4LALA

Crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
368
structure length
368
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTAHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
total genus 136
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lalA00
1HZYA 1YMYA 4EPKA 1ONXA 4GBDA 3GIQA 4C6JA 4DLMA 4DO7A 4GY0A 4I6KA 2OGJA 1PTAA 2PGRA 3IACA 3RCMA 1KRAC 1WXYA 1WXZA 2WJEA 3S2JA 3UBPC 4GC3A 4BY3A 1ITUA 3GG7A 2PLMA 2Z2AA 4GXWA 3O7UA 3A3WA 4PBEA 1XWYA 3E0LA 4Z42C 1NDYA 3URAA 3SFWA 4KIRA 4DYKA 5LXXA 3F4CA 3PANA 1EJWC 4IFRA 4HJWA 4C6BA 4CQBA 1EF2A 4IQJA 2WJDA 3TN4A 2OOFA 3D6NA 4AC7C 2Z24A 1YBQB 1XGEA 2HBVA 4XD3A 1I0DA 4GZ7A 2ZC1A 4L9XA 2GOKA 4LANA 1W1IE 4H9ZA 3RN6A 1QW7A 5CH9A 4NI8A 1PB0A 2RAGA 2Y1HA 1EJSC 4B92A 4RZBA 2WJFA 3T81A 3ICJA 2P53A 4LALA 1EJRC 2Q01A 3TN6A 2XIOA 1FWFC 1POKA 4KERA 1J79A 2UZ9A 3PAOA 3UF9A 1K1DA 4R88A 4C6PA 1FWDC 3WMLA 2D2HA 3O0FA 1ONWA 1R9YA 2HPMA 2GSEA 1K6WA 4XAFA 2HNHA 1KRBC 2R1MA 3IPWA 4INFA 3GU1A 2G3FA 4C6OA 1GKRA 1EJXC 1R9XA 1V79A 2EG8A 1FWGC 2Z29A 3TN3A 3URBA 3UPMA 2PUZA 4C6CA 4GY7A 3RHGA 4IFKB 2F6KA 1UIPA 2Z28A 3FDGA 4H9TA 2Z25A 4NG3A 4WGXA 2PAJA 3B0XA 1NFGA 4MUPA 2I5GA 4YIWA 2VHLA 2OODA 4BKNA 3ID7A 1NDZA 1EJTC 1IE7C 2FTYA 3UR2A 4J35A 3MVTA 3T8LA 2W9MA 3OU8A 1PSCA 4R7WA 4H9YA 4P5UA 1RK5A 4QROA 3ORWA 2Z26A 4IG2A 4PBFA 3GIPA 2IMRA 4C6DA 3LGDA 1RA0A 5G4HC 1GKPA 1FWJC 3QGKC 3N2CA 4C6KA 4HK6A 4IF2A 1YIXA 4M51A 1EZ2A 4UBPC 4GX8A 3MKVA 4PCNA 2HPIA 1A4LA 2E25A 4E3TA 1EYWA 4B3ZA 1QXLA 3IGHX 1FWHC 2YZ5A 1DPMA 1A5LC 4C5YA 3RYSA 2R1LA 4DZIA 3NURA 1BF6A 2ANUA 4IH3A 5HMFA 3NEHA 1K70A 2BB0A 5A6TC 1M7JA 4TQTA 4IFOA 3AUOA 3E38A 3AU6A 4CEUC 3OQEA 4EP8C 3G77A 3FEQA 4KETA 1XRFA 3QY8A 1UIOA 4LCQA 4H9UA 2VR2A 5FSEC 1XRTA 4CNTA 4QRNA 4JOMA 4H9MA 2FVKA 2YXOA 1UBPC 2A3LA 2GWGA 2Z2BA 2EG7A 3S4TA 3GUWA 1RA5A 1KCXA 2E1WA 3LY0A 2Z27A 4KESA 2ICSA 1RAKA 4OFCA 2D2JA 1EJVC 2OB3A 3TNBA 3OOQA 3ITCA 2R1KA 2DVTA 4F0LA 2VM8A 3QY6A 4H9VA 1A5KC 3LA4A 3MSRA 1P1MA 4LEFA 3DUGA 4WVXA 4LAMA 3MTWA 1FWEC 4R85A 5HMDA 4DZHA 2KAUC 4H01A 1ADDA 3IRSA 4QS6A 1J5SA 2DVUA 1P6BA 3URNA 4WHBA 4XD5A 3AU2A 2R1NA 4XD6A 3GTIA 3CAKA 3MDUA 4CNUA 3DCPA 1O12A 1RJRA 3MPGA 3IV8A 4IGMA 4IGNA 3UR5A 1E9YB 2FFIA 4HK5A 1P6CA 1RJPA 2D2GA 4QTGA 5FSDC 1NDWA 1V4YA 3QY7A 2DVXA 2YB4A 4ERAA 4L6DA 3MVIA 1PO9A 3WZ0E 3K4WA 4F0SA 4G7EB 1V77A 3GTXA 3NQBA 1S3TC 4GX9A 4V1YA 3A3XA 3R0DA 4J5NA 1KRMA 1RJQA 4RDZA 3HPAA 4LH8A 4DI9A 2AQVA 4RDYA 3BE7A 3KM8A 2VC7A 2QPXA 3B0YA 4C5ZA 1VFLA 4ERIA 2O4MA 2Z00A 2UBPC 4PE8A 2QVNA 4XAZA 4F0RA 3F2BA 2HQAA 3F4DA 5HMEA 4GYFA 1A5NC 1FKXA 4GY1A 3PNUA 3FDKA 4ICMA 4LAKA 1FWAC 3LSBA 2P50A 3HM7A 3QGAC 3S2MA 4DI8A 3LU2A 1JGMA 4CEXC 2GZXA 3IJ6A 3LSCA 4C60A 3T1GA 4RE0A 3CJPA 4KEZA 4ZSUA 3JZEA 1M68A 2YB1A 4LAOA 3OODA 3LGGA 4C6IA 4G2DA 1FWBC 4QS5A 3B40A 3MDWA 4LFYA 4KEUA 4J2MA 3EWDA 4EPDC 1UMLA 2Z4GA 1E9ZB 5E5CA 4XD4A 3EWCA 1ITQA 4H00A 5AKQA 3S2NA 1YBQA 2Z7GA 2VUNA 3C86A 2HBXA 4CNSA 3F2DA 3PBMA 3WYZA 3GU9A 3F2CA 4EPBC 4NP7A 3GTHA 1EJUC 2AQOA 4V1XA 4HA0A 1YNYA 2QT3A 4GK8A 1A5MC 4C6LA 3OVGA 2I9UA 2AMXA 3IARA 4XAGA 1I0BA 4BJHA 4H9XA 4RDWA 3URQA 1A5OC 4XAYA 4D8LA 4DLFA 1J6OA 1FWIC 3OJGA 2PGFA 1NDVA 3LS9A 2ADAA 4B90A 3GU2A 3LNPA 4EPEC 3ISIX 1YRRA 4KEVA 2FVMA 1FWCC 3PNZA 1RK6A 2QS8A 4DIAA 2R1PA 4KQNA 4I6VA 3E0FA 2FTWA 3K2GA 3CS2A 2VC5A 1V7AA 2OQLA 2WM1A 3GRIA 4CQCA 4UB9A 4C6MA 4CQDA 4IFKA 4GOAA 4LCRA 2O4QA 2CZVA 4ZSTA 3V7PA 3SO7A 1J6PA 4C6EA 4C6NA 1FKWA 4C65A 3GTFA 1KRCC 3E2VA 3A4JA 1R9ZA 3E74A 4G7EA 4C6FA 1A4MA 1ZZMA 2Q09A 3EGJA 3MJMA 4QSFA 2BGNE 4C6QA 4B91A 3TN5A 1GKQA 2GWNA 4AQLA 4HK7A 4IG2B 1O5RA 3S2LA 4RDVA 3HTWA 4ERGA 4PCPA 3E3HA 3DC8A 1M65A 1POJA 2EG6A 1V51A 4DNMA 4KF1A 4LCSA 3K5XA
chains in the Genus database with same CATH superfamily
2NX1A 1ONXA 3HQPA 3GIQA 3L68A 1J8VA 1XM3A 1XLFA 1W3HA 1LBMA 2C71A 3S2JA 4QITA 4H3DA 3FKRA 4MJ4A 3U2OA 5I3GA 3GG7A 3IS4A 3VAVA 1WDPA 3P8JA 1SMAA 3LG3A 4I7WA 4NX5A 5E0FA 3T40A 4JQ1A 3FEMA 4JFWA 1YPXA 2CLMA 3IVTA 3UW6A 1JZ3A 3QOKA 1TJ2A 2ZUUA 2QF7A 3ZLFA 1P0EA 1SO5A 2YDRA 4AC7C 3G24A 1ITCA 1UH3A 4JKKA 1ZU8A 1DJXA 1W1IE 5J04A 1JNDA 3QW4B 3NSMA 2AKZA 1H5YA 1DXFA 2Y1HA 4U2ZA 4ZQPA 3F03K 4DWDA 2FFCA 1R87A 4H8UA 2J7EA 3GXDA 3WJYA 3BMVA 3PWAA 4KEMA 1TZ7A 1K7FA 3BH4A 4B5WA 1W3LA 5DT5A 5FEXA 3WFLA 4PSPA 4ZENA 3DYOA 2OCZA 3O6AA 2GSEA 4XAFA 1T8QA 3W70A 4U10A 4XZBA 3DGRA 2XN1A 3TJLA 5CJMA 2DZWA 4UQAA 1G9HA 3VIFA 4AHQA 4C6CA 1RCXB 3BAKA 1AODA 1QOPA 1MFUA 4N6EA 3N25A 3SBFA 4CQ9A 1XH0A 4D72A 3QBUA 3R7MA 1XLJA 3NCOA 5FIPA 1VFTA 4FLSA 2G5WA 2GVEA 4NF7A 5EYWA 2NSXA 1B4EA 4B5TA 4D1IA 3SN1A 1RY0A 5D8WA 3L12A 1IGSA 2VMFA 1P0NA 3VABA 1SR0A 3DU0A 3E9AA 4JTGA 1Q7QA 3W6MA 2J79A 1NELA 1E6XM 3H55A 2C79A 2I14A 3FSTA 1NVMA 3THUA 4Z2GA 4LQ1A 2QNEA 2FYMA 1EYWA 1U22A 4MDOA 3ABQA 4UQ9A 3DKLA 1B9BA 1R2RA 2VENA 4Y6GA 3TV8A 3ANVA 3BG5A 2CC0A 1C92A 1UZDA 1ZLPA 4D6IA 2OMAA 2D22A 3L21A 1H7PA 2AL2B 3W28A 3TYZA 1RCOB 4A05A 1LBLA 2XVNA 4PMXA 1VEMA 3AALA 8RUCA 1Z89A 1US0A 3OW1A 3EOUA 4E4PA 5FSEC 1RXOB 4TO8A 2Z1SA 4LV4A 1I45A 