1W2PA

The 3-dimensional structure of a xylanase (xyn10a) from cellvibrio japonicus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
346
structure length
346
Chain Sequence
GLASLADFPIGVAVAASGGNADIFTSSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQKIVALSPTLKIKITELDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDSWLYTHQNLPDWPLLFNDNLQPKPAYQGVVEALSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE A PRECURSOR
publication title The Use of Forced Protein Evolution to Investigate and Improve Stability of Family 10 Xylanases: The Production of Ca2+-Independent Stable Xylanases
pubmed doi rcsb
source organism Cellvibrio japonicus
total genus 132
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w2pA00
1EO7A 3UG5A 3ZJ6A 4LYQA 3E1F1 4GI9A 3POHA 3AHVA 4W5UA 1OIFA 2CBVA 1SMAA 4Z2IA 2YDSA 1XHGA 4YHGA 1GJUA 4B16A 1BQCA 5I5RA 3M7SA 4CCDA 4J28A 3T0AA 4B15A 1JI1A 1UD3A 4AZHA 1EDTA 5FD0A 2JEPA 4Q7NA 3VO0A 1XV8A 4J3TA 1JAKA 1FP9A 4CCCA 4R5EA 3HN3A 3VIGA 1FFQA 3SCNA 5FIPA 3RMEA 3IK2A 2JF6A 4PTWA 5I24A 2VRQA 3DHUA 1CXIA 5BRPA 5A3HA 3EDJA 1JXKA 4M56A 1HJSA 4J3VA 1U30A 3ZOAA 3UEQA 2BNJA 4CN6A 4W88A 4AD2A 2BVDA 2BVTA 4EKJA 1W3LA 4MAVA 1ISWA 4MDOA 2ZUTA 4QFUA 1MVYA 4V28A 4CN4A 3SCPA 5KZ6A 4PMOA 1HKJA 2D3LA 1TR1A 4HZ6A 2XGIA 1EO5A 4GXPA 5D8ZA 3AS3A 3W27A 2JALA 2XVKA 1E5NA 5DMYA 3BSGA 3M6DA 3GTNA 2D20A 3AIQA 1BG9A 3CZKA 1TMQA 4CD6A 5DEZA 4HA3A 1PEZA 2EJ1A 4HOXA 3EMZA 3PZOA 1J0KA 2ZE0A 3OLIA 4MTVA 3AIWA 1UR0A 2OSWA 1OSEA 1V0LA 4HA1A 1VFFA 2GSJA 2E4TA 1JYWA 2EPMX 2AAAA 3PZVA 3K4AA 1I75A 1CECA 1EQPA 3AMLA 1JXJA 1E3ZA 1MXGA 1G1YA 3UR8A 1E0WA 4RE3A 5EFDA 2DSKA 3NDYA 1V08A 1AQMA 1NP2A 1E15A 2CESA 2D0GA 4TX8A 1W32A 4QDMA 5IFPA 4S3JA 4A3YA 1KR0A 3QGVA 2WHMA 5E9AA 3VGHA 2DSVA 3W82A 2BHYA 2ZUWA 3W4RA 2WMHA 4MNKA 3WQ6A 5ABFB 1JD7A 2WC4A 3WMSA 5GNXA 1CLVA 2CYGA 1CLXA 4U31A 3CZJA 3WF4A 5AYBA 1JDDA 3AS0A 3AI0A 3AZTA 3N11A 3T2QA 3TTSA 3L4WA 1V3IA 1WNOA 5CXPA 3CGTA 3OLDA 1Q4NX 3SUSA 4Z2GA 5ABHA 4JFWA 4J27A 5DO8A 1A47A 3FY1A 1GQIA 4HU8A 1UA7A 5FOOA 3WH7A 1EGZA 1XH2A 3LPPA 2VO5A 3WBEA 1D7FA 1C93A 1E0VA 2WC3A 4NSBA 4MJ4A 1UKQA 3NSMA 2PWFA 2EXOA 3WH9A 1O6IA 2X09A 1H0IA 4D72A 1UKPA 2J75A 2WBGA 3GXIA 3DHPA 4HPHA 3B9AA 3MUAA 5BXPA 1NOUA 1UH3A 4LYPA 4WJXA 4V27A 3OA5A 1E72M 3VVGA 3CHDA 1CDGA 1AVAA 3VIIA 4ZENA 2ZUVA 1QI4A 3EBVA 2CERA 3NIYA 4AZGA 1RP8A 3ZR5A 2QMJA 3PZUA 4GZEA 5HBFA 4R27A 3GM8A 1BHGA 1HL9A 2HVMA 3SCOA 3VDCA 5A2CA 4LX4A 4OOZA 4Z2KA 1QNRA 3WEMA 2XM2A 3WH5A 1GOOA 3K8MA 1JYNA 5ABGA 1TCMA 2V3DA 3WNOA 1E6RA 2VC9A 3VMPA 5HXMA 3W6LA 4AIEA 1GOWA 1TA3B 4AWEA 5GNZA 4XB3A 5D8WA 3CUFA 4MNJA 3WUGA 4MPKA 1HJVA 3VMOA 1VF8A 3WMCA 2OYKA 4TVDA 2OWCA 4H2CA 1BLIA 4OZOA 4AD0A 3D5HA 1QHPA 3CZ8A 4ACZA 3U7VA 1JFXA 3RJYA 4PMNA 2WKLA 2CNCA 4HP5A 2ZUSA 2WLYA 3MU7A 2FHCA 1ITXA 4X0NA 3WDJA 4Z2JA 2DSUA 3UETA 1BGGA 2OLHA 3POCA 2JF7A 4NRSA 2E9BA 1JFHA 4AD5A 2XVPA 2YBUA 3U5UA 3WF2A 3BMVA 1KBBA 5IFTA 2WZHA 1H0GA 2E0PA 2E3ZA 1ZJAA 3T2PA 1FOBA 2CBUA 1BTCA 4EAMA 1H4PA 2C7FA 1H11A 4LGXA 3T09A 4M8UA 3KL3A 2DIJA 3NDZA 1GUVA 3AIUA 1UQZA 3ZJ7A 1GCYA 1C91A 1VBUA 2VMFA 2WMIB 3LMYA 4BQ3A 1FHLA 3W25A 5A8OA 1HT6A 4W85A 5JBDA 5C71A 3VMNA 4L4OA 1PX8A 3VKKA 1QNPA 3ARWA 1OB0A 2D24A 1BYDA 3L4VA 4GI6A 1J0JA 1VEPA 1W9VA 2VOTA 3WDIA 1XSKA 2DH2A 2WXDM 1OWQA 2YBTA 2FHFA 2V3GA 5A94A 1UOKA 2WCGA 4OUEA 1J01A 2J8FA 1UKTA 5GQBA 1DWHM 3MSDA 5HDRA 1HVQA 2JEQA 4P8XA 3W24A 5E6ZA 3MV11 7A3HA 1W3KA 2F2HA 5A2BA 4E8CA 2EPLX 1FH7A 1ZBCA 1S46A 3W26A 1C8QA 1JF5A 2XGBA 3TOPA 1I1XA 3THDA 3WSUA 4P8VA 4D6GA 3ZQ9A 4TOQA 3BAWA 3K1DA 1V02A 1XYFA 1YHTA 1H3GA 1JI2A 1EHNA 5A6MA 4MNLA 3LPFA 1BYCA 4AW7A 1DWIM 4CD4A 2PWHA 4QLKA 4LQ1A 4P7LA 2GJRA 1OGSA 3ARQA 1CXFA 4XZBA 1OBAA 4U33A 1GQJA 3ALFA 3N17A 2VVSA 1QHZA 1GQKA 4JKKA 5M3WA 4W87A 2YLAA 3OLEA 3WN6A 5IHSA 4UR9A 3HJEA 3L2LA 4AD4A 3T0BA 4CD8A 1GVIA 1H1NA 5HOSA 2GJPA 2QHAA 1OT1A 2W92A 4H04A 4PSRA 1Q6GA 1CWYA 2QPUA 4BCEA 3SEPA 3W29A 3W81A 1JG9A 2WNWA 3I3DA 1E56A 1NWUA 3CBWA 1LQ0A 2OYMA 4M80A 4WSJA 1UYQA 4TVCA 1DWAM 2J47A 1PAMA 1V6VA 2FGLA 1G94A 2XTKA 3B9EA 2AOSA 3AISA 5CQ1A 2XVLA 4ACYA 4BZYA 3RM8A 4AC1X 4HOZA 3NSNA 1KFWA 4CVUA 2O9RA 4KRUA 3TTOA 1V3JA 3WL1A 1HVXA 3AS1A 3TA9A 2EQDA 1GNXA 3IAPA 2RGMA 3WD3A 3RCNA 2V5CA 1DP0A 1UZ1A 3AMDA 3AZSA 3PZIA 4KGJA 1LLOA 3BC9A 1QBBA 4CKQA 1ZU8A 5JBEA 4P7OA 4W7VA 2W66A 5C8BB 4Z2LA 2DT1A 4JZ5A 4TTUA 3NJ3A 1EA9C 2E40A 2DPEA 2BHZA 1ZS2A 3CZLA 3AOFA 4DUWA 4F9JA 1W9BM 2ZX7A 3VDBA 2YDRA 1CXLA 2Y4SA 1J0IA 1UR9A 3ALGA 1XCXA 1TVPA 3VTRA 1CGVA 4D6FA 1Q6FA 4UOZA 2XSBA 1V02E 4U5KA 4UQEA 4MADA 4W8AA 3ZMRA 3QR3A 1MYRA 3T0DA 1EHAA 4D6CA 3ZT5A 4C7FA 1DWFM 2JIWA 2O9PA 4D1JA 4YPJA 3M07A 3MV01 3FN9A 3VIOA 1C92A 4IUGA 1XD0A 2XM1A 3UESA 1G5AA 4HA4A 1V0MA 1FHDA 4N42A 1UH4A 1WB0A 1B0IA 1KGWA 4W93A 4PMDA 5A2AA 1BYBA 2DT0A 3CHFA 1EOKA 3K8LA 4BS0A 4MDPA 1GJWA 3CPUA 3VIKA 1P6WA 4TTGA 1CZ1A 2WLZA 3MMDA 2Z1KA 2J74A 1B3WA 3D3AA 1O7AA 1TUXA 3ZIZA 4BF7A 1UWTA 2WVUA 1UKOA 2ZX6A 4FF5A 2NW0A 2GDUA 3BLPX 2X8RA 1JIBA 1X1NA 1BF2A 4D6EA 1OGGA 1FH8A 1TG7A 1LL7A 3BXWA 5DT5A 3AZRA 2O92A 3J7HA 4HOWA 1C8XA 