA 5M03A 1DIEA 3DOPA 5DELA 2CZFA 3MO4A 2YW3A 3W72A 1ICSA 3TSBA 5I3KA 1KLYA 1V0NA 3VVGA 4PRTA 3GFYA 1R87A 1QMLA 3VNLA 4BI6A 1ONWA 3G77A 5ECVA 3CWOX 3RFAA 3RO6A 3OU8A 4FOKA 1XINA 1HF6A 1HT6A 3I68A 1XH0A 4FAMA 1UHVA 3NQ8A 3SUTA 2NQZA 1I2RA 3W7KA 2VZSA 3NURA 2C13A 4TO8A 1JAKA 2F38A 3EPNA 4MG4A 1H49A 2QCEA 3BG9A 3RILA 4I8YA 3ABQA 4IMEA 3PPCA 5HMFA 5CGMA 3K13A 3NEHA 2PWVA 2BY1A 3S1XA 2E9LA 2ZTKA 4PUMA 3R79A 1OT1A 1M1BA 1Q6EA 2JGYA 2OFJA 4HA3A 2VCAA 1EYWA 3DFTA 3WEZA 3NQ7A 2QMKA 3L66A 1OGBA 3B9DA 1XISA 1V6XA 4E3TA 1XLBA 4C6FA 4S3DA 3HOJA 3L65A 2GJLA 1FWGC 2WHKA 2QAPA 4A35A 3UWWA 3W1UA 3UU0A 4YIWA 3MHFA 3NEVA 1US0A 1HO1A 3SCQA 1TCMA 4DM2A 3VKCA 3O9NA 4NJJA 3MHGA 2YCKX 2EKGA 2V68A 1ZBVA 4O8RA 4D6IA 2DVUA 1I60A 1U5HA 4D6JA 1KM3A 3IJLA 3QR0A 4B91A 1OX5A 4HCHA 2V81A 4LH8A 3NL5A 4XBSA 2XIOA 1BVZA 1VRXA 2NVDA 4Q3MA 1W0MA 2ONEA 3WMCA 4HMDA 5ABGA 5TIMA 2E5DA 1ZY9A 4O12A 2YCJA 4H6QA 3PS7A 3UJRA 4WQ6A 2W62A 1H1YA 3RIKA 3WEMA 1ECEA 1SVDA 3R8GA 3WQOA 3C0SA 4JX6A 1H0IA 4H04A 4A8LA 4C1NA 4Z42C 2HE8A 2INZA 4KWVA 2JEQA 1PBGA 1YHTA 4QGCA 1K03A 4P8UA 3VMOA 3VZXA 1RK5A 2PWGA 3NQVA 4Q8PA 2VL4A 2WMKA 1XPGA 4DEFA 1AQMA 3FGCA 2ZCGA 4HZ7A 4HSHA 4RE4A 1BRLB 3FYPA 3DHFA 1GJUA 2WQDA 2J6VA 3WUGA 3KWXA 2EG6A 4AC1X 3F5JA 5AZ0A 4Z1AA 3VA8A 3PWIA 5K9CA 4JEJA 4QXIA 2ON3A 3EA2A 4HK7A 1E9YB 1RLCL 3VOHA 4F0LA 3RJYA 4WKFA 4PL1A 3VDBA 1LBMA 3N3TA 4HP5A 2DY3A 2Z00A 4ML9A 5DRIA 3OA5A 3HPZA 1V7YA 2DU2A 4ORIA 4L56A 3IARA 1TPVA 1TPUA 2VDIA 3URQA 4KT2A 4NUWA 4DWSC 1E6RA 1NEYA 4MB4A 2QCDA 1P6WA 1XLCA 2NUYA 5A6TC 3RR1A 3DERA 2R82A 3TA9A 4UOZA 4AF0B 4PCTA 3BE7A 4S38A 4U33A 3HG5A 3W7MA 4JDBA 3STFA 4HTYA 3S9YA 2ZXBA 3AHVA 3RPDA 3E6EA 1P4CA 3C0LA 3ZOAA 2VRJA 1AH4A 4YHEA 2HCVA 5I3GA 3NQFA 3A12A 4ACYA 3CQHA 2Q02A 4WXZA 5AC6A 3OGSA 2V5BA 4ZMGA 1K70A 4ZOEA 5LIUX 3U6WA 1NOWA 3L5LA 2PDLA 4XO7A 5AHLA 3KAOA 1BVNP 4NI8A 3UR7A 1QO2A 1WXJA 5CCZA 1U5VA 1DQXA 1FXQA 3MVIA 4AEOA 5GJNA 2BVWA 3T81A 1W1TA 5LA0A 5LNSA 1F4HA 3RAOA 2QGHA 2ZZ5A 4UTHA 2IKGA 2DSZA 5E9AA 4Y96A 4QRNA 3TQPA 3VIKA 4HOZA 3SI9A 1CLXA 4ZL1A 2WNWA 3APYA 1R3SA 4KRTA 3CASA 4F2UA 3MTWA 3D3AA 4O4WA 2C1GA 1N2VA 4P7RA 3WD1A 4AFYA 1XCXA 1EP1A 4DX3A 1KXQA 4YWIA 3GNDA 4J5NA 2ZUMA 2BHYA 2HV5A 4LYKA 3URBA 1DXEA 3WKZA 4K38A 1X8FA 2FFIA 3T40A 1R9XA 2WVVB 5LIWX 4G5DA 3VNIA 4GUGA 4C6OA 1GONA 3HBLA 1Z9AA 3MCNA 3OP2A 3GSMA 4QS5A 1I1XA 5BYWA 3VAVA 4E2VA 4HYVA 5LA2A 4BFAA 4C6LA 1ZSXA 1R3TA 1PHQA 5CSUA 3LBCA 3U7BA 1W1IE 1EX5A 1X98A 2J4GA 4LRSA 3WFZA 2NLYA 2DDXA 5HJLA 3CPRA 4AXKA 2VQTA 4UNIA 4DB7A 3UGRA 3PTMA 2CWNA 1RBAA 1W9PA 1OK4A 1KKRA 3KZSA 3JW7A 2GGHA 1SGJA 2G3IA 1AA1B 3CZEA 1LOQA 5G4EA 2OOGA 4HYRA 2HROA 3P5YA 4QX4A 4WXYA 3QC0A 1E0UA 2NUWA 1S5VA 3RCNA 3QOKA 3CTTA 3GTIA 1NOFA 4MVAA 3MVTA 2PDKA 5CZ0A 3RU8X 4CN1A 3RLUA 1S2TA 2C16A 1WZAA 4EP8C 4OUIA 4HPNA 3W1QA 3WQWA 5TF0A 4PBFA 3IJ9A 3SN1A 4Q6JA 4TOQA 4HPGA 4XG1A 4FXSA 2HBVA 4JEQA 4IJBA 3TE9A 4IHCA 1AG1O 1XBVA 3IRSA 2VCCA 4OECA 3TJXA 3TYCA 1A5NC 2ISFA 4O13A 4DPPA 2OSXA 2J7DA 2DVTA 1XKYA 2W61A 1BYBA 4O16A 1JCYA 4C7FA 3NVDA 2J74A 4ERGA 3P74A 1OX6A 5AC5A 1IEWA 4JS3A 3DN5A 1EJ7L 5I3JA 3M5XA 4EXBA 5LKYA 