1W2PA

The 3-dimensional structure of a xylanase (xyn10a) from cellvibrio japonicus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
346
structure length
346
Chain Sequence
GLASLADFPIGVAVAASGGNADIFTSSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQKIVALSPTLKIKITELDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDSWLYTHQNLPDWPLLFNDNLQPKPAYQGVVEALSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Use of Forced Protein Evolution to Investigate and Improve Stability of Family 10 Xylanases: The Production of Ca2+-Independent Stable Xylanases
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE A PRECURSOR
total genus 132
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w2pA00
2BY1A 1US3A 2DSZA 3OIHA 2WM0A 1F4AA 4F66A 1XHGA 5BRPA 1FP9A 4CUCA 2XJ7A 4ML4A 1HNYA 3T2OA 1GOIA 2CBVA 2WXDM 4WKHA 1WNOA 2E3ZA 5FOOA 2YLAA 2XWDA 2F2HA 1OIMA 1WO2A 3WSUA 1WDQA 4AMCA 3U7VA 1JI2A 3ARSA 1V3IA 1I1XA 1V0MA 5CG0A 5A8QA 4D1IA 1NOUA 2Y24A 2XVLA 3ZO9A 1H41A 2ZICA 2GUYA 4XX6A 3THCA 1JFHA 3II1A 3AIWA 1E71M 4WF7A 3THDA 1HIZA 2WZIA 3L4TA 3KZSA 1SYTA 1Q6EA 1B3ZA 2YJQA 5D4YA 1TMQA 3JUGA 3K46A 4ZEPA 1XSIA 3AROA 4JFWA 3OBAA 4P7OA 1HVQA 1D7FA 1CGVA 4OOZA 1CIUA 3AZRA 4F9DA 2CBJA 1CWYA 4KMQA 3SCSA 1B90A 4UCFA 3VUPA 3N18A 3WNMA 1WP6A 3UERA 1V0LA 1FP8A 2Y8KA 5IXEA 3VNZA 1JAEA 2TAAA 2YA1A 1K9FA 4UZUA 1JYXA 1J12A 1SFSA 3GTNA 1BVZA 4GXPA 1EH9A 2OSYA 1GJWA 4TOQA 1C91A 2BVYA 1E1FA 1TA3B 5A6SA 3IJ9A 5A6KA 2VQTA 2ZUUA 4PMUA 1M7XA 5CGMA 2XVKA 1CGUA 1PBGA 3CLWA 3WQ4A 2CETA 5I2UA 3K8MA 3CO4A 2EPKX 1E6XM 1GPFA 1GZJA 1E6RA 2VURA 3ARPA 3NIYA 3FXYA 1MWOA 5GNXA 3ARRA 5ABHA 3WD3A 4RE2A 4W8BA 2CYGA 3DYMA 3LPFA 2XIIA 4MAZA 2WMIA 1CBGA 3VMPA 1V3MA 4GKLA 4XZWA 4HPHA 1KBKA 2VRQA 3WF1A 4MDOA 1VFOA 4D1JA 3T09A 1CEOA 4Z2IA 4PTXA 1JD9A 1NWRA 2EQDA 2ZUTA 3F5JA 1J0ZA 1DWJM 3N12A 3OGRA 3MKKA 5CPQA 1DP0A 2FHFA 1BLIA 4UTFA 2CPUA 2OWWA 1LG1A 5D9OA 3TONA 1W1TA 1OGBA 5HBFA 2YLLA 5E0FA 4LXFA 1C8YA 2WCAA 1V6YA 1LG2A 4KWUA 2J7DA 3W81A 2F61A 2YA2A 3VGGA 3DHUA 3GNPA 3NDZA 1IZJA 2WW5A 2V3DA 2D3LA 2CBIA 2YKKA 2ZX7A 4HOWA 2W92A 5E70A 4AZGA 2BXZA 1G5AA 1UQYA 3RILA 1OBAA 2PWHA 4X0NA 2ZOXA 4JKMA 4U3CA 1E43A 2YBTA 3PZOA 2OLHA 2WVUA 4LPCA 4S3JA 5D9PA 1GJUA 4QCEA 3WNNA 4MB1A 4FLQA 3VIJA 2CESA 1FH9A 2VZVA 3KEHA 5KEZA 3AJ7A 3B9DA 1D3CA 3MUY1 2QMKA 4FK9A 4U2ZA 3VD7A 3UG5A 1W32A 1BF2A 5F7UA 5HNNA 3GH4A 1GOWA 3WELA 2WCSA 2A3AA 3N11A 1HP5A 3VGDA 2D3NA 4PEEA 2V3GA 4AIEA 3W82A 4PCTA 1DWFM 5D9MA 2WYSA 1MW2A 4AZBA 1LJYA 4WSJA 1HJUA 3ALGA 4BZYA 2ZUWA 2WMGA 1H09A 1K9TA 4WKAA 1KXTA 1FFQA 3BAJA 3DYPA 1ISYA 3NSXA 1D2KA 1IT0A 2HISA 4MNKA 3HN3A 2J8GA 1K9EA 4JZ5A 1J9YA 3VD3A 1AVAA 1G94A 1CZ1A 2PWGA 5ECUA 3WH7A 4WIWA 2YL5A 1HF6A 3K4AA 3CUIA 1XD0A 2W66A 6TAAA 1L8NA 2DDXA 1V6VA 1R7AA 4ATLA 2J47A 1W9UA 3CZGA 4LYPA 5I5RA 3RO8A 4WKFA 1CPUA 1I1WA 2ZXQA 4NRRA 3U5YA 2FHBA 4PMNA 4F79A 2VX5A 1OWQA 1GCYA 2E40A 2ZUNA 4CCCA 1TG7A 4P7LA 3VVGA 3FHAA 5HPCA 1KR0A 2O92A 3BAXA 4GZIA 4ZFMA 5A2AA 2WVSA 3AXIA 3LPOA 1CNVA 3MS8A 3W25A 4AEEA 1SR0A 1RP8A 1ZBWA 5JBEA 3RM9A 1JZ8A 5D9NA 3WF0A 4PYSA 1U2YA 1L0PA 3F5LA 3NSNA 4URIA 2J7HA 2GDVA 3B8SA 2W62A 4HPGA 1PJ9A 1UR8A 3T08A 1BAGA 1NP0A 1EOMA 4E8CA 1UOKA 3WNLA 4OZOA 2A3BA 4UR9A 4B3KA 1UG6A 3AMKA 1JYWA 5ABFA 2XHYA 4FLSA 5GNYA 4HMDA 4EANA 1FHLA 3ZMRA 1VB9A 3L4WA 3VGFA 4Z2LA 1E40A 3PZGA 1NWTA 2C7FA 1E4IA 3POCA 1WZAA 3WKZA 1ZJBA 3UG3A 1B30A 7A3HA 1E73M 1PIFA 1GNXA 1J0HA 2CNCA 4W85A 1IZKA 5DEZA 1TA3A 5M3WA 2PB1A 4GO8A 1EDGA 3MO4A 3QOKA 4ZENA 1VBRA 2EJ1A 3VDAA 5LA0A 1DEDA 2D0HA 1QI3A 4D71A 4D72A 1PEZA 4QDMA 1GW1A 3S6TA 5A8PA 1UR2A 4PMRA 2DSVA 2VR4A 1W1VA 3VX1A 1BSIA 1GQJA 1I75A 2VOTA 2WHKA 2PWFA 4W8LA 5EMYA 1BQCA 3GM8A 3CUFA 1CGWA 1FFRA 1DWAM 3AMLA 3VX0A 1XSJA 1TZ7A 3VIOA 1EA9C 1RPKA 1VENA 2O9TA 3UETA 4PMXA 4WK9A 2WHMA 4U5IA 3WNPA 3OLIA 5IFPA 1NQ6A 1VF8A 1E5JA 3A4AA 1Y7VA 1B0IA 1E3ZA 1V6UA 1FH8A 4PMDA 4CCEA 3CZ8A 1CLVA 3D3AA 1KGWA 4NI3A 3RDKA 1QNSA 4TVCA 1Z32X 3L4XA 1B9ZA 2BHZA 4UOJA 1UWRA 4WSKA 3W27A 2AMGA 4AISA 4B15A 4DUWA 2NW0A 3ZR6A 2YDRA 4MNJA 3GBEA 5DF0A 3SURA 1C90A 1QOXA 1CDGA 3AS0A 4CD7A 4M8UA 3NDYA 1UH3A 1VBUA 5GQBA 1LL4A 4BQ3A 1NWSA 1J0IA 2YBUA 4UOQA 4IISA 3DHPA 1JZ7A 2NT1A 1HJXA 5E0CA 1TUXA 1OIFA 3AHYA 4AZIA 2W61A 1KFWA 4M29A 4PCSA 2J7GA 2CKSA 2E8YA 4JFUA 1W2VA 4OOUA 3WMCA 3VNYA 4M82A 2J7BA 3K4DA 1C93A 3CUGA 1X1NA 5A8OA 2G3IA 4J3UA 4D6GA 1UH4A 1XH1A 4U31A 1ODZA 1FA2A 2QF8A 1V02E 2VO5A 3CHEA 3MMUA 3VGBA 3VIGA 3BMVA 3WH9A 2EPMX 5JBDA 5CSYA 3ZJ6A 5A2BA 2VRJA 2WB5A 4Z2JA 1W9DM 3ECQA 3WD0A 4BA0A 1BG4A 3PZQA 4DWSA 2OYLA 1QPKA 1LWHA 1UD2A 1CGYA 2ZUVA 2X05A 1JDAA 1GONA 4AEFA 3I3BA 3F5KA 1V0NA 4JCLA 4MNLA 3VMOA 1YQ2A 3F4VA 2JEQA 2XIBA 5FCZA 4RE3A 1JZ3A 4OBSA 1QBAA 4UFMA 5I6SA 2IXUA 4IPNB 5A8MA 5CLWA 4H8UA 1B2YA 1VAHA 2WK2A 3MV11 2V5CA 4AW7A 2QV4A 4JCMA 3DECA 1NWUA 1E70M 1JD7A 2A3HA 3N17A 1WPCA 2YDSA 3WMSA 1UD6A 4DM2A 1ZB5A 1UWTA 2WVTA 1UD8A 2O9RA 1UKQA 1BPLB 3PZIA 3OB8A 1PIGA 4P8XA 8CGTA 3ZSSA 3TTOA 2AOSA 3GBDA 2WHLA 3W53A 2HVMA 4HU0A 3L2MA 4U5KA 1ECEA 2J7CA 4BQ2A 2XSAA 1JDDA 1M04A 1OB0A 4MPKA 3TTYA 5HXMA 3AQUA 