1KFEA

Crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with l-ser bound to the beta site
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
268
structure length
252
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the Role of AlphaTHR183 in the Allosteric Regulation and Catalytic Mechanism of Tryptophan Synthase
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 96
structure length 252
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfeA00
4OE7A 1EEPA 3NQ8A 4EWND 2NUYA 3UPWA 3IVUA 4MKNA 4S2CA 3LHYA 5E93A 1A53A 3BO9A 4O16A 3C8FA 2PC4A 3LLDA 4HN4A 1SW0A 4A2SA 2GQ9A 3W1RA 2X1RA 4WUIA 3I7QA 2OZ0A 1WA3A 3LCHA 4LVAA 4LWWA 1ZJIA 3QMTA 4WJEA 3IEBA 4MZ1A 2QKFA 1LBMA 3M5VA 5LSMA 3MHUA 2B4GA 4E0CA 2WNNA 2H3DA 3NPXA 3B0VC 1EP1A 1TREA 2J9YA 2NX9A 3SECA 4LV9A 2GPTA 1WDWA 1P5BA 3C4UA 3PC0A 2E09A 4H6KA 5K4ZA 3UXAA 4O4VA 3YPIA 4FX7A 5L9FA 4JD4A 3HG5A 2VFEA 4UIOA 3W7KA 2G96A 5CGQA 1JUEA 1YTDA 2A7RA 1W5PA 2QCHA 4FIRA 3PB0A 4UTMA 3PS7A 1VJIA 3N14A 1EX5A 4HT3A 4OQVA 1M7PA 1FUYA 1YXCA 4QJ1A 3RF9A 3RU6A 1ALDA 3QEZA 3W1LA 4ZQOA 5C2XA 2DZVA 1ZY9A 4FNTA 1I4NA 4X3ZA 2Z0IA 1VCFA 4JTSA 1SO3A 4GBUA 3UZJA 2A2IA 1S5WA 4DO5A 2Y7GA 3TAKA 1ML1A 3GLCA 3LERA 4IXHA 1QR7A 3IV3A 3NM1A 4NJHA 4DBDA 4MLJA 1IXPA 2ZDRA 1QCWA 3NQCA 3WK1A 3MUXA 3G8RA 3MI2A 1VCGA 2HTMA 4MOZA 1YXDA 4K37A 1H61A 3KVKA 4NJGA 4FO4A 1DJQA 1AK5A 1QAPA 3PBYA 1Z42A 2Q8ZA 1T96A 3LCXA 5AHFA 3B4UA 5U7SA 3GDMA 3MP5A 3SW6A 2CZ5A 3KRUA 1MZHA 1GT8A 1DQXA 1ZALA 4JIQA 2XFWA 4XBKA 2VFIA 4LUJA 1ME9A 4UFJA 1W0MA 1EWEA 2B7PA 2RDWA 4RZ4A 1Z41A 4QIUA 4OV4A 1LM1A 3UQNA 3O06A 3S9YA 1LBFA 3B06A 3QM3A 4UTJA 3B8DA 3A5VA 1OX6A 1FX6A 3FJ6A 1JCXA 3L5MA 4FF7A 3LCWA 3N3MA 2ABBA 3KRSA 4Y90A 3UXDA 3MP4A 1QPRA 1LZOA 4EVZA 1P4CA 1OVDA 3G1DA 4MIMA 3EXTA 4NQ1A 1RZMA 3BLIA 5G5IA 3L65A 1OFOA 1QO2A 2QAFA 1YTEA 4N6FA 4DPQA 2RH9A 3CEPA 2VFGA 2UV8G 5LHFA 3O6DA 4CCCA 2WSQA 1TO3A 5D05A 3S5ZA 3E9AA 3LBCA 5G2IA 2I14A 3DFNA 2FIQA 3HJZA 1JCJA 1WAUA 1ADOA 2WPBA 1J2WA 4CNNA 4K7VA 3TCEA 4RZ5A 3TJXA 2P1FA 1CI1A 4K6AA 3UD6A 3HIJA 3HGRA 3P8JA 1TCDA 1W5OA 4ZVJA 3TSBA 3GDKA 3W6YA 3DFOA 1OFDA 1JVNA 4CQAA 2BXVA 3BK0A 4RKAA 2B7OA 2X2GA 4BWLA 2VEPA 1KM1A 1OFQA 5D38A 1ZCOA 3M7WA 1GYNA 1LOQA 3RNDA 1UCWA 2ZZ4A 2C13A 3TW6A 5K9DA 3W2LA 3A22A 1QPNA 1KTCA 4LW7A 3I65A 4NZFA 3T7VA 1JULA 4HSOA 1G4PA 1K02A 1THFD 4J9JA 4FXSA 2FLIA 3ABOA 4OHQA 4DELA 2Q3RA 1Z44A 3CIXA 5F1VA 1C8VA 5K3VA 1O5XA 4JEQA 1RD5A 4JICA 4JNMA 3P61A 4LS1A 3LRLA 4WXZA 3WJXA 1SR9A 5CG7A 2PRHA 2R14A 3G0XA 2GQ8A 5AC7A 4MY9A 1VZWA 3TQKA 5AHNA 4O14A 1D3GA 4HNUA 2EKCA 5FF3A 3IGSA 4DF0A 1H7OA 1H1ZA 1OYCA 4NNCA 3TR2A 4JX5A 1KLZA 3W75A 5T26A 3NR0A 2DZWA 3V1PA 3HG3A 5HULA 2J9ZA 4WD0A 4MLRA 1OYAA 2V2HA 2C1HA 2GVLA 2Z6IA 2EPHA 3BG5A 5L6UA 4TIMA 1A5SA 2ISWA 1GZGA 5D33A 2OX1A 3NQAA 1JR1A 1G4TA 4IMFA 5FF2A 1YPFA 1K8YA 4ZL1A 1B4KA 3UY8A 4YWIA 3TV8A 1L2UA 1SW3A 4M7TA 3R2GA 4QSHA 4POCA 5D30A 1W54A 1DJNA 1OX5A 4Z1AA 2FFCA 2ZQ0A 1TTQA 5G2WA 1I2NA 2ABAA 3NQGA 4IPJA 4IUOA 5F2MA 1H62A 4RCXA 4GUGA 4M5PA 2WOQA 3DH7A 3A24A 1ZAHA 3TC6A 1RR2A 3LTSA 2IQTA 2O7QA 1KBIA 3B0UX 1DHPA 5F4XA 3PBWA 3W1NA 1ICQA 2E68A 4AWSA 1SFLA 1FWWA 5LNVA 3DXIA 1GG0A 3MMTA 2H6RA 2PRLA 4E38A 1W5MA 2DZTA 5CSRA 5A8GA 1Q3NA 2NX3A 4GUFA 3NZ1A 1W31A 2HMCA 4K7YA 4N2YA 3TFCA 3S5YA 1YTKA 4TU1A 1JCNA 1P0KA 4QISA 1PV8A 1YPIA 1T99A 4NNAA 4GWEA 5AHMA 1R2TA 1SUXA 1BWLA 3GKFA 3DFPA 1L6YA 1SO5A 1J5TA 1LRQA 4A22A 2RFGA 3TX9A 4I9AA 5KZDA 1NEYA 1K8ZA 2Y6ZA 4AWTA 5LGZA 1XUZA 3P80A 1KM0A 4CQ8A 4NJJA 3PG8A 5FEPA 3LHUA 3QW4B 3G0SA 3TH6A 3GDTA 1SQ7A 4CQ9A 2ISSA 1TPB1 3C3NA 3NYZA 3N73A 3LCIA 3CQ0A 3LM7A 1O4UA 4RZ6A 4AHOA 3GAYA 2ZBTA 2BTMA 4KKXA 3GR8A 2EHHA 3DZ1A 1JRBA 5BMXA 1OK4A 1A5AA 2GJLA 3LXCA 4AH7A 3P7YA 5BW6A 3THQA 3WK3A 1L6SA 2E77A 3W2NA 3NPUA 2PRMA 3Q37A 4PA8A 2V82A 3BVJA 4JGDA 4XKYB 5FESA 3L67A 1GG1A 3VCRA 4MY1A 3QH2A 2CLKA 1KM6A 3O6YX 4JR5A 3WJYA 3HPXA 1F7BA 4O8RA 2FQIA 3MO7A 1UBSA 5F4SA 1SSGA 3M9YA 4RV8A 4MZ8A 5FEZA 1A5BA 3EX6A 1H50A 1DV7A 1K03A 3P60A 2QUTA 5BMWA 3HF3A 2DU2A 3LLFA 4ORMA 5CZJA 5SWUA 3UY7A 4UXDA 4JDBA 2NUWA 1U83A 2QCLA 1ZAJA 3MYPA 1UASA 3HQ1A 2EAWA 3UNDA 2VEKA 4UFHA 4Z1BA 3GKAA 2RKXA 3PWAA 3IVSA 1KW1A 1NAL1 4OT7A 3L0NA 4QM1A 1FCUA 2Y7EA 2OT0A 4ICNA 3UWVA 3SGUA 3C52A 4JIPA 4MUZA 2DORA 3LRMA 2NZLA 4FEZA 2A7NA 4WQ6A 4XQ6A 4BWLC 2KZHA 4JYFA 3N34A 1OF8A 2FTPA 4LVBA 3G1VA 1M5WA 4HPXA 5TBOA 3M47A 3PUEA 5EA9A 3ABSA 2RHGA 3EXRA 1GPWA 5KINA 4M19A 4LY8A 3NAVA 1E51A 4EF8A 2FJKA 4RLIA 3EWBX 5DXXA 1H63A 3BW4A 3LRKA 1KV5A 5F2IA 4KWVA 5EMUA 2LLEA 2WSRA 4KFOA 2V5LA 4DPPA 5K7JA 1SPQA 3GDLA 1N7KA 3LGEA 5DY2A 1OX4B 4XBSA 1I2OA 2CLMA 4UTUA 3O07A 3CIWA 1IIGA 4IJBA 2A1YA 3W88A 3A23A 2GVGA 4PTNA 3LTYA 2VC6A 1ZAIA 4N02A 3FFSA 5DCBA 5LKYA 2PURA 3LXBA 2E6DA 4O4WA 4JYDA 3M43A 5F2LA 1G67A 4HNTA 2DZSA 3DI0A 4O15A 4FNRA 1ME7A 5HJLA 3PY2A 1PE1A 2A5HA 5HINA 4LT9A 4UFMA 2QDGA 4CLMA 3JR2A 1HUVA 1SO4A 3NQ7A 3NXFA 4TMBA 3UZ5A 3JS3A 2ZA2A 1WXJA 2CLFA 1BTMA 4JTLA 4O54A 1OFEA 4XKYA 1W5NA 4MY8A 2JGQA 4FNPA 4XTDA 3IRDA 4DO4A 4UTHA 5LZLA 3IIPA 1FY6A 2B7NA 2ZZ7A 