4LALA

Crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
368
structure length
368
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTAHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
molecule keywords Uracil-5-carboxylate decarboxylase
total genus 136
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lalA00
3E0FA 3S4TA 3MJMA 1ADDA 2BB0A 1EJSC 4D8LA 3TN5A 4F0SA 1FWJC 4IG2A 4DZIA 2OQLA 4BKNA 2QT3A 4F0RA 2GWNA 1ITQA 4HJWA 3B40A 3AU2A 2VHLA 1QW7A 4LANA 3K5XA 3A4JA 4CNTA 1UIOA 4H9ZA 4ERAA 1WXYA 2O4MA 3K2GA 2ADAA 4EPBC 3GTXA 3IV8A 4RDZA 5CH9A 3ORWA 4XAZA 2DVXA 3T8LA 1YRRA 4DZHA 3E3HA 3A3WA 3PANA 4G2DA 3QY8A 4NG3A 4IFKB 4C6OA 3CJPA 1XWYA 4C6PA 4QS5A 3EWCA 4LAOA 1EJXC 3NQBA 4C6KA 4C6NA 3GIQA 3DC8A 2YZ5A 1NDVA 1QXLA 2RAGA 1FKWA 3E38A 2Z2BA 2PLMA 1YBQB 1XRFA 2A3LA 4QTGA 4H9YA 2UZ9A 3FDKA 1S3TC 2D2HA 4ZSTA 1A4LA 4C6CA 3OODA 2YXOA 4DLFA 1PTAA 3MPGA 3OVGA 1RJRA 2AQVA 2XIOA 4LCQA 3URQA 4YIWA 3IARA 1GKPA 1P1MA 4KEVA 1KCXA 3GIPA 4C6BA 4DNMA 4J2MA 3URAA 3E0LA 4BJHA 4G7EB 4GYFA 1IE7C 1V7AA 4IH3A 1DPMA 1YNYA 3MDWA 4KEZA 3HM7A 1EJTC 4PCNA 2QPXA 2YB1A 4ICMA 3PNZA 3OU8A 1NDZA 2GWGA 1FWGC 4GBDA 3IPWA 4KIRA 3URNA 3LSCA 2I9UA 2O4QA 2Z26A 3E2VA 3AUOA 4IQJA 1NDYA 1A4MA 1FWAC 1KRCC 5FSEC 3MVTA 1JGMA 5A6TC 1K6WA 3LU2A 1BF6A 4WGXA 1P6CA 3E74A 1KRBC 3CAKA 2QVNA 3UBPC 4PCPA 1V4YA 1W1IE 4H9VA 1KRMA 1NDWA 2OGJA 1V79A 1ONXA 1PO9A 3S2NA 3OQEA 4HK6A 1O5RA 4GY0A 3TN4A 2EG6A 3BE7A 4GY1A 3FDGA 3GU2A 2EG7A 1UBPC 3A3XA 2VR2A 2Z00A 2ICSA 3UF9A 4OFCA 4RZBA 4WVXA 3JZEA 2I5GA 4IGMA 3UR5A 4CQCA 1XGEA 4INFA 3SFWA 3ITCA 4XAYA 3GTIA 4RDVA 4PBFA 3F2DA 3LNPA 2GZXA 3WZ0E 4J35A 4EPEC 1XRTA 1FWCC 2OODA 2Z29A 1RA0A 4H9MA 4IG2B 2WJDA 2W9MA 4QROA 3F4DA 4AC7C 3FEQA 2OOFA 1ONWA 1ZZMA 3TN6A 2VC5A 1EJWC 1FWEC 3C86A 3TNBA 4C65A 3GU9A 3TN3A 3PNUA 4KERA 3O0FA 4R85A 3EWDA 4GC3A 4H01A 1EJVC 4EPKA 3O7UA 4KESA 3S2JA 3LY0A 4B91A 2G3FA 1J79A 1M65A 5HMEA 3S2LA 3S2MA 4GXWA 1UIPA 2D2JA 3IGHX 5E5CA 2Z27A 4KEUA 4IF2A 1GKQA 4EP8C 4RE0A 4R88A 2YB4A 4DIAA 3GRIA 4KQNA 3QGKC 3IRSA 1FKXA 3GTFA 3HTWA 2WM1A 4RDWA 3K4WA 4WHBA 4H00A 1R9YA 2WJEA 3IACA 4L9XA 4LAKA 3GTHA 3EGJA 2R1MA 1EYWA 3RCMA 4DLMA 2Z24A 4AQLA 4I6KA 1E9YB 2P50A 1HZYA 4HK5A 4LAMA 3RYSA 1FWFC 2PAJA 3MTWA 4LEFA 2VC7A 4XD3A 2CZVA 3RHGA 1V77A 4LCRA 4NP7A 4CQDA 4BY3A 4DO7A 3ISIX 1NFGA 1FWIC 4V1YA 4LFYA 2HPMA 1EJUC 2DVTA 2PGRA 1FWDC 2ZC1A 1A5NC 1J6OA 4XD6A 1YIXA 4C6FA 2HPIA 4KF1A 3UPMA 4HK7A 2BGNE 3F4CA 3MDUA 4DYKA 3MKVA 1POJA 1A5MC 4QS6A 4EPDC 4UB9A 2HBVA 3WYZA 5FSDC 3GUWA 1EZ2A 1KRAC 1EF2A 4IFOA 1UMLA 4GY7A 2Y1HA 4C60A 1PB0A 4B3ZA 5LXXA 1O12A 2DVUA 4C6LA 1POKA 1A5OC 4IGNA 1J6PA 4PBEA 4TQTA 4LCSA 2Z2AA 2FTYA 3CS2A 3OJGA 1I0BA 3OOQA 4LH8A 4E3TA 1RA5A 3LA4A 2F6KA 4HA0A 1GKRA 4NI8A 4XD5A 3QY7A 4H9XA 1WXZA 3IJ6A 2GSEA 4LALA 1K1DA 4ERIA 3NURA 3AU6A 4C5ZA 2R1KA 3PAOA 3F2CA 3T81A 1RK6A 2Z4GA 4QSFA 4CQBA 4C6EA 2UBPC 1M7JA 4XAFA 4GK8A 4P5UA 4IFKA 2WJFA 4V1XA 4M51A 4MUPA 3LGGA 4GOAA 3T1GA 2HNHA 3D6NA 2FTWA 3QY6A 4ZSUA 3B0YA 2P53A 4I6VA 5G4HC 3HPAA 1R9XA 1M68A 1VFLA 3MVIA 4CNUA 3QGAC 1P6BA 4CEUC 3URBA 4R7WA 2D2GA 2Q01A 3G77A 1E9ZB 4G7EA 2PGFA 1EJRC 4JOMA 2VUNA 2FFIA 4DI9A 2VM8A 1V51A 1ITUA 4B90A 4RDYA 2Q09A 4ERGA 1K70A 2R1PA 3GU1A 2AMXA 4L6DA 2Z28A 4C6JA 1A5KC 1RJPA 1RAKA 4Z42C 1R9ZA 1YBQA 2Z25A 3GG7A 3WMLA 2IMRA 4H9UA 5HMDA 1FWHC 4DI8A 2OB3A 4XAGA 2E25A 4C6IA 2KAUC 4CEXC 4F0LA 2HQAA 2QS8A 4QRNA 4PE8A 2FVKA 1FWBC 4XD4A 1A5LC 1RK5A 3LSBA 3B0XA 3F2BA 4B92A 5HMFA 2R1LA 2E1WA 3ICJA 3DCPA 3V7PA 3N2CA 4KETA 3UR2A 3MSRA 2PUZA 3ID7A 4C6QA 2R1NA 2FVMA 3RN6A 4IFRA 4GX9A 1YMYA 2AQOA 2Z7GA 2ANUA 3LS9A 4H9TA 3DUGA 3SO7A 1PSCA 4C5YA 4CNSA 2HBXA 4GX8A 4GZ7A 5AKQA 2EG8A 3NEHA 4C6DA 1J5SA 1I0DA 3KM8A 4J5NA 2GOKA 4UBPC 3R0DA 3PBMA 3LGDA 1RJQA 4C6MA
chains in the Genus database with same CATH superfamily
4KH2A 5A69A 3IS4A 1JCYA 3E0FA 3MSGA 4GNVA 3CM4A 1ADDA 3HFTA 3BK0A 3EZ4A 3SGGA 4LVAA 1W5NA 3ABOA 4F0RA 4UTHA 1GUVA 2FHCA 3KVMA 4MLRA 3I6RA 2F6XA 3MUCA 3IIPA 3FY1A 1OM0A 1XL9A 2PRMA 5BW6A 1E1CA 2FPYA 3PS7A 4GYPA 1UHVA 1J0HA 3U2ZA 1XH1A 2VQUA 1MW3A 1TYGA 2YBVA 1W54A 4G6CA 1E72M 3M0ZA 3W7PA 2XH7A 3HB9A 3THUA 2GGIA 1H63A 5K9XA 3CUFA 2EGZA 3SCTA 1AW5A 1IV8A 5AHNA 2NQHA 3MWAA 1XLCA 3R43A 2BTMA 1EJXC 1TVLA 4H83A 4AVFA 2VYOA 1PZ1A 1DTNA 2BBFA 1XINA 5CZKA 2YZRA 5CJMA 1NJJA 1UWSA 1HKMA 1EP2A 2HS8A 4IMGA 4UOQA 4M6QA 3QFWA 4LAZA 1PDZA 3MP3A 2GUBA 2R94A 2Y5EA 4GYFA 1EOKA 2ZX7A 1R87A 3MDWA 3U4AA 1S2WA 1JDFA 3G1VA 3WNKA 4NSBA 2D73A 3NQFA 1EFZA 3W25A 5F4XA 3CB3A 4AX7A 2F61A 4KIRA 1DEDA 2VVNA 4A3UA 3IGSA 4E2BA 4RE3A 1E0TA 3BXWA 3P67A 2OLHA 1ZCOA 3COTA 3QPYA 4JGDA 2GQ8A 5HQLA 4M8UA 4ECLA 4NZFA 1H50A 1NDWA 3EEZA 1ONXA 1PO9A 3NAVA 1W5OA 1B31A 2PWEA 3WCZA 1E1FA 3TN4A 3DDMA 4RE2A 2ZUUA 3WNMA 4O1DA 3W7NA 3VOJA 3WLKX 2A3EA 5JVLA 3GDMA 3WJWA 1M04A 1JNDA 1EGZA 2YCIX 3K13A 3PPCA 3AS3A 1FWTA 1A5SA 1IXPA 3IJLA 2ZX6A 3M0YA 2IKHA 4NNAA 2POTA 2QV5A 3AUJA 2WQDA 3L66A 4GQRA 2WK2A 5EMJA 5LA0A 3QSTA 4O10A 3CGTA 2C91A 3L2LA 1PIGA 1XICA 3G18A 3HJEA 4ZE4A 3QHNA 3W07A 3IJIA 