1MQQA

The crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1 complexed with glucuronic acid
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
675
structure length
675
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Geobacillus stearothermophilus alpha-glucuronidase complexed with its substrate and products: mechanistic implications.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ALPHA-D-GLUCURONIDASE
total genus 284
structure length 675
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mqqA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1mqqA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1mqqA03
1J0KA 1M03A 4NRRA 1E1FA 3TOPA 3CZ8A 1ZB5A 1CLXA 3SURA 1CBGA 1MYRA 2F61A 3T2QA 2WW5A 3EYPA 2PBOA 2D23A 4XV0A 1B1YA 1PZ2A 2J78A 4GXPA 1JF6A 2BVYA 2WLYA 2WZEA 4MNKA 1IZKA 1UUQA 4QAWA 4OBRA 2E9MA 5AY7A 4AMCA 5I24A 3BC9A 4FLRA 1MW0A 4PMXA 5I23A 5ECUA 4U33A 1M53A 2VX7A 5A2AA 1JIBA 1UR8A 4D6EA 2PC8A 2WMIA 3M46A 1UD6A 3EDJA 3FXYA 4PUEA 5TD4A 3AFBA 5BXPA 2VMFA 1ZL1A 3MMWA 2XUCA 5HPOA 1WDRA 3QHMA 4PSRA 2NW0A 4CCCA 2WXDM 2BHUA 2EPKX 2ZXQA 2X05A 5A95A 2E9LA 1MW2A 2D0HA 2ZUUA 2ESCA 5BXSA 5GPRA 1DWHM 3ZR6A 4EE9A 3ARTA 3K8MA 1UG6A 4J28A 3WSUA 5A6AA 5A3HA 3PZ9A 3WNLA 4HOWA 1FP9A 1V08A 3TA9A 2YL5A 2YA1A 4X0NA 3AYSA 2YJQA 3KL0A 2DT2A 3CO4A 2OLHA 2GFTA 1V3KA 5BRQA 3W25A 3MMUA 1ITXA 4OJYA 2QMKA 1WCGA 4BS0A 4UTFA 1VBRA 4BF7A 1V03A 5CPTA 4ZEPA 3N1AA 3VMPA 1BSIA 3B9AA 4C90A 4UFHA 1PAMA 3L4UA 1W9XA 1VFFA 2VRJA 3I3EA 2BHZA 3B9EA 1OCQA 3BAXA 2JF7A 3A4WA 3BAYA 4GZJA 1CXKA 4CD8A 1KR0A 3BAIA 1QHOA 4UQCA 1PX4A 1Z32X 1HP4A 2JIWA 3GBDA 3AJ7A 3AIBA 3QHOA 2XFFA 4AD1A 2AOSA 1JZ4A 1I1WA 2ZX6A 3ZO9A 4AEEA 4PTWA 4AY1A 5A8OA 1DWAM 5AC5A 4E8DA 5CGMA 1K6AA 1KGXA 1KBBA 3VGEA 1XSJA 1G0CA 4HMDA 2DPEA 5M17A 3ZOAA 1VEPA 2WNWA 3CZLA 4UFJA 2A3EA 1UQZA 2CKSA 4RE4A 4U5IA 1JDCA 3KEHA 3T0AA 1GQJA 3ZMRA 1EGZA 4MNJA 3CZGA 5GNYA 4W85A 3CUIA 3F5JA 5ABHA 2J8GA 1JD9A 1E55A 1CPUA 4CCDA 3WEOA 5E70A 2G3JA 1XH2A 3K8KA 5A6BD 3WUGA 1H09A 2WYSA 2VQUA 5CPSA 1UQYA 2EEXA 3CHEA 2J7HA 3AIRA 3UETA 2DEPA 3GXFA 3NJ3A 3WMSA 4U5KA 1EDTA 2XVGA 4NI3A 3HN3A 1DTUA 1UWSA 1C8XA 1FFRA 4P7QA 3NIYA 1B9ZA 1H5VA 1TR1A 3AIQA 1UA3A 3SUSA 3SUWA 2PBGA 3VILA 1E6XM 1G9HA 4XX6A 5GNXA 4JAWA 4AD3A 3TP4A 2NT1A 4CU7A 1JAKA 2VCCA 2ZWYA 1B3WA 3LPFA 4PUDA 2FHCA 1QBBA 2WHLA 4GI6A 3O2LA 3W0KA 1V3LA 4D6DA 2ZUWA 2J75A 2VUYA 1C8QA 4QLLA 3EMZA 4ZE5A 2VTFA 1RP8A 2EPLX 2BY3A 1Y7VA 2GJXA 2AAAA 3CGTA 1MQRA 3ARSA 3ZSTA 3VPLA 1W91A 1GW1A 2XIBA 1OWQA 1OM0A 3PTQA 1DP0A 2XJ7A 5E0FA 1TA3A 1U30A 2WC7A 2Y24A 4GKLA 3VD5A 1W32A 3VGFA 3NSXA 3VOCA 2WMKA 1JZ3A 3ARVA 1CNVA 2CNCA 3MANA 4F9JA 4JFUA 2J7CA 1EHAA 3N15A 3WQ4A 5HOSA 2OYMA 1M01A 4U31A 1ZJAA 3GH4A 1JG9A 1UD8A 3L2MA 4PMDA 5EBAA 1W3LA 5I5RA 5BRPA 4JIEA 1HVQA 4DWSB 4TX8A 1R86A 5GNZA 4AZHA 1PIGA 3AHTA 1BGAA 2E4TA 5AYIA 1NOFA 2YDRA 3OZOA 3WN6A 4CN4A 1HKJA 1HVXA 4ZE4A 1PJ9A 2A3HA 1FHLA 5C70A 1HXJA 1MW1A 3NDZA 2Z1KA 4DWSD 5CGTA 3ARUA 1E56A 1HKIA 3WF1A 4HZ6A 4CVUA 4D72A 3SIMA 2WCAA 3FN9A 3EMQA 2D3LA 2BY2A 2RGMA 2G41A 1KR1A 4HOZA 3RCNA 3OLIA 1W9UA 5A6KA 3D5HA 4IPNB 4WSJA 4PTVA 4ACYA 5HDRA 4J27A 3B9DA 3SCRA 1E9LA 4FF5A 1EDQA 2C8NA 4GZEA 1B30A 1NARA 1J11A 3VIFA 1V3HA 4H8UA 4XUYA 1NP0A 4P8VA 1KQYA 5LA0A 4MAVA 4QDMA 4J3TA 4B9YA 4CU6A 3AXHA 4UFIA 4KRTA 3RJXA 1PPIA 2J25A 1TMQA 4OUEA 1Q6CA 1KXVA 5FKYA 5FOOA 3S6TA 5DMYA 2BV9A 3CZKA 3QR3A 5D8ZA 3WF3A 3AMGA 2YA0A 2VR5A 5I78A 3ZSSA 2CHOA 2ZUVA 1CWYA 4GQQA 3ZR5A 3PZGA 2ZXBA 1CTNA 1XD1A 2BY0A 2CXGA 3VU2A 3ARZA 2YKKA 2D22A 1BYCA 1HIZA 1JI1A 1FH9A 3POCA 1CZ1A 2D24A 3CUHA 4BCEA 2FGLA 4JCMA 3WFLA 2TAAA 3WQ8A 1VF8A 1GOMA 2E8YA 3THDA 4AXNA 1GOOA 2WBKA 1W1PA 3OBAA 1NQ6A 4DUWA 1H2JA 3PZOA 3RM9A 4C7GA 3GXDA 3WNNA 1BVZA 2XWEA 1ITCA 2PWGA 2DSZA 2ZE0A 2WWCA 1HX0A 3CLWA 2J4GA 3AMKA 3WL0A 1QNQA 3WH8A 3WEZA 1C7TA 2WB5A 2J7FA 1E73M 1CENA 4H8HA 1D7FA 4HTYA 8CGTA 4W8AA 2WVUA 4EANA 1LL7A 2O9TA 2GUYA 3K4DA 3GNRA 2JF6A 2BY1A 1JI2A 2Q8XA 1OD8A 1QNRA 3IJ8A 2FHBA 3GNPA 3N18A 1KWKA 2X09A 1CXLA 3L4TA 4JFWA 1GZJA 3FAXA 4M24A 1HJUA 4C7DA 2OSXA 1CGTA 1KXTA 5A6LA 4UQBA 3NUKA 3PZQA 3TTQA 1WO2A 2XG9A 4KMQA 3PZTA 3WF2A 2C0HA 3NSNA 3CUJA 1W9DM 3CMJA 3VIGA 1Q6FA 3EBVA 1WZAA 3SCQA 3KWXA 4JCLA 1UR4A 2WVVA 2X1IA 1VFMA 3ARWA 3PZNA 4NSBA 3AHYA 2G3IA 3VMNA 4W84A 1B3YA 4P8XA 1MFVA 1LL4A 3BLKA 2YBTA 1OB0A 1U2YA 2ZUNA 2GDVA 3AOFA 1MXDA 3CTTA 1GQLA 4AWEA 1B3ZA 2XTKA 5D4YA 3WQWA 1BHGA 1OIMA 2EPMX 3KL3A 3CUFA 1EQPA 1XGZA 1UYQA 3N11A 2WMIB 5BCAA 4AZCA 2ZXAA 2V3DA 4L4PA 1EA9C 4H41A 2VRKA 5D9NA 5M3WA 3IAPA 1LLOA 1WE5A 2CESA 1B3XA 4QLKA 3ZIZA 1Q6EA 4B3KA 1WB0A 4P7OA 5EB8A 9CGTA 4OIFA 3VIOA 4U3CA 1PX3A 3GDBA 2XPKA 3AS3A 4PTMA 1BPLB 2QLYA 3CHCA 5A8QA 2EJ1A 4B3LA 3AXXA 3F4VA 4JHOA 1CYGA 4B15A 2DSUA 4AISA 1BQCA 1EHNA 2WANA 5DT7A 5HNNA 1WAWA 2YIHA 2Y5EA 2ZX8A 4GI9A 4MB5A 1P6WA 3MUIA 1ECEA 3VDCA 3CZJA 3W28A 5A8NA 5IHSA 1JL8A 3AHXA 1HN1A 2V5CA 1B3VA 1M04A 1RD6A 4D6JA 1DHKA 1JFXA 1IV8A 3SCUA 2WAGA 1BAGA 4AZIA 2DIEA 1HKMA 1V3MA 1MFUA 3DYOA 5CQ1A 6CGTA 3GZAA 2PWHA 4CD4A 4YN5A 3U7VA 3WUFA 1US3A 1HF6A 3AIUA 3WNPA 