1KFEA

Crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with l-ser bound to the beta site
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
268
structure length
252
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the Role of AlphaTHR183 in the Allosteric Regulation and Catalytic Mechanism of Tryptophan Synthase
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 96
structure length 252
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfeA00
2WKJA 4GRSA 3IGXA 3W2LA 2V5LA 3U8GA 4K7YA 2FQIA 4LUJA 4O19A 3STCA 5EYWA 3TIMA 1C9DA 1ICQA 1VGAA 2PURA 1W3IA 5EKYA 3LLFA 2QAPA 4O15A 1VCFA 1FWSA 1SU5A 1VLIA 4GE8A 2Y88A 4IMGA 1LZOA 1DL3A 4N9BA 3RU6A 1JCJA 4UR7A 1JCNA 1DJNA 4AEOA 1X8FA 4ORMA 1JCXA 3DXIA 4ONVA 2G97A 5LSMA 4UC5A 4O1CA 5AHLA 4K6AA 3W7OA 1D3HA 1ML1A 2NWRA 1Z48A 2FPTA 1YXCA 1TPC1 3TW6A 3W72A 1GQNA 3B0VC 1TPDA 2PE4A 4DF1A 3EXRA 3GXTA 4LOCA 4AHPA 4RCXA 5MHBA 2LLEA 3ABOA 5HJLA 1SW7A 1O4UA 4OQVA 1I2OA 4NJHA 2GQ9A 4O8RA 3T78A 2QCCA 5BMXA 1JUEA 4UTKA 2NX3A 4WZHA 3N3MA 3KVJA 4GNJA 3CPRA 4M19A 6ALDA 2WJZA 2WV8A 3GB6A 1AW2A 5EMUA 2QUUA 5G1TA 3FKKA 1AL7A 4QJ1A 4YCOA 1FUYA 1SPQA 4JX5A 3I68A 1BWLA 5ABTA 3UWUA 4A2SA 4FNSA 2Y70A 3GVGA 1KFJA 3SZ8A 3W85A 3P8IA 2ZDRA 2CZ5A 5BOOA 3R5EA 3HJZA 5D02A 3B04A 3L9CA 3W2UA 3ABRA 2C0AA 4O0KA 3PF3A 2OCZA 5D33A 1YDNA 2YSWA 4AH7A 2B7QA 4WY0A 3C2FA 1ZFJA 2BXVA 3LBCA 4O16A 3NPXA 2H3BA 2E6YA 3TC6A 2Y63A 3UY8A 3UY7A 1TV8A 4XBSA 5IM51 4GUGA 3USBA 1IXOA 3ABSA 4AXKA 4ZQOA 3KRUA 1OF8A 1SSGA 4LVFA 1MSSA 2EAWA 3P62A 3PY2A 5F1VA 4G1KA 3B03A 2GVJA 1H7WA 4KWVA 3UZ5A 4YXGA 3VNDA 4DPPA 3C2OA 5CPOA 4JYFA 1LTDA 1GOXA 1TPUA 2VFIA 2WPBA 4WUIA 5A5WA 4O53A 4MKNA 3GKAA 1Q6LA 3OVPA 3QJAA 4ADUA 1DBTA 4RZ4A 4AWTA 1RZMA 3T55A 2YW3A 5L9FA 4DO5A 1F2JA 3GXNA 2B7OA 3S0CA 1EP1A 3SJ3A 3HO8A 3NPVA 1NF7A 3KAOA 4LW7A 4MZ1A 3B8DA 1AW5A 4GUFA 4UTTA 5CG7A 1QPQA 3TQVA 4RV8A 3LHTA 5C54A 3PB2A 3NL2A 3Q94A 2G95A 5KMYA 1YLVA 3C52A 4AWSA 5SWUA 5DCBA 3GKFA 5F2GA 1JCLA 3W1QA 3DFSA 4QSHA 1FWWA 4TR9A 1GVFA 3HPZA 3G1VA 2QCDA 1XUUA 1QOQA 3AO0A 1K7EA 1VQTA 1VCGA 5F4SA 4FO4A 1W5OA 3NPUA 4IMCA 4NQ1A 3TMLA 5K2ZA 1M5WA 3S42A 2DJLA 1YTDA 2C16A 5FEXA 3N73A 4MIMA 1W37A 2B0MA 2WSRA 4ZQCA 3L67A 2ZBTA 3W7GA 2E77A 3P84A 1LYXA 4ADTA 1UB3A 3C0JA 4JYDA 5K3VA 1F6PA 2ZTKA 1KBIA 2VKZG 4LS0A 5EPDA 3W2KA 2E5CA 2ZQ0A 4E2BA 5AOUA 1XL9A 1IXPA 3L5MA 3M16A 5TBOA 4ZVJA 3H54A 3L2IA 1W0MA 1J4EA 1TQXA 4JDYA 3LLDA 4NNCA 4RLIA 3GDMA 3HPSA 4JTEA 3EX1A 5E1QA 2B4GA 2AQWA 2F7FA 3WJYA 3HGOA 5FESA 1OFEA 3UXDA 2GJLA 2BTMA 1YTKA 1PE1A 3S1UA 5I3IA 5EA9A 5HUOA 3TW7A 3P61A 4M5PA 3FA5A 1KA9F 3W75A 2FDSA 3T40A 1F76A 1VRDA 1WBHA 2J9ZA 2BZNA 2DP3A 3M44A 4RJEA 3RFAA 5F2IA 1KTBA 1T0OA 1LOSA 3MHGA 4C1KA 1VHCA 4IXHA 1WQ5A 1G6CA 4IXXA 3NQ7A 3TAKA 1GTHA 4JTKA 3W7MA 2X1RA 2RDUA 3NZ1A 2CLMA 3C2RA 2A85A 5E0KA 5G5IA 2C15A 1G4SA 2DORA 4LU0A 3KXQA 2Z6JA 4JTFA 3NGJA 4CNNA 3EWZA 3LXBA 3NYZA 5E93A 5IBXC 2WSYA 4ZMGA 1QPNA 1JRBA 1LRTA 2V0TA 3OIXA 1FDZA 1RPXA 4UMCA 4I9AA 2TPSA 5BRBA 2A6LA 1R2SA 3E49A 1XI3A 4S2BA 2CLHA 2YFNA 3W7RA 2DZXA 4GUHA 4O1BA 2A1YA 4MY9A 4Z1DA 2CLEA 4E0CA 1EA0A 3KVKA 4HHPA 3S1XA 1HO1A 3G3DA 2A0NA 2VENA 1UUMA 5K9DA 1JULA 1P0KA 2DU2A 2ZRVA 4RXFA 3DBPA 1QPRA 1H61A 2ZZ4A 1H7RA 3T44A 1C8VA 2NV1A 3KVMA 4BFAA 1G67A 2F84A 5G2IA 1M6JA 5AYXA 3EXSA 3N19B 4WQ6A 1QO2A 4N9EA 2E6DA 4PH6A 4AF0A 2J9XA 3GDKA 1G7UA 1OX4B 3SY5A 1OFQA 2A7PA 4Y90A 1TO3A 2O7QA 4NJGA 1OHLA 4EVZA 2C19A 2I1OA 4OWGA 2GJNA 2GPTA 5K9XA 1P4CA 1L2UA 1OVDA 3IGSA 1XBYA 4JTGA 3NM1A 3W7DA 1Q45A 3WK0A 1TPVA 4FNTA 3EKLA 3H55A 2R91A 1ICPA 4NJJA 1H7PA 4NJKA 3UWVA 3W86A 3DAQA 4UTLA 3T7VA 5I3KA 2VEPA 4LVAA 2VEMA 1TRIA 3EWBX 5K9CA 3BW4A 3W1NA 3HG2A 2ZA2A 1FY6A 3LI0A 1Q3NA 1KV8A 2NWSA 3W2NA 4JX4A 3S5YA 5F4XA 3DKJA 3MYOA 2FPYA 2OJPA 1AK5A 1RQBA 3FJ6A 3UPWA 4HNNA 1YPFA 2R8WA 2V30A 3ZWTA 1TJRA 4GWEA 4N02A 4UTWC 4JYEA 1IIHA 3RLVA 1NEYA 4JDBA 2ZZ6A 2WO5A 3TROA 5KITA 3NVTA 4UTUA 3HGRA 4JR5A 5D2TA 3F4WA 2ZCGA 3L0GA 4A3UA 5DN1A 3W3OA 4MFEA 1LP6A 3GXPA 1A50A 1L9WA 3HIJA 5KZMA 4PL1A 3B0PA 1RVGA 1XXXA 3CIXA 3IGUA 1FCBA 1OX4A 4QNEA 3TAOA 3W7LA 4YWIA 3TR2A 2JGYA 3G1AA 2D73A 5AYZA 4HNTA 1G4TA 1N55A 2QJIA 3F1QA 3E12A 2W79A 5DCEA 1TMHA 1SFJA 4IMDA 3S5NA 3A24A 3IRDA 2ZYFA 1V5XA 4JEQA 1JJKA 4O52A 5CPNA 5CZSA 4Z1AA 4MY1A 3N9SA 4K37A 3RNDA 4WD0A 1OFDA 1TCDA 1GJPA 4XZ9A 1Y0EA 3ZFHA 3EKZA 3C61A 3IVUA 2QR6A 5K4XA 4P61A 2QCHA 2NUWA 1CX9A 1RQEA 3LHWA 5I3FA 3STEA 1R47A 2VOMA 3SGZA 3F03K 1SZFA 3FOKA 4YCPA 3S1WA 3GR7A 5FI8A 3P74A 4AMAA 4WXYA 1TTIA 3M6YA 3KRSA 4R7JA 3L5AA 1MEWA 1FWTA 5AFDA 3NM3A 3NQFA 3TSDA 1LROA 1LDCA 3BG9A 1F74A 3PUEA 2A7NA 2ZZ3A 3UWWA 1TPFA 4UCGA 4UMBA 5G4EA 1ME8A 1OFAA 1GVRA 2Z0IA 1LOLA 1IGSA 3TNOA 3GZ3A 3HBLA 3C4UA 3HPXA 5LNWA 2B7NA 1YTEA 4KFOA 2V9DA 1W5MA 2G96A 1I2PA 3IIVA 3WJSA 1U83A 5FEPA 2RH9A 3S5ZA 4ZQMA 5FEZA 1X1OA 1VYSX 1JCMP 2BSLA 2PC4A 3LM7A 4IUOA 4UUIA 3M43A 4BF9A 5LHEA 3TV8A 3CU2A 3BGGA 1PV8A 5HULA 4QQ3A 6TIMA 5DBUA 1VPXA 2QJGA 4NXSA 3LCWA 3P81A 4I7UA 1FCQA 4HN4A 5AYYA 4AB4A 2VELA 3MI3A 4CLMA 3STGA 1EPXA 3W1LA 3UNDA 3FYOA 3LXCA 