2Z2BA 3S4TA 4FOUA 3SCRA 1UP0A 1ZJIA 1OGSA 2A7PA 1J10A 1RAKA 3HJEA 3TR9A 3M4HA 4Q4PA 3U2ZA 2DVTA 4ZB0A 5I3KA 2E1DA 4PZVA 3GDTA 4HCLA 2GGJA 3BLKA 5A6MA 1AG1O 1JPIA 3BV4A 2IKGA 3MCNA 5H2ZA 3OVPA 4DJEC 3BCFA 4H01A 4AX7A 1MWOA 1GOIA 2D0GA 1E70M 4UNLA 3S6OA 3E12A 4HA1A 3WD4A 5KINA 4FLOA 3DEQA 3AXIA 4NJIA 1D2KA 1S2AA 4XZ9A 1E1FA 3NZ1A 1EA0A 1W5MA 2W79A 1H7NA 3SFKA 2BV9A 2OSXA 4Q6XA 3V0UA 3WZ0E 5BMWA 1UWUA 2D3NA 1S3TC 2A0NA 1P5BA 4Q32A 4YTTA 3CIVA 1XC4A 4RDZA 2OZTA 2AQVA 3VNLA 4KH2A 3MBFA 4NZJA 4JX5A 4KCWA 3R11A 3STEA 3GBEA 3S9IA 1LUCA 3PTMA 3RPMA 3QPYA 1QK0A 4MLRA 1N7KA 3PJXA 4B2DD 4UUIA 4TX9A 5HMEA 1JNEA 3NDOA 3MW7A 3G1VA 2OLHA 4GYPA 3GS6A 3FDKA 1W9VA 1SMDA 3OA3A 3B4UA 3A3HA 3WEOA 6ALDA 2VZVA 1E4LA 5CLWA 2VEGA 2YSWA 2PRMA 2XN0A 1YX1A 4RE0A 1C9WA 3ZMRA 2ACQA 4ZSUA 1LM1A 5J5RA 4JKMA 2WV8A 2WHJA 4AHOA 1JXKA 2I1OA 3WD1A 1V8EA 4Y90A 4FIRA 1JF6A 1QNPA 1VJSA 6ENLA 2Z4GA 5GNYA 2X0YA 4A8NA 4MLJA 1ADSA 2QDGA 3F5KA 5C9RA 1YBQA 4JTUA 3BJFA 5CKSA 4CNSA 3L9CA 2FTPA 1QPQA 4UOZA 1GQJA 5JBFA 3GVWA 4Q8QA 1TR1A 4IXXA 3EEGA 1XYFA 3T2OA 2JFEX 4DVOA 3QC0A 4O1FA 4WQ6A 3W2LA 3EPNA 1YTDA 3LS9A 2QCEA 3EB4A 2XHYA 2WCAA 4O17A 3BGAA 1ZSXA 1L6GA 4AEOA 3G6LA 2VCBA 2FTWA 4QLJA 3W7CA 5D9OA 4K2SA 4ROQA 1UA7A 4YPJA 3ZFHA 2YW4A 4JICA 3N2XA 3TNOA 4PUMA 2CZVA 4KWSA 1HJUA 5J8LA 4UTMA 2ZADA 3AYTA 3RU6A 3NO3A 4LVAA 1BRLA 3BSHA 3VXGA 4K8HA 3E02A 4IJRA 2G37A 1QPKA 4W4QA 3I6TA 3VNZA 3G5EA 4ZOBA 1WZLA 1H5VA 4JS3A 2D24A 4ORIA 3MB9A 1YE4A 2V67A 4LYPA 1H0GA 4AEEA 3LI0A 4LC8A 1QUMA 3M9YA 3O63A 4MKVA 3WQGA 4I90A 3LV5A 1E73M 3NZQA 1VEPA 2BHZA 4MZ8A 2PURA 3KW3A 4O1CA 1CXFA 2ALRA 5FJPA 5C2GA 4KWWA 3TA6A 2UV8G 3L4TA 3P6LA 3WQEA 1G4PA 1ZP3A 2FPYA 1X98A 4KIRA 4DYKA 3AOFA 4US5A 4D6FA 3C5QA 4PTVA 1GQNA 1JFXA 4B5VA 4GJ1A 3TZNA 1J0IA 4NZ4A 4RW5A 4RR4A 5I3JA 1JCJA 4GZ7A 2O92A 3UWYA 3TE9A 1WO2A 1G5AA 3VOCA 4C1KA 4NAEB 5G2HA 2PD5A 1SU5A 2QYGA 1VFMA 3QLLA 2CLIA 3IIPA 2Q01A 4UQCA 3R25A 3UVAA 3WQPA 4TUFA 1GWJA 3BICA 3U8GA 1TJRA 3KWXA 1OCBA 2D2HA 3O0FA 2HPMA 1RQEA 3OG2A 2W66A 3FS2A 3G18A 3TAOA 1MW0A 3FV9A 5LA0A 1GKRA 4IPNB 3EXRA 3NDZA 4QG9A 5FF0A 3G2GA 3TFXA 2DIKA 2Z29A 4Y7EA 3URBA 3AHVA 4HSOA 3TUUA 3KOWA 3DIPA 4IFKB 3TYCA 3H21A 3HGRA 3TC3A 5T8GA 3FDGA 3RPDA 2VZTA 3LERA 5FF2A 5KSWA 3AIEA 4RCXA 3T8QA 2GFTA 4CVUA 4I5UA 3WELA 3ONBA 3F5LA 4Y96A 4PRTA 3CZKA 3T8LA 5C5YA 2DDXA 2CIPA 2IKIA 2XM1A 4GYPC 5EL1A 4G56A 3CASA 5JBEA 1QTWA 1VR6A 1TRIA 3GUGA 3MMTA 1FWJC 1TTQA 3N2CA 1XYAA 3IIZA 3ARRA 3NNTA 4MWAD 1MRQA 3TEVA 2VVSA 4O52A 4B3ZA 1K7EA 3E2RA 1UD3A 4QM1A 3TK7A 2YZ5A 2B0MA 4JTQA 4O11A 5AYIA 4CQ8A 1UD6A 1UKSA 2ANUA 1EUAA 3MJYA 4UTLA 1AJZA 4JPGA 3KX6A 4AVOA 4TQTA 3REQB 4ASTA 4OUIA 1IXNA 2XPKA 1QBBA 3KP1A 5EMKA 4BCEA 4N02A 2C19A 2PWDA 2Z6IA 5AYBA 4E6MA 2OSWA 4JOMA 3H8AA 4S3GA 1VC4A 3EOEA 5CPOA 2EG7A 4DWSB 1DJQA 1MQPA 1MO0A 3TNBA 5I06A 3TKFA 3ITGA 5KEZA 2VGGA 5ECVA 4H9VA 4NXSA 4MTVA 3IV3A 4MNMA 5DXXA 5H8UA 1DQXA 1NQKA 2P3EA 4N9CA 4DZHA 4ZO8A 2VEPA 2QF8A 3FVDA 1J5SA 1IYXA 3P2VA 4MZYA 3URNA 1LORA 1E1CA 3P82A 3DESA 4W86A 4Q4OA 5AFDA 4BQ4A 1ZHAA 4HD5A 2XIIA 4HOXA 4HSHA 2NQZA 4PR4A 3BO9A 3BWWA 3L66A 4Z2KA 1N2VA 2E9BA 2O9TA 4DBEA 3IVSA 3W71A 3S6TA 3UWEA 5HATA 3SIZA 4X60A 3MVIA 3STCA 4GUHA 4V15A 5CEWA 2YL6A 2OSYA 4JIQA 4GKLA 1CXIA 4EXAA 5AZ0A 2JGQA 3KBNA 3W37A 3LMZA 4IT1A 3N15A 4QBXA 5JMUA 3TQPA 4UC5A 3DYPA 1HFBA 3HPSA 3ARQA 2HQAA 5DBUA 3BUVA 3ARSA 3GR8A 1TPUA 2PDNA 1EYEA 3PTDA 3DGBA 1W31A 3N4AA 4PRRA 4DRSA 4ICMA 2NUWA 1PKLA 3PZUA 3B9NA 4CNNA 4Q4QA 3GNOA 1E6NA 1OINA 2E9MA 1U5HA 5AY7A 3W87A 1RPKA 2WMKA 4LAOA 2CLOA 2G4JA 3ZQ9A 1XLGA 4LUTB 2QJJA 4CLMA 2Y70A 3B4YA 5C9ZA 3OIXA 4NAFB 1E6QM 5DLCA 3TJ4A 4A8LA 3EX2A 1WP6A 4PL2A 4JNZA 4DJFD 4DX3A 3P61A 2Q71A 3NYZA 3C86A 2X8RA 3KVMA 3C3NA 1K77A 3Q67A 1IGWA 1J5TA 1W9UA 4JDYA 2ZQ0A 3LV6A 4W85A 4GBUA 4OGZA 4EPBC 3NGJA 5EA9A 1M41A 4HA0A 4UTTA 1YNYA 4GK8A 5HQEA 4UTWC 1H1YA 4XAGA 4ATDA 4ZEPA 1FWIC 2QKFA 2X42A 1BLIA 4X2RA 4DXVA 4LS0A 4LBRA 3RJXA 3GHTA 1C3FA 1IF2A 3APTA 4KEVA 5ABFA 1G94A 3C4UA 3E49A 2QS8A 2BXVA 3C56A 2DJLA 2W27A 4QAWA 3M0MA 3MHGA 4Q22A 2VJXA 2X7VA 2OYLA 2ZX6A 4C6MA 1ML1A 3FY1A 5LA2A 1TREA 5AHLA 6XIMA 3AIRA 3MUCA 2RDUA 2OG9A 1XSKA 3LCXA 4NUWA 4FMVA 4M19A 3GWQA 3W72A 3NXLA 4G7EA 1A3HA 4H8VA 1NF7A 3EDKA 2NT1A 4B91A 4XB3A 4AIEA 1W1YA 4FR1A 1BF2A 1EDTA 1KXHA 3VNMA 3W7DA 3FA3A 2WOQA 3AIBA 2EG6A 2TRSA 3B0UX 4JFSA 3KUMA 3H7RA 2PWFA 4OBSA 1NOWA 2ZUSA 3F5JA 3AHTA 2HVMA 4E3VA 2P8CA 3MMDA 1JAEA 4IPPA 1WUEA 4YU1A 2PZNA 3L5AA 4ECLA 4DM1A 4BY3A 1VFSA 1XLCA 3N04A 2V2DA 4GINA 4FX8A 2FHBA 5A6BD 2X40A 1EF3A 3WUGA 2ZZ4A 4P7QA 3PN8A 3HG3A 3ABZA 1FFRA 4P7NA 4S2BA 5BOFA 3FXGA 3TWBA 1VS1A 3GXFA 4ACZA 1KQYA 4YWIA 4CQBA 4DZAA 4HQVA 2EGZA 1M9HA 1H51A 5CPTA 3SUUA 1V6VA 4X22A 4LVFA 4WKHA 4CN6A 3BZGA 3QHNA 4S3AA 1ZB5A 1IT0A 3PFMA 3ZXWA 2HS6A 3WQVA 3VDAA 3PWGA 4JY9A 4KKXA 3WMLA 4L9ZA 1GVYA 4HYVA 4EF8A 2HNHA 3OYZA 4JTKA 2WVVB 5CBBA 3A5FA 5MKGA 3MWCA 3K13A 3UP8A 2ZRVA 3KEHA 3M07A 5JU6A 1E6PA 4DPQA 4WGXA 4FEZA 4M0XA 2PI6A 4Z1YA 1F3WA 3AHYA 1VP5A 3B3DA 2XGBA 3IIVA 3W24A 