1KFEA

Crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with l-ser bound to the beta site
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
268
structure length
252
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Role of AlphaTHR183 in the Allosteric Regulation and Catalytic Mechanism of Tryptophan Synthase
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 96
structure length 252
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfeA00
4JIPA 4E2DA 1TPDA 1I2OA 1VGAA 5KINA 1DJNA 1S5WA 4N02A 2BWGA 3I7QA 1YPIA 1YXDA 1G4EA 1KM0A 4O13A 3GIYA 4AEOA 4MY9A 1TV5A 1FDYA 2NLIA 5CPMA 3STGA 3UY8A 1FWRA 4CCEA 5G2HA 2A0NA 1WV2A 3QW3A 3GXTA 3BARA 3KRUA 3KVKA 3PWAA 3DFPA 1JUBA 3LCGA 5BNKA 2Y61A 1K3UA 3NVTA 4NNBA 1DQWA 4O1CA 4UC5A 3E96A 3P60A 3DFOA 4D2JA 4B5NA 2X1SA 5KITA 4EWND 2ZRWA 3RF9A 2EGZA 4DPPA 2NUYA 1WA3A 4M5PA 2ZFAA 1JR1A 2V9DA 4DO6A 3DH7A 5AHEA 1VLWA 3USBA 5BOOA 3FEMA 1DKWA 1K8YA 4FIRA 3MBDA 4E2BA 1GEQA 3ATYA 1VJIA 3B8DA 4PTNA 3TX9A 3LRMA 2YYTA 2DZSA 4TMCA 1I45A 3EWUA 5G1YA 5BMWA 3G0UA 5I3HA 3DFTA 4O53A 1ZENA 4PEKA 3QH2A 3TCEA 3HG5A 2Y6ZA 1NVMA 1VR6A 2JKPA 2RHGA 3PUOA 3M44A 4XBSA 1LBLA 1YDNA 2QCGA 4FX8A 1FWTA 4N6EA 3W1PA 4QAIA 3FIGA 3W2LA 3BGGA 4DO5A 3UZJA 1QAPA 3H54A 4GNJA 4ALDA 5D09A 2VC6A 1H61A 3P61A 4UXDA 1AK5A 4A21A 3UY7A 2VFHA 6TIMA 2R94A 1KM3A 4MZ8A 2G97A 2G95A 3SW6A 4JTIA 3IIVA 5F2MA 1G7VA 4WXYA 4E0CA 3SFKA 2RFGA 5TBOA 2AAMA 1ML1A 4JTSA 4N9BA 1FQ0A 1R30A 2YSWA 3LCXA 4UFLA 3I65A 1W5MA 5AC6A 2I9EA 1TPFA 1JCXA 3EKLA 4RCXA 2CZFA 3PUDA 4QQ3A 2HMCA 2A1YA 1KM1A 3LHTA 3QPZA 1GVRA 1OJXA 4JYDA 1JULA 1NSJA 2JKEA 2V2CA 2QF7A 4NT0A 3UXDA 1QO2A 3H55A 1QDSA 3GDRA 3NL3A 1ICQA 3G3DA 3GR7A 3N2MA 1OFDA 1Q6OA 3C2VA 3LV6A 2NX3A 2E5CA 4IMDA 3WJSA 3W7JA 2Z6JA 2WSQA 3NPVA 4CCDA 2YW4A 1BEUA 2C6QA 3JRKA 5J5RA 1I2RA 4WJEA 3FJ6A 3UWUA 4TR9A 4JY8A 2GPTA 4LVBA 4QM1A 1VS1A 1Q3NA 4IOTA 1GG0A 1TB3A 2ZRUA 1YYAA 4GBUA 4IMFA 2QCHA 2BTMA 4M6VA 1LBMA 1QO5A 4JY9A 5I3GA 4Z1AA 1KFJA 1F2JA 3EWZA 1ZAJA 4RKAA 2DJLA 1F7BA 4MOZA 4UFIA 4KWWA 4GUGA 4I9AA 3L0GA 2AGKA 3TSBA 1W1ZA 2V2DA 1EUAA 3M47A 2ZZ3A 2OT1A 3DKJA 4JS3A 1LLWA 3BV4A 4O12A 3VCRA 2JGQA 1D3GA 1N7KA 1X7FA 2ZZ2A 3UNDA 4K37A 4NJGA 4HKPA 3TKFA 3C8FA 4PH6A 5HJLA 1OX5A 4UTMA 4H3DA 3R8RA 5G4EA 3G1AA 3L21A 4J9JA 1G4PA 3EWWA 2TYSA 4X22A 1H1YA 1PVNA 3WFAA 2J24A 1TTJA 3RLVA 2ZA2A 3NM1A 3LXBA 1IGSA 2WOQA 1F74A 1ZJIA 3LTSA 5EL1A 5AB3A 2E1DA 3OVQA 4GWEA 2FTPA 5CPOA 3FA5A 4A2RA 2ATSA 2QCCA 1SFLA 4Y6GA 1W5OA 1TQXA 5KZEA 1YTDA 2NXIA 1VHCA 2I14A 2V8ZA 3LTYA 4O14A 3TQ0A 5U4NA 1YADA 3NGJA 1Z41A 1ME9A 1W3NA 4G1KA 5DXYA 3WK2A 1OYAA 3TW6A 4N4QA 3C0JA 3LXCA 3O8AA 5EKYA 3G18A 3PSVA 3W1QA 3FJLA 5KTLA 3NAVA 3MBFA 5HMSA 3LXAA 1M7PA 3C61A 3GAYA 2PCQA 1ICPA 4EIVA 2E5BA 4K8HA 3M5ZA 2EHHA 4BR1A 3EX2A 4MLJA 5G4WA 1SPQA 3QC3A 4UTKA 3BLFA 2DZWA 1GVSA 3NQVA 5F1UA 1WAUA 4S2BA 2H3BA 2WO5A 5F4XA 1JCNA 1P0NA 1W56A 2Y7GA 1NF0A 2ZTKA 1EIXA 3L5AA 1X1ZA 1SO3A 3QSTA 3ZS4A 1K8ZA 5EMUA 1MEIA 5E93A 3SGUA 2B7PA 3PVFA 5EA9A 4GC4A 1TYGA 5CKSA 1OFRA 4HSOA 1TQJA 3M5YA 3W9ZA 2CU0A 3N34A 3W76A 4CQ9A 5AFDA 1A5SA 1OFEA 4LVAA 2B7OA 4LT9A 5LHEA 3LTPA 3HG3A 3P74A 3IGUA 1H1ZA 2ISSA 3HPXA 1TRDA 4AH7A 3M16A 5EY5A 5U7SA 3PAJA 4DBEA 3C4UA 4O16A 1XFBA 1LROA 2A7RA 1YTEA 4DELA 4Y96A 1W8SA 5C6MA 1OG0A 1QR7A 1F05A 3P8JA 1KBIA 3G8EA 1ZNNA 4ZL1A 1WBJA 4FHAA 1KM2A 2R8WA 1XUUA 1Q6QA 3NL2A 1Y0EA 3VE7A 1O5KA 4RZ4A 3NXFA 2VKZG 2FPTA 2NZLA 1GQNA 1TSIA 1J4EA 5FEPA 4P61A 3HGJA 3KRZA 1RV8A 2FB3A 3G0SA 2E09A 2YYUA 5FF0A 1S5VA 3ZWSA 1LBFA 3RMJA 3HO8A 5FI8A 4TMBA 3OVRA 1A5AA 2VFEA 4LW7A 3GZ3A 5KZMA 4R7JA 4ORIA 3NPUA 4O1DA 2EPHA 4MUZA 4CNOA 3W1XA 2WPBA 3QMTA 5AHMA 1L9WA 5DCEA 1ZY9A 2ZZ6A 1QPRA 2VEPA 2BX7A 2DP3A 4WX2A 1JVNA 3SZ8A 3WK1A 4R53A 4O4VA 3C2EA 1N8FA 3UWWA 3VKJA 1D3HA 3A22A 4JX6A 3TFCA 3H53A 1QOQA 3LX9A 1RPXA 3A23A 4JTGA 3EWYA 3DENA 3QYQA 4ORMA 1O60A 3Q2DA 4RR4A 1JRBA 4M6PA 5HWMA 1W0MA 1EP1A 1A50A 1KM5A 1QPNA 4H6KA 1T99A 2CW6A 2Y89A 2ZDRA 1ADOA 2XN1A 3G1XA 3GK0A 3LM7A 1BWLA 1HO1A 4N6FA 4FF7A 4WUIA 2DZVA 4S1FA 2NUWA 5DY3A 2P10A 2VEMA 3NQEA 3HOJA 2OJPA 4LC6A 5K4XA 5D38A 3G0XA 3F4WA 3QQ1A 4LUIA 4NXKA 3PBVA 4XTIA 3A9IA 3KXQA 3L67A 1O94A 1R47A 5HR7A 3NPWA 3TJLA 4JICA 4OU1A 3C56A 3FYPA 5C5YA 1PE1A 1OFBA 4O1BA 2RDUA 1TPUA 3NM3A 3M6YA 3ZFHA 2PURA 3TXZA 1BWKA 2W6RA 3E02A 4FXRA 4OGZA 5BRBA 5E1QA 1FX6A 4DF1A 1AL8A 1K7XA 3DHFA 3W1AA 4ZQRA 3CB8A 4UTWC 4UUIA 5FEWA 1H7PA 3MP3A 2CWNA 1OYBA 3G1DA 3FLUA 2A7NA 1OX4B 3G1SA 1G7UA 5F2GA 1LOLA 2QJHA 1OK6A 3NQ8A 2QEZA 4IJBA 2ZRYA 4OQVA 3IIOA 2CFFA 2JGYA 4KFNA 3W2MA 3EWBX 1G6CA 2VFIA 4JTHA 4ICNA 4O15A 2RDWA 2QDHA 4MJZA 4UTHA 4AWUA 4HSNA 3W7NA 2X1RA 3BW3A 4HPJA 1KA9F 5ABTA 2GQ9A 5HUPA 3DKLA 3B04A 1EWDA 3MP5A 3KAOA 3MYOA 2X16A 4JEQA 5LKYA 3SGZA 1THFD 2ZZ4A 3Q37A 4QITA 4BI6A 2VXNA 4L4MA 3EX1A 4UR7A 4K6AA 1TPC1 4MYAA 1KM4A 4O8RA 3TA6A 4RZ5A 4N2YA 2V0TA 3C2FA 3GXNA 5HUOA 1LCOA 1VLIA 3QSRA 2RH9A 3KHJA 3QW4B 1ICSA 4RXFA 1B57A 4PFMA 4IPJA 2V5LA 3BLEA 3TIMA 3KX6A 1OFOA 3DI1A 4FB7A 1EX5A 2FIQA 2BLEA 3T55A 2WNZA 1WX0A 4FX6M 3FKRA 1G4TA 2UV8G 1WOAA 