3BAKA 2CIPA 3VDBA 4AYSA 1PX3A 3AHZA 4GI8A 4PMZA 4ZXOA 1ISXA 2PBGA 2QPSA 2WMFA 4F9JA 1KCLA 2XYLA 3UESA 3RJXA 3BC9A 4AD2A 1GUVA 2ZX9A 1XRVA 1QHPA 5BXTA 3CUJA 5FL1A 2BY3A 2X0HA 2UY2A 2WSKA 2GJRA 4W8AA 3GZAA 2OYMA 3E1F1 5E9AA 1J18A 1QVBA 3M7SA 3AICA 3ZQ9A 3WDPP 9CGTA 1P6WA 2V3EA 1R85A 3U5UA 1HXJA 5CPTA 4JAWA 1AQ0A 1W1YA 2E9LA 1UD4A 2CBUA 1JNEA 4UFHA 4AZCB 4EE9A 2QHAA 2EPNA 1BTCA 2UY5A 4UQEA 4HP5A 3MU7A 3MV01 1HL9A 2G3MA 1KWKA 1EGZA 1V6XA 4DUVA 1BGAA 1KGUA 1R8LA 4MADA 1O7AA 1UYQA 3AYRA 4ACZA 1NARA 5HOSA 4LQ1A 5EBAA 3KL3A 4UQAA 2GDUA 4HA4A 1UR9A 2PWEA 1UD5A 3DYOA 4AY1A 2EO7A 3OA5A 2WMHA 3AZTA 1E4NA 2CXGA 1HT6A 3PTQA 3L4VA 1LL7A 3IAPA 3SCUA 1X6LA 2JALA 3GXMA 2WZHA 2ESCA 3CMJA 4D6HA 1WE5A 3WQVA 3EMCA 3N04A 2X0YA 1HKIA 1VEMA 5DT5A 1GQIA 1CGTA 3KWXA 2W63A 2FGZA 4HU8A 1CXEA 5JBFA 3QHMA 3RPMA 4JHOA 1C92A 4GIAA 1UH2A 4RL3A 1RP9A 4R5EA 1ZJAA 2XFFA 3EMQA 1MFVA 3AOFA 2CKRA 3VD5A 1K9DA 4GINA 2VR5A 2J75A 2WHJA 4H41A 1HKMA 1XCWA 3ARTA 3UR7A 1PPIA 1UKTA 1E1EA 4X9YA 3A47A 3ZOAA 2OSWA 1VJZA 4AZ5A 1CLXA 3AMCA 1GHSA 4KGLA 2DH3A 4EAMA 3CZEA 1MW0A 1NOWA 4XZBA 3WNKA 1KXHA 1V3LA 2VUYA 2YL9A 1W91A 3CIVA 4GQRA 5A1AA 1B3XA 4PN2A 5A69A 3IAQA 2X09A 3IANA 5DO8A 1B1YA 1RH9A 2ZUMA 4D6CA 5E6YA 4AXNA 2VCCA 3I3DA 5BXRA 3W24A 4AIUA 3J7HA 1BYCA 4TTUA 2VX6A 2A3EA 1DWHM 1H3GA 4W7WA 1ITXA 2DH2A 3CZJA 1VJSA 4MTVA 4A3YA 1CENA 4KGJA 3WUBA 2WKLA 2Z1SA 3BXWA 5BXPA 2XM1A 4JHZA 1AMYA 1CXIA 2VJXA 5I78A 4H8VA 3ZT7A 1OGSA 2GVYA 2J79A 3WIJA 5BCAA 4ATDA 3OG2A 4H8HA 2B31A 2FH8A 3AIQA 2F8QA 5A6LA 4LX4A 4TX8A 4TVUA 1VEPA 1SMDA 3A4WA 1Q6CA 3SCRA 4GZJA 3VGEA 1S46A 4PSRA 3SUVA 2ZX6A 3GXDA 2PWDA 5CXPA 4BS0A 1KQYA 2D24A 5AYIA 5C8BB 3NSMA 3WENA 2Y4SA 4BCEA 3OGSA 4F8XA 4FLOA 4HMCA 5A6MA 2X2YA 4HZ8A 3SCOA 1VFMA 1E6PA 1MYRA 1NP2A 4IM4A 1V02A 1G9HA 1ZBCA 3B9EA 5C70A 1ZBVA 1Q4NX 1OM0A 2ZX5A 2FHCA 3RCNA 4QLLA 6A3HA 1XGZA 3W4RA 4OIFA 5A6BA 4LYRA 4GQQA 3GDBA 4CVUA 4ZE4A 4XV0A 1QHOA 2OWXA 1OD0A 2VQUA 2EPLX 5A6AA 3U57A 3WBAA 1WZMA 1WAWA 4UQ9A 4CN1A 5KZ6A 4H04A 4AD4A 1E0VA 3L4UA 1H1NA 2EEXA 3I3EA 4M80A 3POHA 1ODUA 4L4OA 4ZE5A 5IHSA 3BMWA 1UKPA 1V3JA 1EXPA 1GVYA 3AXHA 4PMVA 3BSHA 3VTRA 4PMQA 1MXDA 1YHTA 1KBBA 4JKKA 1HJVA 4QLKA 4W5ZA 1VIWA 1W9XA 3O6AA 2JF7A 3PZTA 5AC5A 5M03A 3AIEA 3GYCA 1GHRA 3W38A 4X0VA 1XV8A 2CHOA 3G6MA 1TFVA 2X1IA 4DM1A 3ZM8A 4AZCA 5CZKA 3BCFA 3N9KA 4RE4A 3WNOA 4V28A 1C7SA 3T2QA 4MB3A 1JYNA 3TTQA 4MJ2A 3PTKA 3PZUA 1XYFA 2DSUA 3WMBA 4UFJA 4NRSA 3ZT6A 1EO7A 1EO5A 1KXQA 1JI1A 2XFYA 4A4AA 1GQKA 4AC1X 3SEPA 2XVPA 2YL8A 4W84A 1E6NA 2ZXDA 1J01A 1H0IA 3ARQA 4PMYA 2YIHA 2WBGA 4HZ6A 3NJ3A 2BS9A 2V38A 4NF7A 2QPUA 1B3WA 3B9AA 3VINA 3OLEA 1WB0A 3PZ9A 4W88A 3WD1A 3WD4A 1H49A 3WUFA 1W9PA 1NOFA 1DTUA 1XC6A 3W6LA 3CPUA 5FL0A 4J28A 4J27A 2E9BA 1QW9A 4LGXA 3BH4A 4W7UA 3PHAA 2XGBA 2PF0A 3MMWA 2MANA 1KXVA 1US2A 1E6ZA 2BFGA 2G8ZA 3HJEA 3BSGA 2W91A 3ZSTA 4CU6A 2ZWYA 2X8RA 3T0DA 4AWEA 4UZSA 4CN6A 1KWGA 2BV9A 1HL8A 1TVPA 4V2XA 3OGVA 1JZ2A 4QLJA 2JIWA 4CD5A 4JFSA 2WPGA 2V3FA 2UWFA 5I23A 2OYKA 5CQ1A 1KR1A 2YDQA 2JF6A 3VIHA 3WDJA 1E4MM 1K6AA 1QI5A 4LYQA 1W3LA 3OLDA 1WDPA 1C8QA 2JEPA 3QGVA 1TE1A 2VX7A 3U7BA 3AIUA 4J7RA 4CCDA 1W3KA 4N0RA 3FY1A 2XPKA 4B9ZA 3ARYA 3LMYA 1KCKA 1HVXA 1EHNA 1QBBA 4V27A 3T0AA 4CD6A 3FAXA 2WC7A 3UG4A 1C7TA 2WWDA 3VMNA 5BXSA 2O9OA 2DQXA 3W26A 4E4PA 3WEMA 4AZ7A 2ZE0A 1WDRA 2VVSA 3AHXA 4QFUA 4XUYA 1GOMA 4YHGA 1BYBA 1ISWA 1KQZA 1ZU8A 1JL8A 3M46A 5DT7A 5CJ5A 4JFTA 1XCXA 3PZMA 4HOZA 4PBGA 1JYVA 2VRKA 3QHOA 1J0JA 4K68A 2DEPA 2AAAA 3ZR5A 3EMZA 3SCNA 2BVDA 2D2OA 1H0GA 2ZUSA 3WFLA 3WL1A 1QI2A 3G6LA 5E09A 4Z2KA 2Q8XA 2WLYA 3GH5A 1UWIA 2WCGA 5IDIA 1JXJA 2WVVB 3K8LA 3PTMA 2OSXA 3VDCA 4D6EA 1CECA 2CEQA 3VM7A 2J25A 3MUZ1 2UY4A 3ZT5A 1N82A 4DWSC 3O2LA 1EQPA 2CHNA 4HMEA 3WH8A 2J4GA 3KL0A 4OUEA 3CTTA 4W87A 3L4ZA 2ZXBA 3CHDA 4C7GA 3HU7A 4HA1A 3NCOA 4FMVA 3CH9A 1BYDA 4W5UA 1WZKA 4UQCA 3PN8A 5TD4A 2DT2A 1ZS2A 2GFTA 4WJXA 5DMYA 3WF4A 5AC4A 1VRXA 3K8KA 1IV8A 4HOXA 3SCVA 3GXIA 4TXEA 3AYSA 2O9PA 1WKYA 3SUUA 1VFFA 2E4TA 5I77A 2G3NA 4JFVA 3UEQA 5M17A 2RGLA 2D20A 1UKSA 2WANA 5JUVA 3BLKA 3CHCA 1CYGA 1UWSA 1M01A 5A6BD 3D5HA 5I24A 1UUQA 3WQ8A 4J3VA 5EFDA 1E4LA 1EHAA 3GXFA 1JDCA 2VTFA 4UQBA 4AD5A 1G01A 4A3HA 2WKGA 3UR8A 5ABEA 3T0BA 1E15A 1QNOA 4E8DA 3HMCA 3KE0A 4GZEA 3SUSA 5HPOA 2E8ZA 3A6OA 5BYWA 1JZ6A 1GVIA 3TOPA 3BCDA 5D8WA 4TUFA 2PC8A 2W4XA 2C0HA 2WAGA 1BFNA 4CU8A 4QP0A 4W86A 1C3FA 2YA0A 3CZLA 1XH2A 3SUWA 4YN5A 4MDPA 3UCQA 4AD3A 4W7VA 4U33A 2VMFA 1PZ2A 4GI9A 2D23A 3MUIA 4MJ4A 1ESWA 2VZTA 2WC4A 5BWFA 1XH0A 1QI0A 4UOZA 3WL0A 3SCWA 2GSJA 4QAWA 2J77A 7CGTA 2NT0A 1GOOA 1BG9A 1HP4A 4CKQA 1MW1A 5FD0A 2WSPA 3RJYA 1E56A 1PZ3A 3AMGA 4QCFA 1LF1A 1CTNA 1U30A 1CXLA 2D1ZA 4J3WA 2WVVA 4YHEA 4D6DA 1OGGA 3FAWA 4FF5A 2VNCA 1JG9A 4BQ5A 1CXKA 2EXOA 1LWJA 1OSEA 2JE8A 2VI0A 4UFKA 4Q22A 1MQPA 3WUEA 1VFUA 1CGXA 3WF3A 3VM5A 2DGAA 1QNQA 1W2PA 1FOBA 1JNDA 4MAVA 5LA1A 4MB4A 5ABGA 1JXKA 3EYPA 2C8NA 7TAAA 3ARZA 3IK2A 1EIBA 4JL1A 4BF7A 1X6NA 5EFFA 4J3TA 3FN9A 4U3AA 3WDQA 5DFAA 4FLRA 2ZXAA 3AI0A 4HTYA 2UY3A 3WH5A 3L2LA 4PUDA 3W28A 1LL6A 1W9BM 1H4PA 1DWGM 1M03A 3O9NA 