1MQQA

The crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1 complexed with glucuronic acid
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
675
structure length
675
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-D-GLUCURONIDASE
publication title Crystal structures of Geobacillus stearothermophilus alpha-glucuronidase complexed with its substrate and products: mechanistic implications.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 284
structure length 675
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mqqA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1mqqA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1mqqA03
3ZT6A 5HOSA 3OLGA 5CZKA 1UR8A 2XGBA 3VIPA 4XZWA 4AY1A 4PSRA 1W3LA 1R87A 3AZRA 4UTFA 4JFVA 1KQYA 3OLEA 5BCAA 3PZ9A 1D3CA 3RDKA 3LMYA 1UD4A 1EQCA 4L4PA 1GVYA 3GZAA 4HA3A 5A8NA 1V3JA 5CXPA 1UWTA 3VO0A 1NH6A 4NRRA 2CXGA 4BS0A 3OZPA 1SMDA 3SCNA 1HP5A 3L4WA 1UD3A 3G6LA 4MB3A 2WC7A 1ZBKA 4Z2IA 3SCTA 1LWHA 1GJWA 5A1AA 2WZEA 3THDA 1B90A 1XHGA 4AZIA 4CD6A 4HP5A 4W7WA 1JYNA 3VD4A 4KWUA 5D9NA 1GZJA 3NDZA 4ZE4A 1H09A 1OBAA 3WBEA 2EPOA 1PIFA 2D2OA 3UG5A 3RM4A 1EHAA 3F5JA 2E0PA 3MU7A 3GH7A 4HPGA 4B16A 3WUEA 4QCEA 3SCSA 1E3ZA 1K9EA 3VIGA 1QW8A 4ZFMA 3CUFA 3I3BA 2BHZA 5AY7A 1QI5A 3L4TA 5LA1A 1OGBA 4B3KA 1JFHA 3OGVA 2WWDA 1XV8A 2A3EA 5JIWA 4H8VA 4V27A 1CECA 2IXUA 3NDYA 4HA1A 3IJ7A 4BA0A 1XH2A 3A4AA 5C8BB 3W6LA 3AI0A 1EA9C 3BAKA 1KR0A 4AW7A 4X0NA 1QNRA 2DDXA 1UZ1A 2WYSA 1UA3A 4B15A 2WKGA 3QHNA 1CGXA 1V02A 3DYPA 4BQ2A 2VR4A 4AC1X 1RD6A 5IXEA 3CZ8A 1E43A 3T09A 4XV0A 2JIEA 2XHYA 3BAYA 1V6VA 1WZMA 1GUVA 1JZ3A 1J9YA 1V03A 2PWDA 1WAWA 1RP8A 3QOKA 3BGAA 4C91A 1XD0A 2XGIA 3KE0A 3M6DA 4MB5A 4TVCA 4JAWA 3WF3A 4UQDA 1MQQA 3VPLA 2O92A 4MDOA 3AMLA 4M29A 1V6WA 1R85A 2XVPA 4HMEA 4IISA 1BYCA 2YL8A 4PMZA 2GVYA 1EOMA 1PBGA 1MVYA 1GHSA 3T08A 3AHZA 3KWXA 4AXNA 1VENA 3ARPA 1ECEA 1UR2A 2VZVA 3MMUA 3T0AA 4ATLA 1LWJA 3NSMA 2WBGA 3EDJA 3VIFA 3VIIA 2ZUSA 2J7EA 5A2CA 1KBBA 4M56A 3U57A 1E71M 1AVAA 4CD8A 2ZXQA 4W8LA 3FHAA 1VAHA 2EPKX 2C0HA 4MJ4A 1QBBA 2V5DA 3CPUA 1BF2A 4OKDA 1UKOA 5IFTA 3GBEA 3IK2A 1PEZA 4KRTA 1CXHA 2DH2A 2UY4A 1G9HA 1GCYA 4E8DA 5FOOA 3TTQA 4UFLA 5D8ZA 5M3WA 3CZKA 4TUFA 1WB0A 1JDDA 1M04A 3WL1A 3IJ8A 1KXVA 1CENA 2XSAA 1NOWA 4E8CA 3EBVA 4AD3A 1UR1A 4MJ2A 3AIVA 5JBEA 1QNPA 2JF6A 3AIUA 1EO7A 1FHLA 1P6WA 5FL0A 3AZTA 3ZJKA 4BZYA 1WCGA 4GINA 4JHZA 1WZLA 4H2CA 4QCFA 3RILA 1E1EA 2G4FA 1BG9A 4PCSA 4JZ5A 1QI3A 3BMWA 1E0VA 4PYSA 3L4YA 4MTVA 3U7VA 1BAGA 1ZL1A 3CZEA 1EDGA 1Q4NX 1E73M 3BLPX 4GO9A 3F5KA 3VGHA 1GOIA 2OSXA 2VQTA 4D72A 4TVDA 1C91A 1GQIA 1B2YA 4AIUA 5I0DA 3ALGA 1JF6A 1LG2A 2PWFA 2X09A 1OIMA 2GJRA 4TOQA 3ARXA 1JI2A 2J74A 4U2YA 2GUYA 3AYRA 2CERA 4OBSA 1TA3A 2F8QA 1B30A 3ARWA 4J3VA 5DT7A 1AQMA 4CD7A 1D2KA 4ZXLA 1LQ0A 1UWQA 3VGGA 2C7FA 2WMIB 3N1AA 1NQ6A 1E6SM 2OLHA 1HIZA 5BXRA 1V6YA 3A3HA 5CQ1A 1TCMA 1WE5A 2Y24A 3B9DA 1EO5A 1NWSA 1WDPA 4D1IA 3KEHA 4F8XA 4V28A 4CUCA 2E8ZA 4HOZA 4J3SA 1OGGA 3ARUA 4A4AA 4C7GA 4AD0A 5A8MA 1H41A 4CCEA 2XIBA 4BQ4A 5E6ZA 2XVNA 3HN3A 3MUZ1 3PZMA 2EEXA 5BXSA 2DSVA 3NYDA 1VBRA 5CPSA 2WHLA 3WDHA 4YHGA 4AZGA 4W88A 1E55A 1V0KA 1CTNA 5A6JA 3UG4A 2WXDM 4ML4A 2XVLA 3N17A 4PMOA 2WSPA 3DYMA 4OZOA 3SCVA 2WHMA 3WD2A 1EQPA 1E5NA 2G41A 1AQ0A 2B31A 1WDSA 3SUSA 1V0MA 2WW5A 5HPCA 1ZBCA 1W3HA 3O2LA 1JYWA 1ITCA 3ZJ8A 4LPCA 2WMGA 5HBFA 5I24A 2YLAA 3UERA 1W1VA 1KFWA 3U7BA 1JAEA 2YLLA 4V2XA 1KB3A 3BSHA 3ZSTA 2D24A 1FP8A 1ZB5A 1BYAA 2X0HA 1PJ9A 1SYTA 4CGTA 3BAIA 1E70M 2QPSA 2X0YA 1KWGA 3N9KA 4B9YA 2A3HA 3CGTA 3CZJA 1UKPA 2J79A 3SCOA 1H3GA 4MNMA 4GZEA 1CXIA 2O9TA 2XSBA 4D6GA 2E8YA 4TX6A 2PBOA 2GK1B 1HJQA 3KL0A 3GNRA 3L4UA 5CLWA 1H4PA 1A3HA 3WUBA 4W93A 5I2UA 2E9LA 1US3A 1J0HA 3WNLA 1VFUA 4J3UA 2VR5A 2YL6A 1U2YA 4HU8A 2CIPA 1QPKA 3ECQA 4W8AA 4WSKA 1TG7A 3SUVA 3KL5A 5JUVA 1PIGA 5AYBA 1V6XA 3VGEA 4KH2A 1W91A 1VEOA 1HXJA 5FL1A 1XGZA 1JZ6A 2YA2A 4YPJA 2W66A 1VEMA 4A3YA 4F9DA 5IFPA 1IZKA 2D3NA 1JDAA 3KL3A 3OIHA 1Q6FA 2ESCA 2ZX8A 1KXQA 2V3GA 4DUVA 5E09A 3LPOA 2Y8KA 3WF0A 2BVYA 3W82A 1EGZA 4HOXA 2ZUUA 1X6LA 3CZGA 2XUCA 3OGSA 3W4RA 3WF4A 3HU7A 2VL4A 1DWJM 4GZIA 5CG0A 1O7AA 2FGLA 1UKTA 3AS1A 4PRWA 2DQXA 1KXHA 4OBRA 3EDFA 1JD7A 3QOMA 3PZQA 2D0FA 1NM9A 3TONA 1B9ZA 1E4IA 1QNSA 2CESA 4PMNA 2OYKA 1VIWA 4ZXOA 3VDAA 1JI1A 2J7FA 5IHRA 3PZOA 1XCWA 2VI0A 1N82A 1VBUA 2FDMA 4CN1A 5FCZA 1ISXA 5HNNA 8CGTA 1PX3A 1ISYA 4XB3A 1V3IA 3WNNA 1DWAM 1QI4A 1K9DA 3WEZA 3K46A 1YHTA 3GNPA 2CNCA 3U5UA 3BXWA 3MS8A 1UZ4A 3ZR5A 3WFZA 2JFEX 3B9AA 5F7UA 3DHUA 1XSKA 3ZJ6A 3D3AA 1ESWA 1UH3A 4Z2LA 3ARYA 2ZUMA 4J3TA 2J62A 1MFVA 4FF5A 4PMVA 4F79A 1OWQA 2DT1A 2BS9A 4AWEA 5FKYA 2E9MA 2D0HA 3ZR6A 4W5ZA 3AIEA 4EANA 5BXTA 1SFSA 4AZBA 2W61A 1IT0A 3PZUA 3IJ9A 5CPTA 5A8OA 1JYVA 4GQRA 1KQZA 2ZX5A 5CPQA 3TTYA 4R5EA 3UR8A 4ZE5A 2XWEA 4RE4A 2UY2A 3J7HA 4MAVA 2QLYA 2W67A 2XYLA 2OSWA 1J01A 1V0LA 2ZX7A 4IPLA 1V6UA 2A3AA 2E9BA 2O9OA 3GNOA 1BTCA 3ARRA 3NUKA 1HT6A 1V0NA 4WKHA 1VJSA 1OB0A 3PTKA 1X6NA 1CXEA 4BQ3A 1W2PA 5A6AA 1DTUA 1QHPA 3PZIA 2WPGA 1W9VA 3WSUA 2HVMA 1W9PA 2Z1SA 1V3HA 4OOUA 1JDCA 