4YMZA 1WXJA 2CZDA 3FFSA 3R2GA 1XBXA 1GVOA 1W37A 3GDLA 3STCA 3NR0A 1EB3A 3KVLA 4DO4A 1TPWA 5AYXA 1LM1A 3ZR4A 3RLUA 4O57A 2CLHA 3NL5A 2OZ0A 4IQLA 2TSYA 2V5BA 1RR2A 2NV1A 3FKKA 4O4WA 1LZOA 4O0KA 2YCEA 2NX1A 5F4SA 3W7HA 2C1HA 3UXAA 2ZBTA 1RD5A 4Y8FA 4X9SA 3P5ZA 3W1NA 2OCZA 3PBYA 4JTEA 4XQ6A 1KFLA 3MHFA 1OX6A 3P8IA 1TJPA 3GNNA 3MJYA 4FO4A 1Q45A 3TQVA 4UTLA 4OV4A 1H63A 5A8GA 1I2NA 5K4ZA 3W2JA 4Z1BA 2FFCA 3LCHA 2GQ8A 4WY0B 4FNUA 1H7RA 3OBKA 3TJXA 2YPIA 1GWJA 4ONVA 3W2KA 4JX5A 2TMDA 3P84A 1L6WA 4ADSA 3CEPA 4I7VA 4GUJA 2E5DA 3GVGA 2ZRXA 4Y90A 5C2XA 4NJIA 1JCYA 1O95A 4MYXA 4K39A 3HMJG 3GB6A 3NQDA 2V82A 1I8JA 1XDMA 2EAWA 1L2UA 4Y9AA 3S8HA 4K7VA 3AO0A 3TUUA 2QR6A 1TTIA 3BW4A 4Z08A 1ZAIA 1Q6RA 3ELFA 3L65A 3LRKA 1R2TA 1JCMP 3PS7A 1WQ5A 4JTJA 3MW7A 1GPWA 4YCPA 1W3TA 3A5VA 4CCCA 4HNVA 3WK3A 5MHBA 2O7SA 2V81A 3THAA 1FCBA 1CW2A 4XKYA 1SO4A 2Y70A 1KFEA 4O17A 3S5OA 3M9YA 5DN1A 3W2NA 1SSGA 1EWEA 4ZVJA 1K7FA 1NFBA 3NDOA 1V5XA 4GXMA 3HJZA 2NX9A 2I1OA 3ANYA 4TO8A 5I3KA 4C1KA 1ME7A 3W88A 1F76A 7TIMA 3B06A 3UPWA 4UTWA 2H8ZA 4ZQOA 2C3ZA 4KFPA 1DJQA 2QAFA 4MFDA 1SUXA 4FIQA 4LVGA 1PCWA 2V2HA 1QOPA 3LHWA 3TR2A 4WD0A 3W74A 2FLIA 5DBUA 3DHDA 3MO7A 5HNRA 3QEZA 3MI3A 3KFTA 3GXPA 1F5ZA 3F1QA 3W22A 1FCUA 3PR2A 1LDCA 2Q8ZA 1VCFA 1SR9A 2CLLA 4HHPA 2GJNA 4A22A 3QRHA 4XZ9A 4AXKA 1PL9A 1ZAHA 4NXSA 1D9EA 3Q94A 1TTQA 3G24A 5CSRA 1VCVA 5IBXC 1LYXA 2FJKA 1K8XA 1Q6LA 4IPIA 3VE9A 4JIQA 3QQ0A 3RK8A 4FNQA 3LB0A 1W5NA 5G2IA 3O6CA 2P1FA 1V7YA 1VHNA 5LZLA 4TX9A 2ZCGA 5HULA 4U4MA 3WJXA 4JYEA 3T4CA 5G5IA 5TIMA 3M7WA 4JN6A 2LLEA 4GUFA 3V75A 3GDMA 3U6WA 3OEXA 5F2IA 3LHZA 2A4AA 3G22A 2E6DA 5D32A 5C55A 1W5QA 3LBMA 5KZDA 3TMQA 3L66A 2OX1A 2JBMA 2Y7EA 2E6FA 3YPIA 3HF3A 3MWAA 3W1LA 1O5XA 1R46A 4PCFA 1TPVA 3NQGA 1ZALA 5AYZA 3VFLA 2ZZ1A 4GUIA 4FNTA 3P80A 3LV5A 5DCBA 3WJZA 1R2SA 3LDVA 3W7IA 2E68A 3NG3A 1G4SA 1T0OA 1X6UA 3P62A 4GRSA 3MHGA 3GX9A 1FBAA 2Y88A 3W7DA 3TK7A 3O6DA 3PG9A 3EXSA 3G1HA 3R12A 4K36A 2YW3A 2ZQ0A 3RNDA 5D05A 2H6RA 1DQXA 2E6AA 4NUWA 3W3OA 1QNVA 2QKFA 5H2ZA 3QF0A 3PUEA 3QMRA 4DEFA 1PCKA 1TJRA 1IXOA 4N9CA 2ISVA 3PBWA 2CZ5A 2HTMA 4MJMA 4X3ZA 1A5BA 3CIWA 4MVAA 1DORA 4UIOA 4UTTC 3DFSA 4RX0A 4A29A 3O6YX 4BF9A 3W7GA 3S0CA 4LNYA 1OF6A 5CPLA 1EUNA 2YR1A 1OF8A 1LRTA 3M0ZA 1SW0A 3W84A 3E49A 5I3IA 3L0NA 4DBDA 1PHQA 1GVFA 1J2WA 3ATZA 1GYNA 3W07A 1SO6A 1SSDA 2WKJA 3ABRA 3T40A 2VFFA 2J9YA 2C15A 2HS8A 2GVLA 5DLCA 1KW1A 2Q3OA 1G67A 1KTNA 4UFJA 4YCOA 1EA0A 1VYRA 4IMEA 4AF0A 2J88A 4POCA 3PC0A 2DJXA 3DI0A 2DU2A 3CPRA 2FPVA 1B4EA 1M6JA 2H3DA 4OV9A 4O10A 2ABAA 4C1LA 2NXHA 4QJ1A 1LORA 1GYLA 3DFNA 1XKYA 1IF2A 3SECA 2PC4A 4JTTA 3W23A 2WV8A 4R34A 5D2WA 1OX4A 1TRIA 4JNMA 1KV5A 4UNLA 1TPB1 4UFHA 1I2QA 4NQ1A 3BG3A 1SW7A 5T26A 2ZZ7A 5HINA 3TDFA 4CNPA 2XN0A 1XBVA 1UJPA 5K2ZA 3HQ1A 1MEWA 2QCDA 1XCFA 3TSDA 5TQLA 1JQXA 3QZEA 2ZA1A 3GLCA 3F03K 2ZRVA 4HNTA 3EXTA 3EEGA 3CM4A 4DPQA 3NEVA 4UFKA 3V1PA 1QWGA 3R89A 1K7EA 3O63A 2XN2A 2Y62A 1I4NA 3C6CA 3A5FA 3G3MA 5DCDA 2GJLA 3S1WA 3THQA 3W2UA 5D2VA 3M43A 3SR7A 3CU2A 4NJJA 2AQWA 4Z1DA 3NZ1A 1XI3A 1OHLA 2H90A 2J9ZA 1RZMA 3B0PA 3GDTA 3MHUA 1MO0A 1VZWA 1HUVA 1IIHA 5CG7A 2Z6IA 2QCNA 1VC4A 5LNSA 4LUJA 1H5YA 1TIMA 2YFNA 4O50A 5D30A 5L9FA 3S6DA 3R5EA 4AMAA 3PB2A 2IQTA 2GUUA 4NJKA 5K9CA 1P5BA 1ZHAA 4QIUA 3U8GA 4YLWA 3OA3A 1AW5A 1C9DA 3D0CA 3KVJA 2QAPA 4HNUA 1J5TA 2TPSA 4M7SA 4EF8A 1YXCA 1YXYA 2VEKA 5F1VA 5LGZA 3HGOA 1E51A 1BKSA 1NF7A 2D73A 5C54A 1CX9A 5I3JA 4PL2A 4PA8A 1FXQA 4Q32A 4X2RA 1DBTA 3TE9A 3IVSA 4XWUA 2A6LA 4CLMA 1QPQA 2Z1BA 4MFEA 2EKCA 3RFAA 1U83A 2X30A 3IIPA 3UD6A 3W7MA 1B4KA 1UUOA 3CQ0A 4E38A 1VYPX 3R13A 2YDAA 4WOQA 3EX3A 5DXXA 1TO3A 1RQBA 2B4GA 2RKXA 3FS2A 1JUEA 4HNNA 5EPDA 5D02A 1AW1A 3S1UA 1Z42A 1T8XA 4ZZ9A 5KMYA 3IIZA 4NZJA 3KVMA 5CZTA 3P81A 5HWNA 2CLEA 4ZQNA 5HWJA 2A7PA 1YDVA 2PRMA 2VOMA 3I7SA 4IUOA 4LY8A 1TTPA 4EOUA 3EX4A 2DZTA 4EF9A 1KLYA 3DFQA 3MMTA 2Y7DA 3EB2A 1GZGA 2Q8LA 5HR6A 3W1TA 4QISA 3IVTA 1SFJA 5BW6A 4JYFA 4HN4A 2PE4A 2QDGA 2ALDA 4O54A 3IV3A 1F73A 2F84A 4P2VA 1M7OA 3LRLA 4MZ1A 1IXPA 5AOUA 3TROA 1FDJA 3B05A 2CLIA 5BMXA 2OT0A 4YWIA 2C14A 4WOZA 3IIXA 4AB4A 1AMKA 1KBJA 3MYPA 2P0OA 5FF7A 1IXQA 3STEA 4LC8A 3CWOX 3I6RA 5G2WA 3LHUA 5EBUA 2YZRA 3BPWA 1VRDA 5EYWA 4AHPA 2ZZ5A 3N9RA 4LTSA 4LS2A 1IIGA 1Z48A 3W7KA 3MUXA 4GFSA 2QUTA 1RVGA 3TU9A 4N9EA 3KOFA 4UMCA 3O05A 1F6KA 1U5JA 2VFGA 1C29A 4QNEA 3NNTA 2CLKA 4BFAA 2H8XA 1LLZA 3LHYA 5AC7A 3W71A 3IVUA 1GOXA 3PG8A 3DU0A 3GKFA 3N19B 3S9YA 2QJGA 2NWSA 4JR5A 5D03A 4UR8A 4LS0A 3O15A 2VENA 3L2IA 3HGSA 3IRDA 4HT3A 3W75A 5IM51 1H60A 3RU6A 3TC6A 3C52A 1O4UA 3GNDA 4JTKA 3VI2A 3UPBA 2A2IA 4UCGA 2HS6A 3HB9A 5KSWA 3UWQA 4MY8A 1HFBA 5FEZA 1OFQA 2Y7FA 4S2CA 1K03A 2QJIA 2QUVA 4QNWA 1S3HA 3E12A 5D04C 1W54A 3LCFA 3BK0A 5F4WA 1ALDA 4JX4A 3N73A 5LNRA 3TQKA 1FXPA 4FNRA 4LRSA 4XUGA 5D37A 3B4UA 5J5DA 1KFBA 1OABA 4FX7A 4IWWA 4NZFA 4N4PA 3DBPA 4ZQCA 4DQWA 5LNUA 4PODA 4O1AA 1FWWA 5CGQA 2ATMA 4XTDA 2WSYA 4AF0B 1TV7A 3OVPA 2F7FA 3NQFA 1ZCOA 3W1RA 4HIBA 5AC8A 1JCJA 4O0ZA 3W7EA 1W5PA 3DAQA 3T44A 4K7YA 5K3VA 3TMLA 3QPYA 2GVJA 3MI2A 