5DFAA 1BVZA 2WVTA 4PMVA 1N82A 1V0KA 5A6BD 1UHVA 2Q8XA 4ML4A 3VM7A 2PWGA 6TAAA 1E6SM 4BA0A 3CUHA 5I0DA 1QVBA 3U57A 5JUVA 3K8KA 2CPUA 3PZNA 5E09A 3KE0A 4PMZA 1ZB5A 2VCCA 3SUWA 5CG0A 1W9DM 1MQRA 2GJXB 1KCLA 5BYWA 3IJ9A 2RGLA 3GXDA 3WQ4A 3CTTA 1XSJA 1F4AA 1TA3A 2WC7A 2D2OA 2VR5A 1XD1A 3VDAA 2J7BA 3WNLA 1V6YA 1E1EA 4D1IA 3F5LA 2FHBA 3SCVA 1MW1A 1QNQA 2D0HA 1WZLA 2X2YA 4EK7A 2WB5A 5GNYA 3VNZA 3MKKA 1ODUA 1HP4A 3SCRA 3WFZA 3SCQA 2XG9A 3F5JA 4OJYA 3A47A 2CBJA 1E6QM 1GONA 5AC4A 3EMCA 2WVVB 1CYGA 3IJ7A 5A8NA 4B3LA 1JDAA 1B3ZA 1KB3A 1E5JA 1HJWA 3NSXA 2WCAA 2J7EA 3RILA 2VX4A 3QOMA 2UWFA 3GDBA 3F5KA 1M7XA 4U5IA 2XSAA 1QPKA 2JE8A 1PZ3A 5D9NA 2ZWZA 4FLOA 4Z2HA 2G41A 3OZPA 4P8WA 1ZBVA 4F79A 1KBKA 4ZXOA 3ARYA 1KWGA 1WAWA 2J78A 1UH2A 2NT1A 4JKMA 1EIBA 3AHTA 4JL1A 1KCKA 3PHAA 3PZTA 2VVNA 3O2LA 3WKZA 5D4YA 3WDRA 2OSXA 4F66A 3MUY1 1E4IA 3NCOA 1DWJM 4ATLA 1UD4A 5A6KA 1NARA 4JCMA 1OIMA 1XRVA 1NH6A 5EMYA 4A3HA 1QW9A 3W0KA 1V3HA 4K68A 4JKLA 3GXFA 5BXSA 3VX1A 5M17A 1X6NA 5IDIA 2YA0A 1E6XM 1WPCA 1WKYA 3G6MA 1YQ2A 2WSPA 2ZXBA 4LPCA 1E40A 1C7SA 3QHOA 2WMFA 4NF7A 2Y2WA 2J7HA 1HL8A 1Q6EA 1KXTA 2GDVA 2EBNA 3OG2A 1BYAA 1ITCA 3GXMA 4OKDA 2EPKX 1JGIA 3CIVA 1MQQA 5GPRA 3RM4A 3GH7A 1OGBA 3ARRA 2PC8A 2J77A 4P8UA 5BWFA 4BQ5A 1PX4A 5BROA 3GYCA 2NT0A 2WHLA 4DWSC 1B30A 1J11A 1KQZA 3T2OA 2JIEA 2YA2A 2PI6A 3OLGA 2J7CA 3ZT7A 1KR1A 2YIHA 2YL9A 4MB3A 3ZT6A 1FH9A 2WK2A 3TP4A 1QNOA 3O6AA 4Q22A 5EBAA 1CPUA 3FNDA 4S3KA 2A3EA 1B90A 4ZE5A 3WL0A 3ZJKA 3WD0A 5M5DA 3UR7A 3SIMA 1C3FA 2GVYA 5CGTA 3VGEA 1WE5A 3WDHA 2J8GA 4JFVA 2A3BA 3FAXA 4PEEA 1JZ4A 3A4WA 1A3HA 1GOKA 3KWXA 4YHEA 1XH0A 4X0VA 1B1YA 5D9OA 3ZM8A 4PCTA 3AHXA 4DUVA 2J25A 1GOIA 3A4AA 4GQQA 3WENA 1ISVA 1E9LA 2BV9A 4NI3A 2WSKA 1VFOA 3U7BA 1XSIA 4TUFA 1Z32X 8A3HA 3S6TA 1AMYA 4AEFA 4N0RA 1Q6CA 3VIMA 2XYLA 4EE9A 3BH4A 3AMCA 5A6AA 1JYVA 3W37A 3WUBA 5M03A 1VRXA 3DYPA 4XV0A 5I77A 1NM9A 2WZIA 1LWHA 2BY2A 3OZOA 2ZUMA 5LA2A 4H41A 1CEOA 1W1YA 3VINA 1H41A 1UKSA 4H8HA 4J3XA 3WD1A 2FH6A 2ZUUA 4AZCB 1JNEA 4QCEA 1UWIA 4WK9A 4HMDA 3RIKA 1OM0A 4FLQA 3WH8A 4CN1A 4P7RA 1H5VA 3U5YA 2E8YA 1QI0A 3BLKA 3O9NA 4UQAA 4UTFA 1U2YA 2IXVA 2YL6A 4YN5A 1FP8A 4DWSD 4QP0A 1GZJA 3L4ZA 2DSWA 4C7GA 1PPIA 1QBAA 3WQ5A 4UNIA 2OWWA 1BAGA 1E6NA 3QHNA 2JFEX 5BXRA 1HKKA 4B9YA 1UWQA 4OBSA 6CGTA 4KWUA 4JCLA 3ZR6A 1R7AA 3THCA 2WM0A 4PMRA 1V03A 2WYSA 1CIUA 3QHMA 4LYRA 2ZXDA 4DM2A 3ARZA 2V3EA 3RPMA 4FK9A 2XHYA 1PX3A 2WCSA 4KGLA 2XPKA 4CD5A 3L4YA 4PUEA 4WKFA 3BMWA 2GFTA 2PBGA 2W61A 1H2JA 1L0PA 4AXNA 4CD7A 3WF3A 1EDGA 5ABEA 1HKMA 2BVYA 3UCQA 4E4PA 2XWDA 3II1A 3SCTA 3GZAA 5D9MA 3TTQA 5FCZA 2FDMA 5DT7A 4MB5A 2QF8A 2W67A 1RD6A 2WKGA 2DSZA 3PZMA 1CNVA 4B9ZA 2WMJA 4UFJA 1HXJA 2J7DA 2YJQA 4WIWA 4C7DA 1E0XA 1W91A 1F4HA 3ARSA 5A6SA 1AQ0A 3SCWA 4UOJA 3WF0A 3L2MA 2X0HA 2ZUNA 3MUIA 4QLJA 1CGTA 3W28A 3VM5A 5ECUA 4HTYA 3HU7A 3S2CA 1EXPA 3UERA 2VZVA 1KXQA 3VD5A 4PUDA 3VGGA 2GJXA 2UY2A 1MQPA 3VU2A 1UWRA 5LA1A 1VFUA 1UA3A 1W3HA 3CZGA 3LPOA 4JFSA 3VILA 3SURA 1JF6A 4FMVA 4TVUA 2OYLA 4AEEA 3FAWA 1ZL1A 5I3DA 5BCAA 2FH8A 1W2PA 2E9MA 7CGTA 4DWSB 1ECEA 3AIVA 3CMGA 3OGRA 3WNMA 2BY0A 4BQ4A 2UY3A 4W7WA 3T08A 4QCFA 3RDKA 3CUJA 1KGXA 1E3XA 1BGAA 1PJ9A 3AHZA 5CZKA 1M53A 3WY1A 5CSYA 3VGDA 3ECQA 2WAGA 1W1PA 4PBGA 3TTYA 4PMXA 2W4XA 1GHSA 2G3NA 3BAXA 4D6HA 2WVVA 5A6JA 3VPLA 1WDRA 1K9EA 2DDXA 3BCFA 2BS9A 1IZJA 1V6UA 4W7UA 1GOQA 2ZX9A 2WHKA 1WZMA 3CH9A 3WNNA 8CGTA 2W5FA 9CGTA 5IXEA 4W89A 1W1TA 3AIBA 2XWEA 2ZXQA 3ZJ8A 2XUCA 4FLSA 3OBAA 4CVWA 1V0NA 2D0FA 2XFRA 3WIJA 3AYRA 1W9UA 1QHOA 3KZSA 2IXUA 5LA0A 2A3AA 5I2UA 1CENA 3CLWA 4MAZA 3BGAA 4TX6A 3PTMA 1WDQA 2PBOA 2XFYA 2WZEA 5ABFA 2X0YA 3MS8A 3JUGA 4WKAA 5A6BA 4D6DA 4RE2A 3WH6A 3MSGA 1B3VA 3N04A 3VD7A 2E9LA 2YDQA 4XZWA 2BXYA 1WDSA 3BAKA 4X9YA 3NYDA 4OBRA 1LF1A 1VEMA 4CU8A 5AY7A 3FW6A 2EO7A 2IUZA 4ZFMA 3W38A 3DYOA 3RJXA 2WMKA 1E1FA 4L4PA 1NQ6A 1M03A 3SCSA 2F61A 4ATWA 1BVNP 4AZIA 4OIFA 1E6PA 1XH1A 3GNPA 4IM4A 3PTQA 1B3YA 1W3JA 2E8ZA 3B9DA 3EDDA 4AZ7A 1OD0A 1US3A 2WWCA 3AMGA 4U3CA 3SUUA 1J9YA 3WFLA 1HNYA 1ZBKA 2VZOA 3L4UA 4E2OA 5A1AA 1J0ZA 4GO8A 3DECA 1K9TA 2YA1A 4PSPA 1GHRA 1LG1A 4GZJA 1V3MA 2VT0A 4URIA 4AIOA 2Y5EA 4AZBA 1WZKA 1R7OA 3HMCA 3MMUA 4LXFA 1VAHA 4GZIA 4WSKA 4HPGA 1ISZA 3PZQA 2BFGA 1MW2A 2G8ZA 4M81A 4WKHA 4J3UA 1CXHA 1UZ4A 5D9PA 3VGBA 3WDPP 1WZAA 3GBEA 1VIWA 4AZ5A 1W1VA 4Y7EA 2VRKA 4KRTA 3OB8A 1B2YA 1NP0A 4UFIA 5E0FA 1VJSA 2MANA 1V3LA 4GIAA 1V6WA 1NWRA 1E4MM 2OWXA 3CZEA 5HNNA 1EQCA 3WDQA 4PMQA 5JBFA 4CCEA 1CGYA 2CHOA 1V3KA 3VD4A 4UQBA 5A69A 2DGAA 2J7GA 3VIPA 1DWGM 4MJ2A 4J3WA 3AXIA 2X05A 1MXDA 1L8NA 1SMDA 1GPFA 4NZCA 1B9ZA 1QOXA 3WF1A 3ARVA 1IZKA 2Y8KA 2VX5A 2ZX5A 3UG3A 1DEDA 1LWJA 1WP6A 3G6LA 3I3BA 5CLWA 1VJZA 1PBGA 1OCQA 5FKYA 1JYXA 3MMWA 2F8QA 1E70M 5CPQA 2ZICA 5A8MA 4GQRA 3UG4A 3GH5A 1VBRA 4GPNA 3AYSA 4HZ7A 3GNOA 3CHEA 2QV4A 1UR4A 1FFRA 3VGFA 2CIPA 1VFMA 2VQUA 3W6MA 3RO8A 3AROA 4UFMA 3WQWA 4U2YA 1BPLB 5KEZA 5I79A 2VURA 1E6ZA 1GQLA 4AZCA 1CXKA 2W63A 1V6XA 3KL0A 2WMIA 2VX6A 3EDKA 7TAAA 3VD9A 6A3HA 1CXEA 2XVGA 3ARTA 1US2A 3I3EA 4PCSA 4AMCA 4UCFA 3WMBA 5E0CA 1IT0A 4RL3A 4MB1A 3AXHA 