4JIPA 1WOAA 3G1DA 3O05A 3MBDA 1BWKA 4LS1A 2DZWA 4NU7A 1WBJA 3L65A 1KFLA 1SR9A 4W9TA 3LI1A 1M7PA 3NR0A 3L0KA 1K7FA 4QIUA 4XUGA 3ZS4A 4BWLC 2HSAA 4UFMA 1WV2A 4FXSA 1ZAJA 1TIMA 4TU1A 4EF8A 2E1DA 2FTPA 4A22A 1B9BA 3GDRA 1FDJA 1TJPA 3G8EA 4RZ5A 3LTPA 3QC3A 5FF4A 5F4WA 1W5NA 3GAKA 1DJQA 3AJXA 4O11A 4O28A 4UMAA 3M47A 4CCEA 4DXVA 3VFLA 2UV8G 3GR8A 2FB2A 1PS9A 2FB3A 5F2LA 3GNNA 4NJIA 3NQMA 4GBUA 4UFJA 4FIQA 3G1SA 1JUKA 4X22A 1WA3A 4HNVA 3PULA 2GQ8A 1OFBA 3QF0A 3NA8A 1XUZA 2WNZA 5TQLA 2NX1A 4Q32A 3IVSA 4BK9A 4UFLA 3P80A 1VR6A 3L0NA 3PAJA 4S1FA 5L6UA 3STFA 1OK4A 1BTMA 1TTQA 1EP3A 1TV5A 1ICSA 5AHNA 1C29A 3HF3A 2NLIA 1O60A 2YZRA 3LERA 2QCMA 2Y62A 4UTIA 3RF9A 1EB3A 3W7NA 4GXMA 1KLZA 2GOUA 1GVQA 3QM3A 3NQDA 4NZJA 3SW6A 1HUVA 3M5VA 1UCWA 3GLCA 4Z0SA 3B06A 1PVNA 4UTWA 4AAJA 5DXYA 5KZEA 4XTIA 1R2RA 1P1XA 1LCOA 3BLIA 4K8EA 2Y7DA 4NUWA 4QM1A 3PVFA 3O16A 5HNRA 2ATSA 3UYCA 4LWWA 2VFFA 4R33A 2WSQA 1YYAA 2YCEA 4DO6A 4PCFA 1QWGA 2WQPA 4RZ6A 4CCCA 2YYUA 2FJKA 1Z44A 2YFOA 2VFHA 3W84A 2ZTJA 4O13A 1XFBA 3OHIA 2R14A 1SW3A 2A6NA 4IPJA 4O14A 3N2MA 4MZYA 4C1LA 3S1VA 2EHHA 2DZPA 2RFGA 1HL2A 1H51A 2ISSA 4O1DA 4AWUA 3MHFA 3V1PA 3WK1A 1AG1O 1TRDA 1IIGA 3E96A 2V2CA 2JKEA 4AHQA 5I3JA 5BW6A 2I14A 4Z08A 4TMBA 4ML9A 1A5BA 4MLRA 3S9YA 1QCWA 2CLIA 2X1UA 4MYXA 2ISWA 5CZ0A 4AHOA 5DY3A 3O6YX 3W7EA 1OYCA 1SO4A 3M7WA 1Z42A 4RR4A 4HPXA 1K3UA 4FHAA 2OZ0A 2XFWA 3L66A 1ALDA 1H50A 1LBMA 3O63A 2JK2A 2CLKA 3TQKA 1QPOA 4LTSA 1GWJA 1LM1A 3PSVA 5D05A 4IQLA 5AB3A 3PSWA 4IJBA 3NL5A 1F05A 1VYRA 1SFLA 1QO5A 5I3GA 3KRZA 1B57A 5F2MA 3ANYA 3S6DA 4HSNA 3INPA 2JGQA 3LCGA 3QW4B 3W1RA 2ZRYA 1TV7A 4FF7A 5G4WA 2CLLA 1JQXA 4N4PA 4P2VA 4CQ8A 1W5QA 3LRMA 3LX9A 3PG9A 3M1ZA 4LC8A 3EX3A 3M9YA 1YADA 3UQNA 1ADOA 4NX0A 2YPIA 3SIZA 2V5BA 3NEVA 2J9YA 5HMSA 2A7RA 2QAFA 3L68A 3PBWA 2IQTA 1JCYA 1EX5A 4DPQA 1RQHA 4JY8A 3M5YA 3TSBA 4LVGA 3MMTA 4JS3A 4GUJA 1YDOA 4RKAA 3IV3A 5AHMA 4N9CA 3ABQA 3DFTA 4B5NA 3I7SA 1FWRA 5D04C 2CLOA 3PBVA 2BLEA 2C18A 4Q4KA 1S5WA 4M7TA 1AMKA 3DFOA 3C3NA 2X30A 1K8ZA 5LNVA 4X9SA 4NX5A 3I7QA 1GEQA 3KFTA 1TPH1 5D2VA 1XDLA 4N2YA 1Z41A 2QCNA 3EWYA 3QMSA 3HGJA 1ME7A 3WJXA 1VS1A 4OT7A 1R30A 1GG0A 1KM3A 4M7SA 5LZLA 4H3DA 4PA8A 5U4NA 3A21A 1QDSA 3NG3A 5T26A 4LRTA 2Q8ZA 5LHFA 2W0UA 5LGXA 3BO9A 2FLIA 3FS2A 2DZTA 1A5AA 4NNBA 3CWOX 2BWGA 1ZALA 2DZSA 2Z6IA 1VYPX 2Q3OA 3CWNA 5LNRA 1S5TA 1I2QA 2VEIA 3L5LA 1TB3A 5DLCA 4ALDA 4GUIA 1PCWA 1G7VA 3E02A 5AC6A 2VFGA 3NOEA 2HMCA 3V75A 3IEBA 3DGRA 3MWAA 4WOZA 1S3HA 3W6YA 3N2XA 1OABA 4M6QA 3PB0A 1JVNA 3B0UX 4EOUA 1S5VA 1RD5A 3JRKA 1TTPA 1W3NA 2AAMA 1H1ZA 3QEZA 1YDVA 2ABBA 1LRQA 1XC4A 4IMFA 3OBKA 3P67A 3LCIA 3BW2A 4MFDA 1KM4A 3W2JA 2J6XA 3W70A 4O50A 4WXZA 2FIQA 1EUNA 4A2RA 1P5BA 1KBJA 3WJWA 3U2OA 3NQEA 1ZHAA 3M5ZA 2J88A 2C14A 5G2WA 4LVDA 2E5BA 5HWNA 2TMDA 3W87A 3CM4A 3Q37A 1NFBA 1ZAIA 1Q6OA 3EXTA 4WOQA 3MP5A 4M6VA 4MLJA 1ZAHA 2VFEA 3UXAA 2ZRZA 4ORIA 5CKSA 1GVSA 3C8FA 3CEPA 1ZNNA 4Z1CA 1GT8A 2QUVA 4QAIA 1T96A 3GX9A 3O8AA 4UFHA 1TSIA 1H7NA 3SSJA 4RK8A 1K8YA 2G5WA 2OX1A 3I65A 4JICA 1H63A 3EWXA 3LB0A 3OA3A 1OFRA 3PS7A 3KHJA 4DEFA 4TMCA 3PBUA 2YDAA 1I2NA 5AC7A 3BG3A 1H5YA 3NXFA 3EX6A 3DFQA 3TJLA 1W31A 1P0NA 2X1TA 2H3DA 4MZ8A 4TX9A 2QCLA 3BV4A 3VKJA 1SZNA 4FEZA 1PL9A 5LNSA 2W6RA 2QCFA 1FX6A 4O18A 5LNUA 3IIOA 3NL3A 3NQ6A 1R46A 4QITA 3IIZA 4YLWA 5I3HA 2ZFAA 3WJZA 2VXNA 4FIRA 1XDMA 3DI0A 3P60A 3NO5A 5EY5A 3L21A 5D09A 4ZQPA 1HFBA 5KTLA 3WK3A 2EKCA 3BW3A 1QFEA 2OMAA 3LTYA 3G18A 4IOTA 2H6RA 1F7BA 1TYGA 1WXJA 4FXRA 2WNQA 3Q58A 3MP4A 3LRLA 5KSWA 1FBAA 4GJ1A 4WJEA 4UTTC 3G24A 3N9RA 2ZZ1A 3CLMA 3P82A 3P8JA 3GDTA 4BI7A 2X16A 5KINA 1PHWA 3FEMA 1GVOA 1A5SA 4BI6A 3HOJA 4XKYB 5HR7A 7TIMA 1DKWA 3I6RA 4N4QA 3LCLA 3TA6A 2QEZA 1KLYA 3N34A 2PRLA 1DVJA 3RLUA 1D9EA 2GUUA 3QQ1A 2YR1A 3R12A 1X7FA 4FX8A 3A5VA 3TXZA 3W7IA 2HS8A 4KWWA 4LT9A 4CQAA 2A4AA 3NDOA 4ADSA 1F73A 2VC6A 4HKPA 3RMJA 1QNVA 1K03A 2QDGA 3W7CA 2NUXA 4R53A 3W88A 1EWEA 1XM3A 2PCQA 3U6WA 4E38A 4M6PA 2QCEA 1HTIA 1QAPA 4O4WA 3THQA 1L6WA 3W2MA 1I2RA 2CW6A 1G4EA 2O7SA 4R34A 3O06A 3DENA 3VE9A 1TQJA 2P10A 3S5OA 4MPQA 1BEUA 5HQEA 4NXKA 4EWND 1H7OA 4KFPA 1YPIA 4K8HA 1M7OA 4HIBA 1LOQA 4OBTA 1LLWA 1PHQA 1J5TA 3PUOA 4J9JA 4ZZ9A 5D30A 1SUXA 3HQ1A 2P0OA 4JTUA 3BG5A 1VH7A 3M5XA 5IBXA 3NQCA 1KW1A 3FIGA 3RK8A 4UTHA 3O07A 3DFNA 3TMQA 4DF2A 1ZENA 1O94A 4PFMA 2Q3RA 5C5YA 2YGYA 1NF0A 3VE7A 2CZDA 3FYPA 4TO8A 5G2HA 1SO3A 1EEPA 1KFBA 3W23A 2TSYA 3SFKA 1OK6A 4POCA 1T99A 3CT7A 2E5DA 4ZQNA 1THFD 3PM6A 2R94A 5D32A 4X3ZA 1CI1A 1OX6A 1LBFA 4UR8A 4H6KA 3G1YA 1B4EA 4LV4A 1WAUA 4JTHA 1K02A 1TREA 4LC6A 4OU1A 1OFOA 4LV9A 2J27A 1ZY9A 3FLUA 1W56A 3W7PA 1TPB1 3EWWA 1A53A 1I45A 1GG1A 4XQ6A 4Y6GA 5HWMA 3E9AA 4LRSA 4WY0B 1OFPA 1UJPA 4DBDA 1O5KA 3MI2A 4A21A 1FWNA 4NVTA 3LDVA 4YMZA 2DJXA 2YYTA 3CC1A 3P5ZA 1O5XA 1F5ZA 3KX6A 1DOSA 1EIXA 2NUYA 3G1XA 4UFKA 4Q33A 1SO5A 2HS6A 5HUPA 1QMLA 3GNDA 2NXHA 5FF7A 8TIMA 2P1FA 3W1TA 1OX5A 2EF9A 3W83A 3C2EA 1MEIA 4XTDA 4JNMA 1A5CA 4FNUA 1Q6RA 1K7XA 2JKAA 4Z1BA 3R13A 2FFCA 2C1HA 1E51A 2YXGA 4ZQRA 2FPVA 3NPWA 3QPZA 2WNNA 3TSMA 1DORA 