1MQQA

The crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1 complexed with glucuronic acid
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
675
structure length
675
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Geobacillus stearothermophilus alpha-glucuronidase complexed with its substrate and products: mechanistic implications.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ALPHA-D-GLUCURONIDASE
total genus 284
structure length 675
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mqqA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1mqqA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1mqqA03
2CKRA 3W6MA 1EOMA 4W5UA 1V03A 2DSUA 1GW1A 1H5VA 3TP4A 3DYOA 5A6KA 5ABGA 2FHFA 1EQCA 1E6SM 3SCWA 2XGBA 4ML4A 4L4PA 2ZXQA 4PTMA 2ZUWA 1RP9A 2WMJA 3BGAA 3ARPA 1CGUA 2CKSA 2CPUA 3AISA 4V27A 2W5FA 2BV9A 3OIHA 2XIIA 3VIFA 5A3HA 4UQCA 4WKAA 3AS1A 5EBAA 2WMHA 1KB3A 2XFYA 4FK9A 2J7BA 2VZVA 4S3JA 3UG4A 1G9HA 3CUFA 2WWCA 4W85A 1TVPA 3MV01 2D24A 4AZBA 1J0ZA 1ECEA 3CHEA 3AMKA 4FF5A 3AIRA 3VD3A 3L4WA 4UNIA 4OBRA 4MAZA 3WNKA 3VMNA 3VIJA 3GXMA 1TFVA 4BQ4A 2XM2A 1AQ0A 3QGVA 4UQBA 1B1YA 4UFLA 3AXHA 4PMYA 3VGDA 3ZM8A 5GNZA 4NI3A 1UR1A 3U7BA 3ARZA 5BCAA 1QW8A 2E9BA 1OIMA 5A8QA 1O6IA 3N04A 3ZJ8A 3KZSA 3WDQA 3WEMA 4IM4A 3WNPA 1FH8A 4RE2A 1LL6A 4ACZA 5A6MA 1ZBKA 1M53A 1R85A 1UWSA 2W61A 3GNPA 2WAGA 1PX3A 3GYCA 4TX6A 1QNQA 2QMKA 1CGYA 3WD0A 1NWUA 1E4MM 4U2ZA 1RPKA 4UQAA 2V3GA 4AW7A 3ZSTA 2ZICA 3VIPA 3SCVA 3I3BA 3QHOA 1V6XA 3M7SA 4J28A 2Q8XA 2EPNA 3VGFA 3M46A 5A2CA 1W1PA 2X1IA 1XHGA 1UKTA 4HU8A 3LMYA 2JFEX 3WMSA 2D0HA 5CJ5A 4NF7A 2X05A 3RILA 2QF8A 2ZX7A 4HPGA 2J8GA 1KCKA 2YIHA 1G94A 3WH6A 4OIFA 4MB4A 1JXKA 1VF8A 4AIEA 3BLPX 1Q6FA 4CD5A 1J9YA 2ZUSA 1CECA 1JAEA 1PIFA 2VUYA 2WVUA 5I24A 4PUDA 3NYDA 2QLYA 1V0KA 4DM1A 2A3BA 2PBGA 2YL9A 3AMCA 3WUEA 1DWJM 1QI3A 3WEOA 1ZJBA 3VKKA 3UEQA 1H3GA 3AI0A 3AFBA 2AMGA 3II1A 4JZ5A 3AS3A 4QP0A 3LPGA 3BAJA 3WNLA 5FCZA 1QPKA 1R87A 5EFFA 1EQPA 1JF5A 1E43A 1ISVA 4D6DA 4J3WA 2O92A 3SCRA 4DWSB 4GZJA 1VFMA 1PIGA 5AYIA 2V5CA 4E8CA 2E0PA 2EPMX 1W1YA 3OLDA 4B3LA 4EE9A 4CVUA 3WH9A 3ZT7A 3FNDA 4XX6A 4GQQA 1MWOA 3O6AA 3NUKA 2VJXA 2D0GA 3WMCA 1UOKA 8A3HA 4WK9A 1CYGA 3CUIA 3BAKA 2ZWYA 3KEHA 2NT0A 3A4XA 1HKMA 4PCTA 1Q6CA 1JI2A 2JE8A 2VRKA 1LJYA 4GKLA 1BVZA 3O2LA 1DWHM 3VU2A 4AYSA 5BRPA 4ZEPA 3GXDA 5KZ6A 3U57A 1WDRA 4AZHA 7TAAA 1JFXA 4FLRA 1LLOA 4CD8A 1JZ2A 2ZUVA 1FA2A 4PMVA 1FOBA 4QCFA 4CU7A 1M03A 1LWJA 3N18A 2QV4A 5GNXA 2BVTA 1C8XA 5BXPA 1OGSA 2D23A 4HA4A 3CMGA 3W53A 4NRRA 4AD4A 1JL8A 1ZBWA 1QVBA 1MXGA 5FIPA 3BH4A 2WKGA 1B2YA 3FXYA 2VQTA 1Q6EA 3AHTA 3M6DA 1GORA 1GPFA 3WDIA 3WDRA 3VIKA 2WW5A 5DF0A 1UWTA 1EO5A 2CBJA 3WY1A 4JL1A 1H1NA 2J4GA 3VM7A 2E8ZA 1JYNA 3OGRA 1UR8A 3WQVA 1L8NA 3WDPP 4K68A 1R86A 5I6SA 4Q7NA 2WSKA 4PRWA 2YLAA 2FGZA 1BFNA 1XRVA 3WDHA 1A3HA 1XYFA 5FD0A 2NW0A 2BVDA 1JDAA 1PZ3A 4FLOA 1QHZA 5HOSA 3ARXA 3A6OA 5IFTA 2WXDM 1ISXA 1I1WA 2BHZA 2XG9A 4PUEA 5D9MA 2W92A 2FGLA 3NSNA 1VJSA 1CXEA 3CGTA 5JBEA 4JHOA 3L4YA 2VCAA 4AD5A 1VEPA 1KCLA 3VD5A 4MDPA 5A8OA 1IV8A 4PMNA 2VZOA 4AC1X 3VDHA 1JZ7A 1E1EA 4TXEA 2X2YA 3VIOA 2VX6A 5I77A 2VOTA 1DWFM 3O9NA 1E0WA 3MMUA 2JF6A 2GJPA 1DWIM 2WVVA 1ZJAA 1GQKA 4U3AA 3SUTA 3GH7A 1KR1A 2PWDA 3EBVA 2O9PA 4AZ6A 1S46A 1E4LA 2YBTA 4PMUA 4GQRA 4TX8A 2W4XA 4MJ4A 1DWGM 2J75A 3ZR6A 1EO7A 5AC4A 4IUGA 3N11A 3SCPA 3EDEA 4FLQA 4MB1A 1P6WA 2J25A 2BNJA 1PX4A 5HPCA 5E0FA 1W9UA 1BYCA 1KWKA 1W3HA 3VIHA 1CTNA 5CSYA 4N42A 4ATLA 3BMWA 1TCMA 4AZCA 5CXPA 3CZEA 3CZLA 3WF4A 1CGXA 4QDMA 5DT7A 1CXKA 4E2OA 3NSXA 3EMZA 4GXPA 2IXUA 2CBIA 5LA1A 1WDPA 3WN6A 1BVNP 3BLKA 1CDGA 1FHDA 2HISA 2ZX9A 4M82A 4IISA 1UZ1A 2Y4SA 4UQEA 2E9MA 2OWWA 5CLWA 3MMWA 2XHYA 4XUYA 5DT5A 3W81A 4GPNA 3G6MA 4CUCA 4HPHA 1FP9A 3MUAA 2O9OA 5EMYA 2RGMA 3J7HA 3F5LA 5I5RA 1QOXA 1HX0A 2PC8A 1CBGA 1MXDA 4Z2KA 1OIFA 3L2MA 5A8NA 2CBUA 3WF0A 2WMIA 5JIWA 2DT0A 2WM0A 1SMDA 4AZ7A 3WUBA 1MW3A 4AD0A 3PTKA 1KGXA 2WB5A 3G6LA 3U7VA 1UR2A 1V6WA 3IK2A 3WNMA 2DSKA 3WNOA 5IDIA 1WDQA 1EH9A 1JGIA 5DMYA 1E4IA 1HVXA 5HPOA 1H4PA 1TR1A 3KL0A 4X9YA 1E9LA 1IT0A 2CHNA 1W9XA 2BY3A 5C70A 3AMLA 2J62A 5A1AA 2BY0A 2V3FA 3WL1A 1EDTA 1KFWA 5M5DA 2OLHA 3IANA 3BCFA 1E40A 2VZUA 3AICA 4DWSC 3TTYA 2F61A 1NP2A 3S6TA 4AEEA 5A8PA 4OJYA 1TZ7A 5M3WA 4GI6A 2WZHA 1ODUA 1E71M 3MSDA 3QHMA 2VX4A 1JIBA 3E1F1 3W26A 1B31A 2VTFA 2VZSA 5JBFA 3K46A 1UR4A 1DEDA 1LG2A 3RPMA 4W89A 3OBAA 2XVPA 3CPUA 3WUGA 1KQZA 1GOWA 3CMJA 2D3NA 1XV8A 1V0NA 4P7OA 2E3ZA 3CZ8A 3IAPA 4C90A 3FHAA 1QNSA 3OB8A 4BZYA 5CGTA 2WHLA 4M80A 4GINA 3GH4A 1TUXA 1BYDA 1EHNA 4MNKA 3NIYA 1EA9C 3FHQA 3SUVA 1D3CA 4WKFA 4AWEA 1OD0A 3BAIA 1J01A 1MYRA 2ZUTA 1JNEA 3WDJA 1EDQA 1CIUA 4A4AA 3SCUA 1KXQA 4H7VA 5GPRA 3B9EA 1E3ZA 1QI4A 1NH6A 1HT6A 1CWYA 4WF7A 1PZ2A 1C90A 1UQZA 4ACYA 2BXZA 1W3LA 1W9DM 4B9ZA 4UZUA 1PX8A 4EANA 4KRUA 3TTSA 1E1FA 3VMPA 2DH2A 2JIWA 2ZE0A 4Z2GA 3VGEA 1VRXA 2G3MA 2GVYA 3DECA 3I3DA 2BY1A 5E0CA 2YJQA 4UOZA 5ABFA 1G5AA 5E6YA 5KEZA 4Q22A 3PN8A 1CGVA 3RIKA 4HA1A 5EB8A 4CN4A 4TTUA 5A2BA 1JXJA 5CSUA 4XZWA 4AISA 4MAVA 1EXPA 4YHGA 2W62A 5A6BA 