4Z2HA 4N42A 4J3SA 2BXYA 3KL5A 4BQ4A 3OLGA 5CLTA 2XVNA 2ZWZA 4JIEA 3AHVA 4D6JA 2WMKA 3MANA 4P8WA 1BHGA 1AQMA 1W1PA 3EDEA 5D8ZA 1UZ4A 1EDQA 4KRTA 2PI6A 3DC0A 1E6SM 1QHZA 3OZPA 2DSKA 1ISZA 3WBEA 2EPOA 2VCAA 3VOCA 5AY7A 1C8XA 4XB3A 3AS2A 2VX4A 3LPPA 2DIEA 3RM4A 1R86A 4GO9A 1JGIA 3IJ7A 4KH2A 1PX4A 2VZUA 1UA7A 3SUTA 1E5NA 4JL2A 1UD3A 4R27A 1MW3A 3IJ8A 1J11A 2XFRA 4MB5A 1OT2A 3GNRA 4CVWA 3SCPA 5I3DA 1R7OA 5JIWA 3EBVA 3WQWA 2FH6A 1V3HA 3EDJA 4Z2GA 3NUKA 5BRQA 5IFTA 4J3XA 1PAMA 4DWSD 5M5DA 3PBGA 2D0FA 1QW8A 1W3HA 3MUAA 2CERA 1PX8A 1OCQA 5GNZA 2EBNA 3ZJKA 3VIMA 3AMDA 4B3LA 1E55A 3WH6A 4P7QA 3VIFA 4D6IA 4KRUA 1Q6FA 1SMAA 3RIKA 5CPSA 3SIMA 3AISA 2FDMA 3M6DA 4L4PA 3TA9A 2GK1B 1H11A 2IXVA 4PTWA 4C7FA 3ZJ8A 1MQRA 3K1DA 5FIPA 2GJPA 5CGTA 2J74A 1MFUA 1V6WA 5I79A 1UR0A 3OZOA 4B9YA 4P8VA 3GH7A 3AS3A 3BAYA 1HN1A 5EB8A 1H5VA 4CD8A 2J8FA 1OINA 3VGHA 2BVTA 3AHTA 3ARXA 1XD1A 3N1AA 3CBWA 1M53A 4AD0A 3BGAA 3CUHA 2Y5EA 1GQLA 1XYZA 2WNWA 4AIOA 4PTVA 3WDIA 3A4XA 5A2CA 1HKJA 3AZSA 1MXGA 3GNOA 4CN4A 3CGTA 1JFXA 1JIBA 1UZ1A 2ZX8A 4GPNA 1OT1A 5A3HA 3WQ6A 3EDKA 2DPEA 3T2PA 4EKJA 3WFZA 2D22A 2PBOA 3SCTA 1UQZA 2YOCA 4P7NA 3ZIZA 5A94A 4DUXA 1JZ4A 1V3KA 2XGIA 3FW6A 3BAIA 1ZBKA 4M56A 3ARVA 4HA3A 1UA3A 4ATWA 3W29A 4P7RA 2J62A 1G1YA 3CZKA 1HJSA 2WBKA 3PZNA 4JKLA 5FKYA 3WF2A 4OJYA 4U2YA 5JIPA 1NH6A 5ABFB 1MVYA 2DSWA 3VDHA 1KB3A 3WEOA 2XTKA 4CU7A 1HX0A 1ZL1A 4UNIA 1DWIM 1GOKA 4PMOA 4NSBA 1E0XA 1WZLA 3EDFA 1HJWA 3EDDA 3VIIA 4UFLA 2XG9A 4UFIA 3W0KA 2GJXA 3LPGA 4PTMA 4H7VA 3CMGA 2XWEA 5HDRA 1OD8A 3RMEA 4DWSB 3VIKA 1V0KA 3MMDA 1BGGA 4W93A 3QOMA 1JAKA 2QLYA 3VD9A 5AYBA 2DIJA 3AXXA 4H2CA 2XM2A 2Y2WA 3VD4A 4ZXLA 3S2CA 1QNRA 1UR4A 2J7EA 3ARUA 1W3JA 1FH7A 3M07A 2WLZA 3NYDA 4MNMA 2WMJA 3MSGA 3CHFA 1V08A 3L4YA 3TTSA 5A95A 1JF6A 4D6FA 3MSDA 1LQ0A 1UWUA 2IUZA 3WN6A 3AFBA 3QHNA 1ISVA 2BHYA 4IPLA 1BVNP 1J0KA 1E6QM 1QNPA 3WEZA 1TVNA 2OWCA 1Q6DA 2A3CA 2Y8VA 2CCRA 6CGTA 4TTGA 2CITA 4M1RA 5LYRA 5I0DA 1A47A 2G4FA 8A3HA 3WDHA 1EOKA 4B16A 2BY2A 1B3VA 1W9VA 3FNDA 1G0CA 1FHDA 1CXFA 1HKKA 2BY0A 3FHQA 3SCQA 1F4HA 2G41A 2BHUA 5LA2A 3ARWA 4ACYA 1UKOA 5BROA 4AZHA 2D0GA 3AIRA 2V5DA 4CD4A 4NZCA 2NSXA 3VU2A 3WD2A 2RGMA 1J10A 1KGXA 4OBRA 1HJQA 2VL4A 2JFEX 1UWQA 2VT0A 3W37A 3A3HA 3VKKA 3AIBA 1LLOA 1CXHA 4M24A 1GOQA 4C7DA 5IHRA 3WUGA 1E3XA 4PUEA 2Z1KA 4HZ7A 5A8NA 2YL6A 2XSBA 1QI4A 1ITCA 1H2JA 2VZOA 5E6ZA 4GI6A 2BNJA 3ZJ7A 2W5FA 4E2OA 5C71A 1WCGA 1BYAA 2JIEA 2W67A 2E9MA 1Q6GA 3W6MA 1DHKA 1XSKA 1AQHA 1V03A 1U33A 4ACZB 4AD1A 3BLPX 3APGA 2XVGA 4S3KA 4CGTA 1E0WA 2GJXB 4M81A 4EK7A 3N15A 3WQ5A 3VIPA 4UQDA 3N13A 2FGLA 3BAWA 2GK1A 1JZ5A 3AS1A 1GORA 4Q7NA 2WZEA 4Y7EA 4W89A 4WLCA 1JF5A 3TP4A 1TR1A 4PSPA 3VILA 1O6IA 1UHVA 1UR1A 1VEOA 2G3JA 2VZSA 2XUCA 4OKDA 2E0PA 4YPJA 3PZVA 1WDSA 2DT3A 3WY1A 3ALFA 3VO0A 3AIVA 3WDRA 1B31A 4TVDA 3RM8A 4AZ6A 1E9LA 4P8UA 5GPRA 1R87A 2DT0A 4IUGA 1RD6A 2DT1A 1A3HA 1NM9A 1B3YA 2VVNA 2WWCA 3QR3A 2ZIDA 2J7FA 5A6JA 5CSUA 2VC9A 1J0YA 2QMJA 2WMIB 2WC3A 4PRWA 2J78A 4TX6A 3VPLA 1EQCA 2VCBA 1MQQA 1E72M 1TCMA 1EDTA
chains in the Genus database with same CATH superfamily
4EF9A 1US3A 2DSZA 1NAL1 2PLJA 2GUUA 1T41A 2Y7EA 1XHGA 1DIKA 3R94A 3LM3A 4ML4A 2OGYA 1ITQA 3BW4A 3BUVA 1GOIA 2CBVA 2G50A 1VFHA 3WSUA 1S1PA 4XWUA 4WRHA 1D7KA 1JI2A 3ARSA 1S38A 1ENUA 5A8QA 4D1IA 3WBXA 3ZO9A 1H41A 4DHGA 1PZ0A 4MIMA 3RYSA 4X2PA 3THCA 1RV8A 1E71M 5CBBA 4XK2A 3THDA 5J04A 4B90A 1HIZA 2WZIA 3L4TA 4FOKA 4LBUA 1S2VA 4Y9OA 4NYYA 4JTKA 5D4YA 3P2VA 1UPPA 3OBAA 3N2XA 4QTGA 3CH0A 1CWYA 3QJAA 1PTGA 1WX0A 5E1QA 3WNMA 1DIEA 2W0UA 3IJDA 3UERA 1DJWA 1XYMA 1FP8A 3EXTA 3UZ5A 1VZWA 2YA1A 4IQEA 4UZUA 1FWJC 1UUMA 3FJLA 2G5WA 3SN0A 2PDIA 4IMEA 3Q67A 3H8AA 2BVYA 1EX1A 1K3UA 5A6SA 1MMFA 2R14A 2VQTA 2ZUUA 4PMUA 1A0EA 2VP8A 3M0ZA 4B4HA 4Q8OA 3CLWA 3WQ4A 1TV8A 5I03A 1I9CB 2BZNA 3CV2A 1ITUA 3BJFA 5G4WA 1TSIA 1UCWA 1ZNNA 3UWWA 4HYVA 3RLHA 4C6IA 4GVGA 1TWSA 4FOUA 1YNPA 5DQPA 3ARPA 2P3ZA 5GNXA 3W1QA 2YDAA 4QG8A 4GIYA 3W7NA 5KINA 1UJPA 3LDVA 2XIIA 4MAZA 4CQ8A 3HPSA 3H54A 2CZEA 3W7MA 1M3UA 3W1LA 3M5ZA 4BFAA 3VOFA 4NJHA 4PTXA 1NWRA 2ZUTA 1REQA 4FR6A 1DWJM 3OGRA 3HG3A 4K38A 3VKBA 4N02A 2VDIA 4O1FA 1BLIA 2CPUA 1LG1A 5D9OA 2FIQA 2OOGA 1C9WA 4LXFA 2SFPA 4JTLA 4JQ3A 1V6YA 1LG2A 5FI8A 4S3CA 1NELA 4HHLA 3GNPA 2WW5A 2D3LA 2PP1A 3HV8A 4ZO7A 4Q8PA 2PDHA 3KCOA 1R0MA 1YADA 4GYFA 1OBAA 2PWHA 2ZOXA 5C9ZA 4JKMA 4U3CA 5K7JA 1QR7A 2YBTA 4QS6A 2WNZA 4LPCA 3ABSA 3FA5A 2JGYA 5D9PA 2FGBA 2FLIA 4MB1A 4MKVA 1GEHA 1UZDA 3AJ7A 4IJCA 4FK9A 3MUY1 2QMKA 3W02A 3VD7A 3GHSA 1BF2A 5HNNA 3UG8A 1GOWA 3WELA 4GHRA 3N11A 1OYCA 2QPXA 2I5IA 1K7XA 1KTCA 3B8IA 2J13A 1Z89A 1LJYA 1PWMA 4KQNA 3VKCA 4BZYA 2ZUWA 3U6WA 1K9TA 1R30A 4F3HA 3RLVA 1FFQA 1ISYA 2ZA1A 3NSXA 1IT0A 4JZ5A 4J1OA 1W5QA 3VD3A 4PL1A 4NNCA 5ABTA 1VCFA 2I56A 2IKJA 3CUIA 1RJPA 1L8NA 4A3QA 1R7AA 2J47A 3O1NA 3UGRA 4QHRA 3RO8A 3U3HA 4TR9A 2ZTJA 2HPIA 2B7QA 2ZXQA 2G97A 4QISA 4DBUA 3VFLA 1VR6A 3UZYA 1AZ2A 4Q33A 1DTNA 1OWQA 2MUCA 3QPYA 2HDJA 3LXBA 2QVHA 2PDGA 2Y7FA 3YPIA 3M44A 3GYEA 5HPCA 4GIEA 3PNUA 1U83A 3MS8A 1XM3A 1JZ8A 3BG9A 4FO4A 1OEPA 3F5LA 3GSMA 