4DN1A 1KBKA 3OIXA 3P0WA 2P88A 1DWJM 4DWDA 1XSKA 2POTA 4M3PA 4U3CA 3VGGA 1JF5A 1A5KC 2Q8ZA 3N25A 4MZ8A 1CXHA 3WLOA 1X8CA 1BYDA 4RNJA 1ZAJA 4L6HA 5I78A 3DC8A 4GYJA 3VOJA 4DJED 2BP1A 4AZ7A 3PF3A 3CQIA 1LLWA 4IXHA 5GNYA 1N8WA 1V4YA 2VEKA 4B92A 3H2MA 2TSYA 1TRDA 2VURA 5FJIA 2H9AA 3THUA 2H8ZA 2OSWA 4EF9A 2GVJA 2DGAA 4NJHA 3NDYA 1MNSA 3K30A 3AZRA 3DH7A 3CYJA 2ZICA 4C1NB 4WGHA 4UTWC 3FSUA 4NNCA 3RM4A 2D24A 4NY2A 1NDVA 1TPB1 3CJPA 3GC5A 4UXDA 3USZA 2OMAA 3UXKA 5JMUA 3GS6A 1XDMA 4Z1CA 3FGCB 3KRUA 2ESCA 1FTXA 1KRCC 1TB3A 3PSWA 1EC7A 2PP1A 2VFHA 3C86A 3W75A 1VFUA 3CUGA 3SGZA 1XFCA 4AB4A 2UBPC 4ZFCA 3NZGA 1HJXA 1BEUA 5BXSA 1ECQA 1TRIA 2ASHA 1W1ZA 4DBEA 4PL2A 5EBUA 4A3HA 3O7UA 3VIIA 3PWGA 1QRQA 4B90A 1HJSA 2GJRA 3DHDA 3M1ZA 4CNUA 3AMDA 3M0XA 3WH8A 2QCDB 4AZBA 1QW8A 3MYPA 3ONCA 4N9CA 1FCVA 3TNBA 3RJXA 3GXTA 1QXLA 1Q4NX 5HWMA 3OHMB 2BHZA 4O10A 5JU6A 3H7VA 3U7VA 3QRHA 1AQHA 3GQYA 3V1HA 2WMIA 4GVFA 3FVDA 1KRMA 3H2EA 1F76A 3QYSA 4IMGA 4N4QA 4C6MA 1W2VA 3UXDA 3IAPA 2DZVA 3Q65A 3E5BA 3BV7A 1EXBA 5T91A 1OCNA 2FFCA 1PX3A 3OZOA 1VJZA 2G3FA 1VH7A 3G1DA 4M6VA 1ZAIA 2G50A 5BU9A 2G5WA 5AY7A 5ABHA 4D72A 2PDFA 4BQ5A 4TUFA 2PFHA 2I17A 1UQZA 3EKGA 4UFIA 3ZYZA 3PZIA 2DSWA 3BV4A 2E6AA 1K9FA 3U2EA 2VOMA 4LVAA 2J78A 1TJPA 3QQ1A 2YXGA 3BAJA 5E5CA 3VCRA 4U4MA 2B7PA 3HQ1A 5AHMA 4J7RA 1DXFA 4JOMA 2Y5JA 2Y1HA 2Z29A 5C9XA 1M53A 1GORA 4XIAA 3URNA 5DY2A 4GX9A 4DUVA 1DV7A 1UMLA 4UTMA 4PA8A 3G1FA 3IJQA 6REQA 5I06A 4S3AA 4GRSA 3CHCA 3C3NA 2PBGA 3ARPA 2VM8A 1JZ4A 3VKJA 3QTPA 2NT1A 1M7XA 1Q45A 1FY6A 3VNZA 3LQGA 3MP3A 1VEMA 3T0AA 5CPSA 4JGDA 3SCWA 2KZHA 3QXBA 4AZIA 2PDQA 4LANA 1QJWA 3S6OA 1X97A 4UWMA 3QV7A 1AW1A 3GKFA 1IIHA 4J3TA 1IQ8A 1ADSA 4FPSA 4PMVA 4RE2A 2V3GA 5GPRA 2ACSA 4PSRA 3W7CA 4RDYA 4FP1A 3UA3A 3VINA 1PX4A 2EF9A 5FAJA 4FNSA 4PRWA 2AGTA 4O0ZA 1ZS2A 2XM2A 5T9CE 4W5UA 2OZTA 1ZJHA 1EGMA 1FBAA 2PU0A 3FK4A 1F4AA 1GVIA 1E55A 5AECA 1GW1A 3W25A 1HP4A 3IWPA 5C5YA 3PN8A 1CECA 3LI1A 1UP2A 1DPMA 1BLIA 1NH6A 5HNTA 2NXGA 4LUJA 1P6CA 3UVAA 3BXWA 2PDYA 3QMSA 5LA1A 1TZ7A 1X1OA 3A4JA 3GDKA 4HOWA 1EP3A 1EIXA 2CZEA 2O9OA 3QPYA 4O1FA 1GYMA 5AB3A 4D6CA 3TOPA 2DZSA 3VUPA 3FHQA 2GJXA 3HGRA 3UNDA 1MXGA 1SSDA 1MQQA 3BL3A 4PB5A 2J8TA 1X6LA 3SURA 2ZFAA 2CBUA 4D6FA 1B2YA 4RZ5A 1GZ1A 5EY5A 1E6XM 2ADAA 4DAIA 1RALA 4ZO6A 4HU4A 4I8DA 4W8LA 1HKIA 1L2QA 3FEMA 4XUGA 4CQAA 2J25A 3UXIA 2XVPA 5HBFA 3WJXA 3UPBA 5JBEA 3AIQA 5I00A 1K6AA 3W23A 1XLFA 3WBWA 3W7RA 1YPIA 2F6KA 4GXMA 3LXCA 5FF4A 4ZQRA 1SMAA 1A53A 4EPBC 3G1VA 3BICA 2YBTA 3HQPA 1NF0A 4X2PA 5TNVA 2GFTA 1D2KA 1UASA 2IS7A 3JZEA 3PFRA 2D3LA 1PZ3A 1XUUA 1JPIA 3L2IA 1JD7A 1TVPA 5AVHA 3CMFA 2GGGA 2DP3A 1PWLA 3UF9A 1IXOA 3CS2A 3SCUA 2OB3A 3NSXA 1J11A 1FHDA 4FIQA 4GY7A 3OODA 4MIMA 2GGJA 4S2CA 3LRLA 3W07A 4LEFA 4JYFA 1XXXA 4NX0A 1NOUA 1NY1A 4OVXA 1O94A 1WDQA 2H3BA 2H9AB 4U2ZA 1DORA 1E4LA 3L9CA 4FS9A 5BXRA 4N6EA 2W79A 3WX7A 2YX0A 4Q8WA 3SRHA 4J2PA 1F9CA 5H1WA 3BC9A 1SQ7A 1SW0A 3UWEA 1OYAA 4J3UA 5HR6A 3MUAA 1W9DM 2OZ3A 2Z2UA 1ISXA 3ORWA 3TYUA 1A4LA 1GOIA 1V5XA 2VXNA 4A3QA 3OBAA 3C5QA 3GG7A 1J18A 1W32A 2Q3RA 2HISA 1PS9A 5CJ5A 2YL9A 4QDMA 4R7WA 1EX1A 2A5HA 