1W2PA

The 3-dimensional structure of a xylanase (xyn10a) from cellvibrio japonicus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
346
structure length
346
Chain Sequence
b'GLASLADFPIGVAVAASGGNADIFTSSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQTVHGHALVWHPSYQLPNWASDSNANFRQDFARHIDTVAAHFAGQVKSWDVVNEALFDSADDPDGRGSANGYRQSVFYRQFGGPEYIDEAFRRARAADPTAELYYNDFNTEENGAKTTALVNLVQRLLNNGVPIDGVGFQMHVMNDYPSIANIRQAMQKIVALSPTLKIKITELDVRLNNPYDGNSSNDYTNRNDCAVSCAGLDRQKARYKEIVQAYLEVVPPGRRGGITVWGIADPDSWLYTHQNLPDWPLLFNDNLQPKPAYQGVVEALSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A PRECURSOR
molecule tags Hydrolase
source organism Cellvibrio japonicus
publication title The Use of Forced Protein Evolution to Investigate and Improve Stability of Family 10 Xylanases: The Production of Ca2+-Independent Stable Xylanases
pubmed doi rcsb
total genus 132
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1w2pA00
5KZ6A 2WVVA 5CZKA 2J7DA 1UR2A 4M8UA 4NRSA 4B9YA 5LA1A 3UETA 2J7FA 4NZCA 3IJ9A 3OLGA 4W87A 4H04A 1EGZA 3BAXA 5A6BA 5F7UA 1CLXA 4CCDA 4F66A 1HN1A 1W9VA 2WB5A 5GPRA 5CLTA 3EBVA 3ZT7A 3BGAA 3GDBA 1E6PA 3SCQA 4XZWA 7TAAA 4W5UA 4AZGA 1DTUA 2DDXA 4WIWA 5A8OA 1BSIA 3W26A 4TX8A 2VJXA 1XSIA 2ZOXA 1VFUA 1XH1A 5JIWA 4JFVA 1V0MA 3GNOA 4PTMA 1E9LA 4DWSD 4D6DA 4UOJA 3VVGA 1E56A 4IISA 2VR5A 5HXMA 1G9HA 3MV01 3WDRA 3WF2A 1JYNA 1ZL1A 3ZT5A 1B90A 1QOXA 2Y4SA 4UQDA 1EO5A 3OLEA 2JALA 1TE1A 3WKZA 4AWEA 1W9DM 3VM5A 3ECQA 4B3LA 4DUWA 2A3CA 4CKQA 1CDGA 2J4GA 2O9RA 3A3HA 4IM4A 1VEMA 2J75A 1UHVA 1GZJA 3BAWA 2VZTA 1FHDA 3OGRA 1QBAA 1E4MM 1HKMA 2CCRA 2PC8A 1V6XA 1BTCA 2B31A 3HU7A 1WB0A 2JIWA 3VGBA 5AY7A 3PZIA 3WIJA 3N17A 1V6VA 1K9FA 1E6RA 1UD4A 3VNZA 3CTTA 3VKKA 1ISYA 4MADA 3UG4A 3ZJ7A 1GOOA 4FLSA 1CXLA 1IZJA 2YBTA 1E5NA 1CNVA 4TVDA 2CEQA 3VGHA 2E8YA 2BHZA 4PMUA 3ZSTA 3VX0A 3VD7A 2C0HA 4WKAA 1VJSA 2Y2WA 4AZHA 4F8XA 3UESA 1HJQA 2EPOA 5EBAA 3N18A 2YLAA 2BVYA 1U30A 2EXOA 3ALGA 2J7CA 1LWJA 5CPSA 4AD2A 4WLCA 2F8QA 1OM0A 5BXSA 3O2LA 5A8NA 1MQPA 4PMDA 2BNJA 2D1ZA 2ZXAA 4UTFA 3NUKA 2V3DA 3RCNA 2YDRA 5CJ5A 3LPPA 1Q6EA 1FH7A 2D24A 3VGEA 3CHEA 4MPKA 2FHBA 2OYLA 1XHGA 4MB3A 1QPKA 1V08A 1GOWA 2G3JA 3AMGA 4AYSA 1G01A 1JZ5A 4DWSB 1PZ2A 1QNRA 4XX6A 1UOKA 1EIBA 1KR0A 4UQCA 1LG2A 3WQVA 5A2BA 4AXNA 2BY1A 4W7UA 1UZ4A 2WVUA 1AQHA 2G3MA 2NT0A 1BG4A 1W9BM 3W6LA 1W9UA 4EANA 1H49A 1QW9A 4PMOA 4XV0A 1NWUA 1CZ1A 5CPQA 4UCFA 2CHOA 4GI6A 3CUIA 1CXHA 3WUGA 2NW0A 4ATDA 2HVMA 1VF8A 4OJYA 2YJQA 4WSKA 1WCGA 3K4DA 4UFMA 1V02E 1E43A 1XGZA 4E2OA 1UWRA 2J7HA 1GJWA 4JCLA 2GFTA 3AJ7A 1ODUA 2OWXA 3AYRA 3K4AA 3MMWA 2PBGA 2WBGA 1O7AA 2YOCA 3OG2A 3L4TA 1DHKA 3FXYA 4HOZA 4UZSA 1RH9A 1TFVA 4LPCA 1QI4A 6TAAA 4RL3A 1J0IA 4Q22A 1GONA 2XFRA 1R85A 3WNMA 2ZWYA 4ACZA 2GVYA 1LWHA 2W61A 1W3JA 4PBGA 3M46A 1UR1A 4J28A 1D2KA 2DT1A 1VFOA 2PWGA 3K8KA 1GQIA 2WPGA 1UQZA 4BS0A 2ZE0A 3SUVA 3MUZ1 2WCGA 3CPUA 2J7EA 2GK1B 1WZKA 1F4HA 2Y8KA 5E6ZA 2X2YA 5I78A 1J10A 5I2UA 3WMCA 2XIBA 3VO0A 2IXUA 2G3NA 1Q4NX 4HPGA 1ISZA 1DWJM 4CGTA 3VU2A 1CGTA 1M03A 1CGXA 1KBBA 3EMCA 3BCFA 2XSBA 4R27A 4AW7A 1M04A 3GH7A 3ZIZA 4FK9A 1ISWA 2EEXA 1NOUA 5A8PA 4PYSA 4ATLA 1FP9A 5EB8A 1BF2A 4OKDA 2CETA 3GXMA 5HDRA 1I1XA 1GQLA 2BS9A 3MANA 1JD9A 4PMNA 1Y7VA 2XWDA 3IJ7A 4GINA 3WH9A 4CU7A 4J3SA 5FOOA 1PIGA 4PMXA 1CLVA 4L4PA 3HN3A 1VBUA 3W25A 5EFDA 8CGTA 4F79A 2V3GA 3BH4A 3B8SA 1UA7A 2YL8A 1FFRA 5BWFA 1UD3A 5I77A 3CMJA 5FKYA 5BXPA 1MYRA 1D3CA 5CXPA 2ZX5A 2A3HA 5GNXA 3VUPA 1TVNA 3EDKA 2CESA 5BYWA 4U2ZA 4OIFA 2XJ7A 3G6LA 2WVTA 4NRRA 1UQYA 1OT2A 2X8RA 2VX7A 1AVAA 1VIWA 1UKPA 2GSJA 5M5DA 1RD6A 1E73M 4EKJA 4QLLA 1X6LA 1MXGA 3BMWA 1GPFA 1SMAA 3A4AA 2ZICA 1V3JA 1P6WA 1BLIA 1L8NA 1H0GA 1TA3B 1V3IA 2VZOA 4GO9A 1HT6A 1K9TA 1GCYA 4JFTA 4CVWA 2DT0A 4MB5A 1Q6DA 1G5AA 3CO4A 1KB3A 2VRJA 1G0CA 4W5ZA 1V0KA 1HJXA 4CN4A 4P8XA 2MANA 4V27A 1WAWA 3FNDA 3HMCA 3VGDA 3ARRA 4PSPA 2J77A 2ESCA 2J62A 3UG5A 2VOTA 4GIAA 4HPHA 1VEOA 8A3HA 1UG6A 4YHEA 1CECA 1XSKA 4H41A 1LL6A 1BGGA 3AHYA 4QFUA 1I75A 3VIMA 1JZ3A 3W4RA 1JGIA 3SCTA 3WUBA 1ZB5A 2OLHA 2O9TA 3WQ5A 3N9KA 4ACZB 1RP9A 1KR1A 2WXDM 2VC9A 3AMLA 3QOKA 3WDPP 2WBKA 2WCSA 5JBEA 1J0YA 4BQ5A 5D9NA 5A8MA 1WPCA 1JNDA 4TTGA 2E0PA 4F9JA 3ARXA 4CCCA 3MKKA 4JFUA 4UQAA 4CN6A 1W2PA 2WHJA 2WMGA 4CD8A 1J0JA 5AYIA 5D9OA 1BQCA 3VDAA 3T2QA 4Z2LA 1RP8A 1BG9A 1JFHA 2ZUMA 3DYPA 4PUDA 1UKQA 1W9PA 1XYZA 1K6AA 4H2CA 4U3AA 1TUXA 3HJEA 4TXEA 1B3ZA 4W86A 2UY2A 1IV8A 3AHZA 1W1TA 4FF5A 5CG0A 3CHDA 1HJWA 3WD2A 3L4ZA 1HVXA 2A3AA 1OSEA 3WF0A 3OGVA 2G41A 3EDDA 5TD4A 1EH9A 3WEOA 4HZ7A 1XH0A 2ZWZA 4MNLA 3VILA 3W82A 4E8CA 2E9LA 2XM1A 1KXQA 3II1A 2ZUNA 2CERA 3BCDA 3POHA 2XHYA 4QLJA 2YKKA 1CBGA 3CLWA 4HOWA 2UY3A 3RIKA 5A6KA 2AMGA 3CZKA 3PHAA 6CGTA 3ALFA 3WBAA 3WEMA 4D6HA 1QVBA 1WDSA 4D6JA 4M1RA 2CNCA 2CKSA 2WZEA 3VGGA 1ODZA 2VRQA 2E4TA 3CUHA 4U33A 3VD5A 2JF7A 1XCXA 3WF4A 1JXJA 1CGWA 1W3LA 3WNOA 4P7NA 4BCEA 1B1YA 3GNPA 2G8ZA 4B16A 3ARZA 1QHPA 4DM1A 2ZXBA 2VI0A 4D6EA 1NARA 3W38A 2EPMX 3CZLA 5M03A 3ZJ6A 2BVDA 4M24A 1JZ8A 1XRVA 1DWGM 2XWEA 4UOZA 1OINA 4YPJA 3VIFA 2VMFA 3WDHA 4ZXLA 4S3KA 2Z1SA 1IT0A 3VIOA 1JFXA 5D4YA 1UH2A 