4LALA

Crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
368
structure length
368
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTAHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
molecule keywords Uracil-5-carboxylate decarboxylase
total genus 136
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lalA00
3WMLA 4P5UA 4GXWA 2HQAA 4IFRA 4WGXA 1J5SA 4I6VA 4DIAA 2E1WA 3AUOA 1A5OC 4PBEA 2BGNE 4B91A 3WZ0E 2FTWA 4J5NA 4QRNA 4XD4A 4KERA 3B40A 1I0DA 1ONWA 3MDUA 4H01A 3SFWA 4CQBA 3HPAA 4HK7A 4EPDC 1RK5A 2Z29A 4C6PA 1RA0A 3F2DA 2P53A 3RN6A 1K6WA 2Z25A 3GUWA 4KQNA 2WJDA 1ITQA 4WVXA 2DVTA 4CQDA 2Z00A 4GBDA 3FEQA 3GU1A 4IG2B 4C6NA 3F2BA 3OJGA 4DZHA 4E3TA 3URNA 1PB0A 4IGMA 1QXLA 3ITCA 2PGFA 3S2JA 4G7EA 1PSCA 2XIOA 2IMRA 3PAOA 4NI8A 4DYKA 3TNBA 2HPMA 1M65A 4D8LA 1IE7C 4PCPA 1JGMA 4I6KA 3IRSA 2CZVA 4F0RA 3GTIA 4IF2A 3GTHA 4BY3A 1UIPA 1YNYA 1O5RA 4AC7C 4ZSTA 4YIWA 2GSEA 3EWDA 3T8LA 4H00A 4LALA 4C6FA 3LNPA 4C6MA 4H9VA 3E0FA 4XAGA 4GYFA 4L9XA 1I0BA 1QW7A 3V7PA 1FWCC 2OQLA 2FFIA 4C6DA 1W1IE 4DO7A 3ORWA 3FDKA 2PUZA 4HA0A 2VC7A 2Q01A 2QT3A 3LU2A 4C5ZA 1YRRA 2OODA 5HMEA 2HBVA 1EJXC 1NDYA 4IGNA 4XAZA 4CNTA 4C6JA 3LSCA 2PAJA 3LS9A 3T81A 2R1MA 3GIQA 4LCSA 4RDWA 2GWNA 1RK6A 1EJUC 3R0DA 1YMYA 4L6DA 1UMLA 4LAKA 4PCNA 5HMFA 3OQEA 4H9YA 1YBQA 3C86A 3OOQA 3S2NA 2ICSA 2R1PA 2VR2A 1K70A 4C65A 1GKRA 3PBMA 2KAUC 4EPEC 2Z7GA 4KETA 4DZIA 1WXYA 2PGRA 1NDZA 4GY7A 2VM8A 2O4QA 1ONXA 3A4JA 4IQJA 2FVKA 4LANA 3RHGA 3K5XA 3S2LA 4J2MA 2GOKA 1E9ZB 3URAA 2YZ5A 3O0FA 3B0YA 5A6TC 2E25A 2WJEA 4V1XA 2F6KA 4OFCA 3GTXA 2A3LA 3CAKA 2VC5A 3SO7A 2EG8A 3E3HA 3EWCA 3GG7A 4QS6A 1GKQA 2R1NA 1RJPA 3GU2A 1GKPA 4HK6A 3S2MA 4GOAA 4C6CA 1FWBC 1A4LA 4CEUC 1VFLA 4HK5A 3FDGA 1E9YB 3F4CA 3QGKC 1FWIC 1V77A 1UIOA 1EJSC 1A4MA 3QY8A 3QGAC 1J6PA 2EG6A 4CEXC 4H9MA 2YXOA 1UBPC 3TN3A 4AQLA 1FWJC 1FWAC 4XD3A 1FWEC 4M51A 1RA5A 4ERGA 4UBPC 3DCPA 2O4MA 3MDWA 3URBA 3MVTA 1PTAA 4EP8C 3F4DA 3UBPC 3NQBA 2AQVA 4C6EA 1EF2A 1FWHC 3LGGA 4J35A 3MTWA 4R85A 4G2DA 1J6OA 3AU2A 3KM8A 4C6KA 4GZ7A 3URQA 2EG7A 3LA4A 2AMXA 4CNUA 4INFA 2RAGA 4UB9A 4PBFA 1A5NC 1FWFC 3LSBA 4DLFA 4BKNA 2HPIA 1YIXA 4KEZA 5G4HC 3JZEA 4GX8A 1M68A 4MUPA 3OVGA 1BF6A 1EJRC 2GZXA 3N2CA 3E74A 1WXZA 3E2VA 1R9XA 4C6QA 1DPMA 2Z2BA 1P6BA 3UR2A 2HNHA 1V51A 1POJA 2R1KA 4EPKA 1EYWA 3IPWA 4KEUA 4DI8A 1P1MA 3WYZA 4IH3A 2FVMA 3RYSA 2BB0A 4LEFA 1FKXA 4DNMA 3S4TA 4H9ZA 2Z4GA 3A3XA 3E0LA 4B90A 1NFGA 2Y1HA 4EPBC 4PE8A 1XWYA 4G7EB 4NG3A 1RJQA 4XD6A 4C6LA 4C6IA 1R9YA 4QS5A 2DVUA 4IFKB 4DI9A 3NURA 2DVXA 3HTWA 4BJHA 1XGEA 1YBQB 1EJTC 4XAFA 4KF1A 1ZZMA 2OGJA 1KRAC 1EJVC 2Z2AA 3O7UA 4ICMA 3UPMA 2D2GA 4RDVA 2Z24A 4JOMA 1R9ZA 3RCMA 2QVNA 2UBPC 3PNUA 3K4WA 4C60A 3AU6A 2P50A 1RAKA 4R7WA 1XRTA 4F0LA 2YB4A 2I5GA 1A5MC 2HBXA 3MVIA 3LGDA 1PO9A 1EJWC 1A5LC 5HMDA 3ID7A 3QY6A 3PANA 1FKWA 3DUGA 3GU9A 3MSRA 4V1YA 4H9UA 4XD5A 4DLMA 4LH8A 5LXXA 3T1GA 4KIRA 2ZC1A 2I9UA 2UZ9A 3DC8A 4QROA 1K1DA 4H9TA 3GIPA 4IG2A 1O12A 1EZ2A 2AQOA 2G3FA 4C6BA 1A5KC 3GRIA 1J79A 4QSFA 2D2JA 5FSDC 4CNSA 2WM1A 2ADAA 3D6NA 4F0SA 3HM7A 4RDYA 4H9XA 3A3WA 1KCXA 3LY0A 3TN5A 2Q09A 3CS2A 4B92A 2D2HA 4GY0A 4QTGA 3ICJA 1ADDA 3MPGA 1POKA 3UR5A 4LCRA 2Z27A 4B3ZA 3ISIX 2VHLA 1FWGC 1KRMA 1NDWA 3OU8A 4LAMA 5AKQA 1V7AA 4HJWA 4GY1A 1HZYA 4KESA 1XRFA 4LAOA 2PLMA 1KRBC 4WHBA 1NDVA 2OB3A 4IFKA 2OOFA 1ITUA 4RDZA 4Z42C 4GX9A 2VUNA 4GC3A 4GK8A 4ERAA 3UF9A 3BE7A 1KRCC 5FSEC 2QS8A 2QPXA 2YB1A 1RJRA 4CQCA 4NP7A 3IARA 4ERIA 4TQTA 3IACA 3NEHA 4R88A 3K2GA 2Z28A 2W9MA 3CJPA 2Z26A 3OODA 3PNZA 1V4YA 1S3TC 3IV8A 3G77A 2FTYA 4ZSUA 3F2CA 3TN4A 4C6OA 2ANUA 2R1LA 5E5CA 4KEVA 1M7JA 1V79A 3E38A 3EGJA 4C5YA 3MKVA 4LCQA 3B0XA 3IJ6A 2GWGA 4XAYA 4RE0A 5CH9A 4LFYA 3TN6A 3IGHX 2WJFA 3GTFA 4RZBA 1FWDC 1P6CA 3MJMA 3QY7A 4IFOA
chains in the Genus database with same CATH superfamily
1TJPA 4DJDA 2BODX 4XVEA 2HQAA 2IXUA 4XAPA 2PEVA 3QV6A 3CL7A 4I6VA 1A5OC 4QRNA 1DKWA 2H3BA 4DWSA 1I0DA 1V02E 1ONWA 2ZVRA 5AVNA 2DIKA 3V5FA 1DIOA 4AWEA 2CFFA 3MBFA 1XDLA 4A4AA 2J8GA 5AHFA 2P8BA 2WJDA 3VM7A 1R2RA 3GD6A 4UCGA 3CHEA 4KBXA 1AD1A 2ZTKA 1EKOA 3CWHA 4CD7A 3P93A 2D3NA 2H8XA 2DT0A 1AQHA 2SFPA 4EAYA 3A12A 4DYKA 3BMWA 4NJIA 4I3GA 1DWIM 5H6HA 1E3ZA 4PCPA 4TR9A 3OBAA 5JVLA 1REQB 4UQCA 4EACA 3CQIA 1QASA 7TIMA 2FGZA 1P0BA 1BGAA 2YXXA 1OT1A 3UXLA 3SRKA 3C56A 4IIFA 1UIPA 4CU8A 1VJZA 2DZPA 3G1RA 4Y6GA 4K36A 4IZGA 1GNXA 2F2KA 1VRDA 1DTUA 4H9VA 4JIRA 1IEVA 1SSGA 2CBUA 3AJ7A 2H8ZA 2FFIA 3FA3A 4JTIA 1VFSA 4I8DA 1QHOA 5CC3A 3FDKA 4FO4A 1Z44A 2EBNA 3E6EA 4YPJA 1YE4A 4HNTA 4ACZB 3DBNA 5ABTA 3GG8A 1ZBCA 2O9OA 1I2OA 3M0JA 3JZUA 2X1TA 2HVMA 3QN3A 2R1MA 5GNYA 1LM1A 1KO0A 3W25A 5CGMA 2CZ5A 4PSRA 1BPLB 2OELA 2ICSA 4LNYA 2R1PA 2CLOA 1R46A 1GKRA 2G4JA 1IWBA 3QLLA 2CPUA 3CPRA 1KFJA 1ZPTA 5DRCA 2IPWA 3RRAA 5A1AA 1P1XA 2B4GA 3HIJA 4O10A 1MFVA 5EMUA 1JYVA 3AHVA 5DO8A 2PDKA 4FX7A 1KQYA 4MAZA 4XZBA 5E9XA 4UTTA 4O12A 4CQAA 1UROA 4EK7A 1M03A 2Y4SA 1OYAA 5MKGA 3A3HA 2EG8A 3TH6A 1E15A 5TIMA 1K9FA 4B2DA 3VIHA 3WQGA 3ZWTA 4QJ4B 1GKPA 3S2MA 3THAA 3FK4A 3JR2A 2VI0A 