3IUIA 1QUMA 2PTYA 3PTDA 1OFBA 4ENLA 2GOKA 2EPMX 3E02A 1F61A 5F2IA 3R0KA 1XUZA 3KL3A 3ARZA 1TO3A 1UYQA 3EA3A 1YEYA 3GIPA 4E4FA 1Q6GA 2WSRA 4Z1YA 2Y7FA 3KX6A 3P82A 4R34A 4M0XA 1W5OA 1UR3M 4LC8A 5JIPA 1ENUA 4M6QA 2QMJA 2H6RA 4Y9NA 3KTSA 4MNMA 3EWZA 4FA3A 1TV8A 2O7SA 1YPXA 5FEXA 4AYGA 4AX6A 3N3MA 1REQB 2QS8A 4CU7A 1R30A 1QPKA 1A5LC 2CESA 2PD5A 1VLIA 2WPGA 4G56A 1HGYA 2QLYA 3H2FA 1OIMA 2ZVRA 1R2RA 3PJXA 1V08A 1OM0A 1QK2A 2WMIB 3GHUA 1JDAA 4H3DA 2GDVA 3GVWA 1R86A 3MV01 3FAXA 4H83A 2WCSA 3EX2A 4LVGA 3E0FA 3P7YA 3TCSA 4K2SA 1KFEA 3CAVA 3LSCA 1PL9A 4EIVA 4RZ6A 4V1YA 1GW9A 4J40A 3TR2A 3WN6A 3VTRA 2Z6JA 3CC1A 3UD6A 4O28A 2GYIA 4AEFA 1U2YA 2QEZA 3QSTA 1U5JA 2EAWA 1X7IA 1UR2A 3AS2A 3CU2A 4XSLA 4NJKA 3GUWA 1F8IA 2AQVA 4XQ6A 4N2YA 4KEZA 3TDFA 1M7PA 3UCCA 1QAPA 2GUUA 3EB3A 2V38A 1CI1A 2YYUA 4Q4SA 3HO8A 3BAXA 4Z2LA 1XSIA 3S5YA 4PCFA 3T08A 3PBGA 4CCZA 5ABEA 3CL6A 1XLHA 6REQB 3N12A 1IV8A 1LLZA 2G97A 2J27A 1LTDA 2VFGA 2A3AA 4M56A 1EGVA 4UR7A 5DO8A 3WG6A 3VDCA 3BMWA 2WBKA 4U2YA 3U4FA 2Y8KA 3LD5A 3P6LA 4AIUA 4FB7A 1B57A 3CUFA 2C79A 5F2LA 5A8GA 1C3FA 4NASA 2OO0A 3NXFA 4KF1A 1P1XA 1W56A 2VENA 4AZHA 3POHA 1YYAA 2V0TA 4PMXA 3AXKA 4JTTA 1I2NA 3OIHA 2UY4A 5D8WA 4EVZA 1A80A 1DL3A 3TIMA 1NDWA 2FPYA 2CZDA 4MM1A 1XI3A 5U4NA 1EJSC 2PUZA 4AD2A 2C18A 1G4SA 4JXCA 4XWUA 5EMUA 5FSDC 1XLKA 3EX1A 1LT8A 2WHJA 1A3HA 1B3YA 2XN2A 4IQJA 3GG0A 4UQCA 5IOBA 1J01A 3A6OA 1UH4A 2A4AA 3SSJA 1RBOB 1DWFM 3AS0A 4F8XA 7CGTA 2ZA1A 1XH2A 3BOFA 1V03A 3GFZA 1Z6KA 4NZJA 2CU0A 4YTQA 4Z2KA 2YL5A 4WSJA 4KBXA 4GJJA 5F1VA 1FWFC 3PBYA 2VD8A 4X0NA 4M51A 4Z0SA 2D1ZA 4ZFMA 4GVHA 4QM1A 5D2TA 1E5JA 3HG3A 2GJXB 4CVWA 2P50A 2G3JA 2J7EA 4CGTA 3I7RA 1QO5A 3G3MA 2XVGA 4S3EA 4ZQMA 1S5TA 4R85A 1YNPA 4NZCA 1UZHA 3L21A 5CZKA 3O1NA 4ZB0A 2OCZA 1M01A 3AZSA 3WD2A 5EYWA 5I24A 3M07A 1FOBA 2J7CA 2XSXA 2ZRXA 4H8UA 4NRSA 3B8DA 1FWDC 4AVNA 1MEWA 3VC6A 2Y7DA 4Y8EA 3WF4A 2ZA3A 3VC5A 5KZEA 1HKMA 5D09A 1RH9A 3MPGA 3DX5A 1OVDA 3I65A 3PBMA 2R1MA 5XINA 3S1GA 1W54A 3NM1A 4E2BA 3AYRA 1G0CA 1H41A 2HTMA 3LLDA 4MYAA 1P43A 2VRKA 3IVSA 1Y5VA 4AX7A 3I3DA 2TYSA 2VZTA 4LY4A 3JUGA 5D30A 4J27A 1P48A 1XL9A 2D2OA 3AUOA 4ZA0A 5CLWA 1VB9A 4QTGA 3HPAA 5K9DA 2PRMA 4E5TA 4L9XA 4B5TA 4H9YA 4XVDA 1ZB5A 3EWCA 3MZNA 4YVXA 1RP8A 1TV4A 1TCDA 4O19A 3VIFA 2E5BA 1IZCA 1VYSX 3LA4A 1GWJA 1IT7A 2FVMA 1JCJA 2ZZ1A 3E1F1 2GJNA 2FIQA 2PI6A 1U22A 3BLDA 5E0KA 1SO3A 2QDDA 4HD5A 1AQFA 2J9YA 3C4UA 1ZCOA 2P53A 2ZX7A 4ZO9A 3LCXA 1W3HA 5FI8A 2C8NA 3IEBA 5CEWA 4UR8A 5A2CA 3R2GA 4Q4MA 3XINA 1O1HA 3WK0A 2X09A 5HANA 3W1RA 3GIQA 2CCRA 4GI6A 1P7TA 2E7FA 1EQCA 3DC0A 2C1HA 4CNTA 1EH9A 2CLMA 4XD4A 1V8EA 1UWUA 1RJRA 1SZRA 3B8VA 1QOXA 5C7HA 4QFUA 3L0NA 2PWDA 4F0SA 3LXAA 1UJQA 3LCLA 2VTFA 2OG9A 3BW3A 1DOSA 2XH4A 4WZHA 3WBYA 7XIMA 4JDYA 4AYSA 5K4ZA 1VLWA 5ABFA 2DUZA 4IQDA 3VOGA 4LAUA 4MHBA 1KTNA 2JE8A 4XK2A 1GPFA 2Y2WA 3EWYA 1GVYA 4IICA 1PCWA 4NAFA 4DF2A 1TX0A 4YXGA 4W8BA 3NUKA 3WBXA 1V0KA 1H7XA 4GPNA 3ECQA 5BWFA 1MRAA 1SZNA 3EWUA 1J2BA 4JIQA 1KQYA 3CO8A 2BGSA 2X1SA 4C7GA 5AN7A 2XISA 3S1UA 1EWDA 5I07A 4UFHA 3CL8A 4G6CA 1E4MM 3LZ5A 2KX9A 4AD1A 3DFSA 4EE9A 2GLKA 5AHIA 5C9RA 4I5UA 