4ACYA 3OGRA 4MY1A 4ADTA 3P80A 4P5UA 4CN1A 4U33A 3LBOA 4JCMA 4ZO7A 4CNPA 1CYGA 1ME7A 1RA0A 2JIWA 4P7OA 3B9DA 2QV4A 2J74A 5A1AA 2E4TA 3W7JA 4MHBA 4H7CA 2PS2A 3S9YA 3QSRA 3S6DA 1WB0A 5A6KA 3IK4A 1Z69A 3HIJA 3UG8A 1A5UA 2PTDA 4R9OA 1F3EA 3LCFA 2WAGA 4JN6A 1VCGA 2V68A 3KTCA 4OHQA 3MI3A 5FJIA 3FEQA 1YXDA 2XGZA 1XRFA 4BWLC 2YCJA 5KTLA 3VIPA 4A3HA 2VR2A 1KV5A 1J0KA 1FBAA 5F4SA 3HFTA 4REQA 2J7BA 3RO6A 3WLKX 3GUWA 5FACA 4ZQCA 1VF8A 4PMNA 4B9ZA 8A3HA 2D2JA 2DUAA 4P2VA 2Y6ZA 3LX9A 4BQ3A 3HURA 5A95A 3WDPP 1ME8A 3T05A 2PDBA 3M43A 1JZ4A 3DECA 1TVNA 4AB4A 1WDDA 4K7YA 1W32A 1OSEA 3V5OA 3L67A 2NVCA 4H8HA 2WSKA 4U3CA 4FSAA 2ODOA 4AD4A 3VKCA 1E5JA 1JD7A 1PBGA 1CEOA 1R3VA 4BS0A 4PEKA 4H6KA 2ZXDA 3T9PA 5FF3A 9XIMA 3WSUA 2HXUA 2QJIA 3QY7A 1W1TA 2ZUNA 2J8TA 1I75A 1PO9A 4FNTA 3NOEA 4H7ZA 3LLXA 3KE0A 4JQ4A 3VM7A 1JRBA 2F2KA 3GG8A 3FSUA 5DRCA 2WC3A 3WQ5A 4ZOAA 5M5DA 4RUBA 2LLEA 2CBIA 5A6LA 1VD6A 4LVDA 3QMTA 3BW4A 5FJTA 3Q45A 3UG3A 4ERIA 4JQ3A 5FL0A 4YYFA 4UNIA 1XF0A 4XAZA 3QLDA 3MI6A 5CJ5A 1Q8AA 2PBGA 1PKMA 4L80A 3HFYA 1W17A 1CIUA 2BVTA 3VMOA 1MXSA 3T0BA 3KRUA 1V3HA 4JTIA 4DI8A 1JGMA 3LU2A 3LSCA 3A64A 5I02A 3S1WA 1CW2A 4QSHA 3BAJA 2OEMA 1TA3B 4NZ1A 4XTDA 5FCZA 3B40A 4H4IA 1W5QA 3TVAA 4KEUA 2NXGA 4UFIA 4HNCA 2XFWA 4AHPA 2X2GA 1XSJA 5U7SA 2XG9A 4S3FA 1XLKA 4HOZA 3B8WA 1Q6CA 3TFCA 1KTCA 4J40A 4CD8A 2OYKA 2ZA3A 4LPCA 4I8DA 1D9EA 3F2CA 2XIQA 5BMXA 3S8HA 3KOZA 1OABA 3I3EA 4BF9A 2WZMA 4D6HA 3XINA 3LHYA 3OLIA 1J6OA 4LBUA 2BASA 5HJXA 4AD5A 1B2YA 5CZJA 4HMDA 1SZEA 3SQSA 1KFCA 1R0MA 1AJ2A 1RK6A 4I6VA 1EP3A 2Y8VA 1TPEA 3A4XA 4K1WA 3LM3A 5DBTA 5A2CA 2WM1A 2PDYA 4CQCA 3W1QA 2G97A 1ZAJA 4WGHA 4CGTA 5C0QA 3DG6A 1DE5A 5CGQA 4JKLA 2BTMA 1AH3A 1V7YA 4UOJA 3CZGA 2ZUMA 2C6QA 1TIMA 3PFRA 1HJQA 5FEZA 1LG1A 3QRHA 3UZ5A 3VIIA 4IISA 1TMHA 3STGA 2C1IA 2WMIA 4LEQA 1V0KA 1RBLA 4I7UA 2C14A 4KF1A 4HP5A 1YYAA 3R94A 3O05A 2GUYA 3NSNA 3ARZA 3JRKA 1ZBCA 3FX4A 4IL2A 3H2OA 3WH6A 2DFAA 1W1ZA 3QFWA 1O6IA 3VMNA 1K8CA 3UBPC 3EOOA 5E6YA 1GK8A 3E2QA 2WKJA 4F9DA 3BDKA 5A8MA 4H6QA 3HU7A 5T9BG 3STPA 2R8WA 3A3WA 5FOOA 1G4SA 3WD2A 3W29A 3GYEA 1MMFA 4NZ5A 1MQRA 1HJSA 2HSAA 1EJWC 1P0BA 5C8BB 3GZAA 2VO5A 3UY8A 1XIIA 4V2XA 4O0KA 5AB3A 1ZAHA 2O56A 3CAWA 3I3BA 3FJ6A 4EF9A 4JY8A 1VCVA 2NVDA 1V3IA 5IRPA 4QX4A 2VL4A 4BF7A 3RO8A 1JRCA 1TE6A 5DMMA 2OWWA 3M47A 3W27A 3WFAA 2QJGA 2P1FA 2P53A 3LHTA 4LALA 5HANA 3WQWA 4HIBA 2V5KA 1QRQA 4O0ZA 2UZ9A 4AZGA 4MAVA 3AS0A 2X09A 4G9PA 1JUBA 4M5PA 4XIMA 4DF0A 2CXGA 2WSYA 2R14A 1U2YA 1FOBA 1B9ZA 4N9BA 4DUXA 4CCDA 2CITA 1FWGC 1KFWA 4A21A 1AW5A 3W7LA 1W1PA 1UHVA 1F7BA 1X1NA 3KHDA 1R3RA 2OO6A 4K38A 2WSPA 1UMYA 4FS9A 1NFBA 5TAOA 1WDSA 3W7IA 1XLAA 4GVFA 4O50A 1KFJA 3NWRA 2P0IA 3G0UA 2WPGA 1IE7C 1LUCB 4NU7A 8XIMA 1GOKA 5AC6A 4LUYA 1KM2A 1BHGA 3I3DA 4H9YA 5FJRA 4R3UA 3CGTA 1N8FA 4RNFA 1OYAA 3WH9A 3Q94A 2XM2A 4XBJA 2E6DA 2YFOA 3ZSSA 4IICA 4AZ7A 1E72M 1ADOA 1XD0A 3DG7A 3B05A 3N12A 4FOJA 2AL1A 1G69A 4UFMA 4JQ2A 1EBGA 2POZA 3I6RA 3IGHX 2ISSA 1KW1A 2DIEA 5ECUA 1EX5A 4DEFA 4O19A 5DF0A 1XBZA 4XX6A 3W22A 3AU6A 1UH4A 5AVNA 3WLMA 7PTDA 2DT0A 4HNLA 4IJCA 1GORA 4LY4A 4LTSA 2ZZ3A 1N8WA 1B3OA 1ZJAA 1KQZA 1UBPC 1RH9A 4LB4A 3TTOA 2Y7GA 3MP4A 1L2QA 1OFAA 1SZGA 2OB3A 3DHPA 3USZA 3GNNA 3RITA 4ZL1A 4UCGA 2NXIA 2WHLA 4RKAA 2GUUA 2FKPA 2VR5A 2HCVA 1R3QA 1MYRA 4UFJA 1UP3A 5GJNA 4TMCA 3FW6A 1IZJA 3IRSA 4WY0F 3W7HA 2DVUA 4UNKA 1HKWA 2F7FA 8XIAA 3KDOA 3M7SA 1W91A 1E9YB 4JBRA 3QR3A 1IR1A 1WBHA 2JK2A 3CUXA 4HNUA 4YYCA 1XIHA 1V4YA 1FQ0A 3OHMB 3JS3A 5D05A 2GVLA 2YB4A 4YTSA 2HXTA 1DKWA 3NL2A 1KNWA 3OEXA 3NQBA 2BOGX 3W7NA 3R0DA 3WDRA 3W0KA 3R2GA 4XZHA 1US3A 2B4GA 3BJSA 2G4FA 4E4UA 4XKMA 4JL1A 1DJYA 2ZWYA 4NX0A 1X39A 3DBPA 1XLLA 4K36A 3PP7A 3B8TA 4LAKA 3W1MA 3CV1A 4MWAC 1OY0A 1AQFA 2BMBA 2F6XA 4R7OA 2PP1A 3OIHA 3L5LA 1TV4A 3PG8A 4S23A 3L0KA 3CYJA 5IDZA 4QS5A 4NZCA 2ZUWA 3T7VA 3UFYA 1TPH1 4UTHA 4OV4A 3ZWSA 1UWQA 1TFVA 1O1HA 4DJDA 2XZ9A 4W7VA 2E5DA 5CSSA 3SDOA 4PTXA 5E6ZA 1XLHA 7REQA 1UYQA 1OCJA 3W00A 1VLIA 5EMLA 1ITQA 1P1XA 1UR9A 4DWSD 1KFLA 3GW3A 1V6YA 4AZCA 5A8GA 2HBXA 4JZ5A 4M6UA 4MGGA 4US6A 3C0QA 1E0UA 2XN2A 1L6YA 1UZ4A 3ABXA 3EKZA 3UCDA 3TAKA 3GHSA 3GTHA 3SURA 4P8VA 3UG5A 5XIAA 1G1YA 3LYEA 2AMXA 2EF9A 2OZ3A 2YX0A 1BSIA 3SRKA 1HVXA 3OJGA 4LXFA 5IFPA 2CWNA 3EYPA 1X8FA 2O0TA 5K2ZA 1KTBA 2R1PA 4KQNA 3VKBA 2E0PA 2PWVA 1GVSA 2DZAA 3GVRA 3WF4A 4QEEA 3VMPA 3PHAA 5K9XA 4MZ1A 4KWVA 4UTIA 2VZOA 3RUBL 1AL8A 4HMEA 3UJRA 4ZSTA 4MNJA 1KFBA 3FCPA 4W87A 4XKYA 3LHWA 4P8WA 4F4RA 1C93A 4ZGYA 1JCNA 2XIMA 3SSJA 1XUZA 2DZPA 3S3GA 4C6FA 1A4MA 1NAL1 4LAUA 3WMCA 1GHSA 3EGJA 1CGTA 1JPKA 4C6QA 3S1VA 3QMRA 4AQLA 2OEKA 3EDEA 1L0PA 1QJWA 3O07A 2ZXQA 4RDVA 4PCPA 4QCFA 1FCVA 3S42A 1IZCA 3CHFA 2ZXAA 5TQLA 2D1ZA 3GVGA 3UJ2A 4DNMA 1SFLA 1XJBA 4A3RA 3MSYA 1YMYA 3BGGA 2VGBA 1DWIM 4H7VA 3ZLGA 4C6JA 4DLMA 3BK0A 5D03A 2OGJA 4GI6A 1LL7A 2J62A 3OBKA 2WJEA 2GL5A 4ZVJA 4E2OA 4PMOA 2SFPA 3H2EA 6A3HA 3GD6A 4XZLX 3VNYA 3OZMA 3DYMA 5CSUA 3U0HA 3TYBA 1JVNA 1Q13A 3T0DA 5A69A 2G8ZA 4FOKA 4J4KA 1S5VA 3VGHA 3UWWA 3NQ6A 3DC0A 4OBRA 