5LYRA

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-noeuromycin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
total genus 134
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5lyrA00
2YBTA 2NSXA 4TUFA 4OUEA 1DHKA 3VGDA 5ABGA 5E0CA 4PMNA 1DP0A 3THCA 3VNZA 3GTNA 3OZOA 3VIOA 3ZJ7A 3VKKA 3AYSA 3VX0A 3WBEA 3SCTA 1CGYA 3GNPA 1HJWA 2ZXAA 1MQQA 1UR8A 3PZTA 1UQYA 3WUFA 1FH7A 4A4AA 2QMJA 3HU7A 1QNPA 1FA2A 2VX6A 3F4VA 1UR1A 3LPPA 1UWIA 3MUAA 2WNWA 4W89A 5CPTA 3VD9A 1CXHA 3N18A 3CBWA 1KQZA 3S6TA 3KWXA 4GI9A 2GSJA 1E6SM 4DUWA 1LLOA 1HKIA 4BS0A 4HA3A 3WQ5A 2CHOA 1CGWA 2PBGA 4AZ5A 3N13A 4AC1X 4PTWA 4U5IA 4BF7A 4PRWA 1MW0A 3TONA 3GH4A 3ARXA 1GNXA 4W85A 2NT1A 1V02E 1E71M 2VVSA 5LYRA 3WUBA 2QPUA 3VD4A 2ZIDA 3WEOA 1CLXA 2X09A 1ODZA 3IK2A 4EAMA 3EBVA 1CBGA 8CGTA 2Y2WA 1RP8A 2IUZA 4PSPA 4U3AA 5A69A 1XH0A 3L4VA 3NJ3A 2J8GA 3W24A 3II1A 3TTOA 1U30A 5JBFA 3WDPP 3PZGA 4AD3A 1BGGA 3WD4A 5A8OA 2DSWA 4H04A 1V6YA 3SUTA 2YJQA 4M24A 4UFKA 1MW3A 1UD5A 1NWTA 4UR9A 1CGUA 3T2PA 2F8QA 3WDHA 2WLZA 4MAVA 1OCQA 3K46A 5CSYA 1K6AA 1E4NA 4P8UA 1ZB5A 4PUDA 4YN5A 1AQ0A 3MUY1 3GNRA 3NSMA 2FHCA 1V3MA 2BXZA 1CPUA 1QHZA 3VO0A 1W3KA 3VD7A 2E3ZA 4DWSA 3DYOA 3PZUA 2UY3A 2XFYA 3WF2A 1VENA 2W66A 3MSDA 3SEPA 5I77A 3RMEA 2DIJA 3AMLA 3N9KA 4HMDA 2E9MA 1B9ZA 4UQEA 5BXPA 1B0IA 2WVUA 1HN1A 4S3KA 5ECUA 2D0FA 2VJXA 2CETA 4E8CA 1JZ5A 1FOBA 2OYLA 4JFWA 4Q22A 3CTTA 3MMWA 4UFLA 3W6LA 3WEMA 2WBGA 2VQTA 3VDBA 1HT6A 2XVGA 5E70A 4J28A 3ZJ6A 2WMIA 1D7FA 3A4AA 1KBKA 1EDTA 1XH2A 3WL1A 3MMDA 4M80A 4JL1A 1E6NA 1EO7A 1J0KA 3RJYA 7A3HA 1MQPA 1AQHA 4UFIA 3ZIZA 1PEZA 2DSUA 1D3CA 1TR1A 1XD1A 4P7QA 3DHUA 4KMQA 1UQZA 4DWSB 4L4PA 3ZR5A 1CIUA 3PBGA 3VIJA 2XSBA 4JL2A 1MFUA 2G8ZA 1KGWA 1ISYA 2XM1A 3L2MA 3WBAA 1Z32X 4D6GA 1VBUA 1H5VA 3MSGA 2PBOA 4Z2LA 1OT1A 1KGXA 4HU0A 4EE9A 2XHYA 3RILA 1GW1A 7CGTA 1JGIA 4V2XA 4UFMA 2W63A 3GXFA 4UQCA 3VIKA 3B9DA 3POHA 4AEFA 2O9OA 4V27A 1QHOA 1LL6A 2XFRA 1B3YA 3ZQ9A 5ABFA 3W28A 5I5RA 5IFTA 1OB0A 4PMDA 3SCVA 2CKRA 2FHBA 3RDKA 3AFBA 4W7VA 1ISWA 2WMIB 1JYXA 4ZEPA 1G9HA 4XZWA 2D0HA 1UD8A 2VTFA 2XG9A 4U5KA 2A3CA 1EOKA 2QV4A 2XWDA 3AS0A 5A6JA 5GNYA 1VIWA 1E3ZA 1UWQA 3BAXA 2XWEA 2QF8A 3WUGA 2WBKA 1K9TA 2WCAA 3SCOA 5M3WA 4AD4A 2G3JA 5CSUA 2XIIA 1BG9A 1U2YA 2J4GA 2W5FA 3EDFA 4PTVA 4LYPA 3WH8A 1BYBA 1V03A 3VGEA 1R85A 3CO4A 1PX4A 4CN4A 5CG0A 4HOXA 1RPKA 5BWFA 2YKKA 3E1F1 1IV8A 3IJ7A 6CGTA 2UWFA 4PYSA 4AD2A 4JZ5A 1XRVA 4W5UA 4AISA 2DGAA 5ABFB 4LQ1A 3GH7A 3BCFA 2XSAA 2XVPA 4PN2A 2G3NA 3CUHA 1H49A 3AIQA 4JKKA 3A47A 4UTFA 3G6MA 1H1NA 5D9PA 3B8SA 2OWXA 2DT2A 4P7NA 3QGVA 4M8UA 3LPFA 2QMKA 4N42A 2G3IA 1GHRA 4QLLA 1W1YA 3ZJKA 1P6WA 1E72M 1NP2A 4CU8A 4AXNA 4MNJA 4AEEA 2EO7A 2WWDA 1PPIA 1W3LA 3QHNA 3CMGA 1MXDA 5I79A 1DWIM 2TAAA 4FLQA 3THDA 4LYRA 1GJUA 2E0PA 4MNKA 3WD2A 4CN1A 3OG2A 1XCXA 3UR8A 1JYVA 3FNDA 2BV9A 3MUIA 1HVQA 1V6WA 4KGJA 3W37A 1KQYA 4PMVA 1JDDA 2BHZA 5LA0A 1W1TA 1W9BM 1C7SA 2Y5EA 1BTCA 3GNOA 3NYDA 4AZCA 1PX8A 3SUSA 3N15A 3AMKA 2J74A 3AOFA 4UQDA 4H8UA 1H41A 3WMBA 1LL7A 3K1DA 3EDDA 4PMRA 5I0DA 4Q7NA 4D6IA 3JUGA 2ZX7A 4MB3A 3U7BA 4YHGA 1WO2A 2VT0A 4J27A 5A2AA 2DH2A 1QW9A 3MV01 3WSUA 1PBGA 3L4YA 1LG1A 1JDAA 1I1WA 5E9AA 5C70A 2J62A 3ARPA 4DM2A 2J7CA 2OLHA 1W1PA 4EK7A 2VCCA 3WNKA 1AQMA 1XSKA 3L2LA 1JFHA 3UR7A 5A2BA 1OSEA 1M53A 1UKPA 3VINA 1JZ8A 4WKHA 5A8NA 3N12A 4HPHA 4UCFA 5EBAA 6A3HA 1UA7A 3UETA 2VCAA 4AZCB 4CVUA 1KB3A 1UR9A 1QHPA 3NDZA 1ESWA 4HP5A 2PWHA 4FF5A 2OYMA 3EMZA 1HJSA 2BY0A 5CZKA 4FLSA 4D72A 3AZTA 3CHEA 1E9LA 1PAMA 4HOZA 3M07A 3OLIA 1OGSA 3VMNA 1IT0A 2Z1KA 1GOWA 2W61A 3DHPA 3NCOA 3N1AA 2XGIA 2JF6A 2WM0A 5CJ5A 1VEMA 5DT7A 3WQ8A 5BXRA 1V3LA 1W2VA 1Q4NX 3NSNA 4W7WA 6TAAA 2W91A 3CH9A 4B3LA 1UR4A 1J18A 1WDQA 2DT3A 3VIPA 1E3XA 3BXWA 4AIUA 3IAPA 4UZSA 1TVNA 1V6VA 2J7HA 4CCEA 3POCA 3BAJA 1L8NA 4P7OA 3IAQA 1JXJA 3GH5A 4QDMA 2D3LA 3U5YA 3KE0A 3UG5A 4JFTA 3GZAA 3TTQA 1CENA 5HBFA 4GO9A 4RE3A 2VNCA 3AIEA 3VM5A 2WMJA 4PMXA 5JUVA 5CQ1A 5KZ6A 1E73M 1SYTA 4J3XA 1JI1A 3PZOA 1G94A 2VUYA 3A4XA 2F2HA 3BCDA 3ZJ8A 5D8ZA 4UOQA 5TD4A 3UEQA 5BROA 3PTKA 1J0HA 7TAAA 3EDEA 1BF2A 2WPGA 1MVYA 1KR0A 1WZKA 1JZ7A 1JI2A 3WNMA 4MB5A 2WHMA 4J3VA 4YPJA 1VFOA 2BVDA 2WLYA 1C93A 3PTMA 1VAHA 1OBAA 4F9DA 3WNPA 3VNYA 3ZMRA 2D1ZA 1J10A 1WAWA 4IISA 1J12A 1UR0A 3WD3A 4H8VA 2BHUA 1UWUA 2ZX6A 3OBAA 2GDUA 1XV8A 1QOXA 1WKYA 3CZJA 2A3EA 4BQ3A 1FH8A 1UA3A 4KRUA 1NWRA 3VVGA 2XVKA 3FN9A 4U2ZA 4W8BA 5D9NA 3VOCA 5CPSA 1C92A 3MANA 1JD7A 5IDIA 1Q6EA 1XD0A 4AY1A 4HOWA 4RL3A 2EPOA 2A3BA 1E5JA 1JXKA 1V0NA 2O9PA 3QOKA 3SUWA 3NUKA 2J77A 5JIWA 1UOKA 2WC7A 3WEZA 4AZ7A 2X1IA 1BG4A 1QI2A 4PTMA 3OLGA 5A8QA 2CYGA 2YA0A 2DEPA 1PX3A 2V3EA 4D1IA 3L4WA 2UY4A 1TG7A 4GINA 2VZUA 1ZJAA 4AW7A 1E0WA 8A3HA 3TTYA 5FOOA 1YQ2A 3W0KA 1LQ0A 2OWCA 4MNMA 2JIWA 4JIEA 4XX6A 2CERA 1W32A 5DO8A 3AIWA 4GIAA 1HX0A 4CU7A 4B9YA 1JIBA 5A2CA 3CZGA 1CGVA 3WDQA 5D8WA 4NRSA 4CVWA 1GQLA 1LG2A 1G1YA 2CEQA 3ZM8A 3AMCA 3WENA 5I78A 2WZEA 2CKSA 5DT5A 3AMGA 3CGTA 2PWFA 3PZNA 1XGZA 4HMEA 2DSVA 1WPCA 2PWDA 4IUGA 2V38A 3ZT5A 1PZ2A 