3L68A 3TV8A 1SU5A 3W7OA 3CTLA 3DGRA 1LTDA 3T78A 1XL9A 3N14A 2JK2A 1TV8A 4WXZA 4TIMA 5GVJA 1GTEA 3GAKA 2Z2UA 4NVTA 3NL6A 2J6XA 3G1FA 1I2PA 1L6SA 1KM6A 4IX0A 3HGRA 3W87A 3C2OA 2Y85A 1VQTA 3TNOA 4IMGA 3C3NA 1DOSA 1WDWA 2DZUA 1HL2A 4RLIA 5AYYA 2NUXA 4RXGA 4Q4KA 3VNDA 1MZHA 4UFMA 4A3UA 3NQ6A 2WSRA 5CSSA 4TU1A 3WJWA 2GVGA 4OWGA 2XFWA 3LOTA 3O16A 2GQAA 4DXVA 4LV9A 2FDSA 1LP6A 4U28A 1RQHA 1XDLA 3MI6A 4WZHA 1DVJA 1H7XA 5H91A 2PRLA 3G1YA 4R33A 2Z0IA 4RZ6A 3HPZA 3LBCA 1SW3A 8TIMA 1P4CA 3EKZA 1T96A 5LGXA 1X8FA 1LOSA 3BW2A 4KFOA 1DL3A 1H7OA 1MSSA 2B7QA 1UB3A 1FWSA 1ONRA 4DF0A 5D33A 3PULA 3W70A 2YFOA 2BXVA 4NNAA 3SJ3A 2WJZA 4WY0A 3CHVA 3INPA 1PIIA 4UTIA 2BSLA 3BGJA 1H51A 2E6YA 4IX2A 5AHLA 3P82A 1HG3A 3TAOA 4BWLC 3HPSA 4XBKA 4LS1A 1VH7A 4NX5A 4K8EA 1JQVA 3G1VA 3LI0A 3IEBA 4CNNA 4H4IA 2G5WA 4K38A 3KRSA 2X2GA 1GTHA 3QJAA 4IXXA 4RV8A 4FNPA 2O7QA 5LNWA 1QFEA 5LSMA 2ISWA 2WNNA 3GDKA 2Y63A 4O19A 1TCDA 1L6YA 3NYZA 1OK4A 3CIXA 5G1TA 1GVQA 3TFXA 2FPYA 3B0UX 1OYCA 1UUMA 4LU0A 4MKNA 2W79A 3W7QA 4OT7A 3S5ZA 2KZHA 3W7CA 1TPH1 1K02A 1EP3A 3PSWA 1LRNA 3BLIA 3IGSA 3UWVA 3HBLA 3LCIA 3SSJA 1ZFJA 1FY6A 3W72A 3UWZA 2QCFA 4M19A 5K9XA 3P67A 4EVZA 1UASA 4OBTA 3S42A 4IMCA 2QCEA 5CZ0A 4Z0JA 1A5CA 1EPXA 4MLRA 1DV7A 4MIMA 4JGDA 3A21A 3L5MA 1UBSA 1OFPA 3PB0A 2CLFA 2QUUA 1JCLA 1WYIA 1JJKA 3N9SA 4FEZA 3EWXA 3TH6A 1GT8A 3N3MA 5SWUA 4AWSA 2J27A 2HSAA 1C8VA 4JTUA 2RDTA 4NU7A 3LCLA 4BWLA 3B0VC 3EXRA 4WY0F 1KTBA 4IGHA 3S1XA 4LRTA 1TREA 3EX6A 4Z0SA 1XM3A 4RJEA 2A21A 1WOBA 4JTFA 2QCLA 4PL1A 1SZEA 3QMSA 4ZQMA 2A85A 5CZSA 4CQAA 3W7LA 4UTTA 1KV8A 1W3IA 3CT7A 2W0UA 3BVJA 3P5YA 4LV4A 4NX0A 2C19A 3M5VA 3GYEA 3DZ1A 4BK9A 1MXSA 4DF2A 2V30A 3S5NA 2QCMA 2C18A 3HIJA 1H50A 1Z44A 2YXGA 5E0KA 1PV8A 4KKXA 1LRQA 4LVDA 1S5TA 2NXGA 3BG9A 4KWVA 4W9TA 1SO5A 3LCWA 4LVFA 3NQAA 4JD4A 1GJPA 4FNSA 1KTCA 3AJXA 3NQCA 2CLOA 2VFDA 3CC1A 4O52A 3OHIA 2WNQA 2A6NA 4ML9A 3ZWTA 2TRSA 4ADTA 3JR2A 4I7UA 3ABSA 3UQNA 1YLVA 1XUZA 1M5WA 3CLMA 2R91A 1PHWA 1N55A 1XC4A 1YDOA 4O11A 2C16A 2NV2A 3W83A 3FYOA 3IGXA 3S5YA 3UWYA 3N2XA 3W1MA 5L6UA 4IXHA 3W85A 5AN7A 5K9DA 1UCWA 4WQ6A 1QPOA 4GE8A 1CI1A 1SZNA 5D2TA 5DY2A 4I7WA 1GG1A 3HG4A 2DZXA 3I68A 2ABBA 4MY1A 1QCWA 5AHNA 3K30A 2CZEA 1XBYA 4RK8A 3O06A 4PC8A 1B9BA 3LHVA 4O28A 3HG2A 3SI9A 3P7YA 3M5XA 2Q3RA 1SZFA 2ZTJA 5CZJA 5DELA 3I7RA 2B7NA 2G96A 1A53A 1YTKA 3G8RA 3LI1A 4Q33A 1BTMA 3SIZA 1JRCA 4ADUA 1PS9A 3LGEA 4XKYB 2R14A 3WJYA 2FB2A 2QCDB 5I3FA 1X1OA 2ZYFA 3UYCA 1VCGA 4CQ8A 4M7TA 1EP2A 2C0AA 1RQEA 2FQIA 2CLMA 3STFA 1SQ7A 2JKAA 3OG3A 3TC7A 2VELA 2X1UA 3LERA 3TAKA 1H7NA 2C13A 4OE7A 3NO5A 3TW7A 1IXNA 4UTJA 3TXVA 4UMBA 4JXCA 3PF3A 3M41A 4NNCA 5FF4A 3LLFA 1FUYA 5FF3A 1H62A 3NZRA 4HPXA 3DXIA 3W6YA 5LHFA 4JTLA 2GOUA 2DZPA 4L4LA 5K7JA 3W73A 4AHOA 5HQEA 1OVDA 3BG5A 4Z1CA 3GKAA 3PY2A 1XBZA 1KFKA 1R2RA 4GJ1A 5F2LA 3WK0A 3LLDA 4N9DA 4JDYA 4LWWA 4BI5A 1DHPA 4OHQA 3E9AA 3JS3A 2YGYA 5AHIA 4YL2A 4UNKA 6ALDA 1TMHA 1FWNA 3S1VA 1HTIA 5DBTA 5D2XA 5FESA 3F4NA 3BO9A 4ZQPA 1FDZA 3CWNA 1YPFA 3GR8A 5FF2A 3B03A 3L5LA 3FOKA 1JUKA 4M6QA 4GUHA 3NA8A 3NQ2A 1AW2A 3C2RA 1TPEA 4FXSA 3U2OA 1FCQA 2WQPA 1NEYA 4QSHA 1HO4A 3T7VA 2BZNA 1OFAA 3UZ5A 5FEXA 3QFEA 3O1NA 3QM3A 3NQMA 3Q58A 4YXGA 1ME8A 1SZGA 3NQ7A 4O18A 2J9XA 2YX0A 2NWRA 5A5WA 1F6PA 1VYSX 4AHQA 5LNVA 5D2YA 4AWTA 2E77A 1MEHA 4AVFA 1W31A 2EF9A 4MZYA 2DORA 1WBHA 1KFCA 4AAJA 2OMAA 3NOEA 4LOCA 1AG1O 3W86A 2VEIA 3O07A 5AHFA 3PBUA 3ABQA 5IBXA 4UMAA 4ZMGA 2ZA3A 3ABOA 1G69A 5CPNA 1P0KA 4NJHA 3W1UA 1QMLA 3L9CA 3MP4A 2ZRZA 3OIXA 4BI7A 1LOQA 3L0KA 1XXXA 3NPXA 1NAL1 1P1XA 3CEUA 3SY5A 4MPQA 1H7WA 2B0MA 4A2SA 2A5HA 4JDBA 1AL7A 1VPXA 1EEPA 3TSMA 1B3OA 2X1TA 3A24A 3E0IA 1KLZA 3M1ZA 3PM6A 3W7RA 4UTUA 1FCVA 2PRHA 3W7PA
chains in the Genus database with same CATH superfamily
4DJDA 1I2OA 5T8GA 4RDWA 3VFCA 2R6OA 1VGAA 2WLZA 4HHMA 3WH9A 2BWGA 1JDEA 4CVUA 1YPIA 1G4EA 1KM0A 1M65A 4IL0A 1Q6CA 5A8PA 2WWDA 1V6TA 2NLIA 3STGA 2J8FA 2J6VA 3N2TA 1MI3A 1QI5A 5C8BB 5G2HA 2YCLB 2CXEA 1GOMA 1XDJA 4LAMA 3GXTA 1UPPA 3KRUA 1JUBA 4RE2A 1O7AA 1IEWA 1EOKA 1BVWA 3N25A 1SM9A 5KITA 4H8HA 3RHGA 1KXHA 2ZFAA 4DO6A 3VM7A 1YE4A 3USBA 1RLDA 5J8LA 4FIRA 2PD5A 4B3ZA 3ATYA 1VJIA 3CZJA 3BAKA 2DZSA 2I17A 5G1YA 1E73M 1DHKA 3DFTA 1ZENA 4PEKA 2Y6ZA 2RHGA 3CWHA 3PUOA 4IQDA 3ZXWA 2HISA 2YJQA 1KR1A 1CLXA 4JTAA 2ZUWA 1AQ0A 1ISYA 1FWTA 4MUPA 3SRFA 4QAIA 4AZ7A 4D6DA 1R38A 1Q13A 1YIXA 1QAPA 4ALDA 3UP8A 4IT1A 4A8LA 3GXMA 3OA5A 4UXDA 3UY7A 3G2GA 4ES4A 6TIMA 2VHLA 2ZX9A 3H7UA 2G95A 4IP7A 4MZ8A 4B16A 5C9XA 3SW6A 2ZE0A 2GDUA 3N4EA 3DFYA 2DVXA 5LIXX 3W6LA 1TA3A 4JIRA 1G7VA 1RCXB 3LPOA 4JTSA 4TXEA 2PF0A 2VZOA 4D9PA 1FQ0A 2GJRA 2BDQA 1R30A 4XZNX 2YSWA 4UFLA 3W6MA 2IPGA 3VDHA 2CZFA 3U3HA 3VNKA 5JQ9A 3SDOA 1KM1A 2PODA 4YPJA 1CGXA 3H55A 3F5JA 2WC7A 1QDSA 3U7VA 4FLQA 3PWIA 1V51A 3C2VA 4A3HA 5I0DA 3W37A 1J93A 3S6OA 2E5CA 4X63A 3W7JA 1UR8A 3NPVA 2FDMA 3QOMA 3JRKA 3VYLA 3N3TA 1I2RA 2I7GA 2HROA 1GG0A 2ZRUA 1KCZA 1YYAA 1FWDC 2I5QA 4GBUA 3L12A 3RJYA 2BTMA 1LBMA 2DV0A 2Z29A 4FLOA 1F2JA 3S1GA 3LY0A 4ZODA 4Q3MA 1DWJM 4UFIA 4KWWA 3R6IA 