3W26A 5A6MA 3RPMA 1NP0A 4HZ6A 4PTXA 2XIIA 6TAAA 3T0BA 1HJSA 4IM4A 1L0PA 1W3KA 1TUXA 4QFUA 5ABHA 3WH6A 4U3AA 3GTNA 4UZUA 1HJWA 4KGJA 4D1JA 2EQDA 3VMPA 2DH3A 5E0FA 3WMBA 4UFKA 1WZAA 4CN6A 4M81A 4CN4A 5A3HA 1W1TA 4WIWA 3AS3A 3VNYA 3MUY1 5TD4A 1OD0A 2F61A 4LGXA 4JHOA 2QF8A 2EBNA 1L8NA 5KZ6A 1DWHM 2VX6A 2D20A 2DSUA 1HF6A 2ZX6A 2EJ1A 4D71A 4B9ZA 4QLKA 3CUIA 3OA5A 4FLRA 1GNXA 1OT1A 2PF0A 3CUJA 4UFJA 2BFGA 2FGZA 2Y5EA 1E4LA 4AMCA 2PI6A 3WNKA 4NZCA 2G3NA 3SCQA 1HKKA 3VX0A 3K8MA 4JFTA 1ODZA 3ARVA 3G6MA 4XZBA 3DYOA 4IPNB 2BY2A 4PTWA 2DEPA 2YL5A 4HTYA 4P8WA 1AQHA 3WMSA 3W53A 4UQ9A 1CNVA 3MUAA 4UNIA 1H5VA 1XH1A 3K8LA 9CGTA 2W62A 4M8UA 1UR0A 3T0DA 1XD1A 3CTTA 4RL3A 1C8YA 3ZMRA 1CXLA 4AEEA 4XX6A 5A8QA 2UY3A 4AIEA 2ZXBA 3WUGA 4EK7A 4D6DA 3AXHA 3W37A 2DT3A 2WVVB 4D6HA 1C3FA 2VX5A 3WKZA 3ZT7A 3EDEA 3ARQA 2J7DA 4U5KA 1WNOA 4CCDA 3UETA 1C8XA 1GOOA 8A3HA 3NSNA 3N13A 1R7OA 3CBWA 1JG9A 2VMFA 5JBDA 1WP6A 3CZLA 3MANA 2WHJA 3GM8A 4E4PA 4JKKA 4UFHA 1Y7VA 5LA2A 1CPUA 1A47A 3FXYA 2FH6A 1VJZA 1TE1A 3CIVA 3TTSA 1HKMA 4UQEA 4Q22A 4DUXA 3CLWA 2RGMA 4YHEA 1ODUA 1E40A 3ARTA 3VINA 3VM5A 1I75A 1UWIA 2YJQA 2CITA 5FIPA 5DT5A 2WWCA 1UQYA 4EE9A 5I3DA 1EH9A 2E40A 4CU6A 1TVPA 4UR9A 3OG2A 1QOXA 3II1A 4WLCA 2XG9A 3POCA 3QHMA 5ABGA 4QAWA 2O9RA 3BCFA 2G8ZA 3I3EA 2VJXA 3AQUA 2PWHA 4AZ5A 3T2QA 1V3LA 1C7TA 2JF7A 1W32A 1J0YA 3VUPA 1UH2A 3VMOA 1EXPA 1JZ2A 4MNLA 1W9UA 3AJ7A 1OM0A 3HMCA 3PHAA 1G1YA 5GNZA 2WMIA 3WUFA 5CJ5A 1JGIA 2J7GA 3MO4A 3OGRA 2YBUA 1DEDA 1W1YA 3UG3A 3WY1A 2ZWZA 1HJVA 3D5HA 4C90A 3PZVA 3VIJA 4AD4A 4KMQA 1BPLB 4P8VA 1IZJA 4HA4A 3CHFA 4PBGA 5HXMA 4D6CA 4IUGA 4DWSC 1DWIM 5BRQA 4AZHA 1J18A 2W63A 3BH4A 4FMVA 4CVUA 3FW6A 2A3CA 3VDCA 1FHDA 1VRXA 4M82A 4S3JA 3QGVA 2J8FA 2JEQA 5M03A 1JZ5A 3AHXA 3WH8A 5D9PA 4CCCA 3GBDA 1UWUA 2BV9A 1J0IA 3VDBA 1CXFA 1Q6EA 1QHZA 3RM8A 4ACZB 2CBJA 1UR4A 2WLYA 1TMQA 3N11A 1OINA 1ISVA 1PPIA 4UQCA 4CVWA 1UR9A 4MNJA 4M80A 3RMEA 1UWRA 1XSIA 1E4MM 2WVSA 3OBAA 3WD3A 2ZIDA 1JXJA 3RIKA 2WNWA 3LPFA 1CEOA 3AMKA 2J78A 4W5UA 3TOPA 1WZKA 4EKJA 1MQRA 3LPPA 5CLTA 1BYDA 2CCRA 1E6XM 2ZXDA 4DWSD 2FH8A 3EDKA 1QI0A 5LYRA 2IXVA 1QVBA 4JKMA 2YKKA 1JAKA 3FAWA 5GNXA 1M7XA 1FOBA 1EOKA 1Z32X 1NWTA 3W38A 2VO5A 3THCA 1TFVA 2DSZA 3WQ8A 2WSKA 1S46A 4JIEA 3WD0A 3W28A 2G3IA 1B0IA 5IHSA 4U33A 3GH4A 1FP9A 1ISZA 2X1IA 2GK1A 4PUDA 5A8PA 2DSWA 3AZSA 4TVUA 4NI3A 3SUUA 4UQAA 5AC4A 2W5FA 1B3ZA 1V3MA 1GPFA 1KGWA 1GW1A 1YQ2A 1WO2A 3ZOAA 1E6ZA 2JALA 5ABFB 3PZTA 1NWUA 3CUHA 1XSJA 4Z2HA 1MXDA 4P7NA 5A6BD 2WAGA 3AICA 1B1YA 1CLVA 3M07A 4JL1A 4PMRA 1UD5A 2J4GA 4Q7NA 4H8UA 3GXMA 4Y7EA 3S6TA 1QHOA 2GFTA 4W7UA 2V3DA 2IUZA 4BCEA 3BAWA 2CPUA 1O6IA 1CGWA 1DWFM 1SR0A 3AIQA 2V3EA 2VCBA 1JL8A 1HKJA 3E1F1 3WQ5A 3K4DA 5GQBA 2CEQA 1EDQA 2VX4A 5A6SA 7CGTA 1UUQA 3W6MA 2D0GA 5DMYA 1GOQA 1E9LA 1CWYA 1FH8A 1LJYA 2XTKA 2XWDA 1XC6A 1BYBA 2BVDA 4PCTA 2OWWA 1JFXA 2VRKA 3AIBA 2PBGA 1MW1A 1OSEA 4FK9A 4D6FA 3T2PA 2VT0A 1NWRA 2PB1A 1KWKA 4GXPA 1KXTA 3A47A 4HZ8A 2PC8A 2VZTA 1MWOA 4H8HA 1UD8A 4WKAA 4LYRA 3WH5A 4H41A 4GI8A 3T2OA 1E1FA 4ATWA 5ABEA 4QLLA 4OIFA 5I77A 4ZENA 3EMQA 1CGYA 1V08A 1JXKA 4NRSA 3W29A 2XFRA 2DPEA 1H49A 3AOFA 3EYPA 2C8NA 1GQJA 4WSJA 4CD4A 4DWSB 4DUWA 4HPHA 3WD4A 2WVTA 1OD8A 4H7VA 4PEEA 1CGTA 4BF7A 1WPCA 5DFAA 4MAZA 2A3BA 4MDPA 4CU7A 1GQLA 3SURA 3NSXA 3VIKA 3AIRA 2CKSA 3VGDA 1GONA 1UA7A 1MYRA 4B3LA 5IDIA 3DECA 1NOUA 2J7BA 2YIHA 3WD1A 1CGUA 1ZU8A 3N12A 4URIA 3RJXA 2W4XA 3VTRA 2WZHA 3WF1A 3WDPP 2OWCA 1E6PA 1Q6CA 3JUGA 1D7FA 2WB5A 5D9MA 3VIMA 2GDVA 3WQWA 1BGAA 3CH9A 5I79A 3WNMA 2D23A 5CSUA 3AMGA 2X8RA 1DWGM 4U5IA 3AXIA 5E0CA 3VOCA 2OWXA 3GH5A 5M5DA 2DIEA 3ARSA 1E0WA 1OIFA 3CMJA 4CU8A 3PN8A 1E56A 3VD3A 4DM1A 2VVNA 4U31A 1QNOA 4W7VA 2VX7A 3HJEA 1Q6DA 4X0VA 4HU0A 1HVQA 3M46A 4F9JA 1H11A 4TTGA 1VF8A 3ZIZA 3QR3A 3TTOA 1KBKA 3WN6A 2EO7A 2PWEA 1J12A 4UQBA 1TR1A 1UKSA 3VD5A 1UYQA 2VQUA 4GI9A 5LA0A 3VGFA 3L2LA 4J7RA 2ZE0A 2DT0A 1GORA 1PZ3A 3RM9A 1C8QA 2VVSA 3L4VA 3I3DA 1M53A 2F2HA 1K9TA 4AZCB 1FFRA 1HN1A 1R8LA 4TX8A 2J77A 4PMDA 4HOWA 5EBAA 4P7LA 1JNEA 1MFUA 1C90A 1CIUA 3GXDA 4P8XA 2NT0A 3MUIA 3O9NA 1JYXA 3SEPA 1KCLA 4GI6A 2ZX9A 1E4NA 1I1WA 3WIJA 4CKQA 3UCQA 2D22A 3WENA 4PUEA 1PZ2A 2NW0A 1RPKA 2XM1A 4H04A 3AROA 1VFFA 3WEMA 1B31A 3CHCA 5CGMA 1HL8A 1XCXA 3GYCA 2JE8A 4P7OA 2DT2A 2WKLA 2FHBA 4WKFA 4FLSA 2WCAA 2GDUA 3WDIA 4WK9A 1EHNA 1UG6A 2DIJA 1MW2A 6CGTA 3L2MA 2XVGA 3CHDA 4Z2GA 3NCOA 3SCPA 1UOKA 1IV8A 2YL9A 3CHEA 3SCRA 2DGAA 1OGSA 1GQKA 1EDTA 1KGXA 1FFQA 3F4VA 3WDRA 1HL9A 4ATDA 4GQQA 4GPNA 2CYGA 1AMYA 1MQPA 1WDQA 2BHUA 1QW9A 5I23A 1CBGA 1HVXA 1V3KA 2XFYA 3OB8A 3POHA 2AOSA 3GDBA 1B3YA 1GOMA 4C7DA 3AS2A 2WK2A 1J0JA 4QP0A 1J0KA 3NIYA 5CGTA 1XYZA 3SCWA 5KEZA 5E6YA 4A3HA 2V3FA 4AD1A 3APGA 2WMHA 2YA1A 5BRPA 1HKIA 2G3JA 3ALFA 3L4ZA 2J75A 4FLQA 1ISWA 1E0XA 3WQVA 2Y2WA 4MB4A 2XVKA 2CETA 1H2JA 5C70A 2PWGA 2VURA 3AHVA 2WVVA 3N18A 3ZQ9A 1XH0A 3ZJ7A 1JF5A 4JKLA 2WANA 3VM7A 2X2YA 4GO8A 3WNPA 1OCQA 4U2ZA 5EFDA 1E6RA 4P7RA 3MMWA 3AHYA 3SCUA 4F66A 2ZUNA 5A2BA 2VCAA 4K68A 2EPLX 1C7SA 2FHFA 3VD9A 1M01A 4TTUA 1UD6A 1TZ7A 5D4YA 3FN9A 4WF7A 4AEFA 3FHQA 