4JFUA 3UCDA 5XIAA 3SCSA 1E6NA 1MRQA 4D6HA 4QJ5B 2G3FA 4D6CA 4YTTA 1UIPA 2V2HA 3H7UA 5A6JA 2WKJA 3ANVA 4KEUA 4PTWA 4UMBA 2HWGA 5U4NA 4DN1A 1BWVA 3C0SA 1KR1A 3BOFA 1SJAA 1B90A 3FXGA 3PSWA 1EBGA 3W70A 1AH3A 1HKKA 1MSSA 4I6KA 2PAJA 2QUMA 3WK3A 3R0UA 3R5EA 3N4EA 4IP5A 4CQDA 4HNLA 2WHJA 3MP5A 1SR0A 4BQ2A 1HGYA 4O18A 4LFYA 3M6YA 3L4WA 4F3HA 1JD7A 4FIQA 5AC8A 1KFLA 4HCDA 2CU0A 4J1OA 1UKSA 2FGLA 4O11A 4Y2WA 1UBSA 3BWWA 2XFRA 3QMTA 3U2OA 4C60A 3BG3A 1Q85A 4Q8QA 1QPNA 2I57A 2HISA 4B3ZA 5FF4A 3W6LA 1EHNA 3S1UA 1XSJA 4UTLA 2VEIA 2FB3A 1L0PA 3OBAA 3EA1A 3OZOA 4JTKA 2P0IA 3OJGA 4BR1A 4CD4A 2PBOA 1ZRQA 1ZPTA 1N2VA 2IQ0A 5HWNA 2V68A 1OYBA 3KUMA 1FA2A 1G4EA 2UY2A 4DAIA 4GA8A 2DZUA 5CQ1A 1J0JA 3EDEA 3PZTA 2CPUA 1BKSA 3EB3A 3IVSA 5EB8A 3W2NA 3L5MA 4QSFA 5DMLA 3TJXA 1GZJA 3L65A 1QI5A 2J7CA 4V1XA 5PTDA 1QNRA 3L9CA 5G4HC 3WNPA 1IEWA 1E73M 1OC5A 2OWXA 3WLOA 4AHPA 3G1DA 4H4IA 3VD4A 4MNJA 3GVRA 3M0JA 1EOMA 3OTRA 5LKYA 5I07A 3NZGA 1E3XA 4ERGA 1BRLA 5I09A 1BHGA 2ZCGA 3DFTA 1SPQA 3QPEA 4Z1CA 3HJZA 1XCXA 3O15A 2XISA 1UH3A 4XO6A 1DXFA 2QULA 5A95A 4H9UA 5T8GA 3A13A 1BGAA 1IEVA 3MS8A 3PF3A 3VOFA 3RO6A 5A2AA 3TSMA 5GNXA 4A8RA 1YPIA 3TMQA 4FLQA 3H7VA 4CCDA 1Q2SA 4UNIA 4DXXA 4YYCA 4W8LA 1D3HA 4TVDA 3MSRA 1EXBA 4U3AA 1HO1A 4F9JA 3ID7A 2X1SA 3T0DA 4P7OA 4JDYA 1UD4A 3GIYA 1K3UA 4RLIA 4IL0A 2J47A 3SO7A 4ZEPA 1PSCA 5GNZA 3H22A 3A4AA 1IXNA 4WJEA 5D2TA 3NEHA 1J5SA 2VFDA 3MV11 3W0KA 5C70A 4CNNA 4Q3MA 4UXDA 5FF7A 5DCBA 3MJMA 4HGXA 3WLNA 2CWNA 3CV7A 3OEXA 2HK1A 1WBHA 3AQUA 1KNWA 1V0LA 3UQNA 4QHRA 4GHRA 1D7KA 3UJSA 1H49A 3GG1A 5FJPA 1PX4A 2ZRYA 4Q8NA 3LTSA 1B5TA 1T40A 4MJMA 3DFNA 2ZA3A 1NFBA 4NY2A 2F84A 4GVFA 1OFDA 5CKSA 4XAZA 1PHWA 3FAWA 3QPZA 1WQ5A 5CPLA 4DZHA 3A3WA 4NG3A 4UTTA 4IFKB 2QUUA 3HG2A 3ELFA 1B3VA 1W1VA 3SY8A 5MF5A 2ABAA 4ROPA 3RILA 3P84A 3E38A 2WNWA 4PTVA 3LTPA 3AJXA 4HCHA 4Q4KA 2VR5A 4BQ3A 5G4WA 2CEQA 2A3BA 1UR3M 3D3FA 4X9YA 2XFWA 2G5WA 2VC9A 2ZTKA 2CITA 3KOZA 4GBUA 2PWHA 2CLOA 2CBVA 4NAEA 5KITA 3W7GA 1S1PA 1JYNA 2DZBA 4JN8A 1EJTC 2QGYA 2YB1A 4NXKA 1KWGA 4O1CA 1R2RA 3GHSA 3W38A 5K2ZA 5DN1A 2V69A 4Y9OA 2EXOA 1V93A 1TKKA 2FJKA 4B4HA 2I9UA 3WLJA 3SIZA 1V3KA 1SZEA 3GXIA 4LY4A 3FAXA 2JKAA 1H7PA 1KGUA 2E8ZA 4CCCA 1PZ2A 4PCPA 1X1ZA 3I6EA 2B0MA 3LD5A 4H9VA 1KRMA 3UESA 1V79A 4IUOA 1ZJHA 3HMJG 1AW1A 3A23A 1YTDA 3I3DA 3S1XA 4ZTXA 1G4TA 3DGRA 4Z1AA 2NLIA 1UBPC 4WKFA 1JUKA 1LQ0A 3GE7A 1OT2A 2DZTA 5DCEA 1MXGA 3ZLGA 2OTDA 1XLGA 4WVXA 4JY8A 4Y9MA 4O15A 5HJXA 1N82A 3E6EA 2J7BA 2C1GA 2A7RA 4O12A 3CHFA 1FWCC 4LS1A 3THAA 5A6SA 4H9MA 3KVLA 3KRBA 3FA3A 4X2RA 1DE5A 4N42A 3AAMA 2GSHA 4LOCA 4IMFA 4Q8WA 3T2PA 1W1A1 3HQNA 2OCZA 2VCBA 1QI3A 4OVXA 4F8XA 3S2MA 3E2SA 2V6AA 3B4UA 3QSRA 5FD0A 4MJ2A 3DI0A 3G1AA 1LM1A 3K4DA 4GI9A 1V03A 4MKVA 4U33A 3RK8A 2I17A 5D9PA 2NXHA 4YCOA 3BMVA 3WMSA 3DHPA 3SECA 4UQBA 1RCOB 4LV4A 2XWEA 2BHYA 4ACZB 5IRPA 1EYWA 3R4IA 2GUUA 5BYWA 4YCPA 2A6LA 3RM8A 1CGVA 4ZXLA 5CSUA 3W7LA 1FWFC 3VGGA 1BFNA 1U33A 3HOJA 3ZYZA 4NP7A 2QCDA 1ME7A 1C7TA 4E8GA 3BVJA 4MWAA 5GQBA 3W2MA 1XD1A 3HG4A 3GAKA 2JEQA 2BGNE 3ONCA 3BAYA 4JL1A 2ZZ7A 3EWXA 5FSDC 1YTEA 1E51A 3TWAA 3EB2A 4YTUA 4HSHA 2D22A 2ODOA 3LI1A 2GJPA 1RVGA 5KETA 1B2YA 3VI2A 4IMCA 3KEHA 3WD3A 2OSWA 1W1ZA 2FQIA 3AXKA 1KLYA 2VEMA 3AS0A 5D05A 2RKXA 4OGZA 1VS1A 1E71M 2CIPA 1H0GA 4ZQPA 4UFLA 1PX3A 3TQVA 2ZADA 1KKRA 3HZ3A 2WHMA 5D02A 1Q65A 2XSAA 4DF1A 4GOAA 4XG1A 2CKRA 2ZUWA 4I6VA 4O53A 4IQEA 1JGIA 1IZCA 3SCUA 1YXYA 2EF9A 4ES4A 1A80A 1GJPA 1UH2A 4ZOAA 4PMNA 4DJFA 4F48A 1XLJA 2YOCA 5CGQA 4Q4MA 1BTMA 3EWZA 5I2UA 3LBOA 2AMXA 3SRHA 2E5BA 3AS2A 4CD5A 4S3AA 4AEEA 4UTUA 1E5JA 1LOLA 1EDTA 2IMRA 3MCOA 7XIMA 2MANA 3KRUA 4NUWA 2C13A 3AMLA 2WKLA 2Q71A 2B7QA 2POZA 5I06A 2QS8A 1NWUA 4TX9A 3I3BA 1IR1A 4YTSA 1UR0A 1XYZA 2TODA 2W4XA 1FH8A 3R11A 4D72A 3OZMA 5BOFA 2CLMA 1QO2A 1X6NA 4ZOCA 6REQA 4UTFA 3PPGA 2PUZA 4EAMA 1JDDA 2REQA 1H7NA 2RJHA 1V0KA 4GX9A 2XTKA 3APYA 1NOFA 4GISA 2DIEA 3W87A 2CZ5A 5G4EA 5EMKA 5BOOA 2WZTA 1I8JA 3N6HA 3PULA 5C9ZA 1LRNA 4RV8A 5K9CA 4AIUA 3EKZA 2VX6A 2W61A 3TN5A 1FWJC 4IG2A 3LBMA 1DV7A 2OQLA 2QT3A 1S2VA 2GWNA 5AVHA 2A1YA 1XX1A 4I8YA 1DOSA 3P8IA 1NARA 1GPFA 1X7IA 4WDXA 3WH6A 5EU9A 3CPRA 3TW6A 4M1BA 3CWHA 1DJZA 4LUTB 3EX3A 3BPWA 4GYPC 4GNJA 4UTTC 3W74A 4ZQOA 3TFXA 4MTVA 3LHTA 1Q6DA 3LCIA 5HAOA 3FKRA 2GQ3A 1WNOA 1HJUA 4QS5A 3NQBA 3BMWA 3W7CA 3IIOA 4XKYA 4UUIA 2V30A 3C2FA 5BRQA 2E6YA 4FNUA 4E8DA 4KGJA 1K03A 4C7DA 4JTIA 3TC6A 3CYVA 3GVWA 5KZ6A 1IWPA 2IPWA 4HBKA 3W9ZA 1Y7VA 4HPJA 3WBXA 1CXKA 3ZS4A 2A6NA 4GRSA 4IXHA 4YVXA 2C6QA 1NWSA 1SSDA 1UH4A 2GJXA 3CZKA 1IYXA 6REQB 2YGYA 4GVIA 1OC6A 2C71A 4AF0B 4DXKA 4PUKA 3M6DA 2ZOXA 3LNMA 1TV2A 2ZICA 3KTCA 5I03A 1JUEA 1ALDA 2QCFA 1MUMA 3VNIA 3RJYA 5CXPA 2QPSA 1O1ZA 2L5HA 3W83A 2ON3A 5HR6A 1TREA 3DH7A 4P61A 1E6ZA 3VUSA 3VZYA 4PMVA 1W1B1 3AUOA 4Y8EA 4OT7A 4IQJA 1FWAC 3I4EA 5D9NA 4HZMA 3WKZA 3IGXA 1EL3A 4H19A 4C7FA 1XIHA 1KRBC 4J3UA 3AIEA 4GE8A 3OGVA 1F3XA 1EP3A 4IQDA 3E49A 4MNLA 3PR2A 4I8DA 4F2TA 3I7QA 1JPMA 5FAGA 3MHFA 1DHPA 1PWMA 1WOBA 4US5A 3EX6A 4GLEA 4NILA 4L1GA 1QDSA 