1KFEA

Crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with l-ser bound to the beta site
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
268
structure length
252
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the Role of AlphaTHR183 in the Allosteric Regulation and Catalytic Mechanism of Tryptophan Synthase
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 96
structure length 252
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfeA00
4JY9A 1FUYA 1N55A 5LNRA 2HMCA 4QITA 4H6KA 2NV1A 1PE1A 1FCUA 3FA5A 2G95A 5K9XA 4RZ6A 4IX2A 4JYEA 3GR8A 3NM3A 3KVKA 3NQ2A 2FJKA 3HG5A 4RLIA 3W3OA 4DBEA 3MHGA 4O15A 4WJEA 4NQ1A 2Z0IA 4WX2A 4A22A 5F1UA 3WFAA 3CLMA 3GVGA 2VEKA 1WV2A 4LRSA 4GUJA 4WD0A 4FNSA 4MZ1A 5DBTA 1VYSX 1T99A 3A5FA 5AB3A 3KAOA 4GUFA 1GTEA 4DO4A 1TRIA 3NL5A 2CLKA 4MY1A 4MVAA 4JX5A 1GVFA 4GNJA 4ADTA 2ZBTA 1LROA 3NQDA 1RQHA 3MI3A 1PVNA 2RH9A 4FNRA 3W07A 3T40A 3M5YA 3PR2A 3TIMA 2JKAA 2LLEA 4O1CA 3VKJA 4GBUA 3LXCA 3L68A 1OFQA 2E68A 4FX8A 4GFSA 4NUWA 4MZ8A 4IXXA 3NVTA 5AHMA 3DFNA 4UMCA 3PB0A 2G5WA 3UY8A 3R13A 1NVMA 4BF9A 1I2OA 1XBVA 1QOQA 2OT0A 2HS6A 5EYWA 3UPBA 2B4GA 4A21A 3B0UX 1F73A 2YSWA 3ZS4A 4JXCA 1VGAA 5HWMA 1DL3A 3FJ6A 3NXFA 1PCWA 4ORMA 4LY8A 3ABOA 3STGA 1FCVA 1UUMA 3TCEA 3F03K 1ME8A 3GR7A 1FCBA 4QM1A 1TPFA 4MIMA 1WQ5A 1FWNA 4ZQNA 1YPIA 3BW3A 4N4PA 5CPNA 1XFBA 3CEPA 1SU5A 3UZJA 4Y9AA 1X8FA 3UXDA 1OVDA 4JNMA 3O6YX 4Y96A 3RLUA 1QOPA 4FNUA 5G2WA 4NJKA 1D3GA 1H5YA 4HN4A 1OK6A 3W2NA 2VXNA 4PA8A 1D3HA 5HWJA 3C2EA 4PEKA 4Y6GA 4ZQCA 2Y7EA 4FX6M 4O52A 3GYEA 4UMAA 5D37A 4UTLA 3S5ZA 4ZQRA 3LCHA 3W83A 5K2ZA 2GUUA 1OFRA 1SW7A 4Z1CA 3NR0A 3LLFA 5D05A 4NNAA 3LXAA 1S3HA 1SFJA 2VEPA 1MO0A 3E96A 4JTFA 3GNNA 5TBOA 1AW2A 1LOLA 1DQWA 2RKXA 3Q58A 1QNVA 3N3MA 3NQ7A 1IIHA 2B7NA 4GC4A 3TW7A 2P0OA 3W86A 4HNUA 4D2JA 4MYXA 1NFBA 1TCDA 1FY6A 1ML1A 2CLIA 1G69A 1RVGA 1IXQA 3O6DA 4K36A 2WV8A 1KV8A 2YPIA 4RXFA 1HO4A 2Y62A 3V75A 3NDOA 3KRSA 5IBXA 4E2DA 2ZRWA 3I6RA 1JCXA 4UC5A 1TPC1 3KFTA 5D2XA 3P81A 4NJHA 3G1AA 2ZZ2A 2PRHA 3UWWA 1DBTA 4EVZA 5I3KA 1EIXA 4UTIA 2Y61A 3PBUA 2A21A 4LU0A 2BLEA 2IQTA 1KM5A 2AQWA 5D03A 1G4TA 3HF3A 2EHHA 1V7YA 3W1RA 4TX9A 3P61A 1F7BA 3DFTA 3ZR4A 2WQPA 1KTCA 5LNVA 2TMDA 1Q3NA 3A23A 2YX0A 3NPVA 4O54A 3W70A 2ISVA 3INPA 4PCFA 2VOMA 3N2XA 1FBAA 1TPB1 3M43A 4HT3A 4JIPA 2QJGA 2RFGA 5FEXA 1L6WA 4MLJA 2E5BA 1EA0A 5AN7A 1O60A 3TV8A 3CQ0A 4YL2A 2DZSA 1JCLA 5F2GA 3PBYA 1Z44A 4XQ6A 5KINA 3PSVA 1UUOA 3BK0A 1RV8A 1CW2A 2Z2UA 1GG1A 3TA6A 2GVGA 2A7NA 3G8EA 1W5QA 1XUZA 4B5NA 4K37A 4L4MA 3WK0A 2NXGA 3NQ6A 4FF7A 5E93A 3I65A 2DZPA 2Y85A 1T0OA 1M5WA 4I9AA 3S1VA 5AC6A 3A22A 1WOAA 2OT1A 3IIPA 3IVTA 2ZA1A 4QIUA 4RZ4A 2QKFA 1TQJA 1EWEA 1QWGA 4POCA 3LGEA 1KV5A 2QAPA 5D38A 2Z1BA 1H60A 1N7KA 4N9EA 1OX6A 3CT7A 2V30A 1KM4A 3EX2A 3R8RA 3ABSA 3HIJA 2VFGA 3VFLA 4N2YA 4NT0A 3I7RA 2ATSA 4M7TA 5GVJA 3DENA 1ZCOA 1X6UA 1MZHA 2VFFA 4RZ5A 1B4EA 4AWTA 3LHWA 1W3NA 1NEYA 5CKSA 1X1OA 2KZHA 1RQBA 2NX3A 3PBWA 3G1VA 5HQEA 5D09A 3EWBX 1HL2A 6ALDA 2BXVA 1JR1A 4ZVJA 1BKSA 3LHUA 2ALDA 2PC4A 1ZALA 1L2UA 3W1XA 4O18A 3SGZA 4EOUA 1BWLA 4DF2A 4M6PA 4N6EA 3LHVA 1I2NA 1S5TA 1F6PA 3PAJA 1OYCA 3W74A 3MBDA 3QQ1A 2X2GA 2YYTA 1OABA 3VNDA 4OE7A 1OX4A 3P8IA 4O8RA 1JCYA 3TJXA 2ATMA 3TKFA 3QMTA 1TQXA 4HKPA 3TFCA 1MEWA 2ZA3A 2YCEA 1WA3A 3M6YA 4LVGA 4UMBA 5L9FA 1FQ0A 2A1YA 1KFJA 1PHWA 1HFBA 1YDVA 1XI3A 3LHZA 3TFXA 1JUKA 3S0CA 3B03A 1K7FA 4RKAA 3P5ZA 4N9DA 3HPZA 2CLEA 4Z08A 4NX5A 4DXVA 2FPTA 3DHDA 4JDYA 5KZDA 3K30A 3KRZA 3W7PA 3C3NA 1ZAHA 4GE8A 1K7XA 3L0NA 1E51A 4BWLA 4HNTA 2DU2A 5FEWA 2TYSA 1DV7A 1K3UA 1YPFA 3NPUA 1FWTA 3NQCA 4AWUA 4BWLC 1OJXA 5J5DA 2V0TA 3QEZA 1XUUA 2QF7A 5DXXA 5D30A 4N4QA 3EEGA 2VFHA 3M0ZA 3C6CA 4DELA 4ORIA 1TPWA 1ZNNA 4RV8A 3NL2A 1GVQA 4NXSA 1W0MA 1Y0EA 1BWKA 1LCOA 3KRUA 3FJLA 3HG2A 4UNLA 2Y7DA 4UXDA 5EY5A 3QPZA 2H90A 1K7EA 2J6XA 3TMLA 2A85A 2V81A 3CM4A 4Z1BA 3M44A 5KZMA 3THQA 3QRHA 3UXAA 3U6WA 2Q8LA 1R2SA 1X7FA 4MYAA 3TX9A 4GXMA 2OJPA 4JS3A 3PG9A 1SO3A 1KTBA 4O57A 3STFA 1R46A 2B7PA 3PUEA 4A2SA 3P8JA 2RDTA 3C2FA 3W7HA 1CI1A 4DPQA 5DLCA 1RZMA 3M16A 1AW1A 2DZTA 4K7VA 1P1XA 1OYBA 4QSHA 4LVFA 3G1SA 5LGXA 3WJYA 1KFCA 1EP3A 1IF2A 3VI2A 3HPSA 2NZLA 4GUHA 4O17A 3S5OA 3QW3A 5CSRA 1VRDA 1K8ZA 5E1QA 2J9ZA 4YXGA 2ZRYA 3B05A 4JEQA 3EWXA 4MFDA 5DY2A 4I7VA 4KKXA 1EEPA 3LCXA 1LBLA 3HO8A 3ZWSA 4FIRA 1HUVA 4GWEA 3W1QA 2V5LA 2P1FA 4MKNA 1WBJA 3S5YA 2ZFAA 2WNNA 2Z6JA 3BPWA 3QC3A 5A5WA 3LM7A 3NQMA 5T26A 5D33A 1J4EA 1WYIA 1KBIA 1VHNA 3GXTA 3O16A 1I4NA 4ICNA 5BMWA 4U4MA 1SW3A 5LSMA 1UCWA 3HBLA 3NQGA 2GPTA 5D2WA 3HGOA 4QAIA 3TAOA 2ZRVA 3M5ZA 3G8RA 2I1OA 3W72A 2ZZ6A 3GZ3A 1JVNA 2BWGA 3LI1A 2NUYA 3TXZA 3C2VA 3TQVA 3QF0A 4UTUA 3NGJA 3S1WA 1IXOA 3HPXA 1F5ZA 1SPQA 1DORA 2FLIA 1H62A 3PF3A 4CNNA 4ONVA 2B0MA 2R8WA 2Z6IA 4XTDA 1I2RA 4OGZA 3TSMA 5AFDA 5AHEA 2DP3A 4UFHA 4JTSA 1GPWA 1K03A 3TW6A 2V2DA 2C15A 3QFEA 1IXPA 4KWWA 3PSWA 5D2VA 3GB6A 1TJPA 4O0ZA 4DEFA 5CZSA 1R2TA 4NZJA 3G22A 2WKJA 4PC8A 4DBDA 5CZTA 3BLIA 4XKYB 1JCJA 3MP5A 4O13A 3IIVA 4K8HA 5LNSA 1QDSA 4YMZA 2FPVA 2Y63A 4YLWA 1XBZA 