2RDTA 3EX6A 3BJFA 2PC4A 3P61A 3VC5A 1SFLA 2PTWA 5CC5A 1ZJBA 1GJUA 2RDXA 2YBTA 3QY8A 4PRTA 5FF4A 2ASHA 5BROA 3T9PA 2ZUVA 1FWAC 1SO4A 2ZICA 3M0XA 5D2XA 4UTIA 2PZNA 4H8VA 1XLLA 4F9JA 3FS2A 2VCBA 1XLHA 4QX4A 4FA3A 1KWKA 3QFWA 3S3GA 4E4PA 4O4VA 5C0QA 3T0BA 1PKYA 5D8WA 3UXKA 2C3ZA 5JH1A 3M5VA 1FDYA 1WO2A 1XYAA 4DN1A 2HNEA 2FMOA 2OO0A 4K8GA 4HPXA 2DSWA 1ICQA 3OVGA 3WG6A 4E6MA 1O4UA 3U48A 4R7JA 2VOMA 3OYZA 3I65A 1LOLA 1P6BA 3SR7A 4A3HA 7ENLA 2FFCA 4J3TA 4GIEA 3SUWA 4XIMA 2YSWA 1KXVA 2NQJA 1FXQA 5A6LA 1FKXA 4HB7A 4DNMA 2WSKA 1Q8JA 3FGCB 4JIHA 4JTSA 5BCAA 1RJQA 5AECA 1HKJA 4C6IA 1GVYA 4NJJA 2ZYFA 2DVUA 2WNZA 1L0PA 3WBWA 3U5UA 3AFBA 4PB5A 5I06A 3KHJA 3S83A 1KRAC 4WY0B 3W75A 4IL0A 1KB3A 5DELA 4GINA 2JIEA 2FHFA 2YDRA 2I1OA 3RCMA 3DENA 4GH1A 2ZXBA 2VEIA 5LNSA 4F0LA 1DL3A 4MJZA 1QCWA 1C8YA 3ID7A 4HSNA 4TV5A 3MSRA 3SB0A 3KLKA 1OFOA 4JY9A 3OLIA 3UZYA 1IF2A 3E02A 2FGLA 2HXTA 1E6XM 1UB3A 3R2GA 5FSDC 2W3ZA 3UQNA 3T09A 1UW9A 3BUVA 4HA1A 1JQXA 3XIMA 5CKSA 1EGMA 3TU9A 1TFVA 4GUHA 4D6DA 5BRPA 4W84A 1AFSA 4DWSD 3UWQA 4BI5A 1KTNA 2V5BA 4I9TA 4B3ZA 1NDWA 4QE4A 2ZE3A 3TYBA 1W3KA 4AD1A 2FDSA 3EB2A 4MLRA 4U2YA 4KRTA 2DZAA 2ZRYA 5J8LA 5AC7A 4FALA 1KRBC 4C7GA 4UUIA 1TPDA 4O1DA 1B3YA 1RHCA 3VGEA 2ZX9A 2V2DA 2OEKA 3AALA 4KRUA 5HJYA 1BHGA 2XIMA 2NV9A 7REQA 4CQCA 1OCBA 5DANA 2BLEA 2OYMA 1S3TC 4PCSA 2AOSA 1V3LA 3RK8A 5IDZA 2GVJA 2G97A 1BRLB 1H5YA 4DM1A 3GHSA 2QCFA 2GWGA 2WVVB 4WDUA 4AYSA 3WLLA 1Q13A 1ZS2A 4IFOA 2IW0A 3HPSA 3WMLA 4REQB 2QJIA 1VQTA 3TVAA 1ITXA 3KL0A 5TAOA 2X1RA 3W27A 4D6JA 1WDDA 3BZGA 2YCLB 4MG4A 2P8CA 3N2BA 4NXKA 3HPAA 2Y5JA 2OX1A 1M6JA 2P53A 3I3DA 2Y7EA 1KFKA 4JX4A 3UVIA 4CQDA 2VUYA 1PKMA 4FI4A 4JYEA 1QHZA 3W1MA 2PLJA 2WNQA 1WDRA 1MXGA 1ALDA 3PZGA 5D37A 2DQXA 1A0EA 1CZ1A 1VYPX 2QCEA 4MKSA 2HEJA 1W1B1 4YLWA 2PI6A 1EP2A 3UJRA 3UYCA 4XKMA 1YNYA 3T0AA 1W9BM 1OX5A 3E12A 3VGGA 2XGZA 4A8NA 3LLDA 1PHQA 4TOQA 1G0CA 3ZO9A 3O15A 3PUEA 3AIEA 3N6QA 3W1AA 1UJQA 3BLOA 4L6HA 4ZENA 3SN0A 1FDJA 4DBUA 3V7PA 4GZEA 3BZJA 4DBWA 3S1VA 4JL1A 2VWTA 1IT7A 2Y85A 2VC7A 2Q01A 3TE9A 1GONA 4C5ZA 3BAKA 2PGWA 3WLMA 4CNTA 3LSCA 3CHFA 3CNYA 2VRQA 4IMCA 4LCSA 4B5UA 4O13A 1MEHA 3QYSA 2WCSA 4PB4A 1AL7A 4ES4A 1UMLA 3BSMA 3W37A 5AVHA 2VFEA 3WH8A 4M1RA 3C86A 2BX7A 1WKFA 3VGDA 5AHMA 3SQMA 4QLKA 3GC5A 3V1PA 2FJKA 4IMGA 3RM8A 1KTBA 1K6AA 2WAGA 1S38A 1C7SA 2D3LA 2X40A 5EFFA 3TKFA 2FVKA 3S2LA 1Z41A 4MADA 5D32A 3R7MA 2OX4A 3TR2A 2DV0A 3QQ1A 3RU6A 3W82A 1XLGA 3QHNA 3WEMA 5I24A 3HQPA 1M3UA 3HA1A 1I2PA 3TW7A 1HO1A 1SZGA 3PBUA 9RUBA 3O16A 3N11A 4YMZA 3MA8A 1UR9A 1OVDA 3NQVA 2DP3A 3F4CA 4QFUA 1V77A 3MHFA 2BS9A 4NJHA 2TODA 3U57A 2X42A 2I7GA 1JD9A 4GPNA 4H9MA 1GVOA 3NA8A 2PODA 1GPWA 1MRQA 4NX5A 1EP3A 2AGKA 2VGBA 3GNOA 3KS6A 4WDXA 4ERGA 3EDEA 1S1RA 3DIPA 1B90A 2PLCA 1K8ZA 2EGZA 3V1HA 1DJHA 2QF7A 3UCDA 1KCKA 3F4DA 3EB3A 4W5UA 4IMDA 1W37A 3WF2A 3I7SA 4NZ1A 1UWRA 4BF9A 1GW9A 1KXTA 2NLIA 3RNDA 3ZT7A 3IJ9A 4PRRA 1QW9A 4DO4A 2CERA 3UCQA 4YHEA 2RAGA 1Y5XA 4J3VA 4PBFA 2D0HA 1C3FA 5FJOA 4G1NA 3UJFA 1A3HA 4BKNA 2E6AA 3NPUA 3QZ6A 3CUIA 3YPIA 1LJYA 4E38A 1BF6A 3ARXA 3BJSA 1R9XA 4C6QA 1KW1A 1KGWA 4EAMA 1VHCA 2BBFA 3N12A 3WY1A 3NUKA 1WAWA 4HHHA 2WMHA 1JF5A 2I14A 1X7FA 2HCVA 4Z1AA 3ZVHA 4RCXA 5A8QA 1B3OA 4JDBA 3S4TA 3EDDA 3ZLHA 2WLZA 1XR2A 2XPKA 4PGLA 3VIMA 1PZ1A 1FY6A 7ODCA 3PB2A 1M7XA 3MHUA 3PHAA 1GEQA 3NO3A 4JX5A 1QATA 3H4WA 1FP8A 1TYGA 4BJHA 2ZA3A 4ILSA 1S3HA 1OHLA 1RQBA 4QIUA 5AC4A 3W7DA 3MI6A 4NJGA 1J93A 5HWNA 1VZWA 4AFYA 1KM2A 1Q6EA 1GVRA 4GRSA 4PTDA 3ONCA 4XISA 1IXOA 2J4GA 3VYLA 3QC3A 1SQ7A 3VCCA 4V1YA 5KZ6A 4JTRA 4XD5A 2OTDA 2NV1A 5A6SA 5BOEA 3CC1A 3NQ2A 3VGFA 1QDSA 3U5YA 3BLLA 4KS0A 1BYAA 2WVTA 3CZLA 4IG2A 4F79A 1NFPA 3AIBA 2Z7KA 5BOFA 4JHOA 1PDZA 1C9DA 4XBKA 5LGXA 3LY0A 3LM7A 3OZOA 3TC3A 3MSYA 1Q7ZA 2ZZ4A 1ADDA 5FCZA 1J96A 3RPTA 2E8YA 3Q45A 1IEXA 3IJLA 1TMHA 1QT1A 2VHLA 3CHDA 3NZGA 3V0SA 5GQBA 1XUZA 4Z2LA 3V5CA 4HJFA 4MWAD 2EJAA 2W27A 4LBUA 4LU0A 2VQTA 3GM8A 1B3WA 8CGTA 3WDQA 1VFFA 5M3WA 1I2RA 2ZKMX 5A6JA 4QJ5B 5C9ZA 3C3UA 4HHMA 4H7CA 4Y90A 2OPJA 3UF9A 1ZP4A 4QNWA 4B5TA 3LQLA 2YB1A 4QM1A 2V82A 4NP7A 1FHLA 4TQTA 2ZZ3A 3VD7A 1DEDA 3PNZA 3VMNA 3W7KA 5ABGA 3G77A 2FTYA 2XH4A 2ZWZA 3KOXA 5E5CA 3TSDA 1NWSA 4Q33A 4YTUA 4S2CA 1YYAA 1ZLPA 2C91A 5DXYA 3P82A 4LFYA 4Q4OA 3ES7A 3BTNA 1F6YA 4GQ0A 3L0KA 4LC6A 2VKZG 3GDTA 4JY8A 1YHTA 3L65A 5MHBA 1AQ0A 4FK9A 1TZ7A 1E4LA 3SCWA 3COTA 1TV8A 3M0LA 2BY3A 5B7YA 4H04A 2Q8ZA 3W74A 2EHHA 1SR0A 2Z25A 3GUWA 1X39A 4PMVA 1ZHAA 3WLOA 2XVPA 2PTXA 1LUCA 3NSXA 3TFCA 2PF8A 3R8HA 4YHGA 3HGRA 5FJRA 4WF7A 3EEZA 5K9XA 3L4XA 1H1ZA 2J47A 2OVLA 3VFLA 3AIRA 2XFFA 2VCCA 2ACUA 1OCJA 1ENUA 2A7NA 4QBXA 4UFJA 1K4HA 3CPUA 2Y7DA 1Q6CA 1VJSA 5A8MA 1F6KA 3QZAA 1E1CA 3LNPA 2BP1A 3E0FA 1XINA 4GVIA 3WN6A 3AQUA 2Y8UA 2OQLA 5XIAA 3KRBA 1LBFA 1W1IE 4L65A 1KGXA 3EPMA 2P0OA 4A8RA 4HA0A 3E5PA 3MJYA 2OODA 1F2JA 1TV2A 1NDYA 5A6MA 1VBRA 1THFD 4DWDA 1GVIA 4GQGA 1IGSA 4MWAB 2PE4A 1CWYA 3PTKA 1UWTA 1TX2A 1UWSA 5HMFA 2DW6A 3OOQA 1BRLA 1W9PA 2Z0IA 3NL3A 4JFWA 1WXJA 5A69A 1BLIA 3O1NA 3M43A 4GH3A 3SCQA 