1MQQA

The crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1 complexed with glucuronic acid
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
675
structure length
675
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRWWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-D-GLUCURONIDASE
publication title Crystal structures of Geobacillus stearothermophilus alpha-glucuronidase complexed with its substrate and products: mechanistic implications.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 284
structure length 675
sequence length 675
ec nomenclature ec 3.2.1.139: Alpha-glucuronidase.
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mqqA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1mqqA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1mqqA03
1C8YA 3IJ8A 4C7GA 2GUYA 2EPOA 4UQBA 2J4GA 2ZX7A 3BSGA 2DH3A 1Q6FA 4ACZA 2J7BA 3ARUA 2VCAA 2WCAA 4AISA 5E09A 3ZM8A 4JFWA 3AMKA 5I3DA 3VDAA 5AC4A 3K1DA 5HBFA 1QBBA 3CHEA 5A6SA 1UOKA 1RP9A 1M01A 2BVYA 4W8LA 5D9MA 1CGWA 4J3TA 1W1VA 4V27A 4Z2HA 3LPPA 2E0PA 4CN1A 1CXFA 1P6WA 2WXDM 4W5ZA 5I79A 1H3GA 2W5FA 2GJXB 3CUHA 4UOZA 1XH1A 4FF5A 4PTWA 3VMOA 2V3GA 4W87A 1ISWA 5FKYA 4AD2A 4GPNA 1HT6A 4HMDA 1CXHA 1MW3A 3GH5A 1FHLA 3K8LA 3B9EA 1GONA 1V0MA 1HJVA 4HA4A 4HOXA 3U5YA 2XSBA 5FCZA 3G6LA 4H2CA 4FLRA 2EXOA 4U3AA 4UFJA 1HF6A 3IJ9A 4PYSA 1HKIA 3WQ6A 4TTGA 4H8VA 1CGVA 2Z1SA 4F9DA 2A3AA 1Q6GA 2BS9A 2WZHA 3AMGA 4IPNB 1WB0A 4X9YA 3DECA 1J12A 3HN3A 2D0HA 4M24A 1JDDA 1B31A 3AOFA 3L4TA 1LF1A 3MSDA 2WVVA 1V3LA 2BVDA 5BYWA 3W37A 3BAWA 1UA7A 4D6HA 1W3LA 2BY0A 4JIEA 2XIIA 1E6PA 4M56A 4AZCB 3SCPA 1ITCA 3WUBA 1GQLA 1PEZA 1M53A 2WBGA 1LG2A 2VVNA 1JG9A 4TUFA 4UOQA 1CXLA 4CD6A 2OSYA 4OOUA 1E3XA 3RJYA 1VIWA 4CVWA 1GUVA 3CZJA 4P7OA 1NARA 2W91A 3L4ZA 2ZX9A 3K4AA 1VEOA 5DMYA 3RILA 4PTMA 2VX4A 2XIBA 5I5RA 5E6YA 1B0IA 4W89A 1EQCA 3B8SA 3W27A 1GORA 2GJXA 3AISA 2PI6A 1VBRA 4PMRA 1WDPA 3BMVA 1NH6A 4HA1A 3W28A 4KMQA 3A6OA 1FOBA 3OGSA 3VINA 4U2YA 2WC4A 1BYBA 1E0WA 4GI8A 4UFHA 2YDQA 3RMEA 3WQWA 4PUEA 1O6IA 3EMCA 1UR2A 3W38A 3RO8A 5IHSA 1I1WA 1JAEA 2NSXA 2XGIA 4PMUA 3VMNA 2CYGA 1LWHA 1Q6EA 2WC3A 1HJUA 3J7HA 5A2BA 1UH2A 2VR5A 5E6ZA 1ITXA 2AMGA 3DHPA 1WDQA 5IDIA 3WF4A 2QMKA 1QNSA 3UETA 1V08A 1LL6A 1G0CA 1C7SA 3WFLA 1E55A 2CPUA 2ZX5A 2ZXAA 3SCRA 3LMYA 3OBAA 3L2LA 3WF2A 1MYRA 1E43A 3WENA 1LLOA 3I3BA 1VAHA 4UFIA 2VZSA 2EBNA 1C91A 2WLYA 4U5IA 1EQPA 4GINA 3WEMA 3CGTA 4UZSA 1FFRA 4D6FA 1OGGA 1D3CA 4LYQA 3GH7A 1D2KA 2OWCA 4MAZA 2XVLA 4HA3A 2YIHA 1KB3A 4MB1A 3RCNA 4AEFA 2G4FA 1E9LA 1W2VA 1V6UA 1UWIA 1J9YA 1UKOA 2ZE0A 2CBUA 1WO2A 1GOKA 2OSWA 4GZJA 3AHVA 1E6QM 3F5JA 3BGAA 4W7WA 4QCEA 3AZSA 4CCCA 4GI9A 4H41A 5HOSA 3T0BA 1WZLA 4HPGA 1UUQA 4KGLA 1JF6A 3WH9A 2G8ZA 3AXXA 1XCXA 2CXGA 4W88A 2WKLA 4MNJA 3WH6A 4AZ7A 1KXQA 1V02E 2VNCA 7A3HA 5GPRA 1QI2A 3W6LA 4P8UA 4Q22A 2E40A 4WJXA 3VGEA 4EKJA 3AS1A 1GOOA 3HMCA 1B2YA 3O2LA 2VO5A 3TTOA 4MJ2A 1E4LA 2ZXQA 4M82A 4XX6A 1BF2A 3N11A 4JFSA 1OM0A 4MB5A 4FMVA 4AZ6A 1ISYA 1HNYA 3BH4A 1YQ2A 3CUGA 1GZJA 3BAJA 2DT1A 2A3BA 1HP4A 1A47A 1QNPA 2C7FA 4ZXOA 1XGZA 4HU8A 3NYDA 4LX4A 5AC5A 1B3YA 4ZEPA 4HMEA 4AIUA 3PTQA 2NW0A 3KL5A 4UZUA 2J7GA 3ARVA 4W93A 4W7VA 3VIJA 3APGA 4MNLA 2VVSA 1ZBCA 3CIVA 1ZU8A 1UQZA 2QPUA 2W4XA 1ZJBA 5BRPA 1B9ZA 2BHZA 4XZWA 4J28A 1W9UA 1FP9A 1MWOA 1BAGA 1H2JA 2ZOXA 5D8WA 2ZUTA 2HVMA 1TA3B 3CO4A 3QR3A 5CQ1A 2VQUA 2WLZA 4EE9A 2PWEA 1W9VA 1R87A 2XUCA 2XFYA 1LG1A 1J0JA 1E40A 5BRQA 1VENA 2VZUA 1W9DM 3OZPA 1JFXA 1K6AA 2ZUSA 3GXDA 3VGFA 1NP2A 4HU0A 4N0RA 1GOQA 2CERA 2CHOA 2WVSA 1N82A 1GJWA 3BSHA 1WP6A 1JI1A 2OSXA 1WZMA 2VRQA 3TONA 1EOKA 3OLIA 3ZJ7A 3HJEA 1WDSA 2IUZA 4D71A 1CPUA 4IPLA 4JFUA 4ATDA 1KFWA 1BGGA 2WHJA 1MW0A 3L4WA 2UY2A 4URIA 1BG4A 3W0KA 3WF0A 2BFGA 1MXGA 3BC9A 4W7UA 3IAPA 1W9PA 1JZ5A 4UQCA 3MMWA 2ZUUA 4Z2JA 4PTXA 4CKQA 1H5VA 5A6BA 1L8NA 2UY4A 1DWIM 2X09A 5ABFB 1JXJA 1U2YA 4D72A 4D1IA 4BQ4A 4DM1A 3KL0A 3PZVA 3W4RA 1QOXA 4GI6A 2BNJA 1E0XA 3WQ5A 2RGMA 2VX7A 2AOSA 1XD0A 4FLSA 1ZL1A 5A6LA 1HP5A 2GJRA 5I24A 4C90A 1QI4A 1KWKA 1PZ2A 3U7BA 2DH2A 1HKJA 3D3AA 3NIYA 1XYFA 1XCWA 3UG4A 4C91A 3WL1A 4QDMA 1ZBWA 2ZXBA 4AD3A 1QNOA 4YPJA 5M5DA 1SR0A 2E4TA 1H11A 3CHCA 2ZX8A 1QPKA 3LPOA 4WIWA 2JF7A 1HN1A 1UKTA 1UH4A 1CDGA 4JHOA 2A3CA 1V0LA 1PAMA 1LJYA 5GNXA 2W62A 4JKMA 4P7NA 1JIBA 3TTQA 3M07A 4PN2A 4EANA 1E15A 1TVPA 4TVCA 1LL7A 3ARTA 1BVZA 3QHOA 2YKKA 1XC6A 5CPTA 3T2QA 4WKHA 2XSAA 5EMYA 4D6CA 2V3DA 1H1NA 5I6SA 2BY3A 1JD7A 2CIPA 2W67A 3VD3A 4ZENA 2X0HA 1R85A 5CPQA 1UZ4A 1E3ZA 3VOCA 4TVDA 1W2PA 3POHA 1MFVA 1CGUA 1RH9A 2D20A 4Q7NA 1R7OA 2DT0A 5LA1A 4U33A 2WHLA 1QHOA 4NZCA 4PMZA 1EDTA 1BG9A 2FH6A 1CEOA 3MSGA 1DTUA 4P8VA 1FH8A 5ABFA 1E4MM 3WN6A 3W81A 1E6XM 2F8QA 3II1A 5BCAA 2WHMA 5AY7A 1GVIA 4MNMA 3S2CA 2PC8A 2OYMA 2XFRA 1KXTA 4C7FA 3CZKA 1H49A 2E9MA 4FLQA 1PZ3A 1G01A 1U33A 3ZSTA 5DT7A 3AMDA 3KZSA 3WBAA 1JYWA 3G6MA 1W9BM 2VTFA 3VX1A 1XSIA 3WDRA 5FIPA 2O9PA 4EAMA 4PMXA 4DUVA 1CXIA 3THCA 4D6GA 1KXHA 1JZ7A 2W66A 3IJ7A 1E6NA 5D8ZA 1E56A 1MXDA 2QV4A 1UD8A 3M6DA 5A94A 2JE8A 4HZ8A 2Y2WA 4M1RA 1W91A 2QMJA 3WNMA 1BGAA 1BHGA 3QGVA 