4FNPA 3DAQA 3L4YA 3F4WA 1E4IA 2XIBA 3FIGA 6PTDA 4CKQA 3QYSA 2EKGA 3TOPA 3W7EA 2I9EA 2YCKX 3N2MA 4FX7A 4QLLA 2P8BA 3L0GA 3AS2A 2OKOA 1E1CB 4O1EA 1FWDC 4X0VA 1KCZA 1DE6A 4GA8A 4W7UA 2RJGA 3AJ7A 3BLEA 1WKYA 4DAIA 2JIEA 4WXZA 3VIOA 2RUSA 4I9JA 1FHUA 2NZLA 1OZQA 3NO1A 3TN3A 3LENA 1TPDA 1NIUA 5F4WA 3W7QA 3CQHA 3GC5A 3OA5A 5HWMA 3NPUA 3QXBA 3T09A 3LTPA 1AFSA 3SGZA 3ONCA 3MU7A 3TQKA 1XYCA 3B0PA 2QMJA 3P8IA 3G8RA 2NLIA 4RNJA 5LKYA 1TB3A 4FALA 4QNEA 5IOBA 4BEUA 4FNSA 4MYAA 3SUWA 5G1TA 2C18A 3R89A 3GIPA 4QJ5B 1MUWA 1XCWA 3UYCA 4E5TA 2QULA 4XO7A 3TYUA 4MNLA 5CPNA 3T2PA 2VDHA 3W1AA 1BYAA 4U5KA 1CXKA 2WBGA 3L4VA 3ZWTA 4K39A 1TPVA 2GGEA 4UQDA 3H53A 1NFPA 2FZ9A 2BOFX 1NWRA 5DX7A 4C5YA 2YBTA 3A13A 5HMFA 1O5XA 1Z42A 4DJDC 3M0JA 2WHMA 1UW9A 3G1XA 3QKZA 1KBJA 4JTSA 1RQBA 5AOUA 4IHCA 2GOUA 3VFCA 4WOZA 3L4WA 3W26A 2IXVA 1AZ2A 4PH6A 4RJEA 4IMEA 2XINA 3K4AA 5HPCA 2FVKA 3PY2A 2YXOA 2A3LA 4GVHA 2CETA 1MZRA 4FHAA 2Z1XA 1DWAM 1GYNA 4ZMGA 5A6AA 1ZL1A 3O8AA 3KL5A 2VM8A 3ZJ7A 3IJIA 1P1MA 3GBDA 1EOMA 2J13A 3M44A 1J0JA 1EO5A 3AUJA 2XH4A 2DSWA 3BLFA 4JN8A 4XD5A 1AD1A 3TQVA 4CD6A 3GTIA 3ZJ8A 3UU0A 3DCPA 4OZOA 3CLMA 2OWCA 3WX7A 3A21A 1JCMP 1P6CA 2UWFA 3OGVA 1S39A 1PTGA 2QAFA 3K1DA 1XSIA 5FEWA 3A22A 3KCLA 1LCOA 5C9XA 3M0IA 2YA0A 2G96A 2ABAA 1JL8A 5G1YA 3UXDA 3WQFA 4G7EB 1EGMA 2J9XA 3XISA 3A3XA 4HHMA 3T55A 2J78A 7TIMA 4LGXA 4WJ8A 2RJHA 5CLTA 1VB9A 1JULA 3G0XA 2UBPC 3J7HA 5CSRA 3S47A 3PB0A 3TQ0A 1L6WA 2ZDRA 4LU0A 3CH9A 1X7IA 3UWVA 3G1RA 4WLCA 2ZTJA 2DZBA 4PB5A 3NEVA 3WK1A 3PTKA 3B8UA 6TAAA 3C0JA 4KRZA 1OX4A 1TELA 4AD2A 1PX8A 3ALFA 3C2FA 2DQXA 3AIUA 4W8LA 2EXOA 1XLBA 4KEZA 3RIKA 2YDAA 4O57A 2GGHA 1ODUA 4AY7A 1UB3A 4I9AA 4G2DA 1U1HA 1XUUA 1TCDA 3TMLA 4IIFA 3BW3A 1KFEA 4J2MA 4JTLA 4YN5A 3SN4A 3GK0A 4L4PA 4ACZB 2WKGA 3EZ4A 1E9ZB 2VZSA 3DFQA 5EU9A 3QJAA 3O0KA 4GKTA 3LCWA 1RALA 1OT1A 3AMCA 3F2DA 4D1JA 1U30A 1H61A 3PZIA 3LHZA 2EQDA 4G8TA 3GU9A 1YLVA 4WDWA 4MB3A 1ZP4A 4NP7A 4A22A 1EPXA 3OHIA 3WKZA 2Y8KA 1E3XA 1I0BA 4DJED 4BQ5A 4WJEA 3RLVA 3VD7A 4L9YA 4F0KA 5IM51 2Q3OA 4EPEC 3KS6A 5J5DA 3W74A 1M5WA 3PSVA 1NQ6A 2Z1WA 4PODA 1OG6A 5MKGB 1JDDA 1GJUA 2VFHA 2V5BA 4Z08A 3L65A 1V7AA 3DZ1A 1W6TA 3LRKA 1JI1A 1CBGA 5C71A 1A50A 4M7TA 3JU2A 2DQWA 2I17A 1KRCC 2FIQA 2CBUA 3G0SA 4ZQMA 1JCYA 2Q09A 3GX9A 2C1GA 4QDMA 4Q8VA 2PF8A 3AHXA 3TROA 4HK7A 4ADSA 4HPHA 3SAZA 2PZ0A 1GOOA 3HTWA 2FQIA 4C1LA 1TPFA 1LQ2A 3SI9A 5IFTA 4Z2HA 4L4MA 2QCNA 3VO0A 4XSLA 3H70A 4WRHA 3ITLA 9CGTA 3QH2A 4GYJA 3VKKA 3HPZA 1WXYA 4GG9A 3WBXA 2OT0A 4EE9A 2GJNA 4GC3A 2VYOA 3SCWA 3ITVA 1R8LA 5DRIA 4FPSA 3VFLA 3R43A 3TWAA 3VTRA 3THQA 4JTHA 3WNLA 2QEZA 2RGLA 1TZ9A 7CGTA 4MAZA 1Y0EA 3HN3A 5M17A 4PA8A 1EF2A 4FAMA 4REQB 4E8DA 2FZNA 5JBDA 3UPWA 1Q6FA 4JYEA 3WLOA 3CL7A 3GFYA 1R7OA 3GHUA 2HBVA 4XD3A 1I0DA 2ISDA 2DT3A 2ZC1A 3N2BA 1T5AA 1FP8A 1EEPA 2YBUA 1I2RA 1KCLA 1OADA 2FB2A 2OYMA 3CWNA 2RDXA 4B92A 1PZ3A 1SZNA 3ZM8A 1QCWA 2Y5EA 2X0HA 4A35A 1EJRC 3TN6A 4EXQA 4QE4A 2A6NA 2FHCA 2WMFA 1CB2A 4L65A 2C15A 2PLCA 4LOCA 3H2FA 5IHRA 2CFFA 3IPWA 1C7TA 1FWNA 3GU1A 3W7KA 3W23A 1XXXA 5TIMA 5BYWA 4DZ5A 1AUSL 3KXQA 3E0VA 3OP2A 2E8ZA 3QPZA 3V36A 1KLZA 2PAJA 5LIWX 3TU9A 3H2MA 2TMDA 3SQMA 4RV3A 1JUEA 2ZE0A 3VA8A 1J0ZA 1BD0A 3N9SA 2E6YA 1XLIA 3A9IA 4BQ2A 3OU8A 1PDZA 3CHVA 2ZRWA 4OIFA 3C2RA 3NZRA 1QI2A 5JXQA 1WAWA 3ME3A 5HNUA 1RCQA 1Z8AA 3W1RA 2V3FA 1PHWA 4TR9A 2WK2A 4W5ZA 2HPIA 1W8SA 4XTIA 1DWFM 4LVBA 5AHNA 5F2MA 3GO2A 4CCZA 3RYSA 2R1LA 2PDJA 4AZ6A 3OLEA 3PZ9A 2V5CA 4M29A 3G22A 3E38A 1E0VA 4CEUC 5FL1A 5I2UA 4FNUA 3SR7A 2ISFA 3KBSA 1KGXA 4GQBA 3UWQA 4S3CA 3ECQA 3KDNA 1Q5MA 1KCXA 1KO0A 8TIMA 5TD4A 2Z27A 3V0SA 1GG1A 3B9EA 3N14A 3H4XA 3W7PA 3FYPA 2VX7A 3JZUA 4QLKA 3SY1A 2QIIA 2OEJA 1NARA 1YXYA 5LNWA 4I9TA 2VRJA 3W6LA 1UBSA 5HR6A 2NQHA 3AXHA 2F9RA 2V38A 2IPJA 4MUZA 5AHFA 4DO4A 5EFFA 3CUHA 1XHGA 3S5ZA 5F7UA 1BYBA 3WLJA 1M03A 3BAIA 1TV5A 1R2SA 3KP0A 4QR6A 1GVFA 1JCXA 1H7XA 4M6PA 1X1OA 3LOTA 2EBNA 1FUYA 1JIBA 4KIEA 3IV8A 4IGMA 4C7GA 1KKOA 1R3SA 2E09A 4QDPA 1OQFA 2J7FA 4UZSA 4JX6A 3W76A 3N3TA 3TOYA 4A6GA 3VDBA 2FDMA 5I00A 4QTGA 1NOFA 3VDCA 2PDGA 3UESA 4EOUA 1TUFA 3GW0A 1KM6A 2ZZ5A 4QISA 4F0SA 3RDKA 3FJNA 1NWUA 2F2HA 3WO8A 1V0NA 4V1YA 4KWUA 4D6GA 1DP0A 4Q7BA 1A5CA 2V3GA 4W5UA 1TTIA 3OB8A 4C5ZA 2WMIB 4PE8A 1Z7AA 3N34A 4F0RA 3T4WA 1IT7A 3NFUA 2Y4SA 4PMQA 1RP9A 5DANA 2DW6A 1E9LA 2X30A 5AECA 1PHQA 4IX0A 4Q4SA 6REQA 4C60A 4MWAB 2OQHA 3SCTA 1EB3A 1GVOA 3NL5A 5CPLA 1R38A 2GQ9A 2CPUA 4V28A 3VDGA 2J7HA 1PIFA 3MKKA 1FWBC 4GYKA 1XGZA 1KKRA 1BKHA 5ENLA 4ALDA 3E5BA 1FH7A 3VDHA 4FF5A 3FKKA 5FJOA 5C2CA 5AKQA 5HMSA 4K8GA 3WL1A 1A53A 4WY0B 1A80A 2XSBA 1Q4NX 2F84A 1HNYA 5IDIA 4B5UA 4MB4A 3KBJA 4AXKA 1F74A 1XD1A 2OLAA 4L1XA 1XYLA 1RD6A 3P3BA 3LTSA 3GDRA 2W91A 3SCNA 1H7WA 2P3ZA 5JQ9A 2B7NA 5BW6A 2PDPA 1CT5A 1XCFA 2V69A 3CS2A 5I23A 1EZWA 3GRIA 2FZDA 1DHKA 3D3AA 4M56A 4GOAA 3S5OA 3GH4A 1EC8A 2VX5A 2NV1A 3PK7A 4C65A 5G2IA 3KTSA 3S5SA 2XUCA 1R9ZA 1BQGA 3RX3A 3TC7A 3KOXA 5CBIA 4JEJA 3MV01 1TWDA 3CH0A 4AWUA 4N4QA 2QDHA 1TV3A 1BXCA 3RMJA 2Y62A 1SYTA 3HMCA 