2NSXA 2BHYA 3UEQA 3AXXA 4LX4A 5GPRA 1CZ1A 5DEZA 3BCDA 4MPKA 1GOWA 5E70A 3AMCA 4P8UA 1FA2A 5A6KA 1H0IA 4J3WA 1J0ZA 1R7AA 2G3MA 2VZOA 1W9XA 1W1PA 4XUYA 4OUEA 3MSGA 4PTVA 1E6NA 1UKQA 5A6LA 2J8GA 2XJ7A 3RJYA 3AISA 5HDRA 2WCGA 3FY1A 1GJUA 1ITXA 3VILA 5EB8A 5HPOA 3UR7A 1U30A 2D1ZA 2VTFA 2BY3A 2WBKA 4GKLA 1V02E 2GJXA 4UFIA 2NT1A 5BWFA 1JD9A 1ZBVA 4ACYA 3L4XA 1X1NA 4RE2A 4UOZA 2BY0A 1E15A 3A6OA 1ZJAA 5A2AA 3W81A 4GZJA 5A94A 4LYQA 2OSYA 2GJXB 1MXGA 2ZXAA 1UHVA 4S3KA 4D6EA 2E4TA 3ZT5A 1ZS2A 1RH9A 3OLDA 4AD2A 2VOTA 1BVNP 4UOJA 3TA9A 4Z2KA 2RGLA 4JFSA 1JIBA 1K9FA 3TP4A 2X05A 1QBAA 1B3VA 3BAXA 2ZWYA 3S2CA 2ZUTA 4OOZA 3WL0A 2J7CA 3VMNA 1HP4A 1VB9A 4KGLA 3N04A 5EMYA 3WH7A 1G01A 3EDDA 2ZICA 1UWSA 3VDHA 2WMFA 4N42A 3WMCA 3WDJA 5JIPA 2WHKA 2EXOA 3W0KA 2ZUVA 3W24A 3WH9A 1U33A 2XPKA 2J25A 1PAMA 4J28A 3WNOA 2O9PA 4QDMA 1QI2A 1NP2A 4AYSA 3OZOA 1CXKA 1CLXA 4RE3A 3MSDA 3A4WA 1LLOA 2E3ZA 1VFOA 4ACZA 3W27A 4KRUA 3U5YA 3K8KA 4HMDA 1G94A 3CMGA 5M17A 1HX0A 1VFMA 2MANA 2YDQA 3SIMA 5A69A 3VGBA 3UESA 1R86A 2VC9A 4QLJA 2QMKA 2J7HA 4NF7A 4LQ1A 3BSGA 2YDSA 4PN2A 1DHKA 4PMQA 4PMXA 1QNQA 2OYMA 3SUTA 1E3XA 4W8BA 5DF0A 1GOKA 4M24A 2WC4A 2GSJA 1TA3B 3FAXA 1KR1A 2OYLA 1WDRA 4JCMA 2D3LA 1HJUA 2BY1A 1H1NA 1PX8A 3ZM8A 1E5JA 3MMDA 2Q8XA 1CGVA 1BSIA 2W92A 4HMCA 1CDGA 3AYSA 2VNCA 3BC9A 5CSYA 3QHOA 4NSBA 2V5CA 2Y4SA 4R27A 2VCCA 2XFFA 3F5LA 4HZ7A 4JFUA 4JCLA 3M7SA 3A4XA 5JBFA 1JZ7A 5A95A 1K6AA 1XYFA 2WMKA 4M1RA 4AZ6A 1NOFA 1EIBA 1J10A 5ABFA 3ARZA 2XM2A 4MNKA 4CD5A 3CUGA 4AIOA 2CBVA 1UH4A 1KGUA 3O6AA 1XRVA 3ZO9A 2EPMX 2FHCA 2CBIA 2YOCA 4LXFA 3RO8A 2QHAA 4OJYA 3AFBA 3FNDA 1LL4A 5EFFA 2CHOA 4UZSA 1W9BM 5AC5A 4AD5A 1F4AA 2ZOXA 4FLOA 4BQ5A 2WMJA 3BMVA 2QPUA 2UY5A 1BG4A 3VX1A 4MB1A 2WVUA 1I1XA 3PZGA 1OT2A 2JEPA 1MW3A 2WM0A 3B8SA 1BGGA 2BXYA 4UFMA 4W87A 5ECUA 4W85A 4TXEA 6A3HA 2AMGA 4Z2JA 2VRQA 3VKKA 1BLIA 3VIOA 3WFLA 5BROA 3PTMA 4W84A 3BAJA 3IAPA 1LL6A 4YN5A 1LL7A 3LPGA 2W91A 2QV4A 3WEOA 3RCNA 4UOQA 2YBTA 1B3WA 7TAAA 3SUWA 3ZSSA 1WKYA 2YDRA 1ZBWA 3DC0A 1GVIA 2Y8VA 1C92A 4C7FA 4AISA 3MV11 1FH7A 2V38A 2ZUWA 4U3CA 3NJ3A 4PMUA 5I6SA 1CYGA 4DWSA 4D6IA 1BQCA 3WBAA 1LF1A 4WJXA 1GHRA 2VUYA 2CKRA 3EMZA 3GXIA 1TVNA 3PZNA 1G0CA 2TAAA 1H0GA 3AS0A 1B3XA 3VVGA 2JIWA 1RP9A 2GJPA 1J11A 1SMAA 2WCSA 3BLKA 4ZEPA 5DO8A 1W9DM 2WLZA 4L4OA 4DM2A 3MKKA 2UWFA 4E2OA 1E72M 3GXFA 4UCFA 1E6QM 3WDQA 3DHPA 2J47A 4AZ7A 3EMCA 2BXZA 5C71A 3PBGA 4W89A 4PSPA 1UQZA 5E9AA 4JL2A 1KCKA 7A3HA 1HNYA 5BYWA 2WZIA 3WF2A 1MW0A 1JNDA 1M03A 3WQ6A 3CO4A 1HJXA 3AIWA 1JZ4A 2BVTA 1DP0A 1Q6GA 5A6BA 1ZJBA 2EPNA 5I5RA 3N15A 1FH9A 4J27A 3AHTA 2VZUA 1BFNA 1LG1A 1BHGA 2WC3A 4N0RA 3PTQA 1UD2A 3KZSA 5GNYA 5I78A 4JFWA 5D9OA 2HISA 4AZCA 3W25A 4GIAA 3VU2A 1VEPA 1US2A 1BVZA 4PTMA 1JZ8A 3K1DA 2CBUA 1F4HA 4W86A 2DSKA 1W3JA 4LYPA 3IANA 4MADA 4X9YA 2Z1KA 5FD0A 3IAQA 3K4AA 5BXPA 3VNZA 2BNJA 5D8WA 3AMDA 3VIHA 3VD7A 2QMJA 3OLIA 2YA0A 1G5AA 4D6JA 2VRJA 3B9EA 3WELA 4PMYA 2VZSA 4EAMA 1PX4A 4J3XA 3MV01 1NARA 1W2VA 2CHNA 5AYIA 3WQ4A 2AAAA 1C93A 4P7QA
chains in the Genus database with same CATH superfamily
3M0KA 4H9MA 4O12A 3LCIA 1XQKA 2XGBA 2RDTA 4NAEB 3DUGA 3UFYA 4M7SA 4G1KA 3S83A 5XINA 3O06A 1D3CA 3RDKA 5JH1A 4A3RA 2DZXA 5LXXA 1PZ1A 4HA3A 2ZZ4A 5AHEA 3VO0A 1PYFA 3PBWA 3L4WA 4LVGA 1R6WA 1Q4WA 3C6CA 4LC6A 2NQ5A 3S2MA 3W1QA 2J8TA 1OFEA 1GJWA 1O68A 3SRKA 5A1AA 3DFQA 1B90A 4EPEC 1K7FA 4CD6A 2Z27A 2R82A 3W7GA 1JYNA 3VD4A 4FPSA 5D9NA 4ZTYA 2I5QA 4REQA 4X2PA 1Q8AA 3WBEA 3MSRA 1I9CB 3UG5A 1Q13A 1CCWB 1EHAA 1IWPA 2GDQA 4HPGA 1XLLA 3I6EA 1LOQA 1K8XA 1NEYA 1XLBA 1QW8A 2PMQA 1C9DA 4K8EA 5T9CE 2BHZA 3TN3A 3NVDA 1KFJA 2Y0FA 1OGBA 3G8EA 1S1PA 1JFHA 3OGVA 2WWDA 5J5RA 3BG5A 2A3EA 2IXUA 3NDYA 4FF7A 5CC3A 3LD5A 3WJYA 3A4AA 3DDMA 5C8BB 4WY0A 3GVRA 5F2MA 1PYMA 4AW7A 1R3QA 3VNJA 2DVXA 3QZEA 4X0NA 3HJZA 3PANA 3I7SA 1UZ1A 2WKGA 3QHNA 3DYPA 2OT0A 5LGXA 3T09A 5AC8A 4X22A 1WZMA 3UU0A 2DJXA 5D09A 1EX1A 1J9YA 1MZHA 1RP8A 3FJLA 1VP5A 3QOKA 3MI2A 3LV6A 4C91A 3KE0A 3LTSA 4AHQA 1A80A 4HYWA 4JAWA 3WF3A 2OQYA 1PB0A 1AD1A 1EKOA 2WJEA 2XVPA 1TZZA 4NZ3A 4MZYA 1YLVA 3IJ6A 1XINA 2CWNA 3ARPA 2VZVA 1S3TC 3D3FA 1LWJA 1VLIA 4IIEA 2WBGA 3EDJA 3DFPA 3VIFA 2J7EA 5A2CA 2DZVA 4M56A 3IACA 3HIJA 4E6MA 3PAJA 4NNCA 1G4EA 4W8LA 1NFGA 2EPKX 4U28A 5LIWX 2V5DA 1SM9A 3CPUA 2E5DA 4JBRA 3QPEA 3TLQA 3GBEA 2HRWA 1RHCA 3TAOA 1XQLA 3UWWA 1RSCA 1G9HA 1GCYA 3VKAA 4E8DA 5FOOA 3TTQA 1MMFA 1NELA 1WB0A 3WL1A 2XSAA 1CENA 2RH9A 1NOWA 3EBVA 1JVNA 3KOXA 1TMLA 1UR1A 1B57A 1FCVA 3W71A 4MJ2A 4HSNA 2HE5A 1ECQA 2JF6A 5FL0A 3PFRA 3AZTA 2VHLA 3ZJKA 5CSRA 1WCGA 3S1GA 1SO6A 2AGTA 2PGWA 4Z1CA 1GKPA 1ZFJA 3W01A 1I2PA 3BMWA 4IX2A 4M6UA 4XD6A 1TV8A 3U2EA 4QX4A 4IQDA 1FKWA 2XZ7A 1PE1A 4ZB5A 1PTAA 1GOIA 3MC5A 4DYKA 1HKWA 5FAGA 1XYCA 4DX3A 2X09A 2BP1A 1W5PA 4HPNA 4E0CA 1TKKA 1X7FA 2GUYA 1TA3A 2F8QA 1B30A 2GQAA 1U5VA 3GHUA 5H8UA 2B4GA 3KBNA 1AQMA 4ZXLA 1LQ0A 3VGGA 2C7FA 4AQLA 1GYNA 4HN4A 2OLHA 5F1VA 5BXRA 1TCMA 4PBFA 1MRQA 2A7NA 4F8XA 4V28A 1LUCB 1VFLA 4HOZA 3IRDA 4A4AA 2PRMA 4AD0A 1RJQA 3VOJA 3LXAA 4JIRA 4XSMA 3P14A 5EGRA 5G2HA 3W7IA 3NL5A 3ITOA 1OK4A 4Z42C 