2G8ZA 4IWWA 4IGMA 1TUXA 2CLIA 3R5EA 3W9ZA 6PTDA 1HTIA 3Q2DA 3PM6A 2DIJA 5ECUA 3K2GA 4S23A 4JTKA 3H4XA 2ACQA 3ATZA 4IIHA 2E40A 1R2SA 1LBLA 2DQWA 3GTHA 3IJDA 5DCBA 2Z26A 4XAZA 1FDZA 3QW4B 1UWQA 5I7GA 3TMQA 3USBA 3M0KA 3FOKA 5A6BA 5K4XA 1UJPA 1KM5A 5G1YA 3CLWA 4MKSA 3CAKA 3MCOA 2C0HA 3KLLA 3GD6A 2AKZA 4Q7BA 4U31A 1CEOA 2DH2A 3PPFA 5FJPA 3M7SA 3RX2A 2YKKA 3AIEA 3ZJ8A 5B80A 3N2TA 3NO3A 1PUDA 3R8HA 1H62A 2OTDA 1PYFA 3M16A 3CUHA 1C9DA 2QJIA 2VWSA 3CPUA 3VX0A 5CQ1A 4DWSA 1W3JA 2OSYA 2YFNA 4AY1A 2XIQA 1ZFJA 3F5LA 3SCOA 3OLDA 1UR9A 3O0KA 4HA0A 4TMBA 2EGZA 4CD7A 3MC5A 2XSBA 3T0CA 1QOPA 5DMMA 5AHNA 2CIPA 4GYKA 4GVIA 3FS2A 3ABXA 2QR6A 4E6MA 1KCZA 3NQ2A 1DTNA 1C92A 1HJWA 4GINA 3TYEA 1LWJA 2CITA 4IIFA 4HJFA 1N55A 3LU2A 4WR3A 3SUSA 4UFKA 2GUBA 3G0XA 3WQCA 2X7WA 2WJZA 3KDNA 1GK8A 1VKFA 4HCLA 1KRAC 4ZENA 1SZFA 1LL7A 4W84A 4UMCA 1RR2A 4NU7A 1K8ZA 2QUMA 3TK7A 4GNJA 1XLDA 3C0JA 2YCIX 4NNAA 3SSZA 3BJTA 1XX1A 3LHWA 3TSDA 3D0CA 1Q6FA 4S3CA 1KV5A 3UWYA 2OO6A 2QDHA 4PTMA 3T78A 3QR3A 1JGMA 3ABOA 1XJBA 1EUNA 3MDUA 4ICMA 2PLKA 5D33A 5HWJA 2PU1A 1WKFA 4LALA 1LRTA 3EKLA 1EOMA 4NZ4A 5IBXC 4Q8VA 1UP0A 5BCAA 5A69A 3WJYA 4LGXA 2NQ5A 2JIWA 2QF7A 4B5NA 1Y65A 1IE7C 2DIKA 2GQ9A 2QCLA 3W86A 5DEZA 3MKKA 1SJDA 1W6TA 3HJEA 4ATDA 3ZWSA 3ZMRA 4HNTA 4X61A 1CCWB 1TG7A 4GQBA 4F0KA 1IT8A 3C2FA 4RW5A 3P60A 3QN3A 1K6WA 4I9JA 1SFLA 3SY1A 2R91A 2HZGA 1MRQA 1POKA 1PE1A 1E0WA 3MT1A 5FD0A 2ICSA 4QG9A 2QULA 3PJUA 4QCFA 1TWZA 3MU7A 4P2VA 3EMZA 3GH7A 1I0DA 1W9VA 1UD2A 3TW6A 4KIRA 4K7VA 4UZSA 5H91A 4JL2A 3WLMA 2PB1A 1IEIA 5AYZA 3EWXA 1XS2A 3NYDA 5BRBA 3WLPA 2Z6IA 6CGTA 2BXZA 4V28A 1GZGA 2OXNA 2VGBA 3UWVA 1RY8A 4HHLA 2FZDA 3BG5A 4MFDA 1H7NA 1R3VA 2WCGA 2NV1A 3N13A 4MB1A 1MW0A 4PMZA 2Z1KA 3DENA 3CLMA 2UWFA 1WDWA 3TLLA 5HXMA 1JDEA 2QVHA 5A3HA 8XIAA 1L6FA 3KL5A 4MUZA 4LAMA 4RDVA 4TX8A 3C8NA 4KRUA 1MO0A 2HBXA 1FKXA 1L2UA 1NP2A 3AXMA 3T2QA 1HL9A 4J4KA 1P7TB 2JK2A 1XDLA 4D6HA 1J8VA 2QHAA 1W1B1 3OEXA 2UY3A 1JQVA 1ZENA 1GZJA 3AWOA 2BVDA 2WCAA 1IWPA 3TSMA 3K4DA 3HMJG 3DYPA 3UA4A 3LS9A 1NFBA 3NO1A 1GJPA 2VR5A 3M0HA 1BG4A 2J66A 2Z1XA 3TQVA 3KM8A 2OEKA 4ZCWA 3D46A 4ZE5A 5DANA 5HOSA 5IRPA 3VIGA 4Q8UA 1M68A 1JRCA 1VS1A 2F2HA 3SCTA 4XKMA 2ABAA 2RDUA 5KMYA 2I16A 4JQ2A 1FWWA 3R89A 1FKWA 4DNHA 3C6CA 1XFBA 2V3EA 4NAFB 3WNOA 3QBUA 4WSHA 1UUOA 1NAL1 4NXKA 2XIJA 3UPWA 1OFQA 1W5QA 1HUVA 4IQEA 1SUXA 4BF7A 4GGBA 3P67A 1S2UA 4E8GA 2Y8VA 4C6QA 2DUAA 4XTDA 4FXRA 2DW6A 2A3HA 1XLEA 1XIDA 3KCLA 2A6LA 3VE7A 2B7QA 3WNPA 3WH9A 1LRQA 4BQ2A 4UMAA 4UTWA 2GQ8A 5M1TA 1S1PA 1SFTA 1B3OA 4WOQA 4KCUA 1F6YA 3BOXA 1IZJA 4QSHA 3ARQA 4QQUA 4UCFA 4DJFA 4LC6A 3PZMA 8A3HA 3VIHA 5HQMA 5FF2A 2TPSA 6XIMA 4C6NA 2J9ZA 3V36A 2WKLA 3QOMA 5A8OA 4NHVA 3VZZA 4YN5A 3UP8A 4JAWA 1JULA 3WLHA 5BZAA 4M19A 2FGZA 3EXRA 2R1KA 1GOXA 5CC3A 5H8MA 2XUCA 1FQ0A 2WWDA 4DWSB 1UC5A 2CHRA 1D7KA 3CIXA 4JFSA 5D9NA 3V7PA 5HMSA 2PURA 2INFA 3APGA 1QVBA 3B97A 4YTRA 4CCCA 2VP8A 4W7VA 1EJTC 5GQBA 4ZXOA 3W7QA 1PXGA 2PDNA 2Q71A 2XSAA 4C6CA 5D04C 3U57A 2UZ9A 1O95A 1OC6A 3DEQA 3QMTA 4AMCA 2ZDSA 2Z28A 2BY2A 3W82A 4UTTA 5HNNA 3W2UA 4LU0A 4WK9A 3GAYA 3U5UA 3K46A 4L80A 2CPUA 