1W2PA

The 3-dimensional structure of a xylanase (xyn10a) from cellvibrio japonicus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
346
structure length
346
Chain Sequence
GLASLADFPIGVAVAASGGNADIFTSSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQKIVALSPTLKIKITELDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDSWLYTHQNLPDWPLLFNDNLQPKPAYQGVVEALSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A PRECURSOR
publication title The Use of Forced Protein Evolution to Investigate and Improve Stability of Family 10 Xylanases: The Production of Ca2+-Independent Stable Xylanases
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Hydrolase
total genus 132
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w2pA00
1GZJA 2JALA 4FK9A 2ZX9A 3WF3A 4UOZA 4LYRA 4W5UA 4CU6A 4KH2A 1E6PA 2JF7A 4ATWA 1E0WA 3W6LA 2ZX8A 3NJ3A 2X0HA 2VX5A 2J25A 5I24A 3TOPA 5FL1A 2DPEA 4TUFA 1CNVA 1LLOA 1NP0A 4ZEPA 2D24A 3GBEA 2CEQA 1MXGA 1OD8A 1XCXA 4QCFA 4CN6A 3T0AA 3SCWA 5A8NA 1XH0A 4AW7A 4NI3A 1R7AA 4HA1A 4GXPA 1HT6A 1QI5A 1VFUA 3SURA 2V5DA 4CCDA 1QBAA 3AYRA 1G0CA 2YIHA 7CGTA 2YLLA 3DYMA 2CHOA 5IDIA 1G9HA 3W4RA 2FHCA 4D6HA 5AYBA 1H5VA 3EDDA 4OUEA 1VB9A 4PMNA 3LPGA 1IT0A 1W3LA 1E6RA 4TXEA 2DT0A 1UKPA 3WL0A 4JIEA 3MMWA 2WPGA 1JF6A 1MFVA 2WWCA 1BYBA 2VOTA 1EHAA 2DIJA 3CH9A 1NH6A 4D71A 1UR4A 3BXWA 1VBUA 1PPIA 4W7UA 3RILA 1HKMA 3PTMA 4DM1A 3WQ5A 4QLKA 2EJ1A 4UFHA 3ZSSA 1AMYA 1IV8A 1H49A 3VGFA 4JFVA 4HTYA 2WVVB 1CLVA 2PWDA 3AROA 3SCNA 3W0KA 2G3NA 1BYDA 2NT1A 3CZEA 3A4AA 1UKSA 5CLWA 4TVCA 2Z1SA 3AMKA 4PYSA 1KWKA 1BVNP 5C71A 2WCSA 2ZIDA 1LG1A 2WW5A 2ZWYA 1E40A 1GOMA 1J18A 2WSKA 5LYRA 4AYSA 4EK7A 2ZXBA 1E70M 3AHYA 2VO5A 2WHKA 1UA7A 1EHNA 3BGAA 4CUCA 3IK2A 1OBAA 1GNXA 1W9VA 4AZIA 3M7SA 2Y8KA 2WC7A 1NM9A 2O92A 4AZCB 2YL5A 5A8QA 1LL4A 1E72M 1C93A 2AMGA 4DWSD 1WPCA 4ML4A 3CZGA 1TVNA 1TCMA 2GFTA 4UFLA 4W86A 3VPLA 3ZJKA 1ISYA 2FH8A 1UWQA 1OT1A 1VJZA 3VD3A 2VL4A 3N13A 4BQ5A 3MUZ1 5D9OA 3AIWA 1IZKA 3WF0A 5LA0A 2WKLA 4AWEA 3WQ4A 4DUVA 3WDPP 2O9OA 3ZT6A 4BF7A 4PN2A 4TTGA 4W5ZA 4MNLA 2CERA 4BQ4A 2X0YA 3K46A 5BXTA 2O9RA 1Q6GA 4OBSA 4FLSA 3UETA 3AZSA 1TZ7A 5I5RA 3GNPA 4AZGA 2HVMA 3WUGA 3VDBA 3VMOA 3WD1A 4WIWA 5A69A 4XZBA 3K4DA 2VRKA 2D20A 3WDJA 1R8LA 3OB8A 1HVXA 2Q8XA 5D9PA 3UG4A 1EQPA 5DO8A 4AEEA 4H8UA 5DFAA 2VT0A 5C8BB 2E40A 3PBGA 1HXJA 4ZE4A 4H04A 4FLQA 1FFQA 3W6MA 1DWAM 1S46A 4UZSA 3U7BA 1PZ3A 4CD8A 1BG4A 3K1DA 3PTKA 1V6VA 2ZICA 1E5JA 1OT2A 2YA2A 1J0HA 3GNRA 1C8XA 3ZIZA 2VZOA 4DUXA 1JL8A 5DT5A 1JZ2A 2JF6A 3FN9A 3VOCA 3WH6A 2BY1A 1JYNA 4UNIA 3BMWA 2IXUA 1UD8A 2WVUA 2XFRA 1NWTA 4JFTA 1E15A 1XHGA 3MMDA 4KGJA 4PUEA 1RD6A 4Q7NA 4AZBA 3WUBA 2G41A 3L2MA 3QOMA 3EYPA 3N04A 4MB1A 3AXXA 1VRXA 3NSNA 4YPJA 2WZIA 3DC0A 4M56A 2V3DA 1V0MA 7TAAA 2CESA 3AMCA 2EPOA 4U2YA 1H0IA 3W24A 5E0CA 5EFFA 4K68A 1I1XA 4EAMA 1VFMA 3TTOA 2TAAA 2WK2A 2XPKA 4CU8A 2WHLA 4UR9A 3CLWA 1TA3B 2EPMX 3GXFA 2UY3A 1PX8A 4HZ8A 4J3SA 2DH2A 4UQAA 3VIFA 3UR7A 3AIEA 3DECA 5CGMA 3BAIA 1K9EA 3M6DA 4C7GA 1GVYA 1CIUA 2ZUNA 2J7DA 1JZ4A 4V27A 5HOSA 2QV4A 1DWIM 2NSXA 3WBAA 3NCOA 2XM2A 1CXKA 1U30A 1PJ9A 3RCNA 4M1RA 1ZJAA 2E8YA 1GORA 2EO7A 1BLIA 1OB0A 2WZEA 1V6WA 1QHPA 4AD2A 2XSBA 3VIJA 2WLZA 1C91A 3UESA 4HMCA 4HOXA 2DQXA 5A94A 1G01A 1LWJA 2UY4A 3N9KA 3THDA 3RM9A 3VIGA 3VIPA 3OGRA 2XIIA 4MJ2A 3TTYA 5BCAA 9CGTA 3GTNA 4E4PA 3BSGA 5HPOA 3BAKA 2VCCA 1EDQA 2GK1A 3J7HA 2XVKA 4W85A 3B8SA 3JUGA 1IZJA 1B3VA 4X0VA 4DWSB 5I2UA 2XVLA 1SR0A 3O2LA 4J3VA 1OM0A 4CN1A 3VIKA 1UZ1A 1QNQA 2VVSA 1OINA 4RE2A 2VR5A 3CUHA 1E3ZA 3AI0A 2A3AA 3ZM8A 1SFSA 1ZL1A 2ZWZA 2ZUMA 1KCKA 4UCFA 1UZ4A 4IUGA 3VIMA 5JIWA 4WKFA 4IPLA 4LPCA 4F66A 4DUWA 4D1JA 3WNPA 1HIZA 1US3A 3EBVA 1OSEA 1DWGM 1AVAA 1B1YA 4R5EA 1EA9C 1KXHA 1QI0A 1UD6A 3CMJA 4D6DA 4Z2JA 4NRSA 1KBBA 1PEZA 5KZ6A 2C7FA 4F9DA 4F9JA 4H7VA 5GPRA 2ZUSA 1E73M 2ESCA 1OD0A 4IISA 3MUY1 3F4VA 3MSGA 3VNZA 1XSJA 2WVTA 2CNCA 3CHFA 4XV0A 4BS0A 3PHAA 3WMBA 4AD4A 1L8NA 5IHRA 4GIAA 3T08A 1TFVA 4CD5A 1V02E 3TA9A 3RJXA 4M82A 3SCOA 3N12A 3OIHA 4H8VA 1CWYA 4WF7A 1UH2A 3ARTA 3N15A 2XG9A 1E9LA 1J0YA 4JFWA 1JZ7A 2VQUA 4Q22A 4P7QA 1FHLA 3L4YA 4GO8A 1PIGA 5F7UA 4CD6A 1E0VA 1HKJA 3SUTA 4AEFA 2WVVA 5HPCA 4AZ6A 4EE9A 4A4AA 2Z1KA 2XFYA 1VENA 2G3MA 2X09A 4LYPA 5I77A 2VX6A 1BFNA 4MAZA 5LA1A 5BXRA 1B3XA 1J0IA 4W87A 1MQQA 3WNOA 3VD7A 3WNKA 3CO4A 4QCEA 5D8ZA 3WNNA 1UYQA 4B16A 4GI8A 2X1IA 3KZSA 1KFWA 5D4YA 4NZCA 3QR3A 2OSWA 3AIQA 1W9BM 2ZX5A 2MANA 1C7SA 3WDQA 4HOZA 4PMVA 2XYLA 2XJ7A 2W92A 4AIUA 1V08A 3SCPA 2BNJA 1WZLA 4AZCA 3OLIA 3SUUA 3B9DA 5IFTA 3NUKA 3GH5A 4BA0A 1CGVA 5I23A 1EDTA 3AMGA 1FH9A 2VQTA 3U5UA 4TVDA 2QPSA 1XH2A 4AIOA 1UKOA 4U5IA 1X1NA 2W4XA 4PMDA 1XYZA 2FGLA 4L4PA 3MSDA 1G5AA 3T0BA 5CSYA 4ZENA 2VRJA 1BGAA 4D6FA 5A6LA 3VVGA 2D3NA 2W61A 4ACYA 3AISA 2O9TA 3LMYA 2UY5A 4OOUA 3AOFA 3BLPX 1YHTA 4JAWA 2DT1A 4CCCA 2X2YA 3TONA 1FH8A 3FAWA 5A8PA 2V3GA 3ZT7A 3VIOA 3WF2A 4PMZA 3WF4A 2WC3A 1W32A 3ARSA 1H1NA 3PZTA 3RJYA 3OGVA 5M17A 1MYRA 2FGZA 4F79A 1EDGA 1J0JA 3KWXA 3WBEA 3DHUA 2WMKA 4P8UA 1H2JA 2YBUA 3OZOA 4E2OA 1MQPA 3NYDA 3M46A 2Y5EA 2D0FA 2ZUUA 4GO9A 