5LYRA

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-noeuromycin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
total genus 134
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5lyrA00
5M17A 1W9UA 1FHLA 4PRWA 3RM4A 1EHNA 4PCTA 2D0GA 1MYRA 3BC9A 1GOMA 3AICA 3L4VA 2XUCA 1P6WA 2BY0A 2QPUA 2XM2A 1OGSA 4FF5A 4MJ2A 4KGJA 2W92A 1W91A 1ZB5A 2XFFA 2ZXAA 2DEPA 3WL1A 1E4MM 4P8VA 3I3EA 4XZWA 3QOKA 3CZLA 3O6AA 3VMPA 3VGHA 1TA3A 1UR4A 2G3JA 2RGLA 3IK2A 5D9MA 2J47A 1UR8A 2EPMX 5A2AA 3FN9A 3E1F1 4BS0A 1KGXA 1JF5A 1JL8A 5A2BA 4GKLA 2TAAA 2JF6A 2WHMA 2XJ7A 2DQXA 3W28A 4BQ2A 3WDHA 3CUGA 3SCOA 2A3AA 1W1VA 1HVQA 3ECQA 2ZX5A 3WNKA 1UZ4A 3AFBA 4CD8A 1OM0A 3CZGA 2XFYA 1GVYA 4PSRA 4FMVA 1CLVA 1C8XA 4A3HA 5CSUA 1E40A 3PTMA 2GDUA 3WF4A 2VR5A 3K8MA 2W66A 5ABFB 1V02E 3L4TA 3T0DA 5IXEA 1TVNA 1DEDA 1ISYA 2BXZA 2A3HA 3MMUA 1CXLA 3WD1A 1K6AA 4OBSA 5ABFA 3AROA 4LXFA 3VD7A 4MB1A 2CBUA 4D72A 2D0FA 3NYDA 1QNSA 2XVLA 1HL9A 1V3JA 4V27A 4PMXA 3TTSA 5LA2A 2JEPA 2XFRA 1HXJA 4D6EA 3F4VA 2DH2A 1OGBA 4UFMA 1JDCA 2VNCA 1HKKA 5HOSA 2BY3A 1XH0A 2VURA 3N1AA 1HX0A 2E8YA 1ZS2A 4W8BA 3WD3A 3ALFA 4GXPA 1JNEA 3TOPA 3GNRA 3QGVA 4PTVA 3TONA 3A4WA 2J74A 3NSNA 3AS0A 2Q8XA 1GQIA 1R7OA 3W24A 4GI8A 4M56A 3B9EA 1XCWA 4GZJA 3BCFA 1V6YA 3PZOA 4AD4A 5E9AA 2CITA 2AOSA 5I3DA 2PC8A 1YHTA 4W5UA 3VGDA 1V3LA 3VVGA 3WH5A 1OINA 2PF0A 4PN2A 3LPGA 4W7VA 3QHMA 4B3KA 1GOKA 4WF7A 1Q6GA 4YHGA 1WDRA 2D1ZA 5I5RA 2VCCA 4URIA 1D2KA 1BYCA 1UD2A 1PZ2A 1LG2A 3B8SA 2VRQA 3AIEA 4W87A 1UA3A 4QLKA 1J01A 3WQVA 1NWRA 2J7DA 4F9DA 3AHXA 1H4PA 2GJRA 2XWDA 4IPLA 1XV8A 5BCAA 1UOKA 1D3CA 2WXDM 1UR1A 4M82A 3UG3A 4CU8A 4H7VA 3F5LA 4OJYA 1N82A 2W67A 4ACZA 5EMYA 1WE5A 4PMZA 4AZHA 3WNLA 1XSIA 3SCWA 2O9OA 3WNMA 1VJSA 2GJPA 1EGZA 1O7AA 2G8ZA 3ZIZA 2FHBA 2D23A 2WVVA 4NZCA 1BSIA 4OOUA 2WCGA 5FD0A 2OWXA 1EH9A 4RE3A 2V3GA 3PZTA 5HPOA 2WVTA 4CU6A 1GJUA 2CCRA 2YA0A 2CETA 3QR3A 1V3MA 3WDIA 5JBFA 2G3IA 1OT2A 3WH9A 4J3WA 3BXWA 3KL3A 1JXJA 1JI1A 4HPHA 5A94A 3WSUA 3SUSA 4EE9A 2J25A 3CUFA 4R5EA 3BLKA 1BHGA 3RPMA 5ABGA 3G6MA 1J18A 4HA1A 4RL3A 3W0KA 1W9DM 2CIPA 3KEHA 1EA9C 4UOZA 2XGBA 3HMCA 4AIEA 1GQKA 1YQ2A 4NF7A 1OB0A 2WANA 3W6MA 5CQ1A 5GQBA 5BXSA 4F79A 2C7FA 1KGUA 2W91A 3DHPA 1VIWA 2BXYA 1J10A 5AYIA 3U7BA 4CD4A 2VC9A 1UG6A 4MB5A 2VX6A 2YDRA 1CGWA 2PB1A 2WCSA 4MADA 2FHFA 3SEPA 2BHZA 2YA1A 2EEXA 1WZMA 3MS8A 1FHDA 1UYQA 1E6PA 3MU7A 4UZSA 2VTFA 3VMNA 4CD7A 3CUJA 3SUVA 4GIAA 3T0AA 1CNVA 3RILA 3RM8A 4IISA 2WBGA 1B0IA 1J11A 2DSVA 1LL6A 2YL8A 5IHRA 2BS9A 4UOQA 1KR0A 1MW0A 4Z2HA 1OWQA 5AY7A 1EOMA 1BPLB 3WF2A 2V5DA 1UQYA 1GHRA 2WC4A 2GK1B 5EFFA 2WHJA 3L4WA 1KQYA 1L8NA 2PBOA 4JFVA 4CCDA 1NP2A 2PWGA 4JCLA 1J0YA 4UFKA 1PX4A 3RDKA 4W93A 4C7DA 2B31A 4U31A 3WQ4A 3OB8A 1NOFA 2VUYA 4UCFA 5A6KA 3CZ8A 1E55A 1UA7A 4IPNB 4HMCA 4W88A 4JL2A 5M3WA 4H8UA 4UQBA 3ARTA 4Z2IA 4NSBA 1E6QM 2DPEA 1JYNA 1E3XA 4CCCA 2VJXA 5LYRA 2ZX7A 1JZ4A 1VJZA 4JKKA 5JBEA 2EPLX 2DGAA 5GPRA 1W2VA 1E43A 4XX6A 4CGTA 2ZUSA 2FHCA 3KL0A 1FH9A 2VCAA 4DWSA 4AY1A 1SMDA 3TTOA 2E8ZA 3LMYA 4L4PA 3AJ7A 1BG4A 1DWFM 4FLRA 5HXMA 5BWFA 4X9YA 3TP4A 2EJ1A 4F9JA 3T0BA 1JDDA 3NIYA 1JI2A 2VX5A 3BAJA 2BFGA 2VZVA 2WCAA 1DTUA 4PUEA 1W9XA 1KQZA 3FHQA 1QI2A 4CN4A 1RD6A 1KWGA 4QFUA 1J0IA 3W37A 3VIMA 1XGZA 3NCOA 6TAAA 1FFQA 5FKYA 2WW5A 3BH4A 3AHYA 1G94A 1M7XA 1Q6FA 3VU2A 5I0DA 3T09A 2OLHA 2GDVA 2CKRA 1I75A 1C93A 1CGTA 2XVGA 2OSWA 4D6JA 1LL4A 1V6VA 2WWDA 3HJEA 1NH6A 3BMWA 3NSXA 2CNCA 2YKKA 1H41A 2WLYA 2BV9A 2ZUUA 4WSKA 3WQ6A 3AHTA 1XSJA 1ECEA 2CKSA 4WIWA 1VENA 5E6YA 2WSPA 2XIIA 5CPTA 3L4YA 1KXHA 1VEPA 3S2CA 1ISVA 4LGXA 1W9VA 3BAKA 5JIWA 1KCKA 1CWYA 1MW3A 2X0YA 1E5JA 1ODUA 2BHUA 1AQMA 4ACYA 3VIPA 3RJXA 1JXKA 1I1XA 2CYGA 2VMFA 5CJ5A 4WK9A 3AZTA 1E71M 1H3GA 1H5VA 4LYQA 2YBUA 4F66A 2WHLA 3WKZA 4D6GA 4XZBA 1CEOA 4CN6A 3CZEA 1R7AA 1B3XA 1PZ3A 2OWCA 3VKKA 4M1RA 2O9RA 1FFRA 3FY1A 3W38A 3BAXA 5ABHA 3ARVA 3M46A 3OLEA 2VRJA 3QOMA 1FH7A 2J77A 1NWUA 4UR9A 3GH5A 2A3BA 2ZWZA 2FH8A 4MTVA 4LYPA 3CUIA 1VFFA 1GQLA 2VL4A 4J27A 5FL0A 1XCXA 2AMGA 2F2HA 2MANA 4GI9A 3K8KA 5CLTA 4W85A 3VNZA 3SCSA 1EQCA 3N18A 3BLPX 4HTYA 3ARRA 3CLWA 3M7SA 3GBEA 4UQDA 5DO8A 3AMGA 2CBVA 1IT0A 4PBGA 3WMSA 3ARXA 3GH4A 2YIHA 4TVCA 1E6RA 3MUIA 1CYGA 2D3NA 2WAGA 1NARA 3WH8A 8CGTA 3WY1A 2DH3A 3WH6A 3RM9A 3W6LA 3N04A 4WLCA 2VX7A 3I3BA 3CHDA 2EQDA 3ARPA 1DWAM 1G9HA 3A47A 1EDGA 1VF8A 3AHZA 4XUYA 4CD5A 3NUKA 1TA3B 2VZSA 3K4AA 1MW2A 5D8ZA 5FOOA 1R85A 3BAWA 3VM7A 1DP0A 2QPSA 1HJSA 3CMJA 4AYSA 4S3JA 1BGGA 2FGLA 1CTNA 4BQ5A 5CG0A 4KRTA 1KWKA 3MUY1 2E9LA 3U5YA 3WF1A 1E73M 3AOFA 3NJ3A 1UD3A 4DWSC 1OBAA 1EQPA 3WUBA 3VD4A 1E0VA 1UD8A 4AZBA 9CGTA 4PYSA 4WKAA 3W82A 1SR0A 1S46A 3AS1A 4V2XA 1WZAA 3DC0A 1QI3A 1V08A 2XWEA 3WBEA 1JYXA 1UKTA 4HMEA 3VIJA 3RO8A 3ARZA 5DMYA 1UKQA 3AMKA 1UKPA 4E4PA 5C70A 2A3EA 2WM0A 3PZ9A 1HP4A 2WVUA 4PMRA 3KWXA 4UTFA 4CU7A 1PIFA 2DSWA 4HPGA 5JIPA 4JAWA 2ZXQA 4PTXA 1U33A 4JFUA 1G5AA 2WMJA 4JL1A 3WUFA 3WIJA 3PTKA 3TTYA 3ZR6A 5A6BD 1QI4A 5CZKA 4BA0A 6CGTA 1PAMA 4ATWA 1J0JA 1LWHA 1GJWA 1E3ZA 3EDKA 5E6ZA 