1CTNA 1BFNA 3IANA 4MB4A 2X1IA 2WWDA 1XGZA 1GOMA 1UWUA 4AYSA 1MFUA 2EEXA 1UG6A 3KEHA 3TONA 1B31A 3WQ8A 3WBAA 3VD3A 1OD8A 1SR0A 3IAQA 1UD2A 1G0CA 1J12A 1H09A 4W86A 3KL5A 1AQHA 1R85A 2O9OA 1ZJBA 1MW3A 5I23A 4IPLA 2D3NA 3GBDA 2ZIDA 4OOUA 4ZEPA 1I1WA 3N1AA 1VB9A 4XX6A 1UUQA 1QW8A 2ZOXA 1XC6A 3AMKA 4PYSA 2VCAA 2CCRA 2ZX8A 1JZ7A 3CHCA 1LJYA 3K46A 4CU6A 3QOKA 3PN8A 4GO9A 3WELA 2GK1B 4JHOA 3DC0A 1HN1A 2DH3A 1XYZA 4JFUA 3PBGA 3K4DA 3F4VA 4E8DA 2DIEA 5JIPA 5I78A 5LYRA 1KGUA 1RPKA 4W8BA 1WO2A 3PTKA 4UZSA 4ZE4A 1PIFA 1MW0A 1E4LA 4M82A 2VNCA 3VX0A 4PRWA 1K9FA 1E4NA 4W5ZA 1UD5A 4NRRA 2QLYA 4IPNB 1HJXA 5CLTA 4PMUA 1HP5A 2CXGA 2XJ7A 4D71A 3WNKA 4D6JA 5HPOA 3VOCA 3OGVA 1HF6A 1G01A 2TAAA 5CSUA 3AICA 3ARUA 1M01A 1UR8A 2ESCA 3WD4A 1RP9A 4QLLA 1Q6DA 2D23A 2CKSA 2VL4A 1GVYA 3BAIA 3A6OA 2XIBA 2BY1A 1EOMA 4AISA 1GORA 4ATDA 2EPNA 1D3CA 2ZXAA 2YOCA 2VRJA 2UY4A 3EDFA 5CPTA 2VI0A 3FHQA 1CGWA 2G3IA 1J10A 1K6AA 1UQYA 2G4FA 4DWSA 3CUGA 2AMGA 5BRQA 4WF7A 4IISA 4XUYA 1SYTA 4PN2A 1C90A 3N18A 2FGZA 3MANA 3N12A 1K9DA 5C70A 4JHZA 1JZ8A 1KWKA 1W2VA 2J62A 1J0YA 2O9TA 1EDQA 1KXHA 3WNPA 1MWOA 1W9XA 2G3JA 1HJQA 4F8XA 2BXZA 1XCWA 4W84A 3AS2A 1UD6A 5E70A 1R86A 1HJUA 3AIEA 1UWSA 3WEOA 1UR2A 4UOQA 4PTMA 4UFHA 4BQ2A 1NWTA 4DM1A 5CJ5A 2V38A 4UFLA 3PZGA 3AHYA 1JAEA 4H8UA 2VZUA 4GKLA 4JL2A 3WUEA 4D6IA 4J3SA 4H8VA 3CUIA 4AY1A 2DEPA 2PWEA 3GNRA 2CITA 3RM9A 4PMYA 4EANA 2YL8A 3CO4A 3MUZ1 1FA2A 1CGUA 2J4GA 3L4XA 3L4TA 2W62A 3GH4A 1UR1A 4UZUA 4JIEA 3EYPA 5A8QA 2PWDA 2D22A 1J18A 4UQCA 1PZ2A 1UD8A 3VNYA 1R87A 2WANA 1NWSA 2CKRA 2VTFA 2UY5A 3LPGA 3W53A 4JAWA 3APGA 1JZ3A 2EPOA 3AFBA 3ZSSA 4F9DA 2XIIA 5F7UA 2WBKA 1VENA 3AQUA 1TVNA 2PF0A 4KMQA 1C7TA 2XVNA 4A4AA 2QMKA 2Z1SA 1ISXA 5EFFA 4AD1A 1H49A 1E71M 3FHAA 5AYIA 4PTVA 4W8LA 2VCBA 1WDPA 1HIZA 3SUTA 2DT2A 1JD9A 2DQXA 4M29A 2Y8VA 2HISA 2XFFA 3IJ8A 2CBIA 1R8LA 2DT3A 1JL8A 4U3AA 3SUVA 4M24A 4UQ9A 2VX7A 1CGXA 4QAWA 4CUCA 3ZSTA 1ESWA 4PTXA 2V3FA 1LL6A 1QNSA 1ZBWA 1VEOA 1M04A 1E43A 3VDHA 1TFVA 4TXEA 1Y7VA 3WUFA 4P7NA 3VIJA 3WQVA 3BCDA 5A6LA 3ARPA 1HX0A 4V2XA 4GI8A 1JNDA 2V5DA 4WLCA 3A4XA 3BAJA 4UFKA 1BG4A 1QI2A 4P7QA 1ODZA 1DHKA 2VUYA 1NOFA 4H7VA 4RE4A 4FLRA 4MNMA 1W9PA 4ACZB 3ARXA 5E6YA 1JDCA 2YL5A 2GUYA 2CHNA 1TE1A 4HMCA 2Y24A 3BSHA 2YLLA 3BAYA 3SCUA 5EB8A 1C8YA 5IHRA 2CEQA 2J7FA 4CGTA 1JZ5A 4HMEA 1E55A 1NOWA 2C0HA 1KXVA 2ZWYA 1KQYA 1X6LA 3DYMA 2VZSA 1QI5A 4DUXA 4B3KA 4ZXLA 3VUPA 1LG2A 5HPCA 3NUKA 2QPSA 1OT2A 3B8SA 3N15A 1IV8A 1D2KA 5DF0A 2B31A 4AD3A 3AXXA 5TD4A 3WEZA 1HKIA 2OSYA 3EDEA 3N13A 3EMQA 3FXYA 2VR4A 1QI3A 1J0HA 3ZO9A 2A3HA 3N9KA 1B3XA 4CU7A 5I6SA 2VQTA 2CETA 1BSIA 3A3HA 1EH9A 2W91A 2WHJA 2WPGA 5FL0A 4U2ZA 1JZ2A 2VJXA 4JFTA 4UQDA 1TZ7A 3AJ7A 4J7RA 2VZTA 4M1RA 5BXTA 3PZ9A 3OIHA 5JIWA 3M46A 1CBGA 2J79A 1U33A 2WVSA 3WD2A 1DTUA 1G9HA 3OGSA 5A95A 2BY3A 3VIFA 2G3MA 2BHUA 2WW5A 5CPSA 3CMJA 5FL1A 4AZ6A 5A8PA 1ISYA 1LL4A 4GINA 2PB1A 5AC5A 1E73M 3AIRA 5CGMA 2D1ZA 2WMGA 1WCGA 4KH2A 4HU0A 3VIHA 1RH9A 4HZ8A 1MFVA 1OINA 2C8NA 1SFSA 1PIGA 2NSXA 1JZ6A 2YKKA 3MO4A 2A3CA 4AIUA 1GW1A 2GK1A
chains in the Genus database with same CATH superfamily
1EO7A 4JICA 4LYQA 3U6WA 4YYCA 4PULA 3POHA 3AHVA 1XINA 3RU6A 4W5UA 1OIFA 2CBVA 1SMAA 3N2TA 5C2CA 5H91A 4E3VA 3M5ZA 4CCDA 4J28A 3UJEA 2GGEA 3T0AA 4H9ZA 1UD3A 4AZHA 5FD0A 4PEKA 4BF5A 4QJ3B 3MJYA 3LHTA 2A6LA 1Q6OA 1O94A 3WG6A 3SCNA 4NZJA 5FIPA 4WJ8A 1AL7A 2I14A 4ICMA 1KM5A 1CXIA 3EDJA 3QQWA 4M56A 4IH3A 1U30A 4J3VA 4F0RA 3ZOAA 1ONRA 3UEQA 2EPHA 1QUMA 2BVTA 4FALA 1W3LA 4LS2A 4AFYA 4MAVA 3ONCA 2H3DA 4A3RA 3PANA 2WQDA 1TX2A 4PBFA 2J8TA 4AB4A 4V28A 1PE1A 3SCPA 4S23A 2XGIA 4GXPA 4NZ4A 2OEKA 1A80A 1P0BA 3FXGA 1E5NA 5DMYA 3GTNA 2D20A 4DXKA 3DUGA 3P61A 4K1WA 3CZKA 1RBLA 2YYTA 2Y6ZA 2Q71A 1QU4A 3EMZA 1M1BA 3DGRA 1TRIA 4CQCA 4L65A 3N29A 3WJXA 1V0LA 6ENLA 5I06A 1SZNA 4MM1A 3G1AA 2Z29A 5AHFA 1U5HA 4GC3A 3UZJA 3PWGA 3D6NA 1EQPA 3AMLA 4CNSA 1E3ZA 1UMLA 1LRTA 2DSKA 4D8ZA 2E77A 4GFSA 1AQMA 5HATA 1NP2A 2P50A 3W01A 1O1HA 2CESA 2D0GA 4TX8A 2O55A 2D2HA 5BRBA 3B8TA 4FP1A 1L8PA 5C9UA 1UP0A 5B7ZA 4NZFA 2BX7A 3H2NA 3VGHA 4ROQA 3WQ6A 1W3IA 1JD7A 1ADDA 4ZOCA 4N9EA 1TPDA 5AYBA 1VHCA 7TIMA 1T40A 3N11A 3IPWA 4HN8A 4I6VA 2O4MA 5CXPA 3EKGA 1TV3A 3S5ZA 4XAGA 1IYXA 3W75A 5AHEA 4J27A 4ZQRA 2TODA 1TTIA 4O1DA 4KBXA 3I68A 1RLCL 3EWCA 3QFEA 1F74A 3NPXA 3LPPA 4LJ3A 1OY0A 3TJIA 4NSBA 2WC3A 1XLKA 3NAVA 1UKQA 4PE8A 3NSMA 3N4FA 2EXOA 3TE9A 3WH9A 4QITA 1XW8A 1VR6A 2CFFA 3UJFA 3HM7A 2WBGA 3HGSA 3LXAA 5CAKA 4ZQMA 4HPHA 3B9AA 2J9XA 1MNSA 3TWAA 4GQBA 2XIOA 4N9DA 4OHQA 5LNRA 4ZENA 2O0TA 3L0NA 4AZGA 3QC0A 4FS9A 4FSAA 3PZUA 4GZEA 1L6GA 5FJJA 1BHGA 1HL9A 1LLWA 4A8LA 4BEQA 2VKZG 1V5XA 4NAEB 2QYGA 1SFJA 4IUOA 1GOOA 4WUIA 1ENUA 1Q8JA 3VE7A 1Z8AA 3MHUA 4LY4A 3HO8A 2VC9A 3P82A 1GOWA 2PDLA 3QGAC 3UWVA 3GNNA 4YJ5A 4XB3A 5D8WA 4N9CA 3FA5A 4MPKA 1HJVA 1XG4A 4F48A 4DNMA 2BMBA 2V5JA 4TVDA 3H2OA 5E93A 4UNKA 4IJCA 4ZQCA 2E68A 1ZCCA 1OYAA 2WLYA 2Y0FA 4H9YA 4X0NA 4O4VA 2Q8ZA 2OLHA 3C3UA 3HA1A 1L6SA 2OJPA 1O95A 1QDSA 2OEMA 2DZTA 1FOBA 2CBUA 1BTCA 4EAMA 3H26A 4WY0A 4DO4A 4GXWA 3KL3A 4M8UA 2GGHA 1S1RA 1TMLA 