3ZMRA 2PMQA 3AIQA 2XZ7A 3CLWA 3POCA 2G41A 2AL1A 3SZ8A 1E6PA 5E6YA 3LNPA 6A3HA 3HA1A 2I7GA 2V5BA 4I5UA 4JHZA 2Y2WA 5AYXA 3UZWA 4OE7A 1HKWA 2YA2A 3AFBA 5I6SA 5IOBA 4DELA 4L61A 3EDKA 4GNKB 3T0AA 3V3WA 3TNBA 3GBDA 1PE1A 3RX4A 1LG1A 1CGTA 3VDBA 4GC3A 4H01A 3BLLA 3VOIA 2BXYA 2PI6A 1B9BA 3S0CA 1FHLA 3S2LA 4FXRA 3EOOA 3LB0A 3IGHX 3S5OA 3N73A 4US5D 1TB3A 1SJBA 1VBJA 3NDZA 2B31A 2D3LA 3WQOA 3AHVA 4RE0A 4FSAA 1OD8A 4Z2JA 1OWQA 1RBOB 5CAKA 1TV3A 3MYPA 3A5FA 1A49A 1ELSA 3GTHA 4MAZA 2YDAA 4L56A 4DLMA 1TWZA 1BYBA 5HMSA 3ABXA 2QDHA 3N6JA 4Z2HA 2CCRA 2E6DA 2Y62A 3W1QA 2W91A 1FDJA 4FX8A 1JXKA 3GAYA 1X8CA 2ZC8A 3KX6A 5LIWX 1SFTA 3W02A 1NWTA 2ACSA 1AH4A 4FMVA 3EWUA 4KFOA 3M07A 3HO8A 4JHMA 2OSXA 4WJ8A 1YHTA 3B0UX 1PB0A 3OYXA 5LXXA 1FTXA 4MM1A 3HMCA 1LRQA 5BU6A 3C8FA 3Q4DA 4A05A 1YE6A 1UR4A 4TVCA 1G4PA 4PBEA 1V3IA 1EB3A 4ZO9A 3HN3A 1QK0A 1GKRA 5FI8A 2DZSA 1VHNA 1WXZA 3S5NA 1AL8A 4M6PA 1Q3NA 4O19A 3UGVA 3PAOA 4LW7A 3NDOA 2UBPC 3T4WA 1W5MA 5LZLA 3V0TA 4YHGA 1YXCA 1OF6A 1LF1A 3GR7A 1GYMA 3G8RA 3PVFA 1H0IA 1E5NA 2GVEA 2WLZA 3UYCA 4NZ1A 3TYUA 2H90A 1P6BA 3MUY1 4CEUC 3CIWA 3WD1A 4HPHA 3N12A 3GKFA 3UG5A 1WP6A 1TTIA 4NZ3A 4DI9A 5HDRA 3EKGA 3LCLA 4E4PA 3SURA 4CQ9A 4R7OA 3LCWA 3U5UA 4AISA 3PBVA 3KCOA 3N19B 3POHA 1VZWA 3WH8A 1HKVA 3W1XA 4UFMA 2HQAA 4GQGA 5D33A 4MPQA 4IJCA 1E0WA 3CV2A 1XLDA 1J2WA 1CNVA 4AMAA 1HL2A 4G5DA 5AC6A 1E0VA 3WK1A 3ICJA 3N14A 3NQ6A 1ZUAX 3DCPA 4NAFB 3RCNA 3BGGA 3KXQA 4JKKA 2QDGA 2QJJA 3VK5A 3OW1A 5HINA 1B1YA 2RDUA 3BJSA 3A3HA 1D9EA 1QNVA 3N13A 3IV3A 5BMXA 2EG8A 1I0DA 1OB0A 4PRRA 3OLGA 5CH9A 2Z6IA 5FOOA 4GIYA 5EY5A 4ZQCA 3TU9A 3FOKA 2DPEA 3SUWA 1TUXA 3WQEA 2BGSA 2ZXAA 4QLKA 3CL8A 3PZVA 1B4KA 4S3FA 3VDCA 1M7OA 1VP5A 3F4NA 1KGXA 3SBFA 2GDQA 1ODUA 2GFTA 4M29A 4D6DA 4PCFA 4C91A 1GONA 4Q8PA 4QCEA 1JCXA 1MNZA 2NQZA 1HF6A 3NQVA 4J3XA 2PWDA 3LXBA 4E0CA 1QI2A 1PIIA 4C6OA 2YYUA 1MXSA 4A3HA 3NQCA 4C6KA 1JDEA 1OCBA 3TA6A 4I5RA 4AH7A 3MY9A 1MO0A 3QQ0A 3V1HA 3L21A 1XRFA 3TSBA 2A3LA 2PURA 4JFTA 2ZDRA 2BASA 4H9YA 8XIAA 3GDBA 5G2WA 5I02A 1A4LA 3S1GA 4Q22A 1E15A 2WMHA 4CCZA 4P2VA 3KWXA 4ZQNA 1JYVA 2DSVA 2W3ZA 2P1FA 4UR9A 2NXGA 1KTNA 3PPFA 1GQNA 4GIRA 3B05A 3GIPA 2ZE0A 2OX4A 1Y0EA 3L68A 1CLXA 5REQB 3SM0A 2J9YA 3WLQA 4IH3A 2J77A 2WWDA 4FAMA 3NGJA 5G2IA 3G3MA 2FHFA 2NX3A 5C9WA 2HJPA 4EXAA 2EPOA 2GUYA 3TR9A 5JH1A 4MDPA 1LWJA 2GWGA 3UW6A 3PUOA 2ZRVA 4OECA 2DH2A 3URNA 2O4QA 2KZHA 3KOXA 2OQYA 3N29A 4DB7A 4WKHA 2QUTA 1CXFA 5DT7A 4JZ5A 2CZEA 2ONEA 2OZ0A 2F9RA 1A5CA 3VGFA 4WGXA 1SGJA 3TIMA 3W37A 4PC8A 3NZPA 4V33A 1ZENA 4ZODA 1ZAHA 2PDQA 5HA7A 1VB9A 5DELA 1OG6A 1UPPA 4Q4QA 4JIQA 1O66A 1WZLA 2WMJA 2QNEA 3WBYA 4FS9A 1Q6CA 3ZWSA 3OBEA 3Q67A 3JZEA 4BF7A 1KGWA 1S46A 1UZDA 2OEMA 3DG7A 3FN9A 1L6YA 1FY6A 2V5JA 4EPEC 1ICSA 1K8CA 3PJWA 3QM3A 2Z29A 1RA0A 2VX7A 4KFNA 2NUXA 3MZ2A 4AAJA 3AI0A 3OZPA 4AWEA 3NOYA 3ZQ9A 3OYZA 5FA5A 3IAPA 4U2ZA 3KWSA 2BS9A 4DBDA 1DL3A 3GDTA 1U22A 4B91A 2ACQA 3ES8A 3DEQA 2FTPA 3N17A 4GXWA 3WENA 1TMQA 4GCAA 4Z2LA 4DM1A 3AYVA 2YL8A 1T7LA 3EX2A 3MBFA 3GRIA 3QGKC 5C55A 1XIJA 3BV7A 3GYEA 4IPIA 1QTWA 3I6TA 5LGZA 4MB3A 1TO3A 4E4FA 3BH4A 3VNZA 4LAKA 1PCKA 3O05A 3O06A 1ITCA 4WIWA 4LCRA 4DO7A 2BY2A 1NFGA 2DQXA 3W7KA 1QNSA 4DXVA 1X1NA 1QHPA 4HHHA 5AYYA 1HJWA 5EYWA 4DO5A 1XKJA 2GVJA 4HK7A 1Q6FA 3F4CA 3MDUA 2QLYA 1EJ7L 3LCXA 2O9PA 4FF7A 1JD9A 3GS6A 3CAVA 4ALDA 2TYSA 5CGMA 3BARA 3IVTA 4XV0A 4BFAA 1R7OA 2OZ3A 2XUCA 4LUSA 2V2DA 4IGNA 2WMKA 4LCSA 4E6MA 5BZAA 3BC9A 3NQAA 3CWNA 4NI8A 3WX7A 2PTDA 2IPGA 3U2CA 1NAL1 4XVDA 3W75A 3AMGA 3NPWA 3NQ2A 2QGHA 4AD0A 1CYGA 2JGYA 3GXPA 1C90A 4P5UA 4IFKA 3SAZA 3LGGA 2CC0A 1XGZA 3USZA 1GOMA 5CBJA 3IWPA 1OFRA 1DXEA 3QV8A 2DDXA 3QGAC 1VFOA 4R7WA 4H8VA 4FX7A 4MKSA 2Q09A 2ZX5A 4ML4A 3MBDA 4H7CA 1A5KC 3DENA 3MKKA 3PTQA 3IVUA 2W79A 2VTFA 1LWIA 1FWNA 1H62A 2JFEX 4RV3A 4RXFA 1OX6A 3PC0A 3RIKA 1WX0A 2E25A 2QKFA 3H12A 1E9IA 2DH3A 3ARRA 3WMBA 3F2BA 1UKPA 4B92A 3UA4A 3VGBA 4D6FA 1HKJA 1FQ0A 1H3GA 5KZDA 1SO6A 4E2OA 4B5TA 3S3GA 4IX2A 4MB4A 4DJFC 5IBXC 2XYLA 3AWNA 1QPOA 2JGQA 2C14A 7REQB 2WCSA 3QTGA 1TWIA 2ANUA 3KRSA 2C79A 5IFTA 2FPVA 4L6OA 4XUGA 2Y70A 5A8GA 1TV4A 4Q6JA 4MVAA 4GX8A 4QEEA 3TUUA 1OFPA 3FLUA 3WK2A 3E0WA 4UZUA 5F1VA 2QCDB 1DIDA 3NG3A 3WQ5A 1KXHA 5G1YA 4K37A 4DZIA 3WBAA 2QCCA 2QZRA 4HHMA 4LB3A 5BXRA 5CC7A 2PE4A 3ZIZA 3BL3A 3A4JA 4PEKA 2WM0A 3QZEA 1K6AA 4EANA 3SRKA 3PM6A 3LN3A 2BY0A 1J93A 1O6IA 3S9IA 3ORWA 1R3SA 5DFAA 2E9MA 3ATZA 1I6NA 3AIUA 3QYSA 3TQ0A 5GPRA 1S2CA 3APTA 1TA3B 1UR2A 1S38A 4YL2A 2V5DA 3RRAA 2X16A 5LGXA 3GB6A 5C9UA 3WLRA 1N8FA 3FSUA 1E6XM 1M7XA 4QG9A 3BTNA 4N6FA 2F2KA 3D0CA 3OVGA 3L4YA 3W1UA 2VZOA 4R33A 3FV9A 4B3KA 1AUSL 4O1EA 2FVLA 5D2XA 4NAFA 3WMCA 1Q7QA 4HSOA 2UWFA 3A64A 4ADUA 1R0MA 2WC4A 1E6QM 1IE7C 3M47A 3TDFA 3MSYA 2ASHA 4PCNA 4JTFA 2QPXA 2CYGA 3W7RA 1TE6A 5GJMA 1JJKA 3DFPA 5G2HA 1R38A 1DYSA 1AH0A 1XH2A 3VNLA 3NEVA 4BA0A 5K7JA 4JR5A 4G1NA 3E2VA 3CTLA 1XV8A 4JY9A 1UA7A 3JVAA 4PUEA 3MVTA 4NVTA 3VFCA 2FZ9A 2NQ5A 5LNWA 1IEXA 3MI3A 1J8VA 1I75A 1SVDA 1XIGA 4V2XA 4X9SA 2AKZA 2EJAA 3WD0A 2XSBA 2DW6A 