1US0A 4PCSA 1C93A 1XG3A 3BLOA 1EUAA 4PN2A 4QLJA 3CL8A 1H1NA 1AQMA 2YB4A 4AZCB 1BQCA 4JFWA 1MYRA 1D3GA 1ZP3A 3QGKC 1UKSA 5HATA 3E0WA 1HL8A 3ZIZA 4UTMA 5FSDC 1RALA 3G1AA 2DIEA 4B92A 5BU9A 1GHSA 5I77A 2V5CA 2J24A 3RLVA 5M5DA 2ZA2A 5HNNA 3LXBA 1F74A 3OO2A 2VO5A 3G6MA 5EL1A 3GVRA 2D0FA 3QY8A 2FTPA 3WH8A 2ATSA 3USZA 3QZ6A 4M0XA 5KZEA 1YTDA 1OSEA 4REQA 2EPLX 4CNSA 4U5KA 1KWKA 1QNOA 4DLFA 4MWAD 5BZAA 4FOJA 4NAEB 5DXYA 5BYWA 1IV8A 4N4QA 3O8AA 1XYBA 2XH0A 3VOCA 3PSVA 3W1QA 4EKJA 2F6KA 4QSFA 1J2BA 5KTLA 3RYSA 1R3VA 4C5ZA 2E5BA 2J79A 3EX2A 4LAUA 4MLJA 3WQ4A 5G4WA 1SPQA 3HMCA 4C1NB 2DZWA 3ORWA 2NW0A 3LK6A 1GZ1A 3OBAA 1KBKA 5KZ6A 2DW7A 3DG7A 2WMIB 2J47A 3FSTA 1EL3A 1NF0A 1P6BA 1HKWA 1W2PA 3L5AA 2JQXA 1NY1A 1K8ZA 1FWGC 3AHVA 4YN5A 1MEIA 1M03A 1V3LA 2ACRA 4W87A 3T81A 3PVFA 1NOFA 1TYGA 1QI0A 4RE0A 4HSOA 4DWSB 3ZZ1A 3ANUA 4UQBA 1OT2A 2W63A 4LVAA 4QJ5B 3B9AA 2FH6A 1XIFA 3P74A 3RRAA 3KL3A 3WUFA 3HPXA 1M3UA 1TRDA 3IV8A 3M16A 4KMQA 2BY3A 2NQJA 4HJWA 3R8HA 4DBEA 1LROA 1V4YA 4FA3A 3RDKA 3MPGA 6ENLA 3GR4A 4DELA 4Y96A 4MG4A 4HCLA 1OG0A 2W92A 2GGHA 2ZOXA 2OZ8A 3DYOA 1FP8A 1ZCCA 2PDCA 7REQA 4ZL1A 4FHAA 4XZBA 2R8WA 2PDYA 1Y0EA 4KPLA 2W66A 1U1HA 2PWGA 2VKZG 1GQNA 1TSIA 1J4EA 3TEVA 1IT7A 2FB3A 3G0SA 2E09A 2YYUA 5FF0A 3B9OA 1QBAA 4YJ5A 3ZWSA 1LBFA 3TYZA 2OQLA 2XTKA 2PGWA 3H2OA 4TMBA 4XSLA 4M8UA 4YTTA 2XVGA 5G1MA 3W1XA 3DHUA 1HVXA 4E2OA 2NVCA 2DP3A 3HM7A 3SZ8A 4H41A 2HBXA 1XISA 4HA0A 1EO7A 3C2EA 3UWWA 1GOKA 3H53A 3LX9A 3WLNA 1D7KA 2OELA 3K4DA 4B5VA 2CCRA 4C6JA 5DFAA 3TLLA 2BOGX 3V5OA 2X7WA 3Q2DA 2DSUA 1A50A 8XIAA 1QPNA 4H6KA 2XN1A 3G1XA 3LM7A 1Q5MA 1BWLA 3ALGA 4N6FA 3LGDA 1NWTA 3NQEA 3HOJA 1E5JA 4C7FA 4I6VA 3CTTA 3UJSA 4B5XA 1MDRA 4Q8QA 3V18A 4WSHA 2EPNA 3DERA 3SN1A 1EYEA 3TJLA 4OU1A 4DJDC 4QQUA 3AIQA 2ZADA 3M0JA 2BY2A 4AZCA 2RDUA 4AZ6A 1TPUA 3ZFHA 2ACSA 3OZPA 3VIMA 5BRBA 1FX6A 3AIVA 2JEQA 4D71A 2BVTA 3CB8A 4UTWC 4UUIA 5FEWA 1OD8A 2OZ3A 1T8QA 1A3WA 1DXFA 3G1DA 4W8AA 3M0LA 3QXBA 4IJBA 4D6EA 4M56A 3H2MA 4KFNA 5DMLA 1SJCA 1G6CA 3UBPC 4L5ZA 1UR9A 4ICNA 4AY7A 1F07A 3IUHA 2PLMA 2NV9A 3EGJA 2QDHA 1ZJBA 1BRLB 2EBNA 5A6BA 3W7NA 3BW3A 4FP1A 2DSKA 4HCDA 3KLLA 1ADSA 2VT0A 3M7SA 4OJYA 3B04A 1EWDA 3F7JA 3MP5A 4Q6XA 3UW6A 3BCFA 2VDGA 4FMVA 5MKGB 1THFD 3OPSA 2HPIA 1Z32X 4KRUA 2ONEA 3EX1A 3H4XA 4AIBA 1JCTA 3KEHA 2WBGA 4K6AA 4RZ5A 2QPSA 3KDNA 4QE4A 2V0TA 4ROQA 1EEXA 3QSRA 1ICSA 3N12A 1UWSA 1C9WA 1TX2A 4A8IA 3TIMA 4PMNA 1UMLA 3DI1A 4FB7A 1XW8A 1UWTA 4GYPA 1B3WA 1DWAM 2E3ZA 3QGAC 4V15A 4W7WA 1XRTA 2WNZA 4FX6M 4GQRA 4YMZA 2CZDA 2V5JA 3FFSA 1GCYA 5EFDA 5PTDA 2A3LA 3KP1A 4UBPC 4KWSA 4LBSA 3SCVA 1G01A 3KCLA 2L5HA 2CHRA 5MF5A 4JQ1A 4PTDA 5FSEC 4O57A 3I4KA 2WANA 1NJJA 4IQLA 3GG0A 2V5BA 2NV1A 4O4WA 1IT0A 2NX1A 4A6GA 4X9SA 4W5ZA 4DWSA 2PDLA 3SQLA 4XZMX 4XQ6A 3I10A 3VX0A 1NWUA 1W3LA 2QXWA 1BF6A 3QFWA 4F0SA 5XIAA 4REQB 4UTLA 2XIQA 4OV4A 1H63A 1I2NA 3AU2A 2DW6A 3LMYA 3EDFA 3LCHA 4G7EB 3FDKA 4GJIA 1UIOA 2VOTA 4FNUA 3ITXA 4GZJA 1H7RA 3VKKA 1A5NC 1MNZA 1GWJA 2PSNA 3W2KA 3DUGA 1Y5XA 4OECA 4ACZB 1XLHA 4ML4A 1I9CB 3B8VA 1POJA 5C2XA 3KDOA 1JCYA 3HMJG 1ODZA 3NQDA 2P53A 4QRNA 5GNXA 3WBWA 1PKLA 3MTWA 3BW4A 1OC7A 4Z08A 1H4PA 3AI0A 3CJPA 3CGTA 3LRKA 1JZ6A 2WMFA 1GPWA 4YCPA 1W3TA 4B4HA 2KX9A 4XKYA 2AL1A 4CGTA 1KFEA 3S5OA 3M9YA 3U57A 4FXJA 5CPSA 1V5XA 4GXMA 2FYMA 2X42A 3W88A 1NOWA 2H8ZA 1WKYA 3MSDA 4E4UA 2NQ5A 4FI4A 4AD5A 1V3KA 4MSSA 1P7TB 3VDGA 1PCWA 3LHWA 1QOPA 4WD0A 2DY3A 4DYKA 3DHDA 3MO7A 3WZ0E 1XYLA 1F5ZA 3RN6A 1FCUA 4J4KA 2Q8ZA 2FMNA 2CLLA 4HHPA 2GJNA 4BKNA 2DT3A 1Q6FA 3Q94A 3ZJ7A 2YCJA 3BUVA 4JNYA 3P0WA 3LMZA 1A0DA 1VCVA 4XB3A 4MAVA 3GUGA 4GI6A 5A1AA 4PCTA 2CESA 4FNQA 1W5NA 2OWXA 3CPGA 5KETA 1V7YA 3VNMA 1UKPA 4C6NA 4TX9A 4C6EA 3VKAA 3WDHA 4ZENA 2GJPA 2WNWA 1EA9C 3ZR6A 4F48A 1ADDA 3K8LA 5IXEA 1N82A 1E0VA 4TTGA 3W81A 4V28A 1XHGA 3N15A 1XD1A 3GDMA 3V75A 2QJJA 3V16A 5CGMA 5T9CE 3GHTA 1XLAA 3G22A 3PBGA 2PLKA 1W5QA 6REQB 3LBMA 1XYMA 4JKMA 3YPIA 3HF3A 3MWAA 3W1LA 3CZLA 4Q7BA 1DE6A 5H6HA 2ALRA 4FNTA 4I9TA 4C6FA 3LV5A 3VMOA 3G77A 5DCBA 4RUBA 1XIEA 3F4CA 3NSNA 3MB9A 1X6UA 4D6HA 5E6ZA 4LH8A 3MHGA 3GX9A 2Y88A 2GZXA 1GQJA 1RH9A 2VDIA 1XH1A 1UH2A 4EXBA 1B5TA 3R12A 3C0SA 1CGYA 2ZQ0A 3BICA 5D05A 1J0IA 4NUWA 3W3OA 4WIWA 3PUEA 4DEFA 1QNQA 1TJRA 2ISVA 3LNMA 2FZNA 3THCA 3CIWA 4YS1A 3ZO9A 4UTTC 1IEVA 1I1WA 3B8IA 3O6YX 3W7GA 3BANA 4K68A 1OF6A 1EUNA 1US2A 3NO3A 5I3IA 3H22A 3L0NA 1FWJC 1OC6A 1GVFA 3ATZA 1GYNA 4K1WA 2OQYA 2WKJA 3ABRA 3PPGA 3T40A 3KTSA 2VFFA 2J9YA 1YRRA 3H24A 4EK7A 1G67A 4IIGA 4MB4A 1JNEA 4AF0A 1DE5A 2C71A 4J1OA 1MQQA 2J88A 4GYJA 2DJXA 2VQTA 2WZIA 1SJBA 2FPVA 2OG9A 2H3DA 4WVXA 2ABAA 1XGEA 3V7PA 3UETA 4QJ1A 1TV3A 2P88A 3SBFA 1EJSC 3SUSA 1XKYA 4GINA 4LUSA 3AS2A 4LEQA 2PC4A 2WV8A 1WKDA 1PYMA 5D2WA 1OX4A 1JPDX 4H9VA 4D8AA 1E4MM 4NQ1A 5T26A 3OBEA 1Z6KA 1FP9A 4CNPA 1RY8A 1UJPA 2DUAA 4F2UA 2OGYA 1XC6A 3VCNA 3MC5A 3QZEA 1EC7A 4KEMA 3EXTA 1M53A 2X05A 5BCAA 3VIKA 2PPGA 1JI2A 2YCKX 5DRIA 2PBGA 2XN2A 1ENUA 4B3KA 3VUPA 4PTXA 4ASTA 3CZ8A 1QOXA 1M1BA 2AQWA 1E9IA 3FXGA 3CPUA 1YNYA 4KRZA 5CC7A 1VZWA 4Z2HA 5CG7A 