3N29A 3TWAA 3B8SA 1XIIA 2Z6JA 4GH1A 5CCZA 1F9CA 1UOKA 4OZOA 1AQFA 2ABAA 2OG9A 4ZTYA 3DI0A 2PZ0A 5ABFA 1YLVA 4OFCA 4DYJA 1KRBC 4B5SA 5HWNA 2VC7A 4HMDA 4EANA 3GG0A 3DEQA 3LRLA 1NWTA 1EL3A 4ZB0A 3WKZA 7REQB 1E73M 2O55A 1QK2A 1GNXA 4IMDA 4ROQA 2CNCA 1IZKA 4EIVA 3GHRA 5FF7A 1HZYA 3L5LA 3MO4A 4YXGA 1VBRA 5LA0A 3VCRA 1DEDA 1EZWA 1DJGA 1O1ZA 4QDMA 4HT3A 3ANVA 2OR2A 4PMRA 1YPXA 2DSVA 1W1VA 3E38A 4H9TA 3M1ZA 1GEQA 4J2PA 2X2GA 4S3FA 5EMYA 3S9ZA 4HK6A 3W7KA 1BQCA 1HW6A 3GM8A 1LRTA 3CUFA 1CGWA 5T8GA 1EA9C 2X16A 2G0WA 4PMXA 3DUGA 4LJ3A 3FS2A 3WNPA 2A1YA 1XLDA 3DX5A 5DMMA 1YBQB 4H83A 2OOFA 1V6UA 4CCEA 1H7NA 4E38A 3TH6A 4XD4A 3RDKA 1ZRQA 1R2SA 1LUCB 2BHZA 4UOJA 5LXXA 1UWRA 5AVHA 3A21A 4AISA 1ADSA 4GFIA 5AYXA 3OA3A 3TAOA 3GBEA 3V0SA 1VFSA 3H2MA 2RDUA 3MSRA 3AS0A 2QYGA 2R1NA 1UH3A 3UT0A 1IE7C 5GQBA 1LL4A 1NWSA 2YBUA 1M5WA 3KCLA 3I4KA 3DHPA 2FMNA 1X1OA 1YDOA 4YVPA 4Q4PA 3I6EA 3L2IA 2W61A 4M29A 2XIOA 2J7GA 1KKOA 4LS1A 3WMCA 2G4JA 4M82A 3A5FA 2J7BA 2NQHA 2WPBA 3K4DA 1C93A 5HA7A 3GNDA 2G3IA 2CLHA 3UY7A 1S5NA 4U31A 2QUVA 1FA2A 1KFBA 3EOLA 2PRHA 3H2EA 2QR6A 4YIWA 2W9MA 3ZJ6A 2W3ZA 4UB9A 2WB5A 3WK1A 1W9DM 3ECQA 4BA0A 6REQA 3M0YA 1UD2A 1MNZA 1CGYA 2ZUVA 1JDAA 1GONA 2ZQ0A 3DDMA 3JR2A 3LHWA 1TPH1 4MNLA 1VS1A 1L6FA 3CEUA 3H7RA 1A5LC 5HANA 5KZMA 3PJXA 4RE3A 1IHIA 3S2JA 3MYPA 5FEPA 5A8MA 1UC4A 3LV5A 4H8UA 1VAHA 1OZQA 3M0JA 1U5JA 3O8AA 1AJ0A 1JD7A 3QSTA 3DFPA 3NOEA 2H3BA 1ZB5A 1WXZA 1MEIA 1SSGA 3MBFA 1UD8A 2JQXA 3E3HA 3T81A 2VFEA 3NTYA 4P8XA 5D05A 8CGTA 3ZSSA 3TTOA 4MY8A 1VHCA 1R3VA 4U5KA 2H6RA 1XIHA 4PMJA 3ES8A 2V6AA 4K37A 4BQ2A 2EPHA 1OB0A 5HXMA 3VDBA 3D3FA 4B2DA 3DFOA 4PMZA 4CNSA 3IJQA 1ISXA 2QPSA 3AUJA 1PSCA 2XYLA 2OO6A 3GTIA 4F0LA 3BLOA 4NL1A 3TROA 3CUJA 5FL1A 2UY2A 1OX4A 3GDMA 3GZAA 2FVMA 3HQ1A 3M7SA 3ZQ9A 1QAPA 1P6WA 2Y1HA 4GNJA 1HL2A 1TV4A 4DJEA 4JAWA 1W1YA 2DIKA 3D0CA 3KLKA 4UFHA 4JTFA 4Q8QA 2EPNA 3MU7A 2IKGA 1MXSA 3KRSA 1EGZA 1A5SA 4DF2A 4DUVA 1BGAA 3W1MA 1O7AA 4WVXA 3AYRA 3PJWA 1ZTVA 4PFMA 3MKVA 3HFTA 4NXSA 4GNKB 5HOSA 1S1RA 1W3NA 1B5TA 4FZIA 4C1KA 3QR0A 4WZHA 4GYPA 4A8NA 1W1A1 3KP0A 4ZO8A 3CV7A 1QTWA 3SFKA 2CZ5A 3M0MA 1VYPX 1TVLA 1LZOA 3TYEA 1RBOB 2Z29A 4ZOBA 3IGHX 3B0PA 3RHGA 3G1RA 3RX2A 4D6HA 1QXLA 4DO6A 2FTYA 3V36A 5LIXX 2Y63A 1VEMA 2W63A 3RITA 4OTKA 1AG1O 3W1UA 5I00A 1NDWA 4HU8A 1C92A 3QTGA 4Q4RA 2ZRUA 4M3PA 3EMQA 1UPMB 4UTIA 4I90A 4TMCA 3T44A 3BE7A 1H7WA 3AOFA 2CKRA 4G56A 1K9DA 3G1AA 4V1XA 2J75A 2WHJA 3NG3A 2A6NA 5HQMA 3GG8A 1CLXA 1YXYA 1L6WA 3RG6A 1V3LA 2VUYA 3TE9A 3CIVA 4PN2A 5A69A 4TIMA 3IAQA 3T8QA 1U1JA 5BXRA 5DXYA 4AIUA 1N8IA 3TN4A 1BYCA 3TYDA 1H3GA 3L0GA 1G69A 4N4QA 1DQWA 3G1HA 4A3YA 4GMEA 4JQ2A 3QFWA 2XM1A 3AJXA 4ZQPA 1F3TA 3SI9A 1O66A 4NY2A 2YCKX 3OG2A 4H8HA 2B31A 1XYCA 2PLCA 5A6LA 4LAKA 3OVGA 3G0XA 1GTEA 1R3TA 3SCRA 1FWFC 1OC6A 3KTCA 1OF8A 4LALA 2VGIA 3SQSA 1C9DA 3I6TA 5HULA 4IIEA 4I5RA 4MKSA 4B92A 4PZVA 2YCEA 3LOTA 3PR2A 3WENA 2Y4SA 2XN1A 4YVXA 4RNJA 1Z48A 4FLOA 1Q6OA 3G1XA 1XRFA 2ADAA 5KMYA 4HZ8A 1VFMA 3LBMA 1MYRA 1V02A 3B9EA 1ZBCA 4RKAA 1K70A 1ZBVA 5U4NA 1HO4A 1OM0A 1F8MA 3E12A 3RCNA 1TV7A 4OIFA 5HNRA 2WV8A 2NXIA 2HCVA 4GQQA 1HQTA 4MVAA 1ZALA 3TLLA 1EJRC 1QHOA 2VKZG 2OB3A 2VQUA 5A6AA 4GXMA 1A0CA 1NDVA 5KZ6A 3QV8A 4AD4A 4C6PA 2DV0A 4R3UA 4YL2A 3H23A 3L5MA 3I3EA 1O5KA 3LTPA 3W1TA 4M80A 1ODUA 4HKPA 4L4OA 4ZE5A 5IHSA 3RU6A 3BMWA 1V3JA 1GVYA 1HFBA 5E93A 3P81A 5EKYA 3LLFA 1MXDA 1YHTA 1KBBA 4DO4A 1FY6A 1HJVA 5TQLA 3TJIA 4LCQA 3LGDA 5D2VA 1BF6A 1EZ2A 3O6AA 2WQDA 2LLEA 5TIMA 2V81A 3GYCA 1GHRA 1QPOA 4HIBA 4FXSA 1EYEA 3TR9A 4FNQA 4DM1A 3PUDA 5CJMA 4PB3A 1UMYA 4Q4OA 3OEXA 3G8RA 1VFTA 4MJ2A 1Q6RA 4IIDA 4JTUA 3PZUA 4WQ6A 3PB2A 5JVLA 4I5XA 1Z41A 1EO7A 2E5CA 1GGOA 3GXPA 1TWZA 1S3HA 3FK4A 1XDMA 1E6NA 1J01A 1H0IA 1DVJA 3KAOA 2DU2A 2YIHA 3H7VA 4C6OA 2OQHA 4KFOA 6TIMA 1KM4A 4WDUA 2PWUA 4DJDD 3GHUA 5EBUA 3OLEA 1WB0A 3H2FA 3WD4A 1H49A 4O16A 3MMTA 2I9UA 1XC6A 1DTUA 3W7LA 2DFAA 3E6EA 3W6LA 2HTMA 2FTWA 4W7UA 5LNVA 2MANA 4JQAA 1OYBA 3NZGA 3F4CA 5GJNA 3F03K 4UZSA 4CN6A 3VFCA 3MT1A 1JZ2A 4QLJA 4PA8A 4CD5A 3FYOA 5AVNA 1OJXA 2PD5A 3C8FA 4R7OA 3N25A 3RR1A 5CKSA 1U22A 5I23A 2OYKA 4GK8A 5CQ1A 4QX4A 1SW7A 4KW2A 3LTYA 4HTBA 5G4EA 1WOBA 1SZEA 4LBSA 2E5BA 4KCWA 1C8QA 3QGVA 4MWAE 1IF2A 5IBXA 3TKFA 2XPKA 3NWRA 3KTSA 2E28A 4KT2A 4CD6A 3UG4A 3BV4A 2WWDA 1G7VA 2ZDRA 3W72A 2QUTA 4AEOA 1TIMA 5BXSA 5XINA 2QCGA 2Z24A 2VVSA 1S2UA 2ZA2A 3F1QA 4K8GA 4LUYA 4YHGA 3W6YA 1KQZA 2YZ5A 4RUBA 3JZUA 3R6IA 3HPFA 4GVIA 1XICA 3FLUA 4NZ1A 4NX0A 3W7OA 1J0JA 4HK7A 3DI1A 1ZGDA 2Z1XA 2JBMA 2AAAA 5BMXA 3MZNA 3ZR5A 5G4HC 3U2ZA 4QJ3B 2BVDA 2D2OA 3V0TA 3WFLA 3W2KA 1YEYA 2A7NA 1RQBA 5MHBA 1UWIA 3C6CA 5IDIA 5EPDA 2WVVB 2QUNA 3K8LA 3CQKA 3SY1A 4D6EA 2CEQA 1XJBA 2ALDA 2NVDA 2A2IA 3ZT5A 1MSSA 2CHNA 3WH8A 3S46A 3APTA 4NQ1A 3O0FA 4PH6A 1R3YA 3L4ZA 3LXCA 1RLDA 2ZXBA 4O0KA 1XI3A 3THAA 2QF7A 3HU7A 4FMVA 2CWNA 4F0RA 3CQHA 3QFEA 1E51A 3W74A 4W5UA 1EJUC 4ML9A 5H6HA 1ZS2A 4WJXA 4JX4A 1MUMA 3WF4A 1BTMA 5BWAA 4HOXA 4TXEA 2BOFX 1KBLA 3C3NA 1VFFA 4HHMA 3H12A 5I77A 4PUMA 3KP1A 5M17A 2WANA 2ONEA 3NQGA 1QT1A 4YYFA 3HF3A 3CHCA 2ABBA 1UWSA 