1LG2A 2D20A 4JTCA 1ZP3A 4E2BA 3ZZ1A 1B4KA 2A3AA 1XV8A 3QOMA 1UR8A 5IBXC 4Y7EA 4LANA 2GDQA 1NVMA 5LIXX 1E0VA 1E9ZB 4FB7A 3NYDA 1RBAA 1PWMA 2O9PA 3B0UX 1VRXA 5LGZA 2DQWA 2YZ5A 5K9DA 3SQSA 3H2CA 3W3OA 5I79A 2E25A 2W61A 1QI3A 4OWGA 3AHYA 4HMNA 3W7GA 1DE6A 1DWFM 3WK2A 4HA3A 4QS6A 3I10A 3C6CA 3R6IA 3PBVA 2GSHA 3FFSA 1UC4A 3CMGA 3CUXA 1E5NA 3QMTA 2QPSA 1H60A 2PA6A 3W2NA 4PN2A 1PV8A 5E93A 2DT2A 2POZA 1B3VA 4DVOA 4Z2HA 2Y7FA 3QGAC 2EKGA 2V5JA 1A80A 2EXOA 3F03K 4GQBA 1OQFA 2PBGA 1TV7A 3BSHA 3MT1A 1XCWA 3NPXA 3QMSA 1FWEC 4TX8A 4X63A 5DX7A 1C90A 1R2SA 1LOQA 4QDWA 4A8LA 4G8TA 3MTWA 4R85A 1J6OA 4FNPA 6TIMA 3M7WA 1CT5A 2GQ3A 3KOZA 5BWAA 4MUZA 5CZKA 3URQA 3QR3A 4MPQA 1B4EA 4GKTA 5JXQA 2YBUA 3UNTA 1A3XA 1OK4A 3B3DA 2PWUA 2HPIA 2V63A 3VOGA 3WQ8A 2XVKA 4PMRA 1S5NA 1AW5A 2VC9A 3KBSA 3TTQA 2XSAA 6ENLA 1W1TA 1W2PA 3WLKX 1HNYA 1GZ1A 1US0A 2J62A 2CEQA 3PY2A 2R1KA 2YA1A 2FDMA 2V5KA 3TMQA 3B97A 2A2IA 1JZ5A 4KWSA 1YDYA 5HUOA 1VEMA 3F1QA 1OG6A 3C61A 3CV2A 3HPZA 3NQEA 1CIUA 5CG0A 3VCNA 2PDPA 2Y6ZA 1XXXA 5DMMA 1VGAA 1R9YA 1SSDA 1D2KA 2DIJA 1NP2A 1T6MA 1KLYA 1EJVC 2Y70A 2Z2AA 5AOUA 4A8IA 4RDVA 2QDEA 3RMEA 3TX9A 4PMYA 3PZNA 4Z1CA 1TPUA 3NXFA 1XRTA 4A29A 5TBOA 5C9XA 4MNJA 4Q4MA 2GGHA 2G37A 2VELA 2XVLA 4IQEA 5JH2A 4J4KA 2X2GA 3UCCA 1UD5A 3HJEA 5H91A 1RVKA 6TAAA 5D30A 3ANVA 4BHYA 2UZ9A 2DFAA 2VX6A 1J11A 2ALDA 3OO2A 4D8AA 3M1ZA 4Q4KA 3DFOA 1K8CA 4XG1A 4J2PA 1XKJA 4H9XA 3AWNA 2VOTA 1A5CA 3DG6A 1WPCA 2EPLX 1BSLA 1BGGA 3L4VA 4AEFA 1K9EA 3CUJA 1OC5A 3B8DA 1Q6RA 3IJ7A 4B5WA 4P2VA 1FH7A 2QGYA 1GYLA 4ZB0A 2XM2A 2V3EA 4Z42C 1BXCA 2NZLA 1EYEA 3CYJA 1ITCA 3A5FA 4JBRA 1H7XA 1SPQA 3P74A 3QPYA 2ISSA 3WSUA 4NVTA 3LCHA 1J8VA 2VZOA 1RUSA 4WIWA 2PP0A 5I5RA 3KBWA 4B2DD 2BG5A 1O5QA 2Z28A 2Z26A 1HW6A 2J78A 3IV8A 3H2AA 2P5NA 2ACSA 4YWSA 2OWWA 3EGJA 5G2WA 5G2IA 3TYAA 4I7UA 4QLLA 4E0CA 2ZE0A 2C1HA 2WC4A 2E67A 2OSYA 5ABFA 2OSXA 4FLSA 3M9YA 2FHCA 4F8XA 3EWZA 3G1DA 4PBEA 4ZL1A 1TTIA 4XD4A 2NUWA 3MO4A 4KERA 3O8AA 5CLTA 5D2WA 4W89A 2VGFA 4AD0A 2J25A 1YDNA 4D6IA 4LUTB 3B8VA 1Q2RA 3W1NA 4QGCA 4ZQPA 1VFMA 5CZSA 4MFDA 3EWUA 2WO5A 4IG2B 4P8WA 1HTIA 4BCEA 4P8XA 3SGGA 5EMYA 3T6CA 3LX9A 4BR1A 4D6CA 1I2QA 1JYXA 3NO1A 2Z2UA 1E3XA 3S2JA 1UD3A 2WPGA 4FNRA 3TNBA 1C92A 3N2XA 4XIAA 4GBUA 2P3ZA 4QNEA 3E2QA 4AEEA 3R13A 2E6DA 2OCZA 1IZKA 2O0TA 4AZCA 3DERA 4H00A 1Q8AA 1LTDA 4GNVA 5BRBA 4RZ5A 4Z2KA 3TK7A 4WJEA 2I9EA 2A3BA 3TOPA 3MB9A 4O54A 3GXIA 3TDFA 4XAZA 2ZADA 3MZNA 1PEZA 1YX1A 3B4YA 2QR6A 1HUVA 5DLCA 2XG9A 3UT0A 3WELA 3A9BA 4JQ3A 4L1GA 1XLEA 2C18A 3LZ3A 3FCPA 1AMKA 4HP5A 3H6OA 4EPEC 4DY1A 3LERA 4Q4RA 1GOXA 1GCYA 3DU0A 2PDBA 3A4JA 1SO5A 2PB1A 4HU4A 4GIYA 4A3YA 3FSTA 4PSPA 3TUUA 2D22A 1XIFA 1IWPA 3WQFA 3KE0A 4DF0A 3WL0A 3NDZA 1GHSA 3SADA 3B8UA 4UR9A 3HGSA 4Q8UA 4TXEA 3UJEA 3C0LA 2DH2A 2QCDA 1ZQ5A 1JULA 3GR4A 2CLEA 2JFEX 4HK6A 3BARA 1QI4A 2ISWA 2GSJA 2PMQA 1E1FA 1M53A 3V36A 2INZA 3ZXWA 4NAFA 5EMKA 2Z1BA 2J13A 3ME3A 1LRQA 4O17A 2E40A 2J9YA 2J27A 3CIVA 3Q94A 2JE8A 2VEFA 4MKNA 3K30A 3L4TA 4LJ3A 3UG4A 4LS2A 1J01A 3MY9A 5KETA 1K3UA 4O1AA 4CU6A 2PDUA 1RCQA 3FVMA 1G4PA 2W4XA 4UTTC 3KZSA 2PDFA 4H6EA 3LEPA 1IXPA 4CVUA 4IPJA 3WFLA 4G56A 4GZ7A 2OYKA 4JS3A 1VEPA 4HMCA 1LDCA 3N2MA 4INFA 1QO2A 4JEQA 1WP6A 4KT2A 1GOQA 1UOZA 1CBGA 3GB6A 4RZ6A 5H2ZA 1E56A 3GBDA 2CLFA 3ARQA 3WL1A 1WXZA 3W0KA 1MVYA 3POHA 4OOZA 4J3XA 1JI1A 1O5XA 3IRDA 3LHVA 1R86A 2FPYA 4DJEC 1D7KA 1ICPA 3GXTA 1OYCA 2NUYA 2QUVA 3QBUA 4LF1A 1H7RA 4MAVA 3UG5A 4GD0A 3I4KA 3MV11 4ECLA 2FVMA 2VGGA 1OF6A 2V5CA 3RYSA 4LEFA 2ABAA 2OQYA 4E2VA 4YYCA 2IQTA 3H55A 2VZSA 4E8GA 4DBDA 2QCNA 1E6NA 3FOKA 3M0MA 1FXPA 3ATZA 5HNTA 5BRQA 1KM3A 1M01A 3BAIA 3CH0A 4EOUA 1ZZMA 1XD0A 2NQHA 2R82A 4ZO7A 2J79A 4NAFB 2G0WA 1LWIA 2D2GA 3ARYA 4NSBA 4DUOA 1OWQA 4HNCA 4JOMA 4RE2A 2ZRWA 2RFGA 1HP5A 1B3ZA 3LMZA 1OZQA 4OJYA 4DF1A 1XJBA 1KC7A 3H2OA 4LB4A 2CBJA 1B0IA 4QLJA 2R91A 1NELA 2OG9A 2VR5A 2OKOA 2WSRA 3VKBA 1PHWA 4R27A 3QY6A 3W1UA 1TPWA 4IIBA 1EC7A 1J0ZA 2JEQA 1HIZA 4I5UA 3VOIA 1EPVA 5IBXA 2QV5A 2ZZ7A 3U7BA 5G1MA 3W70A 4JTLA 3S0CA 1A5KC 4CD5A 5EMMA 4U31A 3SSZA 4QISA 1LRNA 2WMJA 1TCDA 3CV6A 2H6RA 4NY2A 4QTGA 4RLIA 2NX9A 2WB5A 1JJKA 1S39A 1AK5A 2V2HA 3MPGA 1KBJA 4LCRA 2O7SA 1RBLA 3A9IA 2VXNA 1VF8A 1KM0A 3BJTA 5AHNA 2PFHA 3GH4A 4IIEA 2GPTA 4IPPA 4JQ1A 5IFTA 3ZWSA 1J0IA 2ZWYA 2QKFA 1L6FA 4AF0A 2VVSA 2YCJA 2VUNA 3RM4A 1GYNA 1RPKA 4E4UA 1W3NA 4X2RA 3LI1A 3EA1A 3LPFA 3SY5A 1MW2A 1SVDA 1JAEA 4UMBA 5T8GA 1UZDA 2VD8A 2X8RA 2W9MA 1ME9A 5FAJA 1V4YA 3LPOA 4D9PA 1XSKA 1TPC1 5B7ZA 1R7AA 3W2JA 2OZTA 4CN1A 4P7RA 2W5FA 3HF3A 3CAVA 3LHUA 3IGHX 4Q4PA 7PTDA 1JGIA 3B04A 3UZJA 1H50A 1NM9A 1CGTA 4LUYA 2ON3A 3ARVA 1Q2SA 3VIOA 3EX1A 2DZVA 2RGMA 1G4TA 3GDLA 1A53A 1UQYA 3A4WA 1J0HA 5M17A 4L61A 1RK5A 4LC8A 2OSWA 2VMFA 5D33A 2Z1XA 5B80A 4HN8A 4GGBA 3W85A 1GVQA 2VENA 1FCBA 1ZBWA 5U7SA 4LVGA 1E9LA 3LI0A 1JNDA 3LHZA 4HU3A 1Q63A 2A5HA 3PAOA 3TYZA 4MOZA 3AIWA 1OIMA 3BGAA 5E09A 1M1BA 3MANA 1DQWA 3WBYA 3SUUA 1TE6A 3IRSA 3LRLA 3KEHA 3GTIA 3EB4A 1JRBA 1W5NA 5FJJA 1VAHA 1OB0A 1XW8A 3TP4A 4C6FA 1EDQA 2GGJA 