1ECEA 3B9EA 4M56A 2DSKA 3CZJA 2OWWA 4GZEA 2YDSA 3WDIA 1JZ7A 2O9PA 5C71A 2RGMA 2JIEA 3POCA 3WD3A 2ZIDA 5I79A 1W2VA 3LPGA 1XC6A 2W92A 2V38A 3SCWA 1JDCA 1GVYA 3WNNA 4AMCA 1DEDA 4F9DA 4PMYA 2WMIA 3AQUA 5D9MA 1H2JA 2IUZA 4OZOA 4QP0A 1HXJA 5I23A 2XUCA 4UFLA 1HVQA 1KXVA 1DWFM 1C90A 4PEEA 2EPNA 3AIQA 2D0FA 1JI2A 2EJ1A 1XCWA 4MAVA 4JFSA 1PIFA 3GBEA 2CXGA 4P8VA 3CZGA 1OBAA 3F5LA 4QAWA 1PAMA 3FHAA 3VMOA 4W8AA 1QI0A 5KEZA 2AOSA 3CHCA 4X9YA 5I0DA 3WQ4A 5A3HA 4D6CA 4P7OA 3BLKA 4GZJA 2XVNA 3NSNA 4A3HA 2D0GA 4DWSC 1US3A 3MMUA 1TG7A 1UZ1A 4D6FA 3GXIA 4HA3A 4NF7A 2W63A 3N15A 4HOXA 4UNIA 1W9XA 1E70M 2X1IA 2JEQA 4JKLA 3TA9A 2HISA 2Y24A 3OZOA 5CPTA 3KL5A 3DYMA 3NJ3A 2WVVB 4KGLA 2WSKA 4CD5A 3QHMA 1NM9A 3PZGA 2XVGA 2IXVA 1CIUA 2ZUWA 1MW0A 3CUFA 4CUCA 2V5DA 3AIVA 2CIPA 4P8UA 1LQ0A 2FH6A 1HX0A 1V0NA 4QCFA 1PX4A 3ZR5A 2CBUA 3VIGA 1KQZA 2DSWA 2ZUTA 3FAWA 4LYPA 4AD4A 3WUEA 2WC4A 4PMQA 1V6UA 1NOFA 4HU8A 1V3KA 5JUVA 2CKRA 2ZX9A 2YL5A 4FLQA 1B30A 2EPLX 1I1WA 3RJYA 1DWAM 2FH8A 1JYWA 1C3FA 2TAAA 4S3JA 2WZIA 5A8QA 2UY5A 3PZUA 4QDMA 4IPLA 1O6IA 4TTUA 4BF7A 2PWFA 2WAGA 2WANA 3E1F1 4PCSA 2WMKA 1C7SA 3WH5A 3GXDA 2QV4A 3VDHA 4NSBA 2PF0A 3ARWA 4BQ3A 2ZXQA 1HKJA 3B9AA 1FHLA 3N1AA 2C8NA 1Q6GA 4P7QA 4J3XA 2OWCA 2RGLA 3O6AA 2YA0A 3U7VA 2WC7A 1R87A 3LPFA 3TTYA 3ZSSA 3AXIA 1HJVA 3WF3A 4M29A 1C8YA 2A3BA 2X0YA 1PEZA 5HBFA 4OUEA 5A69A 4AEEA 4MNMA 5A6LA 2D2OA 4AZCA 1JZ2A 2W5FA 1UWIA 1Q6FA 4UFJA 1QNOA 1OGSA 4W8LA 2V3EA 2JFEX 4PMRA 3WL0A 4D71A 1J11A 3D3AA 4U31A 1S46A 4MB1A 4JZ5A 3PZMA 4OOUA 4KGJA 1GNXA 1SMDA 3AMDA 4W84A 3KL3A 3AIEA 4W88A 2YIHA 3AHXA 3VIJA 2D23A 3GYCA 3T0BA 2XFYA 2PWHA 3RM9A 4Z2JA 3AOFA 5BRQA 3WNLA 5HPOA 4Z2GA 4DM2A 3DHUA 3PZVA 2G4FA 1E4NA 1AMYA 1LF1A 4W7WA 1CGYA 1BHGA 2X0HA 3WD1A 1E6SM 1GW1A 2QMKA 3BC9A 4J3UA 2VX5A 5FL1A 1E6ZA 5FIPA 1KGXA 3IANA 3RMEA 3WENA 1MWOA 3SEPA 4ZE5A 1GOMA 2DH3A 3KEHA 4U3CA 4V28A 3UR8A 4LX4A 2DPEA 1E71M 3AXXA 1GORA 5E70A 2XFFA 1JXKA 5A2AA 5ECUA 1UR8A 4UR9A 1GHSA 1F4AA 3SUSA 4AIUA 3AHTA 1OCQA 3NSMA 4GQQA 2F61A 3AISA 4CU6A 2W67A 4AZ6A 1HKKA 3VIKA 2VL4A 3THDA 4CD6A 5A6SA 1GHRA 1ITXA 3FW6A 3AS2A 5AYBA 3UG3A 4P8WA 5A6AA 4A3YA 3RPMA 2ZX6A 4JKKA 4LYRA 1CPUA 3W27A 1OGBA 2VX6A 2YLLA 3NDZA 3WF1A 3CMGA 3AZRA 5CSYA 1DWIM 3W81A 2J47A 2XG9A 1TCMA 2J78A 5BRPA 4ML4A 1V3HA 3VOCA 1DP0A 4MAZA 3VM7A 1ZBCA 5DEZA 3MUAA 4MDOA 1R7AA 3CZEA 4GI8A 4AY1A 1ISVA 1JYVA 3CH9A 2WHLA 1JNEA 1XD1A 2Y8VA 1GOKA 1PJ9A 3QHNA 1HP4A 3RDKA 4KWUA 3ARSA 3BSGA 3BAYA 4W93A 2FHCA 1XSJA 4PSRA 3PBGA 2PI6A 3OLIA 4A4AA 4HA4A 2WMHA 1HL9A 1E72M 1MXDA 1CGUA 1VFFA 4EK7A 4E4PA 3IAQA 4N0RA 3ZQ9A 1DWHM 1ZJAA 5DF0A 3EMQA 3CUJA 1NH6A 3MMDA 4J3TA 4R5EA 1ZS2A 4E8DA 3WH7A 3WQ6A 2J8FA 3AZTA 1CENA 4B15A 1WO2A 3IAPA 3KL0A 2YBUA 3MS8A 2DSZA 4TVUA 5CGMA 4AD3A 2XGIA 1BYBA 3VINA 3N13A 2VCCA 1FP8A 1IZKA 3SCPA 1JZ4A 1EA9C 2J8GA 5EFFA 1E15A 1KFWA 5CQ1A 4HMEA 3GXFA 2YL6A 4FMVA 4JHZA 4CD4A 4MTVA 5JIPA 1CGVA 1WNOA 5M3WA 1JDAA 2PWEA 4W7VA 4HA1A 3S6TA 3ZJ8A 3DC0A 3WEZA 1FH9A 5D8ZA 4AD5A 1ITCA 3VD9A 1H1NA 1UWTA 1UH4A 2AAAA 4WKHA 4PUEA 2PB1A 2DEPA 3WMSA 1SYTA 1XH2A 2A3EA 4X0NA 4FLRA 9CGTA 3QGVA 3WMBA 3A4XA 5CSUA 1V3MA 4PCTA 3CGTA 5GNZA 3ARPA 3W0KA 5DMYA 4J3VA 4AZ5A 4C7GA 2GDUA 1W1PA 2CITA 3PN8A 3T0AA 3A47A 3CUGA 4QLKA 5EMYA 3AMKA 3BAJA 3VGFA 1H5VA 3PTKA 1ZU8A 3SURA 3EDFA 3WSUA 3CBWA 2ZX7A 2JF6A 3BLPX 1J12A 3CZ8A 1PX8A 4N42A 1H41A 4JFWA 3WFLA 3M07A 1HJSA 1EDQA 3VD4A 1UD6A 4MJ2A 1E55A 2ZXDA 3EYPA 2Y5EA 4D72A 3NSXA 3AICA 3U5UA 1B31A 3NDYA 3MSDA 2WVSA 3AIBA 3M7SA 2VZVA 2XGBA 1B3VA 3CIVA 3PZTA 1AQ0A 5ABHA 5ABFA 4JAWA 1XV8A 2XYLA 1BPLB 4KH2A 3OA5A 5IFPA 3VNYA 1E5JA 2ZUVA 4YHGA 4AZBA 3TOPA 1JAKA 1JD7A 4GI9A 4H8HA 3AS1A 3BAKA 1YHTA 1PX3A 1V03A 5DT5A 2ZUSA 3VX1A 4PMZA 4GZIA 4JIEA 3RM4A 4U5KA 5BROA 5IFTA 1Q6CA 4RE2A 1VEPA 1UA3A 1HF6A 3SCNA 1U2YA 2OSYA 5AC5A 1KWKA 1E4IA 2GJXB 3EDEA 3D5HA 4WK9A 1ZJBA 1YQ2A 4XZBA 1TR1A 1H4PA 1MW1A 5E09A 2DH2A 2VNCA 2ZUUA 1LLOA 1JL8A 4P7LA 1VFMA 3AMCA 4GPNA 2V3FA 3AS0A 1LL4A 3BXWA 1WZAA 3W28A 1FOBA 4AEFA 5BXRA 1MW3A 4PN2A 4H8UA 1OB0A 3UERA 4TOQA 2VRKA 1GOIA 1Z32X 4MNKA 3RM8A 4GO8A 4Z2IA 4BQ4A 2YA1A 1UKOA 3K1DA 4AD1A 1V3LA 2QF8A 1D7FA 4MB4A 1WZLA 3TTOA 2GJXA 1C91A 1CWYA 1EOKA 4OBSA 1BFNA 4PTVA 1GJUA 3GZAA 3TTSA 2PBOA 4HZ8A 5C70A 4ZE4A 3O9NA 1UD5A 5IHRA 1EHAA 5A6BD 2XSAA 4H8VA 1NP0A 2CBJA 3I3BA 2WLYA 3BSHA 3MU7A 1QNQA 2BHUA 2EQDA 4URIA 4XUYA 3S2CA 5I24A 1OWQA 4ACYA 1GOQA 2ZX8A 4J3WA 4UQ9A 5ABGA 1BVZA 5ABFB 1J18A 4CN1A 3N11A 1K9DA 2WZHA 4ZXOA 1E0XA 1J0HA 4DWSA 1OIMA 1W3HA 1UKTA 3U7BA 1JIBA 3I3EA 5FD0A 1FH8A 3W24A 2D3NA 3ZT6A 1UKSA 5JBFA 1E4LA 3LMYA 4LGXA 3AZSA 4UFHA 2DSVA 2VT0A 1FA2A 2O92A 3W29A 4WJXA 3U57A 1W3KA 1KXHA 5GQBA 2WKLA 1KBKA 3TONA 4HMDA 3OGSA 1CXIA 3UEQA 1SFSA 5LA2A 3ZOAA 2QPUA 2VTFA 1LJYA 3FHQA 3MUY1 2PWDA 3DYOA 3GBDA 1QHOA 3AS3A 1NOWA 1VRXA 4ZFMA 1C7TA 1VBRA 1JI1A 3QR3A 2JEPA 1KCKA 3WDJA 4HU0A 3KE0A 3MSGA 3L4YA 4ZENA 3VMPA 5HNNA 5E0CA 1L0PA 4CCEA 4Q7NA 3ARUA 3RJXA 4OBRA 1E0WA 1H0IA 5E0FA 4V2XA 3FAXA 1WZMA 1WP6A 2WWDA 1X1NA 4AIOA 2JE8A 1TVPA 5A2CA 3TP4A 2BXZA 3AXHA 2E9BA 3SUWA 1NQ6A 2GJRA 1CEOA 4AIEA 2BY0A 2DGAA 4BQ2A 2W66A 2WMIB 