2E9LA 2ALRA 1N8WA 4JL2A 3L12A 4GY0A 1LLOA 1M5WA 1F07A 1IGSA 1VPXA 5HQMA 1JEZA 2EG7A 3BSHA 4GGHA 4WXYA 4MG4A 5A8PA 3E0IA 2I5GA 1XGEA 5GNYA 4LUSB 3GTIA 2Y85A 3ZVIA 6PTDA 4DYEA 3GUGA 1JZ4A 1Y5VA 1L6FA 2W92A 4IXXA 3B03A 1GQIA 1R3YA 1WO2A 1IZKA 4HSNA 1HP4A 3CHEA 1XH0A 4ZB2A 3S47A 1TTQA 2VC5A 3L23A 3DBNA 1GK8A 3R79A 3CV1A 3WEMA 3NSXA 4RE4A 2NSXA 7TIMA 2YCLA 2ZVIA 2I16A 4GH3A 3BJTA 1P0EA 5FKYA 2F38A 2PZNA 2DUAA 3T0BA 3W84A 2OOGA 4IPPA 2R8WA 4R88A 1O5QA 4AY8A 1E6RA 4WK9A 3QJAA 1Q6OA 3HTWA 1TV5A 4FP1A 3WF3A 1FDZA 3S6DA 3DGBA 3AMDA 3RM4A 1GQKA 3BJFA 8TIMA 1XC6A 3YPIA 1E40A 4AYGA 4GO9A 1F3TA 2WYSA 2WO5A 3MTWA 5KZEA 2D0HA 2PZ0A 2CZVA 4NJKA 4L5ZA 4MWAB 4KWSA 4AG0A 5E0KA 1L6GA 3UXIA 3N1AA 1NOUA 4V1YA 3GHRA 4CNOA 5F7UA 4JTTA 2HPMA 4M24A 1FWDC 3G2GA 3RF9A 1V3LA 1EX5A 1RQEA 2E28A 3AXMA 4ADSA 2RFGA 4HIBA 1JDAA 4M3PA 3UZZA 1TMHA 2ZXBA 1EEXA 4ZBCA 4JEQA 4XBJA 1FWRA 1SUXA 3UNTA 5ABTA 2E5DA 1VBRA 3DU0A 1POKA 3P14A 3E02A 3NQDA 3NJ3A 2RJGA 5BWAA 2Y7FA 3VD3A 1XUUA 1XLIA 3TYAA 1C91A 2F2HA 3EDFA 2X8RA 4LC8A 3B9EA 4MF4A 1ODZA 1Z32X 4BZYA 3PZUA 3F2CA 5CPQA 1NQ6A 2ACUA 1Z3NA 3K1GA 4XBKA 1RR2A 4LVGA 1G94A 3H4GA 3TTEA 4KRTA 1B54A 2Y61A 3ABQA 3LQGA 1VYRA 1D3GA 5DANA 3USBA 3HIJA 3LXAA 3QQWA 1SO3A 4AYSA 3RR1A 4LYRA 1E4LA 3PK7A 2ZZ5A 2PGFA 3QC0A 4J2PA 3C0LA 3W71A 4WY0B 1J96A 4L6DA 2PF0A 2O56A 2PBGA 5HK4A 3UA3A 3GR4A 4LTSA 3C3NA 3SQMA 1V0MA 1FWHC 6XIAA 3H24A 4C6IA 4O4WA 2VZUA 1UD6A 1XIMA 1RK5A 4FO4A 2ZRXA 4HPNA 1C92A 3LSBA 3CHDA 3KZSA 4RPPA 1R3WA 3LGEA 4F2UA 3UWVA 5DEZA 4JKMA 2Y4SA 3CEUA 4H04A 3CLMA 3ARPA 5D2YA 1XQKA 3CAWA 5FEWA 2FVMA 1KR0A 3MMDA 3S46A 1PBGA 1HL8A 4L1WA 3UZXA 2O9TA 1H61A 2HSAA 3THDA 2YBTA 3EOUA 2RH9A 4NJHA 2VUYA 2E8YA 2DFAA 1ZU8A 1GYNA 4GFSA 3SN4A 4C6MA 2P3EA 2PU0A 1IT8A 4K8HA 4P8VA 2VELA 3Q65A 3N04A 4WGHA 2NQ9A 1TPVA 3LG3A 4R3UA 3AU2A 3OG3A 2WSRA 1SJDA 2XM1A 1UR1A 4LYKA 3NZ1A 5I7GA 5TAOA 2XIMA 3UD6A 1VQTA 2DZAA 1E0UA 1SW7A 2O4MA 2VGGA 1I2OA 4RDZA 2PDWA 4B3LA 1ZJBA 4QX4A 2GJLA 2XDFA 2GVYA 3WBWA 1W3NA 5I3IA 3WEOA 1O5XA 2FH8A 5CLWA 4MAVA 2OGYA 4HOWA 4M7SA 4J27A 2W66A 3DKLA 4C6PA 2OWWA 3IGUA 2EAWA 1M6JA 1V02A 3ARWA 2CZFA 4MADA 4O54A 4S38A 4Q7IA 1VBHA 5CC6A 3KDOA 5A2CA 5C2GA 2GVLA 3QLLA 3Q58A 4XTDA 4PSPA 4ZO6A 2Z1KA 2WAGA 4BK9A 1T6MA 4R34A 4B5UA 3NNTA 3KL0A 1T8QA 2PC8A 4QQUA 1GTEA 2BNJA 3T42A 3QF0A 3BQ5A 3K8LA 3M5XA 1VPYA 4HU0A 3RX2A 1XLLA 4WD0A 4LU0A 2GK1A 1QAPA 1UWUA 2J24A 2YJQA 2CLHA 3N2BA 2JBMA 1C93A 3EA3A 3ZJ6A 4AFYA 1EC7A 2AAAA 1C8YA 4IL2A 3LU2A 4DPQA 3UWEA 2YIHA 1GOXA 3E74A 4UWMA 4DWDA 2BY1A 3PZOA 3AIBA 3MP4A 3TK7A 4TUFA 4M81A 2AAMA 4L4MA 3TWBA 1RPXA 1PXGA 3B8IA 1Q2RA 3WH5A 4DJFD 1B3YA 2J8FA 1UZ4A 1TJRA 2LLEA 2R6OA 3FK4A 4D6GA 1OK6A 2CNCA 4D71A 1RH9A 4L9ZA 1GG0A 3EPMA 2VR2A 4PMJA 2WHLA 2PCQA 1OIFA 3AIVA 5D38A 2J7FA 4N9BA 4YS1A 3THQA 5HQEA 3UR5A 3SFWA 5T9BG 4TMCA 3KW3A 1P0BA 3MMTA 3NQEA 2XFYA 4K39A 2A79A 2OT0A 3P8JA 1X38A 4UQDA 1C9DA 4S2BA 3WQVA 5A8MA 1V6WA 2WCGA 4YWSA 3WDQA 1ONWA 2OLAA 1KFKA 3LZ5A 2AL2B 4W4QA 3TTOA 1J79A 4HNUA 4DJEA 4H6RA 1B9ZA 5L6UA 5M3WA 4IIHA 1CGUA 4JTCA 4YLWA 3K46A 2XVPA 3TH6A 1OQFA 4DIAA 1W2PA 4L80A 5HULA 1PTGA 1MNSA 4HYVA 2YBUA 3WUBA 3RPMA 4BI6A 1C3FA 3T0CA 4I9JA 1Z41A 1S3HA 2XVGA 4RZ6A 4TTGA 2R1MA 1W5PA 2WVUA 1OJXA 1Q8AA 2PDPA 3R8HA 4HK5A 2Z1SA 3QVQA 1OGBA 5A8NA 2D24A 1DWIM 1P1XA 4JTSA 4UTWC 1V77A 5D2VA 3ITOA 3GG8A 2WB5A 2TSYA 3W72A 2O55A 2Q8XA 5EL1A 5TQLA 1FCVA 1S2TA 3NSNA 3DFSA 2YXXA 4XZWA 3R7MA 1KKOA 4Q8UA 1POJA 1QW8A 4QS6A 4JTQA 4OBTA 1ISYA 3N3TA 1L6SA 3GDKA 5EA9A 1VPQA 5D8WA 3B8TA 4GY7A 1EXPA 3GWQA 3M43A 1F6PA 3UXAA 4FF5A 5E0FA 5EMLA 5IFPA 1ZBWA 3QOMA 1T0OA 4LVFA 4Q6XA 3VMNA 1MDRA 2J75A 1YYAA 3EMCA 3SN0A 1YX1A 1GJWA 4W7WA 3BQ6A 4XKYB 2WKGA 1V6XA 4BEUA 1X39A 3NVDA 5KINA 4MFDA 3ZJ8A 2WC7A 5D30A 4JCMA 2HXTA 5ECVA 2PDMA 1M7JA 1XBZA 4W7UA 2VCAA 1ZTVA 3O16A 1PKNA 1YPXA 3EYPA 1OFAA 1V5XA 1F05A 1E9LA 1NM9A 2VI0A 4R9XA 3WUGA 3W28A 2XIJA 1AZ1A 2OWCA 3DESA 2PDFA 1CB7B 1TJPA 2JIWA 1ENUA 2ZQ0A 3T78A 3SUVA 3TKFA 4XQ6A 2FB2A 4C6JA 3VKJA 3VYLA 1RAKA 2CXGA 4Z42C 2YLLA 3G0XA 3NXFA 4DF2A 1HJXA 3MUIA 1E43A 5HMDA 4DI8A 3SY5A 3OA3A 3IJ7A 2B7OA 1XCWA 4GMEA 1JULA 2KAUC 3TP4A 2DZPA 1KBKA 1FWBC 4WZHA 2WV8A 2WHKA 2E40A 5DXYA 1LL4A 4WRHA 5CG7A 2NVCA 2WZIA 3C5QA 3RLVA 4GVHA 3NUKA 2C8NA 3UR2A 4X60A 3TCSA 3KLLA 2PU1A 5I77A 1LCOA 3B4YA 2FZNA 4PUWA 3AC0A 1K7FA 1US0A 1JZ6A 4Y9AA 1OYAA 4UNLA 5C7VA 2HBXA 1JYXA 1CENA 4EACA 4GQ0A 3FYPA 3QGVA 1AQFA 3OQ8A 3W4RA 3R0DA 4K8EA 4OIFA 1GOWA 4GG9A 3QKZA 4M6VA 5K4XA 3WLMA 1U30A 4DZAA 4IPJA 3O2LA 3NVTA 4DO4A 4BI5A 3QLDA 1K9EA 4ZFCA 2Q6ZA 1AQ0A 4ZB0A 3K5XA 4FLOA 2C7FA 3DYMA 1WKFA 4H9ZA 4W87A 4HN4A 4ZB5A 5AFDA 1UP2A 3M0KA 3GX9A 4JAWA 3DYOA 3BICA 3TYCA 1A53A 2XWDA 4LYQA 1OADA 3WY1A 4V15A 3CH9A 1Q7ZA 1TIWA 1YPFA 4PMZA 3ALGA 3BAWA 1H5VA 3FJLA 4ZVJA 4B5WA 1MQPA 3KTXA 3G6MA 2RAGA 3O3RA 1TZ9A 1W3TA 1GQJA 2IKGA 4PULA 2QF8A 4A4AA 4FXFA 2DJLA 1TPEA 4NZ4A 3M41A 4ICCX 1W8GA 4DLFA 1PX8A 3NM1A 1H5YA 3C0JA 2XU2A 3STGA 4NF7A 3P0WA 1DKWA 3BLKA 4Q4PA 3EMZA 1KA9F 4Z0JA 3R8GA 4J2MA 5T9CE 4GJIA 4RJEA 3WJSA 