4O19A 3AIUA 1UQZA 3ZJ7A 1QRQA 1LBMA 1VBUA 4HSNA 3LMYA 3W25A 5A8OA 3INPA 1HT6A 4HYRA 1B3OA 4H9UA 1XUZA 3FYOA 2C3ZA 3AYVA 1OB0A 1J79A 4KIEA 1DHPA 1VEPA 1J2BA 1W9VA 2VOTA 3LCFA 4XISA 2YBTA 3W9ZA 1MEWA 1GZ1A 1Z44A 1DWHM 3MSDA 3PAJA 4AF0B 5CPLA 4WXZA 1XYLA 1QPNA 4NL1A 4C1LA 1TPWA 2ZZ6A 4RDYA 2DJXA 4Z0JA 1QR7A 3QYQA 4CQ9A 4IIBA 3THDA 4P8VA 1ZQ5A 3NQFA 2PCEA 5REQA 3U2CA 3O8AA 4LAZA 3IUDA 1OG6A 1IEWA 1J96A 1VCFA 5A6MA 4AW7A 2PWHA 4ZMGA 4MMWA 1YW1A 4LQ1A 4P7LA 4XZBA 1OBAA 4U33A 3MZ2A 5HNUA 1S5NA 1MEHA 4O8AA 4JKKA 1OFQA 3IUHA 3A9IA 5IHSA 1XLEA 5K9XA 3AU6A 3T0BA 3GY1A 3JR2A 1J4EA 3KCJA 1GVIA 5HOSA 2Z25A 2QHAA 2X30A 4GI4A 3AWOA 5HULA 1GVFA 1JRCA 1SGJA 3CV2A 2QPUA 3T81A 3BLEA 3VOJA 3C6CA 3QEZA 3FVMA 3V5CA 3FSTA 2JBMA 3MCMA 4NVTA 4ZGYA 6PTDA 1PVNA 1XLLA 2DZXA 1ECQA 1QCWA 4LYKA 3WCZA 1OQFA 4GH1A 3FA4A 1G4SA 2AOSA 2HBXA 4AC1X 4HOZA 1HO1A 1HG3A 3BLFA 1XYBA 4XBJA 1WKEA 2YBVA 4WOZA 2R91A 4H9TA 1S5VA 4FZIA 1W1B1 2Y88A 1HVXA 1THFD 3AS1A 3G5EA 3IAPA 3WD3A 2V5CA 4PODA 4EX4A 1ZY9A 3GUGA 1DP0A 3BJSA 4OE7A 3ABZA 4KGJA 1O5QA 3BARA 4ENLA 3BC9A 3S0CA 3IGSA 1LUCA 2X7VA 5JBEA 3P0XA 1XBXA 2ZYFA 4Y96A 3SN4A 4Z2LA 3D3FA 5HAOA 1XYAA 1L2QA 5TIMA 3V1HA 1TV2A 1SVDA 1EA9C 2R9RA 1MUMA 4X9SA 3MB9A 3CZLA 3AOFA 3CWOX 4F9JA 1W9BM 3VDBA 5FJPA 1UR9A 1FTXA 1HO4A 2VGIA 3LX9A 2X42A 3NOYA 1B57A 4UOZA 1ONEA 4UQEA 5I00A 4MADA 2EG6A 3ZMRA 3QR3A 4IPIA 5LHEA 1JUBA 3VUSA 4HD5A 1MYRA 3G1VA 3GDRA 4AX6A 1BSLA 1EHAA 3GNXA 4C7FA 1DWFM 2R82A 4ZO7A 1CW2A 3H4GA 2PA6A 3W07A 5H8UA 4DYEA 2B7NA 3VIOA 1C92A 4IUGA 1VRDA 2A2IA 5XIAA 4HA4A 3UXDA 2PDGA 3W1TA 1FHDA 2ZZ3A 3M44A 4OTKA 4PMDA 4CQ8A 2DT0A 3SRKA 1EOKA 1LROA 1DQWA 3GG8A 3IIZA 4ZO8A 4JTFA 3CPUA 4PRRA 3VOIA 2HZGA 3VIKA 1P6WA 6REQA 5JQ9A 1CZ1A 2WLZA 2Z1KA 2Y63A 5HMDA 3TZFA 1Y5WA 4WDWA 2WVUA 4FF5A 1JUKA 4FI4A 2X8RA 3RLVA 4Z42C 3PB0A 1OGGA 2O92A 4HOWA 3N2BA 1X6UA 1C8XA 4F3HA 2TSYA 4LC8A 4B5WA 2O56A 2PWGA 1W1ZA 4IF2A 1OG0A 5D2XA 5FSEC 3S5SA 1RVGA 4NAFA 4JXCA 1Q3NA 3VZYA 4EF8A 1QVBA 1GJPA 3BV7A 3U57A 3GX9A 2CPUA 2R1NA 4NJHA 3PZNA 4XSLA 3RF9A 4PMZA 4FO4A 3URQA 3SW6A 3NFUA 2GJXB 4A3QA 3NM1A 4MWAC 4FNQA 1EWEA 2F6KA 5BYWA 4WGHA 4EXAA 2RGLA 1XFCA 3MBFA 1XIMA 3SN1A 3VKBA 4Q33A 2BLEA 2VC5A 1TA3A 1O12A 1VLIA 4GYFA 2CLLA 1SO3A 1XWYA 5HUOA 2CLKA 3UPBA 3UT0A 4PTDA 2FHBA 2V0TA 1QNQA 2D0HA 1WZLA 2X2YA 4PC8A 1A3XA 3BOLA 5GNYA 3MKKA 1RY0A 2ZRYA 2CXEA 3SCQA 3C52A 1KFBA 3F5JA 1MEIA 3IV8A 1GONA 1P0NA 3MSRA 2NLYA 5MF5A 2XH0A 3M41A 2DZBA 3LBCA 1KB3A 5HA7A 1P1MA 3F5KA 4GOAA 1M7XA 4GD0A 4U5IA 2XSAA 2KX9A 2W9MA 2Z27A 3GG1A 2JE8A 1PZ3A 4O52A 5DBUA 3V5OA 5G5IA 4X2RA 1V79A 4NXKA 1DJGA 4DZIA 4F79A 1KBKA 1IEXA 3JZUA 3W2LA 3QTGA 3ARYA 3PB2A 2C91A 3KBWA 4H4IA 2C19A 3G1FA 3ANYA 4O13A 4F66A 3GHTA 3MUY1 1WQ5A 4C6IA 1TJ1A 2NXGA 4Z17A 4F0LA 3NCOA 4ATLA 1NARA 4JCMA 3EKZA 4MWAD 5CJMA 4DJEC 1DL3A 2GGIA 5BOFA 1OEPA 3GS6A 5IBXC 3W0KA 3LZ5A 1V3HA 2H3BA 4K68A 3GXFA 2VFIA 1GG1A 2INZA 2Y7FA 1WPCA 3T4CA 1YKWA 1I9CB 2RJHA 4HGXA 3TA6A 4LPCA 1WUFA 3VFCA 5IM51 1YEYA 3SFWA 1C7SA 1MI3A 2WMFA 3MDWA 2Y2WA 1HL8A 1KXTA 3N9RA 2ISSA 4JTSA 3FFSA 3C8FA 1X8FA 1ITCA 3CH0A 1K7FA 4QG6A 1ZAIA 2OPJA 1XISA 5HINA 4AVOA 4JIQA 1FKXA 3C5QA 2J77A 5FJIA 5EYWA 4BQ5A 5BROA 1XL9A 4DZAA 1KTCA 2HRWA 1J11A 4LAUA 4WXYA 2YA2A 3IVSA 2J7CA 5T26A 3M0LA 4HKPA 3F4DA 2YL9A 1RJQA 1ZNNA 3EWDA 4QNWA 3TNBA 3NQ2A 4DQWA 3O6AA 3MVIA 2OZ3A 3NQDA 3GAYA 1PZ0A 4FXJA 1I60A 2WJEA 4QS5A 3WL0A 3ZJKA 3SIMA 2GVYA 4MYAA 3DENA 2J8GA 1XYCA 1XIEA 1ZALA 3A4WA 2ZZ5A 3KWXA 1FWGC 2AL2B 3BMXA 1A5LC 3ZM8A 3BSMA 1VS1A 2J25A 1LWIA 3A4AA 4DJED 4GQQA 4NI3A 2WSKA 3WLSA 1K8XA 1VFOA 1XSIA 8A3HA 5FAGA 4F4RA 1AMYA 1QAPA 2YYUA 1Q6CA 1Y65A 4UTIA 4XD4A 3BH4A 1JYVA 5A6AA 1QASA 4IFKB 3H6OA 4WQ6A 5M03A 3DYPA 3GIPA 4Q4SA 1NM9A 4QTGA 2WZIA 1IF2A 2BY2A 4K3ZA 4KFPA 3W3OA 2GQAA 1PKYA 3BWWA 4GY7A 3OZOA 3KHJA 2CWNA 3UQNA 1H41A 2GL5A 1UKSA 3GRIA 5HR6A 4AZCB 4QCEA 3B0UX 1UWIA 1OM0A 1BWVA 4ZODA 4QX4A 4NX5A 1XLAA 1QI0A 5JH2A 4UQAA 1U2YA 1S3HA 3I6EA 1N2VA 1FP8A 5TF0A 3LHZA 2GJNA 3IIVA 2VDIA 3EKLA 3CQHA 1GZJA 3L4ZA 4L9ZA 5AYXA 1PPIA 4QDWA 1CI1A 4KCVA 2RAGA 1P48A 3H2AA 1DJHA 4JTEA 3QHNA 4B9YA 4KWUA 3THCA 5AB3A 1DTNA 1U5JA 5D2VA 2XU2A 3QHMA 1R0MA 3L21A 2ZXDA 4O54A 1A5MC 1EJSC 2QJGA 4FK9A 5G2HA 2WCSA 3W7HA 4XIAA 2XPKA 3KOWA 4Y8EA 1DBTA 4HJFA 2IPFA 4PUEA 4WKFA 3H24A 3R8HA 3KP1A 3U2EA 1YNYA 2XH7A 3SGUA 4R53A 3WF3A 3TU9A 5ABEA 2BVYA 3UCQA 4E4PA 2XWDA 2NXHA 4QRNA 3SCTA 5D9MA 2ZA2A 3S4TA 5FCZA 1NIUA 4NIRA 4MB5A 2W67A 1I0DA 2F6XA 2UV8G 2YPIA 2WMJA 4UFJA 2VGFA 2PDPA 4S3AA 3CV6A 4HK5A 4WIWA 1W91A 5A6SA 4GYKA 1AQ0A 3A3WA 4O17A 3WF0A 3L2MA 4MLRA 1GYNA 1F2JA 4KFOA 1V6TA 1KA9F 4NYUA 1TWDA 1TJRA 3DHDA 5ECUA 1XLCA 4O16A 3MHFA 2RFGA 1S1PA 2VZVA 4ZTYA 3FYYA 3VD5A 3ABOA 3VGGA 5T91A 5LA1A 3CZGA 4Q8VA 3JS3A 4FX7A 1F3WA 4TVUA 4NJIA 4AEEA 1A5AA 3HG4A 3DFSA 1ECEA 3AIVA 1A3WA 3VOGA 4BQ4A 3CAVA 3BLDA 5AOUA 3RDKA 3KRSA 5LNUA 1BGAA 4E2DA 3CQ0A 3CAKA 4HSHA 2ZZ1A 3MMTA 5DN1A 1AJ0A 3WY1A 4M7SA 5GVJA 4JDYA 1O68A 4PBGA 4PMXA 2W4XA 3BLLA 2G3NA 4D6HA 1SSGA 1LBLA 2DDXA 3BCFA 2BS9A 1GOQA 4E0CA 1R9YA 2ALRA 3KW3A 4O12A 2QCFA 3MP4A 2EAWA 5MKGB 