5A6BD 3TQKA 2AL2B 1A5AA 3D5HA 3E49A 3W7JA 4PCPA 3WQ8A 4Q4KA 1K8XA 1EHAA 2NSOA 1X96A 2VTFA 1O94A 4PRRA 3KS5A 3LS9A 3GY1A 1G01A 2BB0A 2WKGA 2HE8A 1JRCA 3E02A 1DJHA 3GKFA 3INPA 2Z28A 5I3HA 3A6OA 1XUUA 5BYWA 1JZ6A 1GVIA 4JTQA 1R5YA 4XVDA 3VZYA 3JU2A 4JTJA 3H6OA 3GC2A 2V5BA 2PPGA 4KRZA 2FFCA 4BWLA 2ZC8A 2NX9A 1XLKA 1C3FA 1XYBA 3WQEA 1XH2A 3UJFA 4AWTA 3UCQA 4U33A 3IJLA 3M0KA 1PZ2A 3MJYA 4GI9A 3MUIA 4JQ1A 3WLSA 5C6MA 2OJPA 1V79A 2PDFA 2VZTA 3G0SA 1QI0A 4R85A 2J77A 3TJ4A 7CGTA 2PGRA 2G96A 4Q7BA 5FD0A 1VLIA 2WSPA 3IUHA 4LEQA 1P6BA 3MI2A 3KVMA 3N2TA 3AMGA 1I2NA 1HTIA 5DBUA 2HZGA 3E2QA 4UTLA 1CXLA 4CQCA 4BK9A 3HBLA 2VM8A 1EF2A 1JG9A 9RUBA 4JXCA 2EXOA 1LWJA 5XIAA 1P0BA 1EP2A 3WF3A 3VM5A 2DP3A 1QNQA 3M0HA 1JNDA 4MAVA 4MB4A 3TLQA 5ABGA 3TDFA 4MYAA 4ILSA 5LGZA 1TCDA 1T0OA 1KTNA 5EFFA 1GTHA 3VCCA 4J3TA 1XISA 5EA9A 4FLRA 3WO8A 1R6WA 3AI0A 2UY3A 4K36A 3L2LA 3MUCA 5IOBA 1CT5A 1LL6A 2ZZ5A 4HNUA 2X30A 2XISA 4XD5A 3OLGA 5CLTA 2XVNA 3S5OA 1DE5A 4JIEA 3MANA 3MB9A 1UZ4A 5FEWA 1I4NA 3OZPA 2V2CA 3S2LA 1XLJA 2EPOA 4HA0A 1XX1A 4GVFA 1YYAA 4LNYA 5AY7A 3VNJA 4XB3A 3AS2A 1J93A 2VX4A 3LPPA 1N2VA 2VZUA 3NPWA 5DN1A 1Q4WA 1UA7A 3SUTA 4KS0A 4JL2A 1UD3A 4R27A 3ABRA 3L68A 3OOQA 4EPEC 3PBYA 1LBMA 5JU6A 2PD9A 4BJHA 2Q6ZA 3F4NA 4IF2A 3GNRA 2ZE3A 3QTPA 4CVWA 3DFHA 5I3DA 1R7OA 3N6JA 5JIWA 4ZO9A 1OY0A 2E5DA 4NASA 1R3RA 4Z2GA 1OG6A 2GJNA 4DB7A 2QCMA 4X22A 3E5BA 4H6RA 4DWSD 1PAMA 2VYOA 2D0FA 3MCOA 4MG4A 3K13A 4O18A 1EC7A 3RCMA 1OCQA 5GNZA 4EF8A 2PTWA 3GZ3A 4UIOA 1A49A 1E55A 3WH6A 1RJQA 4P7QA 3VIFA 6ENLA 1SO6A 1Q6FA 3UWUA 1SMAA 1P5BA 3R4IA 1LT7A 2B7OA 4L4PA 2GK1B 1H11A 5FIPA 2GJPA 1R3QA 5CGTA 4AQLA 2J74A 2Y6ZA 3O6YX 5I79A 1UR0A 1O95A 4GCXA 3WQCA 4DWDA 4HQVA 3GH7A 3AS3A 3RXZA 3EX2A 1H5VA 1S2CA 2J8FA 1JULA 2GQ3A 3LSBA 1OINA 4LH8A 2G3FA 3H2NA 2BVTA 3IRDA 1LCOA 1KTBA 4LUTA 4C1NA 3G1DA 4MWAB 1PKNA 2TSYA 2FPYA 1H51A 1ZAIA 2QGHA 3I10A 3F7JA 4JTSA 3CUHA 3D6NA 1I2QA 4E2VA 5FJRA 3EX4A 1WQ5A 3DH7A 5A2CA 3NZPA 5FJIA 2BWGA 3G5EA 5BOFA 4JEQA 3EDKA 5F2GA 2XH2A 2D22A 3R58A 3VKDA 2YOCA 3E96A 4DUXA 1JZ4A 3H2AA 4D8AA 3FW6A 4S3AA 1TWWA 3GR8A 2XIJA 2V2DA 2YR1A 1G1YA 2V68A 2WBKA 4U2YA 4PB5A 4O1EA 2DSWA 2PAJA 1FX6A 4CU7A 1HX0A 1ZL1A 4CNNA 4H4IA 1GOKA 4NSBA 1SZFA 1WZLA 1PIIA 3VIIA 3ZR4A 4UTUA 3QZEA 3GXNA 4US6A 5D38A 3NEVA 3LPGA 4PTMA 4H7VA 5K2ZA 4HVXA 3R2GA 5D2XA 4JY8A 3RMEA 6REQB 5FJUA 2GGHA 5HMDA 1G4PA 1IWAA 3EX3A 3UR5A 3QOMA 1TJ1A 4R88A 1AA1B 1AH3A 3QW4B 1QNRA 4R9OA 1UR4A 5F2LA 4FXFA 1SJAA 1LOQA 3NQCA 2ACRA 3NYZA 5DELA 2VFHA 4DRSA 2WMJA 3IJ6A 1UBPC 4WEVX 3TC6A 4OGZA 4QQ3A 3SN1A 2PDYA 4ZR8A 1JF6A 4RJEA 3RRXA 2H8XA 2A5HA 5LIUX 1LYXA 5K9CA 1B4KA 1FCBA 5H91A 1QNPA 2A79A 3C2EA 3QXBA 1FTXA 2A3CA 2VDHA 3HURA 1W6TA 3RO6A 2Y8VA 3RUBL 2CCRA 4TTGA 2CITA 4WY0A 2G4FA 4RNFA 3A9IA 4OQVA 1OK6A 1RCOB 3RAOA 4JS3A 1DOSA 3FHQA 2G41A 3KCJA 2D0GA 1S3TC 4NZCA 3HGSA 2IPJA 4FNUA 1KGXA 4OBRA 4ZQCA 2OT0A 2B4GA 3W37A 3A3HA 2EJAA 3QC3A 1Q8JA 1SZGA 4M24A 1GOQA 4C7DA 4DO5A 5DCBA 1E3XA 1S5VA 1RR2A 4PODA 3UXLA 3USZA 1AH4A 3UPWA 5FJTA 3K2GA 3PBWA 1QI4A 4HSNA 3SSJA 2QCFA 4WY0F 1H2JA 3ZJ7A 1WCGA 3NL2A 1YXCA 1EF3A 1NTHA 2ZZ1A 3FVDA 4A8LA 4RPPA 4QDWA 5DCEA 3ID7A 4ACZB 2D2JA 3R25A 3APGA 1E0UA 1BVWA 1G67A 2VFDA 4S3KA 4QSHA 4CGTA 2VC5A 4EK7A 3WQ5A 2YW4A 1GG1A 3BAWA 2F84A 2GK1A 1JZ5A 4Y7EA 4ECLA 4A05A 1TR1A 3UXDA 4WHBA 2DW7A 3SRFA 4IPPA 4OKDA 4Q6XA 3PZVA 2DT3A 1FWSA 5K9XA 4UTMA 3VNKA 4HYWA 4AZ6A 1YE4A 1FWIC 3HFYA 4RW3A 4ADSA 3LYEA 1A3HA 1NM9A 2YYUA 4NAFA 2OKTA 3R10A 3BJTA 4MSSA 5CSUA 2VC9A 1TUFA 3KX6A 2QMJA 4PRWA 4TX6A 3QLDA 4DXVA 1MQQA 2EF9A 1XIBA 4DXXA 1F4AA 4MY1A 1PYFA 2BBFA 3IRSA 1S2WA 1DE6A 3T2OA 1JR1A 3T6CA 2Y70A 4GI4A 2F2HA 4Z1DA 1OIMA 4ORMA 4IT1A 3G1YA 1MZRA 3CUXA 4XISA 1V3IA 6PTDA 1I0BA 1NDYA 1FCVA 1QJWA 1XLFA 3W7EA 2CWXA 3LHYA 3KDNA 1T99A 3C0LA 4R33A 1SYTA 1B3ZA 3N3TA 1MO0A 2YJQA 1NU5A 2IPWA 2CLIA 3EX6A 1BRLA 4NZFA 4I9AA 1HVQA 3MBDA 2ZKMX 4WOQA 4NZJA 1CIUA 2PGWA 3AZRA 3P93A 2Z2AA 5E5CA 2CBJA 3W2NA 4UCFA 7XIMA 1Y5VA 4XZHA 4NHVA 5IXEA 1FCQA 2RDTA 1JAEA 4RE0A 4P2VA 4DPQA 4TU1A 5D09A 3BVJA 1VCGA 1K9FA 4KCVA 3CC1A 4L9YA 2OQLA 2H90A 1R3WA 4HCHA 1WXYA 3ZS4A 2VEMA 5EMJA 1AW1A 1C91A 5DX7A 1YPIA 2HXTA 3P62A 3IJ9A 5IDZA 3UPMA 4E2BA 1M7XA 3SQLA 3TIMA 2XVKA 1PBGA 4XZIA 2CETA 3DG6A 5F4XA 1KM1A 4K39A 1GZJA 1ME8A 2A3LA 1YTEA 1MZHA 2P5NA 3NIYA 2WSQA 3GG1A 4GY1A 1K6WA 4MZYA 3DENA 2PRLA 4C90A 4RE2A 3GVQA 2CYGA 3TW9A 3LPFA 3IACA 2FZNA 2XDFA 1UP3A 1D8CA 4C6KA 1W3TA 2X40A 4PUKA 1R38A 3HZ3A 3C0SA 2E6AA 4MDOA 4MHBA 2PA6A 3PSWA 4ENLA 1CEOA 4Z2IA 1JD9A 2EQDA 4RX0A 3F5JA 2EGZA 1W8SA 1KRAC 3NOYA 4HHPA 1L6SA 5GVJA 3UA3A 1PTAA 4PTNA 3TAKA 3IIOA 2OWWA 3W1RA 5HBFA 1A3XA 5FEXA 3E0WA 5KETA 3FGCB 4KWUA 1TWDA 2QCCA 2YA2A 3TCSA 2OX1A 3DHUA 4I7WA 2FZBA 1IZJA 1EP1A 3CWHA 2YKKA 1XLAA 2Y62A 4HOWA 4DZHA 4HJFA 4AZGA 2BXZA 4A22A 1ZFJA 3S6OA 5D33A 3U48A 4ZB5A 3V35A 1LM1A 2C18A 2WVUA 4QS5A 1GJUA 3LENA 1PO9A 1QPNA 4HCDA 3PVFA 2RKXA 2VZVA 3WYZA 3DN5A 1D3CA 4U2ZA 1V8EA 1QWGA 1W32A 4IMFA 3HGRA 4MFEA 2A3AA 1HP5A 5H2ZA 2V3GA 3W7QA 4PCTA 1SO4A 1DWFM 5D9MA 4G1KA 4AG0A 1MW2A 4QSFA 4WSJA 2I5QA 4LCRA 