2CYGA 1KFWA 5A6JA 1R85A 3J7HA 2X0YA 1E4LA 2XWDA 3BAWA 4FMVA 2DSVA 4ML4A 1A47A 4AD0A 1OGSA 2IXVA 3WD0A 1UHVA 2EPNA 1Q4NX 2VQTA 2W66A 4Z2HA 1GOIA 3M07A 5JIPA 4H2CA 4ATLA 2DDXA 2WCGA 4MB3A 4W88A 2ZOXA 1V0KA 1E6PA 4DUXA 4TVCA 4KGJA 1QNOA 4V2XA 2CBVA 1G94A 3LPGA 4P8UA 3T0DA 1J01A 4FLSA 3UESA 4X0VA 1KBKA 1GORA 2BFGA 1CXEA 4DUVA 2FH8A 5DEZA 1V0NA 3MSDA 4PMRA 3TTSA 2JFEX 3WH5A 4HMEA 2OYKA 3AXIA 2G3MA 4M8UA 1VIWA 4PSPA 2CETA 4XZWA 1E72M 4GINA 1UH2A 4JFVA 5A6BA 5A2BA 1V6YA 2XIIA 3PZMA 3UG5A 5EFFA 3A4AA 3OGVA 2J8FA 1PIFA 2VX5A 1H4PA 5ABFB 5FL0A 1ISXA 4JKLA 1B0IA 4AW7A 1WDQA 3VGGA 2BVDA 4N0RA 4J3WA 3WNOA 2VC9A 5D9PA 2OYLA 1W1VA 5AYBA 4U2YA 2YL9A 4IISA 1C3FA 3LPPA 1E70M 1NOWA 2QV4A 2D3NA 2D0GA 3ALFA 2E0PA 3VD4A 1UWQA 2O9OA 2NSXA 1R7OA 1W9VA 1H0GA 4U3AA 6A3HA 1I75A 2DH2A 3FAWA 3VD9A 5DT5A 5LA2A 4ZENA 1I1XA 1VFOA 5M03A 2C7FA 2A3CA 2J7EA 4BQ2A 5CPQA 5CLWA 3PZIA 2YBUA 2J47A 2O9RA 2WBGA 4GO9A 1JFHA 2VT0A 3I3DA 1TCMA 1TVPA 2BHYA 3VUPA 5ABEA 3GXMA 1SYTA 5E09A 3VD7A 1JNDA 5HPCA 4Z2JA 5A1AA 1QVBA 3WF4A 3WD1A 1NP2A 4UFLA 2WZIA 1JDAA 5BROA 4AYSA 4EK7A 2HISA 3MKKA 3WBAA 2VVNA 3RM8A 3UCQA 2CBUA 4YPJA 3VIKA 4Q22A 1TVNA 4WKHA 4NRSA 2YLAA 4J3UA 4OKDA 1E15A 2BXZA 1KWGA 2PWDA 3VIJA 3PHAA 3GTNA 2VZSA 1ISVA 2PWFA 1JF5A 3QHNA 2CCRA 3BCDA 2IXUA 1C7SA 2E8ZA 1CGYA 2UWFA 1E6NA 3PZUA 4CUCA 1JYNA 4MAZA 3VDAA 3OGRA 3A47A 2ZXDA 4MDPA 1C8YA 4JKKA 3WENA 2ZX5A 1C91A 1VAHA 3WY1A 2GJXB 1WZLA 2CKRA 1E3XA 1BG4A 3VIIA 3HU7A 4UZSA 5CLTA 3MMDA 3VMOA 5LYRA 4WSKA 2MANA 1UR9A 3BXWA 1NWSA 4TVUA 4HA3A 2E9BA 1W9BM 1YQ2A 3WNMA 3VM7A 4E4PA 3OA5A 4GPNA 1J0JA 3SCWA 1F4HA 2G8ZA 1GONA 3BMVA 1V6XA 5I2UA 4V28A 1E4IA 1E6RA 3VGDA 4AIOA 5JBDA 1NH6A 4W7WA 1JZ6A 3EMCA 1XH0A 3SUUA 1MQQA 3U5YA 1E40A 4J3VA 1WP6A 1PX8A 4U2ZA 1CGWA 3WELA 3S2CA 4B16A 4HP5A 4D6FA 4X9YA 3EDDA 1JYXA 2CERA 3MS8A 1H41A 4LX4A 1BYDA 1ZBWA 5GQBA 1PEZA 3F5LA 1CECA 1OGBA 3WD2A 3ARPA 4EAMA 1K9FA 4D6IA 3ZJKA 2OWWA 1EO7A 3DC0A 3AISA 4XB3A 1V0LA 4P8WA 1OIFA 2XVKA 4D6CA 3EDEA 2J7DA 1S46A 5I77A 3MUAA 4MJ2A 3UG4A 1LWJA 1US2A 5KEZA 3ZM8A 1IZJA 2GJRA 2FGZA 1GQKA 2ZWZA 1EXPA 5AC4A 3MUZ1 4PMYA 3BGAA 3JUGA 3W26A 7CGTA 3CMGA 4HZ7A 4TXEA 3AICA 4CN1A 2W4XA 2XVLA 3L4VA 3GH5A 2W67A 4HA1A 3ZJ6A 1H1NA 3MUY1 2QPUA 2V5DA 3W6MA 1ZS2A 2D2OA 3VNYA 2ZUMA 1GUVA 2OWCA 1KGWA 3UERA 2EBNA 5LA1A 3PN8A 3U7BA 1VRXA 1CXIA 1NM9A 1ZBKA 3IAQA 3WUEA 3AQUA 2XVNA 2VCAA 4ACZA 3VNZA 4BQ3A 4TTUA 3O6AA 3AMCA 3APGA 2A3BA 3A4XA 1OT1A 1FA2A 1HNYA 1E6SM 1AQ0A 4UQAA 3ZT6A 3CUGA 3W37A 3GXIA 1DWFM 1VJSA 1E0XA 1UWRA 1JZ7A 4W93A 5CJ5A 5BXRA 2YL6A 1OD0A 3VIPA 1XC6A 4R5EA 3K1DA 3RMEA 5A8MA 1H3GA 1UKOA 1E5JA 2O9PA 4NF7A 4UQ9A 2EXOA 1QW9A 2VL4A 1V3IA 4OOZA 1EDGA 3HJEA 3B8SA 4HOXA 1CXHA 2VURA 1JZ8A 2VZOA 1HJXA 3WKZA 1GJUA 1KB3A 4W7VA 4F79A 2WSKA 1C92A 3N9KA 4IUGA 4MJ4A 3QOMA 3QGVA 1HP5A 4AZ7A 3U57A 1FH8A 4LYPA 3WD4A 3W38A 4A3YA 1M7XA 4CD7A 1Q6GA 5A6MA 3AZSA 3KL5A 2WVTA 4HU0A 4FK9A 1JYWA 4KGLA 1X6NA 2XYLA 4UCFA 2VZUA 5E6YA 1V6VA 1QNSA 1QI3A 2VOTA 2WCSA 4YHEA 3W27A 2D20A 3FW6A 3ECQA 5IFPA 2GVYA 2XM2A 3SCTA 2GDUA 1XHGA 1L8NA 1E4MM 1W2PA 3WDRA 2D1ZA 3D3AA 4QFUA 2CIPA 4DM1A 3CZEA 2E3ZA 4W86A 3AMDA 1G5AA 4BQ5A 2UY5A 4WK9A 2Y8KA 5I79A 1JGIA 3ZT5A 3SCPA 1V6UA 3AIVA 3DHPA 5JIWA 1SMDA 3NCOA 1EOKA 1WZKA 3ZJ7A 1XRVA 3RDKA 2XGIA 4UFMA 3UEQA 2D0FA 1LWHA 4TUFA 4HU8A 3N17A 3II1A 2CHNA 4W89A 1GVIA 2DH3A 3WFZA 1HL9A 2J7BA 4CVWA 3PTMA 4IPLA 2W62A 1VEOA 1ISZA 2J77A 2QF8A 4GQRA 7TAAA 2WSPA 3WF0A 4LXFA 3OG2A 1BF2A 1MQPA 1O7AA 4HZ8A 2IUZA 1KCLA 4RE3A 5M5DA 2WKLA 1V6WA 4JL2A 2GJPA 3AIEA 3PTKA 5A94A 3GYCA 4UZUA 2YA2A 4M29A 3VTRA 4PMOA 4Q7NA 3RM4A 1JDDA 2V3GA 3WH6A 1UKSA 5JBFA 2ZICA 4PEEA 3WDQA 1WNOA 2EPOA 1XSIA 5IXEA 1GOKA 1QI0A 4CD6A 4JHZA 2YLLA 1H49A 3WDJA 1XH1A 2QHAA 3VGBA 3AS0A 5CXPA 2YDQA 2W91A 4W87A 4PN2A 3LPOA 4KH2A 4QP0A 4PMVA 2YDSA 4D1JA 2F2HA 2JALA 1E4NA 3HMCA 2BXYA 3IK2A 3BAKA 4BQ4A 1VBUA 4PBGA 1FHDA 4L4OA 2WLZA 3WBEA 4ZXLA 2BVTA 5I6SA 1E3ZA 1J18A 3GNOA 4RL3A 5BWFA 1LQ0A 3MV11 3VM5A 1NWTA 1ZU8A 1QW8A 3L4ZA 1WKYA 5A8PA 4AZGA 2V38A 3EDKA 3ARYA 2FDMA 1ISYA 1JD7A 1WDSA 4V27A 1TG7A 3SCNA 1H0IA 1JAEA 3BAJA 1E6QM 1R8LA 1CDGA 4PMQA 3DYPA 1YHTA 4Z2IA 1QHZA 3QOKA 1F4AA 4OBSA 1W1YA 4MB4A 4E8CA 4PTXA 1VFUA 4Y7EA 4GI8A 4UQEA 3UR7A 1NWRA 3SUTA 4N42A 1LF1A 3L2LA 1GHSA 4ATWA 2XHYA 4QLJA 1QI5A 2VO5A 1W3JA 3VINA 5D9OA 3CH9A 5DO8A 1ISWA 3OLEA 3FNDA 1E71M 2WPGA 1VENA 1HJWA 2VI0A 3WUBA 3RIKA 1JXJA 2NT0A 2CPUA 3WEMA 3VO0A 3U5UA 1BFNA 1BYAA 2XSAA 5FL1A 4UR9A 4BZYA 3OB8A 3G6LA 1QBAA 1LG1A 5D8WA 1G1YA 1DWJM 1LL6A 3BSHA 1GNXA 4D1IA 3ALGA 5CSYA 3WH9A 1UZ1A 3N04A 5A2CA 1SFSA 1UKPA 2DT1A 2WC3A 1ESWA 2HVMA 1E5NA 4PCSA 2J7GA 2UY4A 3SCVA 4DWSA 4E2OA 3ZT7A 1Q6DA 3O9NA 2QPSA 3WDIA 6TAAA 1E43A 4LQ1A 1XD0A 3W81A 1UH4A 3WDHA 1VJZA 4JL1A 1UOKA 4HPGA 3TTYA 4D71A 3T0BA 5I0DA 1QOXA 1CGUA 1MWOA 1JXKA 1UWTA 3POHA 1BTCA 3FY1A 1AQHA 3TTOA 1DEDA 5E9AA 3CHFA 3IJ9A 1OT2A 4HPHA 3WD3A 1JNEA 1HT6A 1E0VA 4M80A 3K8LA 1VEMA 4M56A 1A3HA 1PZ3A 1TUXA 3CPUA 1HJQA 1E6ZA 2YOCA 3AROA 3GH7A 2J79A 4PYSA 2WWDA 1V3JA 2B31A 1KCKA 1K9DA 1UR0A 1V0MA 4H8VA 2WZHA 2EQDA 3OLDA 3G6MA 