4LW7A 4PYSA 4LYRA 1DJXA 2D3NA 3WH6A 2E0PA 1LCOA 3BMVA 1LQ0A 3OYZA 1Y0EA 4K8GA 3H4WA 3QKEA 1E1FA 2R1LA 2V82A 1WOAA 3AHYA 1JPKA 1HXJA 3AJXA 1V3IA 3PR2A 1RCXB 3TWAA 1W5PA 7REQA 3L5AA 4TX9A 4CNOA 3NNTA 1YMYA 3C8FA 2FB3A 3JR2A 4I6KA 1LG1A 4MY9A 1YXDA 3VD4A 5F1UA 4MB5A 1FWNA 3CHVA 1KW1A 1GUVA 3ARSA 2FTYA 2NX1A 1K8YA 4MJ2A 4K3ZA 3INPA 1SW7A 2CNCA 5BOOA 4ZE4A 4QG8A 4H8HA 4K6AA 4UNKA 1DQWA 4DZAA 3O3RA 2GQAA 3GX9A 4WGXA 2J7BA 1HZYA 1VYPX 1ZJBA 2PGRA 2PDIA 3WLNA 4DIAA 1QDSA 2AAMA 3TLQA 2WZTA 1Q8AA 1XP3A 3CYVA 1XLLA 9RUBA 1R3RA 4LUYA 3H55A 5G5IA 1AW5A 3ZLGA 3UFYA 4H7VA 4FIRA 2OOFA 3BCFA 4GWEA 4WLCA 3WUEA 1VC4A 4XAGA 1M7JA 4MF4A 2D0FA 1QWGA 4GYFA 4ZXLA 1WQ5A 4J3WA 3LOTA 1QU4A 4MNJA 2QV4A 2W9MA 3ZLHA 5KTLA 3FYYA 4UBPC 2CXEA 4EACA 3R0UA 1PKMA 1ZP4A 2V8ZA 1V6UA 2B7NA 3AMKA 4MAVA 3KBMA 1EO5A 1T6MA 2ZUSA 3ABSA 3GAKA 3HF3A 4UQBA 4PZVA 1N7KA 3EBVA 1MZHA 3MA8A 3NZQA 2X2YA 3BSHA 2OX1A 4IMCA 4PE8A 3WNNA 1IHIA 3NZRA 2ISDA 5EPDA 3ALGA 1EDQA 2PDCA 3MSYA 1JXJA 5CJNA 2ZRVA 1FH9A 1M65A 1AVAA 1PJ9A 1E6NA 2RJGA 3KCJA 3MBFA 4X9YA 1OSEA 4DY1A 3L12A 1AL7A 2FVKA 1E9LA 4JTCA 2FMOA 3DXIA 3ANYA 3EDFA 4HJWA 3CMGA 3O0FA 4F79A 4HU0A 3ZZ1A 1N8FA 4DLFA 4B5UA 5A2AA 4QIUA 2G3NA 1HJQA 2J8GA 2YLAA 3GR8A 3C2YA 4QNEA 4HTBA 1H7PA 5C70A 2VVSA 4FNRA 3WUFA 5HATA 3D3FA 5H8UA 1TX2A 4EKJA 4PBEA 4R3UA 2Z1VA 1W9XA 1TTJA 1M3UA 4MADA 3WO8A 4DJDD 4ZODA 2Y6ZA 2P8CA 2WK2A 2XH0A 4UIOA 3T44A 2NV2A 5REQA 1E1CA 2PZ0A 1WO2A 4O14A 4Q4RA 2XWDA 2DORA 2YA1A 1F3TA 4OUEA 4K68A 2VEPA 2QPSA 4W8AA 1X1ZA 3KRZA 3QF0A 3R13A 3EMCA 3G3DA 1DVJA 2EKCA 4PEEA 1PTAA 2J75A 4S3GA 3PB0A 3NPWA 4ES4A 1D7FA 4HVXA 4Z2HA 1H1ZA 4GGHA 7ENLA 1UZDA 1NDZA 4O54A 1JCLA 2Z7GA 5CPQA 1AMYA 3PZUA 1E5NA 3NZ1A 4ROPA 3ZM8A 6ENLA 1UA3A 4RE3A 3O2LA 4R27A 4XD6A 1RXOB 3LY0A 5D03A 4AG0A 4R7JA 3PZQA 1WOBA 4CN4A 3NQGA 3W2NA 3LNPA 4NX5A 3MS8A 1QI5A 1VJSA 5E6YA 3WLJA 3UPMA 1ZPTA 2AGKA 3IIXA 3IJ8A 2ODOA 4GABA 5LXXA 3TUUA 4GH1A 1TIWA 4DRSA 1QATA 5MF5A 1QNSA 1VHNA 3UY7A 3W7IA 2BZNA 2BDQA 5C7VA 1VP5A 2YZRA 3VO0A 1E15A 4WF7A 1VBRA 4RX0A 1M41A 1Q8JA 3WL0A 5AC4A 4MDOA 1JYNA 4GNKB 2GVEA 2HDJA 5AFDA 1H4PA 9CGTA 2MUCA 4LTSA 5LYRA 2R6OA 4XX6A 1HG3A 3UYIA 4C1LA 1B90A 3E0VA 4GLEA 4Q33A 4MJMA 3OB8A 1ZAHA 5DRCA 3W1PA 3BDKA 3FA5A 1TJ0A 3NA8A 3A24A 3B4YA 4XISA 4QJ4B 1W3NA 3WF3A 4OV4A 2FHBA 4JTEA 2GUYA 1UC4A 5E93A 2WYSA 1VFFA 1KXTA 4IGHA 2Z25A 2ZOXA 1KGXA 4D8LA 3TC3A 2ZYFA 4E0CA 5J5DA 4HZ8A 3DCPA 4IJCA 2PDXA 1H3GA 4FXFA 1OGGA 4Q7IA 4XKYA 4M8UA 3F7JA 1FRBA 4L61A 4AEEA 3EX4A 4JN8A 1EPVA 1CWYA 2XYLA 4O11A 7REQB 2OKOA 4WD0A 3WDIA 3BG3A 3EDKA 2ZUTA 3Q94A 4JFWA 2HXTA 1HIZA 3HPXA 1TV5A 4F2TA 1F3XA 5A8QA 2ZKMX 4ASTA 5AYXA 2HJPA 3K4WA 1JRBA 4QNWA 4W9TA 3GBDA 2QQ6A 4LEQA 5IDIA 4BQ3A 1EB3A 3ZT7A 1UH2A 1Q3NA 2RJHA 1R9YA 3LMYA 4GMEA 3OPSA 3LM3A 3ZQ9A 1I8JA 3BWWA 2I7GA 3FLUA 3GKAA 1DWAM 3B3DA 1IIGA 4HZMA 1KFWA 3NL6A 4TIMA 2X1UA 1MMFA 1M04A 2E4TA 2WZMA 3R12A 4RNIA 1BWLA 3JS3A 3WQ8A 4R53A 4CN6A 2FPVA 3DYMA 1DJQA 4N0RA 2P0IA 4LCSA 4N7QA 4ZQOA 2G95A 4K1GA 1UZ1A 1OCQA 4MY1A 1TPC1 4Z1DA 3UW6A 1FCQA 7A3HA 4HIBA 4GCXA 4FK9A 5FJOA 1KFBA 2WQPA 1Q7QA 1O5QA 4DJEA 4LV4A 2ZX5A 3RGTA 5JVLA 