4UQ9A 1JD9A 2PWEA 1VBRA 5FL0A 5AY7A 1QHOA 4TTUA 3MV11 1LG2A 4PMOA 1Z32X 3IAQA 3CBWA 1WZKA 5BYWA 5E70A 4WKAA 1BSIA 1K9FA 3AIRA 3L4VA 1W9PA 4PEEA 3WH5A 3EDEA 2DSVA 3AFBA 3WENA 2E9LA 5I6SA 1BVZA 2JFEX 4QLLA 3WNLA 2YL6A 1C3FA 1FOBA 5I0DA 1ZB5A 3OLDA 3W38A 2VC9A 4UOQA 1ITCA 1W3KA 2E8ZA 1MW0A 2J8FA 1EQCA 1X6NA 4OOZA 3GZAA 2E9BA 3AXIA 3B9AA 4OZOA 2Y8VA 3OLEA 2BHYA 1GONA 1CXLA 1V03A 4IM4A 2NW0A 1A47A 3CTTA 2GDVA 1V0LA 1GQLA 4U31A 1E71M 3DHPA 1GJUA 3VX1A 4XB3A 4WJXA 4MTVA 1TG7A 4GKLA 3ZOAA 5I78A 3CZ8A 1NWUA 3N1AA 1HL8A 1KGXA 4RE3A 2CBVA 2WMHA 3VKKA 4JHZA 1I1WA 2A3HA 4J7RA 1D2KA 3S2CA 3TTSA 1V3JA 2DSWA 2WXDM 4B15A 2FDMA 4MPKA 1D3CA 1OCQA 1HKIA 5ABEA 4AD0A 4GQRA 1JF5A 2F61A 2Y4SA 2WMJA 3NDZA 3AS1A 3MMUA 2WLYA 2J7EA 3BAYA 3I3BA 4LQ1A 1HJUA 3VGGA 1ISVA 2F2HA 3LPFA 5BRPA 2BY0A 3CIVA 4PTXA 2OWXA 4URIA 3BC9A 4NSBA 1J11A 4AD1A 3NSXA 1ISWA 3WDIA 1V3KA 1WDSA 2D0HA 2DSKA 4AC1X 1KWGA 3PN8A 1JDAA 5A6SA 2FH6A 5CGTA 4ZFMA 2EPNA 4RE4A 1V3LA 2JEQA 1DP0A 3ARZA 4WSJA 4AZHA 3AS3A 3PZGA 3E1F1 3MKKA 4DWSA 1JFHA 4GI9A 3T09A 3VNYA 2E4TA 4LGXA 1B30A 1E0XA 5M03A 1UWUA 3CZKA 4KWUA 1F4AA 5E6YA 3CHEA 1BG9A 3CGTA 5CPTA 1UUQA 2AOSA 5BWFA 3PZ9A 5FIPA 4WKHA 3FY1A 4HA4A 3VILA 2WYSA 3WD3A 2GSJA 4MAVA 1EOKA 2VX7A 2V3EA 3SCSA 1GQKA 3FW6A 4AXNA 2W91A 4MB4A 1E4MM 5C70A 4JL2A 4KMQA 5AYIA 4PMRA 3GH4A 3RM4A 3WMSA 4P7NA 1EGZA 2X05A 1Q6CA 1JXKA 4PUDA 3FNDA 4HMEA 3SCRA 3NSMA 1XGZA 5EMYA 1W1TA 1UQZA 3WN6A 3MO4A 3VGDA 1LJYA 1UH3A 2CKSA 3ZR6A 4KRUA 2GJXA 3UEQA 1R87A 2PWFA 4P7LA 3K4AA 1FFRA 3ZJ8A 2WWDA 2CETA 4N42A 1HN1A 5FCZA 3TP4A 2CXGA 2J79A 1GW1A 1VF8A 4FF5A 3GBDA 2XWDA 4GZEA 1V6YA 4BZYA 4P8VA 1ZS2A 1E43A 3ARWA 1JNDA 1PX4A 3N11A 4PTVA 3W26A 1QI3A 2G3JA 3L2LA 4AISA 5BXPA 2FHFA 2RGMA 1E4NA 2BV9A 4W7WA 3L4UA 5ABFB 4UZUA 1DWHM 1Q6FA 5BROA 3RO8A 1MFUA 1HX0A 3VDHA 4X9YA 2J75A 1U2YA 1KQYA 5ECUA 1E4IA 2PWHA 3SCTA 4U33A 2VNCA 2YKKA 2YA0A 2BY2A 2C8NA 1GPFA 3ECQA 1VFFA 1GOWA 2DT3A 3CMGA 1DTUA 4U5KA 4JZ5A 3WELA 5E9AA 4M29A 3F5LA 3MUAA 3IJ8A 2NT0A 3AZRA 3ARXA 5ABGA 5IXEA 5A2CA 1A3HA 1HF6A 2OYMA 1JG9A 4W7VA 3VINA 1ZBWA 1KBKA 3WUEA 3QHOA 3WEOA 4EANA 2ZXDA 1GOKA 4PMYA 4CGTA 3AHXA 1C7TA 2E9MA 1VEOA 1CBGA 4XUYA 1UHVA 4MNJA 4OIFA 1CLXA 4PSRA 3D5HA 1MWOA 4MB3A 2XM1A 4YN5A 1JDDA 2XVGA 4PMXA 3FAXA 1LL6A 1ZBVA 1QHZA 3AS0A 3OZPA 4JKLA 1VIWA 3ARYA 4JL1A 1QNSA 1M7XA 4J27A 8A3HA 2VZVA 3WL1A 8CGTA 2JIWA 2DDXA 2WHJA 4JHOA 1TE1A 2D22A 1LQ0A 3WD4A 1PAMA 4W89A 4JFUA 3SIMA 4PTWA 3UERA 1TR1A 3A4XA 2QF8A 2YOCA 4D1IA 2OYLA 5FD0A 5KEZA 1H4PA 3UCQA 4H8HA 2IXVA 3VD4A 5A6MA 2BHZA 1W1VA 4UQCA 5M5DA 2BXZA 1CENA 3PZNA 1VAHA 2PB1A 3PZVA 4S3KA 1FP9A 1GUVA 5A8OA 1ISXA 5JBFA 2WMIA 5CG0A 1CGXA 2GVYA 3QHMA 3VIHA 3KL0A 1KXTA 4D6JA 3QHNA 1QI2A 2A3BA 3W82A 1RP8A 2Y2WA 4LXFA 2WHMA 1UKQA 2DEPA 5EBAA 4W84A 1W91A 3WDHA 4Z2LA 1HP5A 2OLHA 5LA2A 5GNZA 1DHKA 2J7FA 2GJPA 4ATDA 3DYOA 1QNRA 1H09A 1R85A 2ZX6A 1E6XM 2WSPA 1PX3A 1JAKA 5EB8A 3MS8A 3ARUA 4QLJA 1CXIA 4ZXLA 1V6UA 4OKDA 3RDKA 4CVUA 2BFGA 5HXMA 1TVPA 1U33A 3RM8A 3WEZA 2W66A 3SUSA 2AAAA 1EO7A 1UA3A 1OWQA 4M81A 1KXVA 2V38A 4W8AA 5A6AA 2BHUA 2J8GA 1VEMA 3NIYA 4BCEA 1W2VA 3LPOA 1JZ5A 2J77A 2VCBA 4D6IA 3AIVA 1EH9A 3VIIA 3N18A 3ARVA 3W27A 1JYXA 4CVWA 5JUVA 1HVQA 4W88A 1NWRA 1G94A 5A2BA 3WD0A 4BQ2A 3MV01 1Q6EA 5AC5A 5CSUA 5HBFA 1N82A 4KGLA 3K8LA 3IANA 1R7OA 1NQ6A 3WH8A 3ZO9A 2GDUA 1BYCA 1JZ8A 1M01A 2EBNA 3AJ7A 3WQ6A 3QOKA 3CZLA 1BGGA 1GHSA 1UG6A 2WKGA 3AIBA 4V28A 1BHGA 1ISZA 3THCA 3BAWA 2BS9A 3L4WA 1BYAA 1D7FA 4UQBA 2JEPA 1XYFA 1W2PA 2PBGA 3VM7A 4PSPA 2WC4A 1K6AA 1ITXA 1HP4A 4UFJA 2YBTA 5CLTA 4GPNA 2Y24A 1B2YA 2ZXQA 1FP8A 1WDPA 1L0PA 5A6BA 1AQ0A 4DWSC 5FOOA 2VVNA 3SCUA 4TX8A 4H2CA 3CHDA 4R27A 3ARPA 1AQHA 3BAXA 3IAPA 1CGWA 3PZUA 2ZUTA 2W63A 3GYCA 3VTRA 2QMJA 2VURA 1LF1A 2DH3A 2PI6A 1M04A 4WSKA 2WZHA 5D9MA 1GOIA 2D2OA 1BPLB 2D3LA 4MNMA 5EFDA 4UQEA 1WO2A 3AICA 4XX6A 3AMDA 3GNOA 3ZJ7A 1B3WA 3WNMA 2ZUWA 5HNNA 5AC4A 2EPKX 3LPPA 1H0GA 4MDPA 4PTMA 5A1AA 3IJ7A 4QP0A 4AY1A 2W62A 4HOWA 2WBGA 3O9NA 1B31A 4BQ3A 4PRWA 3WFZA 2G8ZA 3I3EA 2DSUA 4ACZB 4QAWA 1NOUA 4D6EA 1JZ3A 2VMFA 5DMYA 1J10A 2OSYA 1UR1A 1JXJA 1XSIA 2GK1B 1UKTA 1ZU8A 2VRQA 3O6AA 3FHQA 4TVUA 1O7AA 1C90A 4M8UA 2J47A 3PZQA 1ZJBA 4Z2KA 2YLAA 1Q4NX 3AZTA 3ZSTA 3AIUA 4P8WA 5JBEA 5M3WA 3EMZA 2OYKA 3WDRA 1E56A 1HJXA 1VJSA 1HJVA 1KR1A 2WMGA 1QI4A 2PWGA 2XVPA 5DEZA 3T2PA 1EO5A 1UWTA 4J3UA 2J78A 4B9ZA 2EQDA 2CKRA 1NOFA 4JCLA 2ZUVA 4AZ7A 1EIBA 1E1EA 3A4WA 4U3AA 1RH9A 6TAAA 2WBKA 3VD5A 7A3HA 5ABFA 2XSAA 4OJYA 2EPLX 3ARQA 1WNOA 1UWSA 2E0PA 4A3HA 1J01A 1WDRA 4PCSA 2BVTA 1TA3A 3SCQA 4M24A 1ESWA 1TUXA 3VO0A 1K9DA 1ODUA 5A8MA 4QDMA 4WK9A 2J7BA 3I3DA 3WFLA 2BXYA 2YDQA 2DIEA 4UTFA 3WUFA 4CD4A 5E6ZA 3OBAA 2VJXA 2QHAA 5TD4A 1JI1A 1KGWA 5DF0A 1MW1A 3ALGA 3EDKA 1E4LA 2OWWA 6A3HA 4AIEA 5A6KA 2UY2A 3APGA 1V3IA 3VDAA 1W9UA 1QW9A 2J74A 1UR9A 3CHCA 3VGEA 2HISA 4A3YA 3VU2A 3WEMA 3EDJA 4YHEA 1X6LA 3AXHA 3NDYA 3ZR5A 2B31A 1W3JA 1OGGA 3POHA 3GXMA 3WY1A 3BCDA 4Z2IA 1JFXA 3FHAA 1R86A 3KL3A 3EDFA 5D9NA 4L4OA 5FKYA 2YDSA 2XHYA 4F8XA 2G4FA 1C92A 1FH7A 2OSXA 1YQ2A 1K9TA 2W5FA 1MVYA 3L4ZA 4CU7A 5GQBA 4W8LA 