5CG0A 4DWSC 4IM4A 4JFTA 3FHAA 4Z2KA 4AIUA 1R87A 1UR2A 5HBFA 5C71A 2PB1A 1GOWA 3VGHA 1CXFA 4M82A 4TX6A 1DWGM 4JFSA 4Z2GA 1XCXA 4AZCB 5BYWA 1RP9A 5CSUA 3LMYA 1H11A 2CITA 4HA4A 4M1RA 4W8BA 1BG9A 4OZOA 3PBGA 2ZIDA 4MNLA 4AD5A 1B2YA 1TZ7A 4F66A 1JZ5A 3RJYA 1QI2A 3W82A 4Z2LA 2Y4SA 5FCZA 1NWUA 4GIAA 1SMAA 3MO4A 1CIUA 1CGXA 4JZ5A 2UY3A 1V02A 4D6HA 4PCTA 4AC1X 4MADA 3WQVA 3OLGA 4AZ6A 3EDFA 4TTGA 3PZVA 2W61A 4WF7A 1V02E 5E0CA 3WL1A 1ODZA 1O6IA 2WMHA 3AS2A 1QPKA 2DSKA 1XYZA 1UR1A 2GK1B 4F9DA 2X0HA 4TVDA 1GVYA 4F8XA 1FOBA 2WVSA 3WMCA 1W3KA 3VIHA 3VX0A 3N13A 1XSKA 3UR8A 3WQ5A 4PMNA 1FH7A 3N12A 4UFKA 5A6SA 1EQCA 4W8LA 5CZKA 2WM0A 1WDPA 2WMGA 4AD2A 3CIVA 4MB1A 2OSWA 3K4AA 1GHRA 3RILA 1UWUA 1UZ4A 3AMLA 4MDOA 1HKKA 5I3DA 3SUVA 1GCYA 1J9YA 2RGLA 2A3AA 2XVPA 1UH3A 3WDPP 4ZFMA 2VRQA 1CGVA 1WZMA 3ZQ9A 4WLCA 3SCOA 4AIEA 4RE2A 5A69A 4FLQA 3BSGA 2WC4A 3L4YA 2DGAA 1GOQA 4OOUA 2WMJA 3RPMA 7A3HA 2EO7A 1BGGA 1L0PA 1C90A 1BVNP 4DM2A 4H04A 2F8QA 5ABFA 1EOMA 1UKTA 2J62A 3AZTA 2OSYA 2BNJA 4JKMA 2VVSA 3MSGA 2X8RA 1KXHA 4TOQA 3VDBA 2UY2A 3VD3A 2VJXA 3ZJ8A 5C8BB 1QNPA 1KQZA 4LGXA 5DF0A 2ZUSA 2YL8A 1MW3A 4J3SA 2CBIA 2VZVA 2Y8VA 2VCBA 1X6LA 2DT3A 1E1EA 2WHJA 2PWEA 3OZPA 1E0WA 4R27A 5DFAA 1PBGA 1JZ2A 2O92A 3AIWA 2XFRA 3E1F1 3BCFA 3KE0A 5D9MA 8A3HA 1K9EA 3IJ7A 3T08A 2AMGA 3W4RA 1KGUA 1XCWA 2JEPA 2W63A 1RPKA 1W1TA 4ACZB 4AD4A 1B90A 4QCEA 2WMFA 1NOUA 4YHGA 2XGBA 4A3HA 1J10A 2XFYA 3THCA 3BMWA 3NYDA 4W5ZA 1DWIM 2V3FA 3UG3A 1J0ZA 3NDYA 4S3KA 4H7VA 3TONA 1J0IA 1ZBVA 1GPFA 1KXQA 3W24A 4P7RA 3A6OA 1LG2A 3WQ6A 1RH9A 4K68A 4J7RA 1TA3B 1U33A 2CEQA 3AHVA 3AYRA 1UD4A 1JYVA 3AI0A 2DIJA 4KWUA 3MV01 2V3EA 4P7NA 4XZBA 1B31A 4P7LA 5FD0A 1BYBA 3WMBA 1FFQA 1W2VA 4MPKA 2WHMA 5FIPA 2VX4A 1D2KA 1GJWA 5IHRA 1CEOA 1OSEA 1W3HA 4HMCA 2W5FA 1VB9A 2VX6A 1EIBA 1FP8A 3GM8A 5IDIA 3W6LA 1OBAA 4J3XA 4CKQA 5ABGA 4S3JA 1TFVA 1SR0A 4CU8A 1N82A 3CHDA 4MTVA 2DSWA 3KZSA 3DECA 3AZRA 4CCEA 5HXMA 1HL8A 1J0HA 3VKKA 5EFDA 3WNKA 1WPCA 3T2OA 4AZBA 4A4AA 4PRWA 5E6ZA 4AZ5A 1HJVA 4UOQA 1ZJBA 1D3CA 4PMZA 2JEQA 5IFTA 3NSMA 3OIHA 4WKFA 4AEFA 2JIEA 3DHUA 3T09A 4M81A 1UKQA 2E40A 2XM1A 4B9ZA 1AQMA 2W92A 4EKJA 1ZBCA 1CLVA 2J74A 3VVGA 2X2YA 2Z1SA 2BS9A 1J12A 3T2PA 2DQXA 3BLPX 1XV8A 2VR4A 3M6DA 4UOJA 4ZXOA 3VIMA 1GQIA 2WKGA 3MU7A 4LYRA 3GBEA 2ZUTA 4BA0A 4UOZA 4UQDA 1LJYA 4C7FA 5F7UA 3ARXA 1QHPA 5JUVA 3M7SA 1BLIA 3L4XA 3OGSA 4W7UA 1ODUA 4GZIA 1W9PA 2WK2A 3FHQA 4LYQA 1TE1A 5BXTA 4NZCA 3DYMA 4FLOA 1EO5A 2G3NA 4LPCA 2WHKA 1X1NA 2ZX9A 2QMJA 3VX1A 1UD3A 3IANA 2GK1A 4KRUA 1UD2A 3WH7A 2PI6A 3F5KA 2GSJA 1XYFA 1K9TA 1HJSA 2WVVB 1UWIA 3AHZA 3CBWA 3ARRA 4WIWA 1IT0A 4D6GA 1OGGA 4CGTA 5KZ6A 4WKAA 1QI4A 1EH9A 4PMUA 3L4WA 5EMYA 2DT0A 3A3HA 2VNCA 4MNMA 4C91A 2Y2WA 2VZTA 3VDHA 4WJXA 3SEPA 1C93A 2ZX7A 1MVYA 1MXGA 1AMYA 2CBJA 1AVAA 1R7AA 4QCFA 1OINA 3RO8A 1J0YA 2G4FA 3BH4A 4URIA 4W5UA 3SCSA 4GO8A 3WIJA 1UA7A 3K46A 3I3BA 2FH6A 1G01A 2XSBA 1UD5A 3W29A 4CD5A 2PF0A 4ATDA 2JE8A 3AS1A 4CN6A 3ARQA 2FHFA 4UNIA 3W53A 2OWXA 5JBEA
chains in the Genus database with same CATH superfamily
1PB0A 2CC0A 2QJNA 4TV5A 3FJ6A 3TOPA 4E3TA 1CLXA 2I56A 3WJXA 4QX4A 4DZ5A 1A5OC 2H3BA 4XV0A 4NNBA 1MDRA 2J88A 4B92A 1JF6A 2BVYA 2WZEA 3STFA 4QAWA 1IEQA 2E9MA 1FWGC 4AMCA 3W22A 4YYCA 3GUGA 5I23A 1LWIA 5D09A 4A05A 2QJIA 4TMBA 2IPGA 3N4FA 4ZCWA 3M46A 2J9XA 1UD6A 4PUEA 5TD4A 3AFBA 2WQPA 2VGGA 4XD6A 1ZL1A 2XUCA 5HPOA 3MC5A 3FK4A 5JXQA 1UUOA 2BHUA 4NAEB 3VABA 2PEVA 3V35A 1MW2A 3CQKA 1KFLA 4E4FA 3GAKA 4PCNA 5GPRA 2INFA 2HVOA 2QKFA 3ZR6A 2OKOA 4DYJA 2Z2BA 5TNVA 1UG6A 4J28A 3WSUA 3VUSA 1OCNA 3EEGA 3WNLA 3CIWA 3LN3A 1FP9A 3O6CA 1V08A 3TA9A 3BURA 4MGGA 2YJQA 3KL0A 3WLPA 2ABAA 3CQHA 1V3KA 4MKVA 1D3HA 4OQVA 1ITXA 2EPHA 4CNSA 1AG1O 1WCGA 3KLKA 4BF7A 3GB6A 2IQTA 4X9SA 1G67A 3N1AA 4M7SA 3R13A 4DAIA 2POTA 1VFFA 3RNDA 1K8XA 3PWGA 4E2DA 2VRJA 1OCQA 3BAXA 3A4WA 1C8VA 1ADOA 2CU0A 4CD8A 4HKPA 4UQCA 3K13A 2GGGA 4AF0A 3H7UA 3QHOA 1BWVA 2Q09A 1H7NA 1RY0A 2AOSA 3R4IA 5A8OA 3C61A 2VGFA 2Q6ZA 3BOLA 1KBBA 1G0CA 4LBUA 1EF3A 1SJCA 3UJEA 4ADTA 4O19A 4JHMA 4JYEA 1UC5A 3PSVA 4IMGA 1VEPA 1AA1B 4YCOA 4L6DA 4WJEA 3C0QA 1UQZA 3LSCA 1GQJA 1ZSXA 1EGZA 4C6LA 3VDGA 3CUIA 3UNTA 3RCMA 4E3VA 1JD9A 4GBUA 1CPUA 4CCDA 4X3ZA 4YMZA 1FWTA 3K8KA 2AL2B 4DZHA 2V30A 4PUWA 3XISA 4G8TA 3MSYA 1TZZA 2OEMA 5D30A 1UQYA 1T7LA 3ZLHA 3CHEA 1B4EA 1XIBA 3UETA 2PDYA 2OZ0A 5I7GA 1EDTA 1GVRA 4O28A 1UWSA 4P7QA 3NIYA 1H5VA 1TR1A 3STEA 3O3RA 3SUSA 3SUWA 3VILA 1E6XM 4AD3A 1I60A 2ZWYA 1B3WA 2WHLA 4DWDA 4GI6A 2OT0A 1V3LA 1ECQA 5LZLA 2ZUWA 2J75A 4QLLA 3V7PA 3CB3A 3LGDA 4ERIA 4GFIA 1T40A 2XN0A 1FWFC 2GJXA 5HAOA 3ZVIA 1MQRA 3ZSTA 3UZ5A 1XLAA 1W91A 1GW1A 2XIBA 4H9TA 2R14A 5C7VA 1S2TA 4TIMA 1H7OA 1OG6A 2DVXA 1T8XA 4M3PA 4B4HA 1U30A 3C2RA 2Y24A 1OFPA 4GKLA 2ZBTA 4QJ1A 1TVLA 3U9IA 1JZ3A 3ARVA 4IIDA 3MANA 3PFRA 1EHAA 3N15A 3M0YA 4C6JA 3PPGA 5HOSA 1G7UA 4DAFA 3GH4A 3L2MA 1H51A 4JIIX 4IIFA 4K1GA 3WBWA 5EY5A 4Q4SA 1FQ0A 4TX8A 1R86A 4GH3A 5GNZA 4OHQA 4UIOA 5AYIA 2H8XA 3OZOA 3WN6A 4CN4A 4JS3A 2RDWA 1YTKA 3P2VA 4QISA 3NDZA 3NQEA 3I68A 5CGTA 3ARUA 1HKIA 2A6LA 3S4TA 2FVKA 4CVUA 