2WMGA 1H09A 4HNVA 3LX9A 1XQLA 2ISFA 4MYXA 1K4HA 3HA1A 1W56A 3DYPA 1D2KA 1FWAC 1WBHA 3T78A 2J8GA 2B7PA 1BKHA 3WLHA 3DHDA 4MGGA 1AVAA 4H9YA 4PRTA 1ADOA 1CZ1A 1OYAA 2E67A 5FSDC 1HF6A 3GW0A 1VYRA 3K4AA 1XD0A 4GISA 2I9EA 4ATLA 4G6CA 3VC6A 3AO0A 5M2FX 5I5RA 4O12A 4Z1BA 1CPUA 1I1WA 3KRUA 2HNHA 4HSHA 3VZXA 4F79A 4ICNA 3IIVA 3UZXA 3A3WA 2ZUNA 1X39A 3SGUA 4NG3A 2BDQA 3CT2A 2O92A 3A13A 4G2DA 3CPGA 4GZIA 3EWWA 5A2AA 2WVSA 3AXIA 3M0XA 1CNVA 3W25A 4AEEA 5I06A 3L65A 1RP8A 1ZBWA 5D9NA 3WF0A 2DY3A 1OC5A 1L0PA 4M6VA 1B9BA 2W62A 1UR8A 5HUPA 3SADA 1XFCA 5D37A 3F2DA 3G24A 1PZ1A 1XQKA 3JVAA 4HNTA 3DERA 2A3BA 4UR9A 3PY2A 3CTLA 3DKJA 1GW9A 2XHYA 4JIPA 4QR6A 3PUEA 5GNYA 2CW6A 4D9PA 3PZGA 4LAZA 2VR2A 4JIHA 1JPMA 3POCA 1WZAA 1XDLA 1FWHC 1RAKA 4ZQNA 1PIFA 3VABA 2R82A 1J0HA 4QJ4B 2IPFA 5M3WA 1RD5A 2GGEA 1A4LA 1U1HA 2PB1A 5LXEA 4GUHA 3W7HA 2ZVRA 3P61A 1FCUA 1GW1A 1UR2A 2PZNA 4DAFA 4OVXA 3ZLFA 1BSIA 1JEZA 2NWRA 1GQJA 3P5YA 4W8LA 3VAVA 1N7KA 3ONBA 1DWAM 1X7FA 3AMLA 3M9YA 1TZ7A 3VIOA 3OVQA 4AVOA 3N4EA 4BY3A 4LV9A 4KCTA 3WLMA 1Q45A 4KWOA 4Z1CA 1LQ2A 5IM51 1E5JA 4QXIA 2YXOA 1B0IA 3EXRA 3G8EA 4AHQA 3PFRA 3N9RA 2R24A 3W1PA 4IP4A 3CWNA 1KGWA 1QNSA 3L4XA 1B9ZA 4WSKA 3W27A 3HM7A 3M41A 4B15A 3NXFA 4DUWA 3TVAA 4LU0A 3ZR6A 1QOXA 4I3GA 1CDGA 2GSHA 3ANUA 3B04A 1IR2A 5LSMA 2ATSA 4G7FA 1EB3A 2O0TA 4C6BA 3TSBA 4HN4A 4BQ3A 1Q2SA 3LCGA 4UTJA 1AZ1A 4UOQA 1B54A 1AD1A 4IISA 4C6FA 2J9ZA 5E0CA 4UNLA 4IQLA 1P7TA 4PCSA 3A64A 2E8YA 4JFUA 4QG6A 5D30A 3VNYA 4Y8EA 2Q8ZA 3CUGA 3K4WA 5A8OA 3WLTA 3H26A 3OBKA 4DYKA 3W22A 4NILA 4PGLA 2QF8A 3CHEA 4HHHA 4XAFA 5A5WA 1MRQA 4GE8A 4B5VA 3VIGA 4W9TA 1PWLA 1EUNA 4IH3A 4WXYA 1XGEA 5A2BA 2VRJA 4Z2JA 1LQAA 3PZQA 3PPGA 3E74A 4WSHA 1V7YA 4WOZA 4LAMA 3S83A 3I3BA 1JJKA 3TA6A 3F5KA 4KKXA 2GQ9A 3VMOA 1YKWA 2PDCA 3F4VA 4CEXC 5HJLA 4NKCA 4UFMA 5AYZA 2GZXA 5I6SA 1ONWA 1IEQA 5CLWA 5I3IA 4ZB2A 4S3BA 2XU2A 2QV4A 2PEVA 1E1CB 1QUMA 3GNXA 3PANA 1WKEA 2VD9A 2PCQA 1WPCA 2YDSA 1UD6A 3MSYA 4KERA 4C5ZA 4DVOA 3U4AA 1F7BA 4DZ5A 2O9RA 1SQ7A 1UKQA 3PZIA 3OB8A 1KRCC 1PIGA 2Q71A 4RZ4A 1XIDA 2AOSA 2E09A 2X0SA 4HU0A 4Z42C 3BW3A 1ECEA 3JZEA 2J7CA 1MDRA 3F4WA 2O4QA 4JNYA 4C91A 4MPKA 2Z25A 3AQUA 4OWGA 4O0QA 3PTDA 2CIPA 4J2MA 1SFLA 1PX3A 4GUJA 1XBXA 2DW6A 2PBGA 5I3GA 7ODCA 4O19A 1KCLA 3LB0A 3UESA 1W3IA 1VD6A 4AD2A 4XAYA 1GUVA 1XRVA 5CPMA 4AWSA 1VHNA 3L12A 3LHVA 3E1F1 3QC0A 3E5PA 5E9AA 1Z9AA 1J18A 1QVBA 2CHRA 3UGVA 2EG7A 5DCDA 9CGTA 4L1GA 4Y90A 2GQAA 3TMLA 3TN6A 3U5UA 3HQOA 5CPTA 2YGYA 3LD5A 2CBUA 2V5KA 3M47A 1V5XA 5D2YA 4EE9A 2QHAA 2UY5A 2FFIA 1E9ZB 1SO5A 1KWKA 1V6XA 2Y7DA 4Y9MA 4DJDA 1GZ1A 1R8LA 4K1GA 1UYQA 3TJXA 4ACZA 5FESA 4LQ1A 3EOEA 2J66A 5E0KA 4AIBA 1W31A 3P0WA 1RBAA 2GDUA 1UR9A 4IFKB 3DYOA 4AY1A 4L4LA 5H8MA 5C9WA 2WMHA 3IGUA 2OMAA 3B0YA 3W1AA 3L4VA 1ZCOA 4KF1A 1LL7A 1XWYA 2ISDA 3SCUA 1Q7QA 1X6LA 2WJDA 3IIPA 1PDZA 3LBCA 4H6EA 4FXRA 1W54A 3FKKA 2WZHA 3KRBA 2ZRYA 4M5PA 2PWVA 4LVBA 3SRHA 1GQIA 1Q8AA 5DMLA 4YYCA 1AFSA 5BW6A 5JBFA 1GVQA 3B8VA 2Y88A 5M1TA 4RL3A 2YBVA 2OZ3A 4Z0SA 1TO3A 3W9ZA 1MFVA 3ME3A 1YBQA 3EOOA 4JTEA 4QNWA 4GABA 2VR5A 3P14A 4H41A 1XCWA 1PPIA 1UKTA 3P60A 5CH9A 1N8FA 3CIWA 4X9YA 3ZOAA 5D03A 2QDEA 2DH3A 1GVOA 1AUSL 4B3ZA 3A4JA 3NQEA 3E2RA 4GQRA 1B3XA 4XQ6A 1XKYA 2NX3A 1LRQA 2X09A 3IANA 1B1YA 1WUEA 5HQLA 1JCTA 3DZ1A 4H6QA 2VCCA 3I7QA 3NO5A 3DFQA 4TTUA 2PGEA 1ZUAX 3S2MA 2GSEA 3L5AA 2QS8A 1DWHM 4DUOA 4W7WA 3WJSA 4IP7A 2DH2A 3JS3A 5CZJA 1KBIA 1EA0A 1P48A 1CENA 1XW8A 4KGJA 2AQWA 4DJDC 3UNTA 2NXHA 4C6DA 4EACA 3S42A 3V0UA 1H1YA 2YSWA 4CCZA 4H8VA 5BCAA 4ATDA 2AGKA 5IRPA 4INFA 1PXGA 4HPJA 3SM0A 1ZJHA 2KZHA 5DY3A 1S46A 3AXKA 3SUVA 3V1PA 3GXDA 3IGXA 1ZJIA 5HWMA 3B03A 1KQYA 1RLCL 2D24A 3PB0A 1XYAA 3OGSA 3MI6A 3SQMA 2A6LA 7ENLA 1U5HA 3SZ8A 1GQNA 3V4BA 2YW3A 1IGWA 1NP2A 3AU6A 1Q7MA 3WLJA 3MI3A 2WOQA 4JOMA 1Q85A 1XL9A 3S0CA 3LEPA 1XGZA 1RK5A 1TWIA 1XG3A 4O50A 4JNMA 5H1WA 3BLEA 4IGHA 3C2OA 1POKA 4RNHA 1QWKA 1I2OA 1XCFA 3ELFA 5AKQA 2DZXA 1IXPA 2O56A 4FOJA 2J8TA 2V5JA 4L9ZA 1V4YA 1M41A 3LCLA 3H55A 2IKHA 4TV6A 1YXDA 2OO0A 3E0LA 3BSHA 5F4SA 4MJMA 2GVJA 2DQWA 3LCFA 3MY9A 2FJKA 1IIHA 1R47A 1F5ZA 1VIWA 3GAKA 3PZTA 5AC5A 3EWCA 3HPXA 5C9RA 1CB7B 3UZWA 4JTHA 4GUIA 1P0KA 2QNEA 1XV8A 4IXHA 3WLOA 2CHOA 1EBGA 1JPIA 3G6MA 3UP8A 1P0EA 2BX7A 5CZKA 2HROA 2J9YA 1PYMA 1XG4A 4O52A 1C7SA 4QNEA 4H1ZA 3VXGA 1BSLA 1M7OA 2DSUA 3ZT6A 4KIEA 1EO5A 1O60A 1EJTC 3CAWA 2XVPA 5CPOA 1DYSA 1W1IE 4W84A 1Q66A 2OZ0A 3W84A 3KDOA 4PMYA 4O0ZA 4BF9A 3M4HA 3RMJA 4RCXA 4HZ6A 3QV9A 3S1XA 1DXEA 3NNTA 4O53A 3B9AA 2CLLA 5EMMA 3PZ9A 3PS7A 3S2NA 4LS2A 1G7UA 1NOFA 3CPUA 5FL0A 3V3WA 2IQDA 2PTYA 2PF0A 1T7LA 3W7GA 2VWSA 3FV9A 2BGQA 2BFGA 2G8ZA 3HJEA 3ONCA 3NFUA 2ACQA 3WLRA 2P53A 4AWEA 1KCZA 3N2BA 3G3MA 1TYGA 2FZ9A 3LY0A 3QGKC 1PL9A 1F2JA 4JFSA 2WPGA 4LYKA 1X8FA 3LCHA 4IZGA 4KFNA 1XLLA 2BG5A 3EPOA 4BF5A 1XIEA 4C1LA 4S3DA 1KR1A 4BHYA 4K7YA 4MZ8A 4KETA 2C91A 2PDQA 1PB0A 1E9IA 1K6AA 1SJDA 4LYQA 3NGFA 2QIIA 3OLDA 2JEPA 3U7BA 3FDKA 3W70A 2VX7A 4J7RA 2YFOA 3UA4A 4NJKA 2E25A 2QJMA 3ARYA 3LMYA 3WQFA 1QBBA 4V27A 5ECVA 2WC7A 4CNUA 4CNTA 1C7TA 1NF0A 2O9OA 3R12A 5FF4A 