1B9ZA 3CZJA 2WCAA 1J0ZA 3POCA 3KL5A 2BVYA 3WQVA 2YJQA 3RIKA 3EMQA 3U7VA 1B90A 2ZOXA 5D8WA 1CPUA 4UFIA 1DWFM 1HJSA 4Z2HA 3A6OA 3W53A 3WH9A 1Q6DA 2C0HA 1FA2A 5CZKA 1CXHA 3A3HA 4PMQA 4E8DA 3G6LA 1EXPA 2YA1A 1KCLA 2VUYA 1J9YA 1TMQA 1V0KA 4XZWA 3OGSA 3W29A 1HJWA 3UR8A 3ZQ9A 1XSKA 2PF0A 5A3HA 2XIBA 5CPSA 1WAWA 4GZIA 3F5KA 4H41A 3K8KA 2XGIA 2CPUA 3MU7A 1GQJA 1XRVA 1ZBKA 1E1FA 1H3GA 1CECA 1QNOA 3PZMA 5CPQA 4GINA 2GJRA 3N17A 3K8MA 1JNEA 2DGAA 2G3IA 4MNKA 1E6QM 4J3TA 3F5JA 4QFUA 1XCWA 2VZUA 3VGBA 4DM2A 3PZOA 4PCTA 3U57A 4D6GA 1I75A 1GHRA 2X8RA 3SUWA 1AQMA 3SEPA 1PBGA 1XH1A 2J7HA 4P8XA 1KR0A 3T0DA 3VX0A 1M53A 2GUYA 1GVIA 3S6TA 2ZX7A 3GXIA 1VFOA 3KE0A 4HU0A 4UOJA 4C7DA 1CXEA 1UWRA 4IPNB 2CBJA 4JCMA 1PZ2A 3WMCA 1HKKA 2RGLA 1G1YA 1B3ZA 5JIPA 1QBBA 4HZ6A 1CGUA 4P7OA 3RPMA 4AMCA 1QOXA 3SCVA 1MQRA 4B3LA 1H11A 2XVNA 4S3JA 1V02A 3ZMRA 2DSZA 1UQYA 3W28A 2CIPA 1BQCA 3GDBA 1PIFA 3L4XA 3U5YA 3M07A 2E3ZA 1GJWA 1SMDA 1J12A 1UD2A 4HMDA 3BMVA 4PBGA 1BAGA 1WP6A 3D3AA 1JI2A 4CKQA 3WF1A 1CYGA 2VZTA 3SUVA 1ODZA 1ZBCA 1CGTA 3ALFA 2VR4A 1GOOA 1EOMA 4E8CA 1KB3A 3AMLA 4U2ZA 4AZ5A 3GXDA 4AD5A 4YHGA 1WZAA 1LWHA 1CDGA 2D1ZA 2CITA 4UFKA 1W3HA 4MB5A 1XD1A 1GQIA 4M80A 4JFSA 4UQDA 2A3EA 3ZJ6A 5IFPA 5GNYA 2UWFA 3WH7A 3OA5A 3II1A 3VMPA 4FLRA 1C8YA 3AQUA 3IJ9A 1C8QA 1GOQA 1RPKA 4D72A 4RL3A 1NARA 1V6XA 1BF2A 3VGHA 5A6JA 1NWSA 2EEXA 3WQ8A 1OGSA 1RP9A 1CEOA 4GI6A 4HPGA 1VEPA 2XFFA 4ACZA 5BRQA 3AHTA 1NOWA 3BAJA 4J3WA 1QNPA 1JYVA 3WQWA 2CHNA 5CQ1A 3WKZA 4D6CA 1E6ZA 5I79A 1OIFA 1H41A 4MJ4A 4PMUA 3TTQA 1WDQA 2WMFA 4MDOA 2F8QA 1JD7A 2J4GA 4N0RA 4J3XA 5BXSA 2J62A 1JZ6A 3BLKA 1UOKA 1WZMA 4U3CA 3CUIA 2ZE0A 1W1PA 3KEHA 1UD3A 4P7RA 5CJ5A 4X0NA 3OG2A 2D0GA 3UG3A 2EXOA 3L4TA 1E5NA 1O6IA 2V5CA 3AHVA 1QVBA 1W9XA 4FLOA 3QGVA 2WB5A 1ECEA 3AHZA 4HZ7A 1JAEA 3CUGA 4GQQA 3WSUA 4NRRA 1CXFA 3A47A 1CGYA 3UG5A 2WCGA 3CUJA 3ARRA 4HP5A 1UWIA 2OWCA 4CCEA 3ZT5A 1Y7VA 3GM8A 1CZ1A 4CN4A 3CPUA 2O9PA 3MUIA 4WLCA 1QPKA 2A3CA 2QMKA 1E3XA 2PC8A 4LYQA 2WM0A 2QLYA 2J7CA 3AYSA 4KRTA 4HPHA 1WE5A 3DYPA 3RMEA 4CD7A 3T2OA 3VMNA 2WVSA 3HJEA 1JIBA 5A2AA 1B3YA 1HJQA 3W81A 2GJXB 1BTCA 2CBUA 3WD2A 1DWJM 1J0KA 4J28A 4Z2GA 4JKKA 2VZSA 1JYWA 4FMVA 3VUPA 4OBRA 1US2A 2PBOA 1DEDA 1B0IA 3VDCA 1V3MA 1F4HA 2QPUA 4TX6A 4JKMA 1FHDA 3G6MA 4ATLA 4ZXOA 1HL9A 2D23A 2IUZA 3PZIA 2CYGA 2JIEA 1UR8A 2J7GA 3VM5A 5JBDA 4MADA 1UR0A 1HNYA 4W8BA 1JGIA 1P6WA 1UD5A 4Y7EA 5I3DA 3AS2A 5DT7A 1GCYA 1MW2A 2BVDA 2YL9A 3HMCA 3B9EA 1E6SM 3VD9A 1SMAA 2FHBA 1MXDA 2YDRA 1WB0A 3WIJA 1KGUA 5IHSA 1XD0A 3CUFA 3PTQA 2JE8A 2BY3A 2CCRA 2WNWA 2XGBA 1SYTA 2CBIA 1XV8A 4ZE5A 4B3KA 1LL7A 5E0FA 4B9YA 4UFMA 1WCGA 2YL8A 1E55A 5A6BD 3FXYA 4C7FA 3MANA 1XC6A 4TOQA 2XWEA 2W67A 2XUCA 3BCFA 1UD4A 5ABHA 3BH4A 2VTFA 1QW8A 2VX4A 3GH7A 3OLGA 4HA3A 4HU8A 4W93A 5HDRA 2VI0A 4EKJA 6CGTA 2XTKA 1WKYA 3W25A 5A95A 2DT2A 4LX4A 1M03A 5CXPA 4AD3A 3BSHA 1CTNA 2WANA 1UH4A 1OGBA 4GZJA 1MW3A 2VCAA 3HN3A 1JDCA 2V3FA 2WAGA 2ZXAA 1NP2A 1W1YA 1KXQA 1E6NA 1V3HA 4NF7A 3W37A 1OIMA 1UR2A 4V2XA 1KQZA 3T2QA 2WMIB 3HU7A 5GNXA 1W9DM 5E09A 3EMCA 1V0NA
chains in the Genus database with same CATH superfamily
4DX3A 1KC7A 1XKJA 2ZX9A 1OZQA 3WF3A 2B0MA 2OQHA 3FJ4A 2GVLA 3KOWA 3U48A 2JF7A 2POZA 3VCCA 3V18A 2PGEA 3UP8A 3TOPA 5FL1A 3V0UA 5AC6A 3OG3A 4ICMA 2OGYA 1XH0A 4AW7A 1VHNA 3CV1A 1D7KA 5TQLA 3EXRA 1ELSA 4PUUA 1K7XA 4DJFC 1NELA 4IFOA 2GSEA 3EX4A 1ZENA 3TWBA 2O7SA 4C60A 5K3VA 1XP3A 4GYPA 2IKJA 4Z17A 1Q6OA 1VB9A 3LPGA 1W3LA 1O12A 1TPH1 3GO2A 1Q85A 1AZ2A 4RDVA 1K8CA 4F40A 2F6XA 3MMWA 2WPGA 1K7EA 4JTGA 4PB3A 4HA0A 3DENA 2OGJA 1REQA 4H9YA 2JKAA 1UR4A 2PLKA 1BRLB 2ZQ0A 3TJIA 1PPIA 4FALA 1HKMA 5C2CA 4EF9A 2XH4A 1S3HA 2Z6JA 3WQ5A 5PTDA 4E2VA 5HR6A 3VGFA 3URBA 4JFVA 3LXBA 1CLVA 3TU9A 4JX4A 4YTSA 2NT1A 2XINA 4J9JA 4WY0A 1PZ0A 2X1TA 1EIXA 4EX4A 4PYSA 3TWAA 3VOGA 5C7VA 5TAOA 4LAKA 1HO4A 4EK7A 1IWAA 3TYCA 1EHNA 1SFJA 3VZYA 2V82A 4CUCA 3HV8A 2FMNA 3IK2A 1OBAA 4LT9A 1W9VA 1WXZA 4XWUA 1NM9A 4PE8A 4AZCB 5BRBA 4HMNA 1LL4A 2Q8LA 3NFUA 1TX2A 4E8GA 5FEWA 4F0LA 4GJ1A 2GFTA 4UFLA 5A8GA 3VPLA 3ZJKA 1FKXA 1VJZA 3VD3A 2WOQA 3MUZ1 3PFRA 5D9OA 3NZGA 1WUFA 5LA0A 3HTWA 3WQ4A 4QEEA 1G4SA 2O9OA 4W5ZA 2R1LA 4MNLA 1UJPA 3K30A 2Z26A 3IIVA 3K46A 5BXTA 2O9RA 1ENUA 1TZ7A 1AK5A 5DELA 3VMOA 4XZBA 5AHIA 5DBUA 3OB8A 1VCVA 2Q8XA 1O94A 4M5PA 5DO8A 4A8NA 3E9AA 3MZNA 2HV5A 2RKXA 3CASA 4XBSA 1FWJC 3LXCA 4F0RA 1HXJA 4O1CA 4FLQA 4PL1A 1EKOA 1ADDA 3EPOA 4GA8A 3M5YA 3OODA 4AY8A 3I6EA 5CAKA 1OT2A 2GQ8A 2HQAA 3GNRA 1IEXA 5DT5A 2GOUA 2JF6A 3FN9A 4R3UA 2J8TA 4JTAA 5REQA 3NQVA 4UNIA 1SU5A 3BMWA 3TEVA 1UD8A 2WVUA 2IKHA 2XFRA 4JFTA 4MWAC 3S5YA 4XZLX 3MMDA 1RD6A 4Q7NA 1XI3A 4XAYA 4V15A 1XLAA 3E2RA 3QOMA 1KBJA 5DMNA 3NSNA 4E2DA 3RRAA 3FSTA 4YPJA 1FHVA 3BANA 1V0MA 3COTA 4U2YA 3V3WA 1XQKA 3IS4A 2ZZ7A 4CU8A 3CLWA 1TA3B 2EPMX 5CZTA 4HZ8A 5DY3A 4IGHA 3VIFA 3AIEA 2JKEA 3DECA 4Q8NA 2B7NA 4U28A 3S3GA 4Q8WA 4JTFA 3UWVA 4C7GA 3LCIA 5HOSA 3SQSA 4Y96A 3S1WA 1KV8A 4KS0A 1CXKA 1OFOA 1S2TA 3E38A 4JIHA 2EO7A 5D32A 4AD2A 2XSBA 3VIJA 1RBLA 1C91A 3UESA 2I7GA 5F4WA 5A94A 1U5VA 2W79A 2FPVA 1JDEA 2C18A 1R9YA 3VIGA 