4JFSA 3MMUA 3AHYA 3CHFA 3VMOA 1W2PA 2EEXA 3IANA 4H8HA 1E1EA 5C8BB 1Q6FA 1B3VA 4ZE5A 5CPQA 2O9TA 1LF1A 2CXGA 1CNVA 3KL0A 3HN3A 3L4XA 1ODUA 4LYQA 1QBAA 2X05A 1OT2A 4PMUA 3SUVA 3WNLA 1GVIA 1E43A 3ALGA 1MWOA 1BAGA 3W29A 4PUEA 4EANA 1V3HA 2JEQA 2VZVA 3O6AA 4WKAA 4W87A 1GHSA 3MO4A 3I3BA 4P7RA 5M17A 2QPSA 1FH9A 4CU6A 1W9UA 4ML4A 4W7UA 1X6NA 1B2YA 2XVNA 4GXPA 5GNZA 3SURA 3W4RA 3DYMA 1ZU8A 1NWSA 1UZ4A 3DYPA 2WCSA 2AOSA 3SCRA 5BRPA 3BAKA 2YL5A 1O6IA 2HISA 2J47A 2O92A 1L0PA 3OGRA 2X8RA 3GBEA 3VIGA 1UG6A 4E2OA 1VBRA 1KFWA 2YLLA 4OBSA 2WSPA 3ARRA 2CHNA 3SCQA 2JFEX 2W67A 3L4UA 5I3DA 4W84A 3VPLA 4LX4A 3AHTA 4GKLA 1EIBA 4MJ2A 1CECA 1O7AA 3VX1A 4MJ4A 1KCKA 1UH4A 4UQ9A 5A95A 3QOMA 3CZLA 4W93A 4PMYA 4Y7EA 2EBNA 1F4AA 3ZO9A 5JBEA 1GPFA 3TTSA 4AZIA 4GI8A 1QI0A 1GQJA 4UZUA 4MADA 3BSGA 2J7BA 1Q6CA 4OIFA 3VGBA 2YIHA 3AIUA 2CIPA 1VF8A 1OM0A 4WJXA 3W82A 4ATWA 2EPLX 3PZQA 1TFVA 1C90A 3BGAA 4RE2A 2Y8KA 3ZSSA 3WF4A 5FL0A 2ZUVA 5DF0A 2CNCA 1GOMA 1WP6A 1UYQA 3WD0A 1E15A 4JKLA 1KWGA 3F5JA 1QW8A 4MDOA 2CBJA 1XSIA 4AD1A 1MFVA 4PMOA 3RO8A 4JKMA 1V08A 4D6CA 3IJ8A 2G41A 1EQPA 1E0VA 3F5LA 3MU7A 1H0IA 1K9EA 4AMCA 1VEOA 3OA5A 4MB4A 1WE5A 1QPKA 4H7VA 2DPEA 2XJ7A 1IZKA 4PTXA 5M5DA 4ATLA 2BHYA 3WQ6A 4F9JA 1K9FA 1M01A 3ZT7A 1CGTA 3D5HA 4IM4A 9CGTA 4GO8A 4ATDA 1JYWA 3EYPA 3DECA 4CKQA 4C7GA 1US3A 4TVUA 4B3KA 1C8QA 3ZR6A 1XCWA 4NRRA 4WLCA 3VGHA 3WQVA 1E6QM 3VUPA 1NP0A 1JF6A 1J0IA 5IXEA 1B3WA 2VRQA 3A3HA 4A3HA 3VIIA 2VVNA 4AZ6A 2X2YA 4KWUA 1PZ3A 1J9YA 2YDSA 1HKJA 2RGMA 3M46A 3WNOA 1EQCA 2AMGA 4V28A 5A94A 2V3FA 1SFSA 1F4HA 3K8KA 3AIBA 4JHOA 1A3HA 3W81A 5CGTA 1TCMA 3NSXA 1HL9A 5GNXA 1OWQA 2WMGA 3BAWA 2J7EA 5CLWA 2WMFA 2WZHA 1GONA 2XGBA 3BSHA 1BSIA 2WYSA 4NSBA 3UCQA 3W53A 4TXEA 4WKFA 3B9EA 4AYSA 2E8ZA 2WHJA 4A3YA 3AS3A 5I23A 1WDSA 2XM2A 4D6EA 5BRQA 4GZJA 4FK9A 5D4YA 1M03A 5A6SA 4YHEA 2YA1A 4TVDA 5EMYA 1GORA 5ABHA 2DQXA 1GOKA 4H2CA 3MS8A 1SMAA 4IPLA 4C7DA 2VR5A 2W62A 2VL4A 2ZE0A 1X1NA 3ZT6A 3SCNA 2ZUWA 3U7VA 5AY7A 3G6LA 1KWKA 2WKGA 3M7SA 1HKMA 1B3ZA 2WW5A 1MQRA 2ZXDA 4W5ZA 3RM4A 3QR3A 3VIFA 1VFUA 1KXQA 1MW2A 1DWAM 1H3GA 2DIEA 3L4ZA 5A8PA 1WNOA 1NOWA 3AXXA 2BVTA 3FAWA 3F5KA 3WF1A 3CZEA 3APGA 1R86A 1E6RA 2ZX8A 4UFHA 4B16A 1TMQA 4CD5A 2D20A 2FH8A 1VJZA 4JCMA 2E9BA 4JHZA 1JAKA 1HJQA 1NH6A 3GDBA 3RCNA 1W3JA 5D9OA 2XTKA 4PMZA 3CUJA 4QLKA 1ISVA 4JFVA 2DSZA 4M56A 4ACYA 2F61A 4WSKA 1UKTA 2WMKA 4MTVA 1SMDA 1UH3A 1DWJM 1W1VA 3CHCA 1DWFM 1HJUA 1E0XA 1E6PA 3BMVA 4PMQA 2VX5A 4TOQA 4H41A 4R5EA 1UWSA 1HVXA 1ECEA 3SIMA 5FL1A 1QNQA 1ZBWA 2D2OA 4TTGA 4ZE4A 1MW1A 4L4OA 4GI6A 3AHVA 1EOMA 1UD3A 1KCLA 3NIYA 1GOIA 1W9XA 2AAAA 1KBBA 3FXYA 5DFAA 2JF7A 3UG4A 4W8LA 2XPKA 4GZEA 1FFQA 4OOUA 4X0VA 5F7UA 3WDRA 4CD4A 1YHTA 4HMCA 1BQCA 3DC0A 1QI3A 3CUIA 3QHOA 1HKKA 1HF6A 1N82A 1R7AA 1BVZA 4AZHA 3WQWA 5A6AA 5AYBA 3SCPA 1TZ7A 3WFLA 5HDRA 5KEZA 1V02A 2ZUTA 3N17A 1NQ6A 1DWGM 5HNNA 1VFFA 3VMPA 4AIEA 3AICA 5E6YA 3VD3A 4XB3A 2QLYA 4U33A 3J7HA 5AC4A 4UQBA 4M82A 2E40A 5BCAA 3W27A 2VMFA 1E6XM 3PHAA 2BVYA 3WMCA 5A6BA 3U57A 4OJYA 5BXTA 1QNOA 1HL8A 4MDPA 4X9YA 2FDMA 2J78A 1C91A 3O2LA 3BC9A 5A1AA 3AHXA 5D9MA 2MANA 4XZBA 4URIA 1RP9A 3AIVA 2YL6A 2DT0A 4WK9A 1E55A 3GBDA 4MB1A 5E09A 1GQKA 2VZSA 4U3CA 4J3WA 5I6SA 3I3EA 1XH1A 4LPCA 1TA3A 3RM8A 4HA4A 3WDIA 1E1FA 1UWRA 2C8NA 3OLDA 3ARSA 3GXMA 1V0LA 1AMYA 3KZSA 5BXSA 2XUCA 3KL3A 1OD8A 3GYCA 1UH2A 4TTUA 2J79A 5BYWA 2YA2A 2D22A 5FKYA 4BZYA 1NOFA 3CZKA 4CD7A 1E56A 2OSWA 1NARA 3WIJA 5C71A 2D24A 4U2YA 2YLAA 4TX6A 1UKOA 1E4IA 4C7FA 1CTNA 2QHAA 2DDXA 2ZUMA 5HOSA 3WH5A 3CUGA 4P8XA 2ZICA 1V3IA 3VM7A 4HZ8A 5JIPA 1JL8A 2PC8A 2ZOXA 1J11A 2C7FA 3VGGA 3ARZA 1U33A 2YBUA 1JNEA 2J75A 4GZIA 2GFTA 4RE4A 4BCEA 4KGLA 1DWHM 3ARWA 4JCLA 1JNDA 2BFGA 4M1RA 1UR2A 2CBIA 5AYIA 1TA3B 1A47A 2WHKA 4KRTA 2ZUUA 1RH9A 5IHSA 2GVYA 1UUQA 4NF7A 1H0GA 5GQBA 1ITCA 2DT1A 2UY2A 1E6ZA 4FLOA 3OGVA 3W6MA 4JAWA 4E4PA 1QI5A 2VC9A 1HXJA 2V5CA 4ACZA 5E6ZA 2Y24A 2VX7A 1EDGA 3ZSTA 1JZ3A 1BYCA 1H4PA 1JDCA 4UOJA 3HMCA 3VIMA 3AMDA 1BLIA 1E4LA 4UOZA 1C8XA 4D6FA 2WVTA 3WY1A 3EDJA 3WH6A 4F8XA 1R87A 3K4AA 1CLVA 1VRXA 1OD0A 1SR0A 4FMVA 4CGTA 4PCTA 4M29A 2ZXBA 5HXMA 2YL8A 3AI0A 2ESCA 3GM8A 3OZPA 2VCBA 3W38A 1VEPA 4S3JA 1GZJA 1FHLA 1Q6DA 3W26A 3AYRA 3W25A 1GQIA 4QFUA 4WIWA 4NZCA 2J7DA 1C8YA 5CLTA 1OIMA 2VOTA 4GPNA 3SCSA 1OIFA 3WELA 4ACZB 1QVBA 3A4WA 4HTYA 4CCDA 4OOZA 3AROA 2WZIA 4GQRA 1RD6A 3T0AA 4IPNB 4BQ4A 1CDGA 1LL4A 3BAIA 1E4MM 4XUYA 1FP8A 4N0RA 1E40A 3I3DA 1VFMA 1UD6A 2XFFA 1K9DA 2OYKA 3O9NA 1D2KA 2VZOA 4OZOA 3U5UA 4Z2KA 1I75A 1QBBA 3WN6A 4D6HA 4QCEA 2PWGA 1G5AA 3TP4A 2C0HA 4PBGA 3LPOA 1WB0A 2OWWA 5A6LA 3ZOAA 1GOQA 3ARTA 1B90A 4X0NA 3BH4A 1OGBA 1PIFA 4WSJA 1CXLA 3WQ4A 1EGZA 3SCWA 4M81A 2GJXA 1ISZA 2IXVA 1ZJBA 2YL9A 1XSJA 1GCYA 3NDYA 3AXIA 2JIEA 4NI3A 4GQQA 1ZBVA 3N11A 3VDAA 3OGSA 2OSXA 1FFRA 4DUXA 4D6DA 2HVMA 5A6MA 3EMCA 2CBVA 3CUFA 1Y7VA 3MKKA 4MPKA 3FHAA 1CGXA 2WKLA 3VU2A 3RJXA 4B9ZA 4PSRA 2EPNA 1JG9A 5DEZA 4CD6A 3VILA 1LWHA 2UY5A 1BVNP 1W9VA 3A6OA 1KXVA 3FW6A 3T09A 2XYLA 1W9DM 3WL0A 4U31A 4P8VA 