3T2QA 3RG6A 4IFKB 2YFNA 4O50A 5D30A 4AMAA 1U33A 1NM9A 1P5BA 1TJ1A 1BGAA 4BF5A 1XYFA 4LFYA 2QVHA 3KVJA 3WLQA 2WMHA 5RUBA 4M7SA 2R9RA 1YXCA 3WX7A 4U3CA 3HGOA 1E51A 2Y8UA 4AY8A 1DTNA 5C54A 1S3TC 4X2RA 4PA8A 3VNYA 3WBXA 3KOXA 3UVAA 3PZ9A 3TE9A 3IVSA 2UWFA 2DSVA 4PTMA 2ZWZA 1LG2A 1VFOA 3CQ0A 5F7UA 1VYPX 3CAWA 1XLKA 1UHVA 1NDZA 3CB3A 4NZCA 5EFFA 1JUEA 1AW1A 1UQYA 4CN4A 3NYDA 3W29A 3KTCA 4ZZ9A 3QBUA 3VIPA 1W1TA 1R3SA 2A7PA 2VOMA 4LB4A 5I00A 3CIVA 4EF9A 4CNUA 2Y7DA 1M68A 3PFRA 4QISA 1NTHA 1SFJA 3KUMA 4HN4A 2QDGA 3ZJ8A 1V0KA 4GCXA 1QNSA 1NWRA 5AOUA 3E2RA 4IICA 4AB4A 1AMKA 1KBJA 3DX5A 3MYPA 2P0OA 2YDRA 4J40A 1IXQA 4CCZA 3SEPA 4M6UA 4AHPA 3CQKA 1VRDA 4YYCA 4PE8A 3M4HA 1WZAA 2ZZ5A 1V0NA 4ZGYA 4LANA 4PB3A 3WLPA 4LTSA 1XH2A 4LS2A 1TUFA 1IGWA 2PTYA 3RR4A 2QUTA 4GZEA 1GZJA 1MVYA 2XINA 2HK1A 3H2EA 3WD1A 4L61A 5HDRA 3NWRA 3STPA 4FLRA 4QNEA 2JE8A 1QWKA 3PG8A 3GKFA 3QV8A 2NWSA 1O12A 1C90A 4JHMA 4LS0A 3O15A 4R7OA 3WUBA 1K9EA 1HZYA 3IRDA 4DZ5A 3UEQA 3W75A 5IM51 3RU6A 4GZ7A 3C52A 2WZHA 2ANUA 3HURA 4L4OA 1O5QA 2A2IA 4R3UA 4UCGA 2HS6A 2QT3A 4MY8A 4Q4RA 4GPNA 4S2CA 3FVMA 4KH2A 4QNWA 1S3HA 3V0TA 1CGVA 2Q09A 3KP0A 2E0PA 3LCFA 5F4WA 4NP7A 1YDYA 4FNRA 3BLDA 4LRSA 3TN6A 4PBEA 1XLIA 5D37A 2D0GA 2E28A 4GNKB 2VR4A 2PP1A 3GH4A 4N4PA 3TLQA 1FWWA 2J7BA 2BGNE 4KWOA 2ATMA 1EJWC 4LJ3A 5ABEA 3K13A 1ZCOA 3FAXA 3W1RA 3G5EA 1JCJA 4DJED 3DAQA 2OB3A 4WSKA 1J0JA 4B3LA 3MI2A 5CPTA 2PAJA 4GY7A 3W7OA 2Y8VA 3VNLA 3WLSA 1A3HA 2JK2A 4BCEA 1TV8A 1PBGA 4TIMA 4DBSA 3A4XA 1J12A 3GAKA 1DQUA 3NL6A 3G1FA 1KM6A 1QK2A 2Y85A 2UY2A 4QS5A 1DJZA 2GDVA 4IMGA 3C3NA 4QCFA 3IAPA 1A3XA 5AYYA 4QJ4B 2NUXA 3TYCA 3VNDA 4S39A 3NQ6A 1OGGA 1UZHA 4LCQA 3LUTA 4YTRA 4XD5A 2GQAA 5CQ1A 4LV9A 1XDLA 3VAVA 3FXYA 3G1YA 1UKQA 1LOSA 3BW2A 1FVPA 1DL3A 1H7OA 2V3EA 2ZC8A 3PULA 4UZSA 4H8NA 3A4AA 4H9YA 3BJTA 3CHVA 3INPA 3F2DA 4DUXA 1DTUA 3SRHA 3KZSA 1XQLA 5DRCA 4KEZA 1QBBA 5A2CA 3KBSA 2PDFA 1H09A 2UBPC 4XBKA 1Q8AA 5AC5A 3P2VA 3G1VA 3LI0A 3IEBA 1Q2SA 1DJXA 1HNYA 1PPIA 3KRSA 3GFYA 3QJAA 4E8GA 4RV8A 1ISVA 4H00A 1JZ4A 3EKGA 2WNNA 2Y63A 2VZTA 4B5UA 1BG4A 1GVQA 3TFXA 2FPYA 2XGBA 4HTYA 4KS0A 1GOWA 1JZ5A 2W79A 3WSUA 2PDHA 3HQPA 4WLCA 1S2UA 3VIOA 1GEHA 4PMVA 2GL5A 4KIRA 3UWVA 2YDQA 3WLHA 3ID7A 4AW7A 1PKYA 3N2CA 3SSJA 4HPNA 5DF0A 2HNHA 1FY6A 4BQ4A 4M19A 1XLEA 1EF3A 2WK2A 4IMCA 2QCEA 3N9KA 4CUCA 3UCCA 4MLRA 3UG8A 1GONA 1AJ0A 3A21A 1UBSA 2CLFA 3LU2A 2NT0A 3UJEA 1H49A 1KCLA 3EWXA 3TH6A 3Q67A 3JW7A 4PMDA 4AWSA 4JTUA 1E0XA 2BXYA 4V27A 2WC4A 1EKOA 5CLTA 3GG8A 5LXXA 3VABA 1AH3A 1XM3A 1SZEA 4RV3A 3UG3A 5CZSA 1YNPA 4UTTA 1PDYA 2W0UA 2J78A 1HKMA 3VA8A 4YTUA 2YZ5A 3WH7A 4HQVA 2C19A 2BODX 3SB0A 2NVAA 3HPAA 4DF2A 3CMFA 4EWJA 1TUXA 3EMCA 2X09A 2AAAA 1EJTC 3IJQA 3S5NA 2QCMA 2C18A 2INZA 2VRJA 2OYKA 1OGSA 3M0IA 1CBGA 2PMQA 2WWCA 3VPLA 1PV8A 1LRQA 1HL9A 1RJRA 1S5TA 2NXGA 5CCZA 4W7UA 2ZUNA 3WLJA 3NQCA 1HF6A 2VFDA 2O4QA 4DI8A 2E67A 2WNQA 2PDKA 3T8QA 3CNYA 4I7UA 1FWBC 2QMJA 2ZXAA 3ABSA 5AYIA 3UQNA 2OYMA 1XUZA 1M5WA 2WVTA 1PHWA 1N55A 2HZGA 3CAQA 1UPMB 2NV2A 1XIDA 3RX4A 3W85A 2PDPA 2CWXA 5K9DA 2AGTA 5I78A 1UCWA 1QPOA 4GE8A 2WXDM 4I7WA 3ABZA 3GVVA 2XVKA 3HG4A 4RNJA 2DZXA 3I68A 3AHXA 3ARRA 4Q8PA 4FS9A 3B4YA 5AHNA 2HK0A 2GYIA 1B9BA 5HK4A 4C6QA 4IP5A 3FVDA 3SI9A 3ARVA 1R3RA 4JIHA 1UP3A 1SZFA 3VNZA 2PDIA 5DELA 1A5UA 4MB3A 1VFTA 5GJPA 2B7NA 4DJEA 1S46A 2VI0A 4TVDA 3V0SA 3TONA 3SIZA 4XKYB 3BAWA 5I3DA 1XR2A 1BQGA 1W1PA 3RCYA 5BXSA 1B31A 4CQ8A 3MKKA 1EDQA 4LUTB 4LGXA 3NZQA 3MANA 3ZM8A 5JXQA 2JKAA 1C8YA 2OVLA 4Q4QA 3V1HA 1Z8AA 2VYOA 2VELA 2X1UA 1UC5A 4GVGA 4HU8A 2VR5A 1IXNA 2V67A 3S3GA 3IK4A 3OZOA 3URAA 1NIUA 3LLFA 1FUYA 1E4LA 5JBEA 2VCBA 1H62A 3T0CA 2QJMA 1IE7C 2DZPA 5CAHA 3WLKX 1XP3A 1XBZA 1U5HA 1EC9A 4GJ1A 1JZ7A 3LLDA 4JZ5A 4N9DA 4JDYA 4LWWA 2VX6A 5I6SA 3RUBL 3FGCA 4UNKA 2D2OA 3TN3A 7A3HA 3S1VA 4JL2A 1E6ZA 5DBTA 3THDA 1TCMA 3CO4A 3BV7A 4AC7C 1PTAA 3GR8A 3PAOA 3TTYA 3NQ2A 4DLMA 1TZZA 4Q8WA 2P3EA 3U2OA 1NEYA 4HHLA 1UZ4A 4BEUA 3T7VA 3ES8A 1R85A 3QFEA 3LYEA 4BQ2A 1PX4A 3QM3A 5FKYA 4J27A 2DPEA 3MV11 1AJZA 3IRSA 1F6PA 1Q4WA 1VYSX 3C0LA 5D2YA 1DYSA 1U1UA 1R9XA 3AZTA 1MEHA 2OLSA 4DUVA 4BF7A 2IPFA 1WDSA 1I60A 3R7MA 1AG1O 3ABQA 5DEZA 3K4AA 4ZMGA 2ZA3A 3ABOA 1G69A 5CPNA 4G1NA 3CUFA 4UOQA 3HPFA 1KGUA 1S5NA 4HA1A 3NIYA 1QMLA 2WCGA 5DX7A 1A0EA 1P1XA 3CEUA 4S3JA 1AL7A 4QDPA 5JMUA 4W88A 5EMJA 4GVHA 1A49A 3RXZA 4UTUA 3PM6A 3W7RA 4EXQA 4CU6A 1SYTA 3L2LA 5TF0A 2PB1A 4NRSA 4DBUA 1OGBA 1CGUA 2BV9A 5EU9A 1PTGA 3BTNA 1W9BM 4AEOA 3PP7A 4RE3A 4ILSA 2DDXA 4PB5A 2NQLA 5ENLA 3ZT6A 2AL2B 1EYWA 4WEVX 4DUWA 3TYAA 4JKLA 4UQ9A 1V77A 3BARA 3KVKA 2IPWA 3DFPA 4U31A 3LCGA 5BNKA 2QYGA 2Y61A 3NVTA 4NNBA 3DYPA 5A2AA 1DQWA 4C6CA 5C9ZA 4GY0A 4O1CA 4UC5A 2BFGA 3R10A 4W85A 2YCIX 4B5NA 4YHEA 1TJ0A 3OOQA 1XPYA 4M5PA 4IMAA 1DJGA 1JR1A 2V9DA 3BCJA 3DH7A 6XIMA 3PHAA 5BOOA 3MBDA 3GNXA 1GEQA 1W3KA 2E9MA 1K8CA 4J7RA 4TMCA 3EWUA 3H2NA 3A12A 3EA1A 3DG3A 3TCEA 3HG5A 1NVMA 1VR6A 1O68A 2DT2A 5FD0A 4XBSA 5A8MA 1SGJA 2GDQA 2KAUC 2BOFX 1TWIA 2XSAA 1DWHM 3P14A 1JXJA 2YA1A 4S3AA 1Q85A 1XYCA 4LUYA 1R0MA 3WL0A 1BYAA 