1FH9A 1XD1A 1C3FA 1BLIA 4H8UA 3ZSSA 3W29A 1V3JA 2WBKA 3SURA 4L4OA 2D0FA 3T0DA 1ZL1A 4UOQA 3N15A 1E6PA 1I1XA 3CIVA 1JAKA 1HL9A 2O9RA 3VILA 3MMDA 2OWXA 2EO7A 4W7VA 3VDBA 1HL8A 2V3DA 3OGVA 3WFLA 1UQYA 2ZXAA 1AVAA 1CPUA 2VRJA 2WMIB 5BXRA 4RE3A 3VINA 4BS0A 5A6LA 5ABEA 3W28A 1XYZA 2DT3A 4XV0A 2VNCA 1NARA 4U33A 1H09A 3VPLA 1US2A 3ECQA 2E4TA 4H41A 5FKYA 4HOWA 2CEQA 4UFHA 3BXWA 1C7SA 1GOMA 2DPEA 3VDAA 5BXTA 2G3NA 5BROA 1GHRA 4X0NA 3B8SA 4JFSA 1FP8A 1DHKA 3VIMA 3ZOAA 1E15A 3GH5A 1JD9A 2YL8A 3UR8A 1V0LA 3MSGA 4DWSD 4CCCA 1E5NA 4JFUA 3W82A 4B9YA 1VJZA 3WF2A 2UY4A 4MJ2A 5ABFB 3WIJA 4UQ9A 5IXEA 1I75A 1BG4A 1EOKA 4GI8A 2J7FA 2VO5A 1D7FA 3OG2A 2J7DA 3UESA 1DWAM 4CU6A 2WC3A 4JFTA 1GUVA 4URIA 3ZMRA 1HJXA 1O7AA 2OSYA 3HU7A 1J0JA 4HA3A 2OWCA 4AXNA 1BYBA 3AIQA 4MDOA 1RH9A 3AZTA 1SMAA 1BGAA 2J79A 4H2CA 3W4RA 1J0YA 1CNVA 3TTQA 1KBBA 3UETA 3AYSA 1W1TA 5E9AA 4F66A 4WKHA 3SEPA 1ZBCA 4PMZA 1UD8A 4BQ3A 4W7WA 2IXVA 1LQ0A 2PF0A 2VX7A 4LPCA 4W8LA 2DIJA 2A3AA 3MU7A 4UFKA 2W91A 1U2YA 1K6AA 2QPSA 3PZ9A 4EAMA 1PPIA 3SIMA 1Q6DA 3OLEA 1BG9A 5I2UA 3GXFA 1UKSA 2VL4A 1KR0A 2ZUUA 4M1RA 3BMVA 3BAYA 1CEOA 1XC6A 4MNMA 3QOMA 3SUUA 3MUZ1 1E6XM 1R7OA 2AAAA 4W93A 5CPTA 4JCLA 1UD6A 3AXXA 3K8KA 2PB1A 4D6JA 1OBAA 2C7FA 5HBFA 3FW6A 4PSPA 3EYPA 9CGTA 1WO2A 3VDCA 2VRQA 1KGWA 4P8WA 4QAWA 4PMOA 3T2PA 1QBBA 4CCDA 2VVNA 3WH7A 4CVWA 1VEMA 4R27A 3RM4A 3NDYA 1K9TA 2VQUA 1WCGA 1M7XA 2J7GA 5CGMA 1PBGA 1C93A 1KXHA 2X0HA 1J12A 1G01A 5A69A 4ZE4A 1GJWA 1W2PA 3ARWA 3WQ8A 4AZIA 1JZ5A 4HOZA 2D22A 5A6SA 4WLCA 1MQPA 4MB3A 5IHRA 2WHKA 3HJEA 2UY3A 3WENA 1WE5A 3B9DA 4V2XA 2EPLX 2JALA 1E0XA 5ABHA 4PTVA 3FY1A 4JKMA 1KQYA 4JHZA 1E70M 2WHMA 1FFQA 4OZOA 3A4WA 1ISZA 3AIUA 2CETA 3L4UA 1WZMA 4ZENA 3PTQA 2J7CA 1B30A 1UKPA 2WSPA 4ATWA 5IHSA 4ACZB 3WQ5A 2ZX8A 1V6VA 1UD2A 1NOFA 1VFFA 1UYQA 4UTFA 3ARVA 2ZX5A 2CIPA 1DP0A 3T0AA 1WZAA 1KXVA 1ITXA 1V08A 1U30A 1WPCA 1JG9A 3AS2A 4PN2A 3VD4A 1JD7A 1GVIA 4QLKA 5CG0A 1MW0A 1R7AA 4P8VA 4BQ5A 2YOCA 3OZOA 4M56A 4D6HA 2JEQA 4QFUA 3W6LA 1E72M 2E9LA 1Q6GA 3DHPA 1G1YA 2D20A 1JZ6A 4AZCB 1V3HA 3AHXA 3L4XA 3L2LA 4F79A 2AOSA 4RE4A 3CUHA 3PZGA 3HN3A 1VFOA 1GHSA 5C8BB 2V3EA 4LQ1A 2WANA 5LYRA 1CGTA 2ZXBA 1JYWA 1E3XA 5BWFA 1W3JA 4R5EA 6A3HA 2CCRA 1MVYA 2CNCA 1W2VA 1IZJA 3ZR5A 1V02A 3GNRA 5HXMA 3WQWA 3MANA 2YA2A 4DM2A 3DC0A 3TONA 1W9BM 2YKKA 2QHAA 2WC7A 3MS8A 1NWRA 5E70A 3UCQA 1ESWA 5A2AA 1MW1A 2BHYA 2J8FA 2GDUA 5GNYA 3EMQA 4HTYA 4NSBA 2VT0A 1CXIA 1WB0A 1LL4A 1H0IA 4PTXA 4ZXOA 2WHJA 4AIOA 1M04A 3UG3A 3PBGA 1ZBVA 2J74A 4TUFA 4EK7A 1HN1A 4JCMA 2Z1SA 3VNZA 3PHAA 2CITA 2WVVB 4N0RA 3BC9A 8CGTA 1NP0A 3W38A 3FAWA 3UR7A 1HJQA 4OUEA 1UD3A 3WQ4A 1CENA 2EBNA 3WF3A 2XYLA 2Y8VA 1TVNA 1H49A 1ZU8A 4PEEA 4AZ5A 1OD8A 2CYGA 3N12A 2Y8KA 4D6FA 2E40A 1GQLA 2WNWA 2EPKX 1KBKA 4GI9A 2F8QA 4HMEA 2FH8A 5TD4A 1UA3A 5CLTA 2EXOA 4C7FA 4X0VA 2JF7A 5I3DA 2DQXA 4J3UA 2W67A 3RO8A 1TMQA 1QNOA 2ZWZA 3WFZA 3DHUA 1CLVA 2GJRA 3T2OA 4JKKA 1FFRA 4JFWA 5FL0A 3AIWA 3PZNA 4P7QA 1L0PA 1H41A 2CERA 3AZSA 1HKJA 3T0BA 3ARQA 2DSZA 1HVQA 1B3XA 3AIEA 3W25A 4GIAA 2CXGA 2E8YA 3DYPA 1Y7VA 1Z32X 1EDGA 3K4DA 3N1AA 3ZT5A 1V3IA 3VGHA 3WMBA 4HMCA 1AMYA 1OSEA 4M8UA 5A94A 1JYXA 1BYAA 1WP6A 1ITCA 2V38A 3UERA 2VX5A 4B15A 3CHCA 4UQDA 2XVLA 2EQDA 4DWSA 1C7TA 3OGSA 4J3TA 5M17A 3RDKA 1HJVA 4D6EA 1CZ1A 4BCEA 3W24A 2PWFA 4ZXLA 2OSWA 3EDDA 1NM9A 4MADA 2UY2A 1YQ2A 3ARTA 5I0DA 5IFPA 4PMQA 1UD4A 3BSHA 2HVMA 5CPSA 3RCNA 2XSAA 4CCEA 1JDCA 4F8XA 1VBRA 4MB5A 2J77A 3D5HA 2QPUA 1GOKA 2GDVA 2GJXB 1UWUA 4W87A 1HF6A 6CGTA 4KRTA 2G41A 7A3HA 3A4AA 1E6QM 1HKKA 4KGJA 4D1IA 2ESCA 1C8YA 4HMDA 3ZJKA 2YLLA 2XJ7A 1B0IA 4U3CA 1OT2A 1WZKA 2EJ1A 3FAXA 1UWQA 2ZIDA 2XVKA 1ISYA 4U5IA 3KE0A 4CKQA 1GZJA 1M01A 1QI2A 2D1ZA 1VENA 1PAMA 3AHVA 1XD0A 3TA9A 5D9PA 1HJSA 1UR9A 2XGIA 4V28A 4AD3A 1OCQA 3M07A 2YL6A 2ZUMA 1VEOA 2XVNA 3GDBA 1KWGA 1IZKA 4RL3A 4U5KA 1QI5A 1QHOA 2XPKA 1B9ZA 5D8ZA 3D3AA 3GM8A 4Z2JA 3WL0A 3GZAA 1EGZA 3W37A 4PMDA 4U31A 4GO8A 1CGWA 2WK2A 1UHVA 5BYWA 4LXFA 3SUSA 5D8WA 2VVSA 1EHAA 2PI6A 1GQJA 4A3HA 3U5YA 2JEPA 1XSKA 3ALFA 4GO9A 4P8UA 1LF1A 3QOKA 2DT2A 3AHYA 1NQ6A 3K8MA 2GSJA 1GCYA 1J0HA 2WVTA 2A3EA 4C7DA 3AOFA 1JZ8A 1C91A 4C91A 4W84A 1XGZA 5GQBA 3WBAA 4KGLA 4E8DA 3GBDA 4Z2IA 2WBGA 4UCFA 3WNNA 5BXSA 1C8QA 1UWRA 1X6LA 1X6NA 2FHCA 3PTMA 2A3CA 1XSJA 2ZUNA 4CGTA 2DT1A 1E0VA 3AJ7A 2WVSA 4BA0A 3S2CA 4YPJA 1TG7A 1E6RA 1E55A 2BY2A 4MPKA 1HIZA 3WEZA 4MNLA 1TE1A 3PZUA 1RD6A 1V3KA 4AZGA 1ZS2A 1H2JA 4LYRA 2GFTA 3WSUA 3POHA 1GJUA 3L4ZA 4KH2A 1BF2A 1BSIA 4WIWA 2WYSA 3F5JA 4UFJA 3VOCA 2DEPA 3LPFA 3TOPA 3A47A 2YDRA 3AS0A 4UR9A 1F4AA 4D71A 3ZJ6A 2J7EA 3BAXA 2B31A 4PYSA 3BCDA 3VMOA 2Y2WA 1B3VA 4PBGA 1UH4A 4M29A 1JI1A 3BSGA 4LX4A 3TTOA 3VUPA 3WKZA 5DO8A 1H0GA 4UZSA 2ZOXA 2WKLA 2NT1A 1K9FA 4F9JA 5CZKA 3NSMA 5AYBA 3POCA 3WUFA 4ATDA 2J7HA 2BVYA 4KMQA 1JZ4A 2OYLA 2WCGA 2O9TA 2FHBA 1A47A 4JIEA 4H04A 3ALGA 2XUCA 2WCSA 1XCXA 1BGGA 1HP5A 1OGGA 2WLYA 5E6ZA 5A95A 1E6NA 2C8NA 1BPLB 1UKOA 6TAAA 4AY1A 2C0HA 2XM1A 4M81A 4UFIA 2WZEA 1QI0A 1V3MA 4W8BA 4WSJA 4TVCA 1G0CA 5I79A 2WMGA 1W9PA 5A8MA 3UG5A 3NCOA 3CBWA 4OOUA 1E6ZA 