4AZ7A 2X1SA 2PF8A 3WLKX 3LBOA 1K8CA 4QFUA 1DV7A 4XUYA 1BYBA 3B4YA 1ISWA 2XSXA 1CX9A 5CEWA 2YFNA 5DT7A 3SFWA 4YTSA 3NPXA 3TYZA 4O1DA 5HMFA 4K68A 4XSMA 2DEPA 3Q65A 4L5ZA 3LCIA 3DFNA 2OLSA 4PULA 1D8WA 3VOIA 4F2TA 3G6LA 3T8LA 3QKEA 4FA3A 1A53A 3WJWA 3GH5A 1K7FA 3CK5A 4DBSA 3PBVA 4JPGA 2Z2UA 4HYRA 2OSXA 3VDCA 2PC4A 3ANYA 4QQUA 4JTDA 1WYIA 1QMLA 1NFPA 4S2BA 2J4GA 3KL0A 1LORA 3CHDA 4C7GA 5HK4A 1VH7A 2F9RA 3OJGA 3NO3A 3TW7A 3E2VA 3GC4A 4UQCA 3PN8A 1ZENA 1TJRA 5TD4A 3O6DA 4WXZA 3K8KA 1IV8A 1VJIA 5DXXA 3SCVA 3GXIA 4MLRA 1SM9A 1WKYA 4HBKA 1O5XA 5MKGB 4JDYA 2G3NA 4JFVA 1KW1A 1XRTA 1J96A 2C1IA 5LNSA 1F8IA 3NZRA 2J24A 3T07A 4NJJA 4FP1A 4A3HA 4KEUA 3UR8A 5ABEA 3R0DA 1QNOA 1QDSA 4MUZA 3RGTA 4Q8NA 1DXIA 4GZEA 2TPSA 4RDYA 3SUSA 5HPOA 3DGRA 4ROPA 2EKGA 1V7AA 2HJPA 3UU0A 4Q4QA 3BCDA 2W4XA 4S38A 4DF0A 4CU8A 3BOFA 4W86A 4H9MA 4IFOA 3QW3A 4ZSTA 3SUWA 2BGNE 4W7VA 1I2RA 1TJPA 2D23A 2BTMA 4GYJA 2I14A 4NNBA 5BWFA 4EX4A 4QAWA 4C5YA 2QZRA 3QMTA 1GOOA 4P5UA 1KC7A 4IL2A 1XFBA 2YCJA 4FX6M 5LZLA 4GBUA 3RJYA 2GJLA 3UXIA 2NUYA 4QCFA 1LF1A 4RR4A 2OU4A 3UW6A 1W17A 4PUNA 4J3WA 1JCMP 1OGGA 2C14A 1M1BA 3TFCA 1OSEA 3REQB 3TJLA 3ATZA 2JE8A 2VI0A 4UFKA 1AL7A 1CGXA 3USBA 1GYLA 2DGAA 1B3OA 4M6UA 1FOBA 3R5EA 3WMLA 5LA1A 1JXKA 3TOYA 2IQ0A 4NJGA 3L23A 3LHTA 2E68A 1FXQA 5HINA 2RJGA 1X6NA 3PULA 2P88A 1GK8A 4JTTA 4MWAA 2YCLB 4PUDA 1S2TA 3GUGA 5BZAA 1M03A 1S5WA 6XIMA 4V15A 4J3SA 3KL5A 2KX9A 1I45A 5RUBA 4D6JA 2WMKA 4AF0A 1POJA 4K8EA 3EDEA 1W1PA 5D04C 5D8ZA 5JXQA 4Q8TA 2F6UA 2C16A 4C6NA 3HMJG 2DZUA 3NA8A 1QFEA 2VCAA 3VOCA 3SY8A 3A5VA 4IUOA 3GX9A 3WCZA 3RM4A 4C60A 4GO9A 1T5AA 4QJ1A 3NQ8A 1E5NA 3BV7A 5I7GA 3IJ8A 4IG2A 1QASA 2Z1VA 2XFRA 1OT2A 3V7PA 1TTIA 1AD4A 4H9VA 1R3SA 1IEIA 3EA1A 2GUBA 1V3HA 2V2HA 2NVAA 5C2CA 2P50A 4DZIA 1JCNA 1W5OA 3ZJKA 1VP5A 3S5SA 4QROA 4K7VA 4FB7A 4KRUA 3Q2DA 2E77A 4HD5A 2P8CA 3SIMA 2ZZ6A 3EXSA 3AISA 2Y0FA 3M6DA 3WLPA 3CLMA 4LT9A 3IVTA 3T0TA 3R7MA 1MRAA 1ME7A 4C7FA 3APYA 2DZTA 3K1DA 3W87A 3KW3A 3OZOA 3P5ZA 4B9YA 4P8VA 3T7VA 1NF7A 1NSJA 5EB8A 2V30A 5BU9A 4LWWA 2JGQA 3VC5A 3P67A 3R8HA 3AHTA 3NQBA 3NVDA 1JCXA 3N1AA 3QEZA 1M53A 4Z0JA 4AD0A 1XIMA 5HNUA 1ZY9A 2E6YA 5CBJA 2INEA 2WNWA 3GQYA 3A4XA 2QIWA 3A3XA 5G5IA 1HKJA 1MXGA 4QE5A 2PS2A 1OF6A 2CXEA 1RPXA 2A0NA 1JIBA 4Q8VA 4EKJA 5A6TC 3WFZA 3SCTA 1QW7A 3ZIZA 1V3KA 5FF2A 2VEPA 4M56A 3ARVA 1KM5A 3PPFA 3GFXA 1OG0A 4UXDA 4DBDA 3N19B 1DQUA 3U2OA 2GOUA 4P7RA 4CLMA 3RLGA 3DU0A 2XZ7A 5FKYA 4OJYA 5JIPA 5LIWX 1NH6A 1Y8BA 2QJJA 3WEOA 3U4FA 3LCXA 1NQKA 2FB2A 2WNQA 4PMOA 2CU0A 3EDFA 1HJWA 3EDDA 3KBJA 3HO8A 4L6OA 4UFLA 1JDEA 3W0KA 3W2UA 4JTIA 1GJPA 4GGBA 1HUVA 1PTDA 3MP5A 1LBLA 3CMGA 5HDRA 2UBPC 3LGGA 1OCNA 3VIKA 1V0KA 3RCYA 3MMDA 3O07A 1BGGA 4I9JA 1YDVA 1MEWA 5AYBA 4H2CA 2XM2A 2Y2WA 4ZQOA 4UTHA 1JUEA 3QPEA 1FWBC 1MEHA 3CO8A 2Z1WA 5C2XA 1KV8A 2PDNA 1W3JA 3M07A 2VDGA 2WLZA 3NGJA 4MNMA 4NAEB 4N7QA 2VGBA 1A5MC 4MJZA 3GD6A 3G1VA 3TTSA 2WNNA 5A95A 4D6FA 1LQ0A 3WN6A 1ISVA 4IPLA 1BVNP 1E6QM 3TR2A 4MPQA 4UCGA 4C6QA 3WEZA 4GC4A 1TVNA 2OWCA 3MPGA 5U7SA 5HMEA 1OVDA 1J5SA 5B7ZA 3OIXA 3QMRA 2J9XA 2F6KA 1DL3A 8A3HA 3EPNA 4LVFA 4PBEA 4B16A 2BY2A 1SU5A 4LUJA 4O4VA 2PP0A 1UKOA 2V5DA 3Q45A 3VU2A 3VYLA 4UC5A 4Z1AA 3BW2A 1J10A 3FJ6A 2VL4A 3FSUA 5CG7A 3TXZA 3EAUA 3VKKA 1LLOA 1VBGA 2FB3A 1RCQA 3RPDA 3GHTA 5A8NA 4M1BA 2POZA 2WZMA 1ITCA 1NVMA 2VEFA 3LMZA 4WDTA 4AFYA 1O5RA 4US5A 4KWVA 2XIMA 2NUXA 1PVNA 3W6MA 1IZCA 5JMUA 3QV7A 3CNYA 4PBFA 1DHKA 2YB1A 4DEFA 3IEBA 2R1PA 1R2RA 3BLPX 3H4XA 2DVXA 1E0WA 2GJXB 3W71A 3LM7A 4S1FA 3N13A 4REQA 3VDGA 3KBWA 4Q7NA 4W89A 3TP4A 4PSPA 1OFDA 3VILA 4H00A 2G3JA 3GB6A 1YDNA 2C15A 2DZWA 4U4MA 3TZFA 3AIVA 3WDRA 3UY8A 3HIJA 3OVPA 1B31A 1QO5A 1HGWA 1E9LA 1KFCA 5GPRA 4IUGA 9XIMA 2WWCA 2J7FA 3C4UA 2WC3A 4LUTB 3BLIA 4AHOA 3VPLA 3RU8X 1E72M 1Z8AA 1EDTA 2INFA 5JH1A 1IEXA 1JCLA 4PC8A 1FP9A 1QRQA 4CUCA 4JD4A 2XJ7A 5MKGA 4CQAA 2WXDM 4WKHA 4G5DA 2E3ZA 2XWDA 4DI8A 1WO2A 5BOEA 1WDQA 3U7VA 5JQ9A 3HQNA 5CG0A 3DCPA 3LNPA 3FOKA 3QV6A 1NOUA 2VENA 2Y24A 1HG3A 2ZICA 5LHFA 4XX6A 3PUOA 2HS8A 3II1A 1RBLA 4WF7A 4ZSUA 5G2WA 3UWEA 3RK8A 3E0IA 4FI4A 4LS0A 2D2HA 3K46A 4ZEPA 4UWMA 3R43A 2VHLA 4ZOEA 3N6HA 1RZMA 2C1GA 3SJNA 1CW2A 4DN1A 3W86A 5AYYA 4MMWA 4S23A 4KMQA 1OK4A 1SUXA 2XFWA 3HB9A 1A5CA 1G4SA 2H9AA 3N18A 2X1RA 2R1KA 3S5ZA 2Y5JA 2Y8KA 3EB4A 3VNZA 5AZ0A 3NQDA 2TAAA 3QLLA 4KCUA 1JYXA 1SFSA 1JVNA 3GTNA 3QYSA 4B5TA 3MCNA 1BEUA 5DRIA 4S3EA 1EH9A 2IS7A 4MM1A 4TOQA 5AHMA 5GJPA 4ES4A 4YTUA 1E1FA 1TA3B 1DJIA 3NQ2A 1ML1A 3GXTA 1CGUA 3EWXA 3UPBA 1EP3A 1PKLA 3K8MA 6ALDA 3REQA 3CO4A 1XS2A 1PUDA 2J88A 1BWLA 1ONRA 1K03A 1MWOA 3N9SA 1EPVA 3ARRA 3R1ZA 3MQTA 5CC6A 3BURA 2AGTA 4W8BA 2NUWA 2A21A 2WMIA 1CBGA 3VMPA 4G7EB 3MDWA 4HPHA 1KBKA 1OADA 2F7FA 2VRQA 4LCSA 2FDSA 4D1JA 4GBDA 3OZMA 1J0ZA 3MKKA 3S47A 2OVLA 1V51A 1KM3A 2X1UA 5EU9A 3SECA 5FAGA 4UTFA 4Q8UA 5E0FA 2YLLA 3E9AA 2IKIA 2WCAA 3JRKA 3GVVA 4N4PA 1ZSXA 4DJFA 3URAA 2DJXA 3OPSA 3VGGA 4O1BA 2GL5A 3NDZA 2V3DA 2CBIA 3M7WA 2GGIA 5C54A 5E70A 4XO7A 4H19A 1B4EA 3Q37A 4R7JA 3DBNA 4C6MA 4X0NA 2I1OA 5I09A 5AC8A 2IW0A 1T96A 2OLHA 5F1UA 4O54A 3I4EA 