2ZUVA 4D6JA 1IEXA 3BGGA 3NXLA 2YIHA 3LLXA 1WB0A 3UZJA 5D09A 1BKHA 3APYA 3P61A 5GNYA 3FV9A 2WJFA 4A21A 2PA6A 1BXNA 2XIIA 3R94A 1LUCB 2VFHA 1KM3A 3D3AA 4BA0A 3O3RA 5T91A 3MWCA 5F2MA 3WQDA 4GI4A 4DI9A 1CPUA 1TV4A 1BXCA 1SFTA 1W1A1 2AAMA 4Q4MA 3L4VA 4H6QA 4JPGA 3T4WA 4DXXA 3A3WA 4MB5A 1JCXA 4Z2LA 3NQBA 1M7XA 4NHVA 2HMCA 3LHTA 4MJ2A 3K1DA 4GYPC 2JKEA 4NT0A 3VGEA 1QO2A 3GDRA 3G3DA 3GR7A 4RW5A 1BFNA 2DGAA 1OFDA 1S5MA 3VMNA 1Q6OA 4AD4A 2NX3A 4JKKA 4KF1A 2VZUA 7REQB 3IK2A 2XYLA 2WSQA 2GWGA 4HHHA 2BASA 5DMYA 3ONCA 2PC8A 4PMXA 4NIRA 4BS0A 2HWGA 5DO8A 2QJNA 3H26A 5CXPA 4MDPA 1J01A 1QO5A 4JY9A 3OG2A 5XINA 5I3GA 1BRLA 3B9DA 1KFJA 1DJHA 2OKOA 3EWZA 4RKAA 1J6PA 1F3WA 4W4QA 5HPCA 3IUDA 3WQ5A 4EAYA 2C79A 1V08A 1Y65A 4W93A 1MXGA 4H9MA 2X8RA 1GKPA 3SCRA 1NU5A 3TSBA 3VC6A 3IANA 4CN1A 4QDMA 2V2DA 2R1LA 2Z27A 3FA3A 2BHYA 1P48A 3LS9A 3M47A 3DKJA 2OT1A 3A6OA 4KWUA 3BV4A 4O12A 3SCSA 1QI4A 3VCRA 1NDVA 2Y4SA 2AL2A 3V5FA 1EIBA 2ZZ2A 3UNDA 4K37A 3BJSA 4UTFA 1WNOA 3VD4A 3N2OA 4H3DA 1G1YA 5G4EA 3L21A 1C8XA 3EWWA 2TYSA 1XRSA 1PVNA 3I6EA 5AC4A 1UD5A 3PTQA 3EPNA 1TTJA 1MNSA 3A4JA 4AVNA 1ZJIA 2HVOA 2W61A 2BS9A 3LTSA 1IEQA 4F4RA 4IIEA 4WK9A 3ZT5A 3QHOA 1SFLA 4Y6GA 3TTQA 1TQXA 1RPKA 2NXIA 1VHCA 2I14A 2V8ZA 3KZPA 3UA3A 5U4NA 3CUGA 3W53A 3JU2A 4X0VA 1YADA 5G4HC 4BHYA 1Z41A 1ME9A 3QVQA 3WK2A 2HVNA 1OYAA 1B54A 4AU0A 3C0JA 3B9EA 5EKYA 3RX3A 2CC0A 2D69A 3NAVA 3MBFA 3MSRA 5CSUA 1M7PA 3O9NA 2GVYA 3CUIA 1ZZMA 3RPDA 1ICPA 4EIVA 4K8HA 3M5ZA 2EHHA 4QLLA 3W25A 2E8ZA 2NQZA 2VUYA 5E0FA 3VD7A 1TZ7A 2XHYA 1ONXA 1CENA 3VIGA 1WAUA 4P5UA 4S2BA 1S2VA 1VRXA 3KW3A 3SCNA 5F4XA 1JCNA 1KQZA 2VDHA 2Y7GA 2ZTKA 4M80A 1SO3A 3AXXA 3PTMA 3PZGA 3FSUA 1JIBA 2GUBA 2XG9A 1FA2A 3SRDA 2V5DA 3WD2A 4DM1A 1EX1A 3F5LA 1YHTA 4QFUA 1NELA 1TQJA 3M5YA 3W9ZA 3U48A 3N34A 3W76A 1LL4A 5AFDA 3AWNA 1JAKA 1POKA 2VMFA 2QVNA 4LT9A 1OQFA 3HG3A 3IGUA 2PS2A 1H1ZA 2Z2BA 1A4MA 1T7LA 2X40A 5EY5A 5A6LA 1JPIA 4MKVA 1EJ7L 3AYVA 1UOZA 1E3ZA 2XFRA 5T9BG 1F05A 2CEQA 4PUNA 4ZXLA 1H0IA 3R58A 3TW9A 5C7HA 5EMMA 2W27A 1XUUA 1UWIA 1Q6QA 2DQXA 2C1GA 2JF7A 4PSRA 3VE7A 1O5KA 3CHCA 4W8BA 4RZ4A 5H8MA 5BOFA 3NXFA 2FGZA 4AYGA 4EACA 2FPTA 2INFA 2NZLA 5ABFB 3BWWA 5FEPA 3L4TA 1IR2A 1J6OA 3KRZA 4NZ1A 3VX1A 4LEFA 4DXKA 5I09A 3HO8A 3FGCB 1B30A 4LW7A 1V02A 3GZ3A 4R7JA 3NPUA 2WPBA 5DCEA 1M41A 3NOYA 3RPMA 3HJEA 2PTXA 3ICJA 2XPKA 1W91A 5CBJA 3WK1A 3REQA 1PAMA 2UZ9A 5FJPA 3VKJA 3A22A 1QOQA 5I23A 3IJ6A 3O0FA 3A23A 3EWYA 2OO6A 1SJDA 3WMBA 1VF8A 1E56A 1O60A 2VEGA 1E55A 4HZ8A 3SCOA 1G5AA 2Y89A 2CW6A 3VKCA 3EAUA 2YCLA 4HGXA 4U2ZA 3GK0A 4AIOA 4N42A 2WVVA 3WF4A 2IS7A 4FF7A 4WUIA 4S1FA 5A6BD 2VEMA 2OJPA 4LC6A 1E6PA 3F4WA 3QQ1A 1KWGA 3A9IA 2VEFA 5HR7A 2GGJA 3QOKA 3QR0A 3N1AA 9XIAA 3CHEA 1TVNA 1ZBWA 3FYPA 4XISA 1OFBA 4HOZA 2CLPA 1HKKA 1ZPTA 5CPQA 3NJ3A 1E4NA 2ZXDA 3M6YA 4W5UA 5LIYX 3E02A 2VGBA 4PUWA 5E1QA 1AL8A 3M0YA 4WKFA 3W1AA 4WDWA 4AY1A 1CZ1A 2WZMA 3B8SA 4ZQRA 4AUBA 4JFVA 5FAGA 2ISFA 1H7PA 2CWNA 4YYFA 1IEIA 1W3HA 2VZVA 1OX4B 3SN0A 4UB9A 2Y5JA 1LL6A 4IJCA 3PZUA 2CXGA 5F2GA 2DZBA 1OK6A 4OQVA 3IIOA 1BWVA 1QW8A 3W2MA 1HGWA 2J8GA 3ARQA 1R8LA 2VFIA 4TVCA 4O15A 5ECVA 4HYWA 1A80A 1CXIA 3CL6A 1Y8BA 3S83A 4AWUA 4IPLA 1MQRA 4HPJA 1CEOA 2DT1A 4U3AA 3KL5A 2PZ0A 1KA9F 2YBTA 1P43A 2GQ9A 3DKLA 2FVMA 2ZKMX 4IIHA 3UR5A 3MYOA 2Z1WA 2X16A 1CLVA 1KCKA 3SGZA 3TOYA 1OWQA 2ZZ4A 2PFHA 2EPKX 4BI6A 3IJ8A 4UR7A 4Y9NA 1KM4A 2W4XA 4LPCA 4GNVA 1UA3A 4O8RA 1OZQA 4KERA 4NYUA 4EXAA 3GXNA 5HUOA 4Q4OA 3OODA 2RH9A 1V8EA 4PFMA 4IPJA 1CB2A 3KX6A 3CUJA 1NDYA 1W8GA 5M2FX 4GLEA 2WHLA 3C2YA 1WX0A 3FKRA 1G4TA 2UV8G 3QLLA 2Y1HA 3T0BA 5BRPA 1GVOA 3REQB 4CU7A 1U5VA 3AS0A 3STCA 4DO4A 1TPWA 2QIIA 3OGRA 2HVMA 4RE4A 2V6AA 2G4JA 2TSYA 4MF4A 1Z9AA 1LZOA 2IKJA 3PBMA 2C1HA 3N13A 3UXAA 2HDJA 1RD5A 2ZBTA 2VNCA 4ACZA 4D1JA 3P5ZA 1W9XA 3WQFA 2EPOA 1LJYA 1K6AA 3PBYA 4JTEA 4KESA 1B90A 4I90A 4UQAA 4ZB0A 3URBA 2PWFA 3P8IA 1TJPA 4ACYA 4FO4A 2R1NA 2BXZA 1DIEA 3TQVA 5FJUA 2VL4A 2GQ8A 2OWCA 3BLKA 5B7ZA 1OCJA 3T07A 1EZWA 1UOKA 3C3UA 4QR6A 3NTYA 1W1VA 3WBYA 1XIJA 3P84A 1EJVC 1L6WA 3CEPA 1AA1B 1PX8A 3GE7A 1XIHA 2E5DA 5E6YA 4Y90A 2R82A 1O95A 1CB7B 3MVIA 3GFZA 1DEDA 3GB6A 4HNLA 1D2KA 4Y9AA 4P7QA 3S8HA 1RLCL 4K7VA 3TUUA 1W1IE 1Q6RA 1P1MA 1GQKA 1EO5A 1GORA 2WSPA 1LT7A 4HNCA 4H19A 3U7BA 2XH4A 2PD9A 4CCCA 4KIEA 5CAKA 3FNDA 2FJUB 2HXTA 4J3SA 2VUNA 2PP0A 1SO4A 3F4VA 2Y70A 4O17A 1ZB5A 1RXOB 3W2NA 1EWEA 4ZVJA 3UZXA 4HMCA 1UD4A 2ZUSA 3H2AA 3HJZA 1SR0A 3ANYA 4DIAA 3ZLGA 5I3KA 4C1KA 1ME7A 3R11A 1F76A 7TIMA 3B06A 3UPWA 4UTWA 4HSHA 4C1NA 2NQ9A 5JBDA 1DJQA 1HJWA 3VDAA 4US6A 1O5RA 3C86A 2V63A 3GHSA 4FIQA 5BWFA 3IS4A 1A47A 3W74A 3CMGA 2FLIA 4IHCA 5DBUA 2QV4A 4QLKA 3BMXA 5HNRA 3QEZA 1W9UA 3MI3A 3KFTA 1IZCA 3F1QA 1Q6GA 3EEZA 1VCFA 3EB4A 1SR9A 3QRHA 4XZ9A 1EGMA 3TYBA 4IG2A 1TTQA 5A8OA 3G24A 1VFSA 4ICCX 2NSXA 5IBXC 4MGGA 3P0XA 1K8XA 1Q6LA 3VE9A 4JIQA 2Y2WA 1EZ2A 3LB0A 2JFEX 3O6CA 3LD5A 2J8TA 5LZLA 2ZCGA 4I5RA 1GOQA 4U4MA 3WJXA 4GX9A 2VZSA 1EJXC 4C5YA 1O1HA 2BY1A 4C7GA 3WMSA 3THUA 5TIMA 1TR9A 4HPHA 4JN6A 2D23A 3U6WA 3OEXA 4B90A 2V5KA 1VBHA 