1KFEA

Crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with l-ser bound to the beta site
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
268
structure length
252
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the Role of AlphaTHR183 in the Allosteric Regulation and Catalytic Mechanism of Tryptophan Synthase
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 96
structure length 252
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfeA00
2J88A 3G1VA 1VC4A 2Y70A 3MW7A 4BI5A 4E2DA 4UMAA 4P2VA 1JRCA 2FDSA 4I9AA 3JRKA 5A8GA 3I6RA 3B8DA 4WJEA 2DZVA 3WK3A 3C2FA 3HO8A 4UR7A 3CWNA 1ME7A 4IMEA 5D03A 4O19A 4UTIA 5AOUA 4UFIA 1H7OA 3G24A 2TPSA 3W1TA 5L9FA 1ZALA 1DORA 3NZ1A 1H60A 3LTSA 3CIXA 3W7PA 3MJYA 4JTTA 2FPTA 1QOQA 5LNVA 2NX1A 2YZRA 1D3GA 1DQXA 3DENA 2VEIA 4NVTA 3ABSA 4AMAA 1A53A 1NF7A 2QCMA 3G1HA 3H53A 3EX6A 4FB7A 3W2KA 3W74A 3R89A 4CNPA 1QNVA 1RV8A 3LXCA 1JCJA 2GQ8A 4S2CA 1XBVA 5LKYA 1YXDA 4UTLA 3SFKA 2BTMA 3E9AA 2DZSA 4PFMA 1WX0A 1T96A 3TUUA 4GUFA 3IIXA 3W7IA 3INPA 3P60A 3IIOA 4JY9A 1I4NA 1VCGA 2NXGA 3VE7A 5G2HA 2H6RA 1C29A 3DFSA 3H55A 3G8RA 4DEFA 4O1AA 4N6EA 3TC7A 2YGYA 3NQ2A 4BI6A 2QCFA 3THQA 4NNAA 4MJMA 3LLFA 2VFFA 3W7KA 2OZ0A 1EX5A 1TTPA 4JIQA 4NZJA 1TJRA 4A21A 1FWRA 2FB3A 1W5QA 1QFEA 1JUEA 1Y0EA 5C55A 3B0VC 1FBAA 5HUPA 5DN1A 1K8XA 3TW6A 2QDGA 2QKFA 2VXNA 1G7VA 2CZEA 1VHCA 4I7UA 1L9WA 1ZAJA 3MHFA 2ZTKA 3PULA 1RZMA 4LVAA 4O1BA 2I14A 1A5AA 3CEUA 4LWWA 4QJ1A 3UPWA 3DXIA 1LRTA 1FX6A 2A5HA 2Q8LA 2EHHA 2GJLA 1EWDA 1ME9A 4R7JA 3O05A 4R33A 1DBTA 2O7SA 5FEWA 1U5JA 5DCDA 1F73A 2PRHA 1H7RA 4Z0JA 1LROA 3W6YA 3THAA 1QPQA 3NO5A 1PL9A 4QAIA 1VHNA 2EAWA 3DGRA 2WSRA 3W23A 4IGHA 4JIPA 3LTYA 1ICSA 1GTHA 4J9JA 3R2GA 5K4XA 4TMBA 3P74A 4WY0F 2ABBA 2YPIA 4FO4A 4CCEA 2QUTA 3LV6A 5F4SA 3O07A 2R94A 4UTWC 3C3NA 1LOQA 1WOBA 3BV4A 2YX0A 4TO8A 2OT0A 1XL9A 3LRMA 3DFTA 5CKSA 3WFAA 2PRLA 1XI3A 1S5TA 1G67A 1HG3A 1LP6A 3LTPA 5TBOA 4JYFA 2V8ZA 5G1TA 3LHVA 1GZGA 2B4GA 1LM1A 5GVJA 2GOUA 3WJZA 2FPYA 2BWGA 1JUKA 1LRQA 1U83A 4LS2A 3LX9A 3KXQA 1GYNA 2R91A 3L5MA 3O6YX 5D32A 3TAKA 5AHFA 3UWUA 3NQVA 4K36A 4M19A 4P61A 3UXAA 3C52A 4O18A 3C2VA 4DXVA 3K30A 1R2TA 4Y90A 4O53A 1TPDA 4AB4A 1UUMA 2WNNA 3KX6A 4O10A 4AF0A 5G2WA 4GXMA 1PHQA 5FF3A 3G3MA 3STEA 1UASA 2QCNA 2JGYA 5D2WA 1ZENA 1S3HA 2GVGA 2HS8A 3S5YA 1PVNA 3W1QA 3S42A 3N2XA 1AG1O 1LLWA 4NJIA 3W7LA 3C2EA 4JN6A 3NPVA 3FLUA 1B4EA 3DZ1A 2RH9A 1JQVA 2ABAA 3IIPA 3PB0A 4M6QA 3P67A 3R12A 3LB0A 4MY9A 3STGA 3UXDA 3HMJG 3TCEA 5LNSA 4ZZ9A 1MEIA 3W7HA 3SI9A 1JCMP 2ZZ5A 4K7YA 4N4QA 1VRDA 3EWXA 1OYCA 5K7JA 3QMRA 2CLFA 3OVPA 4X2RA 4CQ9A 1HO1A 3B04A 1M6JA 3FKRA 4A2SA 2G95A 1WA3A 3LCGA 4ADTA 4R34A 4LRSA 1JUBA 3M47A 3N9RA 3PS7A 1X6UA 5AFDA 3SIZA 1THFD 3T55A 3S8HA 1TPH1 4YCOA 4Q32A 1N8FA 3GDKA 3USBA 2H8ZA 3M1ZA 1SZNA 5LZLA 2FIQA 4UFHA 1AL7A 1TRIA 1OG0A 1KW1A 2QUUA 3QYQA 4AH7A 2TRSA 3FA5A 1JCYA 3B4UA 3BLEA 1XC4A 2CZ5A 3IVSA 1JJKA 3IGSA 1W8SA 1NVMA 1KFKA 3TJLA 2FB2A 3IIZA 3S9YA 4Q4KA 5ABTA 4LW7A 5CZSA 5D2TA 3M43A 4UFLA 4N02A 3W22A 4QIUA 7TIMA 2Q3RA 1W5OA 3EB2A 5DY2A 2ATMA 5CZ0A 3KRUA 2ZA2A 1JRBA 3YPIA 5HWNA 3C2RA 1M5WA 1LYXA 4N6FA 4Z0SA 2YR1A 5I3IA 4M7TA 3LCIA 1XBZA 1MO0A 3LGEA 1UJPA 1ZHAA 3PUEA 4NNBA 5EKYA 1SPQA 3R13A 4JTUA 3LXAA 1TPC1 3CQ0A 4IPJA 4MY1A 2Q3OA 4O0KA 1SO4A 3NG3A 3M0ZA 4GWEA 3S5ZA 1L6SA 4LT9A 4KKXA 5DY3A 5K2ZA 3G8EA 3PBWA 4FNRA 4OE7A 2VOMA 3ABQA 4O12A 3L0NA 3N34A 4FIQA 3W7RA 2E6YA 3TC6A 2I9EA 4OGZA 1FCVA 5D09A 2YW3A 4NX5A 4TX9A 4IMGA 1W3TA 1OX4B 4LUJA 2Y85A 4DO6A 2ZA3A 3P8IA 3A5FA 4D2JA 4GUJA 1XDLA 4K39A 1NF0A 4UTTA 5BW6A 4XQ6A 1G4TA 1T0OA 1RQEA 2BZNA 4CQAA 2HMCA 4M5PA 5BNKA 5D02A 3W7JA 3NQCA 1YPIA 3HG3A 1SFLA 3W2JA 4HT3A 1UUOA 2A6LA 1H5YA 2GVJA 2BLEA 1C8VA 2TSYA 1J4EA 4BI7A 2X1TA 2X1UA 2CLLA 4S1FA 3A5VA 4XBKA 4JTGA 2GPTA 3L5LA 3SSJA 3T7VA 5IBXC 4MOZA 1WYIA 4YXGA 3HGOA 1EP2A 2C18A 2ZYFA 1YDVA 2Y88A 3GB6A 2A7RA 2QCCA 3GK0A 4DELA 1M7OA 1OFBA 3BARA 3LM7A 3KVLA 4M6PA 3CTLA 3EXTA 1DVJA 1WBJA 3W86A 2ZRYA 3P8JA 3VNDA 4LS0A 1X7FA 3ZS4A 2ISVA 2JBMA 1YDOA 3Q2DA 2JK2A 5G2IA 1F6KA 4UTJA 1Q6QA 2V5LA 3PG9A 4Y96A 1KM3A 4WOZA 1IXNA 1AMKA 4ZVJA 4MFDA 4QNEA 3SY5A 3C2OA 1YLVA 5EPDA 1AW1A 1I8JA 3O6CA 3UWZA 1KM1A 3O15A 1YXCA 3T78A 3CIWA 4M6VA 5HWMA 4O52A 3GXTA 3P7YA 3Q94A 1Z44A 3TDFA 5DCBA 5EY5A 3C0JA 2B7PA 3L0GA 3PUOA 2AAMA 4LC6A 1DOSA 1H61A 2J9YA 3RU6A 2V2HA 5D04C 2Z2UA 1A5SA 3CU2A 3TQ0A 3O6DA 3BO9A 3KHJA 4K8HA 4ADUA 4NU7A 2NWRA 4ZQMA 2VKZG 3W85A 1TPEA 4FXRA 3EWYA 4JGDA 1ZFJA 5D2XA 1GVSA 2A1YA 1OF6A 2DJXA 3W1AA 5G1YA 2V2CA 1Z41A 1F6PA 3EX4A 1UBSA 3NQGA 4BK9A 1TPUA 1EPXA 1KM2A 5E93A 1VYSX 3W7DA 4HN4A 1ZNNA 5AHMA 1FWNA 2WKJA 4N9CA 3LI1A 5KZEA 2EF9A 3NQFA 3L68A 4NNCA 3CT7A 4CCCA 2P1FA 3N73A 2V0TA 4A22A 4EIVA 3GLCA 4HNNA 3L66A 1O95A 3NL2A 3QEZA 3PB2A 5F1VA 1GVQA 3WJWA 2WNQA 4MLJA 2ZDRA 1SW0A 2FLIA 3MI3A 4O15A 3SGUA 3E0IA 2CLEA 2ZFAA 3OEXA 3QJAA 3FKKA 1SO5A 3CM4A 1QO2A 5AB3A 3G0SA 1G4PA 3LLDA 1LRNA 1LORA 4HKPA 3M5XA 4HNTA 1TTIA 3CPRA 4UIOA 2B7NA 4LTSA 4JTFA 5FEZA 3JR2A 3W1XA 2DZPA 2E5CA 4JTKA 1TMHA 3P5YA 1OX4A 3EX1A 2C19A 