1KXHA 1VB9A 1JAEA 1FHDA 4DWSC 1AVAA 1IZJA 4DM1A 3CMJA 4QP0A 1XYZA 2PF0A 1CEOA 2ZX5A 1J0YA 2GJXB 5EFDA 3S2CA 2WC4A 1EHAA 3T0BA 3WMSA 2GDVA 2ZUSA 1I1XA 2A3AA 5LA1A 4R27A 1G01A 3IJ9A 3UESA 2E8YA 1M04A 2VX4A 1WZLA 1V3JA 5AC5A 3QHMA 3T2OA 2V3DA 1GUVA 2VRKA 4ZXLA 3N04A 2VO5A 1HJVA 2X0HA 4MAZA 1UKSA 3BMWA 2Y8VA 5A8MA 3WKZA 3PN8A 4F79A 4Z2HA 3TA9A 1UD2A 1WCGA 5EB8A 5EFFA 3ECQA 3AZSA 4AWEA 1MYRA 1J0ZA 3VDCA 3KL5A 4PCSA 1ZS2A 3PTQA 3WDJA 4QAWA 3WH7A 2NW0A 3PZ9A 3T0DA 3WUEA 2Q8XA 5LA2A 1ISXA 1JYNA 3ARUA 2D0GA 5A6BD 1B30A 2FH6A 3AQUA 2B31A 2X0YA 4D6JA 2CCRA 4E8DA 3KEHA 1E70M 1UKQA 4AZBA 3RPMA 1CXIA 2CPUA 4K68A 4WF7A 2EXOA 5E0FA 4B15A 4TVCA 2J25A 3ARQA 3PZVA 3AJ7A 1HP5A 1J0JA 2V3GA 2D3NA 1HP4A 2VURA 5I24A 1J01A 2J8FA 1X6LA 3WF0A 4CCCA 1B31A 4J3SA 3VDHA 1BGAA 2GK1A 2V5DA 1FP9A 3WD1A 2W4XA 4W88A 5A3HA 4Z2GA 3T08A 4TX8A 4CD8A 4HZ7A 1JFXA 4EKJA 2NT0A 3D3AA 3OB8A 1CZ1A 1QNSA 2ZXQA 1QI4A 1R7OA 1ZL1A 2J7GA 3MUZ1 2CBUA 5IHRA 3K8LA 1CYGA 1BYAA 1ZBCA 2VI0A 2O9RA 4OBRA 1W9PA 3RIKA 1B1YA 4OKDA 2WC3A 4D71A 4BA0A 1H09A 3LPGA 3GXDA 3BLKA 1XYFA 2WVVA 5FIPA 4P8WA 1R8LA 1LJYA 3L4TA 1E5NA 3UG3A 1MXGA 1C7TA 1WZAA 1BPLB 3CZ8A 1V3KA 1W91A 3ARYA 4AZGA 2XVLA 3OIHA 5GPRA 3SUUA 3AIRA 1TUXA 1CWYA 2GK1B 4HZ6A 2FHFA 4HPGA 2W92A 3LMYA 1GJWA 1BYDA 1OGGA 2ZWYA 1JD9A 1V0MA 2EPMX 5ABEA 1EA9C 3UERA 2BNJA 3WH9A 1WZMA 2IXUA 1DEDA 4ZFMA 5DMYA 1Q6GA 2PWEA 4FLRA 5A6KA 4F66A 2WSKA 3SCUA 3B9AA 1TE1A 1PJ9A 2EQDA 1C3FA 2JEPA 4PEEA 4Z2JA 1KR1A 3ALFA 2WVVB 1WDPA 4UFJA 2D23A 2ZUNA 4Z2IA 1EO5A 1QNRA 1B3XA 4CN6A 1LWJA 2WCGA 2EJ1A 1HNYA 3AHZA 1V6XA 2VRJA 2OSYA 4BQ5A 1G0CA 3OLEA 2BY1A 1WDRA 2YDRA 3CIVA 3TOPA 2WK2A 1JZ2A 1UWTA 4W86A 2JE8A 2EPKX 1NOUA 2PB1A 1TVPA 1HIZA 5IFPA 3M6DA 4DUVA 2YOCA 4HU8A 2WAGA 4QCFA 2WANA 4QLJA 4AIOA 3EMQA 2A3HA 1JZ6A 3WF3A 2DH3A 4ZXOA 2CESA 2BY3A 2WMHA 3K4DA 1UD4A 1NM9A 5HPCA 1BHGA 4MNLA 2G3MA 4J3UA 2VZTA 1CXKA 4KH2A 4AD5A 5CXPA 4XV0A 2G4FA 2Y4SA 2DSKA 4JFUA 1GOOA 1CXEA 2GUYA 1UZ1A 3AISA 5M03A 1EXPA 4ZENA 3VTRA 2FGZA 1W3HA 4UQAA 2J7FA 1JF5A 5FCZA 2Z1SA 1JZ4A 4DWSD 3CPUA 2GJPA 1EDQA 3WNNA 3MV11 2WVSA 3EDKA 4J7RA 1DTUA 2VR4A 3AXHA 1ITXA 4CUCA 2VQUA 4HA1A 1S46A 4W8AA 3RM9A 3VGFA 1XC6A 3PZMA 1GVYA 2PI6A 4P7LA 3T2QA 1KGUA 3WFZA 3VIHA 3AS1A 2GJRA 1H2JA 3K8MA 2YDQA 1V0KA 2FGLA 3HJEA 5JBDA 1CXFA 2WB5A 3AS2A 2BS9A 3CLWA 2BXYA 1OINA 1VJSA 3ARVA 1M7XA 2WHLA 2BY2A 2ZX9A 4BQ2A 1PIGA 5HPOA 3VD5A 1ZBKA 3FHQA 1EH9A 2RGLA 4AD0A 2JALA 1BFNA 2E4TA 1H11A 4LGXA 4D1JA 3GXIA 1XHGA 3AZRA 5I2UA 2CITA 4LXFA 5CGMA 2XIBA 1US2A 5FD0A 1UHVA 1V6UA 2ZWZA 1NWUA 2E9LA 2WXDM 3BLPX 1KXTA 1EHNA 3BAYA 1HJXA 3CHDA 4J3TA 4UNIA 3PZIA 2WWCA 3FY1A 3FAXA
chains in the Genus database with same CATH superfamily
2YBTA 4UWMA 1XS2A 4IP7A 4B4HA 4LANA 3VNZA 4K7YA 3OPSA 3VKKA 3AYSA 1QOQA 2ZXAA 1UR8A 3PZTA 4FA3A 3GKFA 4A4AA 2PUZA 4IX2A 2QMJA 3HU7A 3DFOA 1GYLA 3S0CA 1RR2A 4UTLA 3F4VA 2DW6A 1UR1A 3B97A 5HJLA 3MUAA 3TJ4A 2WNWA 4PUUA 5CPTA 1KQZA 3S6TA 3EOUA 1E6SM 3TE9A 2HS6A 1LLOA 4MKSA 1OFDA 3GC5A 3CK5A 4GC4A 2ZYFA 5D05A 3N13A 3N73A 1NVMA 1MW0A 4CQBA 2GSEA 2PDIA 1OJXA 5CC6A 3UWZA 3H21A 1XLIA 3OVPA 2VVSA 1XLFA 2GUUA 4X2PA 3VD4A 4X2RA 1ODZA 3BMXA 1ZAJA 5FJIA 4UC5A 2X7VA 1NFGA 3L4VA 3NJ3A 3W24A 5HUPA 3II1A 4BF9A 3WDPP 5E0KA 3C8NA 3IGUA 2NWRA 1R3YA 4QJ1A 1K8XA 2DSWA 5C9WA 5K9XA 3L5AA 2YW3A 3BLEA 1UD5A 4PODA 3W7KA 1NWTA 1CGUA 3QXBA 4ZA0A 3TROA 3Q37A 4NZ3A 1K6AA 4P8UA 1ZB5A 5HUOA 1H61A 3LGGA 4JTDA 4YN5A 3NL2A 3MUY1 4UTHA 4X61A 3LRKA 2GSHA 3GNRA 4JD4A 3NSMA 3JU2A 1V3MA 2CLEA 1W3KA 3UYIA 4Z42C 2E3ZA 2FZBA 2UY3A 1VENA 2W66A 7ODCA 1TYGA 2POZA 1AW5A 4S3AA 4H7CA 5I77A 5K9CA 1U83A 1R47A 2W79A 1Y8BA 2QVHA 4LT9A 1DJNA 2CLKA 1VYRA 1XBYA 4UQEA 3B8TA 1B0IA 4GQBA 3W7PA 1EYEA 4E8CA 3P62A 1H7OA 2R1KA 3W6LA 3WEMA 3LEPA 3G3DA 2PDXA 1HT6A 2G37A 1D7FA 2A21A 1KBKA 2GQ3A 3Q45A 3WL1A 4M80A 2VFIA 1E6NA 1J0KA 1AQHA 3ZIZA 1S1RA 4G7EA 1UMLA 1X8CA 3AU6A 4XAGA 4IQEA 4ADSA 4QDWA 1CIUA 3RHGA 4K3ZA 2XM1A 3TEVA 3L2MA 3LY0A 5EBUA 3M6YA 4Z2LA 1KGXA 1XPYA 3RILA 4UUIA 1GW1A 3C0LA 5CZTA 4UFMA 2W63A 3LDVA 3GXFA 3FKKA 4UQCA 3TYDA 1SJBA 3VKAA 5DMNA 3JS3A 2O9OA 5ABFA 2XFRA 1B3YA 1Y5XA 2E5CA 3Q4DA 2ZZ3A 3RR4A 2NUWA 5IFTA 1OX5A 3UWEA 1ONXA 3SCVA 2FHBA 3RMJA 4DBUA 2XH0A 1XIGA 4I5XA 2D0HA 1UD8A 4GH3A 5EMLA 5GNYA 1VIWA 5IBXC 3EWBX 1E3ZA 5C2GA 2OEKA 1F05A 4RV8A 2FMOA 4G7EB 4H1ZA 4RZ4A 3WBYA 2G3JA 2P0IA 1W1ZA 5CSUA 2XIIA 1OF8A 1G4SA 1G6CA 2J4GA 3EDFA 5AHNA 1VBJA 3SQLA 4PTVA 1NJJA 2F6UA 2OCZA 3S2MA 4B5UA 2G4JA 3HIJA 3CO4A 2F6XA 2Z25A 2OG9A 3OVRA 1KFKA 2V5KA 3ZVIA 3DGBA 1RPKA 4MVAA 5H8UA 5DRCA 3C52A 4O54A 3IJ7A 5LIUX 4C6MA 1XRVA 1KM1A 4MLJA 5ABFB 3GH7A 2XSAA 2NXGA 4R53A 3A47A 1FWFC 2GUBA 4M8UA 3LM3A 2QMKA 2PCQA 1G7VA 3NQVA 1CB7B 1DQXA 1PS9A 2O7SA 3T8QA 3ZJKA 1AD1A 2ZA3A 3L0GA 2EO7A 1PPIA 3M64A 3NG3A 3VUSA 1NY1A 5I79A 4A21A 4M0XA 3I7RA 3W2LA 2TAAA 2Y6ZA 4LYRA 3H23A 5D30A 2FFCA 3FNDA 3GAKA 3LB0A 3HQNA 4LWWA 1G67A 1WXYA 4C60A 4F40A 3W37A 2RDTA 4PMVA 1JDDA 2HVOA 3NYDA 1I2QA 1F3XA 2ISFA 4UQDA 3ICJA 1W3NA 2ZZ2A 2FPTA 4Z1BA 2Z2UA 3HGSA 4WUIA 