2E6DA 1A5KC 4R88A 7CGTA 2PDGA 5C55A 5KZDA 4W7VA 2Z26A 2Y7EA 5HQLA 1O5XA 1R46A 1O66A 3EPMA 1S2TA 1KFWA 1UD6A 2PUZA 3CL7A 1JAEA 2VX4A 4M1BA 3WJZA 3LDVA 2E68A 1OIFA 3P62A 4C6KA 3ARUA 3GVWA 1BG9A 2CKSA 3W7DA 1VJSA 3EBVA 3O6DA 3CZGA 3G1HA 2CETA 1LWJA 1AQHA 2H6RA 2FZDA 3S5SA 2E6AA 1OY0A 4HK5A 4GIEA 4GQBA 3GC4A 2QKFA 4J3ZA 5H2ZA 3QMRA 3PBWA 2I5IA 4GCAA 4BQ3A 4O1EA 1BAGA 4MJMA 1HJUA 1A5BA 2FTWA 4MVAA 4DAFA 1DORA 4HP5A 4E8CA 4J2PA 3EPOA 4RX0A 3WEOA 4A29A 4BF9A 5CPLA 5BXPA 4FK9A 2QULA 4JQ3A 7ODCA 4HOXA 3M0ZA 1SW0A 3W84A 5D8ZA 1VEPA 4PMOA 2BGSA 4DBDA 1GHRA 1ECQA 1PHQA 4L64A 1XCXA 2EKGA 1J2WA 4R5EA 4WR3A 4R85A 3W07A 1BVZA 4IZGA 3CUXA 4LSBA 2XSXA 1KTNA 3WLLA 4PMQA 3GWQA 1PO9A 3ARSA 4YCOA 1QXLA 4A35A 1YNQA 2ZE3A 3B0XA 3CQHA 1M6JA 4Z42C 1JDDA 3AYTA 4GYKA 4URIA 4XG1A 1LQ0A 3T6CA 3DFNA 4CD8A 4LAZA 1WUFA 3W23A 5H1WA 2Z1XA 4X61A 3I3BA 3QV7A 2PWUA 1CDGA 2OTDA 3BG3A 2ZZ7A 5HINA 3GU1A 5D4YA 1XBVA 3RJXA 1JQXA 3PZOA 4HPGA 2ZA1A 3GLCA 5H8UA 2ZRVA 4L56A 3FYYA 3NEVA 1GQIA 2X0HA 5EMKA 5M3WA 1I4NA 3C6CA 3A5FA 5DCDA 4CEUC 1RBAA 2GJLA 3M0XA 3THQA 4E3VA 1UMYA 3M43A 4KQNA 5LXEA 2WZTA 1QNPA 3UZYA 3CU2A 5M17A 3SAZA 3RGTA 4CD4A 1RJPA 2OOGA 1FTXA 3CBWA 3CK5A 6PTDA 2C1IA 4NYYA 2J9ZA 3GDTA 4L9XA 1TVLA 4NZ4A 2Z6IA 1K9DA 3PZNA 4IIFA 2FZ8A 3ZR5A 3KCOA 2QUMA 1ZHAA 1VPYA 4Q8VA 5I2UA 2PWDA 3E2SA 1AW5A 1C9DA 3CV6A 1EGVA 8CGTA 3R43A 3QV6A 4LQ1A 1J8VA 1VEOA 4F40A 1W2VA 1NF7A 2D73A 4DWSC 3AMCA 1FXQA 4Q32A 2Q71A 4GMEA 2PTZA 4TUFA 4XWUA 1U30A 1AZ1A 5IOBA 2OR2A 1U83A 2IKIA 4AZ5A 3GH7A 4LYQA 3B8WA 4F9DA 3WCZA 2WZEA 3R13A 3IJIA 3MS8A 4PBGA 3EX3A 5DMNA 4M82A 5DXXA 3SADA 1RQBA 5EPDA 2Z24A 1AUSL 2QV5A 1XIGA 2OODA 1B3YA 1RA0A 3IIZA 4NZJA 5KMYA 3KVMA 1VIWA 4QEEA 5HPOA 5HWNA 1J9YA 1OCBA 1K77A 4ZQNA 1YDVA 2PRMA 4LY8A 2VCCA 3H4WA 3EX4A 2DZTA 3EB2A 2G37A 1OIMA 3W1TA 1JXKA 5BW6A 4ATLA 3IV3A 3WD3A 2F84A 4OBRA 4C90A 3TROA 1FDJA 3ZJKA 5BMXA 1ZRQA 2YDSA 2O55A 4LC8A 1PWMA 4KCTA 3VIIA 2XM1A 3LHUA 2YZRA 3BPWA 2F2HA 3QHNA 9RUBA 4Z2GA 1BYDA 5KEZA 4DVOA 2A3BA 3CH9A 4WGHA 1FWHC 3W7KA 1HIZA 4OBSA 4UMCA 3H7VA 1C29A 1HKJA 3NNTA 3ZSSA 1LLZA 3LHYA 4U10A 5AC7A 3IVUA 2D2HA 2XUCA 1QW9A 1GOXA 1SJAA 3N19B 3S9YA 3WELA 2NQHA 1GVEA 1IR1A 1Q8JA 1YEYA 2VENA 1UWRA 2ESCA 3HGSA 1EH9A 2WVUA 3UPBA 4CVWA 3T1GA 3QKZA 3HB9A 1VFHA 3UGVA 5KSWA 4UR9A 2D3NA 4JIEA 5FEZA 2Y7FA 1U2YA 1K03A 2QUVA 3G6LA 1P6CA 2PEVA 1W54A 1JL8A 1DP0A 1LUCA 3CV2A 3WENA 3EDDA 4XUGA 3AISA 5J5DA 1OABA 4B9YA 3LQGA 4NZFA 3UR7A 4ZOEA 4DQWA 5LNUA 4PODA 5FJIA 2BP1A 1FOBA 3ZVHA 1R9YA 2R1MA 5AC8A 4O0ZA 4ERGA 1W5PA 3TMLA 2D20A 2GVJA 4O0QA 3CYVA 3TV8A 5CJ5A 3DGRA 3TWBA 3N18A 3BLLA 5C71A 1XL9A 3N14A 4FPSA 3BZGA 1GTEA 1F4HA 4RDYA 2Z2UA 2J6XA 4GABA 4NRRA 2H9AA 3E74A 3FHAA 4GI8A 4IX0A 3C2OA 3GC5A 1QI3A 3GHRA 1XIMA 3TNOA 3II1A 1HL2A 4F8XA 4RLIA 5CH9A 3TTSA 1MZHA 4UFMA 4A3UA 2WSRA 7XIMA 4G8TA 1N8IA 1RA5A 3D6NA 2JALA 4YVXA 3F5KA 1OB0A 2FDSA 4U28A 1ZS2A 1BGGA 4DBWA 2PRLA 4R33A 4RZ6A 3BGAA 3EKZA 2YBUA 3BZJA 5LGXA 5HMDA 4KFOA 3FJNA 1MSSA 2QLYA 3FJ4A 3N6QA 3WLIA 4INFA 2GOKA 3OLDA 1V7AA 2E9LA 5D33A 3VIFA 2YFOA 4KCWA 4B15A 3H7RA 3ITCA 4CEXC 4XBJA 3A9BA 4WY0A 1PIIA 3DDMA 2BSLA 4RPPA 2PZNA 2WQDA 2PDMA 2WAGA 4IX2A 1ONEA 5AHLA 3ITYA 3TAOA 1M04A 1JQVA 4XAZA 4H4IA 4M51A 5FJJA 1GTHA 4KW2A 4FNPA 5EBAA 2O7QA 5LSMA 2ISWA 1VFLA 4S23A 4PGLA 4Z17A 1TCDA 1L6YA 2D24A 1OK4A 3CIXA 5G1TA 3R8GA 1XWYA 4D8ZA 2IPJA 3VM5A 4UOZA 3W7QA 4OT7A 3S5ZA 2KZHA 3W7CA 4WJ8A 1TPH1 2GGEA 2PI6A 4ZXOA 3BLIA 3BL3A 4L7ZA 3ISIX 3W4RA 2Z1KA 1ZFJA 3W72A 3UWZA 1GVIA 5K9XA 4LX4A 3P67A 4I3GA 4EVZA 4GYFA 3MKCA 4PMYA 1UASA 4OBTA 4R7WA 2F9RA 2V3DA 3WO8A 3AXHA 2QUUA 1F9CA 1JCLA 4JNZA 1WYIA 3A47A 4OIFA 3KBJA 2GK1A 3ARPA 1WZLA 3W38A 1C7SA 4MJ4A 1ONWA 4E2VA 3OGSA 3I3DA 4TTUA 2D3LA 3K8KA 4NU7A 1WKEA 4BWLA 3B0VC 2BOEX 3S1XA 4LRTA 1XKJA 1TREA 4Z0SA 3WH5A 3TA9A 1X8CA 3PJWA 3LENA 4PL1A 4M1RA 5LA0A 1KV8A 3FX4A 1W3IA 3CT7A 2J62A 5GJNA 2OEKA 3EOSA 1QUMA 1YBQB 4OUIA 3GYEA 3BQ5A 2J66A 3BC9A 3MCOA 4PUEA 3SSZA 1JFHA 4PZVA 2HV5A 3BMVA 3AXIA 1Q6EA 4LVDA 1E72M 4W9TA 1XRFA 4JD4A 1QATA 4FNSA 3HFTA 1GJUA 3GUWA 4O52A 1XPGA 2Y24A 3OHIA 4ML9A 2TRSA 1HX0A 3GZAA 2PCEA 5JUVA 2R91A 1YDOA 3VNJA 3BXWA 4CKQA 3UWYA 5L6UA 2WMJA 1GVYA 2DVUA 1V79A 4WQ6A 4MDOA 4ZSUA 1CI1A 4L4PA 5D2TA 5IFTA 2TAAA 3BDKA 2ABBA 4MY1A 3UGRA 4GO8A 1U1JA 1QCWA 5E5CA 4AVOA 1QU4A 4GY1A 4PC8A 3ZSTA 1RD6A 1V02E 5C9UA 3O0KA 3U2EA 1IHIA 4JQ2A 3HG2A 2ZUMA 2YA0A 1CXEA 4XAFA 3P7YA 1QT1A 3M5XA 2Q3RA 4R9OA 1E1FA 3HV9A 3UXKA 1VBUA 1S1RA 3R1ZA 4ZTYA 4ADUA 3ZLFA 2VD9A 4S3EA 4XO7A 2ZYFA 2DZAA 1GNXA 3BMWA 3IJ7A 1FH9A 4LYPA 3OG3A 1MRQA 4KCVA 1C8QA 3ZYZA 3VGFA 2INEA 2OEJA 4UTJA 4FLSA 3GRIA 1MWOA 4JXCA 3B97A 3M41A 1UD3A 4NNCA 3AIRA 5FF3A 3DXIA 4WHBA 5LHFA 3S4TA 3IARA 4L4LA 3UZZA 1W9PA 3UJ2A 3VGDA 3N4FA 4AHOA 1UR1A 2FHFA 1OVDA 1X6LA 3TZFA 3DGBA 4MNKA 3OYXA 3NSXA 3E0VA 2X0SA 3C8NA 5F2LA 3JS3A 2YGYA 4YL2A 6ALDA 4NKCA 1YQ2A 4FR1A 1FWNA 1KC7A 3A13A 5FESA 2Z1VA 1FDZA 1KB3A 5HAOA 3BSGA 3L5LA 1P0DA 1TPEA 4FXSA 3RCNA 1FCQA 2WQPA 3VO0A 1HO4A 4D6GA 4CD7A 2BZNA 1OFAA 1JDCA 3DESA 5GPRA 5FEXA 1X1NA 2OZTA 4DUOA 