1VCFA 1EP3A 4QNWA 4O54A 5F2LA 1ICQA 5FF4A 3BLFA 5CSSA 2VEPA 1RD5A 2ZRVA 3NQ8A 5CZJA 2QDHA 4O1CA 4JXCA 2QCGA 3KAOA 1ONRA 1SW3A 3W7GA 4NXSA 3I7SA 1DKWA 3QFEA 2A21A 1H51A 1R2RA 1RPXA 2ZQ0A 3IEBA 3L2IA 2Z1BA 1FWWA 1SQ7A 2E5BA 1P5BA 3W1MA 2V82A 2FQIA 4GUHA 3NEVA 5E0KA 1DL3A 4TR9A 4OV9A 1HTIA 4MFEA 3S5NA 2JKAA 1YTKA 4JX4A 2NUXA 3NNTA 5CPLA 1OX5A 4KWWA 4UTHA 1GPWA 1H1YA 3O06A 4O14A 4UCGA 2ZBTA 3DBPA 2NWSA 3GXNA 3S6DA 2V2DA 4E2BA 1IXQA 3GYEA 1CW2A 4AXKA 4MZYA 3BK0A 1GG0A 1OF8A 4AWSA 2Y7EA 4ZQNA 3BVJA 1G69A 5C54A 3W71A 2CLHA 3F4WA 3T40A 5F2MA 3NQDA 2DZWA 2E09A 3WK0A 2Y61A 4UUIA 1Q3NA 4WOQA 3FEMA 4ZQOA 1IIHA 3S1XA 3TXZA 4UNLA 4UTUA 3L0KA 4Y9AA 3MO7A 1TTJA 3TSBA 1OK6A 4FX7A 3RLVA 3DKJA 4L4MA 2A4AA 2FTPA 3NOEA 1OX6A 3BG5A 3S1VA 4WX2A 3HGJA 3T4CA 3OBKA 2VFHA 1BWLA 2RKXA 4MIMA 3KRZA 3GDRA 3NR0A 3O63A 3DH7A 4NJKA 4O13A 4B5NA 2ZZ6A 4UFKA 1LLZA 4OU1A 1I2NA 5FESA 1GTEA 4KFNA 3A21A 3OIXA 3GZ3A 5HR6A 3UD6A 4UTTC 5AYZA 3QSTA 4Y8FA 4WZHA 4XKYA 4UFJA 3M6YA 4S2BA 1NAL1 4N2YA 3BLIA 5LSMA 4LNYA 4OBTA 5AC7A 5HR7A 1H63A 2NUYA 1F5ZA 3VFLA 3N19B 5CPMA 3C56A 3ELFA 3V75A 2YYUA 1AL8A 1EUAA 2CLOA 4FNTA 3MI6A 3CB8A 3DFOA 2WSQA 1LCOA 1SSGA 2CLMA 3PAJA 2B7QA 1JULA 4HPXA 2Y89A 4AHOA 3ABOA 1LTDA 3I68A 4JTJA 1F05A 2EKCA 3HOJA 5KMYA 3HBLA 3HIJA 2QJIA 4JDYA 3LERA 1FQ0A 4O16A 1KM4A 3L21A 1GWJA 4FX6M 4ZQRA 2RDUA 2ALDA 2YFOA 4ZL1A 4L4LA 3E96A 1OHLA 3W7EA 5I3HA 1XFBA 3TW7A 4R53A 1OFOA 4Z1DA 1XUUA 5IM51 5D33A 3GNDA 3NAVA 3GDMA 4RR4A 4JTSA 3CEPA 3TSMA 5BMXA 2NV2A 2QR6A 3LCWA 3EWZA 4XZ9A 2QUVA 1MEWA 1FCBA 2VEKA 1WQ5A 4Y6GA 4AEOA 4LVDA 4TU1A 2A7NA 4NUWA 3TE9A 3SZ8A 2ZRWA 4AWTA 5C5YA 3P62A 1KV8A 1O4UA 1VH7A 3DI1A 4MJZA 1XCFA 4WD0A 4DF2A 2C13A 3R8RA 4PC8A 1QPOA 3STFA 4DBEA 1OFAA 4GFSA 4FNQA 1PV8A 5DLCA 2A0NA 3TK7A 3FOKA 4DPQA 3HB9A 4JDBA 3NPXA 1QWGA 3FJ6A 1JCXA 2R8WA 3FIGA 3OVQA 3IVTA 1R47A 3UZ5A 3DKLA 1Z42A 4NXKA 5KSWA 2LLEA 4DPPA 1GVOA 3SGZA 2OJPA 1O94A 1HO4A 5LNUA 3M5ZA 4ORMA 5EBUA 1OFPA 4JEQA 4BWLC 1ADOA 3OA3A 2KZHA 3HGRA 2ISSA 2VFGA 4O4VA 2W79A 3KFTA 1K8YA 3EWWA 3G1DA 4O1DA 4NJJA 3W1LA 1VGAA 1NSJA 4RXGA 1TIMA 1VYRA 5D05A 2YYTA 4YWIA 3W2LA 2OT1A 2FJKA 3MHGA 4RZ5A 4MY8A 4LV4A 2DU2A 2GQ9A 4FEZA 4PL1A 4WY0B 4JYDA 4QM1A 4UR8A 1I2RA 3EWBX 4UFMA 3AO0A 2A7PA 1GVFA 4MUZA 4WQ6A 3GIYA 1O5KA 3B0PA 2C14A 3EX2A 4I7VA 5I3GA 4QSHA 3NQAA 4LVFA 3W1RA 5LNWA 3HGSA 5BOOA 1K8ZA 3P82A 1H7XA 3TQVA 4JICA 1EEPA 3GNNA 5D38A 4X9SA 1KM5A 2DZUA 4IX0A 1JCLA 1W0MA 2GQAA 3UWWA 3W7NA 1NFBA 1F2JA 3L9CA 3MBFA 2E77A 2W0UA 2CWNA 1L2UA 3NM1A 1I45A 1KFCA 2TYSA 4A2RA 1QPRA 3EEGA 3IV3A 2HSAA 1V7YA 3NVTA 4PL2A 5C6MA 2QCDB 3TFXA 1EIXA 1PE1A 2E1DA 3UZJA 4UTKA 4N9EA 3G1FA 3IGUA 4FNPA 3W7CA 4LY8A 1KFEA 1VJIA 1FWTA 4Z1CA 3U8GA 1LZOA 2ZTJA 2HS6A 3NQMA 3QC3A 2YSWA 5KZDA 1WDWA 4ALDA 3LHYA 1KBIA 1LBLA 1TB3A 3F1QA 4A29A 1M7PA 3HJZA 3W73A 3W2UA 3STCA 2ZZ7A 4K7VA 5AYXA 1HFBA 3N14A 3MMTA 3UNDA 3PWAA 1TREA 1SR9A 4G1KA 2NXIA 3ATYA 3GKFA 3R5EA 4EOUA 3W2MA 2PURA 6TIMA 1YTEA 8TIMA 3TFCA 3W84A 1SU5A 4NQ1A 2JKEA 1W5PA 4YLWA 1QCWA 3QPYA 3W7MA 1TPB1 1TV8A 4IUOA 2HTMA 5DBUA 5L6UA 3FYPA 1YDNA 3M9YA 5CPNA 4BR1A 4CCDA 2GVLA 2ZRUA 3WK2A 1L6WA 4YL2A 4TIMA 1YYAA 3LI0A 5AHLA 3QW4B 4KWVA 4GE8A 3NZRA 1WOAA 3PF3A 4PEKA 3PM6A 5FEPA 3W76A 1FDJA 4JTHA 3LXBA 3WJYA 2UV8G 3LRLA 2GUUA 4LC8A 3ATZA 3PBYA 4WUIA 2GJNA 2X1SA 4GJ1A 4HSOA 3TXVA 2NXHA 1SO3A 1GG1A 3N3MA 1AW5A 3M44A 2ZRXA 1B3OA 3NGJA 1H7NA 1KM0A 3EKLA 3NPWA 5DXYA 3L67A 2FPVA 2J6XA 2JKPA 2X16A 1CI1A 3OVRA 3QW3A 2F84A 2B7OA 4EWND 1GOXA 2NX3A 4LOCA 1Q6OA 3NL3A 2QJHA 5EYWA 2YDAA 3O8AA 5KZMA 3W7QA 3G18A 1Q6RA 2TMDA 3TA6A 4A3UA 1TRDA 1E51A 1SZFA 1TO3A 4GUGA 1WAUA 3LRKA 4C1KA 5EA9A 2PC4A 3UWYA 3B03A 3M16A 1LDCA 1F74A 2ZZ1A 3M41A 1OFEA 1TV5A 1TSIA 2C6QA 2X30A 3D0CA 5HINA 4O0ZA 1TJPA 1MSSA 2BSLA 4FNSA 3G1XA 1R30A 4XTIA 1A50A 3GKAA 3LCHA 3G0XA 3UYCA 1OYBA 1BWKA 4UMBA 3E02A 3M5VA 4POCA 1LOLA 1EA0A 3PC0A 1SUXA 4RLIA 1GEQA 4UC5A 1W56A 4IXXA 3S0CA 2H3BA 5BMWA 2QCDA 4FHAA 1GYLA 2ZCGA 5DELA 3P5ZA 4O17A 1FCQA 3ABRA 5AYYA 1VLIA 2WQPA 5EL1A 2ATSA 4LVGA 3TMQA 3OHIA 1W3NA 3CLMA 2YCEA 4H4IA 3W88A 3RF9A 4Z1BA 3QSRA 3RNDA 4H6KA 3GAYA 2E6DA 4X22A 3IIVA 4JR5A 2WV8A 2VFIA 4GC4A 4EVZA 1RQBA 3HQ1A 5LGZA 2V9DA 4OT7A 4O8RA 1O5XA 4RZ4A 1JR1A 2CFFA 5SWUA 4XWUA 1K7XA 1VLWA 3NYZA 3GDLA 4X3ZA 4U28A 1W31A 4PA8A 3ZWSA 5CZTA 4MPQA 3EWUA 1AK5A 5FF7A 4DF1A 4HNUA 2H90A 4CLMA 1SW7A 4LRTA 4FXSA 3SR7A 2CLKA 3LV5A 3U6WA 3UY7A 5K9XA 1VQTA 1DJQA 4MZ1A 1OYAA 3NQEA 3C8FA 3W3OA 2ISWA 3E49A 4GBUA 3S5OA 3ZFHA 2VELA 2V30A 1VYPX 1EWEA 1X8FA 4IJBA 3G0UA 5K3VA 3NDOA 3G3DA 1XBXA 4M7SA 3ANYA 4JTLA 1ICPA 1MZHA 2XFWA 3F4NA 4AHQA 4DO4A 1N7KA 4C1LA 3KVJA 4JD4A 3MYPA 4H3DA 4N4PA 3GR8A 1PS9A 2Y6ZA 4JX6A 3I7RA 5G4EA 3GXPA 1UB3A 4I7WA 2VFEA 3HG2A 4IMCA 3RK8A 2A85A 4BFAA 2VC6A 2CLIA 4GUIA 1OFQA 1S5VA 2CZDA 1TV7A 4HPJA 2C0AA 1P4CA 2YW4A 4HHPA 4N9BA 1VZWA 3LCFA 2QF7A 5AC8A 1I2QA 3LHUA 3C4UA 1O60A 3NQ6A 2WPBA 2W6RA 4AF0B 3PY2A 1SSDA 4RV8A 1GJPA 2FFCA 1RQHA 3PSVA 2Y7GA 4TMCA 3Q58A 3FJLA 1S5WA 2ZRZA 2XN1A 2V81A 4DBDA 5K9CA 2WJZA 2CW6A 3M5YA 2J9XA 5F1UA 4LVBA 