4EE9A 2WNWA 4GXPA 3WBEA 5M17A 3VMNA 4IUGA 1HNYA 2G3IA 4YN5A 2WWCA 3WELA 2UWFA 5HPCA 3ARVA 5ABEA 4P7RA 3PZ9A 4U2YA 1JAEA 3WUFA 2GUYA 1B2YA 4JL1A 2WLZA 5AC4A 2W62A 1W32A 3QHOA 4L4OA 3WQWA 2Q8XA 4M82A 3SUUA 1XD0A 4JL2A 3WH6A 2FDMA 1LG1A 4CU8A 5D8WA 2F2HA 2WC3A 2YA2A 2VX4A 3AIRA 4HP5A 1UYQA 3MV11 1VAHA 4U5IA 3K46A 3T08A 1HJUA 1KGUA 2QHAA 2WW5A 3L2LA 4UFIA 3THCA 4AZIA 4AZCB 2OYMA 4J27A 3L4XA 3FY1A 2CBVA 1V6YA 5LYRA 2OSXA 2V5CA 5I5RA 2NT1A 4GKLA 4BA0A 2J25A 2DT2A 1VB9A 3SCOA 1BGAA 1WE5A 4W85A 2VUYA 4Y7EA 3WNPA 1UH3A 3UCQA 3W53A 3VD3A 3VIHA 1SR0A 2YL9A 5FCZA 1UUQA 3BAIA 1B3YA 1KWGA 3PZNA 5A6MA 1B0IA 4KMQA 2E9MA 1GQKA 1EXPA 4TX6A 3W37A 1H09A 1JF6A 2XVKA 3ZR6A 1UR9A 1R8LA 2CYGA 2D3LA 4M80A 1HIZA 7CGTA 1VENA 1EDTA 1QBBA 4QCEA 1JYXA 2VURA 4PMVA 5E6YA 1E1EA 1NWSA 2FGZA 2VO5A 2D22A 4IPNB 1OIFA 1J0ZA 3QOMA 3PZQA 1KQYA 3AIUA 1V6WA 1R7OA 5A94A 3AIWA 3LPOA 2FGLA 4DUVA 1WDPA 4MJ4A 1A47A 1B9ZA 2BY3A 1QW8A 4ZEPA 4Z2KA 3U5YA 1ZBKA 3F5KA 2OYKA 1E6XM 1B3XA 3K8MA 2BV9A 3APGA 2WMJA 3OB8A 4PTXA 3ZO9A 4TVCA 3G6MA 1UWQA 2WKGA 2EO7A 4MDPA 1JDDA 5C8BB 4H7VA 1U33A 1M01A 1BYCA 2DSUA 3GH4A 5A1AA 1JZ6A 5CLWA 3WFZA 4XB3A 1BVNP 1CXFA 2XPKA 1ZBVA 1AQMA 4PTWA 1M7XA 1KGWA 3FN9A 3GTNA 3M6DA 3WH8A 3OIHA 1HL8A 4W89A 2WMFA 3TTQA 2XM2A 3VIIA 3SUTA 3PTMA 3AHVA 4MNJA 1CTNA 4RE4A 3WNKA 3AROA 4JHOA 5HOSA 2E3ZA 3L4VA 3T09A 1WDRA 2C7FA 1VJZA 1E3XA 3VIPA 3PTQA 2QLYA 4B3KA 2VQUA 3ZM8A 3AFBA 2WYSA 2D20A 1EQPA 1BYAA 2VR4A 4D1JA 1J9YA 1PZ3A 7A3HA 5A6JA 1W91A 1MQRA 2GDVA 5FL0A 4EAMA 4GQRA 3L2MA 3IK2A 3ZMRA 4AC1X 1QI5A 4WSJA 5DFAA 3OBAA 3EMZA 1J0KA 1E0VA 2CBIA 1JF5A 1UR0A 3N12A 4C7FA 3WL1A 2O9OA 5I6SA 2DQXA 2XVPA 1C8QA 2BXYA 5CGTA 2NSXA 1GVIA 3F4VA 1HKIA 1UD8A 1UWSA 1QI3A 3ARYA 3T2OA 1OGGA 1QI2A 3RO8A 1OD8A 5I3DA 2EBNA 2Z1KA 1QNPA 3SCVA 2VZSA 3PZOA 1E6QM 2VQTA 3AI0A 2VCAA 5IHSA 2UY4A 2E8ZA 3WD4A 2WHMA 2WM0A 2E40A 4HTYA 1K9EA 4D6IA 3I3DA 1E6NA 3KZSA 3L4WA 4ATWA 1JG9A 2X09A 1RPKA 1E1FA 1TMQA 4CVUA 4FLOA 1H11A 1N82A 1V02A 2VCBA 1C92A 1TA3A 1XYFA 3NIYA 1J01A 4X0VA 2VVNA 3ARTA 3VDBA 2W91A 4B9ZA 4C7DA 3K8LA 4WF7A 1QNSA 2J7GA 1UWUA 4UZUA 2VZUA 1EOMA 1TZ7A 5IDIA 4OOZA 4UOQA 3ARQA 2J74A 1EHNA 5LA0A 4DUXA 2X05A 1R86A 2VVSA 5BCAA 3A4WA 3B9DA 1WDQA 4HZ6A 1X6NA 2CHNA 1OT1A 4AZ7A 2BFGA 5IXEA 1UR4A 1W1YA 4HMCA 4JCMA 1WKYA 1EO7A 3SIMA 1W1VA 3GNRA 2GK1A 3RILA 2XIIA 3MUIA 1CXEA 2QPSA 2FHFA 3DHPA 4BZYA 2QMJA 3JUGA 3T2PA 3N04A 4AISA 4TUFA 2BY2A 3KWXA 2CPUA 4K68A 5DO8A 1CXKA 3SCSA 3WN6A 3BMVA 5GNYA 2GJPA 1HP5A 2WHKA 2DT3A 4WKFA 3UR7A 2OSWA 2WK2A 1UD2A 3VDCA 4LYQA 6A3HA 3OLDA 4JKMA 3SCUA 3OZPA 1C93A 1E3ZA 3NCOA 3VPLA 1E40A 1GQJA 2W4XA 5A95A 1MW2A 4D6GA 1EDGA 1KCLA 3WY1A 3AYSA 1BYDA 2EPKX 3WD0A 4KRTA 4LXFA 4UQBA 1OD0A 2WCAA 1PPIA 5D9PA 3F5JA 2YDQA 1H3GA 3SCRA 2BHYA 4UFKA 1MFUA 2J79A 4AD0A 3W6MA 3CHFA 3IJ8A 3EDJA 3L4UA 1LL7A 1NP2A 3WDQA 1V0LA 1G1YA 1FFQA 5DT7A 3GH5A 3WQ8A 4W8BA 3J7HA 4CD7A 3T0DA 2J7BA 4KRUA 3MO4A 4RE3A 4J7RA 3NYDA 2BVTA 1PBGA 3DECA 3GM8A 1ISXA 4D1IA 1B3WA 1NWRA 1MVYA 4PRWA 3A6OA 2D0HA 2DIJA 3VTRA 1MQQA 2XTKA 1ZBWA 1KXTA 4LQ1A 5BXTA 1C8XA 2WSPA 1NWTA 1GUVA 5E9AA 1MFVA 2XVLA 5JBDA 2DIEA 4UQEA 1ESWA 1A3HA 1CYGA 1US2A 1G94A 1BAGA 1EQCA 4NI3A 1QHZA 1M53A 3ZJKA 4M81A 4Z2HA
chains in the Genus database with same CATH superfamily
3PB2A 4HSHA 5KZ6A 1TWIA 5CZKA 2Z6JA 3RU8X 3SIZA 1MMFA 3HG2A 2J7FA 3VKBA 1O68A 3IJ9A 3OLGA 3BZJA 4W87A 1XLHA 3BAXA 5F7UA 4PEKA 1TRIA 3DAQA 1CLXA 2QS8A 5J5RA 2BB0A 4GACA 3M7WA 4Z17A 3MDWA 4AUBA 3WLMA 5CLTA 3LUTA 4S39A 3ICJA 3GAKA 2JGYA 2KAUC 3EBVA 4PZVA 3L66A 2WQDA 3OJGA 4L1GA 4XZWA 4QTGA 4XG1A 1GEQA 2HRWA 5I06A 4Q7IA 1FUYA 5FF2A 1MZHA 4TX8A 1VFUA 4J2MA 4R7JA 4C6NA 1VS1A 3BV7A 4PTMA 4H8NA 3P81A 1O1HA 1E56A 4FX6M 4IISA 1YKWA 3M0YA 4YTTA 1TELA 2H3BA 1AUSL 2JALA 3WKZA 1P1XA 3KZPA 3W7OA 1W8GA 4OUIA 1CDGA 2J4GA 1GJPA 1XG4A 2VWTA 3GG0A 3P67A 3V16A 3BAWA 4DJFD 3T9PA 1FHDA 2CCRA 2PC8A 3L2IA 4V33A 4I9TA 3SADA 4JTIA 4QBXA 2DZSA 1TTIA 3O05A 1WB0A 2JIWA 3TQKA 1O95A 4IMFA 3VNLA 3RLUA 1YBQA 1FWRA 5HMEA 3I6TA 1UD4A 4MADA 4LEFA 2OO0A 3B8IA 1CXLA 1IZJA 2QDGA 1JULA 3LG3A 3OVQA 3HO8A 4TVDA 2CEQA 3MWCA 1FCVA 3GHRA 3ZSTA 4O8AA 3VX0A 4JPGA 2ZADA 2QEZA 3UQNA 3UCCA 2Y2WA 4AZHA 1HJQA 2EPOA 3QEZA 1XRTA 4Y9AA 3VA8A 3ALGA 2J7CA 3KFTA 2FIQA 1E9YB 4QM1A 1OM0A 5BXSA 3O2LA 4QXIA 2ZKMX 4C6QA 3FJ6A 4UTFA 3NUKA 2V3DA 4C6PA 3NPVA 1MEIA 3DX5A 1Q6EA 1FH7A 1SSGA 2OYLA 3KTSA 3L68A 4NIRA 5GJMA 2NSOA 3N29A 2WZMA 1AW2A 1GTEA 3OU8A 4DWSB 3NM3A 4XD6A 1UOKA 1P1MA 1KR0A 4LEQA 1SU5A 1LG2A 3R5EA 1SFTA 1NEYA 1XPGA 3VCRA 4AXNA 3GDLA 1OEPA 3ZZ1A 4WOQA 2ZFAA 2NT0A 1SUXA 1PCKA 1W9BM 4EANA 4FP1A 4W9TA 2VFDA 3W71A 1QW9A 4HCHA 4XV0A 1NWUA 3FYOA 1XP3A 2NQ9A 2IPFA 2OGJA 2PTZA 4UCFA 3TC3A 3CUIA 2HVMA 5E0KA 1P4CA 5EPDA 4KCWA 1H60A 1C9WA 3K4DA 1JCYA 1UWRA 3AJ7A 1TJPA 3MMWA 3ME3A 4DY1A 1DHKA 3B9OA 2GSHA 1UMLA 4RL3A 3QW3A 3WNMA 4F2BA 1LWHA 2OEKA 4JIQA 1D2KA 1VFOA 3EZ4A 1TQJA 3CHVA 1GQIA 2JK2A 3TK7A 3DFTA 1R38A 3C2OA 3DFHA 3CAQA 4L7ZA 1KA9F 1WZKA 2Y8KA 1YPFA 1VCFA 5E6ZA 3HTWA 1J10A 5I2UA 2XIBA 4JXCA 1JPKA 1UPMB 1Q4NX 2OCZA 4HPGA 4CGTA 4JTGA 3OG3A 2QJGA 1CGTA 1WDDA 4F0LA 3OZMA 4H00A 