3VIPA 3D0CA 9CGTA 3DFQA 5LXXA 1TPDA 1PWMA 4QITA 5KZEA 1YDYA 4QGCA 5I2UA 4NL1A 3XISA 1TZZA 2YSWA 5I3GA 1OM0A 1TWSA 2H90A 4K8HA 1FWFC 4DRSA 3PUDA 3W1QA 2PTZA 2PE4A 1Q8AA 2PA6A 4DJEC 1LCOA 1TREA 2PLMA 1SW7A 1SFSA 1KCKA 5T9CE 2V63A 1XDLA 1XIBA 5FJRA 4G2DA 3UCDA 4WKFA 5M1TA 4F66A 4DUWA 1PVNA 1US3A 1Q6LA 1XM3A 4KEMA 2RH9A 1JEZA 3G1RA 3RHGA 4B2DA 4FS9A 1TWIA 3DOPA 3CMJA 3E0IA 5ECVA 4C6IA 1NTHA 2R82A 3H7RA 4E4FA 2C7FA 1W5PA 3F2DA 3CEPA 1YXCA 4O11A 5GPRA 1JDFA 3MUY1 4KT2A 3B04A 5AZ0A 2WNNA 3VNZA 4E0CA 3E0VA 2ZE3A 1H7PA 2ZA1A 1OABA 4GVGA 1U5HA 2E25A 2E1DA 1L8NA 4GIAA 1TFVA 3QFWA 1S1PA 5BW6A 3SCOA 5KETA 3N12A 5B7ZA 3USZA 4XAGA 4ZO8A 1UH2A 3L7RA 3TQ0A 1J0YA 1AG1O 1EYEA 2DJXA 3L4YA 4N6EA 3U2EA 4LAZA 3S46A 2ISWA 4Q4QA 5DQPA 5HPCA 1YE6A 4GX8A 3SN1A 3GW0A 2Z1KA 2NXHA 3BK0A 2ANUA 3CK5A 3P14A 4IG2B 3LOTA 2OZTA 3HG2A 1AH4A 4MAZA 4IPPA 1B3XA 1AW5A 4F48A 4HZMA 2JGYA 3MY9A 2XN0A 4GI8A 2X1IA 3KZSA 4JTDA 1LRTA 4HU4A 4LUYA 1W9BM 2ZX5A 3B3DA 4PMVA 3W7IA 3D3FA 4CNOA 4DB7A 3SR7A 5E93A 1UP3A 4EXBA 3TR2A 4LAUA 5LIYX 2WV8A 4AZCA 3OLIA 4NP7A 1Z48A 2NZLA 4GK8A 5KSWA 2VQTA 3U5UA 2V81A 1R9ZA 3WJWA 4UTHA 3IUIA 1ZSXA 2QPSA 4D8LA 4JTUA 4U5IA 1X1NA 2W4XA 1PXGA 3BDKA 2DZUA 3MSDA 1I2NA 3T0BA 4GJJA 2TSYA 3GTFA 3VVGA 1QASA 1C29A 3ATZA 3AISA 4JY9A 1OVDA 4Q32A 4AVOA 1KLYA 4GOAA 4HNTA 1RBOB 3TONA 4LNYA 3HPSA 1BVWA 3R10A 3UZXA 5LSMA 1A5KC 3WF2A 2H8ZA 3DFOA 1F74A 3GR4A 3RJYA 2V9DA 3F4WA 4KCVA 3STFA 1J2BA 5AHLA 3OIXA 4WOQA 3ABXA 3LRLA 3LHWA 3D46A 3DHUA 1OX5A 1H2JA 2YBUA 1VHCA 5JVLA 3KOZA 4E2OA 4LEFA 3HPAA 3P61A 3M46A 2Y5EA 2ZUUA 3SIZA 1F6PA 1VZWA 2B7PA 2IQDA 4I8YA 3KHDA 5G4EA 5D2WA 1M41A 3LMZA 4WKAA 3EXSA 2QJJA 4OHQA 3R13A 3BSMA 3AFBA 3WENA 1K8ZA 1XLCA 3N73A 3MHGA 5I6SA 2JFEX 1XYMA 3NEHA 4ICNA 2PU0A 1AD4A 1IWPA 4NX5A 3UWEA 4H01A 2NX3A 2QDGA 1PO9A 1AL8A 3C4UA 4UOQA 3I4EA 1GEQA 2R1NA 2DVUA 3V7PA 5JH2A 1KM4A 2YCEA 4IM4A 3WLHA 1OQFA 4PCNA 1GQLA 1E71M 3RK8A 4XB3A 1FWTA 5K7JA 3L5LA 3ZXWA 1NWUA 2IKGA 4MZ1A 2DUXA 3QQ0A 1UR3M 4HCHA 1XYCA 4IQDA 3TV8A 1QWGA 2QUVA 3C2EA 4J7RA 3QC0A 1D2KA 3S2CA 4Q4MA 3M0VA 3LCXA 4MPKA 1D3CA 4GI4A 1VYRA 1OCQA 4F2UA 4LUSA 4XK2A 4GQRA 4RPPA 1WDDA 1JF5A 4XIMA 2Y4SA 1JRBA 4LH8A 1AL7A 3AS1A 2X41A 3QJAA 2KX9A 1XIJA 5DY2A 2R1MA 5BRPA 2BY0A 3CIVA 2OWXA 4AD1A 3NWRA 2XIQA 4MYXA 4J2MA 3B0PA 2FH6A 5A6SA 2NV1A 4OECA 2PEVA 3PUEA 1UOZA 5AHFA 3DFNA 3AS3A 3G18A 3PZGA 1L6WA 3MKKA 3OBKA 3VNYA 8XIAA 1D3GA 1XGDA 3LZ3A 2AKZA 5JMUA 2QIWA 1ZNNA 3S1UA 4KWUA 5E6YA 5D05A 5DXXA 4QR6A 1EP2A 5CPTA 5BWFA 1VBHA 3PZ9A 4HA4A 3VILA 2VEPA 1HG3A 2ODOA 1EOKA 2V3EA 4I9MA 4MB4A 5IBXA 1SO4A 2A85A 5K4ZA 1SZNA 3E2VA 3T9PA 5HMFA 3T1GA 4PUDA 2Q02A 1NU5A 2CLLA 4WCJA 3WLMA 3FOKA 1UQZA 3NQGA 3WN6A 3PBYA 1YTKA 3QGKC 1IGSA 3ZR6A 3A13A 4P7LA 4GKTA 3AU2A 3G1DA 3KDOA 2WWDA 1EC7A 2CETA 3W74A 1GW1A 2YCLA 2FJUB 4J35A 1EPVA 4BZYA 1ZS2A 3EWUA 1E43A 1FBAA 3H2OA 4UTWC 1JNDA 1Q65A 3N11A 3JW7A 4NJIA 2G3JA 4JHMA 2FHFA 1KTNA 3KCOA 1E4NA 4O52A 4A3UA 4W7WA 4O0QA 4YWIA 3HF3A 3RO8A 2WO5A 2PSNA 4DO5A 3DFTA 1HKVA 1VD6A 1XINA 2ICSA 3P5ZA 1U2YA 5ECUA 1JPKA 1E4IA 2PWHA 4H9UA 4U33A 3SCTA 3STPA 4IG2A 4M6QA 1GPFA 1GOWA 2DT3A 4EVZA 1DTUA 5E9AA 3E3HA 3MUAA 1FUYA 1YLVA 3IJ8A 3ITXA 1HF6A 5CGQA 1UC5A 1JG9A 4Q8UA 1ZBWA 3WUEA 2ZXDA 4LVGA 1GOKA 4CGTA 2ISDA 1CBGA 1LP6A 3WQGA 2VDHA 2OXNA 1UHVA 4OIFA 2DUAA 1RALA 3BOLA 2XM1A 1RLDA 1AODA 1UZDA 1YEYA 2B4GA 4XZNX 1LL6A 3HA1A 1BKHA 1F61A 3ABOA 3ARYA 2QCFA 3WL1A 3EAUA 8CGTA 4JHOA 2XIJA 1PAMA 4MY1A 4W89A 4CEUC 4QS6A 1TO3A 2QF7A 3T4CA 6PTDA 1KM5A 4KPLA 2Y61A 2QF8A 3SGUA 4O0KA 2XU2A 4M7TA 4QIUA 1H4PA 3UCQA 4H8HA 2H6RA 1IXPA 4NKCA 4F0KA 5A6MA 3UG8A 4KEZA 1HZYA 1CENA 4JYFA 1ECQA 3PZVA 4A8IA 2E5DA 3HGJA 4C91A 1P6CA 3FV9A 1GUVA 1AJ0A 1CGXA 1VPYA 3OO2A 4HHPA 3T07A 2IKIA 3CNYA 3KL0A 1KXTA 3VIHA 3W82A 3GKFA 3WO8A 2PP0A 3O6DA 4LRTA 4O15A 3TN3A 4B92A 3Q58A 1A5AA 5LZLA 4WRHA 4L6HA 4NUWA 1HP5A 5LIUX 3ITYA 5D2TA 1GGOA 3VA8A 3F2BA 1A49A 3CAWA 4UUIA 1OF8A 2P50A 3DYOA 4EOUA 3DCPA 5EB8A 2WSPA 3MS8A 3ARUA 3EXTA 4QLJA 1CXIA 1EJVC 3S6DA 3RDKA 3WEZA 4MUPA 3RM8A 6TIMA 2FTPA 2I56A 1KBIA 4I9JA 1JRCA 2XZ7A 1KXVA 3C61A 5CPLA 5A6AA 3CIWA 1XIIA 3DFSA 3NQDA 3S0CA 3AYVA 2Y7FA 4LEQA 1JZ5A 2J77A 5C55A 1WKFA 3OU8A 3H8AA 3NAVA 3W27A 4CVWA 4DPQA 3L66A 1HVQA 3P74A 4MVAA 4QJ4B 3KLKA 5A2BA 2ABBA 1QO2A 4BQ2A 3URQA 2FZ8A 5CSUA 1N82A 4KGLA 3K8LA 4IXXA 2PDCA 2A2IA 3S1GA 1CX9A 4YCPA 3E12A 3WH8A 3ZO9A 3GNNA 1BYCA 4YJ5A 3CO8A 2EBNA 4LCQA 2PPGA 1BGGA 1GHSA 1G4TA 4L64A 1BHGA 5FI8A 4P61A 3C2YA 4PC8A 3IGUA 2BS9A 1QT1A 3CQJA 5DRIA 2ZDRA 1WA3A 2YCJA 1TV3A 4PODA 3LY0A 1TJPA 3T0TA 4L4LA 1ITXA 2DVTA 3M44A 4UFJA 5BU6A 1W1B1 2XIMA 2YBTA 1RZMA 1B2YA 1FP8A 3LRKA 3FJNA 1RCXB 4DPPA 1AA1B 3QY8A 4DWSC 1ADSA 1S5MA 3CHDA 2NVAA 1AQHA 3IAPA 2F7FA 4IICA 3CM4A 1CGWA 3PZUA 2W63A 3GYCA 2OPJA 1T99A 1LF1A 1TPWA 3DESA 2D2OA 1BPLB 3EOEA 1T5AA 3S8HA 3HURA 3W1TA 4ADUA 3AICA 3NPVA 1E9ZB 4O0ZA 3WNMA 5HNNA 4MDPA 4B5XA 4JX6A 4B5SA 1TJ1A 2EG6A 2ZDSA 4AY1A 2WBGA 3N2OA 2W9MA 3PK7A 4NILA 4PRWA 4REQB 2G8ZA 3I3EA 4XO7A 3VOFA 1Q4WA 4NQ1A 2FFIA 3UJ2A 2VMFA 5DMYA 1J10A 3TIMA 1UR1A 2GK1B 4JPGA 2ISVA 4UTLA 2Y62A 