4KMQA 1MXDA 2J7CA 4AEFA 4D71A 3CZJA 1OIFA 2WB5A 1FH8A 4MB3A 1KR1A 3MMWA 3WFLA 3EDDA 4ZE5A 4C7FA 1OSEA 1UH2A 2OSYA 2XVKA 1E1EA 3DHUA 1W1YA 4FK9A 4UFHA 1LF1A 3UR7A 1K9TA 1Q4NX 1CGXA 5DF0A 2ZX9A 3M6DA 2CXGA 2WBKA 5A8PA 1RH9A 5A8NA 2XVNA 2VVNA 1GHSA 3TA9A 1UR2A 4MDPA 1GZJA 1XD0A 4AZGA 1NOUA 2JALA 5I78A 2J78A 3AIBA 5GNYA 4N0RA 2FDMA 4EAMA 2BY1A 5CXPA 4CUCA 3EMZA 4ML4A 3AYSA 3PZGA 2ESCA 4LYRA 2WVSA 3UR8A 4BQ4A 1ZBKA 3OZPA 2QMJA 1ODZA 2BNJA 2UY2A 4AC1X 2CERA 5CGMA 3VTRA 3WD4A 1LLOA 3BAYA 2ZX6A 3KL5A 1JAKA 4UFJA 1XC6A 2D24A 1NOWA 2CBJA 1JD9A 2CHNA 2ZUVA 3GXMA 4OIFA 3CH9A 1AVAA 1BYDA 5FCZA 2XPKA 1NP0A 1OGGA 3WMCA 2E9MA 3NSMA 1VB9A 4QAWA 4PMDA 1QHPA 4L4OA 3KZSA 4ACZB 5EB8A 1E72M 4AXNA 2VZOA 4LQ1A 4CVWA 1UR0A 3UG4A 2UY3A 2WVVB 5F7UA 1W1PA 2XHYA 3SCQA 4C7GA 3POCA 3AZSA 5I23A 1WO2A 1M03A 3T2PA 1E70M 5D9OA 4ZXLA 4P8WA 1NM9A 4NRSA 1KCLA 3CZKA 2GVYA 2GJXA 2VRKA 4PCSA 1JZ5A 1ITXA 1XH2A 1LWJA 1SYTA 4J3VA 2WHKA 2VVSA 1J0HA 1QNPA 2ZX8A 3GXDA 4MPKA 4GO9A 4OBRA 3KE0A 3O2LA 2PWDA 4QCFA 1PX3A 4X0NA 3UCQA 1HVXA 1B3ZA 1CXIA 1CGUA 3DYPA 2YA2A 2J7FA 1Q6EA 2ZXBA 1U2YA 2J75A 2JE8A 1GNXA 1HT6A 1TZ7A 3VGFA 4Z2JA 1QNOA 1G1YA 4MNLA 4BF7A 4HU0A 3II1A 2W61A 2WSKA 2VX4A 3CGTA 2E9BA 4YN5A 1QHZA 1JFHA 2OYLA 3BCDA 1FA2A 5TD4A 1J0ZA 1PX8A 4AEEA 4XB3A 4JFTA 1UR9A 1X1NA 2WPGA 1BF2A 5I79A 1GOQA 4UFLA 4J7RA 1MXGA 2J79A 1V02A 2VT0A 1U30A 4DM2A 3WDRA 3WH7A 1NWSA 2JIEA 1MQQA 1PJ9A 4QLLA 3SUTA 4DM1A 1WZKA 3EDJA 1TVPA 3DYMA 2E40A 3N12A 3WDJA 2ZIDA 4AZCA 4FLOA 4RE2A 4J3XA 3LPOA 2YL5A 1E4IA 2E3ZA 3VDCA 4HOZA 1TG7A 1WAWA 1ZL1A 5EBAA 3M07A 1E6SM 4AWEA 4ZE4A 3N15A 5KZ6A 1GUVA 4CCEA 7CGTA 1KXTA 1F4AA 4DUXA 1RP8A 2O9TA 1EDQA 1UH3A 3GZAA 3ZSTA 1UWUA 3FAXA 4W7WA 3U5UA 2WC3A 2BVYA 3U57A 1VAHA 1FP8A 1KXQA 3S6TA 1UQZA 1QW8A 3RJYA 3ZT6A 1HL8A 4KRUA 1E15A 3GYCA 1CXEA 2F8QA 3JUGA 4MNMA 3VILA 2X8RA 1GW1A 1CXFA 4TVUA 5CPQA 2WK2A 2YBTA 1E5NA 2WYSA 1E0WA 2WMGA 1HJVA 2VCBA 1TR1A 3WMBA 1GONA 3WF3A 2G3NA 1FOBA 2JF7A 2C0HA 4DWSB 5D8WA 5DT7A 2NT0A 1MFUA 1JAEA 4IUGA 2YL9A 3AHVA 2E0PA 3UEQA 1BVNP 1GQJA 4H2CA 1PBGA 3ZT7A 5A8MA 5E70A 3CHFA 4B15A 4PUDA 4W89A 1GCYA 4QLJA 1HJWA 3FXYA 3CMGA 4N42A 2JFEX 3VDHA 5BROA 1W3JA 3DECA 2X1IA 3FW6A 5BXTA 1PPIA 1DWJM 1WCGA 4PTWA 1VBRA 2J4GA 4U2YA 3CHEA 1V0MA 1UWTA 1B30A 1H1NA 3FNDA 4HMDA 3EMCA 3THDA 1QI0A 1UKSA 4R27A 3LPPA 3VGBA 4ATLA 2CHOA 4Z2KA 1QVBA 2YDQA 3ARWA 1LQ0A 1QBAA 2Y8KA 5D4YA 2WWCA 3IANA 1GOOA 2V3EA 1C8YA 5I6SA 1C91A 5IDIA 5GNXA 4H41A 3VD3A 5AC4A 1JZ3A 4MB4A 2ZUWA 4ZEPA 4JCMA 4UQCA 1OIMA 3AXIA 4HA4A 1VFMA 1CENA 4NI3A 5E09A 3VGEA 3AZRA 2G3MA 1HKIA 4D6DA 3MO4A 2QLYA 3GNOA 2Y24A 1M53A 5IFPA 1E0XA 1CZ1A 5A6BA 3NDZA 2X0HA 1A3HA 1H11A 1OD0A 3WD0A 3F5JA 1V3HA 3T2QA 1VFOA 1OT1A 3OZOA 1DWGM 2WKGA 1US3A 4H8HA 1JD7A 2WZHA 3W4RA 5CLWA 4JHOA 4CD6A 2UWFA 4A4AA 2WKLA 1RP9A 2OYKA 3L2LA 1VRXA 3A4AA 4OZOA 3VD5A 2ZICA 3MSDA 1PIGA 1Q6CA 1JG9A 4P7RA 1W9PA 2XSBA 3WELA 5E0FA 3EDFA 3VINA 1AQ0A 2Z1SA 4PEEA 4S3KA 1PEZA 4HZ6A 1IZJA 2W63A 2QHAA 4W86A 2D22A 3WDQA 1WZLA 4JZ5A 2XYLA 5DEZA 1KB3A 1BAGA 5D9NA 2RGMA 1HJUA 4KWUA 1SMAA 1TE1A 1CGVA 4MAVA 1UWSA 1M04A 2XIBA 3AQUA 3PZQA 1QHOA 4B9YA 5JUVA 4WKHA 4JKLA 1ZU8A 1ESWA 1D7FA 1K9DA 1W3KA 3EDEA 3WQWA 5M03A 1GOWA 3GXFA 1DWHM 4AW7A 3EMQA 3OGVA 4AD1A 2XTKA 1CXKA 1HJXA 2EPKX 1V0LA 2WZIA 4IM4A 4LPCA 2DIJA 2UY4A 4AZ6A 4V28A 3WN6A 4J3TA 3W27A 1L0PA 3AS2A 2WMIA 4PMQA 3T2OA 2XG9A 4DUVA 3GNPA 3MV11 2J7HA 2VI0A 1BLIA 4OOZA 2GSJA 3MSGA 3OIHA 3PTQA 4TVDA 3QHOA 1KFWA 2ZXDA 4GQRA 4TOQA 3RMEA 1C90A 4JFWA 3MMDA 1XHGA 1QPKA 1W3LA 4H04A 3MUAA 3AIWA 1HN1A 5E0CA 4TUFA 3SCUA 4MDOA 1VEMA 7A3HA 1X6NA 1Y7VA 2HISA 4JHZA 2IXVA 3CTTA 5CPSA 3PHAA 4DWSD 1B3YA 3ZM8A 5IHSA 1WNOA 3OGSA 2ZUTA 1TFVA 2C8NA 2DT3A 1UD6A 3W25A 1ISWA 1HJQA 5A2CA 2DSZA 4WJXA 1W3HA 2FGZA 4UZUA 5CGTA 3GXIA 3CBWA 2OSXA 4P7OA 1C8QA 3WENA 4EKJA 3IJ8A 3ALGA 1B3VA 1CIUA 1UWIA 1XSKA 3OBAA 3AXXA 3VX1A 3PBGA 4GZIA 4JFSA 4WKFA 2D0HA 1R87A 4LX4A 4W7UA 2Y2WA 3VD9A 1J12A 4W8LA 3DYOA 3ZJKA 2OYMA 3AIUA 4B9ZA 4Y7EA 3VDAA 3ZJ8A 1XD1A 4GZEA 5A6LA 5CSYA 5AYBA 4GPNA 4UOJA 4A3YA 5I2UA 2JIWA 3J7HA 4U5KA 3VIOA 1CGYA 4EANA 1BYAA 1JZ2A 4BZYA 2CPUA 4U3AA 2G4FA 4YHEA 5A6JA 1MQPA 3L4XA 4P8UA 4AZ5A 2CESA 3WL0A 3WQ5A 4HOWA 4CN1A 2VR4A 1K9FA 1B9ZA 7TAAA 4GO8A 3SIMA 2DT2A 3WF0A 1MQRA 1JYWA 3VM5A 1JFXA 3GH7A 1MFVA 4U5IA 4AD5A 1DWIM 5EFDA 2WMKA 5ABEA 3U7VA 3AMCA 4TTUA 5A8QA 5HPCA 2XM1A 2EXOA 1O6IA 1E4LA 3PZIA 2HVMA 3AIQA 3WUGA 2O92A 1CLXA 3WEMA 2G41A 3VPLA 1C92A 1ITCA 1GVIA 4KH2A 3D3AA 2J8GA 1QBBA 3T08A 1VFUA 1AQHA 1W32A 5AC5A 3SUUA 1H49A 4P7QA 5FIPA 2ZUMA 1US2A 3OGRA 3OLIA 1B31A 3IAQA 3EYPA 4AZ7A 3W29A 4GQQA 2DSUA 1CPUA 5GNZA 3K1DA 3WQ8A 4D1JA 2DIEA 2XVPA 2ZOXA 3HN3A 1CXHA 1QI5A 3POHA 3ZJ6A 1V6UA 3WFZA 1WDPA 3VIIA 1XYFA 4GI6A 1QOXA 4UNIA 3PN8A 5DFAA 1B3WA 4BCEA 1ZBVA 5A6SA 4MNJA 3OG2A 4M81A 1G01A 1F4HA 3L2MA 3AIRA 2DDXA 3VNYA 3A4XA 2EPOA 2BVDA 1UKOA 2YLAA 1EXPA 1XRVA 2J8FA 1FP9A 2YJQA 1R86A 2PI6A 5A69A 2X2YA 3SCRA 3WEOA 2GJXB 1IV8A 2W5FA 4AISA 5A6AA 8A3HA 3MKKA 2DSKA 4AD0A 1AMYA 3F5KA 3EBVA 