5B7YA 1V7AA 4LUIA 2J4GA 4PA8A 3OBKA 4QE1A 4AF0A 2PS2A 1U1HA 4URIA 1AODA 4ICMA 4H8NA 2VRQA 4I90A 3BW2A 4B5XA 4FI4A 1TV7A 3H4XA 3MUAA 4K8GA 4K36A 3CTTA 4R7JA 1KCZA 3TOPA 1UZHA 1KQZA 4YU1A 1P6CA 4PB4A 4B5SA 3WBEA 3CAKA 1Q6GA 8XIMA 4OOUA 1JPDX 1W1IE 2VDGA 2Z7KA 3TQPA 3NYDA 1BSLA 4O17A 2Y7GA 4GY1A 3B9DA 1JDCA 4GQBA 1QJWA 1VLWA 1TR1A 1C7SA 3E96A 3KOWA 4JTRA 3T2QA 5CPMA 1SO5A 1ZLPA 4OFCA 4RZBA 4PMXA 3KBJA 4CQCA 2PD9A 2BDQA 5EPDA 3U4FA 1V3MA 4RDVA 1K02A 1KW1A 1TQJA 1IT0A 2RGLA 1N7KA 1X1OA 4IG2B 4AZ7A 3I7RA 1LROA 5A8OA 3DHDA 3EWBX 2X7VA 3SFKA 3LQLA 1BWKA 1EGMA 2IXUA 3GH5A 1VENA 1TUFA 4S39A 4F66A 3V5CA 4GUGA 3LCGA 4AZ5A 4H8UA 2G3NA 1L6WA 5C6MA 3B8UA 1O7AA 4J3SA 4B16A 3M46A 3W7OA 1C8XA 1SU5A 1UD2A 6ALDA 2E1DA 1OBAA 2QCLA 4O57A 3EKLA 1CBGA 1CECA 1AFSA 2DORA 2ZVRA 2JIEA 1CIUA 2NV9A 1B4EA 3AZTA 1W1PA 3T07A 3V5OA 2PDGA 3CIVA 1EPVA 5H2ZA 3EGJA 3UR8A 4NNCA 2Z24A 3WDHA 2P50A 3HPXA 3WF1A 2Z1VA 3PY2A 4K38A 1S5MA 2VC7A 3PZGA 5D9OA 3PWGA 3VX0A 3M5ZA 4FOKA 4KRZA 4JBRA 5M03A 2PGRA 2ZC1A 3G3DA 4IPLA 3WF2A 3CAQA 4KWUA 3UPMA 3GTNA 1SZNA 3U7BA 1SO4A 3OGRA 3MV01 3VMPA 2WWCA 1YE4A 4GI4A 4JIHA 4FZIA 1CZ1A 3TVAA 1FCQA 1S5VA 3IANA 3KRZA 3WO8A 3MHGA 1A5OC 4EVZA 1R6WA 1AG1O 5A1AA 3LV6A 9XIMA 1I0BA 3BURA 4S3KA 2D20A 2EKCA 3BO9A 4B9YA 3U0HA 2GJRA 4RXGA 4QNWA 3L4XA 4NJGA 1OYCA 4C5ZA 4X63A 1W1TA 2R1KA 4HOZA 3ZJ7A 4IMAA 5L9FA 3T4CA 2Z4GA 2ZA1A 4C6EA 3QFEA 1SFSA 2EHHA 3QXBA 5C2CA 2VCCA 5JH2A 5M1TA 1BF2A 1P48A 3MWCA 3PTMA 4AC1X 4C7GA 4J3ZA 4NQ1A 1WAUA 5LSMA 5BU9A 3SW6A 3VAVA 1AW2A 1TZ7A 2D0FA 2FPTA 2VGFA 4NAEB 1BQGA 3FHQA 4JQAA 5DX7A 4N4PA 3CMGA 1CGXA 3SCNA 3K8MA 4RDYA 1HJSA 1QW9A 2UY3A 4Q8OA 3CQJA 2YCEA 5HPOA 1XW8A 3PBGA 3DHUA 2X1UA 2NSOA 2QQ6A 4UTWA 2BLEA 5D4YA 4PMQA 1YBQA 3PBWA 1UZ1A 1RBAA 1H1NA 4HHPA 2G4JA 1EC9A 1HP5A 2V5CA 5CSRA 2B7NA 4QGCA 1LBFA 5HNRA 1LORA 4PB3A 3BW4A 2CFFA 3RPDA 2FVKA 5ABFA 5AYIA 2ZXDA 3UR7A 2E1WA 4QSHA 2JF7A 3E5BA 3ZT6A 6TIMA 2XINA 3U9IA 4IMDA 2G50A 1EDGA 3B06A 3U3HA 3V35A 1FHDA 4C6QA 5FIPA 2DZVA 3MANA 4IFRA 5BOEA 4RX0A 3VCNA 2WMFA 2PSNA 3W23A 5CPOA 1OCNA 2MNRA 1W31A 3VZZA 1BKHA 2VOTA 9CGTA 5BWFA 3VTRA 2ZZ6A 3VE9A 4TX6A 2WPBA 3LTYA 2BVWA 1DQUA 3P60A 3S9ZA 1P7TA 2J7DA 2PDCA 3RUBL 4EX4A 4J40A 2XVLA 3O6DA 4GWEA 1KBBA 1LDCA 3LRKA 4GGBA 3SCVA 3WIJA 1ML1A 1K4HA 1VRXA 5CG0A 3LCHA 4X61A 3QR0A 3UWWA 4YJ5A 4AD4A 4CD7A 3LI0A 1XHGA 1T8XA 1VBGA 2NT0A 4QBXA 2Q8LA 3K2GA 1U1UA 5DMMA 3LHUA 1KB3A 1E55A 1LG2A 1UQZA 1TJ0A 4BF5A 5D03A 4MNKA 3G24A 3VA8A 3AXHA 4A8LA 1OFOA 2E6FA 2H8XA 3LXCA 3KFTA 3U6WA 3FKKA 1JRCA 4N9EA 1OFEA 4TIMA 3ABSA 3VILA 5ABGA 4D2JA 3WQDA 2PLMA 4BWLA 2FIQA 2YCJA 3UPWA 1A5BA 3TJLA 4TTUA 4CVUA 1DVJA 5TIMA 1SMAA 4F2BA 1XYLA 3WDJA 2YDSA 1MEHA 1RJRA 4LCQA 3URQA 3GY1A 1Z8AA 4GACA 3A21A 3BMXA 6ENLA 3ITVA 3W2JA 5AYZA 1GVSA 2RDXA 3MI6A 3H8AA 4CN1A 4AX6A 1NELA 4GXPA 1KFJA 4BQ4A 2A7PA 4DY1A 1PUDA 1I1WA 3R0KA 4KBXA 2NV2A 1DJNA 5H91A 3GYCA 3T6CA 1UD3A 3UG8A 5DMYA 3QRHA 3WLIA 4GABA 2YXGA 4CQ8A 4X3ZA 1JZ5A 5CEWA 5FSEC 1W32A 1K6WA 4UFIA 3TLLA 1CPUA 5JXQA 1K8YA 1KM2A 2IQDA 3UBPC 4GKTA 3B97A 2C19A 3HF3A 5LNUA 2BVYA 4HK6A 2HDJA 5CSYA 4TV6A 5DBUA 3EXRA 1E6SM 2VL4A 3PFRA 4PYSA 4ZTYA 1JCJA 1RP9A 5I3FA 4Y9PA 2WQPA 1EPXA 5FJUA 5CGTA 1PYFA 2JALA 1UD8A 2EPKX 2GZXA 1A50A 3XISA 3PUEA 4AEOA 3GHTA 4D6IA 4WJXA 3M16A 3SJ3A 2DV0A 3OGSA 4OJYA 5HNTA 2ISDA 3CQHA 3CHCA 4XKMA 2PWGA 3DFHA 1Q6EA 2FLIA 3H2CA 3U8GA 1XLAA 2DT0A 4IGSA 2CLPA 4C65A 3GU9A 4QFUA 2G3MA 5F2GA 1ISVA 1AQMA 2F8QA 4RW3A 3LLFA 3LY0A 3NO3A 2P5NA 1M65A 3VDGA 5H8PA 3SRFA 1JPKA 2XGIA 3I4KA 3W7HA 1MQQA 3VM7A 3C2OA 3BLEA 4LNCA 1ZFJA 3PSVA 1G4SA 3GTFA 2QCEA 3QV6A 4JTAA 4KWOA 2WM1A 1OEPA 3SB0A 5D37A 5KMYA 4OWGA 1FP8A 4F0KA 4F4RA 4GUJA 4AQLA 3TROA 5JUVA 2QYGA 4HVXA 5CBBA 3E9AA 3QHOA 2ISFA 5B7ZA 4J3VA 4XD3A 3WDIA 4I7WA 4QM1A 2ZUVA 4IZGA 3R12A 4MLJA 3ISIX 1M03A 3VMOA 4N02A 3MYOA 3PPHA 4PRWA 4C6FA 3S9YA 4AD3A 5LNRA 4MJZA 5HNUA 4PMYA 4U10A 3FNDA 1EZ2A 4G56A 5FJIA 3KVJA 1ZJAA 4IFOA 4PH6A 3VC5A 1NQKA 4A3RA 2E3ZA 2Y1HA 1K9TA 1HG3A 2ZFAA 1ONEA 1LL7A 2Z2AA 1BVWA 5DRIA 4LEQA 3TW7A 1YNPA 3QYQA 1I2QA 2GSEA 3RFAA 4CU6A 4U5IA 2DT3A 3LBCA 1E4IA 2X1RA 3GNRA 4JD4A 4L65A 3KE0A 4O1BA 2HK0A 1T5AA 4UOJA 1RQHA 3J7HA 4W8AA 2J8TA 2JK2A 1VJIA 2F6UA 1WDSA 3P81A 4CGTA 3VDHA 3HPAA 1XSKA 4FHAA 4J3TA 2BZNA 4A8IA 5CBIA 1FFRA 1VJZA 4JOMA 3FYOA 2VUNA 1A3XA 1V51A 1ITUA 1GJUA 4W86A 4GI6A 3ZSTA 5DO8A 4CN6A 3F5JA 1O94A 4P7QA 4Z2GA 3STEA 1MFUA 1A0CA 4IIBA 1CT5A 1PV8A 2G3IA 4MWAD 4ZMGA 1M3UA 3A4WA 1LRTA 4RK8A 1VEPA 1VR6A 2HVMA 3CPGA 1UQYA 1LOQA 3D3AA 2OEJA 4D6JA 4JNZA 1G7UA 1A0DA 3N2MA 3O63A 3GW0A 1GOKA 1NF7A 4A3YA 4G8TA 1W3IA 3MT1A 2JKPA 3GO2A 3FA5A 4JCLA 2ABBA 4FK9A 5C2XA 3WQGA 1K77A 2YA1A 1GOQA 3KOYA 3NZRA 1HX0A 4RW5A 4Z0SA 3B3DA 5I3JA 1FDYA 1W9DM 5CC3A 4U4MA 2INZA 1WAWA 3KM8A 2BXVA 3DFYA 3Q94A 1HNYA 1KCKA 1DORA 3VKDA 3SR7A 3S4TA 3WUEA 3LK6A 1YDOA 5ABEA 2XN1A 5T91A 4D8LA 4F0SA 3ITTA 1DIOA 4PFHA 3BAIA 4IICA 3CZ8A 1D7FA 2FH6A 1REQA 5E0CA 1KBIA 1XBVA 1TPWA 1UJQA 4LANA 1ME9A 1W37A 4CNTA 3VVGA 1EKOA 1WUEA 3W2KA 1J0YA 3FGCB 1XJBA 4DHGA 4CU8A 