1W1ZA 4BF9A 5A5WA 3B05A 3GX9A 4HIBA 2P0OA 2ZZ3A 1QOPA 3MP4A 1OVDA 1K03A 2XN2A 3MUXA 1T8XA 3A22A 1B4KA 4XUGA 1FXQA 2EPHA 4PODA 4QQ3A 4CNNA 4IQLA 1VCVA 3AJXA 3QMSA 1KTBA 2NLIA 1HL2A 3MP5A 1ML1A 1TQXA 3G1YA 5AN7A 2Y7FA 2QJGA 1LBMA 3SJ3A 4JYEA 1DQWA 3W9ZA 3LDVA 3W2NA 1LOSA 2WNZA 2XN0A 3W87A 1W5MA 3UY8A 4K38A 1UCWA 3BW3A 5KITA 3HPSA 1G7UA 1H7WA 2Z0IA 2A2IA 2QCLA 3ZR4A 5KTLA 2Y62A 4HSNA 2WOQA 5FEXA 1KA9F 2QCEA 1R2SA 1LBFA 5FF2A 5IBXA 4O11A 2E6AA 4IPIA 1ZAIA 3W72A 3CC1A 2A6NA 1VPXA 3TAOA 3W07A 3QQ0A 3WJSA 5F2GA 2RDTA 5U4NA 3HF3A 1G4EA 1TQJA 2E6FA 5KINA 1QPNA 4FNUA 3WK1A 1WXJA 2G97A 3PBVA 3VCRA 3LBCA 1TTQA 1Q45A 5TQLA 1XKYA 1SO6A 1N55A 3NL5A 1IXPA 1ZCOA 4MYXA 4FF7A 4PTNA 2O7QA 1A5BA 1H50A 5CGQA 1P0NA 3BGJA 4LU0A 3QQ1A 2DP3A 3NL6A 2PE4A 2RDWA 4WXYA 1JCNA 3DI0A 2RFGA 3GR7A 1JQXA 3IVUA 2NX9A 5HQEA 3TNOA 3G22A 5DBTA 5BRBA 5T26A 3S1WA 5CG7A 1DHPA 3GVGA 5K9DA 1OABA 1D9EA 1VS1A 3KVKA 2DZXA 2CU0A 1GQNA 3FYOA 1KLYA 3DFQA 4XTDA 2VFDA 5FF0A 1XUZA 5MHBA 2OCZA 5LGXA 4ICNA 3NQ7A 1CX9A 4MYAA 5CSRA 3S1UA 4UTMA 3ZWTA 3N2MA 3MYOA 3MHUA 1BKSA 4O57A 1IGSA 3TX9A 4DO5A 2NUWA 5I3FA 4O4WA 3DFPA 2VENA 1FWSA 3C61A 4K37A 3U2OA 3LCLA 3FS2A 5D37A 5TIMA 3TU9A 1K3UA 1R46A 1ZAHA 1H62A 3BW2A 3KRSA 3L65A 1KFLA 5HNRA 3CHVA 1FDYA 3QMTA 4ZQPA 1SZGA 1MXSA 4AWUA 4AAJA 1IIGA 1YPFA 2E68A 3DFNA 3PSWA 4YMZA 2Y63A 4FIRA 4K8EA 4IWWA 4ORIA 1OJXA 1QO5A 3TKFA 2J9ZA 3VE9A 4ONVA 3UPBA 1PHWA 4JTIA 4NZFA 5HUOA 5I3KA 2C16A 3SW6A 2R14A 2BX7A 2I1OA 1D3HA 1G4SA 2Q8ZA 3BW4A 3RMJA 1KTNA 5H91A 3DHFA 1X1ZA 2C1HA 1T99A 1DJNA 4PCFA 4MZ8A 3O16A 1J5TA 3LCXA 1OK4A 3QRHA 2WSYA 4JS3A 3QF0A 2D73A 2J24A 2YXGA 3HPZA 3HG4A 5AC6A 1I2OA 3H54A 3UQNA 5K4ZA 1GVRA 3EKZA 2ZZ4A 2H8XA 4JTEA 3UWVA 1H7PA 4WXZA 4UXDA 4IOTA 2JGQA 3LHWA 4RZ6A 1P1XA 1HUVA 1SFJA 4O28A 1FCUA 2WO5A 5HMSA 1EB3A 3TQKA 3SECA 3TIMA 4E38A 4CNOA 1XBYA 4JX5A 3DAQA 1W3IA 1VR6A 4Z08A 5G5IA 4RK8A 1F76A 3O1NA 3EXSA 2G5WA 2C15A 3PBUA 3NA8A 3VI2A 3KVMA 5D2VA 1C9DA 2Z6IA 1B9BA 4Z1AA 1Z48A 1MEHA 3M7WA 3LHZA 3GDTA 4OWGA 2NZLA 3T44A 3I7QA 4MKNA 4OQVA 2DORA 4OV4A 5I3JA 3KOFA 3MI2A 3TROA 1GT8A 3BGGA 4RKAA 2Z6JA 3UWQA 2Y7DA 2DJLA 3BG9A 4XBSA 3PG8A 3RFAA 1EUNA 2V5BA 5J5DA 1P0KA 3MP3A 4UNKA 3Q37A 1RVGA 1YXYA 1QR7A 4KFOA 4NX0A 5U7SA 2RHGA 1H1ZA 1X1OA 3F03K 4IMDA 3TH6A 1PCWA 1DV7A 4LUIA 3LHTA 5AHNA 3P81A 1JVNA 1OFDA 3A9IA 4Q33A 3EXRA 5HWJA 4RJEA 1QAPA 1IXOA 3A24A 3W83A 4UMCA 2F7FA 5H2ZA 1TPFA 1I2PA 4MVAA 2QEZA 2VEMA 1BEUA 2QAPA 4JNMA 3E12A 3PVFA 5DCEA 4GRSA 2ZA1A 4IX2A 1XDMA 2X2GA 3G1SA 4N9DA 4O50A 2QCHA 2ZZ2A 4AVFA 4ZQCA 3W1NA 1ZY9A 3L5AA 4PH6A 3A23A 4IXHA 1XM3A 1FXPA 1TYGA 5D2YA 3PUDA 4RX0A 5F4WA 3B06A 4ZMGA 4MLRA 1W5NA 3LOTA 1V5XA 1TPVA 1ALDA 1KBJA 3TMLA 1EP1A 5F2IA 2AGKA 1FUYA 1KTCA 4FX8A 4WY0A 5HULA 1W37A 3B0UX 4NJGA 4AHPA 1NEYA 3N9SA 2DZTA 2EGZA 4U4MA 1YADA 1Q6LA 5AHIA 1FDZA 1BTMA 1PIIA 3C6CA 3MWAA 2E5DA 2P10A 5FI8A 3PR2A 4KFPA 2C3ZA 3W70A 3V1PA 1KFBA 4OHQA 2IQTA 4QITA 4LV9A 5F4XA 2J27A 2PRMA 5J5RA 3RLUA 1B57A 2AQWA 3DHDA 3NXFA 4UTWA 4HNVA 3DU0A 5C2XA 1ZJIA 5DXXA 4QISA 3IGXA 1KV5A 1K02A 3TV8A 4RXFA 3QPZA 3LBMA 3G1AA 3HG5A 4NT0A 2NV1A 3BG3A 4EF8A 5LHEA 1PCKA 2YFNA 3OG3A 1KLZA 1KM6A 3TJXA 5D30A 1WV2A 2G96A 1W54A 1ME8A 3W1PA 3TR2A 4EF9A 3QH2A 1K7EA 3BPWA 3MBDA 5CPOA 5G4WA 1AW2A 1IF2A 4DQWA 3WJXA 1G6CA 3GAKA 1RR2A 3FFSA 3P80A 4DF0A 3W75A 3EX3A 4XKYB 1QMLA 4W9TA 1FY6A 4GNJA 3VKJA 1KFJA 2B0MA 4BWLA 4CQ8A 1L6YA 2QAFA 3NPUA 5HJLA 4IMFA 3IRDA 1A5CA 2PCQA 5EMUA 1F7BA 1TCDA 1XXXA 4RCXA 4ADSA 1TPWA 3QM3A 4NJHA 2H3DA 3W7OA 3QZEA 4K6AA 2OMAA 4E0CA 6ALDA 1WBHA 5LNRA 1OFRA 4YCPA 3W1UA 2BXVA 5LHFA 1K7FA 2OX1A 5E1QA 5AHEA 3I65A 3P61A 4LS1A 1J2WA 3TSDA 1QDSA 3HPXA 4JY8A 3NM3A 2X1RA 3JS3A 3CWOX 3P84A 4ML9A 1SZEA 1YTDA 2CZFA
chains in the Genus database with same CATH superfamily
3G1VA 4M8UA 4R7OA 4E2DA 3F7JA 3R10A 3WH7A 3B8DA 2DZVA 4G56A 3C2FA 4F0KA 1EPVA 3W6MA 2OO6A 1JZ3A 4O19A 1VFFA 4UTIA 1UA3A 3USZA 2TPSA 1ISYA 3PBMA 4GVFA 1ZALA 4AZHA 1DORA 1VFUA 3W7PA 3S2MA 1T8QA 4JTTA 5C9XA 2VRJA 5JBDA 2VD8A 5JUVA 1TMLA 4CVWA 2YZRA 1DQXA 1VJSA 2VEIA 4NVTA 4L61A 2F8QA 3OHMB 2IUZA 4AMAA 4R85A 4XV0A 3GR4A 4HPGA 3T8LA 4FB7A 5CLWA 3R89A 5H6HA 1ZBWA 3LXCA 4F0HA 4L1XA 2CLPA 2GQ8A 4WKHA 1XBVA 1YXDA 3SFKA 4PFMA 3VNKA 3E0FA 4M6UA 4GUFA 4EP8C 3P60A 3IIOA 1P0DA 3EPOA 3AS0A 5G2HA 4S3FA 3MC5A 4PUJA 1RK5A 3MWCA 5AVNA 3H55A 1KQZA 4PB3A 4N6EA 4QJ3B 1UP3A 2PDHA 4DJED 4YN5A 2WZTA 3VD9A 3THQA 4NNAA 3LLFA 4AYGA 1UC5A 2FKPA 2VFFA 4C6BA 2OZ0A 3O7UA 1TTPA 3A3WA 4JIQA 4NZJA 4Q7NA 1F07A 1TJRA 4A21A 1JUEA 4KMQA 1LL7A 4K8GA 1HGWA 4W5UA 5HUPA 3WUGA 5DN1A 4US5A 2QDGA 4D8LA 2CZEA 4HOZA 3MU7A 4E3TA 5I77A 2X42A 1QBAA 3V7PA 2CITA 2ZTKA 3WMCA 4LVAA 4O1BA 1A5AA 4RE4A 3CEUA 4AEEA 1W17A 3UPWA 3ZR6A 1LRTA 2A5HA 2YL9A 3QQWA 2D20A 4R7JA 5BOFA 3LN3A 4CD8A 3W6YA 1XLHA 4MSSA 1VHNA 2VGBA 2NSXA 2IPFA 4LX4A 3T81A 2CHOA 1IZCA 3W23A 1R0MA 1ICSA 1XIDA 5A1AA 1YIXA 3AFBA 2XFYA 3HJEA 3N6JA 4TMBA 3FGCA 1MWOA 3CAWA 7REQA 1M04A 2ZXAA 3AUJA 4FO4A 4CCEA 1A5LC 2QUTA 2QLYA 1AH0A 2BS9A 3C3NA 4EX4A 1WOBA 1QVBA 2QUNA 5DMYA 4P7QA 3LRMA 3DFTA 