1MQQA

The crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1 complexed with glucuronic acid
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
675
structure length
675
Chain Sequence
b'GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-D-GLUCURONIDASE
publication title Crystal structures of Geobacillus stearothermophilus alpha-glucuronidase complexed with its substrate and products: mechanistic implications.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 284
structure length 675
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mqqA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1mqqA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1mqqA03
2Y24A 1G9HA 4JKKA 1ZL1A 3K46A 3KEHA 1E70M 1UKPA 3LMYA 3OG2A 3SUVA 4JHZA 4NRSA 5D9PA 3J7HA 4W8AA 3GXFA 4U3AA 2JFEX 1W1VA 2XTKA 4URIA 2B31A 3II1A 1KFWA 1PZ3A 3VKKA 2E8ZA 1V02E 1WPCA 4MB5A 3CUFA 3KZSA 5M17A 1NWUA 5EMYA 2EJ1A 4AD1A 3FNDA 2XJ7A 5EB8A 4C7DA 2FHFA 2QV4A 1OD8A 5D9MA 1US3A 3BCFA 1E0WA 1LLOA 1E6RA 4NI3A 5CG0A 4PMZA 3AISA 2BVYA 2PWHA 1OGGA 2V3GA 4W7UA 3VIPA 4CD7A 4D72A 1XD0A 2W63A 1CGYA 4J3WA 5D8ZA 4W89A 2A3EA 1JNEA 1A47A 1HJQA 2BHZA 2CBJA 1H0GA 1V0LA 4J3VA 2J75A 3M6DA 4AYSA 1JL8A 2WMHA 2DSKA 1E9LA 2VI0A 4UFIA 1JYXA 4NRRA 1UH2A 4HOZA 2J8GA 4JL2A 4U3CA 3WDQA 4PYSA 2PC8A 3NDYA 2WWCA 2GJXA 4D6GA 1W2VA 4CUCA 2EBNA 3KL3A 5C71A 3AHTA 4JFTA 3RJXA 2VRJA 3QHNA 1VF8A 3U7BA 1JI1A 4QLLA 4HPGA 3WDHA 2BVTA 3KL5A 4OOZA 5A6BA 4PRWA 1TE1A 3SUWA 4AIOA 3K8KA 1KBKA 3OBAA 3VOCA 5I5RA 3PZTA 1UH4A 1UQYA 2PB1A 2V3FA 3WDIA 5DT5A 1V6UA 1BQCA 3ZSTA 2ZUSA 3ZOAA 4WKAA 3AJ7A 1UWSA 2Y2WA 3AIBA 2J7CA 1LL7A 2VCCA 4Z2GA 4AEFA 1E71M 1GOMA 5A6BD 4AZIA 1SYTA 1QI4A 2WLZA 1CLVA 5IFPA 3HJEA 5D9NA 4CCCA 4GIAA 1J11A 3F4VA 4GZJA 1CXKA 5AC5A 2C7FA 3AYSA 5LA1A 4PBGA 1WAWA 1E55A 3AICA 2WZHA 5AYBA 4WKHA 3NDZA 4OZOA 3VIOA 2D0GA 3OLEA 1VRXA 4W84A 5I3DA 2X2YA 4CVUA 3VD3A 3LPPA 2J7EA 3U7VA 4CD5A 1P6WA 1MVYA 4UNIA 3WNOA 3A4XA 3VD4A 2GK1A 1KWGA 1J0ZA 3KWXA 2YIHA 4GQQA 5A6JA 4FLQA 2YL6A 2VRKA 1JFHA 1WDPA 3GBDA 4XZWA 4AZCA 1RH9A 4LPCA 4UOJA 3CH9A 4CN4A 2D23A 1PPIA 2A3BA 2WB5A 3QOMA 1UKSA 1FFRA 3W53A 2WVSA 4EKJA 1QNOA 1ZS2A 2OYMA 2ZUVA 2XYLA 2NW0A 1J0JA 2QMKA 1WE5A 4XX6A 4UCFA 4WLCA 3ARYA 2E8YA 4P8VA 2O9TA 3VIMA 4Z2JA 5BYWA 2GJXB 3VMNA 4H8VA 2UY4A 4BQ2A 1PIGA 1ZU8A 1OBAA 1PEZA 2BS9A 3IAQA 1JYWA 3VPLA 5FOOA 1XD1A 1XH1A 4PSRA 4CN1A 4BA0A 1M04A 3AIUA 1EDTA 4B15A 4CU8A 5HPOA 1XSJA 3WF4A 5DT7A 4UFHA 3W6LA 2RGLA 3CHDA 1JXJA 3SUTA 3AS3A 2BNJA 5AYIA 1R7AA 4RL3A 2D2OA 2XVKA 4PMQA 3WMBA 1VBRA 4UQAA 3PZUA 3BC9A 3T2OA 4FK9A 1QBBA 3DC0A 3UERA 2VZTA 1VEMA 3ZT5A 4HU0A 5F7UA 4UR9A 1N82A 1MWOA 4NSBA 5CSYA 1GCYA 1CXHA 1B3YA 5D4YA 3SCRA 4F66A 4QFUA 4KMQA 3AFBA 2W91A 2VZOA 3WY1A 4JHOA 1UZ1A 2A3HA 1E43A 4YN5A 2GK1B 4GZEA 4UOZA 3PTKA 3PN8A 5ABFB 2A3AA 2FDMA 3RIKA 2J74A 2ZXQA 4W88A 3FY1A 1HJUA 2DDXA 3L2MA 1YHTA 4A4AA 2OLHA 1NOWA 1XSKA 5I79A 2WMFA 3WSUA 1FP9A 3AIQA 3G6MA 3ALGA 4TX6A 4WIWA 4GO8A 4CU6A 2CNCA 1B9ZA 1B0IA 3EDJA 4AC1X 1UWQA 3PZQA 1EOKA 3AMCA 1U2YA 2VVSA 2VMFA 4DUXA 4YPJA 1WZLA 3NYDA 1UUQA 1GNXA 1ISYA 5CGTA 1ZBWA 1BYBA 3ARQA 3B9EA 3ZSSA 4CGTA 3WH9A 1W91A 3VD5A 1GW1A 3PZ9A 4PMDA 5AY7A 2GUYA 3GXDA 4MB3A 1VFUA 4HA1A 2CPUA 1LL4A 2DGAA 1UD5A 4HU8A 2VURA 2DH2A 1LJYA 5CZKA 4P7NA 5BROA 3N17A 4X9YA 3BH4A 3WNPA 1E6QM 1QVBA 1M53A 1E6XM 1GOOA 4MNJA 1VEPA 2YBUA 4U33A 3IJ9A 4IM4A 4GI8A 2WMGA 3WMSA 1DTUA 2DSVA 4AZGA 4QLKA 3ARXA 3GH7A 4EE9A 3WQVA 1QW8A 2CHNA 1LF1A 2BV9A 2OWXA 4UFKA 1RPKA 2WZEA 4DWSD 2J79A 3FW6A 5A2AA 1V02A 4FMVA 5CPSA 3K1DA 4JFWA 4ACZA 1JD7A 3CZKA 1VFFA 4AD3A 1GQJA 2EEXA 2X09A 4IPLA 4Q22A 1MYRA 3F5LA 3VMOA 2W67A 3WH5A 1NH6A 4F9DA 3ZJ6A 2ZIDA 3AOFA 1HKJA 2X0YA 3RCNA 1OB0A 3K4DA 1CLXA 4HMDA 1HL9A 4KGLA 1HXJA 1OGBA 4HTYA 1Q6CA 5GNXA 1ECEA 2DIJA 2G3IA 3L4ZA 3T0BA 4JKLA 5A6SA 4JAWA 5A6AA 4AMCA 1E1EA 1PIFA 4PMUA 4AZHA 2HVMA 1JDAA 3WF2A 1OT1A 3W6MA 3PZMA 4FLSA 1IZKA 3UEQA 2EXOA 1W32A 4KRTA 4U2YA 4YHEA 2J77A 3I3EA 2Y8VA 2YLAA 5CQ1A 1JZ6A 1JG9A 3D5HA 3EMQA 5HXMA 3GYCA 3PZNA 1WDQA 1EO5A 4PUEA 3ALFA 1BLIA 4ACYA 2NT0A 3W81A 1JYNA 1LG1A 2G4FA 1CNVA 5JBEA 1VFMA 5CSUA 2IXUA 2VNCA 3POCA 2VUYA 1R8LA 4M81A 2XSAA 4WJXA 1GOKA 3VD9A 5CPQA 2YKKA 4CD8A 1E6SM 2WKGA 1WDSA 2FH6A 1Q6DA 3K4AA 1KWKA 3VIGA 3S6TA 2DT0A 2E4TA 4AZ6A 1C8YA 3EDKA 3SCUA 2G8ZA 3WENA 1JZ4A 2X0HA 4J3XA 3WQ8A 1XHGA 1D3CA 4ATDA 2Y5EA 4ML4A 3UCQA 3AZTA 1MW2A 1GOQA 1UD6A 1UR9A 5A8OA 3RPMA 1W3KA 4BZYA 2YDSA 4NZCA 3AROA 1EOMA 4D6JA 4AW7A 3WIJA 4H2CA 1QNQA 2WANA 1VB9A 2XSBA 1C8XA 3VDBA 3ARVA 4MTVA 2QMJA 3BAJA 3RM4A 1QBAA 4AWEA 3AZRA 1CBGA 1O6IA 1BAGA 3BAYA 2WK2A 1FA2A 4TVUA 3WL1A 3BAWA 3E1F1 1OGSA 4AZ7A 2JIEA 3MSGA 1B3VA 3D3AA 3PTMA 2XGBA 4MDPA 2XFRA 1GOWA 2VRQA 1ZJAA 2BY0A 2DSZA 2XHYA 3BCDA 3NJ3A 3O6AA 1KCKA 4HOWA 2O92A 4JZ5A 1W2PA 2J7GA 1JF6A 1NQ6A 1HJXA 3W26A 2CETA 3OZPA 1E15A 1TA3A 1EH9A 2WMIB 5DF0A 3ZM8A 4TTGA 1G94A 4M80A 2OSYA 3MV11 3AI0A 2O9OA 4RE4A 1E6PA 3CO4A 3SCOA 7A3HA 2V38A 1IT0A 4GKLA 1AVAA 4L4OA 1W3HA 2GJRA 1E3ZA 3CUHA 5ABHA 1XCWA 3W27A 1AQ0A 5E09A 1HT6A 3VGBA 1W9PA 3GH5A 4ATLA 2DPEA 