1S1PA 3SIMA 4MKNA 2REQA 1GOXA 3KP1A 4WY0F 2R9RA 3XIMA 3OLIA 3N29A 4MWAA 3H2EA 1LUCA 2F7FA 4PTVA 3RU8X 4E4UA 1G7VA 3M47A 1NARA 4WRHA 1NP0A 5LXXA 4GYKA 1KQYA 3NQFA 4QDMA 5F4XA 5MKGB 3SSJA 2PDPA 1LORA 2GSHA 3IVUA 4KEMA 4JTDA 4Q4KA 3AXHA 3OQEA 5TQLA 4KRTA 4DEFA 1PPIA 4OUEA 2YB1A 5EMJA 1KXVA 1EL3A 4OV4A 3FJLA 1DE5A 3EGJA 5DMYA 4DLFA 4K8HA 3WF3A 3AMGA 2PPGA 5CSRA 3OOQA 1BSLA 2VR5A 1IE7C 5I78A 3U2EA 5T9BG 2CHOA 3CUZA 4GQQA 3TZNA 3SQSA 1XD1A 4OGZA 4RW5A 4F4RA 2CXGA 3HGJA 1FHUA 5XIAA 4JX6A 3CYJA 3ANYA 1JI1A 3MMTA 2ZZ4A 1CZ1A 4S23A 2MNRA 4JCMA 1JCYA 2ACSA 1KO0A 2DUXA 2KX9A 1NSJA 4FNUA 3OBAA 4GNKB 6ALDA 5IOBA 2G37A 3RM9A 3GXDA 3P3BA 3WNNA 4B5WA 2EF9A 4NAFB 2XWEA 4TO8A 3NQAA 4F40A 5F4SA 3BSMA 2Z6JA 4Q32A 3CLWA 2J4GA 2HCVA 5H8PA 2J7FA 1E73M 4Q8MA 4GYPC 4H8HA 1JUKA 1VFHA 1D7FA 4W8AA 3ZYZA 4H19A 3LS9A 4EANA 3TC7A 4A8LA 1JI2A 1OD8A 4XZHA 2FFCA 2OCZA 2FHBA 3N18A 2DJLA 4I7VA 5A6TC 2RAGA 3SRKA 1HJUA 4LUTB 3GVWA 4O10A 2QNEA 5A6LA 1KXTA 3PZQA 1WO2A 2XG9A 1Q6RA 3KDNA 3KX6A 3IIPA 4ZSUA 3WF2A 3CUJA 1IT8A 1S1RA 3CMJA 3VIGA 3OEXA 2XN2A 2Q71A 4MIMA 3SCQA 4MYAA 3KWXA 2C1HA 2RDXA 3PJUA 3WJSA 2PCQA 1RK6A 3H7VA 1EFZA 3INPA 3PBYA 2EHHA 4AX6A 3PZNA 4NSBA 2XFWA 1MEHA 3L23A 4JTEA 2YB4A 4IPIA 1LL4A 3TK7A 1LOLA 2YBTA 5LKYA 1U2YA 2CFFA 5DRIA 2GDVA 3AOFA 1MXDA 3CIXA 1B3ZA 2V68A 2E5DA 3V18A 1Q5MA 1OIMA 4RNHA 4JY9A 3S9IA 5HATA 3E3HA 4LB3A 3KL3A 1EQPA 4DZAA 2VD9A 4Q8PA 2ZXAA 2EKGA 3UBPC 4L4PA 1REQB 3C0LA 3U2ZA 1A50A 2CESA 4NY2A 1LRQA 3P84A 2NQHA 3TFXA 5EB8A 4AQLA 3GDBA 3AS3A 4O0KA 4PTMA 3GDRA 2ONEA 1BPLB 2Y1HA 1XDMA 1VYPX 2AAMA 2PTXA 1NDWA 2F6KA 2X1SA 3PJWA 4CQ8A 2DSUA 4AISA 5CAKA 3NZ1A 3GFYA 5KTLA 3R58A 4MB5A 3PSWA 3MUIA 2NQ5A 4EF8A 3E2SA 3W28A 4XISA 3AHXA 1HN1A 5LNRA 1B3VA 4EX4A 3HQ1A 4D6JA 1WUFA 3AYVA 2OPJA 4D9PA 4ZTYA 5G2HA 2FPTA 1V3MA 1MFUA 3B4UA 2F6XA 3C3UA 4RNFA 4CNTA 3AIUA 5CJMA 1B4KA 5FJJA 3J7HA 3KHJA 2X0YA 1E4LA 1JQVA 4IJCA 2DSVA 3ANUA 3IS4A 1A47A 2CLLA 1E0TA 1UHVA 1Q4NX 1TWZA 3W2NA 1XM3A 4Z2HA 4K36A 4PGLA 3KW3A 4ATLA 3TDFA 3TLLA 2WCGA 4MB3A 2HROA 2ZOXA 3BARA 4TVCA 3B0VC 1WUEA 4V2XA 1W1IE 1EBGA 3MQTA 3FKKA 1GORA 3LV5A 4DUVA 5BOOA 4NHVA 3MSDA 3TTSA 2OYKA 3AXIA 1VIWA 4ASTA 4XZIA 5C9RA 1E72M 1J6PA 3LA4A 1MEIA 1W1B1 2PZNA 4O0ZA 5A2BA 2G95A 5EFFA 1R0MA 2W27A 3GAYA 3L7RA 4UB9A 3U2CA 2C71A 2RDTA 5XINA 3TW6A 2RH9A 5CAHA 4AW7A 5LNUA 4EPDC 3P80A 3GHRA 1W1VA 4PB5A 4QHRA 1MEWA 4X2RA 3IVSA 3EX3A 1NIUA 1S39A 4DELA 4MWAE 1P7TB 1E70M 4Y9AA 2I1OA 2D0GA 1H62A 1IR1A 2E0PA 2E68A 4IJRA 4DJFD 6A3HA 3W1TA 5LA2A 1YADA 2NWSA 4G6CA 1I1XA 4GY7A 1VFOA 1EX5A 1PHWA 2WNNA 3A4JA 5CPQA 3PZIA 2CLMA 4ERAA 2VT0A 3IJDA 3VUPA 2BP1A 5ABEA 1SYTA 1JPDX 4R53A 3N3MA 3WF4A 3TOYA 1JDFA 3WD1A 1JDAA 4AYSA 1IR2A 4EK7A 2E5BA 2HVNA 4NUWA 2VVNA 2J9YA 3C86A 3RM8A 2CBUA 3VIKA 2DZUA 4Q22A 4NRSA 1JRCA 4ZMGA 1YW1A 1UIOA 1OK4A 4NJIA 3GTNA 2FB3A 4KFPA 1JF5A 3W7NA 1PWMA 2CCRA 3BCDA 2IXUA 1E6NA 4CUCA 4FAMA 4MAZA 4P61A 5D37A 3OGRA 5E1QA 2DORA 5BOEA 5HNRA 4RPQA 2CKRA 3QPYA 5HNTA 1E3XA 4POCA 3KOFA 3HU7A 3GQYA 3MMDA 4WSKA 1NWSA 5C0QA 3AU6A 4TVUA 2P76A 1W9BM 1YQ2A 3VA8A 3CYVA 4MFDA 3KRBA 1GONA 3N73A 1V6XA 4UR7A 5HA7A 1XF0A 1E4IA 5CSSA 1OEPA 2ZKMX 5ENLA 3LLXA 1F3EA 4US5A 4W7WA 1XH0A 1P48A 3TQVA 1M7JA 1F3TA 3E49A 2PWUA 4U2ZA 4E38A 3PVFA 3THUA 3N14A 4D6FA 4V1YA 3EDDA 1JYXA 1PIIA 1ZBWA 4PBFA 4PULA 3F5LA 4O1CA 3WD2A 3DN5A 2OWWA 3LQLA 3DC0A 3AISA 4XB3A 3T7VA 4P8WA 4D6CA 4EF9A 3A3XA 3KS5A 4ZO8A 5I77A 3UG4A 4G7EB 2OGYA 3KCLA 1S5MA 2GJRA 4LNCA 3PAJA 1Z3NA 3GU2A 2C19A 3PNUA 2XSXA 5AC4A 1Q7QA 3W7PA 2HXUA 2XIOA 3BTNA 3PUDA 4G56A 2OZTA 1OCJA 3GH5A 1KKRA 4LCRA 4HA1A 4H9UA 3MUY1 2QPUA 2V5DA 3W6MA 5HMSA 4GCXA 1LM1A 2OWCA 2RJHA 4Q4MA 1SR9A 3UERA 5LA1A 1VRXA 1CXIA 2WSRA 4UTWC 1GYMA 3IAQA 1FCQA 2XVNA 4BQ3A 4TTUA 3AMCA 4A35A 3GKAA 3CEUA 4FNTA 3ZT6A 3W37A 1A5MC 2NQLA 1OCBA 1JZ7A 3IIXA 1XC6A 3EX4A 3NDOA 3BWWA 3W88A 5K7JA 2V67A 7TIMA 1XIIA 3MVTA 4PTDA 3NG3A 2GQ3A 1Q8AA 2VL4A 4YTUA 4HOXA 1CXHA 1DOSA 4GQBA 4H6RA 1AH3A 4IT1A 4PH6A 2VURA 1GJUA 3GXTA 2WSKA 1C92A 4PODA 2UZ9A 3B9OA 5HNUA 1DJWA 4LEFA 4AZ7A 4WHBA 1K02A 1QOQA 1XIHA 5AVHA 4XZ9A 1YBQB 3DKLA 3E96A 4A2RA 1M7XA 4CD7A 3TYCA 3NZRA 3VKBA 3FKRA 5A6MA 3O07A 3UU0A 4L6HA 3M6YA 4UCFA 4IG2B 1LBMA 3LHZA 3R6IA 3WJZA 2VZUA 5E6YA 1V6VA 1RVGA 4GLEA 2VOTA 3W1PA 4GCAA 3FW6A 5CBBA 1XHGA 1L8NA 1IEWA 3D3AA 4IOTA 4RKAA 3HGRA 2CIPA 4BQ5A 4UTUA 4ZOCA 1OFOA 2ZRUA 1JGIA 4ZQCA 1LT8A 3W1LA 4GY0A 2RKXA 1ICPA 3DHPA 2NUXA 1WBJA 1EOKA 1VBHA 3RFAA 3RDKA 3TWAA 2QUTA 3V4BA 1JRBA 1LWHA 3II1A 1GEHA 2J7BA 2W6RA 4U10A 3EOOA 2J77A 3QVQA 4NZJA 1BKHA 2GOUA 1EZWA 1BF2A 4RE3A 1K8YA 2WKLA 2Z29A 4HA0A 3G22A 1LQAA 3AIEA 2NX9A 1F9CA 2C14A 3PANA 3DHFA 3NR0A 3S1UA 3A9IA 4ZGYA 3HF3A 4G2DA 6ENLA 3LQGA 1TPEA 5DX7A 4WDWA 4Z1AA 1E9YB 1H49A 3WDJA 3B05A 1XBZA 3QF0A 1UROA 1XKYA 2YDQA 3CL6A 4PN2A 2ACUA 2NUYA 4LS0A 1SZNA 3DBNA 3KLLA 2YDSA 2NUWA 1TTQA 4QE5A 4GIYA 5CPOA 2HJPA 2FZDA 2WLZA 5FEPA 2BVTA 2Y8UA 2WNQA 4AWSA 4WGXA 4C5YA 1NWTA 3QN3A 3R8RA 1HKWA 1ZU8A 3L4ZA 1WKYA 5A8PA 2V38A 3EDKA 5B7YA 3ARYA 5CH9A 2FDMA 2ZDSA 1ISYA 3VNJA 3WK2A 1MZRA 2UBPC 4Y90A 2QCFA 4ICNA 