5BXRA 1E6NA 4AMCA 2AAAA 1BGAA 5A8OA 1QNRA 3WDPP 4GINA 1EO5A 2O9PA 4JKMA 1OCQA 3ARQA 2XGIA 1H0IA 2DT1A 4M8UA 3UESA 1GOIA 3O9NA 1MWOA 1A47A 3VIFA 3G6LA 1HP5A 3AI0A 4K68A 4AD2A 5C71A 4FLSA 1H0GA 2WLZA 4E2OA 1JZ8A 1E9LA 1KXVA 2VQUA 4B16A 2NW0A 3AMLA 1EDTA 3LPFA 2V3DA 3N17A 3SCTA 4D6IA 1KBBA 2D2OA 2DT0A 3SCNA 2VO5A 1JZ7A 4D6HA 3MUZ1 1JYVA 1X6LA 4P7LA 1W2PA 1H09A 4RE4A 3AIVA 4HA3A 1GORA 1C7SA 3W53A 4U2ZA 1WKYA 1MVYA 2X09A 4X0VA 5KEZA 2YLLA 3FHAA 4U3CA 1Z32X 4J3SA 2WMHA 3OLDA 2BY2A 1XYZA 3SCPA 2VZUA 2YDSA 4TX8A 2ZE0A 3W26A 5ECUA 4QCEA 4AIUA 4AZCB 5IFTA 1EIBA 5LA1A 1VBUA 2J7BA 1BQCA 1WP6A 3ZOAA 1E6ZA 2WZEA 4QDMA 3D5HA 1RPKA 3W81A 2WC7A 1ISZA 5I24A 2VOTA 1E56A 4E8DA 4NRRA 3WBAA 1ISXA 1CDGA 4Z2GA 3BGAA 3PZNA 4AIOA 3AISA 3NDYA 3GDBA 3L4ZA 3MV01 5A6MA 3OA5A 1TMQA 4OKDA 2NT1A 2YL6A 3K8LA 3RCNA 3TTQA 1UHVA 4FLQA 3UERA 1J9YA 3SCVA 1JDAA 4D6CA 4KGLA 2D20A 5A3HA 4ATDA 2FH6A 1XH1A 3BSHA 1I1WA 4TXEA 5LA0A 4HP5A 2F61A 4Z2LA 3AXHA 4HOXA 2QF8A 1JNDA 1WPCA 1B2YA 3CO4A 3ZMRA 4WSJA 3OLGA 1QNQA 3UG5A 5BXPA 1V0KA 3GM8A 3VMOA 3WD2A 2GUYA 4MJ4A 1VEOA 3WEZA 5D9PA 1JIBA 2YOCA 2V3FA 2V5CA 1MW1A 1Q6DA 2CBIA 3ARYA 2GK1A 3VIKA 3B9DA 4TX6A 3K4DA 3A6OA 3ARSA 3CHCA 4MAZA 1E6XM 3ZQ9A 3THCA 2Z1KA 3IAPA 4HZ8A 1HIZA 1EHAA 4W84A 3ZR5A 1IZKA 2UY5A 1UZ1A 1TUXA 3VIGA 3A3HA 4J3UA 4B3LA 3PZUA 2D3LA 2PWHA 4P8XA 4AD3A 1J0KA 4UQAA 4EK7A 1EOKA 1BTCA 2W4XA 3K46A 4F8XA 4BQ3A 1JZ6A 1QW9A 4UQEA 1KBKA 2EPNA 1V6XA 1UWQA 1ZBWA 3VGGA 3AS3A 2WMFA 2QV4A 4ZXOA 4P7NA 1W9BM 3BMVA 1UUQA 1WDSA 3RIKA 1R8LA 5HDRA 4PMVA 2QMKA 4PMNA 1ZJBA 4J28A 4OUEA 1E4NA 3CUHA 4M80A 4AZIA 1UD4A 4W5ZA 5JBDA 3PZMA 3WUEA 4UQ9A 5HNNA 1LL7A 1WB0A 5M5DA 3FAWA 1HNYA 4PMOA 2W62A 1B1YA 1ZJAA 4ZFMA 3CIVA 1V03A 3APGA 4U33A 4PMYA 5BRPA 3VX0A 4Q22A 1JGIA 3ZO9A 3ARUA 1NQ6A 1JF6A 2IUZA 1BVZA 1B90A 3UETA 2J7EA 4CVUA 4TTGA 3L4UA 1CBGA 4QP0A 2EBNA 2BVTA 3N11A 5FL1A 3VDBA 1M01A 3ZJ7A 4Q7NA 5BRQA 1K9EA 1H2JA 4HU8A 5BYWA 1NWTA 2J7GA 1BFNA 3SURA 3B9AA 3BSGA 3AMDA 2WNWA 4PMUA 2VQTA 5I77A 3BAIA 1LJYA 4H8VA 3ZSSA 1LG1A 1TCMA 2NSXA 2Y5EA 4HZ7A 5C8BB 3HU7A 1G0CA 2GFTA 3WNNA 2EO7A 2ZWYA 3I3DA 4W8AA 1SFSA 5DT5A 2Y4SA 4XV0A 1V6WA 3AYRA 1EO7A 4ZENA 3MANA 1C3FA 3VIHA 3ZT5A 2J62A 3SUWA 3GBDA 1W1TA 2PWFA 3WNOA 2A3CA 4M24A 4DUWA 4CKQA 1BG9A 3IJ7A 4M29A 2OWWA 2X05A 2BHYA 5A1AA 4PTMA 1UH4A 1OD8A 1HKMA 2E4TA 3N13A 1V3KA 3IJ9A 1V3IA 1ZBCA 3N9KA 2WMIB 1CECA 2JEQA 4E8CA 1E1FA 2ZUNA 3GTNA 1UWRA 5HBFA 6A3HA 4YPJA 3VOCA 3CPUA 2VZTA 2PBGA 2V38A 4MNKA 1GPFA 1KGWA 5A95A 1HF6A 1C7TA 1HKJA 2CEQA 4UFIA 1DHKA 2XSAA 3PZVA 1WDQA 3QHNA 3VO0A 4PSPA 4D6FA 1UD5A 2IXUA 2PWEA 2Y8VA 3WNPA 4JIEA 4D1IA 1V0NA 1BYBA 3VUPA
chains in the Genus database with same CATH superfamily
4R7WA 5M17A 2OKTA 3PJUA 4G5DA 1EHNA 4O1DA 2D0GA 1MYRA 3AICA 3S2MA 2XUCA 1FHVA 1P6WA 4K7YA 2BY0A 2QPUA 3P7YA 2FGBA 4KGJA 2C19A 3U48A 1W91A 1JQVA 3MWAA 4Q4PA 1SW7A 2DEPA 2ZXAA 2PSNA 1Q63A 1E4MM 3QPEA 4P8VA 4ZSTA 3EGJA 4IPPA 2RGLA 3NQFA 4Q6XA 4NX5A 2ADAA 3O07A 4H1ZA 1IEWA 4J4KA 1RK5A 4MZYA 2DV0A 7ENLA 1K1DA 1E9YB 3E1F1 2H8XA 5I06A 3C0JA 3SQMA 3EKLA 1XXXA 2NLYA 1PIIA 2JF6A 3FLUA 1YNPA 3WDHA 5I00A 1AW2A 2OZ3A 3QJAA 5D2TA 3GXPA 2QV5A 3NNTA 3A3WA 4IL0A 1VBGA 2YXXA 3NQCA 4PSRA 1DV7A 3LUTA 2PTZA 1SSDA 2DORA 2XINA 3C6CA 3VE9A 4XZIA 3TC7A 5J5DA 3WF4A 1A5CA 2W66A 5ABFB 1V02E 3L2IA 4H6KA 3ITLA 2VEMA 4OWGA 5HMFA 1RA5A 4GMEA 1IEVA 4PEKA 1SJBA 1IGSA 1G6CA 2VEFA 5CPNA 3MMUA 3B0YA 1CXLA 1FKXA 2YXOA 4LXFA 4MB1A 1F5ZA 2IS7A 2PS2A 3GFXA 4IMAA 5CC7A 5HQMA 4ILSA 3TTSA 1H7XA 2XFRA 4IP7A 1HXJA 3S9ZA 4D6EA 4O15A 1X96A 4QG6A 3TWAA 2DH2A 3XINA 4TU1A 1SW0A 3N1AA 2E8YA 2GQAA 4W8BA 3VC6A 4B2DA 2PLKA 4DF2A 3TR2A 4G8TA 4AAJA 3AS0A 1E9IA 3CL7A 4Z1DA 3B06A 1MMFA 1POKA 3BCFA 3PZOA 3R5EA 2ISVA 3E2SA 3KRUA 4F48A 4KPLA 4F0SA 4NXKA 1OINA 2VM8A 1XUZA 4XZ9A 2H9AA 3NVTA 4LWWA 4PN2A 1PL9A 3EB4A 3W9ZA 3ORWA 3N6QA 1EXBA 1QJWA 2X7WA 4XIAA 1EWDA 3QMRA 1D2KA 3HM7A 4HB7A 3B8UA 1UD2A 1PZ2A 3GHSA 1AJ2A 1RZMA 2GUUA 3CIWA 3UZWA 1LG2A 2PWVA 4W87A 1FBAA 1XINA 1NWRA 4F9DA 3AHXA 2VFIA 2Z7GA 2GJRA 4CQ9A 1SZFA 4IPLA 4NVTA 3OBEA 5BCAA 3GSMA 4H7VA 3F5LA 2W67A 3H2AA 1TX2A 2VC5A 1AH0A 2PDBA 1ME7A 3SCWA 3WNMA 2GJPA 4YNGA 2PODA 2D23A 3KHJA 4ERGA 2LLEA 4XD4A 5CSSA 2OWXA 1WKDA 2FVKA 3DBPA 4CU6A 2CCRA 4LY4A 4DPPA 4GD0A 1E0UA 2GPTA 1KM4A 2G3IA 5FEXA 4BWLA 4N4QA 3LHWA 2EPHA 1KFBA 1K4GA 4EPDC 3BXWA 4J2MA 1J96A 3L68A 1KM2A 1JXJA 1WUFA 1JI1A 3SUSA 4EE9A 4IXHA 1YXDA 3W7RA 2H3DA 2YR1A 3BLKA 1BHGA 3RPMA 5ABGA 3W0KA 3UPWA 3KEHA 1R2SA 1EA9C 1LLZA 4M3PA 4XSMA 2DZPA 1K8ZA 3VNDA 4B92A 4NY2A 2WANA 4FAMA 5CQ1A 5GQBA 2JKPA 4LUIA 4NYUA 4WEVX 3N9SA 2PMQA 5AECA 3TLLA 1MI3A 1FRBA 2AGKA 4A2SA 1UG6A 4MB5A 2YDRA 5LHFA 2PB1A 1F6KA 1GYLA 3LGGA 4NJHA 5XIMA 3LZ3A 2IW0A 2HVNA 3MS8A 1FHDA 1WXYA 1UYQA 1DHPA 4CD7A 3CUJA 3SFKA 4GIAA 3AJXA 4HKPA 3W1XA 5T91A 4E4UA 3CJPA 1UB3A 3O06A 3UYCA 1C9DA 1SR9A 1GWJA 2V5JA 1A80A 3PBVA 3VZXA 2YL8A 3ONBA 2TPSA 3GIPA 1KV8A 1X1OA 1OFOA 1ITUA 3UP8A 1EX5A 3JS3A 4XO6A 3SW6A 1EOMA 1H62A 2QVHA 4IIFA 3WF2A 4PUNA 2V5DA 2GK1B 5CZJA 2WHJA 