3RMJA

Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
307
Chain Sequence
TNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDFEAVNAIAKTITKSTVCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIHMEYKLKMKPKQVIEAAVKAVKIAREYTDDVEFSCEDALRSEIDFLAEICGAVIEAGATTINIPDTVGYSIPYKTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQVECTVNGLGERAGNASVEEIVMALKVRHDLFGLETGIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSETYEIMSAESVGWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-isopropylmalate synthase
publication title Removal of the C-terminal regulatory domain of alpha-isopropylmalate synthase disrupts functional substrate binding
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 128
structure length 307
sequence length 321
chains with identical sequence B
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rmjA00
3LM7A 3IIZA 4FIRA 2ZBTA 3W1NA 4ORIA 1S5VA 3W1XA 1TSIA 3E49A 4JTUA 4TU1A 4HNNA 1MEHA 3LBMA 1ME9A 3OIXA 5AFDA 1QDSA 3GDLA 1TPB1 3DU0A 2O7QA 3B8DA 4M5PA 1B3OA 1TQJA 3W73A 3EX2A 3O16A 3CLMA 1KBIA 3LCHA 3B04A 4Y96A 4PCFA 2A85A 4XKYA 2Y7DA 1LBFA 1AL7A 4OV4A 1F76A 4Y6GA 3QQ0A 3CEPA 2A6NA 5HUOA 2TMDA 2JKEA 2NUYA 1G4EA 4IMDA 5E0KA 4HPXA 1HL2A 3N19B 1OYAA 3LHUA 4FNRA 4DELA 2GVLA 3SECA 3PBVA 5LSMA 4NZJA 2ZCGA 2QCLA 1HFBA 2ABAA 5K4XA 1WQ5A 2ISVA 3L65A 1KFBA 1W5QA 2Y62A 4JIPA 3RLUA 4DO6A 1SFLA 2E6YA 1OF6A 2GVGA 1SR9A 3P5ZA 2RDWA 3TXZA 4UUIA 1SO3A 3BK0A 2H90A 3KFTA 3G8RA 1U5JA 3BO9A 4IMCA 3TCEA 3WK0A 1IXPA 2OT0A 4ICNA 3QZEA 4XKYB 4LVFA 3EWBX 3OVQA 5IBXC 3SR7A 2BXVA 2EPHA 2OJPA 4JTSA 2ZQ0A 4XBKA 3G22A 3EWUA 3DBPA 2OT1A 3LTSA 1NAL1 5DBUA 4BWLC 4XWUA 3W7MA 2G97A 3SIZA 1K8XA 1KFJA 4OT7A 3WK2A 4N9BA 3IIXA 5FF3A 4XTIA 4JTIA 4O1AA 3N2XA 4XTDA 4O52A 3NM3A 2C3ZA 3PBUA 5FEPA 3C8FA 3ZWTA 2OMAA 4R33A 1GVRA 2FIQA 3FJ6A 3W7QA 4D2JA 1W54A 1Z41A 1P0KA 2ZRVA 3MO7A 4NXSA 1H7PA 3B4UA 3FS2A 3ABQA 3LLDA 2ZZ6A 5G1YA 3P7YA 5K9CA 5HINA 1VZWA 1YPFA 3ATYA 3L5AA 3MMTA 2QAFA 1GVQA 3TMQA 2C14A 3W3OA 3M43A 3A5VA 3NPXA 4MOZA 4HN4A 4IPJA 1SO6A 3OA3A 4NUWA 2YDAA 4Y9AA 4TMBA 4UNKA 3P62A 2D73A 1D3GA 4MLRA 2QCHA 4OHQA 5F1VA 1VYRA 3RLVA 3ZS4A 3NR0A 4JXCA 2W0UA 4DF2A 1Q45A 2E5DA 1ZHAA 3A21A 4UTKA 3NEVA 3W2LA 2DORA 2QJGA 2H8ZA 4PTNA 2DZSA 3I6RA 