2WO5A 3AC0A 4A3UA 4PULA 4HMNA 5BXSA 3GSMA 4ZFCA 1F7BA 3NYDA 1VBRA 5CPSA 3TSBA 2WHLA 3KX6A 4KCVA 1E55A 5K2ZA 1KC7A 4LTSA 1XYMA 3RU8X 4S1FA 3AALA 2Y63A 2WXDM 4ML4A 4C6NA 2WSPA 3GG1A 4S38A 4H9ZA 1D3HA 1HZYA 5CZSA 1UIPA 3CB8A 3WD2A 4A8RA 1AD4A 1AQ0A 4DLMA 4PTDA 5D38A 1WDSA 3B4YA 4NT0A 3FSUA 2C19A 2WW5A 1ZBCA 2WJFA 3BUVA 1JYWA 4LPCA 3NXLA 4J4KA 4LAZA 2WMGA 1OVDA 4J2PA 1O5XA 1S38A 3TVAA 1ZB5A 3C2FA 4XKMA 2BLEA 5AHMA 4CGTA 4MWAA 1E70M 1B4EA 5C9ZA 4I7VA 1KWGA 2X0YA 2GZXA 3CGTA 3CZJA 5CH9A 3A12A 4IMAA 3MZ2A 1V51A 4GZEA 2HXUA 4Q8VA 2PBOA 2GK1B 3NZPA 3OOQA 4AWSA 3EXRA 5XIMA 4LB3A 2VFHA 1A3HA 3WK3A 1FDJA 1NF0A 5I3FA 4I90A 4W93A 1JRBA 3NZGA 2E9LA 4CQAA 2NVAA 1US3A 4KESA 4LB4A 4LANA 3N6HA 1LLZA 3HGJA 4I5XA 3BPWA 3LI1A 1FWAC 4WSKA 1QPQA 1M1BA 3H55A 3SUVA 3VGEA 3CQHA 3N2OA 1XGZA 3ABSA 3QFWA 4JN7A 4YPJA 2I9UA 2Q8LA 4F9DA 5IFPA 4BJHA 3GFXA 4C6DA 1PXGA 1IYXA 4S2CA 3UWEA 2Z2AA 2ESCA 4GNJA 4LUIA 5H1WA 2PD9A 4WCJA 3LNPA 4GH1A 4HOXA 2ZUUA 1IIGA 3CZGA 2Z28A 2P8BA 4WXZA 1EJRC 1G7VA 1DWJM 3FS2A 5AVNA 4FNUA 1A0DA 1RZMA 1V5XA 5CG0A 4ZO6A 1EZWA 1P48A 3LU2A 2DQXA 3DG3A 3EDFA 2ZRWA 4O16A 3G22A 3PZQA 3TONA 3S5OA 2JKEA 1FCBA 4DO6A 1P0KA 4BWLA 5I3IA 1JQVA 4QQUA 3EWUA 3W76A 5IHRA 3WK0A 3PZOA 3URNA 1XCWA 1I0DA 4Q7BA 2EF9A 2HROA 3T8QA 3VAVA 1PX3A 1M7JA 4P2VA 4GIRA 3QW4B 1V3IA 4XB3A 3WNNA 1WX0A 3I68A 1YHTA 2YCIX 2YGYA 3BLFA 3EX3A 4CNNA 3U5UA 1RD5A 1UZ4A 3ZR5A 1UBPC 3F1QA 5GJPA 2JFEX 5E93A 1EF2A 2HEJA 3DHUA 5F7UA 3ZJ6A 1QW7A 3PWGA 1UH3A 4GNVA 4PMVA 1OWQA 2DT1A 5FF3A 2Z26A 2E77A 3VKJA 4PRRA 2ZKMX 4AWTA 1QNVA 3N34A 3AIEA 1AJ2A 4W5ZA 3GZ3A 4EANA 1N55A 2BZNA 3VCNA 3PB0A 3NQDA 3EA3A 3E0VA 1J93A 1EJ7L 2ZTJA 1IWBA 5E9XA 1O4UA 3PZUA 3IJ9A 3IUHA 3WLIA 3A22A 1YIXA 5BOFA 1Q45A 5C5YA 4ZE5A 5FJIA 2UY2A 3J7HA 2BOFX 4MZ1A 4F2TA 2W67A 2XYLA 4R53A 1J01A 3P74A 5C0QA 3ANUA 1V6UA 2Z00A 1PKMA 3W1AA 2A3AA 4QSHA 5LIYX 4P02B 3KLLA 1Q65A 4ERAA 4UWMA 1OB0A 3PTKA 1K7EA 4BQ3A 5A6AA 3D0CA 5MF5A 1G4PA 3MZNA 2IW0A 2PRHA 3WSUA 2C1HA 2BBFA 4ORMA 1H5YA 4HNTA 4XQ6A 2CHRA 4PTXA 1HW6A 3B8DA 5CPLA 5I3KA 1ALDA 2PODA 2A85A 1MEIA 4C65A 5F2IA 4UZUA 1H60A 5J8LA 1SW3A 4D1JA 2EQDA 4US5A 1WZAA 4M81A 3G1SA 2F2KA 5FEPA 5TAOA 2Y88A 4WDUA 1OD0A 4LGXA 5KZ6A 2VX6A 1IEWA 4YL2A 5JH2A 4O19A 3OA5A 2BDQA 4MYAA 1OT1A 4A22A 2E1WA 3W72A 3WNKA 1S2UA 4NZCA 4NJIA 4Q4MA 3I6RA 1JCJA 3VX0A 2OGYA 4I8YA 3LBMA 5K9XA 3DYOA 2VGIA 3PNZA 2NLIA 4PTWA 4Y9MA 4Q32A 3IVUA 4I7WA 3WMSA 1XIIA 2OQLA 3W53A 1LOSA 1BVWA 5HMSA 4Q4SA 1XH1A 3AO0A 4GX8A 1CI1A 3IIVA 3XISA 1TPH1 5BNKA 4MLJA 4JOMA 1CXLA 4XX6A 2VFDA 4AIEA 3WUGA 3GTIA 1TPWA 4IJBA 2DZSA 5HUOA 3UNDA 4ZVJA 3ERPA 1U1HA 2J7DA 1OX6A 4P00B 1FWWA 1GWJA 1W0MA 1V6TA 1C8XA 2Y89A 3E5PA 3QMSA 4CQ9A 2Y7FA 1YX1A 1JG9A 3EKLA 1XLFA 3MANA 4DF0A 2J9XA 5CZTA 4UFHA 1QUMA 3AUOA 1EJUC 1EUAA 3HFYA 2VYOA 2WZTA 3TTSA 4JGDA 3S1XA 4DHGA 3FYYA 4QISA 1XKJA 1CT5A 4DUXA 4YHEA 2F84A 3NAVA 3VOFA 3JRKA 1HL2A 3LCGA 1PV8A 3WLKX 4LH8A 5EBUA 3TR2A 2XN0A 3V1HA 4X61A 1EJVC 3QHMA 3BCFA 2G8ZA 4YCPA 2JF7A 3R25A 4F0KA 5C9UA 1UH2A 4XO6A 4HG6B 2BWGA 2Y6ZA 1JZ2A 1W5QA 1W9UA 1OM0A 1S5NA 1TZ9A 1YTKA 1ZHAA 1TTJA 2D73A 1BWVA 4WDTA 1DXEA 1RBAA 3PZVA 2Z1XA 2Y7DA 4AD4A 1FKXA 4DJEA 3GU2A 1TYGA 1IZJA 3CHFA 1LUCA 2IPGA 3M0MA 4D6CA 4IUGA 1YDOA 4DWSC 1R9XA 2W63A 5HJYA 2V5KA 4CVUA 2ZCGA 3C2OA 1PWMA 1VRXA 4S3JA 5KITA 3UQNA 3QGVA 2J8FA 4PB5A 2GSHA 1IF2A 4M7TA 3AHXA 3WH8A 5D9PA 4CCCA 1E1CB 4D8ZA 5CG7A 1KM2A 3A64A 1J0IA 3UYCA 4XZ9A 4AU0A 1QHZA 1UZHA 3RM8A 4ACZB 3Q67A 1UR4A 2WLYA 3IWPA 5AYXA 2ZA1A 5MHBA 1ISVA 3FDGA 2D2HA 2B81A 1BTMA 1V7AA 1UR9A 3PF3A 4BK9A 1XSIA 3WD3A 1XM3A 4DI9A 3BWWA 3RIKA 2W6RA 4GYJA 2INEA 3LPFA 2VGGA 2J78A 4RPQA 3V16A 1M65A 1Q2RA 1LRNA 4N4PA 3LPPA 1RAKA 5M2FX 3NQMA 3LSBA 1Y65A 3WQCA 2GVJA 4DWSD 2FH8A 2FTYA 1QVBA 2YKKA 3JR2A 5D02A 1EOKA 1Z32X 2EG6A 4BF9A 1A5KC 2QJIA 1F07A 1RBLA 4M5PA 1YPXA 1AA1B 3TOYA 1TFVA 1B9BA 1PKLA 2GVLA 2DORA 4K2SA 3WD0A 1B0IA 2NX9A 3TNBA 1KRMA 3DHDA 1UZDA 4B5TA 5K9DA 1W6TA 1D7KA 3RR1A 2GK1A 3TW9A 1J79A 4LS2A 3DBNA 3P80A 5JQ9A 4IIHA 1GPFA 1KGWA 1VHCA 5REQB 2Z1VA 2HSAA 3EB3A 2J88A 4L9YA 1E6ZA 5ABFB 7REQB 1S2AA 5G5IA 1O95A 1GZ1A 4INFA 1MXDA 2E5BA 4IH3A 5A6BD 4RNJA 3CAQA 2PLCA 3L23A 1UD5A 2PDXA 4Q7NA 2C1GA 3GXMA 2HNHA 2NV2A 1XS2A 2GFTA 4DN1A 4W7UA 2V3DA 4BCEA 4Y9NA 3BAWA 4RV3A 2V3EA 3FA4A 1ICPA 1HKJA 1O1ZA 3E1F1 3WQ5A 3UJEA 1XIMA 4KKXA 3K4DA 1Y5WA 5E0KA 5GQBA 1XLHA 4O54A 1LJYA 2YXGA 2XWDA 4JD4A 3F4WA 1EUNA 3KOWA 3HA1A 3SM0A 3LM7A 4ZR8A 2PB1A 4GXPA 1H7NA 2A1YA 1IR1A 2VZTA 4WKAA 4NY2A 4IQEA 4GI8A 3T2OA 1E1FA 3H53A 1SW0A 3C3UA 4ATWA 4CNUA 4YTSA 3C0QA 3LXBA 1V08A 3EZ4A 4MIMA 4OT7A 2XFRA 4O0QA 1Y0EA 4DUWA 4C6EA 4GBDA 3RMJA 2EHHA 3ABQA 4H7VA 3KHJA 2QGYA 4BF7A 4C6MA 5HNUA 4CU7A 2WKJA 3SURA 3TLLA 1XF0A 1GONA 4KWVA 3GFZA 5IDIA 3W7JA 3LNMA 1KKRA 3DECA 2J7BA 3WD1A 4JN6A 1CGUA 1ZU8A 4Z0SA 2ZA2A 3BJSA 4DBDA 3WDPP 5G1YA 2E09A 1RJRA 3FVMA 4Y90A 3WQWA 3NEHA 8RUCA 3TQVA 1V79A 3HURA 4H6KA 1YRRA 2IPWA 4EWJA 1EC7A 4LAUA 4LUSB 5LIXX 5M5DA 4O14A 3CMJA 1EYEA 1RK5A 3PN8A 2REQB 1E56A 4JTTA 3VD3A 4DM1A 1IHIA 4U31A 1QNOA 4HU3A 4W7VA 4JNZA 1XLGA 1Q6DA 1M3UA 