4HPNA 2V5BA 4OT7A 1DVJA 1AFSA 1PX4A 2X0SA 4GGBA 1LUCB 3LQLA 2V9DA 4GVHA 2B31A 2GGHA 4HMCA 4W88A 1XKJA 1DJWA 2G4JA 4Z2IA 1E6QM 2DPEA 1E3XA 2VJXA 1QPRA 4YVXA 4TO8A 3N3TA 5JBEA 2EPLX 3MVIA 3HG5A 2J9ZA 1FWDC 4H2HA 4IZGA 2QCCA 2ZUSA 1LM1A 4UR7A 4DWSA 3HPAA 1SMDA 4Q8QA 3SR7A 3LMYA 3SZ8A 3AJ7A 3HJZA 3W72A 4X9YA 4LW7A 1GYMA 3E0FA 2R8WA 1JI2A 2W79A 3KZPA 4O0QA 1DTUA 1W9XA 1LBMA 1SFLA 1WDWA 2E1WA 4H4IA 1KWGA 3TSMA 2CLIA 1J0IA 6TAAA 1FFQA 4MWAC 1T8XA 2IKHA 1M7XA 3T09A 5I02A 3JZEA 4NJGA 2PDPA 3TEVA 4IT1A 1XLLA 2P53A 1GT8A 1J2BA 2CKRA 1I75A 1CGTA 3LCWA 4D6JA 4JD4A 1A5MC 1I2OA 4RNHA 2VXNA 2YKKA 3KHDA 1H41A 4HN8A 1TKKA 3GB6A 3UJEA 3H2CA 4WGHA 4WIWA 3W76A 1VENA 4OBTA 3VAVA 2EGZA 4R7JA 1DKWA 2B7QA 1EJXC 4YTSA 3JZUA 5AN7A 3GZ3A 2YCEA 3GHUA 3PUGA 3H26A 3BAKA 3LCLA 1KCKA 2BVWA 2RFGA 1M6JA 2DZBA 1GZ1A 1X39A 1AQMA 3TN5A 4NZFA 1XIHA 1JXKA 1PWMA 2O7SA 3BANA 1CB2A 3MB9A 3CQIA 1E71M 1H3GA 1H5VA 3G3MA 5H91A 2YBUA 4F66A 3SIZA 4FEZA 1TIMA 5GJMA 3WKZA 2GQ9A 4XZBA 2ON3A 1CEOA 4CN6A 4HHPA 2OWCA 1DXEA 1FFRA 3FY1A 3W38A 1TELA 5ABHA 3W75A 4JTEA 3TAOA 1NWUA 3ANVA 2FH8A 4LYPA 3CUIA 5HMEA 4AHQA 4J27A 1MZRA 2AMGA 3F2BA 1ONEA 4PUJA 2F7FA 3OW1A 4O8RA 3NA8A 4X60A 3KDOA 1Q6RA 3LTPA 1Z3NA 3ARRA 3MCNA 1E9ZB 1VH7A 4UTWC 3I7SA 5DO8A 3A9IA 4JYDA 4PBGA 3WMSA 1XBXA 1DL3A 1E6RA 2QJGA 4YWSA 3WH8A 1XLAA 8CGTA 1OFEA 4GCXA 2NX1A 4LUSB 3EPMA 3RM9A 1R5YA 3ITTA 4TIMA 4JIHA 3H53A 3PY2A 1DWAM 3AHZA 1EDGA 1VF8A 1FWRA 4XUYA 5DBTA 1TA3B 2WZTA 1OFAA 1DP0A 2Y7GA 3RK8A 1KRCC 2PDWA 1HJSA 1OVDA 3EWYA 4JTJA 5EY5A 1BGGA 2V63A 3GDRA 1F3TA 4BQ5A 3UR5A 1EF2A 1US0A 2UBPC 1J79A 3S5NA 1KWKA 1KFLA 3I7RA 1W56A 2QPXA 4KWOA 2OEKA 4AX7A 4REQA 3UXAA 1EQPA 3KRBA 1UD8A 9CGTA 3SY8A 1A50A 2DVTA 1NJJA 1TPUA 1WZAA 4V33A 4V1YA 3ARZA 3DN5A 4JBRA 4WDXA 3V35A 5HK4A 3L67A 3EPOA 3WLKX 4E4PA 5EMUA 5C70A 2A3EA 5FACA 3UVAA 4ADTA 3WLPA 3W2KA 3M6YA 3QPZA 1DORA 3M0MA 3P84A 3IWPA 4CU7A 1PIFA 3HO8A 1V93A 5HNRA 2INFA 2Z1VA 3ES7A 4QJ1A 4JAWA 4ASTA 4PTXA 1U33A 4ZMGA 3WIJA 2ZRXA 1KRBC 1OFRA 5A6BD 1OX4A 6CGTA 1PAMA 3FXGA 3UU0A 1J0JA 1LWHA 4QG9A 1YYAA 4HSHA 4Q8MA 2J7CA 4AEFA 3GKAA 3WX7A 1AA1B 4D71A 1B9BA 3N6JA 4GNVA 3W1TA 1EBGA 4HYWA 1YBQA 5M2FX 3MMWA 3WFLA 4C7FA 4IFKB 1OSEA 1AG1O 2H3BA 1E1EA 3ERPA 3V18A 3VE7A 4FK9A 4UFHA 3W00A 3N2BA 1KM5A 3C52A 4NZ5A 1Q4NX 5DF0A 2ZX9A 3FSTA 4K39A 3PULA 4AC7C 5A8NA 3KBNA 3BUVA 1W5NA 4YTRA 3GAYA 1NOUA 4NX0A 1RBLA 4EP8C 4N0RA 3VZYA 2FDMA 5EMMA 4EAMA 4GCAA 5CXPA 3KLLA 4S3CA 2D69A 1VC4A 2YBVA 3T40A 4WX2A 3AYSA 1GEHA 2ESCA 4PCNA 3W70A 4DIAA 1R47A 1KD0A 2UY2A 4AC1X 3LBMA 1SFJA 1D8WA 2QAPA 2CERA 5CGMA 3VKAA 3WD4A 1UMLA 4KWSA 1M1BA 1JAKA 1AVAA 3MWCA 2RUSA 3CYJA 5FCZA 3W6YA 1ONRA 3FSUA 4UC5A 4QBXA 4CCZA 1XG3A 4QAWA 2WOQA 1FCUA 2V67A 4DO6A 1JUEA 1A3WA 3VDGA 3W22A 4Z1AA 2FTWA 4L4OA 5EB8A 3S4TA 1W3IA 3OJGA 3NQ8A 4N9CA 4LQ1A 3W3OA 1UR0A 3UG4A 1YPFA 4C7GA 1WO2A 5D9OA 5K4XA 1G67A 1SUXA 3OVRA 3HMJG 3R79A 1O4UA 4NRSA 2I1OA 1ADSA 4PCSA 2Y70A 4XUGA 1SYTA 1XF0A 1W3TA 5CCZA 1P4CA 5G2WA 1X6UA 1QNPA 3NQ7A 3GXDA 4BEQA 4GX8A 2PWDA 3DG6A 2GJLA 4QCFA 1PX3A 4X0NA 1CXIA 3RPTA 4YCOA 4KBXA 1GNXA 2HK1A 4BF7A 3WJXA 3G1VA 3II1A 3P60A 3CGTA 1Q6QA 3QV7A 1N8IA 5TD4A 3UPBA 3DENA 2NV9A 4XB3A 3SFWA 4J35A 1I8JA 1BF2A 4Q7IA 4UFLA 3DGRA 3ZVHB 2AKMA 3QLLA 1EJUC 3QYQA 1AQFA 3WDRA 4DM2A 5BZAA 3OYXA 4WY0F 2P88A 1YDYA 3QZ6A 4DPQA 3PC0A 2J24A 3SUTA 4L4MA 2CZFA 1AZ1A 4EF9A 2CXEA 4I5RA 3AU6A 1FCBA 4FLOA 4NNCA 4J3XA 2NUYA 3VDCA 3QM3A 1AH4A 4JX5A 1WAWA 5EBAA 3IVTA 4AY7A 4ZE4A 4C65A 4QDWA 3L5LA 3IIVA 1OZMA 4CCEA 3FYOA 4ZO7A 2V2HA 1ZGDA 1F4AA 4DUXA 2Y88A 3UY8A 4UBPC 2O9TA 1EDQA 1UH3A 3MSYA 3T44A 2BVYA 4GH1A 1WUEA 1KXQA 3S6TA 5F2IA 5FJRA 1CXEA 1JPDX 2ZVIA 3IGSA 5G4WA 1UJPA 3I6TA 2B4GA 1GW1A 1T7LA 4UMBA 5CPQA 2WK2A 3HGRA 3BOLA 4MJMA 3RX4A 1HKVA 2CZEA 3EEGA 5CBJA 4QQ3A 4UTMA 5DT7A 1Y65A 3WQFA 2TSYA 3OIXA 2YL9A 3VNIA 2E0PA 5TIMA 3UEQA 4YL2A 1BVNP 5LNSA 5BMXA 4H2CA 3CHFA 4W89A 2X1RA 3FXYA 4N42A 4S2CA 3CQHA 3DECA 1L8PA 3Q37A 4DELA 4WOQA 1Z42A 1T41A 3WFAA 1A0EA 2J4GA 4AMAA 1FWFC 4H9MA 1UWTA 1H1NA 3THDA 3EMCA 1QI0A 4EXQA 3VGBA 3WLTA 2CHOA 4Z2KA 1QVBA 2JGYA 4DJDC 4LBSA 5L6UA 1AW5A 4O52A 1UPMB 3IANA 1KM1A 2V3EA 1C8YA 3TNOA 1CW2A 3RN6A 5IDIA 1JCMP 5GNXA 4H41A 8XIAA 3AXIA 3B4UA 3L9CA 5E09A 4D6DA 4A8NA 1S39A 2Q3OA 2QLYA 3GNOA 3OVQA 1CZ1A 5A6BA 4GXMA 1ME9A 2X0HA 3GFZA 3NDZA 1T6MA 1A3HA 1H11A 1P0BA 4UNKA 3WD0A 3F5JA 4XSLA 1V3HA 4EACA 2P10A 4LAKA 1OT1A 3TMQA 5F4WA 5CAHA 3T6CA 4L5ZA 3RX3A 2VEIA 1OG0A 3GWQA 3HG2A 4JHOA 4CD6A 4O0KA 3TWBA 1W1B1 1RP9A 3BJFA 4XZMX 3KP1A 2AMXA 5H1WA 3VD5A 4JIRA 4M6UA 1W8GA 4Q8PA 1PIGA 1Q6CA 3CQKA 4P7RA 1W9PA 3WLNA 2C16A 1ZNNA 5E0FA 2PDUA 3VINA 4FIRA 2RHGA 3GIQA 1ZPTA 1TMLA 4XVEA 2W63A 4QX4A 3U4FA 1PHWA 3HQPA 1B54A 3IIXA 3WDQA 1XBYA 2XYLA 5FJPA 1BAGA 7PTDA 4DNMA 3EWWA 3DOPA 1FWCC 3BE7A 1QO2A 3E0VA 3PZQA 5E5CA 3CWOX 5JUVA 4WKHA 4NJJA 4JKLA 4HNNA 5XIAA 1D7FA 1FWTA 3TQVA 2Z27A 4AW7A 2A1YA 4B3ZA 3OGVA 3CL6A 5F2MA 2PCQA 3NM1A 3ANUA 1H63A 1Z44A 4V28A 5BU6A 3HF3A 2YCJA 1NDWA 4J3TA 4LVFA 1AZ2A 1L0PA 2E1DA 1RQBA 