5H2ZA 3BW2A 3L0KA 3FIGA 4UTWC 4UR8A 1H61A 1I8JA 3W88A 3W87A 4O0KA 4A2RA 3MWAA 5EL1A 2NWSA 3STEA 3W1NA 1F6KA 4ZZ9A 3UWQA 2VKZG 1MEHA 3R5EA 4PL2A 2NUWA 5IM51 2DZVA 1OG0A 2FFCA 1XL9A 4CCCA 3IRDA 3CIWA 4FNTA 3GAKA 1VR6A 1L9WA 3LTPA 4LVDA 1ME7A 3R89A 3T44A 3C8FA 2YXGA 5DCEA 4HPXA 3P80A 3EXTA 4A29A 4CLMA 2AGKA 3SIZA 1S5WA 3F4WA 4WUIA 3EX3A 4AHQA 4K39A 1VZWA 3NL3A 1ME9A 5K3VA 2JGQA 5K9CA 3JRKA 3LOTA 3LRKA 2YYUA 4FHAA 1LP6A 3GIYA 4IPIA 5FF2A 4Z1AA 4X3ZA 1W3TA 2B7QA 3KOFA 4JTUA 4MY9A 4LWWA 3G1DA 2CZDA 3QZEA 2Q3OA 2C14A 3PVFA 4FO4A 1HG3A 4MPQA 3LDVA 4UFMA 3MHUA 3W7EA 1QPNA 4S1FA 3FOKA 4TU1A 3DH7A 1U5JA 3L9CA 3W2UA 1TPH1 4DO6A 1UBSA 5G2IA 2ISWA 1OFAA 3L5MA 1OF6A 1LBMA 4JTJA 4LVAA 3QSRA 1ZY9A 4ZQMA 1QO5A 1KFBA 5K4ZA 5D32A 1YYAA 2PURA 3MMTA 4K8EA 1THFD 2ZRXA 1KFKA 3JR2A 2CW6A 5FF0A 1YLVA 3EX4A 3GDKA 1A5AA 3IVSA 4IQLA 3E0IA 1OFBA 5E0KA 1EX5A 2QCFA 4M19A 4BI7A 5FF4A 3CC1A 1V5XA 2NXIA 2GJNA 3GDTA 2H8XA 4UNKA 1OK4A 2WNZA 1VC4A 3EKZA 3W76A 4NJGA 2QCDA 3HG3A 4EIVA 1DJNA 3O8AA 2X1RA 1LBFA 4M6VA 3C4UA 3LRLA 3MI2A 3L67A 2CZFA 1H7OA 2JKEA 3HQ1A 4IPJA 3B0PA 1H7RA 3G3MA 5LNUA 4AHPA 4AAJA 1VHCA 2V9DA 5FEPA 1SO4A 3W75A 2A6LA 2WPBA 3IGSA 5CPLA 1XBXA 1MEIA 1OFOA 3ELFA 5DN1A 4FNPA 2W6RA 1TREA 3FEMA 2FIQA 1MSSA 4EF9A 4YCPA 3GLCA 4Z1DA 1KLYA 4LV9A 5D02A 4I7UA 1LYXA 1W5OA 3B04A 3TU9A 1SSGA 1IXNA 4N6FA 2ABAA 5G4WA 4AVFA 3BLEA 3EWUA 3YPIA 2P10A 3KXQA 4OHQA 5DELA 5I3FA 1OF8A 1FDJA 1AG1O 3O63A 3W7QA 4JYDA 1F05A 1JULA 4G1KA 3TUUA 3GDLA 1FXQA 3G0UA 5EA9A 1TRDA 3MBFA 1O5XA 4OWGA 2V82A 4NJIA 2Y89A 5AHIA 3M5XA 1JCNA 3A9IA 5LHFA 1VCGA 3KHJA 1ZHAA 1W54A 1MXSA 3TSBA 2A7PA 2H3BA 3A21A 1Q6RA 5K4XA 3PUOA 4R53A 5C5YA 1JRBA 5F4WA 3CTLA 2ZDRA 4O50A 4U28A 3HG4A 4MFEA 1EWDA 1GJPA 1W31A 3NEVA 3TH6A 1VCFA 3AJXA 4HIBA 2TPSA 4JIQA 3Q94A 2C13A 3W1AA 4KFPA 1WXJA 4RR4A 3P62A 3N2MA 4O4WA 3THAA 2GVJA 3LXBA 1TO3A 1ZENA 4NZFA 1ALDA 5BW6A 4JR5A 3TK7A 3N9RA 3B4UA 3N73A 2CLLA 2DORA 1KW1A 4MLRA 1H7WA 4OV4A 5J5RA 1DJQA 4IOTA 5KMYA 4DQWA 2C3ZA 3OG3A 3W84A 4UTTA 4O28A 3UWYA 2OMAA 1ICPA 4IMFA 2VC6A 4N9CA 1XDMA 4UTTC 4FXSA 3T7VA 3N19B 3DKJA 1JJKA 1G4PA 1ONRA 2X30A 4OU1A 3P60A 4CQAA 4Z0JA 3BW4A 2J27A 3W7NA 3U2OA 1OFEA 4O10A 4QQ3A 1G7VA 2PCQA 1LM1A 4QISA 3DU0A 4AXKA 3O15A 3PY2A 3ANYA 3QMRA 3BVJA 1H51A 1KA9F 4JTGA 3EWYA 1YTKA 3M7WA 1W37A 1TYGA 1TTPA 3GKFA 3I7QA 3PS7A 1GTHA 3L65A 1SW0A 4LC6A 3TNOA 1F76A 4PFMA 5TIMA 3CIXA 2CZEA 1DVJA 4IGHA 3EXSA 1K8XA 3STCA 2XN1A 4O1AA 4Y90A 2I14A 4S2CA 1FWWA 2Y7FA 3W7IA 2X16A 3S9YA 4JX4A 4WOZA 3W2KA 2QR6A 2QJIA 4M5PA 5F2IA 3F1QA 4LTSA 3DFOA 2E09A 2RHGA 1OFDA 2WNQA 1KM0A 5CPOA 2C18A 8TIMA 4GRSA 1FCQA 1EUNA 4RCXA 3ABQA 4WY0A 3W9ZA 4LS0A 3OVRA 2NWRA 4CCEA 3E9AA 5HUOA 3TXVA 2J24A 3ABRA 1W1ZA 3IIOA 1SZNA 1J5TA 3BG9A 2FPYA 1LORA 3UWVA 1H7NA 3G1XA 5CSSA 1QPOA 5AC7A 4JTHA 1OX4B 4OV9A 1QFEA 1ZFJA 4ZMGA 3EWZA 1KFEA 1O94A 4ZQOA 4NNBA 4RJEA 4UTKA 1KM3A 1OX5A 2ZYFA 3FKRA 3NL6A 4JY8A 1PL9A 2NV2A 5EPDA 3OA3A 5C6MA 3LLDA 1IGSA 5G1YA 1SZFA 2QCHA 4IWWA 3RF9A 3UWUA 2HSAA 4NVTA 4AHOA 2NX1A 3O06A 1KFLA 3B0VC 3NO5A 3WJZA 4E38A 1AMKA 4JTIA 3WJSA 3UYCA 1TV5A 1QPQA 1LOQA 2QCNA 4BI5A 5BOOA 2BSLA 3I7SA 1TPEA 5KITA 2A2IA 1BEUA 5I3JA 3SECA 1HO1A 3ATZA 4K7YA 3DI0A 4WXYA 4AMAA 2TRSA 1NSJA 2EPHA 5FF7A 3TAKA 4FEZA 4TR9A 1FX6A 4JICA 1AK5A 4DF0A 2QCCA 3EB2A 4MY8A 5AYXA 2CLHA 1WAUA 4YWIA 3SI9A 5F1VA 4S2BA 5CZ0A 1LLZA 2QUTA 3R12A 4O1BA 4JX6A 1WDWA 1A5SA 1VJIA 4ZQPA 4AF0A 4N02A 3NQVA 3W7CA 5CZJA 5F2LA 5LNWA 1QAPA 5HULA 2FQIA 1VYPX 5H91A 2VELA 3M41A 1R30A 3TQ0A 3WJWA 1GEQA 1M6JA 2ABBA 3QJAA 2W0UA 2QAFA 1KM1A 1M7PA 5EBUA 4R33A 3QQ0A 4UTMA 1KBJA 1WOBA 3PBVA 3SSJA 2V2CA 4HHPA 1TPUA 2PE4A 7TIMA 3C2RA 1JCMP 5AC8A 1P4CA 2QCGA 2GVLA 3SGUA 4X2RA 3BG3A 3EX6A 2ISSA 2CLMA 2NX9A 2Y6ZA 5HNRA 2GQ9A 3UPWA 2YGYA 3LBCA 2A7RA 1W56A 1XCFA 2C0AA 2O7QA 3S1XA 3TMQA 4CCDA 1EB3A 2WSQA 5G2HA 1VH7A 3PB2A 3MUXA 4HNNA 1B57A 4I7WA 5A8GA 2VEIA 3IV3A 1T8XA 4ALDA 5G5IA 1ICQA 1B3OA 4BI6A 2NLIA 3G0SA 1D9EA 4CQ8A 4UCGA 3JS3A 1GG0A 3V1PA 4PH6A 1LZOA 3QM3A 1L6SA 4TMCA 4PL1A 3TQKA 1FXPA 3EKLA 1PS9A 2B7OA 5ABTA 5HR7A 3O05A 3BG5A 1DQXA 1G7UA 2ZZ7A 3P84A 4LOCA 1A53A 3IIZA 4JGDA 4A3UA 3HMJG 4KWVA 2ZTKA 4N9BA 3F4NA 4Q32A 1TTIA 5F2MA 3LV6A 1RD5A 4Z0SA 4GUGA 2VENA 1K02A 4UTWA 5BRBA 2ZRUA 4C1LA 1OHLA 2FB3A 1W5NA 2ZQ0A 3C52A 3NA8A 1WX0A 5EMUA 3W1TA 3LTYA 1GOXA 4UIOA 3UQNA 5HR6A 3NM1A 4O1DA 4GJ1A 4P61A 1QO2A 3IVUA 1XM3A 2CFFA 4OQVA 1Q6QA 2E1DA 3C0JA 1QPRA 4AEOA 5AHFA 5HUPA 3LRMA 4QNWA 2EGZA 2JKPA 5LHEA 5BMXA 5AHLA 3DKLA 5F4XA 3SR7A 4BFAA 3FYOA 1SUXA 2ZZ1A 2GOUA 3NPXA 3W23A 3P74A 3SZ8A 1P5BA 3H53A 1G6CA 3G24A 3W1PA 3CEUA 1W3IA 1GT8A 5I3HA 2PRLA 2A6NA 3NOEA 4JYFA 2HS8A 1U83A 3GAYA 2RDWA 3RNDA 2O7SA 3CB8A 1OYAA 2E6DA 3D0CA 3UNDA 1VS1A 1C8VA 1UB3A 3TC7A 3UD6A 4Q4KA 2QDGA 1EUAA 3CHVA 4P2VA 4PODA 1W5PA 3LCWA 4ADUA 3GXPA 4LUJA 3T78A 2HTMA 4XBSA 4IMEA 4KFOA 1B9BA 1XDLA 3VCRA 1FWSA 4LRTA 3MO7A 2CZ5A 2NUXA 3IGUA 5EKYA 4QJ1A 2C19A 2F84A 4IXHA 2XN2A 3EWWA 4FB7A 3HGRA 2XFWA 3CPRA 1VCVA 1K8YA 1LRNA 3GKAA 5DCBA 3WK1A 2WJZA 4RK8A 5K7JA 2QEZA 4WQ6A 1C29A 3TDFA 