3S5YA 3PBGA 1YPFA 2WSQA 1WNOA 1UPPA 3W02A 4WUIA 4JHMA 3GNXA 2GVGA 3W4RA 3FHAA 3G8EA 4IMDA 5CCZA 4R34A 3EBVA 5LNVA 4FXFA 4JIPA 5MHBA 3Q58A 1QHOA 1Q7ZA 2WCGA 3RM9A 3ZT7A 3QHOA 2OWXA 1UZ1A 4US5D 4WSHA 1W1VA 3CV6A 4Y8FA 4A3QA 4WKFA 3E0LA 4YNGA 4MYXA 1C8YA 2WSRA 3PANA 1Z48A 1DL3A 1FDZA 2OZ8A 2OO0A 5CC7A 3D6NA 4ZXLA 2C91A 5GJPA 1GT8A 5BCAA 3R6IA 3WF0A 2PE4A 2VFFA 3W2NA 4YHGA 1T40A 2RAGA 1EJSC 3LRLA 1B30A 1W3NA 3SCVA 1FWFC 4OTKA 3RNDA 4C6PA 1JQXA 1EDQA 3COTA 3I7QA 2WNWA 1IXQA 4FR6A 2P0OA 4NNBA 3KBWA 3GXIA 1MDRA 3UT0A 4C6OA 2H8ZA 3ZLHA 2EG8A 2IW0A 3QVQA 3QQ0A 3GKAA 4IPLA 4DQWA 4DBDA 3ABSA 1B90A 3KVKA 1VJZA 3AS1A 5BU9A 4QNWA 4AEFA 4Z2LA 3I65A 2YCIX 1W9BM 5AHEA 1W3JA 4QP0A 4OECA 1UKQA 4DYEA 3WH7A 2GJPA 1DIDA 4GJJA 3UR2A 1GUVA 3GSMA 4LYKA 4KRUA 1BEUA 5GPRA 3EDDA 4AX6A 1N8IA 1KWKA 3LBCA 3RGTA 3VOGA 2TODA 1TTPA 4C6KA 4IF2A 3WDJA 1MFVA 1I60A 1TPB1 4XUGA 4PCNA 1G4TA 4EWND 5LGZA 1MNSA 3AIVA 2WCSA 3IUIA 5CZTA 4YTRA 1TQXA 5HAOA 4DZIA 3TXZA 5LXEA 4E0CA 1DIEA 1K70A 1FHVA 1W9PA 2JKAA 4FZIA 3LEPA 3H54A 3G1YA 4TIMA 2YKKA 5AYXA 4C7FA 6TIMA 1Q66A 3QMSA 7REQB 2BDQA 1J11A 1G7VA 4S3DA 4UR7A 3THCA 2V2HA 4AZCB 2HDJA 5D33A 1GZGA 3PZMA 2RKXA 1R5YA 4AZHA 2E5CA 5K9DA 4CVWA 4YVPA 4W8BA 1UKPA 1W54A 4UTJA 4E2BA 4DPPA 3WLQA 4HPNA 1QNQA 3B04A 1FWEC 4KWOA 3IGXA 2PDQA 2Y85A 4L61A 3GXNA 4C91A 4OUEA 2R1NA 1W8GA 4GGHA 3VGBA 4O53A 3OZPA 1V3LA 2JALA 3L7RA 3AHZA 2Y5JA 1OCQA 4S1FA 4AWEA 3VUPA 2D2GA 3W81A 1NDWA 2Y24A 4BI5A 3SGUA 1LBFA 2FB3A 4D2JA 2CKSA 4OQVA 3VIJA 4GX9A 3C8NA 4GZIA 3PPHA 5BRQA 2QCCA 3BE7A 4PB4A 2ZRXA 3CEUA 3A4AA 2BSLA 1HF6A 2E40A 1NWTA 4PUWA 4IL0A 5FD0A 1KM3A 5BXPA 1V3JA 1WX0A 2CBJA 4A4AA 5A8QA 5D2YA 5LNRA 3NXFA 3P0XA 4TOQA 1EQPA 4GYFA 4GY1A 4POCA 2QMKA 3ZIZA 2GK1A 3SSZA 3ZR4A 2JF7A 4I5XA 3NVTA 3ARTA 3LGEA 1E6SM 4MJZA 4K6AA 4HNTA 3GAYA 3M5YA 4W84A 2QDEA 4F0MA 2YL9A 5G2WA 2G3MA 2WC4A 2DH2A 2V6AA 2I7GA 1TX2A 2PC4A 4S3JA 4LFYA 3EWDA 4ZR8A 2BXZA 1RVKA 1ISXA 4OT7A 3TSMA 2C0HA 3M41A 1HO1A 3R8GA 2YIHA 1FTXA 1FRBA 4H00A 3SCUA 4C1NA 3UCQA 2JEQA 3SCPA 3SEPA 2FMNA 1NF0A 2Y0FA 3HGSA 4AC1X 2P76A 4QDWA 5C55A 3CNYA 1S1PA 3PR2A 1UG6A 1ICQA 4DLFA 1OFEA 1SO4A 1WDRA 4GCAA 1LDCA 4IXHA 1TMQA 4PCTA 3GU2A 2OLSA 3MYPA 1P48A 4AY8A 1W3TA 2RH9A 2J7DA 4P7RA 5FESA 1WXJA 1Q6GA 1MEIA 4UXDA 1I1XA 3NQGA 2ZRZA 1YTEA 2O4QA 1YDVA 4Y9OA 3SO7A 1X6LA 1E1EA 1TTJA 4C6NA 2RFGA 4HPGA 3VD9A 1R6WA 5D04C 2E5BA 1HVQA 4QSFA 4JQAA 4NRSA 1DXIA 2BG5A 2Z2UA 4UR9A 1IZKA 7A3HA 2BOEX 2PRLA 4JHOA 1O5RA 2FPTA 4DBWA 3RPTA 2NXHA 1US2A 3POCA 4YJ5A 1ZGDA 2UY5A 4B3LA 1VHCA 3QYQA 4JTCA 1WE5A 2GJRA 3DC8A 2A3BA 1V51A 4D8ZA 4LBSA 1JXJA 1CGXA 1KBKA 3A12A 3UY7A 1XX1A 1LYXA 2DW7A 5I03A 3W2UA 2I16A 5HDRA 3RMEA 1E4NA 2NQJA 2R24A 3WF1A 1EIBA 3U57A 3PUEA 4BEQA 1TWSA 1AMKA 3TLQA 3VCRA 3ELFA 3L4XA 2AL2A 2XVPA 4WOQA 4Z42C 2WNNA 4MM1A 2X1SA 3LCHA 3NZGA 1MEWA 3HOJA 5HOSA 4IQJA 4HYRA 3KBMA 3M0VA 5E0CA 5BNKA 5IHSA 1EWEA 3PZVA 3PJWA 4GO9A 4L6HA 1J2WA 2WMGA 5DELA 4TXEA 3ARWA 2NSOA 5I3HA 1DJGA 3BSGA 1UZHA 2C16A 3WLTA 2Y7DA 3PVFA 4J3WA 4MB1A 2IUZA 2XGIA 3QV9A 4R88A 1H7OA 2QW5A 4NIRA 2R1MA 3TTEA 4RE3A 5E70A 1NTHA 4F40A 4NYYA 3GLCA 3ZJ6A 3EMCA 2A3EA 5C6MA 3ZJKA 5AC7A 3M6YA 4AWTA 4XG1A 1V02E 1X6NA 1KV8A 1IIHA 2Z28A 3I4KA 3TYAA 3G1AA 4M80A 2FVLA 1OFPA 3AIQA 2ZTKA 3N2TA 1T96A 3UWUA 2E8YA 2GGGA 4FLQA 4BKNA 4HSNA 2JKEA 2WZHA 1TJ0A 4MG4A 5CZKA 1EQCA 1QW8A 1LT7A 4PBFA 1TWZA 5H8PA 2WLZA 1GKPA 3WDHA 3QGKC 4HK6A 5D02A 1OX4B 2PCEA 1UH2A 3CK5A 4GX8A 2CEQA 2G3NA 1H4PA 2OXNA 1PX4A 3EWZA 5G1MA 2PP0A 1FH9A 4FLRA 3U7BA 3W1XA 3SUVA 2QUVA 2QUTA 1PKNA 3GC2A 2BB0A 1MNZA 1QOQA 3OBEA 2YL5A 2C1HA 1GJWA 3ATZA 2JQXA 4EP8C 3T08A 1GZ1A 4G5DA 2E28A 3DFTA 4QRNA 5HXMA 3LTYA 1FXQA 3LY0A 3IJ8A 1BVWA 1E43A 1GVQA 2R1KA 2VR4A 4I9MA 4K7VA 1E0WA 3B9OA 1KGUA 2REQA 3W7RA 5CC6A 3LA4A 4NNAA 4TV6A 3BLDA 5BOEA 4HN4A 4H8NA 5KZMA 3WLIA 3HJZA 1ODZA 1J12A 5M1TA 3NTYA 3WLRA 4A29A 1FCUA 5BXRA 4WDUA 1U5JA 3B8IA 4GQRA 1IR2A 1TWWA 4KW2A 1DJIA 3CAKA 4JFTA 3LHVA 2QCGA 3MDUA 1OFRA 1O12A 1RJRA 2PGWA 3C8FA 4UTUA 1H63A 4AXNA 3GG1A 1EA9C 5FSDC 5AHMA 3WLHA 2NQLA 5HNTA 1W5PA 5XIMA 5BRPA 2XFYA 1DJHA 2J6XA 3MWAA 5G4WA 2I57A 1TZZA 4LH8A 4YLWA 5CC3A 1AH4A 5CG7A 4JHZA 3B0VC 5B7YA 4JTEA 1XISA 2O4MA 1KWGA 4RNHA 3O6YX 3TR2A 2PDLA 2G41A 3HA1A 1VLWA 5CAKA 1E6ZA 5HUOA 1BGAA 4RLIA 2Z1KA 1J18A 3F1QA 4JEQA 1A5NC 4DY1A 3RX4A 1EUNA 2XFFA 2YLLA 3HM7A 3QV6A 4QG6A 2NUYA 4EVZA 1FCQA 3RU8X 3GQYA 1R86A 2E9LA 4KFNA 4CCCA 2CKRA 2ASHA 3MUZ1 1OIMA 2YB1A 2Z6JA 1EH9A 4D8AA 1T8XA 2XSAA 2ZICA 4H6EA 4ZO6A 3W73A 3MA8A 4XBSA 2CBVA 3MP5A 4FA3A 1YDYA 2QV5A 3QZ6A 3M64A 4DB7A 2PWEA 2WB5A 3D0CA 3KAOA 2Y2WA 3WLSA 2YFNA 4ZODA 3VGGA 3AMDA 3L23A 2BHYA 1CLVA 5BROA 3P5YA 4FF7A 3M7WA 5A2AA 1UJQA 1TVLA 3UA4A 3WF3A 5D2TA 1A5MC 4HT3A 1QPOA 3IARA 2BHUA 1SJBA 1F73A 1PYFA 3QOMA 4RDWA 3P5ZA 1DQUA 3QEZA 2Y88A 2ZUTA 4GC4A 4YL2A 1IT8A 4GZJA 4DYJA 3RLGA 1ICSA 2OVLA 4GABA 1P0DA 3E0IA 1XS2A 2AKMA 3GTNA 2CESA 4AIUA 1KR0A 3TJXA 2BGSA 3T44A 5A8OA 5LIUX 1TWIA 4CQDA 1LG2A 4IFKA 3UZWA 3UA3A 2FZBA 2ZVIA 1Q85A 4F8XA 3QR1A 4HPXA 3W2KA 2PDCA 