5JIWA 1Q6EA 1HG3A 1LP6A 1TIWA 3WD1A 5TBOA 1VJZA 4TVCA 5IHRA 1EQCA 1LM1A 1HF6A 4IJCA 5GVJA 2GOUA 1CGTA 1XKJA 2BWGA 4U31A 4LS2A 4AY8A 3PK7A 1OIFA 3KXQA 1OZQA 3L5MA 3QXBA 5D32A 3TAKA 5AHFA 1HJXA 2W66A 1Q6DA 2CCRA 3CZGA 1D7KA 2OU4A 3CZKA 1E0VA 1WNOA 5MF5A 3OO2A 1J0KA 4Y90A 1TPDA 1O66A 4URIA 5G2WA 1HJSA 2IS7A 5FL0A 3STEA 1UASA 2QCNA 2JGYA 5D2WA 2HS8A 1PZ3A 3W1QA 3N2XA 1LLWA 3W7LA 4JN6A 2VDGA 2Y8KA 5A6JA 3W38A 4H83A 3QN3A 3VIJA 3CV6A 1JQVA 3IIPA 4AD4A 3UESA 4DUXA 3CZEA 1UMLA 7XIMA 2SFPA 5LNSA 5M03A 1E4NA 4ZZ9A 5REQB 4RE2A 4MB4A 1NDZA 3QMRA 3W28A 2CLFA 4C6DA 2JF7A 1C9WA 3B04A 4P7OA 1M6JA 1WKYA 4V27A 4DJEC 3SB0A 2G95A 2BGQA 3LCGA 2J74A 2OWCA 1XC6A 1B1YA 1J0HA 5CAKA 1X6UA 5AFDA 1E6ZA 3S8HA 1TPH1 3E2QA 4CGTA 2WQDA 1KRCC 1ONWA 3GDKA 3USBA 3M1ZA 5BXTA 5LZLA 3QYQA 2QUUA 1L2QA 3OZYA 3EWCA 3BLEA 2ICSA 3AOFA 5C2GA 4C6FA 3S9YA 3CAQA 4DB7A 4LW7A 3CTTA 4Z17A 3GC2A 7TIMA 2Q3RA 1GZ1A 2UZ9A 1NQKA 1EDGA 2ZA2A 3C2RA 1EBHA 4N6FA 4M29A 4IFKA 4X61A 5G1MA 3IK4A 4M7TA 1PO9A 4WDTA 1V6YA 1NDWA 1OC5A 1E6QM 1KFWA 5FAJA 3ZT7A 4GXWA 4IGSA 4LBUA 3CQ0A 4IPJA 5ECVA 2G3NA 1CXEA 2WMIB 9XIAA 1SO4A 4RNJA 3WCZA 3OBAA 5CPQA 3PBWA 4OE7A 2VOMA 1J10A 1IT0A 1EZ2A 2E6YA 5D9PA 4OGZA 1GVEA 1PDZA 1L8NA 3ITOA 3PZOA 1W3TA 1XR2A 4DO6A 3N12A 4BHYA 3WUBA 5FA5A 3PZGA 5BW6A 1G4TA 1OC6A 1POKA 3D47A 1ITQA 5BNKA 1EQPA 5D02A 3W7JA 3DECA 1YPIA 4H01A 2FVLA 4HT3A 3W2JA 3MB9A 1H5YA 2P0IA 1LL6A 3KWXA 2ZX7A 1C8VA 1QBBA 1R3YA 4KWSA 2CLLA 3ZJ8A 2QNEA 4XBKA 1JDFA 1BSLA 3L5LA 2RDXA 4DI8A 1GORA 3GVRA 2VZOA 3GM8A 1YDVA 4C90A 4GH1A 2A7RA 5FCZA 5MKGA 3LM7A 3EXTA 1XLFA 5EFDA 1E1FA 2CERA 4W86A 4L1WA 3CB3A 1PDYA 3RM9A 5BWFA 1ZCCA 2V5LA 1KM3A 4ZVJA 4MFDA 1AVAA 4AX6A 4D8ZA 1P6BA 1OD8A 3I3EA 3KOWA 1YLVA 1GOWA 4XZLX 1DIKA 1BYBA 3CQKA 1KM1A 2Z1WA 3T78A 4X60A 1GQKA 1JD9A 3GH7A 1VPYA 2Z2AA 3ZLGA 1PKYA 3Q4DA 1UWQA 1NELA 2IMRA 3BAJA 2NW0A 1DOSA 5EMYA 1H61A 3RU6A 3CMJA 3TQ0A 1M01A 2QS8A 3O6DA 1UZ4A 1V3MA 5ECUA 1S2CA 1ZP4A 3EWYA 4JGDA 5C2CA 1YNPA 3GIPA 4J3SA 2A1YA 1OF6A 2ZC1A 3K1DA 3SUUA 3U0HA 4XX6A 4RNHA 1UBSA 2KX9A 1VYSX 4E8GA 1MXGA 3W7DA 5AHMA 2WKJA 2WW5A 3LI1A 3QTGA 4NNCA 1FWDC 5FJOA 3WELA 2FZBA 4HNNA 3URNA 2EBNA 3BMWA 3PPFA 3GHUA 3AU6A 1SW0A 3KCJA 3SGUA 1QW7A 2XFRA 3FKKA 3CM4A 2J75A 4GQBA 2VQUA 5BWAA 4MHBA 2BOGX 1KCXA 4HNTA 1JZ6A 2BB0A 2Z7KA 4UIOA 4LTSA 3JZUA 1TX0A 5T8GA 3GY1A 2VQTA 1UBPC 2V5CA 1UWAA 5FEZA 2PC8A 3LZ5A 3P5YA 2P8BA 2W5FA 2XPKA 1CXLA 1EP3A 4QNWA 3BLOA 1ONEA 3BLFA 3NQ8A 2QDHA 2P5NA 3CT2A 3N4EA 3WNLA 3ZLHA 4LUTA 1SJBA 4LCRA 2VURA 3DUGA 3S9ZA 3NQBA 2QHAA 3S6OA 2REQA 3L2IA 1LUCB 3CYVA 4J2MA 4W93A 3KUMA 3NEVA 2DGAA 4TX6A 1S3TC 1HTIA 1K4HA 4QG6A 4NZ5A 1ZSXA 3CL8A 4JX4A 3URAA 2D0HA 5CPLA 1XLKA 3O06A 1X8CA 3DBPA 2ZWZA 4U3CA 2NWSA 3GXNA 3S6DA 4E2BA 3OQ8A 4MZYA 1RSCA 1OF8A 5FSEC 3WQ5A 3BVJA 3AHYA 3RDKA 5C54A 2DV0A 4XSMA 1E40A 2GQ3A 1US2A 4ZOCA 2CLHA 2VHLA 1TVNA 1VBJA 3T40A 3MA8A 4X63A 2E09A 4KS0A 3GHRA 4DIAA 1Q3NA 4WOQA 4JHZA 4XK2A 4ZQOA 3THDA 3S1XA 4PN2A 4UTUA 1S2WA 1CENA 3A47A 1W9UA 4IIFA 3WBEA 4CN4A 5DT5A 3WMLA 4ZB0A 1HJUA 4F3HA 3OGRA 3TTOA 5C9ZA 2FTPA 3NOEA 3S1VA 3WLSA 1S2TA 3T4CA 3OBKA 4D6GA 2RKXA 4MIMA 4F79A 3A6OA 3NR0A 3O63A 3DH7A 4K1WA 4O13A 4LYKA 2XSXA 2ZZ6A 4UFKA 1LLZA 4OU1A 5FJRA 3B0XA 1GTEA 4KFNA 3A21A 5HR6A 2R1KA 5AYZA 4XKYA 3G2GA 3M6YA 1MXDA 2OLAA 5LSMA 3QY7A 1QNOA 4LNYA 3BLKA 3KP1A 2OELA 1OADA 1J5SA 1ZJAA 3C56A 3ELFA 1WPCA 4BQ4A 4HU0A 3CB8A 1O68A 4WSJA 5M2FX 4MTVA 2WSQA 3K4WA 5CLTA 1LCOA 1WDPA 3MTWA 3PAJA 3LMZA 4KEZA 1RP8A 4AHOA 2CHRA 3ABOA 5GQBA 1GW9A 2QJIA 4JDYA 3MS8A 1A49A 3LERA 2GYIA 1QNRA 1GWJA 4FX6M 3M0VA 4ZQRA 2ALDA 2XYLA 4L4LA 5I3HA 1W3JA 4H8HA 3KTSA 1CYGA 3KBNA 4JFWA 4B3LA 4Y6GA 1VPQA 3TE9A 2J7CA 4Q7BA 4AD3A 3SZ8A 3P62A 3TYZA 1XRFA 3DI1A 3IK2A 4RDZA 3R1ZA 4WD0A 4HCDA 1RJQA 1GKPA 1WB0A 3STFA 4DBEA 3MO4A 1GOIA 4V2XA 5EFFA 1QJWA 1XYZA 3FOKA 4DPQA 4W7WA 1QWGA 1JCXA 1Y65A 2GDQA 2R8WA 1G0CA 4E2OA 1R47A 3UZ5A 4DJDA 2BVWA 2GK1A 2O9OA 4NXKA 4XSLA 1A5NC 4ECLA 3HV8A 4F2TA 3W81A 3NJ3A 4KCWA 2OJPA 1WXZA 4WF7A 5LNUA 3M5ZA 3ABXA 4BWLC 4UCFA 3BH4A 2TAAA 1MVYA 4E3VA 4I5XA 5FJJA 2VFGA 3DCPA 4MDOA 3EWWA 2GSJA 2VEGA 1VGAA 1NSJA 1MQQA 1DJZA 1VYRA 1JFXA 4RZ5A 4LV4A 1TV4A 2DU2A 4FEZA 4UR8A 4LYRA 1I2RA 3EWBX 1BF6A 4UFMA 3AO0A 8CGTA 2ACUA 1GVFA 1EF2A 3B0PA 4M3PA 3EOOA 1E6XM 4DI9A 4QSHA 3GRIA 2WANA 4LY4A 3PNZA 4ATWA 1MFVA 4XVDA 1CCWB 3HPFA 5CSYA 1CIUA 1EEPA 2ZDSA 4X9SA 1KM5A 3CQIA 2WVVB 3WF1A 1XYCA 4JAWA 1FTXA 2PTXA 3N04A 3L9CA 3P3BA 4MG4A 4ZOAA 2W0UA 2CWNA 2ZE3A 4X0NA 1I45A 1KFCA 1XW8A 3IGHX 2HSAA 1R86A 5C6MA 3MVTA 1J8VA 3WL0A 2PDYA 3IGUA 3W7CA 2OSXA 2X7VA 4HJFA 3OZMA 2J79A 3UXIA 2GGGA 1XIGA 4AVNA 2YSWA 1E1EA 4EAMA 1WDWA 4J3ZA 4C6KA 4HOWA 3LG3A 4A29A 1M7PA 4J35A 1EC7A 5KZ6A 2ZZ7A 3AS3A 3N14A 3WQGA 3UBPC 1J0ZA 1QK2A 1UWTA 1XLLA 3SCSA 2CEQA 3ATYA 1FHUA 4EOUA 4BQ5A 6TIMA 3EMZA 1VF8A 1SU5A 4NQ1A 4IQJA 2JKEA 5RUBA 2GVYA 2FZNA 3VGBA 3RR1A 2PWFA 3QPYA 2Y2WA 2QIWA 1TWDA 2J7FA 1PZ2A 3HMCA 1NQ6A 3QZ6A 5DBUA 5TD4A 3T0BA 1K9TA 1G94A 1PB0A 1BXCA 2HZGA 3WLLA 1YDNA 2NVCA 4BR1A 3KDOA 2DSKA 1EJRC 5AHLA 2ZUMA 4MB3A 