2EQDA 1O7AA 1BTCA 2YA0A 4W87A 1DWIM 3GTNA 4PEEA 3BXWA 2W4XA 1BYCA 3CZ8A 4R27A 2WWDA 3DYOA 2EPKX 5JIPA 3SCPA 4UQBA 3B9DA 3VIFA 4E8DA 4MJ4A 2FGZA 2F61A 5DMYA 3NCOA 1DHKA 1XSIA 3T09A 4CD4A 1FHLA 1CWYA 3PZVA 3WF1A 3WUGA 2D24A 4CN6A 1WP6A 2D20A 4UQ9A 2YDRA 3IAPA 2J4GA 4H41A 3W38A 3WUFA 5AC4A 2D3LA 1D2KA 2W5FA 1UD8A 1V3HA 2J8FA 1OIFA 3UETA 1VEOA 4AIUA 3QHOA 3WNKA 2O9PA 4B9ZA 3KL0A 3GXMA 5A8MA 3WUEA 1HX0A 4S3KA 3HN3A 4N0RA 4P8XA 1XYZA 3VIIA 2YDQA 4P7LA 3VDHA 5CLWA 4MNKA 5A8PA 3UR8A 3GDBA 3BLKA 3DECA 4D6DA 4KH2A 3FAWA 4C91A 2E9LA 1V6YA 1XGZA 2WVTA 1E0VA 4HMEA 1C7SA 3M7SA 3WNMA 3THCA 3CMGA 1QI2A 2JE8A 3AHZA 4XZBA 3WN6A 1KXVA 3GZAA 3NSMA 2GFTA 7TAAA 4D6CA 3OGVA 1B2YA 4U5IA 3U57A 1E1FA 5HOSA 1E73M 3BSGA 1V3LA 2Y8KA 4QCFA 2WSPA 3A4WA 4W5ZA 1X1NA 3WL0A 2FH8A 1LG2A 1CPUA 4CCDA 2E9MA 4P8UA 2BY2A 2FGLA 1PJ9A 4J3SA 3ARUA 1U30A 4MPKA 4N42A 3GBEA 3F5JA 3WEMA 5D9OA 3PZGA 4UQEA 1Z32X 2JEQA 4CCEA 1E4IA 3ARRA 3AIRA 3WKZA 3AMLA 4HZ8A 3VO0A 4GPNA 2WCSA 4P7OA 2PWEA 3U5YA 4LGXA 3WDJA 4UZSA 2DT1A 4DM2A 3CTTA 3TP4A 3MUZ1 4UQDA 1HJVA 3WD0A 1AQHA 1JZ5A 3S2CA 2DIEA 1Q6EA 2XG9A 4PSPA 1FHDA 3CMJA 3CHFA 1HNYA 3UESA 5A6KA 4PTWA 4U5KA 3MV01 5JBFA 3DYPA 2G41A 3AXIA 5I77A 1XC6A 1JAKA 4F79A 1OM0A 4IPNB 2BY3A 1E4NA 2DSWA 1UKTA 1I1WA 3O2LA 1A3HA 3F5KA 1B31A 2ZUWA 5FL0A 4DUWA 1B30A 4B3LA 4BS0A 4CU7A 1CXLA 3G6LA 5BRPA 1ZBVA 4PTVA 2YL5A 2XIIA 1CEOA 1QHPA 2PI6A 5DO8A 5BXPA 3QHMA 2XUCA 1MQRA 1AQMA 2VL4A 3IJ7A 2JALA 1UA3A 1VENA 3W24A 4B3KA 4TVCA 1JZ3A 3GXIA 3VM7A 2OWCA 2XIBA 3WUBA 4W5UA 4HZ7A 3L4YA 1MFVA 1G0CA 4M1RA 1GHSA 1C3FA 3NIYA 2V3DA 2NSXA 4ZXLA 1FH8A 3VGGA 1HIZA 4C7GA 4MAZA 2WBKA 1B3XA 2J7HA 2Z1KA 4UFLA 3ZJ7A 3L4UA 2OSXA 4MNMA 3SUSA 1E6NA 4AZBA 2DSUA 4AD2A 2UY5A 1NOFA 3VTRA 3POHA 4J28A 3AHYA 4FLRA 3OZOA 2PWFA 3FAXA 1UD3A 1UYQA 4H8HA 5GQBA 5TD4A 2E9BA 1EQPA 1MXGA 1UH3A 5FCZA 3MANA 1QW9A 8CGTA 1JAEA 2XVNA 4AZCB 4PMOA 1JDCA 3APGA 2DQXA 5IDIA 1BSIA 2JIWA 4W93A 4WF7A 4QP0A 4PMVA 3N18A 5DFAA 3WELA 2XPKA 5E0CA 1EIBA 5IXEA 3K8LA 1JZ2A 3AIWA 1W9BM 4RE3A 1CDGA 2GVYA 2Q8XA 4P7RA 3T2PA 3WNNA 2VZVA 1OT2A 1W9XA 1JYVA 1E56A 1W3JA 1V0KA 2WHMA 3RM9A 1X6NA 1NM9A 4PMRA 1BGAA 1V08A 2BXYA 3LPFA 1J12A 2WYSA 1ISXA 1JF5A 2OWWA 3OLGA 1FOBA 2J25A 3ZR6A 1BFNA 6CGTA 2UY3A 1J01A 2DT3A 5IFTA 2YLLA 1JXKA 1WZMA 7CGTA 1CENA 1OSEA 1HKMA 2GDUA 1UWUA 2WMJA 2CBVA 1UR0A 4BQ4A 4BCEA 5HBFA 1EDQA 3B8SA 2FHCA 1V6WA 1V3JA 4PMYA 2VOTA 4DWSA 1QI0A 2WM0A 3EBVA 4D1IA 3EDDA 1L0PA 5CLTA 1H3GA 1HJSA 2VTFA 3QR3A 1H1NA 1JDDA 1WB0A 2YA2A 2QPSA 1TR1A 1QNRA 2WPGA 5E9AA 3VIJA 4TOQA 1KR1A 4V28A 5JBDA 2ZWZA 4M29A 1PAMA 1CYGA 1UR4A 1E40A 2ESCA 4GQRA 2JF7A 3TONA 1HN1A 1W9UA 3BAIA 1W9VA 3EDEA 3SCWA 4HP5A 3ARPA 1W1YA 4GI6A 3L2LA 1AMYA 1JFXA 1KB3A 1ESWA 2PBGA 4PUDA 4MB1A 3UG4A 4Z2HA 1XRVA 3N04A 5EFFA 5A3HA 1KQZA 4XV0A 5KZ6A 2YJQA 3I3BA 1OIMA 1QHOA 4MJ2A 3WF0A 3SCVA 3DHUA 1ITXA 1VAHA 4M82A 3WBEA 1SMAA 3NSXA 3A6OA 3N11A 1XH0A 1TG7A 4AXNA 4HA3A 2MANA 4OBRA 2EPNA 2FHBA 4YHGA 1FP8A 2XGIA 2D1ZA 4ZEPA 4AD5A 1GONA 3CUJA 2QF8A 6TAAA 3WH7A 5JIWA 4WKFA 3HU7A 2J47A 4GXPA 2UY2A 5I0DA 1HJWA 3VVGA 1XH2A 1GZJA 2ZX5A 3WD4A 5BCAA 4AD0A 3DHPA 2WVVA 5GPRA 5A69A 3VNZA 1TUXA 4A3HA 1JIBA 2IXVA 2ZX9A 3SCSA 5I24A 1Q4NX 1NWRA 5A2BA 3TA9A 2ZUUA 3GH4A 4HA4A 3RDKA 1KR0A 3AMDA 3MUY1 4GINA 4GI9A 1CGUA 5A8QA 4W8LA 4DWSB 4OOUA 5CJ5A 1K9TA 2NT1A 1KXTA 5A6MA 1QI3A 1E4MM 5DEZA 3PHAA 1NWTA 1VIWA 3B9AA 1NP0A 3SUUA 1K9EA 2VCBA 2DEPA 4R5EA 1GJUA 2VZSA 5FL1A 4WK9A 4JL1A 3CZGA 2E3ZA 2PBOA 3ZIZA 2GSJA 2F8QA 1UD2A 3HMCA 3SIMA 2VVNA 1HP5A 2XVGA 1JNDA 1UKQA 2ZWYA 5EFDA 3MMWA 4ACZB 1UZ4A 1KGUA 3CZEA 5A6LA 1C91A 5BXSA 4PMNA 1R87A 3VINA 2D0FA 2BHYA 3CZJA 2VC9A 4HMCA 1UR8A 3IJ8A 4LQ1A 4D6HA 1HP4A 5M5DA 3TOPA 1SR0A 4DUVA 1BVNP 1WCGA 2W92A 4KWUA 2ZX8A 4GO9A 1QPKA 3WDPP 3T0AA 2ZXDA 3RILA 3BLPX 1JGIA 2GDVA 3CIVA 3TTOA 2ZUTA 2WHJA 2ZICA 1MXDA 4AISA 1ISZA 4ZENA 5BXTA 1EO7A 2CITA 1DWHM 1U33A 3TTSA 4F9JA 4U2ZA 2BHUA 1QNSA 1HL8A 2BXZA 5I2UA 1UQZA 3ARSA 1HF6A 4AEEA 4JIEA 1E5NA 2WVVB 1CXFA 3MO4A 2ZX6A 3AHXA 3DYMA 1WZKA 2E40A 1TVNA 1DP0A 4XUYA 5EBAA 3WFLA 3N9KA 4BQ3A 3A3HA 4NF7A 1Q6GA 3GNRA 2Y4SA 1GOIA 3LPOA 3WDRA 1W1PA 5I6SA 1UR2A 2ZUNA 1WO2A 5CPTA 1PX3A 1W1TA 3OGSA 2BY1A 5IHSA 1MFUA 1IV8A 4D6IA 1H2JA 3AXHA 4LX4A 1X6LA 2WXDM 5D8WA 1V03A 1OINA 1EQCA 3FN9A 5M03A 2ZXBA 3WD2A 1W9DM 1BG4A 4LYQA 3WD3A 1E6ZA 3M46A 1UA7A 1LWJA 1PX4A 1FH9A 1CIUA 1CECA 4J27A 4XB3A 2WCAA 2WNWA 2VR5A 2CERA 2WVUA 4AIEA 4Z2LA 4FLOA 4QLJA 4MB4A 4M56A 1J0YA 3ARTA 3UG5A 2CEQA 2J78A 4C7FA 1EHAA 1L8NA 5LA2A 4D6FA 3NUKA 1D7FA 4PCSA 3WQWA 1ODZA 1Y7VA 3ZR5A 3MUAA 3UG3A 1CGVA 1K9FA 5LA0A 1EDGA 2VR4A 4J3UA 4WSKA 4Z2KA 2W61A 5BWFA 2VX4A 4CVWA 2YOCA 3VM5A 2VT0A 2PWDA 4Z2IA 3VDAA 1ZJBA 2YA1A 2J7DA 1C92A 3SURA 2VQTA 3BMWA 3EMZA 3SEPA 5A2CA 2AOSA 2D22A 2J7BA 1ISWA 2J62A 1M03A 1OD0A 2BFGA 1TA3B 2DT2A 4KGJA 1EGZA 3TTQA 1FFQA 1GUVA 1MQPA 3T0DA 4UOQA 1UWTA 3VGHA 2G3NA 3BSHA 3FHAA 1HVXA 1PBGA 3AZSA 3A47A 1EHNA 1R86A 3W28A 3SCNA 1MQQA 4EAMA 1KXQA 3AYRA 1J0KA 2XFFA 3CUIA 1NWSA 5BXRA 2YL9A 1WKYA 3MS8A 1CXIA 4FF5A 5ABGA 3W4RA 5A94A 1RD6A 4H04A 1BVZA 2WC4A 3U5UA 