1C7SA 1QO2A 2HMCA 3USBA 4GLEA 4O8RA 3NPXA 3VKDA 4WD0A 4XBKA 4PB3A 1V93A 2C3ZA 1XLMA 5AN7A 4DO6A 2KZHA 1M7OA 1WOBA 3EB2A 1VHNA 2Y7EA 3N9RA 3IJQA 3A24A 1WOAA 1EJ7L 1S5NA 1I2QA 1K03A 1TIWA 4LRSA 1Q8JA 4DO7A 3M0YA 4RPQA 1KRAC 2DZTA 1UWRA 1WQ5A 5BOOA 3PBUA 3GFZA 3M46A 2VURA 4GACA 3CAVA 5DY3A 1ITUA 1P43A 1TV2A 3E1F1 1OX5A 4NI3A 3QZEA 3EAUA 3U3HA 1RUSA 1CXHA 4Z1BA 2NV9A 4CN4A 4U4MA 2DSZA 3QFEA 3VGFA 3LXAA 4J3UA 4XZNX 4XAPA 1K8XA 1ENUA 2XTKA 4DWSA 2X41A 3P62A 3GHRA 4LANA 1QW7A 9XIAA 4S38A 1X7FA 3LCLA 3IJDA 1PB0A 3MI2A 5GVJA 1WKFA 5LHEA 3ES8A 3WFZA 1MRAA 1BSLA 2DZUA 3PAOA 1V02A 1TSIA 3G3MA 3WY1A 1R9YA 1W1B1 2IKHA 3HGOA 3BV7A 3BVJA 4OU1A 4PMYA 1PAMA 3D46A 1VJIA 2G3FA 4JTTA 2VFEA 4IPJA 1GVEA 3UPMA 3LPPA 1O5QA 2PUZA 3GIYA 3B8VA 1K3UA 1XPGA 3UZXA 1Z9AA 3B8DA 1UIPA 2OELA 4WDXA 3EB3A 4H04A 1AL7A 4JYDA 3C0SA 4N9DA 3V18A 2HE5A 4Z17A 5IBXA 4GQGA 3R5EA 4YIWA 7ODCA 2OODA 1U1JA 1C91A 1Q6RA 5D9NA 3MVTA 3U4AA 4RK8A 2EPHA 4MFEA 1HJWA 1PSCA 4OJYA 3NQDA 3W07A 1W2PA 4HBKA 1NY1A 3HG4A 5F1VA 1JG9A 1W2VA 5I3FA 4GUFA 3H6OA 4M51A 3KL3A 3A6OA 5DO8A 2GQ8A 2V8ZA 5E9XA 3SGGA 3DFYA 4NNCA 3L2MA 3HG5A 4E3TA 3PBYA 1S5WA 1KCKA 3NUKA 1XBVA 1FWHC 1DPMA 1SR9A 1XQKA 1XYMA 4ILSA 4O18A 1BG4A 1LOLA 1VYPX 5LGXA 2VEKA 1PL9A 1CI1A 4F79A 1ZAIA 1GJPA 4CD4A 2CZDA 2TPSA 3QM3A 2BVYA 1GZJA 4ZQOA 2HROA 4LCQA 2VCAA 4AW7A 3NVDA 1VRDA 4TVCA 2CLKA 1KBBA 4WX2A 4UMAA 1FCBA 3O15A 3QTGA 2E1WA 1C8VA 5PTDA 3C2VA 4JTJA 1JYXA 4DUOA 1BWVA 1V3KA 5FAGA 3T42A 3V5FA 4B3KA 4LEFA 2PTYA 1VBJA 3N6QA 1K4HA 3UYIA 1EHAA 4O15A 1X6UA 4PMUA 3ITYA 4L4LA 4QS6A 4FNQA 3N4EA 1MXDA 4ML9A 2OJPA 4GNVA 2HE8A 1B4KA 1XFBA 1OC7A 1SM9A 2O55A 1M6JA 3SUTA 3WUBA 1OT2A 5T91A 4IQLA 1FDYA 1V6UA 3H4GA 1THFD 3IIXA 4KS0A 1ECEA 1DWJM 2DVXA 3AYVA 1B5TA 3IRDA 4L6DA 4MDPA 2VOMA 1QO5A 1KXQA 3GTXA 4MJ2A 2BVDA 4RL3A 2D0HA 3CYVA 3IAPA 4J5NA 3NQVA 3LRMA 3U4FA 3RG6A 2W0UA 1LLWA 4PTMA 2QVNA 5GQBA 3ZVIA 3CIXA 3BLLA 5CJNA 2HK0A 2YOCA 3QN3A 3GR4A 4XO6A 4I5RA 4M6QA 1DJNA 1FWAC 2J66A 3QR0A 4F9JA 4PGLA 3T78A 4NKCA 3CUJA 2J7GA 4O1BA 4ZBCA 4AY1A 1VCFA 1F2JA 2VI0A 2OOGA 3KFTA 3PB2A 5AZ1A 4LF1A 3ABRA 1F76A 2PWHA 4K37A 4OOUA 5DMLA 2YR1A 2J8GA 1ME9A 5GNXA 1IQ8A 4JNYA 4DJDD 4GD0A 2QCHA 2CNCA 1Q6EA 1JZ5A 3EXSA 3WD3A 1SO6A 3WBAA 4LSBA 3WCZA 3EPOA 3QW3A 4O0QA 1VKFA 3WLLA 1YDNA 1L2UA 3MBDA 1H09A 1EDGA 4E2VA 1EX1A 1Q65A 4JAWA 3AJXA 3IJ7A 3TONA 2GSJA 1SZRA 2QPSA 3V75A 4BI6A 2HV5A 4J28A 1S2TA 4ZB2A 1TKKA 1UD8A 4BI7A 3CWHA 1WAUA 2GJXB 1LF1A 5AYYA 1QI5A 1BVZA 3ZVHA 1Y5WA 2FVMA 3WMBA 5D2VA 3MS8A 3KZSA 1AJ0A 1RD5A 3P93A 2X1UA 2VT0A 4LCRA 2ZDSA 5IBXC 4GIAA 7XIMA 2XJ7A 4HZMA 2GPTA 3RJYA 1PZ1A 2ZC8A 3VIKA 3AICA 1Q6LA 4LNYA 1LTDA 3E74A 4BHYA 3VE9A 2JBMA 3R8RA 3PUOA 4TMBA 1WV2A 2AAAA 1CLKA 3WEZA 3LZ3A 5I78A 1E9IA 1I2OA 3S2LA 2XVKA 1E71M 3WJZA 3W53A 3BAWA 1FP9A 3UXIA 4GIYA 3DN5A 4PTNA 4LC6A 4Y8EA 1PXGA 2YLAA 3EOLA 4N2YA 4JFVA 1S2CA 4W7WA 1O95A 3NQ8A 3SZ8A 4EPKA 5D30A 3MSDA 1H41A 2Y7FA 3WUEA 3IACA 3RCMA 2A3CA 3F7JA 1WXZA 3TW9A 3TYEA 4ZXOA 4MJMA 4Q7NA 4HMNA 5HWJA 3TW7A 5M03A 2POTA 2GSHA 1OC5A 3QHMA 1UR4A 2E68A 3LUTA 3TDFA 4PSRA 3CTLA 5D37A 3ZZ1A 3MSGA 3WLPA 5FF7A 1XCXA 3V5CA 4Q8UA 1FFQA 4ZQNA 4GPNA 2QHAA 5M2FX 4D6EA 1MW2A 4UTTC 4LVGA 2BY1A 3YPIA 4AZ5A 3R0KA 1XIFA 1VQTA 4RZBA 1OFBA 5LNSA 2GJLA 3CV7A 2Q8XA 3VZYA 2OFJA 1XYZA 2BNJA 3UF9A 1HJXA 9RUBA 1RBAA 3N29A 4JIHA 3N17A 2AQWA 4HYWA 4GJIA 2HS8A 1RBOB 3UZYA 1KRBC 3O1NA 1VFFA 4I7VA 3BJTA 5BWAA 3LLDA 1REQB 2V63A 3PS7A 1S2UA 2DY3A 1U5VA 1B31A 3ZT6A 3OLDA 1TV8A 3U9IA 1V3MA 2J8FA 1WDQA 1NP2A 4UZUA 3ARUA 4RZ5A 1F61A 4W9TA 1LRTA 3W1NA 5JUVA 4BZYA 1YADA 2ISVA 4H2CA 4Y9AA 1JZ6A 1GYMA 2E6FA 1RK5A 4WSKA 1Y8BA 5DMYA 3ORWA 3XIMA 4IG2A 3BLIA 2I5QA 3LGDA 5G4HC 4O16A 5JH1A 2DZVA 1UASA 2GK1B 1HO4A 2Z1VA 1G01A 4LAZA 1BYDA 1RSCA 3ZT5A 1E55A 3EDJA 4AAJA 2QVHA 3NURA 3ES7A 1TA3A 1DWGM 3GE7A 3BW2A 4F2TA 4ATLA 4GHRA 3CLWA 3U2CA 1HIZA 3AIWA 1ZBWA 2B81A 4Z0JA 4AYSA 4H9UA 3WQ6A 3SRFA 2WNQA 4CNTA 4C1NB 4DM2A 5EMMA 2PF0A 2GWGA 4IM4A 1K9FA 3JR2A 1RHCA 4HCDA 1VFUA 3BMWA 4I3GA 2VFIA 3S2CA 2BWGA 2BODX 4F0LA 4G1KA 1JGIA 3VOFA 5D9PA 4JYFA 1SJDA 3S1XA 4LAMA 3MTWA 3C2YA 2VXNA 3PULA 5C7VA 4J3SA 5EMJA 2TSYA 2X1TA 4MPQA 3DOPA 2VWSA 1Q3NA 2IQ0A 2FH6A 2PDFA 2O7QA 3KBVA 3TC6A 4CNUA 1FH8A 4L7ZA 3C6CA 1EHNA 5H1WA 3TYDA 4TVUA 5CPSA 3IGUA 1CECA 1BVNP 1YQ2A 3T0TA 2HWGA 1UROA 1RZMA 4HZ8A 1MW1A 4IIDA 1ZQ5A 2PDUA 4ZTYA 1WUFA 2ZCGA 3PPGA 1AZ1A 3S1UA 3VKJA 2X7WA 1KRMA 2R94A 3SY5A 1Q45A 1W1A1 4RDYA 3CL6A 3L2LA 3FOKA 2Z00A 2QUNA 4YCPA 4YS1A 1PYMA 2QCDA 2GQAA 4FIQA 1XDMA 4KCUA 4MSSA 1G6CA 4PYSA 3H2AA 3VCCA 1H2JA 4Q8OA 3LDVA 2UY3A 1F6YA 1YKWA 3QV7A 3KS5A 3IIOA 1ZS2A 2ALDA 2OQYA 3LLFA 1E15A 2UY4A 4QXIA 3UZZA 1S3HA 1D8CA 3W7OA 1DOSA 4HPJA 5MF5A 3AYSA 1XKJA 1E3ZA 1UMLA 4OE7A 3CMGA 3CQ0A 5HJYA 1FA2A 4WCJA 2OX4A 1VBUA 2J9YA 1LL4A 1KGWA 1YDOA 2Z7GA 1YNQA 4O28A 1XC6A 1D8WA 3MUIA 2WO5A 1E5NA 2ZA2A 2XU2A 3AAMA 2A85A 1Y5XA 4X9SA 1DV7A 3T0AA 1ZALA 1PV8A 3NQCA 4DF2A 4TV5A 4BJHA 3URQA 3NQFA 2X1IA 4GH3A 3MKCA 3AFBA 3N13A 3DFPA 1NDVA 3Q2DA 5HWNA 1L8NA 3LNPA 2VEFA 