4DF1A 3C2OA 2CLOA 2QUUA 3MJYA 4IMCA 3WJXA 1TSIA 3W6YA 3W2JA 3RFAA 3EX1A 1OFPA 1VYRA 2DZUA 4TO8A 1SR9A 2E6AA 1YTDA 3LCIA 3L66A 1YXYA 3TE9A 5AYYA 3OIXA 3SJ3A 3G3DA 1TIMA 2OCZA 3O6CA 1H63A 1QR7A 3W2LA 4ZL1A 3O1NA 3KVJA 1ZAJA 4FX7A 3W7MA 2E5DA 4QNEA 2V5BA 2G97A 4HPJA 4EF8A 1GVSA 3W22A 4IMGA 5HINA 1YXDA 3UWZA 3M5VA 4PTNA 2QCDB 4CQ9A 1UASA 1SZEA 4DO5A 3OHIA 2E6YA 2X1UA 4LV4A 1Z41A 3FFSA 1KM6A 2JGYA 3WK3A 1A50A 2BZNA 5G4EA 2J88A 4IMDA 4XUGA 1WBHA 2J9XA 5AOUA 1TV7A 5BNKA 5LGZA 2EKCA 3W73A 1RPXA 3S8HA 1VQTA 4K6AA 3CU2A 4WXZA 1NAL1 2Y7GA 2ZZ3A 3RLVA 2F7FA 1GZGA 5IBXC 3LI0A 1G4SA 3G1YA 3GXNA 1XKYA 5HJLA 4DPPA 3LERA 4UFKA 2OX1A 1O4UA 1H1ZA 3LCFA 5F4SA 1ICSA 3LTSA 3GNDA 4UFJA 3AO0A 3UZ5A 3BGJA 4EWND 3KX6A 3GX9A 5D04C 4CNOA 5FEZA 3PC0A 1YADA 3S1UA 5U7SA 2A5HA 3BARA 4MZYA 3T55A 1XXXA 3R2GA 5C55A 3LHYA 5CG7A 4MUZA 5DXYA 3N34A 5G1TA 4LT9A 1Q6OA 4JD4A 5MHBA 1VLWA 1BTMA 1LRTA 1ADOA 1YTEA 4C1KA 1G67A 3LB0A 4NXKA 3Q37A 3W7KA 1R2RA 4FXRA 3L2IA 1O5KA 1Z48A 3QSTA 4XWUA 5C54A 3L5AA 3W1MA 3W7RA 1TJRA 3RMJA 4LC8A 2C1HA 3T4CA 3TR2A 3G1FA 3NQAA 4XZ9A 1XBYA 4RX0A 3CWOX 3A5VA 2UV8G 1PCKA 5HMSA 5DBUA 3DHFA 3SW6A 3PWAA 1GYNA 3ZFHA 5LKYA 3M47A 3KVLA 5FESA 3DFSA 1X1ZA 2Y88A 5TQLA 3L21A 1UJPA 4LUIA 4O14A 4UTHA 3RU6A 3NYZA 2YR1A 3HGJA 3CWNA 1GVRA 5CPMA 3U8GA 5D2TA 5U4NA 3P5YA 4RXGA 5FI8A 2D73A 2YW3A 4JN6A 4W9TA 3QMSA 2QDHA 3P82A 2YFNA 1H7PA 4JTTA 2H3DA 4CNPA 3OVPA 3QYQA 3L0GA 4JTLA 4MJMA 4ADSA 2CU0A 2DZXA 2RDUA 2NXHA 3MP3A 1NF0A 3BLFA 4MJZA 4UUIA 2YW4A 3MP4A 1B4KA 1AW5A 2V8ZA 3NPWA 1PV8A 3H54A 3IIXA 4L4LA 3FYPA 4M7SA 2ZRZA 1VLIA 3OVQA 3TJLA 5KTLA 1I45A 4AH7A 1O95A 4E0CA 3TROA 5DCDA 3GDRA 1A5CA 4R34A 1LTDA 1LDCA 2W79A 1DOSA 3LX9A 5CGQA 2WO5A 3G1HA 1I2PA 2FB2A 1SSDA 2G96A 3Q2DA 1GYLA 2YZRA 3TSDA 3QPYA 1H1YA 4LVBA 1W5MA 1SFLA 5C2XA 4LS1A 4UR7A 2QCEA 3W7JA 1AL7A 3M9YA 3DZ1A 4JTEA 4ML9A 3P7YA 1L6YA 2R94A 3GDMA 4R7JA 3DFQA 2A4AA 3QH2A 4WY0B 3OBKA 1SO5A 3PG8A 3RK8A 3DI1A 4BK9A 3BGGA 5I3GA 4GUIA 1YXCA 4H4IA 1TPDA 3G18A 1LOSA 1RR2A 1DKWA 1FDYA 3IEBA 4MOZA 1QCWA 2EAWA 3HJZA 4FIQA 1FWRA 3FS2A 4LNYA 1JUBA 3MHFA 1P0NA 4OT7A 5I3IA 4J9JA 1JQXA 3BO9A 2YDAA 4X22A 1JRCA 1Z42A 3FLUA 3KVMA 1M7OA 1F2JA 3NZ1A 2J9YA 2ZCGA 3W1UA 1JQVA 2A0NA 2E6FA 3NQEA 1GVOA 1ZJIA 2Q3RA 1VPXA 3S42A 2R91A 3NG3A 1N8FA 3BV4A 5SWUA 3NZRA 2ZA2A 1YDNA 4YCOA 4HSOA 4AB4A 1SQ7A 3LBMA 3MI6A 3NQ8A 4OBTA 2QCMA 3E12A 2ZTJA 4HNVA 5FF3A 3HOJA 2E77A 4O11A 1TMHA 3W2MA 1Q45A 2H8ZA 1KTNA 3HGSA 2DJLA 4H3DA 2E5CA 3FKKA 1Q6LA 3EXRA 2WSRA 3NQFA 1TPVA 1TTJA 2YFOA 4WZHA 4X9SA 4O12A 1S5VA 4NU7A 3MYPA 1SO6A 3LCGA 2PRMA 3I68A 3G0XA 1GQNA 2BTMA 3E02A 3W7OA 1PIIA 3O07A 6TIMA 4BR1A 2R14A 3LV5A 2VFIA 2X1SA 4HSNA 4NJJA 1HTIA 1CX9A 1QMLA 4WY0F 1GWJA 4JDBA 2WSYA 3QW4B 2WOQA 4IUOA 2CLFA 3UY7A 3W7DA 4KFNA 4O16A 2GQAA 1IIGA 3C61A 2AAMA 1H50A 4TIMA 1H7XA 4XBKA 3N9SA 3SY5A 1I2QA 2GQ8A 4WOQA 3LCLA 4Q33A 1F74A 2I9EA 4O19A 3OEXA 3VE7A 3DXIA 2VFEA 1DHPA 1SZGA 4E2BA 1RQEA 1LRQA 3MW7A 4JTKA 1T96A 5HWNA 1KLZA 4AF0B 1LLWA 3MYOA 2DZWA 1PHQA 2JBMA 2ZZ5A 1EP1A 1P0KA 2JK2A 4O53A 1JUEA 4Y8FA 1TTQA 5AYZA 3LHTA 4XTIA 3W7LA 4UFIA 5K9DA 5KZEA 2Y70A 2V2HA 2H6RA 4AWSA 4IJBA 1XC4A 1G4EA 1AL8A 5KSWA 3W71A 3H55A 4IX0A 2XN0A 2VFDA 3IGXA 4NX0A 3S6DA 2CWNA 3C56A 2Q8ZA 4UTJA 3VE9A 3ZWTA 1FDZA 1C9DA 2VEMA 2QUVA 4LW7A 3N14A 1NF7A 3PM6A 2FTPA 3PUDA 1TB3A 3DBPA 3P67A 1EP2A 2EF9A 3A24A 4LS2A 3TC6A 1A5BA 1TV8A 2QCLA 1KM2A 3SFKA 5D2YA 3PULA 4NNCA 4O4VA 2C6QA 2C16A 2QJHA 4FNQA 1R47A 3DAQA 2ZZ4A 1J2WA 3ATYA 1YDOA 2TSYA 1W8SA 5AHNA 2BX7A 5LZLA 3NAVA 3E49A 3WK2A 4XKYA 2DJXA 1ZAIA 4M6QA 3S5NA 3B06A 3W1LA 3DFPA 3W85A 5L6UA 3NNTA 2OZ0A 3USBA 4K38A 5DY3A 3L5LA 2GJLA 2FDSA 1EPXA 2X1TA 3B8DA 3W7GA 3HB9A 4TMBA 4UFLA 3DGRA 3M1ZA 3GK0A
chains in the Genus database with same CATH superfamily
1VIZA 2ALRA 1N55A 1CDGA 3VKBA 1XWYA 1ZSXA 5FL0A 3GVWA 3H23A 2IXVA 1M9HA 4GY0A 3FA5A 2QULA 1WDSA 1MW3A 5AC4A 4DBEA 3KBJA 4X0VA 1RJQA 4NQ1A 5LA1A 2R24A 3VK5A 3E2VA 3P14A 2HVMA 3EOEA 1WV2A 3GXIA 4WD0A 4FNSA 5DBTA 2CC0A 5E70A 1T99A 3A5FA 3APTA 4TQTA 1PX3A 5AB3A 5I09A 4DO4A 1TRIA 3KOXA 4GACA 4MVAA 5CPQA 4MNJA 3VYLA 4MGGA 4DN1A 1GVFA 1BF2A 1ECEA 2ZBTA 2FTYA 1LROA 3WLHA 4C1NB 2OGJA 3MI3A 1PVNA 2RH9A 2VWTA 3PR2A 4FLRA 5D9MA 3A6OA 3LXCA 3TLLA 3CTTA 1OFQA 1DWGM 3AIRA 4IGMA 2QT3A 2XSAA 1FWEC 3G2GA 3N18A 3NVTA 5AHMA 4B92A 2VCBA 4UMCA 4WSKA 4HCDA 3U5UA 1NVMA 2PODA 1AD4A 1I2OA 5EYWA 3E2SA 2P8BA 4A21A 2YSWA 1N8IA 4D8ZA 3OB8A 1BHGA 3FJ6A 2PWGA 4LY8A 3UJEA 5IDIA 1FCVA 3GR4A 4QM1A 4KIEA 4MIMA 4H00A 2J25A 3K4DA 1XFBA 2VX6A 1SU5A 3CZJA 3UZJA 1X8FA 4IICA 4NZ5A 4Y96A 3RLUA 3UR2A 1K70A 4ZTXA 5A6KA 2VWSA 1EDTA 3Q65A 5G2WA 2PDFA 1IEIA 1H5YA 1OK6A 4QE5A 1D3HA 5HWJA 3CAQA 4DB7A 3KBNA 4I90A 4UMAA 3S5ZA 5K2ZA 5JH2A 2Z26A 4Z1CA 1I0BA 2AAAA 4NNAA 5TBOA 1DQWA 2RKXA 2YB4A 2XVLA 3U7VA 3N3MA 1IIHA 1JNDA 4D6IA 4GVGA 3TW7A 3W86A 2D0FA 3VMNA 4HNUA 4I8YA 4D2JA 2P0IA 1TCDA 1W91A 2CLIA 3QY7A 1TVLA 1VEOA 3GNPA 2OKOA 1IXQA 1TMQA 4HU4A 4K36A 1HO4A 3RPTA 2PI6A 1KQZA 3V75A 1XISA 3F2BA 2GVEA 3JW7A 3KRSA 4E2DA 3I6RA 4UC5A 2CPUA 3KFTA 3DX5A 