4XAGA 2CLMA 4GMEA 4Q8PA 4JPGA 4Y9OA 1JFHA 3TYEA 3CZ8A 1ZTVA 3ORWA 4OVXA 3LM3A 4GG9A 2DORA 3VD9A 2QT3A 3FKKA 2AGTA 4HZ7A 1OGGA 3LS9A 3HB9A 1VHNA 1KM5A 2XZ7A 4ROPA 5CPNA 1PTDA 3Q67A 3LCFA 1DWAM 4IOTA 5KZMA 4ZFMA 4W8BA 4ZOCA 1WXYA 3BAXA 5FD0A 4L4OA 5A2BA 3BPWA 4GISA 2J7BA 1R3VA 1WKEA 2PDXA 2QUTA 4ACYA 4F40A 5DMYA 4WQ6A 4NKCA 2IXVA 2AL2B 1JDAA 4AU0A 4J40A 1G7UA 4UTFA 5C70A 3JRKA 3S9ZA 3SJNA 5T9BG 3UWVA 2NT1A 1O68A 5T9CE 1FTXA 3I7QA 1H41A 2WW5A 1PVNA 1O60A 3DKJA 4L1WA 1BVZA 4GOAA 2WC3A 4C6CA 1R3SA 2PDCA 2Y2WA 4MNLA 1PBGA 3KBNA 3P67A 3AOFA 3CBWA 2X30A 3TC6A 5M03A 3ECQA 1U1JA 3VNZA 8XIMA 4QE5A 3N15A 4M51A 4AWUA 2FZMA 5TD4A 3ZQ9A 3O6AA 1U5HA 3W2KA 4NYYA 5I3IA 5CPSA 1NWTA 2W91A 4UTHA 4FF5A 1OYBA 3BG5A 4HBKA 3S9YA 4EWND 3WQPA 1TRIA 1XUUA 3LOTA 5LYRA 4G2DA 5AYIA 1Z48A 1Q6GA 1Q6FA 1XIDA 3AS0A 4TMCA 4C6KA 4KWUA 1C93A 3U6WA 1ONEA 5HMSA 1S5MA 5JBEA 4AIUA 4DAFA 1TRDA 1FWFC 1XYCA 3IIVA 3ITGA 4TU1A 3NQAA 3N9SA 4BWLA 1SMAA 3RJXA 3JW7A 2VFFA 6XIMA 3STPA 4O1EA 3H23A 4JR5A 3W7EA 1W56A 3TTSA 1E40A 4MGGA 3M0IA 2AL2A 1J2BA 4NNAA 2CXEA 4S23A 1WX0A 2YBVA 3BURA 4B90A 3AWOA 3TJXA 1NFGA 2PS2A 4PUDA 2P3EA 1XIJA 4GFSA 4XD6A 3UR8A 4HTBA 2XFRA 4J3SA 1A5BA 4NX0A 2OKTA 4IUOA 3HTWA 5I3DA 1HJWA 1UKTA 4KWVA 2ZA1A 1UR2A 4UMCA 5EGRA 3RCYA 4D1IA 1C7TA 2JQXA 1G4EA 1TTJA 4PMXA 1F9CA 1P0NA 1L2UA 5CEWA 3M16A 4JN6A 3LD5A 2WMFA 4FPSA 1LF1A 2QJMA 1FVPA 5CQ1A 4K8EA 1UCWA 2XHYA 5E0CA 3SZ8A 4ADUA 3H2EA 3UZXA 5MKGB 4OBTA 4A35A 2PDGA 2XIBA 1E4NA 1P0KA 4AY7A 1CGVA 3VO0A 3W71A 4LUIA 5EB8A 2GGGA 3Q4DA 1PZ2A 3G18A 4P7NA 1Q6LA 3WBEA 3APGA 1H61A 4GXMA 2Z27A 2YIHA 4UQDA 1W1ZA 2QAFA 3WUFA 3DDMA 4BS0A 4YXGA 4IJCA 3NVTA 1HKIA 5PTDA 2PWHA 3D5HA 4JQ2A 4JN7A 1EXPA 5FKYA 1A5SA 1PCWA 3TYUA 4GC3A 3OPSA 3V18A 2QS8A 3NZRA 3PBWA 1WKDA 2VFDA 3EMCA 5D04C 2E1DA 4H7ZA 2OYLA 3PB0A 3B05A 3ONBA 1T99A 1LLOA 4ZSUA 1EB3A 1M7JA 4JYFA 2GGIA 1C29A 4RV3A 4Z0JA 3IJ6A 3AO0A 1EUAA 1O6IA 4WCJA 1UH4A 1GG1A 2REQA 4FLQA 4NIRA 3LPGA 3TN6A 5HA7A 3GQYA 3QKEA 1V6XA 2DZTA 1XQKA 4U5IA 1VLWA 1BTCA 2BFGA 2DZUA 3T08A 1XBXA 2ZXAA 2WOQA 1LG1A 3BSGA 1MSSA 3VX0A 4HPHA 1TUFA 4XSLA 4AZ5A 4GUJA 2VEMA 3NPVA 2C14A 3UZZA 2F9RA 3HOJA 3L0NA 4CCEA 2YL5A 4UC5A 2DZBA 3R8GA 3J7HA 4DZHA 2E68A 5FF2A 3KWXA 1BKHA 4Q8VA 3G3DA 3RR1A 4GUIA 3LXAA 3ITCA 4WD0A 3T0DA 2XIOA 4GLEA 2CHRA 3ABRA 1M5WA 3GXFA 3NQ8A 3ANUA 4HYRA 1O7AA 2POTA 3BXWA 3VGHA 4HMDA 1GOMA 3GVWA 4OIFA 2QUNA 4BY3A 2BV9A 3GNRA 1FA2A 4AC7C 1ADOA 3T8LA 1WUEA 3UFYA 1W1A1 4J1OA 3AZTA 3L23A 2TYSA 4QG6A 2A7PA 4HN4A 2QJJA 3AYVA 3P8IA 4KCVA 2E77A 2NQLA 1R87A 1YW1A 1VR6A 3SY8A 2KX9A 4K7VA 4HOZA 4JGDA 1R7OA 4KCUA 1CECA 4PMZA 3LRKA 3V75A 4B5VA 3OGRA 3VDHA 2UY4A 3AIVA 1W2VA 3S2NA 1ELSA 2I17A 2VURA 2ALRA 2B31A 2B0MA 5REQB 4O4WA 4UTWC 1ECQA 3EKZA 4ORMA 2G95A 2VM8A 2NX3A 3W88A 2OU4A 4C1LA 5BXTA 1MUWA 5A94A 5A3HA 5LIKX 3ZLGA 1EWDA 2ZVIA 3GVVA 4UTMA 4DUWA 5C2XA 4PUUA 3WD2A 2NVDA 2Y7GA 1D8CA 3VKKA 1Y65A 2Z1KA 3L4WA 5IHSA 1K7EA 1J0YA 1BWLA 2VL4A 1OG0A 3S46A 3WLSA 3SY1A 2XIJA 2WBKA 3DFQA 3A4XA 1GT8A 3QYQA 1VFLA 4ORIA 4CD8A 1X38A 1K03A 3BLPX 1OM0A 3TAOA 4DYJA 1DBTA 4TIMA 1TWDA 1U2YA 1F76A 3OBEA 4K3ZA 1TVPA 4HT3A 4QDMA 4DXVA 1CXHA 3VTRA 4AX6A 1UBPC 4PMQA 5HULA 2NSOA 1V6YA 3SSJA 3IIPA 4L1XA 3SGZA 3ABSA 2QDDA 3S1UA 1FH8A 1WDSA 2GQ9A 2VEGA 4TV6A 2CLKA 2YLAA 1EH9A 5AHIA 4E2DA 1QWGA 3PS7A 1PPIA 1FWHC 1UYQA 3K1GA 1Z8AA 4PZVA 1FHDA 5D03A 3Q65A 4N7QA 5CJNA 3ITYA 5I77A 1W9XA 4J28A 3GHTA 3M0ZA 5AHLA 3KWSA 1DYSA 3AYSA 1Q7QA 2YA0A 3JZEA 5AN7A 2VZVA 1QFEA 3VGBA 3T42A 3VZZA 2HJPA 3E74A 3E2VA 1HJQA 5M2FX 2ZFAA 4BFAA 2GQAA 3I3BA 3MKCA 4EPKA 1V5XA 5HK4A 3WJYA 2YPIA 4TVDA 1P1MA 3EMQA 1W3JA 4KW2A 1ZSXA 3EX4A 3CQ0A 3HURA 3P62A 4F66A 3SUVA 9XIMA 3PSVA 3ZVIA 4PE8A 4MJ4A 4G7EB 1XG4A 4NG3A 5I03A 4R53A 3E0VA 1U30A 4DI9A 3IAPA 3TTYA 5BYWA 3AMLA 3IUIA 1A5AA 1KTCA 1ZJIA 4X0NA 2H9AB 1IT0A 4XQ6A 4MWAE 1T96A 1X7IA 1XRVA 3TCSA 7TAAA 4F2UA 1P48A 3GXDA 2YB4A 1A5MC 2HBXA 3PJXA 1P0EA 4KCWA 2VC6A 4X9YA 3R10A 2DZWA 2CLLA 1MQRA 2PPGA 3AZSA 2QVHA 5IRPA 4H8HA 1M9HA 4M0XA 4UZUA 4YN5A 2IKIA 5CPMA 3CMJA 3PPFA 3HPFA 5LXXA 3WLIA 3B4UA 4GFIA 4AHQA 1E5JA 3AIUA 4XUYA 2ZX6A 3R43A 1JZ4A 3RRXA 4FSAA 4W7UA 1T5AA 4JTGA 2C1GA 4MB4A 3IGXA 3TW6A 3ICJA 1KR0A 2BSLA 5H8UA 2PC8A 3UR5A 3CU2A 3L67A 2OZ8A 4FP1A 1EGVA 2J8TA 3TQVA 1CYGA 3OU8A 1ZGDA 4HJWA 4FAMA 3TJ4A 1EX5A 2P1FA 4WHBA 4JHZA 4IFKA 4I7VA 1TZZA 3NOEA 2AKZA 1IGWA 4FNQA 1EHNA 3ENLA 2YXGA 1U22A 4AVNA 4Q8NA 1LWHA 3IARA 1AL8A 3ZFHA 3GHRA 1UKSA 2GYIA 2WSQA 1D3CA 5C7HA 3CJPA 4D71A 2ANUA 4AAJA 5LIUX 2QXWA 4GE8A 2E3ZA 2R14A 2JF6A 4A22A 1NQKA 3R58A 4XAYA 3I4EA 3CO4A 4U3AA 1JCMP 2WJFA 1FWDC 5AZ0A 2DZSA 3WQOA 4YTSA 2HK1A 3LQGA 4IFRA 4MSSA 3AUOA 4Q32A 2TAAA 2RGLA 4GUFA 3HQNA 1OFBA 3GFYA 4AVFA 2OZ3A 4RV8A 4L4PA 1JCJA 3QKZA 3D47A 3U9IA 8A3HA 1CW2A 4CQBA 1JCLA 5FAGA 4HOXA 2ZC8A 4NRSA 4C6PA 2OEMA 5HNRA 1H51A 1KV5A 1Z6KA 1V0KA 4YYFA 4C6NA 3F2BA 2R6OA 2E6YA 4DJDC 5C71A 2PTYA 3N19B 3THQA 2QZRA 4NAEB 3URNA 1O5KA 3AXXA 1YLVA 3KHDA 4TO8A 2EEXA 1UG6A 1XH2A 1JCYA 4UR8A 3KL5A 1US2A 4EF9A 2VYOA 4MF4A 3STFA 1V03A 