1BAGA 3RJYA 1W91A 2Z1KA 1MFVA 1QNPA 4Y7EA 4QLLA 1R8LA 4LYQA 4UOJA 3PZQA 3AIVA 4AEFA 2WMFA 2XVGA 1OB0A 1UKQA 4XZBA 1E73M 2DSWA 2GK1B 4H8HA 1XH2A 3WH8A 3GTNA 1B90A 3ZQ9A 3KL3A 4W88A 3CZJA 5EFDA 2PBOA 2DDXA 1QHPA 1WKYA 4JAWA 4PMRA 2UWFA 3BAWA 3PZOA 1W3KA 1GNXA 1MFUA 4FLSA 2CBVA 3CO4A 2BFGA 4M24A 1W1VA 3A3HA 1HNYA 1MQQA 4NZCA 3SCTA 4D6CA 3CHFA 1C92A 2D2OA 4P8XA 1AQHA 5BRQA 5CQ1A 5D9OA 1MW2A 1UZ4A 2XTKA 1K9DA 2G3IA 3W27A 1UG6A 1OWQA 3MV11 2TAAA 2WWDA 1BTCA 3CLWA 1FHLA 3EMCA 2OSXA 2XFRA 4GZEA 1JYVA 3AYRA 4NRSA 1WDSA 1SFSA 2YA1A 4PSRA 2YDSA 1LWHA 4D1JA 2PWHA 4W5ZA 5AY7A 3IJ7A 1KGUA 1E5JA 5HNNA 3VGBA 2VI0A 2G8ZA 2VCCA 4TVDA 2VZTA 1J11A 1QBAA 4Z2HA 4LYPA 1VAHA 2WZIA 3N13A 1V0MA 4P7RA 1FH7A 3K4AA 5D4YA 3VIIA 1B3WA 1LG1A 1PJ9A 4C7GA 2J78A 4FMVA 4CN1A 3NDZA 1VFUA 4TOQA 3CTTA 2J47A 1CLXA 5F7UA 3THDA 1D2KA 2VMFA 1JDDA 3AIBA 4UFMA 2OYKA 5FL1A 4D6GA 1W32A 3T09A 2X09A 3APGA 2WPGA 4JL2A 3VO0A 3ZO9A 3LPPA 4TTGA 1VIWA 3IJ8A 2VCBA 3ARYA 4CD4A 4MNJA 4A3YA 3N17A 1OM0A 3FN9A 5DFAA 1V6YA 3AMGA 1E56A 5JIPA 2V5DA 4J7RA 1Q4NX 4LGXA 1UUQA 4IPLA 5D9NA 4D72A 2XSBA 1LL7A 5M03A 3GNOA 4AD1A 4F9DA 3THCA 3WQ6A 3WF1A 3W0KA 3QR3A 4J27A 3ARSA 3AQUA 1VB9A 3OLGA 1HJWA 1SYTA 3SCNA 1GVYA 2ZX6A 2YDQA 4CD7A 3VNYA 3WD2A 1N82A 2WC4A 1GONA 3VIGA 1OT1A 4PTWA 2XWDA 3WD1A 5JBDA 3I3EA 1H11A 2FDMA 3JUGA 1HP4A 1F4HA 3CUJA 3WH5A 1UH3A 1U33A 1JNDA 2BXYA 5LA2A 4CU8A 3CZGA 3VGGA 4J3XA 3EDJA 3GBEA 2DSVA 2DIEA 1HXJA 1K9EA 3SCOA 1X1NA 3VX0A 4E4PA 4JKLA 1GOIA 1WAWA 3KWXA 4DUWA 5I23A 1NOUA 1NWSA 5AC5A 1HJUA 3ZIZA 2VC9A 2GK1A 1WNOA 2VURA 5DEZA 4P7NA 3K8LA 4B16A 4TVUA 2YL5A 2DH3A 2YA0A 7CGTA 1EIBA 2XWEA 4D6IA 4AD2A 1V3LA 1KXTA 3T2QA 2EEXA 1SR0A 3QHNA 3RMEA 1UWIA 1PEZA 1US3A 3F4VA 4QLJA 5CPQA 4QCEA 3ZJ7A 1TA3A 5A6BD 4HZ8A 4S3KA 1QNRA 5E09A 5ECUA 4BF7A 1J0KA 3AZRA 5JUVA 1CXHA 1CXLA 1J18A 3F5KA 1XH0A 5A6JA 1E4NA 1ISWA 4ZFMA 3VM5A 1NWTA 4JFVA 4W7UA 3VD9A 1DTUA 1HKIA 3MKKA 1QW9A 1V02E 2PWGA 3GXIA 4YN5A 3AXIA 3AMDA 2F2HA 3OLIA 1OGBA 2Y5EA 2RGLA 1J10A 1B3ZA 3MO4A 1XH1A 2GUYA 4MTVA 1ZB5A 1JZ3A 1GOOA 1UD5A 1UH2A 3HMCA 4J3VA 2QMJA 2UY5A 3OA5A 2A3HA 4HZ7A 4P7LA 1BQCA 1JFHA 3OZPA 4XB3A 3SCQA 3LPOA 3EDKA 3T08A 3WELA 3RJXA 3VX1A 3KL5A 3PZTA 2XFFA 3PZVA 1W9VA 4HOXA 2ZXDA 3CHDA 1VBUA 1B3YA 2W63A 4OKDA 2WLZA 2NSXA 2X0YA 1XCWA 3DYMA 2VR4A 5HDRA 3CZKA 4CD6A 1GQIA 3B9AA 5C71A 2BHUA 1J0IA 3MUY1 3WD4A 3AROA 1NOWA 3VD7A 3ARUA 3WBEA 3IAQA 1OINA 1XSIA 4U2YA 3K1DA 5I78A 2BS9A 3N9KA 1YHTA 4AMCA 1WZLA 3SCSA 3SUWA 2WCAA 3IJ9A 4HP5A 2XIBA 2DGAA 4CN6A 4H8VA 3U5UA 2WMKA 2OYMA 4Z2LA 4AIUA 2VR5A 3ZT6A 4PMXA 2GJXA 1CXFA 3L4TA 4IPNB 4YHEA 3VVGA 4OBSA 5A6AA 1JF6A 5FOOA 2G3JA 4BQ2A 2G4FA 4HZ6A 3PZMA 3VTRA 4W8AA 4HU0A 2PWEA 4EKJA 3PZIA 1MQRA 2CHOA 3RM8A 2X8RA 3CH9A 2YBUA 2Y24A 4J3SA 3NJ3A 4KWUA 2D3LA 3EDFA 1BHGA 4GZIA 1TA3B 4DUVA 2FH6A 1V6UA 2JIEA 4DUXA 4WSKA 3WD3A 3L4VA 2W66A 4PCSA 1AQMA 2CESA 3CUGA 2IUZA 3MUIA 4B3KA 3AHZA 4W86A 1UR0A 1GOQA 4ZE5A 3ARRA 1UA7A 3RM9A 2EPOA 4WJXA 5LA0A 4OOZA 1RP8A 2MANA 1ODZA
chains in the Genus database with same CATH superfamily
2CKRA 4BI7A 4AG0A 4Q4MA 1EOMA 3W6MA 1V03A 1J2WA 3TCEA 3M9YA 2PDNA 5ABGA 1N2VA 2QULA 2E7FA 1ONRA 4ZB2A 4PTMA 1RA0A 3WLHA 1LOSA 2WMJA 2VFEA 3KBMA 3LOTA 4PBFA 1OG0A 1UC4A 2CPUA 2C1IA 3TW9A 1M7JA 2Y6ZA 4Q6JA 4EAYA 3CUXA 1XJBA 2BV9A 4S23A 4CEXC 1N7KA 5D04C 3VIFA 4M6UA 4WKAA 4WXYA 1KB3A 2XFYA 2X7WA 2J7BA 1QO2A 3UG4A 3A5VA 3AXMA 3QH2A 3UWVA 3BPWA 3VCNA 5ABTA 3P2VA 4YVPA 2D24A 1OC7A 4OUIA 5K2ZA 1ECEA 2OLAA 3UCCA 4FF5A 1DE6A 3AIRA 3VD3A 9XIAA 4B2DD 2AL2A 3DFHA 3PNUA 1L6YA 2XM2A 4BQ4A 1AQ0A 4UQBA 3P5ZA 4UFLA 5HMSA 3SM0A 1P6BA 3MBDA 3VGDA 2A7PA 5GNZA 4N9CA 1GKRA 2PD5A 1R9XA 4JYFA 4DEFA 4N7QA 4Q32A 1OX4A 2V69A 4Y2WA 3L5AA 1R85A 1UWSA 5C2CA 1PB0A 3BZJA 3GYCA 1QNQA 3HPFA 1E4MM 1VBHA 2XIJA 4U2ZA 4LVDA 1DJHA 4C1LA 1RY8A 3VIPA 1ZP3A 1JCYA 3S2MA 3QHOA 4A22A 4WHBA 4DZIA 4L9YA 4J28A 4GH1A 2QVNA 4MY1A 2B81A 4UTUA 1UKTA 4Q8UA 5BMWA 1MRQA 2P8CA 3CC1A 4FNQA 4NF7A 2X05A 1S5VA 3RILA 4HBKA 1ZUAX 4IMEA 1EJUC 2ZX7A 1YDVA 1G7VA 2ONEA 2YIHA 1G94A 4GD0A 3ZWSA 3HA1A 1JXKA 1VF8A 2FPYA 4RV3A 5HINA 2D2GA 2WVUA 5I24A 4PUDA 1RJRA 1V0KA 2TMDA 2A3BA 1QK2A 2FPTA 3LHVA 1QATA 2XH7A 4O11A 3WEOA 4PTNA 2ZDRA 2J88A 4QSFA 2DORA 4QP0A 3LPGA 4EWJA 3GUGA 3STPA 2Y88A 4JX5A 5EFFA 1JF5A 1E43A 4J3WA 4DWSB 4IPIA 4GZJA 2NSOA 1SM9A 4FB7A 1PKMA 4HK7A 1ZLPA 4YL2A 3MJYA 4G56A 4UR8A 3O6AA 4GA8A 2QCEA 1S5WA 3AUOA 8A3HA 2FMOA 4IIGA 3CUIA 3VC5A 3A22A 2NT0A 4DF1A 3QXBA 3TQVA 4C6QA 1JI2A 1GW9A 2VRKA 2FLIA 3O2LA 4BK9A 1DWHM 3ZVIA 4HK5A 4ICCX 1M41A 3UYIA 4CD8A 5XIAA 3GD6A 4H7ZA 3LU2A 3CNYA 1L8PA 4CU7A 2VUNA 4GNJA 5A5WA 4PCFA 3N18A 1XR2A 2D23A 1H7RA 4AD4A 4KCVA 1OC6A 3UGVA 1TVLA 4A6GA 4HYRA 2IKGA 4RDZA 2WKGA 3A24A 1B2YA 3FXYA 3WK3A 2PPGA 1Q6EA 5M2FX 3N2CA 1I2QA 2QW5A 2X1SA 1EO5A 1UCWA 1N8IA 4N4QA 2V2HA 3UQNA 4JL1A 4ML9A 4LS0A 3WQVA 3WDPP 5D05A 3LD5A 4A8RA 3FDGA 3TZNA 3VK5A 3WDHA 4S3GA 1A3HA 2NW0A 3QGAC 3LA4A 4C6NA 4KFPA 3N2XA 1I2PA 2W79A 1IEXA 1X98A 2WXDM 2B4GA 1XBYA 3FKKA 3W86A 1RD5A 1E51A 3CV7A 1UB3A 4GCAA 2FGLA 2V6AA 3CGTA 1RVGA 5JBEA 2DW7A 5LIWX 1C29A 