3VO0A 2OEJA 4D1JA 4NAEB 5I3KA 1EIXA 1H41A 4F9DA 4UTIA 3D6NA 1H49A 5BU9A 3KUMA 2BY0A 4ZXOA 1MW0A 4B15A 3B97A 2AQWA 3TYEA 1S1PA 5IRPA 1NDYA 3MUIA 2EHHA 1V7YA 1XG3A 2JEQA 2XVGA 1BYBA 3P61A 3DFTA 3A13A 3ZR4A 1A47A 1KTCA 1TA3A 4LSBA 5LNVA 3FAXA 1C91A 4H7ZA 1E72M 3NPVA 1V02E 4NIRA 1Z89A 2PCEA 4V2XA 4A35A 1Y65A 1TPB1 3M43A 1EFZA 2QJGA 2RFGA 1W1VA 3V4BA 1UKPA 2ZDSA 4GQBA 3W02A 2E5BA 1EA0A 3BOXA 4YL2A 3EOLA 1JCLA 4HOXA 3PZUA 3VOCA 2A3CA 3MZNA 4PE8A 3FV9A 3NOYA 1QJWA 1CW2A 3KBWA 3TA6A 2DH3A 3G8EA 4CD4A 1TG7A 2O4MA 3H2MA 4I9MA 3BAIA 3WK0A 2NXGA 3AOFA 3WQGA 3PBGA 1XS2A 1E6XM 2FJUB 4HHLA 3B9OA 3TWAA 3IIPA 2ZA1A 1R9YA 1XRTA 3LGEA 1KV5A 5D38A 4Q7IA 3IACA 1N7KA 1R3VA 4IIBA 2QF8A 1QHZA 3HIJA 2VFGA 4NT0A 3I7RA 1J2BA 2Z1SA 4M7TA 3VZXA 4IUGA 2W4XA 4QE4A 4D1IA 4AWTA 5CQ1A 3S47A 4RE2A 2PTZA 2MUCA 1HKMA 5CKSA 4H9VA 1E1FA 3AQUA 4PYSA 2BOEX 5FL1A 3EWBX 1HL2A 3WLMA 2OZTA 2BXVA 5D9OA 1BKSA 2PC4A 4QS6A 4URIA 2QPUA 3S46A 1W1IE 3W1XA 1POJA 1GOKA 4HMCA 1PX8A 1B3XA 3A3XA 4NAFA 2XM1A 1K4GA 4MNMA 1XIDA 4FP1A 4AG0A 1WUFA 3DYPA 1I2NA 1S5TA 3T4WA 3MBDA 3QQ1A 3VNDA 4DBWA 4D6HA 4O8RA 2VZSA 2ATMA 3WKZA 3VDHA 4HKPA 1MEWA 1MDLA 2ZX9A 2A3HA 1FQ0A 3WQWA 4ZGYA 4ERIA 4PFHA 3B03A 1K7FA 4N9DA 3WN6A 4IP7A 5C8BB 1ISWA 4HHHA 5A3HA 3BOFA 2A79A 3E1F1 3KRZA 3L23A 2ZWZA 3W7PA 3QQWA 2PB1A 3MB9A 1NWSA 3OYXA 1U30A 3O9NA 3ZLGA 5BRPA 3OW1A 1YPFA 3NPUA 4BWLC 3GUGA 2V0TA 2XIQA 4N0RA 1NARA 5D30A 1MNSA 3S3GA 3WDRA 4N4QA 2PWDA 3EEGA 2VFHA 2QIIA 1VJZA 3F4DA 4XZHA 3AYVA 2OQYA 1GVQA 1Y0EA 2F2KA 2CERA 4WRHA 1BWKA 1KNWA 4MB1A 4UNLA 4JKKA 4JHZA 1ODZA 2Y7DA 1K9DA 1V6VA 4C6NA 5EY5A 3RM8A 3MQTA 2PDPA 1XYZA 3WY1A 2J6XA 5KEZA 2A85A 1IWBA 4GA8A 4MWAD 1AQ0A 4REQB 2J66A 3U6WA 1XLDA 3N2OA 4MYAA 3TX9A 4GXMA 2GL5A 1D7FA 4JS3A 2D1ZA 1PB0A 3TYUA 1KTBA 1R46A 4Q4RA 2B7PA 5DMYA 4A2SA 3P8JA 4DI9A 4F79A 1CI1A 2W62A 5DLCA 2ACQA 1OYBA 5LGXA 3WJYA 1RHCA 4XAFA 1XLKA 1X1NA 1VRDA 5CJNA 1HJVA 3B05A 3OIHA 2BVDA 2PTDA 4YU1A 4L80A 4KKXA 4GWEA 1TZZA 3S5YA 2WNNA 1R9XA 3LQLA 3BPWA 4FZIA 1PEZA 3SRKA 3ENLA 4IG2B 1E1CB 4MJ2A 2V5KA 6CGTA 4BF5A 1JPHA 1VHNA 1VBGA 1S2CA 2AQOA 3WQPA 2WXDM 3VKDA 4H9ZA 3TEVA 3T05A 1QW8A 5F7UA 4IZGA 1QU4A 2QHAA 2J6VA 4ZOEA 6ENLA 1JZ7A 3M5ZA 4EWJA 3BWWA 2I1OA 1UKQA 3W72A 3HQNA 4CVUA 2ZZ6A 3GZ3A 2BWGA 3TQVA 4UTUA 3NGJA 4EE9A 3HPXA 4RV3A 1F5ZA 1SJCA 1TKKA 1I0DA 1BGAA 4OGZA 5AFDA 1MQPA 2DP3A 2ZE3A 1Q65A 1O68A 1XLJA 1IXPA 4PUKA 2NQ9A 3GB6A 4Q4SA 4BEQA 1TJPA 1MFUA 1LQ2A 5CZSA 4JIRA 4JN8A 2XJ7A 4NZJA 4LY4A 2OLSA 3GRIA 5CZTA 3WQ4A 3SRHA 5DO8A 2HV5A 5JBFA 3QR0A 4HMDA 3EBVA 4UR8A 1I8JA 3W87A 2BVYA 3PPGA 4O0KA 4A2RA 5EL1A 4B3ZA 2NWSA 3STEA 2DVTA 4WDUA 4XZIA 3VNLA 2JF6A 1J11A 2G4JA 3R5EA 1FFQA 4PL2A 5IM51 2DZVA 3NTYA 1CXKA 3IRDA 1GUVA 3CIWA 2DEPA 3GAKA 4Y2WA 1VR6A 1GQIA 3AISA 3WBXA 4LVDA 4GNKB 1HJSA 1WDQA 5DCEA 5A6JA 5HMEA 2QS8A 4C6EA 2G41A 4QBXA 4CN4A 3EX3A 1ME9A 3I3EA 3K2GA 3TN4A 2JGQA 4L7ZA 1MRAA 3LRKA 3WFLA 2WMFA 3EDFA 3CUFA 4FHAA 4IPIA 5GPRA 4LUYA 3GWQA 1OGGA 1QTWA 1VKFA 3V0SA 2Q3OA 1LLOA 3RITA 4XX6A 5T8GA 5GJNA 3W2UA 1WB0A 3B8TA 1IT0A 3D3AA 5G2IA 4Q8QA 2ZE0A 2XHYA 3S2JA 3L5MA 3B8WA 4JTJA 3QSRA 3EZ4A 1QO5A 4DVOA 1YYAA 3OJGA 2POZA 4E2OA 1UA3A 2WKLA 3AI0A 4H7CA 1KFKA 4HU3A 2J7EA 2QVHA 5FF0A 1YLVA 2YBUA 1A5AA 4UB9A 3PWGA 2BY1A 4M19A 3EWCA 2GJNA 4H04A 3GDTA 4UNKA 1RCQA 3ITTA 3EKZA 4NJGA 1V6XA 3TN6A 3HG3A 3WQ5A 3ITYA 2X1RA 1JDFA 1R38A 1LBFA 2HNEA 2WHLA 3MI2A 2CZFA 1H7OA 2JKEA 2IPGA 3G3MA 1J0HA 1VHCA 3G77A 1U22A 2V9DA 1VBJA 1SO4A 2GK1A 2BS9A 2Y5SA 1VPYA 3LSBA 5A8PA 4MB5A 2VURA 5IOBA 1ZRQA 2HQAA 2XIMA 2DT3A 4EF9A 3FEMA 2FIQA 1EJVC 3MT1A 1BQGA 4C6LA 4KESA 5M5DA 5D02A 4I7UA 3QTPA 6TAAA 3B04A 2OO6A 3AYTA 5G4WA 3EWUA 3O63A 4PN2A 4AZCB 4CQBA 4H8UA 4AZIA 4GGHA 3EDJA 1JULA 4G1KA 4R27A 2HNHA 1REQA 3MBFA 3BAKA 2V82A 4EACA 4NJIA 4E4FA 2Y89A 5AHIA 3M5XA 1KRAC 2C8NA 4O1FA 2Q01A 1MXSA 5C9XA 2CYGA 1Q6RA 4JQ3A 5K4XA 2EBNA 2OWWA 2ACSA 3CTLA 4U28A 5AYBA 3WLIA 2WM1A 4MFEA 1GJPA 1RPKA 3O7UA 3NEVA 2PSNA 3DECA 3DOPA 3BSGA 2DH2A 1TA3B 4GIEA 4ZODA 2QIWA 1RK6A 2C13A 3W1AA 4X9YA 1ONEA 2Q8XA 2QUNA 3P62A 3V1HA 5EMYA 1ZENA 2CHRA 1ALDA 1MVYA 3N9RA 4EX4A 2CLLA 4F40A 2Y24A 5J5RA 4IOTA 3CO4A 2XINA 5HOSA 1RALA 2TAAA 3GXFA 3SN4A 1PX4A 4DQWA 3ZVIA 3WD2A 2PPGA 2C3ZA 1IZKA 5HJXA 5FJJA 3NURA 3EGJA 4UTTC 4PULA 4FXSA 4X61A 1JJKA 4WK9A 2X30A 4CQAA 3P60A 3B8SA 2VYOA 3TYDA 5A8NA 2J27A 1CLVA 2VD8A 3U2OA 4QQ3A 4HZ6A 4AXKA 5FAGA 1KA9F 4S3GA 5CZKA 2D2JA 4FSAA 7PTDA 1EO5A 3M7WA 1TYGA 2X05A 3TCSA 2G3FA 1L6FA 4KCUA 1CWYA 3GKFA 4C6JA 4MG4A 1GTHA 1XDJA 4YTSA 1SW0A 3TONA 4JCLA 4YWSA 3AIBA 3Q4DA 3R79A 3TNOA 2PDQA 5TIMA 4IGHA 1DVJA 3EXSA 4MB3A 4GVHA 4Y90A 4S2CA 1FWWA 3S9YA 3RDKA 4EPKA 4KBXA 1UZHA 1BVZA 3F1QA 1DP0A 1XIFA 3TVAA 2EJAA 3UYIA 1PWLA 1X39A 2WNQA 1XGDA 2C18A 1ZQ5A 2JEPA 4WKHA 4XIMA 3BGAA 5FJRA 1EUNA 3CYJA 3ZT7A 1PKLA 4Y8EA 3O6AA 4Q3MA 3W9ZA 2AQVA 4S3DA 3GNOA 2D0GA 3OVRA 4P7NA 4E8GA 3UZZA 1QNSA 3CUHA 2J24A 2WJEA 3D5HA 1VIWA 2OYMA 1GZJA 4NAFB 4QHRA 2FPYA 1V03A 3CV7A 4CD5A 1GQJA 3SJNA 4KEVA 4XG1A 2VGFA 4DYEA 3H22A 5AC7A 4OV9A 1QFEA 4O0QA 1ZFJA 1V0MA 4RUBA 