2AAAA 1CGYA 1DIDA 5BZAA 3N4FA 3I68A 4QITA 1Y0EA 2EPOA 4D6HA 4XKYB 3D3AA 1TJ0A 1WYIA 3ZYZA 3TJIA 3S42A 3FJ4A 1BEUA 4M7TA 3VK5A 4DEFA 1ZY9A 2V68A 3LU2A 1YRRA 4ZQNA 3BC9A 3NTYA 1V93A 5L9FA 3CK5A 3EWBX 1L6SA 1JPIA 1RK6A 3WNOA 1YMYA 3MUZ1 3KBMA 1QHPA 1V7YA 1OADA 1V0LA 4GC4A 4UFIA 1UD4A 3C8NA 1H2JA 3IK4A 2Z7GA 2V5LA 3CYVA 2PGRA 4NAEA 3VI2A 1VPXA 1EUNA 3DECA 1EDTA 3C4UA 3L5MA 3L68A 5HAOA 1QK2A 3RHGA 2D24A 1WZLA 2CZEA 4UFLA 4D8ZA 1P0DA 2PTZA 4ZODA 2HWGA 1LL4A 2PWVA 3TSBA 3GX9A 1K8XA 4OECA 1MW0A 4P8UA 4GYPC 1TA3B 5AC6A 9CGTA 4V2XA 1WOAA 1W6TA 4W86A 3GG7A 2ZZ2A 1K02A 2VX7A 3KLLA 3FY1A 5CPOA 5HBFA 1A4LA 4P7QA 1HVXA 4JTDA 4JQAA 1CLKA 4UTLA 2WBGA 1RPXA 4JTEA 1FWIC 4QSHA 1EJSC 2QCHA 1JQVA 4DBEA 1QOQA 3ERPA 1DJXA 1UWIA 5F1UA 1SJCA 2CLHA 3TTEA 3VA8A 4HHLA 1N55A 4M82A 1H7PA 2ONEA 3W53A 4LUSA 3MVTA 4REQA 1PTAA 4EP8C 2H3DA 1C8QA 1F7BA 2B7PA 1NQ6A 3TYDA 3BLKA 2YDSA 3ZIZA 3ARUA 2PTDA 1W1PA 2CKRA 1MUMA 4ZXLA 3P60A 2GJNA 4BEUA 2C15A 4YVXA 1U33A 5JIWA 1MW3A 1AZ1A 3T07A 3USZA 3LXBA 1V3HA 2JF7A 1W5MA 3W29A 4F2BA 5EFDA 3L0GA 1TTQA 4M5PA 4IWWA 1XIEA 2WV8A 1R2TA 2ISDA 3DFHA 5HINA 2Q8LA 2HSAA 3UZWA 3WBAA 4LY8A 4AD3A 4DYEA 1HGYA 1QPKA 3UVAA 2GFTA 4TX6A 4AXKA 2NV2A 2Q8XA 2ZDSA 1UASA 4PCFA 4AZ6A 3KDNA 3FXGA 3MUCA 4PRWA 3HBLA 4H41A 1HL2A 3CZEA 3FHAA 3W1TA 3OA3A 3QLDA 2W63A 4GYKA 1Y8BA 3MMDA 4XVDA 2J9XA 3VVGA 4JIQA 1ZBVA 4XK2A 3BWWA 1BXBA 2JKAA 3GE7A 4YU1A 3SQLA 3AU6A 3Q58A 1ML1A 4JTKA 1FWSA 1OX4B 2BGSA 4DPQA 3BH4A 3NWRA 2I5GA 1W17A 3S1GA 1ZRQA 3APYA 1F3TA 4AF0B 4W87A 3PJTA 1MNZA 3B03A 1JDEA 2VT0A 4XBJA 2YDAA 4S3DA 3ZSSA 1YDOA 1CDGA 2CETA 2WNWA 3ABOA 1L9WA 4KPLA 1HF6A 3P0XA 2P10A 2NUXA 4Y9NA 1L8PA 4TTGA 2G3FA 1EEPA 2PDWA 3K4AA 2PDIA 4GA8A 1OFEA 3NVDA 1TWSA 4O18A 1OY0A 4RL3A 3B9EA 2CITA 4J9JA 3QFEA 5BMXA 1VC4A 3ZT6A 1POKA 3IUDA 2WZEA 3WJWA 1E55A 1FWWA 3WLNA 1UQZA 1A3WA 3LMYA 4Q3MA 4H6KA 4CNOA 4CD4A 2PDLA 3W76A 1R6WA 1X8FA 2G3NA 2PBOA 3W7HA 4JEJA 3JUGA 4NL1A 2OB3A 3FNDA 3NQCA 2JBMA 3C0JA 2A6LA 1BFNA 2WVVA 4X60A 4GX9A 1L2QA 4NNCA 1Q4NX 1RP9A 4RK8A 3DHFA 2WHMA 2PCQA 3W7LA 4BQ5A 1RCXB 3H2NA 3FIGA 2J88A 2WMGA 1S5TA 4ERIA 1X1NA 5CXPA 3NQ7A 3VKJA 3M0YA 2FKPA 1QNRA 3W7PA 2QW5A 3BV7A 1L6YA 4AZ7A 2C0HA 3K46A 3FSUA 2XDFA 4RE0A 4HPGA 3DFTA 2V3FA 5I3JA 4PUNA 3VNKA 3NDYA 4GJIA 3F7JA 1KD0A 5DQPA 3T4WA 3GTFA 4RZBA 1QPOA 4P5UA 1SZNA 1NF0A 3GK0A 3A13A 3BW4A 1IEWA 4PTNA 3M5ZA 3W6LA 3MUIA 1GK8A 1BQGA 3VIIA 1JUEA 4WY0F 4CLMA 1XLBA 3T2PA 4QQ3A 3P84A 1FBAA 4O11A 3FAXA 1R85A 1TREA 2J7EA 1J5TA 3MCNA 4C1NB 4C7DA 4LPCA 1XYLA 2VFHA 1AODA 4ICNA 4HHPA 1Z3NA 3CTLA 4WXYA 3VU2A 2O9TA 3NPWA 2VNCA 1GYMA 4QE1A 4GQQA 4S3GA 2IUZA 1B57A 2EPNA 5LA1A 3DFSA 1DJWA 1YPXA 1H4PA 4I5XA 1OF8A 1KCZA 4GNKB 4MY9A 4WGHA 1P43A 3BAWA 1WUFA 3NQDA 1S5WA 3V16A 4I5RA 1TPFA 1DJGA 1W0MA 2CZVA 3QV7A 2CIPA 2R24A 2J7CA 4O1BA 4ML4A 3NO5A 3ITVA 4KFOA 1IYXA 4D6GA 2PP1A 1CLVA 1RY8A 1TE1A 1H7WA 4C6DA 3GDRA 3ITXA 3OG2A 3AAMA 4QR6A 1LZOA 1PZ3A 4DELA 1EXBA 4O15A 4LTSA 2QMKA 1QR7A 3QM3A 3BLDA 1K77A 1RV8A 1N82A 4D2JA 3VOHA 1B9ZA 2J6VA 5CSRA 4XTIA 3C2FA 4WUIA 2WZIA 5JUVA 4KH2A 2J74A 4B3LA 2YDQA 2ISVA 2G8ZA 2YCKX 1NDZA 1W91A 1NSJA 3TYCA 5EBUA 1D8WA 1ONXA 3NJ3A 3B8IA 5GNXA 4HVXA 3BV4A 2YKKA 3VOFA 6REQB 2X0SA 3PTDA 4V28A 4W8LA 1TJ1A 2WLYA 2WWDA 1KKRA 4C1NA 2IKJA 3RFAA 1KM1A 3BCJA 4OOUA 1YE6A 5LNUA 2A3LA 3CAKA 4MZYA 1VFUA 2BY2A 2VC5A 5LSMA 1F3WA 5E6ZA 3SO7A 3T55A 3EWCA 4BQ4A 2R1NA 1PIGA 1RJPA 3GU2A 4IX2A 1OFRA 3WF0A 1LROA 4U3CA 2B7OA 4O53A 1S2TA 4JIIX 3CT2A 3CUGA 2EO7A 2ODOA 1QUMA 1Q5MA 1JZ3A 1TPVA 3BCDA 5A6KA 1GGOA 2OLSA 4HYWA 3WEZA 1TPB1 5LNVA 1PE1A 1YQ2A 3NIYA 4WSKA 1K7FA 1ZCCA 3CUHA 4FXJA 3DCPA 1YTDA 4GVGA 2O4MA 1DHPA 4AD4A 2QJHA 1LOSA 3VDGA 4L56A 4C91A 1QTWA 1AUSL 1GQKA 3G6LA 1XLDA 4UQBA 5FOOA 4N6FA 4L6OA 2ZOXA 3OBKA 3LENA 3TZFA 4MB1A 3T0TA 1CEOA 1YEYA 1E9IA 4H8NA 1GWJA 1JIBA 4MUPA 1CCWB 3IAQA 1QU4A 1QNVA 1UD8A 2HVNA 2A0NA 4CCCA 3HG5A 4IXXA 2FIQA 2Y88A 1PX8A 4ZQOA 2ACRA 5M5DA 5IM51 3SEPA 3TONA 3A24A 1CPUA 4OZOA 1LQ0A 4WLCA 3VX1A 2YYTA 3OW1A 1CGXA 5CC6A 1GVEA 1QPNA 1XX1A 2Z4GA 3KP1A 2B7NA 1VYRA 4MM1A 3KXQA 3WUGA 2XIIA 3K1DA 5REQA 1XL9A 5FEPA 5IHRA 4IFKB 1DVJA 4GCXA 1D7FA 3SRDA 2E7FA 3QPEA 4UOZA 4NRRA 4BWLC 3VE7A 3NCOA 4HU0A 3PBGA 3PNUA 3B8SA 4C60A 2ACQA 1E0TA 2PCEA 4LXFA 3VKCA 4EVZA 1LLZA 1F5ZA 1EJWC 3BOXA 1H7NA 4GIAA 2YCIX 4R5EA 3GU9A 3UW6A 4DAIA 3OLGA 3S8HA 4HZ8A 4DF2A 1UP2A 5CGQA 3DC8A 1QVBA 4JDYA 4HMEA 4C6BA 4EXAA 1LCOA 2FTPA 1D9EA 4DRSA 4AXNA 3E0IA 2ADAA 3KW3A 4PODA 5AYBA 3G2GA 3VNIA 4LW7A 4IX0A 1GORA 3CS2A 1MFUA 3N18A 4PMUA 3WQVA 4B92A 1KA9F 1JCXA 3R12A 4K68A 1VBUA 4CNNA 3WQ4A 1A0DA 3N4EA 4WX2A 2V9DA 5I02A 3VPLA 2X2YA 4KESA 3MW7A 1WDPA 4S3JA 1NDVA 5ABFB 1XIIA 5C8BB 5H8MA 4UTKA 1ZBKA 4DJEA 4GO8A 2WJZA 1IXQA 3HO8A 2MUCA 3AI0A 4UXDA 3HGOA 5DBTA 3GKAA 2F84A 4PUEA 4JFSA 1TPEA 3SURA 1JF6A 3CV7A 3OODA 3L66A 4IXHA 4GACA 4ZB2A 4NZ4A 3NEVA 4XX6A 3UPWA 4ZZ9A 1VB9A 3B0XA 4AWSA 3NFUA 1RZMA 1V3IA 4CQ9A 3GDKA 1IT8A 4GUGA 3GVGA 1NIUA 2CBVA 3AMCA 5AYZA 4BQ2A 2FHBA 5K4XA 1RR2A 2E1WA 5FA5A 1V08A 3PPHA 3UXIA 3CV1A 1AMYA 2ZX8A 