1O66A 4D6IA 3O1NA 2REQA 3K1GA 3PP7A 1FDZA 4V1YA 2TMDA 1NTHA 2BASA 4MB3A 4J27A 5A2AA 4HD5A 1PBGA 3L4YA 1NF7A 2V63A 5EU9A 4QQUA 2J62A 3M47A 2IKGA 4DM2A 2J7CA 2QCMA 2VCCA 1AQMA 1XSKA 1P1XA 3L12A 1EL3A 2R1LA 5B80A 3IVSA 2Y61A 3QY6A 2PRLA 4UCFA 1KB3A 3TDFA 1QHPA 3NDZA 2C1IA 1EP2A 2OQYA 3WK2A 2FKPA 5CZKA 1I2NA 1UW9A 1E9LA 3L7RA 5H2ZA 5FAJA 2REQB 3H70A 1L2UA 1EF3A 3UXAA 1IT0A 2Z1KA 1N55A 3SM0A 2QNEA 2XGIA 3JW7A 4LB3A 5DT7A 4ZSUA 4LU0A 1EEXA 5BXRA 3C3UA 2ICSA 1W5QA 1BKSA 4W7WA 2W91A 4M5PA 1LOSA 1E1CA 1EBHA 1UR4A 1W5PA 1X8FA 3VIPA 1FWIC 1OHLA 4UZSA 4DX3A 4W9TA 1C8VA 1K7XA 3BAJA 1L8NA 4Q33A 1JXJA 3W1LA 3NQFA 4DJDD 4MMWA 2C18A 4K1GA 4YYFA 5GVJA 1CENA 1WKEA 1P6BA 1KTCA 3H12A 2ZTJA 3VYLA 2F9RA 5KZ6A 1HQTA 3M41A 1E73M 1GEQA 4J3XA 1WXJA 3QEZA 3BCDA 3T0TA 2KZHA 5D8ZA 3UEQA 1VYSX 4MZYA 7TAAA 2C91A 1TJRA 3EDEA 3LHZA 1MVYA 3RF9A 1WZKA 1JI2A 3ITYA 1XLDA 3WNMA 1E1CB 1YE4A 2WHMA 4MB5A 4CQ9A 4YPJA 1OFEA 2WLYA 4S3BA 2RHGA 4ZBCA 3THQA 3ZMRA 4FEZA 3AWNA 4IISA 3OVGA 1JCMP 2ZX6A 3G1SA 2VEGA 1A53A 4PB5A 3MHFA 4BQ3A 3B0UX 3SZ8A 5I3KA 3FEQA 4KRUA 2GJLA 3E38A 2QIWA 3VOCA 1R3TA 1C92A 1EX5A 4YL2A 1Z69A 3GC4A 1H51A 1WX0A 2DZPA 1W37A 1BD0A 4KFPA 2EPOA 3QMRA 1E5JA 1JXKA 3QOKA 2FVMA 4ZO6A 2CLLA 3UXIA 4KBXA 2J77A 3I7SA 2QGYA 4JICA 2X1IA 1QI2A 1GZGA 2YA0A 2A0NA 3P67A 3K5XA 1NF0A 3M5XA 3R4IA 2F38A 2UY4A 2HVNA 4GINA 1ZJAA 1E0WA 3G77A 3R2GA 3TTYA 4WOQA 3NURA 3Q65A 1UPMB 3W0KA 1LQ0A 3QR0A 3IARA 1KFLA 3GNNA 4GIAA 3NQ8A 4A8LA 1JIBA 1MSSA 3GNDA 3RK8A 1L6WA 5AB3A 3CZGA 5CC3A 4N2YA 5D8WA 2ZRUA 1LG2A 4ES4A 3C0QA 3M0YA 4WX2A 5DT5A 3JRKA 1XGZA 4E4FA 2PWDA 2V38A 3ZT5A 1PZ2A 3KOZA 3GKAA 1RY8A 4BI6A 1W2PA 2EEXA 2YYTA 2A7PA 1B3VA 1PYFA 1KM3A 3TN5A 3DEQA 3KL0A 3L4XA 2I14A 1ODUA 4RZ6A 4LYQA 2DFAA 2BVWA 4Y96A 3WNLA 4DZ5A 3ALGA 3S1GA 1TTJA 1UJQA 1MWOA 2AMXA 2QKFA 5MF5A 3UPBA 2VZVA 1WXZA 4DJFC 1EUAA 1ECQA 1ZENA 4P7RA 4GNKB 1FH9A 4ZOAA 1W9UA 4IMDA 4GXPA 5GNZA 3W4RA 1VLWA 4JIRA 2WCSA 1RSCA 5CKSA 4KKXA 5G1YA 1UP0A 2WM1A 2X2GA 3FYOA 1SSGA 1Z6KA 3E12A 1K3UA 2O92A 3PVFA 3VIGA 2DY3A 5CEWA 1X97A 4XBSA 1Q45A 1XXXA 1FXQA 2GQ9A 1E0TA 2JFEX 1ZJIA 3L4UA 5FA5A 2VM8A 4KRZA 2Q6ZA 2PDUA 3AHTA 2X30A 5TIMA 4MJ4A 1KCKA 1UH4A 3UBPC 4UQ9A 4NYUA 3MSRA 3CZLA 2Z1VA 4XD6A 1S2CA 3TTSA 4L6OA 1XRSA 3B0VC 2V2DA 2J7BA 3COTA 1Q6CA 4OIFA 3PUEA 3AIUA 1VF8A 2V5JA 3DIPA 3TSMA 1AW2A 5CC7A 4ATWA 3HQ1A 4UNLA 3LRMA 1TFVA 1C90A 3HQOA 2YCIX 2YXOA 2ZUVA 2ON3A 2PDCA 2QIIA 1UYQA 4JQ4A 4JKLA 2CBJA 1XSIA 1MFVA 4CEXC 4E0CA 4H9TA 2ALDA 1T40A 1V08A 4O18A 3STCA 1E0VA 3F5LA 3CQHA 3WLRA 2ZTKA 3AUOA 2D2HA 3OA5A 3UP8A 3TFCA 2ACSA 2C15A 1EYWA 2XJ7A 1IZKA 4ATLA 4C6PA 2QZRA 4IJRA 4RZ5A 3WQ6A 2ACRA 4H9ZA 4ZGYA 1C9WA 1SZNA 3ABSA 2PEVA 1S5WA 4JTIA 5F2MA 3VKCA 1DJZA 3S3GA 4TVUA 4HK6A 3ZR6A 3E0FA 3LYEA 1FKXA 1ZUAX 1QPQA 1B3WA 2JGYA 3A3HA 3VIIA 1V5XA 4AZ6A 4KWUA 1AD4A 3L0NA 2V3FA 4F0RA 2FYMA 1PL9A 3W81A 4GUJA 2CLMA 5GNXA 4GMEA 3WYZA 2WMGA 1MEWA 3LLDA 3BW3A 3H2EA 1GONA 3KLKA 2C13A 3BSHA 1KM5A 1D8CA 3D46A 4BKNA 5BRQA 2VGFA 4YHEA 3IWPA 3WLLA 3NQBA 2TPSA 3W76A 3N2OA 5ABHA 3A3XA 3DU0A 3C2VA 1K7FA 1O5XA 5KINA 1GOKA 4C7DA 2EAWA 4CQCA 3THUA 2VL4A 2IMRA 3ZT6A 3U7VA 4X22A 3U2CA 2Z2BA 1Z42A 3E2SA 3M7SA 2FGBA 3OJGA 3CYJA 2ZXDA 1MQRA 3AYVA 3HG3A 2VOMA 3CLMA 1JUEA 1DWAM 4NZ4A 2DIEA 5A8PA 4LBSA 1WNOA 1T5AA 3OBKA 1L9WA 1M7JA 2INEA 1XKJA 2ACQA 1GG0A 2PE4A 4HCHA 4PEKA 3URBA 1EZ2A 3TYEA 3CPGA 5G4HC 3RX2A 1OX4A 4L80A 4GVGA 4G7FA 5HATA 3QF0A 2PLKA 3DG7A 3L66A 2FH8A 3P80A 3DENA 3C8FA 1LQAA 3NTYA 1RQBA 3RCNA 5D9OA 3SY5A 4MOZA 2XTKA 3CUJA 4DJEC 2V69A 4JFVA 1GOXA 1UJPA 3SO7A 4GIRA 3BOXA 1YW1A 1L6YA 1QXLA 4MTVA 4B90A 1ZQ5A 5CGQA 2ZC1A 1CX9A 1ITUA 1HJUA 1TVLA 3MB9A 1JPKA 4R7JA 4TOQA 1UWSA 3SIMA 5FL1A 5MKGA 4M6QA 2CHRA 4NY2A 1IEXA 1EUNA 3U48A 1EOMA 3NZRA 4ORMA 1UZHA 4FIQA 4FXSA 3FXYA 1OX4B 2QEZA 1U1UA 5KETA 3UG4A 2XPKA 3G1YA 4GZEA 3CL7A 4OOUA 2NUYA 1XLEA 3N2MA 1YHTA 1BQCA 4O1CA 3R25A 2QUVA 1QI3A 3DC0A 3R6IA 4AIBA 3KRSA 5HWMA 3W23A 3C0SA 1HF6A 1GVFA 1BVZA 4LVAA 3LMZA 3PB2A 3FVDA 1YDNA 3N17A 3CPRA 1DWGM 1QWKA 5E6YA 3VD3A 2XINA 1TKKA 4QIUA 5MKGB 4KEUA 3J7HA 4JN6A 4FP1A 1OY0A 3SB0A 2I56A 5BCAA 2PAJA 2BVYA 3WMCA 5C6MA 1IWBA 1VCGA 4HSHA 3NQMA 4MWAC 1FHVA 5BXTA 1QNOA 1HL8A 3O2LA 2J78A 1ELSA 3AHXA 3UWYA 4GJIA 4LS2A 3ITTA 2DT0A 4FX7A 1V4YA 3P3BA 3GBDA 5E09A 4HSOA 2W3ZA 4C6BA 5I6SA 3I3EA 4YTTA 5C2XA 4HA4A 4JX4A 5CZ0A 4AAJA 1XWYA 3WDIA 1E1FA 1R46A 4FF7A 1UWRA 3ARSA 4PB3A 3KZSA 2ZQ0A 3SFWA 3C0JA 3KL3A 1FWBC 2QYGA 2D22A 1VD6A 2Y7GA 3CZKA 2OSWA 1NARA 1NAL1 2V2HA 3O8AA 3F2CA 4TX6A 1CTNA 3IRDA 3GTIA 4MUZA 2NQ9A 3L9CA 5HOSA 2YXGA 3WH5A 5A8GA 5DX7A 3GVRA 4ZSTA 2ZICA 6XIAA 4FXJA 4XISA 4BWLC 4ZB0A 3PC0A 4TU1A 1JL8A 2ZOXA 3W01A 3M44A 2J75A 4GZIA 2GFTA 1DWHM 3M9YA 4JCLA 4M1RA 1UR2A 2GZXA 1XYBA 3JR2A 4LVDA 2Y7FA 5GQBA 3DBNA 1QPRA 1FXPA 1EJUC 2PPGA 3OGVA 3WQGA 3W22A 3IJ6A 4E4PA 5E6ZA 1EC7A 2H90A 4AB4A 3ZSTA 1JZ3A 1BYCA 3F2DA 1H4PA 1HO1A 3HMCA 3KRUA 3LCXA 3IGSA 1ZZMA 3UG8A 2DORA 3EDJA 3EB3A 3ABOA 1GWJA 2YL8A 3OO2A 2ESCA 1VEPA 1OFQA 1TV2A 1NSJA 2D2JA 3AYRA 1XPGA 