4ZMGA 1WCGA 2FH8A 3ICJA 3WL0A 2YBTA 2VT0A 3IJ6A 4RJEA 2YOCA 3FKRA 2HPIA 1XF0A 3T2OA 4QJ5B 3LLDA 3VM5A 2HXTA 3VD9A 4NVTA 4W4QA 2FFIA 2NX1A 1W3LA 2C7FA 4BQ2A 1K9EA 2VUYA 1LWIA 4GC3A 2Y8KA 5A6SA 3DG7A 2QCNA 4BI5A 5BOOA 2FH6A 2OSWA 5FD0A 2FDMA 5CAHA 2RGLA 2BDQA 3BE7A 1L2QA 3WQ8A 4KWSA 1BEUA 5I3JA 2PD9A 4XVDA 3VGEA 5FACA 2EPHA 5FF7A 4B5WA 4P8VA 4H7VA 1TZ7A 3K5XA 4GH3A 4TR9A 3RR4A 1J10A 1FX6A 3UZXA 3EB2A 2OLHA 1KR1A 3RO8A 2PLJA 1DXIA 1WAUA 4YWIA 4H8HA 5I77A 2VR4A 2OODA 3L4WA 3MDUA 1A5SA 1VJIA 3W7CA 3AWNA 5CZJA 4LAOA 1HGWA 5HULA 2FQIA 4U10A 1E6ZA 3M41A 3F2CA 3H2OA 3N2BA 4R9XA 5C2GA 4DYKA 2OXNA 2NSOA 2OLAA 3VIHA 1KM1A 1XLBA 1Q66A 4JL1A 4EPDC 3QQ0A 3I3BA 3CJPA 3SSJA 4R7WA 2FGBA 1TPUA 7TIMA 1NFGA 1JCMP 3L2MA 5AC8A 2Q02A 5EFFA 3SGUA 1E70M 2ISSA 5HNRA 2Y6ZA 4IJCA 3OU8A 5G4HC 3H12A 3REQA 2A7RA 1A0EA 2O7QA 3LY0A 4KRZA 2KAUC 1RCXB 2WSQA 1XC6A 3KM8A 1UIPA 1E9LA 3GHSA 4JAWA 3PB2A 1PIFA 4UOJA 3WH8A 2ISDA 5A8GA 2DSZA 1K8CA 1QBAA 2PLKA 4B5UA 5E6YA 2R1NA 4GXPA 3BAYA 1W6TA 2OVLA 3GG1A 3G0SA 4Q6XA 3JU2A 3V1PA 4PH6A 1LZOA 1UOZA 1KCLA 3NYDA 1V08A 4B5SA 3QM3A 3TQKA 1FXPA 3EKLA 1J12A 3QR3A 4TV6A 1XSKA 1A53A 4A3UA 4KWVA 1E3XA 3FHAA 1IR1A 1TTIA 3KP0A 5F2MA 2CCRA 1K02A 4UTWA 2V3FA 1KCZA 1E56A 3AHZA 3C52A 3UQNA 4O1DA 3MMUA 1LG1A 3BUVA 1XM3A 5AZ1A 4OQVA 2GGEA 2OSXA 3LPGA 2PU1A 4DJEA 4NILA 5HUPA 3BLKA 3AIEA 3D46A 2EGZA 3KDNA 5BMXA 2BGNE 2PDYA 3ALGA 1JI2A 5F4XA 2DIKA 3THUA 1S5MA 3M0KA 1V6UA 2V6AA 3VNMA 3CK5A 3G24A 2Q09A 1QUMA 1UP2A 1KCKA 1W3IA 1GT8A 4D6FA 2FTWA 3IJQA 2P8CA 1HP5A 3NOEA 3N25A 3CUIA 3PZMA 3RNDA 1S2VA 2VVSA 2ZADA 2ZUTA 1ISYA 3UNDA 1UB3A 3UD6A 3NIYA 1UD5A 2CKRA 3KW3A 3UJ2A 3FX4A 4FMVA 3GXPA 3K4AA 1ADDA 4LUJA 3T78A 4XBSA 4KFOA 1XDLA 3VCRA 2PWUA 5HNTA 4IHCA 3LPFA 2CZ5A 1V02A 3IGUA 1FOBA 5EKYA 5CC7A 3CLWA 3CV6A 4F2UA 4FB7A 1NDWA 3CPRA 1K8YA 1LRNA 4FF5A 3WBWA 1EGVA 3GQYA 1HIZA 1BGGA 2L5HA 1EJTC 5K7JA 4DWSA 1HJXA 4XVEA 3TDFA 4L56A 3MJYA 3WJXA 1WDDA 3W2JA 3RFAA 3M6DA 1OFPA 3QKZA 2DZUA 1SR9A 3AS0A 4LAUA 4TV5A 1BKHA 2E6AA 4LEQA 4WIWA 1KD0A 2QV5A 3SJ3A 3ZYZA 5AVNA 3G3DA 3O6CA 4L64A 1H63A 1QR7A 3O1NA 3FVDA 2GGGA 4M8UA 3WUBA 1A3XA 1C9WA 1NDVA 4HPJA 4EF8A 1GVSA 1Z9AA 3W22A 1DJHA 1CGXA 5HINA 4H2CA 3AMGA 4UTFA 3UWZA 1DYSA 4CQ9A 5I07A 1BG9A 2UZ9A 3HN3A 1SZEA 4DO5A 4C5ZA 2E6YA 1XYLA 4GPNA 4LV4A 4GISA 1KCXA 4MKSA 5I2UA 2BVTA 1KM6A 3VIMA 3B8UA 4B16A 2GDQA 2J88A 4XUGA 1S2UA 2YLAA 2J9XA 4ZO8A 4HYWA 2GK1B 5LGZA 4LUTA 2EKCA 3K8LA 1ZZMA 1RPXA 2W67A 1VQTA 4K6AA 3MPGA 1F3XA 4LNCA 1EF3A 3DFHA 1US0A 2ZZ3A 4XIAA 3RLVA 4Z2JA 1OC6A 2DUAA 3WLJA 3G1YA 5HJLA 4DPPA 3LERA 1FP8A 4GZJA 4J28A 3S2CA 1H1ZA 4DUVA 1WUEA 1XPGA 3LCFA 5F4SA 2JALA 1ZJBA 2PF0A 2XU2A 4R5EA 3BGJA 4H6EA 3V36A 4Q8TA 5D04C 2G0WA 1YADA 3M7SA 5U7SA 1DE5A 4JFTA 4DAFA 4RW5A 3T55A 4D6GA 1XXXA 3R2GA 1E15A 4MUZA 1REQB 3N34A 1PBGA 4PTDA 1TVPA 1KRCC 1YTEA 1LRTA 1ADOA 1KGXA 4C1KA 1G67A 3LB0A 4J3WA 4XV0A 2BV9A 3Q37A 1FWCC 3GXMA 3VDCA 4BEUA 4RZBA 1J01A 2O9TA 1O5KA 3IK4A 3TA9A 3I3DA 3W1MA 1TJRA 3IS4A 4D9PA 3RMJA 1A3HA 4TVDA 3R11A 4EANA 3AIWA 4M24A 3NQAA 1XBYA 1PCKA 4WSJA 5DBUA 1HKJA 3DHFA 2IXUA 3KVLA 4IF2A 3L21A 2Y5JA 4ZO7A 1MQRA 5IDZA 3NYZA 2YR1A 3CWNA 2I7GA 1PZ3A 3P5YA 4OECA 4C6CA 4RXGA 2PDUA 2R6OA 4QGCA 2YA1A 1QW9A 3P82A 5FJTA 2YFNA 4QP0A 2WWCA 4JZ5A 2CU0A 5BXRA 1V3KA 4JKMA 2WZTA 1CEOA 1TZ9A 4V15A 4UUIA 1AW5A 2V8ZA 2MANA 2QQ6A 3IIXA 1UR8A 2XYLA 4HK6A 1SYTA 1LJYA 1MWOA 3MO4A 3QFWA 4GYKA 2NT1A 1U33A 1O95A 4XBJA 4G1NA 5CJ5A 2PWEA 1DWJM 3PPFA 2O56A 1WZLA 3PANA 1AH0A 1A5CA 2J75A 1DOSA 3M0MA 5CGQA 2WO5A 3G1HA 3SUSA 2FB2A 5IFPA 2G50A 3QPYA 3AIVA 4KWUA 5C2XA 4LS1A 4HPGA 2QCEA 3DZ1A 4IIFA 1AZ1A 3SCWA 3OOQA 4MWAE 1B31A 1L6YA 2R94A 3QH2A 4IIGA 2E1WA 4ATLA 3APGA 2V5DA 3A3HA 5M3WA 3PG8A 2PZNA 4MTVA 2XFFA 1LT7A 3DI1A 4BK9A 4GUIA 1YXCA 4IGSA 4Y9NA 1UMYA 3ITXA 3W38A 4MOZA 1QXLA 2EAWA 3FS2A 1JQXA 2ZIDA 2YDAA 2AL2A 1JRCA 3MWCA 3FLUA 1M7OA 2Z27A 4HJWA 2VGBA 3LENA 1PKYA 3WMLA 1JQVA 2A0NA 1GVOA 1ZJIA 2Q3RA 1VPXA 1EHAA 3S42A 3NG3A 2ZA2A 4LQ1A 2WNWA 3LGGA 2I17A 4M3PA 3OP2A 1U2YA 4W88A 1Q45A 1KTNA 2FVKA 1XV8A 4XZWA 3AYRA 2XDFA 3TYBA 4RPPA 4AY8A 2WSRA 3GVVA 3WNPA 1EBHA 3TQPA 1A0DA 3PZVA 3VAVA 3I68A 2BTMA 4FOUA 1JPMA 1PIIA 2GVYA 2OYKA 2J8FA 1CX9A 1EJUC 2PWFA 4JDBA 4ZSTA 2WSYA 4X60A 1E9IA 2CZVA 3V5CA 1IIGA 3C61A 4ZOAA 1H50A 4TIMA 3WDJA 1GW1A 1S5NA 3SY5A 3W28A 4Q33A 4LB3A 5A6MA 1F74A 3TN3A 5D8WA 4HP5A 3A12A 4P7RA 5DEZA 3HA1A 5HWNA 3CL6A 2NVDA 1LLWA 1HQTA 3MYOA 2YCKX 1PHQA 2ZZ5A 1EP1A 2YCIX 2JK2A 4O53A 3WZ0E 4H9UA 4Y8FA 1MZRA 3CV2A 4JPGA 3LHTA 3W7LA 4RDVA 4QCEA 1RCOB 4AWSA 4XO6A 1XC4A 3PN8A 4DJFA 3MVTA 5JQ9A 3W71A 2FZMA 4CU8A 2RAGA 3JUGA 2XN0A 2VFDA 3AMCA 2Q8ZA 2B31A 1EO7A 4UTJA 4IP4A 2CITA 3PUDA 2WQDA 4E3TA 4GVFA 2QJMA 1ZJAA 3BLOA 1TV8A 4A8NA 1KM2A 5D2YA 2F61A 1HKIA 3MJMA 3OA5A 2QJHA 2YA2A 1R47A 1POKA 1YDOA 4M56A 2DUZA 3VGBA 1W8SA 5AHNA 4LUSA 4L1WA 4ZB0A 4RDWA 2DJXA 1ISXA 3B06A 3W1LA 4BHYA 3W85A 3NNTA 2OZ0A 3LMYA 3USBA 4CVWA 3F5JA 5DY3A 3ZXWA 2D20A 3KEHA 3UJRA 2OU4A 1IHIA 1V3MA 3N15A 2AKZA 4HU0A 2QDEA 4AVOA 3GK0A 2R1PA 3PZQA 2VEGA 1FUYA 2HMCA 4H6KA 