1XF0A 4AD5A 1VEPA 3VD5A 1FCUA 4MDPA 3ABSA 2VZOA 4DY1A 4AC1X 2PTXA 3VDHA 4P02B 3QV6A 3VIOA 1DWFM 5D2VA 3O9NA 2AGKA 3MMUA 2JF6A 1GQKA 3S1WA 5FEXA 1SW7A 1LZOA 1OYAA 4AZ6A 1S46A 3CAQA 1G67A 3Q2DA 2YBTA 1O95A 3BARA 4MJ4A 2J75A 3VOFA 5HWNA 1EO7A 5AC4A 3V3WA 3UJEA 3SCPA 3QZEA 2VFGA 2PDKA 3I4EA 1XYAA 4FLQA 4JNYA 1P6WA 2BNJA 3BG5A 2C3ZA 1WOBA 2OTDA 1W9UA 2OEMA 3H26A 5EBUA 4O1DA 3PUGA 3W6YA 2DUXA 3RG6A 4AZCA 1JPDX 4AAJA 4L6OA 2C6QA 3CZLA 1U1UA 4KEVA 4QDMA 3NSXA 4JEQA 1PV8A 3E2RA 1X7IA 4BEUA 3DC8A 3URQA 1WDPA 3WN6A 1BVNP 4ZSUA 4GKTA 1CDGA 2PGEA 2PUZA 2ZX9A 2C91A 1UZ1A 2Y4SA 5REQB 1AH3A 2E9MA 3MHGA 1UMYA 1S2TA 1KFCA 2XHYA 3BMXA 2GVGA 4CUCA 5AC8A 4MG4A 3KBJA 3O6YX 5EMYA 1SW0A 5I5RA 5FEPA 1HGYA 1A5AA 4LF1A 1QOXA 3UXIA 1S38A 2W27A 2ZVRA 4G7EA 4Z2KA 4DZHA 4PUJA 3S5OA 3COTA 4QM1A 1EGMA 2Q6ZA 2PZ0A 2Y63A 3W7GA 1SMDA 1REQA 4AZ7A 3FV9A 4GQ0A 3G8RA 3QJAA 3S47A 3DG6A 4AD0A 4GJ1A 4GYPC 3QLLA 4UTWA 1SO3A 2CFFA 2WB5A 1DBTA 4Q8NA 2PU0A 3MP3A 3WBWA 4UCGA 1V6WA 2DJLA 2V5JA 1FWWA 1WOAA 1XQKA 2DP3A 1KTBA 3T8QA 4IUOA 1ZRQA 4MJMA 3GU2A 1IT0A 2CHNA 2BY3A 4JX4A 2D2HA 2PLJA 4GUJA 3UD6A 3MA8A 1LLWA 2PRMA 1EDTA 1QDSA 4JTJA 3N14A 2R1NA 3BDKA 1ZCCA 3UYCA 3R13A 3PVFA 4QS6A 1Q66A 5D03A 1UBSA 3SGZA 4DWSC 2F61A 3OBKA 1QO5A 3IUDA 2P1FA 1T0OA 4RXGA 4O1FA 4GI6A 2WZHA 3QPEA 4JIIX 4LANA 4IF2A 1E71M 1P1XA 3S9YA 1NU5A 3TSBA 3MSDA 1JIBA 1K8CA 2VTFA 1ZJIA 2VZSA 5JBFA 1KRBC 3K13A 1XKJA 2XN2A 1Q6LA 4JTCA 1DEDA 3NQAA 3WBYA 3OBAA 3QY8A 1FY6A 4JR5A 3SQSA 4S38A 3CMJA 2D3NA 1XV8A 3CZ8A 1QNSA 3OB8A 3IJIA 3MCNA 5CGTA 2HNHA 3T6CA 2WHLA 1F6KA 5FF3A 1BYDA 1REQB 4LNCA 3FHQA 5HQMA 3THUA 4JXCA 3F4DA 3ZVHA 3HB9A 2VGIA 1KXQA 4H7VA 2FJKA 1UASA 1HT6A 5CC5A 2BXZA 2VXNA 1W3LA 1H50A 1W9DM 4B9ZA 4GRSA 1A5BA 5G4WA 1W0MA 3I65A 1VRDA 2HBXA 4YNGA 4Z2GA 2JIWA 1KCXA 2GVYA 1JPHA 7XIMA 4JY9A 4TV5A 3FYOA 3PN8A 3RIKA 5EB8A 4Q7BA 4YLWA 1K03A 4DF2A 4N9EA 4ONVA 4YHGA 4E5TA 1FH9A 3VABA 2FIQA 3OZYA 5FF2A 2I9UA 1GQNA 1C3FA 1BLIA 3ONBA 2NX9A 1V3JA 2WBKA 2D0FA 4PZVA 1ZL1A 5CC7A 2QVHA 4UOQA 1MNSA 3CIVA 1ME8A 1GVFA 2VM8A 3MMDA 2PURA 2EO7A 4PUUA 1HL8A 1YX1A 3WFLA 1KFEA 3WJZA 1AVAA 2ZRWA 1T96A 2Z6IA 3IVUA 5A6LA 1XYZA 4S2BA 3KVMA 2HCVA 2OQHA 4XAPA 1H09A 4AHOA 1FWGC 2EAWA 4H41A 3RLGA 5FKYA 1RJQA 2CEQA 2H9AB 3ES7A 2FZDA 3VDAA 4DYKA 2IKJA 2PP3A 1XCFA 3KHJA 5AHIA 1K8YA 5C54A 3QYQA 3B9OA 1BWLA 3VIMA 4FHAA 2INZA 1JD9A 2YL8A 2OODA 2G37A 4LUTB 4YCPA 3C61A 3GU9A 3RK8A 3LXCA 4TO8A 3LLXA 4KERA 1R2SA 1XPGA 3G1AA 2HROA 4HHHA 2J7DA 1DWAM 2WC3A 4JFTA 1GUVA 2OSYA 3HU7A 3VKJA 4XSMA 1IGSA 1J0JA 1KM1A 2J24A 4NNCA 2OWCA 4AXNA 2ZZ4A 1RH9A 2Z1BA 2J79A 4XTIA 1J0YA 1CNVA 1V77A 2NVAA 3N4EA 3AYSA 3UETA 3TTQA 3U2EA 5E9AA 1OCJA 3SEPA 1ZBCA 3IRSA 1QTWA 4BQ3A 1O66A 4LVFA 4OQVA 2IXVA 2PF0A 2VX7A 1H7XA 5HJXA 5AC6A 2YYTA 4MVAA 4K3ZA 2YYUA 1U2YA 1K6AA 1R6WA 3C52A 2HMCA 3H12A 4MYXA 3QPZA 2QPSA 4MSSA 4EAMA 3GVRA 5KETA 4ES4A 3RAOA 1AL7A 1F3WA 1TPWA 1Q85A 4M1RA 3ES8A 3LGGA 3LMZA 3BMVA 1DJYA 2XN1A 3QOMA 4DLFA 2WJZA 1V7YA 1R7OA 1UP3A 1KRMA 3EWXA 1UD6A 3K8KA 4DZAA 4L56A 2PLKA 3EYPA 1WO2A 4TX9A 4BF9A 3NQ7A 3DENA 3EXTA 5C2XA 4CVWA 4R27A 2VQUA 1PBGA 4GJJA 1R3TA 1KXHA 5H2ZA 1T6MA 5HMFA 1J12A 2WNNA 4E38A 5A69A 1GJWA 3S9IA 4JDBA 4AZIA 4XD4A 1RBOB 1LRTA 2D22A 4WLCA 1MQPA 5IHRA 5DCDA 3HJEA 1FQ0A 3S1GA 3WENA 1O5KA 1E0XA 1XBZA 2Z25A 3O0FA 1E70M 3QTPA 4NY2A 2CETA 1WZMA 3H24A 3Q58A 1B30A 3H22A 5IBXC 3S5SA 2E77A 4OV4A 3AJXA 1TV2A 2OX1A 1PXGA 5E9XA 4RPPA 2ZX5A 1DP0A 3T0AA 4NZ5A 9RUBA 4CNUA 1QPOA 4PN2A 1XIDA 4BWLA 4I9JA 3W83A 2BWGA 2YOCA 3DFTA 4M56A 3R11A 5F4SA 4QFUA 1A5KC 4ORIA 2NWSA 2E9LA 1OCNA 3DHPA 3N6QA 2I9EA 3DESA 3A13A 2AOSA 4J40A 2IPFA 2NQZA 3DGBA 3IJ6A 4LQ1A 3V7PA 1CGTA 2IPJA 5CC6A 3VKAA 3H2MA 5BWFA 4WOQA 1RLDA 1Z69A 4DWDA 3L5MA 1IZCA 1KV8A 4KEMA 3S2JA 3IRDA 1V02A 3NQDA 2QYGA 3ITOA 5HXMA 1PTDA 3WQWA 5G4EA 2OZ3A 2YA2A 3DC0A 3TONA 4KWVA 1W9BM 2WC7A 3MS8A 5E70A 5KZDA 2RAGA 4FI4A 2BHYA 4GZ7A 2Y7GA 2GDUA 2H3DA 4NSBA 4UMBA 3Q45A 4ROQA 1CXIA 1SO5A 4HNTA 4ZXOA 1TWIA 3CQIA 1RBAA 3PBGA 2PDJA 1N55A 2ZZ1A 4TUFA 1BRLB 3LCFA 4EK7A 2Z1SA 3VNZA 3H23A 1G4PA 4IIHA 2QKFA 2WVVB 4KCWA 4L4MA 3RNDA 3LHZA 3FAWA 3UR7A 3IGSA 1HJQA 4OUEA 1VBJA 3OTRA 3WQ4A 2OR2A 2EG7A 3MHUA 5EJZB 3WF3A 3L68A 1XG3A 1OFOA 3PAJA 2CYGA 3TYEA 3N12A 4UC5A 3H2AA 5AKQA 3LN3A 1ITUA 4HMEA 4WDWA 2FH8A 5TD4A 5F4XA 3UR2A 3GIYA 4X0VA 3TNOA 5I3IA 1FCVA 2DJXA 2DV0A 5B80A 5I07A 2R9RA 1LUCB 4M3PA 2ZWZA 1K02A 1CLVA 4J1OA 3L2IA 4NAEB 4IQLA 3PZNA 1Y5VA 1SU5A 3AZSA 3LCXA 3NAVA 3W01A 1NF7A 3QW3A 4MF4A 2J6XA 4GIAA 3HFYA 2CXGA 3VUSA 1EDGA 3ZT5A 2FJUB 3O06A 1TJ2A 4HMCA 5A94A 2YR1A 1JYXA 4XD3A 3N6HA 3UERA 3W00A 3CHCA 4UQDA 1EP1A 3WG6A 3R25A 3OGSA 4IT1A 4HVXA 5BOFA 4JY8A 2OSWA 4H1ZA 1KM4A 4HNNA 2VFHA 3BK0A 5C9UA 1XLHA 3VNLA 4M6PA 1JDCA 4UBPC 3RUBL 3FK4A 4FNTA 3D5HA 4ZSTA 2GJXB 3ICJA 3W2JA 2IS7A 1W5MA 3S46A 5LIXX 3L66A 3V1HA 2ESCA 4MWAA 1C8YA 3KFTA 4UMAA 1R2RA 2E25A 1KM2A 3MP5A 3UWYA 4U3CA 3OODA 1SW3A 5HQEA 3QLDA 1X8FA 4DNHA 3NPWA 4U5IA 7REQA 3KE0A 1GZJA 2D1ZA 1PAMA 3WLOA 3TA9A 3A12A 5HULA 3SRFA 4GLEA 3IIOA 3TNBA 4RE0A 4AD3A 1EWEA 3M07A 2JGYA 4HNUA 5DMLA 