3MP3A 5KZEA 4S3AA 3OVGA 1F8MA 4MKSA 1GJPA 1Z9AA 4FNUA 1QUMA 1TJRA 1BLIA 3HA1A 5H8MA 2GVEA 3PTQA 3A5VA 1C9WA 4IIDA 4TVDA 3KM8A 4BI7A 4GQRA 4TOQA 3RMEA 1C90A 4JFWA 1PUDA 3P6LA 3M0LA 2ANUA 4YTUA 3UPMA 1QPKA 1GVRA 3ONCA 1VPYA 1LOQA 3AIWA 1HN1A 5B7ZA 2FZ8A 2ATMA 1VEMA 4CQDA 4QHRA 2HISA 4NZJA 1KFEA 1G4EA 3LQGA 1IF2A 4K8HA 1B3YA 5REQB 1U83A 5J04A 3EX4A 3MQTA 3OGSA 1XYLA 2DT3A 3HG4A 1CB7B 3SY5A 3FGCB 3PFRA 1UC5A 3A23A 2PGFA 3GAKA 1NFPA 3ALGA 1B3VA 4LFYA 1CIUA 2QJIA 3T7VA 3WBWA 3PBGA 2FLIA 1F3XA 2D0HA 3GFYA 1HO4A 2Y2WA 4YU1A 2QS8A 5D2VA 3IV3A 3ZJKA 3BURA 3CPRA 4PC8A 3NG3A 1LRNA 2I7GA 2JK2A 4HNVA 4ADSA 3VIOA 5G1TA 5G2HA 4LV9A 1JZ2A 4BZYA 2CPUA 4K6AA 5F4XA 2E67A 2VDHA 2R1KA 5FJTA 3QQ0A 1V8EA 1REQA 3CWNA 1DIKA 4P8UA 2GGEA 2CESA 3TTEA 3WL0A 2VEKA 4HOWA 3N34A 5D02A 1B9ZA 2QGYA 2DT2A 3WF0A 3NPWA 1E1CB 1MQRA 5HULA 1S5TA 4G9PA 3MKVA 3LA4A 4HNCA 3U4AA 5EFDA 3A24A 4B5NA 3G5EA 2V6AA 3TR9A 3U7VA 2Y7DA 1ZQ5A 4TTUA 3LHUA 2EXOA 3AU2A 1E4LA 3P61A 3PZIA 3AIQA 1NVMA 4ICCX 1CLXA 1TX0A 2G41A 3UWWA 3VPLA 1JPHA 1HKWA 4KEVA 2YW3A 3D3AA 3WLMA 3E3HA 4QXIA 1DJXA 5AC5A 4QNEA 2ZDSA 1US2A 3OGRA 3OLIA 2I57A 3VXGA 3W29A 4O54A 3W1MA 3K1DA 3CYVA 3QN3A 5C9UA 2Z2AA 1OABA 4AF0B 1CXHA 3PPHA 3SY1A 4QJ5B 3POHA 5LSMA 2VD9A 3GVVA 4GI6A 3TKFA 1QOXA 2B81A 1XYBA 1YLVA 2VC6A 3E2VA 1ELSA 3PN8A 5A6SA 3H7UA 4BCEA 1JULA 5BOEA 1PHQA 4XZHA 4MNJA 1O60A 3OG2A 4PBFA 1G01A 3BG3A 2BVDA 4M7TA 1EXPA 3TC6A 3B04A 3V75A 4IMGA 8RUCA 2YJQA 4IMFA 3HQ1A 3SCRA 3I4EA 3NL3A 3RO6A 1D9EA 4AD0A 3F5KA 1BKHA 3QTGA 2AAAA 1NQKA 1BGAA 2XISA 5A8OA 2A79A 3DZ1A 5D03A 3SJNA 2XGIA 2VKZG 4PL1A 4M8UA 2ZVRA 4IJBA 3B8IA 1A47A 3G6LA 2GGIA 1XLJA 4HK6A 1H0GA 2WLZA 5AYXA 5EKYA 1SQ7A 1KXVA 2VQUA 4B16A 2NW0A 1EDTA 3MO7A 4L9ZA 2DIKA 3RYSA 3TIMA 4D6IA 5HJYA 2D2OA 2IQTA 2R14A 2XZ9A 5MKGA 1W2PA 3EOOA 1H09A 4QROA 1KFJA 5FF2A 7TIMA 4JNMA 1RCXB 4R9XA 1C7SA 3W53A 1YKWA 1WKYA 1VYSX 2X09A 4X0VA 5AHIA 5KEZA 2YLLA 3ITCA 4WR3A 1OK4A 5L9FA 2BY2A 1RSCA 3CT2A 1XYZA 3SCPA 1UIOA 4Q32A 2ZE0A 3W26A 4QCEA 4ZOAA 1TREA 3P8IA 2J7BA 1XP3A 4JHMA 1E6ZA 4C6JA 4ZBCA 4B5UA 4LJ3A 3WLRA 2P8CA 1RPKA 3W81A 3TU9A 1E56A 4ERAA 1W54A 1XISA 1CDGA 2QT3A 3AISA 4X61A 2DU2A 1Q5MA 3KRZA 1WBHA 4NASA 1P7TA 1TMQA 1C29A 4OE7A 2PDCA 1Y0EA 2NT1A 4GLEA 1A5SA 4FLQA 3RMJA 4GRSA 4KGLA 1XH1A 4KT2A 4DXVA 4TMCA 2J27A 3WQCA 5AZ1A 1WPCA 4IH3A 3RCMA 3ZMRA 2V81A 4WSJA 2Q3RA 3GM8A 3VMOA 1ADOA 3LB0A 2QIWA 3EX1A 2FZ9A 1ZLPA 4MJ4A 1VEOA 3WEZA 1UP0A 3SECA 2IKJA 4RCXA 1HW6A 3IUIA 4UIOA 1MW1A 4EPBC 4JTUA 3OHMB 4GY7A 2QXWA 4LALA 4P61A 1RA0A 2RDXA 3ZQ9A 3OEXA 2Z1KA 4HZ8A 2EG8A 4EAYA 3VIGA 4J3UA 2YSWA 3W73A 4PH6A 4EK7A 1EOKA 2R1PA 5GJNA 2W4XA 1S2UA 4RZ4A 5C2CA 3W2JA 2EPNA 3MVTA 4O13A 3R6IA 4IP4A 3EWZA 2BOGX 1WDSA 1OFBA 3TYDA 3F1QA 1MEIA 1TJ2A 2NQHA 3SQLA 4PMNA 4WJEA 3REQB 3QSTA 3NQGA 1G4SA 3CUHA 4C6BA 3PZMA 3WUEA 3R94A 1EC9A 1WB0A 5G4EA 1KC7A 3UVIA 4PMOA 2W62A 3W84A 3WQOA 2J9YA 3MZNA 4QRNA 1V03A 3APGA 4U33A 3KFTA 1OYAA 5BRPA 2RH9A 3K4WA 4R88A 3ZO9A 2PTWA 4RPPA 2I56A 4DB7A 1IZCA 2OOFA 1U5VA 1TCDA 2J7EA 4LANA 4CVUA 4CQ8A 5AZ0A 4TTGA 3N11A 4M0XA 3VDBA 2EG7A 1RVKA 4KEZA 4HCLA 1PZ0A 5BRQA 3PPFA 4HZMA 2E6AA 4D8ZA 3L7RA 1H2JA 4RXFA 2FTYA 1D8CA 3RXZA 1OQFA 3BOFA 3W2MA 1VLIA 3EA1A 1LJYA 2O55A 3W87A 2JQXA 4YXGA 4S3DA 3P5YA 1XFCA 1M7JA 2AL2A 2ZWYA 1SO4A 3I3DA 3QR1A 4WUIA 4OUIA 5DT5A 5BU9A 2YCIX 1V6WA 1QT1A 4RZ5A 3PJTA 3IUDA 1C3FA 3ZT5A 3TJXA 4X22A 5HANA 2FIQA 4QE4A 2QDDA 3QYSA 2BHYA 4PTMA 2ZZ7A 2GQ8A 3HPFA 2VGBA 4DI9A 3TFCA 1R3YA 4DLFA 1W17A 3VYLA 2QW5A 3NGFA 3AAMA 2IPWA 3W71A 4Z0SA 3VOCA 2V38A 5A95A 1C7TA 2A0NA 1K02A 4GG9A 5BW6A 3SGUA 4D6FA 1O1ZA 1UD5A 3PFMA 4O10A 2IXUA 2Y8VA 1H51A 1RBOB 3NDOA 1AL8A 4QJ4B 4D1IA 4V15A 1BYBA 3KOYA 4IXXA 1W9UA 1XI3A 4KEMA 4PRWA 3BSMA 2HRWA 3T4CA 3S1WA 1JDFA 2XM2A 4MJ2A 4GNJA 4LAUA 4X2RA 1Y8BA 4ZGYA 1OCNA 4DVOA 3VGHA 3K13A 4I8YA 2J47A 4DJFD 2PDKA 1FHUA 2EPMX 3FN9A 2ZTJA 1KGXA 3S1XA 1DBTA 1J6OA 4NZ3A 3H4XA 3MC5A 4IFRA 5A2BA 4S3EA 4JTFA 1KV5A 3EPNA 4NKCA 2WHMA 3THQA 3W28A 3IJ6A 2QVNA 4IG2A 4BQ2A 1ML1A 3L21A 4FXRA 1IQ8A 1EYEA 3SCOA 1W1VA 3EB2A 5MF5A 4A29A 4WCJA 4AWTA 4PCFA 4ZO8A 1OM0A 5G1MA 2IKIA 1EJWC 4JTDA 4FMVA 3H2FA 4FX8A 1FVPA 1KTCA 1C8XA 2P0IA 4A3HA 4I9JA 2JBMA 3GHRA 1OEPA 2WPBA 2GDUA 2DFAA 1SO6A 4RKAA 3OOQA 5B7YA 5IXEA 4Q4KA 2QGHA 4E3VA 4K8EA 1PCKA 1F61A 2HE5A 5ABFA 3VD7A 3N4FA 4D72A 1RBAA 2D0FA 3KTCA 2DW6A 3CMFA 4I9TA 1V3JA 3LXAA 2PTYA 4EVZA 1U1HA 5HJXA 3BARA 4X9SA 3F4VA 4RPQA 1IT7A 1HKKA 4GYFA 1ZS2A 1ZJHA 2CLEA 1KO0A 3QGVA 1BQGA 4F2TA 4PTVA 1F73A 3OU8A 4JXCA 4JY8A 4F0HA 1KFKA 3KOZA 1R9ZA 3QY8A 3V3WA 1AD1A 2NV1A 4GI8A 1XCWA 3F4CA 1V6YA 4AD4A 2AOSA 4KCUA 2GSHA 2PC8A 2BLEA 1V3LA 2G5WA 3QV9A 1PKLA 1ZHAA 2CFFA 5H8PA 3M0HA 1YDVA 4B3KA 4WF7A 4PUUA 4YHGA 3MZ2A 3S83A 2D1ZA 4HK7A 3CQJA 2VCCA 4URIA 1BYCA 2PE4A 3UJRA 1JUBA 3ABSA 1UA3A 1U1JA 4HJWA 4NP7A 3IIPA 1SVDA 4C6QA 2I17A 3RU8X 1PZ1A 3W02A 4EPKA 1XV8A 1UOKA 2WXDM 2CU0A 1UR1A 2YPIA 3UG3A 3EOEA 1N82A 1VR6A 2F2KA 2FZMA 4ACZA 1WE5A 3WNLA 3RUBL 2O9OA 3I6RA 1VJSA 1ZAJA 3UQNA 4C1NB 3SQSA 5E1QA 