3WBAA 2ZOXA 3ZT7A 1UR1A 3AMGA 1QNPA 2XVPA 4PTXA 2VX5A 4LXFA 4H8UA 5ECUA 2ZX7A 3BMVA 5ABFA 3GNPA 1KCLA 3CPUA 2OYLA 3O9NA 4ZFMA 4W86A 1I1XA 4TXEA 3T08A 3PBGA 5FD0A 4GZIA 2PWGA 2X05A 3AMKA 5BRQA 3EMCA 2OYKA 4HOXA 1H11A 2V3EA 2RGMA 5A1AA 4UZUA 2AMGA 1CZ1A 4OKDA 1HKKA 3VGDA 4W7VA 4TVDA 3SCQA 1GVYA 1BG9A 4JFUA 3IANA 2QPUA 2ZE0A 1NP2A 4JFVA 2CKRA 3VUPA 4B16A 1H0IA 1C7TA 2W66A 5ABEA 3AQUA 3W25A 3WD1A 4IUGA 4P8WA 2WMKA 5I78A 1V6XA 1QOXA 3T2QA 1DEDA 3LPGA 1UD4A 1TZ7A 2ZXAA 3THDA 1E4LA 1GJWA 5E6YA 5IHRA 2A3CA 1BGGA 4M8UA 2YL8A 4OBSA 3TTYA 1C93A 8A3HA 3CHEA 3CHCA 1C8QA 4H7VA 3QGVA 1OWQA 4TX8A 3CGTA 3N13A 2C8NA 2G3MA 4C90A 1J0IA 4IISA 2VX7A 1UHVA 4E8CA 2CKSA 2VZUA 1MW1A 2ZUMA 3ZO9A 2Z1SA 3WQ4A 2EPMX 2PF0A 4W7WA 2CIPA 1MW3A 1ODUA 1HKIA 2EPOA 4PN2A 9CGTA 5C70A 3VX0A 2JF6A 2VCAA 1BF2A 1XV8A 1V0NA 1G1YA 1E0XA 1GORA 1VJSA 2WBGA 3WNLA 5HPCA 1J10A 3WH8A 3A4AA 3WF3A 3W29A 3VILA 1K9DA 1NOUA 2WHKA 1UOKA 4CKQA 1SMDA 1LL6A 4S3JA 1ITCA 3OLIA 2AAAA 2GJPA 5FIPA 2WW5A 3I3DA 4X0VA 4HZ6A 1V0MA 4RE2A 4EK7A 1G5AA 5HDRA 5JUVA 3ARWA 2D0HA 3AHVA 2EPLX 1DWAM 2HISA 3QOKA 1YQ2A 3CBWA 5LYRA 4LYPA 4UFMA 2C0HA 1ZB5A 1R85A 5E70A 3EDFA 4A3YA 4WSJA 2VX6A 1CGTA 2V5DA 3VGEA 1PZ2A 1LWHA 3FXYA 3SCTA 3ZJ8A 3CUGA 3L4XA 3L4WA 3AIEA 1EA9C 3VNYA 3OIHA 3WH6A 5M3WA 1TMQA 2QLYA 3M07A 2VJXA 2X1IA 3WFZA 4F8XA 2E0PA 1BYAA 3ZMRA 3ARZA 2CXGA 1J9YA 5CXPA 1R7OA 1B3WA 4MNLA 3ECQA 3L4TA 3W37A 1GQIA 3EYPA 1J0HA 1H49A 3WEZA 4QDMA 1GPFA 3OGRA 1V3KA 2XFYA 1CTNA 2EO7A 2W62A 4UTFA 4JKMA 5FKYA 4EANA 1CXEA 1VBUA 2BVDA 1US2A 1M7XA 4QCEA 1GQKA 4U31A 4E4PA 4JCMA 4TUFA 2WC7A 3VX1A 4P7QA 4MADA 3ZQ9A 2WC3A 1ZBKA 1EXPA 5HNNA 6A3HA 3AS0A 3NSNA 4CD6A 3JUGA 1RP8A 4ZXOA 2CYGA 1WDRA 3PZOA 2XWDA 3ZT6A 2JEPA 1HVQA 2VQUA 2XVLA 1M01A 4K68A 4V27A 1PX8A 1H5VA 4UFJA 1Q6FA 5GNYA 4AY1A 4JFSA 2CHOA 3MMUA 3VU2A 1QHZA 3VIHA 1UKOA 2F2HA 3BAXA 4Y7EA 1CGWA 3OLDA 4BQ5A 2TAAA 4ZE4A 1DWGM 3PTQA 3AXXA 2WSKA 3VD7A 4OJYA 1E5JA 1I75A 1JD9A 3KE0A 2XM2A 2WCGA 1GQLA 1XYFA 1JZ7A 4PCTA 2CBUA 3WEOA 4J3TA 5I23A 4LYRA 2XWEA 1ISVA 4ZE5A 2WZIA 4PTMA 3RM8A 1J18A 3OA5A 1BPLB 1XCXA 2CBIA 1E3XA 1F4HA 3GNOA 1GHRA 4OUEA 3BAKA 4X0NA 5E6ZA 4ATWA 3AS1A 4TTUA 3VIKA 1UG6A 1B90A 3VGFA 1DWFM 1K6AA 1FH7A 4UQCA 2V5CA 1KGXA 1UWRA 1V3IA 1VFOA 1BYDA 2WMIA 1KGWA 1QI5A 2UWFA 1ZBCA 1DWJM 1NARA 2OSWA 3K8MA 3MKKA 5GNZA 4M24A 4B9YA 1CGXA 3FHQA 1WNOA 3L4VA 1UWIA 3MU7A 4QAWA 1C90A 4JCLA 3VMPA 2QHAA 4AZ5A 1E72M 2YBTA 3GM8A 4Q7NA 3ZJKA 1S46A 1G01A 4OIFA 4AD4A 1BHGA 2XM1A 4W85A 2CESA 3RMEA 3UR7A 1B3ZA 5A8NA 5C8BB 3AS2A 2WLYA 1JI2A 1TVPA 4MDOA 1V3MA 3AIVA 4BF7A 1MW0A 4PMXA 4L4PA 1OCQA 1H41A 1KBBA 1WZAA 3BGAA 2DH3A 2IUZA 2VO5A 4KRUA 4DM1A 1SFSA 4W8BA 3OB8A 1F4AA 2CCRA 2J7FA 1TFVA 2G3JA 5KEZA 3N15A 2WAGA 3PZIA 3WQ6A 1V6VA 2WHLA 5E0FA 1IZJA 3RJYA 3MUIA 3MMDA 4D1JA 1TCMA 3VDCA 5A95A 3W0KA 3CLWA 1H4PA 4J7RA 1RP9A 4E2OA 3RO8A 4D6EA 1W3LA 1GVIA 1LQ0A 3WQ5A 2WKLA 4DWSC 2D3NA 1VJZA 2X8RA 1KQYA 4D71A 3MSDA 3CZLA 3WMCA 4MAVA 1KXHA 3IK2A 1JZ8A 1B1YA 1H09A 4HPHA 2O9RA 3N1AA 3W82A 5CGMA 4V2XA 3N12A
chains in the Genus database with same CATH superfamily
4Z1YA 1YXCA 4JKKA 2PU1A 3K46A 3KEHA 1E70M 3VK5A 1UKPA 1Z9AA 4LFYA 4JHZA 4WDWA 5D9PA 3GR4A 3W76A 1ZTVA 4IQEA 2XTKA 1UCWA 4LU0A 3II1A 1KFWA 2VFEA 2E8ZA 4LAKA 1V02E 1XIBA 3CUFA 3EX6A 5M17A 1QK0A 1GOXA 3LCGA 2PDHA 2QV4A 5D9MA 5D2YA 4OGZA 3BCFA 1LLOA 4C6JA 1E6RA 1KM4A 1QPNA 4LV9A 1U1HA 3UPBA 3R89A 1BVWA 5M1TA 1AMKA 4CD7A 4D72A 5DCDA 3M1ZA 3MMTA 4F0HA 1WXZA 1MEWA 2W63A 1XLBA 2DZAA 1TRIA 1HJQA 1BEUA 3QSRA 4OBTA 2BVWA 3MZ2A 2J75A 3D0CA 2EPHA 4AYSA 2INFA 2DZTA 1Q6QA 2DSKA 3IS4A 2VKZG 4H7ZA 2V2HA 5FA5A 4HOZA 4H9TA 2VGGA 3U48A 1XLMA 4IJCA 1TV5A 3WDQA 1BTMA 2PC8A 3GG8A 4D6GA 2EBNA 4QE4A 4B5TA 3AHTA 4JFTA 4S3GA 3RJXA 2VRJA 1S2TA 5DY3A 1F74A 1JI1A 1M41A 3ABQA 5AZ0A 4HPGA 1PV8A 2CLHA 2BVTA 4XD3A 5A6BA 4PRWA 4JQ4A 3GXNA 4OU1A 1JQXA 2OX1A 3LMZA 1YPFA 3WDIA 2CW6A 5DT5A 3RG6A 3ZSTA 2ZUSA 3AJ7A 3MI6A 2OGJA 4GUJA 3GIPA 3LZ5A 2AKMA 2KZHA 2HK0A 4QEHA 4Q4PA 3LCWA 1KFEA 1LL7A 5DBTA 2VCCA 1E71M 1KFLA 1QI4A 3DFSA 3QPZA 3T44A 1CLVA 5D9NA 4YNGA 1J11A 4JIRA 4FF7A 1LWIA 4ZOCA 3L67A 2V82A 1CXKA 1A50A 3CAKA 4LCRA 1SZRA 2WZHA 1FCVA 4H3DA 5I3DA 3M41A 3GHTA 4XKYB 3C2OA 4GIEA 3LPPA 3U7VA 3WNOA 3A4XA 1ZZMA 3QV8A 3DFNA 5A6JA 4RNIA 3KTXA 1WDPA 3GBDA 4XZWA 1QO2A 3HG5A 2BGNE 3M0MA 4QRNA 3LNPA 3HPSA 2X0SA 8XIAA 2WB5A 1UKSA 2I9UA 4GUGA 3W53A 2WVSA 4EKJA 4AMAA 3GTFA 3O07A 3UXKA 5HMFA 2Z2AA 4P8VA 4IWWA 1PDYA 4H8VA 4PFHA 3RLVA 1PEZA 2BS9A 3VPLA 4CQ8A 1IEWA 3TNOA 3JU2A 2PPGA 1QASA 3WBWA 3GSMA 4S23A 2QCEA 1KKRA 3M5YA 1IXNA 2OPJA 3AIUA 4C6KA 1KTCA 3SB0A 2OLAA 3GWQA 4CU8A 1XSJA 3WF4A 4G7EA 2D2GA 3THUA 3VAVA 2R9RA 1EP3A 3T78A 1NDWA 2BNJA 1R7AA 4GJ1A 1X1ZA 3S1UA 1PKLA 1TJRA 4K38A 2Z00A 4GY0A 1GKRA 4AH7A 3SQMA 3KOYA 3VKBA 3UERA 4DJDC 1VEMA 3QBUA 4IGSA 3BTNA 4O1DA 1ICPA 2ZRVA 1MWOA 1ZGDA 2ATMA 1GCYA 1CXHA 3RX3A 3USBA 3CV6A 4GNJA 5D4YA 3UZ5A 4QFUA 3LNMA 3HG4A 1K8YA 2VZOA 4O10A 4PCNA 4QDWA 5DMMA 1RQBA 1Z89A 4GZEA 4XBSA 5ABFB 2A3AA 1Q5MA 5C2XA 1LRNA 2ZXQA 3FY1A 5D09A 4ADUA 2DDXA 5KTLA 3LCHA 5K9XA 1EX1A 2OLHA 4RJEA 