4JFVA 4KRTA 3CZ8A 2CESA 1FH9A 3AHXA 4HZ7A 1VB9A 4W8BA 1IV8A 1CXEA 2O92A 3ARPA 3GTNA 4W84A 4E8CA 3CTTA 2GDUA 1X6NA 2CKSA 3N12A 4H04A 1NWUA 2G41A 2ZUWA 4GIAA 3ALGA 2Q8XA 5EBAA 1W3KA 5FOOA 3AIBA 5BXPA 2VZOA 2WBKA 1CLVA 2D0FA 1CGTA 2DSUA 1W3JA 3AJ7A 3OLEA 2TAAA 4J7RA 7TAAA 3IANA 1J11A 4AYSA 3ZO9A 1NM9A 3A4AA 1MW1A 1VFFA 4P7LA 3WH5A 3ZR6A 5I2UA 1VFMA 3W6MA 2YBUA 4LPCA 4CVUA 3BMWA 1GPFA 4M80A 1L0PA 4JHZA 4CU6A 3PHAA 3PZQA 1EIBA 5JBEA 1OGSA 3QOMA 3MANA 2J47A 2V38A 4CU7A 5JIPA 2PBGA 5CGMA 1DWHM 3SURA 3PN8A 8A3HA 3MS8A 1F4AA 5FL0A 3DYPA 2XM1A 1CNVA 1UKPA 2NT1A 2ZUMA 3MU7A 3N15A 4RE2A 4W86A 4PTVA 2CITA 2IXVA 3A4XA 1XYZA 2GFTA 1TMQA 2X05A 2ZICA 3RM9A 1J0KA 4YN5A 3MUIA 3N13A 1JYXA 1GCYA 5E0FA 2VZTA 3WF3A 3PZUA 2OWWA 3W29A 3WNLA 3VIIA 1BVNP 3GNOA 2GDVA 1ODUA 4TX6A 4CN6A 1HJQA 1QNRA 4S3JA 3VTRA 2G3IA 5CSUA 1GJUA 5JBFA 1VJSA 3EYPA 2BVTA 4ZFMA 2FHBA 2YJQA 3EDJA 1H09A 1ISXA 2QLYA 2D2OA 4HOWA 1JYVA 1KBKA 1XSKA 3AI0A 3ZJ8A 4OKDA 3M46A 4JKKA 5HPOA 3T08A 3WMSA 5JUVA 1TR1A 1OSEA 5CJ5A 1CZ1A 2Y5EA 3ZT7A 4KH2A 2CEQA 1PX4A 3SCVA 4HMCA 1CTNA 1B90A 3VNYA 1QW9A 2FGZA 1US2A 1HJWA 4S3KA 2CCRA 1IZJA 2DT3A 1G1YA 1M7XA 1QI3A 3CUJA 4HPHA 3VD4A 2Y24A 5M17A 2J7FA 1UR1A 2DPEA 4PRWA 5EFFA 2XGBA 5IXEA 1OD0A 1OIFA 3WELA 4D6EA 1HVXA 4DWSB 3WDPP 4UCFA 3ZR5A 3WF1A 3WEZA 4ACYA 1GOIA 1W3HA 2J7DA 5EFDA 2AAAA 4PEEA 3AICA 3WBEA 4WKFA 3RJXA 4PMNA 2WMHA 4MB3A 5DFAA 1JZ2A 3EDFA 1OT2A 4MNKA 1C93A 3EBVA 1WPCA 3AFBA 1KWGA 1IZKA 3NSXA 1AMYA 2F61A 1E72M 2EPKX 1EH9A 5A8NA 1ISZA 3CZGA 2IXUA 2WK2A 2BHUA 3CLWA 1GHRA 2VOTA 3N1AA 2YL8A 2E8YA 3VO0A 2VCCA 1NWSA 3OB8A 2JIEA 2VJXA 1UD4A 1ISVA 1EGZA 3N9KA 2VC9A 3B9AA 1GQJA 3THDA 1PX8A 1DWFM 5HNNA 1EHNA 2BY2A 3FXYA 1AQMA 1VRXA 4AZHA 4LGXA 3WMCA 4CCEA 4AIEA 3VD5A 5BROA 3VGHA 1V0NA 1KGXA 1MQPA 4U2ZA 2ZIDA 3MV11 3AS3A 3T2PA 2WMGA 1GOMA 2WMIA 5A69A 1HL8A 4NRRA 3NCOA 4A4AA 1VFOA 3AYSA 3VUPA 2MANA 3WNNA 3DYMA 2XYLA 1XRVA 3O9NA 3WD4A 4B15A 1CGYA 3AZTA 2HISA 4M8UA 3SUWA 2YDRA 2WKGA 2WWCA 1PX3A 3L4YA 3VDHA 4WK9A 4DWSA 3VGBA 4XZBA 4X0NA 4DWSC 2EJ1A 2X2YA 1E73M 3MUZ1 2VZVA 4J3SA 2PWGA 3E1F1 4PCTA 2XJ7A 4A3YA 4AD4A 3ARWA 2Y8VA 2ESCA 2WSKA 1H0GA 3BCFA 3WUFA 2UY3A 2WANA 3AHZA 5BWFA 3PZOA 3ALFA 4J3VA 3VIKA 1UG6A 1ZS2A 3AXHA 3SCQA 3FHAA 1E70M 2J74A 3AMCA 1V3HA 1E0VA 1UA3A 2BXYA 3FNDA 3MUY1 3CUIA 4H8HA 4JCMA 2C8NA 5DEZA 5A3HA 4IM4A 5JBDA 3UG5A 2DDXA 4F8XA 1JZ8A 3WDHA 4E4PA 3AHTA 3PZTA 3OIHA 4U31A 3L4UA 3NDYA 1BQCA 2W92A 3BLPX 4CD8A 1KQZA 1V6YA 5LYRA 4UFLA 1CECA 3VGDA 1ZBVA 4WSKA 5KZ6A 3WNOA 1BFNA 4ZXLA 3U7VA 3K8KA 3LPFA 2CNCA 1DHKA 3VGGA 3VNZA 3AS0A 4UFMA 2QHAA 1V02A 3SUSA 4UR9A 1CWYA 3KE0A 3VDCA 3WL0A 1PPIA 1GNXA 3SCOA 1I75A 3VIHA 3FAXA 3FW6A 1D7FA 3PZIA 4V28A 4D1JA 3I3DA 5BXSA 2VQTA 1CYGA 3GNRA 4L4OA 3CUFA 2DQXA 2WMFA 3MUAA 1DWAM 1R8LA 4W8AA 3MV01 5E0CA 3GH4A 2VRJA 2YL5A 5LA0A 3CPUA 2YBTA 2A3EA 3BAIA 1H41A 2OWXA 1W32A 2D24A 3U57A 2Y4SA 1BTCA 3SUTA 1E1EA 1OINA 3ARXA 2J7HA 4QLJA 3QHMA 3W26A 3WQ8A 4OUEA 1EO7A 2JEQA 5IFTA 1ODZA 4XUYA 5CPSA 3LPGA 1SFSA 5AYBA 1JFHA 1TCMA 4C7DA 1MFUA 1V3IA 3WKZA 1FP8A 5A6KA 3N04A 3AMLA 2XHYA 1JXKA 3A47A 4PCSA 1OWQA 2J8FA 2C0HA 4MDPA 4JL2A 2PWFA 4ATLA 4PUDA 3RIKA 5TD4A 2XPKA 2YA0A 2OYLA 5ABEA 4KWUA 3FN9A 1FHDA 5E70A 3VX0A 3ZT6A 2DEPA 4Z2GA 3ARQA 3F4VA 4K68A 3SUUA 1OIMA 3W24A 5ABGA 2VX5A 3WDQA 3ARSA 4KRUA 4BQ2A 1WZKA 4XV0A 1UWTA 2GVYA 1QW8A 3IAQA 3TTYA 5D9PA 1ZBKA 3WMBA 2PF0A 3B9DA 5IFPA 2WMKA 1W1YA 2J25A 2BY1A 1MVYA 1LQ0A 3EMQA 4DUWA 2BHYA 2CBIA 3CZLA 1E6RA 3GZAA 4OOZA 2WNWA 1J0ZA 2GSJA 3CMJA 1KGUA 4BQ5A 4TTUA 3GBEA 1UR9A 1GQKA 3WH7A 3ARRA 3AIQA 5D9OA 1QBAA 1E4IA 1W1TA 4JCLA 4AIOA 3ZSSA 2O9TA 2X0YA 4CGTA 5E9AA 1H4PA 5A6JA 3VU2A 1UR0A 3NSNA 3ZJKA 3CHDA 2VT0A 4P7QA 3WDJA 4GQQA 3T0AA 1MQRA 2VI0A 4J27A 1SMAA 3SCSA 3L2MA 1ZJAA 4XB3A 1EXPA 1JZ6A 3UERA 3D5HA 3BCDA 2D23A 1C90A 3VKKA 5CLWA 2WZEA 4Y7EA 2E8ZA 4M29A 2DSZA 3EDKA 4B9YA 3BLKA 3OZOA 4JL1A 2XWDA 2EQDA 4B16A 4JAWA 4NSBA 3GXIA 4H8UA 3GBDA 2VURA 3T0DA 3TA9A 3VM5A 5M03A 4E2OA 1OGBA 4FLOA 1M04A 4M81A 3FY1A 3AYRA 5DT5A 3DYOA 1ESWA 1SMDA 3A3HA 1J18A 2RGLA 2CHNA 5A6AA 2J77A 2EO7A 1VJZA 1KR0A 3VMPA 1EA9C 5FL1A 2GK1B 1Y7VA 3WSUA 2ZUVA 4CUCA 2FGLA 2PBOA 2VMFA 4GKLA 5CSYA 1AQHA 4MTVA 4ZE4A 4ATWA 4LYPA 4MB4A 1GW1A 2J7EA 4AW7A 4F79A 5CG0A 2YLAA 4DUXA 4TOQA 2XVPA 1ECEA 3AIRA 3JUGA 2YOCA 5GNYA 2Z1KA 1IT0A 3SUVA 2JALA 4P8WA 1NOWA 1C8QA 2XVKA 2EEXA 1PBGA 2EPLX 1HKMA 4B9ZA 1UZ1A 4JFTA 3PTMA 3VIGA 3WH8A 2XTKA 2CETA 4WKAA 1EO5A 4W85A 1JD9A 1J0YA 3CH9A 2X1IA 2FHFA 4UTFA 3WIJA 2W61A 3SIMA 3GDBA 2VRKA 1E71M 3BAYA 5C70A 2PWHA 1X6LA 2YL9A 2V3FA 2JFEX 2WCGA 1Q4NX 4F9JA 3GNPA 4ZE5A 2WW5A 3UCQA 1KR1A 2BXZA 2WC7A 3L4VA 1C92A 2J75A 1JGIA 3AIVA 5IHRA 4E8DA 1E5NA 3ZIZA 1NQ6A 3W82A 1UKQA 2W63A 4R5EA 1J0IA 3GM8A 4CD7A 5A95A 3ZT5A 4RE4A 1E6ZA 1RP8A 2DSKA 4UQ9A 1UH3A 3SCWA 2G3NA 1DWGM 4CD5A 4D6JA 1JDAA 3MMDA 3WQVA 4YHGA 1JYNA 1S46A 4OBRA 1UHVA 2YLLA 4A3HA 1K9FA 1JZ4A 3VIOA 4P8XA 3ARZA 3KEHA 1TE1A 1WCGA 1LWJA 2OLHA 3VM7A 2EPNA 1DP0A 4GZIA 1QI5A 1NWTA 3L4XA 4Z2LA 4UQAA 2X8RA 5I0DA 2WZIA 3RM4A 3AZRA 4AY1A 3PBGA 3GYCA 3ZQ9A 1GVYA 2E3ZA 3VPLA 1B1YA 2GK1A 