5C2XA 4Y96A 3QPYA 3UWYA 3DZ1A 3TQ0A 3T4CA 3O15A 1W54A 1T8XA 1XKYA 5GVJA 5J5DA 3TKFA 3HB9A 3W7JA 5CPLA 4I7WA 5EBUA 5CSRA 3F4NA 1VZWA 4JY9A 5KZDA 1X1ZA 2V82A 2CWNA 3QSRA 1H7XA 1LLZA 5F1UA 5J5RA 4BR1A 4U28A 3SECA 2EGZA 1N8FA 3HGSA 5DY2A 2H8XA 2Y85A 2Y6ZA 3VCRA 3MUXA 4HNUA 3G0XA 5HR6A 3MP3A 4JTJA 2ATMA 1MEHA 2NV2A 1QOPA 3W7HA 1GZGA 3Q2DA 3GDLA 2E6FA 5BNKA 1J2WA 3W1MA 2QCDB 3QH2A 4DF0A 1WDWA 1V7YA 2ZZ7A 3UWZA 1RV8A 3TCEA 1VCVA 4DO4A 2NZLA 2B7PA 3OG3A 3W7KA 2CU0A 3QMTA 1NSJA 3W1XA 3K30A 3HG4A 3QSTA 4FNRA 3A22A 3YPIA 3FJLA 1L6SA 3WK2A 1KTCA 1KM6A 1MO0A 3NZRA 3NNTA 4JIQA 2QCGA 4JD4A 3TXVA 4S2CA 2Y7GA 3LV6A 3FFSA 3P7YA 2ABAA 3DHDA 3R2GA 5H2ZA 1WYIA 1IF2A 3ATYA 2V8ZA 4UIOA 3NQGA 3O1NA 4RXGA 3DH7A 1GYNA 2CFFA 1QR7A 5CZJA 4OGZA 3OVRA 1KFKA 1K8XA 1R2TA 3B05A 1W8SA 1DV7A 3NQ2A 3OEXA 2Y7FA 3BLFA 2NXGA 4DQWA 4L4MA 2ZA1A 1LBLA 2VFDA 1KM5A 1GTEA 1SW0A 4I7VA 4MJMA 1UASA 1KFCA 5FF2A 3G0SA 2I9EA 4JTIA 1L6YA 4PEKA 3R8RA 1OF6A 2TYSA 5DCDA 2H90A 3LHUA 3GK0A 1NVMA 5BMWA 3NQVA 3QZEA 2Y61A 1KTNA 1CW2A 2E09A 3WFAA 3DFPA 3W22A 2A21A 4Y8FA 1LRNA 2YW4A 4GC4A 4NNAA 1W5PA 5AHIA 3A5FA 4OHQA 3I7RA 1WX0A 5FF3A 3CB8A 3TU9A 1YXDA 4PL2A 1KV5A 3LV5A 3G0UA 3ATZA 3B4UA 2NXIA 4UNKA 4PODA 1WOBA 4O1AA 4CNOA 5CZTA 1IXQA 4JN6A 3CQ0A 4LUIA 1XBXA 3LHZA 3EX4A 2J24A 1F6KA 2XN2A 3FKRA 4UXDA 3UPBA 2ZZ2A 3MYPA 3ZR4A 2KZHA 1MXSA 2H8ZA 4MJZA 3UZJA 3QRHA 2GQAA 3CIWA 1XBVA 4TIMA 5FF0A 1BKSA 4PC8A 3G3MA 3TH6A 5HWJA 4WX2A 4JTTA 4UTJA 4AF0B 3TX9A 3JS3A 1KM0A 1OYBA 4MY8A 2RKXA 3MI6A 3BGJA 3N14A 3W71A 3QQ0A 3UWQA 4BWLA 4EIVA 2CLFA 3C2VA 5AHEA 1ME9A 2EPHA 4YL2A 3P5YA 4LVBA 1OYAA 3BVJA 4LNYA 4LS2A 2CZFA 5K7JA 4L4LA 5CPMA 3GYEA 4CNPA 4ICNA 1FQ0A 1AL8A 1RR2A 1U5JA 3HMJG 4K7VA 3KOFA 2DZUA 1TPWA 4O0ZA 4MUZA 4XBKA 1PCKA 2V81A 2DZVA 1JUBA 4CCDA 3MBFA 3CEUA 4KKXA 5H91A 3G1FA 2RHGA 2HTMA 2PRHA 2C6QA 1W1ZA 3PC0A 4N9DA 1VLWA 4JX6A 4WY0F 3EWUA 1DQWA 2ZRUA 3NQAA 2C13A 3IIPA 3MW7A 2XN1A 3TK7A 2AGKA 5DELA 3G1HA 3LRKA 2RDTA 2QF7A 1UBSA 3W1AA 5TIMA 1FDYA 2WOQA 1DHPA 3QW3A 3NAVA 3LCXA 3IIXA 4UNLA 1N7KA 1D3GA 1AW1A 2QKFA 2Y89A 4RX0A 3HG3A 1EUAA 2GVGA 2TRSA 4MVAA 1OG0A 4E2DA 5D38A 3TUUA 3TE9A 3R89A 5AHFA 2ZRXA 3LCFA 1G69A 4PTNA 3DI1A 5DBTA 3W1PA 5D2YA 5C55A 1JQVA 1B4KA 1VC4A 3LCHA 3MO7A 4IPIA 4IGHA 5CSSA 5LGZA 1XBZA 4ZL1A 5G1YA 2QJHA 1XCFA 3LXAA 4IMEA 3LBMA 3W74A 3W7QA 1UUOA 5AN7A 1ONRA 1NAL1 1SQ7A 1DQXA 2JBMA 2OT0A 5K4ZA 5D37A 3TDFA 2BX7A 1H60A 3BARA 1FCVA 4MYAA 5D2XA 3THAA 3TFXA 2OT1A 4Z0JA 3NQ8A 4UTMA 1PIIA 3SR7A 1H62A 2XN0A 1W3TA 1YXYA 4JTLA 3LHYA 2X1SA 1GYLA 3S8HA 4AVFA 5HINA 4FB7A 1KM1A 1LORA 3C6CA 4DBEA 3LTSA 4NZFA 4OV9A 1KM2A 3BK0A 4OE7A 3W9ZA 1SO6A 2E68A 3W1UA 4CQ9A 1I8JA 4IWWA 2VEKA 3SI9A 3A9IA 3VI2A 2E6AA 1ZJIA 3G22A 1H1YA 4NT0A 4U4MA 3EX2A 1SZGA 4IX2A 3G8RA 3ZWSA 3DKLA 3M0ZA 5EL1A 4QNWA 2QDHA 1FCUA 3UD6A 3KVLA 1EP2A 3E0IA 1EWDA 3EB2A 3PBYA 3LGEA 1X6UA 3W07A 1O95A 4HT3A 3QYQA 4QISA 2RDWA 4XWUA 4DELA 2Q8LA 4K39A 5D03A 3MJYA 5A8GA 4H4IA 1Q6QA 2ISVA 3LHVA 5D2WA 5C6MA 4KFNA 5AC8A 1JRCA 3HG5A 1G4PA 3GIYA 3W76A 3QMRA 3DU0A 4Y9AA 2CZEA 3TJXA 3CTLA 4FNPA 3ELFA 1VHNA 3OVQA 3M41A 2NX9A 1OJXA 3W73A 3O6CA 4EF9A 4O4VA 4JXCA 1GPWA 1B3OA 2V2HA 3GAYA 3IVTA 5LKYA 2PRMA 1ZCOA 4O54A 1SZEA 4OV4A 2X2GA 2A5HA 4D2JA 2ZRWA 3TFCA 3D0CA 3LOTA 1HO4A 2QUTA 3PUDA 3SGUA 4O17A 1VJIA 2GVLA 3MHUA 1MZHA 1SSDA 4HPJA 4K38A 5DXXA 4A29A 4O12A 3QFEA 3H53A 1HG3A 4JGDA 2C3ZA 3TC7A 3PG8A 3BLEA 4GFSA 4K36A 4HSOA 1IXNA 3EEGA 3BPWA 3PWAA 4FNQA 1KFEA 1TPEA 2ALDA 3A23A 4FX7A 2Z2UA 2Z1BA 5U7SA 3C56A 4UFIA 1JR1A 3CHVA 2A2IA 4JTSA 2JKPA 1I4NA 2V2DA 4X2RA 2YX0A 1TTJA 5FEWA 1FXPA 3JR2A 2ZZ5A 4N6FA 4O10A 3O6DA 5CGQA 4IX0A 3PR2A 4XKYA 4LY8A 3DHFA 4MOZA 4BI5A 2ZA3A 4O57A 4N6EA 1FXQA 2Y7EA 4FX6M 3NL6A
chains in the Genus database with same CATH superfamily
4GRSA 1C7SA 3IGXA 2X09A 3P0WA 4K7YA 2FQIA 4ACYA 2Y0FA 5EYWA 1VFOA 2FZBA 2PURA 2VX4A 5EKYA 1NDVA 3UA3A 3HZ3A 5LIYX 1EEXA 1SU5A 4GE8A 5CPTA 4N7QA 1LZOA 4N9BA 4BQ5A 3WFLA 1X8FA 3R58A 4JN7A 3W6LA 3AHXA 4ONVA 3GRIA 4QG6A 1U5HA 1YXCA 1TPC1 2VMFA 3G77A 3TW6A 3W72A 1XRVA 1EO7A 2E1WA 4XIAA 3VNJA 1WKDA 2PF0A 3CJPA 5I79A 1EF2A 4AHPA 5MHBA 1E9YB 2WZHA 2LLEA 5HJLA 4IIBA 1V6VA 2XWEA 5H1WA 4HD5A 1UZDA 5C8BB 3N3MA 4PUEA 3TTEA 1MRAA 3CPRA 2I5GA 5ABGA 6ALDA 3H2CA 2BFGA 2QUUA 3TZNA 5G1TA 1AL7A 4LBRA 4QJ1A 2CC0A 4YCOA 1SPQA 3I68A 1BWLA 1KRCC 1XIGA 4A2SA 1MUWA 2Y70A 3GVGA 1KFJA 2YL5A 1TVLA 3SZ8A 1TJ2A 2ZDRA 3WF4A 1CTNA 3BCDA 4FOJA 3WDIA 3R5EA 5IFPA 4Q7IA 3GFZA 4HZMA 3E38A 1KRBC 4LAKA 2R9RA 3TOPA 3WUEA 3AROA 1ZUAX 1I1WA 2YSWA 4PB3A 4HSHA 4CKQA 1POJA 2VDGA 2BXVA 3P0XA 4J27A 1NWUA 4HTBA 1Q6FA 3UY8A 5A6KA 4MNKA 4PFHA 2EPNA 4XBSA 4GUGA 1HN1A 3LLXA 5A2BA 5LIXX 1UYQA 1OF8A 2YB4A 2EAWA 1XG4A 4C6MA 3MQTA 4E2VA 4P7QA 3DECA 4KWVA 3UZ5A 2FGBA 2J8FA 3C86A 3I3DA 3VNDA 3CAQA 1GQJA 2WPBA 2OYLA 3B8SA 2D23A 1J0HA 4MKNA 1Q6LA 3DHPA 3UJFA 2WMJA 3SCVA 1DBTA 1JAEA 3TN3A 5KETA 2Q8XA 4RZ4A 4AWTA 3HFYA 4DO5A 2JE8A 3VGEA 5GQBA 3S0CA 4RNFA 1OCNA 1EP1A 4FLQA 1GHSA 3PANA 3CXOA 4LW7A 1O5RA 4GUFA 5BRQA 1SM9A 4OFCA 3VIFA 1YW1A 4Q8PA 2HCVA 3NL2A 