1AD4A 3H21A 3ZR5A 1KFCA 3LENA 4YTQA 2HS6A 4P7NA 2VC6A 4PCTA 3AOFA 4LRSA 5DY3A 1HN1A 3EXSA 4LBSA 1J0ZA 2ISWA 1IR2A 4LAOA 3T7VA 3GIQA 4ASTA 1QXLA 3PJUA 4JX4A 1B30A 2O7QA 3AROA 4QCFA 1QNQA 1R85A 2R9RA 1J12A 2BP1A 3FDKA 1BAGA 4DWSD 4HOXA 3GXNA 4HCLA 2DSKA 3RU8X 3IK4A 2GGJA 1Z48A 4DZ5A 1BGGA 1SQ7A 4O28A 1CB2A 1O5KA 5HJYA 2DQWA 3KS6A 1QPQA 4I9AA 2XIQA 5HWJA 4HT3A 4BJHA 4L7ZA 5FL1A 3B0PA 1DBTA 3IIZA 4JTEA 3LRLA 3O1NA 3TE9A 4FX6M 5JMUA 1TPUA 4ONVA 2J62A 1TQXA 3QBUA 5SWUA 1J2BA 3SEPA 5HUOA 4LSBA 2OSYA 1OC7A 2ISVA 4K68A 3VNDA 2Z26A 4EF9A 5EFDA 1A4MA 1DQWA 1K4GA 3S1WA 1JGMA 4Z1BA 1BVZA 2EPMX 4UTIA 2DT2A 4R5EA 2FZ8A 1H1YA 3JR2A 1AJ2A 3K8KA 3FA4A 5D09A 1T96A 3AXIA 1PYMA 1KM3A 4GPNA 4AUBA 1AJ0A 1JI1A 3NXLA 3MCMA 4HYWA 4K2SA 5AZ0A 4Y96A 3ERPA 4FLSA 2YCKX 2OYKA 4O1AA 4GD0A 1XD0A 4INFA 1QWKA 3SUTA 2G8ZA 4NZCA 2QCNA 4IMEA 4Y90A 3BAJA 4J35A 4PTDA 2DY3A 4GH1A 1RV8A 1P0KA 1OZQA 4W5ZA 2BOFX 1I4NA 2BFGA 3SUSA 2DIKA 3F4DA 1QHZA 3OA5A 3U5YA 2P3ZA 3ZZ1A 1WDPA 1R2TA 2VMFA 5G1MA 3TN3A 2CBJA 2OPJA 1CCWB 5I3GA 1U5JA 4B2DD 1RPKA 4IJBA 1EIXA 3WL1A 1AJZA 1ICPA 1XPGA 1DWFM 1D3CA 4U28A 1OD0A 4P8UA 1OF8A 4UFJA 3M5VA 4IP4A 4OQVA 2YKKA 4WR3A 1EA9C 4AW7A 3P7YA 2CLIA 4JTUA 2W27A 2FMNA 3IRSA 8A3HA 5AC5A 3K4WA 1W8SA 1UYQA 1A0EA 1OHLA 1QNOA 3AYTA 4AB4A 4E5TA 3QR1A 3OVQA 2FDSA 2Z0IA 3HPZA 4DUVA 1KXTA 3MUZ1 3W1RA 3N34A 3UYIA 3P3BA 1V02E 1JXJA 5FEPA 4HU3A 3RHGA 4YPJA 1JCTA 3MO7A 3SQSA 1QPKA 1M41A 1FWIC 5AHMA 4O52A 4K7VA 5HUPA 2PTWA 1J6OA 4HA1A 4AZGA 1CLKA 1AMKA 4UIOA 4ENLA 1Z42A 2A21A 3DXIA 3ZFHA 3W1LA 1FCBA 3I10A 5AN7A 4XZ9A 4E8CA 1XDMA 1P0NA 2VOMA 3VNJA 2DGAA 1UCWA 2V9DA 2H6RA 1QNPA 3EAUA 1J6PA 4TQTA 1IWBA 4C90A 5K3VA 4DPPA 3UJEA 3T9PA 3LA4A 4HA0A 1DJHA 4Q4RA 3HGSA 3V75A 1F61A 3H6OA 3M0XA 3VOHA 4H3DA 1VBUA 3NPVA 3T81A 1RK6A 1WZKA 3W2LA 1VFFA 4RNIA 2A2IA 1N55A 3TYDA 2VURA 4ZOBA 2I14A 3T1GA 2WSYA 3B0YA 3M1ZA 4BF9A 1K8ZA 3TTSA 5AHLA 4LUTA 4O14A 1BXCA 1JCNA 2X2GA 4RCXA 3AYSA 4F0HA 3VIFA 4L6HA 4KS0A 4QEHA 1X96A 1EJRC 2YFOA 3IJ9A 3BLFA 3PN8A 3TOYA 4IWWA 1XYBA 1S5TA 2OR2A 1Z6KA 1UC5A 1K70A 3VGHA 4OV4A 3DKJA 5D04C 1RJPA 4W5UA 4FNSA 2E6AA 3VU2A 1DWJM 1HVXA 4KFPA 3OVPA 5JIPA 3GW3A 5JIWA 1J18A 4O0ZA 3WQ4A 2GGHA 3CZEA 1Q13A 2QIIA 5DF0A 1JQVA 2X09A 3EPNA 2GPTA 4MY1A 4PE8A 1LUCB 2HV5A 2R82A 4QQ3A 4ZFMA 3B0XA 3LCFA 2REQB 1SFJA 1XYCA 3HQOA 1WDQA 3QV9A 3PZMA 4AXNA 3RN6A 2OYLA 2GOUA 3BOLA 1F6KA 7PTDA 4HNOA 4LF1A 5CZ0A 1XRVA 1XC4A 4H9TA 4LX4A 2GOKA 4UBPC 2XN2A 1EWDA 1R3QA 1G69A 4MYXA 5I78A 2PC4A 4AD2A 5CPTA 3T09A 1F76A 3S6OA 1UUMA 2E5CA 3N3MA 1QFEA 3T2OA 1TJ1A 4DJDC 1DE6A 3G1XA 2W6RA 2P8CA 3JZUA 2ADAA 2CERA 4H6EA 2DSUA 3SIMA 1B0IA 2X41A 4A6GA 3PUGA 2BWGA 4M19A 4OHQA 4Y8FA 3DG6A 2J74A 1Z44A 2V63A 1QT1A 1UB3A 1WKEA 3UXKA 1PJ9A 3CL6A 1KQYA 3Q37A 4YTRA 4DBUA 3GXTA 2PGWA 3EWCA 3FHAA 1VFHA 3R2GA 3DC8A 1F4AA 1NDVA 2QAPA 4YXGA 1PKMA 1QUMA 1FKWA 3LHZA 4N7QA 4HP5A 1TV8A 2WJZA 1A5AA 3KBNA 2V2CA 2I9EA 4N9DA 1R3VA 1Z7AA 1R7AA 4JQ4A 3WNLA 3LZ3A 1S1RA 2PFHA 3CUGA 3FFSA 3WDPP 4KIEA 1DJWA 2QW5A 1H7WA 3HPFA 2HTMA 3PUDA 1NTHA 1XIIA 1OCQA 1ZGDA 3UXLA 2J13A 3GQYA 4G7EB 4Q7BA 2NUWA 3M0HA 3C6CA 1VYPX 4LGXA 4OU1A 1RSCA 1RXOB 2X1TA 3DI1A 2V0TA 1W17A 3BSMA 4IGHA 1XBXA 4EIVA 3UCCA 4D1JA 3FEMA 5GJPA 4RZ4A 5C71A 1XSIA 1FHUA 3U7VA 3L0GA 4HZ8A 3RGTA 3O0KA 4XUYA 4JQ1A 3WFZA 1JL8A 2INFA 1ONRA 1GTHA 5LA1A 1FBAA 4BI7A 2Z6JA 1QHOA 1RHCA 4K6AA 3KBSA 2WVVB 4KWWA 1SFLA 1KO0A 1VKFA 3LHWA 2PRHA 2XGBA 1WPCA 2AGTA 3TFCA 2Y24A 3B9NA 4Q7NA 1GQLA 2Z00A 2E7FA 1TX2A 4IX0A 4GJJA 4PL2A 2A7NA 2PLJA 2UY4A 3ITCA 4GJ1A 4RUBA 5FESA 4XAYA 1TA3A 5DBTA 2GVGA 4ML9A 3RR4A 3WZ0E 3F2DA 4D9PA 1QK2A 2J78A 1ITXA 1IWAA 3F5KA 4AIBA 3NQGA 1J01A 1ECEA 4HKPA 3G0UA 3N9RA 4GZEA 4FIRA 3QV7A 3IRDA 5E09A 4L64A 1SJCA 5XIMA 2PP1A 2C15A 3W29A 3PNUA 4GI8A 3VNKA 3EWDA 4EPKA 4XZLX 1B3WA 1U2YA 3ZXWA 2FHBA 1XS2A 1YLVA 1ZSXA 1GVEA 4RNJA 4HMNA 4DWSB 2CXEA 5C7HA 1TRDA 2BG5A 3UGRA 5FJRA 3VOCA 3W1MA 3IUHA 4AZCA 3ANUA 1ZY9A 4PMOA 4M82A 4TXEA 4JIIX 2QIWA 4WHBA 3SGZA 1F6YA 3NGFA 2F7FA 4WX2A 4GUFA 1X7FA 3OZYA 4A29A 2Z1BA 5CLTA 3V0SA 4HMEA 3VCCA 4KT2A 4LT9A 4MY8A 3BGAA 4UCFA 3ZVHB 4PODA 1QOQA 4TVUA 3RRXA 2DVTA 1OGGA 1NFPA 3MJYA 3H54A 4J3WA 1RD6A 1JPHA 1YIXA 5EFFA 1QOPA 4JFVA 5CC5A 1MZRA 3UWZA 2XIIA 3H55A 4NX0A 1PPIA 1EUNA 5AC4A 1ME8A 1EF2A 4S2CA 1BXBA 3A12A 1XR2A 3STCA 3KAOA 4HA4A 1J0IA 1X97A 3HGOA 3VCRA 4C1LA 3CT2A 3G8EA 1I2PA 1PIFA 4O0QA 1K7XA 4ZENA 1W6TA 2FGBA 3PBYA 3EX1A 1MZHA 1MUCA 3CS2A 4E3TA 2NWSA 3M0VA 1Q4WA 3F7JA 3QY7A 1VIZA 3CQ0A 1TWSA 3HURA 3TAOA 2NLYA 3WNOA 3TYEA 3LYEA 4CQBA 3N2TA 4X0VA 1XCFA 2BHUA 3GK0A 3EA2A 4XAFA 4MUPA 2NQJA 1CXLA 5F4SA 3GM8A 1HT6A 2GDVA 3TTQA 1L8NA 1L9WA 1M68A 3TYZA 3HPSA 4B5NA 3URBA 2D2GA 3R58A 1V8EA 2ATSA 5CSSA 1PVNA 6TAAA 4HB7A 2DW7A 1O1HA 3OO2A 5A3HA 4OOZA 3OP2A 4Y9NA 3TLQA 4XIMA 4NT0A 2QR6A 1M01A 4ZOEA 4L1XA 2B81A 4MSSA 3GG7A 4GZIA 4Q33A 5HJLA 5ECUA 3CO8A 1VRDA 1TX0A 3NL2A 3NPXA 4ACZA 4IHCA 4O8RA 4BEQA 2D2OA 2GGEA 4QRNA 1R3RA 4AMCA 3SCPA 4LUJA 4LVDA 1UMYA 3VNMA 3V7PA 5H8UA 1EEPA 2ZDSA 3JUGA 5IHRA 2R1NA 1CLVA 1RBLA 