5BXRA 3HU7A 1AVAA 3FAWA 1XV8A 3F5LA 1ZB5A 1B3ZA 2YA2A 1OCQA 4WF7A 4CN4A 3SCUA 1G5AA 1K9DA 4BZYA 2WMIB 5F7UA 4OBSA 6TAAA 3EDDA 4QP0A 2WVUA 8CGTA 3S6TA 3NUKA 3DHUA 4TXEA 1QHZA 1FA2A 4LQ1A 3VDBA 2XFFA 2XVGA 3NDZA 5A8QA 2JF6A 4GO9A 1Z32X 1HL9A 3AIUA 5D9NA 2UY5A 1B30A 2ZWYA 4AZGA 4IUGA 1UWSA 2DT2A 5A2CA 4NRSA 3WD0A 1KGWA 1V3MA 1PIGA 4AC1X 3ZOAA 4MPKA 2NT0A 1UYQA 1J0HA 3SCNA 3WD3A 4QFUA 3MMUA 1WZAA 1AQ0A 5FD0A 1V6XA 4PSPA 2G3JA 2WPGA 3VVGA 3WY1A 3CMGA 2FH8A 1PJ9A 2VX6A 3N18A 4OJYA 1TFVA 4PMQA 4X0VA 3OGVA 3ARYA 1KXVA 3VIFA 5GQBA 3AQUA 4BQ3A 3OLGA 3TP4A 1WE5A 2BV9A 4NF7A 3BAKA 2G3MA 3CBWA 3PZ9A 4AZCA 2D3LA 2JIWA 1KQYA 1VEMA 4HP5A 3WUGA 4IISA 3WDIA 3WD1A 1M03A 4LYRA 4RL3A 4D6DA 1XSJA 2QF8A 2D0GA 1UR8A 1C8XA 4YHEA 1V03A 2WCSA 1A3HA 3AIEA 1QVBA 1KCLA 4CD4A 1JI2A 1BPLB 1F4HA 4UQEA 1HJSA 4FK9A 1Q6CA 3QHNA 3ECQA 5CLTA 4DM2A 3U5UA 1NOFA 1HJXA 1EOMA 3I3EA 2OYKA 4AEEA 1YHTA 4P7RA 1G94A 2D3NA 1TVNA 2ZWZA 5C8BB 1OB0A 4CU8A 2WM0A 2VCBA 2ZXDA 4BF7A 1EDGA 4GXPA 3AHYA 1CGXA 2CBJA 2O9OA 4UQDA 5DO8A 1PIFA 2J8GA 1UD5A 4AD1A 1GOWA 3T09A 3WNPA 7CGTA 3K8MA 2WB5A 3N17A 1J01A 2VR4A 1E1FA 5CGTA 2CBVA 1LL4A 4AZIA 2XG9A 5EB8A 4AZBA 1MQQA 2DGAA 1V3JA 4OZOA 4HOZA 4V2XA 3EDEA 9CGTA 1H0IA 1NWRA 3WQ4A 4GQRA 2YL6A 4U3CA 1V3KA 4AZ5A 1WAWA 1BYCA 1UQYA 5D4YA 1JNEA 1MW2A 1FFQA 4R27A 1US3A 3PZNA 3UG3A 2Y8KA 1VFUA 3SEPA 3UEQA 1OT1A 3NSMA 1QI0A 5DF0A 2WWDA 3POCA 2VL4A 1UWQA 2UWFA 2YA1A 2ZUNA 2JEPA 1GQIA 4GZEA 3PTKA 4BS0A 5HPCA 2WVTA 3W53A 1CIUA 5ABHA 1HIZA 3F5KA 1C7TA 1B3XA 3OGRA 4WSJA 4J3WA 1TG7A 1QNQA 5CXPA 4U5KA 2WMJA 1E6SM 4AXNA 1QHPA 1UWUA 1VEPA 3UESA 5CZKA 1JNDA 3CHFA 1SYTA 1CBGA 3RM8A 4TX8A 1TUXA 1KCKA 4DWSD 2GJPA 4MAVA 4ML4A 2WYSA 2VUYA 2D1ZA 1VBUA 4D6IA 3KWXA 4W5UA 3VD7A 5JIWA 4F66A 3WD2A 2WAGA 3K46A 4MJ4A 4PMYA 4EK7A 5BXTA 4B3LA 5AYIA 1W1PA 1G9HA 5ECUA 1I1XA 1RD6A 3TOPA 4BCEA 1E5JA 2E9BA 3EMZA 4BA0A 3GXFA 1CENA 3RPMA 1UD6A 1UKSA 3WNKA 2D22A 1B3WA 1DEDA 1UR4A 3ZMRA 1JF5A 2O9RA 2J62A 1U30A 4QLKA 3WUEA 3MO4A 2WSPA 4QLLA 3CZEA 3SCTA 2WHKA 1FH7A 6CGTA 2PB1A 1HVQA 3W25A 1HKKA 1BYDA 1XHGA 1VF8A 5I77A 3O6AA 1WNOA 4JZ5A 1EHAA 4AD0A 2XM2A 4MADA 5A6MA 2V5DA 2V3EA 4GO8A 4AMCA 1V6VA 3WFZA 3OLDA 1X1NA 4B3KA 1NOUA 4UFKA 3AIWA 2ZX6A 1UD2A 1BSIA 1J10A 3UR8A 5HXMA 4LXFA 4L4PA 4J3XA 4HZ6A 1JAKA 2J7CA 3AXIA 5KEZA 5M3WA 5A8OA 4UOJA 4ACZB 1K9TA 1XH0A 6A3HA 3AS2A 1W9XA 2CKRA 4MDOA 4QCFA 2V5CA 2DSVA 4PMDA 5HDRA 1EDQA 2PWDA 1TA3A 4Z2KA 1JDCA 3WEOA 3MKKA 3RDKA 1UWRA 1CXKA 5A6BD 5I78A 3VD9A 2E9LA 1B3VA 3OA5A 5LA2A 2FDMA 1E4NA 5A1AA 1JZ3A 1HX0A 2YDSA 5A2AA 3PZGA 4N42A 1XH2A 4Z2IA 4RE3A 4PBGA 1V6WA 2J79A 3VILA 5A8MA 1OBAA 1BLIA 5I23A 3DC0A 3IK2A 4PMOA 3VIMA 1WDRA 4KGJA 1K9EA 4AWEA 1V0KA 3FHQA 4TVUA 1UD3A 4J3UA 1JL8A 1RPKA 3OG2A 3VIPA 4JKLA 1HXJA 2QPSA 1C3FA 3PZMA 1O7AA 2EPMX 1BYAA 4PMVA 1DWJM 3QOKA 5C71A 3M7SA 1KBBA 1XD1A 3BXWA 4WLCA 3T2OA 1WKYA 1R7AA 3NJ3A 2XWEA 3K4DA 2DIJA 1OD8A 2FHCA 2XVNA 3A4WA 3KL3A 3GXMA 2B31A 1CLXA 1Q6DA 4OIFA 5GNZA 3TTSA 4HTYA 3UR7A 2DSWA 1R86A 2WVVB 4QAWA 4PSRA 3BAXA 3AROA 2DIEA 4AD5A 4UNIA 5A8PA 2F2HA 1NP0A 2A3HA 1TZ7A 1GHSA 2J78A 3ZJ6A 4H7VA 4CCDA 4NI3A
chains in the Genus database with same CATH superfamily
1C8YA 1OCBA 2GUYA 1E9IA 3BSGA 5BW6A 4AISA 1NFGA 5EIYB 1TV8A 3C0SA 2NUWA 3FS2A 3KOZA 4A8NA 3RR4A 2BVYA 2OQLA 5E9XA 4QG9A 2BDQA 1DIOA 3C8NA 2GJXB 4UTWA 1DIDA 4PTWA 4E8GA 4UTWC 1JCMP 4HPJA 4S2CA 4IJRA 3KBJA 4HMDA 4PUWA 2X1UA 3K8LA 4S1FA 4H9MA 2TPSA 3EGJA 1XIEA 4HOXA 1G4EA 4PRTA 4H2CA 2EXOA 4UFJA 1TB3A 4BI5A 4DJEA 1HKIA 1HQTA 2Z1SA 3P14A 4DJEC 4JTKA 4IPNB 1XYBA 2GVGA 4M24A 2D0HA 2QT3A 4XAPA 4HNNA 4CQCA 1NFPA 5BYWA 1DJGA 3HV8A 3W37A 1U5VA 3BAWA 3A21A 2XIIA 1XKYA 4AY8A 1YTKA 2ZRXA 3SCPA 1NJJA 3G1XA 3TYUA 2QCHA 1XINA 4FB7A 4LVFA 5DX7A 4TO8A 1M53A 1LG2A 4L61A 2GGEA 3GG7A 3BJTA 1RJQA 4LF2A 3WFAA 3F4CA 4BFAA 2DZVA 4OOUA 1MDRA 1VIWA 1PXGA 1GUVA 1F8IA 3CZJA 1OVDA 1TTQA 1S2UA 3K4AA 3UZXA 2HBXA 1KLZA 1GT8A 3TNOA 1B0IA 4W89A 1B54A 1V51A 3C0LA 3W27A 1GORA 2XH2A 3QPEA 4GI4A 1NAL1 3WLPA 4ZQRA 1VBRA 1WDPA 3BMVA 4CQDA 4KWVA 1FOBA 3OGSA 3LZ5A 3ITGA 3JVAA 3UPMA 3DFNA 1E0WA 4AB4A 4RZ5A 3AXMA 3I7QA 4M1BA 2OU4A 4PUEA 3QZAA 4LUSA 4DVOA 1D3GA 4PMUA 4QEHA 4FIRA 5H6HA 2CYGA 2WC3A 3QPYA 5A2BA 3F4DA 2VR5A 1IHIA 2AAMA 3WMLA 3W74A 1SFJA 2VD9A 4A35A 4IHCA 3AU2A 3OJGA 3UETA 3W7LA 2PLMA 4KBXA 4FP1A 4KQNA 5I3JA 1V77A 4Z1DA 2ZX5A 2ZXAA 4KCVA 1UWAA 3OBAA 5JMUA 3CV7A 5T91A 1EP2A 5IOBA 2VGGA 2QQ6A 5DMNA 4JN6A 2WLYA 4U5IA 1EQPA 4UMAA 3CGTA 1YPXA 2R8WA 6XIAA 3HPFA 3MVTA 4D8AA 3N9RA 3W7JA 3HQOA 5M1TA 2HE8A 4R33A 4MAZA 4HQVA 1KB3A 3RCNA 3RF9A 3EWXA 1IWAA 4IQLA 4CNSA 1W2VA 4HNUA 3LCXA 3OVQA 4C6OA 4JTUA 4FNQA 3SR7A 1WO2A 1GOKA 1IZCA 4Z17A 2IW0A 2YFOA 4MYXA 4GI9A 5HOSA 1I0DA 3T0BA 2YB4A 1SW7A 3QC0A 3EEGA 3WH9A 2CXGA 4L7ZA 1QI2A 5FJUA 3EB4A 1XYMA 4EKJA 2Z26A 2DUXA 4D2JA 1T8XA 5CC6A 3APTA 2VEGA 5SWUA 1KBLA 3RG6A 4XX6A 3HG5A 3N11A 2J6VA 3DERA 4JFSA 2QCMA 1ISYA 3BH4A 1HGWA 1YQ2A 3W1AA 3BAJA 4JHMA 3PR2A 2DT1A 3TQVA 5EMUA 4H9VA 4UR7A 3NQVA 3ZS4A 2OO6A 3V18A 1QNPA 4LAOA 4HU8A 4M7TA 4CEUC 2XN0A 2IPWA 4UZUA 4DJFC 3ARVA 3W1PA 2Y63A 4JXCA 4MNLA 