2G95A 4TQTA 1XIHA 2X41A 3FV9A 5DCBA 3GKFA 5F2GA 4G9PA 1D8WA 2E67A 1QOQA 1VCGA 4FO4A 3S42A 4NZ5A 1CGYA 2QZRA 3AZRA 3T08A 2DJLA 4F0HA 2Y2WA 1TX2A 1JFXA 3SCSA 4D1JA 2ZBTA 4KH2A 4W7WA 4DLMA 1XLHA 1LYXA 3SUSA 4ADTA 1UB3A 1CZ1A 2VKZG 4AZCA 2ZQ0A 1RHCA 1XL9A 4D71A 3L5MA 3M16A 4Q4PA 1PX3A 3WMCA 1GHRA 1Z6KA 1TQXA 2ZVIA 4RLIA 3D3AA 3GW3A 2FKPA 2FVLA 4C6BA 3RN6A 2AQWA 5J8LA 3WJYA 1VRXA 2DIKA 5FESA 3DDMA 2GJLA 1ITCA 1YTKA 4L1XA 4A6GA 3AZTA 3KTCA 2PSNA 3WLTA 3P61A 2CITA 4M5PA 3FA5A 3KZPA 3T40A 2J9ZA 4M8UA 3U5UA 1KTBA 3OHMB 1LOSA 3MHGA 4IXHA 5RUBA 4DUOA 3OGRA 3W7MA 2HEJA 1B5TA 2A85A 5E0KA 2DORA 4HHHA 4IGSA 3C0QA 4CNNA 3WLQA 2PGWA 3LXBA 1GQKA 3NYZA 2PP1A 3BZJA 3QR0A 3LMZA 4JTAA 3OIXA 3AC0A 1TE1A 1PB0A 1TELA 4UMCA 1W32A 1R2SA 4S2BA 2CLHA 3TTOA 2XWDA 2DZXA 4M82A 3ZVHB 1A49A 1EL3A 3WKZA 4E0CA 4L4PA 4LALA 1EA0A 1HO1A 3G3DA 1F3WA 4ZO6A 2VRKA 2G3NA 2ZRVA 3BQ6A 3M0YA 1RCOB 4OTKA 2CBIA 4WF7A 1H7RA 1UPMB 5CBIA 1G67A 2J74A 4JKMA 3V16A 3WD2A 4GGHA 5MF5A 3H24A 3AMLA 5XIMA 3D3FA 1S5MA 1AZ1A 1G7UA 5FOOA 1ZPTA 1TR9A 3HJEA 1NY1A 4NJGA 4V15A 2I1OA 4OWGA 6REQA 2WB5A 1OVDA 1R3WA 3TYCA 3W26A 1XBYA 1X8CA 3W7DA 1KKOA 3MC5A 2BP1A 3W38A 3IJIA 5DRCA 1PYMA 1KXTA 1YBQB 4UTLA 4KEZA 3EWBX 3H2FA 3JVAA 1MNZA 3RX2A 4H8VA 3LI0A 3W2NA 3AXMA 4DJEA 2FPYA 1AK5A 2BODX 1RQBA 2CWXA 4HNNA 1YPFA 2R8WA 2X40A 4PMDA 2OWWA 4IZGA 3EAUA 2FZMA 1KXHA 4ZOEA 3TROA 4FK9A 3L4VA 1DWAM 4JR5A 4Y2WA 3B9NA 2XJ7A 3I6EA 2FMOA 3BJFA 2BOGX 2XUCA 3GNRA 4QLLA 3RX4A 3N15A 1E72M 1VBHA 2WWDA 2GQ3A 1JF5A 5AYZA 5BXSA 3F1QA 3BMWA 1IT0A 2G3IA 1V3JA 3EDFA 5DCEA 4FSAA 4BJHA 4U2YA 4LPCA 1GJWA 4G7FA 1GUVA 3IRDA 4QS6A 5CZSA 4KESA 3AIRA 3KBSA 3T2PA 2DW6A 2YDRA 1GJPA 2Z7KA 4H8UA 2WKLA 4P61A 2WHJA 3LHWA 5I3FA 1R47A 1XC6A 3FOKA 3VIJA 4ZTXA 1V3IA 3M6YA 3KRSA 4GZJA 2JFEX 3U48A 1MEWA 4MG4A 5AFDA 3NM3A 5AYBA 3BOFA 1LROA 1CXFA 1TV4A 1OGGA 2ZZ3A 3B9DA 3IJ7A 4UCGA 2HVOA 2O9RA 2OO6A 1TVPA 2HV5A 5DQPA 3QFWA 4C6DA 1I6NA 3TNOA 5FA5A 3HPXA 5LNWA 1UP2A 2ZKMX 3GUGA 3L4UA 1BHGA 4KFOA 1GKQA 3GHUA 4MMWA 3UWEA 3A3HA 5JIPA 4ZB0A 3S5ZA 4IFKA 1NM9A 1US2A 3LZ3A 5ECUA 5DFAA 3WL0A 3NJ3A 1FKWA 1HKMA 7ODCA 4X9YA 1VPXA 2MANA 2Q02A 4NXSA 4IIDA 1RY8A 3P81A 1KRAC 5M3WA 3HFTA 2W9MA 8RUCA 3E0LA 3MI3A 3STGA 1C8YA 1V7AA 2BHYA 3FYOA 4JIPA 4DAIA 4OBSA 3S6TA 5BZAA 1BWKA 1NOFA 4IQEA 3F4VA 1SR9A 1D3CA 1KKRA 1S3TC 3BAIA 2QGHA 5LA0A 3ZS4A 1V3LA 2HSAA 4UFMA 1WV2A 1ZAJA 4EF8A 1EHAA 1EFZA 4L80A 2FTPA 4PRRA 1L0PA 1B9BA 1X39A 5A8OA 3G8EA 3QC3A 5F4WA 1W5NA 3GAKA 1DJQA 5REQB 3T0AA 2IPWA 2QF8A 4O28A 6XIAA 2X0YA 3VC5A 5C7VA 3GNNA 1UKSA 1CLXA 3NQMA 2YCKX 4FIQA 4X22A 3L4TA 3PULA 4L9ZA 1KRMA 3QLLA 3D6NA 4P5UA 4Q32A 1CECA 5CAHA 4BK9A 1HJSA 2ZWYA 3AS1A 3SJNA 1E9LA 4GH3A 1BF6A 5M03A 1FP9A 3MU7A 3T2OA 5AHNA 1ZZMA 3HF3A 2P5NA 3GTIA 3MO4A 3U7VA 3SCRA 4DJDD 3TYAA 2PP3A 3LERA 1VEMA 3RF9A 3T8QA 4FLSA 2F61A 2ZXDA 1EB3A 3W7NA 1GVQA 1UD3A 3UBPC 3QM3A 3AXKA 4NZJA 4ZO7A 3M5VA 3ARQA 1QW9A 2OSYA 1PVNA 4H7ZA 1R2RA 4U31A 3PZGA 1LCOA 3BLIA 4QE4A 5JH2A 2Y7DA 3IUIA 2KX9A 3GTHA 5MKGB 1QNQA 1V4YA 4HOXA 4CN1A 2WC7A 2CYGA 2XU2A 1QWGA 1R86A 2WQPA 4DJDC 3PPGA 2XFYA 5ENLA 2VFHA 5M17A 1XFBA 2R14A 1SW3A 1XIBA 5I03A 5CQ1A 4ZO8A 1BYCA 4MZYA 1RY0A 1EJSC 2DZPA 1H51A 2ISSA 1S46A 1U33A 3KEHA 3BSMA 4LF2A 1TRDA 1ZJAA 2DSVA 2YCLB 5I3JA 2I14A 3K13A 4TMBA 4ML9A 1A5BA 3BGAA 2EJ1A 1V51A 4MYXA 5EFFA 4AHOA 3O6YX 2ZVRA 3KBWA 1OYCA 1NDWA 1Z42A 1DWHM 2OZ0A 3MPGA 3RU8X 4W8LA 1QPOA 4Z2GA 5D05A 3WLPA 1JPDX 1SFLA 1QO5A 1W9PA 5I3GA 1B57A 1DWGM 1UWSA 4YU1A 1EXPA 2YCJA 2HK1A 1NU5A 4QG9A 1LQAA 1K6AA 3ITTA 4FF7A 1K9DA 1OCJA 1Q13A 2XIIA 1EJ7L 4N4PA 3URBA 4LUSA 1HGYA 1B2YA 3DCPA 1UMYA 1Q6CA 3R0DA 1WKFA 1YADA 3UQNA 1ADOA 4XSLA 1E6SM 1XG3A 3P6LA 5HMSA 4AWEA 1TJ0A 3L68A 4LAMA 4DPQA 2XSBA 3TSBA 5KZ6A 1HJXA 1YDOA 3WQGA 4YTQA 2WZTA 1PZ2A 3DFTA 3I7SA 1FWRA 5D04C 6XIMA 3JUGA 3PBVA 4ENLA 4IIGA 3WQOA 5C9ZA 1WUEA 1M9HA 4TV5A 3DFOA 3B0YA 3IK4A 4C6JA 2X30A 1AUSL 4F4RA 2DSZA 4QS5A 1UD8A 1XDLA 4LF1A 1ISZA 3D46A 1XYCA 2WVVA 3HGJA 1XIIA 3WJXA 3CMJA 1KM3A 4CN4A 2Y5EA 1QDSA 4MAVA 2BMBA 2FVKA 4JFVA 4G8TA 1REQA 1B1YA 2HWGA 4TTUA 2ZIDA 2JIEA 4NNBA 2R82A 3CWOX 3IWPA 2Z6IA 1VYPX 2QHAA 3L5LA 1TB3A 3M07A 3RM9A 2C79A 2ZUUA 2PGFA 4GUIA 2QW5A 3WNLA 2V68A 2HK0A 4S3KA 4C6LA 1R9YA 2PMQA 4WOZA 4I8DA 5TAOA 1O66A 1GYMA 1JZ7A 3N2XA 1CXKA 3PB0A 4QQUA 1US0A 3FJNA 4EOUA 3JRKA 3VPLA 1EPVA 1YDVA 3R0UA 3VAVA 3WLRA 4R88A 2D2HA 3P67A 2V3EA 3GTXA 3BW2A 4MFDA 3T9PA 5HNUA 3W70A 2F6XA 1PTGA 3CUFA 4IFRA 2J88A 2C14A 3VM5A 3TEVA 5AVHA 2VWTA 1A0EA 3W87A 5A3HA 3Q37A 1ZAIA 1UPPA 4WOQA 2XGBA 4EAMA 1XWYA 4MLJA 1EZWA 2VFEA 3UXAA 2FZ8A 4GK8A 4B5SA 3CAKA 2QT3A 3CZJA 1DIKA 3E2QA 2GJPA 5CSUA 5FJOA 2OPJA 4ZTYA 4QAIA 3O8AA 3FW6A 5D9PA 1Q65A 1O12A 1K8YA 3SUUA 3GM8A 3A3WA 4GD0A 1ODUA 4NILA 2AGTA 2DH2A 1JEZA 3O6AA 4NP7A 2XM2A 1I2NA 1OGBA 1W6TA 2CKSA 1W9XA 3BG3A 4IPLA 3DFQA 5DMNA 2PDFA 4G6CA 1LL4A 1PX4A 4PUKA 1TWWA 3CQIA 2DQWA 3BL3A 2GWGA 3VKJA 1UC5A 3N18A 1F4AA 1E6ZA 3NL3A 1UC4A 4XISA 2VXNA 4FIRA 3DI0A 4DBSA 5EY5A 4WEVX 3PAOA 3AWOA 5KTLA 3WK3A 2EKCA 2HNHA 4L64A 5HPCA 3HU7A 1TG7A 3EOUA 