2YW3A 1PSCA 3MP3A 4O18A 1ZCCA 1R8LA 2PDNA 4K8GA 1YHTA 4Z2IA 1F4AA 1XIMA 3MUXA 3HM7A 3QYSA 1YXCA 2HDJA 1NWRA 4ZQMA 3LMZA 3SUTA 2BVWA 2P50A 5C9UA 3W71A 2CWXA 4FO4A 1XYLA 3CH9A 5DO8A 1ISWA 3OLEA 4HHPA 2RDUA 2WPGA 3LBCA 1AQFA 4ORIA 2VI0A 3WUBA 1KW1A 3W9ZA 5DMNA 4Q8VA 3TV8A 1BFNA 1BYAA 5FL1A 4UR9A 4AMAA 4PR4A 3WK0A 3G6LA 3PBUA 4C6CA 1G1YA 1DWJM 4W9TA 1Z48A 3ALGA 3QLLA 3MWCA 3UWQA 3GX9A 1UKPA 3EWDA 1F76A 4PCSA 3SCVA 3TYDA 1YIXA 3DERA 3E9AA 3ZT7A 3O9NA 3WDIA 4LQ1A 1XD0A 4HYRA 2QCCA 5AHFA 3WDHA 3W72A 3KRSA 1F3WA 3TTYA 1W5MA 1CGUA 1UWTA 1F7BA 4AWTA 3VNMA 3ZWSA 1POKA 1VGAA 2YCKX 4FIRA 1JNEA 2FYMA 5AN7A 1IIHA 4ALDA 1SJDA 4Q7BA 2I9EA 3K4WA 1XLMA 3HG4A 4V15A 2VEIA 3AROA 4NVTA 2J79A 4PYSA 2B7QA 3QMSA 1TR9A 2B31A 3U48A 4ZFCA 3B0PA 3TQ0A 3CAKA 1ICQA 4DWSC 1YBQA 5A8GA 2PRLA 1ZZMA 1R87A 3QPEA 2C16A 1HGWA 2PB1A 3VGHA 1XRSA 2PDJA 2R8WA 3QTGA 2Y7FA 3VFCA 4M82A 5FA5A 4Z2GA 4AZCB 3KOXA 5CSUA 1EP1A 2QT3A 2D73A 3LMYA 1RJPA 5FF0A 2H8ZA 4W8BA 1FRBA 1IHIA 1W17A 1ZALA 7REQA 4LVDA 2QDGA 1B2YA 1TZ7A 2GPTA 2FTPA 2QCNA 1WDDA 3W82A 1Q6LA 2Y4SA 2R1KA 1X39A 5XIMA 1VFSA 1SSDA 1SMAA 1I9CB 3MO4A 1KFBA 4NKCA 2E6YA 4JZ5A 4D6HA 4PCTA 4MADA 3U8GA 9RUBA 1R46A 1I2QA 1BQGA 1ZENA 3PZVA 4MPQA 4WF7A 3V16A 3GVVA 3GDLA 3TR2A 1IEIA 4F2BA 4TVDA 1FOBA 2C0AA 1VP5A 3WBYA 3WMCA 2YX0A 1C29A 4IFOA 3N13A 1XSKA 4DI9A 3WQ5A 4PMNA 4UFKA 2PSNA 5A6SA 4B2DD 1EQCA 5TF0A 5AHNA 4Q8OA 2O55A 4M6QA 3SW6A 3NPWA 4FEZA 2XZ9A 5HINA 4MB1A 3W6YA 1OC6A 3RLVA 3BQ5A 3GVGA 3K4AA 3HFTA 1UWUA 3REQA 1W5NA 3UF9A 2YR1A 3WDPP 4ZFMA 1A53A 2AGTA 2G97A 1CGVA 3VOHA 5KMYA 4DLMA 5A69A 1NELA 3BSGA 2WC4A 3WLQA 1JR1A 3A5FA 2WMJA 7A3HA 2EO7A 1JCNA 1KM0A 3ITOA 2ZRVA 1C90A 5U4NA 4Y96A 4L1WA 2F8QA 2OSYA 4JKMA 1QPQA 3K2GA 1EWEA 2UY2A 7PTDA 4YTRA 3IPWA 5C8BB 1KQZA 1MSSA 1DVJA 1RJQA 4DF2A 1NU5A 1KBLA 3OA3A 3DFHA 2Y8VA 4AF0B 4GVHA 1X6LA 4I8YA 2PLJA 1TPWA 4FHAA 4AEOA 2WHJA 2PWEA 2Y0FA 3QM3A 4HYVA 1YTDA 3BJFA 2O92A 3EOSA 1XYCA 5B7ZA 3W76A 1KGUA 4UTMA 1G4PA 2W63A 4O13A 3A13A 5DMMA 4AD4A 1B90A 4YHGA 4N4QA 1F3XA 1TWSA 4Q6XA 5LIYX 1XDJA 3KVMA 2A7PA 2V3FA 3TWBA 2IKJA 3FA5A 4JD4A 3NDYA 4KW2A 2OO0A 4S3KA 3G1FA 3ZR4A 1ZBVA 2E67A 4L64A 1RH9A 3ONBA 4L7ZA 1T5AA 3AHVA 3AYRA 5HUOA 4I9MA 3DIPA 1NDYA 1YXDA 2V2DA 3JZEA 1F05A 3M5VA 2HNHA 5FD0A 3DFPA 3TYUA 1XLGA 3EWUA 1SSGA 4FF7A 2OQHA 2WHMA 1PO9A 2X42A 3CM4A 5HR7A 3LUTA 1VB9A 1I6NA 3V1PA 3URNA 5IDIA 5CGQA 5M2FX 1TX0A 4LW7A 4J3XA 3VZXA 4YWSA 5ABGA 2WZMA 4JN7A 4OT7A 4JX5A 4CU8A 1L2UA 1B5TA 1GYLA 3M64A 1TV7A 3AZRA 4CCEA 1K7EA 5DQPA 2DZXA 3ELFA 1AD4A 4AZ5A 4GUGA 4UOQA 4WSHA 1EUAA 4A8IA 3XINA 4AHQA 2QQ6A 3R11A 2JIEA 2YCLA 3WCZA 1BRLA 3IK4A 1CLVA 3N25A 4ZBCA 2BGQA 3ITGA 2X2YA 2Z1SA 4P00B 3AO0A 3T2PA 2PTDA 4LU0A 1TJPA 3G24A 5KINA 4YCPA 2WKGA 1KFJA 4LYRA 4NXKA 2FFIA 3SFWA 4LVGA 2OT1A 4C7FA 4ZVJA 5JUVA 2JKEA 1RUSA 3L4XA 2NX3A 2V5JA 1ODUA 2IKIA 2LLEA 4ORMA 2YW4A 2OR2A 3NYZA 1VZWA 3DYMA 3AU2A 1EO5A 2G3NA 2ZX9A 1UD3A 2R94A 3WH7A 2PI6A 4H7CA 2GSJA 2JKAA 1K9TA 1HJSA 2WVVB 3CBWA 3R1ZA 3ARRA 4D6GA 5KZ6A 4X60A 2PMQA 4WKAA 2CW6A 1Q3NA 3L4WA 4I90A 2ZE3A 5EMYA 3A3HA 4MNMA 3C2YA 1FBAA 1DV7A 3VDHA 1OVDA 1C93A 1JEZA 4LBSA 1MXGA 1AVAA 3SRFA 3T0CA 1POJA 4JTFA 3BH4A 3QMTA 4URIA 4O8AA 4I5UA 4DYKA 1GVSA 3M0XA 3R25A 1SO5A 1G01A 1UD5A 2JE8A 2J9ZA 4RW3A 3VE9A 3HPXA 1J0KA 1IEVA 3N2OA 3LENA 2PF8A 1XW8A 2Z27A 1RZMA 3HFYA 4PUJA 2D23A 1B1YA 3NO5A 3TYBA 4ZOBA 2WPBA 4O17A 2I5IA 2Z7KA 3W3OA 1EPXA 5HWNA 3Q37A 4OBRA 4KERA 4K6AA 1G69A 1MW0A 4AU0A 3B3DA 4H01A 5H8MA 2VX7A 4S39A 3FYPA 1LCOA 2V63A 4IG2A 3RRXA 5LIUX 1L2QA 4N9CA 2ZRZA 4IPJA 5DY3A 1AD1A 4JN6A 1PHQA 3NQBA 3QHMA 4PSRA 4GUJA 2PA6A 3OBEA 3UQNA 5RUBA 2ZXQA 2X05A 3TJIA 5A95A 3EB3A 4OV9A 4QAIA 5BXSA 2HE5A 5GJMA 3GTHA 3GNNA 3NWRA 3BZGA 2GDQA 1N7KA 5A6AA 3SADA 5A3HA 4HOWA 4LVFA 4ONVA 4PB4A 4B5UA 3UXIA 3LU2A 1R6WA 3W74A 1VQTA 2OO6A 3CO4A 1YEYA 1DORA 4N2YA 3MO7A 3MMUA 1X1ZA 3DFSA 3H22A 1XBYA 4UTFA 2NXGA 1V03A 3T55A 4ZEPA 2CZ5A 1SPQA 1BSIA 1MUWA 3B9AA 1O5RA 1W9XA 2DUZA 2DIKA 3QH2A 3ABXA 3NVTA 3I3EA 2BHZA 2JF7A 2A7NA 4OBTA 1OJXA 4LRTA 3MP5A 4LT9A 5G4EA 1DE6A 4V1XA 1OX4B 3LXCA 1P5BA 4LF1A 1HP4A 1QWKA 2W3ZA 1M6JA 3I6EA 3GBDA 3LGEA 4QDWA 4GVGA 4YWIA 3P62A 3AJ7A 4RZ6A 2CLFA 3IVTA 1FY6A 3S9ZA 2E1DA 2XFFA 4IFKB 1XQLA 1N8WA 2TMDA 4QNWA 4E8DA 3DFYA 4US6A 3UPBA 1EC7A 1PUDA 5BZAA 3PUGA 4I9TA 2OG9A 2WNWA 4FOJA 4I6VA 3CZLA 4RE4A 2E6DA 2A3LA 2ZZ3A 4HHMA 2VWTA 5LIKX 4RR4A 4W85A 3R0DA 4Q33A 3F5JA 1EJRC 9XIAA 2CZVA 2C3ZA 4MUPA 1OC7A 3IJ6A 4UTKA 3WUGA 3IUDA 1XIDA 4AG0A 2WYSA 5CPSA 2VHLA 1GZ1A 2EEXA 2VELA 1XIJA 2J7HA 3LB0A 2DEPA 2DZBA 3NJ3A 1IEXA 3WMSA 3W7JA 3E6EA 4JQ1A 3UJ2A 1GT8A 4KCUA 5CBJA 2GGEA 3AIQA 2XH0A 2ZA1A 5GNXA 4JAWA 4PUDA 1MXSA 2FHCA 3LYEA 3PFMA 3P60A 4S3FA 1DIEA 1K70A 4D6DA 3VKAA 2VUYA 3EKZA 1VKFA 4KWSA 2VTFA 4B2DA 1AUSL 1KRCC 2EPLX 4GQ0A 1KRAC 2H9AA 4RLIA 4JTGA 4Y9OA 2OLAA 1OM0A 3PTQA 2XJ7A 5E0FA 1TA3A 3UCDA 2WC7A 3CQ0A 1F74A 2BG5A 1CB2A 3VD5A 4QTGA 1SO3A 3PG9A 3VGFA 3NGJA 4IH3A 3MCNA 8RUCA 2J7CA 1M01A 2R1NA 1JG9A 3DI0A 4G5DA 5I5RA 1YYAA 4JIEA 1H60A 3KVKA 2VENA 1VYRA 3AHTA 1YNPA 1Z6KA 2YDRA 3HZ3A 4PRTA 2HBXA 