2V0TA 4LOCA 3QF0A 1QOPA 1H7NA 3T55A 5LNWA 2ZRYA 1SU5A 3QFEA 1TB3A 3R5EA 4N9EA 3PAJA 3C2VA 3C56A 4O0KA 1X1OA 1AL7A 5K9CA 3W2MA 4M6QA 1ZHAA 4O17A 4O53A 1AW1A 2EF9A 2QCEA 5HWMA 3S5OA 3W7QA 2C18A 1H7PA 5D02A 5DCEA 4AEOA 2X16A 4UNKA 3CTLA 2C3ZA 1U5JA 4U4MA 4JYEA 1QFEA 1JCLA 2NLIA 2CLIA 5HWJA 5LNSA 3HGOA 3P74A 1GVSA 3FA5A 1TPC1 1VYRA 4JX4A 3MBFA 3DBPA 3W87A 4E2BA 1ICSA 1F74A 1W3NA 3QSRA 2ZZ5A 3W1AA 5K2ZA 5LGXA 3INPA 3G1HA 3FKKA 3DU0A 4YXGA 1W56A 3M16A 3QZEA 2ZZ3A 3MI3A 2R91A 3B0PA 3W1XA 4FNSA 5IBXA 2ZTKA 4ZQCA 3UWQA 3FYOA 3STGA 1N55A 1TV8A 1G7VA 3S8HA 4CCDA 5F1UA 4O11A 4IMGA 1F76A 4UCGA 2WKJA 3DFTA 4L4MA 4L4LA 4AWUA 3MJYA 1FQ0A 1GTHA 4O50A 4JX6A 5D09A 4RK8A 4NVTA 3U8GA 3W7EA 3QPYA 3B05A 4ZZ9A 4M6PA 2BLEA 3C0JA 1H60A 1TSIA 5C55A 3E49A 3AJXA 1YDVA 1VCVA 5I3FA 4IX2A 5FI8A 5HUOA 1OX4A 1NF0A 3EEGA 3W7IA 4UFLA 2VFHA 1F5ZA 3EWUA 3I7RA 4O18A 2WJZA 1TTIA 4IQLA 3SZ8A 3GAKA 5DY3A 1I45A 3C2RA 3LHZA 1VYPX 5KSWA 3N2MA 3KOFA 4GUHA 4K39A 3O63A 3M41A 2W79A 4OV9A 1M7OA 3C61A 3I6RA 3W9ZA 1VQTA 2YFNA 4DEFA 3STEA 1D3HA 2TSYA 3Q58A 4JTEA 1UUMA 2Y70A 1RQHA 3GK0A 3BARA 2G95A 3PBVA 3TQ0A 1OFAA 4NXSA 4LS0A 3VKJA 2C16A 1W37A 3TU9A 1BWKA 3OEXA 2ZZ2A 1FCBA 3CWOX 3ZR4A 4KFNA 3E96A 5E0KA 4Y6GA 1GWJA 2B0MA 4BK9A 2P10A 5EKYA 1V5XA 3ABQA 2YFOA 4LRTA 4N6EA 4UTIA 3PF3A 4GUIA 4ZQPA 3QJAA 4LC6A 3BW2A 3H54A 5CPLA 3V75A 3LV5A 1O5KA 3W1PA 3ZS4A 2VOMA 4YCOA 3W70A 4IOTA 3LOTA 5DN1A 2GJNA 1VRDA 5K9XA 6ALDA 3RK8A 3N9RA 2E6YA 4XWUA 2OMAA 1I2QA 1LDCA 3MYOA 5KTLA 4GXMA 1ZFJA 3ELFA 1DL3A 2JKEA 2O7SA 3TXZA 3P5YA 3M5XA 1BEUA 4LVGA 1SSDA 1TJPA 3MI6A 3TMQA 3DFSA 3W84A 3IVTA 1MO0A 3TNOA 2VKZG 5AHEA 1GEQA 1WV2A 2DZXA 3O6CA 4HNNA 5AB3A 5DXYA 1EB3A 4LS2A 2A0NA 5FF4A 5EBUA 3W22A 4UC5A 3UWYA 1OJXA 1FWRA 4QAIA 1QDSA 2P0OA 3USBA 5AN7A 4UTKA 1A5CA 4UNLA 1VYSX 5I3HA 3O16A 3EKLA 1L9WA 5EL1A 3TA6A 4EF9A 3HMJG 3HG2A 4W9TA 1IF2A 4NUWA 4Z0JA 2G5WA 5DLCA 4GUJA 1B9BA 1LROA 3S1UA 4O1BA 4JTIA 4DF1A 4H4IA 1YLVA 1X1ZA 1XBXA 4UMBA 3M6YA 3KVMA 2WNZA 3IGUA 4UTTA 5I3KA 4D2JA 2ISVA 1WOAA 3OVQA 5G4WA 5ABTA 3BPWA 2RDTA 1C9DA 5I3GA 1KM2A 1B57A 5LHEA 3G1FA 3LBMA 5G1TA 1ZNNA 2FPTA 4JTUA 3NPWA 2E1DA 4DF2A 4CNOA 4JTJA 2YCEA 4WOZA 4ML9A 1J4EA 4PL1A 3GNNA 5C6MA 3FOKA 4TMCA 1P0NA 1TTPA 2JKAA 3W71A 3IIZA 4G1KA 3LXAA 5HUPA 3FYPA 2V2CA 1W8SA 3ATZA 3P5ZA 4UTLA 4PC8A 2X1UA 4A29A 2B7QA 3EB2A 2ALDA 5AYZA 1N8FA 1TPWA 3EX4A 3TJLA 3W83A 3G3DA 3LCFA 5IM51 2HS8A 2BX7A 3PVFA 4O13A 3W1QA 3KX6A 2YDAA 4PH6A 2CU0A 4MPQA 4I7UA 1EUAA 3M1ZA 3W2KA 4Z08A 1O95A 4AB4A 1SW7A 2Q8LA 3MBDA 1PIIA 4HHPA 5AFDA 3TK7A 4O10A 4LTSA 1QMLA 5KZEA 2Y88A 1XXXA 1EWDA 1KM4A 3THAA 5FF0A 4ADUA 3GNDA 1YDOA 2DP3A 6TIMA 4DXVA 3QMSA 2Q3OA 3QQ0A 5H91A 1XDLA 3S1WA 5MHBA 4FX6M 4WY0F 2H3BA 2TPSA 1Q6OA 4WX2A 1ICPA 4C1LA 2FPYA 3OIXA 3G18A 1LTDA 1FXQA 4N9CA 3E12A 3FLUA 3W1UA 3ZFHA 1OG0A 1F73A 2NUXA 4JTKA 3P8IA 3TQVA 3P84A 1IXOA 3WJSA 2H90A 2WV8A 3OA3A 5AYXA 5IBXC 1RQEA 2I1OA 1R2SA 5D2TA 1OFRA 3W7PA 1LBLA 1DKWA 3KHJA 1EPXA 2DJLA 3QQ1A 1VGAA 3TMLA 3W7OA 3TFXA 3EXSA 2W0UA 3NPVA 4UR8A 3TSDA 1H7WA 4PODA 4HNVA 3CT7A 3K30A 1TMHA 3LI0A 1GVFA 2BWGA 1Q6RA 4X2RA 2ZRZA 3AO0A 5LNUA 3LI1A 4B5NA 3C2OA 1XDMA 4BI7A 2Y63A 4BF9A 2OCZA 4OBTA 4AHPA 3T4CA 1EIXA 2ATSA 3FEMA 3RMJA 3SFKA 1JJKA 5KZMA 3HO8A 3QC3A 4JY9A 3A21A 4JS3A 3HOJA 4TX9A 3S42A 1BKSA 3ATYA 3SJ3A 2VENA 3NL3A 5CZSA 4O12A 2NX1A 3NQFA 2QF7A 1KFJA 3STCA 4M6VA 2V9DA 3EX1A 5CPOA 3P81A 3T44A 4Q33A 4XUGA 2ZRVA 1C29A 1PHQA 4A2RA 1HTIA 5DBTA 2VFFA 1HO1A 1JQXA 5D2VA 1O94A 5D04C 3OVRA 1Z48A 2BZNA 5AOUA 3UYCA 1GVRA 4MYXA 1MEHA 2CW6A 3L66A 2YR1A 1F6KA 3H53A 3SGZA 1XC4A 1WX0A 1XBYA 3GXNA 2CZDA 2QCNA 3L68A 1NSJA 2VFDA 3B03A 3P62A 3DGRA 4IGHA 1VHNA 3T78A 4O1DA 4NU7A 1KM5A 4QQ3A 3W76A 2QCGA 3NNTA 1NF7A 1VS1A 3HG4A 5I3IA 3M0ZA 2YW4A 4GC4A 1R30A 1AG1O 3SR7A 1FDJA 2V5BA 1TIMA 5CKSA 3DHFA 5KITA 2E5BA 2A6LA 1IXNA 1M6JA 3G24A 3OHIA 1LYXA 2DJXA 4X9SA 3W7RA 4FX8A 1TRDA 4O1AA 4JTHA 1ONRA 4N4QA 5F4WA 5HWNA 4UFIA 4U28A 1TPUA 3W7MA 3NVTA 1TQXA 1WBHA 4R33A 1TPDA 1CX9A 3F03K 2QCMA 5DBUA 4GJ1A 3KFTA 2ZRUA 3O05A 1LRTA 1H7RA 3FS2A 2E5CA 2A4AA 3LHWA 1QPQA 2BSLA 3KAOA 4Z1CA 3R89A 1OYBA 2C0AA 3GZ3A 1VHCA 4HIBA 3GX9A 1XKYA 1I2PA 3DKLA 5CPNA 4BFAA 1LCOA 3NA8A 4FXRA 4Y8FA 1DVJA 1EP2A 2YPIA 2ZYFA 5DELA 4JTGA 3LTPA 2JKPA 5BOOA 2CLHA 1TV7A 4Z0SA 4PCFA 2C15A 3NEVA 4S2BA 3Q94A 1HFBA 5EYWA 2VXNA 3W7CA 3W86A 2XN2A 1EUNA 2ZCGA 4K8EA 4UTTC 4YCPA 1GJPA 3GDRA 2Z6JA 3B04A 2NV1A 1KM3A 1O60A 1VC4A 3G1YA 3LCLA 1KLYA 1QPOA 1MSSA 2J9XA 1B4EA 2Y62A 3SSJA 2QCDA 4NX5A 3IGXA 1TPEA 3ZWSA 1XL9A 1JCMP 2VELA 3WFAA 3GVGA 4LRSA 1PVNA 2X1TA 4DO6A 1RV8A 2JGYA 2CLOA 2Y7FA 4A21A 3G8EA 2HSAA 4RXFA 1OK6A 1FWNA 1FDYA 2Y85A 4WXYA 3TKFA 3OBKA 1FWTA 1LORA 3L21A 3L0GA 3EWXA 3KRZA 1G69A 3DENA 3QYQA 1VLWA 1KTNA 4N4PA 3TW7A 2ZTJA 2ZZ6A 3S1VA 4IX0A 4TR9A 4M7SA 4AMAA 3S6DA 1LOSA 1QO5A 1TYGA 5U4NA 3A9IA 3UWZA 2GUUA 3EKZA 3GXTA 4KFPA 2VEMA 2R94A 4O1CA 3VNDA 2WNQA 1AW5A 4IMEA 3UWUA 4TO8A 3M44A 3OVPA 3HPSA 1X8FA 2QCCA 3DFQA 5KMYA 2NWRA 1LP6A 3NO5A 3MW7A 5HR7A 2QDHA 1GOXA 1GTEA 2JK2A 4AXKA 1OHLA 3L5LA 3NQDA 