3CL8A 4NIRA 2WNQA 3Q58A 2X42A 3N13A 3N9RA 1VBRA 4L9YA 5KEZA 4DVOA 1A5SA 4KCTA 1FWFC 4BI6A 1RBAA 3HOJA 1K70A 5HR7A 3AYTA 3SUWA 2YA1A 2QEZA 2R24A 1KLYA 2PRLA 1DVJA 1XJBA 5HJXA 2ZX7A 4XD5A 1BXCA 2YR1A 1SFSA 3L7RA 1LJYA 2C91A 4FX8A 4Y8EA 4LT9A 2R1KA 4CQAA 2A4AA 3BCFA 3S1GA 3ES8A 1LUCA 4PYSA 4NRRA 3K2GA 1Z69A 1XM3A 2W5FA 3THQA 4DWSB 3L4WA 3W2MA 4AX7A 4C91A 4IIEA 4FLRA 4GXPA 2FHCA 1TQJA 4MPQA 4Q22A 3HQNA 5AECA 3IPWA 3CV6A 4GZEA 4HIBA 5LIUX 2VZUA 5G4HC 1J5TA 4C6EA 4M24A 4ZZ9A 4JTUA 3BG5A 1VH7A 1PBGA 5TF0A 2RGMA 3PFMA 4QG8A 3WX7A 3DFNA 2Q3RA 3ZLGA 2INZA 5C5YA 1J10A 5G1MA 2HRWA 3FYPA 3ZIZA 3F2CA 2ESCA 5G2HA 2HBVA 1EEPA 1KFBA 3SFKA 1LT7A 1OK6A 4IL2A 2VX5A 4HA3A 3QGVA 1T99A 1A0DA 2HQAA 2E5DA 4W89A 4KCUA 1XYZA 4RW5A 4IT1A 1B4EA 1VFSA 4LV4A 3UR5A 1TREA 2CETA 4LC6A 4TVUA 1ZY9A 3W7PA 2ON3A 1A53A 1M01A 1GG1A 4XQ6A 4Y6GA 3E9AA 3M0XA 1O5KA 4BS0A 4A21A 3LNPA 4GIRA 4YMZA 2DJXA 1QHOA 3EKGA 3QKEA 3KX6A 3F5LA 3ENLA 5E9XA 1EDGA 1SO5A 4JAWA 5HUPA 2OVLA 2UY3A 3K8MA 2P1FA 5DT5A 3ANUA 5A6AA 3KBNA 4JNMA 3HPAA 1GW9A 2VDIA 3GTNA 1VB9A 1RD6A 3QV7A 1HP4A 4Z1BA 3QXBA 2HBXA 3ID7A 2C1HA 4ZQRA 2FPVA 2OLSA 3NPWA 1VFLA 3BOXA 3TSMA 5C2XA 6ENLA 3TQ0A 3GC2A 3W7JA 1POKA 3PTQA 3VD9A 4MHBA 1Q8JA 3VA8A 5CSRA 1I0DA 3BJTA 4U28A 3SECA 3HGSA 3ABXA 2H8XA 2Y85A 4WGHA 2Y6ZA 3VCRA 1H0GA 4HNUA 3KHDA 2GSJA 3OPSA 3Q45A 1MEHA 2NV2A 3IJ6A 1PTDA 1T8QA 2E6FA 3U0HA 1R6WA 1Q2SA 1QHPA 4DF0A 4MB5A 1M41A 2POZA 1DXFA 4AEEA 3W53A 3TCEA 4FOKA 3DUGA 2B7PA 3OG3A 4HMEA 1XLMA 1AD4A 4H9XA 1GJUA 4XO7A 2XHYA 3LM3A 3HG4A 3QSTA 1J01A 1BAGA 1MI3A 1L6SA 2AKZA 4AZCB 2VDHA 1KTCA 3NNTA 4JIQA 4TX8A 2QCGA 5CC6A 3TXVA 3LV6A 4ZO9A 2GK1A 2ABAA 4TOQA 1Y5WA 2F38A 3WMSA 3LPFA 3A64A 4UIOA 4RXGA 2J7FA 2XVPA 5CZJA 4ZFCA 1HKJA 1K8XA 3SN1A 1PKNA 2WQDA 1RALA 4S3FA 2BY3A 4JIHA 4DQWA 4L4MA 2ZA1A 1WXZA 5EMJA 3TN5A 3BLLA 2QGYA 3GVRA 3RIKA 4AFYA 3W24A 3WLJA 3KL3A 5FF2A 2I9EA 3I6TA 4PUWA 2NQ9A 1SJAA 3H7RA 1PSCA 4Q7BA 4D8AA 5DANA 2BB0A 1E6NA 4WK9A 5BMWA 3NQVA 3CLWA 2Y61A 2E09A 1MW1A 4Y8FA 1LRNA 4JN8A 4NNAA 5E70A 3EA3A 1J2BA 1K1DA 5AHIA 1JFHA 2TODA 1YXDA 3RPTA 1UD4A 4U3AA 3G0UA 4LBUA 4R5EA 4U2ZA 1MVYA 3SCPA 4UR9A 9XIAA 1UP0A 4LGXA 1PEZA 4GO9A 1WOBA 2YL6A 1IXQA 3GNPA 4QGCA 4YHEA 3FKRA 3MYPA 3WEOA 5CC7A 4B92A 4RDWA 3VGFA 3VOGA 3WBEA 2H8ZA 3R11A 5CXPA 5T8GA 4BA0A 4BEUA 3V5OA 3RRAA 2EKGA 3PTKA 4TIMA 3Q65A 4XD6A 1W3LA 1OYBA 2AMGA 2G3JA 3W71A 1OSEA 4XZBA 3B8WA 4EIVA 1LWHA 2XH4A 4KIEA 1IV8A 6REQB 3P5YA 1S1PA 2ZE0A 4C6IA 1W3JA 4LNYA 4LS2A 2J8GA 1KXQA 4GX8A 3KW3A 1JI2A 3HMJG 3KOFA 2DZUA 2E4TA 2POTA 4DLFA 2GL5A 4H04A 2VQUA 3NWRA 5H91A 2RHGA 3V35A 4A3RA 3EOEA 4I6KA 4OUIA 3TJ4A 4ZB5A 4JHZA 1UKTA 1JXJA 4F40A 2F2KA 4AZIA 3BAYA 3S46A 1FP8A 4QAWA 1E4NA 2XN1A 2AGKA 5GJMA 4UCFA 3W1AA 2WMKA 4PZVA 1XLBA 1DHPA 2FFIA 4IJRA 3NAVA 3LCXA 3VNZA 4B5VA 3VD4A 2J7CA 2P53A 1FWCC 3NGFA 1D3GA 1AW1A 2QKFA 4H6EA 4P7LA 3WF2A 4QR6A 4DJFD 2QUNA 4E2DA 4QJ4B 2D0FA 3UGRA 4RUBA 5C0QA 5DBTA 2DIJA 2XVGA 2E0PA 2O4MA 2QJHA 3E74A 4URIA 2HPIA 4B5UA 3H21A 3QV6A 3R8GA 1BTCA 3VVGA 4IMAA 1UUOA 1ONRA 1EJUC 1SQ7A 1DQXA 2JBMA 3FA3A 4RE3A 4GNKB 1FCVA 1RA5A 1UH3A 1AFSA 4C5YA 2INFA 4DJFC 1JPKA 4EPDC 4MYAA 2VL4A 5CEWA 4GZIA 1O1HA 1PIIA 4JTLA 2X1SA 4QJ3B 3VDCA 4FB7A 4OBRA 1EIBA 3VDHA 3PJWA 1LORA 3B3DA 3K1GA 2NQ5A 3CUZA 4IF2A 2E68A 1ITXA 3SBFA 4CQ9A 4Q6XA 2RUSA 3UETA 4JNZA 3FXYA 1KWKA 5IFTA 1KCXA 4IG2A 1H1YA 4U4MA 2J13A 1O1ZA 4IX2A 3ZWSA 3DKLA 4HB7A 1KGUA 4MUPA 2QDHA 1EP2A 3E0IA 5GPRA 5HBFA 3QYQA 2VRQA 4DUVA 3LENA 1E55A 1GONA 1G9HA 1Z9AA 2ISVA 1H41A 4KFNA 3VOIA 4UQBA 3MSGA 3HG5A 1DIOA 4IIFA 2CZEA 1W3KA 3LPOA 4JOMA 4MDOA 3VC6A 3CTLA 3THDA 4FNPA 4GJJA 4ZCWA 1OJXA 1RAKA 5B80A 1BSIA 3UG4A 1YNQA 4W8BA 1BQGA 4E5TA 3RPMA 4EF9A 3UJ2A 2WMIA 4O4VA 2NQJA 2PRMA 3O7UA 4ERGA 1Q8AA 5HOSA 4D2JA 2ZRWA 3HN3A 2O56A 3AHZA 3TTYA 3RCYA 1H1NA 3H53A 3TC7A 5FJPA 3QQWA 1TMQA 3OB8A 1J79A 3BPWA 4XAGA 4H7VA 1F6YA 2A79A 3A23A 2Z2UA 2Z1BA 4PTMA 4JKKA 3HMCA 2V2DA 4X2RA 2QPSA 3VOHA 2PDXA 1A4LA 5FEWA 3PZVA 1MXDA 3O6DA 3ZM8A 1QI5A 4IX0A 1YNPA 2PF8A 2VHLA 1TWZA 5E5CA 2OEMA 2Y24A 2WKJA 3PP7A 3W2LA 1FKXA 2RAGA 2HISA 2BHUA 4HK7A 4LUJA 3SRDA 4NG3A 3TIMA 1C9DA 1VGAA 2ZC8A 1YRRA 2QAPA 4O15A 1KGXA 3QV9A 1WZAA 1A5KC 1DL3A 2EQDA 3RU6A 4UR7A 4Z2HA 3OIHA 1W2VA 1V6TA 1TUXA 4O1CA 4TUFA 4H6RA 1ML1A 5DX7A 1Z48A 5D8WA 5BYWA 1GQNA 4GISA 3WQ4A 3WYZA 1M04A 4CQBA 4FF5A 4PMNA 3ZYZA 1UQZA 4O0QA 3N6HA 4PULA 2PLJA 5M1TA 5A2CA 1EGVA 4RCXA 3AYRA 3ABOA 2BXZA 1SW7A 3VIGA 3U5YA 4DYKA 3EDEA 1XX1A 5FL0A 1JUEA 2NX3A 2I16A 4C6FA 1R9ZA 3GBDA 2OODA 1JL8A 4C65A 2WV8A 1H11A 3PHAA 3FKKA 1TA3A 2NW0A 5ABTA 3W85A 3P8IA 4CN6A 2OR2A 3AALA 2PP0A 4HJFA 2UY4A 1WKEA 3DGBA 4ERIA 3MUAA 2WHKA 3C0LA 4GYPC 2XH7A 3KL0A 4O0KA 2OCZA 5D33A 3O2LA 4E8CA 1FWGC 1GVEA 4AMCA 2KAUC 2B7QA 4DJFA 4GQQA 4UNIA 3DC8A 4PTVA 3W37A 2J78A 1UOZA 1M7XA 1F07A 1HKIA 3UY7A 5BU6A 5IM51 2ADAA 4N0RA 4ZQOA 2OX4A 3KWXA 3Q67A 4LVFA 7REQA 1M1BA 4DNHA 4M3PA 6CGTA 3WSUA 2VO5A 4KW2A 4YXGA 3N4AA 4DPPA 1UKQA 3C2OA 5CPOA 4LUSB 1LTDA 2OSWA 4D6EA 1JZ6A 3OVPA 3G6MA 2FZDA 3VCCA 1R3VA 1RZMA 2HXTA 2OQYA 1GOMA 3L4ZA 