2W27A 1VFHA 1PE1A 5HQLA 3WMBA 2OKTA 4RZ6A 4IX2A 1W1B1 3KLLA 5C0QA 4UOZA 4RLIA 3U48A 3W3OA 1CB7B 4IPLA 4WX2A 4A22A 3P2VA 4LRSA 3R25A 5CSUA 6PTDA 5HDRA 3QHOA 3W6LA 2JE8A 2CLKA 4MY1A 4JX5A 1T40A 2VX5A 2V63A 3NQDA 3QOKA 1HX0A 2VX7A 1FWIC 2JKAA 3L4TA 4O1CA 2HBXA 3VKJA 2BHYA 2Z7KA 4HCLA 3H2EA 1H2JA 4TVCA 4NUWA 3LGDA 4AD4A 3UW6A 3P0XA 3PB0A 3R13A 3KBSA 4ERGA 4GBDA 4BF9A 3OPSA 3ITGA 4R9OA 1UR9A 3U4AA 3UPBA 4XD3A 5BXSA 2B4GA 3AFBA 2QVNA 1R86A 1IQ8A 1OY0A 4OVXA 4G2DA 1DL3A 2WMKA 3W37A 1J6PA 3UR8A 3CL8A 3ABOA 1UUMA 1ITXA 3LUTA 3OG2A 5CPNA 4OTKA 3CPGA 4DZHA 2CHNA 1OVDA 3UXDA 3V7PA 1EYWA 3ZOAA 1P6WA 2DVUA 4PEKA 4FX6M 3CHDA 1ITCA 4DWSB 5LIYX 2PZ0A 5CJMA 5I00A 4DBUA 2VEPA 1MO0A 3E96A 5IHSA 3GNNA 2CLPA 1Q63A 3Q58A 1QNVA 3OODA 1DJGA 2XISA 3V35A 4I5RA 1RVGA 2ODOA 1T5AA 2YPIA 3WF3A 5JMUA 4IP5A 1SFSA 3I10A 2PGWA 1NOFA 1UW9A 4AD3A 2IUZA 1GNXA 4R7OA 5IBXA 2XFRA 1TPC1 5D2XA 3UCCA 1YEYA 8RUCA 2PRHA 1DBTA 5EB8A 1UD4A 2Y61A 2A21A 3IJ8A 3BSHA 1KM5A 4LUTB 4MDOA 4JIHA 4R85A 3SFWA 1XICA 5D4YA 3PWIA 1C92A 3W1RA 1JXKA 3ZT5A 3FK4A 1NQ6A 1Q3NA 3A23A 3L4YA 3ARWA 2GZXA 1HN1A 5CBBA 4AYGA 1HKVA 1R9ZA 5FJIA 4ML4A 1TR9A 1U1HA 3AWOA 1QPKA 5FEXA 3WNMA 1L6WA 5AN7A 5EU9A 3FA3A 2XH0A 5CPSA 4D71A 2PDHA 5F2GA 3PBYA 4UR9A 1Z44A 4DZ5A 3RIKA 3PSVA 2Z7GA 3DC0A 1ISVA 7ENLA 5I78A 4LEFA 4AIOA 4FXJA 3MY9A 1GG1A 3NJ3A 4L6HA 4NI3A 5E0FA 2HVNA 1UMLA 1QHOA 3SCRA 5CEWA 4E8CA 3I65A 1R3SA 3W01A 1B90A 3KOWA 1YW1A 1T0OA 1M5WA 4I9AA 3S1VA 3UVAA 1E6PA 3A22A 3LPOA 2VVNA 3RO6A 4RZ4A 4Z1YA 1ECQA 4UQBA 4POCA 1IEXA 1BSLA 1AJZA 3SEPA 3WMSA 1H60A 3ZMRA 5J8LA 4HZMA 3CT7A 2V30A 4N2YA 4QLJA 2ATSA 4X0NA 3WX7A 1XGZA 2P50A 1NJJA 1X6UA 2DGAA 4EXBA 2CWXA 1B4EA 4BQ5A 4PCNA 2KZHA 5C9ZA 5HQEA 1EYEA 6ALDA 3BXWA 2XGZA 4ZVJA 4Q8NA 4ATDA 4W8LA 1L2UA 1CXEA 1F4AA 3PZ9A 4H6RA 4DF2A 3UZWA 1V8EA 1OX4A 4RNFA 5TF0A 3TJXA 3PFRA 3TFCA 1TQXA 2RDXA 3H70A 4C6FA 4CQCA 2WJDA 2XUCA 1TJ0A 1WA3A 3KWXA 3M6YA 4NZ3A 3FSUA 3SCUA 3WH6A 1CBGA 5H8MA 1JUKA 4ENLA 4S3EA 4LYKA 4RKAA 2ZXAA 3H21A 3TZNA 3LM3A 4Z08A 4NX5A 3DHDA 4JDYA 3FY1A 5KZDA 5C9UA 1ZGDA 3L0NA 1RJPA 4BWLA 5D9PA 1DV7A 3WFZA 1K3UA 2W91A 3CHFA 4QTGA 1OJXA 1EOMA 2AL2B 3H4GA 5DXXA 2G3MA 1VFSA 4KEUA 4ORIA 3W00A 1PSCA 1ZNNA 1KXVA 4INFA 3RU8X 3GSMA 1UH3A 3NL2A 1VEPA 1W0MA 1XG4A 1BG4A 4PBGA 4QE1A 4AZHA 2O0TA 3T2PA 4UXDA 4S3BA 3QPZA 2H90A 5A8MA 4LCQA 4C60A 3TMLA 3VOGA 4GCXA 3ZLFA 3KCLA 3FGCA 2Q8LA 5E6ZA 3L7RA 2XGIA 2ZX6A 1X38A 3PUEA 4YTTA 5FCZA 2RDTA 4DHGA 3OBEA 1XD1A 2GWGA 1AW1A 2DZTA 4K7VA 5EMLA 1EP3A 1YNYA 2J7CA 4FLSA 3GVQA 4GUHA 5I23A 4O17A 4QS5A 2J9ZA 4UZSA 3DEQA 2ZRYA 3EA1A 2HXUA 4I7VA 4CD6A 3HO8A 2IW0A 3IARA 2V5LA 4QRNA 4AWEA 4I5UA 2ZUUA 4PUUA 1CXFA 2C71A 3NQMA 1QI0A 2HDJA 4XAGA 4LCRA 1MXDA 4PUMA 5D33A 4U31A 1WYIA 3RCYA 1KBIA 1I4NA 2BMBA 5A2AA 4U4MA 1SW3A 5LSMA 3GNXA 3NQGA 3HGOA 4QAIA 3TAOA 1YIXA 2ZRVA 4PBEA 1KC7A 2OG9A 2AMGA 3LI1A 3MU7A 2EG8A 3QF0A 1PUDA 3VMPA 1MW2A 1KFWA 4CNNA 4ONVA 2R8WA 5AHEA 1XX1A 3PSWA 4WEVX 3VX1A 2VR2A 4PMYA 4AX6A 4HCHA 4O0ZA 1JG9A 4C6KA 4DLMA 1R2TA 5DRCA 4LUSB 4JIEA 3VIPA 4IIDA 1CB2A 3KS5A 3H7VA 2INZA 3N4FA 3MP5A 4K8HA 4J3XA 4I9JA 2Y8UA 3L0KA 4CU6A 4UTWC 3ITCA 4GQ0A 3MSDA 4U3CA 2QGYA 4GY7A 3UCQA 3QN3A 5DF0A 4GX8A 3RN6A 3UWQA 4HJFA 1DQUA 5LIUX 2NUWA 4QG8A 1OG0A 1XL9A 4DJEC 4IGNA 1ESWA 3S83A 3A4AA 3VM7A 3R89A 2WC3A 5T9CE 3AHYA 3C8FA 4HPXA 2EPKX 3BZGA 1U1UA 3SIZA 1WXYA 1S5WA 3F4WA 1DJWA 4AHQA 1BSIA 5K3VA 4GI6A 2X7WA 3A9BA 4XUYA 5K9CA 3JRKA 3LOTA 2YYUA 3EEZA 1LP6A 3GIYA 1ZUAX 3DDMA 4Z1AA 2B7QA 3EWDA 3BMVA 3T08A 1JEZA 4JEJA 1MW1A 2J4GA 3BCFA 1NM9A 1CXHA 2CZDA 3PVFA 2C14A 1HG3A 3LDVA 2AGTA 1QPNA 3FOKA 3L4XA 2ACRA 2QGHA 1TPH1 4LBSA 1OT1A 1DEDA 4TOQA 3XIMA 1LBMA 1IR2A 1QHPA 1OZMA 2NQJA 3FW6A 3VNIA 4JIIX 4UQEA 3WCZA 2CW6A 4GGBA 3URBA 3R8HA 3FVMA 3GDKA 3GNRA 4EKJA 4EPBC 1OFBA 4DWSC 4B9YA 3VNYA 2OOGA 1RAKA 4PB5A 5FF4A 2PDNA 2AOSA 1OK4A 1MRQA 2WNZA 3W76A 3PNZA 4TVUA 4EIVA 1E6QM 2GDUA 1XH1A 4M6VA 1L0PA 3LRLA 2D0HA 4IPJA 4WKAA 4QR6A 5CGTA 2QPXA 4F3HA 4HPNA 3CASA 2A6LA 1QI4A 4B5VA 3LZ5A 1JZ4A 1MEIA 1P48A 5TNVA 1IEWA 4DM2A 1E1EA 3ITOA 2W6RA 1TREA 2VRJA 1MSSA 4Z1DA 4Q8OA 1KLYA 4F66A 4LV9A 4BY3A 1LG2A 1J0YA 4RNHA 1SSGA 2ICSA 4UCFA 4TTGA 4H9MA 3V18A 3BLEA 3YPIA 4OHQA 1AMYA 5I3FA 2YLLA 1OF8A 2W63A 1FDJA 1EPVA 4CU7A 4JYDA 4GJIA 2PDKA 3GDLA 4FS9A 1RP8A 2ONEA 2PLMA 2D2HA 1M7XA 2Y4SA 4RNIA 2VC7A 2CETA 4GK8A 1NY1A 1W54A 4ES4A 3TSBA 3UPMA 3ZT6A 1OD8A 4R53A 2QV4A 2WCAA 5F4WA 1W32A 4MWAA 2ZDRA 4L1GA 4M1RA 1EWDA 1UHVA 3V0TA 1DWFM 2XM2A 2QLYA 2ZXQA 3AJXA 3UG3A 1UD2A 2Z24A 2JFEX 3URQA 3Q94A 4Q4OA 2O4QA 3WH9A 3R0UA 3LXBA 1QNRA 1EF2A 1RBOB 4MLRA 1VRXA 1S39A 3VC5A 1JPDX 4YPJA 1W9XA 4MNLA 3GH5A 4UTTA 4Y9PA 3W84A 1HP4A 1UKTA 3T0CA 4H19A 1W8GA 4W93A 3LYEA 1EGMA 4I5XA 3VABA 3N19B 3DKJA 4OU1A 4Z0JA 4HB7A 5I0DA 2HE5A 4XZLX 4O10A 2C91A 4PB3A 2PCQA 5AZ0A 1EIBA 4PSRA 1H4PA 5ECUA 3DU0A 1V6TA 1MMFA 3O15A 3ANYA 3QMRA 3BVJA 3WLQA 4QCFA 3EWYA 1YTKA 3FDKA 2PDIA 3EPOA 3TYAA 4HK7A 3PS7A 4Z2LA 1UD6A 3L65A 4LC6A 3QHMA 3CHEA 1OGBA 1F76A 4B90A 1PZ2A 2Y7FA 3W7IA 3ARUA 1GORA 4JX4A 4GD0A 4WOZA 2QJIA 