1F73A 3PANA 4M8UA 1X6UA 1ZJBA 1H51A 3QV8A 2PF8A 3ZSTA 2I5GA 4V1XA 3EMZA 3PC0A 3P84A 3UGRA 3O0KA 1HJVA 1T6MA 2PWGA 3M5ZA 3T2PA 4AUBA 4X9SA 1GTHA 3GNXA 1EO5A 4YTTA 3EB2A 3PBUA 4Z1DA 1VYPX 1AMKA 2ZUVA 4CQ8A 1EIBA 2X2GA 3WQOA 2PD9A 3NO5A 4JBRA 7A3HA 3HQ1A 2PRLA 7REQB 1YNYA 1KFBA 3IK4A 5C9ZA 1TPB1 1E0UA 4DBUA 3SCQA 1TUXA 2Y63A 4DWDA 3VO0A 4C1NB 3KM8A 3UFYA 3F1QA 3M6YA 3PY2A 5K4XA 2YDQA 2DIEA 5H1WA 3U9IA 5E6ZA 4LW7A 1EWEA 3QTGA 5DF0A 1QOQA 2RDXA 3DHFA 4Y9MA 2G95A 3EDKA 4JTCA 1GKQA 4AIEA 5A6KA 3N9RA 2A6NA 3VDAA 1PYMA 3RN6A 3VGEA 5F2GA 2YBVA 1VRDA 3VU2A 3WEMA 3EDJA 5B7YA 3C2RA 4C6CA 5C9RA 5LIWX 1VJIA 5TF0A 3IJQA 1DIEA 1KM6A 3POHA 3GXMA 1DE6A 4HN8A 2NUWA 2I9UA 1KRMA 1KW1A 4NZ3A 1FH7A 2OSXA 2NX9A 1DTNA 1MVYA 5GQBA 1ME8A 3HOJA 4IL2A 2WCAA 5J5RA 2FQIA 1MDLA 3IGXA 4HQVA 4IQEA 3PBMA 1NDWA 3RIKA 3EMQA 4C6BA 2EAWA 4XD3A 1XYBA 1DWFM 1KRAC 3AJXA 2C0HA 3NQMA 1W17A 3A3HA 3TZNA 1W37A 2EG8A 1ZUAX 1EXPA 1UJQA 3NR0A 1SFLA 1A5NC 4WDXA 3UR8A 4N9BA 2VHLA 3SJNA 3NXLA 3DERA 3A23A 2GZXA 1K8XA 2PF0A 5A3HA 3CHVA 4PR4A 4YYCA 4GZIA 1AFSA 1L6SA 4QG9A 5EKYA 3DI1A 3D47A 2IPGA 2XGIA 3A22A 2QVHA 3W3OA 2YCKX 2CPUA 3RITA 1GQJA 1E1FA 4IL0A 1EP3A 4K8EA 1R3WA 3KTCA 5CPQA 3RAOA 1O66A 3H53A 4IP5A 5D02A 2BX7A 4MNKA 3F5JA 1I4NA 3EOSA 4IT1A 3VE9A 4DM2A 1J79A 4PCTA 4WEVX 3GHSA 3LV6A 4BI7A 3F4NA 1I75A 3TFXA 4FIQA 2OZ3A 4ML9A 1ME9A 1IEVA 4WZHA 4HJFA 3LZ5A 2GUYA 1GVIA 3ZLFA 3KE0A 4UOJA 3INPA 3U2OA 2E7FA 2SFPA 4ERGA 4S3AA 4IPNB 1HKKA 2RGLA 1G1YA 1H50A 3G0SA 1DJQA 2WSYA 3SCVA 1MQRA 4B3LA 1H11A 2XVNA 3B4UA 1V02A 4IMDA 2CIPA 1BQCA 3GDBA 3M07A 2DZAA 2E3ZA 4Q8QA 2Q71A 4G7FA 1VBJA 3T05A 3VNMA 4A22A 1BAGA 2ZRVA 3CB8A 1WP6A 3D3AA 4XSMA 2MNRA 4I7VA 4WY0F 4B5VA 2Z0IA 1CYGA 3SUVA 1UW9A 4HNVA 1V7YA 2VR4A 3W88A 1GOOA 5HA7A 5LNRA 3LCFA 3KDNA 2PDKA 3RCMA 3UR5A 4DJDD 1N8FA 1GQIA 3ANYA 1KRBC 5GNYA 3WH7A 3II1A 4L80A 4LUTB 3G0UA 3TX9A 2EEXA 3DZ1A 3ITOA 1BTMA 1UPPA 4UMAA 3QMSA 4J3WA 1QNPA 3VAVA 3S42A 3GU1A 4D6CA 5I79A 1IT8A 3PWIA 4MJ4A 1YDOA 4MDOA 1J6PA 1C8VA 3RLHA 3IJIA 3WJZA 4J3XA 5BXSA 3HQPA 3V0SA 3BLKA 3MCNA 3MBDA 4C6MA 1CB7B 3W01A 3FIGA 3H2AA 4P7RA 2FPYA 5CJ5A 4X0NA 1SO3A 2XSXA 1SJBA 3W76A 3MP5A 1O6IA 2YW3A 3TW9A 3OOQA 2WB5A 4HZ7A 2C6QA 2X40A 2CZDA 1RA5A 3CUGA 4FNUA 4G5DA 2ZZ6A 4M0XA 3UY8A 3E49A 3NDOA 5HANA 1R6WA 4GRSA 3W23A 4JNYA 1F3EA 3ARRA 3A3WA 3GM8A 4XO6A 4K7VA 2O9PA 2Y0FA 2ABAA 1EYWA 1E3XA 4KW2A 4Z0SA 2UV8G 4S3DA 4KRTA 3DYPA 1GOXA 3RMEA 4QJ3B 3T2OA 3VMNA 1DQXA 3UWWA 3VOJA 4CCZA 2CBUA 3EWBX 1QATA 3S2JA 3FJ6A 2REQA 2V5JA 1EBGA 4J28A 4Z2GA 4NYYA 3UYCA 4DY1A 2BMBA 4XAFA 5K9XA 3CH0A 3B40A 2VC5A 1DEDA 3LGEA 1C9DA 2QPUA 2NQLA 3ELFA 3WJSA 4GYFA 4TX6A 1FCVA 3ICJA 4Z1AA 3Q37A 1RQBA 1NEYA 4ZXOA 4H19A 2JIEA 1PKNA 1QU4A 6REQA 4W8BA 3V36A 2YL9A 3S1VA 1XICA 3BG9A 3EWCA 1MXDA 4C5ZA 3M5XA 3BG3A 5IHSA 3CWHA 2WNWA 3CYVA 2QJMA 4O16A 3UPBA 3S9IA 1QK2A 1DQWA 1KLZA 3SBFA 1WCGA 1A3WA 1Q45A 5A6BD 3BO9A 3FXYA 4IMFA 4L1XA 1FRBA 1WBHA 5DXYA 3U4FA 4AVFA 4CNNA 3WMLA 1BXNA 1UD4A 3CV6A 4BI6A 3BH4A 5F1VA 4TR9A 3MQTA 2INEA 3WLIA 3GH7A 1XLJA 8TIMA 1QAPA 2PCEA 3JU2A 1WKYA 5XINA 3QBUA 2BASA 4HD5A 3GHTA 1ZHAA 3BSHA 2IS7A 5DX7A 4FSAA 2BLEA 3VFLA 2VCAA 3PM6A 5C5YA 4IIBA 4ZQCA 2NLYA 4OT7A 3MB9A 2WAGA 3CXOA 4GVFA 3RGTA 1O1HA 5CJMA 2P10A 4LS0A 1D8CA 3RLGA 1OYAA 1OIMA 2CZ5A 3BJSA 4O57A 5G2IA 4V2XA 2ZZ2A 5FESA 4ZB5A 4LANA 2WMIB 4JQ2A 1FTXA 1OK6A 1GZJA 2JALA 1I8JA 3P5YA 3TOYA 3OQEA 4UOZA 4LYRA 4W5UA 3UA3A 4KH2A 2PDNA 4HYWA 3GXPA 4ATWA 1E0WA 2CLOA 2ZX8A 2X0HA 2VX5A 4IPJA 1MEWA 4MF4A 4TUFA 1VLIA 2D24A 4RKAA 3MJMA 1OC7A 3LI1A 1XCXA 4QCFA 4CN6A 3LTSA 2R24A 2RFGA 3LLDA 4GXPA 4HA1A 2YPIA 4MUZA 3M0XA 3KXQA 1VFUA 2OO6A 2GOKA 5T9BG 3SURA 3TC6A 2V5DA 1QBAA 2QZRA 4GQ0A 2P5NA 1R30A 1DJZA 4HSNA 7CGTA 3UR2A 1WKEA 3DYMA 2Z1XA 2OLAA 4AIBA 1H5VA 1XX1A 3KWSA 4OUEA 4CQ9A 3K5XA 4FA3A 3O3RA 2DT0A 1UKPA 3O8AA 1V4YA 4JIEA 1EF3A 3GX9A 1MFVA 1GVEA 4PUKA 2R1KA 3N29A 2DIJA 2WZMA 4X60A 2INZA 1KNWA 4QNEA 4KQNA 3BWWA 1EZ2A 2EJ1A 2OEMA 1FDJA 3ZSSA 1H49A 3G8RA 4HTYA 2WVVB 3AROA 3IGSA 2G3NA 5MHBA 1BYDA 3CZEA 1UKSA 5AFDA 4TVCA 2E6DA 2Y70A 3W7PA 1KWKA 1BVNP 3O6YX 4TU1A 2WCSA 5F2LA 1LG1A 2WW5A 2ZWYA 3OZMA 4ERAA 1GOMA 1SGJA 5KZDA 4JDBA 5LYRA 3UGVA 4AYSA 4LBRA 3HM7A 1DV7A 1E70M 4GIEA 3TYBA 3GXNA 2Q8ZA 3BGAA 1Q3NA 1G67A 4CNUA 3CIXA 1DJGA 3ONBA 3C8NA 3LHVA 1XIGA 2HEJA 1E51A 3ABQA 3L0NA 3TJ4A 3STGA 1E72M 2JKPA 1NJJA 3TQVA 3U8GA 3CZGA 9XIAA 4GUJA 4EPBC 1UWQA 3BL3A 3GNDA 2YFOA 3IRSA 1LROA 4LYKA 2VL4A 4M6UA 3TZFA 4BQ5A 3AIWA 1IZKA 5BOEA 3P3BA 2O0TA 3WDPP 1W8SA 4R33A 5FJUA 4TTGA 4HHMA 1IT7A 5J8LA 4BQ4A 4DXVA 4FLSA 4K2SA 3JS3A 5I5RA 3GNPA 1BEUA 4EXAA 3WUGA 3WD1A 4WIWA 4LU0A 2D20A 3GKAA 1HVXA 3Q94A 5D9PA 5HJYA 4HK5A 4AEEA 4MKNA 4HK6A 3QM3A 3UA4A 2VT0A 4H04A 1XF0A 4KESA 2CLHA 4FB7A 1DWAM 3N4FA 4UZSA 1PHQA 1PZ3A 2DFAA 4CD8A 3EX6A 1BG4A 1EJSC 4MFDA 1V6VA 4DO4A 4ILSA 3B0YA 3SGGA 1J0HA 1GZGA 3ZIZA 1C8XA 1L6FA 1VH7A 2VZOA 1DORA 4DUXA 2TYSA 4FZIA 3VOCA 1JYNA 1XLGA 1PDYA 3VZZA 1I2PA 1NWTA 1SQ7A 1XHGA 4PUEA 3T8QA 4DNHA 3TLQA 3W1XA 2C79A 4PEKA 4AZBA 1Z7AA 3L2MA 4O18A 4DJFA 7TAAA 1PDZA 3PR2A 3AMCA 1SZFA 5DMLA 