3ZIZA 4NZCA 1IT8A 3GS6A 4H9VA 3ENLA 4L6DA 2V3GA 3A5FA 3WBYA 3GNXA 3P2VA 4PGLA 5FI8A 2CETA 1J2WA 4LVAA 1JCYA 3RFAA 1V3MA 3H2OA 5C2XA 1OT2A 1R3SA 2KAUC 5B80A 3WH9A 5EU9A 3S42A 1YXYA 3UWEA 1MO0A 4WD0A 5A94A 3SBFA 3CC1A 3VOIA 3HQOA 4RZBA 1J18A 4DO7A 1ZSXA 6ENLA 2CIPA 3HMCA 4AIEA 1YQ2A 3PPGA 3FDGA 4ZA0A 3W6MA 4JTIA 1FCQA 5HUPA 4BF9A 3NO1A 1OG6A 2ONEA 5HINA 3PG9A 1EKOA 3B8VA 4MIMA 1A4LA 1J10A 4BFAA 5EYWA 4IIGA 1IE7C 3TROA 1G4TA 3BLOA 4MADA 2FHFA 2HNHA 3QSRA 3PBUA 3FDKA 1MNZA 4PUKA 4F0MA 1XIJA 2GOUA 3VMNA 1NF7A 2VENA 3RM8A 3C0QA 1JJKA 4NZ1A 4O57A 1B0IA 1J11A 3UGVA 2DSVA 3SJ3A 1LL6A 3CPGA 5D38A 5IHRA 3ABRA 1KR0A 4Z2HA 3O3RA 3OQEA 3TJ4A 1GKPA 1BPLB 4V1XA 4G1NA 1YEYA 3VZZA 2Y7EA 2PBOA 2W6RA 4B5WA 4OGZA 3RDKA 4W93A 5C2GA 1AD4A 3MHUA 3OB8A 1L6SA 1XM3A 5A6KA 4JN7A 3LCHA 4DXXA 5M3WA 4UQBA 3OPSA 4NSBA 3MJYA 3M0JA 2GVJA 4B90A 1JZ4A 4HSNA 4Y9PA 1E0TA 1SGJA 3COTA 4Q4RA 1E43A 1FWIC 4S38A 2FHCA 2VCAA 3IEBA 4WDTA 3TTOA 4Y96A 2E77A 2E8ZA 1IWBA 3NXFA 4L4PA 2HS6A 4DJFA 5HXMA 2HDJA 5BWFA 3LHYA 3NZ1A 2EJ1A 2XN2A 3V36A 3WLJA 4F9JA 5CJMA 4HBKA 2B7PA 1JDDA 3UBPC 2VX5A 3NIYA 3XIMA 3UG8A 1RJRA 4JTLA 5DQPA 4OVXA 2WCAA 2WKJA 1MZHA 3NQEA 4MUZA 1KQZA 3BK0A 2QDEA 3QW3A 4J1OA 3N4EA 2RJGA 3R58A 4GBDA 5FKYA 2WW5A 3GU9A 3AHYA 2PF8A 2HS8A 4GOAA 2XH7A 1XDMA 2OLHA 3PP7A 1TO3A 3HPXA 2XVGA 2OSWA 2QUNA 1EPXA 3UCCA 3W7IA 4Q8UA 3BMWA 3BV7A 3NSXA 4GVGA 4I9MA 2WLYA 4S3GA 2PP3A 1RJQA 3QRHA 2ZUUA 3CAVA 3KBMA 3FYPA 4WSKA 3AHTA 3Q4DA 1OYBA 5HNTA 5CC6A 4A22A 5E6YA 2A6NA 3CLMA 3MY9A 4XO7A 5F1VA 4AUBA 2XIIA 5CPTA 3L4YA 1KXHA 3EB3A 2YZ5A 3EX3A 4FZIA 3S2CA 1H50A 1H7PA 3DXIA 4O1AA 4IMCA 5JIWA 3LXBA 1MW3A 2V69A 1HFBA 1E5JA 1ODUA 2X0YA 3B0XA 2X40A 3VIPA 3RJXA 1I1XA 4LC6A 2DZVA 4HCDA 3O16A 1TJ0A 1HL2A 3E6EA 4LYQA 3GU2A 3KW3A 1XRFA 1WOAA 2WHLA 4HIBA 1H7OA 3URBA 2V82A 2Z1BA 3QV8A 5FJIA 3R89A 4M1RA 2O9RA 3EA2A 3BAXA 3ARVA 1DQUA 3OLEA 2VRJA 2J77A 4GHRA 1ZAIA 2A3BA 3TXZA 4GGHA 3NL6A 1AL7A 4MTVA 2NV2A 1WV2A 4UTKA 3EOSA 4DNHA 1XCXA 5K3VA 1ZCCA 4RR4A 3WK3A 1O94A 2E6DA 4GI9A 3VNZA 3APYA 3SCSA 3VOGA 3FYYA 3LERA 4ZFCA 3M7SA 4UQDA 5FF7A 4B91A 2E09A 2WNZA 3W7NA 3ARXA 3GH4A 4IX0A 2D3NA 3B9NA 4OU1A 4GKTA 2FZBA 1EJTC 4S1FA 3U2ZA 4INFA 3M0XA 4PRTA 1EZ2A 4AG0A 1O1HA 1F7BA 4DHGA 4ZODA 2ACUA 2XFWA 4IL2A 6REQA 5TF0A 4B4HA 3A47A 3NUKA 4PFHA 2E25A 5CPLA 5CEWA 3BAWA 5KTLA 2ZBTA 3GRIA 5ABTA 2QCEA 3VM7A 1EC7A 4M5PA 3W1QA 3JW7A 4K7VA 2QEZA 1JGMA 1UUMA 4AYSA 4EWND 1LRQA 2P0OA 5BOFA 4EXBA 4NAEA 2QJMA 3EXRA 3W7PA 4KRTA 1SZEA 4CLMA 1BXBA 3NJ3A 1UD3A 3P93A 3C3UA 5C5YA 4U10A 4WKAA 1GGOA 3W82A 1EEPA 1K77A 1NU5A 4CNUA 4FI4A 1XDLA 2XH4A 3VIJA 3O6YX 3PAOA 1UKQA 3AMKA 1J6PA 2G50A 3DGBA 4H83A 2EHHA 3QVQA 2WVUA 5AB3A 1H61A 2DSWA 2Y8UA 3N2TA 2P5NA 3HOJA 4KCVA 4GC4A 3L65A 3AO0A 1G5AA 3LV6A 2WMJA 1AJ0A 3ABZA 3WUFA 4ECLA 4LS1A 3ZR6A 3B9OA 2ATSA 3C0LA 3P82A 2O7QA 3B8WA 2Q71A 1EA0A 1E3ZA 4KMQA 1MXDA 4K1WA 3KOXA 4DBEA 3CB8A 2WB5A 1FH8A 5KITA 4NL1A 3TLQA 1J93A 3JRKA 3EDDA 2OGYA 4PRRA 1UH2A 2OSYA 1V6TA 4QSHA 1MNSA 3DHUA 1W1YA 3N29A 4R34A 3UR7A 1K9TA 2ZA1A 5KMYA 2CXGA 2WBKA 4YMZA 5A8PA 4MZ8A 1UR2A 4LS0A 4IIEA 2WSRA 4E2VA 4AZGA 3LCIA 1OFQA 1GPWA 5I78A 1O95A 4JNZA 5GNYA 3SRKA 2Y5JA 2H9AB 1JRBA 2BY1A 4GJJA 3EMZA 4BHYA 3KBJA 3RRAA 3QC0A 2XN0A 3EKGA 3PAJA 4LYRA 3OHIA 3ABQA 3P81A 1F07A 3PBYA 4M51A 1DJHA 1WQ5A 4LTSA 3FJ6A 3CB3A 3VTRA 4Y9AA 1EUAA 3BAYA 3NOYA 2ZX6A 3KL5A 5CSRA 2C13A 2D24A 3QF0A 1JD9A 2ZUVA 1RQEA 2HROA 1D7KA 3MI3A 4ZOCA 2E9MA 3NSMA 1TSIA 3CV2A 1ECQA 1PYFA 4PUWA 1KM6A 3M1ZA 4TV5A 2X41A 4JYEA 3UXKA 3PANA 4CVWA 4LUTA 1LDCA 1YTDA 3GDLA 2UY3A 2Z0IA 3SSJA 2XHYA 3SCQA 4YCPA 1XQKA 3IIOA 5JH2A 4XKYB 2Y89A 3NQDA 3PBWA 3WBXA 2OEJA 4P8WA 1NM9A 1KCLA 2IQDA 2I9EA 3BLIA 5C6MA 3WLIA 1DJZA 3HURA 4CNSA 3E38A 2HE8A 4J3VA 2Z4GA 5AHLA 1MDRA 3T42A 3WK1A 5IRPA 4MPKA 3NQBA 1M3UA 4HSOA 3UCQA 2PPGA 4QE1A 5FJJA 4BK9A 2YA2A 3CU2A 2Y85A 4A2RA 3W23A 1TZ7A 3VGFA 3TN6A 2DZTA 2W61A 3GLCA 1ONWA 3LCGA 4JEQA 1TE6A 1FA2A 3BCDA 2QCFA 1PX8A 5JQ9A 1W1IE 4XKMA 3ZLFA 1GOQA 1Q7QA 2ZCGA 1GG1A 1JCJA 1YX1A 4M1BA 3V0SA 2C15A 1U30A 5LNVA 1Z41A 5H6HA 1YW1A 1NWSA 3GG0A 1MQQA 3SN0A 1PJ9A 4IQJA 4GUIA 3LTYA 4HD5A 2Z24A 4S2BA 2QCDA 4LAZA 4AZCA 5FSEC 2BOFX 4RE2A 3LPOA 1E4IA 2J88A 2NWRA 3M5YA 4C60A 3LGEA 4F4RA 1Q2SA 3N15A 1TPC1 1GUVA 4XTDA 4FSAA 3STPA 1M65A 7CGTA 4X3ZA 1KXTA 3RPDA 3RITA 2HV5A 1IXPA 2FJUB 4IIHA 1OC7A 2IMRA 1UWUA 3FAXA 4F0RA 5FA5A 4W7WA 3U5UA 4C6DA 3U57A 1FP8A 1UQZA 4IHCA 4QS5A 1E15A 3GYCA 4ICNA 4POCA 3VILA 3GUWA 3E9AA 2H6RA 4TVUA 2OZ0A 1E5NA 2WMGA 3M0KA 3EXTA 1GK8A 1HJVA 3GTFA 2P1FA 3LX9A 5AFDA 3WF3A 1QASA 3QZAA 1UIPA 4R33A 4HCHA 2C0HA 4DWSB 1QOPA 4H7CA 1DJGA 2P3ZA 2QNEA 4JX4A 3FKRA 1PB0A 4W4QA 1I2QA 1H7WA 5HQEA 5E70A 5DCDA 1QXLA 3CAQA 1POJA 1GW9A 3ZXWA 1UBSA 3CMGA 4L1XA 4A8RA 4QQUA 2DVUA 2JFEX 2BX7A 3VDHA 4LSBA 1A3XA 1W3JA 4B5XA 3CV6A 4DX3A 2NQZA 3ZR4A 5SWUA 5BXTA 1PPIA 1DWJM 3V1PA 3UZJA 1KCXA 4XISA 4S3BA 1GVEA 2GGJA 1QCWA 4O17A 5DRCA 2PRHA 4U2YA 3CHEA 1B30A 3W7LA 1O66A 4ZSUA 2CW6A 1SJDA 5CC3A 5CPMA 4CEUC 3SN1A 3LPPA 2VEPA 3DFQA 3ARWA 