1HVXA 3TYAA 3LM3A 4ZE4A 5CEWA 5C70A 5LGXA 2XIJA 1MW1A 3PUOA 4O53A 4OU1A 3B4YA 4PUUA 4JQ3A 3T8LA 4G7FA 4DO5A 1AMKA 2WCAA 3FN9A 3EMQA 1U22A 5EMLA 2RGMA 4RDZA 1TRDA 4JTIA 4GUIA 1X8FA 1QO2A 4WSJA 4ACYA 4J27A 3TH6A 2R1PA 5REQB 3GTXA 1EDQA 2C8NA 3C8NA 4GZEA 3VIFA 1V3HA 3P61A 3LX9A 4H8UA 4GUHA 4HTBA 2DZWA 4BFAA 4P8VA 3N6JA 4GY1A 5LA0A 4J3TA 2FQIA 1O4UA 4K39A 1XBVA 3H2OA 2PDUA 4BJHA 3LCFA 3RJXA 3RR4A 1Q6CA 3F4WA 4O4WA 2QIWA 3S6TA 2VDIA 3IGHX 3L0NA 4MY8A 3LZ3A 1SQ7A 1NEYA 5KITA 3ZSSA 1CWYA 1HZYA 1UP2A 3PZGA 2AGKA 2PD9A 4CQDA 3EX6A 5AZ1A 3ARZA 2Y70A 1W5PA 4QJ3B 3NQMA 4EOUA 1BYCA 5J8LA 1TE6A 3AWOA 5I3HA 3KHDA 4BR1A 4YLWA 1V5XA 4ZB0A 1ZJIA 2TAAA 1VF8A 3M0HA 4HBKA 4HNTA 1DJYA 1TV2A 3G77A 4AXNA 1GOOA 1NQ6A 5J04A 4IIHA 3KRUA 3REQB 4DYEA 2DSZA 3E0LA 3LHYA 2ZE0A 2WWCA 3NZQA 3EXRA 4ZODA 3DCPA 3F4DA 4A29A 1X97A 2OELA 3WH8A 1NDVA 3WEZA 3LGGA 4DO6A 4R9XA 4XTDA 3EX2A 4ZOAA 2WVUA 3UT0A 5D32A 4EP8C 1LL7A 2O9TA 3K4DA 3GNRA 1SZGA 2BY1A 5ECVA 4IGSA 3ABSA 3GNPA 1KWKA 2DW6A 3D47A 2X09A 1CXLA 1DTNA 4CNPA 3B06A 4MWAC 3TVAA 4C7DA 2OSXA 4UQBA 1U5VA 1J5SA 4FX8A 2Q3OA 5G1MA 2Q02A 3UGRA 1YE6A 3DUGA 3I10A 1Q6FA 2FZBA 4WOZA 3ITLA 1WZAA 3HPFA 3R0UA 3GO2A 4BKNA 5K2ZA 1O66A 3KTSA 4JTQA 2IPFA 5FAGA 1P6BA 3QQWA 3R12A 3ARWA 4DXKA 2G3IA 2GGHA 1O5QA 3VMNA 2P5NA 3LTSA 5DN1A 4W84A 1B3YA 4C6PA 1EBHA 2QDEA 3KFTA 4QXIA 1OB0A 4ZOEA 2ZUNA 5CPNA 2ZVIA 2XTKA 5D4YA 3WBXA 4QRNA 2EPMX 3QV6A 4UXDA 3G0XA 5IM51 5EJZB 3WZ0E 3N11A 4E6MA 4IFRA 5HMEA 2WMIB 1WYIA 3MP4A 4AZCA 1FHVA 2V3DA 4F3HA 4C65A 2BGNE 1EA9C 3PBMA 3SECA 1HL2A 3EWBX 3JS3A 4QLKA 1Q6EA 3TUUA 2CLIA 1BWLA 1L9WA 3L2IA 1LRNA 3VIOA 4U3CA 4DJDC 4AB4A 3QXBA 3CHCA 1RHCA 4F2TA 2WSQA 3SB0A 3O15A 4Z0SA 4R88A 2AKZA 1CYGA 1XUZA 3CS2A 3M44A 4GI9A 4DO7A 4IX2A 2WV8A 1ECEA 3VDCA 5C6MA 1R38A 3B03A 3W1MA 1RD6A 1XUUA 6PTDA 1JFXA 4OECA 2Z1WA 1JJKA 4AZIA 1HKMA 1WXJA 3BGJA 1BXBA 1O5XA 6CGTA 2Q8ZA 1ALDA 3EEZA 3NQCA 2YBVA 2J6VA 5A6JA 4FMVA 5HJXA 2FMNA 4E0CA 1TTIA 3CASA 3WD0A 3QV7A 4MZ1A 3M43A 4A3UA 2VQTA 3OJGA 4GA8A 4FS9A 1GOIA 4GD0A 2DDXA 1PKYA 1V0KA 3CQIA 1QNOA 3S2NA 2CBVA 4DHGA 1D3GA 3UWZA 3TSDA 1XLEA 4FLSA 4LAKA 4X0VA 1R3YA 3MBFA 4PCFA 2FVLA 1CW2A 1GVEA 4IL0A 3LNPA 1LOQA 4EIVA 1CXEA 2CZEA 3VZYA 3CPGA 1EF2A 2FH8A 1V0NA 2XINA 4PMRA 5EMMA 2JFEX 1IXNA 3CAVA 2G3MA 1ME9A 1WXYA 4M8UA 4EWND 4NZ1A 4XZWA 2HS6A 4GINA 3MI6A 2NV9A 4KEZA 3SY8A 1T96A 4HSNA 3JW7A 1V6YA 3R89A 3PZMA 2Z26A 4KCVA 3OGVA 2RHGA 2J8FA 1PYFA 2JK2A 1H4PA 3RR1A 1B0IA 1N2VA 4UTHA 4LY4A 2OEJA 5FJUA 2BVDA 1VS1A 4N0RA 1DBTA 2VEKA 1QPNA 4J3WA 3WNOA 1M7PA 2FZNA 1WKDA 4YTSA 4S1FA 3H2NA 1R47A 2JQXA 2Z24A 4IISA 5CBIA 3W7RA 3VD4A 3W84A 3M0LA 1R7OA 1W9VA 3VD9A 1RLDA 4DPPA 3OIXA 1W1A1 3HB9A 2CLPA 3IGSA 3NQ7A 4AUBA 3QFWA 2ASHA 3OU8A 5EGRA 5FESA 4G1KA 4WXYA 2O9RA 1N8IA 3LLDA 1JFHA 3PWAA 3GXMA 4B5XA 1TIWA 4L56A 1QU4A 1KM2A 1JNDA 4Z2JA 4ZQRA 1GG0A 1EJVC 3TXZA 1BD0A 2QJHA 1NP2A 2QZRA 4UFLA 2WZIA 5BROA 2YCEA 3WBAA 1KLZA 3UCQA 4YPJA 3ME3A 4WKHA 3MHFA 2YLAA 4O1EA 4OKDA 1E15A 2BXZA 3S83A 2PWDA 3VIJA 3WLKX 3PHAA 4O1BA 2PWFA 1P7TA 3I7SA 4Q8UA 1C7SA 1CGYA 3LI0A 1JYNA 3ATZA 1XYBA 4O8RA 3A47A 3TC3A 2ZXDA 1P0NA 3WK1A 1YDNA 4DZIA 3WENA 4HCLA 3JVAA 1O1ZA 1VAHA 2GJXB 1WZLA 1Z89A 4XG1A 4WQ6A 3VIIA 4UZSA 3FV9A 4OFCA 5LYRA 1X7IA 1XDLA 1QW7A 1YX1A 1UPPA 2E9BA 3WNMA 3TU9A 2EAWA 1XRFA 4RDWA 4E4PA 2QGHA 4DNHA 2ZZ2A 3U0HA 1EYEA 3RPDA 4V28A 1E6RA 3FCPA 4JR5A 3L68A 1LLWA 3BMXA 3EMCA 3NGFA 4HD5A 1MQQA 1E40A 4LS2A 1VBGA 4Q8WA 4LJ3A 1KFCA 3A9BA 4X9YA 4V33A 5D33A 2V5KA 1UR3M 4ICCX 3O7UA 1BYDA 4D8LA 3W87A 4XK2A 3BJSA 1CECA 1OGBA 3NQ8A 4ENLA 4O11A 1K9FA 4NZ4A 4D6IA 3W7MA 1V0LA 1OIFA 5HMDA 4Y9MA 1S46A 3MUAA 4MJ2A 3QTPA 1LWJA 1ZP3A 4IUOA 4IQLA 4GJJA 4E5TA 1IZJA 3R2GA 5D05A 3RU6A 1PDZA 2FGZA 1GQKA 2ZWZA 5F2IA 7CGTA 3CMGA 4H8NA 3N9RA 3W83A 4GNJA 3L4VA 4RDYA 3W2MA 1QPRA 1XIFA 2W67A 3ZJ6A 1H1NA 2FVMA 2ZUMA 5JMUA 3KBJA 3PN8A 3U7BA 2GOKA 1WKEA 1ZAJA 3WUEA 1IIGA 2VCAA 3A24A 1Q4WA 2WJEA 2PGRA 4GX8A 1AQ0A 1VC4A 4UQAA 3CUGA 5G2IA 4ES4A 1E0XA 1UWRA 4QIUA 4MF4A 2YL6A 2Z1VA 4R5EA 4DRSA 1TWDA 4XZMX 4L65A 4FOKA 2Z2AA 3K30A 2V0TA 5E93A 1QW9A 2KZHA 1V3IA 1EDGA 3B8SA 4C1NA 3DGRA 3GY1A 4HZMA 3FDGA 1FKWA 5AZ0A 4OTKA 4W7VA 5BNKA 1M41A 1G4TA 1UC4A 2R24A 3TR9A 3W73A 1FH8A 4GKTA 4YL2A 3W38A 3UXKA 2Q3RA 4A3YA 2G5WA 3AZSA 2PP1A 2WVTA 4NAFA 4HU0A 4ZQPA 2XYLA 2FGBA 1GYNA 3PB2A 2QUUA 1K6WA 3M7WA 1HW6A 2GVYA 3CC1A 1E4MM 2DVUA 2EJAA 1Z8AA 4QFUA 2QAFA 1PTAA 3IACA 4LALA 2OOGA 4DM1A 4W86A 4ZA0A 3TSBA 1ZLPA 5HR6A 2ISSA 3A5VA 4XBKA 1XL9A 5JIWA 3WQFA 3NPVA 1DJHA 1XRVA 3I6TA 2QW5A 3ZFHA 3GU1A 3E0VA 3N17A 3DI1A 3IGUA 2DH3A 2VGBA 4AVNA 4CVWA 1H7RA 1PKMA 4YVVA 2W62A 4PB3A 1ISZA 2WSPA 2QPXA 3OG2A 4NNCA 4L80A 1O7AA 5JH2A 4F0RA 3CK5A 3WYZA 3WQDA 2F38A 1W56A 2VC7A 2Y7GA 3VI2A 4OVXA 2YA2A 3VTRA 2ZZ6A 4PMOA 3RM4A 1JDDA 2V3GA 3QR1A 3TN4A 2ZRWA 1UKSA 3VFLA 2Y5SA 1FXPA 5J5DA 2ZICA 4QEHA 3DAQA 2TYSA 1Z42A 3WLNA 1WNOA 3KVLA 3C3NA 3HG3A 3FYOA 1SFLA 5AC6A 4MYXA 2W91A 4W87A 4I9AA 1K1DA 1KRMA 3LPOA 3IK2A 3BAKA 3L21A 1VBUA 4LAZA 4ZSTA 4L4OA 5I6SA 1E3ZA 1S2VA 2GVGA 4RL3A 1LQ0A 1OZMA 3MV11 3VM5A 3E74A 2WJDA 