1PTAA 2DJLA 2EPOA 2XISA 4R7JA 1H0IA 1XIEA 5E0CA 4K68A 3KRBA 3NQFA 4EAMA 4J1OA 2QUUA 2DZPA 3MYPA 4IIFA 4UR9A 5MKGA 2WKJA 3SFKA 1XIFA 2UY3A 3VE7A 1H1YA 4J3SA 3UR7A 1TSIA 2OQLA 4X61A 1CIUA 5BOFA 2J7DA 1JZ4A 1PE1A 2QV4A 4E2BA 4F0MA 5FF7A 2C71A 3WBAA 3NCOA 2XM2A 3VKDA 3FA4A 1U30A 3RCNA 4JN7A 1BLIA 1OB0A 2WZEA 1V6WA 1N8IA 4GIRA 3W72A 3TMLA 4K37A 3LS9A 4IFKB 5DMMA 4GUFA 3EPMA 3FGCB 1G01A 4B5NA 4NY2A 1W3TA 5D37A 1WBJA 5K9DA 3A64A 3THDA 3RM9A 5CPOA 4NNBA 4O1DA 1POJA 3TTYA 1OG6A 4ZQOA 3LERA 2HVNA 4H7ZA 1KM1A 2YFNA 1Q2RA 3J7HA 3AO0A 3H23A 4BEUA 4W85A 3LTPA 3JUGA 2GGIA 1IZJA 3P0WA 3PAJA 2HE5A 1JULA 1SR0A 1Y65A 3O2LA 3B8WA 3C3UA 4GFIA 4GZ7A 4J3VA 3WQCA 2FZMA 1QMLA 4E6MA 2EGZA 4IX0A 4NASA 3R8RA 4CN1A 3BLLA 3VIKA 5I3KA 5HMEA 3B8IA 5AHNA 3HZ3A 2OB3A 4RE2A 4LAMA 3VNJA 2VR5A 3GHUA 4GISA 3SM0A 2C3ZA 1E3ZA 4GGHA 3ZM8A 2ZWZA 4UCFA 1UZ4A 4BF9A 3O63A 5JIWA 4LPCA 1XKYA 2P3EA 4LF2A 1HIZA 1DWGM 1AVAA 1B1YA 1TV7A 3PS7A 3Q45A 1UD6A 4D6DA 4K6AA 4NRSA 4ZB0A 4GJIA 5F2MA 1GG0A 4FOUA 1R3VA 4H7VA 5CCZA 1F3WA 4O8RA 1OD0A 1XG3A 4G7EA 1JR1A 2VGIA 3PNUA 1XSJA 2CNCA 1X7FA 4HNCA 4XV0A 4RZ4A 4A29A 2DZWA 4RV3A 3PHAA 4O4VA 3O16A 3WMBA 4AD4A 3SY5A 4Q8PA 2WNZA 3LCWA 4JTEA 3TK7A 3EEZA 4FXSA 4H8VA 2CU0A 1CWYA 1VFSA 4MWAA 2GJLA 4DLMA 5C2GA 1A4MA 2EHHA 2VQUA 4P7QA 3QPEA 1XYLA 4DQWA 4GO8A 1PIGA 4FEZA 4QX4A 1QDSA 1H7RA 1R3YA 5DANA 1MZHA 1U83A 2WVVA 5ENLA 1Z8AA 3M0ZA 2DU2A 4A4AA 4LYPA 3LQLA 5MF5A 2VX6A 4MLJA 4W87A 1MQQA 3RO6A 2X0SA 4QCEA 1R9XA 1TPFA 3M0IA 4B16A 1OFPA 4S3GA 1KFWA 4XUGA 3R0UA 2OSWA 3NTYA 4HOZA 2W92A 4ZO7A 1EGMA 1EC8A 2HRWA 3G1XA 4MFEA 2VDIA 3SCPA 3QKZA 3SUUA 1S2CA 3B9DA 1A0EA 3RF9A 5DCBA 5I23A 3N34A 1FH9A 4GBUA 1LORA 1DE5A 3QZAA 1Q13A 1XH2A 1XYZA 2CWXA 3CB3A 4PGLA 3M1ZA 5CSYA 2VRJA 3MYOA 5A6LA 4TMBA 5H6HA 1S2VA 1ZALA 2O9TA 2UY5A 3RPTA 4OOUA 5HQLA 2WJZA 3RU6A 4JAWA 2Z4GA 3NURA 4W9TA 3LENA 3FAWA 3L68A 2V3GA 3H22A 4R9OA 3CWOX 3VIOA 1RQEA 4TX9A 4PMZA 2VEKA 3M0YA 3OYZA 3L67A 2Y7GA 5I09A 3NM3A 2Z1VA 2RUSA 3KRUA 1VGAA 5M17A 1BWLA 4GVHA 3B9OA 3FX4A 4JYEA 4L56A 2X7WA 1MQPA 3QMTA 3B4YA 4XD4A 4GO9A 4UQ9A 1JD9A 5CBIA 1VBRA 3GK0A 1IWBA 4DJEA 1KFLA 2ZA2A 3S1XA 3MV11 1TZ9A 3T42A 1LG2A 4PMOA 3IAQA 1WZKA 1XLDA 4KKXA 1LQAA 1K4HA 1BSIA 2VR2A 2R91A 1V77A 1KV5A 3AIRA 4E3VA 3IGHX 3WK3A 2E9LA 2I57A 4QLLA 4LWWA 1C3FA 4I9TA 3WLQA 3I10A 1W3KA 2J8FA 4OOZA 4BHYA 1L6YA 3B9AA 3C0QA 3QY6A 1V03A 1CXLA 1NAL1 4WDTA 2NW0A 1A47A 3CTTA 1YPIA 1V0LA 1TMHA 3DHPA 3BCJA 4HPNA 3H2EA 3VX1A 1TG7A 3SSZA 3ZOAA 5I78A 3N3MA 3N1AA 1G7UA 3MVTA 3VKKA 4EPDC 2YGYA 3NQEA 4C65A 1W6TA 1DBTA 3SECA 3CL8A 2NUYA 3GSMA 3VK5A 2P0OA 4IIHA 1PSCA 3C5QA 3IACA 4AD0A 4GC4A 4ADTA 4ES4A 4RDYA 1XFCA 4IFKA 4ZODA 3BV7A 3EEGA 1NDYA 3KRZA 3NQ7A 1H7WA 2G3FA 3I3BA 3VGGA 2F2HA 3LPFA 4WJ8A 4DELA 4URIA 4NSBA 1FCBA 1WDSA 1H7XA 1O4UA 4GABA 4WXZA 2QUMA 2EPNA 2GGGA 3GD6A 5T26A 4XKYB 1OHLA 2A7PA 1GT8A 4FX7A 3ARZA 4JQ4A 4AZHA 3E1F1 3PTDA 3F03K 4ZOCA 3GW3A 4Q8OA 4H3DA 4S23A 3P93A 1TQXA 3WZ0E 3TN5A 3DFYA 4LGXA 1RA0A 1E0XA 4ALDA 4EAYA 1IEQA 3JR2A 3R25A 1F4AA 3N3TA 3CHEA 1BG9A 1X98A 3CGTA 1UUQA 2AOSA 1PCKA 3W1LA 4TV5A 4WKHA 3L21A 3GAKA 2V2CA 4S1FA 3LNMA 3SCSA 1GQKA 3FW6A 3SQMA 1TQJA 4JXCA 2W91A 1FHUA 4RX0A 2DW7A 5HAOA 4KMQA 1DJNA 3WMSA 4K1WA 3ATYA 2XN1A 2PRMA 3QSTA 6ENLA 3BUVA 1JXKA 3B8VA 3UVIA 4DAIA 3KBNA 3NSMA 1XGZA 1OC5A 4LAOA 4HCDA 5EMYA 1W1TA 3FXGA 1A0CA 3LI0A 2GJXA 3UEQA 1H7OA 1R87A 2PWFA 3K4AA 4XVDA 5F4XA 2CLFA 3CL6A 1OK4A 2CXGA 2J79A 1C9WA 2XWDA 2IPJA 2NQ9A 1PX4A 3U0HA 4UBPC 3NZPA 3WBYA 1E0TA 3L2LA 5BXPA 4BEQA 3KZPA 1SUXA 3KHJA 1EPXA 4N4PA 3MBFA 4J4KA 5BROA 1GKRA 1ZJHA 2YB4A 1HX0A 5G1MA 3BZJA 4X9YA 3RR1A 3PBVA 1KQYA 3T7VA 2YB1A 4DXXA 2C8NA 1OADA 4ORIA 3CMGA 3WELA 4N7QA 4XAZA 2NT0A 3AZRA 5U4NA 6ALDA 2NWSA 2OYMA 5LHFA 3VINA 1W1ZA 3QHOA 3B8UA 4EANA 3AUOA 3NZQA 1C7TA 3AHXA 3BOXA 4GVIA 1UUMA 4XUYA 3UY7A 4PSRA 1PUDA 4EPEC 4GYJA 4MB3A 4PMXA 3VC6A 1QHZA 3S47A 4JKLA 4JL1A 1HKWA 4J27A 8A3HA 2DDXA 1GVFA 2WHJA 3IIXA 3FDGA 1R46A 4KFPA 4JFUA 3SIMA 2PD5A 4O54A 4QTGA 1TR1A 1Q7MA 4RPQA 1FWBC 2OYLA 5FACA 3KBMA 1LOQA 4FR6A 5EMMA 4UTJA 1W1VA 4GUIA 2V5KA 3DG6A 3G2GA 4S3KA 1FP9A 1PZ1A 3SFWA 5JBFA 5CG0A 3W7JA 2GVYA 1M1BA 4K39A 4D6JA 4YWSA 2RJHA 2XDFA 4B5UA 1IEWA 1RP8A 1KKOA 4B5TA 1GZ1A 4LXFA 2XGZA 1XS2A 2WHMA 4LS1A 3DC8A 5EBAA 1LM1A 2PGFA 1W91A 4KWSA 1EZWA 3LBOA 4G1NA 2HJPA 1XLKA 1TMLA 3WLPA 3I6RA 1IQ8A 2GJPA 4ATDA 4UTIA 3E5BA 2ZX6A 1NY1A 1RCOB 4L6OA 1PV8A 1WXYA 1XL9A 4R34A 3WYZA 2VGBA 4ZXLA 1V6UA 2BFGA 1JPIA 2W66A 1EO7A 1UA3A 4B2DD 4DUOA 4A35A 3HQOA 4QEHA 3EB4A 2HS6A 2PDJA 5HNUA 1OY0A 3C8FA 4QS5A 2VFGA 4OQVA 1VEMA 2QJGA 3ABRA 3NIYA 3LPOA 4HSOA 3RYSA 3N2TA 4ICCX 2VDGA 4LC8A 1TJ0A 5DN1A 3ARVA 1RUSA 4XZIA 1BKSA 4L4MA 3W7OA 4W88A 1G94A 1X97A 3M4HA 1S2WA 3MV01 4JTHA 1MXSA 5CJNA 1MNZA 2ZRZA 5REQB 1V5XA 5CKSA 3TYAA 1R7OA 3C86A 1ZRQA 1NQ6A 4MLRA 3ZVHB 1JZ8A 3DH7A 3AJ7A 1Q66A 3CZLA 3GU9A 2PCQA 2WKGA 3W1RA 5HQMA 2WQDA 3W70A 3P8IA 4ZGYA 1J8VA 4H7CA 2ZRYA 4QJ1A 2AL2B 2JEPA 1XYFA 5KITA 3LM7A 3GIQA 4V1YA 2X42A 1K6AA 2C91A 1HP4A 2BSLA 5D09A 1EA0A 4GPNA 4MGGA 1WDPA 1NDVA 2C14A 2AMXA 4JTLA 3WLJA 3W7EA 3LGGA 