2H3DA 4DVOA 3QQ1A 1HVQA 3M46A 1H11A 1VF8A 1J2WA 3QMTA 3NNTA 1KM4A 4UQBA 3M0YA 2X0SA 1AODA 4NJGA 3VD5A 2FVKA 4E2BA 2VGBA 1W56A 4FNRA 1F76A 1PZ3A 3CJPA 1C8QA 1M53A 4I9TA 4KEZA 1J6PA 3GG0A 3NXFA 5EMKA 4E3TA 1QATA 4TX8A 3IUIA 3CLMA 1XPGA 2CLOA 3DCPA 4HOWA 3SQLA 5DLCA 1C90A 4JX6A 4CCZA 4ZOAA 2ZC1A 1SJBA 1E4NA 3R4IA 1F61A 2XU2A 4Q33A 2V81A 1QOPA 3HOJA 1XLAA 2NW0A 2POTA 3P7YA 3UR2A 4H04A 3TUUA 1VFFA 4R3UA 3DGBA 3N2BA 3CHCA 2Z1BA 4XBKA 5CGMA 3KS5A 2JE8A 2DT2A 1UPMB 4L1GA 5KZEA 1RCOB 3KDNA 4B2DA 2QUNA 2WCAA 2GDUA 3WDIA 3S42A 3R43A 3PJWA 3GDRA 4DRSA 6CGTA 2XVGA 3E0FA 3CHDA 1AH3A 2YL9A 3CHEA 3SCRA 2R9RA 1H1YA 1KGXA 1FFQA 3F4VA 4LT9A 4GQQA 2CYGA 2YBVA 1KTCA 4NZ5A 1NTHA 4H6RA 5CZ0A 1J96A 1IXOA 2IKJA 4Q8QA 2XFYA 2P3EA 1T0OA 3QYSA 3MQTA 1FWGC 2WK2A 1J0JA 4QP0A 4Q6XA 1XYLA 5CGTA 2FZ8A 3SCWA 3H2FA 5E6YA 4IXXA 4AD1A 3APGA 1ONXA 1TE6A 3ALFA 1YBQB 1E0XA 3WQVA 2XVKA 3LHUA 4RLIA 5LHFA 2CETA 2EG7A 4HSOA 3AHVA 4M1BA 1XCFA 1MO0A 3ZJ7A 5EMLA 3ITCA 4JTQA 4GO8A 4ML9A 3STCA 1P5BA 1OCQA 2W9MA 1M7PA 4P7RA 2OEMA 3AHYA 3SCUA 4ZL1A 2CLKA 4NJJA 3E38A 4K68A 1C7SA 1U5JA 1UD6A 1QO2A 4DZAA 5D4YA 3FN9A 1P6BA 4I9JA 4IPJA 2OT1A 5C2CA 1K70A 1GPWA 5HULA 3M0JA 4P8UA 3UZYA 4RR4A 4JY9A 1KA9F 4R33A 3TX9A 1W9XA 4HHPA 1UKQA 5A6LA 2V30A 3ZS4A 1SSDA 4K7YA 4U4MA 4CLMA 5HDRA 2PWVA 3LZ3A 4OQVA 1ITXA 1FHVA 3TROA 3O7UA 3VNIA 3EPNA 3UR7A 1U30A 2R14A 2HV5A 1VLWA 1W5NA 2GJXA 3A24A 2ACRA 1R3WA 4AFYA 4L7ZA 3QY6A 1JD9A 1NSJA 1TQXA 4XZHA 3TA6A 5A2AA 3GAKA 1K6WA 3B05A 2PDIA 1SFLA 4LYQA 2HTMA 3E12A 3EWDA 1MXGA 3B03A 1AZ2A 4MMWA 3HGSA 2VOTA 2CLIA 1BVNP 5CJNA 2RGLA 1JIBA 1MNZA 5HANA 2PDFA 3WL0A 2J7CA 3VMNA 1HP4A 3G1RA 3N04A 4YTTA 5EMYA 3THUA 3WH7A 3A5VA 1G01A 1K7XA 1OHLA 2ZICA 3WMCA 3HGRA 4XD4A 4L9ZA 4JTDA 3WH9A 4XBJA 1U33A 4GISA 2J25A 1PAMA 3WNOA 4DBSA 4AYSA 2FB3A 3MSDA 1XIHA 3A4WA 4DO4A 3ITGA 2ATMA 4ACZA 1ME8A 4FXRA 3LX9A 1OADA 4LVBA 3S5SA 3VE7A 3URBA 3S2LA 4RK8A 4HMDA 5K9CA 1G94A 2MANA 1W54A 3UESA 1HUVA 3NO1A 6XIMA 3EPOA 3NL2A 4NF7A 2PCEA 1IT7A 2YDSA 4PN2A 2VP8A 3Q58A 3OQEA 4WDWA 3N2MA 2FQIA 2HPMA 3DH7A 4HVXA 5DF0A 1VFHA 2WC4A 5I09A 2QIWA 3EGJA 2C3ZA 4JTSA 1EEXA 1K3UA 1RY8A 3W07A 4IMCA 4JCMA 2D3LA 3HPFA 1FBAA 1UASA 3NZRA 4KETA 4LCSA 5GVJA 3MMDA 3UVAA 5D2WA 1EYWA 5HATA 4HMCA 4R9OA 1F05A 3BC9A 5G1TA 3KWSA 3QHOA 5LNUA 2Y4SA 2ZADA 2DVUA 3DC8A 4QJ4B 2Y7EA 3F5LA 4Y8EA 4I3GA 4HZ7A 3THQA 3B0PA 5FI8A 3A4XA 3H22A 1XYFA 4LUJA 5REQA 2WMKA 3P8IA 5ABFA 3ARZA 5C9RA 7REQA 4AIOA 4GUHA 4AHOA 3O6AA 3V5FA 2FHCA 4DAIA 2R1LA 4A8NA 2YCEA 3AWOA 2CBIA 2YOCA 2PDQA 1EX5A 3AFBA 2Z4GA 3FNDA 1LL4A 5EFFA 2CW6A 3MSYA 2HS8A 2PU1A 4UZSA 5HNTA 4AD5A 3V7PA 1DV7A 2ZOXA 1DPMA 3DXIA 1BQGA 1EF3A 4IMDA 3RR4A 4FR6A 1OFDA 2WVUA 3NTYA 4O10A 4PB4A 3UA3A 2WJDA 3B8SA 3H26A 4R7OA 1BGGA 4XAPA 3CB3A 2AMGA 2Q3RA 3JS3A 4J3ZA 2VRQA 4HD5A 1BLIA 3WFLA 3W74A 2WSRA 1T99A 2QV4A 3WEOA 3FX4A 4UOQA 4F0RA 4LW7A 3ZSSA 1RK6A 1GVIA 1C92A 4AISA 4TR9A 2V38A 4MHBA 3M16A 4U3CA 3NJ3A 4GE8A 3CV1A 1GHRA 3B9OA 2CKRA 2X7VA 5AECA 5AZ1A 1J2BA 4IL2A 4DNHA 1I4NA 4DJDC 1X96A 2TAAA 3BCJA 3BO9A 3VVGA 3NWRA 4RNIA 4Q7IA 1RP9A 2F7FA 1W31A 3U0HA 1U22A 3H6OA 3MKKA 4LCRA 2DZPA 3GXFA 4UCFA 1E6QM 3WDQA 3KCOA 2OOGA 5LNVA 2J47A 3E2RA 5FEXA 1TPFA 4AZ7A 2BXZA 5C71A 2PSNA 2KX9A 3HPXA 3PJTA 1YKWA 4GGHA 3WCZA 4NHVA 4JL2A 4G56A 4LUSA 2CFFA 5BYWA 3U8GA 2Z2BA 4UR8A 3WF2A 5BW6A 1SZFA 5HMEA 2REQA 2P50A 2PLMA 3CO4A 1HJXA 4HPJA 2BVTA 3AXMA 3VZXA 1RLDA 1XLKA 2QEZA 4TU1A 4MY1A 5M1TA 4FXFA 1FH9A 2ISFA 4J27A 2VZUA 1LG1A 1W3NA 3OVQA 1BHGA 1KFBA 1GVRA 1ICSA 4UXDA 1W1B1 7TIMA 1PHWA 3PTQA 4DJDD 2OLAA 3KZSA 2HNEA 5GNYA 4KRZA 4ICMA 3OPSA 4DY1A 2HISA 3AWNA 3UGRA 4E4FA 1OCBA 3UCCA 3V0UA 5H8PA 1SO5A 5CC7A 1JZ8A 5LSMA 5FJOA 2CBUA 2QQ6A 4QTGA 4MADA 2OG9A 4OECA 7ODCA 3K4AA 1NU5A 1JDFA 3VD7A 3KCLA 3PBMA 1O66A 2GJLA 2QMJA 4MJZA 4D6JA 3B9EA 2VZSA 4J3XA 5F2GA 3W85A 2W79A 1NARA 3VKBA 3O6YX 2CHNA 3WQ4A 4P7QA 3INPA 3ZT6A 2NX3A 1HO4A 2PZNA 3CAWA 5KSWA 4FOUA 5FF7A 4Z1BA 3VIPA 4AY1A 1EGMA 1W3LA 1R87A 3AZRA 4UTFA 3DFYA 2PDPA 2TRSA 4UMBA 5D04C 1TELA 2V5BA 5BCAA 3PZ9A 5J5DA 4GNKB 2PTZA 3GZAA 3IGHX 5A8NA 2DY3A 3KVKA 1V3JA 4BS0A 3AU6A 3SCNA 2B7OA 1HP5A 2G97A 1UD3A 3G6LA 4MB3A 1W37A 4H4IA 3BQ5A 5IBXA 1XHGA 1F3WA 1TPEA 2YB1A 4HB7A 3P8JA 4W7WA 1X1OA 4RZ4A 3NDZA 3H4XA 1A5SA 1THFD 2O0TA 3TYAA 4ZGYA 1YBQA 1PIFA 3SRDA 4AX7A 3W70A 2E0PA 3MU7A 1EBGA 3WUEA 3H8AA 1E3ZA 1K9EA 5I00A 2X30A 3CUFA 5C54A 4E4UA 2Z2UA 3BGGA 3M4HA 3UNTA 5CEWA 1CECA 1F9CA 4HA1A 4A6GA 4C6IA 1XH2A 1A5UA 2O7SA 4AYGA 4I9AA 2KZHA 3AI0A 1EA9C 1DKWA 2ICSA 3LI0A 3SSJA 1QXLA 3N29A 3W7EA 2Z7GA 2WYSA 1UP2A 1CGXA 1V02A 1E9ZB 1RD6A 1AH4A 3CZ8A 1E43A 2XHYA 1KFKA 1GUVA 1X38A 3LS9A 3C56A 1JZ3A 5SWUA 4WHBA 1PTGA 5IOBA 1SVDA 1XD0A 5DXYA 2P0IA 3M6DA 4MB5A 3TJXA 3VYLA 4UQDA 1MQQA 3W7KA 4MDOA 4M29A 4B4FA 2OEKA 1R85A 4ADUA 1BYCA 2YL8A 1OF6A 1EOMA 2IS7A 3AHZA 4XK2A 3SGZA 3W7CA 1VENA 3UXKA 3T0AA 4ATLA 3NSMA 4Z08A 3TW7A 2HK1A 3LRKA 3W75A 1KBBA 4HHMA 4CD8A 2ZXQA 5HQEA 6ALDA 3PFMA 1DJZA 3FHAA 5AC7A 1BKHA 4MJ4A 1KM1A 3W7LA 1H1ZA 4K1WA 2R8WA 1W1IE 3FJNA 2PU0A 3C2RA 3MJMA 4OKDA 4IGHA 1TPVA 4MKNA 1XW8A 4UB9A 