3H7UA 1HP4A 7ENLA 2XSBA 2CNCA 3QV9A 4GG9A 3W76A 3KWSA 3H2NA 4JTHA 2UV8G 3LRLA 4NZ3A 4JIHA 3UCQA 3SCPA 4GQGA 4WUIA 4B4FA 4DRSA 4HSOA 3TXVA 1EYEA 3M07A 1SO3A 3M44A 1B3OA 1BRLB 4J3UA 2OSYA 5M3WA 1S39A 4PCSA 1F3EA 2OYKA 4ILSA 1XF0A 4LOCA 2QJHA 3N9KA 4X9YA 4A3RA 1CBGA 4JNYA 4D72A 4K2SA 3FJNA 5CC7A 4FALA 4GC3A 4XISA 3NVDA 5EA9A 4C5ZA 2DSWA 2NQZA 2E9MA 4OUIA 4JTDA 3IAPA 7PTDA 4A4AA 1S46A 3MSRA 4J7RA 5HPOA 1UD3A 3R43A 4IIDA 5HINA 1IT8A 3G5EA 1WUFA 3SQSA 3UJSA 2BSLA 1ITUA 3LCHA 1W1PA 3G0XA 5M5DA 1BWKA 4DXKA 5ABFA 3AIRA 2PDQA 3E02A 3M5VA 8XIMA 1LOLA 3AMDA 1H41A 3L4XA 2XH4A 2NQJA 2F38A 3GTHA 3BJFA 4UC5A 1FH8A 2H3BA 4FZIA 4FHAA 1GYLA 3ARRA 3PHAA 3P5ZA 3RUBL 2OLSA 4Y9PA 4O17A 4G7FA 3ABRA 3MV11 3L23A 3LS9A 5CBBA 5EL1A 5CZKA 3TMQA 3GO2A 2WC7A 2PTDA 4CNSA 2G4JA 3OHIA 1W3NA 3CLMA 4CQDA 4H4IA 3W88A 3QSRA 4YVPA 1XLCA 2PGWA 4HMCA 4FSAA 3GAYA 4PSPA 4GC4A 4EVZA 2XJ7A 1XX1A 4IZGA 4R88A 4EKJA 4OT7A 4O8RA 3MKVA 4RZ4A 2V3FA 4WIWA 4XWUA 3WDPP 2J62A 2PU1A 1RD6A 3CAVA 1EIBA 3UVIA 4HU8A 1OGBA 2NLYA 1JYWA 1AK5A 4DF1A 4CD6A 4EPDC 1SW7A 4EPBC 3UY7A 1DJQA 4LF2A 1E5NA 2J8FA 2BY3A 4DJEA 1V02E 3P2VA 3C8FA 3W3OA 2QPXA 5DO8A 3E49A 4GBUA 3GHTA 3HTWA 3QR1A 5A8MA 1VYPX 1XLJA 4DO4A 1N7KA 3EOSA 1XICA 4GD0A 4C1LA 4JD4A 4H3DA 3DG6A 2Y6ZA 2C7FA 4JCMA 3LZ3A 1V93A 4BQ2A 3ZOAA 4OECA 1DXIA 2A85A 4NI3A 1WDDA 2QT3A 1PX3A 3LENA 4R7WA 3RRAA 5I2UA 2HXTA 2CZDA 1W91A 3MQTA 4BF5A 1BF2A 4HHPA 3KOXA 3VZXA 3Q67A 2OQHA 2DVUA 3CO4A 4PE8A 1SSDA 2FFCA 3K2GA 4PMVA 3PSVA 3W0KA 2XG9A 4LBRA 2ZRZA 2XGBA 5DRCA 3UJFA 1QRQA 2V81A 4DBDA 5K9CA 4L1GA 3QV6A 3M0MA 2BFGA 4YU1A 4BF9A 3UG4A 3BAKA 3OBEA 3B05A 3NURA 3AHZA 4W8BA 4S23A 2I56A 4AIUA 1K03A 3KTXA 1TV3A 3QKEA 3A22A 4JZ5A 1R3TA 1FXQA 2VEFA 2EPHA 4PODA 4F66A 3U7VA 4CNNA 3HQPA 2YCKX 4CEXC 1PZ0A 1N8WA 1OD0A 1HL2A 3G1YA 3B8SA 4HK6A 4MGGA 4JYEA 3S1GA 1LOSA 2WNZA 3W87A 4C6CA 4Q6XA 3NSMA 3UY8A 1UCWA 2DT0A 1G7UA 4IIHA 3WQDA 2Z0IA 2QCLA 3ZR4A 2Y62A 1A80A 2BVYA 4RZBA 3APTA 4PTXA 1QK0A 1QW8A 1ZAIA 4L7ZA 4WDWA 4A8RA 3CC1A 2PLMA 4CD5A 3WH5A 4QCEA 3QQ0A 4AC7C 1HXJA 5LIXX 2RDTA 5U4NA 2QXWA 2E6FA 1VRXA 3M7SA 3TWBA 3QHMA 4FNUA 4UTFA 1VFHA 2RGLA 3VCRA 3K46A 1H49A 1B9ZA 1SO6A 2PBOA 3QKZA 1N55A 2J7EA 1ZCOA 4MYXA 2O7QA 3WL1A 3F4CA 3PPCA 2RDWA 4MAVA 1OT2A 2RFGA 3GR7A 3C0LA 1JQXA 1LWHA 1XSIA 1N82A 3B97A 9RUBA 3TNOA 2DH3A 5DBTA 5T26A 2YCIX 4ZB5A 3U2EA 3HFYA 3V1HA 3GVGA 4WRHA 4UB9A 5DANA 1VS1A 1HL9A 2DZXA 4B4HA 4XB3A 2DPEA 4QE5A 3BCDA 1KLYA 4XTDA 5FF0A 1XUZA 1E6SM 1B31A 4ICNA 4MYAA 1MUWA 1BGAA 3O6AA 2EG8A 3S1UA 1AD1A 3MHUA 4FR6A 2V6AA 4PRTA 1XPYA 5FJPA 1POJA 1MW2A 5CBJA 3DG7A 3BSHA 4DZAA 3L65A 4AMCA 1KFLA 3PP7A 3CHVA 3EYPA 1FDYA 3QMTA 4ZQPA 1CGXA 5CBIA 1J6PA 3IPWA 5I07A 4FIRA 4QLLA 3SM0A 4EPEC 4HB7A 3UPBA 1GPFA 4QROA 4ACYA 5D9OA 2NT1A 4NZFA 5HUOA 5I3KA 3U2CA 4W4QA 2C16A 4XBJA 4IP7A 2AL2A 2BX7A 1D3HA 3BW4A 4AD0A 3V4BA 2PD9A 3DHFA 4E4UA 4HZ7A 4MZ8A 3MY9A 3O16A 1UH3A 2FTYA 5CGMA 3KBVA 2YXGA 2J24A 4PTVA 4Q4OA 1W3LA 4ZO8A 1GVRA 3PZUA 3EPMA 4PUUA 4Q8WA 8RUCA 3EKZA 3Q45A 4IOTA 1FHDA 1RLCL 1HUVA 2WO5A 4FOUA 5HMSA 3ID7A 2Y4SA 3SECA 2POTA 5BU6A 4O0QA 3COTA 1CXIA 1CB7B 3F5JA 1IGWA 1VR6A 2W62A 2FHFA 2XIOA 4GY7A 4QSFA 3RJYA 6PTDA 2D2GA 3KL0A 3EXSA 4FLRA 3RXZA 1C9DA 3T2OA 3N6QA 1E15A 2V3GA 1OY0A 1R9YA 4B2DD 2PPGA 3H2AA 4ZO7A 1OC7A 4OFCA 3T44A 4EXBA 3GSMA 3FW6A 4OQVA 1ZQ5A 3KOFA 4IP5A 4RKAA 4XBSA 5J5DA 2I9UA 1KR0A 3QLLA 3ZT6A 4UNKA 1YXYA 3EZ4A 3MCNA 2A3EA 5EGRA 3KLKA 1KBKA 4IMDA 3REQB 3VZZA 3ALFA 3GNRA 3P81A 4H9UA 1E6RA 4J28A 3MCOA 4MDPA 2AKMA 4UWMA 1ESWA 1FFRA 1IXOA 1C91A 4UMCA 2FH8A 3V36A 1NU5A 3QGVA 1UMYA 1HNYA 3N2OA 3G1SA 1ELSA 3N4AA 4O50A 1X96A 3L12A 4QHRA 3QY8A 4U10A 1E6NA 2A3LA 3AIEA 4M1RA 1ZY9A 3IJ9A 1XIFA 1Z32X 3A23A 4H00A 4IXHA 5D2YA 3WQPA 2REQB 5F4WA 3B06A 4GVHA 1V5XA 4IFOA 1ALDA 3AHTA 3CV7A 4HCHA 3WENA 1XD1A 7ODCA 4ZTYA 3WBAA 4QG8A 4TUFA 4B5TA 4H9MA 2DUAA 2DZTA 1AZ2A 1Q6LA 1YADA 1FDZA 5AHIA 1CLKA 3C6CA 5FI8A 4UZUA 2DFAA 4XAYA 2NQ9A 2IQTA 4QITA 3V35A 5F4XA 4HA1A 2J27A 1CLXA 4LCQA 2XSAA 1JF5A 3GU9A 3PWGA 2AQWA 3GC4A 3MKCA 7A3HA 3DHDA 2HNHA 4UTWA 1EKOA 1ZJIA 3BJSA 1BHGA 1AJZA 3AROA 1CPUA 3CHDA 2WVSA 1KV5A 3WEMA 4RXFA 4Y9MA 1JZ2A 5D9NA 3E0WA 1VEMA 4J1OA 3N11A 2XZ7A 3ARZA 3KBJA 4F0MA 4EF8A 5LHEA 1PCKA 2YFNA 3OG3A 2QJJA 2HPMA 4LAMA 3PBGA 2CETA 3AMKA 4HZ8A 5LIYX 4LANA 1ME8A 3N2BA 3AXIA 5FIPA 5D8WA 1TWIA 1K7EA 1RALA 1TZ7A 5CPOA 2D3NA 1AW2A 1RR2A 3BMVA 4DF0A 4JFUA 4XKYB 4PMRA 1W1B1 1QMLA 4DWSB 1FY6A 4FMVA 3CZJA 4BWLA 3QOKA 4LAZA 2R6OA 4IMFA 5EMUA 1M1BA 5LIWX 1OCQA 3GU2A 1US3A 3H22A 1XXXA 3WDHA 1UG6A 2IQ0A 4AYSA 1P0BA 3QZEA 2OMAA 4E0CA 6ALDA 1OFRA 2OXNA 1W1VA 4C91A 2OO0A 3AWNA 3W1UA 5GJNA 1ADDA 2BXVA 1GZJA 2G0WA 3CO8A 1W1IE 3IJ8A 3TCSA 2IW0A 3UETA 4AX7A 1SZEA 1XIEA 4FPSA 4P2VA 4HZ6A 5CQ1A 3I6RA 4XG1A 3WD3A 4WJEA 3G6MA 3PWIA 3RN6A 1GUVA 4QJ4B 4PULA 3G24A 3W1TA 5LNVA 3H2FA 1MYRA 1D3GA 2YKKA 3ABSA 3MPGA 3SCWA 1KC7A 4W5ZA 3W74A 4YS1A 5GNYA 4CNPA 3TONA 1RV8A 1JCJA 1XLDA 4P8XA 5LKYA 3RCMA 4XUYA 1ZB5A 1T96A 2WVUA 2J78A 2FGBA 2Y5JA 3W7IA 3UT0A 4C65A 1E1CA 1JD7A 3IJIA 3SAZA 3VPLA 1I4NA 2NXGA 