1DKWA 4AEOA 3GH7A 4FK9A 2DUXA 1H62A 5BRBA 4GBUA 2OMAA 3I4KA 1BF2A 2QUVA 4OKDA 1EEXA 1I1XA 4GFIA 2PDXA 3SBFA 3NTYA 1UWAA 2XWDA 3NO3A 4GINA 4CU7A 4J3SA 3KCJA 3HN3A 4BWLA 3W25A 3KS6A 4NAFA 4Q3MA 1YDNA 3VC5A 1YE6A 8CGTA 4C6DA 4HK5A 3W7LA 1MSSA 1W3TA 3G1YA 3D46A 3CMJA 3VE9A 2RKXA 5BXPA 2NQJA 2QUUA 3QH2A 2EGZA 5GNXA 4ILSA 4ZOCA 3VUPA 4MYAA 3NURA 1D3GA 1CI1A 3N4AA 1Y5XA 2X8RA 2VX7A 1AVAA 2GSJA 3PVFA 4JHMA 5CBBA 2J9ZA 1MXGA 4UMAA 4P61A 5K9DA 3HQPA 5DELA 2NWRA 1BLIA 1SFLA 1L8NA 1TA3B 4NJIA 1V3IA 1HT6A 1K9TA 4ZSUA 1GCYA 2FYMA 2QAPA 2JKEA 1OFBA 4B5TA 3GKAA 4MB5A 5REQA 1G5AA 1EPXA 1M7JA 3KWSA 1XLJA 2C18A 2H90A 5C7VA 4GNJA 4P8XA 3UJRA 1JCMP 1EZWA 2MANA 4V27A 1FWCC 1IT7A 3HMCA 2ZRYA 2NQ5A 3BANA 2ZA3A 4MPQA 4IF2A 4GUIA 3DFSA 2Z0IA 4HPHA 2R94A 2CXEA 4S3EA 1VEOA 2WNQA 4HK6A 5FJPA 1KRMA 8A3HA 3LI1A 4MKSA 5DBTA 4EF8A 4YHEA 4HKPA 1XIEA 4H41A 4IMCA 1D3HA 3HFYA 1YNPA 3W4RA 3SCTA 4JX6A 3N9KA 3IV8A 2YZ5A 4TMCA 2FZ8A 4LS1A 1LWIA 2WXDM 1XGEA 2V82A 2VC9A 3AMLA 3O6DA 4LUYA 1J0YA 4BQ5A 3MSRA 1GK8A 2QDDA 5A8MA 1JNDA 5D2XA 4TTGA 3MBFA 2YGYA 5KSWA 3M4HA 4IX2A 5LHFA 3TWAA 4F9JA 3MKKA 4JFUA 5H8PA 4UQAA 2WHJA 1ZAIA 1J0JA 5AYIA 3VDAA 1YDYA 4C6FA 1BG9A 3MC5A 2QGYA 4PUDA 3WBWA 1W9PA 3MCNA 3QM3A 4H2HA 4H2CA 4U3AA 1X6UA 4W86A 3WO8A 3GUGA 4FIRA 1VLIA 5FEZA 5CC6A 3MWAA 4KEMA 4O1FA 3GWQA 2WJEA 1GKRA 3CHDA 1L2UA 3W07A 1JCXA 3V36A 1HJWA 3LGEA 4RX0A 3B0UX 3B0XA 4QNEA 3OGVA 3EDDA 4K36A 1EH9A 1TWDA 1XH0A 3TU9A 3LQLA 3GAYA 3VILA 3QJAA 2A79A 3II1A 2CERA 3BCDA 1P0NA 4QLJA 2YKKA 2DP3A 4PGLA 3MP5A 4HOWA 2UY3A 2E1WA 1H7PA 2AMGA 3PHAA 2FZNA 1Q65A 4NJJA 3UWUA 3ALFA 1GG0A 3WBAA 4AWTA 2QF7A 4ZA0A 3RN6A 2YCIX 2F6UA 2X1SA 1IWAA 3VGGA 1ODZA 1MNSA 2E4TA 4AWUA 3ANVA 4D8ZA 3BLDA 1CGWA 1W3LA 4K8EA 1QHPA 3HV8A 4D6EA 3I6RA 2EPMX 1XR2A 1JPHA 4A2SA 3CZLA 4Q4RA 3V18A 4IG2A 2IKGA 4C60A 3C2YA 1XRVA 1OFQA 2G3FA 5A6TC 2VMFA 3WDHA 4PFHA 4S3KA 3LY0A 3M6YA 2Z1SA 1IT0A 4J3ZA 4GHRA 1UH2A 5J04A 3W85A 2DSKA 3CZJA 3HPFA 4GZEA 3LMZA 1VJIA 2YDSA 2VD9A 2O9PA 2ABBA 4K37A 2BODX 5K4XA 4GH3A 3GFYA 2HEJA 3HPZA 4Y9OA 1XRSA 4J35A 4GY1A 2W92A 3P0XA 2ONEA 4JYEA 3KVMA 1QO2A 2DVTA 3N9SA 2JQXA 4AMCA 1MEWA 4YNGA 5FA5A 1BD0A 1H2JA 1A5LC 2J6XA 1VBHA 3CEPA 1HXJA 2IKHA 3S1WA 1C90A 1PKMA 3KW3A 2D0FA 1JI2A 3Q67A 4OWGA 4K1WA 4JDYA 3GXTA 2CXGA 3RK8A 1LRNA 1NQKA 3VMOA 3FHAA 4W8AA 1QI0A 4K8HA 5HANA 3BOFA 3GR8A 3CHCA 1EJ7L 5I0DA 4D6CA 4R9OA 2D0GA 3ATZA 3S5ZA 1US3A 1M3UA 5HATA 1TG7A 3GU1A 1F3EA 1UZ1A 1AK5A 2Z25A 4HOXA 3H7VA 2FMNA 1RQEA 1P0DA 1IEQA 1OCJA 3BLFA 3B0VC 4N7QA 3TA9A 4GVHA 2HISA 3TYUA 1A50A 4KGLA 1KRAC 3PZGA 3OYZA 5AHMA 5IBXA 1BQGA 3GVWA 3CUFA 3LZ3A 2X16A 3FCPA 4KWSA 2EJAA 4P8UA 1R3WA 1HX0A 1BXNA 1PX4A 4HNLA 3ZR5A 2CBUA 4ZCWA 1VH7A 4MWAA 5CSSA 1UIPA 3ONCA 1NOFA 4XVEA 1XLBA 2ZX9A 3WLNA 2YL5A 1KM2A 1C3FA 5A8QA 4UR8A 2VEPA 3IIPA 6TIMA 1S5WA 1MUMA 3G3MA 4BF7A 5I07A 2WANA 3FJ4A 4YTSA 3PBYA 1C7SA 3QMSA 3E49A 3GXDA 4I3GA 2E25A 1GGOA 3TJIA 4I6KA 4IMDA 4NSBA 3H12A 5AC8A 1VCGA 4F0HA 4UNKA 3ARWA 3BGGA 4BQ3A 1RJRA 1JUKA 1HKJA 3B9AA 1FHLA 2PU0A 2IPJA 4P7QA 1UBPC 3U2ZA 1R6WA 4LS0A 2WC7A 1XQKA 1HJVA 3WF3A 4M29A 5FSDC 3I7QA 3A64A 3IUHA 4BI5A 3IRSA 1AH3A 1I45A 3C52A 3HG5A 4JQ4A 1QNOA 2PZ0A 2ISFA 1OGSA 1H1YA 4GE8A 2V3EA 4D71A 4TIMA 2IS7A 4HHMA 3UNTA 3L5LA 3OHIA 1YXCA 4N4PA 1VCVA 1ELSA 3NGJA 4DBEA 1DBTA 4ROQA 3VIJA 4IQLA 5XIAA 1D9EA 1HO4A 2GJLA 4ZQMA 1RD5A 4AX7A 5T9CE 4MLRA 4LANA 4DM2A 3PZVA 1E4NA 3Q4DA 1LF1A 3TZNA 1E6SM 4ICMA 2VX5A 5FL1A 2VDHA 3KDNA 5FIPA 3IANA 3WENA 1AW5A 4ZE5A 1GOMA 2D2GA 2YW4A 3GTHA 4S2CA 4MZ1A 4LX4A 3UR8A 8XIAA 2XGZA 1GKQA 1F4AA 2MNRA 3SUSA 3VYLA 1LRTA 1GTHA 1HKKA 2VL4A 2FFIA 2FTWA 4QJ3B 2X1UA 5C2XA 3FW6A 5C0QA 3THQA 3WK1A 4U10A 1OGBA 2VX6A 1X7IA 3WF1A 5CAHA 2GLKA 3MO7A 3AZRA 2ACQA 1LRQA 3W81A 3R0DA 2Y5JA 3G22A 5BRPA 4ML4A 4Q7BA 1A5AA 4ADSA 1G67A 1LLZA 3L65A 2VP8A 5HWNA 3WMLA 1SGJA 3MUAA 1ITUA 3PM6A 3VE7A 3EPNA 4GI8A 4BHYA 4AY1A 2VELA 1JYVA 4AY8A 3CH9A 1JJKA 2WHLA 4IIDA 2QCNA 2FZDA 3LCLA 1JNEA 1O60A 1GOKA 3REQA 3QHNA 1LTDA 1IQ8A 4W93A 1FWBC 1WOBA 3MCOA 2A21A 2WMHA 1Q6LA 5FJOA 2GDQA 3RU6A 4L5ZA 5K3VA 1QCWA 4Q6JA 4E4PA 3UPMA 1A3WA 3TC6A 4N0RA 3G1SA 1BKSA 1DXFA 1SJDA 1NH6A 3MMDA 4R5EA 3WQ6A 2J8FA 3SRFA 4B15A 5HULA 4GRSA 4A3RA 3E02A 1EJSC 5CGMA 1BYBA 2QCGA 1EA9C 2J8GA 2VHLA 1H51A 3BCJA 2YL6A 3FKKA 1XFCA 1XYMA 1CGVA 5M3WA 3H55A 4BR1A 3EWWA 3EWCA 3S6TA 2PSNA 3DC0A 3H2OA 3WEZA 2H9AB 3APYA 1ITCA 4NT0A 1JCTA 1UH4A 3CWOX 1TPFA 4FNUA 4PUEA 2DEPA 1A5NC 3G2GA 5C2GA 3GW0A 4X0NA 5TF0A 2I57A 3QGVA 3VKCA 1MRAA 4DJFA 5GNZA 3ARPA 1HGWA 4NZ3A 3WX7A 4C7GA 2GDUA 2R1KA 2FPYA 1W1PA 3ABZA 2PU1A 1EX1A 3N2BA 2Z1VA 3CB3A 4J1OA 3EDFA 3CBWA 2BP1A 1NAL1 3BLPX 4CLMA 3MHUA 3CZ8A 3W1QA 2GWNA 2POZA 3NL3A 2B0MA 1LBLA 3C86A 3VD4A 2XN1A 2GQ3A 2VC7A 1E55A 1ZTVA 2PFHA 4D72A 4B3ZA 3O07A 2PPGA 3MSDA 2WVSA 3M7SA 1QO5A 2VZVA 1YXDA 1VKFA 3PZTA 3M5VA 3FGCA 1ZCCA 5AFDA 5FJRA 3PJUA 3VNYA 4YHGA 1SW3A 5TQLA 1ZALA 1JAKA 4GIRA 3EX2A 3KOWA 4H8HA 2TSYA 3BAKA 1V03A 2EKCA 3UZYA 3PBWA 1REQA 4PMZA 4GZIA 3T8LA 3RM4A 3CU2A 4U5KA 1Q6CA 4HD5A 4Z0JA 1VEPA 2VEKA 3LCIA 4QAIA 3MVTA 3QGAC 1U2YA 3O0KA 3UZ5A 3B8DA 1KWKA 4OHQA 3D5HA 