3W84A 1W1TA 1QTWA 2X1RA 4FLSA 2D0FA 1WAUA 3WIJA 1N55A 3AYRA 3EGJA 5XIMA 1QHOA 1M7PA 3GKFA 3MYPA 4IJBA 4FNRA 1WDQA 3IEBA 2WZEA 2X0YA 3MS8A 3JUGA 4Q4MA 5A6BA 4RE2A 2VC6A 1TYGA 1HKWA 2P53A 4LB3A 3QZAA 5CG7A 3RX2A 1EP3A 2E9LA 3CK5A 2YDQA 4XZWA 2BXYA 4JHMA 4YTTA 3BAKA 1LF1A 4NJKA 4X3ZA 1EIXA 4R3UA 4LV4A 2IUZA 3DYOA 4ECLA 1YPXA 1O60A 1C29A 2WMKA 3VZXA 4L4PA 2C1GA 4RPPA 1C8VA 2C0AA 1RBAA 4YWSA 1BVNP 3UWQA 4ZOAA 1XH1A 5C0QA 1UR3M 3KVLA 1W3JA 2E8ZA 3B9DA 3TXVA 1OD0A 5D33A 1K02A 1LTDA 2YCEA 2VWSA 2JKEA 4GO8A 3WLKX 2ZRVA 1LG1A 2EF9A 1V3MA 3LLDA 5LIWX 2Z1VA 5F2IA 4Q6XA 2O7QA 4AZBA 1R7OA 4GVHA 4MGGA 2B81A 5EBUA 4GZIA 1R2SA 4A2RA 1P0KA 3PZQA 3PY2A 4M81A 2ZA1A 3VGBA 1WZAA 1VIWA 5AZ0A 2VRKA 4US5D 1OVDA 4RKAA 1S2TA 4GVFA 2MANA 3UU0A 4JNZA 1V93A 1NWRA 1E4MM 2OWXA 3CZEA 5FEZA 5HNNA 1DIEA 2OLAA 4PMQA 4CCEA 1AW1A 3FIGA 3VIPA 6TIMA 1JDEA 4H83A 4H7ZA 1MXDA 1GPFA 5G1YA 1IE7C 1IZKA 2ZX5A 1DEDA 3JZEA 4IGSA 4GABA 1YXYA 3A4JA 4A35A 1PBGA 1OCQA 5FKYA 5LIXX 3UY7A 5HJYA 4KWVA 2ZICA 4GPNA 3TQ0A 1ITQA 3LXBA 3EWUA 1HUVA 3CT7A 2QV4A 1UR4A 3DFPA 1VFMA 2QAPA 3BV4A 3RO8A 2WZTA 3W1LA 2P0OA 3KTXA 4UFMA 3M0VA 5KEZA 2QKFA 5I79A 4K6AA 1PDYA 4GHRA 2QUTA 1EBGA 3R58A 5J5RA 4GA8A 9RUBA 3V35A 3E2VA 5K7JA 3ARTA 3I3EA 3CV7A 1AH4A 4RL3A 4KQNA 2QNEA 4MB1A 2HVOA 1FWSA 1BFNA 3IANA 4MB4A 3GXPA 5DCDA 2EG8A 1UWUA 3L68A 1UG6A 3WQ8A 1B31A 1ME7A 1HFBA 3QZEA 1UD2A 1G0CA 2NWRA 1H09A 1FUYA 4W86A 1AQHA 3ZS4A 1I4NA 3UXAA 9XIAA 4DPQA 2H8XA 3GBDA 2ZIDA 4CCZA 3PVFA 4QEHA 5FESA 4K1GA 1UBPC 1XC6A 2VCAA 3UWUA 3K46A 1PYFA 3PJXA 3MY9A 1E9YB 3DZ1A 4O28A 3TSBA 1FWBC 4PUWA 1HN1A 3PBGA 3K4DA 4BI7A 3F4VA 3TYCA 4RXGA 4QISA 2DIEA 4UMAA 3SR7A 1R3RA 3TQVA 5AECA 3QJAA 3DI0A 3MO7A 3UG8A 1HL2A 4UNLA 3P62A 4M82A 2VNCA 2OODA 2FKPA 5CSSA 1V77A 4JX4A 3IJQA 4ZR8A 1UD5A 3PNZA 3RN6A 4IPNB 3GQYA 3NPVA 3OZMA 3T8QA 2ASHA 4PMUA 1NF0A 1HP5A 1RQBA 4H6RA 4D6JA 1V7YA 3W2NA 1HF6A 1LYXA 2TAAA 5CSUA 3AICA 3ARUA 4IWWA 1BWLA 1UR8A 1XIDA 2YCLA 1RP9A 4QLLA 2GSHA 4H3DA 2Q3OA 3GDKA 2CKSA 2ZZ7A 4JGDA 2VL4A 3PUGA 1EOMA 2EPNA 2ZXAA 3UY8A 2BP1A 3HQNA 3VNMA 1H51A 2VEKA 2VRJA 1JEZA 3FHQA 1J10A 2G4FA 4ERIA 3CUGA 3OP2A 5BRQA 3FEQA 1EC9A 3M0KA 4NNBA 3N18A 4ORMA 3GDMA 5DCEA 3N12A 5D2YA 3WQOA 5FF4A 4GX8A 3S47A 1R5YA 4AXKA 1W2VA 2J62A 3E49A 3WNPA 3E2RA 4L4LA 2DW6A 1EJRC 3I4KA 2NQ5A 3CS2A 2ZRUA 5GJMA 1XCWA 4GIRA 1PYMA 1UD6A 2PGRA 4ZOBA 1H60A 1YXDA 1ZENA 2P5NA 1VQTA 3DKLA 4UOQA 4BQ2A 2HXUA 4DBEA 1MRAA 3ITXA 5LXXA 2V2HA 4GACA 1AH0A 2QPXA 5HNRA 2PRHA 3WUEA 1ZLPA 4H8VA 4AY1A 2PWEA 3QSRA 2V30A 2ZRZA 3MUZ1 3S9YA 5G2WA 4DY1A 5E5CA 3GH4A 3R13A 1UR1A 3LNMA 4JIEA 2PWDA 3HPZA 1BXCA 4MHBA 1RA5A 1TJ2A 5E0KA 3QR0A 5DCBA 4H6QA 2Z1WA 3VNYA 2WANA 5RUBA 4JYFA 1UCWA 1JZ3A 1EA0A 3APGA 4AHOA 3TMLA 4LUYA 4XD6A 2WQPA 4F9DA 1TWWA 2QCLA 3CB3A 3NEHA 4G7EB 2WBKA 3GU1A 1TVNA 3A21A 3ABQA 4A4AA 2XVNA 2QDDA 4XIMA 1PV8A 2Z1SA 5EFFA 4YS1A 1WXYA 1H49A 1ELSA 1JCNA 1F5ZA 1OCBA 2F7FA 2DV0A 3E2SA 2VCBA 3RG6A 2OT0A 3QQ0A 3L5LA 5JVLA 1Q2SA 1HIZA 5HK4A 3G8RA 3H22A 2DT2A 1JD9A 1TJPA 4H7CA 2OELA 1ZGDA 2HISA 2XFFA 1JL8A 3SUVA 3QR1A 4CUCA 3KX6A 3KRUA 1VEOA 4I5RA 1AG1O 2FIQA 1XRFA 3T0CA 1EZ2A 2YXOA 4TXEA 1Y7VA 3WUFA 4P7NA 1UOZA 3BCDA 3ARPA 3DBPA 3SECA 4DRSA 3A4XA 3BW3A 4LF2A 3LDVA 4M6VA 4PGLA 2VUYA 3RLGA 4JIHA 4XQ6A 4HK7A 2QCGA 4MNMA 4ACZB 3ANVA 3LCHA 1JDCA 3RO6A 2GUYA 2B7PA 3BAYA 3SCUA 1NTHA 3VOHA 4ML9A 4E2VA 1NELA 3M0ZA 1E1CA 5IHRA 2CEQA 3STGA 1NOWA 2C0HA 4Y8FA 3PULA 1EGMA 3B8WA 1X6LA 3DYMA 1SU5A 4F0KA 1XQKA 3CWNA 4ZB0A 1OT2A 2GZXA 1IV8A 3V0SA 4Q4KA 2G4JA 1XRTA 3TDFA 2I56A 2BOGX 4RV8A 3EMQA 2FFCA 2VR4A 1BEUA 3N9KA 1B3XA 4CU7A 1ZAJA 3ME3A 3RCYA 1BSIA 3L0KA 3HV9A 3EXRA 2W91A 3UCCA 3M0IA 1C9DA 1XIIA 5EMKA 4H2HA 4N6EA 3PF3A 1BWKA 3H2EA 3NYZA 3PSVA 3TNOA 4XWUA 3OIHA 1CBGA 3AU2A 4JTLA 2C1IA 1PB0A 4LNYA 5LIKX 1EKOA 4HU3A 2BY3A 4QE1A 2UBPC 3W72A 3A3XA 2WW5A 4IG2A 5CBBA 5HWMA 1ZUAX 1M7OA 3CJPA 2QDGA 2XISA 3EEGA 4HYVA 2XIQA 3C2EA 3AIRA 5CGMA 4HU0A 4HZ8A 1RZMA 1OINA 3GVVA 1P0DA 2C8NA 1QT1A 5F1UA 4AIUA 3H12A 1ZZMA 3QRHA 3ZJ6A 2Q6ZA 3BE7A 3GYEA 4GYPA 1X98A 2ZZ4A 3UFYA 1XHGA 1G4EA 4ZQOA 4YHGA 2G0WA 5KETA 2PDXA 1JI1A 4XZLX 3W2JA 2WPBA 4Q8TA 3OHMB 4Q7NA 1V7AA 3W1QA 1B54A 4BJHA 3C0QA 3QC3A 3KTCA 4J3TA 2AL1A 1JAKA 1FP9A 4IXXA 4CCCA 3VIGA 3VKAA 4WEVX 4A3UA 2JF6A 5AN7A 1JCXA 2BVWA 5I24A 1DE5A 4BK9A 4E38A 1KM3A 1JXKA 4LVFA 1ME8A 2DIKA 3KHDA 4EKJA 3NZPA 3T55A 1ISWA 2ZUTA 4JTTA 4C1NB 2Y61A 4QFUA 3OQ8A 5T8GA 4LEFA 3UJSA 2CC0A 2HK1A 3W7OA 3E6EA 3EZ4A 3W83A 1TR1A 4IFKA 4Y9AA 5BMXA 5D8ZA 2HROA 3GO2A 4YTUA 3LS9A 3DBNA 4J2PA 4TV5A 4XBSA 3E02A 1R3VA 3T42A 3PZOA 2ZE0A 1REQA 1OSEA 3F2CA 2GPTA 1S3TC 4FX6M 2E4TA 2QCHA 6ALDA 1FWEC 3PZVA 1GKPA 1LQ2A 1E0WA 4RE3A 4H00A 3CUXA 4GJIA 2R8WA 5FF2A 1K4GA 2ATSA 4YYFA 1M7JA 1U1UA 2IW0A 3SGZA 2Y89A 3DOPA 3RCMA 4WOQA 2YDAA 4DVOA 3RPTA 3RX3A 4QDMA 5IFPA 3EWZA 4JX5A 2PAJA 1IXNA 2ISFA 2WHMA 1BTMA 2DSVA 3W82A 2ZUWA 3W4RA 4EAYA 3TN6A 1AODA 3WMSA 1EC7A 2DU2A 1CLXA 3TC6A 1JDDA 1PHQA 4YL2A 3AI0A 3P0WA 3T2QA 2QGYA 4PB4A 3CGTA 3WJWA 2G37A 3VA8A 3GVQA 4CEUC 5H6HA 1A47A 2G3FA 3D47A 2PURA 4NZ3A 3TMQA 4IP7A 3WBEA 1ZFJA 1D7FA 