3BVJA 4UB9A 5AYZA 3CIVA 1ZU8A 1UQZA 2BX7A 2W4XA 1ZJBA 4JQ2A 4GCXA 1FP9A 1BAGA 3DCPA 3W7IA 1R46A 3CO4A 4LUTA 4EE9A 2RJGA 5AB3A 2XFYA 1E40A 4U28A 5D2XA 3VGFA 1NP2A 4H6RA 2DZAA 1EBHA 1GJWA 4JNZA 1Q7QA 3BSHA 4GJ1A 3BTNA 1JI1A 4O16A 5G5IA 3EX4A 1IXNA 2REQB 3TONA 4DBUA 3KX6A 2ZZ4A 1ZSXA 2R6OA 3VC6A 1BKSA 1KM0A 3HJEA 4JTEA 4FXRA 3M6YA 4NAFA 3WYZA 3ICJA 2BXVA 3GTXA 1MW0A 3UBPC 3L4WA 4URIA 1BG4A 2E1DA 5I3GA 1JZ5A 3IAPA 4C6DA 3MMWA 4H7CA 3U0HA 2DQWA 1RCQA 4CKQA 3NURA 3TJLA 1UUOA 2ZVIA 3T42A 4UTUA 1JXJA 3BOFA 4D72A 1BSLA 3NQ6A 4B5NA 2V5KA 1QOXA 3BSMA 1UASA 3T6CA 5EMLA 3PG9A 1O66A 1OYAA 3OTRA 2PDMA 4PUMA 4ADSA 1XD0A 1PZ2A 2DH2A 1HKJA 3VI2A 3D3AA 3N4EA 1HUVA 1EX1A 3Q45A 3TTEA 3LSCA 1AUSL 3WL1A 4QDMA 2Y1HA 4ZO7A 1B4EA 2BOFX 3VXGA 4QQ3A 3P80A 1LRQA 3L0KA 5G2WA 4JHOA 4US5A 5D02A 3R12A 3DH7A 3SO7A 2ZVRA 2WJDA 4PN2A 2W3ZA 4NZ1A 4TVCA 1ADDA 3UXAA 4B5TA 1LL7A 1XC6A 3T2QA 5I3FA 3CUZA 4AWSA 3HURA 4Q4KA 3RX4A 4B2DA 4RR4A 2ZC1A 2CIPA 3TN5A 4UTHA 1JCJA 1KM5A 4R7OA 1E3ZA 4TVDA 1S5NA 1CGUA 1RH9A 3L0NA 4HNVA 1R7OA 4FNSA 1QHOA 3D0CA 2F2KA 4UIOA 1EDTA 5ABFA 2ZTJA 4HJFA 4YS1A 4LJ3A 1G67A 4QJ4B 3H55A 2G97A 1E6XM 3M0XA 3FX4A 5HATA 2QNEA 2WHMA 5AY7A 3S0CA 3HZ3A 3S2CA 4EOUA 2PC8A 2YDAA 1BXBA 3BK0A 4R9XA 5CEWA 4C7FA 4FLQA 1G01A 2AL1A 4L1GA 3IJ6A 3ZSTA 3AMDA 1JYWA 3B8IA 2VTFA 4DAIA 1XSIA 3WDRA 5FIPA 3B04A 5I02A 1KXHA 4GKTA 4EWJA 5D8ZA 2PSNA 1XICA 3MYPA 3NEHA 1UD8A 3VNIA 5A94A 2HNHA 1W91A 2P53A 3QGVA 3EWWA 4XTDA 4PC8A 4W8BA 4OHQA 3TE9A 5KETA 2CFFA 2O92A 3ARPA 3GTNA 4W84A 4XKYB 3W00A 3CTTA 4P02B 2G41A 1W3KA 2GGIA 2WBKA 3STPA 4KCUA 4DYJA 2DUZA 3CWNA 4GFSA 3OLEA 2TAAA 4JEQA 1DTNA 5LIWX 1YBQA 2ZZ3A 2QCDA 3A4AA 3USZA 4PUNA 4C6MA 1SO3A 1VFFA 1F3XA 1KFJA 2I5IA 1BWVA 2QGYA 5AECA 3FVDA 3ONBA 1H7XA 2DV0A 3FYYA 4JHZA 4CU6A 4Z1CA 5TF0A 4L64A 1OGSA 4LWWA 4RXGA 3O0KA 2PD5A 4C6QA 3MANA 2J47A 2V38A 2ICSA 3TJIA 2I5GA 4CU7A 5CGMA 2FLIA 2H3DA 3W70A 1DWHM 4XO7A 8A3HA 4MPQA 3QQWA 3LK6A 3LRMA 4AX7A 1UKPA 5E93A 3DI0A 3LQGA 4JTGA 1F6KA 4RE2A 4PTVA 4ORMA 4J1OA 2WNNA 4C6JA 4GG9A 1TMQA 2VM8A 3RM9A 1J0KA 3N13A 4GNKB 1JYXA 5FEWA 1ONRA 4GVIA 3EZ4A 1TREA 4NILA 5D03A 1ODUA 3QZ6A 3BZJA 2G3IA 5JBFA 3ABOA 2YJQA 4LBRA 5AHNA 2VFDA 1OADA 3EDJA 3BL3A 1H09A 2FFIA 2QLYA 2VOMA 1N7KA 2D2OA 8XIMA 1PYFA 1FWCC 3MPGA 3T08A 4NIRA 1XG3A 1TMHA 4KFNA 3HGRA 4F2BA 5K2ZA 4KH2A 1PX4A 3SCVA 3H53A 3C2VA 3QMTA 2FIQA 4V15A 4JTHA 1GEHA 7ENLA 1EFZA 3HMJG 1J6PA 4JTQA 3TFCA 1TWSA 3N6QA 3O6CA 3O0FA 4S3KA 1WX0A 3CUJA 1UR1A 2DPEA 5EFFA 2HS8A 2XGBA 4ADUA 3UP8A 5IXEA 2WM1A 1THFD 1ZZMA 1HVXA 3T7VA 1SSDA 4QXIA 1TPFA 1W1A1 3WEZA 2BSLA 3N29A 4MWAB 5EFDA 4REQB 3WBEA 3L12A 3H7VA 4PMNA 1AJ2A 2WMHA 4K39A 3ABSA 1OT2A 4Y2WA 3GDKA 5K3VA 3I6EA 4EP8C 1FCBA 1IE7C 3FA4A 3LM3A 1IZKA 1E72M 3IPWA 1TPH1 4XQ6A 2BHUA 3IIVA 4RNJA 3C0JA 1OC6A 1VLIA 3UXDA 3N1AA 2O7SA 2E8YA 2CZEA 2VCCA 2VJXA 2NLYA 1EGZA 3N9KA 3C3UA 1GQJA 1ML1A 3THDA 1Q45A 3TYAA 1DWFM 4AY7A 5B80A 3QTPA 2VFEA 3G22A 3AXKA 4B5VA 4IWWA 1EZ2A 3HG3A 4Q8QA 3H24A 4CCEA 1A50A 5BROA 3VGHA 3IRDA 4AHQA 1V0NA 1TUFA 4MF4A 3F2DA 3AS3A 4MIMA 1SU5A 1Q65A 1FWNA 3T2PA 5LGZA 1GOMA 2WMIA 1HL8A 4LY8A 2V9DA 4FOJA 1H7OA 5L9FA 6TIMA 3WNNA 3WK0A 3O9NA 2H6RA 1L6FA 4YMZA 3WD4A 4B15A 1CGYA 3L68A 1JEZA 3OA3A 3SUWA 1W5OA 2YDRA 4O14A 1EWDA 4XBJA 4WXZA 4WK9A 3XIMA 4Y9NA 4XZBA 5J5DA 5I09A 3S83A 3DESA 1A5CA 3TXZA 1XLFA 5BU9A 5GJMA 3MUZ1 4KWSA 4UMBA 1V79A 2RH9A 2ESCA 1H0GA 3PBWA 1TE6A 3WUFA 2UY3A 3AHZA 2V82A 4AU0A 1A5NC 1ZS2A 2Z2UA 3KCLA 3FHAA 4AEOA 1V3HA 4A05A 4JCMA 4TR9A 3M7WA 4O0KA 3UY8A 1GYMA 1SW3A 3T81A 1AG1O 1F61A 1ONWA 2W92A 3G24A 4YVVA 1EEPA 3GTHA 4UFLA 2ACUA 4MLJA 4QNEA 4D8LA 5KZ6A 1PS9A 4WDWA 3S4TA 2X41A 3VYLA 3NAVA 3LCLA 1DHKA 2J24A 1W31A 5BU6A 3KW3A 3BICA 3QSTA 1GNXA 1S39A 3ITLA 3T4WA 3VIHA 3UR2A 3H12A 1AFSA 3DG7A 3FAXA 3PZIA 9XIAA 5D04C 3LXBA 2AQVA 2CZDA 3CEUA 1YPFA 1QPRA 4L4OA 5MKGB 1GVRA 3TKFA 1UPPA 2X1TA 2YCKX 4LEQA 2C16A 3MV01 4RXFA 3KS5A 1XPGA 5FEXA 5E0CA 2NZLA 4FX8A 2VGIA 2A6NA 3REQB 5LA0A 4V1YA 3SN4A 3BLFA 5J8LA 2A3EA 1H41A 2OWXA 1LBFA 4NX5A 2D24A 3HPZA 4IFOA 1E1EA 3NQMA 1GTEA 3ARXA 5M2FX 4QLJA 1VC4A 3WJSA 4L6DA 3TH6A 3W26A 3WQ8A 1N55A 2I57A 4MY9A 2GQ9A 2YCLA 5IFTA 2HVOA 4IMFA 1Q4WA 4DI8A 4Y96A 3A9IA 4MJZA 1JFHA 4QEEA 2OX4A 2PURA 4C7DA 1J79A 1UMLA 1V3IA 2Z0IA 1LT7A 4JEJA 3AALA 4EF8A 1JXKA 3CJPA 1OWQA 2J8FA 3U2CA 2C0HA 4MDPA 4JL2A 2PWFA 4ATLA 4PUDA 2I56A 3UWYA 5TD4A 4JIQA 2OYLA 1TR9A 5ABEA 1OX4B 3DEQA 3SAZA 4LRSA 1GTHA 5E70A 4Z0SA 1A5UA 1PDZA 2ZC8A 3W76A 3MCOA 4O1EA 3ITYA 2YXOA 4LW7A 1UC5A 5D9PA 3WMBA 2WMKA 3KOXA 1MRQA 2BY1A 3YPIA 3WK2A 1LQ0A 4O50A 3AWOA 2E6DA 4AQLA 4XD3A 1E6RA 1J0ZA 2GSJA 4BQ5A 1S2VA 4X2RA 1G7VA 3PP7A 1E4IA 6REQB 5T8GA 5E9AA 3GVRA 5A6JA 2WQPA 1NF0A 4ZSTA 3VU2A 1H7RA 3ZJKA 3W7NA 3H2OA 1QR7A 4GQQA 1KFLA 2FKPA 3T0AA 2VI0A 4ZTXA 4IFKB 1RQEA 4KWOA 1MSSA 5FF2A 1ZJAA 4XB3A 3EPOA 1JZ6A 3UERA 1A5LC 3D5HA 3BCDA 1XLKA 3P5YA 5G1TA 4A21A 1VFSA 3FA5A 1YRRA 3GW3A 4W4QA 2A5HA 4FNUA 2PDIA 3W73A 1U83A 1X97A 5LXEA 2QAPA 4OFCA 4JAWA 1M68A 4NSBA 4DZAA 4YJ5A 3H4XA 3T0DA 2HJPA 3EWZA 4GX9A 5M03A 5B7YA 3N2TA 2OMAA 4FLOA 2MUCA 2X0SA 3FY1A 4OVXA 