1TMLA 3WEOA 5TNVA 2VO5A 1C8XA 1EA9C 4OBRA 3PPCA 1KBBA 3SFWA 5C54A 3BK0A 1SUXA 1AQMA 2FH6A 1P7TB 3RN6A 2W92A 3AXMA 1TJRA 4FR1A 1J4EA 4OUIA 1V3KA 2EJ1A 3FEQA 1G4SA 3WJXA 2Y0FA 5BNKA 2PDQA 1E72M 4WOZA 3O6DA 1JL8A 4Q22A 3WFZA 4D6EA 1J0JA 5I09A 1SZFA 2VDGA 3A23A 4GJJA 4DJFC 1ESWA 2OLHA 3BW2A 2NVCA 3NZ1A 4GYJA 5FL0A 3OQ8A 4K6AA 2CWNA 2YLLA 3CASA 4MJMA 5GJNA 3RPDA 4MWAA 4JCMA 2PWEA 4ZMGA 2CYGA 3VABA 1M41A 1CGWA 3WNKA 1WNOA 1DIKA 3DGRA 3PM6A 1I1WA 5KMYA 2E09A 3O9NA 4AMCA 2C19A 3GVQA 4M1BA 3THCA 1DQUA 4B9YA 3GYEA 4BI7A 2PAJA 4H19A 4RDWA 4LUSB 4L6DA 3C5QA 3B8TA 4E2OA 2CZDA 3DI0A 1NAL1 1RD6A 3CWOX 3IV3A 4IIHA 3PK7A 3MO7A 3CL8A 2VR2A 3W4RA 1K70A 1XI3A 2WSPA 3PBMA 1DWJM 4CUCA 3SFKA 4GY7A 3M4HA 1OINA 1HO4A 1YPFA 3G24A 3NL2A 2HS8A 3IK2A 2CNCA 3E0WA 4K37A 3FXYA 2PD9A 1IEQA 1EIXA 3Q37A 4D1JA 1PAMA 1UPMB 1G9HA 2IS7A 4JHMA 4WDWA 2DT3A 1JD7A 4M24A 4I90A 3DI1A 3UWUA 3WFAA 3PF3A 3EBVA 3TAKA 1K8YA 3E3HA 2PDJA 2OT1A 3H2FA 3PZ9A 2O55A 3OVPA 1M7OA 2BDQA 2NQZA 1EC9A 5F7UA 1WKYA 3FDGA 2RJGA 3A64A 1LYXA 1E9YB 1PL9A 1TZ9A 5T91A 3UWEA 1AQFA 4EXQA 4FXSA 4M19A 3QGKC 4GKLA 5GNZA 3UXDA 4K2SA 1U5VA 3QRHA 1QNPA 5D4YA 1ISZA 2WYSA 3VNMA 5KEZA 3TN3A 2DU2A 5KZDA 3NG3A 3PUGA 4AQLA 5HDRA 2PWFA 4Q8OA 1SFJA 2ZXDA 4S3EA 3OVQA 4MHBA 5LXEA 1TWIA 4XSMA 4TTUA 3STCA 3M07A 3TQ0A 1R0MA 3PPGA 4JX6A 1EF2A 1WOBA 3EZ4A 2NVAA 2NT0A 4B9ZA 4L64A 1S2UA 2AMXA 3KFTA 4JTHA 4UR7A 2FLIA 1V8EA 2PURA 3EA3A 1YIXA 2WKLA 4S3FA 3QMRA 3OLDA 2FB2A 4GX8A 1EJRC 3KZPA 4CN4A 1DPMA 3H22A 2ZX5A 3KX6A 4JIPA 5JBDA 1PKNA 2HNHA 4EF8A 1E0WA 2OWXA 4MYXA 2J6XA 1US3A 2VWSA 4RJEA 3OP2A 3WYZA 3WLTA 4WSHA 2VJXA 2FZBA 3DFPA 4ZE4A 3S6TA 3TXVA 5C2CA 2FMNA 4Z2GA 5A8NA 2WMIA 2WXDM 2D1ZA 5K3VA 3NDOA 1TV3A 3KCOA 4QS5A 1Q3NA 4JFUA 1OEPA 3LYEA 2ZDRA 1KM6A 2WCAA 5HWMA 5I3GA 3H53A 3HQ1A 5EU9A 3T4CA 1CENA 1EJTC 1SW7A 8RUCA 5HJLA 3W83A 3SN1A 1VJIA 2W6RA 3L5AA 3P2VA 4A2RA 4S38A 4CVWA 1R9ZA 1OX6A 5CSYA 1G5AA 5I2UA 2GVYA 5BXSA 1OD0A 4FIQA 4HSHA 1PO9A 3MWAA 4AHPA 2EAWA 3L21A 1CNVA 1W9DM 2WHKA 4F3HA 3RLVA 4ZOBA 3N73A 1RALA 3KRZA 1F4AA 4JQ4A 3IGUA 5A2AA 1XG3A 1HKVA 2J75A 1XC6A 4WKAA 4NASA 1G67A 3L4UA 4UWMA 3HM7A 1LL7A 2A79A 1TWWA 3RR4A 4IJRA 3G0UA 1GJPA 4AG0A 5A5WA 1KR1A 3EXSA 3NNTA 2D2HA 1SO6A 4LYRA 4M6QA 3K8LA 4LNCA 1HZYA 3HJZA 4I7WA 1LL6A 1E6PA 3T0CA 1Z89A 3ZOAA 3A22A 3GNDA 3PWAA 3LK6A 1XH0A 2C79A 3WK1A 2UY5A 3VNDA 1E0XA 2JEPA 1RQHA 1NF7A 4ERAA 3N04A 3IJ8A 2YR1A 5BXPA 4O0ZA 1DJZA 3DGBA 3U2ZA 3BL3A 3K2GA 5A2CA 4Y9AA 1MZRA 1UA7A 5C5YA 2BOGX 3OZMA 4DJED 1DQXA 2XYLA 1TO3A 2FZDA 2WZMA 4BQ3A 3RX4A 4ZEPA 2W79A 4JYDA 3MJMA 4YVVA 4GI4A 1XP3A 3IVSA 3STEA 1JEZA 3LB0A 4MNMA 2W0UA 4GXWA 4WGXA 4A21A 4DIAA 4DX3A 2BGNE 2QYGA 1TG7A 4ZO9A 3HV9A 1E71M 2XGIA 5AYYA 4H01A 1ONRA 3II1A 2JK2A 2DGAA 3ZJ7A 1H1YA 3BDKA 4GXPA 4XBSA 5HNUA 1GQLA 2FYMA 2YZRA 3PAJA 4AUBA 3UPBA 1REQA 2DT1A 2XTKA 2BVYA 2GJLA 4E3TA 5HR6A 5T26A 1N2VA 2D23A 3RJYA 3CEUA 2PGFA 4X22A 1MXSA 1NU5A 3WK3A 3RAOA 1X96A 1CXEA 1JGMA 4UMAA 3GNXA 4OT7A 4FXFA 4AB4A 2RH9A 3BLFA 4N0RA 4C6MA 3AROA 3SM0A 4PTXA 4Z1YA 3MS8A 1HVQA 4DO7A 2PDMA 3RO6A 3C2YA 3VIPA 1AJZA 4KFPA 1BF2A 1CXIA 4HIBA 5D9NA 1A47A 3F5JA 1SR9A 3HU7A 4KCTA 5HMEA 3IVTA 4IIDA 4AH7A 1N7KA 3K4DA 2DSVA 3ABQA 4C65A 4OQVA 2OFJA 2KAUC 3IS4A 1DIEA 1XSIA 2VZUA 1PJ9A 1PIFA 7CGTA 3VE9A 6XIAA 1ZFJA 3W23A 1ME8A 3KVLA 3WF3A 1YNPA 2VCAA 1KGUA 4J2MA 2GOKA 3DXIA 4U33A 1JYNA 3SRHA 2HZGA 4H4IA 2HTMA 1F4HA 5I7GA 4YTRA 1H1NA 1BG4A 1DP0A 2ZCGA 2F6KA 4ROQA 4Q8WA 5J04A 2XGBA 2XN0A 2HRWA 1Q4WA 2XJ7A 3G1YA 2BVTA 3EOLA 4DB7A 3C2VA 5F4SA 2PWDA 3DYOA 4HKPA 4NI3A 1KKOA 5G2HA 4CEUC 3GNNA 4PMOA 3G1HA 1QI2A 2QGHA 3MZ2A 5DT5A 3M6YA 1J6PA 5CGTA 4DJFA 3S5ZA 3CZJA 4O16A 4L80A 3VDBA 1FWJC 3MI3A 4K8HA 4ONVA 4B5SA 1TQXA 4FNTA 1RA5A 2GK1A 1EO7A 4JZ5A 3M0VA 3UBPC 2RUSA 2WHJA 2IPJA 1XFCA 4WZHA 2XN2A 4UIOA 4XWUA 1EQCA 3AU2A 4YVPA 1ZUAX 3MYPA 3NAVA 2GVGA 4Z2IA 1GG0A 1VIWA 2EG7A 4CNUA 3M46A 1SFSA 3H7RA 2OWCA 1YNQA 5CSSA 1WZMA 2E6FA 3E96A 5LIWX 1TCMA 4YJ5A 1S2VA 4QP0A 1XFBA 2YCLA 3KCJA 3WLHA 3WD0A 3MBDA 4CN6A 3ITOA 3W7IA 1UP3A 1XBYA 3GC2A 2KZHA 2MANA 3BCFA 3LN3A 2VRKA 3CM4A 3IVUA 1VKFA 2X41A 4MKVA 2BB0A 3AXKA 3HPXA 4H9ZA 4LQ1A 4IMFA 2NX1A 1SO3A 2DDXA 3AS1A 3W87A 3W72A 1R3WA 4H2CA 1K9DA 1SGJA 2V38A 3N2OA 2HROA 5G1YA 4GYPA 2YL9A 4M6VA 3EYPA 1Z42A 3CQJA 4L4MA 2F6UA 2OGJA 4MFEA 4AISA 4O14A 3MQTA 3WIJA 2ZRUA 5CAKA 1MYRA 1L6WA 1QRQA 1R3QA 3SIMA 2XH0A 2DIEA 3WH7A 3O6YX 4RXFA 1KFBA 2P50A 4QG8A 1E6ZA 5CZ0A 3PJUA 1UH2A 2DEPA 1GZJA 3LGEA 3LGDA 1UUOA 5HOSA 4PMNA 5DXXA 3ABZA 3CUZA 3AMKA 4DNHA 6PTDA 2QJGA 3ZJ8A 1ODUA 2I9UA 1M04A 2OOGA 4GNJA 5CPTA 1W54A 2XU2A 1E70M 1GOWA 2GJRA 1TPH1 1EZ2A 3SCUA 5IOBA 3IIZA 2IPFA 3VFCA 2CESA 1KFLA 4QSFA 5IDIA 5CAHA 4RDYA 1ME7A 1OC7A 1KQZA 1UH3A 5LA0A 3UG3A 3TJLA 1VLIA 2XINA 4RR4A 3UESA 4ATDA 5RUBA 1KFWA 4LS1A 3AS3A 5CSUA 2ZUTA 2BOFX 1J0KA 5AKQA 3GO2A 3CAQA 4LWWA 1QBBA 2VZTA 5ABHA 1OJXA 4GZIA 3B9DA 2V81A 4JAWA 1DE5A 2IQ0A 3S5NA 1XKYA 4S39A 1XDJA 3MU7A 3A4AA 2J7FA 3VOCA 3LBMA 3QTGA 1R3YA 1EOKA 5CPLA 3N17A 3MHGA 1DHKA 1DXEA 5A8PA 4N02A 2ZRZA 