2C0HA 2VO5A 2V68A 3MT1A 4RDYA 2CC0A 4CQCA 4DEFA 4O1AA 2YGYA 2OODA 1G5AA 2GGIA 3E6EA 3EOLA 5ENLA 1W5QA 4B91A 1XGEA 2EPLX 3B0VC 2Z28A 1Z6KA 3KBWA 4MM1A 2QKFA 5A6LA 5I78A 2XZ9A 4EK7A 1ZAJA 3I6EA 3MHFA 4JQ2A 5I3DA 1O5RA 4M1BA 2D2OA 1XSKA 4LWWA 4QJ1A 3ANVA 4F8XA 3N1AA 3R6IA 1EWDA 4WJXA 4R33A 3O05A 1DBTA 1QU4A 1W3HA 1BG4A 1U5JA 1U22A 2VGGA 1EJXC 5DFAA 3B8IA 4Z0JA 1LROA 1QPQA 1B0IA 4UOZA 3UR2A 3R25A 3WLTA 4R3UA 4IGHA 4JIPA 4G5DA 2YA0A 4J9JA 3E2RA 3U9IA 4JHMA 4YTRA 2PGFA 4KIRA 4WY0F 3P6LA 2BVTA 2YCLA 1YX1A 3LV6A 2R94A 3SY1A 2R1PA 1LOQA 4I8YA 4TO8A 2HWGA 3AICA 4S38A 4NIRA 4LJ3A 3UZYA 5I5RA 1S5TA 4V33A 5HAOA 3TNBA 3GBEA 4JYFA 1WP6A 4J2PA 5G1TA 3VDGA 2B4GA 4H19A 1A4MA 3LX9A 4C1NB 1GYNA 3SGGA 4US5D 2WZHA 2ZWYA 3UWUA 4ML4A 2PWEA 1AMYA 3UXAA 4O18A 3PTKA 3C2VA 4O53A 1J9YA 3C5QA 2WNNA 3KX6A 4AF0A 1D3CA 4GXMA 5FF3A 2HK0A 5IXEA 1ZENA 1LQ0A 4S3EA 1TE6A 3C2EA 4JL2A 2HV5A 4JN8A 1UKPA 3FLUA 3UXLA 1FWIC 3CPGA 4I9TA 4MY9A 3UXDA 3P67A 2OZTA 2YLAA 3TCEA 1XLGA 1RVKA 1XQLA 1JCMP 2ZZ5A 4PYSA 1OYCA 3GIQA 4R5EA 5FL1A 4GA8A 1E3ZA 4CQ9A 2EPKX 2J66A 4J4KA 1R3WA 2GJRA 4Q6JA 5M17A 1OZMA 3FKRA 1WA3A 2WLZA 4AY1A 3W29A 3VGFA 3QGKC 4X0VA 1JDAA 3VOCA 3M47A 3PS7A 4ASTA 4YCOA 1N8FA 3KS6A 4C5YA 2H8ZA 1SZNA 3A4WA 1C8XA 3W24A 4UFHA 1OG0A 4AH7A 1EGZA 2Y5SA 3FA5A 2CZ5A 3IVSA 2YA2A 5A6SA 1NVMA 1KFKA 4LCSA 4DJFA 1YE4A 3IIZA 1P43A 1BWVA 1FVPA 2CPUA 1RA0A 1A3WA 4ATLA 4N02A 4E4FA 2PA6A 5DY2A 1GEHA 3VZYA 3KRUA 3KW3A 3QGAC 1AQFA 1M5WA 1LYXA 4Z0SA 2YR1A 5I3IA 3LCIA 3SCVA 3CV1A 3S46A 4XZMX 1ZHAA 2CHNA 4GINA 5EKYA 4JTUA 3FAWA 4GYPC 2FHBA 3UR7A 3LXAA 4S3AA 3VOHA 4LEQA 3M0ZA 4GWEA 3S5ZA 3LNMA 1JFHA 1JAKA 1UJQA 4NY2A 1Y5XA 1XIJA 1E73M 4FS9A 2ZX6A 2PDKA 3W7RA 3TC6A 4DN1A 3BLDA 5D09A 1IQ8A 3DN5A 4TX9A 1CGVA 3U5YA 1YKWA 1OX4B 4LUJA 2JALA 1W1TA 1IEIA 3GDBA 5HK4A 3VNLA 2ZA3A 3P8IA 4PMJA 3A5FA 1A0DA 2D23A 3RJXA 3VOFA 3GG7A 4Q8MA 1NF0A 4UTTA 1VIWA 1V3IA 3VIFA 4PMZA 1X98A 4DZIA 2XM1A 1RBOB 4BKNA 2A6LA 2VVSA 1X97A 2PDNA 3WDJA 3JUGA 4LBSA 4DBSA 1V79A 2X1UA 4U33A 3TZFA 3Q65A 3SSJA 4MKSA 3KZSA 4YXGA 3HGOA 3HZ3A 1EP2A 2ZYFA 4DLMA 4Q22A 2Y88A 2QCCA 3ZO9A 3LY0A 1XLEA 1OFBA 1XH2A 3BAXA 3W86A 1JPKA 2ZRYA 3ITXA 1X7FA 1JNDA 4HNOA 5REQA 5G2IA 3Q2DA 3PG9A 4Y96A 1AMKA 2WZIA 3NZQA 5E09A 1REQB 1AW1A 1I8JA 3O15A 1YXCA 4M6VA 5C0QA 1HKKA 3GXTA 3P7YA 2OG9A 5IDZA 1DXFA 1EJSC 3FSTA 1UWIA 5DCBA 3GNOA 3L0GA 2QJMA 2J9YA 4A3QA 3CXOA 2Z2UA 1A5SA 2GDVA 3RG6A 1JF6A 3FCPA 3OGSA 1IHIA 4K8HA 1DJWA 2HEJA 1FHVA 4MWAB 4ADUA 3AUOA 3FXYA 4BCEA 3W85A 1TZZA 4NP7A 4YWSA 1W8GA 2PWGA 1GVSA 3SCNA 2DJXA 3W1AA 4NHVA 3NQGA 5A2AA 3WKZA 3AZSA 5E93A 1XISA 3ITGA 2INEA 1DTUA 4XAZA 2PDJA 4FXJA 3NQFA 3GWQA 1MUMA 2YBUA 3L68A 3P14A 3CT7A 4DBWA 4XIMA 5EMMA 4A22A 4EIVA 3GLCA 1TG7A 4D6IA 1V6WA 3L66A 1O95A 1XYMA 2WMIA 2JE8A 3H2CA 3E0IA 3OEXA 3QJAA 5KEZA 4IG2B 1EDTA 5HATA 3WH6A 3I6TA 4JL1A 4LPCA 4HKPA 6TAAA 4NF7A 3GD6A 2CBUA 4XKMA 3CPRA 1JDDA 4Y8EA 3B9DA 2E5CA 4JTKA 1MW0A 1AUSL 2HVNA 1VCFA 2E7FA 3DC0A 4CVUA 5CSSA 1C93A 1RD5A 2VEPA 2YXXA 1IV8A 1RH9A 1YRRA 1YMYA 2PDPA 3PUGA 3CYJA 4XD6A 1K77A 4EPKA 4A3YA 1ONRA 3W7GA 4NXSA 3I7SA 4AISA 5BRQA 1R2RA 5CPSA 1RPXA 2ZQ0A 1S2AA 3IEBA 1FWWA 3WQ6A 2E5BA 3WD2A 1CGUA 4QQUA 3W1MA 1PSCA 1JXJA 2FQIA 4GUHA 2PGRA 1K9FA 3TN3A 1DJGA 3FVMA 1PJ9A 3BCJA 3S5NA 2JKAA 1YTKA 2AMGA 4MB5A 3MZ2A 3QV8A 3NNTA 4UTHA 4L9XA 4O14A 4D1IA 4AD2A 2FZ8A 4UCGA 4KGJA 1RA5A 1TR1A 4BZYA 3GYEA 3DYMA 1CW2A 2PWHA 4HSHA 4AXKA 3M0HA 1OBAA 2W67A 4ZOBA 3NDYA 3F4WA 3ECQA 3VINA 4WDUA 5F2MA 3NQDA 3MCMA 4W8AA 2DZWA 4W89A 1W9VA 2XUCA 3WK0A 4XVEA 1E56A 1VB9A 1IIHA 3R58A 3V16A 4D6DA 4D9PA 3AS1A 1BPLB 2HJPA 4Y9AA 2PTYA 3TSBA 4UQCA 1OK6A 2BY2A 2C79A 2QJNA 1ZLPA 3HGJA 3AIBA 3URBA 3KRZA 5CJMA 4IMAA 1ODZA 4NJKA 2FVMA 1R6WA 2DIEA 1LQ2A 1V0KA 1PUDA 1UIOA 4Q4PA 3GZ3A 2OEKA 4Y8FA 4WZHA 3BXWA 3OLEA 4LALA 4N2YA 4YTUA 4GI8A 3BLIA 1S1PA 2DZBA 4OBTA 6ENLA 3QR0A 5HR7A 4JEJA 1PKLA 1M41A 2NUYA 2XVGA 1DWHM 3SQMA 1R85A 5AZ1A 2G3FA 1AL8A 1EUAA 4FNTA 2HXUA 1MI3A 4MADA 3ARWA 2PZNA 4EE9A 2CLMA 4IQEA 2EKCA 3HOJA 4GISA 4GI4A 3HBLA 2WMGA 4O16A 5JVLA 5LXXA 2QVNA 4ACZB 2RDUA 2YFOA 2DUXA 2O9TA 3VMNA 1XFBA 1NFGA 3GTNA 1P0EA 3K5XA 4Z1DA 1R3SA 5IM51 1JZ4A 2D24A 2EG6A 4Z2LA 5BMXA 3A13A 3GVWA 5FJIA 3EWZA 4XZ9A 2QUVA 3M0IA 2VEKA 5C5YA 1OIMA 4AWTA 1IEQA 4E8CA 3WNPA 1KV8A 5I6SA 2Q8XA 3FDKA 2CKRA 4DF2A 4GCXA 1KQYA 3R8RA 1QPOA 1OFAA 1JZ8A 5CPTA 1LUCA 3DFHA 2A0NA 3HB9A 4JDBA 4GH3A 3NPXA 4L64A 4GQRA 3FIGA 4CU7A 3W02A 4XD3A 1Z42A 2LLEA 1UHVA 3VNMA 3SGZA 3UJEA 1O94A 4KGLA 1HO4A 4ORMA 4JEQA 1J0JA 2FVKA 5FJUA 1PAMA 2OTDA 4B2DA 3KE0A 1RAKA 2ISSA 3SCQA 5CGTA 2PUZA 3EEZA 2FJUB 4I6VA 4AZGA 2W79A 3VNIA 1W9XA 3GFXA 1K8YA 1V3HA 1XHGA 3W1LA 4H8NA 1I0BA 1KXTA 1LJYA 1UW9A 2YYTA 3W2LA 3WQWA 5F7UA 2ZIDA 4MY8A 3PNUA 2GQ9A 3V3WA 1TUFA 4QM1A 1AQ0A 5A8NA 2HDJA 2YBVA 4MUZA 3GIYA 1O5KA 2V69A 4Q8OA 3DESA 3RCNA 3CJPA 5I79A 2PU0A 1LF1A 5LNWA 1DIDA 5J8LA 4HYRA 1M9HA 4GGHA 3P82A 4XO7A 3TQVA 5E9AA 1CDGA 4JICA 3G6LA 3A12A 4YPJA 2X40A 2DZUA 1WCGA 4IJRA 2DSUA 4H8VA 3DHPA 4XZNX 3CHCA 4PTWA 1NDVA 3QZAA 3MBFA 2E77A 2G50A 3NM1A 