4WK9A 4M6VA 4A8LA 3KRZA 1YQ2A 1QPQA 4IQJA 2ISDA 3WBXA 1TR1A 1X96A 1A0DA 1NVMA 1UR3M 1S5VA 1V5XA 4LUSB 3V5FA 3TYBA 4MJZA 3AMCA 3W28A 5BXRA 1W1B1 2VRKA 1GOIA 3M5XA 4BQ4A 1O5XA 4JN8A 1XLDA 4H7CA 3TTOA 1QRQA 3GDMA 3W87A 1TPC1 3TTSA 1AA1B 4O1DA 3G1VA 3NM1A 1DORA 3OW1A 5BWAA 4ZE4A 1EIXA 1EHAA 4H8VA 2A6NA 2CBJA 3OO2A 1KFKA 4XUYA 1KBIA 4WEVX 1OWQA 4ACYA 3KRSA 3USBA 4J3WA 3N14A 1J18A 5BOEA 1J0HA 3AU6A 1S1PA 3UXKA 1OIMA 3I3EA 1FH8A 4L9ZA 3W24A 2YDAA 4C5ZA 3AZSA 4UFHA 2DSVA 1PCWA 2O92A 2PCEA 3MA8A 1KXHA 4YTUA 4IMAA 2QUNA 2CLFA 4PCFA 4WX2A 3UEQA 3TQVA 1SFSA 3STEA 3ZOAA 4LB4A 2QPUA 2VTFA 1LJYA 2GL5A 1R2RA 3DYOA 4CQCA 2OLSA 4XTIA 1VBRA 1W37A 2HTMA 1RJPA 3V0SA 1KCKA 3WDJA 3T7VA 4HU0A 4E4UA 3KE0A 2OLAA 3L4YA 2HPIA 2BX7A 3AWNA 3KRUA 3VMPA 4GVGA 3WQOA 3MJMA 4H01A 4CCEA 2D69A 3NEVA 3T55A 4Q7NA 3ARUA 1T40A 4DIAA 1K70A 1E0WA 2FLIA 3TWBA 2V5JA 5DLCA 1WZMA 3UP8A 3BLEA 3GXPA 2VGIA 4UTTA 5XINA 3SSZA 2X7VA 4Z1BA 1AJ2A 3H4GA 4AMAA 3AXHA 2C14A 3VNKA 2IMRA 1CEOA 3S1XA 2BY0A 1NF7A 3AALA 2DGAA 2W66A 3W2JA 2PDUA 5CH9A 2OZ3A 2QDHA 1M7PA 2PLMA 4O50A 5LGXA 4GXPA 2WQPA 3LXBA 2V9DA 5G4HC 4L61A 5D04C 4G5DA 4Y9MA 4DZAA 3FK4A 4S3AA 3BWWA 3T4CA 5ABEA 1YNQA 3R43A 2GOKA 1E0UA 3L5MA 1JAEA 2CLPA 4JNYA 3IPWA 5C2CA 4YLWA 5AC4A 1FHVA 2AMXA 3V1PA 3LHUA 3P62A 3SI9A 5D8WA 3SN1A 4NI8A 3RLVA 3WQEA 4G1NA 3P84A 2TPSA 3R2GA 1EBHA 4KBXA 1KM5A 4CEUC 1UYQA 3M0KA 2ZRVA 1HJUA 5HINA 2WW5A 3GRIA 3HOJA 3LHZA 4ZQOA 1FWTA 2PLKA 2ZRUA 4Q8WA 5HNRA 3FY1A 1XIMA 2A6LA 3V3WA 3M5ZA 3PS7A 2Y0FA 1TJ1A 2J25A 3G8RA 4GGHA 3MYOA 3W53A 3VD3A 2CLIA 2ZZ6A 3EX3A 2P3EA 2WJZA 2FVMA 4JR5A 1CX9A 3TJXA 1QNVA 1B0IA 3FSTA 2E9MA 5D09A 1H09A 3OVPA 2XVKA 4H3DA 2OKOA 1UR9A 3USZA 1WUFA 4MWAB 2D3LA 2UZ9A 1OADA 3HPXA 2Q3OA 3MZ2A 5EBUA 2Z28A 3HGSA 5E6YA 1WX0A 3PFMA 2FGZA 3UJFA 3TN6A 3GG7A 4IGNA 1DPMA 5G1TA 2FGLA 3ES8A 4QS5A 1FWGC 1WDPA 2PDGA 1QOPA 4M7SA 3F5KA 1E6XM 2XFWA 2BV9A 2DW6A 3EPMA 2GOUA 3LLDA 3QKZA 4INFA 3GS6A 3S9YA 1GWJA 4C6BA 4MDPA 2Q01A 1EXBA 4FI4A 3TA6A 3H2FA 3C0SA 4I8DA 1M01A 3PJTA 3E0VA 4XB3A 1BVNP 4M6QA 2PDHA 1BKHA 1P43A 2NQZA 3PF3A 3VFLA 5B7YA 3IV3A 2EF9A 3BOXA 5DCDA 3E5BA 1NSJA 3WLPA 3U4AA 4W89A 2XM2A 3VIIA 3HIJA 1TZ9A 3QQ0A 4NXKA 3R89A 1TPDA 4RNJA 4JHOA 5EGRA 2E3ZA 3L4VA 5BOFA 1WDRA 5F2IA 3VAVA 2QLYA 2POTA 3NQEA 1BYAA 4D1JA 1K02A 2PEVA 1XIHA 1MQRA 1FWFC 2GDVA 5FL0A 3AC0A 2YB4A 1E0VA 3RMJA 5G2WA 1OFAA 4XAFA 3WFAA 4K7VA 2A5HA 3DBPA 4ZTYA 4AFYA 1SZFA 3WL1A 4NAFB 3W74A 2XVPA 1SZNA 2BXYA 3JU2A 3UA4A 1L6GA 4KFPA 1B5TA 4R9XA 1ALDA 2OO6A 1VR6A 2ACRA 4DBUA 1FWSA 2C19A 1OK6A 1G4EA 2F9RA 3T2OA 1QI2A 1OD8A 2EBNA 2JKAA 1MZRA 4CNSA 1QNPA 3T81A 4YXGA 1P5BA 3AWOA 2V0TA 2VQTA 2R1LA 2UY4A 2E8ZA 4FXSA 2WM0A 2E40A 4HTYA 4D6IA 1JRCA 3KZSA 5HNTA 4ATWA 3G5EA 3MW7A 1TMQA 2CWNA 4CVUA 4UTWC 1C92A 3D0CA 5CSRA 2Z00A 1TA3A 2VKZG 3H22A 3QTGA 3R1ZA 4X0VA 4GFSA 3VDBA 5G5IA 4DQWA 4WF7A 1GVFA 5DX7A 3A9IA 4O4VA 1TZ7A 3UA3A 1Q6QA 1POJA 5IDIA 4OOZA 4UOQA 3LHYA 1RQHA 2UBPC 4FIQA 1NTHA 3B9DA 2G97A 3IUDA 4U28A 4AZ7A 5IXEA 1W1YA 3PP7A 4A05A 2QNEA 3GNRA 2REQA 1FRBA 1XIDA 3SZ8A 1Y65A 2WPBA 5AYZA 3DHPA 3RR1A 4B5XA 4XKYB 3GIYA 4BZYA 2QMJA 5LHEA 3JUGA 2E28A 3N04A 4X61A 3R25A 3E0FA 1CXKA 3TCSA 4LAZA 5HUOA 3DOPA 3P0WA 3BMVA 1F73A 5GNYA 5CPMA 1I60A 4RZ5A 3EB4A 4GYPC 4Y9NA 2OZ8A 1JDEA 4E3TA 4J2PA 3OZPA 3QF0A 3LSCA 1NELA 1YDVA 3NCOA 2W4XA 3NOYA 4FXFA 3VABA 4BI6A 1EDGA 3WY1A 4DYJA 2AKZA 4UWMA 4UQBA 3EB3A 1OD0A 2AQVA 4MKNA 2ABAA 4O17A 2XDFA 4HPNA 2Z7GA 3ZS4A 2QAFA 4M6PA 3CHFA 3EDJA 6REQA 1TCDA 3L4UA 1NP2A 4K1GA 1V0LA 1DJGA 3GH5A 4W8BA 4CD7A 2V30A 3TW7A 3FV9A 2R24A 2V5LA 3UJ2A 5L9FA 3FDKA 4J7RA 1PBGA 3XIMA 3GM8A 1EX5A 2Z6IA 4HPXA 4C1LA 4Y90A 4D1IA 3DFQA 4PRWA 2E6DA 1KXTA 2BG5A 1F76A 3QZ6A 5C54A 3THAA 2RJGA 2IKJA 3GU2A 4DAFA 1BAGA 2X1TA 3QZAA 4XZLX 2C13A 1ZUAX 2QULA 3PG8A 1OYAA 4JTQA 5FAJA 2GUBA 2WVVA 1UPPA 3W7NA 3STPA 4JTEA 4DLFA 2NV9A 1Q4WA 3CS2A 3UZJA 4NRSA 3UW6A 4B9YA 4B92A 5LA1A 3KP0A 4WDXA 1UUMA 1Z8AA 4BI7A 4L80A 1QJWA 3NWRA 5F4SA 4QS6A 1ONXA 1OYCA 1LUCA 2I5QA 4FA3A 3EWYA 4CCDA 2Z26A 4F66A 4RDWA 5FJTA 1HN1A 4ZB0A 3C8FA 3IGXA 3MSYA 5GPRA 1DJNA 1AFSA 4GXWA 4QX4A 2QYGA 1E6PA 4HQVA 4LUJA 4W5UA 3EGJA 4AZGA 1YTKA 1DTUA 1ZAHA 2DDXA 5A8OA 1BSIA 3W26A 3EXRA 4DBSA 1A80A 2ZOXA 4FNQA 5JIWA 4JFVA 3S0CA 3E0IA 2H8XA 1W6TA 4FHAA 3GNOA 4GISA 3ONBA 3BJSA 1E9LA 4D6DA 4UOJA 1G9HA 3WDRA 3W75A 3WF2A 4OTKA 1OX4A 1G7VA 1B90A 1QOXA 2Y4SA 1EO5A 4V1XA 4YMZA 1W9DM 3EKGA 3VM5A 4B3LA 4B5NA 2A3CA 4ADUA 2E5DA 3DFPA 1GVQA 4IM4A 4I6VA 2J75A 3S47A 1UHVA 3LTPA 2VDIA 2ZC8A 1E4MM 3EA1A 4MY9A 3VGBA 5F4XA 3N3TA 1SZGA 1YRRA 1I2QA 2GGHA 3WIJA 3N17A 3NVTA 1V6VA 4PTDA 1K9FA 3VKKA 4Z1CA 1ISYA 3L9CA 4MHBA 2QCLA 3ZJ7A 1GOOA 4FLSA 4HSNA 3O7UA 2OOGA 5J8LA 2BGQA 3N19B 4UTHA 2Y89A 1A5KC 1AMKA 2G37A 1TV7A 2E8YA 2FGBA 4PCNA 4WKAA 3JR2A 1PTGA 1VJSA 1EGMA 3UESA 4F8XA 4H6RA 3TKFA 1O1ZA 5EBAA 1PYMA 1SO6A 1LWJA 5CPSA 4WLCA 1PO9A 3R0UA 1MQPA 1GZ1A 2BNJA 1KBLA 1KRCC 3GDRA 2ZVRA 1XISA 2D24A 3VGEA 2FHBA 1SO5A 1X98A 2SFPA 1V08A 4O57A 3E38A 4XIMA 4X9SA 3AMGA 1JZ5A 1QNRA 3S8HA 3WQVA 1I8JA 1I2PA 4DX3A 3W72A 2P5NA 4XSMA 1GVRA 2NUWA 2DZXA 1MRQA 3RHGA 4W7UA 3QGKC 3ORWA 