2P50A 4FNUA 4IGMA 3SCSA 3QY8A 3VKBA 4NKCA 2QUTA 1LOLA 2G97A 2P8CA 5C54A 3IIPA 1XX1A 4IPNB 5FEPA 1CDGA 4ZQPA 3TNBA 2HJPA 4WGHA 4KWVA 2YCEA 4L56A 4E2VA 1BSLA 4O14A 4XUGA 4HNUA 8TIMA 1VFMA 4JN8A 4LJ3A 3BWWA 4US5A 1IYXA 4S3DA 1D2KA 3BQ5A 1I75A 1QBBA 3HM7A 2RDUA 4D6HA 4QCEA 2QJMA 4R7OA 4Z1AA 2PGWA 5KZMA 2RFGA 3O63A 4V33A 3ZOAA 1CW2A 8XIMA 3LXAA 4NXSA 3NQEA 1KLZA 3DDMA 1MUWA 1DHPA 3SCWA 1ISZA 1E9YB 1ZJBA 1XSJA 3NDYA 1QASA 3B3DA 4YWIA 2JIEA 4JTFA 1P1MA 5FF2A 4GQQA 5MHBA 3ZFHA 3WJZA 3QLLA 1KBJA 4DLMA 4GXWA 4JEJA 4DUXA 4D6DA 1SO6A 4QSFA 4YTUA 1P43A 2CLPA 3CAVA 3EXSA 2H3DA 3CUFA 2WKLA 3VU2A 1JG9A 4CD6A 3EAUA 4IWWA 5BWAA 2PGEA 1BVNP 3NL3A 3CWOX 2KAUC 2NVCA 3VOJA 4WD0A 5TBOA 1KV8A 1JAEA 3VFLA 3H8AA 3CMJA 4QP0A 1XYZA 3UT0A 2ZX5A 5JH2A 2GVLA 3ABQA 5C2CA 1DXEA 1OFOA 2CLIA 2GDVA 2ZUSA 3CT2A 3G1VA 4DO7A 3KUMA 1W54A 5HMEA 1A5CA 1G01A 3IJ9A 1RJQA 2VX4A 3P93A 5CC5A 4ZB2A 1GUVA 4I6KA 2VO5A 2VKZG 1U1HA 2Y8VA 5A8MA 3WKZA 3PN8A 3RN6A 4PCNA 3TA9A 1PKYA 4AWUA 5IRPA 5AKQA 2Y62A 4C6QA 4CLMA 3BL3A 4O50A 2X0SA 2WSYA 1F07A 3W6YA 1ZS2A 2BG5A 1KFCA 1RBOB 4E6MA 4QAWA 3WH7A 3QW3A 4RKAA 1W8GA 2HS8A 4IP4A 2Q8XA 5LA2A 1JYNA 1DYSA 2FH6A 4PRTA 4QM1A 1AQFA 3RPMA 3M1ZA 4ZZ9A 4K68A 4WF7A 2PDLA 2EXOA 2NX3A 2WJFA 3DFSA 3KAOA 4PBEA 3S83A 2J25A 3TWAA 1D9EA 5I24A 3KW3A 4HU3A 4O52A 3AXKA 3TMLA 3WF0A 3CAKA 3B8DA 3BGGA 1FP9A 3WD1A 4W88A 2DVXA 2NSOA 2Q02A 4R9XA 4CD8A 4EKJA 3BQ6A 2QAFA 1YPFA 5M1TA 5IHRA 3NFUA 4IUOA 3OHMB 4KEVA 3N4EA 1CYGA 1BYAA 4OBRA 4YCPA 1B1YA 5EY5A 4OKDA 1IIGA 3LPGA 4MZ8A 3CL8A 3U4AA 5FIPA 1XLCA 4P8WA 3L4TA 1TV7A 3PAJA 1WZAA 3FIGA 3RLVA 4DLFA 3V5OA 4WSHA 1JQVA 1V3KA 4I7WA 2R8WA 3UW6A 3TR2A 3ARYA 2G0WA 1CCWB 3OIHA 5GPRA 3UZWA 1TUXA 1HGYA 5ABEA 1EA9C 5DY2A 3OODA 4HHLA 2DZSA 4AUBA 1OYBA 2BNJA 4Y9AA 1WZMA 2E6YA 4IH3A 1DEDA 3ONCA 2Q3OA 7PTDA 2PWEA 1OEPA 1TPEA 1ZY9A 4KIEA 3BW4A 1C9DA 2ADAA 1C3FA 1VC4A 3ALFA 4DBSA 3KHDA 4ZODA 1DORA 3TSBA 4ADUA 3ITGA 2ZUNA 3UJSA 3RPTA 1BWKA 1LCOA 1B3XA 4CN6A 3W70A 1Z7AA 4W4QA 4MY8A 4HCDA 4DBEA 2DVUA 1V6XA 1TX2A 3APTA 3W2KA 5DBTA 2FLIA 2CZVA 1WDRA 3CIVA 4J5NA 3DFHA 3TX9A 9XIAA 4TV6A 3VE9A 1HIZA 4YIWA 1MMFA 2YOCA 2WAGA 3C6CA 3LG3A 3WK0A 3OYXA 4K7VA 3EMQA 3EWUA 3PR2A 1BXCA 4R88A 2CESA 4L5ZA 3EB2A 4Y8FA 3UPMA 3N4AA 1GVEA 1XDLA 1DIKA 4IXXA 3MUXA 1PTDA 4KH2A 3PPFA 3IK4A 4LB4A 1HZYA 4PTDA 3V75A 1OQFA 3U0HA 3GX9A 3BV7A 1UZ1A 3AISA 4G1KA 3B05A 2P76A 3VTRA 2FGZA 3RLUA 9RUBA 2J7FA 3N2BA 4LCRA 1HG3A 5AC7A 3O6YX 1YTEA 1JCJA 2GJPA 2YW4A 1Z44A 2A85A 3WNNA 4FOKA 3GR7A 3EDKA 3F4WA 1DTUA 2BB0A 4ZO7A 1EJ7L 1YIXA 4TIMA 3AXHA 5AHIA 4CUCA 2VQUA 1S46A 2QDEA 3M0KA 1PYMA 1E51A 1XC6A 4F4RA 3L65A 1AH3A 1KCXA 3KBSA 4H6QA 3DFPA 2PI6A 4IFRA 1K8ZA 4K36A 5H8PA 3WFZA 4HK7A 3CQKA 3AUJA 4KIRA 1YDYA 2XFWA 5D2TA 3ITVA 2WKJA 3V35A 4B2DA 2BXYA 1A80A 1M7XA 4QJ3B 2GWNA 2QT3A 5T8GA 1ZBKA 3REQA 4AD0A 4NUWA 2VFDA 1AFSA 4LGXA 1X98A 4LEFA 1XHGA 1Q8JA 2QCEA 3PUDA 1R9ZA 5FD0A 2NX9A 1T6MA 1TZ9A 2VEPA 3F2BA 1KXTA 4V15A 4FAMA 3GZ3A 2CWXA 1F74A 5CG7A 3S2NA 1S5VA 3PAOA 4UNIA 3PZIA 3H6OA 4LTSA 1ZALA 3CMFA 3EOLA 4OUEA 3VGDA 3WJYA 5ABGA 1GGOA 4PMNA 3THCA 3SQSA 3OZOA 1VIZA 1YEYA 4QITA 4S3CA 1HJWA 1MQQA 1AODA 3SRHA 2DV0A 4BEUA 1MDLA 1KM4A 1RY0A 3RX3A 3HZ3A 1Z8AA 1UWIA 2CLFA 3REQB 4JEQA 1Q6QA 4N9CA 2VEFA 1P5BA 3N18A 1B5TA 3KWXA 5DN1A 3W7JA 3WQ5A 3GU9A 3U2ZA 1CGWA 3H7VA 3IVTA 3M0JA 4BF7A 4OE7A 4LUSA 3TONA 5AC6A 1MRQA 1GK8A 4WEVX 1FWRA 2SFPA 4W85A 2NT1A 1V02E 1BF6A 1E71M 3IGHX 3AAMA 2ZIDA 3WEOA 4MPQA 2IPJA 4GE8A 2A7NA 1UP3A 1AH4A 4CNOA 5BNKA 2INZA 3K30A 4MZ1A 1DJXA 4GG9A 4HN4A 3S1VA 1K8CA 3TTOA 4OV4A 5F4SA 4C91A 2OLSA 1NDWA 1W56A 1QATA 1T41A 2YJQA 4I90A 4M24A 1IZCA 2HXUA 1FWTA 1MW3A 1P6CA 3FJ6A 4O0ZA 3KCLA 3T2PA 2F8QA 4LUSB 3WDHA 4E38A 4MAVA 5HQLA 5CCZA 4J40A 1OCQA 3GUWA 4DJED 5HJYA 4PUDA 5JH1A 4IMGA 3BJTA 1IHIA 3W1AA 3QM3A 2Z1XA 1VPQA 1F76A 1UP2A 3NZGA 4XD4A 2HPIA 3KLLA 1QAPA 1TELA 3F03K 1UIPA 3EPMA 2XISA 4IHCA 4DWSA 1TQXA 2A2IA 4C6LA 1UCWA 3NGFA 3KVJA 4QX4A 1VR6A 3I6TA 4M7SA 2W27A 2PTXA 6ENLA 4FPSA 4A29A 4L4LA 1ZTVA 4YMZA 4DAFA 4NHVA 1RCQA 1ZPTA 2HNEA 2DIJA 4LEQA 2B7QA 3E49A 1W1A1 4PBFA 3BG3A 1IIHA 5BXPA 5D2WA 3R8RA 3GDTA 2D0FA 1PTAA 3HOJA 3R1ZA 5D37A 2BP1A 4JFWA 5FJUA 4HIBA 1F6PA 5E70A 4J28A 1RJRA 3F4NA 2WMIA 1DPMA 3A4AA 3UY7A 3QPZA 4GBUA 4HPJA 1EKOA 3MMDA 4YWSA 3OOQA 3S9IA 4JL1A 3WBXA 7A3HA 1D8WA 2V8ZA 4JDBA 1OFRA 3IUIA 1PEZA 2DSUA 3TZFA 3IEBA 4FNSA 1D3HA 4AEOA 4HNVA 4DWSB 7ENLA 3N19B 2XSBA 4ERIA 3ATYA 4JL2A 2G8ZA 1FRBA 1KGWA 3BCJA 4DXKA 3V36A 2RJGA 1Z32X 4D6GA 1VBUA 4MWAD 4XSLA 1H5VA 3UJ2A 3PJXA 4EE9A 2XHYA 2YSWA 3KBNA 4L9YA 1HO4A 2WZMA 7CGTA 5A6TC 1JGIA 3QVQA 4NXKA 3VIKA 3B9DA 1QK0A 4JTHA 5D2XA 1F73A 4ICMA 3LBOA 3T55A 2HV5A 2Z1BA 4Y9NA 2C1HA 4W7VA 1ISWA 2WMIB 1JYXA 4ZEPA 4XZWA 3VOGA 2XG9A 4H8NA 2A3CA 4U5KA 2QV4A 3BGJA 2PF8A 1BWVA 1UWQA 3BAXA 2XWEA 2B4GA 2QF8A 4FSAA 2WCAA 4LF1A 2QVNA 4AD4A 3R0KA 4LNCA 3NNTA 4L9XA 1DXIA 4LYPA 1UZDA 4LF2A 3PUOA 3WH8A 3FEMA 5HJXA 4K8HA 2P8BA 3LQLA 2GVEA 3B03A 1AZ2A 4CQDA 1MO0A 4AFYA 5I03A 5FESA 4AD2A 1RCXB 3FA3A 2VGBA 