1NOWA 1XSKA 4HKPA 4NYUA 3WSUA 3W86A 1FP9A 1Z48A 1ZCCA 3AIQA 5AYZA 4A21A 3ALGA 3GHRA 2CNCA 2ZVIA 4H7CA 4O57A 4Q4MA 3IJQA 1XIMA 3PZQA 4DUXA 1YXDA 3VE9A 4YPJA 3PR2A 1UUQA 3IACA 1GNXA 3BZGA 3AUOA 2FPVA 1EKOA 1LT8A 4JTDA 3BMXA 1LOLA 3SRDA 3LB0A 3V0SA 3GXDA 1TWZA 1GVOA 4HA1A 2CPUA 1LL4A 2I14A 1LOSA 4HU8A 3HFTA 5CZKA 4P7NA 4Z1BA 4G7EB 4HA0A 1W5NA 4WQ6A 4DXKA 1DIOA 4Q8NA 4BF5A 4PH6A 2E68A 1VEPA 5FSEC 4U33A 1CLKA 3IJ9A 2WMGA 3KBMA 1DTUA 2DSVA 3W84A 3CM4A 3GH7A 3T05A 2V0TA 2CHNA 3R11A 4U4MA 4UFKA 2QQ6A 2CLPA 1V51A 2VUNA 3GVGA 2J79A 3V4BA 4DBWA 3DHDA 3NQGA 2C3ZA 1O1ZA 4AD3A 3W00A 3S9YA 1GVFA 3PUEA 1MYRA 3F5LA 4C6OA 4DJFA 1NJJA 1NH6A 4QS6A 4F9DA 3ZJ6A 5LNWA 3CB3A 1OB0A 1CLXA 4YYCA 3OOQA 3QYSA 1HL9A 1HXJA 3V1PA 5GNXA 4XISA 2DIJA 4DF0A 2JQXA 4KW2A 2G3IA 2ZC1A 3T0BA 3CAQA 4JAWA 3KVMA 2HVMA 1S1RA 3BG9A 4FLSA 1A5LC 2RDXA 1XYAA 3GG1A 1T5AA 4XZ9A 4U2YA 1SFLA 2Y8VA 3NOYA 2YLAA 5AHEA 5G2HA 2QDGA 5ABTA 3CXOA 3PSWA 2FFIA 4PTNA 3O63A 3EMQA 2OVLA 1DJZA 3SQSA 1BLIA 3WLQA 3W81A 3E0WA 3QXBA 4YVVA 4RX0A 3VYLA 3KBVA 4F4RA 1R8LA 4M81A 1GOKA 1T41A 3LI1A 1HGWA 1I60A 2WKGA 3FOKA 2FH6A 2DJLA 1DQUA 3EDKA 3N6HA 2WSQA 1XHGA 1ZJHA 5CEWA 4KBXA 2Y5EA 5D32A 2FVMA 4TX9A 4HNOA 1IXOA 3HJZA 4YMZA 3STCA 3L68A 3S1GA 3U3HA 1F9CA 5FJRA 2A1YA 1UD6A 1UR9A 2DY3A 4CNTA 4K36A 3RPMA 4LCQA 3FYOA 3AJXA 3AROA 2Z6IA 4GY7A 4R7OA 1EOMA 3ZWSA 3A9IA 3P5ZA 1VRDA 2WANA 2C91A 3DHFA 3PF3A 3AZRA 3HBLA 1O6IA 2WK2A 3W07A 2P1FA 1FDJA 3KRZA 1BXCA 3D6NA 2XGZA 4GY1A 4MDPA 1TIWA 2BY0A 2DSZA 2E5BA 1VYRA 2PRMA 3BCDA 3O6AA 2O92A 4C60A 4JZ5A 2X1UA 2XISA 2ZA1A 2W3ZA 4L6DA 2CETA 5D05A 3OZPA 3GTXA 1E15A 5LZLA 5DF0A 5FI8A 2PGWA 2F2KA 3NO5A 4TTGA 1G94A 2OSYA 4AF0A 4S39A 5C7VA 4HNNA 4RE4A 4GKLA 1AVAA 2GJRA 3CUHA 4DJEA 1XCWA 5ABHA 4KKXA 5E09A 4Q8WA 1PWLA 3VGBA 1PTDA 3I6EA 1EEPA 1UMYA 3UWZA 3PB0A 3OBKA 2YA0A 1DWIM 5HWMA 4UTMA 2PDWA 3GUGA 4R27A 2PCQA 2WWDA 3CHVA 2EPKX 4DZAA 2Z24A 4C1NA 1EFZA 4MJ4A 1XDMA 1A3WA 3B8UA 3HQNA 1R9YA 1SVDA 3N2CA 2E6DA 3WK1A 3EB3A 5AYYA 1WP6A 5B7ZA 2D20A 4H4IA 3WUFA 4C1LA 2D3LA 2YCJA 1PO9A 1IWBA 1Q7ZA 1VFSA 4KEZA 1UD8A 2J8FA 3WLSA 1FWCC 2OB3A 4YJ5A 3NZRA 3VIIA 1GEQA 4P7LA 3VDHA 3WLRA 4MPQA 4MNKA 3U2CA 5AN7A 5HUPA 3BLKA 1PCKA 4S3EA 4ZO6A 5C54A 2GJNA 4C91A 2E9LA 3B40A 4FIQA 4EAYA 3P67A 3A23A 2J66A 1SJCA 5I06A 2EF9A 3THCA 1QI2A 4LVBA 1OF8A 3AHZA 2HNHA 3SJ3A 1GT8A 3NL2A 1MEIA 7TAAA 1A5NC 4D6CA 4OTKA 3OZMA 4QROA 3ITXA 3V16A 3UWVA 5HOSA 4JN7A 4FNPA 2BSLA 1V3LA 4QCFA 3G18A 1NFBA 4W5ZA 3WL0A 1LG2A 2IPGA 2YZ5A 2Y63A 3CIWA 4DI8A 2BY2A 3E02A 1P0KA 1FXPA 4BI7A 3H4WA 3GBEA 3OVPA 1YMYA 2PTYA 2VEFA 4CCEA 1A5BA 2DVXA 2CU0A 3ARRA 3HA1A 2OJPA 2ZZ5A 3WLJA 2YCLB 1RY0A 4P7OA 2PWEA 4FEZA 4LGXA 4O28A 3LRKA 8XIMA 5H8MA 3HQPA 4GVGA 1LTDA 1DQWA 3MSYA 3HGOA 3IV3A 3OU8A 1GVQA 2YB1A 1P1XA 2X7VA 4PSPA 1WX0A 2PDKA 4ZOBA 3TN5A 3UESA 4GG9A 5REQB 3PS7A 1F61A 5DBUA 5A6KA 3C0QA 2G41A 4UB9A 4I9TA 1XC6A 1JAKA 3T40A 4IPNB 4R7JA 4C6EA 4C6FA 2DSWA 3AAMA 3QQ0A 4LRSA 3O2LA 1W3TA 3H70A 4C1KA 3WFAA 3MDWA 1CX9A 4DUWA 1B30A 4YTUA 4CU7A 3PANA 2FTYA 5DX7A 4WOQA 2FZNA 1ZBVA 1NFGA 2PI6A 1W31A 3AU2A 1WBJA 3QHMA 2XUCA 1MQRA 4K8EA 3UD6A 2JALA 1UA3A 3M43A 1B3OA 3B0UX 3W24A 1LBFA 1JZ3A 4NXKA 3H12A 3OP2A 3WUBA 1G0CA 2F84A 3B8IA 4I5XA 4WDUA 4A35A 1XP3A 2Z1BA 2HBXA 1GKPA 1FH8A 4ZXLA 1PTAA 4KEUA 1FHVA 2Y5JA 3NM3A 3ZJ7A 3BL3A 3L4UA 3TWAA 4MNMA 4AEOA 4AZBA 2GVEA 3OYXA 1GTHA 1GVRA 1V7YA 3POHA 3VTRA 2DIKA 4YVPA 3AHYA 2Q09A 5CZ0A 3GO2A 3OZOA 4ZB2A 4FZIA 4JYFA 4EWND 1SPQA 3NZ1A 1JR1A 5FCZA 2IKGA 1QW9A 2V9DA 3APGA 1VLIA 2DQXA 4W93A 4WSHA 3H22A 1G4SA 1JCNA 2QUVA 3N18A 2X1RA 4BJHA 2Q02A 1DJWA 4X22A 3I4KA 4XZIA 1RVKA 1MO0A 4KFOA 5IXEA 3K8LA 1JZ2A 3AIWA 5L9FA 5F2LA 5D04C 2POTA 2Q8XA 2YW3A 3EWBX 2BWGA 1V0KA 1EJSC 3WK2A 4PMRA 1BGAA 1ISXA 3NDOA 3P14A 4LTSA 4Q8QA 6CGTA 3TYCA 1BSLA 4A22A 3RCMA 1J01A 2DT3A 2V5BA 4FSAA 2VDGA 1JXKA 1OSEA 1UWUA 1WV2A 3B4YA 2C13A 1EP2A 1T96A 1V3JA 1XYCA 5D2VA 4S1FA 2BGSA 4Q7IA 1XR2A 3EBVA 1TZ9A 2WJZA 3KCLA 4V1YA 2VTFA 3QR3A 3S2JA 2QPSA 3AYTA 3I7RA 3LD5A 3LXCA 1W1A1 5E9AA 3WZ0E 1TV4A 3GC2A 1WKFA 1J8VA 3EGJA 4H9XA 1UR4A 2GL5A 4JDYA 2IPFA 4WJEA 4M5PA 2ESCA 3DFTA 1R3YA 3SFKA 4KCVA 3BAIA 4GUIA 1OFAA 3ENLA 4C6NA 3EDEA 3I6RA 2ON3A 4I7WA 3Q58A 3M5XA 3ARPA 4R53A 3FVMA 5HATA 3RR4A 2HE5A 1THFD 4XIMA 2VFGA 3UG4A 3XINA 1TV8A 5A3HA 2DZUA 1FCUA 1ZAHA 4NKCA 5KZ6A 3WF0A 1US0A 3GK0A 2YYUA 3A3WA 3NSXA 2ZDSA 4QEEA 1U5VA 1TG7A 4ZZ9A 2JGYA 4JHMA 4OBRA 1AL8A 3R8HA 3CC1A 3KAOA 4NVTA 4JD4A 3CUJA 3R13A 4M51A 2QCFA 1EPXA 4HCLA 5I0DA 3TYEA 3WLOA 1UP0A 2QAPA 3CNYA 5B80A 3KCJA 3UXAA 2Y0FA 4JTIA 3SZ8A 4N4QA 3PFMA 3W7JA 3VOFA 3QV7A 2QUTA 3B05A 4UXDA 3SCSA 2V5LA 5AC6A 4H01A 1J6PA 3VCNA 4HA4A 1RQHA 4QNWA 1KR0A 4GINA 1CGUA 4NJIA 4OOUA 4WVXA 4FPSA 2ZRZA 1Q85A 1H51A 4Y8EA 1FBAA 3B9AA 3MO7A 3I68A 3SUUA 4AAJA 1Q13A 1RVGA 4R5EA 5J8LA 3GG0A 4DZ5A 1KRCC 3AU6A 4ZQMA 3HMCA 3B9NA 3DG6A 5HWNA 3G24A 4C6CA 4FNSA 2ZRXA 2XVGA 3LEPA 3RN6A 3RF9A 4ACZB 1OF6A 1KGUA 2HJPA 5A6LA 2IKHA 7XIMA 5DANA 4RZBA 4PMNA 2PMQA 2D0FA 2BHYA 3CZJA 3Q4DA 1NDZA 1V77A 3LY0A 1UR8A 4K7VA 2ISVA 1XQLA 1K77A 4AHOA 3LA4A 4DUVA 4IF2A 