2DT2A 2E09A 2BY3A 1YRRA 3M0HA 3ANVA 1XJBA 2BFGA 3GC4A 1KM0A 4ZTYA 8TIMA 4CNSA 4D8AA 4ZE5A 3ABQA 4WY0A 3MANA 2DQWA 1Q6CA 2YXOA 1B0IA 3M07A 3E9AA 5HUOA 3TXVA 4W7WA 3ABRA 3ARZA 4HOZA 4IM4A 2ISFA 5CSSA 2VCCA 1K4HA 5IXEA 1UQYA 3FA4A 5BWFA 1OX4B 1CGYA 4B9ZA 4PMJA 5M2FX 3M0XA 4J2PA 5EPDA 3OA3A 1UWTA 3CQIA 4B3LA 4AD5A 3KP1A 1IZCA 2QCHA 2YKKA 2UY3A 2Z2BA 4UQAA 4JQAA 1G94A 4NRSA 3RILA 3B0VC 3NO5A 1HKWA 3MVIA 3T8LA 1AMKA 4E38A 4JTIA 3CQJA 4KS0A 1X6NA 3WJSA 4MB4A 2HK0A 1TV5A 4ZEPA 1KWGA 2PD5A 1AD1A 2IQDA 1CT5A 1WZKA 3VD4A 4PRTA 1UJQA 5KITA 3E5PA 3M0VA 4ACYA 1UQZA 2BODX 4HA1A 7TAAA 4U5KA 1QOXA 3F4CA 4K7YA 3HV9A 2EG6A 3DI0A 4WXYA 2QZRA 3KL0A 1H0GA 3G5EA 2TRSA 4HSHA 4FEZA 4JICA 1HL9A 4IL0A 3WLPA 4GFIA 4MY8A 5AYXA 3WQVA 4Y7EA 2VC9A 3S2MA 5F1VA 4RPQA 4S2BA 1WDWA 4AF0A 3NQVA 3VVGA 3T2QA 1QAPA 3SUWA 2XSXA 2WZEA 3FGCB 1F3WA 4FI4A 1VYPX 4NZ1A 5H91A 2VELA 4E4UA 5XIMA 4GY1A 2FKPA 1V93A 3S2LA 1GEQA 1UOKA 2QAFA 4CD8A 5EBUA 4UTMA 2CBVA 3PBVA 4J5NA 2V2CA 4XSLA 4HHPA 1J93A 3K1DA 1EQPA 4M80A 1RXOB 1K9TA 1ZTVA 2OGYA 1P4CA 2CNCA 5DT5A 5HNNA 4HGXA 4PUDA 4S23A 3V3WA 1GQLA 1JF5A 3EX6A 2OZ3A 2CLMA 3LSCA 1US3A 3K13A 4AU0A 2PMQA 1R3RA 3GY1A 2WCSA 2C0AA 3PNUA 3S1XA 3HTWA 1EB3A 3DC8A 5G2HA 1XLEA 3MUXA 2FHBA 3VCNA 4F0RA 4GO9A 3CNYA 4WF7A 4EAYA 5EMKA 3S5SA 2VEIA 1P7TA 1T8XA 2HEJA 3IV3A 1H3GA 4ALDA 5G5IA 5HK4A 1ZS2A 4V28A 4BI6A 4UCGA 3JS3A 3VILA 2PC8A 3IAQA 4Y9OA 4DUWA 4HK5A 2GJPA 4I9TA 1F8MA 2DT1A 1W9PA 4D6EA 7ODCA 2B7OA 4EP8C 5GNZA 3LD5A 4PRRA 4LOCA 3H7UA 1NIUA 3IIZA 4AZ5A 3HMJG 3GYCA 2Z29A 2ZTKA 3G1RA 1RD6A 3OQEA 4FOJA 1J9YA 3F4NA 1X7IA 4Q32A 5CH9A 1J18A 3PP7A 3UA4A 1I6NA 1AQMA 4Q7NA 4A3HA 2PUZA 3AICA 4G56A 5BRBA 2FB3A 3S2NA 3NA8A 1WX0A 5B7ZA 2NV9A 3DYOA 1GOXA 5CG0A 1V77A 1ENUA 3SQLA 3IVUA 3R0KA 3T0AA 3SCOA 2CFFA 5HATA 2E1DA 1BTCA 3VGDA 3C0JA 1QPRA 3TZFA 3GG0A 5A6BD 2BY2A 2W61A 2JKPA 5LHEA 5ABHA 1UWQA 3SR7A 1CTNA 4B91A 3NPXA 4ZO6A 2FZDA 2IPJA 5AC5A 3H53A 4KGJA 1O1ZA 3CEUA 4GG9A 1LT8A 1E4NA 1WXZA 5I3HA 2V69A 3O0FA 2A6NA 2HS8A 1U83A 3GAYA 2RDWA 4I8DA 5C7VA 3CB8A 2VOTA 1ELSA 3WBAA 1NWRA 1VS1A 3UJSA 1EUAA 3CHVA 5C9RA 3CUJA 4PODA 1W5PA 1J0IA 3UXIA 2FGLA 1KKRA 4LXFA 3AMKA 2J13A 1EJ7L 1B3YA 2D2OA 2HTMA 5E0CA 1B9BA 1R3TA 3WD1A 4LRTA 1N8WA 2NUXA 1XIHA 4QJ1A 4UOQA 2C19A 2DW6A 1TMLA 2XN2A 3UA3A 4KEZA 1TV2A 3UFYA 2W92A 3WK1A 2WJZA 4RK8A 4UZUA 2QEZA 4W5ZA 2DSVA 1FHUA 3NSNA 3AS3A 1V6WA 3W6YA 2YL8A 1XFCA 1NWUA 3QTGA 1VYRA 4IQEA 3MCMA 4NZ4A 4DRSA 1FWJC 1Q5MA 4GYJA 3L66A 1YXYA 3GO2A 1Q4WA 3OLDA 1TIMA 3N3TA 4ZL1A 3KVJA 2ZVIA 3W7MA 3BOLA 2V5BA 2G97A 3QBUA 4KQNA 3V16A 2OWXA 3CQHA 4IMGA 4IH3A 1D8WA 3B3DA 4PTNA 1PJ9A 3WG6A 2RUSA 4JQ1A 1VBUA 4QLLA 2JGYA 1VPQA 3MKVA 1WBHA 1DJZA 3DYMA 4RL3A 3U9IA 2XH2A 2DW7A 5BNKA 1ITQA 4DJDD 3S8HA 5CC5A 1A5KC 4V33A 4DNHA 1S2AA 4FA3A 5H1WA 2F7FA 1ISZA 2CXEA 1OC5A 5IBXC 3GXNA 1XKYA 5GNYA 1M01A 4NKCA 1EC7A 4RDYA 3UZ5A 4WR3A 4L9YA 1O66A 3PC0A 3BARA 4MZYA 1RJRA 4ICMA 3WELA 4IFKA 2PA6A 1WE5A 1JPKA 1EDGA 5DXYA 5G1TA 1OGSA 3SADA 1YNQA 2X0YA 5CLTA 4WCJA 3W7KA 1Q8JA 3GZAA 4GMEA 3R58A 1Z48A 2P5NA 3QSTA 4D6CA 1V4YA 4YTQA 3C0SA 3KWSA 4GQRA 3JZUA 3W7RA 2BASA 3IJDA 3CMGA 4MWAB 4FAMA 1W1A1 4DI8A 4DZAA 2VZOA 1XH2A 3A5VA 2UV8G 4EK7A 5HMSA 3ZFHA 3PWAA 5LKYA 1KBKA 3M47A 5FESA 3DFSA 3HU7A 3RGTA 3E5BA 4NI8A 1F4HA 2DZAA 4O14A 3TNBA 4UTHA 4PMOA 4NF7A 3HGJA 4C7GA 2QJNA 1GVRA 5U4NA 5FKYA 1IV8A 2E67A 2OSYA 3SRDA 5E5CA 1TUFA 2YW3A 4JN6A 1LL7A 1H7PA 1DXFA 4CNPA 3QYQA 3L0GA 4JTLA 1P6CA 2PU0A 3RJXA 1W9UA 2RDUA 2NXHA 2WANA 4IFOA 5B80A 4MJZA 3SN0A 1FWDC 2YW4A 3UXKA 3NPWA 3KCJA 3FYPA 4M7SA 3OVQA 3WLSA 4UQDA 4PUNA 2NSXA 4E0CA 1GQKA 3EOOA 4KERA 5LXEA 3AZSA 1LTDA 4PSPA 1LDCA 3W53A 5EMJA 1DWIM 1NELA 3LX9A 2NW0A 1I2PA 3DN5A 2G96A 1BYCA 1YKWA 2PTXA 3T0TA 1GYLA 2YZRA 4GYFA 4ZENA 3TSDA 3PK7A 4YTUA 3AIUA 4LVBA 1W5MA 1IT7A 1SFLA 4UR7A 1JPIA 3M9YA 3USZA 3P7YA 4AMCA 4ICCX 3DFQA 4WY0B 4D6DA 4YIWA 4B5XA 1W17A 3G18A 1UUQA 1RR2A 3ZSTA 3IEBA 5DANA 1BVWA 1CGUA 2P3ZA 3VKKA 3MHFA 1P0NA 5I3IA 1M1BA 2Z25A 4P7OA 1WPCA 3AAMA 2J9YA 2ZCGA 3W1UA 1KB3A 4F8XA 1NP2A 2ZUNA 1JGMA 1VF8A 5SWUA 3NZRA 4HSOA 2PDJA 1IYXA 1SQ7A 4OBTA 3GFXA 4W89A 2QCMA 3HMCA 1O12A 4HA0A 4HNVA 3CUZA 1U5HA 3HOJA 1TMHA 5HAOA 5HMFA 2ZX8A 3HGSA 2E5CA 3SCQA 1X98A 2YXXA 4P8WA 2F6KA 1TTJA 4NG3A 4PB4A 3VDGA 3PTDA 4WLCA 5C2CA 3E74A 3LCGA 2DIEA 4BS0A 5BWAA 4LB4A 4PUWA 2R14A 1DWAM 1EKOA 4GABA 3POHA 4NJJA 1X96A 2WLZA 1R87A 3EDEA 4IUOA 3E0LA 3KRBA 3UY7A 3M64A 4O16A 2GQAA 2F6XA 5FIPA 1I2QA 3LCLA 1IGWA 1D3CA 2I9EA 2JIEA 3DXIA 3RXZA 3LNMA 2DFAA 1RQEA 1LRQA 4J35A 4WJ8A 1CYGA 4JTKA 4ROQA 1KLZA 3QV6A 4UWMA 4AF0B 2DZWA 2JBMA 4Q8MA 4H9YA 1JUEA 1TTQA 4OOUA 4XTIA 1TX0A 2Y70A 3U57A 1TWZA 2H6RA 2W9MA 2YDRA 1EJWC 1AL8A 5KSWA 1J79A 1AJ0A 3H55A 3SIMA 3WD3A 3IGXA 4NX0A 5CGMA 3C56A 3E2QA 1C9DA 2VEMA 4LW7A 3PM6A 3AS2A 5JU6A 2EF9A 2VJXA 2VX4A 3A24A 4LS2A 4FPSA 3NQBA 3SFKA 3UEQA 4O4VA 3DCPA 2X0HA 2C16A 4W86A 2GUBA 4O8AA 4QAWA 4M51A 2TSYA 2VQTA 1I75A 3VIFA 3K1GA 3IGHX 3OQ8A 4J3ZA 2EPNA 4LYQA 4WHBA 2MNRA 1P7TB 5ABGA 3GH7A 5D8ZA 1WZMA 2HZGA 1OM0A 4Q4QA 1EHNA 4K38A 2X40A 