3PZTA 5D4YA 2BGQA 3MSGA 3QPEA 1E0XA 1J10A 2QCGA 3NOEA 1OCJA 4RUBA 3PTQA 3L4WA 2VJXA 2QCMA 4S3JA 1EBHA 1ME8A 1O1ZA 1J6OA 3T2OA 4KRZA 2NWRA 2D23A 3W73A 1P5BA 3CHEA 2XPKA 4NG3A 5KZMA 4DM1A 1O5RA 3T9PA 1VIWA 3GC4A 3PSVA 3CPGA 5A6LA 4P8VA 1XQKA 2TMDA 3TC6A 5FCZA 3T05A 1EJUC 3RHGA 3L0GA 1YPFA 3M6YA 4PC8A 3H6OA 3TEVA 1UQYA 3GTNA 4PSPA 2PF0A 2PWFA 3P93A 3BQ5A 3HGSA 4X60A 3CV6A 4GXWA 1SMDA 4ZB5A 1YKWA 1WX0A 2YDRA 1EWEA 3MHUA 4I9AA 1KWKA 2GJPA 4L64A 4JTAA 5DXXA 3G0UA 1ZHAA 2P8BA 3LX9A 4F0RA 3BW2A 3WBEA 3U2CA 3WMLA 3QQ0A 2YW4A 3THAA 3SCSA 3WZ0E 1GGOA 3MCMA 3RG6A 1R7AA 1DWGM 1TR9A 2QIIA 3NZPA 5KZDA 2ZUUA 1VEOA 1TVNA 4HCDA 3W0KA 9XIMA 3AJ7A 3SY5A 3W88A 1W31A 2XGIA 3AHXA 3GDLA 5AYYA 1F2JA 1NFPA 1WKEA 2BODX 4BWLA 4YVVA 1FHUA 1I6NA 3EA1A 4I5XA 1HQTA 3HTWA 1T8XA 2HQAA 4XTIA 1YTDA 2C71A 1KXHA 5T8GA 3PHAA 4AHQA 1XIIA 4ZSTA 2RKXA 1H09A 4NZ3A 3L4YA 2P10A 3S1WA 2QGYA 2DJLA 2JFEX 4WDWA 2ACRA 3TFXA 3WLRA 4GBDA 3AXIA 1I2QA 3V1PA 1OQFA 5LIYX 2DZBA 4LS2A 1UR4A 4INFA 1YNQA 2ZXDA 1BGAA 1LOSA 3EEZA 3R8RA 5REQB 4H4IA 1E1CB 3WDPP 4WJ8A 3R0DA 2DT0A 2DZAA 4AF0A 1JFXA 1JCMP 4IP7A 4WDXA 5L9FA 1KD0A 3QV6A 4HHHA 3POCA 3N9SA 1IEQA 4RZBA 4RV8A 4D2JA 1DJYA 3CEUA 1E4IA 4PCNA 1DJNA 1UPPA 3GDMA 5IHSA 1QNPA 3C2OA 2GWNA 4Q4PA 5M5DA 1RQBA 1VRDA 1PIFA 4XZMX 1CBGA 1P6BA 1KCLA 2VUNA 4PMJA 4DNMA 3T1GA 1TPWA 1UKSA 3AIRA 3SAZA 4LVBA 1JZ8A 3AICA 1KC7A 5I09A 4RV3A 2OT0A 1J0HA 3L7RA 4A8IA 3AIBA 3GNOA 3H2OA 2AQWA 1NQ6A 4F9DA 4IIDA 2QUUA 3S5NA 2YLLA 4HPHA 4HA4A 1KA9F 2XIIA 4OBTA 3ZR4A 3UR2A 1R38A 4AIOA 4UFLA 3TWBA 1OX4B 1EHAA 3B9OA 5EMJA 1XRTA 4OIFA 1XIMA 1ITCA 3HMCA 3TTEA 3QC3A 1TPH1 3MKVA 3KTXA 1ONRA 2FPTA 4I9TA 4AZGA 3LQLA 3MUZ1 3N2XA 2OEJA 2R1NA 1AJ0A 2WLZA 1D3CA 1VJIA 4ZOBA 4MWAE 3CTLA 5F2MA 5JH1A 2F2KA 4ZGYA 2VNCA 2XINA 3NFUA 4ZQNA 2E77A 3QGVA 3A5FA 4UQEA 2DZTA 2CBIA 2WHLA 4PTXA 5TD4A 4J35A 1W5MA 4B4FA 2RGLA 2FZMA 1N82A 3LG3A 2Y24A 3VD9A 1ISWA 2WANA 1JVNA 1F6PA 4LFYA 4PUEA 3WJZA 7TAAA 3S6DA 1Z32X 2GQ3A 3M6DA 4E2DA 4L4OA 1JCNA 1VEPA 1UWIA 4JY9A 1S2VA 2HMCA 1RQHA 1N8IA 2BXVA 4PTWA 1BWKA 4XKYB 5D9PA 1GOOA 1M9HA 4KGLA 4JIHA 1FWBC 1TWIA 2YDSA 1MUMA 1SJCA 2NZLA 3AHZA 5FF7A 5IHRA 4Y8FA 4Y7EA 1L9WA 3F4VA 4IZGA 5D9OA 4LB3A 5HINA 4A21A 2AMGA 4H41A 4ADSA 5AZ1A 4M7SA 4L9YA 2PC8A 1BYCA 3MI3A 4AMAA 2W67A 4DUOA 2F8QA 1TZ9A 1NQKA 5LNRA 2DPEA 1XG3A 4CQCA 2HNEA 1V02E 1VCFA 3EPMA 5D8ZA 3PPGA 4RE0A 3H2AA 2BOEX 4GQRA 1KFKA 1KTCA 1OFRA 1XHGA 4MLJA 1JDCA 3S42A 3QFWA 2P5NA 4IPPA 4CD8A 3OZYA 1DJGA 3WDQA 3GWQA 5CZJA 4IL2A 1W1YA 2PBOA 4F3HA 3G1RA 1PTGA 1ITUA 4ROQA 1SO6A 1S3TC 2E09A 2RFGA 4YNGA 2HWGA 3QEZA 4X22A 1RJQA 2YYTA 1UMYA 4I3GA 2WLYA 4HA1A 4TTUA 1FWTA 3BLOA 1RA0A 3EMQA 3BLLA 1KXVA 4XAPA 1BTMA 3ITVA 2E8YA 4JQAA 3E2SA 4IJRA 4JN7A 1DWHM 1ADOA 1ZNNA 3TFCA 4RDZA 4DLMA 3QH2A 4G8TA 3UZJA 1Z44A 2VC5A 3N1AA 2DZPA 1HKWA 1F6KA 4UFJA 4BI7A 3VKBA 1GJWA 4BCEA 3WQ5A 4HNVA 1JFHA 3A21A 1WAWA 4GD0A 3HJZA 5CG7A 5AKQA 3PUGA 3QHMA 5GJPA 1A0CA 2WJEA 4M7TA 1KGWA 5IBXA 5GNZA 3I6TA 3IVUA 1W3LA 1A3XA 2GOUA 5DN1A 3TZFA 4KW2A 5AOUA 2EPLX 2IQTA 3G6MA 5K7JA 1RUSA 1CXIA 4A22A 3EB2A 3UT0A 4AAJA 3STGA 3NR0A 3W7GA 4XZIA 2A21A 