3BCFA 2OR2A 2XIQA 5C55A 3CHVA 4JKKA 4KCWA 3G6MA 1T8XA 1H1NA 2DT2A 4JNZA 3LV5A 3CASA 3MWAA 1EJSC 4PA8A 1GHRA 3CL6A 4CNSA 4E4UA 1P6WA 4RDZA 1E72M 1NP2A 3ISIX 5HR7A 5TF0A 1V7YA 1W3LA 3KZPA 4OHQA 2YCLA 1TRIA 4OU1A 3UZXA 4YVPA 1TTPA 4FLQA 4PMJA 4UTWA 1GJUA 4XIMA 2E0PA 4JPGA 4MNKA 2NQ5A 1J93A 1GTEA 1XCXA 4F0HA 4JTSA 2BV9A 3BLIA 5I07A 3MUIA 1KM2A 2PU1A 2VFGA 4I7UA 4LUTA 1OADA 1DQWA 1KQYA 4CQ8A 3GNOA 4K6AA 1XRTA 3AMKA 2J74A 2FQIA 1X7IA 3WMBA 1JCXA 3LHUA 1LL7A 3HFTA 4F0LA 3TW6A 3W7GA 4PMRA 2ZE3A 3DERA 4C1KA 2EPHA 3ID7A 3TN3A 1YTKA 3S5SA 2D2GA 1WO2A 2DH2A 1QW9A 3QBUA 1LG1A 3MHUA 1NIUA 3SSJA 2YCLB 2HZGA 4EPEC 2OLHA 1NELA 1W1PA 3WNKA 4GVIA 3L2LA 1JFHA 3UR7A 5A2BA 1RBAA 3RU8X 3EX3A 1JZ8A 1R30A 1I60A 5JXQA 4RNFA 4LUTB 2FIQA 4HPHA 5EBAA 5EMMA 4CVUA 4DELA 1UR9A 1DKWA 4IL0A 2PWHA 1UOZA 3GVVA 5EMJA 4FF5A 1HJSA 2QXWA 4IPPA 2O56A 3CQIA 4C90A 3OLIA 1JRCA 1OGSA 3VMNA 4I3GA 4HYWA 3DHPA 5JQ9A 3GC2A 3NCOA 3I10A 1EIXA 1Y65A 1AZ1A 5CJ5A 1VEMA 1V3LA 1Q4NX 2AL1A 3R94A 1W6TA 1AA1B 2DT3A 4AIUA 2E1DA 3IGXA 1POJA 1V6VA 2A6LA 3POCA 4QE1A 3GH5A 3UG5A 1ALDA 4O12A 3EA2A 5HBFA 4GBDA 3C3NA 1A5NC 4RE3A 2PU0A 3BJSA 3RU6A 1SZRA 5DANA 5KITA 4JX5A 1SYTA 3D0CA 5REQA 2LLEA 5TQLA 2YPIA 3PZOA 3TJIA 4LNYA 3ZJ8A 3I4KA 5LXEA 2A4AA 5TD4A 3S46A 5BROA 3PTKA 3GTFA 4RDVA 3QLDA 1KR0A 3ELFA 5CPOA 1I45A 3S5NA 2E6AA 4XAZA 1VPXA 1VFOA 1GYMA 5T26A 4F0MA 1XLJA 1J10A 2V0TA 1WAWA 3ZWSA 3FSUA 2WPBA 1EC9A 1LDCA 2FPVA 4H8VA 4AU0A 1XV8A 1QOXA 1WKYA 3CZJA 4MY1A 1TPC1 4RXGA 4EAYA 5HANA 5CPMA 3TH6A 1UA3A 3PWIA 2AQOA 3VVGA 2XVKA 3FN9A 4WRHA 4W8BA 3MANA 3LHWA 3QRHA 5IDIA 3OQEA 5PTDA 4HOWA 4Y8EA 4RL3A 4JDYA 5C5YA 2OJPA 3GNXA 3FSTA 2OMAA 4HKPA 2O9PA 3UWWA 3SUWA 3NUKA 2BTMA 1UOKA 2WC7A 8RUCA 5LGZA 4AZ7A 4DY1A 1BG4A 3DUGA 3CAQA 4PTMA 2CYGA 2ABBA 4M6PA 2YCJA 1ADDA 2AL2A 4HCLA 2BGSA 4D1IA 1O68A 4AW7A 2H9AA 2G3FA 3GHTA 3XISA 1YQ2A 5RUBA 3ZVHB 4JIEA 4MJMA 2CERA 4A05A 4FB7A 1XIFA 1W32A 1JCYA 4CQAA 3AIWA 3QV6A 1HX0A 2XU2A 2HK0A 1TB3A 3W73A 4GUFA 4A8RA 3WDQA 4JTEA 1XLMA 1TZZA 3DFTA 3ZM8A 3AMCA 4KPLA 2PWFA 4HMEA 4YTRA 3TOYA 3AHYA 2I16A 4DEFA 3CHFA 3VMOA 2WQPA 1PB0A 3IANA 4H8HA 1JCNA 1E1EA 3VABA 2ISVA 3KOWA 5C8BB 3SW6A 2V9DA 2H9AB 1ME9A 2CXGA 2PD9A 3LERA 4FXFA 1FVPA 1QBAA 3B9NA 4PMUA 2C16A 4RPPA 4JNMA 3RNDA 3ANYA 1GVIA 1E43A 4RDWA 2QDGA 4RZBA 3VKDA 3HG2A 4DQWA 1BAGA 4QS6A 1A3WA 2O55A 1I6NA 1V3HA 2JEQA 4ROQA 4LBUA 4W87A 4YU1A 4JTKA 4N02A 4CU6A 5BU9A 4W7UA 4O17A 3ZLGA 3SECA 4OBTA 2XVNA 1ME7A 4DJDA 3THAA 3DYPA 4B5VA 4O1EA 4BFAA 3UVAA 5DCBA 5K4XA 3SCRA 4C65A 1UR3M 3BAKA 5FJTA 3W87A 2HK1A 3DBPA 1O6IA 4X9SA 3MI3A 2C6QA 2HISA 2FVKA 3OGRA 1A5OC 4E2OA 1AMKA 3P6LA 1AH0A 1AUSL 3S42A 1KFWA 3D3FA 3URQA 3CC1A 2WSPA 1RD5A 2X42A 2IPWA 1PCKA 1TR9A 1OYCA 4I6VA 3ARRA 3O15A 3SCQA 3QTPA 2W67A 4O8RA 3VPLA 2HBXA 3OTRA 3VCNA 3ZLHA 2Y1HA 2DZAA 3WQDA 3VX1A 2QCLA 3W02A 3NZQA 4BI7A 2WNQA 4LAMA 2VP8A 5A95A 4R9OA 3N14A 1P0EA 4Y7EA 3ZO9A 5JBEA 1GPFA 1QI0A 4WGXA 4XZIA 4KFOA 2ISDA 3ZWTA 2DVTA 4RDYA 4MADA 4IIDA 3VGBA 2JKEA 3IV3A 2YFOA 5E9XA 1XIJA 1OM0A 4F2UA 4WJXA 4JIPA 2EPLX 1XYLA 4EPKA 2R82A 3BGAA 4RE2A 2Y8KA 4HBKA 4OVXA 3WJXA 3IV8A 3VOHA 5FL0A 1WP6A 3FK4A 3WD0A 1A5MC 3R79A 3W75A 5BRBA 4FR6A 3OU8A 3XIMA 2FVLA 3TJLA 3RO8A 3QZ6A 4D6CA 1EQPA 3ABZA 1Q13A 2FZ8A 3VAVA 5B7ZA 4KW2A 4HVXA 1VEOA 1JPDX 1MZRA 4IF2A 1VGAA 2DPEA 4K8EA 4PTXA 2DUZA 3QYQA 1H50A 4RUBA 2VD8A 4F9JA 1TWSA 1M01A 3ZT7A 4IM4A 1ZAIA 9CGTA 5I09A 2Y89A 1JYWA 4XAFA 3EYPA 2WQDA 1Q4WA 4CKQA 4NZFA 1XGEA 3BE7A 5F1UA 1XYMA 3QV9A 4DNHA 3VUPA 3URNA 3PJUA 4MGGA 4A3HA 1S2VA 1F61A 4DRSA 4BR1A 1J9YA 2YDSA 3WNOA 4V28A 1F4HA 1LOQA 3AIBA 5U7SA 1A3HA 2ZRWA 5CGTA 1TCMA 3NSXA 1MZHA 2RAGA 3BAWA 2J7EA 2WMFA 4DBWA 1EXBA 1M7OA 1F3WA 3SJ3A 5FAGA 3PB0A 1W8SA 5LNWA 2IKJA 3CEUA 5I23A 4A3YA 1WDSA 2XM2A 4Q8QA 2OKOA 3PTDA 4GZJA 5D4YA 1M03A 1O5KA 3CO8A 5A6SA 3M5YA 2YA1A 1W3IA 2VR2A 1EEPA 3CV7A 1I0DA 2CLHA 4DWDA 2PC4A 3TQ0A 2ZE0A 4HNLA 1X1NA 4QE5A 2W0UA 1A5UA 3G6LA 2WKGA 4AVOA 4IQDA 3P8JA 1ZNNA 1B3ZA 3KOXA 2PWUA 3RM4A 2P53A 2JBMA 3VIFA 3TXVA 1VFUA 1KXQA 3W2JA 3E0LA 3U4FA 3NO1A 3RYSA 4ERGA 1TMHA 1YBQA 2C14A 1NOWA 3AXXA 4NG3A 3EKGA 3MKVA 1Y5WA 4JYEA 1FTXA 1PZ0A 3F5KA 4AHQA 3CZEA 2EG8A 3APGA 4Y90A 2FTWA 3VNJA 3VC6A 3S2JA 1LWIA 4H4IA 1R86A 1E6RA 3R43A 3N3MA 4B16A 2Y63A 4XIAA 4CD5A 1H7XA 1VJZA 5JMUA 4JCMA 2E9BA 4JHZA 4RJEA 2JQXA 1JAKA 1HJQA 1NH6A 3DAQA 2QDHA 5LXXA 4QLKA 2PGRA 1ISVA 1ICSA 2F61A 3NL5A 1W1VA 3CHCA 3E6EA 1ZP4A 2VX5A 4IZGA 4H41A 3P7YA 1IXNA 1QNQA 5HR6A 3W7HA 4DYKA 1YBQB 3WJWA 1A5KC 5JU6A 4TTGA 3O0FA 1MW1A 4GI6A 3TN6A 2CU0A 1WUEA 3ORWA 3B8VA 3W1TA 3TCSA 3GSMA 4Q4PA 2Q01A 4KT2A 3O06A 1XICA 4W8LA 1UPPA 1FFQA 3U2EA 3W7EA 1XLLA 3CT7A 4X0VA 3WDRA 4XZNX 4CD4A 3AWOA 3W83A 3CUIA 2E25A 4EXQA 1LZOA 1AG1O 1R7AA 3W7IA 1BQGA 1UASA 3SCPA 4I5UA 4ONVA 5HDRA 5KEZA 2YYUA 4EF9A 1NQ6A 1VFFA 4JGDA 3AICA 4J35A 2QLYA 4U33A 2CLOA 4M82A 3UZZA 3NL6A 3N3TA 1L6GA 4NJIA 4I9MA 2VMFA 4UMCA 4RLIA 4GFSA 3PHAA 1NFPA 3NOEA 3FCPA 3KCJA 3MVTA 5G2WA 1Z3NA 2QAPA 3BC9A 5F2LA 2MANA 3KCOA 3L67A 5I3JA 3DFQA 2F6KA 1E55A 