1KWGA 4U5KA 2XPKA 3IARA 3AXKA 1B9ZA 1H7NA 4NXSA 5D8ZA 3ZXWA 1DE5A 3GZAA 3W37A 4U31A 2P53A 4LXFA 3SUSA 4I6VA 1LORA 2PI6A 3LBMA 3KTCA 4CNNA 3W7KA 1JPKA 1NQ6A 5HUOA 1TPEA 3MWCA 3EOSA 3W85A 2WVTA 2GVJA 1JZ8A 3AOFA 1W17A 5FJUA 3F1QA 1H7OA 4QISA 4LVAA 5GQBA 3GBDA 1PHWA 1GT8A 4NJJA 3IGXA 3R8HA 4C6KA 5BXSA 1X6LA 3ATZA 3AU6A 2ZUNA 1XSJA 1QWGA 1S2CA 3AJ7A 3I6RA 3VCCA 1OY0A 4YPJA 1MXSA 3W72A 3H53A 1HIZA 4PL2A 3FA4A 4LYRA 3WSUA 3POHA 1IIHA 3L4ZA 4KH2A 1F8MA 4UTTA 1W3TA 4NZFA 3C2VA 3M0LA 2OKOA 2PDWA 3TOPA 4QQUA 1NFGA 3VNDA 1W6TA 4Q4SA 2YDRA 1S2UA 4UR9A 1H62A 5AFDA 4PODA 3VMOA 3NEHA 2DZUA 4PBGA 2IPWA 4Q4QA 3IJQA 2RUSA 1UH4A 4ICNA 4IQDA 4ZB5A 3BSGA 2BMBA 4AY8A 4KETA 4KWSA 4I9MA 3CHVA 3WKZA 1PCKA 2ZOXA 4Z0JA 3S0CA 2QCLA 4LUTA 3NSMA 5AYBA 3WUFA 3H21A 3PTDA 5AZ0A 4FOKA 1TTQA 3CL7A 3BW3A 2O9TA 3P62A 1TWWA 1FBAA 1AJ2A 1PYFA 3P67A 2QDEA 3GDTA 4H04A 4WY0A 2XUCA 1GG0A 3UJ2A 4Q7IA 3DOPA 3SZ8A 2WLYA 5HNRA 4NZJA 3W23A 2C8NA 1BPLB 2Q09A 4UTLA 4HYVA 4UFIA 2WZEA 2Y0FA 1GVOA 2ISSA 4W8BA 4WSJA 1UPMB 1I0DA 1OG6A 5A8MA 4ZR8A 3WLRA 1FX6A 2Q3RA 4OOUA 4FAMA 4JPGA 3V0UA 4AMAA 4B3ZA 3TFXA 3WLKX 4J5NA 3LB0A 2QV5A 3EKZA 1OYCA 5F2MA 2WJFA 1TZZA 1W54A 3GFZA 1E73M 1P1MA 2GK1B 2NXHA 4K2SA 1XH2A 3IV8A 3I7QA 2WPBA 4WZHA 5AZ1A 3QMRA 2I5GA 2PBOA 2DDXA 1BWKA 4N9DA 3ONCA 4HYWA 1JQVA 1WUFA 1O12A 3GDLA 1W3KA 3IWPA 1GNXA 5MHBA 3CO4A 3S42A 5DRIA 3A3HA 2YCLB 4NZCA 4PC8A 1C92A 1HO4A 4P8XA 5BRQA 4WGXA 1UZ4A 3M5VA 1UJPA 3B4YA 2JQXA 2V67A 3ZYZA 1PL9A 2PGRA 2WWDA 3GVGA 3S5NA 3CLWA 2XFRA 1ZAIA 4FNUA 2J6VA 1DIDA 3AYRA 1SFSA 3PBVA 4Q6XA 1OX6A 3HM7A 2PWHA 1H5YA 5AY7A 3BLLA 3IJ7A 1R38A 3LLDA 5EMUA 1E5JA 5HNNA 4FX7A 1FHVA 1UIPA 2QT3A 1PKLA 3IACA 3F03K 3EB4A 3SN4A 5FAGA 3E0WA 1TWDA 1R46A 1LG1A 1PJ9A 3TVAA 4J2PA 4J3ZA 3GC2A 4LFYA 3PJXA 4MKSA 3CTTA 2J47A 3D3FA 2VFDA 5EL1A 1ADDA 2R1KA 2A85A 2WPGA 4V33A 3MDWA 3SO7A 3ZO9A 4TTGA 4RZBA 3IJ8A 4CD4A 4JDYA 3ITLA 4A3YA 1KO0A 1OM0A 2OKTA 3B04A 1K8XA 4Q8PA 4J7RA 1Q4NX 4HHMA 5KZEA 2Y62A 1ZTVA 3ABRA 2VDGA 5C9WA 1Y0EA 4GABA 2QCMA 2FFIA 4OBTA 4C6PA 3QFWA 3THCA 1XC4A 3M0VA 2PDPA 5K7JA 4MZ1A 4EF9A 3ARSA 4JIPA 1SYTA 3SCNA 1GVYA 2QIWA 4S3BA 3ITYA 2QCHA 3VNYA 4NZ4A 5AYYA 3FGCB 1D9EA 1UC5A 4MFDA 5I03A 4J9JA 5JBDA 1OFRA 2RJHA 4M51A 2FDMA 2ZZ6A 1F4HA 4WD0A 1UH3A 1U33A 1JUKA 2R1LA 4F0KA 3KBVA 7ENLA 5LA2A 3QW4B 3LGEA 3VGGA 2QUVA 3OHIA 5CZTA 1BXBA 3GBEA 4ICMA 2G50A 1HXJA 3S2LA 4DAFA 3SCOA 4Z1YA 3QN3A 4WJ8A 3SIZA 5DLCA 4ENLA 1XISA 4NT0A 2GK1A 1WNOA 1AJ0A 4Q4RA 1DJZA 3K8LA 3JU2A 4QE4A 4TVUA 4DO7A 2WM1A 2YA0A 4JTGA 3FIGA 1V3LA 4ZO7A 2BGSA 3V5OA 3GW3A 2HE8A 2HV5A 3R58A 4Z1AA 4C6EA 3GVWA 1XWYA 1PEZA 4G8TA 1US3A 3IEBA 4QLJA 4X61A 1TWZA 4R7WA 4QCEA 3C3NA 3ZJ7A 1TA3A 4S3KA 3BVJA 2ALDA 4RW3A 5JUVA 1EC9A 1RK6A 1XM3A 5AVNA 1I2OA 1CXHA 3N9SA 3P0XA 3F5KA 1PKNA 1TUFA 4JTUA 4FXFA 1V02E 3GXIA 3BLEA 4UB9A 4YTQA 1YXYA 1OGBA 2YXXA 5TBOA 2Y5JA 3DI1A 1TPC1 4TR9A 5CPNA 3HGOA 4MTVA 1ZB5A 4J35A 1UH2A 3HMCA 3NQBA 2UY5A 4HZ7A 3H2FA 4P7LA 1IXOA 2A79A 1JFHA 3OZPA 3SCQA 3EDKA 4P00B 4O16A 4WXZA 3WELA 3RJXA 1GVEA 1DL3A 3TJ4A 4H9YA 1W1B1 3S5YA 2XFFA 2ZXDA 1G4SA 3CV1A 4US5D 3WJSA 3NL2A 1AFSA 4H19A 2WLZA 5T9CE 1XCWA 4H01A 4HT3A 4BY3A 2VR4A 5AHMA 5HDRA 5FSEC 4E2VA 3CZKA 2ZFAA 4O50A 1XINA 5LXXA 3WD4A 3AROA 3QKEA 3RITA 3WBEA 4U4MA 4JBRA 5I3GA 1OINA 1RV8A 4S3CA 4GYPA 1VFTA 1ONWA 1WZLA 3HIJA 1R47A 4S3EA 3P0WA 3LK6A 2XIBA 2V5LA 3PBMA 1SQ7A 3E96A 4KPLA 2VFFA 2OYMA 4AIUA 4P61A 3HG3A 4PMXA 2GJXA 1SZGA 3L4TA 1H61A 1KM0A 1UMLA 5FOOA 4O4VA 3C0JA 4BQ2A 5PTDA 3PZMA 2R91A 4W8AA 5GJMA 3KHDA 3PZIA 3ZVHB 1B4KA 2Y24A 4J3SA 3CEPA 4KWUA 3MZ2A 1I4NA 4D8AA 1VFLA 1XRTA 1TA3B 1MNZA 1P48A 2HTMA 4U10A 4ZO8A 3GHRA 4NASA 4PCPA 3L4VA 3PG9A 3M5XA 4PUKA 1AQMA 2FZMA 3P74A 4NL1A 5DMMA 2BGNE 3CUGA 4HPJA 4B3KA 3E2SA 4C6JA 4W86A 2CW6A 1UR0A 5JH2A 3HPSA 2EPOA 3NEVA 5LA0A 3QTGA 3A3XA 4OOZA 1RP8A 1EJTC 4C6LA 5DCBA 4W5UA 4REQA 2DSUA 3W7EA 5A6KA 1QMLA 2RDWA 2FHFA 1EQCA 2ABAA 4UTWC 2CZ5A 3CXOA 2ZUWA 4XBJA 3WLLA 1DXFA 4Z08A 3BGAA 3OQEA 3GTFA 3AISA 4WQ6A 5I7GA 2NXIA 3AS1A 3HO8A 1KLZA 2YDAA 3GC5A 2VZVA 2PF8A 1G9HA 1CLKA 4QROA 2WWCA 1P6CA 3RLUA 2VFIA 1J0ZA 1KM5A 3MT1A 4KEZA 3TROA 4MAZA 2TYSA 4BJHA 3LBCA 1TFVA 2ACRA 4IIEA 4MKVA 5M1TA 5G5IA 3RR1A 3HF3A 3QGVA 5CBIA 3EWBX 1B1YA 1ICPA 3E3HA 4NI3A 2FTWA 3EOEA 4HA0A 1GYNA 3ARZA 5BCAA 1QW8A 2E9BA 1OIMA 3N04A 3GB6A 1R9YA 1E0UA 4FO4A 1AW5A 4ACZA 1EJXC 5D2WA 4LSBA 4DRSA 5A6MA 1CX9A 3M16A 4QAIA 3T42A 2F38A 2W61A 3BG3A 3UJSA 2WAGA 2P0OA 4QSHA 2A0NA 3KRBA 4TX6A 2CZEA 2QMKA 5C2GA 4O4WA 1TREA 2GQ9A 1NWUA 1YKWA 3ANVA 4NNAA 4FEZA 1F07A 4UQAA 2V3GA 3ZSTA 3W1XA 4Z17A 2VR2A 3SY5A 1XG4A 4XG1A 3W7MA 2VYOA 3M7SA 2FB2A 5A2CA 1XLMA 2G3FA 1W1PA 4HU8A 3LMYA 2YSWA 5A8GA 3U2ZA 3W1MA 3UT0A 2QF8A 3V1PA 2ZRYA 4Y90A 3IVSA 3G1SA 1J4EA 5C9XA 1BRLA 1VFSA 4XO6A 3NPVA 3PANA 4MB4A 4AIEA 4LCRA 2QGHA 4H6KA 4CD5A 3TR9A 2ZUSA 1CECA 4RXFA 3NZ1A 1P0KA 4ZGYA 5DN1A 3AMCA 2PZNA 4GIRA 3WUEA 3V35A 4DQWA 1ZJBA 1JEZA 4WGHA 3UEQA 4JOMA 4PE8A 3AFBA 2AMGA 3ELFA 1WBHA 4LC8A 3WNLA 1CW2A 1ISVA 4D6DA 2O92A 3O0KA 1VFMA 8RUCA 5AYIA 3CK5A 1S3HA 2I14A 2WSQA 2EPMX 2YFOA 4CVUA 