3EOSA 4JFSA 1GVRA 5F2LA 3A9BA 1W9XA 1XFCA 2WMGA 1S2AA 2Z7GA 4AVNA 3LS9A 5FF3A 1QU4A 3MUXA 1TTJA 4JYDA 4E2DA 5FL0A 2Y8KA 1GNXA 2EQDA 1GZ1A 2ZTJA 3TYBA 4UR7A 4WY0F 4IP7A 3WEZA 3AALA 4AIOA 2ZZ3A 3R8RA 3RMJA 2WXDM 1U5VA 1VH7A 3F03K 3TZNA 1W2VA 3SI9A 1RP8A 2QMJA 4GXMA 2ZX8A 3EMQA 1JQXA 3VGDA 1FHVA 4XK2A 2HNEA 1S5WA 3VIIA 4GIAA 4AZBA 4L4LA 3WD4A 4HNNA 1JYWA 1HL9A 3A5VA 2OX1A 3F4VA 1JZ8A 3HG5A 3N4FA 1NSJA 1EGVA 4LS0A 5CJNA 1XPYA 1X6LA 1TVPA 5C54A 3UZJA 3M44A 2IPJA 4GVGA 1FX6A 4CCEA 3QQ1A 1TPDA 3ECQA 3NWRA 2W0UA 1HKIA 3A6OA 1S3TC 3PZIA 3UWYA 2P8BA 3CYJA 2GJXB 2E9BA 4LXFA 3PTKA 4QR6A 1L2QA 3KP1A 3GVVA 5ABFB 4YIWA 5JBDA 1XFBA 4KEVA 1HW6A 5HR7A 1J11A 1A47A 3MCNA 1FH9A 4N0RA 2JE8A 4PMDA 1CW2A 2QJHA 1JNEA 4DNMA 2VZSA 3IJQA 3VKBA 4LJ3A 4CUCA 2CBUA 2HE8A 2HVOA 3HBLA 4WLCA 3BLDA 1XP3A 3KS5A 1YNYA 4QIUA 4ACYA 4ORIA 4N9CA 5DY2A 2XVKA 2TMDA 1R47A 3PNZA 4EF8A 1CGWA 1GVIA 4FA3A 1NDZA 2QJNA 3C2EA 1EP1A 4GO8A 1C9WA 3HV9A 2XGZA 1NDYA 3W81A 5A6LA 3GBEA 1QOXA 3NDYA 3QMRA 4IT1A 2PWUA 3MQTA 1IEQA 1XKYA 2I5QA 2CESA 2ZKMX 1LWHA 1ZP4A 1PL9A 5D8ZA 3F5LA 4MY9A 4Z2IA 4LYPA 3FGCA 1QI4A 4UTKA 1OX4B 4QAWA 3DECA 3M4HA 3CNYA 4KCWA 1J9YA 3S83A 3SY1A 2DSWA 1HXJA 2A5HA 2OEKA 3AHXA 3M0LA 1AMYA 2ICSA 5LIXX 1TG7A 4FOUA 5A6KA 4IGMA 3CZLA 4LPCA 3OB8A 5LNSA 3ATYA 3MO4A 2PDYA 2VKZG 3VIHA 5XINA 4TX8A 4FNPA 1RLDA 1QPRA 1J10A 4Q8VA 4IISA 3P62A 3EOEA 1DWGM 1S39A 3FEQA 3LM7A 4M0XA 4NYYA 4J28A 2OXNA 3TN6A 4HYRA 1YW1A 3LLDA 4S3BA 5I5RA 2X2YA 3GNDA 3O0FA 4O1FA 1F8IA 4XWUA 3ZLHA 4DRSA 3W7DA 2JF6A 3DC0A 2HRWA 2V82A 2P0OA 5AHFA 4LRTA 1C29A 3CC1A 4UTJA 1CXIA 5AVNA 3RLHA 5AECA 1DJXA 5DXXA 3C61A 1V6YA 3UVAA 3R94A 3RCMA 5AOUA 5H1WA 3KBWA 2PDBA 3WL0A 1SR9A 2FMOA 3QTPA 4HZ6A 2V81A 2Y88A 1FRBA 3RYSA 4LEFA 2HCVA 7ODCA 2OO0A 2YL6A 1VD6A 1EWEA 3KOFA 3UP8A 3NZQA 4KW2A 4US6A 3ITYA 1MW1A 1BYAA 2ACRA 4I9MA 3VIKA 4E3VA 4GYJA 1UKOA 4DF0A 3RU6A 1UC4A 1BEUA 1EA0A 2ESCA 3WYZA 2JQXA 1Q6LA 2KX9A 1UUOA 5HPCA 3ONBA 5TNVA 3EXTA 4QE5A 4HQVA 1KFBA 4AZHA 3KBMA 1HJVA 3ZLFA 2VGIA 3DG3A 2BMBA 1OX4A 4O13A 2JKEA 1QWGA 1VJSA 4L4PA 5CZTA 1XIFA 5IHSA 1K1DA 3MA8A 3NURA 1DP0A 3ARSA 3STFA 3U57A 4M5PA 1LLZA 3TTYA 2ZUNA 5LIUX 3TC7A 2JEPA 4BQ5A 5A6BA 5FJJA 1KBJA 2IUZA 1NP2A 1JRBA 1DJGA 4AIEA 3M64A 3DAQA 5I24A 3W88A 1TPC1 5GJNA 2HNHA 2ZWYA 3LPFA 1OY0A 1NWRA 2YL5A 3CUZA 1JF6A 2RHGA 1JFXA 4ATLA 4WUIA 3RX3A 1BRLB 1BYDA 2FZMA 2ZX9A 3AIRA 3S5ZA 5IDZA 1TWWA 1R8LA 2OMAA 4XZBA 2P88A 5BXTA 3WLLA 2VM8A 3KL3A 1AA1B 1YADA 2IW0A 1MEIA 3EX4A 3WNNA 1XXXA 2R1PA 4LY8A 3ZJKA 3UCQA 4HA3A 4RL3A 2VEGA 3AICA 4U5KA 1NH6A 3BG9A 3CQIA 2PP3A 3ARVA 4ZR8A 4H6KA 1JFHA 4A35A 2WZMA 4LAUA 3VUPA 2Y63A 4W9TA 1DXIA 1EDQA 2J25A 5CPNA 1M9HA 3GNOA 4A22A 1KWKA 3O6CA 5A94A 3RDKA 3N25A 3N2XA 3R1ZA 5M2FX 2R1LA 4POCA 3ZOAA 3U48A 1CX9A 4FNQA 1RY8A 3BW3A 1TPFA 3OHMB 3DOPA 3N2CA 4ILSA 1UG6A 3VDAA 4NJJA 2XHYA 2YPIA 2D69A 5DRCA 3P93A 1FP9A 1W3HA 3DUGA 4HJFA 1YNQA 3BZGA 3PP7A 4TMBA 4GZ7A 3VABA 2AOSA 1V3HA 3PBMA 3LM3A 1M53A 4IOTA 1OVDA 4QJ4B 4Q8TA 3ARUA 2QHAA 3MMUA 3WF4A 3UWQA 4M80A 1EJSC 3IJ8A 2CETA 1FCUA 3R89A 2WOQA 1F4HA 1YTKA 1H1ZA 3GH4A 4MOZA 4AY1A 2IKIA 1D8CA 3GC5A 4AHQA 3QZ6A 3RMEA 3H4WA 2IXVA 4EXQA 1PS9A 3CZGA 2EEXA 2ZZ4A 1TCMA 1WZAA 3C3UA 1PKLA 1BSIA 1XG4A 2DVXA 2PTYA 5MHBA 2HMCA 2XG9A 1N8IA 2HVNA 4CD6A 1BYCA 4HU4A 3CJPA 1HGWA 2YZ5A 3L4UA 4CQAA 4Z17A 4PTNA 3UY7A 1JG9A 2Z2BA 5LYRA 5BMWA 3HFYA 1XLMA 1TRIA 4MIMA 4QTGA 4F9DA 4D1IA 2ZE3A 5AHEA 1UJPA 1A5UA 2D2HA 3VIGA 4IIDA 1KM4A 5FEXA 1PTAA 3GNXA 3LPGA 2Q02A 2AQVA 2XIOA 3DERA 1SM9A 5BCAA 2ZXQA 1XLBA 5G1TA 5EMMA 1GT8A 3ALFA 1XF0A 3AO0A 2Y8VA 3CUIA 4YYFA 2BOEX 3KL5A 3RLGA 1MI3A 1TTPA 3NL5A 3FVMA 2OU4A 3NL3A 5AHIA 2QUVA 3CUJA 3VM5A 2VR4A 4DJDD 4MUZA 4ZGYA 3K30A 2H3BA 1Q66A 1Y65A 5A5WA 1KTBA 2A4AA 2YL9A 3IAQA 3OVRA 1O4UA 3W6MA 2OVLA 2C0HA 3IPWA 5A6BD 3UU0A 3KCLA 3GFXA 3LSCA 4B4FA 5DLCA 1H11A 2NT1A 4D6EA 2GK1B 4HMCA 3GR8A 4Q4SA 1MEWA 3UPBA 3TSDA 3L5AA 3PAJA 1XLFA 3DX5A 3WJXA 1OINA 3GZ3A 1UP0A 4DBWA 3W7JA 4S3GA 2PODA 2G0WA 1WKDA 1LQ2A 5FEZA 2I1OA 5JBEA 1IQ8A 3FDGA 3A3XA 4XZMX 4B2DA 4S3JA 4PCSA 4ICNA 4FNRA 4WF7A 2DZXA 3H2MA 4JXCA 3TJ4A 3VFLA 3D5HA 2RUSA 1VFUA 3W7MA 3TV8A 5BRPA 1UP3A 3GD6A 3WLTA 2YLAA 1Q7MA 8RUCA 5FJTA 4JTLA 4P8WA 2ZRZA 1RUSA 2BHZA 3E2QA 1K8XA 1UKTA 2OYMA 1CEOA 1UWRA 3FJ6A 7A3HA 3P82A 3SUUA 4CKQA 3S5YA 1MMFA 4F40A 4R85A 2Y0FA 4QLJA 1EJVC 1UROA 5LIKX 3EBVA 4KESA 1F74A 2V38A 2Z1WA 1SZFA 5HANA 1IIHA 1VCFA 2Z27A 2PDKA 4F0MA 3CUHA 3DHFA 3SCOA 1BG9A 4Z2KA 3CV6A 3PZQA 5CPSA 1UASA 1G5AA 1R9YA 3VD7A 1B3XA 2H3DA 2XN0A 3UWUA 4L9XA 1MYRA 4CNPA 1H60A 1RCXB 2Y6ZA 4U31A 2YW4A 4KKXA 2ZRWA 5BXPA 1E9YB 5C9XA 4BWLC 1WCGA 1GHSA 3B04A 2X05A 1Q4NX 3RPTA 4BY3A 2EPHA 4XX6A 1ZAJA 3A22A 1RALA 5F4WA 4OZOA 2I56A 4D8AA 1E4MM 3UJFA 3E1F1 2HPIA 1RCQA 1TPH1 4REQA 2PWFA 3NA8A 4E38A 1A5MC 3W7QA 3HU7A 1KRAC 2WLYA 3L5LA 4OTKA 1UMLA 1E3ZA 5EMUA 3AS1A 1WB0A 2TAAA 1BPLB 4NRSA 3W6YA 1OSEA 4NX5A 2BODX 1H41A 5E9XA 1JZ3A 4MNMA 2FTYA 4NZ5A 3OG2A 1RA5A 3H2FA 4JTHA 3ARYA 4V28A 4H8HA 3NQ8A 3AU6A 1XM3A 3XIMA 2PLKA 2D3NA 4RNFA 5J5RA 