1W0MA 3LLDA 1BRLB 2PWUA 5GJNA 2OG9A 1J18A 1DJQA 2QCFA 3EX6A 1M7OA 1KR0A 3LEPA 4RV3A 1Y7VA 4DNHA 4CUCA 3IIOA 5LIKX 4UTIA 4MB4A 2XIMA 4FALA 4F2UA 2Z6IA 3D47A 3IUDA 2YLAA 1QASA 4DUXA 1VPYA 3WQPA 1ECEA 1F3WA 5H1WA 5GNYA 1IT0A 4Y9OA 2JALA 2HTMA 5EMMA 4KWWA 1NOWA 2XVKA 1A5MC 1RBLA 2EPLX 4MY1A 3B8TA 2ACRA 3IV3A 3PTMA 1HW6A 4W85A 3NL6A 1JD9A 3HG2A 2X1IA 2FHFA 2PDCA 3VNKA 3CWHA 1E71M 4AFYA 4IQJA 1AH0A 2PWHA 4CQBA 3EX1A 3ANYA 2P5NA 1HKVA 4F9JA 4XKMA 2WW5A 4G7EA 5DCBA 3L4VA 3OU8A 3VCCA 3DFOA 1I6NA 3SSJA 3ZIZA 4KEVA 1UKQA 1O68A 1J0IA 2FMOA 1GGOA 5A95A 4HIBA 4WDUA 1RP8A 4Y8EA 2BB0A 2DSKA 3L0GA 1XLDA 2G3NA 1JYNA 4CD5A 1S46A 1UHVA 2YLLA 4A3HA 3KEHA 4ZCWA 1WCGA 4RPQA 1GG1A 2OLHA 2EPNA 1VBJA 3N3TA 4UMCA 1QI5A 1NWTA 4H8NA 2XH4A 3AZRA 3EB3A 3VPLA 3QY8A 1QPOA 3BW3A 1S1PA 1EGMA 3PPCA 2YA2A 4O57A 1G5AA 4G6CA 4BZYA 1TQXA 4OBSA 3EDDA 1WKEA 4F0LA 3PFRA 1PTGA 3NUKA 4U4MA 3NXFA 1OG6A 5FACA 1POJA 2ZA2A 1XW8A 3OZYA 3STCA 2DJXA 5A8QA 5D9NA 3NOYA 5AFDA 3QZEA 1UBSA 4IUGA 3QW4B 1I45A 1P0KA 4MPKA 3WLMA 2NQ9A 2QUTA 4LC8A 3CQ0A 3PSWA 4AVNA 4C1NA 3UU0A 3UWWA 1AQ0A 3GG1A 1U1HA 3NM3A 4HMNA 5TIMA 4PSPA 1OYBA 4LNYA 4NZ5A 3V3WA 1PJ9A 3LB0A 1JRCA 1WKDA 3ZLGA 4M19A 3LHZA 1OF8A 2Q8LA 2E5BA 3WCZA 2BV9A 4NF7A 3UWZA 3R11A 3S1VA 2G3MA 5LGXA 3LG3A 2D3LA 4WY0A 1DXFA 3TJXA 3BWWA 2JIWA 3MP3A 3RUBL 4IISA 3WDIA 4MSSA 2PP1A 3FJ4A 1M03A 3RK8A 4D6DA 1ZAJA 1EF3A 2D2JA 5T9CE 4O8AA 2QCCA 1FQ0A 1XLHA 4UQEA 3SDOA 3USBA 3FCPA 1GJPA 4DM2A 3U5UA 1NOFA 2QDHA 5JXQA 3B0YA 3I3EA 4AEEA 1YHTA 4BK9A 1G94A 3TSDA 3SRHA 3HFYA 2VCBA 1EX5A 2ZXDA 3B0VC 3S2LA 3L21A 4YWIA 4UQDA 5LIXX 5DO8A 3CAWA 3T09A 2DVUA 3STEA 2DVXA 3WNPA 7CGTA 3WQFA 2FPTA 2O56A 2FVLA 3N17A 1J01A 1E1FA 5F2GA 4WRHA 2XH7A 1LL4A 3HBLA 3M5YA 2C91A 1IEIA 4AZBA 4D8ZA 4HOZA 4O4VA 1H0IA 4K8EA 3NGFA 2YL6A 3G1AA 1SO4A 4QISA 5LSMA 3W23A 3WJXA 3UZJA 4Q8OA 5G4WA 1JNEA 3OHMB 4MHBA 2NX3A 3MHGA 1XF0A 2YPIA 4MFDA 2OFJA 3BG3A 4H4IA 4MUZA 4Q4QA 3UG3A 1LT8A 1XDJA 3IJQA 3SEPA 1W3IA 1OT1A 3ZWSA 2WWDA 2YA1A 2JEPA 1GQIA 1KM4A 3QN3A 4GZEA 4KW2A 3BJSA 4S3CA 2WVTA 3RU8X 1HIZA 5LNUA 3RLUA 3VCNA 1B3XA 3OGRA 5KINA 3V7PA 3HQPA 4J3WA 3KCJA 1OFAA 4XAGA 3PC0A 2WMJA 4AXNA 1TX0A 2PGWA 4N4QA 3TMQA 1VEPA 3HM7A 3TYBA 3VKJA 1RXOB 1TWIA 1CBGA 3RM8A 4LAUA 3QMSA 4MAVA 2R14A 4ZO8A 4WSHA 4PFMA 2D1ZA 1FVPA 3SY8A 4W5UA 4J9JA 3K46A 4US6A 4EK7A 1G9HA 1VPXA 3BCJA 4K38A 4O54A 3BG5A 3TOPA 5AHMA 1R0MA 2DFAA 4BA0A 3HPSA 1UKSA 2PRLA 4IMCA 1MXSA 1B3WA 1K4HA 1UR4A 3ZMRA 4QAIA 2O9RA 3R89A 3UCCA 1U30A 4QLKA 1HTIA 3EOLA 1I60A 2WSPA 4DLMA 1TJ1A 5DRCA 5LNWA 4FXSA 4L1XA 3GNNA 3CYVA 3FEMA 3WQOA 4IGNA 3PY2A 2CC0A 2PDFA 3P62A 4KRZA 1WNOA 3I4EA 1PE1A 3N4AA 1NTHA 3H22A 2QDEA 2VXNA 4FR6A 1ZENA 1QRQA 1Z9AA 4Q8TA 1V7AA 3UJEA 2Z2AA 1M9HA 2Z29A 4Q4RA 3OYXA 1X1NA 3RX3A 3GAYA 3O3RA 3AIWA 1DE6A 1UD2A 3DHDA 5TBOA 3TN6A 4LXFA 4JDBA 1SZFA 4UR8A 2CWNA 4J3XA 1O5KA 1KBIA 3GKAA 3LYEA 2AGKA 3MUCA 3ZR4A 3GWQA 1OJXA 3V4BA 5D33A 3LTPA 2PU1A 3KOYA 4UOJA 3TQPA 4ACZB 1K9TA 3AUOA 6A3HA 2V5CA 2DSVA 4H01A 4PMDA 4KESA 2PWDA 4Z2KA 1JDCA 3RDKA 3KS6A 1V93A 1XXXA 2E9LA 3OA5A 5LA2A 1BXCA 2WSYA 1QUMA 4GNJA 1D3HA 3T55A 4HBKA 4DBSA 4PBGA 2I14A 3I10A 1V6WA 2Y8UA 5I23A 1FWIC 2GVLA 1RK6A 3FHQA 1DJHA 5DBTA 1S1RA 4E2VA 5I7GA 3N6HA 1JL8A 5D37A 1RPKA 4MZYA 4JTJA 1QTWA 2E5DA 4IPPA 2QPSA 4H83A 1UC4A 4BI6A 1DWJM 1POKA 3W07A 4GBDA 3QGAC 1TPVA 1KBJA 1K4GA 4QROA 3MWAA 4XAFA 1SZEA 1R7AA 1AH4A 3NJ3A 3G3MA 3QV7A 2DIJA 4X2PA 2FHCA 1BF6A 3FEQA 1PYMA 4Q4OA 1UB3A 3FDKA 5FEZA 4BEUA 3SGUA 2DZWA 3QKZA 3MJMA 3TFXA 1K70A 1H63A 4NY2A 1E0TA 3EWUA 4I90A 4NI3A 2HXUA 4IOTA 1FY6A 1Q85A 2J4GA 2ZX7A 5JQ9A 3IRSA 1Q6FA 3ZWTA 2J7BA 2VCAA 2WCAA 3L66A 3VNMA 3ZM8A 5HQEA 3OQEA 4HJWA 4DIAA 1K6WA 4IX2A 1O95A 1ZP4A 3VDAA 3WBWA 3LS9A 1QBBA 5A6SA 1UOKA 2BGSA 3EKLA 1KTBA 4UTTA 4W8LA 3TWBA 5D9MA 1CGWA 1IF2A 4Z2HA 2QXWA 5KMYA 4UTTC 4CN1A 4H19A 4C60A 1PVNA 2WXDM 4QHRA 4W5ZA 5I79A 1FWTA 3BW4A 3UY7A 3GC5A 1QT1A 1ZQ5A 1Z7AA 3E2VA 4FF5A 3VMOA 4IX0A 4W87A 4NJGA 4AD2A 1ME8A 1CXHA 3N2OA 2F6XA 1GONA 1V0MA 1HJVA 5LKYA 3U5YA 2O4QA 3GSMA 4XIMA 4FNPA 3C2OA 1QO5A 3Q4DA 4NX0A 5EY5A 3WQ6A 1CGVA 3LENA 4GA8A 2PD9A 1KTCA 2R1KA 2F6KA 1TPB1 3P67A 2PODA 4X9YA 4GACA 2Y89A 2YXGA 5DRIA 1LF1A 2WVVA 3R8RA 3KBWA 1V3LA 4PODA 4D6HA 1W3LA 1XLMA 1OFDA 2Z2BA 1M7PA 3MW7A 4M56A 1LOSA 1VZWA 2TRSA 3H6OA 3WUBA 1GQLA 1PEZA 1RA5A 1NY1A 3V36A 4PB5A 4DUOA 5C9XA 4S3BA 1NFBA 4J2MA 4UOQA 3L23A 4LVDA 1HO1A 2HVNA 2WOQA 1CXLA 4NNBA 3IIZA 3ES8A 4P2VA 1NARA 4IL2A 3L4ZA 3MVIA 3LV5A 3WBYA 5HNUA 1UJPA 4PTMA 2VX4A 4YTQA 3NO5A 3BARA 1XLJA 3S9ZA 5E6YA 3NO3A 2QPXA 4Y9AA 2HMCA 3OQ8A 1SJDA 4IMAA 2GJXA 4FOKA 1SR9A 2QJIA 3NPVA 4NXSA 3VNLA 1NH6A 4HA1A 4KMQA 3A6OA 3BZGA 3VINA 4U2YA 2GWGA 1LDCA 5FJRA 3C2FA 1AL8A 3KVJA 2Y70A 1KFBA 3WQWA 4NQ1A 4LCSA 1I0BA 4H00A 1XL9A 3KP1A 1XLCA 3NFUA 2NSXA 3NNTA 2CLPA 3SIZA 2NV2A 2YSWA 1HJUA 3G1SA 3P93A 3S47A 3UYIA 4OE7A 1ITXA 5E6ZA 2AMGA 3DHPA 1WDQA 2HCVA 1VLWA 2BODX 1S2CA 5IDIA 2ZCGA 2NWSA 1DPMA 1LL6A 1C7SA 3WFLA 1U5JA 1Y5WA 3PANA 1UUMA 3W1QA 2IPFA 4X9SA 3L2LA 3WF2A 1MYRA 3WENA 1LLOA 4MUPA 3S1GA 1VAHA 4QG6A 2EBNA 5LIYX 4S3DA 1IWBA 1C91A 2Y61A 4DBWA 