4A8LA 3WH9A 3FNDA 4XX6A 3NFUA 2PODA 3E0LA 3WMCA 3BAKA 2ZWYA 3KEHA 3A4XA 4PULA 3DN5A 3NDOA 1Q6CA 3IJDA 4GKLA 1BVZA 5FEWA 3DFPA 3VU2A 2X40A 1IEWA 5BRPA 5BZAA 3QFEA 1WDRA 4FXJA 7TAAA 1A5CA 3B06A 4FLRA 4YYCA 4XUGA 1LLOA 3LRMA 5DQPA 4L9XA 3T78A 3WJYA 4E2DA 1FWSA 1FA2A 1FOBA 1FWIC 1M03A 3BV4A 1LWJA 2QV4A 4H2HA 1V7AA 3R0UA 5BXPA 1SVDA 3CMGA 4NRRA 2ODOA 3BH4A 2OPJA 1B3OA 3M6DA 4IFOA 4IIBA 1GORA 3D0CA 1GPFA 4DJEA 3VIKA 2WW5A 1UWTA 3VNIA 5DMNA 3RX4A 2P50A 1M7PA 2H3BA 2CC0A 4M6VA 3NQCA 2J4GA 4MUPA 1RQBA 3JZEA 2QJGA 1JYNA 3OGRA 1MUMA 1LQ2A 3TYDA 4WDUA 3AU2A 1XLIA 2YW4A 5FD0A 4DI9A 5D32A 3RCMA 2RDUA 4FLOA 2QCNA 4ALDA 2UV8G 3FLUA 1EEXA 3CT2A 4OU1A 5IFTA 1XXXA 4CLMA 1GG1A 2XG9A 5LKYA 3PUEA 2W92A 3TYBA 1N8WA 4IIDA 1VJSA 2VP8A 2H6RA 4NX0A 5TIMA 1LBMA 4MPQA 4IHCA 1KCLA 3FJLA 1YEYA 1PWLA 4I3GA 2AKMA 3RMJA 3OIXA 2VOTA 3STGA 2PTDA 1D7KA 1DJQA 1ZP4A 3EX2A 4U3AA 4YS1A 1KR1A 3HMJG 3KVLA 1O4UA 3EBVA 3LHYA 2O9PA 4HNCA 3FSUA 2X0SA 1U5JA 4GQRA 2W4XA 1DWGM 2Y7EA 3KBNA 3ZR6A 3A9IA 2NLYA 4L65A 2XGZA 1AG1O 1FWBC 4IUGA 4XKYB 1S1RA 4MB1A 4IGNA 5T91A 1KWKA 3FYYA 4NP7A 1WV2A 3IIPA 4F2TA 3BMWA 3OYZA 3L67A 4AWSA 4JTHA 5G1YA 2J8TA 5CBJA 2VHLA 1CT5A 2IXUA 1G69A 1XQLA 3CLMA 4JTLA 3UFYA 3BLKA 6PTDA 4ROPA 3ZLGA 1EF2A 3WZ0E 2F2KA 5SWUA 5CLWA 2UBPC 4Y9OA 1W1A1 2O55A 1OCBA 4XUYA 4A2RA 2ISWA 4PB5A 2PEVA 5F1UA 2G96A 2O9OA 3F5LA 3WLQA 4MGGA 4E6MA 3G22A 2PP1A 3FA5A 2NUYA 3NXLA 4CNOA 1U1HA 2PC8A 2ZZ7A 1CBGA 1OIFA 4JTDA 2IKIA 3WF0A 3DHDA 4YWIA 3SAZA 5CC3A 4GY7A 3W7DA 3H7VA 3NZPA 3R7MA 1IWBA 4UTMA 1MW3A 3MY9A 2OEKA 3P7YA 3PTKA 5BMXA 1JUEA 1DQXA 2QQ6A 3U7VA 5D09A 1S5NA 2GYIA 3QQ1A 3GVVA 3WNOA 2C15A 1RAKA 1JGIA 1TQJA 4LS1A 1YXCA 1HVXA 1MZHA 4KFOA 3GG0A 3UWWA 1VLWA 1E9LA 1TSIA 4IG2B 1JUBA 3ITXA 2BY0A 3BJFA 3GK0A 1KFWA 2YXOA 4F0LA 2OLHA 3ABOA 5EMKA 5CSRA 5EMMA 2VZUA 1NP2A 3S6TA 2FYMA 1GYLA 3NPXA 3TJIA 1SGJA 1VFHA 3GNDA 1ODUA 3NNTA 5L6UA 3QHMA 1Q63A 4L1WA 3PG8A 4V15A 1XP3A 1NDYA 3RPMA 3RN6A 2OFJA 3OP2A 3CPUA 2Z00A 1KQZA 1TPFA 1GOWA 4ZVJA 6TIMA 1V0NA 4P7OA 3V16A 4C90A 1H7WA 4PUWA 4BZYA 1DOSA 3C0QA 4M80A 4GINA 3MI2A 1LTDA 1VR6A 1EHNA 3CWNA 4MNKA 4DJEC 1EA9C 5HUPA 4WKFA 4AWEA 2XFWA 1R3QA 4HPXA 1AA1B 3BAIA 4ZB0A 1EDQA 1CIUA 4QDWA 4A4AA 4AHQA 3UPBA 5GPRA 3B9EA 1E3ZA 2PAJA 3EA1A 3MVTA 1NH6A 1TJ0A 3RFAA 1LYXA 4ZZ9A 1C90A 4ZFCA 1UQZA 1JCXA 3U3HA 3R89A 3VOHA 4NZ3A 1PX8A 3WO8A 1E1FA 3TK7A 1Q8JA 3VMPA 3VGEA 3DECA 3I3DA 2BY1A 2ON3A 5ABFA 1DXEA 3LCLA 5E6YA 4Q22A 1W37A 4HA1A 1V51A 4LAKA 5EKYA 4CQDA 4FOUA 3TOYA 4L64A 4Q8QA 1NAL1 1NSJA 4IXHA 4MAVA 4AISA 1OQFA 1DV7A 2F84A 4OTKA 3GSMA 5E5CA 5CAHA 5LNUA 2DVTA 1D3HA 3DI0A 4JX6A 2E6AA 4H8UA 3RPDA 3BLDA 1XYMA 2REQA 5CCZA 4O8AA 4QQ3A 3OHMB 1E6PA 1HL9A 3VILA 1DIKA 3E0IA 2OWXA 1W3NA 2XIOA 3E5BA 1LOQA 3PJWA 2PWVA 1M5WA 3OGVA 4KQNA 3LCGA 3OVQA 1FWTA 5C7HA 1UQYA 1FWCC 1EC8A 2PMQA 2ZXAA 1CPUA 3GHTA 3FS2A 2YB1A 4BS0A 4DF0A 5ABEA 4FX8A 5K9DA 3UZZA 2VNCA 4U33A 4C1NB 4XZMX 3A4JA 1US2A 2E4TA 5J5DA 1U5HA 3PB0A 3GWQA 3BXWA 5I06A 4LUSB 2HEJA 5BROA 5E1QA 5ENLA 1GHRA 6XIMA 2PRLA 1U1JA 5CPLA 3VOGA 1DHKA 2XIMA 4A05A 3S4TA 3CV2A 4OWGA 3GH5A 1R3SA 2CWXA 1L6GA 2Y85A 1XGEA 4DWSD 4CCCA 3W7RA 2EKGA 3IGUA 3B05A 3G1VA 4JFUA 3W82A 5ABFB 3WIJA 2GDQA 1BG4A 1EOKA 2JK2A 2J7FA 4GI8A 3QM3A 4I7UA 4L1GA 2HRWA 3GE7A 1NTHA 3HTWA 2DIKA 3LNMA 1T40A 4GMEA 3TCSA 4L6DA 1EYEA 4MLRA 3AIQA 3TYCA 2WJEA 4F3HA 1SMAA 1BGAA 3WCZA 1MEIA 1W1TA 4F66A 3B03A 4LCSA 1M1BA 1BD0A 2OT1A 4QXIA 1UD8A 2AKZA 1LQ0A 1TJ1A 2NQ5A 3P80A 4LH8A 3CQHA 4B92A 4UFKA 1B54A 2W91A 2X16A 4MYAA 2VENA 1AW2A 2V63A 3BTNA 1DQWA 3SIMA 1BG9A 2FVKA 3CMFA 3GS6A 3NVTA 1UKSA 5KINA 2VL4A 3ZZ1A 2ZUUA 1CEOA 6XIAA 5D33A 4ZOBA 3SUUA 4W93A 2VEIA 3EA3A 3KS6A 1T5AA 3AXXA 4Q4OA 4AWTA 4D6JA 1A0EA 1OBAA 5HBFA 2H9AA 9CGTA 3VDCA 2ANUA 4P8WA 3BWWA 3R8RA 3EXRA 4CCDA 3WH7A 3SRDA 2GOKA 1VEMA 5XINA 3W7OA 3RM4A 1TO3A 2YCLA 4HJWA 1M7XA 1Z89A 4AC7C 3EWCA 2F9RA 2J9YA 4WVXA 5HWMA 3C2FA 2BLEA 1G01A 3VI2A 4ZE4A 4IJRA 4EACA 4LBRA 1AJZA 3WQ8A 3GHSA 5A6SA 4KRZA 5CKSA 2Z27A 1WE5A 2EPLX 1AODA 2JALA 4MMWA 4CQAA 5C9ZA 3O1NA 3FY1A 4GBDA 5DBUA 3W1PA 4JHZA 4IMAA 1UW9A 2DZBA 4GX8A 4OZOA 4UTJA 3W2MA 4DJED 3A4WA 1ISZA 3U2CA 2ATSA 1K7XA 3PTQA 3IS4A 4O28A 4ATWA 4XQ6A 3M0IA 3AWNA 2H90A 4FA3A 1UYQA 3ARVA 3RX3A 2IW0A 3F4CA 1WZAA 1KXVA 1V08A 3G1YA 1GEQA 1JD7A 3E12A 1GVIA 4DBWA 1I2NA 1MW0A 3NL3A 4QJ1A 3HG5A 4DBEA 5HATA 3CJPA 4LB3A 1Q6GA 1G1YA 2D20A 4AZCB 3IUHA 3AHXA 3L2LA 1OK6A 1IEVA 4K36A 1IYXA 3HGRA 1RUSA 5CAKA 4H9ZA 2V3EA 4FIRA 4L7ZA 1QOPA 1XBXA 3GU1A 3W1RA 3RGTA 4FPSA 3HV9A 3BLFA 1RCOB 2CCRA 3ABXA 4HN8A 3EPMA 1ZFJA 1YXDA 2QJHA 3N2BA 4XD5A 4DI8A 1V79A 4GGBA 1MUCA 2HPMA 5G2IA 3GNRA 2HWGA 1TV3A 1K1DA 2A4AA 2Y89A 2QHAA 4B4FA 1ESWA 4GYJA 5A2AA 4C5YA 3QY6A 3HURA 2VT0A 4NILA 1IQ8A 1H0IA 3I6EA 4PTXA 1E0TA 4AIOA 2ZRXA 1PCWA 1ZBVA 2J74A 3LUTA 3BUVA 4LEQA 2O7QA 1HN1A 3V0TA 3BC9A 2O7SA 2QDHA 1YPIA 1UD3A 2EBNA 2QIIA 3A9BA 2WOQA 2XYLA 2RKXA 1TVNA 4ZBCA 2GUBA 3W7HA 1ZU8A 3CL6A 4PEEA 4R3UA 1VZWA 1FCQA 2Y8KA 3G1FA 4C65A 2E40A 3CS2A 1GQLA 5LNRA 1K4GA 1QPQA 2WNWA 4GI9A 2JKEA 1OX5A 5JU6A 3B0UX 4DJFD 2EXOA 4C7FA 1NDZA 