4WJ8A 3PSVA 3W6LA 1H49A 1M1BA 2XZ9A 3UU0A 3V35A 3AUOA 4UMCA 3GIPA 2GGEA 1ZPTA 4WSKA 3EEZA 1WCGA 1SW7A 3OTRA 1V02E 4E2OA 2J7HA 1GJWA 2NQLA 1KTNA 4KPLA 3V5CA 1K77A 1ODUA 4GQ0A 1O94A 2GVEA 2DU2A 4F2TA 4GWEA 3VZYA 1RQBA 3F2CA 4JEQA 3L4TA 2OEMA 3FXYA 1RH9A 5K2ZA 3RF9A 3V7PA 1BWVA 3OBEA 3LX9A 1J0IA 1ZHAA 2HNEA 3RRAA 4E2DA 1GONA 3E6EA 1R85A 2GVYA 2GGJA 4PBFA 1XUZA 2W61A 3MI6A 4PBGA 3T8QA 3G0XA 4J28A 1BF6A 4NASA 1WV2A 3TXVA 2ZRXA 2D2JA 3GB6A 3LM3A 3PBUA 1UQZA 2ZE0A 3SUVA 4MWAE 2WCGA 3CPUA 1YYAA 2J7EA 2CW6A 3A5VA 2TYSA 4LBUA 1THFD 3UJEA 4DXVA 3MJYA 2ZA1A 3KUMA 2BDQA 2G3NA 5AC7A 3VU2A 1CGXA 1W31A 3EMCA 3BCFA 3GD6A 2XSBA 4KT2A 3NYZA 2DV0A 3ZIZA 1ISWA 1JUBA 5A8PA 5H1WA 1SJCA 2F7FA 1LOLA 4LJ3A 2IW0A 2CETA 5HDRA 1GQLA 1UP2A 4PMNA 1Y7VA 1NFBA 3RLGA 3XINA 1CLVA 1XKJA 1UCWA 1VBUA 3S5OA 2OKTA 1PKNA 3C6CA 2V3GA 5EA9A 1FFRA 1UD3A 4F40A 3N25A 3FVMA 3UWZA 2PGWA 1QOQA 1MYRA 2QJHA 3E2QA 4GYKA 2A3HA 1EF3A 1FDJA 1G69A 4RDYA 4EIVA 1XBZA 3HURA 2XJ7A 3NZQA 1O5QA 1XLEA 3G6LA 4H9YA 3K1GA 4NRRA 3S9ZA 1PWLA 3FFSA 3T1GA 3TR9A 3CMFA 2CU0A 5CPOA 3CTLA 4IFKB 2ZVIA 2ZICA 3MT1A 1H0GA 4GO9A 5D30A 3SQLA 4I5RA 3OVRA 4PULA 4CVWA 2DT0A 4L65A 3CO4A 1NFGA 1M5WA 2VRJA 1G0CA 4LY4A 3FNDA 4GYPA 2J77A 4YU1A 3UPWA 1R5YA 1RBOB 2Q02A 3UG5A 1OX6A 4O18A 1LOQA 3QKEA 3I7RA 4AVOA 2J66A 4JN6A 3AYTA 3NDOA 2G0WA 1D8WA 1LL6A 5DY3A 3AHYA 2INFA 5HQEA 3LHWA 3P2VA 3WJSA 1RP9A 1OFDA 4M3PA 2Q3RA 2E5BA 4O53A 3KVJA 1JRBA 2WCSA 5JBEA 1RSCA 4HK7A 1VPYA 4QEEA 5I03A 4AB4A 3TEVA 2W0UA 2PTDA 3ARXA 1WXJA 3W01A 5D9OA 5KETA 3GR4A 1UP0A 2ON3A 1L6FA 3F03K 1XYZA 5HAOA 5I3KA 1TUXA 2YXGA 4MJMA 5C5YA 1EYWA 4I9AA 3NGFA 3LD5A 5CG0A 4L1XA 3VNIA 7XIMA 4XZMX 5BOOA 4KWOA 2FFCA 1VGAA 2A3AA 1OSEA 2DZWA 4M51A 2G41A 4GCXA 2ATSA 4HSOA 3H53A 4HZ7A 2R8WA 1EPVA 1JCJA 2P76A 5AHEA 3SN0A 2ZWZA 4DO5A 1FXQA 2W27A 4FR1A 3W82A 2E9LA 2XM1A 2ZUNA 4Z0SA 1XUUA 4MFDA 3DZ1A 2XHYA 1IXOA 2A7NA 1CBGA 4IGSA 1Z44A 4N02A 1WAUA 2ZYFA 5JMUA 1TPEA 4D6HA 4N6FA 1WDSA 4D6JA 3W22A 3BUVA 4JTCA 3PUOA 2YR1A 2VRQA 3CUHA 4U33A 3TH6A 3VD5A 2JF7A 1XCXA 3WF4A 4GYFA 1JXJA 2GJNA 3WNOA 4YYFA 4P7NA 4IIGA 2VR2A 4B16A 3ARZA 4DM1A 2VI0A 1W3IA 3W38A 3EX4A 3SFWA 5M03A 3ZJ6A 1B57A 1DWGM 2VC5A 2XWEA 4UOZA 2QVNA 4GLEA 4L4MA 2PDFA 3VIFA 4AHOA 3TC7A 5FEXA 4ZXLA 4S1FA 1A5OC 4M56A 4IQDA 5LKYA 4RPQA 2OWWA 4US5A 4S2BA 4YTQA 5C71A 1GG1A 2RGMA 2JIEA 1ITQA 2ZIDA 4FX8A 3WD3A 5I79A 3ANUA 1HKWA 4PL2A 1W2VA 3GSMA 1XC6A 1TJRA 2V38A 3SCWA 1E9ZB 4LV4A 1U22A 1FKWA 1DL3A 5HWJA 3MI2A 4WSHA 4F9DA 1XQLA 4PMYA 3T4WA 4F2UA 4GY0A 3AQUA 4PTNA 5D9MA 4OZOA 4YWIA 3BW4A 1Q2SA 4QISA 5G4WA 2GSEA 3EXTA 2XUCA 4UFLA 1KXVA 1R3QA 3H8AA 5CBIA 1VFHA 3AIQA 5K9CA 4HYRA 4I5UA 1I2OA 2TODA 2EJ1A 3BOLA 1XCWA 3TFCA 1V93A 2I5GA 2Q8ZA 5FF4A 3SFKA 3F5LA 4QAWA 3NZRA 3DHFA 4RK8A 3BE7A 3WQ4A 4GZJA 5C9UA 3VOGA 2FPVA 3QY6A 1VIZA 3QRHA 3MMUA 3URAA 5K7JA 3GXIA 4AY7A 4GNKB 2ZTJA 2YCLA 4KW2A 1W9XA 3L7RA 3O1NA 1OX5A 3KL5A 2Q6ZA 3T07A 3ABXA 4LFYA 1N55A 2Z29A 3W1PA 4CD5A 4LC6A 4B4HA 2XVGA 2ZUWA 1ICQA 3QR0A 1EC9A 3AIVA 5AECA 1FDZA 1VD6A 5TAOA 1V0NA 2PCQA 8XIMA 1EB3A 1J5TA 2ZZ1A 2ZUTA 3FAWA 4WY0A 4AD4A 2AKMA 2R91A 4YWSA 4PMQA 4X3ZA 4M0XA 3PG9A 4HU8A 3EOEA 3ANYA 1DXEA 4FLQA 5EKYA 5ECVA 2L5HA 3AO0A 4BWLC 3BG5A 1Q6OA 3CO8A 3LM7A 3PZUA 1DHPA 3R6IA 4IPLA 2QIIA 2WAGA 5D33A 2XN0A 2WMKA 1XLMA 3WH5A 2DW7A 3VDHA 2Z4GA 3Q37A 3M5YA 3M41A 1FBAA 1WKEA 6PTDA 1KO0A 4J3XA 2QJIA 3O6AA 3L5AA 2YA0A 2Z2UA 3PR2A 1R87A 3LPFA 3ELFA 3TTYA 3AXIA 3STCA 2Y88A 2X0YA 5HBFA 4EPKA 5FJUA 2E68A 4OUEA 3U2EA 2D73A 5A69A 4C6OA 5GJPA 4MNMA 2D2OA 4CQBA 3L0GA 1JZ2A 4NKCA 3S83A 2W5FA 3T40A 1UWIA 4UFJA 4A2RA 2JFEX 5FJIA 1IWBA 5AB3A 1S46A 2Y85A 4MB1A 3HF3A 4JZ5A 1RY0A 4KGJA 1GNXA 1SMDA 3AMDA 3AIEA 1K3UA 3C2EA 3GYCA 3GYEA 3A23A 3CL6A 3U9IA 3WNLA 2OB3A 1EYEA 4POCA 4Z2GA 3DHUA 1Q45A 2Y70A 5HJLA 2W9MA 2ALRA 1CGYA 3EPOA 1NFPA 3WD1A 4GGBA 1X8CA 3B03A 2YXXA 3BC9A 4JGDA 1I0BA 3KAOA 1PHQA 3W1NA 2Y63A 3W2NA 9XIMA 2DVXA 2DH3A 2QUMA 4V28A 4I8YA 3AXXA 1E71M 5E70A 5JH2A 1XINA 1JXKA 2GVJA 3QV9A 5ECUA 1M6JA 2Y6ZA 1UMYA 1OCQA 4P5UA 3Q2DA 1HL2A 4N6EA 4L9YA 4UMBA 2AQWA 5IM51 5AYBA 5A6AA 4P8WA 3LGDA 1AQFA 4A3YA 2CZFA 1Q8AA 1QK0A 4JKKA 3VKAA 9RUBA 3GZ3A 1GPWA 4G2DA 4FR6A 4Z1AA 1AD1A 1XDLA 4G8TA 2B7OA 1DWIM 2RDUA 3EA2A 1TCMA 1KC7A 2YCLB 2PWUA 3LSBA 4C1KA 1V3HA 4UTWA 1DP0A 4RKAA 4MAZA 1VBJA 1U5JA 5EMUA 1IZCA 3CZEA 5DXYA 4HU4A 1P0KA 4XO7A 3W1XA 3SQSA 1XD1A 2Y8VA 2PP3A 4JTRA 3P3BA 1A5UA 1HP4A 3RDKA 4KWUA 3ARSA 3BSGA 5LNUA 4PSRA 1QWGA 4A4AA 3ITYA 1HL9A 1VFFA 2WJDA 5AZ1A 3SM0A 1G4TA 2NV1A 1VHNA 4DXKA 1TV4A 3SB0A 2QVHA 1ZJAA 3CUJA 4LU0A 3WH7A 1CENA 1SZEA 1M41A 4TVUA 1VFLA 2Y7EA 3VINA 2FZMA 4HZMA 2A3LA 3SCPA 3DH7A 1BTMA 1Y0EA 3KCLA 5CQ1A 3T0TA 2ZE3A 3KBMA 3DEQA 1SO4A 1UZHA 2V5BA 5JIPA 1WNOA 1TE6A 4KFOA 5MKGB 3ITVA 1OFEA 3INPA 3VD9A 1UWTA 2AAAA 2OELA 4WKHA 4UBPC 1KNWA 1A49A 3ZR4A 3WMSA 1XH2A 2PDBA 4R88A 3S6DA 3TN4A 5DRCA 3UGVA 5CSUA 4US5D 5CBJA 3RGTA 3VNJA 2LLEA 3A5FA 4J3VA 5CJMA 4AZ5A 3AXMA 3A47A 3CUGA 4QLKA 3MHFA 3S1UA 3VGFA 3E96A 1RK6A 3DESA 4XVDA 3PTKA 3BLLA 3SURA 2AGTA 3GFXA 2JF6A 2G5WA 5CPNA 3ATYA 2JGQA 3ZLFA 3G1XA 1H41A 2QUTA 3KVKA 4JFWA 