1MO0A 3L0KA 1QTWA 4HB7A 3GVGA 1XUZA 1YW1A 4DO6A 1XLIA 3UYIA 4IPIA 1TE6A 2OU4A 2ZRUA 1XRSA 2ZUTA 5AC8A 3NOEA 2QMJA 4QQUA 2DH3A 2GVGA 3CAVA 1VP5A 3NGJA 3V75A 4KCTA 2WZHA 5D9MA 4MNMA 3E74A 2NX1A 4GG9A 2QCEA 4UQEA 3QR1A 1M9HA 1WO2A 1OG0A 3AMDA 3URNA 3CV2A 2BBFA 3LPPA 1H0GA 3G1FA 3QSRA 5A1AA 3IJ7A 3EGJA 3R8HA 4B4FA 5IBXC 2GVJA 4RXFA 3TNOA 3C3NA 4UR7A 3W1MA 4QAWA 4D6EA 4ZTYA 2V68A 1JZ3A 3OHMB 1WDWA 4A2SA 1NFPA 2OSYA 3GDMA 2JK2A 4WDWA 1O7AA 1BWKA 1Q2SA 2NUXA 3PZQA 4Z2KA 2TPSA 4LVAA 4DZHA 2GUUA 3W22A 3ZS4A 3AZTA 4B4HA 3HPZA 2FB2A 5B80A 4MOZA 2DZVA 1QI4A 3LHZA 2XVPA 4DN1A 3VXGA 1UWTA 4J3UA 3G1AA 1XBXA 1LLZA 3UPMA 1NOFA 4JCLA 1O1ZA 4U3AA 2J9ZA 6TAAA 5DCEA 2WBKA 4GUGA 4GH3A 2XSAA 1QWKA 2W3ZA 4AX6A 1T41A 1UWSA 4EF8A 4PCSA 3M0MA 1TTIA 4NZJA 2V69A 3SRHA 1P0KA 1K9DA 1WOBA 4JNZA 2I9EA 1ODUA 4NJKA 3BLDA 4AB4A 4KFNA 3I3DA 1A5CA 4UTFA 4J5NA 3WUFA 4CD4A 2ZFAA 2F84A 1EC9A 1R3SA 1XC4A 1GYMA 3QZEA 1GPWA 1KGWA 4JNMA 3W7RA 2Z7GA 4ZL1A 3SRKA 1E4LA 1EEXA 1XRFA 1V3IA 3IPWA 4AWTA 3M0JA 4QE1A 3Q65A 1H60A 3LB0A 4FF7A 5LHEA 4M51A 4AF0B 1IZCA 3BE7A 1QR7A 1TIWA 2OFJA 2IMRA 1IF2A 2DY3A 3NDYA 3ZR5A 4F2TA 3UNTA 3I68A 1CW2A 3FHAA 3TYDA 3KL3A 2OMAA 1FCUA 3IJDA 3UXKA 3SO7A 4OU1A 3K2GA 2G4FA 2CXEA 3M41A 3EOUA 1K9TA 3W02A 1B9ZA 3RPDA 4PBFA 3POCA 1UUOA 2MUCA 5G4HC 3FSUA 2BVYA 1DPMA 4CQDA 2FKPA 2C1HA 4IXHA 2ZOXA 3DN5A 5HNTA 4UFIA 4DBSA 2EJAA 4Z2HA 2NQHA 1FA2A 3N25A 1RXOB 3BURA 5EY5A 4B91A 3G6LA 3SRFA 1W3IA 1KCLA 2YA1A 1LBLA 4MYAA 1V0KA 4XZWA 3W29A 1W5QA 2CC0A 1JVNA 4Q7IA 1XSKA 4GQBA 1ALDA 5LNSA 1B5TA 4K38A 2AQWA 3BV4A 3F5KA 4H41A 3KBJA 3CEUA 3W2UA 2CLPA 2J6VA 4IFRA 3L5AA 3W73A 4GNVA 1RSCA 1S39A 1ZBKA 1CECA 1POKA 3PZMA 3DKLA 3K8MA 3F4DA 3NXFA 2DGAA 2G3IA 2V67A 2ZVIA 5KTLA 3SW6A 4QFUA 3TA6A 5AN7A 1XCWA 2ZADA 4HNOA 4ZCWA 1KRCC 3VGBA 3PZOA 4JGDA 2CW6A 2QT3A 4D6GA 3DKJA 1AQMA 3TKFA 2J7HA 1KR0A 1XISA 3R12A 1VFLA 4FNTA 1A5MC 3S6TA 1CT5A 2PDLA 4US6A 1U1JA 1VFOA 4C7DA 4C90A 1CXEA 4DVOA 1KM0A 4JCMA 4U10A 4FNSA 3ZVHA 5JIPA 1CGUA 3U2CA 4M6PA 3RPMA 3A5VA 4IJCA 4S3JA 2C19A 3ZMRA 2DSZA 1DQUA 1UQYA 3W28A 2ZA3A 3V16A 3U5YA 2AL2A 4GNJA 4JEQA 3GE7A 2PFHA 4X2RA 1SMDA 1J12A 1ONEA 4YVXA 4IGMA 4HMDA 2Y88A 1ITQA 3D6NA 3RX3A 3VUSA 3B0UX 1VFTA 1DJHA 1CGTA 4E8CA 1KB3A 3AMLA 2QR6A 2G37A 1WZAA 1LWHA 4YHGA 4M19A 2IPFA 3CQ0A 2HPIA 2D1ZA 4LUJA 4H00A 4UFKA 1AD1A 1XD1A 1JCLA 4LUSB 4M80A 4UQDA 1VPXA 2IW0A 3IIOA 3ZJ6A 2UWFA 2DUZA 1G69A 3VMPA 2LLEA 1C8YA 3AQUA 3IJ9A 1WOAA 4CQBA 1GOQA 2CZEA 5A6JA 3WQ8A 1RP9A 3S83A 1G4EA 4GI6A 2XFFA 1NOWA 1SJAA 3BAJA 5BZAA 1ZTVA 1JYVA 4XSLA 4F2BA 1E6ZA 1OIFA 1N7KA 1FY6A 3CT7A 2WMFA 4LBUA 3AU6A 1JD7A 2VD9A 4N0RA 1RJRA 4AHPA 1UZHA 4LS2A 2ZCGA 4B90A 3BZGA 4U3CA 2ZE0A 1W1PA 3WFAA 1ONWA 1VLWA 3Q67A 3PP7A 3OG2A 4O8AA 3M16A 3QLLA 2NQJA 2D0GA 3GG8A 3VNKA 1EJXC 1GYNA 4FP1A 2BG5A 1QPQA 3AHVA 4UCGA 1QVBA 3U6WA 1JQXA 1W9XA 4FLOA 2HNHA 1EXBA 3BVJA 3GC5A 4ONVA 2C1IA 1JAEA 3REQB 3KBVA 5H8MA 3EWZA 4C6EA 4NRRA 1CXFA 4M1BA 3HGOA 3UG5A 3CS2A 2WCGA 1R0MA 1UWIA 1A5BA 4MMWA 4PUJA 4W4QA 4LB3A 2FYMA 1KD0A 4CN4A 1QPKA 2A3CA 2WM0A 2PDBA 3AYSA 4YS1A 4HPHA 1TV4A 3EB3A 5EMJA 2NV9A 3W7LA 1UP0A 4XVEA 3FK4A 2H9AA 1M65A 1I0DA 2FTYA 3WD2A 5IRPA 4C1LA 2FFCA 3R6IA 3H12A 2YCLB 2A7RA 3VUPA 3O05A 1B0IA 3GVRA 4IMCA 2P3ZA 4YU1A 2ZKMX 4FOJA 3G6MA 4ATLA 4D8ZA 1HL9A 2D23A 4ZQNA 2I14A 2J7GA 3C2FA 4PUNA 5JBDA 4MADA 2YXOA 3QV7A 1UD5A 3MWAA 2PRHA 4AF0A 3AS2A 5DT7A 3VD9A 4JIRA 2F9RA 1TJ2A 1KGUA 1XD0A 3PTQA 5C6MA 4CQCA 1UBSA 2XGBA 2CBIA 1XV8A 4I5RA 4B3KA 3RMJA 7ODCA 3E0WA 3NO1A 3MVIA 1LRNA 1X1OA 4LC6A 4WOZA 3BLOA 1MEIA 1VYSX 2A3LA 1XLLA 3MANA 3OHIA 2ATSA 3GFYA 3UXIA 1LDCA 4O1BA 4FNPA 2G4JA 2W67A 2XUCA 3PBWA 3IJLA 2VTFA 1QW8A 3KX6A 4OGZA 4HA3A 4GQGA 2JQXA 1NSJA 2H3BA 4DBEA 4RZ6A 2BZNA 4HNNA 3W25A 3ERPA 5CZSA 2DT2A 3TAKA 5CXPA 1RPXA 1CTNA 4GZJA 4IWWA 1XYAA 3HN3A 2QCCA 1I2OA 2HZGA 1W1YA 4FI4A 1H61A 4IMEA 1KXQA 4RDZA 1OCNA 1AQFA 3W37A 1R38A 1UR2A 1OYCA 4LVDA 5GNXA 5E09A 3RNDA 2VFDA 4QAIA 1PKLA 3TMQA 3W2NA 3KFTA 2QW5A 4CU6A 2GWGA 4AXKA 3V0TA 4YTRA 1E6PA 3GDRA 3B9NA 2HDJA 3W6LA 2J25A 3ZLHA 4C6PA 2DPEA 2Q3RA 1LLOA 4ZEPA 1F76A 2CEQA 1MXGA 3P7YA 3T0AA 3SCWA 2ALRA 4MG4A 4NI3A 1R7AA 1XPYA 2ZZ4A 1FKWA 1KA9F 3TCEA 4CCDA 1YNQA 3VNDA 2YIHA 2YLLA 5IDIA 2CHOA 4UMCA 3W4RA 4D6HA 5AYBA 1XBVA 3N2MA 3TSDA 3EDDA 4AC7C 4PMNA 1E1CA 3EWDA 2OG9A 2WZTA 5TIMA 1SVDA 3ZWTA 1EP1A 4TXEA 3QXBA 3WL0A 3LX9A 4RNFA 1JF6A 1BYBA 2VOTA 3IVSA 2YDAA 3BG5A 3LG3A 5M2FX 1VBUA 4JTSA 4MZ8A 4W7UA 3RILA 3PTMA 4DM1A 1QK0A 3CV7A 4UFHA 1AMYA 2C15A 4H4IA 3P67A 3SCNA 3NZ1A 3SI9A 2XZ9A 4NJJA 1XBYA 2QCHA 3KCLA 3H2CA 4L9XA 2Z1SA 3IV8A 3ZYZA 1W5MA 1E40A 4PFHA 1RAKA 1J18A 4ORMA 5JXQA 4R9XA 4IF2A 2G0WA 3LU2A 1IEIA 1UA7A 2PGRA 3C2VA 1IXQA 1IR2A 1HGYA 4IP7A 3S5OA 1GNXA 2WC7A 4LOCA 1ZAIA 1C93A 2Y5JA 2AMGA 1SW0A 2GGJA 2KZHA 3OQ8A 3UVAA 1DVJA 1EX1A 5LNWA 3NL5A 4WXYA 1Q7QA 4HNUA 3NPWA 2OX1A 2WKLA 4AWEA 1OYBA 5D38A 4BF7A 4PN2A 3GG7A 2PP3A 2PLJA 1VPQA 2J66A 1Q6GA 2OZ8A 3TW6A 1P43A 3REQA 2HVMA 5CBJA 3VDBA 5A69A 3AWOA 1R8LA 1PTDA 4NZ5A 3S2LA 5GJPA 3WLRA 2DV0A 4JIIX 4KWVA 3E96A 2BGNE 3ANUA 2GJNA 4UNLA 2OO0A 3PBGA 