2VTFA 1YRRA 2VFGA 1HW6A 3PNZA 3CTTA 2ZYFA 1XV8A 3AQUA 3APGA 2XISA 4NRRA 1HN1A 2OQLA 2YXGA 1Z44A 2X2YA 2WKLA 2IQDA 1H7RA 2H90A 1PIGA 3LB0A 3ABOA 1IHIA 1DTUA 3FVMA 4C6EA 5C7HA 1CGUA 4HA3A 1TVPA 3PM6A 4PUKA 4NT0A 4GCXA 4WXYA 3NL6A 3B97A 4UTFA 3VNDA 4ICNA 4XZIA 3V35A 3VGEA 3WNKA 3OTRA 3TN5A 1A0EA 1H0IA 1FWWA 4RPPA 1LQAA 5F4XA 3RX2A 3BL3A 4ERGA 1MEHA 4J7RA 3OZOA 1E51A 2KX9A 4RZ4A 4UFLA 3OZYA 1ZRQA 3GZ3A 3K5XA 1A0CA 4EAYA 3M0HA 1XKYA 2FGBA 3BG9A 2D3LA 1UUMA 4UOQA 1YNPA 3AYRA 1W37A 4DELA 4I6KA 4QE5A 1OFDA 1DORA 1PTAA 3W01A 5FI8A 3GM8A 3D5HA 1CWYA 1XBXA 3BLPX 5B80A 1YW1A 2ZX7A 2IXUA 2VKZG 3N2OA 4YVXA 2V3DA 4YTUA 1C8XA 4A3YA 4PBEA 1JPMA 3WD0A 1XWYA 3FFSA 4EAMA 4DXXA 4P8UA 4LUSA 4A8RA 5LIYX 1UR2A 1H60A 1KR1A 2H3DA 4HJWA 4H6RA 5A6JA 3LPFA 1CCWB 4P61A 5CXPA 4PMDA 1HKMA 5L6UA 1OD8A 1YBQB 2WBKA 4AD1A 2REQB 4X9YA 1OM0A 4UR8A 3PF3A 2V3EA 3GXPA 2P88A 1XDJA 1N82A 2JEPA 4GH1A 3WDIA 1UR1A 3APYA 2BY3A 1VPQA 3WF2A 2HK1A 1GHRA 3FAWA 1QVBA 1K9EA 1JYNA 2BBFA 1BWLA 4INFA 3PPFA 1W3KA 1KM1A 4DBUA 2EAWA 1RLCL 2AOSA 2J7CA 5D9MA 1EJXC 3WBWA 2A4AA 2PDWA 4Z1AA 4GY7A 1Z32X 4XIAA 5BU6A 5CZSA 4A2SA 3SM0A 2I56A 4MKNA 4NG3A 4GI8A 2ON3A 1X96A 4ZQRA 1OYCA 3GYCA 3GXTA 3IJLA 2XZ7A 3EMQA 4IMFA 3RRAA 4UMCA 1GTHA 5F1UA 1BRLB 3UR8A 4Q8TA 1WZMA 1FHDA 4WKAA 3M0ZA 1CXLA 1XGDA 4AYGA 3S5NA 4S3BA 2ZX9A 1BTCA 2XH7A 1S1RA 5EY5A 2W63A 4ZE5A 1E0TA 4JCLA 2PU0A 2FHFA 4K68A 3BTNA 4JD4A 4OV9A 3CUFA 4M8UA 2Z1BA 2Y8UA 3MCMA 3AZRA 4LW7A 3SB0A 2GLKA 2XFRA 3S1GA 4HOWA 4OWGA 4JNMA 3SJNA 4HA4A 2PP3A 2O9RA 3RR1A 3RCNA 2RHGA 1JPDX 4AVNA 3OGSA 1OWQA 2INFA 1M7XA 3MYOA 3M1ZA 2RGMA 3QSTA 2XVLA 3OQEA 3P7YA 4AVFA 2FGLA 4J3ZA 2JF6A 3P84A 3QY8A 2J6VA 1R85A 1W9XA 1GYLA 1EGZA 4UIOA 1TE1A 1EXPA 2QXWA 1GONA 3ANUA 4FXSA 1CX9A 3VILA 3BANA 4B4FA 4OFCA 3K30A 4X63A 1EJVC 3ITXA 2CCRA 4IJBA 3EKGA 2R6OA 1QNVA 5L9FA 2ZXBA 1SUXA 5K4ZA 3PZNA 4J27A 3WQOA 5BXTA 1BFNA 4U28A 2H3BA 3IVUA 3W9ZA 4UTWA 2PRHA 4CCEA 4HU4A 2WW5A 4LUJA 3UXLA 4R9XA 2DJXA 3U5YA 4NJHA 3UR5A 1UUOA 4DF1A 4HNOA 5A2BA 1HKKA 1S5MA 1PWMA 2VD9A 2I5IA 1JDCA 1UP2A 3L2IA 4C7DA 2DV0A 4EWJA 1DTNA 4JIEA 4B16A 1GG0A 1OK4A 4LX4A 3NQAA 3C61A 3DI1A 3HPAA 4WSJA 2VC7A 2QPXA 3B0YA 4HJFA 2PA6A 4KRTA 3FJLA 3N4FA 5DN1A 4L56A 1S46A 4PUNA 5GNZA 4KGLA 4H1ZA 3CHEA 2QAPA 5DCEA 3B06A 5EKYA 4Q8PA 3VGDA 1KXVA 1B3ZA 4H2HA 2ZVRA 4A2RA 3EX4A 1ZBKA 2QCFA 3D3FA 3SN0A 2XYLA 3IJ6A 1IEVA 3BG3A 3T1GA 4J9JA 3EWWA 2BS9A 1ZTVA 3S46A 3VOHA 3OODA 2MNRA 4O1DA 3VI2A 2G95A 2NVAA 3MDWA 2YA2A 2EO7A 1AQMA 5JVLA 1AQ0A 2PDXA 4PUJA 2QJNA 3BGJA 5A3HA 3JUGA 3W84A 4CQAA 4KFOA 3EDFA 2Y63A 2W5FA 4AG0A 3NM3A 4GQ0A 4M81A 2VUNA 1WKEA 4S3KA 1LLZA 2D20A 3WYZA 1OB0A 3OYXA 4CNOA 2DORA 4L5ZA 1OC6A 1R3TA 2B7OA 3GY1A 3MQTA 1XL9A 1GPWA 4MPKA 1QHPA 3WLNA 3EXTA 3R12A 2CLFA 1U1UA 1JDAA 5EB8A 3RFAA 1ZFJA 4HHPA 4HU0A 1O68A 3BXWA 3ZSTA 4Q8WA 2WZEA 4DIAA 4HVXA 1BG9A 3TH6A 4QEHA 3E0FA 1DXEA 1PE1A 2R9RA 3WH8A 5KMYA 4IUGA 1YTKA 3M16A 4GQQA 4IQDA 2NUXA 4UB9A 1V03A 3V7PA 1LLOA 1S2WA 3CPUA 1J6PA 3NG3A 3BCDA 1AK5A 3VC6A 1QI4A 1SSGA 3BCJA 3WNOA 2XH2A 4D6JA 3GR7A 3LD5A 1W3IA 3N11A 4BK9A 1I6NA 3M0KA 3DKJA 3MC5A 3HPFA 3P0WA 4ZTXA 2ATSA 4XZMX 4M3PA 1SJCA 2E77A 4L1WA 1J96A 1M65A 4N9EA 3H2NA 2WWCA 3MV11 4LCSA 1GTEA 4HB7A 2YYTA 3ALGA 3WK3A 1HZYA 1WZAA 2CLPA 1KB3A 1G67A 1R7AA 1A5AA 2EPMX 2J27A 5HNNA 1SPQA 4M24A 1UOZA 4IP5A 5C9UA 1BQCA 4ZFCA 2PCQA 3NGFA 1UR8A 4KT2A 4LRTA 3URAA 3QF0A 1XR2A 3SFWA 4BF5A 1BAGA 2QJHA 5LXXA 2BGQA 1VPYA 2VGFA 4C6BA 2YBVA 3AI0A 3W82A 2WJDA 4BWLA 3VZZA 2OOFA 1T7LA 2YL8A 3H22A 2WLYA 1PZ2A 3GB6A 5E09A 2INZA 4L9XA 2GOKA 1IEQA 1ZJHA 2QJMA 1UJPA 2EPKX 5CH9A 1T41A 4GI9A 1OVDA 3T81A 1KBLA 5BZAA 3WJWA 4H19A 2V82A 1DHPA 1POKA 3ARYA 4XV0A 3KRBA 4B5XA 5E9AA 1GQLA 5H8MA 2OR2A 2V5DA 4IPIA 2GDVA 5ABFB 1FWTA 2OKTA 1IXPA 4HTBA 2ISWA 1ZENA 4GGBA 4URIA 2O7SA 1IWBA 1P4CA 1XH2A 1R9XA 2ACUA 3UXKA 1QNSA 3NAVA 4TU1A 2Q02A 1K8ZA 1L6SA 1IWAA 1UWTA 4DUWA 3U6WA 3B0XA 4IIBA 1E4MM 2W62A 3WQ8A 4MUPA 2I5GA 2FJKA 8CGTA 2WHKA 5CG0A 1PX3A 4PUUA 1XDLA 3ID7A 2Q3RA 5A94A 1RY8A 1NP0A 1SVDA 2FTYA 3LMYA 1L8PA 4J3VA 4D9PA 4R7WA 1R3WA 3N18A 1GCYA 4QROA 2Z26A 2YW3A 2IMRA 2Z0IA 1C29A 2CLHA 2A79A 3UJEA 3KCJA 3H2CA 2D0FA 1DIKA 4UBPC 1QFEA 1I4NA 1PTDA 4F48A 3EKLA 3UNDA 5B7ZA 3WH5A 1CDGA 1QNRA 4IX2A 1HKIA 4M82A 1DVJA 2TYSA 1XIEA 4C90A 3PAJA 1DQWA 3QGVA 1LP6A 2Q6ZA 2DP3A 5DFAA 2HEJA 1V6WA 4IH3A 2PDMA 5EMUA 3OVQA 5A6TC 1XFCA 4LUIA 1BPLB 1QI0A 3VNJA 3HBLA 4QQ3A 5F2LA 3SCSA 2X0SA 4UWMA 1AMYA 2VC6A 2VFDA 3G77A 3Q37A 4MWAE 1B3YA 3FA5A 1TCMA 3CUZA 3TX9A 4JIIX 3WG6A 3ATYA 2G3IA 4Z0SA 4U2YA 4QJ3B 3OOQA 2ZZ6A 1HL8A 1RR2A 5DCBA 4IMAA 1ISWA 1EGVA 4WVXA 5G5IA 4R85A 4JTRA 3ZVHB 4W89A 5GJMA 5HQLA 3K8LA 1WDWA 2VRKA 4H83A 2Q8LA 1WKDA 4H41A 3DG3A 2VGIA 4TVDA 4CU8A 3WMSA 1GVRA 1FVPA 1ICPA 1BXNA 4HN8A 2ONEA 1CB7B 3AZTA 4D71A 3KRZA 3R58A 1A3XA 3R79A 3S83A 3W83A 3MY9A 4ERAA 1XH1A 1V77A 4I8YA 4X0NA 2H6RA 3KCOA 1X1ZA 2ABBA 3PZQA 4LYQA 5HQMA 3O3RA 2H9AA 4EANA 2Y89A 2QCMA 1LRNA 3WBEA 1KD0A 1J4EA 3DFOA 1CZ1A 2H8XA 4L6OA 3F4VA 4XSMA 4YHEA 3E5PA 4E4FA 1UKTA 