2NV1A 2I14A 3LZ5A 2QUNA 4UWMA 4B5SA 1JD7A 5FSEC 1QRQA 4HK5A 4N9DA 4KWWA 3SCNA 4CQBA 4JYFA 1PYMA 2G0WA 3MT1A 1TSIA 4N6EA 3FYYA 2HSAA 1H0IA 4LAOA 3RK8A 4LWWA 1ITUA 2Y85A 3E0FA 4HHHA 4XKYA 3T1GA 1CDGA 4PMQA 2C1IA 3WLMA 3GW0A 4XAZA 5HWJA 3L5MA 4Y7EA 2V6AA 3SFKA 4RV8A 5F2LA 3PR2A 4N42A 3PPCA 1GHSA 2F6UA 2XHYA 1QI5A 1VLIA 1GKRA 1W3JA 2HTMA 5D9OA 4FX7A 1JPMA 2PLMA 4UNLA 4RNIA 4BWLC 4AYGA 1VENA 1LTDA 3DBPA 2VXNA 3HPSA 2ALDA 3BW3A 2BX7A 4XZLX 3UXAA 3OB8A 3MZNA 2VFDA 3MVIA 5D8WA 3CWHA 1GNXA 5I02A 1YDOA 3GIYA 5CSYA 3WH9A 1UZ1A 3BG5A 5A2CA 1SFSA 3RAOA 2WC3A 1PTDA 1WKFA 4DWSA 4ZO7A 1AZ1A 1OFDA 5AVNA 1SJBA 1YNQA 3QQ0A 1UH4A 4JL1A 1O1HA 4NZ5A 1AK5A 4X22A 4HPGA 3T0BA 3F4NA 1JXKA 3H55A 3WQOA 3C4UA 1MUCA 3CHFA 3L5LA 1OT2A 4HPHA 1FCBA 1HT6A 1E0VA 1NVMA 3K8LA 1VEMA 5CZ0A 4M56A 1SFJA 4FNQA 3HTWA 1A3HA 3DXIA 4JBRA 1TUXA 2CLHA 3COTA 4XD4A 3CPUA 1HJQA 1PE1A 5ABTA 2YOCA 3GH7A 4NJGA 3LCXA 3KBVA 4Z1BA 2PODA 4AVOA 1V3JA 1UR0A 4BI7A 4XAFA 4YU1A 3WG6A 2WZHA 2EQDA 3OLDA 2V5BA 3H2AA 3GW3A 2WM1A 5CG0A 4PUMA 5H91A 3LDVA 1OFAA 5HBFA 4JPGA 5C71A 2R82A 1S5TA 3QC3A 3HO8A 3C8FA 4M6PA 1CXFA 1RBLA 1IWPA 4BK9A 5LIWX 2PDKA 4LS1A 4EACA 3S6DA 1F6YA 3G1VA 4M1RA 3UA3A 4GOAA 4C1LA 2DU2A 2ZIDA 2OOFA 3S6OA 3W01A 4NP7A 1FCVA 1F8IA 4A21A 1JCMP 3IRSA 1RD5A 3H26A 1QI2A 3S1GA 3P74A 1NWUA 4PA8A 4GIAA 1NDZA 4KF1A 4XSMA 3DOPA 1IWAA 3MZ2A 3MWAA 2B7PA 4AZ6A 3WQVA 4R3UA 3MUCA 3ZLFA 2GGIA 3EA1A 2WSYA 2H6RA 5DCEA 1V02E 2PFHA 5E0CA 3WL1A 1ODZA 4LCQA 2WMHA 3AS2A 1ME8A 3BW2A 1QPKA 1X1OA 1UR1A 4F9DA 4EVZA 1GVYA 4F8XA 2WVSA 5FF7A 1WOBA 1WOAA 1W3KA 3OTRA 2A7RA 3VX0A 1KM5A 3UR8A 1U5HA 4WY0B 1S2AA 1RA0A 3N12A 3OODA 5K3VA 3RLUA 1AH4A 3E2RA 2WM0A 4IWWA 4AD2A 4UMAA 3CIVA 4O1FA 3NOYA 3ABQA 2QXWA 4DY1A 4JTHA 1HKKA 2A6NA 5I3DA 1VCVA 4GXWA 2XVPA 4N7QA 4GXMA 4A8NA 3ZQ9A 4AIEA 1YRRA 1UP0A 1YKWA 4FLQA 4IJBA 3HJZA 3L4YA 4OOUA 1M1BA 3RPMA 1BGGA 1L0PA 1MI3A 1BVNP 4NL1A 4Q8TA 5D2YA 3IUIA 2Y63A 2BNJA 3IIOA 3VNKA 4BY3A 2VVSA 2C91A 3NXLA 4TOQA 2YXGA 4RCXA 5BU9A 3ZLGA 3ZXWA 1QNPA 3GZ3A 5IBXA 4E2BA 1BVWA 2VDGA 5DF0A 2ZUSA 3E12A 2YL8A 4R33A 3W1AA 4EXAA 2CBIA 3YPIA 1H63A 2FIQA 3TJ4A 2DT3A 1U1UA 3NFUA 4XKYB 2QCDB 3B97A 3E02A 3GLCA 3OZPA 1E0WA 2OLSA 3GHTA 5DFAA 4IFKA 1PBGA 1KM6A 1Z41A 3KE0A 5FF4A 6XIAA 3UR5A 1K9EA 1Z44A 3VK5A 3W4RA 1XPYA 3U2OA 4EPBC 1XCWA 3T78A 1RPKA 3FJNA 4INFA 4JIHA 2WMFA 1NOUA 2GGJA 2XGBA 1H61A 3GU9A 3ITYA 2X40A 2XFYA 1Q6QA 3P93A 2FJUB 5CZSA 2I17A 4NX5A 4QSFA 1FWRA 2H9AB 4Q4QA 4ZL1A 2OKTA 4B4FA 1AODA 3SSZA 3TONA 3LCLA 1J0IA 2F9RA 1KXQA 3IJQA 3G3MA 5MKGA 1I2NA 1TA3B 3MB9A 1U33A 1RY8A 1TJRA 3SDOA 4PUNA 5CZTA 4K8EA 4QG9A 1R30A 1B31A 4P7LA 3M0VA 2Y88A 1W2VA 4HPXA 4MPKA 1LLZA 1UIPA 5BMWA 1XFBA 4UR8A 4FNSA 4MLRA 2VX4A 1OK6A 3N2XA 1CEOA 1W3HA 2W5FA 2VX6A 3N2MA 1HO1A 4IGMA 4L9YA 2XH4A 4XO7A 3NL5A 4H9YA 1WBHA 9XIMA 3C52A 2W79A 1KV8A 2ZTKA 3G1XA 4FR6A 1O60A 1TPVA 4JDBA 5LHEA 3DECA 3R8HA 1HL8A 2HXTA 1WPCA 3T2OA 1EJSC 4AZBA 5BU6A 4Z1YA 3MSRA 5E6ZA 1OYAA 4PMZA 2JEQA 5IFTA 3NSMA 2FPYA 4AEFA 4J1OA 1UKQA 1P0EA 4B9ZA 1AQMA 1ZBCA 4RJEA 3UXDA 2QS8A 3LD5A 2J74A 1TJ0A 1EPVA 3VVGA 2BS9A 2HQAA 3O63A 1J12A 3HURA 2DQXA 1FUYA 4L9ZA 8XIAA 4XBJA 3VIMA 1GQIA 2YXXA 2YFOA 2FLIA 3D0CA 1AL7A 1UW9A 3C2VA 4BA0A 4UQDA 1LJYA 1XG4A 1QHPA 4B3ZA 1W0MA 1BXNA 4PCPA 3EWXA 4W7UA 4GZIA 1W9PA 4KT2A 4HQVA 4LYQA 1TE1A 3P0XA 2I5QA 5I3KA 1PKLA 4FLOA 1TJ2A 4HYWA 1PCKA 3UY8A 3TEVA 2OJPA 5EPDA 1W8GA 1GTEA 3OHMB 3USBA 1RXOB 1TB3A 4RK8A 1LBFA 5GVJA 1XI3A 1OGGA 2NXIA 3EWYA 3UZJA 4PMUA 2G3FA 2VNCA 1XKJA 1ONWA 1OX5A 4LOCA 5EU9A 3OG3A 1MVYA 4FB7A 5KZDA 1R7AA 1N55A 4IXHA 3RO8A 4W5UA 3SCSA 1UA7A 3K46A 3LHVA 3AYTA 2OVLA 2FH6A 3NQDA 1LBLA 1BRLB 4CD5A 1KTBA 4ATDA 2HEJA 3TX9A 4CN6A 3W53A 1BEUA 3EB2A 3RN6A 4W4QA 3BCJA 1DYSA 4NRRA 3O6YX 2ISVA 3QYQA 5D2WA 3T2QA 4L4LA 2WW5A 3EYPA 3GG7A 1J2WA 2PBOA 2OODA 5D03A 2J78A 1A80A 2YCLB 3EA2A 4GXPA 3N2TA 1CT5A 3M0IA 3PJXA 1Z7AA 2WLYA 1IZKA 4UTTC 4MOZA 4G1NA 3VCCA 3PF3A 4IP5A 2VOMA 3TA6A 4AIBA 3EA3A 3N6HA 4FLRA 4PMXA 5C5YA 1L6FA 1JIBA 3G8EA 2IKGA 1UR8A 3KS6A 4D6EA 2GJLA 2PC8A 2QCDA 2WMIA 3PK7A 2PTZA 3FXYA 3CH0A 4IMEA 1EEPA 3V3WA 4DF1A 2JKPA 3MMWA 1Q65A 3C5QA 1WDRA 1EZ2A 2NW0A 3CNYA 4AHOA 4CCCA 2WXDM 4IL2A 2E5CA 2ALRA 1ZAIA 2E9LA 3WQEA 2AQVA 4MJMA 3L12A 4OWGA 2ZUUA 2ESCA 1DWHM 3N3TA 4EE9A 2GUBA 3ARTA 3K8MA 3W2LA 2ZC1A 2J66A 4KFOA 4GZ7A 4QM1A 4PE8A 4LV4A 3QC0A 2YL5A 2YA1A 4X0NA 1KC7A 1LZOA 1NF7A 4CQ9A 4GRSA 1QWGA 2H3DA 3QJAA 3W25A 1LRTA 3JU2A 5G2WA 1ONRA 1JUEA 1FWIC 4FNRA 4BS0A 4ILSA 1T99A 4K2SA 3VMPA 3RF9A 1OYBA 2OEKA 5AHEA 5EIYB 1TPB1 4C90A 1RK5A 1PAMA 1XP3A 2GSEA 3N4AA 2NLYA 4C6OA 1EC9A 3BAYA 1CXKA 1YDYA 1FWWA 1KR0A 3S5OA 3UA4A 3SR7A 3GFZA 3QBUA 4WCJA 1GGOA 1X38A 1PX4A 3OYXA 2JIWA 4WXZA 2WJFA 4AD1A 4NIRA 3W2UA 1I1WA 2ZX6A 4AEEA 5CKSA 5AC5A 1DWAM 3R43A 1KGXA 3LNMA 1AFSA 3I7RA 3VGEA 3ZOAA 5FF2A 5K4XA 2X1TA 2V5LA 2HZGA 1KKOA 3W85A 4C6NA 5HQLA 1XG3A 3NM1A 3KBSA 4UFJA 2A3EA 1U1HA 1JDCA 3SQMA 2Q01A 3ZMRA 3CZGA 4REQB 1AL8A 1UP3A 1XLKA 1S3TC 2J8GA 4O16A 2PDQA 5E70A 1XH2A 5D2TA 1XCFA 1H09A 3DZ1A 4GG9A 2VQUA 1SW7A 4LAUA 3UPMA 1VIZA 4U4MA 3KCOA 4MHBA 