3KCOA 4PB4A 4M1BA 1BYAA 2Z29A 2Z1XA 1Z3NA 5CBJA 3MS8A 4MZ1A 3A9BA 4PRTA 1AW5A 4UTTA 2BS9A 3MKCA 3WO8A 3R94A 1PZ1A 3UR8A 5CG7A 1XIJA 3PJUA 3QV8A 4B90A 1XFCA 1E0WA 3VMNA 8XIMA 1SZRA 4QE5A 4AWSA 1VPYA 2IXVA 3MMUA 5AY7A 2VGIA 2MUCA 1JNDA 3ARZA 1Q6GA 2V3DA 2VGBA 4QSHA 1KR1A 3MWCA 1HKWA 1FTXA 1VQTA 3HTWA 3NPUA 4IMCA 1E0XA 2WVVB 4Z2KA 1KCZA 3F5JA 4FAMA 1W37A 2B0MA 3L67A 1S5NA 3W7GA 2VRJA 4LCQA 4F3HA 5K3VA 3N9KA 3N12A 1REQB 5EPDA 3LN3A 3CV2A 1I1XA 2E5CA 4E2BA 2R1LA 5E0CA 5TBOA 2V38A 1F3EA 3AWNA 1GNXA 3II1A 1J4EA 2O0TA 4HCDA 1EXBA 1Q7MA 3E5BA 3GDMA 4I3GA 3APGA 1RCQA 2B4GA 4DXXA 2F7FA 5H8PA 3HGOA 3PZQA 1OFEA 3UXDA 2BTMA 1TFVA 1FRBA 4FR6A 1PE1A 5I3IA 2OYKA 1K4GA 3RPDA 2YXXA 3GY1A 3L4XA 4UOQA 1EDTA 3M44A 4RJEA 1CGXA 4JBRA 3U2CA 4ICCX 2I9UA 2VUYA 3W00A 4IXXA 5GNXA 4JTKA 3ZZ1A 2RDUA 4EPKA 3UG8A 2PDKA 5G5IA 2C15A 4B16A 4JTFA 3WLLA 1HL9A 1NARA 3H2NA 1HX0A 2DEPA 1TUFA 2XTKA 5IBXC 3VDBA 5A95A 4ZMGA 1S2AA 1RPXA 2DT3A 3HPFA 5BRBA 2G37A 3VO0A 2UWFA 2PWDA 2Z25A 1S2WA 1E4MM 1U2YA 4Z1DA 1W1YA 5HAOA 2IUZA 2PDGA 2WCAA 2VENA 5K9DA 1JULA 4JIEA 4KEMA 1G01A 2WNWA 4EPBC 1QPRA 1H61A 1Q4WA 4D6JA 3EPOA 4GH1A 1ZJHA 3T81A 2NV1A 3KVMA 1E1CA 2F84A 3MSDA 1M6JA 1OIMA 3WD0A 1QBBA 5AYXA 4Z2JA 3EXSA 3N19B 4PUDA 3DYPA 4KEVA 4N9EA 4PH6A 2J9XA 4JIIX 4HMCA 3C3UA 1OX4B 1XLGA 2A7PA 4Y90A 1QI0A 4EVZA 2NVCA 4RPQA 5K9XA 1P4CA 2XVLA 1JAKA 3IGSA 2PLKA 1Q45A 4FNTA 2P88A 3EKLA 3JU2A 3AIUA 1TX0A 4AD3A 1XINA 2GFTA 3KTXA 2OLAA 3CGTA 3DAQA 5EBAA 3Q4DA 3BW4A 1Q3NA 2NWSA 3S5YA 5F4XA 3MYOA 4H1ZA 7XIMA 3IACA 5I2UA 3RLVA 1NEYA 3PFRA 1K9TA 3WG6A 1RBOB 4US5A 3NVTA 5I6SA 4H9MA 3HGRA 2BDQA 3ERPA 2ZCGA 5DN1A 1JZ3A 3OQEA 1LP6A 5IDZA 1DXIA 3TYDA 1RVGA 3NTYA 3TAOA 4JTRA 4HNLA 2JGYA 3G1AA 3VX0A 2D73A 1O5QA 1G4TA 3VOFA 1B30A 2EPLX 3MVIA 2W79A 1SJBA 1PWLA 4Z1AA 4K37A 5LIWX 4WD0A 2OLHA 2J25A 4JQAA 3UFYA 1BKHA 1Y0EA 3EKZA 3C61A 2QR6A 1GOOA 2GZXA 5K4XA 4RE0A 3UJEA 1DIDA 4LEQA 2VOMA 3SGZA 3F03K 4YCPA 3S1WA 2BOEX 3GD6A 2VCCA 3GR7A 4S3CA 5FI8A 3EB4A 4AMAA 4PUMA 2AQVA 2WZIA 3K4DA 2BV9A 2XIOA 1UIOA 4Q8WA 4WVXA 1FWTA 3WLIA 4WGXA 1BVZA 4PMYA 2O9OA 4ML4A 4WKFA 4A3HA 1ISVA 3LQGA 3DFHA 3WLHA 1W1A1 1Q7ZA 1F74A 2Y8UA 1E9IA 3UWWA 1W91A 5G4EA 4HHLA 3OQ8A 2ALRA 1LOLA 3GWQA 2XH0A 4GIYA 3GZ3A 4HA1A 3UR7A 3CNYA 1YTEA 1UWRA 4PR4A 3PWIA 2UBPC 1W5MA 3ICJA 4KRUA 3GTFA 2PTDA 3WJSA 3OGVA 1U83A 5FEPA 4ZQMA 5FEZA 1X1OA 1E5JA 1BXNA 2XGZA 3BAKA 3LM7A 4UUIA 4OUEA 2EPMX 1MQQA 4AZGA 2PD5A 4QQ3A 3ARRA 4JEJA 1UIPA 1WKYA 6TIMA 4C6QA 1RXOB 2X7WA 2IPJA 3R8HA 5DMLA 2Z1KA 5FJUA 3RLGA 5EMYA 2GJRA 4LUYA 1EPXA 1I0BA 1WOAA 1R7AA 4RNHA 3LSBA 5EMMA 3MBDA 4LS1A 3ITLA 2DZWA 4NU7A 1WBJA 3LI1A 3FVMA 4XUGA 4AXNA 3DFYA 1QVBA 1SVDA 2QV5A 1VBUA 2G3FA 4EAYA 2GVYA 4JQ4A 1U1HA 2E1DA 3UT0A 4H9VA 4HNOA 2IKHA 1YPXA 3IAPA 4AUBA 2O4QA 3GHTA 1D7FA 3M47A 3GR8A 4RNIA 3NXLA 3SO7A 2WK2A 4U3CA 4EXBA 3G1SA 4DHGA 1WA3A 1OD0A 3I3BA 2PZNA 2VJXA 2WNZA 3QY6A 4A3YA 1J18A 3VIPA 3PAJA 1KO0A 3STFA 2NVAA 4U33A 1EP3A 1TV5A 4AYGA 4Z42C 3GH4A 3UEQA 3WDHA 1O60A 3WQCA 4Y9OA 2VR2A 4CEXC 3TQPA 5HMEA 2QCMA 2Y62A 2ASHA 3IJQA 2GK1B 3A47A 2ZDSA 3ES7A 3WMBA 2DPEA 4Q8OA 3WDRA 1V3HA 1JGIA 2R1NA 4QCEA 1UCWA 3GLCA 3VILA 4Z0SA 3B06A 4GY0A 4A8NA 5DXYA 4W7VA 3WD4A 2OOGA 4K8EA 3W29A 1FH8A 4NUWA 3TWAA 5C7HA 3H22A 5E09A 3I4KA 4NYUA 2WCGA 3PVFA 3UYCA 2A3AA 2VC5A 3VNYA 4LWWA 1UUQA 2VFFA 2YCEA 1V02A 3S3GA 3OGSA 3CZLA 2D24A 1OC7A 3WH5A 3W84A 2ZTJA 1R87A 3XISA 1IZJA 3TLLA 2GUYA 2O9PA 2PDJA 3KWSA 4C1LA 3QVQA 1NWSA 1XLIA 3MHFA 1Z89A 3ANVA 3V1PA 3WK1A 4AWUA 1AG1O 1IIGA 1QNRA 1XH2A 2PAJA 3UXLA 3VK5A 5DEZA 3POCA 2JEPA 1CWYA 2ANUA 2BVDA 4JTDA 5GNZA 1QCWA 2DV0A 2ISWA 5CZ0A 5DY3A 4PUUA 3KL5A 3WENA 1CENA 1HZYA 3N25A 4RR4A 1K3UA 4FHAA 2XFWA 4W8AA 2JK2A 1I75A 1X96A 1LM1A 5AB3A 3PTDA 3NL5A 4Z2LA 3PJTA 5FL1A 5EGRA 5F2MA 3LUTA 1WPCA 2JGQA 5D8ZA 4KS0A 3LCGA 3M46A 1SMAA 3QW4B 1TV7A 4PE8A 2CLLA 4NZCA 1JQXA 4H83A 1Y8BA 2ZWZA 3AHVA 3UZYA 3EX3A 4K1WA 2R1MA 2YLLA 3C5QA 2EXOA 4NX0A 3N1AA 1J93A 1E5NA 3SIZA 4HYWA 1HJVA 3VGBA 3NEVA 2J9YA 2A7RA 2IQTA 1RVKA 3BUVA 5DMYA 4W87A 3C2YA 3U3HA 1PWMA 4JS3A 4GUJA 1JNEA 1XCXA 1E6QM 5AHMA 2Z4GA 1GKPA 1JGMA 3R79A 4B5NA 2YIHA 2BOFX 4LH8A 2C18A 2BVYA 1AMKA 1EC8A 1S2UA 1UROA 3B8UA 1G0CA 4NX5A 3VIIA 3NCOA 3WLKX 1TPH1 5D2VA 2QPUA 3VKCA 4CCZA 4GQ0A 1Z41A 2QCNA 2OSXA 4GI9A 3QMSA 5FD0A 1ME7A 1VS1A 1GG0A 5LZLA 3V1HA 4H3DA 5U4NA 1MDLA 3EOLA 4H2CA 5T26A 4LRTA 3U2ZA 5ECVA 5LHFA 4DWSD 2W0UA 5LGXA 2WPGA 2WVUA 2DT2A 3FS2A 3EWDA 4KCVA 1A5AA 1DJHA 2PDPA 2BWGA 2DZSA 2Q3OA 3CWNA 2CKRA 1I2QA 3KBMA 1FWJC 3D5HA 4PBGA 3TTQA 5H8MA 2QLYA 2DDXA 1UP3A 1PCWA 1UWTA 4B5XA 2F2HA 3IEBA 3DGRA 4XZMX 1PKLA 1S3HA 1BFNA 4PCNA 4DWSC 1JVNA 1EDQA 4TTGA 1S5VA 1RD5A 1TTPA 2AAMA 3QEZA 4YHGA 3MUCA 2VOTA 2ABBA 5D4YA 3MZ2A 3ISIX 4Z17A 4QDMA 3F2DA 2Z00A 3AS2A 3FYYA 4WXZA 1BSLA 1VBGA 3WJWA 4F66A 2L5HA 4QHRA 1V79A 1FWAC 1VJZA 3CUJA 2CEQA 2TMDA 3H26A 2W62A 4F2BA 1VF8A 4QJ5B 3MP5A 4HOZA 2XIJA 4IG2B 2XPKA 1ZAHA 2QIIA 1QW8A 4ORIA 4IPPA 3URAA 5CKSA 3W01A 1ZP3A 2AOSA 3C8FA 3THCA 3VOJA 3EA2A 1ONEA 1HJWA 2PBGA 4DO7A 1KWGA 3GX9A 1NQ6A 1TSIA 