4MJ4A 3GUWA 1O6IA 4X63A 2X40A 1UKPA 2J75A 5DANA 3GXIA 3DHPA 4UWMA 3MUAA 1K8CA 1NOUA 1UH3A 4LYPA 3RU8X 3OA5A 2HJPA 3CHDA 2RDTA 1BF6A 4JY9A 1JPIA 2CERA 3ZR5A 3RRXA 5HBFA 3TSDA 1B9BA 3GM8A 3IIOA 2WKJA 4DI9A 2EG7A 1U1HA 4JTCA 4OOZA 3W7MA 4Z2KA 2C18A 2WM1A 2DQWA 4WSHA 5ABTA 3HZ3A 1RK6A 4UUIA 1H7XA 1EF3A 3W6LA 3KBNA 4AIEA 4LUTB 4AWEA 3LXCA 4L6DA 3WUGA 1PO9A 1GKQA 4GBUA 2OMAA 1O5XA 2OYKA 4OZOA 3V3WA 1QHPA 3U7VA 1JFXA 3CU2A 3RJYA 4IX2A 4PMNA 2WKLA 2CNCA 2ZUSA 1W6TA 3MU7A 2OOFA 1F05A 4KERA 3WDJA 1ONXA 4QXIA 2IMRA 4JTJA 3EB4A 4NRSA 2E9BA 1JFHA 3DFQA 4AD5A 2QUVA 2VP8A 1KRCC 2OO6A 1M41A 2YBUA 3U5UA 3WF2A 1KKOA 3BMVA 1U1JA 2WZHA 1H0GA 2E0PA 4Y9OA 3G3MA 5A5WA 1WUEA 1P43A 1IIHA 3BOFA 4J3ZA 2WMIB 3B40A 4BQ3A 1S38A 1FHLA 2XN1A 2DZWA 2DVXA 3VMNA 2B4GA 4JIRA 1PX8A 1QNPA 1WKDA 3MJMA 1MUWA 4IIFA 5D2TA 3PM6A 2V81A 4AWTA 1XSKA 1CCWB 2DH2A 2WXDM 1OWQA 2V3GA 5CPOA 5D38A 4OUEA 1J01A 2J8FA 3ZLFA 1I6NA 1DE6A 4D8AA 5C5YA 2JEQA 5E6ZA 3FDKA 4J2MA 3MV11 2F2HA 4YWIA 2EPLX 4PH6A 5CGQA 3T9PA 5C9WA 1SPQA 2B7QA 3V4BA 5U4NA 5EL1A 3C0SA 3R43A 3TSMA 1HGYA 2XH2A 3VFLA 3GC4A 3W76A 4AVNA 3H2FA 4O1BA 5IRPA 3R25A 4XK2A 3WX7A 1AJZA 1OFDA 4HNUA 4IZGA 4LVBA 3VKDA 4CQAA 1DWIM 4CD4A 3DC8A 4IL2A 1OGSA 3ARQA 1CXFA 3CHVA 3R79A 4LF1A 4YNGA 2YB1A 3ALFA 1A5BA 3N17A 2VVSA 3W1NA 2QF7A 3PFRA 4QG8A 1IGSA 1GQKA 1K1DA 3EAUA 4YIWA 3WJSA 3CIWA 3L2LA 2NZLA 4CD8A 1KFCA 1H1NA 2GJPA 1OT1A 2W92A 4RNJA 4PSRA 4NASA 4FNTA 3HPXA 3APYA 1JG9A 1XLJA 4DB7A 3I3DA 1NWUA 2VEIA 5F2LA 1R3YA 1KFJA 1UYQA 4TVCA 5CJNA 2J47A 4DWDA 1W5QA 1PAMA 4E6MA 3S1XA 2XTKA 3B9EA 3AISA 1T0OA 2XVLA 3RM8A 2OZTA 1XGDA 3L65A 4IP5A 5DRIA 5JMUA 2A85A 1KFWA 3THQA 4RE0A 2ANUA 4DLFA 1YYAA 4D8LA 2NQ9A 2O9RA 4H1ZA 3TTOA 4S1FA 3ES7A 1NSJA 2WJDA 2EQDA 4K39A 1EZWA 3QSTA 3E96A 3LGGA 3LK6A 4GE8A 4OGZA 3I7QA 1LLOA 4GG9A 1IWPA 2BGQA 1UZHA 4W7VA 4E5TA 2SFPA 1EYWA 3K5XA 3NJ3A 3EWXA 2VELA 2YX0A 2E40A 5DRCA 2BHZA 3BGGA 2OR2A 2ZX7A 3SQLA 1CXLA 5KINA 4NKCA 4MUZA 4DYJA 4H01A 7ODCA 1FWAC 2F9RA 3VTRA 1CGVA 5AYZA 1A5OC 4TU1A 1V02E 3H54A 3ITOA 4U5KA 5J8LA 4W8AA 4RCXA 2WOQA 2NXIA 3ZT5A 2JIWA 2O9PA 1YDVA 4YPJA 5I3KA 3NL2A 2QVHA 3MZNA 3NVDA 3UESA 1UJQA 1AQFA 3BJFA 4DJDA 4NYYA 2QZRA 4KEVA 1WB0A 5CKSA 1TPEA 3CHFA 4CQBA 1W17A 3ITGA 3TQKA 3K8LA 4BS0A 3N6QA 4J35A 1UWAA 2XZ9A 4TTGA 1TV8A 4LW7A 2Z28A 5JH1A 2BB0A 1XP3A 1UWTA 3CPGA 3W2MA 2XZ7A 5FI8A 3WLNA 1X1NA 1M65A 3W7QA 1A5CA 4U10A 1S2AA 4FXRA 3DDMA 4N02A 3N34A 4ADTA 3GG7A 5DFAA 3REQA 2WVTA 3LENA 5A6BD 2Q8XA 1LZOA 2ISWA 3VM7A 3KP0A 3KZPA 3BZJA 6TAAA 4BA0A 3CUHA 1M3UA 3LNPA 5I0DA 2A7RA 3RNDA 3I6TA 5IDZA 5E09A 4EPBC 1CT5A 4A8NA 1PKNA 3B4YA 3EA1A 1MQRA 1KCLA 1R9ZA 1H1ZA 3GTIA 2RJGA 3OVRA 3F4NA 3IJ9A 3WQ4A 3CTTA 1XSJA 1KM1A 4RW3A 1F4AA 5F2MA 2C14A 4E4FA 3NQ8A 4R33A 2D2OA 1W1A1 2RDWA 1V6YA 4M51A 3EOUA 3PBMA 2FJUB 3F5LA 3SCVA 3A12A 3OPSA 3VNZA 2XSXA 2PDMA 5K9DA 1HP4A 2E5BA 3DFOA 4DYKA 1EF2A 1E6QM 4IHCA 2W79A 4K7YA 3QMSA 3IJ7A 4B3LA 1VCVA 1RUSA 1KTNA 1HJWA 4HVXA 4FR6A 4GNJA 2VX4A 5BOOA 2YZRA 1GEQA 3GDBA 1XLDA 2Y5SA 4AAJA 4RLIA 2JK2A 4LCRA 5D9NA 4FLOA 3W74A 3QMTA 1PTGA 1MUCA 4F2UA 3H23A 1WAWA 2NT1A 1EIBA 1W1IE 3AHTA 3BQ6A 1KCKA 2PDNA 3O2LA 3WKZA 3R8RA 5D4YA 5FF3A 3U48A 2OSXA 2QDHA 3KS5A 2DJLA 2PWVA 3KOFA 4PUMA 4C6QA 2EKGA 4H19A 3UWYA 1TPH1 2PUZA 1O4UA 1UD4A 4P5UA 5EMMA 1OIMA 1XRVA 4PBEA 3UP8A 3PBUA 3RRAA 5EMYA 4H6KA 4A3HA 2WJFA 1QW9A 5BXSA 3VX1A 3EXTA 3ELFA 2YA0A 1HGWA 5LSMA 1WKYA 1F6KA 1R47A 4FB7A 1UBSA 1S2CA 4US6A 1YQ2A 2ZXBA 1E40A 4GGBA 4BKNA 4NF7A 2J7HA 2PZ0A 2G97A 4S3GA 1BYAA 3N2XA 3R2GA 4ZBCA 3GDTA 3GXMA 3A13A 4OKDA 4W9TA 1JGIA 1UROA 1MQQA 3RM4A 3GH7A 3BURA 3NG3A 4XKYA 1OGBA 3MVTA 1LCOA 4OV9A 3OO2A 4KWSA 2PC8A 2VWTA 1PX4A 2DZUA 3GYCA 4YU1A 3OLGA 4GZ7A 3I4EA 2GWGA 4MB3A 4DHGA 3I7SA 1RCXB 3ZT6A 2WK2A 1QNOA 1CPUA 3N19B 5EY5A 2ZRWA 3TVAA 3HG2A 2VEGA 5M5DA 3UR7A 3VGEA 3WDHA 3DFYA 4G2DA 3IJLA 3DERA 3T0TA 1GOKA 2JKPA 3WQPA 4X0VA 5I7GA 3ABXA 4PCTA 4DUVA 1IEQA 1GOIA 1GTHA 4A8RA 2R94A 3R1ZA 1D3GA 4O50A 3WENA 4UTWA 4NI8A 4QG9A 3QQ1A 3GFZA 4TUFA 1MDLA 3C2OA 3DFTA 3S6TA 2AMXA 1HQTA 2GVJA 4NNCA 3QW4B 2XYLA 4MWAB 3WUBA 1TSIA 3LMZA 4GIEA 5I77A 3SQMA 1LWHA 1V8EA 5LA2A 1S5TA 4QE5A 1QK0A 1CEOA 3QKZA 4J3XA 3WD1A 3LHWA 2ZUUA 2Y1HA 4LRTA 2Y7GA 4WK9A 2IKHA 3GXTA 4FLQA 5L6UA 2DW7A 4P7RA 1A0CA 4A21A 4RR4A 3PAOA 2E8YA 4F2BA 3EX2A 4YN5A 1VGAA 2DSWA 4MUPA 1YPFA 1QBAA 4DELA 1BAGA 5BW6A 1PL9A 1VJIA 4JOMA 5BXRA 4O15A 1HKKA 1TVLA 4OBSA 6CGTA 4JTUA 4HNLA 4JTRA 1R7AA 4PMRA 1CIUA 4JQ4A 2QJNA 3UJ2A 2ICSA 2A1YA 3RPMA 3BGJA 2FTWA 2XHYA 3LV6A 1TPVA 2ONEA 4Q8NA 4CD5A 3TAKA 2GFTA 3L12A 1Z3NA 1SO6A 2PBGA 4LUIA 1H2JA 4FAMA 2EKCA 3C61A 1BKHA 1EDGA 2IKJA 1GQNA 2IQ0A 3GZAA 2ZE3A 3WLPA 5DT7A 5DQPA 3V36A 3UR5A 3PZMA 2AKMA 1CNVA 3UA3A 4KCWA 3B9NA 2J7DA 4UR7A 2YJQA 1E0XA 4LOCA 4F40A 3H7UA 3M64A 3CAQA 4UOJA 1DJWA 1FXQA 2ZUNA 4FEZA 4QLJA 4JTDA 3GHRA 5LZLA 2DUAA 4HNTA 3UERA 4CNTA 3AYTA 1VFUA 4IQEA 2INFA 3SY5A 7REQB 2NV2A 3LPOA 4JFSA 5EU9A 1EC8A 2QIWA 3SURA 4FMVA 3FAWA 3MT1A 3N14A 1VFTA 1ZL1A 5I3DA 1XKYA 5BU6A 3I10A 1X1OA 1C9WA 3VCNA 1EJ7L 3WNMA 2BY0A 4Z1DA 1DYSA 3T08A 3CUJA 5BU9A 1F07A 