1SFJA 1SZEA 1FWSA 2QUVA 3W73A 2NXIA 4BI6A 1GVOA 3R12A 1K8XA 1R47A 3F1QA 2X1SA 3PBUA 4AF0B 3CPRA 3SI9A 5GVJA 3MWAA 3W1MA 4E2DA 1KFEA 5G2HA 2QJGA 1HG3A 2D73A 2FB3A 4ZQRA 1I8JA 3A5FA 1R46A 3GYEA 3UWWA 1ZENA 2C14A 1K7XA 3ABRA 4H3DA 4PEKA 1Q6LA 2GQAA 1UJPA 2G97A 1PS9A 4NJKA 2ZRXA 1FCQA 1OFBA 1H5YA 3G1AA 3WK2A 3CHVA 1WQ5A 3DAQA 1OFPA 3NG3A 1EP3A 1QWGA 3HPZA 4R7JA 1AL8A 5AYYA 4LU0A 3C2EA 1KTBA 3FIGA 4K36A 4O0ZA 3U6WA 1G4EA 3EWZA 3KVLA 1L6WA 1TPVA 2HS6A 3G0UA 4R53A 4EIVA 2YYTA 3W3OA 2A7PA 1H1YA 1X6UA 4C1KA 1A50A 2RDUA 4YLWA 1IIHA 5H2ZA 1S5TA 3S5NA 3CB8A 4MFEA 3IIOA 5HMSA 4KWWA 1ME8A 1KFBA 2NXGA 3STFA 2QJHA 3F4NA 5I3JA 1B3OA 2YSWA 1DBTA 2QUUA 3SY5A 4OU1A 5D2XA 4P2VA 3VE9A 3TSMA 4HSNA 3KVJA 5CPMA 4MFDA 3RFAA 1K3UA 4UTWA 1IGSA 5FF7A 2GOUA 1TPFA 1PL9A 3DHDA 3NL2A 4NNBA 1YXYA 3E0IA 3PSVA 1FDZA 3CWNA 1H7XA 2QEZA 2AQWA 4NX0A 4GE8A 3TIMA 4AHQA 4LVFA 2AAMA 2GVJA 1P1XA 4N9BA 3PULA 3Q2DA 1VH7A 3VE7A 1D9EA 4JXCA 3VFLA 2E6FA 1XBVA 1JRCA 1NFBA 2F7FA 3GB6A 3IIXA 3O15A 5HNRA 2X30A 2YGYA 3LCGA 1H51A 3W23A 4K8HA 4FIQA 4K38A 4X22A 4JY8A 4Q4KA 1V7YA 1XI3A 2ZA3A 3MP3A 4DQWA 2W6RA 5D37A 4IXXA 3TAOA 3G1XA 1HO4A 2PCQA 2J27A 1KA9F 3P67A 4MJMA 4ALDA 4JTTA 4YMZA 4JN6A 5D2WA 1G6CA 3OG3A 4AVFA 4O28A 3TDFA 1X7FA 3SIZA 3LB0A 3RLVA 4PL2A 3BG3A 4LV4A 4UMAA 4UMCA 2QCFA 1W1ZA 1W3IA 1OABA 1T0OA 4FHAA 4AF0A 3RLUA 1OF6A 3G1SA 1YYAA 3TC7A 2QAPA 1TV5A 4LNYA 4ZQNA 2VEIA 3D0CA 3L2IA 3EX2A 4FNUA 1SZFA 3GR7A 1DQWA 3C6CA 4LC8A 1MEWA 1W3TA 4HKPA 4BR1A 5BNKA 1TQJA 3NM3A 4MVAA 2FB2A 5C54A 1VPXA 2NXHA 3NZRA 3TROA 4AAJA 1K7EA 2CZEA 1QOQA 4Y96A 7TIMA 4P61A 3LHVA 3ZWTA 2C19A 4UR7A 2E6AA 5G4EA 3L9CA 4Q32A 2DZUA 4WZHA 3U2OA 1XM3A 2EGZA 3W7HA 2J88A 4WY0B 4ADSA 1XCFA 4UFKA 4JTFA 4FNQA 3CM4A 5CSSA 2I9EA 2A21A 5G1YA 3PSWA 3NQ2A 5K4XA 4PFMA 3KXQA 5AC6A 3WK0A 1YADA 3MHFA 2A6NA 5D2YA 3I68A 3BGGA 3F4WA 5CZ0A 3NDOA 2J6XA 4RR4A 1XFBA 2CLEA 2FDSA 5EY5A 1PCWA 3NOEA 2C6QA 3DI1A 1TJRA 5D32A 2Y89A 4O57A 3W7DA 1S3HA 3W72A 4A3UA 5TQLA 8TIMA 3W07A 3DKJA 1AW2A 1JCYA 1GQNA 4ONVA 2YW3A 1UB3A 3UPBA 4JDYA 3W2UA 5C5YA 5DCDA 4QITA 3HGJA 3TE9A 4RX0A 3BV4A 4IMDA 5J5DA 1SZNA 1Q6QA 3CEUA 3M5ZA 3O1NA 3N19B 1F6PA 1FCVA 4O19A 2CZFA 3LDVA 2F84A 3W7LA 1YDNA 3NQEA 1I2RA 1LLWA 1G7UA 1EA0A 4LVDA 4S1FA 1FXPA 4O52A 3TXVA 3IIVA 4EOUA 1WBJA 1TTJA 3TUUA 1LRNA 1MXSA 3PB2A 5D03A 3W2JA 3FJLA 2CLLA 1LLZA 2Y7DA 2WO5A 4ADTA 2YYUA 4UUIA 4XTIA 5AHLA 4GRSA 4NJIA 4LUIA 1JQVA 5J5RA 1TRIA 1XUUA 4OGZA 1Y0EA 3QSTA 1PHWA 2H8XA 5FEXA 5HR6A 2V8ZA 4QNEA 3W7NA 3PG9A 3LX9A 4IPIA 3EWWA 2ZRWA 4QNWA 2FPVA 3HBLA 2A85A 4ORIA 2OJPA 1SO6A 1VR6A 2ATMA 4IMCA 3BLFA 3W7GA 2R8WA 3R8RA 3ANYA 3FKRA 1JUKA 4YL2A 3W74A 1PCKA 5FEWA 3MHGA 5E1QA 1KFKA 3NQMA 2YXGA 1SZGA 3W7JA 3PM6A 4OWGA 3W1TA 3NL6A 4MYAA 5F2GA 2H8ZA 2QCDB 3BG9A 2TYSA 3PUOA 3E02A 1RPXA 3N9SA 3QW3A 1UUOA 2ZA1A 1IXQA 3QRHA 3S0CA 5EPDA 1CW2A 1XBZA 1TPH1 3H55A 4NT0A 3NGJA 3I7SA 3G3MA 1T8XA 3NL5A 3QMRA 4FB7A 2V30A 4GNJA 4Z1DA 2QJIA 1VLIA 3O8AA 2NWSA 2PE4A 4WY0A 3CU2A 4IWWA 4Y9AA 4R34A 5LNRA 4CNPA 3P82A 3W85A 4NZJA 2J24A 1JUBA 1NVMA 4ZQMA 2YZRA 3NQVA 4BI5A 2E5DA 4MJZA 5TIMA 3GXPA 1KFLA 3PR2A 2TMDA 2JBMA 4GFSA 5HQEA 3NQ6A 1F05A 3N2XA 5BRBA 2ZFAA 3QPZA 1QNVA 1LOLA 4UTWC 2V2DA 5CZTA 3T40A 3S1XA 1R2RA 3EX3A 3GIYA 2Z2UA 2ZZ1A 1W5QA 2Y61A 2YX0A 3LV6A 2CFFA 5A5WA 1AMKA 3WJWA 1DOSA 3VI2A 3CLMA 4WOQA 1G4SA 1F2JA 3BW3A 3HGSA 1KBJA 1KV8A 3LHTA 4CCEA 1GVQA 1FBAA 4RJEA 1RVGA 2DZPA 3PUDA 3BLEA 2OT1A 1HL2A 2V81A 4DBEA 4N9DA 2AGKA 2CWNA 1GYLA 1Q45A 3WJZA 3HB9A 3C2FA 3L0KA 3BGJA 4I7VA 4XZ9A 5AHIA 1KFCA 2TRSA 3R13A 4I7WA 2XN1A 5AC8A 3JRKA 1RQBA 1K7FA 1WOBA 2QR6A 3G22A 3CC1A 4RXGA 2Z1BA 3L5AA 1S5VA 3M5YA 2WQPA 4HPJA 4NXKA 4ZMGA 1MEIA 1WYIA 2NV2A 2WSYA 1DORA 2XN0A 3EWYA 4MZYA
chains in the Genus database with same CATH superfamily
2WVVA 1EEPA 2EG7A 3SCPA 2ZOXA 2VOTA 3ITLA 3VDHA 2JALA 1F6YA 2PWUA 3UJSA 3GXMA 3UW6A 4HN4A 4LAOA 2GQ9A 1QNOA 1BKHA 3BJTA 3SRKA 1BRLB 3KBWA 4KCTA 2NQLA 4IPLA 2J8TA 5GJPA 3M5VA 4ERGA 4A05A 1K9TA 3QR0A 5CPTA 4QE4A 1IEXA 3H23A 4ZO7A 4E2VA 4LV9A 3TC3A 1NQKA 4MAVA 2ZADA 2ZC8A 1AA1B 1J12A 3UXAA 5CC7A 4DNMA 5L9FA 2VFEA 3W7KA 3SCTA 4DYKA 1YTDA 4UOJA 9RUBA 2QCHA 2J7HA 1EX5A 3BUVA 1M7PA 3DFYA 3IRSA 4QJ1A 3WUGA 3BLOA 3OOQA 3RUBL 3RF9A 3RU6A 1A3HA 2D1ZA 2DQWA 1BGGA 3WF3A 1ZLPA 3O9NA 5C2XA 3E0FA 3TN5A 3SCQA 1ZY9A 2GLKA 4X3ZA 4GQGA 4LUTA 1MUMA 1SO3A 3IJ7A 3E5PA 2A2IA 1REQB 3I4EA 4S3DA 1ZJAA 2Y7GA 1ZZMA 1ML1A 5LIKX 3ONBA 4FOJA 3AU6A 3MDWA 3EPNA 4GG9A 4MLJA 4LBSA 2XFYA 1HKIA 3NQCA 3HM7A 3HFTA 1GHSA 4PMRA 1JD9A 1NWRA 3S1GA 2ICSA 4MM1A 1H61A 3KVKA 4NJGA 2GGIA 2O55A 3O7UA 3AS1A 3LPPA 3PBYA 3B8IA 1T96A 3B4UA 1HJUA 1IZCA 5U7SA 5EMYA 3RAOA 4LBUA 2QGYA 1XKJA 2CZ5A 1E3ZA 3KRUA 2W27A 4DYJA 5EBAA 4UQEA 3WSUA 3NURA 3WCZA 4CUCA 2VFIA 3WN6A 4WKFA 3V7PA 1W0MA 4J3WA 3AROA 1R3VA 3WDQA 9XIAA 3PBGA 3GD6A 5ABHA 2HZGA 1QRQA 2B7PA 4QIUA 4OV4A 3WLSA 3UQNA 1UR4A 1LBFA 4N7QA 3SY1A 4UTJA 1BVWA 4RE4A 2VX7A 1PZ1A 3L5MA 1VRXA 2QDEA 3LCWA 3N3MA 1EX1A 3KRSA 1H0GA 5JMUA 1QPRA 4ZBCA 4GK8A 1NWUA 3EB3A 3G1DA 3WQ5A 2V63A 1IT7A 4NI8A 3M0KA 5G5IA 