4FLOA 4R3UA 3PSWA 4PTWA 1UR0A 3B0PA 3DX5A 2PZ0A 5FF0A 4AZGA 4TUFA 3IACA 3NEHA 4R88A 3WH9A 3THDA 4F0HA 3WD1A 7REQB 2CXGA 3U3HA 2ZZ6A 2R1LA 1NEYA 1JDDA 3GR7A 5FESA 4RZ4A 2O7QA 1NH6A 4JD4A 1Y7VA 1I45A 1VS1A 3HV8A 5EL1A 4L4LA 3LTYA 3DN5A 2UY2A 3LCXA 3FEMA 3EXTA 5XINA 4Y8FA 5TQLA 1VPQA 1NOUA 1TSIA 4B15A 4AC1X 1DXIA 6CGTA 4B91A 2HISA 4JN8A 2H9AA 2GOUA 5HXMA 3LHYA 4LUTA 1TR1A 3W7RA 3MDUA 4IUGA 1H62A 3RU8X 5AC8A 4UOQA 3MV01 2I5IA 3SECA 4HK7A 4EPDC 2EPHA 3PP7A 3F2DA 2Q71A 4N9EA 2ZZ1A 3STGA 3WLQA 3DKLA 4GBDA 1DWGM 4MB5A 2Z6IA 3W84A 3BLIA 4XZIA 3W1PA 1VPYA 1QXLA 3B9NA 3V4BA 1PSCA 3LCWA 3QH2A 3KS5A 3P5YA 2ZIDA 4NI8A 3W2MA 1GVFA 4O8RA 1MDLA 3WQ6A 3DFYA 1X8CA 2F38A 3BANA 4FOKA 1X6NA 2GJPA 3DHUA 3W2LA 4GWEA 3ALFA 4QAIA 1O5RA 1FCUA 3G8EA 3EWDA 1LRTA 3GXPA 4S3BA 4NHVA 3N1AA 5D02A 1CGUA 3WNLA 3RITA 1I0BA 2V6AA 3B0VC 1V6WA 4UTWA 5AFDA 4ZOEA 3QW4B 1DWHM 2Z1SA 4LOCA 1EBGA 5K9CA 3KRUA 4YTTA 3QVQA 4BF5A 2GUBA 1Q6QA 4AZCB 2VVNA 4ZO8A 2HBVA 4XO7A 3T81A 5E70A 3GIQA 1EJUC 1AZ2A 1G69A 1EFZA 4GI9A 4PCNA 3QSRA 3M47A 1CXLA 1TKKA 2NXGA 3CEPA 1UA3A 5E9AA 4Q6JA 2BHYA 2WQPA 1UMYA 1XGZA 2QIWA 4LVBA 1U83A 4WSJA 2ZUWA 3VZYA 4IL2A 4K39A 4LUJA 4ACZA 1AD4A 1XD1A 4FEZA 4CGTA 3REQA 3B9AA 2W66A 1C9WA 4KMQA 2E9LA 3G1XA 2I5QA 3I3EA 1VEOA 3CPGA 1RY0A 5BOOA 2QCDB 2JALA 4QEHA 3TR9A 4G9PA 3USBA 1T8QA 4O52A 2JKPA 1NWUA 8TIMA 4N2YA 2DSUA 4AY1A 4NT0A 2MNRA 3BQ6A 5C9WA 2NWSA 4HK5A 4IM4A 4Q7IA 4LAUA 3ZR6A 2V3GA 3WQEA 1R38A 1GQNA 4NYUA 3C52A 4R7OA 3WDJA 4QCFA 1QPRA 3FJ6A 4DUXA 1OT2A 5BMWA 4JXCA 1NY1A 2FZ9A 1GQIA 1ZJHA 2A3CA 3OTRA 1MI3A 4RUBA 1ISWA 2AQVA 4LT9A 3VINA 3DEQA 1NP0A 1EEXA 1L8NA 3LGGA 2OT0A 1DJIA 3OG3A 3CHCA 4LV9A 5AYXA 5I00A 1F8MA 1EA0A 3BAYA 2ATMA 2O92A 3REQB 3DC0A 4PH6A 2AKMA 4G7FA 1O95A 3KTCA 4OE7A 3UD6A 2A6NA 5I6SA 3BGGA 4UQEA 5LNRA 3GZ3A 4MYAA 4ICCX 3KL3A 2B7QA 2CLIA 1B31A 3P7YA 3VIKA 2V3DA 1POJA 1JUBA 3K8MA 5HJXA 3IPWA 1DOSA 3MSDA 5CJ5A 4J3WA 3UA3A 4IH3A 2BXVA 4JTQA 5GJPA 2A21A 3C0QA 1LBMA 2J77A 3THUA 4E5TA 1FCQA 1ADSA 2B81A 1OGSA 4M7SA 3L5LA 1IZJA 1XIHA 4EPBC 9XIAA 1IIGA 2Z1WA 7XIMA 4JKLA 2DSZA 3LLXA 4C6LA 3W1LA 2GUUA 3OGSA 3LCIA 3IANA 1UWAA 2DVXA 3NURA 1JUKA 4CCZA 3PVFA 4QJ3B 3GTNA 3O6CA 5L6UA 1CTNA 1XIGA 3AHTA 2WWCA 3G5EA 1DORA 3ARWA 3MMUA 3K4WA 4R34A 4V33A 3ITLA 3FLUA 3V35A 5I3HA 3G6MA 4EIVA 1XIMA 1ZAIA 3VD4A 3E2SA 4DZAA 3L2IA 1A5LC 5HMDA 3P14A 4US5A 3PANA 3KUMA 4ZE5A 5HNNA 4DLMA 1SYTA 3F4NA 1Z7AA 4LH8A 3T1GA 1UR1A 2QIIA 4FNUA 2GLKA 2E9MA 2HV5A 4F2TA 3SCNA 3OB8A 4FF7A 3CIXA 1B2YA 4LF2A 2NQ5A 2FQIA 2Y24A 1KCXA 3GUGA 4QEEA 5LKYA 1EL3A 4HNNA 1GOOA 4PULA 1JDCA 3K8KA 4CNPA 2ZBTA 4Q4SA 1MXDA 3BG9A 3OEXA 1UZHA 1VBJA 3FJLA 2PRHA 4RPPA 1B9BA 3ELFA 3SUTA 4GY1A 3S5OA 4GI8A 1TWZA 4GVFA 4LAOA 4WOQA 2CHOA 1HQTA 3KOFA 5ABEA 2PLMA 4U28A 3MP3A 1IHIA 2Y62A 3TFXA 3WMCA 4W7WA 3RX2A 3ZR5A 4RDZA 1HKKA 1O94A 4ZOAA 5FJTA 4YTQA 2WVUA 1U5JA 3LUTA 4MWAC 3H8AA 3NQFA 1DTNA 3S47A 1W5QA 1BAGA 1HJXA 1IEIA 4H83A 1XIBA 4RNHA 1V79A 5I3KA 2A7RA 1CLXA 3C2OA 5BWFA 3NXLA 1XLMA 2QNEA 4PL1A 1BD0A 1X6UA 2CC0A 5BU9A 3MP4A 1V3MA 2BVDA 3O63A 1GOKA 1PXGA 4DO5A 3MUXA 3ARRA 3CWNA 1BYCA 2PU0A 2XH2A 3NZQA 2C7FA 2HE8A 4XZLX 3WQDA 2FB3A 2QDGA 1VFHA 3W73A 1Z9AA 3W6MA 4MIMA 5FF7A 4W9TA 3VMOA 5FJUA 3DYMA 2Z29A 1RA0A 3WNPA 5KZEA 4AY8A 2YYUA 4WVXA 4XKYA 4B4FA 4X0VA 3GU1A 2G41A 3R89A 1WB0A 3PZUA 4DPPA 4NZ5A 1QOXA 3WLJA 1EZWA 2BHZA 1AH0A 5KITA 1XM3A 4HYVA 2Z6JA 3QV9A 1XC4A 4G7EA 3W7MA 1XQLA 3FV9A 1XYZA 2QCLA 1M65A 3I7RA 3T2OA 1RP8A 1TX0A 1OCQA 3GNPA 4MMWA 5DCDA 4Q8MA 3AISA 2DY3A 5BXRA 4F0RA 3UY8A 2YFOA 2C13A 4I9MA 4X2PA 4M29A 3V3WA 1RXOB 1Y5WA 4Y96A 4YIWA 2W62A 2GSEA 3UJ2A 4O1CA 3PG9A 5J5DA 2F2HA 4JKKA 3AMDA 3EPOA 4RX0A 3NQMA 3GG0A 4MZ8A 4XZMX 3UP8A 1QW7A 1W1YA 4LEQA 2BXYA 4W5ZA 1KXQA 3QR1A 3SCRA 3EKLA 3GH7A 1ZJAA 5EMLA 3DG7A 1Q7MA 3ANYA 1PZ0A 2BXZA 1F3EA 1AH3A 1TA3A 2TSYA 1DV7A 4LAKA 4N6EA 3OQEA 4NU7A 1YBQA 3PG8A 2XUCA 1CX9A 4KEMA 1JR1A 3TMLA 4HZ6A 1T0OA 3NR0A 1FRBA 1NOFA 5A95A 3BLEA 3GG1A 3UJSA 3CZGA 1UPPA 3EWYA 3G0XA 4LVAA 2WHLA 3QXBA 2O4QA 1KNWA 5TF0A 1ZALA 2Q6ZA 4IMEA 5BW6A 4DJDD 1H5VA 4OTKA 3TW9A 8XIAA 4E4FA 4XZWA 4QJ1A 3URAA 1OZMA 3TWBA 2IKGA 5A6AA 4ASTA 5SWUA 1QNQA 4IMAA 1FWNA 4V1XA 2RHGA 3RGTA 4OFCA 1VP5A 4BI6A 2PP3A 3PJWA 2UY3A 3GBEA 2XIQA 4WKHA 4WEVX 5HPCA 1YXYA 3WQ5A 2JIWA 1UUMA 2VTFA 4Y2WA 1UD2A 2I56A 5E6YA 4RNJA 2GL5A 5JBFA 2JGQA 3P5ZA 5HATA 2EG6A 3IWPA 3N25A 3W38A 3G1SA 2F61A 1SJBA 2BZNA 1V6TA 4IQLA 4GI6A 2ZRXA 3GW0A 3F5LA 1FCVA 3E9AA 2ZUNA 4H7VA 3OHMB 4FIRA 3SUSA 3TIMA 4UNLA 3EAUA 2E9BA 2XVNA 1HXJA 1OD8A 4J35A 4PYSA 1XCFA 2GVEA 4JTTA 3KM8A 4PEKA 1J9YA 3ZS4A 3ZR4A 4LRTA 1X1OA 3M41A 2V5DA 4DO6A 2CU0A 2D0FA 2V2CA 3TQKA 3MUY1 5U4NA 3H7UA 3HG3A 3N2CA 2OMAA 1M7PA 2P76A 1DXFA 4POCA 2YL6A 3PC0A 3QOKA 3R11A 1HKMA 1V51A 5A6BD 1B3XA 3EA2A 4K1WA 4MLJA 4FXRA 4KEUA 4NZFA 2OLAA 3VM5A 3INPA 3H54A 1SMDA 1FOBA 1MRAA 3DG3A 5CBIA 3VUPA 5CBJA 3HN3A 2TPSA 3U2EA 1FDZA 1XYBA 3TLLA 1V3JA 3UXAA 5D9MA 3BO9A 1WA3A 1XDMA 2ATSA 4LYKA 2X16A 4KGJA 2VDHA 4IISA 4QDPA 3DBPA 3SCTA 4Z1BA 5D05A 3LV5A 1LUCB 2Z24A 