4HN4A 3M0MA 1XLFA 1PJ9A 1P7TB 3BANA 3CYVA 3WK0A 5A8GA 3VGDA 5I07A 2MUCA 2WAGA 3F03K 2H9AB 1GHSA 2WVVA 2AAMA 4ZZ9A 1IZJA 1V6UA 2PU1A 4G1KA 4BFAA 2ZX9A 2WHKA 8CGTA 3QPYA 3UWWA 3WNNA 1UC5A 1J8VA 4W89A 3AUJA 1I2PA 1EP1A 3LHVA 4LUSB 5AYYA 4LY8A 3EOOA 3LEPA 3IVTA 4MZYA 3UR2A 4KIRA 3LLXA 2QUUA 3E74A 2IXUA 3RYSA 5I2UA 3CLWA 4MAZA 3BGAA 3U4FA 3PTMA 5C2XA 5KZDA 4GYPC 3LB0A 4Q32A 1TV7A 2J9ZA 3PP7A 3TC7A 2HNHA 4X9YA 3NYDA 2IPGA 5AY7A 1QOQA 3TKFA 4MY1A 4ZFMA 3W38A 4G5DA 1VFHA 1ADOA 2QUNA 1NQ6A 4LBRA 4XVEA 2F61A 4ATWA 5CBJA 1YPIA 2ZDSA 1OFBA 3T07A 6XIAA 1SZGA 1JDFA 2IPJA 1OX4B 5ENLA 3W7IA 1US3A 3TN4A 2WWCA 3LSBA 1SZEA 1SJBA 4JQ2A 3IJDA 2OTDA 3MI6A 1HNYA 5F2GA 2NVCA 5A1AA 1PHWA 2YA1A 4JTKA 5CC3A 1OJXA 4IIDA 4GZJA 2PLKA 1LOLA 4C6CA 1EXBA 2Y5EA 1WZKA 4XAZA 3MWCA 1VAHA 3H7RA 2PZNA 4O0ZA 3OBEA 4GGHA 1IXPA 4J3UA 1CXHA 4EF9A 3GBEA 4AZ5A 4KRTA 1ZP4A 5F4XA 3IWPA 1UP2A 5E0FA 4GVGA 1TV4A 3LTSA 3SZ8A 1BVWA 2YFOA 1EQCA 4IOTA 1CGYA 2DY3A 1V3KA 4FA3A 3VD4A 2DGAA 5AHLA 4Z0SA 1EUAA 3Q58A 1DWGM 4MJ2A 4Z1YA 3FV9A 4DBUA 1JR1A 1B9ZA 1QOXA 3PBVA 3ARVA 2VX5A 1LWJA 3G77A 1QO5A 3I3BA 1VJZA 2V68A 4E4UA 3MMWA 2F8QA 4ADUA 1E70M 5CPQA 4RNFA 5FAJA 3PNUA 1JCLA 3GH5A 4BI6A 3VI2A 2REQA 2FZNA 2EGZA 1EBHA 5C54A 3GNOA 2PTZA 4O0KA 1FFRA 3VGFA 4KFNA 4JIPA 3FJLA 4M5PA 4J9JA 4U2YA 4GJ1A 4A22A 3O6DA 2HNEA 4DBWA 2YB4A 4QR6A 3EX4A 1CXKA 2W63A 1OK4A 4RNIA 2PD9A 2WMIA 3URNA 7TAAA 3VD9A 4GUFA 1CXEA 2XVGA 4FIQA 4MYXA 4AMCA 1NDYA 1DXIA 3W7RA 2HXTA 2R6OA 1N8FA 1Q6RA 4LC6A 2W0UA 1AZ2A 2X1IA 2WWDA 1QWGA 1ZSXA 2EEXA 4Q4OA 3KEHA 3TONA 1DVJA 4ZQPA 2ZTJA 1EJUC 2ODOA 1KFLA 1WDWA 1SR0A 3W1RA 5GJNA 3TYBA 1J12A 4QJ5B 5ECVA 2O9OA 3ITLA 1YBQA 2V5LA 5CZSA 1XQLA 2BSLA 4OOUA 2GLKA 4ZEPA 1VKFA 2Y5JA 1UUQA 1QW8A 5FJUA 2ZOXA 2XFWA 3AMKA 2QJHA 1K3UA 2CCRA 3CHCA 4JDBA 1Y5VA 3MP5A 3QMRA 3WELA 3EXSA 3ATZA 3DC0A 3VDGA 1K77A 3CB8A 1A4MA 4NNAA 3M43A 4NX0A 1LBFA 5LYRA 5I78A 2HEJA 1RPKA 3MPGA 4UZSA 4ZE4A 1MW0A 5EKYA 2OT1A 4PRWA 1NY1A 1E4NA 4W5ZA 3GNDA 4NRRA 1DPMA 5CAHA 4Y9NA 3T7VA 4N9BA 3CTLA 1HJXA 4INFA 1BXBA 3ZLGA 4MWAE 2Z1XA 3U2OA 1RJPA 2CXGA 4D71A 3MHGA 2QIIA 2CLOA 2D73A 2YZ5A 2VEFA 1G01A 3E38A 4H9MA 1ITUA 1VCGA 3SFKA 2ESCA 1PUDA 1Q6DA 2D23A 4EWJA 2HBVA 1XLMA 4AISA 4M1BA 1JCJA 3GWQA 4DBSA 3NO3A 4C5ZA 4DWSA 5SWUA 3UWZA 2AMGA 1MSSA 4PCNA 5G1TA 3NDOA 2NVAA 3K2GA 3WBWA 2OZ8A 3ERPA 3GVGA 3T05A 5C70A 3UBPC 1EEPA 3BPWA 3ZYZA 1JZ8A 2H8ZA 2PDBA 3LHYA 2C71A 1A53A 3AALA 4MF4A 3Q45A 5K3VA 1MWOA 3DI1A 1K8YA 3S1GA 3CNYA 1HJQA 4F8XA 2IKIA 2BXZA 2PF8A 3GTHA 1RD5A 4W84A 4GLEA 5G4EA 3W23A 5E70A 1PDZA 1G4PA 1HJUA 3EX6A 4R34A 4UR8A 3WEOA 4O0QA 4IFRA 4KKXA 1XGEA 2PLJA 2C16A 4CQDA 4UFHA 4TMCA 2YXGA 4AC7C 3AWNA 3KOYA 5K4ZA 2PDHA 1GTEA 3AHYA 1D8WA 1TPFA 1JAEA 4BR1A 4R9XA 2VZUA 4JL2A 3PBYA 4WZHA 4I8YA 2HK0A 4JN6A 4DNHA 3CUIA 1OFOA 1TIMA 3GNRA 2CITA 3LM7A 3LRKA 3N9SA 4PMYA 4EANA 3CO4A 2HV5A 1CGUA 3L4TA 3U2ZA 3P14A 3Q94A 3S2NA 3FA3A 3S42A 1IXOA 3EYPA 4MKVA 2D22A 1X39A 3W00A 3HIJA 4UQCA 1PZ2A 1FXPA 1R87A 1NWSA 3MC5A 3OBKA 2VTFA 4JAWA 4R7JA 4O4WA 5F7UA 4C1KA 3AQUA 3KAOA 4KMQA 4ICNA 2E5CA 2QMKA 5HQMA 1U5VA 2LLEA 5LXEA 3FHAA 3WZ0E 4MFEA 4LEQA 1IHIA 1VHNA 3DIPA 1SO4A 4B3ZA 2Y8VA 1XG3A 3D0CA 4U3AA 1VLWA 2VX7A 3ZSTA 1ESWA 1F6YA 3GR8A 4PTXA 2V3FA 1LL6A 3WLJA 5K4XA 4HCLA 4I7UA 1KLZA 3HPAA 1TWZA 1P5BA 1E43A 1QMLA 1R46A 4J4KA 4ERAA 1Z41A 3VIJA 3RITA 3OVQA 4V2XA 3NVTA 4GI8A 3W73A 1JNDA 1QI2A 1XICA 5AVNA 4P7QA 1ZP3A 2ZVIA 4H7VA 3UXIA 1W9PA 2YL5A 3G1SA 2CHNA 3WLTA 1L9WA 4KEUA 3BSHA 3CAWA 1VP5A 2JGYA 3OA3A 5EB8A 1Z69A 2J7FA 3TYEA 1E55A 4JD4A 4PZVA 2G96A 2ZWYA 3VNJA 3GW3A 1NDZA 4DUXA 3C3NA 4B3KA 4ZXLA 3NUKA 2QPSA 4OQVA 1D2KA 1XC4A 3KTSA 5FA5A 3TJ4A 4U28A 3H2CA 4AD3A 3U8GA 5TD4A 4DJDC 3WEZA 2NQZA 3EDEA 4WY0B 1KBLA 3TJLA 1L6FA 3IVUA 1ICSA 4L1GA 1DOSA 4IQDA 1OCNA 4REQA 3H55A 2QJJA 3PPGA 3TV8A 4E3TA 2VR2A 3N6HA 2VJXA 1ZAHA 3C2YA 3AJ7A 3BK0A 1BQGA 1XS2A 1H7RA 3M0HA 4MY9A 5BXTA 3BVJA 3HOJA 2J79A 4BF9A 3Q67A 4DLMA 4UCGA 3OGSA 3CIXA 1O1ZA 5CPSA 2VD8A 3KBSA 1SO5A 4QSHA 2ZKMX 3UZWA 5M2FX 3FGCA 1ISYA 4GINA 2PB1A 5AC5A 1R30A 1E73M 2WMGA 3TXZA 3UCDA 1RH9A 2YW3A 5REQB 2NSXA 2YKKA 1YTDA 2C79A 1D3HA 2GK1A 4LSBA 3UG5A 4XAFA 3P6LA 1FKWA 3LCGA 1TTPA 1IT7A 3G1RA 2YDSA 4S39A 4B16A 4DF1A 5I5RA 3ZFHA 3XINA 4B15A 2I9UA 1EDTA 4DJDD 4X60A 3NO5A 3WK1A 2YCJA 4AVFA 1XV8A 1KRAC 1R3SA 4B5NA 3HN3A 1FFQA 1JPKA 4KESA 3ZLHA 3GR4A 3F1QA 3IK2A 1L6YA 4K8HA 3GTFA 3OIXA 4PTWA 3P7YA 3RXZA 1UP3A 4DX3A 2VRQA 3DHUA 5BRPA 5A3HA 4IMDA 4NY2A 3FX4A 2WNQA 4UIOA 3R11A 4QROA 2BNJA 4W88A 2UZ9A 4S2BA 2ZZ2A 4P2VA 3M0XA 4GMEA 4IIHA 1AA1B 2I57A 4MDOA 3S6OA 3M0YA 2V82A 4CN4A 3FCPA 4Q8QA 3JVAA 5KZ6A 4EIVA 4PMOA 1F8MA 2D3LA 3BG3A 5KZMA 1EO5A 2ABBA 3ZR4A 1LRNA 4XZ9A 3W27A 1F73A 3O16A 2XVKA 1NFPA 2PDYA 3XIMA 2A21A 1VBHA 1LUCB 3AIQA 1BG9A 3LTYA 1TMQA 4CD6A 3PC0A 4KRZA 1PEZA 1KV8A 3NZ1A 1GEHA 2EJ1A 3MUCA 1GVOA 2Z26A 3OLIA 4MTVA 1ONWA 1B4KA 1UR0A 4HA1A 1EPVA 2CLEA 2OGJA 1JYWA 2EPMX 4XKMA 3DXIA 3URBA 1W0MA 1XBYA 1CECA 2OG9A 2E5DA 3G8EA 1JXJA 1MXGA 3NZQA 2OGYA 2BGSA 3NDYA 4XZHA 2W27A 4Y9MA 1WKFA 3PUEA 2CLIA 3E9AA 4S3JA 1NAL1 4IFOA 3QGVA 