2Z26A 2VZSA 2OSWA 3F7JA 3CEPA 2UV8G 2Z1KA 3GG8A 5LHFA 3T0AA 4PMOA 1WKFA 1Z89A 1TO3A 4Q8UA 4BQ5A 4B15A 4JFVA 5HMDA 2FIQA 1JCJA 3M0IA 4ZOAA 4Q4OA 1J2WA 2W3ZA 4QXIA 5M5DA 2P1FA 3DECA 1ADSA 3HIJA 3HGRA 4S38A 1OC5A 1T6MA 4Y9MA 4BF7A 2FVLA 1SZRA 4XD5A 1JVNA 4GQQA 4RKAA 2X2GA 3EOUA 1OFQA 3R8HA 4WKAA 3M7WA 3VOGA 4C6BA 4W86A 4GJJA 4DJEA 3W2LA 3GHTA 3TW9A 5FAGA 5I06A 3T7VA 1J8VA 1JULA 4IP5A 4JIIX 4J9JA 3JUGA 3GIQA 3LMZA 3O3RA 2XISA 3UA4A 2IQDA 3ABOA 3GNXA 4OHQA 4DELA 1Z44A 3WDHA 3CIXA 1PKNA 1C8VA 1TJ1A 1O1HA 4JEQA 3WLLA 1NOUA 4JICA 4UWMA 3WENA 2G8ZA 1SR9A 5A1AA 2R14A 3G0XA 2GQ8A 5A69A 1NDWA 4ZENA 3PZTA 4ATLA 3TQKA 4R88A 4O14A 2HVMA 4P7QA 1BXNA 1VIWA 3CJPA 3IGSA 3SQMA 1DJWA 1DWGM 2V69A 4MADA 4HYVA 3LBOA 4C91A 2YA0A 3EDEA 4PUUA 4MLRA 3W29A 3WD0A 2P88A 3DGBA 4Q4MA 1UJQA 3KDNA 4XD3A 1XYCA 4LUSA 1G01A 2EPHA 3BG5A 5L6UA 1FH7A 4KT2A 3WQDA 2ISWA 1EGZA 5D33A 3UG8A 1G94A 2OX1A 3N11A 1JR1A 1G4TA 3RG6A 4L1WA 2CHNA 4I5XA 4K2SA 1T7LA 2R1NA 3RIKA 1DJNA 1OX5A 2GWNA 4MWAE 5A6BA 1YW1A 1YE4A 1TTQA 5G2WA 1I2NA 2ABAA 2WOQA 2AKZA 1SJBA 1TWWA 1ZAHA 2Z1WA 3U7BA 2C8NA 3M4HA 3B0UX 4HN8A 3V16A 1AVAA 1WZKA 3IAQA 1B3YA 1TVLA 2KX9A 2P8CA 3GFYA 3PBWA 3DERA 3TYAA 4AWSA 1ISXA 1TX2A 1SFLA 1FWWA 3CQHA 1GG0A 3MMTA 1W5MA 2DZTA 5CSRA 4LF2A 4F0KA 3TYDA 1Q3NA 2YCLB 4XAPA 1W31A 1U22A 4K7YA 1Q6GA 3CHDA 3TFCA 1YTKA 4X2PA 3EOSA 1Q66A 1IR1A 1JCTA 4RPQA 1GYMA 4P7LA 1ZCCA 1L6YA 2C7FA 4A22A 2J4GA 3LN3A 5KZDA 4NILA 2NT0A 4AX6A 3FHAA 1S2CA 3DHUA 3GH7A 4NJJA 3VGGA 1LL7A 3MUCA 4C6MA 2PLMA 3GDTA 1CGWA 2WM1A 1O4UA 1Q6CA 2FHBA 1QI2A 3GAYA 1QW9A 5RUBA 2EHHA 3DZ1A 2DIKA 2GJLA 3AUJA 3LXCA 3CV6A 3THQA 3A4WA 3CQJA 1L6SA 3W2NA 3NPUA 1GEHA 4XKYB 5FESA 5I02A 4W8BA 4MY1A 3V35A 3QH2A 2CLKA 1KM6A 1PJ9A 4JR5A 8CGTA 2OKOA 4D8AA 2FQIA 4AD1A 5F4SA 4EP8C 4C6DA 3WNMA 4MZ8A 5FEZA 1XLAA 2ZUUA 4MNMA 2UWFA 2QLYA 1LG2A 3A3XA 3R58A 2VWTA 1DV7A 3P60A 3W6LA 3HF3A 5C7VA 2DU2A 1IE7C 2EQDA 1UQZA 4JAWA 2QCLA 3HQ1A 3OA5A 3A3WA 4UFHA 5AZ0A 2F61A 1JI1A 3MMWA 4DWSD 3IVSA 2NT1A 1BYBA 3SUVA 2BHUA 2Y8KA 3FEQA 1EF2A 5FJUA 2GSHA 4LUYA 4LSBA 4MUZA 3QFWA 3DYPA 1YMYA 2A7NA 4Z2HA 4JYFA 2PEVA 2WWCA 3N34A 3FSTA 3MSRA 3G1VA 3VDGA 1KR0A 5TBOA 3SCOA 1VAHA 3Q45A 3EAUA 3EXRA 4NL1A 4LY8A 5E09A 1E51A 2FJKA 4XZWA 4AZBA 4D6EA 4AZ5A 4KWVA 4JPGA 2LLEA 4MPKA 4CNUA 3T2PA 1DJIA 3MV01 4RDVA 1XFCA 3KTCA 4KEUA 1SM9A 3JU2A 1JDAA 3CIWA 4W4QA 1IIGA 6CGTA 4C6CA 3W88A 1HP4A 3A23A 3N1AA 1BTCA 3FFSA 5DCBA 5LKYA 2PURA 2XIBA 4B3KA 5C9XA 3VUPA 2E6DA 5A8OA 3M43A 5F2LA 4A3RA 1L2QA 2DZSA 3DI0A 4FNRA 4L80A 4NYYA 4W5UA 3HPFA 3ARYA 4UFMA 4CLMA 4ATDA 3VMNA 4RNHA 3UZ5A 5DFAA 1WXJA 4RW3A 2NVAA 1BTMA 4C1NA 4JQAA 2POTA 3R8GA 4DO4A 2NSOA 1NDYA 3LNPA 1FY6A 1EQCA 3RRAA 2CNCA 2JIWA 2NSXA 3S2JA 3USZA 5I6SA 3WQWA 4J7RA 1LT8A 1W2VA 1CXHA 3R79A 3SCWA 1SU5A 1DJXA 4PUJA 3SN1A 3VNLA 4N9EA 3PAJA 3SURA 3I10A 2AMGA 1AL7A 2IXVA 4HQVA 2D0GA 1EXPA 2TAAA 5D02A 5DANA 4E6MA 1IEQA 3QHOA 4AZHA 3B9NA 5A6JA 1GVSA 2OSXA 3MBFA 1ICSA 3FYYA 2OO6A 3QZEA 1TZ9A 3MI3A 3B0PA 4FNSA 4C6PA 1I6NA 1V3KA 4ZQCA 3STGA 1N55A 1G7VA 1EO5A 5B7YA 3E0WA 4IPPA 4IMGA 1F76A 1UUQA 1CDGA 2WKJA 2ZUSA 3MJYA 1FQ0A 1GTHA 3B8WA 4NZ1A 2XZ7A 3AIEA 2CHRA 3ITYA 4WIWA 4NVTA 3OHMB 4GX9A 1H49A 3BQ5A 2BLEA 2NQZA 3E49A 3AJXA 1YDVA 1VCVA 3GBDA 3GWQA 1IEVA 3EEGA 1E9IA 3GXDA 1F5ZA 3TA9A 1HX0A 3W0KA 4IQLA 5KZ6A 1FH8A 3N17A 4EK7A 1VYPX 4AX7A 4GUHA 1QATA 3O63A 3GNPA 3EGJA 5B7ZA 4DEFA 1CBGA 5C9WA 1JYNA 1BQCA 7TAAA 2Y70A 1B3WA 1KO0A 3BARA 3F4CA 4DZ5A 4LS0A 3VKJA 5DT5A 2C16A 3UJRA 3Q67A 1BWKA 2FYMA 2CERA 2REQA 4KFNA 1RK6A 3F2DA 4JIHA 4BK9A 1V5XA 2YFOA 9XIMA 4N6EA 2UY4A 4GUIA 4AG0A 5IHSA 3QJAA 1GOKA 1H1NA 4LC6A 5CPLA 3H54A 1O5KA 3W1PA 1JPIA 2VOMA 5FCZA 1V6TA 3OLGA 3AS0A 5DN1A 1RY0A 2GJNA 1JAEA 1DIDA 1V3HA 4LB4A 3DG3A 4EAYA 4KW2A 4XWUA 4M8UA 1F07A 1ZFJA 3ELFA 4PULA 4XZHA 1DL3A 1O5RA 3T0TA 5C70A 4GNVA 4PEEA 1BEUA 2P50A 2WCSA 2A3AA 3CBWA 3MI6A 3UZZA 1XG3A 1B9ZA 3W84A 2J13A 1BXCA 3RJXA 4I9MA 1WV2A 1DIEA 1ZQ5A 3SCSA 1VFUA 5I5RA 3VINA 4HZMA 4PYSA 2QUNA 4D6FA 5AECA 5EMKA 4C6KA 1OC7A 4UC5A 1FWRA 2CLPA 4ATWA 2P0OA 3USBA 4ACZA 5I3HA 3O16A 1L9WA 4H8NA 5EL1A 4BQ3A 1UIPA 2CYGA 1Q6FA 4RDZA 4B9ZA 4Z0JA 2G5WA 5C0QA 1XIGA 2VCAA 1HT6A 4QGCA 1G9HA 3PJTA 4H4IA 2HK1A 3KVMA 3EOLA 2WNZA 2ISVA 2FZMA 4IGNA 4IIEA 3AZRA 1EC9A 2WHKA 5ABTA 4K8GA 3WQ8A 1Q85A 1C9DA 1XIEA 3QV8A 1WPCA 3EMCA 1KM2A 4HA3A 3GRIA 2VZVA 3PP7A 3CH0A 3VIJA 1C92A 4JTJA 1J4EA 3P6LA 2QF8A 3SEPA 1P0NA 1OQFA 1B5TA 2RUSA 3CUIA 2V2CA 3R0DA 3RX4A 4PC8A 4C7FA 2G0WA 2X1UA 4A29A 2B7QA 3WNPA 4XAYA 4QCEA 3GW0A 3TJLA 1WCGA 3LCFA 4DXKA 2D69A 1BHGA 2HS8A 4TX8A 4O13A 3U5UA 3URBA 2CU0A 4GA8A 3W2KA 1TV4A 4Z08A 1PIIA 4HHPA 3HMCA 5AFDA 1M41A 4O10A 1V93A 2Y88A 1EWDA 4PFHA 3KWSA 5FF0A 3PZ9A 1XGZA 3WFZA 1HGYA 2ADAA 6TIMA 1XDLA 3XISA 3WLQA 3S1WA 3JVAA 2HXUA 5MHBA 2EJ1A 4FX6M 3T0BA 1JIBA 1ICPA 1JPKA 2AL2B 1M01A 3G18A 1LTDA 3W1UA 3NSNA 1YBQA 2VTFA 1XIHA 2VI0A 3TQVA 3OP2A 1RQEA 2I1OA 3CB3A 2D0FA 3BXWA 5D2TA 4E2OA 5A2CA 1OFRA 3TN3A 1EPXA 2DJLA 3TFXA 3EXSA 3NPVA 5LIYX 1H7WA 1ONXA 3CT7A 1M65A 3LI0A 1GVFA 2BWGA 3F5KA 3XINA 