1W5PA 1VCGA 1WCGA 3VNJA 3RPTA 3WDPP 4FR1A 2VOMA 3RILA 3REQA 1UIOA 3NFUA 2GDVA 4HK5A 1NVMA 2DU2A 2ZUTA 2WHJA 2ZICA 3V18A 3A5FA 5E0KA 1MXDA 2A6LA 4AISA 1ISZA 4ZENA 1EWDA 3TYZA 3R2GA 1QPQA 2Z7KA 4RNJA 3HZ3A 4K39A 1PIIA 3W7GA 3IUIA 1FCQA 4ZB5A 2PDGA 3IIZA 5EA9A 4AWUA 3SY5A 3ARSA 3UVAA 1HF6A 2O7SA 4JIEA 4HU3A 1MSSA 1FDYA 3DYMA 3VNMA 3O6CA 5FAGA 1Q6GA 4XO7A 4C5ZA 1AJ2A 3V7PA 4HHMA 3VC6A 2A7NA 9XIAA 3QTGA 3GC4A 3W3OA 3WG6A 4G56A 5I07A 1ADOA 3P84A 1W1PA 1XIIA 4IT1A 2UBPC 1W1TA 1K7EA 1D8CA 3JRKA 4R9OA 1IV8A 3CTLA 1TX2A 1EYWA 4DJDA 1X6LA 4FS9A 2E28A 4INFA 4K8GA 3STFA 3SO7A 2ZXBA 2YXOA 1HKVA 1AW2A 4LYQA 3WD3A 1E6ZA 2ZVRA 3M46A 3BLDA 2QJNA 1PX4A 4PB3A 3QY7A 2IMRA 4J27A 4XB3A 3UNTA 2WVUA 3FV9A 3C0SA 4M56A 1J0YA 3UG5A 3HGRA 3O3RA 2J78A 2FMNA 2FZBA 5D2XA 2HQAA 4IP5A 3WQWA 3REQB 2DZBA 1Y7VA 3ZR5A 3KWSA 3R6IA 1RJRA 5LA0A 3T6CA 1I2QA 2VX4A 4CVWA 5HNUA 3VM5A 4HJFA 4I9AA 3C3NA 2J7DA 1Z7AA 2FMOA 2VQTA 3BMWA 4N7QA 3TSMA 1SW3A 2X42A 4BHYA 1AQFA 1IR2A 4L80A 4GHRA 2J62A 2BFGA 2Z4GA 6XIAA 5HULA 5FF2A 4UOQA 3TC7A 4DBEA 2JBMA 2HBVA 2RDUA 3T4WA 4Y9PA 5LXXA 3FCPA 2XFFA 4HYWA 3GVWA 3MS8A 2RUSA 5ABGA 4TO8A 4ZO7A 4H04A 3WQPA 1FVPA 3S47A 2CFFA 4QSFA 4GVFA 3QPEA 1Z44A 1XXXA 3N2TA 3OVRA 2XVPA 2QJJA 2GQ3A 1N7KA 1S2CA 4RV8A 3MTWA 4H8UA 1O5XA 5ECUA 5AZ1A 2QXWA 1R3SA 1HQTA 2REQA 3FKKA 3O05A 3O9NA 1I1XA 4QDPA 1PKYA 3T08A 3AWNA 3GW0A 3PBGA 4DBDA 3H2MA 2X05A 3EMCA 3BWWA 3RYSA 3D46A 4O4WA 1VHCA 3UXDA 3TR2A 3FEQA 5CJMA 4ZOAA 1HKKA 2ACRA 3IUHA 4W7VA 1YBQA 2VFIA 4JFUA 3BLLA 4K8HA 4QBXA 1NP2A 4DIAA 4E3TA 3H2FA 3U2ZA 3KOWA 1A49A 3P0XA 3UWWA 3UCCA 4P8WA 4QIUA 3NURA 5TQLA 5H8PA 1WUEA 3UZXA 2LLEA 2E1WA 3H6OA 4AIBA 5IHRA 1BGGA 2YL8A 3H26A 1X98A 1QOPA 3CHEA 4MMWA 4A6GA 3DBNA 4KEVA 1DHPA 3MKCA 4KS0A 3FJ4A 4ILSA 4KFNA 2CIPA 1D9EA 4PN2A 3M0IA 3MP5A 4PB5A 1V0NA 1G1YA 4ENLA 1D8WA 3RFAA 4IMEA 2VEIA 3WNLA 4ICCX 5HPCA 1J10A 3AALA 1QFEA 3A4AA 3EPMA 3STGA 1NOUA 2WHKA 3IVUA 2Z2BA 3NQVA 3QLLA 5C55A 3WJZA 4S3JA 2GJPA 1QK2A 3CO8A 4HZ6A 2HS6A 1OC5A 3Q65A 1TVLA 4EPEC 1S2VA 1J5SA 3NAVA 1OJXA 1DWAM 2EPLX 1AG1O 3SY1A 3R58A 2C0HA 3FJLA 3VKAA 1KFCA 1VPYA 1WXJA 1KRAC 1Z41A 5LIWX 1PZ2A 2V6AA 2W79A 3NQ6A 1YBQB 1F8MA 3CUGA 3L4XA 1TPEA 3HPAA 3WH6A 3OIHA 1MDLA 1U5JA 2X1IA 1ZNNA 2E0PA 4PRRA 3OODA 3ZMRA 1XLLA 2CXGA 2IQDA 1B3WA 5E5CA 1EBHA 3L4TA 2BOEX 3KRSA 4MWAC 3UXLA 1GPFA 3R8GA 3NQFA 3NGJA 3NOEA 4K37A 1XCFA 5FKYA 1VBUA 3IIOA 1IEVA 1M7XA 2FTWA 4JCMA 1FWWA 3VX1A 4IL0A 4JX5A 3QQ1A 5HNNA 5JH2A 1UUMA 1HKWA 2AL1A 3JUGA 2ZTKA 1WDRA 2CLMA 3C3UA 5CBIA 2WV8A 4GGHA 2C0AA 2VQUA 2XVLA 1HFBA 3Q45A 4X61A 2YFOA 3W72A 4IJBA 2QCMA 5FESA 4K68A 3CT7A 1PX8A 4DO4A 1LBMA 4I9MA 4JN8A 4JFSA 3UPMA 5FJPA 4UR7A 1X7IA 4Q8PA 1YLVA 3B9OA 4ZE4A 3M0KA 3SI9A 3AXXA 4E3VA 3L66A 3VD7A 3L5AA 5GJMA 1E5JA 3QM3A 3WEOA 5CJNA 4RR4A 1RR2A 3RM8A 4CEXC 1J18A 4LUTA 3V1HA 5BOOA 1XCXA 4KCWA 4O1FA 4S3DA 5LXEA 4CQCA 4I90A 2ZBTA 4ECLA 4X0NA 1QJWA 3AS1A 4TTUA 1UG6A 3VIKA 1K6AA 3VFLA 4HNCA 2V5CA 1V3IA 1KGWA 5AVNA 2GSEA 1Z3NA 1FXQA 1ADDA 4GFIA 5GNZA 1DKWA 1Y8BA 4M24A 4B9YA 1YYAA 2P5NA 3PFRA 3Q94A 3MZNA 5KSWA 1UWIA 4QAWA 1C90A 3GKFA 2QHAA 5HUOA 4MG4A 4Z0JA 3UJFA 3E9AA 2FVKA 1OYCA 2XDFA 4QJ5B 3ZJKA 1S46A 1G01A 2XM1A 2CESA 1K02A 2P50A 3UR7A 1B3ZA 2B7PA 1QAPA 3AS2A 3G1VA 2VM8A 1AL7A 3C61A 2WLYA 3UGRA 3V5CA 3T0CA 1LP6A 3GRIA 4D9PA 1WOBA 1KBBA 1WZAA 4ZO9A 3B8WA 2XIOA 1A4MA 2X30A 3HF3A 3SRHA 1Y0EA 2I5GA 1SFSA 1D3HA 2CCRA 2PU0A 2YYTA 1OYAA 3QGAC 5ENLA 2WHLA 1ZLPA 1IZJA 3RJYA 4YL2A 3MUIA 4D1JA 1MI3A 4ZVJA 4JGDA 3VDCA 4DZIA 2ZCGA 5A95A 2WNQA 3TJXA 1O94A 4Q4QA 2OO6A 4HK6A 1VJZA 2QPXA 3RU8X 4RLIA 5I3KA 4MAVA 1ICSA 2OZ3A 1KW1A 3HM7A 4E6MA 2HMCA 2G96A 4LC8A 1QUMA 3N12A 3TTEA 2Y24A 3K30A 3QY6A 1PHQA 4DYKA 3LMYA 4OWGA 3XISA 3GXFA 1ZFJA 3P62A 4GRSA 3VKKA 4HYRA 6XIMA 5KITA 2F9RA 1NWUA 2PC4A 4C7DA 2FHFA 2Z7GA 1US3A 2ZYFA 3OW1A 3ITGA 1E0WA 4EOUA 2BBFA 5G1YA 2BVYA 1OGGA 1VC4A 3VIPA 3KCOA 1AJZA 3IRSA 1FWRA 1CGYA 2AQOA 4J3WA 5D8ZA 1KCXA 1R3QA 4W89A 3LLXA 1JNEA 5CSSA 1A47A 2BHZA 3UNDA 4NYYA 1BRLA 1LQ2A 2FQIA 3FX4A 5DXXA 4MFDA 4GBDA 3O8AA 3LXAA 3KVKA 4Y9NA 3KX6A 3JZUA 4NRRA 1UH2A 2QCHA 2J8GA 2A5HA 3AO0A 1BXNA 1SZEA 4ML9A 2WWCA 1F07A 2HS8A 3PUDA 1W2VA 1GK8A 5FF3A 5C71A 4WDTA 2GPTA 1VF8A 3PBWA 4QLLA 3VCRA 3L5MA 2CWXA 4OOZA 3I4EA 5CZTA 3C2EA 3SUWA 1KBKA 3MYOA 3VOCA 1A5AA 3PZTA 4S38A 3VDGA 4J4KA 2PB1A 4NL1A 1BQCA 2WZTA 3ZOAA 1Q8JA 3L2IA 3FSUA 4WKAA 2QIWA 1VFHA 5T91A 1TPVA 3QQWA 1ZQ5A 2ISDA 3BLOA 2Y2WA 2J7CA 1EP1A 3PUOA 4K1GA 2QDDA 1B54A 3HPFA 5A6BD 3L7RA 1WYIA 2WLZA 3ABOA 4ICMA 2BGQA 1U1JA 4LUSA 5IFPA 3UWQA 3L23A 2OX4A 1R3TA 3HG3A 3EX4A 4ERGA 3T81A 3TUUA 2E1DA 3F4VA 1FCBA 1A5SA 1MRQA 1O60A 1RK5A 5AC5A 3SY8A 1F3TA 2DZPA 3M0JA 4WKHA 1GWJA 2J7EA 3WLLA 4CD5A 1MVYA 5IOBA 1KWGA 3H8AA 1J0ZA 2YIHA 4GQQA 4FLQA 2YL6A 1JFHA 1RBOB 2NX1A 4AZCA 3B0VC 4NHVA 1Y5WA 3FFSA 2G4JA 1RH9A 4QG6A 3T55A 3FJ6A 1S3HA 2D23A 2A3BA 3LBCA 1FWGC 3PAJA 3T8QA 1QNOA 3LTSA 1PSCA 4V1XA 1PHWA 4GVHA 3BG5A 1HO1A 1W3IA 4IZGA 3ARYA 1DL3A 3QW4B 4QQ3A 2O4QA 3FLUA 4BQ2A 2WNZA 1PIGA 4IFKA 1OC7A 3DENA 4HCDA 3TA6A 1JYWA 1IXQA 3HGSA 3O0FA 3NZGA 1XH1A 