3O1NA 4YTQA 3NQMA 3BE7A 3GXFA 4XD4A 1I6NA 1V93A 4AHQA 1TA3B 2CBUA 5LNVA 3AUJA 2FGBA 2E77A 2G50A 4JQAA 1W31A 2EF9A 3GXIA 4ZOCA 4AAJA 2OMAA 4LOCA 3W86A 1L0PA 3PBUA 2D0HA 4AZIA 2HPMA 2D2JA 4DJDD 5E0CA 4C6IA 3L9CA 3MP4A 2ZRZA 1ZJAA 3L0KA 2QZRA 3SY5A 3QY6A 2A5HA 2GQ3A 4HD5A 3WF0A 1VPXA 1EEPA 2C7FA 4AFYA 1B3OA 3A24A 1KLZA 4HNOA 3U5YA 4J35A 4E2DA 3MMDA 1GW9A 2O56A 2OSYA 5KINA 2R1KA 1S5WA 1WDRA 2Q6ZA 1PIFA 3K5XA 4O13A 3GIYA 1IWAA 3Q65A 4S38A 3S2CA 1TV5A 1TJ2A 5CPMA 3UY8A 3ZOAA 4CCEA 1QRQA 3APTA 3QW3A 4CNTA 3PWAA 3CZEA 4YNGA 2VP8A 1K3UA 3ARWA 4DJFC 2Q8XA 3MA8A 3AZRA 3P60A 5A69A 4D2JA 3WMLA 3UXLA 1XICA 2ZRWA 4KBXA 5REQA 3RF9A 1NFGA 2EGZA 2NUYA 1LQ2A 4B2DD 4C6PA 3MUY1 2PDJA 1B3XA 1VLWA 1EHNA 3ZVIA 4E2BA 4PUKA 3UESA 4ZO8A 2J7GA 3B8DA 5H8PA 3TX9A 1E9YB 2YYTA 1JD9A 4XIAA 4H9TA 5BMWA 3G0UA 2PGRA 3GO2A 4HMNA 5I3HA 4G6CA 1XIIA 3QH2A 1E70M 3UG4A 3PZTA 1ITUA 3WQCA 1YDNA 1IZKA 2QCGA 1H41A 3W1PA 4B4FA 5CC5A 3VINA 3W2LA 4DO5A 2CBIA 2F2KA 4AQLA 3H54A 2QS8A 2VC6A 1H61A 1AK5A 3EOLA 3KBNA 3QPEA 1IQ8A 3RM8A 2R94A 2QPUA 1QK0A 2G97A 4JTIA 4ZTXA 2BBFA 3IIVA 4ICMA 1EGZA 2PGFA 4WXYA 4J3XA 4E0CA 3SFKA 5TBOA 4C7DA 1OEPA 5JH2A 2HNEA 2V3FA 1W5MA 4PUMA 2I9EA 1TPFA 3AFBA 3EKLA 2OWWA 3PUDA 2VR2A 3QPZA 1GVRA 2XZ7A 4NG3A 1JULA 1NSJA 2QF7A 2V2CA 3NL3A 1WZMA 1XCWA 3N2MA 3LV6A 4IMDA 1LT8A 4C91A 3LQLA 1BEUA 2C6QA 3MV01 1AVAA 1JPHA 5B7YA 1UR3M 1QHOA 4TR9A 4J3VA 4JY8A 3UWUA 2GPTA 1V0LA 4LVBA 4AIUA 1Q3NA 4IOTA 1NOUA 3APGA 2BMBA 2QCHA 4M6VA 2DEPA 3MU7A 1S1PA 3ARXA 3WLRA 3WNNA 2PWEA 1ZAJA 2DJLA 2X0YA 1TR1A 1F7BA 3KCJA 2WSKA 5I5RA 1K6WA 2O9RA 4I9AA 3WLOA 4AC1X 3L0GA 3UZWA 2AGKA 1XSIA 1XLJA 3OVGA 1W1ZA 3WEZA 2GLKA 2ZZ3A 1LLWA 3GW0A 1PEZA 1XSKA 3BSHA 2JGQA 1L6GA 1Q7QA 1N7KA 1X7FA 5BXTA 4HKPA 3C8FA 3O2LA 1PB0A 5HJLA 2ZXBA 3R8RA 1CXKA 5HMFA 4J9JA 3GHUA 2IQ0A 3WFAA 1R7OA 2QHAA 3MVTA 4RW3A 2XH7A 3NM1A 1HJQA 2WM1A 3UPMA 1IGSA 2WOQA 5C0QA 3N04A 2P50A 1KXTA 1QVBA 5AB3A 2E1DA 4GA8A 3OVQA 4GWEA 3H2FA 5CPOA 3FA5A 4P7OA 5A94A 2QCCA 2P0IA 3WDQA 4KETA 1WO2A 3LTYA 4I9JA 3TQ0A 3QR1A 4JTQA 1GPFA 2BNJA 4G1KA 2OLHA 3LXCA 3G18A 1KRAC 3EOEA 5IHSA 3LXAA 4Q8NA 3C61A 1OM0A 1K4GA 4AX7A 4BR1A 2VRQA 3QC3A 4UTKA 4BEQA 1GVSA 4XK2A 4XZHA 3KWSA 1F8IA 1C91A 4F2TA 2H3BA 6A3HA 2WO5A 3KM8A 1P0NA 4U2YA 4XIMA 4J2MA 1EIXA 2MUCA 2J7CA 1X1ZA 3ZS4A 1WAWA 4W84A 1BYCA 5E93A 2F6XA 1B9ZA 2QQ6A 2XU2A 3V3WA 2YOCA 5EA9A 4GC4A 5CKSA 1OFRA 3RRXA 5HA7A 2CU0A 1Y7VA 4CQ9A 4WCJA 1UBPC 1OFEA 1QJWA 3LTPA 4DZHA 2ISSA 4PFHA 1JI1A 3UR8A 4H01A 1DXIA 5A8NA 3C4UA 4O16A 1XFBA 1MW3A 3OLEA 4G9PA 2A7RA 1W8SA 5C6MA 3IGHX 1TE6A 1QR7A 3CH0A 3P8JA 3V5CA 4H2CA 1KKRA 1KBLA 3B0YA 1ZNNA 3G1RA 1WBJA 1RBOB 1KM2A 3TWAA 2OYLA 3NL2A 4HZ7A 3T0AA 2PDBA 1T6MA 1DXEA 1CXHA 3LGGA 2Z28A 4GVIA 2ISDA 1RV8A 2QMKA 4H04A 1PXGA 1S5VA 3WN6A 3IWPA 4NASA 1XLLA 2G8ZA 2RDXA 1A5AA 2VFEA 3IACA 3QC0A 2ACQA 4WDXA 5JIPA 2YL9A 4AD3A 2YB1A 2EPHA 3SIMA 2FHBA 2IXVA 1L9WA 2UY5A 3MUCA 1QPRA 4OVXA 4GOAA 1QTWA 4WX2A 1JVNA 1UP0A 3SGGA 1HJSA 1D3HA 1O1ZA 2EG8A 1C7TA 6CGTA 1UR4A 4JTGA 4RL3A 4EPKA 4QTGA 1RCQA 3QYQA 4RZBA 4ORMA 4RR4A 4GC3A 3SCTA 4GZIA 1XV8A 1W0MA 5ECUA 4DNHA 5BXRA 1EP1A 4V2XA 1R87A 4AEFA 1T99A 2ZDRA 1XLMA 2E4TA 3BOLA 3HV8A 1HO1A 4JAWA 3OYZA 4PRRA 4GQQA 1S39A 1XRVA 3GQYA 1E1EA 5K4XA 8XIMA 1F3XA 5D38A 3BOFA 3G0XA 4NXKA 3OIHA 4UOJA 5CEWA 4XTIA 2GSHA 2PDQA 3QLDA 4AD0A 4OOZA 4HYVA 2GJXA 2WMIA 4DWSD 3TXZA 4L65A 2W6RA 4FXRA 1UP2A 1K7XA 4YVPA 3FA4A 2EJ1A 1NQ6A 2PDUA 3MP3A 1OYBA 1UH4A 3GU2A 3FLUA 3MSYA 3G1SA 3OJGA 1LOLA 4N7QA 2QPXA 1REQB 3AHYA 3EWBX 3SO7A 2J25A 4I8YA 3VOGA 3IJ9A 3MDUA 2VCAA 1XYAA 2RDWA 4HMEA 4OKDA 1F4AA 4UTHA 2QW5A 1EBGA 2VD8A 2X1RA 1UJQA 4W8LA 1AD4A 5HANA 2Q01A 5ABTA 1KRBC 1QHPA 3SURA 1NARA 4JEQA 2E9BA 3PZVA 1XINA 2Y0FA 2G41A 3PTDA 2JIWA 4Y7EA 4QITA 2VXNA 5E70A 4E4FA 4L4MA 4MYAA 4UQEA 4XX6A 5D9NA 3WQOA 3TA6A 1UWAA 1B1YA 4N2YA 3C2FA 3QN3A 1LCOA 1VLIA 3KHJA 4RXFA 3QW4B 3ITGA 1T41A 1KO0A 4S3KA 4Q6JA 2P3ZA 2V5LA 3BLEA 3GYCA 2OLAA 1UROA 1OFOA 3KS6A 1EX5A 1TWZA 2FIQA 2R1PA 3T55A 3W28A 2OKTA 3LBOA 4CN6A 1BYBA 3R2GA 1XBXA 3K1GA 2FHCA 2DIJA 2E25A 1W37A 2PTWA 5FA5A 4Q7NA 3UT0A 3L2MA 4DB7A 4AG0A 3KVLA 5AYXA 2IMRA 3RLUA 1RP8A 1EHAA 3AU6A 5DANA 3EMQA 1RR2A 4O0KA 5F4SA 2HRWA 4D1IA 3W1NA 2OCZA 1BSIA 1MW2A 3MHFA 1ZSXA 4F0MA 3PANA 3UNTA 4KT2A 4LF1A 1Q45A 4O8AA 3W2JA 4TV6A 4A4AA 3L4YA 4WY0B 2FZBA 4GACA 3OBKA 3TJXA 1XIBA 4JX5A 2TMDA 4ADSA 1TWSA 1OG6A 1VBRA 3GVGA 3EOUA 2ZRXA 4NJIA 4MYXA 2VC7A 4CD5A 3WDJA 3WD0A 1I8JA 1XDMA 2EAWA 3AO0A 2QR6A 1VFUA 2XVNA 3LEPA 3PFMA 3ELFA 1R2TA 3GH5A 1E6QM 3I4EA 3PS7A 1WQ5A 1MXDA 3EB3A 1DJYA 3A5VA 4L9YA 3AMLA 4HNVA 5MHBA 2BVWA 2V81A 3VZZA 1CW2A 3LZ5A 3RITA 1V6UA 2OPJA 2Z25A 3QZAA 4HA3A 1VENA 2J74A 4OOUA 1SSGA 2RAGA 1AD1A 1FHLA 3AMGA 4MAZA 3WEMA 1XSJA 1UYQA 2I1OA 2IKGA 4H2HA 4QHRA 1X97A 2C3ZA 4KFPA 1EBHA 4DY1A 3S2MA 4IH3A 3U2ZA 1Q65A 5ABFA 2YLAA 4FSAA 4IP4A 4UCFA 4PBFA 3JUGA 3L4UA 4HCHA 5BROA 3R0KA 2RGLA 1TELA 1N2VA 3GXPA 4D8LA 3VCCA 4CD6A 3W22A 3E5PA 1R9ZA 2O9TA 4A22A 4AXKA 3CO8A 1ZAHA 1D9EA 3V36A 3S2JA 3AXKA 2WMGA 1JF6A 1ZUAX 1LYXA 4IPIA 3UA4A<