4LYQA 2TYSA 4A2RA 4L6HA 3RILA 3EEGA 1V7YA 3NVTA 4PL2A 2DH2A 4MWAE 3TFXA 1YBQB 2J8GA 2YL6A 3UZJA 4FNPA 4M80A 5I02A 4XIAA 3L4TA 3EA3A 4UQDA 3AHVA 3SCRA 5BXSA 3T05A 1J6OA 3NQMA 1EJWC 3QC3A 3CUHA 1KBIA 1TB3A 3F1QA 1J11A 3UJRA 3W73A 4ICCX 4K7VA 1UWSA 4GIAA 3O9NA 4Z2JA 3WLPA 1TREA 4G1KA 2QMJA 1FH9A 1HJWA 2G3JA 3GUGA 1D2KA 3ZSTA 1E9IA 1V02A 4QEHA 1ODUA 3GKFA 1HIZA 2XVNA 1RUSA 3W84A 3NO3A 4C6MA 1W5PA 1EJUC 4GYKA 1QCWA 5B80A 4DZHA 1TPB1 1TVLA 2HTMA 3TYDA 4DYKA 3H7VA 1BTCA 3ZXWA 3TTYA 3NO1A 2R1NA 3PZ9A 3FYPA 5L6UA 4P7LA 1ZP3A 4PBEA 2VC7A 1TZ9A 2GVLA 2WK2A 2ZRUA 4H2CA 4YL2A 2HPIA 1NFPA 3QW4B 4KWVA 3S83A 2OOGA 3PF3A 4PEKA 5FEPA 4IGMA 2GUUA 3RR4A 3PBYA 4KERA 2GSEA 1TA3B 2Y8VA 1QATA 4P7NA 1IYXA 3OLGA 2HROA 2ZRXA 2JEQA 3NGJA 1KM0A 3KCOA 3NPWA 2WWCA 2XU2A 3L67A 2J6XA 1CXHA 2JKPA 2X16A 2QULA 4WLCA 3GH5A 3OVRA 3QW3A 3BLLA 2B7OA 4MAZA 3RYSA 4R9OA 1S5MA 1GOXA 1SM9A 2P53A 4AVOA 4DWDA 5A6MA 4NILA 5IOBA 1Q6OA 2YDAA 3O8AA 1FP9A 2UBPC 1NM9A 3G18A 1Q6RA 3E74A 1KNWA 3TA6A 4JIRA 1CGYA 5XINA 1TRDA 4RPPA 1WAUA 1O5QA 1VBGA 2P3ZA 3U2ZA 1KGUA 1EFZA 5A6KA 4C6IA 1F74A 3KL3A 1OFEA 3DYOA 1FRBA 4ERGA 2C6QA 1PXGA 2F2HA 4JNZA 4IIEA 5DMNA 5HXMA 5GNZA 1R30A 4MKVA 3TR9A 3GKAA 2WVVA 1B3VA 1OYBA 3CHFA 3AU2A 3CNYA 4UMBA 2J7DA 4C6JA 1XGZA 1XIBA 3WF4A 1KCLA 3PC0A 6CGTA 1SUXA 4RLIA 2CKSA 2GSHA 3KBSA 2HK1A 1W56A 1F8MA 2ADAA 2ZCGA 3E3HA 2Y0FA 5AYYA 4QGCA 1VLIA 2VX5A 2OKOA 2WQPA 2ATSA 4LVGA 3VKAA 3VD5A 2PSNA 3OA5A 1YQ2A 3OPSA 2Y8UA 1FWEC 4H9YA 3RNDA 4X22A 3VIPA 3IIVA 4PUEA 3VKDA 1OM0A 3STPA 3SUVA 4WHBA 5SWUA 4PBGA 2VZVA 1NOFA 1K7XA 1EC8A 1VLWA 3HV9A 4QEEA 3D3AA 1I75A 3BICA 4X3ZA 4U28A 1W31A 1R9ZA 4Q7IA 4ZOEA 4F9DA 1BQCA 2PODA 4HNUA 3B40A 2VC5A 4CLMA 4FXSA 3SR7A 3LV5A 3EB3A 4D1JA 4RW5A 3QY6A 4GXPA 2WWDA 3VCCA 2BY1A 1EGMA 1MQRA 3S5OA 1V77A 1NWUA 1EWEA 4M7SA 4JTLA 3ANUA 3F4NA 1TWZA 4AHQA 4QG9A 1BRLA 3KVJA 1UPMB 4GNKB 2O0TA 3GR8A 5BOEA 2WMKA 4JX6A 3I7RA 5G4EA 3WLKX 3GHSA 4I7WA 3M0YA 3EDKA 1JL8A 3HG2A 3RK8A 2VC6A 4QJ5B 4QBXA 4IPPA 3WFZA 4DBUA 3XINA 1W3KA 2CXGA 5A8PA 3ME3A 2YDQA 4LFYA 1UR0A 2D0FA 3WD4A 5AC8A 2QF7A 1I2QA 2W6RA 3GW0A 4AF0B 3PY2A 2NVDA 1Q13A 2Y7GA 3FJLA 1XS2A 6REQB 2ZKMX 4GJJA 2XH7A 4GYPA 2WJZA 3E5PA 1XG4A 1OCJA 1KB3A 4UQAA 3BTNA 1QASA 4C7GA 2VRQA 2P0OA 4RPQA 3VOGA 2PTZA 4IUGA 5HNUA 1OVDA 3ARUA 2ZUUA 1T8XA 1W9DM 1GOOA 1XLAA 1TFVA 4QQ3A 4F2UA 4L65A 4PRRA 3NZGA 1PBGA 2HQAA 2YZ5A 3QMSA 5AY7A 5CAHA 1KTBA 4N7QA 1IWBA 1KD0A 1HVXA 5DMMA 5AN7A 1UOKA 2QJGA 2Y7FA 1LBMA 3I4KA 2FZ9A 4NYYA 4K38A 1H5VA 4Q4SA 1EHAA 5HNNA 3ITYA 4KIEA 5I24A 2QCEA 3T07A 3LSCA 2OYMA 5HPCA 3PPHA 4C7FA 5F2GA 3ALGA 1WKFA 3HF3A 3VM5A 1G4EA 1QPNA 3WK1A 1WXJA 2G97A 1NIUA 1TTQA 4W8LA 2XWEA 3FA3A 3F5LA 1B5TA 4AUBA 4FF7A 4PTNA 4XAPA 1H50A 3UXKA 3AMGA 3BGJA 1LT7A 5PTDA 2DSZA 4WXYA 3IACA 3DI0A 2ESCA 3ZJ6A 2DQXA 2Q02A 3H26A 3N2CA 2FTWA 3IVUA 1CWYA 5HQEA 3G22A 2J6VA 3OZOA 5CG7A 1DHPA 3A4JA 5K9DA 5I23A 3KVKA 2I7GA 2CU0A 2WCAA 2Z7GA 2W4XA 1U5VA 3FYOA 3DFQA 2VFDA 4OBRA 2OCZA 3DOPA 5CSRA 4UTMA 3ISIX 3N2MA 1ZBVA 1IGSA 4O57A 3TX9A 2NVAA 3UPMA 3HM7A 1FWSA 3C61A 3A64A 3LCLA 3FAXA 3FS2A 1BVWA 5D37A 3UFYA 1PTDA 5TIMA 1K3UA 1XG3A 1ZAHA 1H62A 3BW2A 2EEXA 3QHNA 5HNRA 3PZQA 4AAJA 2E28A 5HJYA 3CZ8A 4YMZA 4ORIA 4E5TA 4IWWA 2DQWA 1UD4A 3CAKA 4ONVA 3QV7A 3VIKA 1PHWA 3BSGA 2XGZA 4JTIA 4GCAA 3UEQA 3SW6A 2R14A 2I1OA 4Q8NA 1G4SA 3RMJA 3TWAA 2GGHA 5H91A 4G8TA 1X1ZA 1KBBA 4PCFA 1HKVA 3GUWA 3LCXA 3QRHA 1VFSA 1AQMA 2D73A 1S2VA 3VGGA 3HPZA 2WZEA 3T42A 4HK7A 1I2OA 3E1F1 1UR3M 4ZO6A 1AH3A 3RPMA 4JTEA 3UWVA 4WXZA 4AQLA 2ZXBA 1DJXA 4S3GA 2J4GA 4AIBA 1FCUA 3TQKA 3WMSA 3LYEA 3TIMA 4E38A 4CNOA 1XBYA 1I1WA 3EGJA 4B90A 1A3XA 1W3IA 2Q6ZA 1ZJHA 1JDEA 1DYSA 1JZ7A 3KHDA 4OIFA 3ITTA 3TYCA 1EJTC 2G5WA 3PBUA 3NA8A 4C6NA 2O9RA 4H6QA 3EPNA 1Z48A 3M7WA 2NZLA 2DVXA 3I7QA 3WNMA 4MKNA 2DORA 4OV4A 3MI2A 3ENLA 2J13A 3ITVA 3TROA 2CIPA 3H12A 1GT8A 4JIEA 5E6YA 2I5QA 1W1A1 2Z6JA 2DEPA 4PTMA 1F61A 4P7RA 1QOXA 3BG9A 2X8RA 1P0KA 4D6FA 3VMPA 1RVGA 3WFLA 4HP5A 3PFMA 4KFOA 4NX0A 5U7SA 4CCZA 2RHGA 1H1ZA 1X1OA 4ERAA 1DV7A 2E40A 1MZRA 1EXBA 5AHNA 4YNGA 2YDSA 2VTFA 3GNXA 4RJEA 1M68A 2RUSA 4BS0A 1YEYA 3SDOA 5H2ZA 2ZUTA 4GIEA 4JNMA 2W9MA 1R3VA 2R24A 2ZA1A 2HE8A 1XCWA 2X2GA 3CPUA 3A3XA 1L8PA 4LAKA 4ZCWA 4ZQCA 3EAUA 1SGJA 4DUVA 3L5AA 1S5NA 2EJAA 2INFA 1V08A 4TOQA 4FP1A 3VNYA 1TYGA 1UKTA 3BLPX 4PRWA 4HCLA 1JIBA 2PDMA 4K1GA 1I60A 3H2MA 3RO8A 1R7OA 1FUYA 4FX8A 4WY0A 2PDBA 1Q8JA 2VR2A 1NP2A 3U3HA 2WZMA 2EGZA 4XD5A 1DE5A 3AYTA 3RHGA 4ZFMA 5TF0A 3CL7A 2P10A 2FZDA 3PR2A 2WPGA 1KXVA 2EJ1A 3BDKA 3FK4A 4OBSA 3RLUA 3WEOA 3OYZA 4HNVA 2BG5A 2JIEA 2PI6A 3MMWA 4QISA 4CN1A 5AYBA 1VFMA 3E5BA 4PUNA 1DWFM 1SYTA 3POHA 1M65A 3NTYA 3BG3A 2DW6A 3V18A 3FX4A 4PUKA 4KT2A 5A94A 4HNCA 2F6XA 4B9YA 5D30A 5AECA 2Z27A 1WV2A 2PS2A 2V63A 3DDMA 1BLIA 1QI5A 1ONXA 2G96A 5A6TC 3B8WA 2IQDA 2PCEA 4ZE5A 3WDQA 3ZIZA 1G1YA 3GYCA 3I3BA 1B54A 4YIWA 1IF2A 4EXAA 4DQWA 1BVNP 1G6CA 3GAKA 1F4HA 3FFSA 3AMLA 3ZYZA 3P80A 4HU3A 1JG9A 3OVGA 2ZUNA 4LQ1A 1KFJA 4DM2A 2CBVA 3MUIA 1L6YA 5HJLA 3IRDA 1F4AA 3KS5A 1GJUA 2BDQA 5I03A 5T91A 