4HSNA 1LM1A 4MOZA 5DLCA 2V2CA 2NVAA 2Y62A 4CN1A 3TN3A 3NVTA 1EDTA 4UWMA 5AC8A 2TYSA 1Z6KA 4QX4A 4UFHA 3CHDA 5AYIA 4IH3A 4RL3A 4IIFA 2XVKA 4PMQA 3GHUA 3LGGA 1XDLA 1VBRA 3BC9A 4M19A 4MZ1A 3DC0A 3N4EA 3WQDA 2VZTA 3TCEA 1AH4A 1H7NA 4L4MA 4HU0A 5F7UA 4JYEA 4IQJA 4NSBA 4WJ8A 5CSYA 1B3YA 1TMHA 4F66A 5BNKA 3WY1A 4EXAA 2DP3A 3O7UA 5CKSA 2F6XA 1UZ1A 1FKWA 2A3HA 3MBDA 1E43A 4BWLC 1XKYA 4DRSA 2WKJA 1IEIA 3PTKA 4UOZA 2FDMA 1RBAA 3DI0A 2NLIA 3S46A 4XBJA 4L9ZA 3S1VA 4A3QA 3PPFA 2WMFA 3TZFA 2VD8A 3B04A 1VS1A 3G6MA 1X1OA 2V2DA 1PZ1A 3BOFA 5C9RA 1B0IA 3BGJA 4RNFA 4Q8MA 1F2JA 3ABZA 4FXFA 1UWQA 3NQAA 1EOKA 3AMCA 2VMFA 4HN4A 3H54A 6REQA 3NYDA 2QVNA 3JR2A 1EA0A 5CGTA 1ZBWA 3ARQA 3B9EA 4IFKB 5HQMA 1H7OA 4M3PA 3WH9A 4CGTA 3HTWA 1ZAJA 3PZ9A 3BJFA 2GUYA 4XAZA 2PDJA 1UD5A 1JCXA 1DE6A 1IE7C 1LJYA 5HK4A 4L6HA 4X9YA 3BH4A 2GVGA 1M53A 4C6BA 4MNJA 4KESA 4GC3A 5HINA 3TVAA 5TIMA 4P5UA 1TJ0A 2B0MA 4LF2A 2YDAA 4IM4A 3WMSA 3KTCA 1Q6OA 3U0HA 4LEQA 4KCUA 3ARXA 2EG7A 3IGUA 2DQWA 2INEA 4Q8OA 4RZ4A 3CV7A 4KQNA 3CPRA 2NVDA 3BLEA 7REQB 1BKSA 5C2CA 2WZEA 4FMVA 3DH7A 2EEXA 2X16A 3QR0A 2QW5A 2X09A 4O52A 1X97A 3VMOA 3LBOA 2W67A 3WH5A 3WJSA 2ZIDA 1Q65A 2X0YA 3G8RA 4HJWA 1KRMA 4IHCA 4IUOA 4GBUA 4KGLA 3C6CA 2ZA3A 1VBGA 5AVHA 4BFAA 4B2DA 4E4UA 1U83A 2HVNA 2HVOA 2PFHA 4H6QA 3L4ZA 1RLDA 3DOPA 5A6SA 1E1EA 2PWVA 1VH7A 3QMRA 4NAFB 4N2YA 3PZMA 1IZKA 3DGBA 2ZADA 3G1XA 3UEQA 6REQB 4PRTA 1T99A 4RNHA 4YHEA 3TN6A 3SN1A 5HMEA 5CQ1A 1JZ6A 1P48A 1NDVA 1JG9A 1P7TB 3D5HA 1JPKA 5HXMA 1L6SA 1T8QA 3GYCA 1DJGA 3WLTA 4WXZA 4DELA 1OFOA 3KS5A 2G4FA 5BOEA 4JNMA 3ZVHB 5CSUA 2XIQA 3N3TA 2IXUA 2VNCA 3POCA 2VUYA 4H9VA 3OO2A 4WJXA 1FWBC 5DMNA 1C9WA 1P6CA 4CD8A 1WDSA 1POJA 2VDHA 1KWKA 3VIGA 2DT0A 2E4TA 3SCUA 1JZ4A 3WQ8A 1QO5A 4PODA 4ADSA 3C56A 4ATDA 3GDRA 3BG3A 4ML4A 5IDZA 1CW2A 1DYSA 3AZTA 4ZMGA 4HYVA 4B91A 2H6RA 2R1MA 2QIIA 3M0YA 1GOQA 4NX0A 2X2GA 4C6MA 5H6HA 3W1UA 1GG0A 4UCGA 2PE4A 1OHLA 1OY0A 3M0HA 4JTHA 2YDSA 1JQVA 1TPH1 4OV9A 4US5A 2QV5A 3S5ZA 1C8XA 4MTVA 1KA9F 1TR9A 3BAJA 3RM4A 1QBAA 4JX6A 3EXTA 4PULA 3BAYA 3N34A 3MYPA 1H63A 1OGSA 4NASA 2NQZA 4KF1A 3MSGA 4MF4A 3PTMA 1FWEC 1SZGA 2XFRA 1ZJAA 2XHYA 4MZYA 4UTWC 1KCKA 2R1LA 2G37A 3MBFA 2J7GA 3WYZA 1NQ6A 2D73A 1TA3A 4WR3A 2WMIB 3QR1A 3ZM8A 1YX1A 2B4GA 5LNRA 4XVDA 3W7DA 2FTPA 3ITCA 3CO4A 5C9WA 3SCOA 4MIMA 1IT0A 4A8RA 4IIEA 4QG9A 2O55A 4FA3A 4B5XA 3BW3A 1XW8A 3W27A 1AQ0A 1PYFA 3S1WA 3D47A 2FB3A 2VELA 1O66A 4HCHA 3E0FA 3UZWA 2PP3A 4DJFC 4NXSA 3DYOA 4GKTA 3SCPA 3BW2A 3S6DA 1YW1A 5DMLA 4E8DA 1I2RA 2FGZA 3MW7A 4JIIX 4RDVA 4CD4A 3EKLA 4DB7A 3PZVA 3WF1A 3P74A 4ERIA 4UQ9A 3F2DA 1DIKA 5C6MA 4GC4A 4H41A 3W38A 2QVHA 4DVOA 5H2ZA 3DBPA 2W5FA 2Z28A 1V3HA 4GYJA 3P0WA 3NL3A 3UETA 3UWUA 4N9BA 3CUZA 2Q3OA 3W1TA 3GXMA 5A8MA 3WUEA 4S3KA 3WLIA 1BWLA 2FKPA 3SRKA 3AXMA 3R12A 2AKZA 4GE8A 1EGVA 2ACQA 4KH2A 4D6DA 4ICNA 3D3FA 1V6YA 1XGZA 2WVTA 3MJYA 3FA5A 4HMEA 3CQKA 4JY8A 3CMGA 3ELFA 5H8UA 3GZAA 3NSMA 4PGLA 2GFTA 1B2YA 3U57A 2PWUA 3W9ZA 4FI4A 5HJXA 1PDZA 2VC7A 2Y8KA 3A4WA 1X1NA 3LV5A 1CPUA 2OEMA 3G8EA 4BEQA 2E9MA 3G0SA 2FGLA 1PJ9A 3T07A 4J3SA 4R88A 2G50A 3ARUA 2WPBA 1U30A 1H7WA 4MPKA 2PGEA 5I02A 3PZGA 1Z32X 2PUZA 3M64A 3M5ZA 1E4IA 4HZ8A 3W2JA 4XAFA 4PB4A 3CH0A 1P0NA 2WCSA 5HNRA 4X2PA 4UZSA 4DWDA 2DT1A 5T9BG 4DM2A 4BF9A 3CTTA 4UQDA 3I6TA 3WD0A 1AQHA 3S2CA 1Q6EA 3CL8A 2XG9A 4PZVA 1ONEA 4P61A 1YRRA 2PCEA 3CMJA 3GW3A 1HNYA 3KXQA 4PTWA 3MV01 5JBFA 3DYPA 3AXIA 3LCFA 4F79A 2BY3A 1E4NA 1UKTA 3GLCA 4FOJA 2ZUWA 2OKOA 1F6KA 3TE9A 2C19A 2ZRYA 4PTVA 2XIIA 5DO8A 3N14A 3W7PA 2VL4A 5XIMA 4NNCA 1VENA 3GXIA 4GCXA 4DJEC 3KFTA 1JCYA 3SGGA 2XIBA 3ZXWA 3LHVA 4HZ7A 3FDGA 4BI6A 1GHSA 1XDJA 3LI0A 3EEZA 3NVDA 2V3DA 4DY1A 4IG2A 4CQBA 3LG3A 1K4HA 4O13A 4C7GA 4MAZA 2WBKA 1B3XA 2Z1KA 4POCA 4C6IA 1L6YA 3SUSA 1E6NA 4AD2A 2UY5A 1NOFA 4NIRA 3T0TA 1J5TA 3U9IA 4J28A 3L5LA 1TUFA 3VNKA 1S5NA 4LUIA 4ZB0A 3FAXA 3PBUA 2GOUA 3WCZA 5HNTA 4JTAA 1V93A 4GWEA 5GQBA 3QSTA 1MXGA 1UH3A 3MANA 8CGTA 1JAEA 2XVNA 1UIPA 1BSIA 3CAWA 2JIWA 3OHIA 5DFAA 4EPKA 1QTWA 5EKYA 1XBXA 5E0CA 1SO3A 1TPB1 2NQ5A 2TPSA 1W9XA 3MUCA 1JYVA 1L6WA 4XD6A 1TE6A 2VGFA 4S3AA 1TX0A 1V08A 3C0JA 3G1AA 2BXYA 3LPFA 2WYSA 2PLJA 4V15A 5BU6A 1FOBA 2J25A 2GGGA 3JVAA 1C29A 2WZMA 4HMNA 2UY3A 1LUCB 4PL1A 2YLLA 4MKNA 4ZFCA 1WZMA 1CENA 4PTDA 1HKMA 3R4IA 4AUBA 4BQ4A 1UR0A 5T9CE 2P10A 2BZNA 2GSHA 2Q71A 4HHPA 3PBVA 1YE4A 1UPPA 5D33A 1G67A 2FHCA 1V6WA 4PMYA 3UJRA 4UNKA 3EWYA 4JIHA 4GJJA 2WM0A 3EDDA 1OVDA 4KERA 1H1NA 5FJIA 1IT8A 2YA2A 1XUZA 4RUBA 4IG2B 5JBDA 1CI1A 2ZWZA 5LKYA 4CNPA 5AYXA 3B0PA 1A5CA 5BMWA 4GQRA 2JF7A 3STEA 5HJYA 3GE7A 4Q4OA 1KV8A 3C2VA 3FYYA 4IXHA 4HP5A 2X7WA 1AMYA 1JFXA 4EP8C 2ZRWA 3VKJA 3TFXA 2PBGA 3DKJA 4MB1A 4Z2HA 3LLFA 5HA7A 5EFFA 1QPOA 4XV0A 4DLFA 1OIMA 2VD9A 1KM5A 3DHUA 4MSSA 1ITXA 4M82A 2PDPA 3B3DA 2HXTA 1J4EA 4HA3A 2MANA 2OQHA 2GJLA 3BUVA 2PDFA 3ID7A 4ZSTA 3EWDA 4KETA 2FHBA 4C6DA 1FP8A 3P81A 3U2EA 1EGMA 4Q4SA 2PRHA 3GTIA 2I56A 6TAAA 2YB4A 5CCZA 2CHRA 1Q3NA 3EOSA 2J47A 3WLHA 3SSZA 4GXPA 1HJWA 3LGDA 4WOZA 1XH2A 2ZX5A 3WD4A 5DELA 5BCAA 4R7WA 2WVVA 3H55A 5A69A 1JIBA 2IXVA 1SO4A 