1PUDA 3BICA 3FFSA 2FZ8A 2JF7A 1F2JA 4G7FA 3UXAA 3QR0A 4B5UA 2GJRA 3OPSA 2Z1WA 5FF4A 5LNVA 4PGLA 2WJDA 4JKKA 2NUXA 1O1HA 3Q4DA 3VZYA 4P7QA 2BVWA 1H41A 4ZCWA 1HKJA 3ARQA 2DSZA 1OJXA 3AIEA 4H9VA 1EZWA 1KFJA 1F76A 2Z26A 4PB4A 4B5NA 4IX2A 2E8YA 2V5BA 1HZYA 3DYPA 4I8DA 4E4UA 2FDSA 1UROA 3K4DA 3N1AA 3VGHA 2PDUA 4ERGA 1J79A 1BYAA 3HFTA 1YIXA 5AVHA 3KOFA 2O4MA 3CQKA 5M17A 3H7RA 4D6EA 2FKPA 4N6EA 3W24A 2PWFA 3QZAA 5FJPA 2UY2A 3TZFA 4M7SA 1TMLA 1YQ2A 5I0DA 3GNXA 1YPXA 5IFPA 3BSHA 2HVMA 5CPSA 4CCEA 3HGJA 5C55A 3Q65A 3KAOA 4LUJA 2QPUA 1MEHA 2GDVA 2ZTJA 4IX0A 3CM4A 6CGTA 3NQMA 4KRTA 4R53A 4WR3A 1QT1A 5DBTA 5EU9A 1E6QM 4DPPA 2HE5A 4KGJA 4Z0SA 4D1IA 3ZJKA 2XJ7A 5HANA 1B0IA 4NX5A 3W7PA 2EJ1A 5CZ0A 3FAXA 4MIMA 4LUSA 3MI6A 4XIAA 4CKQA 1M01A 2YCKX 4GOAA 4JQAA 1XLBA 3QF0A 2EG6A 1XD0A 4M7TA 1HJSA 1EJWC 1UR9A 4V28A 5AOUA 4C6OA 1MZRA 1OCQA 3VC6A 3GTIA 5EPDA 4LUIA 2ZUMA 2B0MA 1HL2A 1IZKA 4RL3A 4EWND 1UBPC 3FVMA 3QPYA 3D3AA 3TU9A 2AL2B 4N4PA 4PMDA 1N8FA 1UHVA 4YU1A 3MQTA 4XZIA 1EHAA 2MNRA 1GQJA 2JEPA 4OV9A 1VIZA 1XSKA 1VKFA 3ALFA 2PDXA 3EB3A 4O0QA 1LF1A 3K8MA 4QTGA 4H9UA 1GCYA 3GY1A 2A3EA 4C7DA 2NX3A 2IKHA 1KNWA 3TUUA 4NXKA 3UZ5A 4LBSA 4W84A 3WBAA 4NAFA 1HW6A 2WBGA 3SR7A 3WNNA 4IL0A 4QNEA 2R1MA 4WY0F 4G6CA 2GPTA 3PTMA 3M47A 2CLMA 2DT1A 1E0VA 2WVSA 4I5RA 2CLLA 2I17A 1E6RA 4MPKA 1KW1A 5AHNA 3WEZA 4MNLA 4LALA 1GTHA 1RD6A 1ZS2A 1H2JA 2GFTA 3PNZA 2OOFA 1BSIA 4LAZA 2OO0A 2WYSA 3F5JA 4C6FA 2DEPA 4NZ1A 3BJSA 3TTEA 3KOXA 3A47A 3AS0A 1F4AA 2VEGA 4D71A 4GGHA 3TAOA 1TTJA 1AZ1A 3BCDA 2Y2WA 1B3VA 5HR6A 1KD0A 1Z42A 1W31A 2WO5A 1JI1A 3CT7A 4DYJA 2A6LA 3PP7A 3IJLA 4LTSA 4GQBA 2ALRA 4KCTA 1PKYA 4UZSA 1W1ZA 2WZTA 2NT1A 4PH6A 4NVTA 2WQPA 1I0BA 1RA5A 1VD6A 1JZ4A 2DZAA 5JMUA 4ZL1A 2A21A 4JIEA 2AL1A 1H1YA 4IJCA 4IL2A 1XCXA 2HVNA 3HPZA 1OGGA 1AH0A 2YB4A 5E6ZA 3P60A 3MCOA 1E6NA 1VPXA 3KBWA 1BXCA 3W3OA 1Q5MA 2FPVA 4XZLX 1YDOA 1R3VA 3TN3A 4DJFC 1IE7C 1G0CA 3T4WA 1WBJA 1QOQA 4M0XA 3VXGA 1BEUA 1BAGA 5H8UA 1W91A 4IP5A 2Z1KA 4Y7EA 1LCOA 1LWIA 1RJPA 4PUNA 4UOJA 3CYJA 3LBOA 1C9WA 2XVGA 4CNPA 3L0KA 1OB0A 4O17A 1UKQA 4XZBA 4H8HA 4Z1DA 3H4GA 3EXSA 2RDXA 1XKYA 1PTGA 4W88A 3CZJA 4GUFA 3CL8A 4FXRA 1IXNA 4JAWA 2FMNA 1FDZA 1DPMA 3PAOA 1O5QA 3WQPA 3LS9A 5DY2A 4O1CA 3GKFA 3WQEA 3BAWA 1I2RA 1MFUA 3ABQA 2CBVA 4IXXA 5T26A 2P3EA 2NZLA 4ZODA 3V4BA 4O1AA 2E1WA 3G0UA 5D37A 3N3TA 1I9CB 5CPOA 4RLIA 5CQ1A 5D9OA 1H63A 3AAMA 4JQ3A 2PFHA 3W27A 3SECA 2PDQA 2PTYA 4TMBA 5IBXA 2OZ8A 1ONEA 4IFRA 4DJDC 1QU4A 1Q7QA 2OSXA 1H60A 4OGZA 1FWEC 4EF8A 3FGCA 1WDSA 4YYFA 4IQJA 3BCJA 1LWHA 2PSNA 3U2OA 4D1JA 1EKOA 4NYUA 5D2XA 3TJXA 1S5TA 5AECA 1KGUA 1O60A 4KEUA 3VGBA 2G8ZA 1YNQA 3UBPC 1TPH1 4TVDA 2VZTA 1QJWA 3O16A 3NWRA 4LYPA 2X1TA 1DIOA 5D4YA 2KZHA 4JNZA 5CG7A 4CN1A 4TOQA 4V1XA 3ITVA 4F48A 1CLXA 2VMFA 1VCGA 4ZTXA 4HIBA 1WX0A 3E5PA 5EJ1B 1FWJC 1W32A 2X09A 3UNDA 4PL1A 1RQHA 1L6WA 3LPPA 4DBSA 3W71A 5BOEA 3GYEA 3ARYA 4MNJA 4FNSA 1V6YA 4ZOCA 4W9TA 2Z1XA 4IIFA 4QG8A 1SR9A 4LGXA 1UUQA 3CV6A 4K7VA 1TV7A 2HQAA 4D72A 3EWYA 3NQGA 1ADSA 4R7OA 4AY7A 1S2WA 3W0KA 5I3JA 4DJDA 1D8CA 3NVDA 4J27A 4O53A 3AQUA 2V81A 3OYXA 3NO5A 2ZX6A 3W76A 3KM8A 3WD2A 1N82A 3UP8A 1KFKA 5J5RA 3VIGA 1OT1A 1OFDA 1YLVA 4JTRA 1H11A 2JKPA 2CZVA 3SGUA 1XRSA 4QJ3B 1HP4A 2QJJA 3WH5A 4IMCA 5FF7A 3T0TA 4UWMA 1NJJA 2G95A 3JR2A 4Q8OA 2BXYA 4J3XA 2XIQA 2DSVA 1YNPA 2QAFA 4EPBC 2OG9A 3H7UA 1Y65A 1LDCA 1GOIA 1WAWA 2GQAA 4K38A 4DUWA 3FYPA 1NOUA 3L0GA 3WLMA 5AC5A 3MUCA 3JZUA 2QCFA 3ZIZA 3K4WA 1YE4A 1RVKA 2VC9A 2CZDA 1QWKA 3CAWA 3PR2A 3VFCA 4K8HA 1GZGA 1R3RA 4Z1BA 4XSLA 3DKJA 2DH3A 4X9SA 4AD2A 2INEA 2ZA1A 1T8QA 1EWDA 4UXDA 3T2QA 4GIYA 3SFWA 1UWIA 3QV8A 3F4VA 3MJMA 2YX0A 4LVGA 5A6BD 4HZ8A 1QNRA 2QR6A 4X22A 3C4UA 3DXIA 5LIYX 2QF7A 1RCQA 2V68A 3BV7A 1NIUA 3NOYA 4DIAA 4WEVX 1Y8BA 1XH0A 5A6JA 3WK2A 2WSRA 1XIHA 3B97A 3P3BA 4ZFMA 4ZO6A 3VM5A 4W7UA 3VD9A 3SN0A 1HKIA 1I6NA 4E2BA 2E67A 3MKKA 4RR4A 4C1KA 1QW9A 4ZQNA 3REQA 1S1PA 1A3XA 3G1HA 1B3ZA 1XH1A 2GUYA 1MI3A 4X3ZA 1UD5A 1LRNA 2CLEA 1FWNA 1RBLA 4IJBA 1W8GA 2GOUA 5HNTA 3DIPA 4B5VA 3MYPA 3T08A 1K70A 3LYEA 3SB0A 1PWMA 3N4FA 2RHGA 2MUCA 3T8LA 3PZTA 2NV1A 3PZVA 1T7LA 1B3YA 4HNVA 2EHHA 3WYZA 3HZ3A 3TWBA 1TRDA 4IPPA 2E68A 4KIRA 4MUZA 4CD6A 3B9AA 5C71A 1FWHC 2OCZA 1J0IA 3VYLA 1TELA 3MUY1 4UR7A 3E2VA 1NOWA 5F2LA 2QCDB 4XAFA 3JW7A 1XSIA 4O52A 5H8PA 3G2GA 1EZ2A 3K1DA 3MC5A 5I78A 2BS9A 3N9KA 4IGSA 5D2TA 2L5HA 4A29A 3W1UA 2WCAA 3E0VA 4OHQA 2VEKA 3EPOA 2R24A 3GZ3A 2REQB 4K8EA 2WMKA 4Z2LA 2BBFA 2D69A 3ZT6A 4YHEA 2R1PA 4Y9PA 5A6AA 5KTLA 3F7JA 3N4AA 3NQVA 2PWEA 3V18A 3VE9A 2QEZA 3CH9A 2YBUA 2R6OA 3RXZA 1XIJA 3NJ3A 3LHUA 3T4CA 4A3RA 1POKA 3ITTA 4RNJA 1S39A 3UF9A 1BHGA 4GZIA 4DB7A 1TIWA 3PWGA 4DUVA 3O07A 4WSKA 3WD3A 2X30A 4NG3A 2ZBTA 2CESA 3MUIA 4IQEA 3KWSA 3AHZA 4LAUA 1Q7ZA 4ZE5A 1UA7A 3RM9A 4H3DA 1YTKA 1NDVA 2OX4A 2MANA 3CIXA 3B8UA 2G0WA 1JGMA 1PDZA 4XKYA 3EKLA 3TP4A 4HNLA 2Z7KA 3DYOA 1E6SM 3MW7A 1FWAC 3OO2A 1F3TA 2ZXQA 3B40A 3M0KA 5KITA 2HVOA 4ECLA 3ARPA 1CGUA 2CKSA 4Y9NA 4DVOA 3EEZA 2W5FA 3G0XA 1LUCA 3OIHA 5A3HA 4CCZA 5EBAA 1SO4A 2WMHA 4FK9A 3E6EA 1Z44A 3W7CA 4S3JA 