4JBRA 3WNNA 1VPQA 3B9OA 4LAOA 3K30A 1OFOA 2EKCA 3KEHA 4H9XA 1GKPA 4N9DA 4AB4A 5L6UA 4ZVJA 5F7UA 1JPHA 3EOSA 3GH4A 3MWAA 1TE6A 1A50A 4C6JA 4DJEC 3VGDA 2D3NA 1JQVA 3EWYA 3C2FA 4AIEA 3W82A 4DELA 2WYSA 3N73A 4IMCA 1EJXC 3PPCA 3NDOA 3P7YA 1RJRA 3PJTA 3MYOA 2PGFA 1FDYA 3MA8A 3FSTA 3BG3A 1F07A 4QDPA 3BLLA 3MUXA 1VRDA 1U1UA 3BAJA 3G18A 4MNKA 3HN3A 4XO6A 3GO2A 3S3GA 3SR7A 1J9YA 3BTNA 1J8VA 4GKTA 4IIGA 1EEXA 4MKNA 5ECUA 3FYYA 1DORA 3HQPA 1V6VA 4CNPA 3LRMA 4HNOA 1W9UA 3CZGA 3T9PA 3MVTA 3W2MA 4LVAA 2QAPA 1ZQ5A 2QDHA 4NRRA 2RAGA 2FHBA 1TTJA 2YX0A 3QH2A 5BOOA 2VX5A 4JX5A 1GCYA 4AXKA 3LUTA 2E40A 5EMLA 2CLEA 1QO2A 4JHMA 1TG7A 3VVGA 3ZVHA 1GZGA 1EEPA 4RDZA 4HK5A 3LERA 3BAXA 4LVGA 2P10A 2C13A 1Q5MA 3ITOA 3B3DA 1MI3A 5CC7A 5B7YA 1SR0A 5JBEA 2Q02A 3EGJA 4IQDA 4PYSA 3GNNA 3NSNA 2J7HA 4HPGA 3LCWA 1PJ9A 3IIZA 3N6QA 3T08A 4K6AA 1BAGA 1QATA 1EOMA 4E8CA 1P1XA 2AQVA 3WNLA 2R8WA 4B3KA 1UG6A 3AMKA 3BQ5A 1JYWA 3W01A 4F40A 1DPMA 2TYSA 2WKJA 4JR5A 3ZMRA 3P80A 1VB9A 3L4WA 1UWAA 3VGFA 4Z2LA 3F4DA 1ZP3A 4A3RA 2PDXA 3KHDA 1ZJBA 3GU1A 3UG3A 4YTTA 4HPXA 3MCMA 7A3HA 1ONXA 1FWNA 1LT8A 3R8GA 1M9HA 4ZO6A 2Y8UA 1EYWA 4JICA 1KKRA 2VUNA 1TA3A 4EXBA 3WLIA 4ZQRA 1EDGA 3QOKA 4ZENA 1LLWA 2EJ1A 4N6EA 2QQ6A 2D0HA 1QI3A 3S6TA 5A8PA 1EWDA 3BG5A 2QCEA 2VR4A 2Z27A 3UZJA 3CAQA 2JKEA 4XZMX 1ONEA 3CL7A 2WHKA 5CPLA 4XG1A 3RNDA 3V1HA 1SW3A 1GVRA 5D02A 3MVIA 3VX0A 3STFA 3KOXA 1VENA 3GDKA 3UETA 2QXWA 3PJUA 4MUPA 1UR3M 4TX9A 4WK9A 2WHMA 4QIUA 4LRTA 3OLIA 5IFPA 1NQ6A 3A4AA 3H4GA 3QZ6A 1RCXB 3OVRA 1FH8A 5IBXC 1TZZA 4PMDA 1CLVA 3QKZA 1FWGC 4NI3A 3S5NA 4TVCA 1Z32X 2XZ9A 3VNMA 2R91A 1J2WA 2NW0A 1M65A 5DANA 2YDRA 3ITXA 3SN4A 5DF0A 3N34A 3VUSA 3VCNA 4CD7A 3W85A 1IWPA 3FGCA 4M8UA 2HVOA 3NDYA 1OHLA 2E6FA 1J6PA 3LK6A 3OW1A 3H21A 1XP3A 3OHIA 3W7IA 4N9CA 2NT1A 4XIAA 1HJXA 5DMNA 4IX2A 3URBA 3EWBX 3AHYA 3FJNA 4AZIA 1KFWA 4RXGA 4OOUA 1D9EA 2QAFA 1H61A 3EB2A 4ZFCA 4Z1YA 1UOZA 2B0MA 4AAJA 4XZ9A 4J3UA 4D6GA 1UH4A 1FBAA 3CL8A 2P8BA 4IGNA 1ODZA 1V02E 2DZVA 1A5OC 1UROA 1TTQA 3QY8A 4QAIA 4OBTA 3WH9A 1K4GA 1JUBA 3RR4A 1AMKA 5CSYA 2YZRA 3HGJA 3G2GA 3UWYA 4BI6A 4DF1A 4F0SA 3VNDA 1W0MA 3WD0A 1BG4A 3ZVIA 2CLKA 2YCIX 1QNVA 2OYLA 3KS6A 2OKOA 5FJOA 4I7VA 5DY2A 3ZLHA 1L2UA 5FCZA 5LNRA 3VNIA 1JZ3A 4OBSA 2Y85A 4AMAA 1ZP4A 4FNTA 1B2YA 3CV6A 2WK2A 3DFTA 4AW7A 1P1MA 1FHUA 2P0OA 3V75A 3O63A 3ICJA 2A3HA 1QOPA 1FWRA 1R2TA 1UWTA 4HCLA 1K1DA 1BPLB 1W8GA 3GTHA 1UB3A 3CS2A 2YYTA 4GC3A 1EJWC 3ZYZA 5SWUA 3W1NA 3L2MA 1EGMA 1LOLA 2XSAA 1JDDA 1M04A 3FX4A 3N14A 1C29A 2WJEA 1TR9A 5AFDA 2OGJA 3WX7A 4AX7A 1TREA 4WCJA 3BO9A 4GI8A 2WMFA 1O4UA 3RJXA 3BC9A 4BR1A 3DXIA 5BXTA 2BY3A 2X0HA 2WSKA 2GJRA 4DYEA 1SSDA 4JN8A 5G1YA 3NQVA 2Y7GA 3AICA 3FXGA 3A9BA 3WDPP 1JPDX 4HNCA 2V3EA 3UR2A 1HXJA 3GG7A 1AQ0A 1TPVA 2C79A 2JKAA 3CYJA 5I3KA 2ZRXA 5F4WA 4AZCB 1BTCA 3STCA 4HP5A 4EPBC 3MV01 1HL9A 3M43A 3C2VA 4YTRA 4QE1A 3L0NA 3EWDA 4F48A 4JYDA 1ICPA 4WDXA 2RH9A 5CSRA 4H7ZA 3PF3A 3DFSA 4Q32A 2EO7A 4XTDA 1H50A 3D46A 4YMZA 3KVLA 3AZTA 4GJJA 3LA4A 3B8UA 4UUIA 2DORA 3S1WA 1RQHA 1R9ZA 3A23A 3FEMA 3B9NA 3M0LA 4UTTA 3W7CA 2OEKA 2RJHA 1HKVA 2ESCA 3CMJA 3TNOA 4LRSA 1WE5A 1HKIA 2VXNA 1KFEA 3W73A 2FGZA 4IIFA 5I3FA 3Q58A 1CXEA 3QHMA 3EWZA 3RPMA 2X7VA 3Q4DA 2W6RA 1SFJA 1UH2A 2GWGA 1TPB1 1TKKA 3KBNA 4C6LA 1YRRA 1H63A 1V93A 1E1EA 3A47A 2F6XA 2OSWA 1W1B1 2DUXA 1VJZA 1XLBA 5FA5A 3AMCA 4KGLA 2P0IA 1Q3NA 3CZEA 1MW0A 1NOWA 4XZBA 1HO1A 1TJ2A 1KXHA 2YL9A 3BANA 4O1CA 3CV1A 1H7PA 4IWWA 1W91A 4DXKA 2E1WA 5A1AA 4B5XA 4E2DA 1O68A 3LN3A 1JCYA 5DO8A 3SIZA 4NT0A 3ZZ1A 4GY0A 3GDTA 1EFZA 1DIOA 3K5XA 5E6YA 4AXNA 1ALDA 3I3DA 2BVWA 2ZZ2A 4WX2A 5CZSA 4PEKA 4UTTC 3W24A 2BLEA 4E5TA 3GWQA 3J7HA 1IYXA 2VX6A 2XN0A 2A3EA 4UR8A 2CC0A 7PTDA 4ERAA 1LTDA 4NXKA 3BQ6A 3DG7A 1ITXA 2QEZA 1F61A 5C9XA 3CZJA 1VJSA 4MTVA 2IMRA 3WUBA 2HEJA 2Z1SA 3BXWA 5BXPA 1XIFA 4JHZA 1AMYA 2VJXA 5T9CE 4AVNA 1OGSA 2GVYA 3WIJA 4DNHA 2FH8A 4EAYA 2F8QA 2GLKA 4IFRA 4TVUA 5E9XA 1SMDA 3ITVA 1Q6CA 4GZJA 4X3ZA 3VGEA 3ITLA 2ZX6A 2W79A 2ANUA 3RN6A 3BPWA 4BS0A 3AWNA 5C8BB 3NSMA 4PE8A 4S39A 4BCEA 1GKQA 3T05A 4AYGA 2PSNA 4B91A 3QF0A 1PE1A 5A6MA 2X2YA 1KV5A 4WDWA 4X2RA 4FF7A 4G1NA 3BZGA 4IM4A 1G9HA 1EIXA 3SAZA 2JKPA 2D69A 2FVLA 1ME9A 1Q4NX 1PS9A 3CJPA 4FNRA 3W4RA 4LYRA 4Y8FA 3VOHA 1KLZA 4GJ1A 4GQ0A 5G1TA 2OWXA 1OD0A 1TV3A 3C52A 1R46A 2R94A 3PWGA 1WAWA 4A35A 4DIAA 3HPAA 4CN1A 3OHMB 3S9YA 2QCDA 2HK0A 1E0VA 3L4UA 5LNUA 3G1FA 3MO7A 3AXHA 1W1ZA 5HQEA 3VTRA 4IJBA 4ZTXA 4YS1A 4JKKA 1WAUA 2C3ZA 2VFFA 3GVGA 1RUSA 2WO5A 3AIEA 3S1VA 3RFAA 2FZDA 2YPIA 2HXUA 4CQ9A 3W38A 4G9PA 2X1IA 1F3EA 3ZM8A 2XH4A 3FJ4A 3TW6A 3BLFA 3BCFA 4KESA 3VOJA 3N9KA 2HRWA 4XVEA 1C8VA 3WNOA 5CC3A 3C61A 3T2QA 4MB3A 1JYNA 3TTQA 3PG9A 4CQBA 1RSCA 1XYFA 1OABA 3WMBA 2Y89A 1ICQA 4HMNA 2GPTA 1KXQA 1JI1A 4A4AA 4AC1X 2CZDA 2R9RA 2Z1BA 3L67A 3BICA 2ZXDA 1YE6A 3XISA 4UMCA 1KM0A 3TX9A 3NJ3A 3AUOA 4GXWA 4FIRA 2V38A 2QPUA 3GUWA 1VPXA 3QPZA 1B3WA 4H01A 1TQXA 1IR1A 4Y96A 3U9IA 3VINA 2B7NA 4R34A 4JTRA 4W88A 3UXKA 3WD1A 5EGRA 3GU9A 4J27A 4XTIA 5REQB 4LGXA 3BH4A 7TIMA 3PHAA 3MMWA 5DRCA 1US2A 3EA3A 3BSGA 4X63A 3GTFA 2VEIA