4H9ZA 1FFRA 3GK0A 4D6FA 1X7FA 3M0IA 4JTTA 2OEKA 4WDXA 3GH7A 2H3BA 1D2KA 2OWCA 4JY8A 3KHDA 2B7QA 2DZXA 2Y5JA 4HA3A 2YIHA 4DEFA 4AEFA 2C1HA 1ZAHA 1UWIA 2YZ5A 1YE4A 3GR8A 4PULA 4E6MA 2XIOA 2CBUA 2OSWA 3ZVIA 3BGAA 3I68A 4QCEA 1PTDA 2HPMA 3CK5A 1WZLA 4HPGA 5AOUA 2TSYA 4KGLA 4WHBA 2TYSA 4RNIA 1RBOB 1UCWA 1YW1A 2WKLA 4MNJA 4HB7A 4KFPA 3A24A 4AZ7A 4HZMA 2VNCA 7A3HA 1F3TA 4P8UA 1UW9A 4WJXA 3VGEA 3OODA 5BRBA 3TTOA 2KAUC 3WQGA 1E4LA 1RSCA 4R88A 4K37A 3PUGA 2PGEA 1OM0A 4MB5A 4M6VA 3LDVA 3CUGA 1GZJA 2A3BA 3QR0A 1OK6A 2A6LA 3TLQA 3CL7A 1XGZA 2PP0A 3KTSA 1EWEA 4GISA 2OZTA 4YTRA 1B3YA 2QW5A 3Q2DA 4HMEA 3EKZA 3TYZA 3KL5A 4G1NA 4HYWA 1Z89A 3IEBA 2FZBA 4W7VA 3VIJA 3APGA 1ZCCA 3A4JA 4IXHA 1AODA 2V5LA 4DQWA 3EWYA 2OZ3A 1WOBA 1B9ZA 3MI3A 1TQJA 4J28A 3B8WA 1W9UA 3EX2A 2DP3A 3PBVA 2ZOXA 1TA3B 1X6UA 5CQ1A 3UZWA 1EPVA 2YCIX 3LCHA 2PWEA 1L2UA 1JCXA 4DO7A 2VZUA 3BG9A 4RNHA 4L9XA 4N0RA 2XGZA 2CHOA 1Z44A 2WVSA 1QPQA 4YVPA 1P0NA 1WP6A 2AQOA 1XBVA 4XO6A 4ZQNA 4DY1A 1MZRA 1EOKA 1AW2A 2NX9A 4F4RA 2IUZA 3GX9A 4IPLA 2BGQA 5AC8A 1GZGA 1KFWA 4E2BA 4IIFA 1BGGA 3MDWA 1I2QA 2XN2A 3WF0A 3EAUA 2BFGA 5DY2A 2PRHA 5B7ZA 3BC9A 1XX1A 1W9PA 3E74A 3AWNA 4UQCA 2ZADA 3N2MA 5AYXA 2RDUA 4PTXA 1OZMA 4O4WA 5C6MA 2UY4A 2X09A 5C55A 2J9ZA 4BQ4A 4J5NA 3KL0A 3PZVA 4NASA 1XBXA 1TV5A 2ODOA 3B8UA 4GY0A 2BNJA 3WQ5A 5FJJA 2VX7A 1BXNA 1UZDA 1M1BA 3GR7A 5I24A 3G18A 1QI4A 1KWKA 5HANA 4GLEA 4KIRA 1XYFA 3QLLA 1XCWA 3SRDA 2ZYFA 2PWVA 1LBMA 2PTWA 5D2TA 4AD3A 5M5DA 2RDXA 1SR0A 5HA7A 1H11A 5J04A 2ZX8A 4DZIA 3U4AA 3URQA 1XPYA 4KT2A 2JF7A 1DIEA 1HN1A 1TJPA 4MMWA 4X63A 3N25A 1CDGA 3BURA 3WLNA 1LJYA 1MEHA 4P7NA 5ECVA 2V5JA 4AVFA 5FA5A 1GW9A 1EYEA 2YKKA 5CPTA 1BD0A 3FK4A 2FZMA 4XZIA 1VD6A 4PRRA 1JDEA 2W67A 3LGEA 4UTMA 1K77A 1H7PA 3QC3A 2GSHA 1ADOA 3Q67A 4ZTYA 1KRAC 2G95A 2O0TA 1EJ7L 3DG3A 4Q7NA 3THQA 4U33A 3JR2A 3ME3A 2FH6A 3MSGA 3U9IA 2Z27A 3WN6A 3R94A 1ZGDA 4GZ7A 3NEVA 2F8QA 5BCAA 4JYDA 3O05A 1ITQA 3MY9A 3FSTA 4MNMA 2A3LA 1Z41A 1KXTA 3W22A 2E6FA 3W2NA 3S3GA 4OWGA 4MGGA 3CEPA 1GPWA 3WBAA 2P3ZA 3G6MA 1KRMA 4GIYA 1EP1A 4AXKA 3M0KA 2O9PA 4HVXA 1VGAA 2PE4A 1CXIA 1XRTA 4D6GA 2JK2A 2W66A 1JCNA 2PCEA 3B0UX 4M51A 1E56A 2JKAA 1OEPA 3P8IA 4AX6A 3JS3A 1B9BA 2C71A 2VFIA 4M1RA 2A79A 1BGAA 1BHGA 4JFVA 4YXGA 2CESA 3AHXA 4HZ7A 1W1ZA 1DJYA 1IV8A 4E8CA 1WDWA 2CZVA 2QJGA 2R94A 2GDUA 1X6NA 4IFRA 4TX9A 4NZFA 4A6GA 2ZUWA 3L5MA 5EBAA 4GJIA 3BUVA 1YNPA 2E6YA 4N2YA 2ZRYA 2B0MA 3AIBA 2VZOA 1PB0A 1Q8AA 1CLVA 3DG6A 2D0FA 2PDJA 5LIUX 9XIMA 1W3JA 3SQSA 3HQ1A 4J7RA 4LUSB 3SGGA 2VEFA 4GFIA 4FS9A 1VS1A 2ABBA 3TZFA 4HG6B 3ZR6A 5I2UA 4LPCA 5I3IA 3BMWA 1GPFA 3ZZ1A 4QE5A 3OG3A 3WLOA 4F0MA 4K8HA 7XIMA 1N8IA 3KRBA 3QOMA 3KDNA 2PBGA 4RPPA 4NHVA 3PN8A 1WQ5A 1F4AA 5FL0A 1G69A 1CNVA 1QO2A 1TJRA 2Z28A 2CITA 3MBDA 1XUUA 2IXVA 3A4XA 2GFTA 3P84A 2X05A 3TROA 3MUIA 1GCYA 3RLGA 4H3DA 1CI1A 3VKDA 2JBMA 4BR1A 2C0AA 2GDVA 1ICSA 4RZ4A 2B4GA 5G4EA 1JQVA 2QVHA 1P1XA 1QNRA 3R10A 3EYPA 4ZFMA 4NJJA 2FVMA 5AN7A 4ADTA 1ISXA 1O4UA 2NVAA 3AI0A 4XKYA 3QXBA 2ZDRA 4R7WA 4JKKA 2GPTA 2PLCA 5JUVA 3WMSA 1SQ7A 1TR1A 1OSEA 2Z1XA 5CJ5A 1FCVA 3G8EA 4JIRA 3ZT7A 1OFRA 2X42A 1UP2A 3R43A 3UXLA 1CTNA 4GD0A 1KV5A 1WAUA 3R79A 4JQ4A 1WYIA 4GYPA 1G1YA 1M7XA 3C4UA 1S38A 5M17A 2J7FA 4GYPC 4PRWA 2A2IA 3PPGA 1OD0A 3HPAA 3SFKA 4DWSB 2DZSA 1D8WA 1RALA 3WF1A 1QFEA 4I7VA 4ACYA 1GOIA 1W3HA 2IQDA 1JPDX 3PWIA 1R38A 5HNTA 1C9WA 2AL2A 3AICA 1HGYA 3RJXA 4MB3A 4J3ZA 3UCDA 1WPCA 4YYCA 3AFBA 1P7TA 3NSXA 1FKXA 4NZJA 3K2GA 4C5ZA 1F7BA 1EH9A 4NL1A 3CZGA 2WK2A 2CHRA 2YL8A 3VO0A 1NWSA 2Y85A 4GVGA 3OB8A 3AYTA 4YNGA 1ZP3A 3B9AA 4ALDA 1PX8A 5HNNA 4MM1A 4IMGA 2IMRA 4LB4A 3C86A 4LUTB 4Y90A 1NQKA 3FXYA 1VRXA 4AZHA 2PDWA 4LGXA 1VIZA 5CKSA 1TWWA 3N3MA 3VD5A 4GUIA 1RCXB 3IWPA 3TUUA 3QV9A 1MQPA 1Q7ZA 2ZIDA 3MV11 2VKZG 4KKXA 1LLZA 2PDHA 3LHYA 4O15A 1LQ2A 5CZTA 1IWPA 4JN7A 5MHBA 1A5SA 1U22A 3L5AA 4GVFA 3FJNA 2Y7DA 5XIMA 1OG0A 1PX3A 3L4YA 4UXDA 1XFBA 3VDHA 2GLKA 1R9YA 3MCNA 3GW0A 2X2YA 2WO5A 4QR6A 4EXBA 1X96A 3DFHA 3UGRA 4J3SA 4B5SA 2PWGA 4PCTA 4BWLA 2XJ7A 4A3YA 4AD4A 3E49A 3BCFA 2YBVA 4BWLC 3PWGA 1GKPA 2WANA 4NJIA 1S5MA 4DNMA 4PB3A 4GXWA 2QGHA 1TV3A 1E70M 2J74A 1XBZA 3FNDA 3MZNA 1P48A 4WGXA 3CUIA 3P5ZA 2WPBA 2C8NA 4BEQA 1FWFC 3QY7A 4F8XA 1JZ8A 3WDHA 2PAJA 3AHTA 3PZTA 4U31A 2TMDA 5FAJA 3AC0A 1YLVA 3NDYA 4F0HA 4JOMA 5DANA 4CD8A 2DZBA 2R1NA 3O07A 4N7QA 1WDDA 1CECA 1GVSA 3UF9A 2PPGA 4E2DA 3PUEA 4WSKA 3SBFA 4O1AA 3W1LA 3K8KA 3QY6A 3LBMA 2R91A 1UIOA 3SN1A 1KLYA 3TX9A 3VGGA 3PG8A 3AS0A 3IJLA 2VEIA 2QHAA 1V02A 4UR9A 3KE0A 3N2XA 3HG4A 5FJPA 4PUJA 4B5UA 1EUNA 1FWJC 1C29A 1HO4A 4OTKA 1EZWA 3RN6A 5BXSA 4TV5A 1XGEA 2PGRA 3GNRA 3S46A 4JQAA 1DWAM 1R8LA 3GE7A 4LVAA 4PUKA 3P8JA 3AU6A 5FSEC 3FGCA 3B4UA 1W32A 4GUGA 4LUIA 3QLDA 2P50A 2G50A 2Y4SA 3ATZA 1BTCA 4K36A 2CW6A 4S3EA 1VBGA 3BOXA 2J7HA 3QHMA 1X38A 5CZ0A 4IIEA 3QMRA 1F74A 4GOAA 4Q8PA 1S3TC 1NDVA 5CJNA 1MFUA 4K6AA 3P3BA 2A1YA 2PUZA 4A3RA 3NZGA 3N04A 3A47A 1EBGA 5JVLA 3DKJA 1BWLA 1GKRA 1UPMB 4I3GA 2YA0A 3FN9A 3I7SA 1FHDA 3OEXA 2BVWA 3ARQA 4WD0A 4AF0B 3GHRA 3SUUA 3HGSA 5ABGA 5AHIA 3ZYZA 2BG5A 2VX5A 3ARSA 1XR2A 3BOLA 