1PZ0A 3UXLA 4PBEA 2OYKA 1HJQA 2HISA 2Y63A 3KL0A 4JEJA 1L8PA 4AHPA 4BCEA 2CKSA 2C0HA 3QKEA 2PDWA 2ATSA 2AMXA 5BU9A 1ZBWA 1L6GA 2XSBA 3QC3A 4JN7A 1GVYA 3A21A 3H12A 1C8YA 5DT7A 3AUOA 1V79A 3STPA 4O12A 3EYPA 2PWVA 3STCA 4JKLA 5CPOA 3HA1A 4B5VA 3K4DA 5D4YA 3BJFA 3E0LA 4ERIA 4OECA 2ESCA 1PUDA 2DUXA 2A3BA 2BGSA 3WH9A 1Q2SA 5D2VA 1U1HA 3OVRA 3UG3A 4GKTA 1MEHA 1OT2A 1YKWA 3GUWA 2DGAA 3SGZA 1XBYA 2QCNA 1EH9A 4IGHA 1VHNA 4O1DA 4NU7A 2FMNA 1SGJA 3CT2A 1GVEA 2FTWA 3W76A 4LALA 1MI3A 5I3IA 4QR6A 3M0ZA 4GIAA 4XO6A 1R30A 1AG1O 1CENA 4P8XA 1LUCA 5CKSA 4G7EB 5IHRA 2VM8A 4PUMA 3OHIA 2YDRA 1LYXA 3CHCA 4K3ZA 4XSLA 4O1AA 4N4QA 5F4WA 2YZ5A 4M51A 1GQJA 1VBRA 3VYLA 2GDUA 1MW3A 3MVTA 5DBUA 4S3EA 4DJDA 2R82A 1H7RA 4ZB2A 3APYA 4B2DD 3R89A 2WLZA 3MWCA 3CAVA 3SRDA 4J3SA 4V1YA 5CPNA 3TLQA 1LCOA 4NAFA 1EP2A 2AQOA 4JTGA 5BOOA 2PWHA 3VM5A 2WC4A 1TV7A 3R0UA 4PRTA 1QNQA 2C15A 4QEEA 3WNNA 4WDTA 3QPEA 3Q94A 5EYWA 1Z8AA 4YCPA 1GJPA 1A80A 3GDRA 5C71A 3CMGA 3PJXA 4AIUA 3N2TA 3NZPA 1KM3A 1N2VA 1XSKA 3GFXA 2F9RA 1B4EA 2BMBA 1HKWA 4HB7A 1R3WA 1WZMA 1M03A 1TPEA 3UEQA 3ZWSA 4GINA 4F0HA 2VELA 2X1TA 1T8QA 1RV8A 1YRRA 2CLOA 1HL8A 4UQDA 3G8EA 1XGEA 1FWNA 2J66A 4WXYA 4DM1A 1FWTA 2IPJA 5CC3A 3L0GA 4NZ3A 2I16A 2WKLA 1VLWA 4PTWA 3OLEA 1KKRA 4HZ7A 3KS5A 1QO5A 4NRRA 3DYMA 3UWZA 1IR2A 2O4QA 3T0CA 4AMCA 3BLKA 3UWUA 1HXJA 2QJMA 3OVPA 4NASA 4AY7A 4HOXA 1X8FA 3DFQA 2YLLA 5FIPA 2J6VA 4JIEA 3MCNA 5MKGA 5C7HA 2DW6A 1A4LA 3M0JA 2QDHA 1LWIA 1UIOA 3ORWA 2ZE3A 4HMNA 1SFJA 3RM8A 4YJ5A 4AYSA 2QUVA 3W73A 2EO7A 1OIMA 1ZRQA 2DV0A 2NXIA 3R12A 2ZX6A 1GKQA 1R47A 2R1KA 3PPFA 4QCFA 3AU2A 3F1QA 4WF7A 2X1SA 3VIHA 1TE6A 2JEQA 4AF0B 3KCOA 3A64A 2HBXA 4Q8OA 2NVDA 3G77A 5G2HA 2QJGA 2X7VA 5DMYA 1YEYA 3A5FA 1R87A 3B9EA 3CUGA 3GYEA 1ODUA 3ABRA 5I07A 2F6UA 2GQAA 1OGSA 2G97A 1E0XA 1JXKA 1PS9A 4NJKA 2ZRXA 1W1B1 1OFBA 4H8VA 1H5YA 4UZUA 1V7AA 3G1AA 3CHVA 1LQ2A 1PX4A 1U5HA 2ASHA 2PWDA 4R7JA 1AL8A 5AYYA 2XUCA 3C2EA 1O5QA 1SYTA 1KTBA 4QP0A 3U6WA 1C90A 1MFUA 3EWZA 1EBGA 2HS6A 3G0UA 2ZDSA 1C7TA 2DH3A 4AD0A 1IIHA 4MFEA 3IIOA 4KWWA 2J7EA 1W1PA 2Z2BA 1B3OA 3VDAA 2OEKA 1DBTA 1BF6A 3TONA 4OU1A 4B92A 5CPMA 3RLGA 3ZR6A 1DTUA 3OJGA 1K3UA 4DWSB 5HOSA 1IGSA 3H2AA 1OM0A 4MWAD 4GO8A 2HVNA 3NL2A 3S83A 3TJ4A 2QEZA 3V3WA 1P1XA 3AALA 4QE1A 1JYVA 5LYRA 3Q2DA 1D9EA 2ODOA 1QVBA 3F4VA 2E9MA 3VFLA 2BXYA 1P6WA 2AAAA 3PK7A 1X97A 2X0YA 2YGYA 1H51A 3W23A 1EDGA 4J27A 1IZKA 4UZSA 3WELA 5D37A 2WKGA 3TAOA 1HO4A 2BFGA 2PCQA 2J27A 1KA9F 4JN6A 4AVFA 4HYRA 3A13A 2PLKA 3RLVA 1UR2A 4PL2A 5ECVA 4D72A 1GGOA 3NCOA 4FHAA 5CC5A 5HMFA 2CESA 1B90A 4HBKA 5D8WA 3GR4A 1TV5A 4DRSA 4TTGA 3G2GA 4M1RA 3VGFA 5HAOA 1DQWA 4TVUA 1XF0A 3ARSA 4LC8A 4J5NA 1W3TA 1EJUC 4BR1A 3NM3A 1R9XA 2OLAA 2WQDA 2GJXA 2CZEA 3CV1A 4LYPA 4NZ5A 2INEA 2OOGA 4EPKA 3OG2A 2FZDA 3IJ6A 2GGEA 1HZYA 1P0BA 1X96A 2VCBA 2VDIA 3WBXA 1XLEA 3U2OA 3CXOA 3BMVA 4UFKA 4JTFA 3VO0A 4FNQA 3F2CA 4PFMA 5AC6A 3WK0A 3BGGA 3WDIA 1C3FA 2CLEA 2FDSA 2NLYA 4JHOA 3WBYA 4QE5A 5F7UA 1I1WA 2C6QA 4RNFA 4J3VA 2DVTA 4GVHA 3W7DA 1S3HA 3KL3A 2WBGA 5TQLA 4A3UA 3W07A 4HCDA 4W93A 4F9DA 1JCYA 1QW7A 4ONVA 3RM4A 3HGJA 4RX0A 4IMDA 5DMNA 4GIEA 3AIQA 4IG2B 3N19B 1FCVA 3AYSA 1A4MA 4S3AA 3XIMA 4JCMA 3BCDA 4AY8A 3UESA 3WMSA 1EA0A 4C60A 1J10A 3FDGA 2FH6A 2GGJA 4O52A 2J25A 1WBJA 2HEJA 1H3GA 3ITOA 3FJLA 3N2CA 4ZOCA 1DXFA 2IKIA 4KMQA 4GCAA 3CUJA 4GBDA 4D1JA 4AZGA 4GRSA 4JQ1A 5J5RA 3QSTA 1PHWA 1R5YA 4REQA 1EYWA 3GH5A 2PDIA 4ORIA 4IZGA 3UGRA 2OJPA 3EA2A 4RE3A 2FZ8A 2YXXA 1JUKA 4YL2A 1RSCA 1PCKA 3MHGA 1KFKA 3ARTA 3A4XA 4L5ZA 3GY1A 3QGVA 3W1TA 1BG9A 1BSIA 1NY1A 3CPGA 7ENLA 1UPPA 3NL6A 4MYAA 3WH7A 1E43A 2TYSA 1WE5A 3QW3A 2YOCA 2ZA1A 1IXQA 5EU9A 3ZVHB 1XIFA 3ZM8A 3ZZ1A 5CZKA 3KP1A 4NT0A 3G3MA 3EEZA 3CQKA 2VNCA 4D6HA 2V30A 4QEHA 3FAXA 3HV9A 2ZC1A 3FDKA 4R34A 1XINA 3VMOA 2VJXA 3AYTA 4J28A 2PD5A 4HTYA 4GQ0A 1KFLA 1WB0A 2QVHA 2TMDA 3BURA 3NQ6A 3N2XA 2HWGA 5J8LA 4UTWC 2V2DA 3UJEA 5TD4A 1EZWA 3L2LA 2Y61A 3R6IA 5A5WA 4GISA 2HQAA 1DOSA 5E6ZA 3CLMA 2ISFA 1F2JA 3BW3A 3HGSA 3C8NA 1GVQA 1FBAA 4M24A 1RVGA 1EC8A 1U1JA 4RE0A 3BLEA 2OT1A 4N9DA 2AGKA 2CWNA 1Q45A 4G2DA 2H9AA 4K1GA 3L0KA 4XZNX 4HOZA 4XZ9A 3GYCA 4GACA 4I7WA 4E5TA 3TJIA 5AC8A 2WZTA 3JRKA 3CC1A 4JFWA 1X6LA 3K1GA 1E1CB 3M5YA 3AC0A 4HPJA 1SMDA 4NXKA 4RDYA 1BYAA 1QJWA 2WSYA 3V36A 3EWYA 3TOPA 3WQPA 1E0TA 1XLFA 3ITVA 3UPWA 3VD5A 1UC5A 4S2CA 2OZTA 1A53A 3FGCB 1FWGC 2V5JA 2O4MA 4O16A 2PC4A 4QDPA 1SW0A 3W1RA 4Z2GA 4QX4A 3SCNA 2OZ0A 1WA3A 3LCHA 3ME3A 3QMTA 5DX7A 4MZ1A 2OYMA 4K1WA 4S3CA 2FJUB 2B4GA 3D6NA 4QLKA 2XSAA 4E0CA 1MW0A 1K70A 1R8LA 3TYZA 1EP1A 1POJA 1NP0A 2GPTA 1WDWA 1P5BA 4I6KA 3RX2A 5J04A 1HVQA 3BANA 4H6KA 2J7CA 4CQCA 1NDZA 1I1XA 4O4VA 1E1EA 3YPIA 3MKVA 4FX7A 3U4AA 4U33A 3VKBA 4R85A 5CGQA 3VIMA 4XIAA 1B3XA 5I2UA 2OOFA 4W7VA 1W1IE 1VFTA 3BQ6A 1W5PA 3PB0A 3PS7A 3N14A 1YXCA 2VZUA 3AMGA 4HMEA 3FV9A 4AZIA 4DWSC 2PDYA 4ZQOA 3K4AA 2PDFA 4H41A 3TCSA 1FWAC 2Z0IA 3U2CA 4JTSA 3AXKA 3SY8A 2ZIDA 4JCLA 4DO5A 5JUVA 1EJXC 2ZX7A 1XCWA 3TAKA 3LERA 3B9OA 4MUPA 4DBDA 4B4FA 4GVFA 4GMEA 2WC3A 2HRWA 3MUXA 4WGXA 3G8RA 4NYUA 2HTMA 