4K68A 2EJAA 3AQUA 3SSJA 4D72A 4RK8A 2GGEA 4UZSA 3WELA 3SY8A 3SCOA 3A4WA 1DWIM 1H63A 3EWXA 3GBEA 1X7IA 3KHJA 2YDAA 1AA1B 3EX6A 3DG7A 2BG5A 3GNXA 1NQKA 4HOWA 4R27A 4J3XA 4B9YA 4MZ8A 3NFUA 4M1RA 3GC4A 2D2JA 3BV4A 2ISFA 3SB0A 1B3VA 4FEZA 2GOKA 2WMIB 3TNBA 4M51A 1PL9A 2QCFA 4H01A 5B7YA 2ZOXA 4O18A 1XCWA 1JPHA 5LNUA 4DBUA 3NQ6A 1R46A 4Q8VA 4QITA 2WJFA 3IIZA 4RDZA 2QVNA 4GA8A 3WJZA 2CLPA 1XDMA 2RJHA 3P60A 2PLCA 3NO5A 3AYSA 1PX8A 1HFBA 4KWSA 4MB1A 5J04A 3KBJA 1PZ0A 4H9UA 3BW3A 2OMAA 5B7ZA 3LTYA 1Q2RA 3G18A 4IOTA 1GQLA 2PB1A 1F7BA 1HIZA 2GSHA 1WXJA 2VZTA 1K77A 4HYVA 2ODOA 5JBEA 3ITCA 3DG3A 4BI7A 5LA1A 2X16A 4DBWA 1PHWA 1DEDA 1GCYA 4IGNA 3WQPA 7TIMA 1DJGA 3LCLA 3BWWA 3KTSA 2EBNA 4ZFMA 3J7HA 2GUUA 3QQ1A 4CD8A 1LL6A 1DYSA 3W7IA 4ROQA 2ONEA 4JZ5A 1GZJA 2ZADA 3RMJA 2ACRA 5A6MA 4OVXA 2QDGA 2ACQA 4J4KA 1W1PA 3UPMA 1YMYA 4LXFA 1I2RA 2CW6A 4Y9PA 2E40A 3DENA 3S5OA 2O92A 1BEUA 1VFTA 4EWND 6TAAA 2YA0A 4KFPA 1QUMA 2I7GA 2GGJA 1LLWA 4NAEA 1PHQA 4J9JA 3PUOA 3E2VA 1J6OA 5D30A 3QR1A 1D7KA 1PDZA 1PYFA 4DIAA 2P0OA 4HZ7A 1CLKA 3WQ8A 1KW1A 2QULA 3PZUA 1GK8A 3GYCA 2QMKA 3MMWA 7ENLA 1A47A 4JHMA 4PTXA 1MFVA 4D6HA 5BXRA 1TA3B 4LEFA 2YJQA 2WC4A 4A8RA 3VABA 2NQLA 4AD0A 3GDBA 4X3ZA 3PZOA 1LBFA 4UR8A 2GUBA 4H6KA 2WANA 1CXHA 4FPSA 1WAUA 2ZICA 1IWPA 4OU1A 1OFOA 1ECEA 2OFJA 1J11A 2FZNA 4EWJA 4XAPA 1V0MA 3EWWA 3SEPA 3QPEA 3AJ7A 4R7WA 5CBBA 1KQYA 4B3LA 4DWSA 1ZBKA 4IFOA 4HTYA 1BGGA 1UJPA 2JALA 3WQFA 1F9CA 4WDXA 3FEQA 3UVAA 3WF3A 3VD3A 2HVNA 2G50A 2VI0A 3IGHX 4MWAA 3LDVA 1W9DM 3CC1A 4TVCA 1F5ZA 2ZUSA 3E2SA 7REQB 3CWHA 3AFBA 1EIXA 2NUYA 4UFKA 1QMLA 1OX5A 2EF9A 4JQ1A 4LAOA 2FFCA 5FCZA 1B0IA 3KDNA 2XIBA 2PS2A 4DJED 1BGAA 4XV0A 1N2VA 2PWUA 4Y96A 3QPYA 3UWYA 1PO9A 1T8XA 5J5DA 2ZX8A 3QC0A 4BZYA 5EBUA 3F4NA 3MCMA 3B9EA 1X1ZA 2CWNA 1LLZA 1WP6A 1TZZA 3BZGA 3AIQA 5DY2A 1EQPA 3WQDA 3MUXA 4H9TA 3G0XA 3S5SA 4JTJA 1H3GA 4YIWA 2ZX9A 1TJ1A 1QOPA 1GZGA 2EPOA 3GDLA 1NDZA 3NURA 3PBMA 3W1MA 4LJ3A 1JDDA 1HJQA 1TKKA 3BAWA 1KR0A 1EJVC 1DHKA 4PGLA 1T40A 2WJDA 4DJEC 1V7YA 3N17A 3U4AA 1AQMA 1MQPA 1S2TA 2PWVA 3LZ5A 4H2HA 1NWRA 1HVXA 1WDQA 4H8NA 3VFCA 2EO7A 4GX9A 4R3UA 3A22A 4YVVA 2G8ZA 3NZQA 1UOKA 1KM6A 3NZRA 2XDFA 2Y7GA 3T07A 1OZQA 1J0YA 5D9OA 3DHDA 5H2ZA 4S3GA 1WYIA 1P6WA 3ATYA 3VNIA 3NQGA 4PTDA 1IZCA 1QR7A 4OGZA 3VX1A 3B05A 1W8SA 4L61A 3PPCA 2Y7FA 3BLFA 3NDYA 2W3ZA 4S3BA 4AIBA 3H2AA 1GTEA 4MJMA 4YTSA 1B90A 1E0TA 3PNUA 1OF6A 1HKVA 1IGWA 3S9IA 3CS2A 4BQ3A 2OEKA 2YDSA 4FI4A 3WFAA 3W22A 2A21A 4FLOA 1XRTA 4GC4A 1EBHA 1XDJA 3ZLFA 2IMRA 4HN8A 1WX0A 3T0BA 1SJDA 3TU9A 4JQ3A 1H4PA 4PL2A 4X2PA 1GVIA 3LV5A 4V2XA 1RK6A 1YNYA 2NXIA 4UNKA 4PMVA 4UWMA 4O1AA 4CNOA 4JN6A 1W8GA 2D69A 4AVNA 1F6KA 4ATWA 4AZ5A 1D8CA 5GJPA 3AHTA 4M6UA 4QDPA 1MXSA 4MJZA 1A3WA 3FXGA 3UZJA 1E1CB 3QRHA 3CIWA 5FJIA 2E9LA 1CBGA 5FF0A 5A2AA 4PC8A 2F9RA 3G3MA 3TH6A 4AZ6A 5HWJA 4WX2A 5JH1A 4UTJA 3TX9A 1X97A 4NHVA 4MY8A 3HM7A 3BGJA 4BWLA 1UWIA 1S1RA 1ME9A 4WSJA 4MTVA 1UQYA 3CUXA 3BURA 4LYQA 3ZXWA 2CZFA 5K7JA 3BAJA 5CPMA 4CNPA 1BYDA 1FQ0A 1OQFA 1RR2A 5FAJA 3QY7A 1IEIA 4XBKA 4QP0A 1K9FA 4LUTA 1YHTA 4NSBA 3TONA 2PDBA 1EKOA 3V36A 4ZR8A 3ZVIA 1UW9A 1V08A 1EYWA 3BLOA 1TMLA 2E8YA 2HTMA 2WVTA 2C6QA 3PC0A 4FA3A 1HKKA 1UR9A 1CXIA 3UCQA 1CEOA 2ZXAA 4LB3A 4F8XA 1MWOA 3GHSA 4HU0A 3WBWA 2P8CA 3UYIA 3MW7A 2NSXA 2W92A 3HA1A 5DELA 5HXMA 1NWTA 3G1HA 2Z26A 3EDJA 3S47A 3EDKA 3WQ5A 3V7PA 1XYLA 3QW3A 9RUBA 3IIXA 1GPFA 3LEPA 4AY8A 4D6FA 4HNCA 4GC3A 3LPPA 5FJJA 3AMCA 2IPFA 2WLYA 2Q6ZA 4MVAA 2F6UA 4ASTA 5D38A 3OLDA 3TUUA 5F7UA 3TE9A 5EU9A 4INFA 4BF7A 1DQUA 1R3SA 1E6XM 3LCFA 3S4TA 4PTNA 1G69A 2RDXA 3DN5A 2J62A 5C55A 3CASA 1NELA 3QN3A 4PRWA 4AZBA 1KC7A 1FWBC 2OG9A 3LCHA 3MO7A 1XBZA 2DVUA 5I78A 3ONCA 1F8MA 2BHZA 2V63A 4G56A 3LBMA 1E56A 1F8IA 4F0LA 1XH0A 2QVHA 3TDFA 1OGSA 4PN2A 1DJYA 3PUGA 2J7EA 1H60A 2WSKA 1QK2A 1UH4A 2J8TA 5FKYA 4UOJA 3THAA 3TFXA 4Z0JA 3BE7A 4AX6A 3SR7A 1EH9A 4AVFA 1E15A 1EC9A 3UA4A 1JZ8A 3LTSA 4NY2A 1KM2A 4OE7A 4AY7A 3TP4A 1SMDA 1I8JA 3PJXA 2G0WA 4IWWA 4ZOBA 1CPUA 1CB2A 3A9IA 3H4XA 4F9DA 1NOUA 3N2CA 4NT0A 3PWGA 3TN6A 2EG6A 3UVIA 3EX2A 4ZODA 2V5DA 3AZSA 4XZHA 1UZHA 1W3HA 3O0FA 3GNOA 1QASA 3PBYA 3LGEA 3HQOA 1O95A 4HT3A 4Q7NA 4XWUA 4DELA 2IXUA 3WBAA 4MPKA 2Q8LA 5D03A 3FJ4A 3S2NA 4PMRA 1E0VA 1MQRA 3K8KA 4HK5A 3LHVA 5CGMA 5CJ5A 4IIHA 1G4PA 3QMRA 4E3TA 1JD7A 4Y9AA 3GXFA 3CB3A 3ZSTA 3TJXA 3CMFA 3GXIA 3ELFA 2OELA 1VHNA 3C8NA 2W66A 2NX9A 2DVXA 4C6KA 4DYJA 3O6CA 1NDYA 4HPNA 5HMDA 1C8XA 2V2HA 1B3OA 3IVTA 1RCXB 3MUZ1 4GNVA 5LKYA 5AKQA 3VDGA 4Q6JA 2A5HA 5I23A 3TFCA 1HO4A 1KNWA 3ARYA 3QKZA 4O17A 1VJIA 1CNVA 5DXXA 3T8LA 2C0HA 3QFEA 1HG3A 1J6PA 2C3ZA 3PG8A 3WUFA 2W61A 1Z7AA 4C1NB 1IXNA 3EEGA 3A13A 3W25A 3WH8A 1XGEA 1KFEA 1TPEA 1LF1A 4WSKA 4LYKA 4UFIA 3CHVA 4N42A 1RP9A 3AYVA 1TTJA 3GH5A 2BGNE 3TYEA 4N6FA 4O10A 2I5QA 2C1GA 1J0ZA 3VKDA 3OLEA 2HPMA 1U1UA 1FHUA 1FXQA 2PBOA 2Y7EA 3B8VA 3LY0A 1DJZA 1WB0A 1AH3A 1ZBVA 2V5LA 3U8GA 4O19A 4PEEA 3RO8A 1W3IA 3IARA 1OB0A 2Y88A 4B15A 5AZ1A 4IMGA 2YDQA 4F79A 3WBXA 3SUVA 3PZ9A 3DXIA 1KQZA 5LSMA 5AHLA 4K6AA 2NWRA 3B0VC 3GQYA 