3QVQA 2PGEA 3M07A 2XIJA 3W7RA 4H83A 4DRSA 3GTXA 1R46A 2Y5EA 4HHPA 3ITTA 2OQHA 3U5UA 3NQGA 5B7ZA 3UYIA 1B3VA 3LYEA 1F6PA 1AQ0A 2QZRA 3JZEA 2DORA 4C6IA 1OZQA 4JAWA 2XYLA 2PMQA 1UW9A 4GC4A 1LROA 5KZEA 2QDEA 1C9DA 3QMTA 5BMWA 1XM3A 3W1TA 5EMLA 5HR6A 4I9MA 3EWUA 2Z1XA 1R3YA 1JQVA 4WZHA 2ANUA 4JIEA 5BROA 1H50A 2FTPA 2FTYA 5IFTA 4A8RA 5FF0A 3EKLA 3SCNA 3T42A 5KZDA 4O0KA 2QKFA 3BDKA 3LA4A 1ZJBA 4Q6XA 5IBXC 1J8VA 1H4PA 2VNCA 4G9PA 3CL8A 2HROA 1R3TA 3AS0A 2R14A 1TV2A 3BXWA 3WLKX 4YL2A 1Q66A 1H5YA 3H2EA 1MW3A 4MF4A 4H8UA 4PN2A 1GYMA 1OB0A 5D03A 4TOQA 4QROA 1Z32X 3RM8A 3TJLA 4QGCA 3K1DA 4XD4A 3P8IA 1YTEA 4MB4A 3N3MA 4OV9A 1JQXA 1C91A 4EOUA 5DY2A 2CZEA 4E38A 5CC3A 1GJUA 3A3WA 1WDWA 5T26A 2PODA 3KBWA 3W2LA 2YX0A 3NZ1A 4HZ8A 5C70A 3TYAA 5A6BD 4ZZ9A 4K6AA 5FSEC 1XKYA 1NP0A 5AYXA 3I3BA 4DO6A 2WLYA 2Y7DA 3MU7A 1QNQA 4MKVA 3S2CA 3S5NA 4LVGA 5T9BG 4AX6A 5I24A 4WOZA 4UQ9A 5ABGA 4CN1A 1E51A 2ODOA 4ZXOA 1IE7C 1PS9A 2ZZ4A 3VUSA 4AYGA 3PUDA 2WKJA 5I3IA 4H1ZA 3GW3A 3TYZA 4A29A 1E4LA 3LMYA 1FA2A 3W29A 4WJXA 4IH3A 2NV2A 2XISA 4UTJA 3SY8A 5GQBA 2E7FA 2WKLA 1PHWA 2P0IA 4HBKA 1S5MA 3UFYA 3EWDA 3I6EA 3IIZA 5AYYA 3B8UA 3CIWA 2P8CA 2G96A 4ZB5A 4PUKA 3R4IA 3MUY1 2PWDA 1R3VA 3W7CA 2PDNA 1N8WA 4C5YA 4GQBA 1VRXA 4MGGA 1QFEA 3B4YA 3QR3A 3TN5A 5BU9A 3R94A 3MSGA 4JQ3A 1X1OA 2O56A 4LALA 5E0CA 4GY7A 1L0PA 1OC6A 1JUEA 1EF2A 1FCQA 3RJXA 4C1NB 3CQHA 4QITA 3FAXA 1FWDC 1WP6A 4H6QA 2JE8A 2W6RA 3TP4A 5A2CA 2BXZA 4O0ZA 2E9BA 4LAMA 3W6YA 2QQ6A 2ZA2A 1FWIC 2QJNA 2PDKA 2PGFA 4DO4A 5FI8A 1RA5A 4QNWA 4MMWA 1R3RA 2WNWA 3NVDA 2V8ZA 3VMNA 1N2VA 4IUGA 5TNVA 3N34A 3BL3A 1HNYA 1X8FA 4YN5A 3BV4A 3QTPA 2F6KA 4ZVJA 3BG3A 4P7RA 4KEVA 3DIPA 2I56A 1YIXA 3O3RA 3EX1A 2XN2A 4UTUA 2GUYA 2YYUA 1KM4A 4FXRA 1J2BA 2WLZA 1Q6RA 1S2AA 1W32A 3QHOA 4M82A 4JL2A 1ZP3A 2PP0A 4LAKA 2NQHA 4O14A 3WG6A 3NO1A 4N9BA 1V4YA 1N8IA 3GK0A 3TMLA 4RR4A 3ITCA 3SGUA 1GQNA 2R1NA 4HP5A 1FWJC 4U5IA 1TPVA 1G7UA 5HQMA 3KHDA 5JU6A 3OIXA 4NZJA 4J27A 3ZYZA 2RDXA 4DZHA 3MP4A 4JN7A 3C4UA 3W1UA 3TNBA 1UJQA 3RXZA 1OC7A 2J27A 3U2OA 4W85A 4Y7EA 1S2TA 3FVDA 3UCQA 3APTA 3S46A 4IJRA 4XZIA 3BAIA 4JTHA 2OQLA 4NXSA 4GC3A 3PZNA 1EUNA 1TO3A 1DE5A 4BY3A 3SGZA 5DXXA 1DYSA 3ZR6A 1R8LA 4GCAA 1F3XA 4A8IA 2TMDA 1JYXA 1E1EA 2I9UA 1PTAA 3CIXA 3SW6A 2D22A 4FOUA 3QOMA 3MPGA 1KQYA 4WD0A 3AIUA 1V6WA 3H2NA 1R7OA 3GG8A 4B5UA 2EPHA 2PURA 3L67A 3W3OA 4NYYA 4PMJA 2DZBA 4MJ4A 1DQXA 2GVLA 1ZBKA 3MZNA 1BVWA 3APGA 3MTWA 4PTXA 4TVCA 2XH0A 4IXXA 2HMCA 1A0EA 4RV8A 1JDDA 3GR7A 5C8BB 2HSAA 1U33A 5EMJA 3GH4A 3WFZA 3VZXA 1F3WA 2XPKA 3IEBA 3DI0A 2QCEA 1AQMA 4JX5A 1KGWA 3FN9A 3AJXA 4ZB2A 1EC8A 3GTNA 1UB3A 3WH8A 4FSAA 2W3ZA 3SUTA 3VK5A 1XICA 2WJFA 1IHIA 5F2MA 2FKPA 2IKIA 1P7TB 3GC2A 5H91A 3AROA 1PYFA 3PY2A 5HOSA 4ZGYA 5AHNA 1E3XA 1RCQA 4O10A 4IJBA 4YVVA 4B3KA 2VQUA 5L6UA 1A5BA 2VR4A 1XX1A 1J9YA 7A3HA 3LS9A 1QDSA 3HA1A 3IIVA 4EAMA 1OX4B 2KX9A 4IICA 5E1QA 3RG6A 1IT8A 4WSJA 3EMZA 1LZOA 4GJIA 3EA3A 4R3UA 1SR9A 1JF5A 1LLWA 1KFLA 3N12A 1B3OA 1QU4A 4Y9PA 4MVAA 2O9OA 1U5VA 1H7OA 1X38A 3CV6A 1L6SA 1GVIA 2PTYA 3SAZA 2VXNA 1HKIA 2GWGA 1UWSA 3H21A 3ARYA 4JTUA 4ZOEA 2HE5A 1JVNA 1OGGA 3DUGA 4AF0A 4IGMA 4D2JA 3N6JA 1KKOA 4XISA 1FDYA 3SCVA 1EKOA 2RHGA 2VZSA 3QLLA 1E6QM 5JH1A 5IHSA 2WHMA 2HBXA 3I3DA 1E6NA 4DNHA 3K4WA 4R33A 3VI2A 1VLWA 1E1FA 3OZYA 3TIMA 3LENA 3DG6A 3TW9A 3M47A 4EPDC 2H6RA 4KWWA 1F2JA 3ZLHA 3E0LA 3R8GA 4EACA 3CH0A 3RR4A 3W7PA 1TRDA 2HJPA 3TQPA 2VVNA 4UNLA 4NZ5A 1PUDA 5HK4A 4B9ZA 4C7DA 4PH6A 1AJZA 4RLIA 1XLCA 1EOMA 2PDLA 1R86A 1DIOA 3TFXA 3QSTA 3UWWA 3A22A 3A4WA 1X6NA 1UR4A 4HMCA 3NQMA 1TTPA 4LUSA 1HG3A 4PB4A 2YZRA 2GK1A 2I16A 3LCFA 1T8XA 1CXEA 1LP6A 2QPSA 3W02A 3KOYA 1GW9A 3V0TA 5LIXX 3W7JA 3DDMA 4AISA 4TUFA 2BY2A 3KWXA 1Q7MA 3WN6A 1HP5A 2WHKA 2TRSA 4WKFA 4DVOA 3OHMB 2PC4A 1Z41A 4FXJA 2E77A 2Y7GA 4Q32A 4B4FA 4JD4A 1R3SA 1TWZA 2OJPA 4ERIA 4D6GA 2CC0A 1KCLA 4ERGA 3YPIA 2PDWA 1N8FA 5KTLA 5D2WA 4ML9A 4OT7A 5CZTA 3WD0A 3S4TA 3BQ6A 3C61A 3F5JA 5I00A 5G2IA 3OVGA 3SCRA 1Z89A 3LV6A 1MFUA 1OC5A 3IVSA 2J79A 3S1GA 3IJ8A 4IIEA 3UCDA 3PWIA 1LL7A 1FFQA 4CQDA 1H63A 4L1WA 2CFFA 3T0DA 4KRUA 3WQGA 2BVTA 1EBGA 1A5CA 2HS8A 3FJNA 5AHIA 1MVYA 3A6OA 4IPPA 3QSRA 1KBJA 4LQ1A 3QZEA 3B06A 4RPPA 5JBDA 3CB8A 4UQEA 1DJIA 1E1CA 2EG8A 3RFAA 4DWDA 3PPHA 1OY0A 1QHZA 3LHVA 1M53A 3CQJA 1K8ZA 4L6HA 2P1FA 3LB0A 2J7DA 1UR2A 4YJ5A 7PTDA 1DJWA 3NFUA 4NZCA 4H04A 1N7KA 3EXSA 1EGZA 5A6BA 1F3TA 3DI1A 3F2DA 3KS5A 2OEJA 3ITLA 3WLHA 3OQ8A 1TIMA 2WB5A 4Q4SA 3ZT7A 1B4KA 4GQGA 3BGAA 4XO6A 1A4MA 3GDBA 1IEIA 2V81A 4MFEA 3U0HA 4IX0A 4WIWA 4R85A 2VJXA 1XSIA 2O55A 4XK2A 4CQ9A 2ZRWA 3H24A 2PA6A 3N6HA 2YXOA 2I17A 4GJ1A 4K3ZA 3WQCA 5HXMA 1ZZMA 3DHDA 1JYNA 4EWND 3HQNA 3OLEA 3P7YA 5HJXA 1W3NA 5F1VA 1HW6A 4LYKA 1P0BA 5EMMA 4CKQA 1VEMA 5EL1A 1GZJA 3OGRA 1QBAA 3KDOA 1HKMA 3LNMA 1K8CA 1BTCA 2WSRA 3KOFA 4IFKA 3PZIA 5AOUA 3WYZA 1E6RA 1HZYA 3PFRA 4RW5A 1OYBA 1KW1A 2A85A 1R9ZA 3BQ5A 4LVAA 2HQAA 1V79A 4WUIA 4V1YA 4CNTA 1F05A 2DIKA 4GI4A 1RPXA 1EJWC 2YBTA 1CNVA 4PRTA 3VGHA 2BHZA 4PMUA 4QG9A 4S3BA 1OCNA 2C0HA 4TR9A 3NQ7A 1GKPA 4Z42C 4CNNA 1KM6A 3W00A 4BEQA 3CQIA 4AD2A 2Z24A 3UXIA 5CZSA 5A8NA 