3QHNA 4MOZA 1EIBA 4ZEPA 4PCTA 5HQLA 1DJQA 3VC6A 1QAPA 5AHFA 3OIHA 1B31A 3N2BA 3MP5A 1KCXA 3GNOA 4OZOA 3AHVA 3URAA 4LUJA 4HZ6A 3AIWA 2PF8A 1CZ1A 3MUY1 4UFJA 4LX4A 3MKKA 4YTTA 3VXGA 3HPAA 4RZ4A 1Z41A 2OEMA 4UCFA 4LEFA 1LM1A 3S9YA 3WBAA 3VGDA 1UOZA 3T9PA 3I6TA 1S46A 4L6OA 1SFTA 1TJ0A 5BXRA 1MVYA 1EGVA 3MP4A 1K1DA 3PZUA 1OVDA 1JZ8A 1DE5A 3VIIA 4MIMA 3EXTA 1B3VA 1W3HA 1DIOA 1QO2A 3IS4A 4H6QA 1MXDA 3O6DA 2W61A 2WSQA 5D05A 1PKYA 3LBCA 1E6QM 2OX4A 3QN3A 5G2IA 2I14A 1CWYA 3DFNA 3HJZA 1MNZA 4GI9A 1ADOA 2HXTA 1XLDA 2WPBA 1J79A 4CNNA 2GJPA 1CYGA 3FVMA 4M6UA 4KIRA 4K6AA 4CN4A 3P8JA 2CBIA 2PBGA 1PWMA 3BOXA 5HDRA 3W6YA 1HIZA 4S3BA 1OFDA 1JI2A 2BXVA 3BK0A 2PZ0A 2VEPA 3AOFA 5I3DA 3H2EA 3FCPA 3WQOA 3ZR5A 1GYNA 1XYAA 1LOQA 4Y9OA 4A8NA 2OEJA 3A22A 2G41A 2VZOA 4HD5A 1KTCA 3QZAA 1JAKA 1OB0A 1QUMA 3NFUA 1THFD 3CYVA 4CKQA 1PWLA 1W91A 3CV2A 4J40A 1UPMB 3UG4A 2EBNA 3K2GA 5EMLA 4WXZA 2PDBA 4N0RA 3BZJA 1KB3A 3H2MA 3SQSA 3IJIA 3BAKA 3PFRA 1XD1A 3DDMA 5LXEA 1HGWA 4Z17A 3AXMA 4G56A 3ZO9A 4B3LA 5ABGA 4H9VA 4LYRA 5FF3A 1HKKA 4PMXA 4IFKB 1OYCA 1CNVA 4NNCA 1RALA 4CQBA 1C8QA 2DZWA 3V1PA 5A8PA 3HG3A 5HULA 1TR9A 6XIAA 2ZUMA 2E67A 2Y5SA 4UB9A 5CBBA 2GK1A 4PB5A 2R1MA 2GVLA 2Z6IA 3GXIA 4CCZA 1GZGA 1R9YA 1XS2A 5GQBA 2OODA 3IJ9A 1QTWA 4YWIA 3MB9A 1PKMA 1TELA 1W54A 2WMFA 1NU5A 6A3HA 4D71A 2ZQ0A 1R3TA 4PCNA 1XGDA 4IPJA 4PUWA 4BY3A 4RCXA 4WJ8A 3T2OA 3LQGA 1RR2A 5E5CA 2VYOA 4ZR8A 1E5JA 3PJUA 2HK0A 1FWDC 3N25A 1FA2A 4J4KA 2H6RA 4Y9PA 4MTVA 3N6JA 3WQCA 1RHCA 5A8GA 2XM1A 4GUFA 4H8HA 2HMCA 2XFRA 3S5YA 4M29A 1JCNA 3F5LA 4TU1A 4Y9NA 1P0KA 2XVPA 4GNKB 3CL7A 4DHGA 4U5IA 2HBVA 1VBJA 4L9YA 2GDQA 1BWLA 1Q8AA 2OB3A 2UZ9A 2DSWA 1GCYA 2BOGX 2HPMA 3DFPA 2R9RA 3CIVA 1VPQA 3KZSA 4WHBA 5C2GA 1FRBA 3T81A 2Y6ZA 4AWTA 2IXUA 3IUHA 1XUZA 4DAFA 3P80A 1KM0A 2QS8A 5M3WA 3LHUA 1JGIA 1FHLA 2ISSA 1TPB1 5FJOA 3LCIA 3CQ0A 3LM7A 1J6PA 1F3WA 1JZ5A 1TWZA 1V51A 3N2OA 5BMXA 1OK4A 1VB9A 1AQ0A 3P0XA 1TX0A 4AH7A 3P7YA 1Z9AA 5BW6A 1TVPA 4IISA 2PRMA 3DOPA 3Q37A 2PLCA 4HZ8A 1J93A 1RA0A 3VCRA 5DO8A 4H7VA 4GI6A 3O6YX 3ABXA 3HPXA 1F7BA 2GSJA 4MWAB 1E6SM 3M9YA 4RV8A 4GX8A 1Q7QA 1WXZA 1DWFM 1ITCA 2PF0A 3VAVA 1S1RA 4M80A 2VRQA 5ABEA 3PAOA 4KS0A 1H50A 3REQB 1K03A 3FK4A 3S5SA 2YB1A 3LLFA 1U5VA 4JDBA 4C6FA 2NUWA 5IDIA 3SFWA 1GJWA 2YCKX 3MYPA 4Z1BA 2OGJA 2RKXA 1NAL1 1R86A 1FCUA 4QBXA 3N6QA 1QNSA 3C52A 1XC6A 3LRMA 3QTGA 2NZLA 4FEZA 3B8VA 4BWLC 4W89A 4S3FA 2XIIA 4LVBA 3DYOA 3WF4A 3R94A 3LMYA 2W9MA 3ENLA 2WM0A 4IPNB 6REQB 1GPWA 4M19A 4DXXA 1HW6A 5HPCA 1FWIC 1RCQA 1L8NA 4RNJA 3KL5A 2VL4A 2ZX8A 4B91A 3BW4A 3HZ3A 1KV5A 5F2IA 4H9MA 1X1NA 2YDQA 4FALA 4MB4A 2V5LA 5K7JA 4X0VA 3K46A 2PTYA 3GDLA 3PPCA 1OX4B 1I2OA 4UTUA 3O07A 1R3YA 2VMFA 2X0HA 2R1LA 1XYZA 3GW3A 3LTYA 2BOFX 3SUWA 4N02A 1Q5MA 4IGMA 4XV0A 1TA3B 3RM9A 1NELA 4JYDA 4FAMA 1G67A 1JL8A 3H8AA 3FW6A 3WMCA 1JDCA 1QW8A 5HJLA 2VGBA 3T6CA 5HINA 3L4WA 4LT9A 2XGZA 2QDGA 1UWTA 4FK9A 3NXFA 2W5FA 4TMBA 1UKTA 3JS3A 4O54A 1OFEA 3ZLFA 1EJTC 1OZQA 1UWUA 2F38A 2JGQA 4XTDA 3BL3A 5LZLA 4A3HA 3IIPA 4KEMA 2B7NA 2ZZ7A 3QV6A 4JFUA 3ZLGA 2VD8A 4LOCA 4GKLA 3T55A 3VZXA 2XH0A 1G5AA 1TB3A 3R5EA 4NZ4A 3JW7A 1RBOB 1AD1A 3GS6A 4GZIA 3C56A 1CXIA 1X1OA 3MMDA 4G7FA 5EMMA 1WKDA 4PMUA 3W2MA 4ROQA 1BPLB 5BXSA 4O53A 2EF9A 2QCEA 3W7QA 2C18A 4KETA 1H7PA 5DCEA 4AEOA 4UNKA 1VIZA 1KBKA 2VZTA 1R7AA 4FOUA 3I4KA 4NZCA 1EF3A 3AZSA 3UNTA 3AXIA 3HTWA 4PTXA 5PTDA 3AJ7A 5DF0A 5EB8A 2CLIA 1PEZA 2PPGA 3P74A 4DBSA 1TPC1 3DBPA 1DQUA 3GZAA 5G4HC 1W3NA 3W27A 3INPA 3FKKA 4AZ6A 1VJSA 3OTRA 2VP8A 2XIOA 1QI3A 1E0VA 4NHVA 3UWQA 3FYOA 3NJ3A 3EMQA 1TV8A 3S8HA 2OQHA 4U3CA 1VFSA 2VDHA 4GOAA 1KRMA 1XHGA 3CHEA 2D22A 3CNYA 4AWUA 4MB3A 1K9FA 4GY1A 1OD0A 3W7EA 3QPYA 1X8CA 3C0JA 1H60A 3MCMA 2BVTA 1TZZA 3KRBA 5C55A 2VQTA 5I3FA 3GXFA 3OGSA 3WZ0E 1RAKA 2BG5A 3W7IA 5T9BG 4ZB5A 1AUSL 3CZKA 3I7RA 3DC8A 2QMJA 2WJZA 1M1BA 3WF0A 3O6AA 3UERA 4EXAA 1J6OA 3N2MA 4H01A 1UBPC 1M7OA 3QV9A 1LF1A 3B3DA 2GFTA 4JTEA 4WSHA 3VDBA 3A9BA 3EA3A 4LJ3A 3PBVA 4NXSA 3L4VA 4GY0A 1W37A 4YWSA 4D6CA 4IJRA 1CTNA 3TU9A 1QPKA 4LBRA 1IWAA 3E96A 5D9OA 5E0KA 2Z24A 4HA4A 5JIWA 3AAMA 1NM9A 2DT1A 3RO8A 1ADDA 4MKVA 2PAJA 4UQBA 3KW3A 4L1GA 3LV5A 3MVIA 3ZS4A 1AH3A 4Q8NA 3W70A 1PTGA 4F3HA 1DEDA 6ALDA 3RK8A 2E6YA 3AYRA 3NXLA 2WMIB 2PU0A 2O7SA 2VX4A 3P5YA 4QTGA 3M5XA 4LVGA 3L2MA 4CN1A 1VBUA 5LIUX 3TMQA 4DUOA 4UR9A 4DIAA 1KGXA 5T91A 3TNOA 2OSYA 1A3WA 2VKZG 1OCNA 1UOKA 4LS2A 5LIXX 5EBUA 1PX3A 4ROPA 3TR9A 4UTKA 4UNLA 1WP6A 1VYSX 2ONEA 4D8ZA 1ISYA 3HG2A 5A6TC 1U2YA 2E3ZA 2BY0A 4GUJA 1B9BA 1ITQA 3TWBA 3T4WA 4Q4SA 1YLVA 3PZQA 3M6YA 2PDHA 4D2JA 1A5KC 3BICA 5G4WA 4M3PA 3U0HA 3AHTA 2XU2A 1AQMA 5I3GA 4Q8QA 4XISA 5LHEA 3LBMA 5G1TA 5BOFA 2FPTA 4PTDA 4JTUA 3NPWA 5C9UA 4FLQA 2E1DA 4DF2A 1J0KA 3WMLA 2QJNA 2QT3A 1TFVA 4R9OA 3WEOA 4DUXA 3GNNA 2JKAA 1DYSA 3LXAA 4UTLA 4HK6A 3LK6A 3JZEA 1D7FA 2ALDA 1D3CA 1TR1A 5AYZA 4DNHA 1DPMA 3EX4A 2V5CA 2WJEA 3VNJA 5IM51 1RBLA 3KX6A 2PDMA 2HVOA 3EZ4A 4MWAC 4MPQA 4I7UA 4L4OA 1EUAA 3S2MA 1J9YA 3B0YA 1SW7A 2Q8LA 3MBDA 3GE7A 2FZBA 4IP4A 2ZWZA 2O9TA 2BNJA 1XXXA 4CQDA 5XIAA 