1KM6A 3BG3A 3P74A 3PR2A 3W22A 3SGZA 2VEMA 1QAPA 1QWGA 1DL3A 4O57A 3PF3A 4KFOA 5A5WA 3EKLA 1YDOA 3WJXA 3M5ZA 4NJKA 3M7WA 4IGHA 4RZ4A 1BEUA 5CZTA 4A2SA 1TPWA 5KZMA 4AH7A 2WNZA 4LVDA 2NX1A 2X2GA 2VENA 5AC6A 4M19A 2VFDA 3IVTA 5EY5A 1XBVA 3A22A 2ISSA 4BR1A 1H7RA 4Q33A 4UTUA 1FWWA 4IX0A 2J24A 4UR8A 1GVSA 2WQPA 4MY8A 4Z0JA 1FCBA 2V82A 1JVNA 1P5BA 3VFLA 3EX1A 4QJ1A 2A2IA 1B4KA 2Q8ZA 3S9YA 2VELA 3MI6A 1DQWA 5D05A 3QPYA 4I7UA 2B0MA 5EA9A 5CGQA 3S1WA 1I45A 3W71A 3L21A 1VRDA 4GC4A 3W07A 5LNRA 4FNTA 2Z6IA 1B57A 3W7HA 4ZQOA 3S1XA 4IWWA 3W1AA 1FWTA 4M6PA 3TQ0A 1H51A 4MFEA 3UY8A 2E5BA 4RR4A 1LBMA 2WJZA 1NFBA 1AW1A 5BOOA 4TX9A 3FJLA 4UFMA 1KV5A 3CU2A 3KVLA 4WOZA 2Y7FA 4QSHA 4JTJA 4WD0A 2H8XA 3O63A 1YXCA 5AOUA 4O18A 1TJRA 4UFLA 5L9FA 2WSQA 4BK9A 3OVPA 5D2VA 3GR7A 1VC4A 3VCRA 3TK7A 3HG2A 3UZJA 2YW4A 3JS3A 1CW2A 2NZLA 3CQ0A 1SSGA 1IF2A 5G5IA 2VFHA 1EA0A 4ALDA 3B0UX 5U7SA 3TA6A 1ALDA 3D0CA 3B05A 4OE7A 4RJEA 1KM0A 4YCOA 4MYXA 3UQNA 4IXXA 1Q6LA 2DZWA 5CZJA 3EKZA 2QCNA 1OK4A 3CIWA 4U28A 5F4XA 3UXDA 4BF9A 4RXGA 1J4EA 1I2PA 3Q94A 5CSRA 1YTKA 3HG5A 3THAA 1WXJA 3T40A 2EGZA 3CB8A 1GG1A 3ZR4A 1XBYA 4MUZA 3I65A 1OF8A 1OX4A 1OX5A 1TV8A 3TW6A 3IVUA 4IMEA 3TNOA 1HO4A 2ATMA 3QSTA 2GQ8A 3EXSA 3W7NA 1DBTA 3I7RA 4P2VA 3UZ5A 3W2MA 1O5XA 3SSJA 1W3IA 2ZZ3A 4ADTA 5G2IA 5D38A 4I9AA 5KINA 1VJIA 4RXFA 5D2WA 2ZA1A 3PM6A 3M6YA 2CLLA 3MYPA 4UFKA 2AAMA 3PB0A 1IIGA 3EX3A 5EL1A 2VEIA 3GDKA 5CPOA 3W7GA 1FBAA 4IJBA 3MBFA 5EMUA 1OFBA 4MFDA 1C29A 3KRZA 1GZGA 4TR9A 2CLMA 4GJ1A 2P0OA 3BLFA 4JDYA 1JJKA 1O95A 2V8ZA 1OX4B 5DY3A 2HSAA 2A1YA 1UBSA 4NVTA 4HT3A 4KFPA 1GTEA 4IXHA 1GVOA 5DCDA 4PL1A 2YSWA 3UWZA 5LNSA 1H5YA 4HNUA 3EWXA 3NQ6A 2VFFA 2CLFA 1KFLA 3NYZA 5KSWA 4JD4A 4K39A 1OHLA 4AMAA 3I7QA 1YPIA 3M41A 4FXSA 1W3TA 3TIMA 3GNDA 1TPH1 2V5LA 3CT7A 5CPNA 3M5VA 4K8HA 2JGYA 2CLEA 4K37A 3HGRA 3PSVA 2PRMA 4AB4A 1VPXA 1AL8A 3W84A 4BFAA 3O07A 4JTHA 5D2XA 4YCPA 1JULA 3W2NA 1H50A 1N8FA 2X1TA 5AHNA 3W1LA 2ZZ2A 4ZQNA 1P0NA 2C19A 3CIXA 1A5BA 3FKRA 1UUOA 1ZENA 1H7WA 3VKJA 1KLYA 3W2KA 1QFEA 1ZAIA 4S1FA 1F2JA 1ZALA 3B0PA 4O54A 1EPXA 3GDMA 1SPQA 3C2VA 3DFSA 3H55A 4DF0A 5BRBA 4O50A 1Q3NA 2H3BA 1AW2A 3R13A 4LS0A 3W1QA 1C9DA 1LOQA 2JKAA 3IIPA 3TUUA 4X9SA 1SO5A 2DJLA 3BGJA 3UXAA 3DKJA 3ZFHA 3L68A 