3QSTA 2VZSA 4U3CA 4J3WA 3H26A 4JQ1A 4R34A 1KRAC 1RCOB 1S2WA 2GVGA 2X16A 3CQ0A 4S3EA 3MTWA 3TSDA 4TTUA 4X60A 3GYCA 1N8FA 5FKYA 4UTJA 3MKCA 4BZYA 4CD7A 1E56A 5J8LA 1UKOA 4C7FA 1KTNA 1JUBA 2XGZA 3GW0A 4P8XA 1AL7A 4LY8A 4PUNA 2GWGA 5JIPA 1YXYA 4QE4A 2C7FA 3VGGA 1U33A 5G5IA 4RE4A 4KGLA 1Q2SA 3ARWA 4KCUA 5AYIA 5FSDC 3HTWA 4JS3A 3VA8A 2WHKA 3E96A 4DYJA 2GVYA 1GVSA 1UUQA 4NF7A 1H0GA 2ZZ7A 5FF4A 1ITCA 4UIOA 3OG3A 1T96A 1E6ZA 4FLOA 4QSHA 3W6MA 4JAWA 1QI5A 1UBPC 3BICA 4RV3A 4ACZA 2VX7A 4Q4KA 1XJBA 1EDGA 3S5OA 1JDEA 1JDCA 2HQAA 5LNVA 1E4LA 1C8XA 4D6FA 3WY1A 2C1GA 5AC8A 4F48A 3QC3A 4GXMA 1CLVA 2QS8A 1OD0A 4FMVA 2V30A 4GISA 4M29A 2ZXBA 5I3HA 4GQ0A 1YPIA 3T81A 1XI3A 4LAUA 3GM8A 3W1PA 5J04A 5AHEA 1IXQA 3QPEA 2J7DA 2VUNA 4B5XA 1C8YA 1F8MA 1OIMA 1ZJHA 4H9UA 3W72A 3GDLA 4PULA 3WELA 4ACZB 4OOZA 1XM3A 5J5RA 2BWGA 3KDNA 2WZIA 4GQRA 5H6HA 5TAOA 1KC7A 4N9BA 4NT0A 2A5HA 1LL4A 2E7FA 3IUHA 1V93A 3BAIA 1MXSA 4WHBA 3NPVA 1E40A 1UC5A 3I3DA 3FJNA 1IT8A 2J8TA 3LTPA 3MQTA 3H2MA 3R5EA 4JYFA 3DKLA 4OZOA 4Q8PA 4Z2KA 3LCHA 5LKYA 3STEA 2OWWA 1WB0A 2J6VA 1GOQA 3ARTA 3UJRA 1SFTA 4PUJA 4X0NA 4KQNA 4LAKA 3T1GA 4DAIA 1EGZA 2GJXA 1SW0A 2YL9A 4AY7A 3GIYA 4YLWA 1VKFA 1Y0EA 4L65A 4ECLA 1FCBA 3LCIA 3DZ1A 4WY0A 2ONEA 1ZCOA 4DN1A 2HVMA 3ATZA 1CB2A 4S3FA 1L6FA 2CBVA 1LROA 3B0YA 1WOBA 4GVFA 1CGXA 4B9ZA 3GS6A 2EPNA 3W7CA 1WAUA 1LWHA 2UY5A 1B3OA 1W9VA 3FW6A 4GA8A 3JZEA 4GZ7A 4WR3A 4J9JA 1VB9A 3V3WA 1YX1A 3QV8A 2R1MA 1AVAA 4NI8A 4DWSC 3GB6A 2J9YA 3N9SA 3B4YA 4EPDC 5C9RA 2XIJA 2ALRA 1J0YA 1P7TA 1VP5A 2VDHA 2GJXB 3QV7A 3S2CA 3TC3A 3HGOA 3WMSA 3M4HA 3W7RA 2A3AA 4HSNA 3U6WA 4R27A 4GH1A 5LA1A 2HE5A 4JBRA 4GKTA 4WY0B 2CZFA 1M04A 3TVAA 1PKNA 3BANA 5HINA 4AG0A 3NQAA 3TQKA 4EIVA 3QHMA 1JPHA 3A5FA 3GDKA 4ZXLA 1HJVA 4F79A 2ZC8A 1YE6A 3OZMA 2GOKA 2IKIA 1UD2A 3UZJA 3DOPA 4PTNA 5EB8A 3UJFA 4ML9A 5EFFA 1R38A 2NXHA 5CAHA 1MYRA 1J0ZA 4ZL1A 1UC4A 1BWLA 1LUCA 2Z7GA 2OQHA 3LTSA 5CZJA 1PE1A 3PZ9A 4RNIA 1ISXA 3G0UA 4D8ZA 4DXXA 1P7TB 1EWDA 4S38A 1B30A 2NWSA 3AQUA 2CCRA 1KRBC 1E70M 1Z9AA 4DZAA 9XIMA 1CXIA 4UBPC 3LCLA 3ONBA 4ZO9A 4PUKA 1FWNA 4LV4A 3UR5A 3ARQA 3AJ7A 3MDUA 1HP5A 4DO4A 1JPMA 1HP4A 2D3NA 1X6LA 3UXLA 1HUVA 2GK1A 2NXIA 2OB3A 2V5DA 1R5YA 1XLKA 1K1DA 2ZDSA 2L5HA 2XH2A 3SGUA 4WZHA 4Z2GA 3T08A 3W71A 4GYJA 2NT0A 3OB8A 3F4CA 4KEZA 4DB7A 2ZXQA 4WDXA 1QI4A 3OHIA 3S9ZA 1R7OA 1ZL1A 4LC6A 2VGGA 4IJBA 1LUCB 4XWUA 1LTDA 3BW2A 4F0SA 2E28A 1KV5A 3GWQA 2O0TA 4NIRA 4XSMA 3QKZA 1H09A 1GVOA 1FWWA 1LJYA 2CXEA 4DI9A 3MSYA 1EPVA 4NAEA 4BI5A 1C7TA 3IIOA 1BPLB 3CZ8A 3FKRA 1YDVA 5XINA 1Q6OA 5I7GA 3IJLA 4G5DA 2RDWA 2GK1B 3TKFA 3LX9A 3FV9A 3NVTA 2W92A 1OGGA 2FZDA 3G0XA 3UERA 1G4EA 3WH9A 4Q4RA 2I57A 1XQKA 2UV8G 1Q6GA 3SIZA 5HQMA 5A6KA 1TMLA 3SCUA 1TE1A 1PJ9A 2EQDA 2R1PA 2ATMA 3NO3A 4QRNA 1KR1A 4M6UA 1S38A 2OOFA 3SRDA 4UTWC 1KRCC 5G2IA 2D23A 3NXFA 2JGQA 1EO5A 4NAEB 3MI2A 1SO4A 2FZMA 3WMLA 2WCGA 4HJWA 4X3ZA 5K4ZA 2BOGX 1HNYA 3G1FA 3AHZA 5G4EA 3G1XA 1KBIA 2VRJA 2OSYA 3GAYA 2FPYA 1KBLA 3OLEA 4TX9A 4WVXA 3GFZA 1JZ2A 1PKMA 2ANUA 3C2YA 4W86A 4AQLA 2PB1A 3GLCA 1Q7QA 1TVPA 3M6DA 4WDWA 4HU8A 4I5RA 3MUCA 4AIOA 2NV2A 3W9ZA 3R7MA 3LU2A 3W2NA 1JZ6A 3CIWA 5CBIA 2OZ8A 2DH3A 4ZXOA 5H8MA 2WMHA 4G8TA 1VBGA 1JUKA 1UD4A 1NM9A 1R9XA 4POCA 3GVGA 4US5D 3KP0A 2G3MA 1FHUA 1O5QA 1CXKA 4P2VA 1VHCA 2X1SA 4AD5A 5CXPA 5C9UA 4UCGA 4BEQA 2NVAA 2DZVA 4XV0A 2Y4SA 4HNTA 4FNQA 2DSKA 1XIIA 2D69A 1OK6A 2G96A 2VDGA 1WKFA 2RJHA 3QQ0A 4ZENA 1W3HA 2F84A 1JEZA 1F5ZA 4FNRA 3GE7A 1PZ1A 5FACA 3NA8A 1G69A 3CPUA 5FI8A 3M7WA 2PP1A 3UU0A 3EWXA 3MV11 1Q66A 3CUXA 3T0CA 5AECA 4RX0A 3LV6A 5F4XA 3RCMA 1OC5A 2A7RA 5CSSA 2TRSA 4JQ3A 1O1HA 2PDJA 4O16A 1PXGA 3SY8A 4GYKA 3PZMA 3WLTA 3QN3A 1T7LA 3CWNA 5M2FX 3AS1A 2ZZ4A 3H22A 4PFHA 4DZIA 3HJEA 4FHAA 4GK8A 4M1BA 3FA4A 1IGSA 3N2TA 2NZLA 4PGLA 3B04A 2WHLA 4BQ2A 3VD5A 3W7DA 3FHQA 2FB2A 2BLEA 4Y9MA 3T40A 3UWUA 3O3RA 1US2A 1UHVA 1V6UA 1F6YA 2E9LA 3BLPX 2HROA 4GJJA 1J5SA 2G50A 2QJGA 3CHDA 1SFJA 1E9IA 2VYOA 4H00A 2NSXA 4TUFA 3EXRA 4JIIX 3E5PA 2BX7A 1R2TA 3VIOA 1TRDA 3VX0A 4PC8A 1CGYA 3GNPA 4HN8A 1F7BA 3USBA 1UQYA 3WUFA 1FH7A 4DO5A 3NEHA 2VX6A 4ICCX 1TWWA 2C79A 5GJNA 3LBMA 2Q8ZA 1CXHA 4H9YA 5DXXA 3CBWA 4GI9A 2GSJA 8XIAA 4Y2WA 1HKIA 1TPVA 2W6RA 1IQ8A 2PBGA 4AZ5A 2O4QA 4AC1X 2C3ZA 4PRWA 5D09A 3GH4A 4GYPA 3ARXA 2GJNA 4JQAA 1H1YA 4G9PA 1GNXA 2VHLA 4C6EA 3MJYA 3NOYA 1PDYA 3UWQA 3MBDA 1CLXA 2X09A 5LIXX 4CNUA 4EAMA 1W17A 3EBVA 3AALA 4M19A 8CGTA 2XN0A 2Y2WA 3SDOA 3EOOA 1RP8A 2IUZA 2Z00A 2YB1A 2IS7A 4PSPA 4U3AA 2ACUA 4NAFA 5A69A 4UR7A 5JBFA 1U30A 2HSAA 2FTYA 3PZGA 4GACA 3WD4A 5I3GA 1V6YA 4MY9A 3LXBA 3BK0A 1EC8A 3CB3A 3EPOA 3H24A 4YS1A 3VZYA 3HG5A 2PD5A 2VFEA 5CSYA 4GIYA 3F7JA 3PSWA 5I02A 1LORA 4B5SA 2QQ6A 2J9ZA 3TQPA 1H60A 3PBUA 1OYAA 3SN4A 2FHCA 2BXZA 1CPUA 3EWZA 3LOTA 1IR1A 3PPHA 1SZEA 4NAFB 5L9FA 3PZUA 3MSDA 5C7HA 3P82A 3CJPA 4DJDC 1Q5MA 3AMLA 3N9KA 2OTDA 1JJKA 4HMDA 2HE8A 4S23A 1XYCA 1SR9A 4S3KA 2F7FA 2VJXA 1FOBA 1XF0A 2XIMA 4Q22A 3QZEA 3MMWA 4UFLA 2WBGA 4Q8WA 1DE6A 4IIFA 5D04C 3TQVA 1N8IA 3ZJ6A 2PDKA 5HNTA 