1KW1A 1XL9A 2FMNA 1PEZA 2OODA 3S0CA 3GKAA 5D8ZA 5M3WA 4TUFA 1JDDA 1M04A 4YYCA 3IJ8A 4ONVA 5DMMA 2YPIA 4AD3A 4FEZA 3AIVA 4HGXA 1QNPA 3HQOA 1P6WA 4I6VA 1KBLA 5FSEC 4O8RA 3KXQA 4H2CA 4QCFA 2G4FA 4IG2A 1QMLA 4PCSA 1QI3A 2ZRVA 1KBJA 1M5WA 3L4YA 2NQJA 3TWBA 3U7VA 4JY8A 4Z1YA 3CZEA 1Q4NX 1L6YA 1TTIA 2FPTA 3BW3A 4F4RA 1IGSA 3PG9A 4AY8A 2DUXA 4D72A 3L68A 1C91A 3EWYA 3F2CA 4AIUA 4K3ZA 1JF6A 1LG2A 1H7WA 3N6QA 4NXSA 4OWGA 2XZ9A 2GJRA 5C7VA 1OY0A 5HMFA 3V3WA 3ARWA 2QS8A 2ABBA 3ZLGA 1D2KA 1UWQA 4L1XA 2PGRA 4ZBCA 1NQ6A 3TYZA 4AMAA 4GVHA 3SQSA 5CC6A 3K13A 1Y5VA 3M5VA 1VPQA 4K37A 3B9DA 1WDPA 1UW9A 3KEHA 2E8ZA 4J3SA 1K03A 3ARUA 4C7GA 1QASA 4QBXA 4ZQRA 2UV8G 4GI4A 5A8MA 5K4ZA 1AW2A 4CCEA 2XIBA 1SJAA 4BQ4A 4D8AA 2XVNA 3HN3A 5D05A 3TW6A 3PZMA 1XKYA 2DSVA 2TSYA 4H8NA 3FFSA 1BWLA 4AZGA 4W88A 3VNDA 1YTDA 1VR6A 3E6EA 5A6JA 1UC5A 4XAFA 3VCCA 4PB3A 4WJEA 3UG4A 4DJFA 3LENA 3M41A 3NPWA 1VD6A 3RO6A 1XGEA 4Y6GA 1XRTA 5B7YA 4A29A 3SCVA 2GVGA 4N9EA 4LFYA 1T6MA 1E5NA 2G41A 5IRPA 2B31A 2ZA3A 4YU1A 1DORA 1DJQA 3UWYA 4GWEA 3KP0A 3GUGA 4LVDA 1W3HA 2PTXA 3O2LA 3Q45A 3EXSA 4NILA 3SB0A 5HBFA 4XG1A 3UERA 4QAIA 3MP3A 1PIIA 3VNMA 1WA3A 3PBUA 4FI4A 1FP8A 1BYAA 2F6XA 3DOPA 1SYTA 3WYZA 3BAIA 2HQAA 1WYIA 3I4KA 4RDYA 1XXXA 2I57A 3O16A 3HFTA 4DQWA 2Y70A 2O9TA 4D6GA 2Y5JA 2E8YA 4TX6A 4YWSA 4KEUA 5FSDC 2C13A 3KL0A 3U48A 5DELA 3NVTA 2OZTA 2PPGA 3LOTA 4PGLA 1O60A 3RXZA 3WUBA 4HK5A 4S23A 2C1IA 2R1NA 2FMOA 3PS7A 2HZGA 4BKNA 1J0HA 3WNLA 4HJFA 4J3UA 2VR5A 4OV9A 2ZTKA 3BJFA 3ECQA 4S3FA 4W8AA 1TG7A 4G1NA 1FHUA 3IJIA 1VEOA 4A21A 1HXJA 3F7JA 5FL1A 1F3EA 2W27A 1JZ6A 3I7RA 3NQFA 1XJBA 4MOZA 1WKEA 2FGBA 4GK8A 1S2TA 1R9ZA 5BMWA 1K4HA 3ITLA 2XN2A 4K6AA 5E09A 1SO4A 1YADA 4XD3A 1R30A 4O28A 3H2OA 1Z89A 2XIQA 2XUCA 4JXCA 3OGSA 3B0XA 1DTNA 3NOYA 3OP2A 5G4EA 1IEXA 1O7AA 2FGLA 1H61A 1DIDA 5FEWA 1OX5A 1FWTA 4OBRA 3G5EA 3R1ZA 1V8EA 3L5AA 1E4IA 2OKOA 4JYEA 1MDLA 1LORA 3SRHA 5AB3A 4ZXOA 3QGAC 1JI1A 4O53A 2J7FA 3UPMA 4N2YA 1ISXA 2XGZA 4LWWA 3NM1A 4GVGA 4PR4A 1DWAM 1VRDA 1QI4A 1T40A 4YIWA 4A35A 3K46A 4KCWA 3W87A 2CNCA 1T7LA 1K02A 3MS8A 1OFAA 3W86A 2AMXA 4FHAA 3PJUA 1A0EA 1ESWA 3DAQA 2ZUMA 3QFEA 4J3TA 2QUTA 2FJUB 3GR7A 3SW6A 5EU9A 4F79A 3WQOA 2NQ9A 3N14A 2ZZ2A 3O3RA 4AWEA 3WLJA 5D2VA 2AL2A 2V82A 2XIOA 2YR1A 3AXKA 2D69A 3IJDA 1F8IA 3LLFA 4Q8WA 5BXTA 2V8ZA 1RCXB 1YYAA 1FX6A 1ONEA 4XVDA 1IT0A 4FNSA 2Z29A 1NDVA 1JYVA 4GQRA 5CPQA 1SQ7A 4KEMA 3SFKA 2XWEA 1PSCA 2NXGA 1GEQA 3BE7A 4JS3A 4MAVA 1H62A 2C6QA 5E1QA 1XDMA 1V0LA 4PL1A 2CLFA 3LUTA 3TXVA 3GNOA 2NUWA 3NUKA 1V0NA 1EC9A 1VJSA 3C2VA 3O15A 1X6NA 1B3OA 1CXEA 1W2PA 1TTPA 3PZIA 1FXQA 2WPGA 1RLCL 1ZENA 1W9VA 3IVTA 4RKAA 3DHFA 4AUBA 4LOCA 5DANA 5CPMA 3B8VA 4OOUA 3CAVA 4MPQA 1JDCA 2F6UA 1V4YA 2QUVA 2CZEA 4B5NA 3ZZ1A 3G77A 2XIIA 9RUBA 1SJDA 3QW3A 1SFJA 1FDYA 1HJSA 1L0PA 1TUXA 3G8RA 3PUOA 4N9CA 3OVGA 1D3GA 4U3AA 3GTNA 1DBTA 1HJWA 3F03K 5H2ZA 1G4TA 1YPFA 2DH3A 5E0FA 3EOUA 4RDWA 5CZJA 3WMBA 3M6YA 3STPA 2E6DA 3E3HA 3B8WA 3AS3A 3VNYA 3MUY1 4Q8TA 2V67A 5TD4A 3WLPA 2QF8A 2EBNA 1L8NA 2ZBTA 5F2LA 2OJPA 3OG3A 1DWHM 2DSUA 1SW7A 1XIDA 4WOZA 2O7QA 3CL6A 1R46A 2PUZA 2EJ1A 1ZAIA 4D71A 3CUIA 4XUGA 3UPWA 1DIKA 1GNXA 3IEBA 3CO8A 1UUOA 2PDLA 3GDTA 2FGZA 4K1GA 1LCOA 5AYZA 4AMCA 1FCQA 1D8WA 1PZ0A 4FX6M 2G3NA 4YJ5A 4JFTA 3K8MA 2Y61A 2YZRA 1ODZA 1YEYA 4KIRA 2X1SA 3BW4A 1NFPA 3ABRA 4IPNB 2BY2A 2DEPA 1JPMA 3HQ1A 3R13A 3LK6A 5DQPA 1CNVA 4RXGA 2JQXA 3C0JA 2W62A 3DN5A 1OJXA 1Q6RA 1UR0A 1OF8A 3CTTA 3TKFA 2UY3A 3T78A 4E5TA 2WZMA 3W37A 3IK4A 3H21A 2DT3A 3APYA 2WVVB 1R3RA 2GLKA 3DFTA 4D6HA 1IXPA 1JR1A 3ZT7A 5CKSA 3EDEA 4GBUA 4Q8UA 3RHGA 3CWOX 2PGFA 3APTA 2FYMA 4U5KA 1RALA 4GGBA 1WNOA 1KCXA 2CXEA 4CCDA 4EWND 2L5HA 3C0LA 5EPDA 1UC4A 1GOOA 8A3HA 2X40A 3EWZA 1JJKA 3SQMA 3CBWA 5FACA 1HGWA 1QR7A 5JBDA 1TV3A 2J66A 3C4UA 2WHJA 2ACQA 3KTSA 1YMYA 3GFYA 5LA2A 1PKYA 3FXYA 2FH6A 1VJZA 4IIFA 2OLSA 3CIVA 1HKMA 3RX4A 3WJWA 2CLEA 4Q22A 3CLWA 2RGMA 5DY2A 1L6GA 3TAKA 2DJLA 2Q71A 3ARTA 4XAZA 3HG2A 3W84A 2YJQA 2VEGA 3WBYA 4IGSA 4IQLA 5DT5A 2QCDB 2WWCA 4EE9A 1EH9A 4CU6A 1TVPA 3M9YA 2RDXA 2LLEA 4R7WA 1TJ2A 2C15A 2V2DA 1V3LA 3QBUA 2FKPA 4FSAA 3L2IA 3AJ7A 4DO7A 3WUFA 5CJ5A 2GWGA 1F74A 4HTBA 2J7GA 5FJTA 5TIMA 3W88A 3BLIA 3UG3A 2ZWZA 4M51A 4C90A 2NVCA 3GVQA 1WQ5A 4HJWA 4KMQA 4P8VA 2QPXA 4JDYA 1LZOA 2FIQA 3SJNA 1VJIA 5HXMA 1DE5A 1EPXA 1EBHA 5BRQA 3G18A 4R34A 1DQXA 5C9WA 4FMVA 4N02A 3HTWA 3B97A 3A5FA 2VOMA 3BV7A 1BRLB 4Z1DA 3GBDA 1ELSA 2BV9A 1S39A 4PCPA 1CXFA 4HSHA 1OZQA 1YXDA 1TMQA 1O94A 1OINA 3D6NA 3ITYA 4FX8A 3ITVA 5F4SA 4CVWA 3O0KA 2WVSA 4LEQA 4GQ0A 3U6WA 3QR0A 4N9DA 3R8GA 1QDSA 3N3TA 3AMKA 4JNMA 3T7VA 4H9VA 2DZBA 4J1OA 2QVHA 3GQYA 4LF2A 2CCRA 3WLLA 2P0OA 1V77A 4YTQA 2AKMA 5GNXA 2PZ0A 3BK0A 5D2XA 1E9IA 3GO2A 3W38A 3THCA 3UW6A 3SN4A 1ZRQA 3Q4DA 4YVVA 1V7YA 3PTDA 4JIEA 3PM6A 4UR7A 1J6OA 3SSZA 3E0IA 3QPZA 4GCAA 1FP9A 1ISZA 2I9EA 2DSWA 1GVFA 4UQAA 3GC2A 4LRSA 5A5WA 2W5FA 3SY1A 1WO2A 3E5BA 1FRBA 1GVQA 3URQA 3M0ZA 1QTWA 3S8HA 3QKZA 2VDHA 1RQBA 3PZTA 3KBVA 3KRZA 1NWUA 3H2MA 4Q4RA 1YNYA 3GHTA 3AICA 3TIMA 3TQ0A 3V5OA 1K8YA 4A8LA 3QQ0A 1SFTA 3SY5A 