3WBXA 1WAWA 2H3DA 3W7OA 4W84A 3MKKA 1GONA 5LNRA 2A79A 4IIGA 4GIYA 3REQA 1Q4WA 4GVGA 3VUSA 5IFPA 4H1ZA 3GTFA 4QS6A 3RIKA 2OEMA 1B2YA 3I65A 5BYWA 4PEEA 4EAYA 1J2WA 1VBHA 2NV9A 3HPXA 3TSDA 3OGVA 3NM3A 3JS3A 2IPGA 3CH0A 2Z1VA 3P0WA 3P84A 4ML9A 4ZBCA 2J88A 3H70A 1WZMA 1VC4A 1Y5VA 2Y70A 3MW7A 3SUWA 1TCMA 4UMAA 3JRKA 2WM0A 5A8GA 3GS6A 3GFZA 4L6DA 1QTWA 3WK3A 3HO8A 3EDFA 4W7UA 1IEWA 2XVKA 3CWNA 1ZZMA 2BASA 4UR7A 1ME7A 4IMEA 4JFVA 4KETA 4UFIA 1H7OA 2BOFX 1C90A 3T0TA 4TV6A 3MJYA 1Z69A 3K8KA 4A3HA 2FPTA 1QOQA 1SVDA 2P50A 1Z9AA 4IQDA 5A6AA 1UD8A 3DENA 2QGHA 6XIAA 4MB1A 2WJDA 4H41A 4H2HA 3WBWA 1A53A 2QCMA 1P6WA 3KRBA 3G1HA 3H53A 3EX6A 4EWJA 2WB5A 4GYJA 1QNVA 3TVAA 3IWPA 4PUWA 4S2CA 3FEQA 1HN1A 2I5IA 3CUZA 3VD4A 2OEJA 3E9AA 2DZSA 2ZX9A 3TUUA 4NZCA 4CD4A 3INPA 3MSGA 2W92A 1XCXA 3WH8A 1VENA 1MNZA 1VCGA 3VE7A 1JPMA 4YYFA 4AW7A 4HYVA 2DZAA 4B15A 4ZXLA 2H6RA 1C29A 1DWIM 1S2UA 1YNYA 3DFSA 4S3CA 1EHNA 1M3UA 3BGAA 3NDZA 1ISVA 5I00A 4GO9A 3W7KA 1EX5A 2IPWA 4ZO9A 1FWRA 2FB3A 1Y0EA 4JTRA 1UKSA 1FBAA 3OIHA 1K8XA 3CWHA 1Y5WA 1G7VA 1H09A 4HHMA 1Q6GA 4PMYA 1VHCA 4DUWA 3SRKA 1L9WA 3WLMA 4MUPA 1UWUA 4DWSA 3GZAA 3GVQA 4NG3A 3PULA 4ZXOA 1RZMA 2I14A 1FWCC 3OW1A 2Q8LA 2GJLA 4RW3A 4F9JA 3FXGA 1C7TA 5FEWA 5CH9A 2A3BA 1F73A 1H7RA 3WQCA 4MNJA 1UP2A 3NO5A 1PL9A 4QAIA 2EAWA 4PB4A 5CJ5A 3DGRA 3LTYA 2FDMA 2ZUWA 1GTHA 3VGDA 3M0KA 3T2PA 3W53A 3R2GA 4Y2WA 5HANA 3PJUA 3RO6A 3P74A 1B3XA 1UR8A 2ABBA 2YPIA 2E67A 5F4SA 4QX4A 2GOKA 4UTWC 4B5VA 3R8GA 4NRSA 3BV4A 4O1FA 2YX0A 2OT0A 3H2OA 1XL9A 5CKSA 3WFAA 1G67A 3LTPA 4FOKA 5CC6A 2V8ZA 1GZGA 3GE7A 1UC4A 1KKOA 2PEVA 3MV01 3GG0A 3VIGA 1JUKA 1LRQA 2EG7A 4H9VA 1U83A 5FKYA 2BBFA 4AIEA 3I4EA 3UERA 2BV9A 3O6YX 5XIAA 4WDXA 3F4DA 4YJ5A 3OLDA 5FAGA 3NQVA 4P5UA 4K36A 1KWKA 4J40A 2ZUSA 4L5ZA 1VBRA 1GHSA 4IL2A 3LPFA 4XAFA 3K30A 1R2TA 1DQUA 4IL0A 3G3MA 3N17A 1S3HA 2GVGA 1LT8A 1ZPTA 4Q8TA 3WN6A 3LPGA 3NPVA 3CUXA 4RDWA 4BA0A 2VUNA 2WHLA 4IPLA 3B8VA 1IWPA 2Q09A 5T9BG 2RH9A 3ZZ1A 3TTQA 2ABAA 1F8IA 4HGXA 3PB0A 4M6QA 4AIOA 3R12A 5BXRA 3H23A 4J3WA 4HA4A 3SN4A 3SI9A 1XINA 4N4QA 3U4FA 1X38A 1VRDA 4HMEA 4QLKA 4HHLA 3ZVHB 5K7JA 3B0YA 3BZGA 1AODA 4JQ4A 1A47A 1PX4A 3T09A 3IUHA 2X09A 1A5UA 1FWFC 3EKGA 3VO0A 1JUBA 4OOZA 3N9RA 1ZGDA 2C8NA 1MMFA 3HPAA 4GLEA 1THFD 3T55A 2NQHA 4Q32A 3P0XA 3WEZA 4A6GA 1UOZA 1GYMA 2FIQA 1AL7A 1TRIA 1NOWA 1KW1A 3D5HA 3EDJA 1XC4A 3IGSA 2E1WA 1YPXA 3TJLA 1UQZA 3PPGA 1RCQA 2VD9A 5CZSA 3G1RA 4Q4RA 4US6A 4ZENA 4NRRA 3VDHA 4UFLA 4JTCA 3HQOA 1A5OC 3W22A 3BC9A 3QVQA 2ATMA 5CZ0A 3YPIA 5HWNA 2X7WA 5M1TA 4OOUA 1V51A 2DT1A 1IEVA 3WNOA 1IZJA 2HVOA 1B3ZA 3IRSA 1MO0A 3E2VA 2JQXA 1UJPA 2PDIA 1SPQA 3R13A 3BL3A 2PP3A 1ZL1A 4MY1A 2Q3OA 4O0KA 3NG3A 3PJXA 3UP8A 4WCJA 4KKXA 3M46A 5DY3A 3G8EA 2XWDA 3OB8A 4FNRA 4E4PA 4O12A 1JEZA 2BOEX 3L0NA 3N34A 4FIQA 1I1XA 2FMNA 2YW3A 1EA9C 3C86A 4IGNA 4ZB2A 3IARA 2ZXQA 1UZHA 4OKDA 1O1HA 4YVVA 4C1NA 2NQ5A 3VXGA 1XDLA 1WUEA 1CT5A 4K39A 3VK5A 4B5XA 4XQ6A 2C91A 1T0OA 2BZNA 4CQAA 2IXUA 2VP8A 3NQCA 2Y1HA 4LNCA 1RPKA 2QDEA 2BLEA 1J4EA 4DJFD 1U30A 3UU0A 2X1TA 4S1FA 3MUCA 3A5VA 1KRBC 3T7VA 1RJRA 4MOZA 1Q5MA 1HJVA 3RAOA 4PCTA 3GB6A 4DELA 3F4VA 3KVLA 1HKIA 2DDXA 4W85A 4FXFA 1PPIA 1DVJA 1WBJA 4GPNA 3BSMA 4GO8A 1YNQA 4LS0A 2ISVA 4M51A 1YDOA 4BJHA 1F6KA 4UTJA 1Q6QA 3HURA 4PUMA 3LBOA 2EXOA 4WOZA 1DEDA 4QNEA 2NSOA 4PFHA 3C2OA 4U3AA 3G77A 2HBVA 3AYRA 2IKGA 3XISA 4AZ7A 3CIWA 2XDFA 4HA0A 4O52A 2XIQA 2PP0A 1E55A 3AXKA 3L7RA 3EMQA 5EY5A 4DHGA 2B7PA 3N15A 3PUOA 2AAMA 4LC6A 3TJIA 1TWWA 1US0A 1MW1A 3E2SA 4PUDA 3CU2A 2PWUA 1GK8A 3ARTA 3KHJA 4XZIA 5C9UA 2PGEA 1P1MA 2NWRA 4ZQMA 3T6CA 1TPEA 3SQLA 4FXRA 4B3ZA 1ZFJA 2Z24A 4KRTA 3R79A 1TPUA 3TYBA 4HN4A 1ZNNA 5KZEA 4N9CA 5JIPA 2AKZA 1R38A 1CEOA 4Z2IA 3AHXA 3GXDA 5IFTA 2W27A 4JKMA 4CCCA 3WUEA 4ROQA 2P1FA 3N73A 2F9RA 3S2CA 3NL2A 3PB2A 5F1VA 1GVQA 2WNQA 4KCVA 2ZDRA 5BCAA 1CB2A 4FI4A 2CLEA 3MUY1 1QO2A 1VFLA 1LRNA 1A5MC 3HA1A 2B7NA 3J7HA 3MSDA 2QMKA 3JR2A 3M0LA 1R3QA 1TMHA 1OX4A 3EX1A 2C19A 4O54A 1ICQA 5FF4A 1AQHA 1N2VA 5CZJA 1OT1A 4MJ4A 2UY2A 1FH7A 4M24A 4DM1A 3LQGA 3MUZ1 1H51A 1EL3A 1GKRA 3VFCA 1SQ7A 4UOJA 1FP8A 1HZYA 2DIJA 4D8AA 1D8CA 4AZ5A 5H8MA 1XIHA 2R1LA 4KBXA 3BAWA 3DC8A 4OV9A 4MFEA 4I5RA 3B9NA 4DJFC 2NUXA 4WVXA 3WF0A 3TEVA 2Z26A 3A4XA 3S2LA 1E0XA 2OZ8A 1F3WA 2XTKA 1IXQA 1NJJA 1J0IA 1MFUA 4GZ7A 1GHRA 4F0LA 4C6LA 3OG2A 5HNTA 3TTSA 3WF2A 3W71A 1UROA 3LK6A 1REQA 3AC0A 4JOMA 3ZJKA 4BF7A 1Q85A 2E3ZA 2Y61A 2BGNE 3FEMA 2HNEA 2O56A 4UNLA 4YTQA 4DLFA 5BZAA 3LU2A 3QYSA 1FFQA 2FMOA 3FYYA 1TTJA 1JGMA 4A8LA 1Z3NA 3NZPA 1AZ1A 4U5KA 3DKJA 1BWLA 4MWAA 3GDRA 2J7BA 4NAEB 2Z1SA 4B5NA 4GK8A 4AFYA 1BGGA 4UTTC 3DX5A 4S2BA 1NAL1 1B30A 2VGFA 4DYEA 4ROPA 3KBMA 1H63A 1F5ZA 3O2LA 3N19B 2XVPA 5CPMA 3MMDA 3V75A 2YYUA 3WF3A 2YIHA 3M64A 1SSGA 4HPXA 4IG2A 3EDEA 4I9JA 1LG1A 1JPIA 3HIJA 1FKWA 3DBNA 3L21A 4DNMA 3R0KA 2WCGA 4RNIA 4QLJA 4ZL1A 1JXKA 3E96A 1OHLA 3W7EA 5CSUA 1ECQA 3CGTA 4JKKA 4R53A 1DJIA 1XUUA 3VC6A 1M03A 4HOXA 3NAVA 3GFYA 2GJPA 4RR4A 4JTSA 3TSMA 1I0DA 1CXKA 2NV2A 3C0SA 3GNPA 3VD3A 1FCBA 5CJNA 4LVDA 4TU1A 1XP3A 2A7NA