1LQ0A 4XAYA 1FWAC 2BTMA 2WWCA 3XISA 3N6HA 1EGMA 3VOHA 3F4NA 4BI5A 1H5YA 3BJSA 1JZ3A 3W7EA 1LT8A 4O14A 4ZEPA 4L6HA 1VFMA 1CENA 3LM7A 4NI3A 4IF2A 4QITA 4KETA 1V4YA 1S5NA 1W3NA 2G3MA 4ZQRA 1HKIA 1XLBA 3VABA 2Y24A 4MVAA 2PEVA 5IFPA 1E0XA 1JPIA 1OD0A 4KESA 2POTA 3QBUA 2HTMA 1TPB1 3P3BA 6XIAA 2YGYA 1FQ0A 4NQ1A 4ZO6A 2BMBA 2WZHA 2QIIA 3R0DA 4RV8A 1IR2A 2OYKA 3CAKA 3L2LA 1VRXA 4HU4A 2A85A 4QTGA 1K7XA 2X16A 2XSBA 4HTBA 2RAGA 5H2ZA 2QHAA 4W86A 5I3IA 1WZLA 2WJZA 5IBXA 3DFOA 2RGMA 3KP0A 3K5XA 1LP6A 4GQBA 4G1KA 4KWUA 1UOZA 3M5ZA 3ELFA 1HGWA 4NT0A 3ZFHA 5K9DA 3ITOA 4IICA 5CKSA 4B9YA 1KBIA 5FJOA 2PDMA 1ESWA 1K9DA 4YTTA 4LUJA 4HJFA 1CXKA 1HJXA 1ZY9A 2W0UA 2WZIA 3UZZA 4GX9A 1VGAA 4WZHA 2UY4A 5JU6A 2OELA 3W27A 5C55A 3QY6A 3A9BA 4NIRA 2WMIA 5LNWA 3T2OA 2XG9A 3S9YA 1KLZA 2J7HA 3ANYA 1SSGA 1X7IA 3G1AA 3MSGA 2IPFA 2H90A 4R85A 2YZRA 4O4WA 3GC4A 3AUJA 4PUMA 4H04A 4TUFA 4REQB 3VKJA 3M43A 2OFJA 1QWKA 3C86A 2VDIA 2RDWA 3R43A 4FPSA 4LV4A 4ZTYA 1I45A 3T8QA 4DWSD 3PHAA 5IHSA 2FMOA 3H6OA 1WNOA 4FNTA 3IARA 4PA8A 2C8NA 1M41A 4I90A 3W25A 4MF4A 4WJXA 1W3HA 4HHMA 4AVOA 4UZUA 2OT0A 3GXIA 3EWBX 3LN3A 3E2RA 1PKYA 3WENA 3VI2A 3OODA 1XSKA 1EEXA 3CUZA 4MYAA 4HK5A 4JFSA 3HFYA 5KZDA 4OV4A 3VD9A 4A21A 1XYMA 1J12A 1VPQA 2TYSA 1LRTA 2OYMA 3AIUA 5GVJA 3ZJ8A 1XD1A 5A6LA 4UOJA 1N2VA 3MHGA 2YCKX 4NNBA 4O1BA 3J7HA 1AODA 3M5VA 4U5KA 4EANA 4UCGA 3VCNA 1BYAA 1FWJC 1YBQB 1KBLA 3WLOA 4U3AA 2CLKA 2G4FA 4AY8A 4WDWA 3YPIA 3LK6A 1TV4A 1MQPA 3W7OA 2OB3A 3AXMA 3WQ5A 3W88A 1X98A 3U9IA 1ONXA 1K9FA 3C2OA 7TAAA 3EWDA 5JXQA 4E6MA 1JFXA 3GH7A 3M5XA 3C2FA 4AD5A 1DWIM 1S2AA 6ALDA 1FX6A 4C6NA 4DBWA 4Z1CA 2X42A 3AMCA 2DZSA 5A8QA 1RR2A 2XM1A 1KCZA 3HB9A 5FF3A 2PP0A 2O92A 4JS3A 5CJNA 3W1LA 2BG5A 4QJ3B 3KAOA 5HATA 3I10A 3T08A 1AQHA 1W32A 2QJNA 3SUUA 2ZUMA 3PWGA 3EYPA 1M7OA 1NEYA 2FPTA 3W1UA 3MPGA 3WQ8A 1DOSA 4HN4A 3UYIA 3GK0A 1K4HA 5DMLA 2VFHA 2ZOXA 3PWIA 4Z0JA 3ZJ6A 4C91A 3LD5A 1V6UA 1WDPA 4Q4QA 1XYFA 2PDLA 3BCJA 4AF0A 4H00A 5DFAA 3F2DA 3DCPA 4KWWA 3L2MA 2EPOA 3NAVA 1Q8AA 3CEUA 3VFLA 1XRVA 3W1PA 1YE4A 1NELA 2XN1A 1LWIA 3HZ3A 2FTPA 2R94A 1IV8A 2W5FA 1YNQA 3MKKA 3UWVA 3R11A 1DE5A 2IKGA 3HFTA 4GA8A 1K8CA 2Y6ZA 3FVMA 4GZ7A 2PDHA 1QNRA 4JKMA 4KFNA 4KW2A 3MCOA 4Z1YA 3IRDA 1GOIA 1XKYA 3O9NA 1MWOA 1OK6A 1WYIA 1HP5A 2NUWA 5K9CA 1XG4A 4FLSA 1JZ8A 4O50A 3NWRA 3RLVA 1B3OA 1VBJA 3AMLA 3LPFA 1KBBA 3SCNA 2VEGA 2VO5A 2OOGA 4D6HA 4P7LA 3FA5A 4XK2A 2PGWA 3N2MA 5IM51 4H6EA 4K37A 3P5ZA 1K3UA 3UGRA 3GVWA 4U3CA 4O4VA 2E68A 5AVNA 1VHCA 3TJIA 2VZUA 4IWWA 2E5BA 4AIUA 4I5UA 4XVDA 1EIBA 3GHTA 3KLKA 3KCOA 5LA1A 3MSRA 3PTDA 3I68A 3A12A 4QDMA 3Q45A 4YYCA 1A53A 2WC7A 2OXNA 3AXKA 2VOTA 3B3DA 2ISDA 4NRRA 3IS4A 3P67A 5HMDA 2O4QA 3WBAA 2OJPA 3S0CA 4L1GA 1LLWA 1MRQA 3MYOA 4O1CA 1EGVA 4UTTA 4WOZA 3L4ZA 3RCNA 3TTQA 3LCXA 3QC3A 3THUA 5HJLA 1IEXA 1XFBA 1YMYA 3BW4A 5A3HA 3CASA 4YJ5A 4LAOA 5JH1A 3KXQA 1I1WA 2DW7A 2F61A 1ZENA 2CZ5A 2YDAA 4HOXA 2DJLA 3KBSA 1JNDA 4HPXA 3OLGA 3TYZA 4I7WA 2VR2A 4MJZA 2ZQ0A 3C4UA 3EXSA 1ZJIA 4JIPA 1HTIA 5D9PA 3G0XA 1JVNA 3MTWA 1JIBA 4B5TA 2YOCA 4M7SA 1VLWA 4HYRA 2PLJA 3VIKA 3B9DA 3K4DA 3A6OA 1K8XA 1TJ1A 3T0CA 1HIZA 4DZAA 1XUUA 3BVJA 1EHAA 4W84A 3T9PA 2UY5A 3RU6A 1UZ1A 1WX0A 3UNDA 3L5AA 2D3LA 1J0KA 2FB3A 1BTCA 2OGJA 3AYVA 4LF1A 4F40A 1V79A 1QW9A 3GE7A 1V6XA 1KRMA 3AS3A 4MWAD 2QV4A 1A5NC 1QW7A 1KW1A 1UUQA 1VFSA 1LOLA 1AJZA 3CL8A 4G2DA 3MA8A 3TYUA 1W8SA 4BEUA 5CG7A 3TDFA 3GR7A 3L66A 3GTXA 4N7QA 1ZJBA 4KERA 1Q85A 4OUEA 3NQ2A 4AZIA 4DZHA 1UD4A 3MHFA 1R3WA 4H01A 5AVHA 5HNNA 9XIMA 5CZTA 4NNAA 1HNYA 1B1YA 3G0SA 4EOUA 1VFHA 3MI2A 3LG3A 1UROA 3O05A 7REQA 4ZFMA 2J8TA 5DX7A 4K1GA 2RKXA 2ACRA 3ABOA 4GY0A 4JQ2A 2I16A 3NL2A 2QKFA 5AHMA 3VX0A 2WQPA 4NU7A 4LEFA 4TQTA 4IP5A 3PJXA 1S5MA 3ARUA 3L0KA 4Q8NA 2QUMA 4P2VA 5XINA 3DUGA 3DKLA 1CBGA 4RV3A 2EBNA 4C6CA 1IHIA 3N14A 4RDYA 4ORMA 4L64A 1R9YA 4HMNA 1K9EA 1VFTA 3H54A 1A5BA 3BG9A 3KWSA 4JIIX 3DG3A 2DVXA 4PMUA 2VQTA 7ODCA 3BAIA 1LG1A 1TCMA 2Y5EA 3ZLHA 2YB1A 3WNNA 4G7EA 3MI6A 3LI0A 4QR6A 3VKCA 4XV0A 3DFYA 3G0UA 2CWNA 4HQVA 1EO7A 5AOUA 3VIHA 3W7CA 2J62A 3SUWA 1OHLA 2PWFA 2A3CA 3LSCA 1TWSA 2QDGA 4M29A 5U7SA 5A1AA 1LZOA 4FOKA 4OV9A 3N2CA 5BRBA 1ZBCA 3N9KA 2JEQA 1E1FA 2ZUNA 3GTNA 2VOMA 1Z6KA 1GVFA 1UWRA 5A5WA 6A3HA 1MUCA 5DY3A 1GPFA 1KGWA 4C1LA 4UFIA 2CEQA 3DC8A 1DHKA 3PZVA 4ZQPA 4PTDA 4QEEA 3TN3A 3T0TA 5TAOA 2PUZA 4H9YA 3DIPA 3PM6A 2F6XA 1UP3A 1Z89A 2NVAA 5K2ZA 1LT7A 2BGSA 4I8DA 5AHNA 4HHLA 3NZQA 1FHLA 2RJHA 4PCTA 4WGXA 3BC9A 1GOMA 3L4VA 1DIEA 2ZC1A 3RLHA 2W92A 1ZB5A 1I0DA 2XFFA 4GE8A 4WRHA 1LTDA 1VP5A 3WL1A 2EJAA 2PCEA 2VFGA 1YRRA 3FCPA 3I3EA 3URNA 3QOKA 3VMPA 3O6AA 3IK2A 1XLHA 4ZL1A 2J9XA 4GFSA 4LB3A 5KINA 1FWEC 1TPFA 1TVLA 3PG8A 4JTKA 3DFHA 3NPUA 4QIUA 5A2AA 3P0WA 1Z69A 4BS0A 3UWYA 2CZDA 1JF5A 3WJSA 2AKZA 4GKLA 2TAAA 2VWSA 3LM3A 3S5ZA 3PWAA 1R9XA 1PTGA 3LGDA 2GYIA 2VC7A 2GVLA 4KFPA 3CUGA 3QPYA 2C0AA 2A3AA 2XSXA 1HVQA 3ECQA 3WNKA 1UZ4A 4CD8A 3CZGA 3PSVA 2XFYA 3AWNA 1GVYA 3UZYA 2VUNA 5JMUA 1CLVA 3IGHX 1XIIA 3IK4A 3PTMA 2VR5A 3VCCA 5IDZA 3K8MA 3L4TA 