1BWKA 2QVNA 5G5IA 4ZXOA 1EBHA 3OZYA 4KKXA 4ZQRA 4E3VA 3DHDA 4R7WA 4J3UA 4Z0SA 3GDMA 4DQWA 3U2CA 3PTMA 2XZ9A 3L4YA 3KTXA 3PFRA 3M0HA 4N9DA 3DUGA 3FGCA 4NZCA 3CIWA 4AHOA 3ITTA 2QDHA 3N34A 4H9TA 3JU2A 3PTQA 2RJHA 4HTYA 1J79A 1V0MA 4WY0A 1NJJA 2XVGA 4WKFA 1N8IA 1SFTA 4TMBA 2WZHA 3DOPA 7A3HA 1XPYA 2FZ8A 4F0SA 4K7YA 4BEQA 2NXIA 3HG2A 4IP4A 1YXDA 1I8JA 2Q09A 4IGHA 1W32A 4N4QA 1BYDA 2XSXA 4HU8A 3WUBA 1XF0A 4AD2A 3ISIX 4M8UA 4AIEA 1PX4A 3MP5A 2ZQ0A 3VIJA 2QJNA 3B06A 4GCAA 1OBAA 1W3IA 4EX4A 4I9AA 2XWEA 3GAKA 1OFAA 2WQDA 2EPKX 2WKJA 4UQ9A 2INFA 2HDJA 5I23A 1WZAA 1MW1A 1E4MM 4W8AA 5IFPA 1UUQA 3H7VA 3ZT5A 3M7SA 2QQ6A 2I16A 3W7QA 3APTA 3JVAA 2QCCA 3ARZA 2GDVA 3O06A 2HXUA 2REQB 3E38A 3W1XA 4C5YA 3LRMA 1XPGA 2E5CA 2Y5SA 3AZRA 2OO6A 2Y89A 3KBJA 4H1ZA 3WDPP 1P6CA 1UR3M 3RILA 3WDRA 4S2BA 3WDIA 4F4RA 1UHVA 4RW5A 4PFMA 2P0IA 1GEHA 1J5SA 4S3AA 3R8RA 3P0WA 3WJSA 4KRZA 3B40A 3BW3A 3MSGA 3EOSA 3BOLA 1HP4A 4O57A 3RIKA 2J8FA 3ARTA 3UEQA 2P88A 4DXKA 3WLPA 4KQNA 3WF4A 3TXZA 5D09A 3E1F1 3PZIA 4IP5A 4ZO6A 5H8PA 4AIBA 3LDVA 5K7JA 2O9RA 3TV8A 3CO8A 3R0UA 5HR7A 4IGMA 1J18A 2WSYA 1Q6DA 5AC5A 1G7VA 3LHWA 3PFMA 2A85A 2IMRA 3P81A 4IP7A 1UD6A 4IPIA 4U2ZA 4YL2A 2WCGA 2XN1A 3SCOA 1QOPA 4ZVJA 1SW0A 2NWRA 4IF2A 1EF3A 3QHOA 3U7VA 4PBGA 1YPIA 1QI5A 2AMGA 2XH7A 2TRSA 3AHXA 3UA4A 4PFHA 3UGVA 1SJAA 1CXKA 2BNJA 1UKQA 2BMBA 2QAPA 1FWCC 1H3GA 2BY0A 4ATLA 3UU0A 2EQDA 3ZM8A 3T8QA 2J7DA 1I60A 4C7FA 3HQOA 1TTPA 2YW3A 4IGNA 1ZAJA 1BVNP 1VH7A 1F74A 1H0IA 5C55A 2GWNA 3WD3A 3U4AA 4AZBA 3RO8A 3S1XA 1UC5A 1V6UA 4RKAA 4H9YA 2OGYA 3C3NA 4FR6A 3O07A 1E1CB 4LB3A 1BQCA 3TA6A 4HNOA 1MQPA 1N8WA 3LTPA 4LV4A 1KFEA 1TVLA 3OIXA 2FVLA 3R79A 4DUVA 1T40A 3K5XA 2QULA 1W9VA 4LS0A 3FA5A 3CL6A 3IJDA 1VYSX 3O0FA 2DW7A 1VBGA 1O66A 4MDOA 3KP0A 1D3GA 1HL9A 3D3FA 3G3MA 4AZIA 4XTDA 1A49A 3UETA 3U0HA 1XLJA 1P7TA 2FZNA 5I0DA 2X1IA 2PSNA 1RQEA 3DH7A 4AZHA 4CKQA 3MMWA 3L12A 2VFGA 1W3LA 3CGTA 5D9OA 3SGUA 1BWVA 1JPMA 1RLCL 2QCMA 3TCEA 1VCVA 5F2MA 1GTEA 3H12A 5HQEA 4JTJA 4UBPC 1RCOB 3EMZA 3UWYA 3H24A 3QC0A 2X05A 3CH9A 2RKXA 1MQQA 1ZB5A 1K9TA 4F0KA 1ZCOA 3NQBA 4C6EA 5IXEA 3UWWA 1BVWA 1DJNA 1CXFA 1S1PA 1VCFA 1H7OA 4AIOA 4JL2A 4WXZA 2X7VA 3LA4A 4MVAA 1E4IA 1Q65A 5LZLA 5HPOA 4GGHA 1A5NC 3HZ3A 3L2LA 5G4WA 1JFXA 3WH5A 1JDFA 2OQHA 4UNKA 3TEVA 3PWGA 4LVFA 4M6PA 1WBHA 1IR2A 2DPEA 3ZJKA 1A5UA 5D8ZA 3JS3A 2AAMA 1R3TA 2X1SA 3WBXA 4EXBA 4N9CA 2CLPA 2CBIA 1RBOB 4DI8A 4KFNA 4KGLA 2CKSA 1EHAA 3GH5A 4PC8A 2VP8A 3WX7A 1W5PA 4FX8A 3G1FA 3AC0A 4JNMA 3D0CA 3L7RA 4NQ1A 3W7OA 1XCXA 3W7CA 1PKLA 3TROA 1TVNA 1V6VA 4I8YA 1F61A 1HGWA 4G5DA 3SCPA 1AW1A 1XGEA 1J10A 1MMFA 4XAFA 4KF1A 3W9ZA 4M3PA 1X1ZA 1XSJA 5DBUA 3E5BA 3TA9A 3UPMA 4WR3A 4NZJA 3GYCA 3EPNA 3FYYA 3KCLA 4PB3A 3SCSA 1YTKA 3GZAA 1GQJA 3W7JA 1TIWA 3LV6A 5DEZA 2XWDA 3GSMA 1NFBA 1HJVA 4HCLA 4J27A 3RDKA 4UFHA 4FZIA 5CZJA 2GUYA 2E4TA 1YADA 2ZX7A 3IGSA 2E5BA 1O1ZA 1LQAA 2PLKA 2HS6A 3MKKA 1FKWA 4H9UA 4IT1A 1FQ0A 2GDUA 3FKRA 6A3HA 1K1DA 5JQ9A 1O12A 2HE5A 2AQOA 4JICA 1XH1A 3QQ0A 3FVDA 5LIYX 3QF0A 4WJXA 4OV9A 1SZRA 3C2RA 2DUZA 4KWOA 1HJUA 2V8ZA 4FMVA 5F1VA 3W2UA 1AH4A 1LLWA 3RG6A 1C8VA 1RD5A 3FJNA 3E49A 4ZGYA 1KRMA 3RUBL 3KVMA 4MTVA 1V7AA 1FP9A 2E0PA 1T8XA 4A2SA 1B5TA 1E73M 4HPNA 4XO6A 5MF5A 3EKGA 2PRMA 2OOFA 4PTMA 4S3CA 1ITUA 4PUKA 4GABA 1JAKA 3VMPA 4N42A 3N3MA 3RXZA 5DRIA 3HFTA 4MB3A 2DH3A 1RJRA 1TIMA 3UWZA 4W4QA 1ZENA 1Z32X 6ALDA 1R47A 2G3MA 3P80A 3ARPA 3F2CA 1W31A 2OZ0A 1HN1A 3VIFA 2CWXA 1W8SA 2XFYA 3MC5A 1W5OA 4MY1A 1S2WA 4Q7BA 2GQ8A 1MUCA 4IJBA 5LNWA 2INEA 1Q6OA 3GVRA 4YNGA 4NJKA 1W9UA 1TMQA 4J5NA 2ZXQA 1O1HA 4I9JA 3WNNA 4D72A 3VC6A 2OXNA 1KLZA 1NWRA 5FIPA 3KTSA 3OA5A 4MJ2A 4O0KA 1XLKA 5I78A 2C1IA 1EX1A 3N14A 4JTFA 2D73A 2CW6A 3OJGA 1S5VA 3NYZA 3PUOA 3LCGA 1MNSA 1PS9A 1AG1O 1E6RA 3EOUA 1PWLA 1XRSA 1XICA 5F2LA 2OR2A 3NOYA 4YCPA 4FOUA 3LG3A 5HANA 1R3RA 4A3RA 1VFOA 4LYQA 1RH9A 1IE7C 3LZ5A 3NSNA 1PDYA 2BY1A 5K2ZA 2DJLA 1QNSA 3EDFA 2YX0A 3VD3A 3RPMA 1LORA 3GTHA 4UTJA 1EO5A 1FWTA 3RLUA 4ZSTA 1XHGA 3U8GA 4J3ZA 2XSBA 2JKEA 2Y5EA 3W22A 3WUEA 1R5YA 1PYFA 2VDIA 4XZ9A 3CLWA 4AEOA 5CPQA 1G1YA 5F4XA 4RXGA 3NL6A 2A4AA 3SN4A 2BOEX 1MEIA 4PTVA 1ZNNA 3W02A 2C8NA 2PDNA 3T7VA 4BF7A 4PUWA 4K1GA 2X09A 1RVGA 4Q8TA 3D46A 1OFDA 2ZTJA 3M44A 4PR4A 3S6OA 3PN8A 3UNDA 1IXNA 3NL5A 4P61A 1H11A 1HG3A 1UJPA 1XYFA 4B3KA 1Q66A 3GHUA 1A0CA 4JTAA 2G3JA 4R9OA 2PDYA 4Q6XA 3LHTA 4IQJA 1H09A 1KWGA 1JI2A 4B5NA 3ABXA 3OLEA 3W81A 3B0YA 5F4WA 4LSBA 4OUEA 4JCLA 5A6TC 2WJEA 3UZ5A 1PYMA 3LTSA 1PCKA 3EDJA 4HNVA 2J7HA 1XLAA 1ZU8A 3QJAA 4LX4A 4DZ5A 4ZTXA 1F6PA 3TOYA 1OGBA 1ZL1A 2YCEA 3PZTA 2D0GA 5A8GA 4B4HA 1QJWA 3FHQA 2HVOA 1GVSA 4PA8A 4N4PA 5D2TA 4JFVA 3U2OA 2FPVA 2FPTA 1LT8A 1IQ8A 2Y63A 3M5XA 3PZOA 3AIQA 1EPXA 3QTPA 4M56A 1TV5A 1WZKA 1VIZA 4H6QA 3CUFA 1JCTA 2BWGA 3WDHA 3MUAA 2W67A 3VAVA 1KBIA 1G94A 1S2AA 2ZUUA 4UCFA 3MDWA 3WH6A 4MY8A 1J2WA 4UNIA 4QXIA 3H26A 2QV4A 1XBVA 1GOIA 1RLDA 1FX6A 3KVJA 4F0MA 3LCLA 1H49A 3ZSTA 2EPMX 3H21A 4RPQA 1S2CA 1X98A 4B5XA 5HWJA 1XLCA 4UB9A 3BMXA 3QZEA 1L6GA 2R8WA 3WK0A 1KBKA 4GZJA 4DLFA