3DX5A 4XV0A 4IIBA 2ZRVA 3C52A 1V4YA 3E0FA 2F7FA 1X1OA 3I6TA 4EVZA 3IARA 1TSIA 4ROPA 8TIMA 4DYEA 5IFPA 2NQ5A 4OQVA 1UP3A 4R53A 1MVYA 3SQMA 3EMQA 3DFTA 1T8QA 2BHYA 2CBIA 3NYZA 1S2AA 3G77A 2X1RA 4OOZA 1GKQA 1KGUA 3LMZA 3TIMA 3LCGA 4ZBCA 2NUYA 3KRUA 1GQKA 1PV8A 3Q94A 5CG7A 3AIQA 4LVGA 1QJWA 1W1TA 4C1LA 1YBQB 3E9AA 2QCDB 4JCLA 4RNFA 2O9TA 2X0YA 4TMCA 1A0EA 1ONEA 3REQA 1YXCA 3A13A 3KBVA 1XIJA 3NSNA 3NPWA 4DXXA 3CHDA 2VT0A 4DJDD 3WDJA 4E3TA 1TIMA 1FKWA 4IUOA 3B9OA 4I7UA 1D7KA 3L2MA 3H7RA 1EP3A 5AKQA 4JDYA 3P7YA 2P8CA 2KX9A 5CLWA 5K9DA 4Y7EA 4ICMA 2NUXA 2E8ZA 1GOXA 4WGHA 2I1OA 3DI1A 4M29A 2DSZA 2Y7GA 4B9YA 1JULA 2XWDA 2EQDA 3PNUA 1OX4A 4B16A 3P60A 5K7JA 1TPDA 2HXTA 3LA4A 3I4KA 4X3ZA 4E2OA 1OGBA 3UVIA 1M04A 1H5YA 3SJ3A 3CAKA 1K8XA 3M0MA 1OX6A 5DCDA 3NQBA 4H9TA 1LOLA 4MJMA 4LV4A 3VUSA 2CHNA 5A6AA 4YVXA 2J77A 1O5RA 2EO7A 1LYXA 1VJZA 1ZJHA 3VMPA 2A21A 2GK1B 1TTJA 3G1FA 4TMBA 4MTVA 4V33A 4DBDA 4H6QA 4PR4A 3C5QA 1ICQA 5DXYA 2LLEA 2OTDA 5CG0A 2ZQ0A 3LUTA 5DBUA 1HG3A 3E38A 2Z1KA 6REQA 5I3KA 3W87A 4HN8A 2C3ZA 2R1PA 1HKMA 1XLIA 3ORWA 5HMDA 4JFTA 2CLLA 3I65A 2XTKA 3CLMA 4AWTA 3SQLA 2V2DA 4Q8NA 1J0YA 4QTGA 2GGGA 1AK5A 2W61A 2VC5A 2Z24A 3GXTA 2VRKA 2Y0FA 3BAYA 5C70A 1KRBC 2VDIA 1M5WA 1X6LA 2YL9A 3W1XA 1N8FA 1XIHA 2V3FA 2JFEX 4WCJA 3NZQA 1GVEA 2WC7A 3B40A 5IHRA 3M16A 4WUIA 1E5NA 1NQ6A 4R5EA 1EGVA 2OXNA 4CD7A 4RE4A 2PEVA 4M6UA 1G7UA 2C18A 4UQ9A 1UH3A 1EKOA 1JDAA 4IZGA 3CV6A 4IP4A 3U4FA 4Q4SA 3VCRA 1T40A 3KTCA 1P1MA 1BRLA 1FWDC 5CCZA 4KS0A 4UQAA 2DORA 3T4CA 5HAOA 1GVYA 2E3ZA 3DENA 3H4WA 1LORA 3IUIA 1XV8A 3F5LA 5CBBA 5CSSA 4UCGA 4CN4A 4IJBA 1CB2A 2WMIB 5F7UA 2NXHA 3G2GA 3BQ6A 3DHUA 3GU1A 4TXEA 3BJFA 4ZL1A 2E68A 5AHEA 4OGZA 2JF6A 5D05A 2C79A 4YTUA 2VDGA 1KGWA 1V3MA 1AJZA 4AC1X 3WLIA 2VFGA 4RCXA 4K1WA 1A49A 2NT0A 1UYQA 2FB2A 4O52A 1A80A 4ZSUA 1TWZA 1WZAA 5FD0A 2DZPA 2WPGA 3WY1A 3V35A 3CMGA 4OJYA 5L6UA 1TFVA 3B4YA 4PMQA 3OGVA 1KXVA 3VIFA 4PB4A 3OLGA 1EPXA 3TP4A 1J5TA 1XLBA 1WE5A 1EEXA 3PZ9A 4AZCA 1J2WA 4LALA 1KQYA 2FTYA 3WD1A 2INFA 1ZPTA 2F9RA 4HHLA 4LYRA 1W56A 3O7UA 4RL3A 1JDFA 2D0GA 1Z48A 4YHEA 1V03A 3OO2A 1A3HA 4QDWA 2PDGA 1BPLB 4L4MA 4JBRA 5KZMA 3R5EA 3CC1A 3QHNA 3W6YA 5CLTA 1LLWA 5BOEA 1EOMA 3CPGA 4P7RA 3EEZA 4Q8UA 3QM3A 3VZYA 2WM0A 4FNTA 1EYWA 4GXPA 4NT0A 3FA3A 3DIPA 3PJXA 4AD1A 1GQNA 3K8MA 3CMFA 2WB5A 5PTDA 2VR4A 1H62A 4HYRA 1WUFA 2P0OA 4F2TA 2DGAA 1V3JA 3UG8A 3EDEA 9CGTA 4XZMX 3WQ4A 4GQRA 1TMLA 1B4KA 2OB3A 2ISSA 3TN3A 1X7IA 2VWSA 1AH3A 5D4YA 1W8GA 5H8MA 1EJVC 2GVJA 2YYUA 3F2CA 3P0XA 3BLOA 1QI0A 2RDWA 2VL4A 5F1VA 3SRFA 3GIQA 3UWQA 1PHWA 4BS0A 5DMLA 5ABHA 4JD4A 3N14A 3F5KA 2A7PA 3G0UA 3TVAA 1TG7A 2QCNA 4A3UA 3GB6A 1XDLA 5CXPA 1TZZA 1ZNNA 4U5KA 2JGQA 4ORIA 3S5ZA 2OT0A 3UESA 4GQBA 5CZKA 4N9DA 3TC7A 4DWSD 4S3AA 4ML4A 2WYSA 2VUYA 3PS7A 3KWXA 3VD7A 2WAGA 4MJ4A 3INPA 2UZ9A 4QS5A 3S6OA 5AYIA 1W1PA 4GYJA 2WNZA 3KDOA 2VD8A 3EMZA 4Y9PA 3SSZA 4DJFD 1CENA 2VGBA 5C0QA 3WNKA 3MSRA 2Q8ZA 4O18A 3K5XA 1TTIA 2J62A 4C6PA 2VFHA 3VOFA 3MO4A 2B7NA 4QLLA 4HHPA 5HWNA 1DQUA 2R9RA 4YCOA 3SCTA 3MP5A 1Q8JA 6CGTA 1ECQA 1FH7A 1Z42A 1IIGA 3V5CA 2E25A 3W25A 1IT7A 3MO7A 1VFLA 2QIWA 1VH7A 3W01A 3KLLA 2FJUB 1VF8A 1GZ1A 4N6FA 1TELA 2QJMA 5A6MA 3GLCA 4HNLA 3O6YX 1UJQA 2BWGA 3OLDA 4Q6JA 2VDHA 4N9EA 4UFKA 2TODA 1BSIA 1J10A 3K4WA 2PTZA 3UR8A 5HXMA 5HK4A 3W7OA 3WO8A 3U48A 3UZ5A 1LUCB 2J13A 2J7CA 3AXIA 3E02A 3T44A 1K7FA 1YIXA 1J2BA 3FJLA 2P1FA 2G37A 1XH0A 4E4FA 3I7RA 2CKRA 4MDOA 1TPEA 2CXEA 5HDRA 3WLHA 1MNZA 2YGYA 2VP8A 4Q7BA 3H8AA 2FDMA 3W2LA 3EPMA 1DJZA 4N42A 5EMJA 1R2SA 4Z2IA 2I16A 2XIQA 3UA4A 1BLIA 3FLUA 2E28A 4P00B 1WXJA 1WDRA 1K9EA 4TVUA 2MNRA 4PEKA 3WLSA 3OG2A 3VIPA 3M44A 3OOQA 1C3FA 2NVDA 2EPMX 1VCGA 1BYAA 4PMVA 5DELA 2RJHA 3QOKA 2H90A 3S42A 3L5LA 3BXWA 1PCWA 3T2OA 3F1QA 1JUKA 2XWEA 3K4DA 3U8GA 3KL3A 1YDOA 2XVNA 1KM6A 4AMAA 2B31A 2V68A 4FHAA 3D3FA 1OFBA 3TTSA 4HTYA 3UR7A 1AQFA 1FWGC 1R86A 5K9XA 4QAWA 4PSRA 4AD5A 2DIEA 3TJ4A 4K7VA 3VC5A 2QUVA 1ICPA 1TRDA 5BWAA 4JN8A 4FXFA 2A3HA 1TJ2A 2Y5SA 1ENUA 2FPYA 4B2DD 3LBOA 3VK5A 5C9RA 5IBXA 2EPOA 3BLLA 4TU1A 1J4EA 2FDSA 2DH3A 5DXXA 4ACZA 4UC5A 4FSAA 4Q3MA 2CLEA 1MO0A 3THAA 3W1UA 4WJEA 5EMKA 1SVDA 1ZHAA 5CGQA 4O8RA 4JFWA 4C65A 2VEPA 3E12A 3GHTA 4V1XA 5I3DA 1Z8AA 4RJEA 1TX2A 2RFGA 2OO0A 5AC4A 3ZVHB 3K1DA 4XVEA 3BDKA 1RP9A 2P0IA 3P0WA 3KXQA 1E1CA 2E0PA 3GUWA 1CXFA 2X7VA 4GYKA 3VFLA 1QWKA 3NGJA 2W5FA 3CUHA 1CCWB 1ISWA 3W7KA 2OR2A 3RNDA 4PE8A 1MW3A 1FHLA 3S1UA 3B9EA 2PZ0A 1K8CA 5D09A 1EC8A 4U3AA 1HF6A 3IJ9A 3KRZA 4PYSA 2YZRA 4F9DA 4EPDC 2WZHA 3AMGA 3DECA 3NO1A 2ZA3A 2ATSA 1J12A 3HN3A 3QQ0A 4CQ8A 2EAWA 5E1QA 1B31A 2WJZA 3QRHA 3AOFA 4L5ZA 2CLMA 3MSDA 1F6YA 2FVKA 3QVQA 4MG4A 1G4TA 4AHOA 4QE4A 3M0JA 3A5FA 4JIEA 2BY0A 1MRAA 3P2VA 4B92A 1KC7A 1E6PA 4LY4A 4EPEC 2ZRUA 3G1VA 2ZRWA 3A22A 1DKWA 1ITCA 4HK6A 3TU9A 5AHFA 1M3UA 4JTSA 1RV8A 5CAHA 2WBGA 2VVNA 1ITUA 1JG9A 1X1ZA 3PBUA 4PBFA 3VE9A 4R34A 1M41A 2Z1WA 1OZQA 2OSYA 3RJYA 1E3XA 4ENLA 2GUUA 3RLHA 2ZX9A 4HNOA 3QYQA 5I5RA 1EQCA 3AO0A 5LNSA 5AZ1A 1KO0A 2PI6A 3GG0A 3LTYA 3W28A 3WJWA 4GHRA 1SUXA 2E77A 4IICA 2PTDA 1F76A 4GI8A 4IPJA 2YDQA 1WXYA 