3UZWA 4BF5A 3VIMA 4GKLA 4BY3A 4P7LA 1JDDA 2GGEA 1A3WA 3QY6A 1ODZA 3AMCA 3DFYA 4S3KA 2V5LA 2PAJA 2XN0A 4PUKA 1F8MA 2CEQA 3LRMA 1TPDA 4HPXA 1PPIA 1BTCA 2D2HA 4KS0A 4OHQA 1K02A 2P3ZA 1XCFA 5DXYA 2OVLA 2ZX6A 4XZHA 3NM3A 1VHCA 3W00A 1MSSA 2ZRYA 5BRPA 1YQ2A 2WOQA 3QPZA 3HM7A 4O0KA 3QR1A 3G8EA 3KVKA 4DI8A 5T9BG 1ZJIA 3GNPA 3OG3A 4QAIA 3EB4A 4PUNA 5HNUA 4LQ1A 1OK6A 4K36A 1CW2A 1Z48A 2ALDA 4BK9A 3LGGA 2ZIDA 3JZUA 2XFFA 3W2LA 3IIZA 3PZNA 2F61A 3C61A 1V0MA 1S5WA 5JIWA 4W93A 3KW3A 3STCA 2E68A 4F2BA 4A3YA 4XB3A 4IMFA 3GDRA 1OFOA 1GYNA 1TWWA 4IXXA 3MMDA 4Z2JA 4IQLA 4YCPA 1FP9A 3O05A 2NX9A 4NP7A 3TAOA 3HURA 3PZVA 2QNEA 1RV8A 3GLCA 4PTNA 5AHEA 3VFCA 3HG2A 6XIAA 1K4GA 1Q66A 4B5VA 1FA2A 4PODA 2F9RA 3T09A 3W85A 2PDGA 1S3HA 2G41A 1ADDA 2Y0FA 3Q4DA 4W87A 2Y89A 2CYGA 2OODA 2AL2A 3IJ7A 1XBYA 5I6SA 2QJMA 4KCTA 1UD8A 3PZGA 3SIMA 2IW0A 1JEZA 1UD3A 2BGNE 2RHGA 3MSDA 2V3DA 1WUFA 3VD7A 1TREA 2OYLA 1TR1A 1PZ1A 1TV7A 4XZBA 4ICCX 1YE6A 2PF8A 1WB0A 3S47A 2TAAA 3M7WA 1FP8A 4UFMA 4CEXC 4LUSB 1PV8A 4EWND 3UCQA 2ZZ2A 3HA1A 3UJEA 5LIKX 3TN6A 1LQ2A 4PMRA 1C93A 2OLHA 1CXFA 2WM1A 2A7NA 1WNOA 3BGAA 5HMDA 5KITA 4J3ZA 2NVCA 3K8KA 3N29A 3N17A 3QV9A 1BSLA 4OTKA 2QPXA 3ZVHA 4AW7A 2IXVA 4M6PA 1POJA 4ZQPA 1TQXA 7PTDA 3FHAA 3GK0A 1WDRA 2A3LA 4XZ9A 4C6PA 5FEZA 1XIEA 5M2FX 1EF3A 4S1FA 3VGFA 4FF5A 2OKTA 2GPTA 4MGGA 4NSBA 3RU6A 2VGGA 2I5QA 1I9CB 3RR4A 1QPRA 1XQLA 3LTSA 3MB9A 4KERA 4O52A 1TMLA 1EC8A 1PSCA 2XZ7A 2FYMA 1ELSA 3LBOA 4GUHA 1B3VA 1FDJA 1QHPA 5C71A 3NL3A 3N2MA 1PIGA 4XD3A 1KKOA 1OJXA 4Z17A 2OX4A 1GVEA 2WPBA 1OIFA 1RBLA 3S2NA 2YCLA 3DHUA 3PAOA 2ZZ6A 4R33A 1MFUA 2CBVA 2RH9A 1RPXA 1Q6CA 1KO0A 2PRLA 4BJHA 1VPQA 2W0UA 1VPYA 3W29A 5G4WA 3WIJA 2I14A 4FLSA 2WWCA 2OWWA 1FWAC 2L5HA 3E2VA 2B0MA 4W7WA 4MWAC 4MFEA 2CLFA 2OQLA 1B9BA 1Y8BA 2Z1BA 4IP5A 3LZ3A 1KM2A 2G37A 4HMEA 1P0NA 4GFIA 3B0XA 3D47A 3W7OA 1OF8A 2A7RA 1XYAA 3AO0A 3LRKA 3CGTA 3N14A 2FHFA 1A0EA 5DBTA 2D2GA 3PUOA 3GRIA 3K1DA 1NM9A 4LAKA 3VE9A 2VEIA 5C54A 4AUBA 2VT0A 4QBXA 3VNMA 4WDTA 4LXFA 1X38A 1TQJA 4DBWA 1CDGA 5A6KA 2E6FA 4GISA 3PY2A 5D2XA 2ZC1A 4MPQA 3LI0A 4LVFA 2V9DA 4K37A 4K1WA 5K2ZA 4L1GA 1E40A 4C60A 5CBIA 2EJ1A 1NWSA 1VBGA 2MNRA 2AKMA 3S0CA 1CLKA 4A2SA 1K77A 4LYQA 1PEZA 2ZC8A 3FJ4A 4B16A 3CB8A 1JYWA 4MLRA 2XJ7A 3R58A 3WFLA 4NKCA 1QK0A 1WA3A 4GCAA 5D37A 5C8BB 1B1YA 1W3TA 4B5XA 5EMYA 5IM51 3UESA 4GACA 3MMWA 3KEHA 4LB4A 5JBDA 2BLEA 4Q4OA 4JL1A 3W22A 3ARVA 2VOTA 5CLTA 3NPVA 1GOKA 3ZXWA 5BOFA 4D6GA 3ZT6A 1X39A 3OZMA 2QCFA 5MKGB 2XN1A 4UMBA 1MDLA 5IDZA 2FDSA 1P0DA 1XIHA 4NRRA 5D2YA 2DEPA 1QI2A 4W7UA 1CGXA 3TXVA 1KBJA 4DJFC 4ZOCA 3I7QA 1G94A 3DU0A 1XICA 3UZZA 3AMGA 5F4SA 4B3KA 2EPHA 3EAUA 1CZ1A 1KFJA 1E70M 5BXPA 4JICA 1IXNA 3AIUA 6A3HA 2A1YA 4DO6A 5A8MA 1RQEA 1TWSA 4MDPA 3G6LA 1JZ5A 2E6DA 3BK0A 1BG9A 3FX4A 3W81A 1V6YA 3KTCA 1Q6QA 1IT0A 4HN4A 3QKZA 4ZZ9A 2WSQA 3EWDA 1BQGA 1THFD 2VZUA 1WZLA 3SBFA 1HL2A 4FXJA 3W4RA 3WMBA 2CLPA 4F48A 3T55A 1ME9A 2ACUA 3VKKA 4EPEC 3U0HA 1REQA 3EKZA 3OA3A 1Q5MA 3V5FA 2BX7A 2GVLA 1VCVA 1JCXA 1ZP3A 4FLRA 1XR2A 1JGIA 4FR6A 1RCOB 3S5ZA 4OOZA 4FEZA 2VELA 1LWIA 2W3ZA 4GIEA 1SZEA 3G18A 3WNKA 3O6AA 1QI0A 