1L8PA 3N2XA 2E6AA 2ZXAA 3GNXA 1Q3NA 5DMMA 4LBRA 3RCNA 3LERA 3VKJA 2YDRA 5CJ5A 1TZZA 4C90A 3CHEA 4FF7A 4MPKA 1XHGA 4LAUA 1ZQ5A 4NZFA 3S1VA 3F4WA 2G3JA 4AYSA 4F3HA 3UXAA 1G01A 4AAJA 1WBHA 3R79A 4XX6A 5E5CA 1DQUA 2IQTA 3ABQA 4UQCA 3GVQA 3FLUA 4QJ4B 4NG3A 4M5PA 2BY1A 4ZMGA 2WVUA 1AQHA 4R7OA 2G3MA 3ABSA 1CW2A 4LBSA 1CB2A 3CQ0A 3CWNA 4S3FA 3G8EA 1SJBA 2CHOA 4GI6A 3WUGA 1CXHA 2NW0A 4ATDA 1W54A 4RNFA 2YJQA 1IIHA 1EJRC 3B40A 1VP5A 4UFMA 5BMXA 4P2VA 3K4AA 2PBGA 1LORA 5CG7A 1XIBA 2WBGA 1O7AA 4LNYA 3OG2A 2BBFA 1GYNA 4HOZA 1XLGA 3TXZA 4UZSA 3CWHA 1QI4A 5AHLA 4GD0A 3SY5A 3GHUA 2Y7FA 1JEZA 4Q22A 1YNYA 2XFRA 1L9WA 1Y8BA 3M0IA 2ZWYA 3GC5A 2WO5A 3ENLA 4ACZA 4WRHA 4IWWA 4DJEC 3W1AA 2J88A 4E8GA 3L0NA 4GABA 4HNUA 1UR1A 4LT9A 2DT1A 4FZIA 4ADTA 2YSWA 1JPDX 3LCGA 2PWGA 3K8KA 3KLKA 1TV3A 2WPGA 3ITGA 4JIPA 3I10A 3MUZ1 5G1MA 1AW1A 2GK1B 5EMKA 3V1HA 4TV6A 3KBJA 5ABTA 1F4HA 1KLYA 2PP1A 3OYXA 5I78A 3CT2A 3CYVA 3WMCA 5RUBA 1DWJM 4JTTA 3GDTA 1M03A 4LY8A 1KKRA 2BGNE 3FA3A 3GE7A 5I3FA 3O6YX 3PPGA 1M04A 3BSMA 4KEZA 3BMXA 2VENA 4HJWA 4IHCA 4ATLA 4HT3A 2Q8LA 1K7XA 1XG3A 1FP9A 5EB8A 1QATA 3TNOA 3M43A 2BS9A 3KBSA 4KERA 3WH9A 5I09A 3UVIA 4L4PA 4KIEA 1WKFA 4LRTA 4C6LA 1XW8A 3GQYA 4QQ3A 3VXGA 4EP8C 1UA7A 2RH9A 1WYIA 2IQ0A 5BWFA 1W5PA 5I77A 1J5SA 5M2FX 2ISWA 1TUFA 2PF8A 4GUHA 5CXPA 2ZX5A 1ZSXA 2VFHA 3WQPA 5I02A 1TVNA 4UTKA 4J9JA 3L12A 3KM8A 5PTDA 2DVUA 3ITXA 2CESA 5BYWA 4YIWA 2NXIA 2JBMA 2YW3A 4BEUA 2QV5A 4RNIA 1UQYA 3GLCA 3NOEA 1OT2A 1VIWA 1X1ZA 1UKPA 5M5DA 1XIFA 4ERAA 3TMQA 4S3CA 1X6LA 5AKQA 2VGFA 2GYIA 4ASTA 1SMAA 1W56A 1RJQA 5D2YA 3NQ8A 1FHUA 3ID7A 3S2JA 5DCEA 4JFTA 3LXCA 3E12A 5C55A 5U4NA 4IP7A 1KB3A 2NLYA 2VEFA 4KS0A 4CN4A 3IGHX 1WAWA 3CXOA 4RUBA 3S5SA 4REQB 4QSFA 2ESCA 2J62A 4GIAA 1KLZA 1TPH1 3QY7A 4WDUA 1CECA 1TX2A 4DYEA 3CPRA 1BGGA 4QFUA 3UG8A 3VIMA 1JGIA 3WUBA 3WQ5A 4CEXC 3VKDA 1G6CA 3AUJA 4ACZB 3AYVA 1KR1A 4LC8A 3G3DA 3QOKA 4XAGA 3AU2A 4IL2A 1WKDA 4L64A 4K39A 4ZBCA 3W7KA 1WPCA 3IACA 2I5IA 4EXBA 5BW6A 2E0PA 3F1QA 1O66A 4LVFA 2BWGA 4CCCA 4CN6A 3EWXA 3W2UA 1BQCA 4ZQNA 3QBUA 4Z2LA 2WZTA 1RP8A 2Q09A 3DYPA 5BNKA 4PUMA 3KTXA 3NQAA 1F7BA 3HJEA 4TXEA 2UY2A 4O52A 1IV8A 3RCMA 1W1TA 4FF5A 3TQ0A 1FWWA 5F4WA 3GC4A 2PD5A 2A7RA 5HQLA 4GK8A 3BO9A 4M1BA 3WD2A 4IIHA 1ENUA 2CLMA 1HVXA 1XLLA 1NJJA 5DQPA 5TD4A 2HXTA 1CLKA 3NL6A 4LV9A 4MWAD 4DPQA 1S2WA 4S23A 1LQAA 3UY7A 5A6KA 2C1IA 6CGTA 4NVTA 2B4GA 1AG1O 2GZXA 1QPOA 4AWSA 3BPWA 4HNTA 4M1RA 2CNCA 3RPDA 4LCRA 5IDZA 3LZ5A 3LI0A 4ZOAA 1VPXA 5IOBA 5T91A 3LTSA 3GNPA 4DZ5A 6ALDA 2ZXBA 1NARA 1U1HA 1TPUA 4LTSA 1ADOA 1GVSA 3FA4A 3U2CA 5KITA 1JZ8A 3KVLA 4GIEA 4H6KA 1R9YA 1RBAA 1E0TA 1OINA 4YPJA 1TVLA 1XXXA 4XQ6A 3TLQA 3VIOA 4OV4A 5D4YA 3B9EA 2ICSA 3IIOA 1M7OA 1J6PA 2DUZA 3SJ3A 4EF9A 2VC6A 1JZ7A 2CZVA 1ZJHA 3BW3A 1ICPA 3POCA 4F48A 4O16A 4D9PA 1TJ0A 1LBFA 3LPGA 4JNMA 4JQAA 2QCMA 1JDCA 1GVYA 3WNNA 1DEDA 3H4WA 3UZZA 2WMIA 3DC8A 4B5WA 1CB7B 1UBSA 3P82A 3LNPA 3O6CA 4JTLA 1HVQA 1DWFM 4PEEA 2HDJA 4YTRA 2HBVA 4GG9A 1EGVA 4DPPA 4MAVA 4G7FA 4JFSA 4C1NA 2H9AA 3S2NA 4H9VA 2BMBA 2PRMA 3FEQA 2FPTA 1HGYA 2F38A 3F4CA 1OBAA 3WBYA 4LWWA 2AOSA 1P0EA 3TTEA 5A3HA 1RY8A 4XBSA 4ENLA 3MYPA 3C3UA 3NSNA 3UZWA 3RX2A 3TAKA 4GZ7A 1MI3A 4O54A 3GDKA 4HA3A 3NQFA 4NF7A 3EOUA 1RHCA 2X1IA 3BJFA 4MIMA 3R10A 4EXAA 2Y24A 4LVBA 3C3NA 3OZOA 4E2VA 3DYMA 8RUCA 2WSKA 2IXVA 2PUZA 3VOFA 4CUCA 3M0MA 2CIPA 1LQ0A 2FH6A 1XPYA 1KM1A 4WQ6A 1X39A 4QCFA 2A2IA 3A4JA 4LYPA 3B4UA 5A5WA 3WUEA 3SRKA 2WC4A 3GTIA 1V6UA 3CAWA 4GUGA 2CLOA 3FIGA 2H8ZA 4DF0A 1I1WA 4R34A 2FH8A 2NWSA 3LCXA 1JYWA 1H7NA 3G1HA 2TAAA 4Q33A 2WZIA 4JY8A 2UY5A 3WLQA 2ZZ7A 1IYXA 2F2KA 4QDMA 2HNHA 2PWFA 3CUZA 4LF1A 3E1F1 3GVVA 4IMGA 3LXAA 2PGRA 3LCWA 5C9ZA 5FAGA 3KLLA 1ADDA 3N2MA 2C1HA 4H9TA 4TU1A 2A7PA 2GPTA 1F6YA 3NA8A 1EZ2A 1BRLA 2KZHA 2XIOA 3UNDA 3OP2A 4NJKA 2R6OA 3ZSSA 2RFGA 3LEPA 3WLIA 2A3BA 1GEHA 1QTWA 1PEZA 3NR0A 2ZTKA 2FQIA 4AEEA 1J4EA 2J9XA 3GVGA 3TCEA 2ATMA 4AC7C 1EJTC 3LHTA 3D3AA 4U31A 5K9XA 2GQAA 1K03A 1P48A 4Y2WA 3PB0A 2YIHA 3AHXA 3NEHA 1QMLA 3B9NA 2PWHA 5EY5A 3RM9A 3ES7A 3AOFA 5BRQA 5HMSA 2ZZ5A 4PR4A 3P60A 2YCKX 3IARA 4WY0F 1AMYA 1BHGA 2X0HA 1GW1A 1IR1A 1FCUA 3CM4A 2PTXA 1E6ZA 3GIQA 3RMEA 3DG7A 4U3CA 5T8GA 4GX9A 1P6CA 1ZLPA 2DPEA 2G4JA 2XFFA 2Y5SA 4UXDA 1GHSA 4AIUA 4NL1A 4JX4A 3KTCA 2P88A 3NSMA 3BK0A 2F61A 2PTWA 4CU6A 3VIKA 1ME8A 2E1DA 4CD6A 5A6SA 1GHRA 3H70A 4MM1A 3BG9A 3AS2A 3UXDA 3UG3A 4GOAA 3RPMA 2WSYA 1R2SA 4A3QA 1CPUA 3W27A 2YLLA 3N6QA 4LVDA 2R82A 3OBKA 3UWQA 3CMGA 5CSYA 3GHTA 4DEFA 5C9WA 3VZZA 1EA0A 3MI3A 1KV8A 1EWEA 2C6QA 3VM7A 5DEZA 4RXGA 3BLOA 4JICA 3TYCA 3WLRA 3O06A 4DO7A 1IIGA 4LOCA 1ISVA 2ADAA 3B04A 1PJ9A 1EFZA 4DNMA 4QIUA 4J40A 3BAYA 4PUJA 3H26A 2VOMA 2PI6A 4HA4A 1RAKA 2XZ7A 4UIOA 5MKGA 4C91A 3CV1A 2OZTA 5DRIA 4HGXA 4DAIA 3IAQA 1GVOA 4O1EA 2DJLA 4A3UA 4G56A 3TN3A 3GVRA 1XL9A 3WLTA 5DF0A 3BW2A 3EMQA 3W9ZA 3TAOA 1ZS2A 3AZTA 1VYSX 1MDLA 5HMDA 1WO2A 3KL0A 4E5TA 4Z1DA 2XGIA 4HHHA 4AD3A 3EEGA 3RYSA 3N13A 1XLKA 3A9BA 1FP8A 1IZKA 5E93A 5EFFA 3IGSA 3NQBA 3GXFA 3F4NA 4FMVA 4JHZA 1L2QA 4CD4A 4MTVA 2BXVA 4TMBA 2V63A 2PWEA 4LNCA 2OPJA 4IIBA 5G2HA 4HA1A 1POKA 1KFBA