1XIGA 3N2CA 3S6TA 2R6OA 4NNBA 4AB4A 4S2BA 3L0NA 4KWWA 1XDJA 2CPUA 1R5YA 2VCBA 2B0MA 3S5NA 3IGSA 3W1PA 3BL3A 4UTIA 4XZIA 4ZQPA 3CPRA 2CEQA 1N7KA 2OZ0A 3W6MA 4UTWC 4WR3A 1CWYA 2OU4A 2XTKA 1BYBA 1R3TA 3UY8A 1DYSA 1XISA 4DUOA 3FEMA 1JFXA 2DP3A 2VRKA 1MW1A 1FWHC 2Y62A 3TN5A 2VT0A 5DCEA 2ZRZA 1UCWA 3W2LA 1KV8A 3A47A 4O52A 4MKVA 1MWOA 4PODA 4H41A 3T42A 1QWGA 3PJXA 3CQ0A 1ZJIA 4OIFA 1JXKA 4NRSA 2RJHA 2ZZ5A 2DPEA 1MUMA 3AOFA 3EYPA 3T0CA 4WSJA 4HPHA 3WD4A 2WVTA 1UIOA 1UB3A 1YTEA 3S5ZA 1CGTA 4XAGA 1K4GA 1JEZA 4XZLX 2XFWA 2V0TA 1ZPTA 1GQLA 3NSXA 3AIRA 3KLKA 4ZQOA 2QIIA 4B3LA 1KRBC 2Z1WA 3UZZA 3CWHA 1N8IA 4J35A 4JN8A 2YIHA 3H4WA 3VTRA 1QAPA 3HQNA 2WZHA 2OWCA 3CHVA 1BGAA 2ALRA 5I79A 3HPAA 5CSUA 2PDGA 2X8RA 2PEVA 1DWGM 4B4HA 3AXIA 3E9AA 1A5MC 2OWXA 1NDYA 4ZQNA 3KRBA 3ARSA 1LROA 4JIPA 3LGDA 4CU8A 2G95A 2PRLA 1WDDA 4HNNA 5AHIA 2VX7A 1VC4A 4X0VA 3QR3A 3OHMB 1KBKA 2PWEA 1XLMA 3SAZA 4IPIA 4GI9A 5LA0A 3R0UA 2ZE0A 3LG3A 1VH7A 2DT0A 2FB2A 1PDZA 4XO7A 2QUUA 4BR1A 3VI2A 3OEXA 3MA8A 4GQGA 3H7VA 3P0XA 4IOTA 1HN1A 1DJNA 1R8LA 2J77A 4PMDA 3B0UX 1XLDA 5EBAA 4P7LA 1XDLA 4UUIA 4MG4A 4QITA 2NT0A 4IUOA 2IPJA 4GI6A 3OBKA 3WIJA 3T0TA 2D22A 4QG8A 3WENA 3G3MA 4PUEA 5FJRA 1PZ2A 1AJZA 1RPKA 3GY1A 3LCWA 1MSSA 3P62A 3WEMA 1B31A 1Z6KA 1US0A 1HL8A 2P5NA 4C5YA 4R7JA 4FLSA 3BOXA 2X1TA 4CNTA 1K8CA 2DGAA 1LM1A 2BOEX 3ONBA 1QU4A 3QVQA 2VEFA 4H7ZA 3WDRA 3V75A 2JBMA 4EP8C 1HVXA 1V3KA 5G2WA 3IJLA 3OB8A 3POHA 3TC7A 5D37A 1IWAA 2AOSA 4LUYA 2G37A 3NQVA 4AVOA 2TPSA 3V35A 2I1OA 3OODA 1GOMA 3ME3A 3AS2A 4ADSA 7PTDA 4S39A 1J0KA 4A3HA 1SSGA 1SZRA 2V3FA 3GR8A 1EP2A 3QV7A 5BRPA 1HKIA 2J75A 5EL1A 4FLQA 1YW1A 4MB4A 3BARA 4JTRA 2PWGA 1KNWA 2VURA 1OG6A 1POKA 2WVVA 3ZQ9A 4F0LA 4JKLA 3WNPA 2NWRA 1SO3A 4U2ZA 1EXBA 1E6RA 2HBVA 3ANYA 2X42A 5JMUA 2ZUNA 2VCAA 3W7PA 2EPLX 3L5MA 1E0TA 1TPC1 1M01A 4XVEA 1KRAC 4TTUA 5LNSA 4QGCA 5HQMA 1TZ7A 1NAL1 3P81A 1XIBA 4UMAA 3FHQA 3PR2A 1KO0A 2BHYA 1XRFA 1LT8A 5AN7A 2QW5A 1GOXA 4DELA 5ENLA 5LNWA 3BCDA 1Z42A 1GOWA 5FF0A 3ZWTA 3SIZA 4HNVA 1J0ZA 1R7AA 3SADA 4HQVA 4OUEA 4QEHA 3MSGA 4LY4A 4L64A 3RNDA 4GC3A 2XJ7A 3UBPC 3AISA 4RJEA 3CQKA 3FY1A 4Y96A 1A5LC 1G69A 4S3GA 4GVIA 1YDVA 3XIMA 2WBKA 4DXXA 1AZ1A 4C6KA 1UUMA 4PUUA 2QV5A 3UXAA 2ANUA 2V2HA 3GXPA 4E2DA 2V9DA 4AY7A 2ZE3A 4IMFA 5FJUA 1JPHA 2HBXA 5TBOA 3A6OA 4BI5A 3Q94A 1LOLA 3W2MA 3W81A 4GZJA 3VKCA 1GG0A 2IKIA 2ZXAA 2CZDA 4D6EA 3N6JA 3ZT5A 1ZS2A 1H7PA 4MWAC 3TA9A 4Z2KA 1X8FA 1K9FA 1KKOA 1WUFA 1FWSA 1B3VA 3BAXA 3FA3A 3DFSA 2VUNA 4KS0A 2WMFA 4AC7C 3WDJA 5JIPA 2WHKA 2EXOA 3W24A 4PFMA 5T91A 4ECLA 4ADTA 4A3QA 1BRLA 1QI2A 4QDMA 1CXKA 1CLXA 3S6OA 1L8PA 4OV4A 1VFOA 1I8JA 5DMNA 4B90A 1QFEA 3CMGA 2YDQA 2QULA 1VYSX 5A69A 1R86A 2ALDA 4C60A 2VC9A 5BU9A 1OZMA 2EG8A 4MWAD 3BSGA 3EWCA 3OVPA 4E2VA 4JHMA 2OYMA 4CQCA 1E3XA 1BXBA 2PTYA 3FAXA 3PY2A 3EB4A 1VBGA 5LZLA 4C6CA 3H54A 1TV5A 1ME9A 1HJUA 3EX2A 1JCNA 1YXYA 2YCLB 3GHSA 1BSIA 1CDGA 4DBEA 5C2GA 3AYSA 5FF2A 4GIEA 1R47A 4R27A 3CV6A 3LA4A 2VCCA 5I07A 1Q6QA 4YLWA 4KFPA 2WNQA 1JZ7A 4FNTA 1K6AA 3JW7A 3G2GA 3M0HA 4M1RA 1EIBA 2VDIA 4AX6A 5T26A 3LY0A 4LVAA 4MNKA 4CD5A 3CUGA 1RBOB 1VS1A 1UH4A 4GG9A 1XRVA 4QM1A 2EPMX 3VZYA 1ZP4A 2RDUA 3EAUA 2CZ5A 4OJYA 3BURA 4NXKA 3K2GA 3P61A 2FLIA 1I6NA 4QHRA 1ZAHA 4FX7A 4JR5A 3VZZA 4BQ5A 3CTLA 1RR2A 2WMJA 3NURA 2UY5A 3UJFA 1BG4A 1O5KA 3WG6A 3O05A 3LXCA 3EPMA 1WDWA 2V5JA 4ASTA 3S2NA 2EKGA 1MW3A 3TYCA 1EWEA 2BXYA 2V2CA 4UFMA 4W87A 5ECUA 3GW3A 4GD0A 4JNYA 3PP7A 1OX4B 4J9JA 2O4MA 5BROA 3PTMA 5BOEA 1H7XA 1LL6A 1DJHA 2A3LA 2IQDA 4AVFA 1Q6OA 3RCNA 3ABXA 3CK5A 2YDRA 3B9NA 3DC0A 3EWBX 2Y8VA 4WUIA 3C8FA 4L61A 1REQB 2VM8A 4D6IA 1BQCA 3WBAA 4WJXA 4AH7A 1KD0A 3GTFA 4LJ3A 2HS6A 3EMZA 1R0MA 1QPOA 1G0CA 1B3XA 4MWAE 2P8CA 3HPZA 1SMAA 3VOHA 4NZFA 2WLZA 3KRSA 4L4OA 2UWFA 5LGZA 3ONCA 4JIHA 5AHLA 3PBGA 3RRXA 4NZ4A 4PSPA 3CEPA 1POJA 1UQZA 4EIVA 4L9XA 1PL9A 7A3HA 1HNYA 3NYZA 1EPVA 1MW0A 4O0KA 3VA8A 1M03A 5BZAA 4WDXA 2XDFA 3AIWA 1JZ4A 1Z8AA 5ECVA 3RU6A 1SUXA 1X39A 1ZJBA 2EPNA 5I5RA 3N15A 1Y5XA 1Q7QA 4OFCA 1BXCA 2WC3A 3NO5A 4N0RA 1JQXA 3S1WA 4US5D 3MUCA 1WAUA 2OVLA 4LUTB 3EX6A 5H8MA 3NQ2A 1A5AA 3FJ6A 3R5EA 4PMJA 5K7JA 2OFJA 3BOLA 1RY0A 4ENLA 4GIAA 1WKFA 4I6KA 1VEPA 1BVZA 4PTMA 3RLVA 3VNLA 4HNUA 1LRQA 1F4HA 4BFAA 1W3JA 4LYPA 4XBSA 1EWDA 2TYSA 4X9YA 4GJ1A 5FD0A 1YE4A 3UZJA 1L9WA 2Q01A 3VIHA 4NAEA 4DF1A 4H9YA 2VFEA 3OLIA 1SGJA 3RPTA 1LYXA 3KW3A 4PEKA 2VRJA 1OABA 4LCQA 1PX4A 1NJJA 2Q8ZA 3B8IA 4B5SA 4QE4A 3YPIA 4IP5A 4JX5A 4LAOA 5HOSA 3OLGA 5BRBA 3BVJA 4XZWA 4D2JA 1TWSA 4NP7A 2PTWA 2QYGA 4JFVA 4TV5A 2ZC8A 3LDVA 3E74A 4PBEA 4S3DA 1XICA 1TPB1 3KUMA 2PDNA 2CLMA 3HPSA 3LMYA 1GW9A 4L4PA 1EQCA 4QG9A 4G7EB 5CXPA 1UWTA 1NH6A 4NRRA 3OZPA 3P5YA 3H2NA 1TJ0A 2DZAA 3RLUA 4MKSA 3IS4A 4ZTXA 3A3XA 4H3DA 1RQHA 5CAHA 4TQTA 3NEVA 5FJJA 4QRNA 4AZIA 3G1FA 1IR2A 3C86A 1PKNA 4MY8A 4ZE4A 1OYBA 1MUCA 1OBAA 4YMZA 1ZUAX 1SR9A 2D2OA 3IRSA 1GYMA 2AGKA 1A3XA 4C6FA 2ZYFA 2E5CA 4IMGA 5BMXA 4Q4KA 3SCSA 4ZFMA 1XBVA 5AY7A 3V5CA 1QI5A 5LA1A 5BWAA 2PDUA 1XV8A 5JIWA 4EXBA 1S2WA 4QR6A 4GA8A 4UMCA 4BA0A 3HZ3A 4GUIA 5HAOA 1KR0A 1Z44A 1S5WA 4CNSA 