3IJDA 2Q09A 1ZUAX 1F6PA 2IKHA 1REQB 1VFTA 5IHSA 2J8TA 3KBSA 1NIUA 2I17A 4JQ3A 1RCOB 3J7HA 4JNYA 4O19A 1UH2A 1ME7A 3M64A 1R2RA 3DAQA 3SM0A 4HK7A 2OKTA 5BZAA 3RHGA 4ZVJA 3WF4A 2QMKA 5JH2A 3OBEA 3RITA 2YCEA 3TC3A 3VOIA 1V08A 3GXPA 3PB0A 3TYDA 4GQ0A 3THUA 4HPNA 4XZHA 2OT1A 4LT9A 2CPUA 3CT7A 3O8AA 2ZFAA 1L2QA 4BF5A 1E43A 5CSRA 2PRMA 3B06A 2BOGX 3I3BA 3LI0A 3RRXA 2VZSA 3EX3A 1FHUA 1XYCA 4UZSA 2OJPA 4I9JA 4L9YA 5G2HA 1OGGA 1D3CA 1QOQA 4LYQA 3NQCA 3W7PA 2WV8A 3W71A 4E0CA 1IEXA 2J9XA 2XVLA 3GDMA 4GE8A 4LANA 4MB1A 2G4FA 1XIBA 1ZTVA 4N9CA 1E9LA 1NF7A 5KSWA 1V6UA 3P61A 1UKOA 2YFNA 4PH6A 2GUBA 3SFWA 1J96A 1BQGA 3VNDA 1C9DA 4GZJA 3AHVA 3S1XA 3TOYA 3H2FA 1PKMA 1E6QM 2WJEA 4KPLA 4W7WA 1W8SA 2GJLA 4GABA 3NL2A 3M41A 4H41A 1I2RA 4A8LA 1JF6A 2G8ZA 3IGSA 3AXXA 4W88A 4AWUA 3VKCA 4DLFA 3F7JA 3RRAA 3BMXA 2FTPA 4GY1A 2EGZA 1KM1A 3W6LA 4Q22A 3AS1A 1GOOA 3HMCA 1B2YA 3O2LA 3VZZA 4QBXA 1XRSA 3N2BA 4MJ2A 2HROA 3H7UA 3E2QA 4HPXA 4FO4A 1CLKA 3NM1A 2QYGA 4FMVA 2RKXA 4JTAA 3V16A 2E5CA 3D46A 3TAOA 4JQ1A 3SW6A 3LLXA 1FWSA 4ZQPA 1A47A 5K9CA 2C7FA 5HINA 4GIEA 3B0PA 3ATYA 3DFQA 3URBA 4AIUA 1Q6QA 3NZPA 2NV9A 4WVXA 3H2EA 3CNYA 3EB2A 4JTLA 3W9ZA 2VVSA 2Y62A 1KRCC 1ZBCA 4O11A 3SJNA 2QPUA 1VFHA 3PUDA 1H1YA 4XUGA 2ABAA 4XZWA 3R4IA 4HN4A 1H2JA 3FDGA 1EL3A 1TJ0A 5D8WA 2ZUTA 1S5VA 4LS2A 2VQUA 2WLZA 1G6CA 3T05A 5D2YA 6XIMA 1R87A 2XUCA 1UOZA 1LG1A 5CAKA 3PFMA 1VENA 1IEWA 3GDTA 2IKIA 1W9DM 3GXNA 1JFXA 1K6AA 3GXDA 4HSHA 3K1GA 4QITA 4HU0A 1NSJA 1GOQA 2CERA 3QTGA 1N82A 1YTDA 1EJRC 5C9ZA 4M5PA 1YE6A 2ISWA 2OSXA 4GVHA 4NJHA 1XGDA 3OVPA 1JPKA 1VQTA 5AC6A 4E4UA 3OLIA 1IEVA 1RAKA 3ZJ7A 3AUJA 3IACA 1WDSA 4D71A 4ERAA 1AD1A 4JFUA 3QV8A 5C2CA 3QJAA 4DF2A 4FPSA 3NZRA 2UY2A 2IQTA 3TXVA 4HT3A 5TQLA 4LV9A 2EHHA 1TYGA 4YWSA 4JPGA 2FZ8A 1A4MA 4Z2JA 1H5VA 2FZDA 5A6BA 1DIKA 1L8NA 2Z4GA 2IKGA 3VE7A 2V0TA 2OEJA 3PPFA 4DF1A 3W83A 2Q3RA 4GI6A 3O6DA 2AKMA 2RGMA 3AAMA 1IGSA 4JIIX 2L5HA 3G1HA 2GJRA 1R3VA 4QSHA 3WK3A 1DJXA 3NIYA 3A3WA 2GGJA 4RX0A 1QNOA 4YPJA 1FHVA 4K2SA 1FWBC 3QH2A 3G0SA 3N2CA 4WIWA 4DJDA 4O0ZA 3H26A 2X40A 1V0LA 4NZ3A 2VEKA 1PAMA 4J4KA 2W62A 4JKMA 1TIWA 3M07A 4EANA 1TVPA 3R1ZA 2ISFA 3EOUA 3KTXA 1XYLA 2IKJA 4LRTA 3EWCA 4WKHA 2XSAA 1G4PA 2VEMA 3IIPA 2V3DA 4G9PA 1H1NA 1QW7A 5U4NA 4R9OA 1JD7A 1LQAA 3R58A 4ZENA 4FF7A 1XFCA 1R85A 2WQDA 1UZ4A 4GBUA 4R85A 2C19A 4LEFA 1WBJA 3VOCA 3POHA 1MFVA 2D20A 2XINA 1AJ0A 4B5XA 4PMZA 1BG9A 1CEOA 3APYA 4P8VA 1DTUA 5CH9A 5F2IA 1F3EA 1FH8A 1E4MM 4GUFA 3W81A 2OQYA 3CQJA 1TWDA 2EJAA 1KFEA 4PCNA 3R13A 1GVIA 3W3OA 3JU2A 1FCQA 3CQHA 2R1MA 2XFRA 3VDGA 1ZRQA 3CZKA 3PTDA 4GJJA 2E9MA 1PZ3A 1OQFA 1ZALA 3R8HA 5DT7A 4MKSA 1W9BM 1IGWA 4Y6GA 3VX1A 3H2NA 4FI4A 3HPXA 4DUVA 3THCA 1C8VA 4HSOA 4X60A 3PB2A 3IJ7A 4L6HA 4ZOAA 4BY3A 4OU1A 4CNNA 2ZDSA 1MXDA 2QV4A 1XIDA 3GD6A 2JE8A 3M47A 2Y2WA 2QMJA 1FUYA 4LBSA 5J5RA 2ISVA 3CZ8A 3RXZA 4C6NA 3BLDA 3SY5A 1FH9A 1OFQA 1VB9A 2DJLA 3NXLA 2XU2A 3W72A 2CKSA 3N12A 4H04A 3COTA 4GIAA 3ALGA 1V6TA 2Q8XA 4B5WA 1DQWA 3LRLA 5BXPA 2X30A 1CGTA 5F2LA 4F40A 3AJ7A 1J11A 5CPNA 2OODA 3LZ3A 4FX6M 3ZO9A 1H61A 1NM9A 2PLKA 4GUJA 1AZ1A 3ITXA 1K7XA 3WH5A 3F4WA 4B3ZA 5BMXA 2UV8G 4A3QA 2ZTKA 4S39A 3TDFA 4DWDA 4GUHA 2YBUA 4CVUA 1K1DA 3FIGA 1A3XA 4M80A 1SSGA 4YLWA 3PZQA 1EIBA 2ONEA 3RFAA 5JBEA 4Y8FA 3BGGA 1OFOA 3NOEA 1UZHA 5U7SA 4Q32A 2EG8A 1VR6A 3CB8A 4ES4A 1K02A 3DYPA 2XM1A 2OGJA 4JR5A 1NDWA 3N15A 4W86A 2PDLA 2FQIA 3U2OA 2ZICA 4YN5A 4DBEA 5E0FA 2VZTA 3WF3A 3W29A 3LGGA 3WNLA 2V63A 1M6JA 1VKFA 4Z0JA 4HYVA 3BLIA 4TX6A 1JUEA 1HJQA 4S3JA 3VTRA 4O1BA 2FHBA 3B05A 1CB7B 3TV8A 1VYSX 2BGNE 2HK0A 3WLKX 4QG8A 2HDJA 2SFPA 3ID7A 3L7RA 3ZJ8A 1VPQA 1W5PA 3M46A 1I8JA 3PWAA 4QGCA 1XCFA 5F4WA 3QGKC 1O60A 2CEQA 3LV6A 1Q6OA 3VFCA 3RGTA 4HMCA 5DLCA 5C7HA 5HJYA 1B90A 1U1JA 1US2A 3W7HA 3CH0A 4IGSA 2UBPC 5CPOA 2DT3A 2VC7A 4ZGYA 1Q66A 3VD4A 1W5QA 2Y24A 3UJRA 3QSRA 3ES7A 3CXOA 7PTDA 5HMSA 1ONXA 1OIFA 1FWRA 6ENLA 2Q02A 2NSOA 3GS6A 3WDPP 4L80A 4ZOEA 1KM3A 3P82A 5F4XA 2AAAA 3Q37A 4WKFA 3FYPA 1W17A 3IJIA 1YTEA 4DF0A 1S5TA 5DFAA 3GVGA 4HGXA 4MNKA 3T78A 4CQAA 1C93A 3EBVA 4ICCX 4JGDA 2F61A 1QAPA 2ADAA 2EPKX 1I2OA 3B3DA 3MP4A 5F1UA 3LHUA 1ISZA 4ROQA 1A0CA 4ZB5A 3FKKA 4UBPC 1GHRA 4QNWA 4MWAE 4L56A 1Q5MA 2Q3OA 4FX7A 4W9TA 1EHNA 4GXMA 1M65A 3TQKA 2BY2A 3S5NA 3VKAA 1AQMA 3KM8A 3CQIA 4M3PA 5G4HC 3IVSA 3C2RA 4XAYA 1KGXA 4U2ZA 1A5OC 3EWDA 2Q6ZA 1T41A 3UPBA 2CZFA 7REQA 4TQTA 5A69A 1RA0A 2QDDA 1KNWA 4H9XA 4ZMGA 4NRRA 4A4AA 4XD4A 2MANA 3FJ6A 2XYLA 1XRVA 3H54A 5CBJA 2PDUA 2OLSA 3AZTA 4M8UA 1KM2A 3TR9A 4WXYA 2WWCA 3ABRA 3H2AA 1R30A 2INEA 3LBCA 1EB3A 3GU2A 3T8LA 3LM7A 3TLLA 1OCNA 3JZUA 4GGHA 4DWSA 2CLHA 1XISA 4DO5A 2AGTA 4X0NA 2JQXA 4DWSC 4TIMA 1E73M 2I5QA 4QJ5B 3CASA 3ARWA 3GO2A 1L8PA 4DJFA 1S5WA 3VA8A 3LERA 3KHJA 4UTKA 4J3VA 2Z6JA 3AXHA 1XLEA 1D8CA 3AMCA 4S38A 3MUY1 3EOSA 4XG1A 1ME9A 5JBDA 3UG5A 1TO3A 2DDXA 4EX4A 4BKNA 2E7FA 3TR2A 4NXKA 3UYCA 3BLPX 1KQZA 2P8BA 4DAFA 4A8RA 1ZBVA 3LHVA 1LROA 1XI3A 1VP5A 3IGUA 3LPFA 4KERA 2CNCA 1MEIA 1Q2SA 4B4HA 4LOCA 1KA9F 4MWAD 1CWYA 3VDCA 1PIIA 3WL0A 3MBFA 1PPIA 2AQWA 3SCOA 1YADA 4LUYA 4RDWA 3RCYA 4WOZA 3FW6A