2ZX9A 4LS0A 1Q4NX 1NWRA 1AZ1A 2ZUUA 4H19A 3GH4A 4WHBA 2ZE3A 4GUFA 3RLHA 4W8LA 4ORMA 4DO6A 2WO5A 4PUUA 3W7CA 3OQEA 2NT1A 1KXTA 5A6MA 1QI3A 1E4MM 1VZWA 3EXSA 5DEZA 1I2PA 3EA3A 5J5DA 3BV4A 3PK7A 2GYIA 2ABBA 3CS2A 3MHFA 4EIVA 1QWKA 4EACA 2VCBA 4HK7A 3W7KA 2VZSA 5FL1A 5JMUA 3QLDA 4WK9A 3CZGA 3LDVA 3GNXA 2PBOA 4B5SA 1RCQA 3TR9A 2F8QA 2FLIA 1F76A 5C9XA 4B5NA 2PRLA 3MC5A 4DEFA 2ZWYA 4HHHA 3MMWA 5G1TA 1UZ4A 3CZEA 3V75A 1M6JA 4ZTXA 3VINA 4RPQA 2VC9A 3K13A 4HMCA 4ZSUA 3G22A 3N25A 1OX4B 4D6HA 3TOPA 1SR0A 3HQOA 1GW9A 3C8NA 4KWUA 5HANA 3CYJA 3T0AA 2ZXDA 5CZJA 4YVXA 4LT9A 4NJHA 1WDWA 3BLPX 1JGIA 1E9IA 2QZRA 4I9JA 1T7LA 4Q32A 4L65A 3YPIA 1ONWA 1BWVA 2INZA 1PCWA 1GKQA 4C6LA 1GGOA 3CQJA 3W1MA 5I3FA 4L64A 4U28A 1U33A 1NELA 3JZEA 3GU2A 4C5YA 3A24A 3H23A 4DF1A 1DJIA 4G1KA 1UQZA 2ZC8A 1ELSA 4AEEA 2OZTA 2WNNA 1E5NA 2WVVB 1W17A 3DZ1A 1CXFA 3MO4A 2Z1XA 4L6OA 1NEYA 5MKGB 4XUYA 2WJFA 3N9KA 4NF7A 1MZHA 3MCNA 1GOIA 3N9RA 4QISA 2RH9A 4AWSA 3LYEA 1BXBA 4WDXA 2P3ZA 3WDRA 1MMFA 4O1BA 3NZPA 4XKYA 1WO2A 2R8WA 1PX3A 5D2TA 2VC5A 2BY1A 1JPMA 1J96A 1MFUA 5IHSA 5C9UA 3GVVA 1H2JA 3UR2A 1LORA 4G8TA 1XG3A 1V03A 1H7RA 4R85A 4YTTA 3VOHA 1AODA 2Y85A 4XSLA 1O5KA 1MUWA 2GZXA 3E0VA 1CIUA 1CECA 2WCAA 2VR5A 4FLOA 4QLJA 4MB4A 3P93A 4DJDD 3GDTA 4C7FA 4BWLA 1OX6A 3FSTA 3CWHA 4UMBA 3W01A 3MUAA 3WQFA 4UTHA 3P7YA 1HO4A 5FF4A 2ICSA 4Z2KA 2W61A 2YOCA 2JKAA 4O11A 4Z2IA 4MLJA 1ZJBA 2HPIA 2YA1A 1C92A 5G1MA 3SEPA 3EA1A 5A2CA 2AOSA 3KZPA 1OD0A 2DT2A 2ZKMX 3S5SA 2OOFA 3UVIA 3DKLA 4JTRA 1E51A 1UWTA 3SGUA 1XKJA 1ME7A 1O5RA 1PBGA 3RLGA 3R94A 1OG0A 3W28A 1MQQA 4EAMA 1J0KA 2YX0A 3CUIA 3E96A 2YL9A 1VPQA 4ZA0A 5FJTA 2NQ9A 2ALDA 2VFHA 2ODOA 4N4PA 3W4RA 5A94A 4YWSA 1BVZA 1AW1A 5CC3A 2ZOXA 3SR7A 2DVUA 1FWFC 1QNPA 1OCJA 2VX5A 1R38A 4BK9A 2RDWA 1S5WA 5LIXX 5ABFA 1KCLA 3CPUA 3W7EA 3W88A 4NZ1A 1OQFA 5I3IA 1ZP4A 4HSHA 3RO6A 4W86A 5EMJA 1A5MC 3M16A 1FKXA 3AMKA 3LRMA 1LZOA 4A8LA 2ANUA 2V3EA 2HSAA 4D8AA 5BZAA 1IGWA 1Q2RA 4FOKA 4TQTA 2A4AA 3WBXA 2PP0A 3LRLA 3SCQA 2ZE0A 4LV4A 1KM3A 1XM3A 3U2OA 1C7TA 3NXFA 5ABEA 3GHSA 1JPDX 3TYUA 3WD1A 2CZFA 4GIYA 3UT0A 2WMKA 2PD9A 1SSGA 4GK8A 3N2MA 3THDA 1K8ZA 3NQ7A 1GJWA 1TQJA 2FPTA 2A3CA 1H62A 3TTYA 4MUZA 4HZMA 3IIXA 1C8QA 3QGVA 1OWQA 5EYWA 3WO8A 4JDBA 3N13A 4I8YA 3FJNA 3VZZA 2G3MA 4IISA 3MB9A 5FJUA 1UHVA 3M0LA 2CZDA 2VZUA 4LBSA 1MW1A 3BARA 1QMLA 1X8FA 1MW3A 1HKIA 1RSCA 2A79A 2DORA 3VX0A 3F2CA 2VCAA 1BF2A 4R34A 1E0XA 1GORA 1VJSA 3UY7A 4B4HA 1PTGA 3TK7A 1UASA 2WBGA 5FEXA 3WH8A 5JVLA 1U5HA 4R3UA 1ECQA 3VILA 1UOKA 4CKQA 1SMDA 2MNRA 5B7YA 1A5UA 3OLIA 2GGHA 2WW5A 4X0VA 1V0MA 3UGVA 3R8RA 4JTKA 4EF9A 2RJGA 2V30A 4HNTA 3ARWA 3PJWA 3CWOX 1QATA 3PG8A 3UZZA 1QRQA 4ERAA 3NO3A 4UFMA 1R85A 3RNDA 4HIBA 1XBZA 2EHHA 5TF0A 2HWGA 5CC6A 1CGTA 2V5DA 2MUCA 2PDNA 3FXYA 3ZJ8A 4D8ZA 4MGGA 1Q7QA 2V63A 1EA9C 3VNYA 5M3WA 1QNVA 2QLYA 1DOSA 3FYPA 3HIJA 1KM0A 2VJXA 3WFZA 3ARZA 1K1DA 1VYPX 1J9YA 3NWRA 4MNLA 4EPBC 3W37A 3RUBL 3T8LA 1GQIA 1J0HA 1H1ZA 2BASA 3WJXA 3OGRA 1V3KA 2XFYA 2EO7A 2GQ9A 1OK6A 4UTWA 4QXIA 4Q8VA 4N02A 4EANA 2R94A 4QCEA 5LSMA 3EB2A 1TV3A 2J27A 3KOFA 3ONCA 9XIMA 4LBUA 3HMJG 3COTA 5G2IA 3AS0A 3UPWA 2Y7GA 3FVDA 3F4NA 4HGXA 5G4EA 4CD6A 2TRSA 3UQNA 3BLFA 4CNUA 1UP3A 4S3FA 5U4NA 3ZT6A 4Q6JA 4RCXA 4LB4A 1KM2A 3LM3A 5GNYA 3W7NA 3MMUA 2PTWA 3VU2A 2F2HA 3BAXA 1S5TA 1CGWA 2GWGA 3OLDA 2F7FA 4BQ5A 3ZYZA 2WSKA 1XF0A 4ZBCA 2VWTA 2XM2A 2WCGA 1JZ7A 1XYFA 3F03K 4PCTA 3VABA 1IIGA 4KEMA 4F0RA 1UUOA 4J3TA 5I23A 3TQ0A 1ICQA 4LYRA 4CQDA 1ISVA 4ZE5A 4N6FA 1IQ8A 5PTDA 1NDYA 3S5OA 1E3XA 3C8FA 3AUJA 3NPXA 1OYBA 3V5OA 4ATWA 3M0VA 4IOTA 1B90A 2DUZA 3CASA 5LGZA 1FH7A 1KGXA 2OEJA 4DNMA 3VOGA 3R25A 2UWFA 1I8JA 3TYDA 3GFYA 3SIZA 2PDYA 4XTDA 1H5YA 3TU9A 1IXPA 3KVLA 4GFSA 1WNOA 1ALDA 3MU7A 4Y9MA 1I6NA 4GGBA 4X2RA 1YE6A 4Q33A 4LALA 1XPGA 3G5EA 1F3XA 4AD4A 1BHGA 4RZ5A 1M65A 4W85A 3QMTA 2XN0A 1SU5A 4UR8A 3C0LA 1JI2A 4XZMX 2VGBA 2CWNA 4BF7A 5AB3A 1MW0A 2VC6A 2OU4A 2YCEA 3GAKA 4O18A 4AY7A 3PULA 1TTIA 4LS2A 3CV2A 4AHPA 3DFYA 1VP5A 2A21A 1R2TA 2G3JA 1QCWA 5KEZA 3N15A 2WAGA 1V6VA 3BO9A 5EBUA 1FWNA 4IMCA 3MMDA 1V6TA 3CLWA 1GVSA 3IJ6A 4O14A 3TSDA 4E2OA 1JCLA 1RV8A 2VR2A 1YNQA 3EWZA 5KZEA 3PJTA 3ISIX 3BDKA 3PG9A 1LT7A 3MSDA 3SAZA 1DJYA 1JULA 1KXHA 3IK2A 2QDHA 5D38A 2O9RA 3W82A 3F4CA 4V2XA 3BQ6A 1QR7A 3IWPA 1ZL1A 2Z29A 3HG2A 3V36A 3OG2A 1IWPA 4NNBA 4GNKB 2GQ8A 2JFEX 4HU4A 2E09A 4URIA 2OEKA 3TXZA 1PZ3A 2ISSA 1YPIA 2OTDA 1KBIA 2EJ1A 1PKNA 4MUPA 3TAKA 5EB8A 5LGXA 4DXVA 1SFTA 4UTTC 4O0ZA 4Y90A 4YCPA 2H8ZA 3A3XA 2XH7A 1JRBA 4NI3A 5CG0A 4DPPA 2V68A 1XICA 2V3GA 4XAYA 5J5RA 3V0TA 4J5NA 4HBKA 4IXXA 1XD0A 3IJLA 4I6KA 4S3CA 2A3EA 2YCLA 1EF2A 1XBYA 1T6MA 3MCMA 4ADTA 3SGZA 5C2GA 4J3VA 5G5IA 1W54A 1HUVA 1PZ0A 6ALDA 1JRCA 1E9LA 2VI0A 1JYXA 6ENLA 4JIPA 1NIUA 4FIRA 4PYSA 5REQA 2VHLA 2B81A 3NDYA 2IPWA 2GJXA 2FZDA 3KL3A 1XI3A 2C14A 4O4VA 3QKEA 1LYXA 3EB4A 3QHNA 4QE1A 4MLRA 5HJLA 3KL5A 1TE1A 1SJBA 4AIOA 1EWEA 3OBAA 3E0LA 5I5RA 3MDUA 1UH4A 1UQYA 2QUNA 3H2AA 2NUWA 4RKAA 4ASTA 2XN2A 3MWAA 2I1OA 3W83A 1SR9A 2V69A 3BPWA 3AIBA 3CAVA 1E9YB 4AZIA 2Q6ZA 3L0NA 1V79A 5XINA 3VCCA 1RJQA 