2BG5A 3B0YA 4YVVA 1ZAJA 4H00A 6ALDA 4AHPA 2GVEA 4AZBA 3WK0A 2DZTA 4XBKA 3AMKA 3GVQA 4UNIA 2OQYA 3WNKA 3VMNA 3VIJA 4N2YA 5BU6A 3BJTA 4DXKA 3T40A 3I10A 3AXHA 3GQYA 3TV8A 5EMLA 3O7UA 4DHGA 3EWZA 3N19B 1EJ7L 3FVDA 1UR1A 3C2YA 3U7BA 3CB8A 1RLCL 3UA4A 1D3GA 5A8QA 2DZPA 3ZJ8A 3KZSA 3WDQA 3F4NA 4NAEA 2ZKMX 4IM4A 1PVNA 1E9YB 2PP0A 4ZQOA 3T81A 4B5XA 4BI6A 1LL6A 3LQLA 3G1RA 1ZBKA 1M53A 1OFBA 1Z8AA 1PX3A 1CGYA 1ZAHA 3WD0A 2GSHA 1JRCA 4XZ9A 4AW7A 1VP5A 2ZICA 3QKZA 1TCDA 3TQKA 3W7LA 3F2CA 3I3BA 1Y5WA 2ACSA 5HNUA 3GFXA 1XBVA 1ML1A 3M46A 2X1IA 2O0TA 2VOMA 1XHGA 4IMFA 1G4TA 4FSAA 2JFEX 3LM3A 3D6NA 3VOIA 4E8GA 2FVMA 5CJ5A 3MUXA 1PZ1A 3L0NA 2PDFA 1FWFC 2Z1VA 1KCKA 3DX5A 4RZ4A 3WH6A 4OIFA 1XGDA 4PCNA 3S9ZA 3H55A 2F6UA 5JVLA 2V0TA 1EBHA 3BLPX 3I68A 1J9YA 1YTEA 3CWOX 5H91A 2QLYA 1D8WA 4DM1A 1FRBA 1R30A 2YL9A 3BOXA 3W2LA 1QI3A 3VKKA 3Q37A 4ADSA 1H3GA 3S5ZA 3STFA 3NL5A 1R87A 3CWHA 1EQPA 5LIKX 5IRPA 1ONXA 3KX6A 3LLFA 4E8CA 2E0PA 4HZMA 3OLDA 4B3LA 1EEPA 4IPJA 3ZT7A 1B9BA 4GQQA 3H2CA 4MKNA 2D0GA 3LHWA 2R94A 4WK9A 3THQA 3DFNA 1HKMA 4PCTA 4XWUA 1LJYA 4YMZA 5G1MA 2HSAA 4AYSA 3M1ZA 4ZEPA 4XVDA 1ZSXA 5KZ6A 4AZHA 1JFXA 2PTZA 1SJAA 4LJ3A 3STCA 2QUUA 3U9IA 1BXNA 2W9MA 4FOJA 1XRFA 3NYZA 2CLKA 5CH9A 4BEQA 2ZUVA 3KRSA 3UY8A 4PMVA 4QCFA 4Q4PA 3URBA 3FX4A 1VHNA 5BNKA 4AQLA 5EMJA 5GNXA 2BVTA 1OGSA 3W53A 4ZQPA 1RR2A 2QZRA 1FWRA 1MXGA 2VGBA 5FIPA 2YZ5A 1OZQA 3AHTA 1P43A 4LV4A 3WDIA 5I3HA 4LW7A 1SSGA 4H8NA 4WRHA 2CBJA 4F0RA 2ZZ3A 3EEGA 3VM7A 4G1KA 4DPQA 2XH4A 4AX6A 2QNEA 1UR8A 5DX7A 1K77A 1SJCA 3ANUA 3NXFA 1JVNA 4Q7NA 2WSKA 2B7PA 2PCEA 2YLAA 2FGZA 3NG3A 1BFNA 1XRVA 4XBSA 3UGRA 5HMDA 3R2GA 3GDMA 4L4LA 3IIXA 1QUMA 1QHZA 3GC4A 3HQNA 3ARXA 1HG3A 3SRKA 3GO2A 1ISXA 3GAKA 1I1WA 1RCXB 1GOXA 1TX0A 3NSNA 4F2UA 1CXEA 3V5CA 4IICA 5HMEA 4JHOA 3T44A 3K30A 1G6CA 1TJPA 5GJPA 3L4YA 2GQ8A 3BGGA 5A8OA 3TA6A 2ICSA 3PFMA 2YW3A 2X2YA 1A5LC 2VX6A 5I77A 1E0WA 3ABZA 1DWIM 4JGDA 2WVVA 1CI1A 3PUDA 4D8LA 1AL8A 4R9OA 4BI5A 3SUTA 3GH7A 2EKCA 4XK2A 5I3KA 4ZTYA 7REQB 4TX8A 1S2VA 4IGMA 2A7NA 3DFOA 2YCJA 4GJIA 3K5XA 2Z2UA 1GZ1A 4XAGA 5D02A 3DH7A 7PTDA 1VBGA 2J25A 1PX4A 1BYCA 1W3HA 4JIQA 1CTNA 4N42A 3HOJA 4M6QA 3V75A 1TCMA 3DFYA 5DXXA 5CXPA 4C1NA 3L21A 3S83A 1R3WA 2NQLA 3WF4A 1CXKA 4E2OA 1AK5A 1TPB1 1JDFA 3EMZA 2GQ3A 2VGFA 1SFJA 2CBIA 3C2RA 1OZMA 3PC0A 4ZOAA 3KDOA 2YZRA 1ZALA 2HISA 2QS8A 2DVXA 5LNSA 3INPA 2E5BA 4EIVA 4YIWA 3NA8A 4AB4A 2PCQA 1KTCA 3MMWA 3FOKA 4RV8A 4O18A 5DT5A 3QSTA 3W81A 3G6MA 4HPHA 1ICQA 1FP9A 3KCOA 1A50A 4QBXA 3MUAA 2DZVA 3S6DA 1KRAC 2J9XA 3PUOA 1HX0A 5CPMA 4H4IA 5C5YA 1NY1A 4LC6A 5A8NA 4XAZA 2WM0A 1Q8AA 1NQKA 4O57A 3M0HA 1V6TA 3H54A 1F73A 4C6DA 3B0PA 2Z2AA 3TJLA 4MOZA 1IT8A 2E09A 3UWQA 3APYA 2JBMA 1G4EA 4US5A 3TAKA 1UR2A 3PS7A 1O94A 1R0MA 2I16A 3T0CA 3OOQA 1AD4A 1EH9A 4WSHA 2FB3A 4S3DA 5LZLA 1Q6RA 3TH6A 1E4IA 5FJIA 5B7YA 4G5DA 4X9YA 3KL0A 2Z4GA 4Y6GA 1AMKA 1W9XA 4YTSA 1YMYA 3AMLA 1J6PA 2V3FA 3O6CA 5M5DA 2PWUA 3IANA 2DZSA 4I7WA 3BCFA 3G1DA 2ADAA 3LZ5A 1E40A 1YBQB 3AICA 4AEEA 5A8PA 3DG3A 1DHPA 5M3WA 2V8ZA 2BOEX 2ZDSA 3ME3A 3W1LA 1MRAA 3NGJA 3E1F1 3W26A 4KKXA 4MZYA 3K46A 3RU8X 1LG2A 3BW4A 5DY3A 2JGQA 3XISA 5AHEA 3NM1A 3WUGA 1VYSX 1XDLA 2Z29A 4LB4A 3IAPA 1SZNA 1WKFA 1W1IE 1XUUA 4F0SA 4AWUA 1XYLA 1TUXA 3GH4A 3DFSA 1SJBA 2PE4A 3SUVA 1D3CA 4QJ5B 1HUVA 1JNEA 4L61A 3NOEA 3TX9A 4K6AA 3WJWA 3M6YA 4AX7A 2GL5A 1X96A 3UG8A 3C56A 1QI4A 4FF7A 1CWYA 4DUOA 4WF7A 5LIUX 1PZ2A 4ACYA 1VJIA 3QZ6A 4UZUA 1R5YA 4EANA 3P5YA 3TTSA 3U6WA 2DH2A 2ZE0A 3NZGA 3XINA 3EKGA 4FNRA 1KKOA 5E0CA 4P2VA 5KEZA 1CGVA 4KWWA 5A2BA 3AWOA 5CSUA 2PDHA 1AW1A 4XZWA 4LY8A 2GGGA 1XI3A 8XIMA 2Y5SA 3WQDA 3ZR4A 1Q13A 1SZRA 2VC6A 3ZSSA 4MY8A 3W29A 1UPPA 4LF2A 4XKMA 2BB0A 1XYBA 2P8BA 3SURA 5AN7A 1MSSA 5C7VA 1GVQA 4IMDA 1I1XA 4LOCA 3VKCA 1JAKA 2O9RA 3LCHA 4XD6A 1GYMA 1TV4A 4XZNX 1KLYA 1IXPA 2CU0A 3MSRA 3VDBA 3W84A 1X97A 1SZFA 2QCGA 2VRJA 2WMIB 3REQB 5BXRA 2KAUC 4E4FA 3VINA 2DT3A 4JYEA 2DQWA 2PD9A 1NARA 4HSNA 1WDWA 4F4RA 1UIOA 3KBSA 4JQ2A 4S3AA 3VPLA 4N02A 3ITCA 4HOWA 4UFHA 1VPYA 3M0MA 1ZHAA 3LV6A 2DPEA 5BXTA 2G3NA 4TU1A 4X0NA 5F2GA 3B8SA 1A53A 1IF2A 2XINA 4GVIA 4AH7A 1H51A 4GIEA 3ZOAA 3GTHA 3UR8A 4Z42C 1XIFA 4JS3A 2OMAA 1E5NA 3QVQA 4ZO9A 4KW2A 1VJZA 3WF2A 2UY4A 4MJ2A 1WKDA 4UQ9A 1I75A 5CZJA 2VO5A 3K1GA 3UESA 3HG4A 5BWAA 3QSRA 3EX3A 4L80A 4GBUA 2ZVIA 3TDFA 5B7ZA 2HS6A 3LCIA 4OECA 2Z24A 1BYBA 3GIQA 1M68A 4MDOA 3AZTA 3W4RA 4MWAE 1KBBA 1A5UA 2YCEA 4PTDA 2V30A 4PMZA 1MUWA 2C79A 3B8TA 3SY1A 3FJNA 4LPCA 4W8LA 2DIJA 3ATYA 1P4CA 2NQJA 3U0HA 3MDUA 2OELA 1E9ZB 3LI0A 2Z0IA 3PWAA 4NUWA 1PPIA 1FDYA 1Q6DA 1Z7AA 3OLEA 5I2UA 1FHUA 3GXFA 4FR6A 4L6HA 3TQ0A 1CB7B 3KRUA 3KUMA 2GGHA 3MUZ1 5CPTA 3ANYA 4EVZA 4GY0A 3R0KA 4QRNA 2GVLA 2PB1A 4O10A 5HWJA 3VOJA 4I9AA 4QAWA 4PMOA 1WXZA 3T2PA 1QBBA 2VVNA 3R79A 3FJ6A 4KF1A 4HD5A 3NDYA 1L9WA 3WX7A 5C6MA 2PDLA 4ZOEA 5CGMA 1XIMA 3W1AA 1C93A 3T7VA 2QJMA 2X0HA 5AHFA 4QEEA 1F5ZA 1W2PA 3HQ1A 1QASA 1PYMA 3CTLA 1THFD 5FACA 5HJYA 1JZ5A 4HOZA 1TB3A 5CZSA 4B91A 2WHKA 1R3YA 4TIMA 5D30A 3RLHA 2F6XA 5ABHA 1AQFA 1O5RA 4PTVA 1KQYA 5AC7A 3UCDA 4RK8A 1FFQA