4KH2A 3GNDA 1YDOA 2DP3A 1XLBA 1JFXA 2Y5JA 2VRKA 4DXVA 1R9ZA 3QMSA 1OADA 2XGIA 1QHOA 1UW9A 4ERAA 3D3FA 3GTHA 3OW1A 2NQJA 2WYSA 1IT8A 4ACYA 3WDRA 1FXQA 1QK2A 3ZFHA 2XM2A 2W63A 2NQ5A 1GNXA 4JTKA 1ZJHA 3RDKA 3P8IA 4DJED 3WJSA 3OA3A 2WV8A 5IBXC 4H9UA 3CAWA 4MMWA 2VC7A 2GOKA 3W7OA 2DVUA 3CAQA 3K4WA 3TSDA 2YA1A 1C93A 2PS2A 5T9CE 2ZRZA 3AO0A 5LNUA 3CL8A 4QAWA 2FZNA 1P1MA 4F0MA 3W02A 5CQ1A 3ITCA 5HANA 1EIXA 4HHLA 3ISIX 3FEMA 3RMJA 3B0XA 3HO8A 3U2ZA 1DP0A 1RBAA 4JS3A 4TX9A 1R6WA 3S42A 4V2XA 1FFRA 2VENA 4HCLA 3CUHA 2YCIX 3NQFA 4DJFA 4M6VA 4AZ7A 2WVSA 4WSJA 4Q33A 2BY2A 3CPUA 5G1MA 1C29A 2E9BA 2WJDA 4J3ZA 2VFFA 1JQXA 1O94A 3BLDA 1X6NA 1Z48A 3C2YA 4UQCA 3UYCA 1S1PA 3CO4A 3TTEA 1VP5A 1TUXA 1XLKA 1F6KA 2IKHA 4HPGA 2YA2A 3WLPA 1XC4A 3TYEA 1WX0A 3GFZA 1ZBKA 2Z1VA 5A6BD 3IK4A 3T78A 2Q8XA 4QJ3B 4QQ3A 3THDA 2VGFA 2QCGA 2P0IA 3CZGA 3ES7A 3AQUA 3NNTA 1DIKA 1VS1A 2E28A 4GC4A 2GYIA 4QLLA 1TZ7A 4EANA 1LL4A 3A12A 2A6LA 1TKKA 1VEPA 2XHYA 4X9SA 1U33A 4FX8A 1ONRA 4PGLA 1ZU8A 3RLHA 1E55A 1K4HA 4TXEA 5KEZA 3NVTA 1TQXA 3EPMA 3T0DA 3RMEA 2PP1A 1CX9A 4P8VA 4QG8A 4CNSA 1H11A 4HA1A 1UWRA 4GJ1A 3KFTA 1K6AA 1JDEA 3SM0A 2VGIA 1WKYA 1LRTA 2E5CA 3D46A 5CAHA 4WSKA 2BSLA 3KAOA 3QY8A 4Z1CA 3NUKA 1OYBA 2B81A 1VHCA 3GZ3A 3GX9A 1I2PA 3WQ6A 4Y8FA 1DVJA 3VKAA 5CBJA 1GVIA 2ZXBA 4Z0SA 3L4UA 4S2BA 3QLLA 2CWXA 1NJJA 1W9DM 3W7CA 2VXNA 1EUNA 2JIEA 1J18A 4K8EA 3KBVA 2E8YA 4UTTC 5CPQA 2E1WA 2E40A 3W6MA 3W53A 1KLYA 2Y62A 4LCSA 2QCDA 1XH2A 1ZS2A 1BFNA 2P3ZA 1XL9A 1JCMP 3GVGA 4LRSA 4YYFA 2QV4A 3RXZA 4MDPA 2BB0A 4DO6A 2QPUA 5AC4A 5CCZA 1S2AA 3P2VA 1W9UA 1FDYA 2C91A 2NV9A 3OBKA 3II1A 1H4PA 3MKCA 4RUBA 4OOZA 1VJZA 1N8WA 2IS7A 3BH4A 4D6GA 3TW7A 2BASA 3WIJA 4IX0A 4M7SA 4Z2KA 4EPEC 2G3JA 5U4NA 5IRPA 3GNRA 1UA7A 4GZJA 3GXTA 1UZDA 1C9WA 4Q8TA 1S2VA 2WNQA 1AW5A 4QG6A 4TO8A 3HPSA 2HE8A 3VGEA 5B80A 1V02A 3TZNA 1LP6A 1FKWA 1XQLA 5E9AA 4ILSA 4IIHA 5HR7A 3CUXA 2JK2A 1A0DA 7CGTA 3NQDA 1QNPA 3BCJA 3WQVA 1P6BA 1D8WA 2WK2A 1P7TB 5CJNA 1GVOA 1V6UA 2MUCA 3UWEA 3OBAA 2FVMA 1AMYA 2DZBA 3MWAA 1XISA 5CGTA 1A5LC 3VCCA 4DUVA 2GQ3A 4ZQRA 3GHRA 2C14A 1UD2A 1K7XA 1PYFA 3BGAA 1Q6LA 2ZUNA 1UJPA 2ON3A 1XV8A 1IYXA 1W9BM 3C5QA 1BAGA 1US3A 3UP8A 3UYIA 1G1YA 4B5SA 3U5YA 4JBRA 5A8MA 1UR1A 4L6DA 4GCXA 4K36A 2E8ZA 4GC3A 3W3OA 5A95A 1IWBA 1X6UA 1A50A 1E4IA 1W6TA 2Z28A 5H2ZA 1M53A 3S5NA 1FP8A 1ME8A 2D0HA 3U57A 4E3TA 1JPHA 5I3JA 2YSWA 4JKKA 3PBMA 1F3XA 1C91A 1JF5A 4XK2A 4HSNA 1J01A 2OQYA 1TMLA 3LQLA 4GIYA 3RFAA 1XRVA 5FF7A 2GDVA 1A3XA 5IFPA 1TPFA 2OXNA 4JKMA 3TYCA 3ZVIA 1FDZA 1CGYA 5CGMA 2PD9A 4O1FA 2AQWA 4LNCA 4LY4A 5JXQA 1P48A 5TAOA 4CD4A 1EXBA 2QVNA 3R0KA 2OGYA 2WAGA 4KEVA 4XG1A 1YDYA 3DFHA 3GB6A 3O15A 2PU1A 1V4YA 4X22A 1XI3A 7REQA 3G1XA 1XLJA 4YMZA 4YS1A 5HK4A 2QZRA 3VC5A 3VVGA 1X7FA 4US5A 2ZVRA 3GHUA 4UMCA 4P8UA 3MUIA 3LPGA 1YYAA 3TC7A 3W01A 5I78A 4ZXLA 4AZCB 3D0CA 4AEEA 3H22A 4IIFA 1BVZA 1B2YA 4WCJA 2BS9A 1UKSA 3C6CA 1MEWA 3N15A 4U3AA 4HKPA 3S6TA 4KCVA 3PPGA 2ZXDA 4KGJA 4MVAA 3WDJA 2A79A 4LCQA 5C54A 2NXHA 5A8QA 2CPUA 3TROA 2GGHA 4AAJA 1K7EA 4YVPA 4A8IA 1QOQA 1PIFA 1UWSA 3LHVA 4E3VA 4FR6A 3T8LA 2DZUA 5A6LA 1JZ4A 2F6XA 4AIBA 4WY0B 4ADSA 1XCFA 2X09A 3RPMA 1YADA 3MHFA 3V0SA 5D2YA 3I68A 3L4TA 3KTXA 1LL6A 3ITXA 3OO2A 2J6XA 2YBTA 3LPFA 1P43A 1PCWA 1UKPA 3NOEA 3DI1A 1FWBC 4IQJA 5FJIA 2VEGA 8TIMA 3EKGA 4CU7A 3DKJA 1AW2A 3RPDA 3UPBA 3W2UA 3N13A 1UD8A 3NZQA 2Y1HA 4HOWA 2FVKA 4L65A 2YBVA 3ZSSA 2QW5A 1FHUA 1SZNA 3QR3A 3FN9A 2VC9A 3O1NA 3ARRA 1F6PA 4XZIA 1UQYA 3LDVA 2V68A 5I7GA 3W7LA 2BHYA 3FHQA 3UZXA 2G3FA 3WO8A 1I2RA 4FLOA 4TQTA 1LLWA 4FP1A 4QJ4B 2GGGA 1FXPA 4F0LA 3ONCA 4X9YA 3TUUA 1LRNA 4CGTA 2B31A 2XVKA 2VR5A 3SQLA 2WO5A 4ADTA 3EWCA 1T40A 2JF7A 2YYUA 4LUIA 1V0MA 2WVVB 1XUUA 3A4JA 4OGZA 1Y0EA 3PHAA 4Q4RA 4Z2JA 2V8ZA 3W7NA 3LX9A 2WBKA 4IPIA 1R7OA 2ZRWA 2A85A 1Q7MA 1XYLA 3ZJ7A 1Y5VA 2IKJA 2ATMA 3PZNA 2Z7KA 3OGRA 5BRPA 3W7GA 2R8WA 4IICA 4Y7EA 5FEWA 2BODX 4S3GA 3NQMA 2YXGA 2ZXAA 4JFSA 1R85A 3MT1A 5F2GA 2QCDB 3RCNA 2VWSA 3QVQA 4GYPC 3CH9A 3RR1A 3GH4A 5EPDA 1CW2A 3TVAA 7ODCA 4RDWA 1A0EA 1TPH1 4MDOA 3H55A 1J2BA 3OGVA 3NL5A 4V33A 4GNJA 3CV7A 3E2RA 2ZVIA 3O8AA 4H2HA 2NWSA 2Y0FA 1RCXB 3CU2A 4X63A 1ITXA 5LNRA 3P82A 3W85A 2WPGA 2PWFA 5LIWX 1NVMA 1OGBA 4ZQMA 5CJMA 2YZRA 1Q4NX 4BI5A 1AQHA 4XD4A 5I77A 2D23A 2WB5A 2WHJA 2CXEA 5BRBA 2ZFAA 4BQ4A 1QNVA 1LOLA 5CZTA 3WQFA 2ZE0A 3GIYA 3U7VA 2ZZ1A 2WC7A 5FJTA 2V6AA 4LUTB 3NVDA 2CFFA 1AMKA 3VI2A 2GUBA 3WL1A 3AIUA 3PZMA 1KBJA 1KV8A 3FJNA 1EJRC 4TV6A 2VGGA 4RJEA 4KRZA 3DG6A 3VKKA 3TP4A 3N18A 2V81A 1V3JA 4DBEA 2ZX9A 3AXHA 3HB9A 5DEZA 5BOEA 4DB7A 2FH8A 4WDWA 3C2FA 1CB7B 3BGJA 5AHIA 2A3CA 4ZTXA 5EFDA 1JZ6A 2TRSA 2XGBA 3R13A 2ZUWA 1TWSA 4A3YA 1BD0A 1HP5A 3N4AA 1WOBA 2QR6A 4RXGA 2Z1BA 1LLOA 4LYQA 5AYIA 3ZMRA 2NV2A 4PBFA 3APTA 2GJRA 4CD7A 4MZYA 2FGLA 3NQ8A 4EWND 2NUYA 2Y4SA 1UA3A 3LLDA 5HJYA 2X1RA 1YNPA 4LWWA 4J3UA 4C5YA 3ARQA 4WJEA 3SUUA 2QKFA 5LSMA 3KCJA 4DWDA 1AZ1A 2V5DA 3MHUA 4NG3A 4W7UA 1JZ7A 1KGWA 1XWYA 1VENA 2PZNA 2H3DA 3FSUA 3HQNA 5A94A 1TREA 2X1IA 1IZJA 2J9YA 4XB3A 3FY1A 2X2YA 4WDUA 3PC0A 2E09A 