3W1RA 1FWGC 4DO5A 3UWQA 4J2PA 1TVNA 1DEDA 9XIAA 4GYPC 1ISYA 4LNYA 2OMAA 3M0YA 2INEA 1K6AA 4PFMA 3AROA 3STEA 4I5XA 5C0QA 3NL5A 3V1HA 3NYDA 2VDGA 4GIRA 3NEHA 3NTYA 4I7UA 3SRFA 1HL9A 3A64A 3NR0A 4PMXA 3D6NA 5LA2A 4WXYA 3H4WA 1OGBA 2GOKA 1XLIA 3ID7A 1UZDA 3VOJA 5HOSA 3R7MA 1XH0A 2VURA 4DJEC 1HX0A 3WD3A 3ALFA 1JNEA 3TOPA 3GNRA 1O5QA 3TW7A 1FXPA 3TONA 4QSFA 2J74A 4I6KA 2Q8XA 1GQIA 3PNUA 3BTNA 1R7OA 3M44A 4M56A 3B9EA 4GZJA 3FJNA 2ALRA 3S1UA 3IVUA 3KUMA 4YTQA 4NAFA 3VGDA 1YHTA 4HNLA 5A6TC 3VVGA 3WH5A 1ALDA 3W2LA 5F2GA 1MUMA 4MLJA 4DXKA 3WLQA 3R8RA 3BLDA 3OP2A 4WY0B 3B0PA 3B8SA 4ICMA 4IIBA 4UTLA 4A3RA 3WQVA 4MWAA 2J7DA 5AHEA 1QATA 1H4PA 4PL2A 1N7KA 2OZTA 3VNLA 1EL3A 2FPYA 2Z1XA 3O0KA 1PSCA 3AUOA 1L6WA 4CU8A 2G0WA 4Z08A 3H2EA 5LNRA 3DI0A 4PMZA 3FIGA 1XSIA 2Z28A 1FDJA 2WVVA 4ML9A 2JKAA 1NIUA 1BSIA 3ITVA 3TV8A 2G96A 5KSWA 5MKGB 2CC0A 5FD0A 3QXBA 2Z7KA 1E51A 5HPOA 4IGNA 5MHBA 3WMLA 2YA0A 3TOYA 3NO5A 1RXOB 3QR3A 6PTDA 3DI1A 5DY2A 3R13A 3W74A 4J3WA 3WSUA 3TQ0A 4L9YA 1PCWA 3B4YA 3S5OA 3O15A 3W7MA 4R5EA 1CT5A 4Q7BA 5JVLA 4RL3A 4JTHA 3GVQA 2XGBA 1OZQA 1GQKA 3B03A 4NF7A 1OB0A 3STGA 2KX9A 2ZFAA 3SB0A 4N9BA 4F79A 1DIDA 2C7FA 4ZB0A 1P7TB 4JY9A 5AYIA 3U7BA 3DU0A 3UCDA 3MW7A 4CD4A 1CGWA 4DBUA 3THAA 3OQ8A 1ICPA 3KBVA 5C9WA 3DBNA 1WZMA 2PDYA 3MU7A 2Y62A 2VTFA 1T96A 3W7JA 1Q4WA 3T0AA 4UTWA 4AFYA 2EAWA 3B40A 1CNVA 3RILA 2OODA 4C1KA 4IISA 4DUOA 3WO8A 4YS1A 1NFBA 4P5UA 4LAMA 1T99A 3TCSA 4JX6A 4UOQA 1MW0A 1A49A 1GZGA 1WXJA 1UC4A 5AY7A 3WJWA 2YX0A 1UQYA 3JR2A 3IPWA 5EFFA 4MFDA 3NURA 5D37A 3CXOA 1NP2A 2PWGA 2BBFA 4UFKA 1K6WA 4CQBA 3WQ4A 1NOFA 3CZ8A 4IPNB 4JL2A 5DBUA 3L23A 4H8UA 1Q65A 3ARTA 1TTJA 1JYNA 4CCCA 5LYRA 2ZX7A 2J66A 3Q67A 2PWUA 4JKKA 3V4BA 4JQ4A 4RDWA 3KL0A 1FH9A 4AY1A 3E74A 3LY0A 3HGSA 2OCZA 2JKEA 1FWSA 4ORIA 2EG6A 4ZB2A 5CBIA 4LBRA 3P14A 1BG4A 1DWFM 3DG7A 1EB3A 2IQ0A 4N6EA 4DJDD 2BFGA 2NSOA 4A3UA 2D2HA 2VZVA 2A6LA 3VK5A 2ASHA 3FHQA 1QI2A 3G77A 2B7NA 1RD6A 3DFPA 1OC6A 4MY9A 4QFUA 4JR5A 1XGZA 3I6EA 5I0DA 3TMLA 2GDVA 1FWWA 1NY1A 3GW3A 3GVRA 3TYBA 4UNLA 2WWDA 3HJEA 1NH6A 2CNCA 2BV9A 5G5IA 3UXIA 3WQ6A 1XSJA 4TMBA 2CKSA 3LYEA 3D47A 3EZ4A 3NM3A 4XG1A 3F7JA 5BOOA 2YCLA 2PDNA 2G95A 3SN4A 4PB4A 4JQ3A 1FXQA 1KTBA 3KX6A 1ISVA 1RD5A 4LGXA 4PB3A 1FKWA 1BWVA 4BWLC 2JGQA 2W27A 1WXZA 1CWYA 2GJNA 4FHAA 2BHUA 1RCQA 4ACYA 2AQWA 2VMFA 2WJFA 2G3FA 1S2WA 5IOBA 2PP1A 3IGXA 3TAKA 2E5CA 3LENA 2Q09A 1R7AA 1T5AA 1B3XA 2DZXA 3NQ6A 3VKKA 3RLUA 1VQTA 3WYZA 5KZMA 4IGHA 3M46A 2VFDA 2NQ9A 3QOMA 1FH7A 5D2WA 1FY6A 3NVDA 5LIWX 1WAUA 3RGTA 1VFFA 4UB9A 4AWSA 2HVOA 4KCTA 5FL0A 3FA4A 2F2HA 1YPIA 2QCLA 1GVSA 3K8KA 3HGJA 5CLTA 4W85A 1FDZA 1EQCA 4S39A 3N18A 3BLPX 4HTYA 3NPVA 5DELA 3CLWA 3L0NA 1N8WA 3GDTA 3GBEA 1PWLA 1U5HA 3DEQA 3AMGA 1R30A 4DYEA 4TVCA 1S3HA 5AC6A 3MUIA 2ZDRA 1CYGA 2VD8A 2WAGA 1IEQA 3W6LA 2CWXA 4WLCA 4ZZ9A 2VX7A 2EQDA 3ARPA 1G9HA 5T9CE 1TV2A 4CD5A 4LS2A 2WV8A 1UJQA 2VZSA 3K4AA 1MW2A 1YXCA 5FOOA 1YADA 4NJIA 1LBLA 3LSBA 3L0GA 1TZ9A 2BB0A 3CMJA 4MUPA 4RXGA 4JTAA 4ADUA 3MUXA 3PF3A 2FGLA 4ENLA 5DXYA 1XPGA 1BWLA 4MKVA 3MUY1 4IG2B 2E9LA 4JN8A 3U5YA 1E73M 3AOFA 1OJXA 1I0BA 4DWSC 2I5QA 1OBAA 3WUBA 1E0VA 4AZBA 3U2EA 2ISWA 3WJZA 5EMKA 4GNKB 4GACA 4PYSA 5E9XA 2PGEA 1EP2A 1SR0A 1S46A 3AS1A 4V2XA 2E6FA 1Q66A 3G1FA 3PSWA 3W1AA 4JICA 2E5DA 4LB4A 1VYPX 2FMNA 1QI3A 3DC0A 3ICJA 2OX1A 4HMEA 5HWMA 5DMYA 4DAIA 1CX9A 5J5RA 5AC8A 4F2UA 2WM0A 3TH6A 3PZ9A 1HP4A 4PMRA 1NFGA 2H8ZA 3S1VA 1EP1A 2HBVA 2ZTKA 4JFUA 5PTDA 3M16A 4PMJA 4JL1A 3VKBA 3TTYA 2R91A 5CZKA 2PD5A 4BA0A 3V0UA 4ATWA 4W9TA 4UTJA 1GJWA 3LZ5A 2FVMA 1XRTA 3UXLA 5E6ZA 1OY0A 3PK7A 3R10A 1TR9A 3FX4A 2CLFA 5FEPA 3FV9A 1GKQA 1XDJA 2XVKA 2HJPA 1T0OA 4LVGA 4GUGA 3S5YA 1LF1A 5CBBA 1L6YA 1CGXA 1TWZA 1ZRQA 3CHVA 3RG6A 2DQWA 3SRHA 1TJPA 2VVNA 3PBMA 3FVDA 4MDPA 4AVNA 4IGSA 2ZRZA 2JALA 3TYEA 3S6OA 2XIJA 2J78A 3AIBA 4GY1A 3RR1A 2Q8LA 1QO5A 4CQCA 1G7UA 3B97A 1SFTA 2QCGA 4Q4SA 1EJSC 2NXHA 4JIQA 4UR8A 1D3HA 4ML4A 1M7PA 1VS1A 2ACQA 3PZGA 5M1TA 2WVSA 3UR8A 1XGEA 4BQ4A 3QGKC 1ZBKA 2HQAA 2PRLA 1ODZA 2VGIA 1F9CA 3E2QA 1F3EA 2HMCA 1ME8A 1LLOA 2UZ9A 3BQ6A 3A22A 3CIXA 2CBJA 2CHNA 3UWUA 3CH9A 3GNDA 4LEQA 2QUTA 1BYDA 1LYXA 4XAPA 2XPKA 3L5MA 5C7HA 2XU2A 2I14A 1KA9F 4RDZA 1VB9A 4PMDA 4DJDA 1KTNA 3KZSA 4ACZB 1XICA 2BXVA 3OZMA 4AXNA 1QRQA 1I6NA 2VZOA 3AALA 2HPIA 2A7RA 1SJCA 4LCRA 5F7UA 1B4KA 1M03A 2QZRA 3T2PA 5K7JA 3U2OA 2ZRVA 3W7GA 3LOTA 3GDKA 1P0NA 3STCA 1OX5A 2GVYA 4LU0A 2GJXA 4RNFA 4O28A 1XIFA 4XKYA 1ITXA 1JZ5A 2W9MA 1T40A 1SPQA 3EX2A 1LWJA 4KF1A 2ZADA 4C6LA 4YVVA 4PB5A 3OZYA 3KE0A 5F1UA 3N9RA 1HVXA 3QEZA 2J7FA 1Q6EA 3W85A 2J75A 2JE8A 5D09A 2INZA 1HT6A 3P80A 4Z2JA 1QNOA 3NFUA 4MNLA 3DFNA 3BLFA 1U5JA 3OVPA 2WSKA 2VX4A 2E9BA 2REQA 1J0ZA 3B0VC 2RDUA 1H7RA 3PB0A 4JFTA 1IXOA 1N55A 1X1NA 2WPGA 4LUYA 4N2YA 2TMDA 3Q65A 4NUWA 2J79A 1V02A 2NX9A 1C8VA 3WH7A 1K8YA 4A3QA 4EX4A 2ODOA 2JIEA 1Q7ZA 4QLLA 4GC3A 4DM1A 3INPA 3KVLA 3MDUA 1H60A 3EDJA 3N12A 3FJLA 5I3FA 5C9RA 2OT1A 3T4WA 3F4WA 1T8QA 1TG7A 3S2LA 1ZL1A 1PTAA 3N2OA 1E6SM 4AWEA 4NILA 3WK0A