3GXFA 4U5KA 2XVGA 4LVAA 4NI3A 3HN3A 1ITQA 1DTUA 1C8XA 1FFRA 3BG3A 1BWKA 1EJWC 3IIZA 4MM1A 1RV8A 1G9HA 3G5EA 4XX6A 2JGQA 3TP4A 2NT1A 1JAKA 3P82A 3LPFA 3TMLA 1QBBA 2Q8LA 3W0KA 3M41A 4Q4OA 2X1UA 3P5ZA 3P67A 1ICSA 1YE4A 2GL5A 3V5OA 3U4AA 1Y7VA 1JPKA 4J35A 4AY8A 3FGCB 2AAAA 3CGTA 3UWYA 4C6KA 1TUFA 3UNDA 2X41A 3ARSA 1NFGA 2OB3A 3VPLA 1VCFA 4IPPA 3APYA 4J2MA 3VOJA 4GABA 1P4CA 4F0LA 3Q65A 3CHVA 4H83A 5KZEA 3HMJG 1UOZA 1W32A 3VOCA 3NSXA 2CNCA 4GGHA 4JIPA 4JFUA 5HWMA 4AXKA 3UYIA 2YCJA 4LSBA 2OYMA 3F03K 4XSLA 4H3DA 4H4IA 1ZJAA 4U31A 4FXJA 1UD8A 3EWWA 1HGYA 5G4WA 3W7OA 1KD0A 1J2BA 5EBAA 1W3IA 1W3LA 1LYXA 2Y62A 5BRPA 4MUZA 3BK0A 1TWWA 4Y8FA 3VXGA 4DWSB 4AZHA 1PIGA 4GMEA 1NOFA 3GXNA 3NVDA 1PJ9A 2A3HA 1HXJA 4I5XA 3T81A 2B4GA 1O5KA 4LVBA 4HZ6A 1OYCA 3GYEA 3W02A 2CXEA 3GR4A 2PGFA 4LFYA 3O16A 3BV7A 7REQB 4ADSA 2BY2A 2G41A 1IXPA 4HOZA 3RCNA 1W9UA 3UFYA 4PL2A 1GJPA 5E9XA 5A6KA 4IPNB 3M0MA 3WQPA 6REQA 1M65A 1PL9A 1E9LA 3S2MA 2OXNA 1XLLA 3ENLA 4Y9NA 1J11A 1E0UA 5F2GA 1QCWA 2KAUC 3NPXA 1ELSA 1CB7B 1ZRQA 2JBMA 3N6QA 3DG3A 4UFIA 3RLHA 1XICA 3T42A 4TX9A 2DZTA 4Y9PA 2J25A 1TMQA 4ECLA 2B81A 5FKYA 4R7OA 5G1TA 4GIRA 3T8QA 5D8ZA 3QR3A 3GD6A 2VFEA 4PEKA 4DBDA 4R9OA 3M16A 3LXAA 5HQMA 3HPAA 3UZYA 3PWIA 3WJWA 2YKKA 4WDTA 7ODCA 1HIZA 1FH9A 1E1CA 3BANA 5BRBA 2ZZ5A 4WUIA 1GVOA 1RLCL 2D24A 4BCEA 3WFLA 4GQGA 1GOMA 5H6HA 3EXSA 1I45A 1W1PA 4DUWA 2BOFX 3PZOA 4C7GA 1HUVA 1XGEA 3M5XA 2W0UA 4ROPA 2R91A 2PWGA 4DB7A 1JCXA 4XKMA 3IJLA 2NXHA 1HX0A 1QPOA 1Q2SA 1UZHA 2J8TA 3GDMA 1QNQA 1AW2A 4IMDA 1C7TA 4WGHA 3TNBA 1CENA 1UCWA 2VDHA 3QSRA 4HTYA 2X30A 4DBWA 3W70A 3V5CA 1EB3A 1SM9A 4LH8A 2GUYA 4EPKA 4Z17A 2Q8XA 2O0TA 1Y5VA 1QNRA 2HNEA 1TV5A 1V51A 1SO4A 4F0MA 3M4HA 1F61A 4UCGA 2ZTJA 3GK0A 3HG2A 4QDPA 4K38A 4XBSA 1B57A 4M24A 1CGTA 3NUKA 4E8GA 3TTQA 3MW7A 4KMQA 2YCIX 3KBNA 3PP7A 3PZTA 2C0HA 3T44A 4F0KA 4D8AA 3B0YA 3A23A 2BOEX 5U7SA 3TYEA 4DJDA 2QCHA 2X1IA 1VFMA 1VR6A 4RZ5A 3AHYA 5AC7A 3MDWA 3EPOA 1GZGA 4P8XA 1MFVA 4UBPC 2IW0A 1TMHA 4JQ4A 4BHYA 3PPFA 1J96A 1J4EA 2D2JA 2Y89A 3W7KA 1ZAHA 1CLKA 1V7AA 4QITA 4QG6A 3CUFA 1XGZA 1V93A 1UYQA 5BCAA 2QV5A 4GE8A 4RV3A 5PTDA 5D9NA 2VRKA 1A5BA 3FGCA 3IAPA 1LLOA 1WE5A 1B3XA 3DFNA 4B3KA 3Q67A 3WK3A 4P7OA 2V81A 1PX3A 4CNNA 1DJNA 4IQDA 3CT2A 1SZFA 2ISDA 4M7TA 5A8QA 2EJ1A 3IJIA 3MA8A 3F2DA 3AXXA 2A1YA 1W54A 1XXXA 4JNMA 1BQCA 2WANA 3F2CA 2YIHA 3N2CA 2ZX8A 1P6WA 3MKCA 3CZJA 5AYYA 3H7RA 1JL8A 2V5CA 1DHKA 1OF8A 1IV8A 4CNOA 3SCUA 1TYGA 1BAGA 2DIEA 5HMFA 5CQ1A 3GZAA 2ICSA 1R3RA 2PWHA 4CD4A 1TCDA 3C6CA 4YN5A 3U7VA 3NAVA 3KOZA 2CYGA 1YTEA 1Q6OA 1R85A 2BODX 2XWDA 3BAWA 4HNOA 1CX9A 4ML4A 2ZDRA 1X6UA 4X2PA 4AD0A 1OGSA 1GVFA 4JTRA 2W66A 3HGSA 1XLFA 3VNLA 2Z7GA 3QY7A 1W1ZA 5JIPA 5FEZA 4H2CA 3KWSA 4W88A 5I09A 1E6PA 2FZ8A 3LI1A 4K7YA 4KGJA 4NQ1A 5DELA 1G94A 4P8UA 3T0DA 2EG6A 5DXYA 2PDFA 2QCMA 4GUFA 1KBKA 5AC8A 3L0KA 1Q7ZA 3WLRA 4NNAA 3AUOA 4D2JA 3W7CA 2E77A 5DEZA 3PBWA 3WH5A 4K7VA 3GG0A 5BWAA 4GVFA 4BF9A 3NQ6A 4AY7A 4PSPA 4LC6A 2HE8A 3VOGA 2VD8A 1UH2A 1MMFA 4JFVA 4Q4PA 3SY5A 1FTXA 4IMFA 5A6BA 1NFPA 2EGZA 2VM8A 3NO3A 4B90A 1IQ8A 5TIMA 3T9PA 3TSMA 1PIFA 2VX5A 2VFHA 3G0UA 1RPXA 4X63A 1ISXA 4JKLA 3B8IA 2INZA 2A5HA 4J4KA 1UMLA 3VGGA 3T0TA 2PDWA 3NEHA 2E6FA 3E0IA 1LOSA 1UUMA 4AX7A 1VH7A 1NOWA 3WLSA 1X8CA 3M9YA 3RHGA 3RUBL 3GRIA 5HANA 2ISFA 1UWQA 1I2RA 4U3AA 3SJNA 2DH2A 3V36A 3FAWA 4X61A 3CAWA 1TPC1 3DEQA 3FVDA 3LM7A 4GC3A 1F73A 4ZENA 3QKEA 3NPUA 2C7FA 2A3CA 3EPNA 5GJPA 3Q2DA 1HTIA 2YBUA 3TCSA 2WBGA 3STGA 3AALA 4KPLA 3I3DA 1TCMA 3W75A 4CNUA 3QZEA 3VD7A 1EWDA 2A2IA 1X7FA 1QOPA 5A1AA 1QVBA 4NZ3A 1XWYA 1L8PA 2R1LA 2HISA 3P0WA 1TVNA 3SY1A 3ANVA 4B5NA 1KWGA 4JTUA 2QYGA 2VZSA 1XLDA 1ISVA 3UWWA 5C9ZA 3FDKA 1R9YA 3NZGA 4WX2A 2VEGA 3VDAA 4L61A 4S3EA 4MDPA 2J24A 5DLCA 1C8YA 3S5SA 4Z1CA 1VHCA 2ZX5A 3FSTA 2ISWA 4QE1A 3NTYA 3WY1A 2AKMA 2PS2A 3F1QA 1BG4A 3PJTA 2QJMA 5CLTA 2PLCA 3VMOA 1ZUAX 1UR9A 2QAPA 4HU4A 2VEPA 2ANUA 5I06A 4UMCA 3F2BA 3R8GA 3B8WA 3NXFA 3OA5A 2C1GA 3UWEA 1RQBA 4GPNA 1J0JA 1RR2A 1F4HA 3UYCA 1OHLA 4XD5A 4IGNA 2G50A 2BOGX 3APTA 3SI9A 4FXSA 4LCSA 1TQJA 3D3FA 3R0KA 1K8CA 2Z1BA 3C2EA 3MI2A 1US0A 2YGYA 1CGWA 3WELA 3QR0A 4HP5A 4HHLA 4HJWA 4B5VA 1XLBA 2CERA 3N4EA 1H41A 4LX4A 5GQBA 3B8UA 3ARPA 3RX3A 4EAMA 2HMCA 4NG3A 3EDEA 1A49A 4MZ8A 5IDZA 1A5NC 5KEZA 2Z25A 4LC8A 5D02A 2DW7A 2QGYA 4R85A 5DCDA 1LUCB 1EXPA 4PMYA 3I7QA 3BGAA 3W26A 3RITA 2O7SA 3E0WA 4DPQA 3KM8A 4TXEA 4O15A 5AHMA 3AICA 3H24A 1WXZA 1EP3A 1OX6A 2O7QA 5I3FA 4DBEA 1EJTC 1ZS2A 2D2OA 3H2FA 4FZIA 1GUVA 1KGWA 3GNXA 4TQTA 3GHSA 2EBNA 4JTLA 1MNZA 1NM9A 5CZJA 2EKCA 2Z2UA 4ACZA 3VNZA 3O6AA 2A3BA 3G3DA 2UV8G 3A4XA 1OT1A 1FA2A 4DF0A 1HNYA 1E6SM 3LEPA 3U3HA 3FVMA 4XIMA 1VJSA 4LUSB 1PTGA 4W93A 1A0CA 3P5YA 4DN1A 5BXRA 3VYLA 3K1DA 3UVIA 3MYPA 3T40A 1UKOA 1M7OA 1P43A 3GKFA 3GNDA 4B91A 1ENUA 2EXOA 2NSOA 1KLYA 3HJEA 4IP7A 1JZ8A 3WKZA 3BOFA 4GJIA 4LUTA 1KB3A 3LRKA 4A3QA 4D8ZA 3N9KA 4IUGA 4IZGA 2Z4GA 2R6OA 3QGVA 1HP5A 4JTJA 2XDFA 3LERA 3ISIX 4N02A 4I7UA 2PRHA 3WD4A 1IF2A 2ON3A 1ZPTA 3KVJA 3QPZA 1Q6GA 2WNZA 3R5EA 4FK9A 4FNPA 2IMRA 4IGHA 1X6NA 4BEQA 2E7FA