4H01A 2R1NA 2R24A 1XH2A 3EOSA 2ZADA 4PB4A 3RJYA 3GTHA 1MQPA 4EWJA 2I9EA 4UFIA 1D3CA 1RHCA 1TR1A 4K2SA 4P7QA 3DHUA 4KMQA 1UQZA 1RV8A 3MHGA 1B4KA 2A1YA 2AGKA 3PBGA 1XDMA 3VIJA 2DP3A 4WDTA 5E5CA 2E09A 1YLVA 1A5AA 2HEJA 2V67A 3WBAA 1OVDA 2P0OA 2PBOA 3PNZA 4HU0A 1EZWA 4V2XA 1TIMA 1R9YA 4ERAA 4UMBA 3BG5A 5AZ0A 4V27A 3ZQ9A 1LL6A 4MUPA 3W28A 3W1MA 4YNGA 5I5RA 3L5MA 4PMDA 3H2OA 2BOFX 3RDKA 1D7KA 2PDHA 1QOPA 3AFBA 2DJLA 3QPYA 1G9HA 1H7NA 1M6JA 2XWDA 3BZJA 4D8LA 3GHSA 3GHUA 4K38A 3HA1A 3ES8A 3EKZA 4U28A 3YPIA 4F2BA 1W5OA 1LBLA 4EF8A 2WBKA 1K9TA 3WLSA 3QJAA 1PDZA 1XISA 4G1NA 1XBXA 4XZLX 5LIWX 2W5FA 3W1NA 1KM0A 3RO6A 1YPXA 1BYBA 1V03A 3VGEA 1PX4A 1RLDA 1QCWA 1UIOA 4A35A 2YKKA 1VLIA 3I6RA 1P4CA 1IV8A 4GNVA 1KD0A 2Y88A 2CZ5A 4PYSA 4JZ5A 4AISA 2DGAA 2HNHA 4LQ1A 4HHMA 3V4BA 2TYSA 3HB9A 2XVPA 4PN2A 3CUHA 3AIQA 2W9MA 4UTFA 1W5MA 3TYAA 5AOUA 5E1QA 3C4UA 4P7NA 3LPFA 2XDFA 4N42A 1H5YA 3C56A 4CU8A 4AXNA 1KTBA 3HPFA 2WWDA 1XQLA 3P61A 3WJSA 4M51A 3NWRA 3AC0A 3HURA 3SGZA 1MXDA 4MF4A 3THDA 1EJXC 4IMCA 4CN1A 3OG2A 3UR8A 1V6WA 3DG6A 3G1RA 3MP3A 4KGJA 2XIOA 3PBYA 2BHZA 2NLIA 1W1TA 1PUDA 1W9BM 3TA6A 2Y5EA 1BTCA 4AXKA 5LA0A 4AZCA 4C6KA 1PX8A 3SUSA 3V5CA 2FMNA 3AOFA 4H8UA 1H41A 3NXLA 4BHYA 1FUYA 5F2GA 3EDDA 5I0DA 3RCYA 3JUGA 1A5SA 3L21A 2ZX7A 1REQA 1S2UA 3R12A 2ZRZA 4A6GA 3U7BA 4L4MA 3G1HA 3MV01 3WSUA 2NQJA 2QCNA 4GCAA 4Q6XA 3ZS4A 3KVLA 3ARPA 4RE0A 2NLYA 3R8HA 2YZRA 4RPQA 1OSEA 1M5WA 2H6RA 5A8NA 2FJUB 1QUMA 3O6CA 3N12A 3TCEA 6A3HA 1UA7A 3UETA 3NZ1A 4AZCB 1TO3A 1ESWA 3DH7A 2OYMA 3EMZA 2BY0A 4Z1YA 3AZTA 3CHEA 1PAMA 1VFTA 4FX6M 3M07A 5G1TA 1REQB 2BOEX 1GOWA 2PRHA 3N1AA 3BVJA 2WM0A 3NZPA 2J6XA 3B8WA 3QFWA 4HYRA 1W2VA 4KERA 3NSNA 3TZNA 1LM1A 2XH7A 3RRAA 4B3LA 1WDQA 3NDOA 5LNUA 1OFAA 3BXWA 3DFNA 1TVNA 2J7HA 3TTEA 1S3TC 3T78A 4EACA 3IAQA 3QC0A 4QDMA 2D3LA 3U5YA 4J2PA 1OX6A 3WLQA 5DLCA 1HGWA 1EP1A 1MUMA 4GO9A 5CH9A 3DN5A 1PSCA 4BJHA 4DNMA 3AIEA 3VM5A 2WMJA 5CQ1A 1T99A 1QPOA 2FFIA 1TE6A 3A4XA 2DZWA 4IG2A 2R6OA 1RA5A 1F2JA 1J0HA 3TC7A 4QISA 2Y0FA 2HPMA 2PLMA 2X7WA 3W85A 4J3VA 4A2SA 4BY3A 1C93A 4LRSA 3PTMA 1VAHA 3M5ZA 4F9DA 1EWEA 3VNYA 4MHBA 1FDYA 2D1ZA 1BEUA 1J12A 3RG6A 1NDYA 1VFLA 1WDDA 3TAKA 3GIQA 1UWUA 1KFEA 1YNQA 5I3FA 3E0WA 1BTMA 4LH8A 2A3EA 3VFCA 2ZZ6A 3B8UA 1FH8A 2PWVA 4J3ZA 2NQLA 2WNNA 2OPJA 1XYAA 1US0A 4Q8TA 1NWRA 4B91A 3DI1A 4GY0A 5I3IA 1A0CA 5D9NA 5CPSA 1F3EA 3KRBA 1JD7A 3M43A 3VNKA 1Q6EA 1SQ7A 1XD0A 3CQJA 3K4WA 4IG2B 4Q4QA 2OT0A 4QGCA 2A3BA 1VJIA 3SGGA 5LHFA 2Y70A 2NVDA 3WEZA 1GTHA 3SSZA 3QMTA 1P0BA 3IRSA 2GQAA 1BXNA 5A8QA 1I2OA 2DEPA 4XAPA 3D47A 3L4WA 4IMAA 1F9CA 2VZUA 4KCVA 3T44A 2KX9A 2P1FA 1ENUA 1LRTA 5FOOA 2OXNA 3PG9A 1BRLA 2PDMA 4LAZA 2JIWA 4XX6A 4LAOA 4WY0F 5DO8A 4QROA 6ALDA 4CU7A 1X96A 4B9YA 5A2CA 2A79A 2ZRXA 4IFOA 4TMBA 4C6NA 4NRSA 3E2RA 2VWTA 4CVWA 4NASA 2CEQA 3WENA 3UY8A 4YTQA 2CKSA 5DELA 3AMGA 2TODA 2DSVA 1WPCA 3TU9A 4ORIA 2ZA2A 3Q2DA 3H2CA 1WUFA 3BLFA 4IIHA 1GJPA 3I6EA 4Q4OA 2OFJA 4G6CA 1V8EA 4L9ZA 3TYCA 1Q6FA 3KVMA 6PTDA 4ZE5A 2QPXA 5CPQA 3JVAA 2O9TA 2J24A 3MJMA 1CNVA 3JZUA 1BRLB 3HN3A 3B0PA 4L6DA 3H7RA 1E9ZB 3E9AA 3WQOA 4E3TA 1QRQA 4GX9A 5DQPA 4OQVA 1ZGDA 3W29A 4PUEA 4EANA 2ZVRA 2TSYA 4R7WA 4WKAA 1A5LC 4H19A 1GHSA 3MO4A 3LLXA 4ZFCA 2QPSA 1DBTA 4L1WA 3WLJA 2QJNA 5G1MA 2PZ0A 3KBVA 2AQWA 2OU4A 3DYMA 3KOFA 1ZU8A 5G4WA 1NWSA 1UZ4A 3W3OA 3MMTA 4NQ1A 4UNKA 3BG9A 1LQ2A 5BOOA 3RAOA 1QPNA 3NQCA 4DIAA 1W1IE 4QAIA 2O7QA 2J47A 4NNBA 4G56A 4TQTA 4NYYA 3EGJA 3R11A 4ZQCA 4OBSA 4AHPA 4LVBA 3U2OA 4BF5A 3W84A 1KKRA 3A22A 5EA9A 5I3DA 4W84A 2PS2A 2P5NA 1EP3A 4NNCA 3FJLA 2G95A 1CECA 1LP6A 2YXXA 1O7AA 3WZ0E 4WQ6A 5AHMA 4W93A 2EBNA 1DV7A 1H63A 1YDOA 4GI8A 2QUNA 1GQJA 2X1UA 2GGJA 4S3GA 2YGYA 2YIHA 2CC0A 3PF3A 2ZKMX 3W07A 3WQEA 3QR1A 3W82A 3PZQA 5BOFA 2PMQA 4AX7A 5D03A 3ZXWA 1AL8A 3NR0A 2MNRA 3ZSSA 3LZ5A 4FIRA 3STGA 3CEPA 4RW5A 5DF0A 2CNCA 2BMBA 3OVQA 1E15A 3VK5A 1QR7A 2GGEA 4QTGA 4NX0A 2X40A 1IE7C 4JKMA 1GG1A 2G41A 2VFHA 5H1WA 4AMCA 5JVLA 4JTTA 1Z41A 3G2GA 4O4VA 1QPKA 1AK5A 4H7VA 3W86A 5M5DA 4IXHA 3LQGA 2PDNA 3MCOA 1K9FA 2YB4A 3WLPA 3R89A 4AVFA 4PCPA 3D5HA 2QW5A 5HK4A 1VPYA 1WKDA 4O53A 2QV5A 4C7GA 3LI0A 2E5BA 1XCWA 4NRRA 2AQVA 4JIHA 3VGHA 3WQVA 4N4QA 1X6UA 1E6QM 1JF6A 4YVXA 1J0IA 4IGNA 1IR2A 2VVNA 4UR8A 2X2YA 3BJFA 5BW6A 1P0KA 4QG8A 4Z1CA 1PZ3A 3TLQA 2GDQA 2RGMA 3M46A 1EQCA 2AMGA 5A94A 3PFMA 4UTMA 3K8KA 4JHOA 3FYPA 4Q8MA 2Z2AA 1HL9A 1OWQA 5D2VA 3CV1A 4L61A 4NZ5A 3LS9A 4HQVA 1TTQA 1BSIA 2WYSA 3B06A 1DJYA 1OCBA 4NZ1A 4TXEA 1I8JA 4WKFA 2E8ZA 2WHJA 3TN4A 1ZSXA 2FTPA 4D6EA 4FK9A 5G2HA 4TVDA 5EMYA 2DQXA 1V79A 4H2CA 3MS8A 1B54A 1SMAA 2WSRA 3SAZA 2AKZA 4HA0A 3SCNA 2ZUWA 3AYTA 1TJ2A 2J9XA 3A3WA 5AY7A 4R85A 1HKMA 4YYCA 3N6JA 4KEMA 1TIWA 2WW5A 5FJPA 5GJMA 4EXAA 5LHEA 3LM7A 2ZRVA 3GDRA 5DCDA 4C1NA 2ZZ5A 3L4ZA 2FB3A 3EA1A 1J6OA 3EX4A 3QW4B 2ZFAA 4Q8UA 1G7UA 3FAWA 1X1OA 2XN2A 2OOGA 1ONEA 3UA4A 1MDRA 4IGSA 4AVNA 4P5UA 3VKJA 4TMCA 2OEMA 4LOCA 2OX4A 4UFHA 3P5YA 4YXGA 3NM1A 4ZTXA 1BVWA 4TR9A 2IKHA 1XUZA 3C86A 4PMZA 2DSZA 1UKTA 4XZ9A 2WMKA 3WBWA