1TPDA 4D6DA 3EXRA 3SSZA 3GXTA 5AC5A 3TA9A 1MZRA 1E4LA 1O4UA 1I2OA 4NJHA 2GQ9A 4O8RA 3UU0A 3BCJA 3T78A 2QCCA 5BMXA 1M65A 3KVJA 5IDIA 1PZ3A 1JZ5A 1ZJBA 1Y7VA 1WDRA 5PTDA 5I07A 1C91A 1OCBA 3GB6A 5EMUA 3I4EA 1TIWA 3VD5A 3SCWA 3EB3A 3UWUA 5A6SA 1S39A 5BOOA 3B04A 1ADSA 3W2UA 1UD2A 3KCLA 3ABRA 2C0AA 2NT1A 1YDNA 1VAHA 3PNZA 2E9BA 3M0HA 3MCNA 1ZFJA 1XYAA 2XZ9A 3ALFA 3O0KA 4O16A 3NPXA 1JDCA 2E6YA 2H3BA 2YLAA 3PTMA 3TC6A 3UJSA 2BNJA 1X38A 3USBA 1IXOA 1SSGA 4XAYA 2WSPA 1MSSA 1M53A 3P62A 3PY2A 3B03A 2GVJA 1H7WA 3CAWA 3QTGA 1EX1A 2NV9A 4IP4A 5C70A 4KGLA 2VFIA 1NP0A 5A5WA 1EA9C 3GKAA 2GGIA 2IKGA 4ADUA 3QHMA 4AZ7A 2IS7A 3T55A 2YW3A 4GIAA 1F2JA 2B7OA 1GW1A 2CIPA 2PD9A 1XICA 3NPVA 1NF7A 2J4GA 4K1GA 3B8DA 3EMZA 5HANA 3TQVA 4RV8A 3LHTA 5C54A 3Q94A 3VDAA 5KMYA 1YLVA 3C52A 4IQDA 5BXPA 4D8LA 3DFSA 3HV9A 4TR9A 7PTDA 3G1VA 1FWDC 2QCDA 3AO0A 1E71M 1K7EA 5F4SA 3TMLA 5K2ZA 1M5WA 1YTDA 4EKJA 2C16A 5FEXA 3N73A 4MIMA 2J7BA 3N6QA 3BQ5A 3CQKA 1JYNA 2DSUA 4AD1A 3V5CA 2QMJA 3P84A 5HQLA 4CD7A 3C0JA 4JYDA 1F6PA 2ZTKA 1KBIA 4LS0A 3W02A 1Y65A 4IP7A 4LCRA 5AOUA 1E43A 1XLJA 4DUXA 4G1NA 2MNRA 1PDYA 2H9AA 4NAFA 5HATA 1UD5A 3H54A 2WBKA 2WMHA 3L2IA 3VNMA 1OC5A 4J1OA 3LLDA 3H8AA 4H7CA 3HPSA 3EX1A 5E1QA 4J2MA 2CPUA 3DHUA 5AYIA 3ARUA 3FAWA 2PDCA 3WQVA 2IKIA 3VU2A 3S1UA 1EJXC 3BJSA 5HUOA 5LXXA 1LT8A 1F76A 1WBHA 3FDKA 1DJWA 2XYLA 2BZNA 3EDDA 5CC3A 2DP3A 4QLKA 2BVWA 5F2IA 2QS8A 4C1KA 1VHCA 1WQ5A 4WLCA 2DUZA 4PMZA 3AMGA 3POHA 2X1RA 4ZGYA 3C2RA 4RDYA 3OZMA 2WM0A 4IQJA 5A8QA 5C9RA 3L2MA 1A3XA 3L2LA 3NGJA 4HA0A 3EWZA 1PKYA 3OOQA 3QZ6A 2WSYA 4J35A 1FWHC 3BDKA 1JRBA 1LRTA 2QQ6A 2V0TA 1JYVA 1FDZA 2HDJA 2A3EA 3RR1A 4I9AA 1QRQA 2A6LA 3DYOA 1B31A 3E49A 4R7OA 1Q6EA 5XINA 4X0VA 3W7RA 2A1YA 4MY9A 2CLEA 3KVKA 1J5SA 2A0NA 1UUMA 3OBEA 3H2OA 4RXFA 3WDQA 3DBPA 4HGXA 5IXEA 2CZVA 2VD8A 4PSPA 1XQLA 2PDLA 4OOZA 4AVOA 1C8VA 2FMNA 4PCPA 3RR4A 2X0HA 3L23A 1QO2A 1XLDA 3GG8A 1UWAA 4NKCA 4DB7A 3GG0A 1ITUA 1V0LA 4J40A 2O7QA 3H6OA 1OHLA 3N2TA 2GJNA 3SM0A 1L2UA 3SY1A 4B4FA 3B40A 1OADA 4JTGA 3LYEA 1R8LA 3QOMA 3H55A 2R91A 4C60A 4NJJA 3GVWA 4NJKA 3UWVA 3W86A 3T7VA 3LA4A 4LVAA 2VEMA 3QZAA 1TRIA 5K9CA 3W1NA 3HG2A 1TVNA 2ZA2A 3WMLA 3BSGA 1RLCL 4A3QA 2YXOA 3GHRA 4XZIA 2OJPA 3AIVA 4J3WA 3UPWA 3FJ6A 3WH9A 2V30A 3GO2A 3ZWTA 4GWEA 1QU4A 1AZ2A 1U5VA 2HXUA 2QV4A 4N02A 4OKDA 2BY0A 4JYEA 1IIHA 4F0MA 3KCJA 2ZZ6A 2WO5A 4AU0A 4PSRA 4UTUA 3WL1A 5D2TA 3F4WA 4PB5A 4P8WA 4H8HA 3PPHA 3APTA 4MFEA 3GXPA 2D2GA 1A50A 1GQIA 4GVFA 2G41A 1DWFM 1WZLA 3B0PA 4HMNA 1XXXA 3GG7A 1LWJA 1MFUA 1OX4A 5AC4A 1NFPA 3TR2A 2ZE3A 3AAMA 2OEJA 4HNTA 1N55A 3E12A 4CU6A 3CT2A 3OG2A 1SFJA 4IMDA 3S5NA 4QX4A 5CPNA 1EOMA 4F9JA 3N9SA 1LG2A 3KDOA 1TCDA 4KMQA 4MF4A 4XZ9A 3ITYA 2NUWA 3JW7A 2HJPA 1LWIA 1RQEA 3AS3A 4XB3A 3STEA 1EJTC 5FJTA 1SZFA 1TE6A 1OY0A 4R9XA 1KD0A 3SCTA 3P74A 4DI9A 1TTIA 4NAEB 2Z2BA 3RX3A 1EQCA 5H8UA 4NYYA 1V77A 4GI8A 3BG9A 2DZAA 4Q4QA 1TPFA 4AC1X 3URQA 2Y5JA 1RK5A 4NL1A 3UXIA 1OFAA 2Z0IA 4P7NA 3HBLA 1AH4A 3C4UA 2B7NA 4W5ZA 1TWIA 3V0TA 4A05A 2G96A 3KS5A 1L6GA 1IEQA 4GYJA 1XR2A 4UOZA 3S2MA 1JCMP 2BSLA 2PDUA 4D6GA 2EG8A 2D20A 2PC4A 2QPXA 4IUOA 1K8CA 3M43A 1P6CA 4C6PA 3TV8A 4YTRA 4MWAB 1PV8A 2P8BA 5HULA 4BY3A 4AD2A 5DBUA 1Q7QA 4IGMA 3A12A 5A8PA 4CD5A 1FCQA 5AYYA 3IV8A 1OZMA 3GR4A 4AB4A 2VELA 1F3XA 1CT5A 3W1LA 1NJJA 3UNDA 4MB3A 2OZ3A 3HQPA 4P8XA 3BAXA 3G1DA 3VIHA 4F2TA 1E73M 1KFLA 4W9TA 1A5NC 3VIMA 1K7FA 4QIUA 1YKWA 2REQA 2ZUMA 1FWEC 1FOBA 1PTAA 1TIMA 2PZ0A 4TU1A 4A22A 4ZXLA 1TCMA 3GDRA 1JZ4A 3RUBL 2DSWA 4YTUA 5FF4A 1A0CA 1MW3A 4CCEA 1UA7A 3VFLA 1EGMA 4GQRA 5AZ0A 1PS9A 2OOFA 2J47A 5F2LA 3RG6A 1C9WA 3NSMA 2HE8A 4UFJA 3SCNA 1JUKA 4IH3A 1UJQA 5I77A 4DI8A 3QF0A 3WD3A 2OGYA 3NA8A 1XUZA 5TQLA 3WLOA 2ZUTA 3WF0A 4X0NA 3P80A 4PMJA 1VR6A 3EMQA 4S1FA 5L6UA 1OK4A 2I57A 3M0LA 1ICSA 1R3TA 4HCLA 1C29A 2NLIA 2YZRA 2FHFA 4XVDA 1YX1A 2D3LA 4CU7A 4AZHA 1E6RA 4GXMA 3E0VA 5HMFA 2GOUA 1JYWA 2YB1A 3NQDA 3SW6A 1HUVA 2FZ9A 3AIBA 3KZSA 3U4FA 4PMXA 5A6JA 4XTIA 1XSJA 4US6A 4BCEA 2FH6A 4PMQA 1JPIA 3ZR5A 4QM1A 1JCTA 1RP8A 3SQMA 1PXGA 1R38A 1XH1A 3KBVA 4UZUA 5HNRA 3O16A 2E3ZA 1EF3A 1VFUA 2XIQA 2VVSA 4R33A 4JQ2A 1YYAA 1IWBA 4PCFA 4A35A 4ACZA 1OD8A 4RZ6A 2Y8KA 4CCCA 5C2GA 3WUBA 1JDFA 2YFOA 2J7GA 1RH9A 4O13A 3OHIA 5EMKA 3GIQA 2A6NA 2DFAA 4IPJA 1KB3A 2A3BA 3GUWA 2DSKA 3LG3A 1VP5A 3MZNA 4TV6A 1HL2A 2Y4SA 3T2QA 2P3ZA 4NZ3A 3H7UA 1ITQA 1W1VA 2FGLA 2JKEA 3URNA 5CPSA 5A69A 3APYA 5BW6A 5BROA 4I8YA 4Z08A 3S83A 4W4QA 3NYDA 4IISA 3SGGA 1V93A 3UCCA 4WKHA 3WY1A 1BPLB 3M7WA 3VZXA 2WHMA 2XISA 4HZ6A 5HNTA 1ALDA 1H50A 3O63A 2CLKA 2GJXA 3WH6A 1IHIA 3PSWA 1F05A 5FSEC 5DRIA 4WRHA 1QK0A 2EG7A 3KRZA 1E6PA 4XZLX 3ANYA 3S6DA 2DUXA 4HSNA 4B2DD 1J0IA 3VKBA 5I3DA 1M3UA 3UZWA 4L1WA 3W1RA 2ZRYA 4DZ5A 3UF9A 4NZ4A 4CQ8A 1W5QA 3LRMA 3LX9A 1VEPA 4YVXA 3OLGA 3M1ZA 2VCAA 1PIGA 2PDYA 3N29A 3M9YA 4J3SA 3VGGA 3SCUA 3F2BA 1XPYA 4ERAA 2YPIA 2CXGA 2PTXA 2PCEA 2QAFA 1P43A 1AMYA 3PBWA 4LUTB 4DZIA 4ZE4A 4KPLA 3V0SA 5D9MA 1PJ9A 4JY8A 1JF6A 3M5YA 1XP3A 3MMTA 4MAZA 1PPIA 4Q4MA 4RKAA 1DJIA 1CGWA 4E4UA 5HNNA 1QI4A 3ABQA 4Q8QA