1T96A 3F4CA 2YCKX 2BHYA 3GSMA 3VZZA 4MNKA 2WC4A 5GNXA 1CLVA 3Q65A 3S1WA 1G7VA 3BUVA 2OQYA 3HJZA 3QY8A 3AZTA 5XINA 3S9IA 2PD5A 3L4WA 1V3IA 3OEXA 4DXXA 2HS6A 1F8IA 3OLDA 5CPMA 4B5TA 3HG3A 4W4QA 3SUSA 1WX0A 3B03A 3TCEA 4LALA 5KMYA 3C8NA 3UF9A 5DO8A 4RZ6A 1DKWA 1UA7A 1G69A 5FOOA 1VIZA 3WH7A 3MDUA 3R0DA 1KM2A 1XH2A 2ATMA 5D04C 1E0VA 4QBXA 5AHNA 2PWFA 1H0IA 3TZNA 1CB2A 1MZHA 3ITCA 3N2OA 3WQGA 1FWNA 1RQEA 2FPVA 2RH9A 4NAFB 1RJRA 1TQJA 3VIIA 3EBVA 4UTWC 3QZ6A 3WO8A 3WYZA 2GVLA 4UXDA 4R27A 2FTPA 3VDCA 4WDUA 3VABA 5A2CA 2TYSA 4Y90A 4RJEA 3HB9A 2XM2A 3WH5A 2PPGA 1TCMA 2V3DA 4NJJA 1E6RA 1TA3B 3ABRA 2PDFA 3WLOA 1AUSL 4KS0A 1M9HA 5F4SA 2QCEA 2XINA 2Y8UA 3EA3A 4GCXA 3VMOA 4B5XA 4EP8C 1VF8A 4B2DA 4ADSA 1LOQA 2OWCA 4H2CA 1BLIA 4EPDC 1MXSA 4I7WA 4EPEC 3STCA 1TTJA 2FVLA 1JCTA 2OB3A 3QPEA 3R8GA 3K30A 1JQXA 1FCBA 3NL3A 1LM1A 2FHCA 2H9AA 2XH4A 2DSUA 1EWDA 1BGGA 3LZ3A 5DXYA 1PWMA 2V8ZA 3LV5A 2E6AA 2PTYA 2XVPA 3ZVHA 4QGCA 1KBBA 4M7TA 3U3HA 2E3ZA 1ZJAA 5EMJA 3T2PA 1UUMA 3AO0A 3EOSA 3GFYA 4I9TA 2ZVRA 2DIJA 3T44A 5AVHA 1R2RA 3NDZA 1GUVA 5CZ0A 2PMQA 2VMFA 1X8CA 1PS9A 3VC6A 1XIHA 2R1KA 5JBDA 1TR9A 1X96A 3ARWA 3QN3A 4GBDA 1BYDA 3L4VA 1J0JA 3OOQA 4YLWA 3AUOA 2G50A 3FJNA 3G0UA 2PE4A 3OYXA 2FHFA 5A94A 3L66A 1UKTA 2OO0A 5HDRA 3UXKA 2J88A 3B05A 4MKSA 3KCLA 1W3KA 4XO6A 5A2BA 5AC6A 2CZ5A 1X7IA 1FH7A 1ZBCA 5D32A 5CZTA 1S46A 3V16A 3W26A 1C8QA 1TZZA 1XLIA 3T4WA 3WSUA 3B3DA 4JTAA 4D6GA 3ZQ9A 3BAWA 2FYMA 1GGOA 1F3EA 2CLMA 3K1DA 4UB9A 3S6DA 4HHMA 1POJA 1XYFA 1YHTA 3MW7A 1H3GA 1JI2A 1KW1A 1PKLA 4GISA 4JS3A 1MRQA 1BYCA 1UZDA 5E1QA 2GJRA 4UBPC 3L7RA 5I09A 3I7RA 3N3TA 1IWBA 2HDJA 5DMNA 3OZYA 3E12A 1QK2A 3CQIA 3FDGA 1FVPA 3OLEA 3FKRA 4AD4A 3CL6A 2P3ZA 1RY8A 4H04A 4M19A 2ZFAA 3B97A 3Q2DA 4I8DA 3W81A 1XX1A 2TRSA 2WNWA 5TBOA 1E56A 3T78A 1FCQA 2I5IA 4M80A 4BY3A 4WHBA 1DWAM 4FHAA 1V6VA 2FGLA 2FB2A 5CQ1A 4J5NA 4JYDA 1CLKA 4ACYA 3GHSA 4LFYA 1GYLA 3QM3A 1JPHA 3IGXA 5FJRA 2Q8LA 1H7NA 1V3JA 3TA9A 1XBVA 1GNXA 2RGMA 3RCNA 1OFPA 3UYCA 3AMDA 3PZIA 4B5SA 4HHPA 2D69A 1QBBA 1ZU8A 4L64A 3TTEA 1QO2A 5I3GA 4P7OA 2W66A 2FGBA 1B4EA 4JZ5A 1FWIC 2INEA 2NV9A 2X0SA 5HMEA 3P8IA 2DPEA 4FOJA 1ZS2A 4N6FA 4Z1CA 4Y2WA 2CW6A 2PLMA 4DBDA 2YDRA 1FWCC 2Y4SA 4EXQA 1J0IA 3KXQA 4MVAA 3QBUA 1SJCA 1XCXA 3ITVA 1TVPA 4PFMA 4I7VA 1DXFA 4GC4A 4Q6JA 5H1WA 3N4AA 2FZ9A 2HPIA 2CLFA 5CEWA 2X1UA 2OZ0A 3M07A 2V63A 4K38A 4WD0A 4C6KA 1G5AA 1N8IA 4N2YA 3QV7A 1XDLA 4N42A 3U9IA 1B0IA 1DIDA 4YTQA 4W93A 4I3GA 1BYBA 1QFEA 4HTBA 3E0WA 4Y9PA 4MDPA 1GJWA 3UA4A 4LBSA 3EPOA 1EL3A 3K13A 2J74A 3D3AA 1O7AA 1TUXA 4M3PA 3ZIZA 4BF7A 1UKOA 2ZX6A 2OKOA 2NW0A 2Z6JA 2GDUA 3BLPX 1JIBA 3LCIA 3V7PA 4D6EA 1H5YA 5DT5A 1VBJA 3KCOA 3J7HA 1SW0A 1N82A 1V0KA 4NQ1A 3CPRA 1VYPX 1UPMB 3M5VA 5HQLA 5HUPA 4JTHA 2GGJA 4WVXA 4C6FA 1XUUA 5JUVA 2WSRA 3KE0A 2Q01A 4G1NA 3SUWA 1W9DM 2A6NA 3D46A 2Z4GA 3B04A 4NAEA 4PUUA 2NUXA 4KEMA 3VNKA 1F3XA 1TPUA 3NNTA 2FB3A 3TN3A 1OX5A 2QCDB 2QCMA 2WC7A 3C2RA 2VR5A 1XD1A 4S3EA 3WNLA 5EA9A 3UZXA 2V5KA 2C6QA 4D1IA 2OX1A 4C90A 1RAKA 2WB5A 2ZA3A 2YXXA 1PCKA 4GNKB 3RMJA 3SCRA 3WFZA 5TQLA 4YVXA 1SR9A 2PDCA 2XG9A 5HANA 1XBZA 2WSQA 3A47A 3BCJA 3T1GA 2A3LA 3MWAA 3EMCA 4NG3A 3TFXA 2VC7A 2R1MA 2XIMA 5A8NA 4U4MA 3QY6A 1B3ZA 1E5JA 3GKAA 3WLMA 2J7EA 2Y62A 4IMFA 3RILA 4CNOA 5B80A 1B5TA 2FZMA 3CM4A 3C0LA 4LBUA 1H7OA 2GWNA 4I5UA 1ALDA 4XTIA 4JY8A 3LQGA 3LI1A 1OC6A 3L5MA 1KWGA 1FQ0A 1TB3A 4JL1A 3PHAA 3W70A 3PZTA 4V1XA 3SDOA 3TYAA 3WDRA 2OOGA 1DQXA 3WMLA 1G7UA 1Q65A 3NZRA 2E28A 5I3HA 3COTA 4M6PA 1EJWC 1DWJM 3N2MA 3H4WA 2FPYA 5T9BG 3F2BA 3NQCA 4JQAA 3AC0A 1IXQA 2I9EA 4JKLA 5M17A 1X6NA 4AF0A 5IDIA 3C86A 4QEEA 3GAKA 2VFGA 1RALA 2VFDA 4F0MA 3LGDA 3W1UA 2I1OA 3B0VC 1GOXA 1EJTC 4EOUA 4IGHA 1TRDA 2GDVA 3CLMA 1LORA 1EX5A 3IRSA 5J04A 2EPKX 5GPRA 1UPPA 5AHIA 3B8VA 1I0BA 4B90A 1OC7A 2AGTA 3BLIA 4P8UA 5BWFA 1OF6A 3W85A 3S1VA 3NTYA 2NT0A 2WHLA 4DWSC 1KQZA 3T2OA 3VNLA 4L9YA 1PZ1A 1VPXA 1SFLA 1KR1A 1TIWA 4LS0A 3KBVA 4GK8A 3OU8A 4LVDA 1JQVA 3TP4A 4Q22A 5EBAA 4AHPA 3SQSA 3FNDA 4S3KA 3S83A 2A3EA 5H8MA 3O05A 2DP3A 1XM3A 3R6IA 3GZ3A 2L5HA 5CGTA 4EPKA 4ZOEA 3RPDA 1OADA 2A3BA 2NX9A 2BGNE 1ZHAA 1JZ4A 1A3HA 4PB5A 2FFIA 1JULA 3CXOA 3PK7A 2HS8A 3C56A 3TN5A 3PPFA 3K1GA 5D9OA 5CCZA 3AHXA 1CB7B 3WLRA 1ISVA 2BV9A 1LP6A 2PC4A 3TLQA 5CZJA 3QLLA 4MJZA 1Z32X 5I3FA 3USBA 1SJAA 1SUXA 4AEFA 4N0RA 3LBMA 3VIMA 3AMCA 3W37A 3EPMA 1QOPA 4D9PA 4H8NA 2GUBA 3QGKC 2XIJA 3O06A 4HZMA 2GGGA 3TAOA 3VK5A 3O07A 1JGMA 1W3NA 2AQOA 2ZUMA 2QJIA 2VDGA 4H8HA 1IQ8A 2FH6A 2HPMA 4KWWA 3RIKA 2FVMA 3ZWTA 3DH7A 3LOTA 4CN1A 3PPCA 4FNSA 4YVVA 5LIUX 4DWSD 1WYIA 4QP0A 3G18A 1A50A 3WQ5A 4IMAA 1E6NA 2JFEX 2R1PA 4HHHA 4PCPA 1YX1A 1UASA 3VCCA 4G56A 1UWQA 1S2VA 2PS2A 5FEXA 3ZR6A 1G4TA 1RCOB 2WM0A 3L9CA 4XVDA 3BO9A 4LYRA 4DM2A 3IIXA 4JEQA 3CEUA 2V3EA 3O63A 1PX3A 3A23A 8XIMA 2PTWA 3TK7A 2OKTA 1QPRA 3BMWA 1JJKA 4ASTA 2W61A 1L0PA 4AXNA 4WDXA 4CD7A 4JX6A 4C6MA 4QIUA 3SI9A 4Q8MA 2Y7EA 3CWHA 2ALDA 2QF8A 1X38A 3GIQA 4X22A 3CT2A 5LHFA 2DSZA 2V67A 4B9ZA 3EWWA 4HSOA 1HXJA 3V0TA 1MMFA 4C7DA 2ZBTA 2J9YA 4MKNA 2NX3A 1HTIA 3SCWA 1TZ9A 2X0HA 4YMZA 4X61A 3RLHA 3W28A