1ZP4A 4JTCA 2FDSA 1EPXA 3B8DA 3W7GA 4UFLA 3DGRA 2ASHA 4JY9A 3B8VA 4AX7A 1ZCCA 2NV1A 1I1XA 2G95A 5K9XA 1UWSA 4JYEA 3GR8A 4AQLA 2FJKA 4LH8A 1Y7VA 2XG9A 1VB9A 1Z6KA 3MHGA 4BJHA 3WFAA 3CLMA 4QDPA 1E4LA 3V5OA 4GUJA 3VIJA 3MMWA 3WUFA 5A6AA 4S3AA 3SUUA 4GUFA 2EJ1A 1GTEA 3NL5A 1E0VA 2YL5A 4ZFMA 4GNJA 1RQHA 4FNRA 1XR2A 2VTFA 3ZQ9A 2LLEA 4GBUA 3L68A 4X2PA 1OCJA 2E68A 2DVXA 4FX8A 1LL4A 1JZ6A 4MZ8A 4B4HA 4IXXA 3DFNA 1OIFA 2G5WA 2CBJA 3UY8A 1GVIA 3HM7A 3UR5A 1QOQA 3VOIA 2OT0A 3AUOA 1R6WA 1QK2A 3B0UX 3ZS4A 4JXCA 3STPA 4J4KA 3MSGA 2X09A 3NXFA 4WSHA 2CBUA 1JYNA 5EBAA 1GHRA 3TCEA 2EQDA 1FCBA 4P7QA 1TPFA 4C7FA 2XIJA 1XYFA 1VENA 2VDGA 4ZQNA 3BW3A 4N4PA 4E4PA 3SCSA 2PP0A 4JNMA 4A3QA 1XSIA 1QOPA 4FNUA 3FJ4A 1DTUA 3N1AA 3W2NA 4PA8A 3IRSA 3C2EA 4Y6GA 4ZQCA 3TTSA 2Y7EA 4G5DA 3GYEA 4QDMA 4GX9A 4QEEA 4UTLA 4ZQRA 4ZO9A 2GUUA 1PTGA 3QGAC 2ANUA 3NVDA 4MNKA 5CBJA 4R3UA 3ZIZA 3NR0A 1H11A 3LLFA 5D05A 3OVGA 4YTRA 1AW2A 2B7NA 2X41A 4GC4A 4AZ7A 3HFYA 1QI5A 2P0OA 2Z28A 3WL1A 4MYXA 1NFBA 1OD0A 1ML1A 1EEXA 1G69A 3PZNA 3N12A 2E9MA 3T6CA 2WV8A 1KV8A 4RXFA 4BF7A 2GQ3A 4HA4A 2Y62A 3OLGA 1D8CA 1GOOA 2GJXA 3NDOA 3ES8A 4N7QA 2ZRWA 1R85A 4HBKA 3P81A 1XIEA 3G1AA 3WDIA 3UNTA 3H24A 4HTYA 4EVZA 2Z2AA 3WQOA 3PBUA 4FXFA 3PAOA 2BLEA 4GJJA 1YDYA 1UWUA 2ZKMX 3A3WA 3FSTA 4GHRA 5D03A 1G4TA 3CHCA 1GW9A 1WKEA 4TX9A 4ZCWA 1XLMA 1F7BA 1AUSL 1OINA 2TMDA 1FKXA 3AZTA 3N2XA 1FTXA 2OEMA 2E9LA 1JGIA 1FBAA 3CZ8A 5CLWA 4HT3A 4JIPA 4YHEA 2D24A 3OZMA 2VRKA 4MLJA 4RNJA 1BFNA 4MWAC 4IFKB 3CQ0A 1TE1A 5A1AA 1EH9A 1A5MC 5D9NA 2WC4A 1XLCA 3B9EA 1UYQA 3BK0A 1FWAC 1M03A 2YCJA 2Z2UA 3R4IA 1UROA 3QV9A 1JZ2A 2GVGA 2J7FA 2A7NA 5BYWA 2KX9A 2CKSA 1XUZA 4L4MA 2OPJA 4FF7A 6A3HA 4JFSA 5FA5A 1F3EA 1A5UA 3T8QA 4AIBA 4US5A 3HV8A 1WOAA 2OT1A 1UH2A 2QKFA 1TQJA 1EWEA 1QWGA 4HHMA 2QAPA 3DERA 4QG6A 4UQ9A 3VIGA 3CV1A 1OX6A 5I6SA 1KM4A 2OOFA 2PDBA 3EX2A 3R8RA 4KCTA 1CLKA 5GVJA 3RM9A 4IQDA 4A8IA 1PWMA 3TP4A 1RY8A 1MZHA 1C3FA 3BCDA 3W24A 2YZ5A 5JIPA 3AMLA 1X1OA 2EKGA 2PGFA 2NX3A 3PBWA 3IJ7A 5D09A 1QNPA 1F07A 1JR1A 3LHUA 2ALDA 3LEPA 3SCPA 3R8GA 4YN5A 3MDWA 1WP6A 1ZALA 3LLXA 5CBIA 1WAWA 3ONBA 5I24A 3SGGA 3URAA 1TV3A 3LHVA 3NSXA 4KW2A 3FJNA 3WLOA 3AALA 3UCDA 2YYTA 1OABA 3PJUA 3P8IA 1UBPC 3ZSSA 2UY4A 5MF5A 3OYZA 2WAGA 2ZA3A 5A8QA 1HL8A 1Q13A 3ZO9A 3WENA 4UMBA 5L9FA 3QLDA 1B3WA 1KFJA 2NVCA 3CH9A 4Q8WA 3S6OA 1YDVA 4IPPA 1UWAA 3LHZA 3S0CA 2Q6ZA 1QI2A 1TWSA 2NVAA 3HPZA 4U5IA 2CLEA 3LS9A 2A3EA 1FHLA 4CEUC 4L9XA 2EO7A 3K30A 1B2YA 2WMHA 1ZL1A 4GZIA 2PWVA 3IANA 1ZAHA 3WMCA 1K7XA 1GEHA 1E51A 4HNTA 2DU2A 5FEWA 3W26A 2VRQA 4JN7A 1VBRA 3NO1A 4J3SA 3NQCA 4GINA 5J5DA 1FH8A 1JDEA 5XINA 1JL8A 2QF7A 3QXBA 2J8TA 1UWIA 3M0ZA 3C6CA 3E0WA 4RV8A 3CS2A 3EA3A 1ZBCA 8XIAA 1OB0A 1PKNA 3HG2A 3HFTA 2Y1HA 4H01A 1VP5A 4G7EA 4IL2A 1HXJA 3GDBA 3VDAA 4WVXA 2Z1VA 2V81A 4CKQA 3CM4A 3M44A 3THQA 3QRHA 3UXAA 1SMAA 4G8TA 1DE6A 2REQA 1X7FA 3WDHA 5CCZA 2VGIA 3EDKA 3WSUA 3STFA 2WK2A 3ARQA 3MCOA 3OGRA 3W7HA 1PKMA 4DPQA 1RZMA 3M16A 1AA1B 1PTAA 1LF1A 4QSHA 5AY7A 4LVFA 3G1SA 1C8XA 1KFCA 1HGYA 1V51A 3BL3A 3H4WA 3N13A 2NZLA 3ZM8A 3S5OA 3SY1A 3QW3A 5CSRA 2X7VA 5EFDA 1K8ZA 5E1QA 4B2DA 3DGBA 1HJQA 2PLCA 3C2YA 4C6PA 3EWXA 4MFDA 3SB0A 5DY2A 1QWKA 2XGBA 1P1MA 3LCXA 4CD7A 4FIRA 1P0BA 1HUVA 3ZR5A 2P1FA 3I4KA 1B54A 1HF6A 2ADAA 5I3DA 2GSEA 3QC3A 1VEMA 5DX7A 2GSHA 3NEHA 4PMZA 3VGGA 3B0XA 2DT0A 5A5WA 4NRRA 4EXQA 1XCXA 1SM9A 1J4EA 1EOKA 3PTQA 3GXTA 3KTXA 3O16A 4U2ZA 2QMKA 3LG3A 1UCWA 3HBLA 2GPTA 4JHOA 2D69A 2D22A 3G8RA 1R5YA 2NUYA 3TXZA 3CBWA 5PTDA 1JD7A 4GO8A 1SPQA 2IPFA 1H62A 4XTDA 1I2RA 4UFHA 1GPWA 1N82A 3TW6A 1BLIA 1O5RA 2C15A 3QFEA 1AFSA 4KWWA 1FVPA 4Q22A 4JTQA 5D2VA 5CC6A 3SY8A 4CNTA 1VBHA 2WKJA 4DXXA 1Z3NA 4DBDA 4C91A 3E0FA 3BLIA 4PBFA 1NU5A 3VTRA 1QDSA 3KTSA 2AKMA 4YLWA 1UP3A 3R1ZA 1SJDA 5H2ZA 3THDA 2XIBA 4JQ4A 1H61A 4LFYA 3GUWA 1AJ2A 4CQDA 3MWAA 3NZPA 3RAOA 2VO5A 3QYSA 4KCWA 1EL3A 2VKZG 1MEHA 4PZVA 4FALA 2FFCA 2YL6A 2A3AA 2OR2A 4GYPC 3WF0A 4FNTA 4LX4A 4YHGA 3SO7A 1L9WA 3LTPA 1A49A 3IUDA 2C1GA 4PR4A 3T44A 2YXGA 8CGTA 3P80A 3EXTA 2AGKA 3NSMA 1VZWA 3NL3A 4W8BA 4K3ZA 5ECVA 3FEQA 3LQGA 4J3VA 5FF2A 3OGVA 4KF1A 1EJRC 3VNJA 3VU2A 4JTUA 3WNNA 4D8LA 2ZUWA 1UA7A 4LWWA 3QZEA 3ABZA 4FO4A 5M1TA 2VZVA 1QW7A 3ARYA 4UFMA 3MHUA 2WWDA 1G5AA 2FZBA 4DO6A 1JYVA 1C7SA 1ZBWA 4MDPA 3ES7A 1ZY9A 4ZQMA 5C9WA 1S1RA 5D32A 1RLDA 5K4ZA 3MMTA 4K8EA 1THFD 4UNIA 3PUGA 3JR2A 4Z17A 4J1OA 3TJ4A 4IQLA 3E0IA 3M0JA 2PDMA 1V3JA 2QCFA 3CC1A 2H8XA 3VINA 1VC4A 1QNOA 5GNXA 1DJNA 3O8AA 2INFA 5I7GA 3GH4A 3C4UA 3TTEA 3IJLA 4S3FA 3HQ1A 3B0PA 4GI9A 1FA2A 3UERA 1S3TC 4AAJA 4H9XA 3UESA 3W75A 2DDXA 2IMRA 1XBXA 3J7HA 3T1GA 3B40A 3ELFA 1S2WA 1BF6A 3QY8A 4AZCA 5KETA 4Q8VA 4DZIA 1XLIA 3GLCA 4GVIA 3MUZ1 1UZ1A 1C8YA 3GS6A 4QQUA 1JYWA 5IHRA 1YE6A 1XCWA 3UGRA 3TU9A 4N6FA 3VDBA 3XINA 5LIKX 3ERPA 4AVFA 2P10A 3OTRA 4QSFA 3U3HA 1AG1O 3MCNA 3W7QA 2GJXB 1XW8A 2G3JA 1F05A 3QZAA 3E38A 3G0UA 5DMLA 5EA9A 1TRDA 1O5XA 4OWGA 3A9IA 5TD4A 3ARTA 1JDCA 2H3BA 2FMOA 3A21A 5C5YA 4GNVA 1NTHA 4U3AA 4FR1A 3H2FA 2I5GA 1W31A 3D3FA 1VCFA 2FHFA 4HIBA 1KXQA 4JIQA