1AQFA 3QHMA 3GU2A 4FLRA 4JD4A 4AVNA 1PXGA 4UIOA 3EDJA 5JU6A 2G96A 1MRAA 4YNGA 1JUEA 3UCQA 4NAEA 4UTMA 4FIRA 1Q8JA 1VJIA 4PCPA 3RJYA 4IGSA 3LGDA 3VKDA 1FUYA 4I9TA 5JBEA 3DBNA 5H8UA 3I3EA 4D6DA 1ALDA 2SFPA 3QEZA 3M64A 3TQPA 5AY7A 4AW7A 4OJYA 3GC2A 4DLMA 2R1PA 2CZVA 3ARUA 1VCFA 4MB5A 4HU3A 4GBUA 1HN1A 3UZJA 4AEFA 2EEXA 3OLDA 2O92A 3WLTA 3KEHA 4PUEA 3UZYA 4EE9A 4Q4PA 3IV3A 4NJHA 1IQ8A 2XVGA 1IXPA 1XRFA 1IGWA 1QCWA 3GC4A 2IMRA 3MI2A 3ICJA 4I8YA 3WLNA 2O9PA 4CVUA 5XIMA 1AK5A 4HK5A 1GONA 1Z42A 4YVVA 1R38A 3LCXA 2J7FA 4DJDD 3GDMA 3SW6A 3TNBA 3C0QA 4PMYA 1MZHA 3R25A 1GT8A 4JIQA 2XFFA 1EJSC 4XBKA 1ME9A 3HURA 5CSYA 3S47A 1EWEA 5CJ5A 4MKSA 1KXTA 5BWFA 4PRWA 1BRLA 5D9MA 3B06A 4LUSB 3QM3A 3R7MA 1FX6A 3MANA 3ARPA 3LUTA 1JCXA 3VZYA 3QZ6A 3UXDA 4LAMA 2X40A 4EVZA 2PFHA 2F2KA 3V0UA 5DQPA 5DMLA 4NQ1A 4W7WA 2QIIA 1UD4A 1RZMA 1NOFA 1OFOA 1YTEA 2I5GA 3RO6A 4DPQA 2RH9A 2I9UA 2PDQA 2IPGA 1OEPA 4CCCA 3S5ZA 4LAKA 3OPSA 2QPSA 3E9AA 1EBHA 4TX6A 2VX6A 3QLDA 1WAUA 4K7VA 3TCEA 4RZ5A 1H0IA 2DZAA 1CI1A 3TJXA 1PTDA 1TCDA 1W5OA 4IIBA 4H2CA 4ZVJA 3TSBA 5C8BB 4IF2A 3DFOA 4CQAA 1CXFA 2ACUA 5D38A 3WNLA 4OUEA 3BTNA 5JBFA 3RNDA 5HPOA 2C13A 1IHIA 5K9DA 3UR7A 3CMFA 1REQA 1OY0A 1QPNA 3S4TA 1E73M 3NQBA 1EL3A 3I65A 1K02A 2J77A 1EEXA 1UR9A 1X38A 5TNVA 4INFA 2Q3RA 1MDLA 1UR0A 5F1VA 5K3VA 1O5XA 3VD9A 1ECEA 3RHGA 3UVIA 1E71M 1A5OC 4PMNA 3P61A 4LS1A 4GO9A 3WJXA 2IPWA 2VVNA 4ICMA 4PSPA 1E6PA 3O0FA 4MY9A 4BEQA 1VZWA 4PMQA 4XO7A 4C6EA 4NI3A 1GW1A 3WKZA 1DJYA 3RR4A 4HNUA 4DF0A 1H7OA 3TR2A 4JX5A 2YKKA 3VNZA 1KLZA 1W8GA 3VUSA 2DSKA 1BYDA 3W75A 2Y5EA 5T26A 4LAZA 3V18A 2OLHA 4HU4A 4KIEA 1OYAA 2G4JA 4W85A 2C1HA 1W3JA 4U2ZA 5JVLA 1EPVA 3NDZA 3W24A 5I03A 3NQAA 2I57A 4PE8A 5FF2A 1YPFA 1R0MA 1ITUA 4ZL1A 4UQ9A 1L2UA 4CN6A 4M7TA 4POCA 5D30A 3POCA 4Z1AA 1DWHM 2E25A 4EACA 1FHVA 3L4YA 4GYFA 4GUGA 2PGFA 4M5PA 1WDSA 4I8DA 3PTMA 2VDGA 3TC6A 3LTSA 3KZPA 3THCA 4LYKA 4B5XA 2IQTA 2O7QA 3BOFA 1KBIA 3TYUA 4Q8WA 1GW9A 1PPIA 1O66A 1BYCA 4RZBA 2E68A 4F2BA 2DH2A 3DXIA 1XLIA 3NZGA 2XWDA 4HHMA 3GVRA 3PTQA 2BDQA 4AY1A 2X7WA 3NZ1A 4A6GA 4ZE5A 3WNKA 4FMVA 2WMGA 4QISA 4ZSUA 1PV8A 1Z6KA 2JQXA 1YPIA 1T99A 5I24A 1GZJA 4NNAA 4AFYA 4GWEA 2XSXA 5AHMA 3K1DA 3T8QA 1SUXA 1D2KA 4B16A 3N6HA 1UZ4A 3GKFA 3VOIA 1SO5A 1S2UA 2YL5A 2RFGA 2OWXA 2DVXA 4I9AA 3HV8A 1VFLA 4UQAA 1NEYA 4QFUA 2X0SA 5LGZA 1KNWA 3E1F1 3CAKA 3MC5A 5CXPA 3PG8A 1R3RA 3TH6A 3SCUA 1ELSA 2G37A 3BAJA 4CQ9A 3C3NA 5TF0A 3LLXA 3NYZA 1TMQA 2V3FA 4RZ6A 1O68A 3N3TA 4KKXA 3SN4A 1W1VA 2W4XA 1GOWA 1JRBA 3LEPA 1KCLA 4GXPA 1A5AA 3U48A 3WK3A 4KRUA 2VURA 2OWCA 2E77A 3RU8X 3A47A 4C1NB 3L67A 1H2JA 1GG1A 4Q8VA 4ENLA 3E2QA 3DHPA 3ARVA 3QXBA 3NO3A 4M56A 3MMUA 3NGFA 2IPFA 2E0PA 3MO7A 2V3GA 1SSGA 1ZL1A 3TTOA 2V3DA 1A5BA 4C6LA 4URIA 1QNRA 1FH9A 2QUTA 3OZMA 5BMWA 2W67A 4HVXA 4YPJA 4ORMA 1BF2A 2EPOA 3UY7A 4UXDA 4O8AA 1EYEA 1H09A 5CH9A 4PUKA 1E9LA 2GVEA 1ZAJA 3DUGA 1UASA 2C79A 4EWJA 3UNDA 3WBWA 2BP1A 1XLCA 3KOWA 3GKAA 1UR3M 3PWAA 1KW1A 1MZRA 3L0NA 2Y7EA 3SGUA 3EA1A 2DORA 4RV3A 1DWAM 2YCLA 1WZLA 4AC1X 4XQ6A 2KZHA 1FWEC 4AU0A 1XIMA 3GVQA 1OF8A 2FTPA 1KC7A 1M5WA 3M47A 5EA9A 3KM8A 3LD5A 3MO4A 4DJEC 5KINA 2X41A 2YCJA 2O56A 3NAVA 4HA0A 4EF8A 3LENA 4RLIA 3W00A 1H5VA 3N4EA 1H63A 1KBLA 3LRKA 5AC5A 1FVPA 5EMUA 2RGLA 4DPPA 1GORA 3ARZA 2V67A 1DWJM 3KOZA 1N7KA 2CXGA 1YQ2A 1E6NA 4IJBA 2PCEA 2WJFA 1QI0A 2GVGA 4PTNA 2X8RA 5E0CA 1W2PA 1ZAIA 2VC6A 4IQDA 3OYZA 3BSHA 1ZBCA 3UXIA 1HF6A 3MQTA 1RP8A 8XIMA 4O15A 2D20A 5AYBA 4P7NA 4YHGA 2I7GA 1GOMA 3JR2A 1HUVA 1NH6A 3M0HA 4ZFCA 4JTLA 4XKYA 2A3LA 4FNPA 3GQYA 4UTHA 2Q6ZA 1QWKA 2V0TA 3AI0A 4XX6A 1VFHA 4HNOA 4G9PA 5LNWA 2P5NA 2QNEA 2REQB 3GBEA 1JYXA 2BHZA 1J0ZA 3H21A 1F3EA 5K9CA 1RH9A 3AS3A 1E1FA 2VUYA 1D8CA 4R9XA 4NP7A 2X16A 4F8XA 1NTHA 1QFEA 4JYEA 4B90A 2D24A 3BAWA 2ZXQA 3WBEA 1JCLA 2NLIA 5HWJA 4JL1A 3ZJ8A 5A3HA 5BCAA 5LNSA 3HGOA 3FA5A 1CLKA 1VYRA 3W87A 4I5RA 3VIPA 5I0DA 3QSRA 3W1AA 5LGXA 5K2ZA 4Q6JA 1ECQA 3G1HA 4YXGA 2PB1A 2ZICA 3W1XA 4DI8A 2ZTKA 3ZOAA 3T07A 3RYSA 3ARXA 4CCDA 4FS9A 4F40A 5F1UA 1SR0A 4O11A 4DZIA 4IIDA 1HVXA 3DFTA 4L4MA 3ZT7A 3VIKA 4ACZB 2YBUA 2FDMA 2GWGA 5BYWA 4RK8A 3EDFA 3U8GA 1OINA 3GTIA 1YNQA 4M6PA 4PUNA 1FWFC 5I00A 3PWGA 1CPUA 4HJWA 2QHAA 4EPDC 3R43A 4IX2A 5HUOA 4IP7A 3PTKA 3AIRA 1WNOA 3ZIZA 3NIYA 4UFLA 1EOKA 4QQUA 3IK2A 2BVWA 1W9XA 3SZ8A 1OGGA 5DY3A 1E0WA 1I45A 3C2RA 3LHZA 3KOFA 4K39A 1QK0A 3IJLA 3M41A 2W79A 2CC0A 3C61A 4TOQA 3W9ZA 2OO0A 3STEA 1D3HA 2TSYA 1UUMA 2DIJA 1RQHA 5MF5A 3TQ0A 4JTAA 4MNLA 3ZSTA 1I0BA 3V5CA 4DVOA 1UR8A 2ZX5A 4JOMA 4HYWA 2A3EA 4MAZA 4GI4A 4MJ2A 1PBGA 1GOOA 3IJ8A 2J7BA 4I5UA 2EG8A 1DXEA 2P10A 2PDNA 2PDPA 1ZB5A 4LRTA 6ENLA 4XAFA 4UTIA 3SO7A 4L61A 3PF3A 3TN6A 4H9ZA 3CZEA 1XIJA 1MFVA 1UKQA 3LOTA 4YYCA 4I9JA 5K9XA 3BWWA 3N9RA 4C7DA 1I2QA 1WDQA 5KTLA 4GXMA 2JKEA 1AH4A 3D47A 5FL1A 1SSDA 3BDKA 1CEOA 4O0QA 1TJPA 3WDPP 1YBQB 2A3HA 4WKHA 1TUFA 1ZP4A 2BY3A 2PA6A 1YX1A 1MO0A 3SB0A 4WRHA 5AHEA 1XICA 1OZMA 4YTSA 2YLAA 4JTCA 5FJPA 2DZXA 3O6CA 4HNNA 2VR2A 1F8IA 3C86A 2A0NA 3W22A 4A35A 2J7DA 1OJXA 2RAGA 2HNHA 1TVNA 3EDDA 4A8RA 1FTXA