2ZQ0A 3QFWA 4MJMA 1S2AA 4J40A 4TR9A 3AYSA 5LA1A 3LHTA 1E55A 1EJUC 5AYBA 3NDZA 4JNZA 3VIOA 3OLEA 3S0CA 1UPMB 3EOOA 2X2YA 4P00B 4UNIA 1OFEA 1EC7A 2ZDRA 1X7FA 3QEZA 3TOYA 3UJSA 2UV8G 1VBHA 3CH9A 2NQLA 4CN4A 4IMAA 1L8PA 1W5OA 3BE7A 3L12A 1FFRA 4JX4A 1ZS2A 2OYMA 1BQGA 4JIQA 4C65A 2QMKA 4H8NA 2Y6ZA 3QFEA 3U4FA 4ROPA 5IBXC 4L9XA 4XX6A 4UCFA 1M1BA 3NGFA 1TKKA 3VIMA 4DLMA 5BYWA 2GJXB 3VMNA 2UY4A 2H3BA 3G1RA 1ZU8A 2PDBA 4LAOA 5KMYA 5FOOA 4L61A 3N19B 4NG3A 4IGMA 2GOKA 1R9ZA 1M04A 3FKRA 4B15A 1YTDA 2BP1A 4XK2A 5DT7A 4HD5A 2J9ZA 4A2SA 2I9EA 3W6LA 1ZUAX 3NG3A 1JXJA 2IS7A 2EJAA 3AS3A 2QJMA 2D2OA 3KW3A 4UQAA 3IIVA 3PZUA 4JTJA 4JTUA 3EX1A 2Y1HA 4FK9A 4GOAA 3W2UA 4JY9A 3OIXA 4GLEA 1H61A 3PPCA 2H3DA 3ZT5A 3W6YA 4ONVA 3KUMA 1N82A 1VHNA 2ABAA 3L9CA 4AWTA 3SCRA 2TODA 4KMQA 3DFQA 2W91A 4W4QA 1XLAA 5CC5A 4YN5A 2C79A 2PEVA 3PN8A 2J74A 4O8RA 4NNAA 1HJUA 3TLLA 3L2MA 1YHTA 3MWCA 4NQ1A 4A4AA 1P6BA 3GIYA 2BDQA 1ZENA 1SFJA 1E1CB 3CLMA 3ANYA 3B03A 4U10A 4TX6A 5F2GA 4IIGA 4GO8A 1I2NA 1Q2SA 2NVCA 4WUIA 1B9ZA 1O68A 2XINA 4O50A 4Y9AA 3EDJA 4AC1X 2H9AA 4JN6A 2ZTJA 1U2YA 2J6XA 2VVSA 3E5BA 4NZ4A 3WJYA 4LSBA 4MKSA 1GQNA 5KINA 1BYBA 3MHGA 3RRAA 2I16A 1RY8A 1WOAA 3JS3A 1W91A 3VD5A 1GW1A 4PMDA 5AY7A 2P53A 2FJKA 3TLQA 1B9BA 3TJLA 2VURA 4RDZA 5BOFA 5BROA 3HFYA 2GLKA 2XN1A 1W1ZA 1E6XM 1GOOA 4MWAE 1OEPA 2YBUA 1GZ1A 3QZAA 5BMXA 1XG4A 4WXYA 4AZGA 4QLKA 5E93A 1LROA 4EE9A 3WQVA 3GDMA 3UZYA 1QT1A 1TWWA 3PJUA 3TEVA 2BV9A 4A3UA 2OWXA 3E2VA 1F73A 3EWUA 4O17A 3CIXA 3THQA 4DWSD 2RAGA 3FW6A 2H90A 1YTEA 3TH6A 3K1DA 4QITA 4JFWA 3UCDA 1JD7A 5F4SA 3CZKA 4ACZA 3GYEA 1J93A 3SFWA 3A9BA 3OA3A 4IPLA 2P8BA 3OBEA 2PZNA 5D03A 3VXGA 5CZSA 3K4DA 2QUUA 3TXVA 4UC5A 4HMDA 1H7XA 4QHRA 1OGBA 4OFCA 4HT3A 4GH3A 1XINA 3ICJA 4JKLA 2DUXA 4AYGA 4IX0A 5A6AA 1PIFA 4KWVA 2V8ZA 3QGKC 3VFCA 4IFOA 3WF2A 1W5MA 3W6MA 3M47A 1OX5A 2H9AB 1N8FA 3VE7A 1DJQA 2PSNA 3DG7A 5C5YA 3EPNA 4KRTA 1GPWA 4E2VA 4B2DD 3I3EA 4QTGA 1DJXA 3PTDA 4S2CA 5KZDA 1MEHA 1WDQA 3ITOA 1EO5A 4F0SA 2QGYA 1HGYA 5D02A 3F1QA 3U4AA 1GVEA 1LG1A 5JBEA 1W1IE 3EKZA 3H24A 3ZFHA 3QKZA 3I7SA 2A85A 2JKEA 2XSAA 1F3WA 3VD9A 5CPQA 5CPMA 2YKKA 5EMKA 3K4AA 3GX9A 4AZ6A 1C8YA 3WENA 2G8ZA 2X0HA 2QCDB 3QH2A 2CXEA 5CPOA 3VKDA 1EPVA 3MY9A 2V81A 4A29A 5EIYB 3OEXA 5K9CA 3IGXA 3F4WA 5A8OA 1R0MA 4NZCA 2CZEA 1P1MA 2R6OA 3BOXA 4D6JA 5CAKA 1UROA 3LV6A 4ZCWA 2EAWA 1VB9A 2XSBA 3VDBA 4G1NA 1OFRA 4AWEA 1GYMA 2V5JA 2VYOA 3W2KA 1BAGA 1FA2A 4RZ6A 4TVUA 3E1F1 2D2HA 1ITUA 4AZ7A 3TIMA 4QAIA 5DQPA 3TC3A 5FSDC 3WJWA 1GEHA 2XGBA 2HPMA 2VRQA 1N8WA 1PE1A 1ADSA 3LTYA 3RXZA 1JCMP 1JGMA 2FFCA 4Q6XA 1HJXA 3W26A 3PBMA 2VEPA 1EH9A 2HTMA 4GXMA 4LUJA 4DPQA 1LRTA 3TX9A 1E6PA 7A3HA 4WY0F 4L4OA 1W3HA 4CQAA 3OJGA 3LZ3A 4YWIA 3EOUA 1A53A 3GH5A 1O7AA 5ECVA 1BTCA 3U6WA 3BXWA 3CZ8A 1EL3A 4FXSA 1IF2A 5JIPA 4QE5A 3B9DA 5EJ1B 4JTGA 3U8GA 3NCOA 4GYPC 1GJPA 1DHKA 3T09A 3H4GA 3C2FA 5I03A 1CWYA 4DHGA 4LRTA 4XAGA 4DYJA 1WXYA 3IAPA 5IRPA 3W1PA 5LIYX 4TIMA 1UZHA 3G1FA 3P5YA 4RXGA 1OIFA 1EJVC 4FX7A 2OQYA 4AIUA 4B9ZA 3WNKA 2O9PA 1V8EA 3TJ4A 3TYAA 3KL0A 3TKFA 1HX0A 4N0RA 4P8XA 1XYZA 1AUSL 3SN4A 1R47A 3EX2A 4HVXA 5CLWA 5A8PA 1NF7A 3DFPA 4CLMA 3GDBA 1ENUA 1OFDA 2QEZA 3S2NA 5HMDA 3FAWA 4GIRA 3RPDA 5K3VA 4GD0A 5A6TC 1VD6A 2DZWA 2VENA 2Y7EA 3M7WA 1YXYA 3A13A 3WN6A 1KXVA 1VBJA 4WZHA 3O6DA 3EXRA 1LDCA 5I3JA 4O53A 1E73M 3BSGA 3IGHX 4IL2A 2WSPA 3LCXA 1VCVA 3LX9A 2FH8A 3I10A 4QJ3B 3HO8A 4CCDA 4K2SA 4O54A 5K2ZA 1H7PA 4L4LA 1XWYA 3GU1A 3LN3A 2VWSA 3SQLA 4MY1A 3F2BA 1T8XA 4G9PA 3W1XA 3TQKA 1LLWA 3WEMA 1F8IA 4UQEA 3BV7A 3VUSA 5HR7A 3AMLA 1Q6LA 3HOJA 4GPNA 3WDJA 3QV6A 3TP4A 3MUZ1 3GTHA 2AQWA 4TMBA 1JZ5A 2FZMA 3LHZA 1YDOA 4PCPA 3UJ2A 4MWAD 1QOQA 3V5FA 5JQ9A 4B92A 3EWCA 3NEHA 4MZ8A 4U5KA 4WGHA 3GY1A 1OM0A 4D8LA 1I1WA 4F2BA 5LHFA 1B31A 4EXBA 5FL0A 1KM1A 2PURA 4B3LA 4BS0A 4UBPC 3GIQA 4F0LA 2YL5A 5BXPA 1CEOA 1QHPA 4QG8A 4FX6M 1TV7A 3QY8A 3IJ7A 3DGRA 1RD5A 1NTHA 4HNLA 1EJ7L 3T9PA 1PL9A 4W5UA 1MFVA 4Z17A 1OCNA 4A8IA 4QR6A 5G4WA 3PNUA 3P80A 4FR6A 1OZMA 2NSXA 3VGGA 1HIZA 4J9JA 1FWHC 4H2HA 1AH3A 3RX4A 2CZ5A 2J8TA 1VFLA 4FAMA 2PAJA 2POZA 3W02A 2YXXA 3DN5A 1HZYA 1SW7A 2EKCA 1TZZA 1UD3A 3W2MA 1WKDA 1W56A 1UC4A 5AHIA 4H8HA 5TD4A 1SZFA 5I00A 4XZLX 2XU2A 1EQPA 3SW6A 2ZFAA 3DAQA 3URQA 3TYBA 2NXIA 3RMJA 1XISA 4PMOA 1JDCA 3STPA 4HSOA 5IDIA 1W37A 4E5TA 4WF7A 1FQ0A 4QP0A 2I5QA 3XIMA 2XPKA 4FALA 1PKMA 1MUCA 4RDYA 1W9BM 2GVYA 4P7RA 4ZQPA 3T2PA 1AK5A 4NUWA 2VZVA 1OT2A 3ATYA 3W7LA 1EB3A 1Z69A 3RM9A 2NX3A 4L1WA 3F7JA 4NAEA 1X6NA 1NM9A 2GGIA 4YU1A 3S9IA 1J12A 1JF5A 2WQDA 1YDNA 3ORWA 4JNYA 2C1IA 7CGTA 2GDUA 2WMJA 2CBVA 4BCEA 3C2YA 2HCVA 1EDQA 4LWWA 4ZQCA 4M6VA 3B8SA 4AVOA 3G1SA 1SUXA 3CWNA 4XIAA 1MDRA 1L0PA 5CLTA 3QC0A 1H3GA 1HJSA 2X41A 1ME8A 1JDDA 4NZ3A 1DXIA 1IIHA 1WB0A 5HQEA 1K6WA 1TR1A 3DG3A 4MM1A 1QNRA 2WPGA 4H9YA 1EZ2A 3RX2A 3VIJA 4A05A 1O95A 1DXEA 1KR1A 4V28A 4IIBA 4LC6A 4M29A 2VFFA 1CYGA 1TSIA 1QWGA 2Z1WA 4O1AA 4LOCA 1E40A 1XIHA 3QZ6A 3ANVA 1HN1A 2E5CA 2XH4A 4ZQNA 2Y7FA 4E8GA 2YW4A 4UTTA 4Q4RA 2HROA 4PUKA 3L2LA 3NM1A 1KB3A 1UOZA 4PBEA 1XRVA 3N04A 5I3GA 2V67A 1VIZA 4NX5A 4H1ZA