1UROA 1QNRA 2OELA 2DDXA 1UA3A 4GYPA 3M64A 3GTHA 3RCYA 3MT1A 4AC1X 2YCKX 3PAOA 3OYZA 2JIEA 1V6VA 1DIOA 1B4KA 3NPXA 3RAOA 4J2MA 2PWDA 1WAWA 3GS6A 2E6AA 3IIXA 3BGAA 4RXFA 3G0SA 2XGIA 1RXOB 4Z0JA 4TVCA 3VPLA 2O92A 1V6WA 2PDMA 1L6FA 3LCXA 4HMEA 4IISA 1M68A 2GVYA 2ADAA 4C1KA 3DFOA 4DJED 1P6CA 2ISWA 3A4JA 3KWXA 1WV2A 4RNHA 2XINA 5AFDA 3QSRA 4AAJA 1XFBA 1ECEA 4ILSA 4C6JA 1ADOA 2HJPA 2OMAA 4BEQA 2ZUSA 4YS1A 3U57A 3V1PA 4FALA 1X8CA 2A6LA 2UBPC 1PDYA 2GUBA 1M6JA 2C0HA 1RV8A 1QBBA 4LU0A 2OZ3A 1BF2A 1UKOA 4YNGA 4KRTA 2DH2A 1P0BA 5DRIA 3OJGA 3G1AA 3I7QA 4UFLA 3TQPA 1LT7A 4DI8A 1BEUA 4E8CA 4X9SA 3WZ0E 1DXIA 3AIUA 1FHLA 1AJ0A 4BZYA 4GINA 1WZLA 1ZCCA 3RILA 3EEZA 3TMLA 4M19A 4GABA 4JZ5A 1KM5A 3LGEA 1U83A 3W1UA 4PYSA 3LMZA 3R11A 3UT0A 1EDGA 1E73M 3TCSA 2Z0IA 3VGHA 2QJHA 1T96A 5A8GA 3QEZA 1GJPA 4HYRA 1B54A 4WGHA 4A2SA 1GQIA 1B2YA 5I0DA 1FDZA 3BICA 2YW3A 1OIMA 3KVMA 4TOQA 3ARXA 2J74A 4U2YA 3NGJA 3AYRA 2CERA 4OBSA 4QDWA 4EPDC 3CT7A 3LBCA 2Z6IA 4CD7A 4M0XA 3GWQA 3LN3A 2WMIB 3N1AA 1IEQA 5LHEA 4AEOA 4NVTA 4E3VA 1V6YA 3A3HA 5CQ1A 2YCLA 3REQB 3IIOA 4GUFA 1QRQA 3BDKA 2Y24A 1LBMA 1G6CA 2I16A 1EO5A 4D1IA 3B04A 4CUCA 4NG3A 1QK2A 1GK8A 1OGGA 4HCHA 4O4VA 2J6XA 3G1YA 3KHDA 3LHTA 2AQVA 5DN1A 4NJKA 4JEJA 3R8RA 5E6ZA 1VCVA 1ZAJA 1BF6A 3NQEA 3R79A 4IWWA 4FAMA 3M0VA 3WDHA 4YHGA 5AKQA 4LS1A 1CTNA 4ROQA 4XIAA 4ZO7A 1KFCA 3QTGA 5D2YA 1XUUA 3WJZA 4FIQA 2GGEA 2Q3OA 4PMOA 3DYMA 2QJGA 2YCJA 4MFDA 3P82A 5KINA 1EQPA 1LP6A 2QCEA 4OHQA 4FA3A 3VNKA 3SUSA 4NL1A 1V0MA 5AZ0A 3E2VA 3GB6A 4AG0A 1WOAA 1Q66A 2ZRYA 5I24A 2YLAA 2IMRA 4V2XA 3BSHA 1OX4A 5T9BG 4LC8A 3TMQA 1MNSA 2X0HA 3R89A 3LCFA 2QPSA 3UF9A 4B9YA 3SCOA 1H3GA 2FZBA 3S9IA 3T9PA 2XSBA 1PWLA 2E7FA 4DB7A 1HJQA 1REQA 3GNRA 1T5AA 3W2UA 3L4UA 3KP1A 3LQLA 3GX9A 3ZLHA 4L80A 5I2UA 3QQWA 5FJPA 4IX0A 1ZLPA 4QSFA 3QSTA 4H00A 3BV4A 1C8VA 2INFA 2YL6A 2IKHA 3WBWA 3TE9A 4HU8A 2CIPA 3S6DA 4X3ZA 1RJPA 3KL5A 1SZGA 2FZDA 4E38A 4A05A 1A53A 1AUSL 1ENUA 1WBJA 2YX0A 2YA2A 2W66A 1VEMA 4C5ZA 1JDAA 4AHPA 1A49A 3U4FA 2V68A 3OIHA 1Q6FA 2RDWA 2ZX8A 1KXQA 1FWCC 5HNRA 4DUVA 4KPLA 1XUZA 3LTYA 2BVYA 4H9UA 3NZQA 3LLDA 2VD8A 4DXVA 2QJJA 1N8WA 2FVLA 2PD5A 2C0AA 4DF2A 1UKTA 3AS1A 1KTBA 3UY7A 1P1XA 1AW1A 1KXHA 4LUTA 1QNSA 2CESA 1PUDA 5KZDA 2PTDA 4PMNA 3QMRA 1S2VA 2OGJA 4O17A 2OYKA 3K4WA 5TF0A 3JVAA 4B2DD 4JTGA 5E5CA 1I2OA 5FCZA 1CW2A 2CWXA 4IFRA 2AAMA 5G1MA 4YVPA 2EKCA 3W7OA 3KRUA 4GX9A 3OO2A 1K9DA 3WEZA 5GJMA 3MVIA 3DU0A 4IZGA 2YXXA 3BXWA 3EA1A 3IJQA 3WFZA 1LDCA 1XSKA 3FXGA 4D8LA 4Z2LA 3ARYA 4ALDA 4UTUA 3M1ZA 8XIMA 4NJHA 3NPUA 4GMEA 2ZQ0A 1AQFA 3GR4A 1W8GA 4L5ZA 2E9MA 3ZR6A 1VPXA 3H2CA 3EOSA 1EGVA 1OFOA 3CUZA 4EXAA 4AZBA 2W61A 5CPTA 4G7EA 5CCZA 1KQZA 1W5OA 2OKTA 4NZ1A 3B4UA 4EPBC 4RZBA 2OSWA 3OTRA 3KOYA 3KS6A 3DG7A 4B5VA 4K36A 1Z7AA 1H50A 4C6BA 2O9OA 4GLEA 3CU2A 1XX1A 1P7TB 3ELFA 2Q02A 1DTUA 2XN1A 2WSQA 4HBKA 4UTWA 1DJGA 2HVMA 3BG9A 2Z1SA 1R9YA 3T4CA 4HHLA 4LBUA 1YPIA 3W26A 4FXJA 3RPMA 1NP0A 2AL1A 3PG8A 2V69A 5EJ1B 6TAAA 4IM4A 1DJYA 1S3HA 1W3KA 3B3DA 1RQEA 3NQBA 1IZCA 5AHNA 4UFKA 1ZQ5A 1FWFC 4CN4A 3B0YA 3MP5A 4WIWA 3GVGA 3P0WA 4PUKA 4KWSA 5HJXA 2E6FA 4JHOA 4KWOA 4TMCA 4N9BA 2D20A 3CC1A 1HF6A 3GNNA 3RYSA 3W6YA 4FLRA 4Q8MA 4UFJA 2BFGA 2Y5EA 4LAMA 2PS2A 1JCXA 3B40A 3EX4A 3TZFA 1XWYA 1UJPA 2VR2A 2PI6A 2TODA 1HKKA 2HVOA 3XINA 3L67A 3ARVA 4XZBA 2VKZG 4YYFA 5U7SA 1VCGA 1TSIA 2YL5A 4HTYA 4NAFB 4P8WA 1AQHA 3PWIA 2DVTA 4UQ9A 4M6QA 8XIAA 3MUAA 4UNIA 3K8LA 2CLHA 1A50A 3T0DA 4EX4A 4DO5A 4RL3A 1C8YA 4AEEA 1GTEA 5A8QA 2ZXBA 3U9IA 4EK7A 3ANVA 4D6DA 3AXHA 2BG5A 3QJAA 5GJNA 1C3FA 4CQDA 3CL8A 2I5IA 4OBTA 3W22A 1O12A 3E0LA 5JVLA 4GYKA 1KFLA 3N3MA 2ZZ7A 4F2UA 3VFLA 3UETA 1JUKA 3OIXA 4UNKA 3EOEA 1LWIA 1JULA 4JTHA 3NSNA 4CQ8A 1R7OA 1V93A 5LNRA 5I02A 2VMFA 1WP6A 5AC6A 1F6YA 2OQHA 4E4PA 4JKKA 4Y8FA 2X7WA 3M47A 2YYTA 3OQ8A 1TE1A 4OTKA 2E67A 4IPPA 1FTXA 1YNQA 3G1XA 2ISSA 1VHNA 2PAJA 4UQEA 1XG4A 3KZPA 2J9YA 1K8ZA 1EEPA 4S3BA 4H01A 3V0SA 4PZVA 1ODUA 3T55A 3QLDA 3N4AA 5I3HA 2G96A 3VINA 3VM5A 4CEUC 1NVMA 1UWIA 4ICCX 2CITA 4ZQCA 3FLUA 1UQYA 1AMKA 5I3DA 2E40A 1JCLA 4KERA 2EGZA 4UR9A 3OG2A 4EF8A 3II1A 3W7RA 2XG9A 3D47A 3POCA 4Y2WA 4QAWA 4GXMA 4MY9A 4HNOA 2VJXA 3RPDA 4AZ5A 3AYVA 1XR2A 1W32A 1J0YA 4ROPA 1MEWA 2H3BA 3KOZA 5LXEA 1ONRA 1GTHA 3HMCA 3NQ7A 1G1YA 4I9MA 5GNZA 2WMIA 2A5HA 3MTWA 1JGIA 4HCLA 3OGRA 1DEDA 1P4CA 3BZGA 5LKYA 3REQA 3D5HA 3RX3A 3T07A 1BPLB 4ZOBA 2PDJA 1E1CA 1A5NC 4HA4A 3UJ2A 2G5WA 3LTPA 1WKDA 1UPPA 5L9FA 4H6EA 4AZHA 3P5ZA 3FW6A 3NG3A 3VDCA 1BD0A 2BASA 2JEQA 5M03A 3BZJA 2XSXA 4PUWA 3WX7A 4H9TA 1TJ1A 5F4WA 5EY5A 2ABAA 4FNPA 1OFBA 2E1DA 3N11A 3CNYA 3R6IA 1F73A 3RN6A 4OUIA 3FK4A 5EKYA 4MNJA 2VWTA 4M80A 3RMEA 4WOQA 2ZIDA 3PUGA 4WZHA 3L12A 5LIUX 3VKDA 3TOPA 3GU9A 5I3GA 3N73A 1OK6A 2DU2A 5EYWA 1MQRA 1XRSA 5CLTA 1BYDA 3WMLA 3LV5A 1E6XM 3IARA 2P53A 2IXVA 4UCGA 4BY3A 2TMDA 5AVHA 2F9RA 3FAWA 4JX4A 1S5MA 4GYFA 1NWTA 2VO5A 1FQ0A 2DSZA 2WSKA 1S46A 2R24A 2PWUA 5G4HC 3THAA 2QDEA 3CV7A 3CUXA 3W28A 2FDSA 7ENLA 3CT2A 1ONWA 2G3IA 4H9XA 3W7QA 4O1EA 3UXIA 5IHSA 4U33A 3GH4A 3WQPA 1TWWA 4WX2A 5DBTA 1QJWA 1XGDA 2AQWA 4ZMGA