1H50A 1NM9A 2WZTA 4PULA 4ZO9A 2CLLA 1JDEA 1ZPTA 1QWKA 3S2MA 1QOXA 4NZ3A 4B2DA 1ZCOA 1UC4A 1M7PA 2ZX8A 4Z1CA 3CXOA 1UR0A 1AH0A 1V6XA 3JZEA 4HNVA 5D2WA 3CV2A 2P5NA 3M5XA 4QHRA 3CM4A 3SRDA 3WNNA 1M04A 1ZUAX 3BOLA 4DUVA 3V1PA 3IANA 4QIUA 1PEZA 3EWCA 4UFKA 4UMBA 3KOYA 4N0RA 2AGKA 3P60A 1QPNA 3S2NA 2NQ5A 1VIWA 3C3UA 1QW9A 3HPXA 3ITTA 2BFGA 4GE8A 1KLYA 1IIGA 4EIVA 3RK8A 1UD4A 4NASA 2L5HA 1HQTA 4TX8A 4UQBA 1G4EA 3LPOA 2QT3A 4JFUA 4QAIA 4B5NA 1HKJA 3NJ3A 4UCFA 2YA1A 2PTWA 1NWSA 4GI4A 4GNJA 4YCOA 1HT6A 3UJSA 5SWUA 4Y2WA 3ISIX 4ZFMA 3TMQA 4AUBA 2ESCA 3S0CA 2VC5A 3GNRA 3DXIA 3RLHA 1J01A 5KZEA 4FB7A 3MP3A 2WANA 1P6WA 3TZFA 4IIGA 1K7XA 3KVJA 1FKWA 3NIYA 4MF4A 1OHLA 2CHRA 3E2VA 4Z1DA 4MNKA 3VK5A 1NOUA 3MJMA 3VNKA 3R0UA 3RXZA 5CZ0A 3FN9A 1GKQA 5G4EA 2GWNA 4GNKB 4IG2B 3VZXA 1EC9A 1U33A 3MHUA 2GDQA 3AC0A 1T6MA 2QQ6A 4QGCA 3V16A 1RV8A 1VRXA 3GVQA 4F2BA 1I2NA 4GMEA 1B54A 1JPHA 4FXJA 1KTNA 1O4UA 3VIMA 2DH3A 3DERA 4S39A 4Q7IA 1TPWA 3OG3A 4A8IA 1JCTA 1PJ9A 5I5RA 2GQ3A 4DNHA 4GISA 2QGHA 3A23A 4XK2A 1NU5A 2D2OA 4NXKA 3ZS4A 3KOFA 3OLGA 1B0IA 4PMJA 4ICCX 2J24A 4IFRA 3PC0A 4U3AA 3PZOA 3BQ5A 2XDFA 5A8PA 1UC5A 1MXGA 4EK7A 2WYSA 2VDIA 1JEZA 1OFOA 5I07A 4HKPA 3HQ1A 4KFPA 2WJFA 3IJ9A 2DT1A 1GOWA 1GOXA 2V0TA 3I6EA 4KERA 1J79A 2PWUA 4QJ1A 1RLDA 1K6WA 4Q8MA 2FJUB 4JDBA 4HTYA 3HMJG 5F2IA 4J1OA 1UCWA 2NT0A 3VCNA 1XIDA 1LROA 2WVUA 2F6KA 3E6EA 1EXBA 1TJ1A 4WEVX 1UOKA 3CU2A 3L4ZA 3HB9A 2PC8A 4WIWA 5TBOA 1VPXA 3RF9A 2VHLA 1E56A 3LM7A 4GXPA 4XWUA 5E1QA 3HO8A 4R33A 1ONRA 4LY8A 1S5TA 4YTQA 2J88A 4M6VA 5I77A 1C8QA 3W25A 1WA3A 1LOQA 2QCDB 1EKOA 5ABTA 3VD3A 2ZZ7A 3TP4A 4XVEA 4GUIA 3KHJA 3VINA 3FNDA 5K7JA 3I4EA 3EWBX 4DN1A 3KL0A 1ALDA 3KLLA 1Q6DA 1YEYA 2W67A 3AS3A 5CQ1A 4CD5A 5CAHA 1XIMA 4MWAA 2FH8A 1M53A 3RRXA 3M5ZA 2TAAA 4O4WA 3PBWA 4Q33A 3OBAA 4LS1A 1B57A 1SW3A 1XPYA 2ZFAA 5HNRA 5CPQA 3AUOA 3CIWA 5A8NA 2NWSA 3VUSA 1F5ZA 5E0KA 1R2TA 2XVGA 5I0DA 1EP2A 1IEWA 3B9AA 4GZEA 4H9MA 1R46A 1OF6A 2YCLA 3H24A 4KCVA 1RA5A 3V0TA 4WY0A 2ICSA 4RE4A 6CGTA 3FAXA 1JI2A 3DH7A 3P67A 4MMWA 4GWEA 1F8IA 3DUGA 1RQHA 5HUPA 2Q8ZA 3G3DA 1RPXA 2WXDM 3LQLA 2BP1A 3LI1A 1P6BA 1DYSA 3RR4A 1CXEA 2DT2A 1X38A 1XP3A 1E6RA 2CZFA 1SW0A 1ZJBA 2E3ZA 2DPEA 3DDMA 3GDLA 2E7FA 2PTXA 5HINA 4GFSA 3S9ZA 4JTDA 2QDDA 1A47A 1A49A 1W56A 1CTNA 1HGWA 4MADA 1DEDA 3W1PA 5KZDA 3RILA 4PCFA 3DFHA 2PEVA 1EL3A 1YE6A 3CO8A 5CC5A 4V27A 1WCGA 1BGGA 2VRQA 1L6FA 1UD2A 3F2BA 2DSUA 3CZEA 3UNTA 4U5IA 4N4PA 3INPA 3RLUA 4GIRA 2E67A 3AXMA 3LCGA 1BKSA 1P7TA 3MZNA 1FKXA 2B31A 1VIZA 1MW3A 4O10A 3LSBA 1GW9A 3T0CA 3BSMA 2GZXA 2IQTA 1JYVA 2QCLA 3CC1A 2V30A 3OVRA 3WL0A 4G1NA 4U31A 3G1FA 3M0XA 4O12A 4LUSB 3ARVA 3PBVA 4F66A 4XD4A 4FP1A 4AD0A 2R91A 4XUYA 2A7RA 2CZEA 1LL6A 4MVAA 5D38A 1VBGA 2VQUA 2DSVA 4DJFA 3M0LA 1M3UA 3SQLA 2DGAA 2VDGA 3DHUA 5I09A 2AQOA 1XW8A 1ZY9A 2QLYA 4PBGA 4KBXA 1A5OC 3QC3A 1MDLA 3FGCA 3H4WA 2ADAA 2EHHA 4RXGA 1HP5A 1PIIA 1PUDA 2GGIA 2WC7A 3LK6A 2ZBTA 2YZRA 2QGYA 1CLXA 2ZE3A 1F9CA 5D09A 4IGSA 3O06A 5ABEA 4P8XA 1E40A 2JGYA 1BWKA 2PB1A 2BZNA 1HX0A 4R7JA 3HQNA 4ONVA 3UG4A 5REQA 3VD5A 2VX6A 1JZ8A 3CUGA 3I7RA 5I6SA 1ZZMA 4O4VA 4XZWA 1TMLA 5AYZA 3CAQA 4ZZ9A 3THAA 5C9WA 3G1HA 3CZ8A 3DFNA 1QMLA 2UY2A 2WQDA 2BVWA 3EX6A 3ZYZA 1F05A 1CNVA 2DZSA 5LYRA 2WPBA 4IGHA 4B15A 1GEHA 1VYRA 2J77A 4IOTA 1B3XA 5DXYA 4YVVA 1MQQA 4XISA 1OGGA 4GBDA 3W38A 1QASA 3BPWA 3UCCA 4K3ZA 2VQTA 3NL3A 3TIMA 1IEIA 4MFDA 3UQNA 5RUBA 3N9KA 4QCEA 5HA7A 4OBTA 3WEMA 1XG4A 2IPGA 1ZNNA 3O7UA 3TTQA 5D8ZA 1NDYA 2CLEA 1MUCA 1A5BA 5I7GA 2AGTA 1ECQA 4P7LA 1OIFA 5A6BA 1BTMA 1F6KA 3WJXA 4WF7A 1SSDA 3TN4A 3LXBA 4AF0A 4FK9A 2Y5SA 5ABHA 2A7NA 1XQLA 1OBAA 1XGEA 1IWPA 3HGJA 1XG3A 2FDSA 3A9BA 1EEXA 3EWXA 3EWUA 1HUVA 2GVYA 2XWEA 1EP1A 1GQKA 2G0WA 1X97A 4HMCA 2FGZA 3AISA 1C90A 2GVJA 4ML4A 5C2XA 3BARA 1KFKA 1W9DM 3MUY1 7TAAA 1F4AA 3PPCA 3O6CA 4L64A 2QIWA 3NDYA 1KM4A 3BZJA 3LBMA 3MUXA 2PGEA 2VP8A 1GW1A 3GH5A 3SADA 2EEXA 4J3XA 1V79A 5A5WA 3O16A 3RHGA 4O13A 4N42A 3SECA 4XKYB 4NHVA 2EPLX 1M01A 1DJZA 3FHQA 2OPJA 4PC8A 4NL1A 3NSXA 5FEPA 1PZ0A 4AD3A 1SFJA 3H12A 1CGYA 3VNIA 5HK4A 2VEIA 1VFOA 2ZUVA 2X05A 5CPMA 3IGSA 2YDQA 3CZLA 4UQEA 4S2CA 1F07A 2PDIA 1YIXA 4O54A 3H26A 4J2PA 3CQIA 3MKVA 1QNOA 2DEPA 2E25A 2D23A 2RDTA 3Q4DA 2OT1A 3L4UA 1QXLA 1JR1A 2J47A 1ISVA 2IPWA 1HG3A 2W4XA 2OTDA 1BF6A 5H91A 5IXEA 4B9YA 4RX0A 1EPVA 4R27A 2CYGA 4JXCA 4K8EA 5HULA 3QPEA 2VVNA 1SW7A 1MZHA 5AC8A 1HGYA 1UIOA 3GDBA 4DJFC 3W7GA 2WNZA 2HRWA 2A5HA 5LIXX 4ZA0A 3VIGA 3LZ5A 1YXCA 4M1RA 4MIMA 2FZ8A 4NJKA 1Q6QA 4KESA 1OGBA 1GNXA 3EX1A 3UZJA 2WJZA 2V5JA 1F6PA 4LF2A 2HTMA 5K9CA 2V81A 3FYYA 3M5VA 3HQOA 3WQ4A 1A5KC 3MSRA 1AW1A 4IZGA 3GVVA 3I68A 3AXXA 5I3DA 4R53A 1QI3A 1JF5A 3MMWA 5HMDA 2FZMA 4WDTA 3AU2A 1XRSA 1KA9F 1OYBA 1ONEA 2ZOXA 1MVYA 2PFHA 5AHIA 2VCCA 4AIOA 4WK9A 3W85A 3U7VA 3BAXA 1RJPA 2E6AA 3TXVA 2P10A 4GUGA 3TSDA 3MUAA 5C70A 3I7SA 2V2CA 3DX5A 1TR9A 3SJ3A 1H62A 3EA1A 4LT9A 3VD4A 3W86A 1FY6A 1IXOA 3CHCA 4LWWA 1Z6KA 4DI9A 3BOXA 3KWSA 4UTKA 1P0KA 4JTFA 2BLEA 1QK2A 3W2MA 3DI0A 1UWAA 2WVTA 4WZHA 4G6CA