4ZE4A 3UZJA 1MUWA 4K3ZA 3W6MA 3OVGA 3U7BA 5FEPA 3K1DA 2X1SA 4HIBA 1E5JA 4H9MA 2YA2A 3H7VA 4HBKA 2BY1A 3UWYA 3ABSA 3MZ2A 2HCVA 1E15A 2X7VA 1I60A 3WUBA 1MMFA 3UWUA 1T8QA 3EYPA 3N04A 4Q4RA 3AXXA 2P1FA 3ZVIA 2WZIA 4TIMA 3B97A 1RHCA 2C1GA 2F6UA 1RY8A 2FLIA 4JYDA 2Q01A 1DXEA 3W24A 5EFFA 1I1XA 3S6OA 1VS1A 4H6EA 3QW4B 2TAAA 2WK2A 2XPKA 2PDFA 2G97A 2X16A 4MSSA 3BW2A 3HBLA 1PX8A 4IP4A 2DH2A 1R3RA 4R7OA 5HJLA 2NXIA 1JUKA 4KWOA 1Z9AA 4NZ1A 3DFPA 1QXLA 1PS9A 5I3FA 1GVYA 2XH2A 1BXCA 1TIMA 1EF2A 3EX2A 1NQKA 1XDJA 3MDWA 4J40A 3PNZA 2OODA 5AYYA 1HQTA 2E8YA 3TXZA 3MJYA 4FHAA 2WLZA 4HMCA 3HMJG 2DQXA 2PLCA 3GB6A 4MJMA 1Z41A 3C52A 4Q6XA 1LWJA 3N9KA 3U4AA 3CLMA 3OGRA 4E4PA 5HPOA 3BAKA 3STEA 4GC3A 2VCCA 1EDQA 3A9IA 2R94A 3BARA 2GSHA 3B8SA 3WQDA 1B3VA 3QYQA 3BGGA 4X0VA 2XVLA 1MEHA 4A8RA 1S3TC 3A4JA 3ITTA 3LK6A 1UZ1A 2VVSA 4JX5A 1OINA 2L5HA 4OBTA 5LIKX 5KINA 3T78A 3R11A 4EIVA 3AI0A 2A3AA 1ONRA 1Q6RA 3GWQA 1FX6A 4O17A 1P1MA 4IUGA 3OW1A 5EMLA 1AUSL 1NF0A 4IPLA 4D1JA 1JQVA 3WNPA 4Z42C 2HTMA 1HTIA 5AC7A 4XZHA 3P62A 1EA9C 1RLCL 5KZMA 1LWIA 4L9YA 1KBBA 1PEZA 4WD0A 5KZ6A 4AQLA 4F9DA 3MHFA 4F9JA 1E73M 4IISA 5AB3A 3F4VA 2RAGA 2FMOA 2A1YA 3QV6A 5EPDA 2WVTA 5FAGA 1KTBA 4RCXA 1R2SA 4C6JA 2VEIA 7TIMA 4PCFA 5IHRA 3QFEA 4CD5A 2HK1A 1B4EA 1V02E 3FA3A 3OIHA 3FVMA 1OX6A 2A5HA 1A5SA 4WF7A 5GJMA 3N15A 2B7OA 4CNPA 4YNGA 4JFWA 2CHRA 1XIMA 1F8IA 3I7QA 5F7UA 1VKFA 3V1HA 3SUTA 4AEFA 4AZ6A 4IGSA 4EE9A 4Q7BA 2XFYA 3BICA 5I77A 4C6DA 1BFNA 1P0BA 5LA1A 1J0IA 4WHBA 1KFKA 1S5WA 4YL2A 4PRTA 3VD7A 4GCXA 5D8ZA 3WNNA 2Y85A 4A2RA 3P6LA 5D4YA 5G2HA 4NZCA 3QR3A 3WK0A 1UPMB 2W6RA 3BW4A 3WBXA 2PDWA 1C7SA 2XJ7A 3W2MA 3R8GA 5TNVA 1V08A 3EZ4A 2BNJA 9XIMA 5IFTA 1L9WA 3GH5A 1CGVA 1Q63A 1EDTA 4AIOA 4BWLA 4PMDA 1EUAA 1ZCCA 2OQYA 5LXEA 1G5AA 4ECLA 3JZUA 3IVTA 4LVBA 1BGAA 1E9IA 3C0SA 2C16A 4D6FA 2I17A 2W61A 1IR1A 3NM1A 1DYSA 1FWIC 1SZGA 3KOYA 3LMYA 3TYEA 1R3QA 3BLPX 5C0QA 4Q4OA 1BF6A 2DT1A 3H2MA 4CCCA 1RR2A 2X2YA 3LRMA 7ENLA 3MKVA 5A8PA 1ZFJA 5CZ0A 3VKCA 5L9FA 4AX7A 3HV9A 4Y8FA 3CUXA 3ZT7A 4GH1A 1DXIA 1LOSA 2Z29A 3WF4A 2WC3A 1W32A 3ARSA 4INFA 1TKKA 1H1NA 5FF2A 3W86A 5I7GA 3OGVA 2I1OA 3W71A 1IIHA 4F79A 2BDQA 1EDGA 4QE5A 1J0JA 3L2IA 3KWXA 2QCGA 2ZZ3A 3WG6A 4H9TA 2RDTA 4P8UA 3FS2A 1Z42A 1AW2A 3NYDA 3CJPA 1M6JA 2ZC8A 3MSYA 2D0FA 2PWEA 2HSAA 5HWJA 5FL0A 4PTNA 3R43A 4TTUA 4XQ6A 2AGKA 3IUDA 1PL9A 1Z32X 1SM9A 3CBWA 5BYWA 5E70A 3R0DA 1NIUA 1K03A 3L4VA 4F4RA 1W9PA 5FJPA 1OFBA 3WH5A 2DSVA 4IX2A 1LOLA 2V5LA 2OT1A 2HXUA 2YL6A 1FOBA 5I0DA 2ISFA 2QS8A 4HPJA 3W38A 3TJLA 2VC9A 3GTHA 1ITCA 3L9CA 1NVMA 3W7KA 1EQCA 4WUIA 4GNKB 4ZQRA 2E9BA 3SY8A 2Y8VA 3OLEA 1EJTC 3CC1A 4XZ9A 2YZRA 4U31A 1GJUA 4N9DA 3TQPA 1P6BA 5BOOA 4RR4A 2GPTA 2PS2A 4MTVA 1G6CA 4GKLA 3HIJA 2Z25A 4O53A 2REQB 1N2VA 3H55A 1J5TA 1TV2A 2CLIA 1I1WA 2QYGA 2DIKA 3JZEA 4GYKA 3VKAA 3QVQA 2HBXA 3TTSA 4MM1A 4A21A 1V3JA 4DZ5A 4XG1A 5K9CA 4DJDC 2FB3A 3NEVA 3V5CA 4NJHA 2NWRA 3W83A 5ABEA 3GG1A 3KTXA 1PB0A 3GDTA 3TSMA 2F61A 3W7GA 1R47A 6REQB 5C9WA 2WMJA 3PULA 3MMUA 1OFAA 2OOFA 4BJHA 4NIRA 1RY0A 3SDOA 2WLYA 3O0FA 3UD6A 3LDVA 2J7EA 1XLFA 1ISVA 3WQEA 3GDKA 3I4KA 1TTQA 4PTXA 3WLKX 4EP8C 1J2WA 1S5VA 3NSXA 2D0HA 3VCNA 4AC1X 1KWGA 1FDZA 3PN8A 1JDAA 5CGTA 4ZFMA 1VCFA 1V3LA 2I16A 2RDUA 1IIGA 3CYJA 3P80A 1JFHA 1X7IA 4GI9A 3VYLA 1LUCA 2G50A 1X8CA 3OVRA 4H1ZA 3CQIA 5M03A 3CZKA 4L61A 5FIPA 3IWPA 1FWSA 3FY1A 5LNVA 4JTKA 3WD3A 2GSJA 4MAVA 2VX7A 1S5TA 4AXNA 1KM2A 1E4MM 4JL2A 3ISIX 4PMRA 3GH4A 1EGZA 2X05A 2E6AA 2AGTA 2ADAA 1FVPA 3FNDA 4HMEA 5I3HA 3DFHA 3SCRA 5HMDA 1J4EA 5FA5A 1W54A 4PH6A 3FYPA 3MO4A 4YCOA 3JVAA 3VGDA 1GVSA 4KRUA 2PWUA 4XTIA 2FVKA 2QCDA 1FFRA 3ZJ8A 1HN1A 1P5BA 1TWDA 4HKPA 1VF8A 2P53A 3UXAA 3UJSA 1YIXA 3M0HA 4GZEA 4NNCA 4OTKA 1T40A 3ARWA 5EBUA 3VKJA 3GR8A 3RLVA 2ZRWA 4PTVA 5D30A 1QI3A 2FZNA 3B03A 4AISA 4ZTXA 2JBMA 2RGMA 4E4UA 4GE8A 2HPMA 3PUGA 3MCOA 4UZUA 2Y8UA 4O14A 5A5WA 3PUOA 1PCWA 3VDHA 2BOGX 2VYOA 3TTEA 2J75A 4DJFD 2VNCA 2YKKA 1DIKA 4WDUA 5LKYA 1VFFA 4U5KA 4M29A 3XIMA 3PVFA 5ABGA 2GQ3A 4CEXC 5EYWA 3QN3A 1A3HA 1K1DA 1QW7A 1YBQA 4W7VA 3BMXA 3CWNA 3VDGA 1KTCA 4ZMGA 3LUTA 3SN4A 3YPIA 2QCMA 4N9CA 1QNVA 4MNJA 1CLXA 2QAPA 3TSBA 3D5HA 2AAMA 4O28A 5CBBA 4YN5A 1FXPA 2V30A 3FAXA 3UJEA 1ZBVA 3DEQA 2O4QA 3AS0A 1O5KA 1VIWA 3F2CA 1EBHA 1QNSA 1YKWA 4US5A 4H9ZA 2JIWA 3UZ5A 2O56A 4MPQA 3W9ZA 2D22A 1LQ0A 4BFAA 1M7OA 4IGNA 1R2RA 2Q6ZA 1F3XA 3M5VA 3A4XA 4ROQA 1UMLA 2YOCA 2OX4A 5FD0A 3THQA 4WJEA 2NV2A 4O10A 2EPHA 1GVQA 2E68A 2IXVA 4QSFA 2D2GA 2BHZA 4H9VA 4UC5A 2OEKA 2BXZA 3PF3A 3PZNA 4NT0A 1ZY9A 3TROA 2PB1A 2PP1A 4S2CA 5A8OA 3L0GA 5CC7A 1ZP4A 2GDQA 2WJDA 3MUXA 2PDUA 2POTA 3QHNA 5FF3A 5XIAA 2A3BA 1ZGDA 3DGBA 2W27A 2J9YA 1JCTA 2Y2WA 4Y9AA 4Y90A 2QCLA 3N2CA 2VKZG 3GAYA 3UNDA 1LT8A 2DEPA 1W1IE 3N6QA 4Q33A 4W84A 3WDHA 1WXJA 3N2BA 3UZWA 5LA2A 5HQEA 5J04A 2J7FA 5CC5A 1F2JA 3IIZA 4FX8A 4IJBA 4I90A 1AW1A 1H09A 2CLMA 2VD8A 3TFCA 4I8DA 1JAKA 3W1NA 1WV2A 4Y9PA 3TAOA 1RJPA 3STCA 2V2HA 5HXMA 4RZ5A 1TVPA 1U33A 2FZ9A 3SUSA 2YCIX 1OWQA 1LT7A 2FVMA 2V5BA 1OZMA 1S2UA 5C9UA 4YYFA 2ZVRA 3NVDA 2J27A 2V38A 2C13A 2BHUA 1R3TA 3BJFA 3MP3A