2A0NA 4NI3A 2C16A 4P7RA 2WW5A 1QASA 1RD5A 1W9PA 3FCPA 3SCWA 4XVEA 2OFJA 2H9AA 4RNHA 4GK8A 4JIEA 2GL5A 2WJFA 3LEPA 2YSWA 4MZ1A 1FWWA 4K3ZA 3KHDA 1CTNA 4ZSUA 1PTDA 4JDBA 1VAHA 4RPQA 3W1NA 2XH0A 4J4KA 3VXGA 1OZMA 2AL2A 1UA3A 2Q01A 2CBIA 5C5YA 1HVQA 5E6ZA 2X0SA 3MMWA 2BOGX 1WKYA 1IF2A 1ZQ5A 1BLIA 2J79A 3GU1A 4LNYA 4HD5A 3TQKA 4XSMA 2Y5SA 3TMLA 3O6AA 1EQPA 4LC6A 4W7VA 2GDUA 4UZSA 3FW6A 2OB3A 4UNKA 4AZIA 2PWVA 4XB3A 4LS2A 3ZT7A 4IUGA 4F0LA 3NCOA 4DJED 2CLKA 1I1XA 2G37A 3EDDA 3I3EA 4DEFA 2J9ZA 2CWXA 2CHNA 3GVGA 3WJZA 3GKAA 4AXKA 2QDDA 2NX9A 2X1IA 1KV5A 4EKJA 3TZFA 5BRBA 1UWAA 5GVJA 1G0CA 1HUVA 4ZE5A 4C6DA 2X42A 2WPGA 1ZNNA 3ITXA 4H41A 3LGDA 4HMDA 4CVWA 1RJQA 5F2MA 3SADA 2RGMA 3FXYA 3ABZA 4AWSA 3MB9A 1VF8A 3FX4A 1FVPA 2J7EA 4ZL1A 1YXDA 1YKWA 2VRKA 4TU1A 3CXOA 4NKCA 2E68A 1Q6QA 3DZ1A 2X40A 3S5SA 4W84A 4I9TA 1UIOA 4EE9A 4Q8MA 2D23A 1CXHA 3THCA 5HNNA 4NZJA 4O8AA 2E4TA 1KM0A 1YRRA 5EMYA 3L7RA 2O9RA 7ENLA 2OJPA 3PB0A 3LERA 4WY0A 1BQCA 5IBXA 2VFHA 2PEVA 4DWSC 2CZDA 3GFZA 1H7RA 4LBRA 1UWIA 3AZRA 4JPGA 2ZBTA 2IPFA 1YBQB 4O4VA 1RLCL 3OLIA 2VX4A 1GPWA 4JX6A 3E12A 3WFAA 2EBNA 1IT7A 1TFVA 3T8QA 2VX5A 4N2YA 3FIGA 4RR4A 3ZR6A 1ZBVA 3BSGA 3EDJA 4QJ1A 3IARA 1P1MA 1RVKA 2HEJA 2Y5JA 2NQLA 5FACA 1KCXA 1KM1A 3W76A 3SCQA 2A3AA 4C6BA 2WNNA 3P0XA 4DBEA 1JIBA 1F73A 1QVBA 3AHZA 3W00A 1RQBA 1U83A 5F1UA 2VFEA 5BNKA 2OKOA 4ZQRA 3WQFA 1EQCA 1PZ0A 4PMUA 3I65A 5I0DA 1GEQA 4Z1YA 1KC7A 1U1JA 3CWOX 1BD0A 4ZZ9A 3S8HA 4WSJA 2XZ9A 1I2NA 3GVQA 2V8ZA 3MU7A 3C2YA 4FXJA 1H7XA 5E9AA 2CLFA 1GOOA 3NFUA 1BTCA 5BXSA 5U7SA 1E0XA 1S5NA 1KXQA 2Y7EA 3EPOA 2WCAA 1BF6A 2NX1A 2VQTA 4OBRA 2PCEA 2NV1A 3GG0A 1WDDA 2QVNA 1V4YA 1ZP3A 1UD5A 1B57A 1O5RA 2WVSA 3W2UA 1DJQA 3KLKA 3FJNA 2A85A 3GU2A 5KZMA 1TJ2A 1UUQA 3VKAA 3LHVA 1GVYA 1F3EA 1AZ2A 3CMFA 2QEZA 1GOIA 2QAFA 1SW0A 3NPUA 5RUBA 2EPLX 5LIYX 1XRTA 1ZALA 2VJXA 1DIEA 2OODA 3W26A 1GVFA 4NRRA 4MWAC 2E67A 2R14A 3EEGA 4ZO7A 1NVMA 1NOWA 4EXBA 2VRJA 4QROA 3SGUA 1X6UA 2YCLB 3VIPA 2B4GA 1FWSA 1CI1A 3AYRA 2O0TA 5FF0A 1R46A 2P76A 1V7YA 4E4UA 3S2JA 4HNVA 2PTZA 2OKTA 3IIXA 5ABHA 1XGDA 3WLSA 3S1VA 3UFYA 3XINA 2Y89A 1CXEA 3FS2A 1ISXA 2D0GA 2XH2A 2XSXA 2O92A 4FR6A 1SZRA 2QXWA 1AVAA 4UQAA 4WOQA 4H7ZA 1FKXA 1JCMP 4GZJA 1OABA 1ESWA 3JRKA 4LQ1A 3N4AA 4PUJA 3IACA 3B9OA 1DIKA 2W5FA 3W22A 5KSWA 2AQWA 5REQA 2QUNA 3G1FA 1W0MA 3LDVA 4DAFA 2NXIA 2NW0A 2ISSA 1OG0A 4AWUA 4H1ZA 3CHVA 4G1KA 2ZZ2A 2DEPA 4AU0A 1FFQA 3GH7A 1HO4A 4WEVX 5ENLA 4WDTA 5I3DA 1SMDA 3HGJA 4DYKA 2E09A 1A3HA 3LPPA 3WSUA 3BV4A 4WOZA 2HBVA 2PDXA 2ZZ1A 1JZ7A 1TIMA 4RKAA 4REQB 5DCDA 3VPLA 3O07A 3D46A 3SQLA 2BY3A 1H2JA 4WSHA 2PTXA 4HU8A 4PUDA 2W62A 5F2IA 3VC6A 2WBGA 2PD5A 3NL6A 2PDNA 2WNZA 4JTJA 1QATA 5T26A 4DVOA 3GDLA 1F8MA 5C8BB 1ZB5A 2F6KA 4WDWA 4OV9A 4JIRA 1DHKA 3HQ1A 3IJ6A 4YVVA 2EO7A 4XZIA 2OG9A 1P7TB 2QF7A 4J9JA 1F5ZA 1LJYA 3FVDA 4DM2A 2PRLA 4M1RA 2BGQA 4FOJA 2G3JA 3CUXA 4KCUA 3H2AA 3NOEA 1IEIA 3AJ7A 3OPSA 3VINA 5I3KA 3KZPA 4CD8A 1LBMA 3U2EA 4BS0A 3WQ6A 2ZWZA 1YDYA 1UWQA 5CZSA 1NU5A 3LX9A 5A6AA 2W63A 4JKLA 5EGRA 1XDJA 4HN8A 3TCEA 1WZMA 1JR1A 3WQWA 4XISA 1VCVA 2GLKA 3T55A 3BG5A 4FR1A 2NZLA 1FXQA 3WMLA 3SDOA 1O95A 1BVNP 3AISA 2XPKA 5JU6A 3PWAA 1PAMA 1QR7A 2X7WA 2C3ZA 5EBAA 5AB3A 3PZ9A 4P7LA 4I5XA 4NYUA 4QLLA 5AY7A 1XG3A 2DZWA 4CN4A 2Y8UA 4FXSA 3EOLA 3V18A 4PRTA 3KP0A 3KTSA 4X2PA 3SCRA 2FFCA 3NTYA 4HHLA 5C9RA 2GQ9A 2VVSA 1ECQA 4CNSA 4V27A 4DNHA 2OO6A 3VZXA 4S23A 3WN6A 1Z69A 1T41A 2AKMA 2HE5A 4XZNX 1KM5A 1ISWA 1Q5MA 3MSDA 5D2WA 3ME3A 3ZO9A 4LVBA 3P80A 3GZAA 5DMNA 4HJWA 2H8ZA 3B40A 4ORMA 2VHLA 3I68A 4GQQA 3I7SA 1QW7A 2CHOA 4JNYA 1LBLA 5JQ9A 1H51A 2WZEA 3CU2A 3CH0A 2B7PA 1JAKA 3TW9A 1JVNA 2DUZA 3T8LA 4UMCA 1OFBA 4K7YA 3MC5A 3PANA 4G2DA 1XWYA 3LLXA 2ZIDA 2ZRUA 1V6VA 4UOZA 4C6NA 4DUWA 4DJEC 3FSTA 1YEYA 4ZXOA 2VENA 3ARTA 4OKDA 3CEPA 1G6CA 1GW1A 3TEVA 3W1AA 2A3HA 1XDLA 1L2UA 3N2OA 3L4TA 3OODA 4TO8A 3FYYA 1HTIA 4AWTA 3A47A 4NU7A 2J8GA 3ZVHA 3VNYA 5AC7A 4QG8A 1SZGA 1E4NA 3SJNA 1GCYA 3GLCA 3C0QA 3VIJA 2VDIA 2IKJA 3L2MA 3IUIA 3URAA 3E0LA 1GZGA 1SYTA 1DPMA 1X98A 2E0PA 1KM6A 1VFMA 4AHOA 4JN6A 2GGGA 4FNTA 3E5PA 3KVKA 4A2RA 3AMCA 2QJIA 3OU8A 3UZ5A 3UEQA 1EO7A 4WCJA 2WZHA 3CMJA 1K9FA 2J88A 3TXVA 2DU2A 2A3CA 3INPA 3T44A 3VKKA 1J4EA 4UMAA 3QR3A 4PB5A 4QG6A 1QBAA 3LUTA 7REQA 1TMLA 3NM3A 3CO4A 1MW0A 3WQCA 1S2UA 3RJXA 2GSJA 2YR1A 3QN3A 3W1PA 2TPSA 2OGJA 4RZ5A 3S2NA 1LLWA 3UNDA 4OUEA 4GKLA 1VCGA 3N15A 3WH9A 3VOGA 1PKYA 3DBPA 3PZNA 1OIMA 3W24A 3RAOA 1ZL1A 4O0KA 2FDMA 3R13A 2J7GA 1TE1A 1LYXA 2CLEA 4JFWA 4PBFA 3N9SA 1HJQA 2VNCA 5FJOA 5J04A 3TC3A 4JYEA 1UOZA 1MFVA 2W9MA 4Z08A 3G1HA 2YA0A 1ICQA 1UKQA 1ZZMA 1XRSA 1EJWC 1QCWA 4JNMA 1LZOA 4YHEA 3HGRA 1PDYA 4I7UA 3UERA 2PDIA 1WUFA 2XVNA 1H09A 4P8XA 1R5YA 2WVTA 1Y8BA 3WH7A 1VLIA 2OELA 3H2NA 3RO8A 4UQEA 5CJ5A 2NVDA 4PGLA 4FLRA 3V1PA 1E1EA 2IS7A 1GYLA 2VFFA 3REQA 2SFPA 4IF2A 5EKYA 1C8VA 1GKQA 4ADTA 4JTGA 1Y5XA 3TA9A 2BSLA 4D8ZA 3MHUA 2X0YA 1L8PA 4G7FA 1GORA 4JQ2A 4JS3A 4CLMA 2MUCA 3UETA 4QDWA 3CL7A 4MHBA 1V08A 4HNCA 5BROA 4AD1A 3UJRA 1KFEA 3GC2A 1HZYA 2QPUA 5EBUA