3IANA 1GTHA 5CSYA 5FJTA 2C14A 3IGUA 4QE1A 4R88A 2QPUA 3STPA 1UROA 4DWSD 2V3FA 4KETA 2WZIA 4FLOA 3G8RA 3S2LA 3AMLA 4LBSA 4UTTC 5IXEA 4HBKA 1I45A 4YCOA 1E1EA 3FJ6A 1EZWA 4GX8A 2E67A 4IOTA 3TX9A 4IMAA 2WSKA 4KWUA 2AL2B 3K5XA 4I7VA 1LG2A 3RITA 3QJAA 3TH6A 3KE0A 3VNDA 4IP4A 1YTEA 1ZBCA 1E4NA 3M5VA 4EXQA 2DT3A 1OG6A 2Q01A 2CKSA 2PDJA 1C9WA 1XH1A 3OQEA 4CD5A 3MZ2A 2PTXA 4DYKA 3VUSA 2OEMA 5A6JA 3PZ9A 4G9PA 4L9ZA 2WXDM 4NILA 1EEPA 1SU5A 1GTEA 4F66A 1VENA 2WC7A 2D20A 3E74A 3GVVA 3WYZA 4IG2A 4QQ3A 4J3SA 4KESA 1H11A 4LT9A 2BNJA 5DLCA 3IRDA 1Q63A 1R7OA 2CFFA 1CB2A 1K9EA 3GYEA 3H21A 5DX7A 2OYMA 3ZVHB 1SFSA 4M80A 1DE5A 1Z7AA 4RXGA 2E1WA 4RK8A 1KM0A 2FH8A 2X1TA 3S46A 2VI0A 2YDAA 5I3FA 4CKQA 2Y61A 1CGWA 1H1NA 1NIUA 2EPOA 1AODA 2X0SA 5E1QA 5ENLA 3KP1A 3WSUA 1XCWA 2A85A 2O9TA 1XYZA 1O68A 3HIJA 3WEOA 4O1CA 2HPIA 1YTKA 4LUIA 4QEEA 3TJ4A 5C0QA 3SQLA 2XU2A 3RDKA 1UKPA 3LPPA 1WKDA 1S2AA 4MYXA 4ERAA 2GK1A 2HVNA 4E8CA 3N04A 4JHZA 1T5AA 3N4EA 3OHIA 5BMXA 2WZEA 4MTVA 1P0EA 4KMQA 1R3QA 1YIXA 2HRWA 4B15A 2YCLB 4H00A 5LGXA 3ITOA 3V5OA 4IIEA 1PZ0A 5J8LA 1T8QA 2QV5A 3VMPA 3UWQA 3S9IA 2V69A 2RDXA 2GSJA 5FIPA 3HPFA 3B0VC 5CG0A 1Q7ZA 2GSEA 1UOKA 3CV1A 5I79A 3CQJA 4PMYA 1US2A 4MMWA 1HN1A 1XWYA 3PC0A 4DUWA 1EGZA 4IPLA 1A50A 3P80A 3WD0A 3DI1A 3BAIA 1WXZA 1IR1A 1JZ7A 3S1VA 3O8AA 3AIVA 5AYBA 1ZBKA 1EF2A 4L4MA 4MKVA 4FMVA 4KFNA 1ZZMA 3IIOA 1KR1A 1LP6A 2VEGA 4JFTA 2PRHA 4DF1A 2DQXA 4LSBA 3UG5A 4GK8A 2E9BA 3WDHA 1IGWA 4TU1A 3GY1A 3GXIA 4WOZA 4YL2A 1IR2A 5FJJA 2GSHA 3FNDA 2C3ZA 3R7MA 4D9PA 1ZQ5A 2DV0A 1U1HA 2DT2A 1AMKA 5TAOA 1MI3A 1YNYA 4Y6GA 4DAFA 4JTJA 1XSJA 3E38A 3T07A 3NOYA 1UBSA 4MY8A 4W85A 2CLOA 3NCOA 5I2UA 3WQFA 1RSCA 1W91A 4JTSA 4R9OA 4K39A 1XGZA 5CH9A 5D05A 4P7NA 1BF6A 1O66A 1XYCA 3AIWA 3B03A 3FCPA 4JN6A 1W9UA 3VIPA 2Y85A 4HSOA 3UJSA 3EGJA 4R7OA 2PC4A 2Q3OA 3DYOA 3THQA 3A64A 1J12A 1OZMA 4HPJA 2D0GA 2AAAA 4MOZA 2WMGA 3W2KA 3G0SA 2E1DA 2VFFA 4ATLA 3P8JA 4AY8A 4L6DA 3T4WA 3H23A 3NPUA 2WMHA 3GW0A 1OT2A 1IF2A 3A4AA 2QCCA 1VBHA 2NXHA 4DZHA 2YA2A 2QT3A 4WKHA 3S83A 3EEGA 1W37A 4NF7A 2P1FA 1QNQA 1MXSA 5CC5A 2OQYA 3SQSA 2FDMA 4BEQA 2NQ9A 1YXCA 4F40A 1L0PA 5HDRA 5E09A 3A3WA 4JR5A 5D38A 4GOAA 2PE4A 3QY7A 3TP4A 1XLAA 4DHGA 3CO4A 4UB9A 1JZ3A 2ISVA 2NQJA 5HUPA 1BD0A 1ITQA 3SRDA 3AOFA 1Q6RA 4OOUA 4PTDA 5DMYA 3GBEA 1SM9A 1GVSA 2VX4A 2WZHA 3TJIA 4E3VA 4AIBA 1YDYA 4FNUA 3H7RA 3P84A 3VGDA 1I2OA 3E3HA 4BR1A 4BI5A 1WV2A 3NO5A 1LZOA 1PHWA 3SJ3A 3AFBA 4S3BA 2AMXA 3CH0A 1W8GA 2V5DA 3AXXA 4UOQA 2ZBTA 3ZR6A 1D3GA 1KTBA 3BLKA 1J0IA 4O53A 3W26A 1YRRA 1JYXA 1SSGA 3PUDA 3VPLA 3MUIA 1J0ZA 4A3RA 1OBAA 3FEQA 3KOFA 4YYFA 1SW3A 1J5TA 5CBBA 3RM9A 1CNVA 4X9SA 3N6QA 1VFMA 1L6WA 1NWTA 3BMXA 2PA6A 4HHMA 2C0AA 3NQEA 1F3EA 4YS1A 1WE5A 3LENA 2EPNA 1R6WA 3R43A 1Q6LA 3B04A 3ITYA 1V6TA 4Q8MA 1G4EA 3XISA 3NVTA 5F4WA 1SFJA 3WBAA 3NDZA 4JD4A 3HV8A 2QUVA 4UZUA 3RK8A 3VM7A 2BASA 3M5YA 3GDBA 1U30A 4FX8A 3RX3A 4OE7A 5HUOA 3A3XA 1ZU8A 3SECA 4REQA 1V79A 4HKPA 1YDNA 3FVMA 4NL1A 2QYGA 3S8HA 4UTJA 4GI8A 2HE5A 4AWTA 1GYLA 1LUCA 3M0IA 5JXQA 3EX3A 3ALFA 4U28A 3F4DA 2O4MA 1EA9C 3WJSA 4AD3A 4XBKA 5CPMA 5EKYA 2ZZ4A 2VGIA<