2GJLA 4UTTC 4AXKA 2WNNA 3W76A 2QKFA 2QCDA 5G1TA 1RQHA 3G18A 4BI7A 4DO5A 4FIQA 3GZ3A 1OYCA 5L6UA 3PB2A 5F2LA 1J5TA 2DP3A 4Y8FA 4K6AA 4JY8A 5BW6A 3QMTA 2R94A 5D30A 3NL5A 3W23A 5I3KA 2FDSA 3WK3A 1S5TA 1EIXA 1WOAA 1MO0A 1LLZA 2X30A 3SGUA 2B4GA 2FB3A 1GYLA 3CTLA 1F74A 3L0KA 2DZPA 4RZ6A 3V75A 3EX6A 5D02A 3NQAA 3MP5A 3AJXA 4PL2A 3UD6A 1W37A 3NL6A 3THQA 2QCGA 2HS6A 4XZ9A 4JICA 2IQTA 3LRKA 1DJNA 5D33A 4O17A 3TFXA 1N7KA 2VC6A 3IVSA 2CW6A 2GQ9A 3GNNA 2HMCA 3TDFA 4GBUA 1TPDA 1D9EA 2C13A 1CX9A 1ZNNA 2V81A 4FF7A 3UPWA 3B0VC 3G1AA 1HTIA 1ICSA 4LRTA 3L0NA 2CWNA 3NQGA 1A5SA 1JCLA 4O0ZA 3GAKA 5J5RA 3W1TA 2NX9A 1TV7A 4WQ6A 2Z1BA 3PUEA 5F2GA 1L6YA 1EP2A 4GRSA 1ZAHA 5D04C 2QUTA 1VS1A 4FX7A 4DO4A 1H7NA 1Q6QA 1X7FA 2V2CA 3TW7A 1H7XA 3W9ZA 2X16A 3LCFA 1FCUA 4O11A 3TJXA 3MW7A 3C4UA 2G5WA 4GUHA 1SZGA 1W56A 2HS8A 3S8HA 1QOQA 4X22A 2PURA 4JDBA 2EF9A 4O53A 4UTMA 2ISWA 2NXHA 2Q3RA 1H7OA 4TMCA 1XCFA 3NPVA 5KZDA 2A7NA 3WJWA 1N55A 3O6DA 2WSRA 3LCGA 4B5NA 4CQAA 3F4NA 1R46A 5BNKA 5TBOA 1EX5A 3PS7A 5BMWA 4UFHA 2CZDA 3NQFA 3DFTA 1PS9A 3EWZA 1I8JA 5HR6A 3EEGA 2A4AA 3DZ1A 3NQ7A 1JQXA 2ZRZA 3HBLA 4LT9A 2W6RA 1ZY9A 2Y85A 1T0OA 1QR7A 3ANYA 2YXGA 5LHEA 3PWAA 5FEZA 3WK1A 1DHPA 4A22A 3TJLA 1CI1A 3LCLA 5K9XA 4IQLA 3C2EA 2QDHA 3MBDA 2Y89A 2CZEA 1GWJA 4CCEA 1FCVA 4OWGA 1YXYA 3MHGA 1FXPA 3W75A 3FIGA 3E02A 5DXYA 3ABOA 3W7KA 3QMSA 2QCMA 3NPUA 3ATZA 1G6CA 2XN1A 5E93A 5KTLA 1TTQA 1PL9A 3GKFA 3NPWA 4LW7A 2ATSA 2DJXA 3GYEA 1T99A 3QW4B 3N2MA 1NF0A 5G4EA 5F2IA 1SSDA 1GG0A 3CHVA 1OX6A 3QH2A 4O28A 4OV9A 5AYYA 3BPWA 3NQ8A 3M16A 1GT8A 1AW5A 1EP1A 3M47A 2AQWA 1ML1A 1ZFJA 3M5XA 1BKSA 2PCQA 4LWWA 4WZHA 2BX7A 3L5LA 4O1DA 4R34A 5C5YA 3G24A 3LB0A 4LY8A 3MHFA 4QM1A 4L4LA 3W87A 4JYEA 3ABRA 1DVJA 3PUOA 4BI6A 3BG5A 4JNMA 3QW3A 2P10A 5AHMA 2ZZ7A 5AYXA 5TQLA 3R2GA 3BW3A 2G95A 1TO3A 3G0SA 2NX3A 3IGUA 4EIVA 1T96A 4FNUA 4H6KA 4RZ5A 3TKFA 4BWLA 2A7RA 2YGYA 5FEXA 4AWUA 3BGGA 3VE9A 2NXGA 1ME7A 3KHJA 3GAYA 2QR6A 4MIMA 3NDOA 4AHOA 5I3GA 2ZRXA 4IUOA 4ONVA 3L5MA 1LOLA 5GVJA 4GUIA 1K02A 3TMLA 2E6AA 3GB6A 4MJZA 2Y7GA 5D03A 5I3FA 1YXDA 3WJZA 1SO4A 2TPSA 2AGKA 4LUJA 3NZ1A 3G1FA 3W7OA 2ZDRA 1O5KA 4EVZA 4NX0A 1TPUA 1XDMA 1KTCA 1LTDA 2A6LA 3WFAA 1FDYA 2JBMA 5EYWA 5FF0A 3RU6A 5KZEA 2BLEA 2PC4A 2GOUA 3DHDA 4HPJA 5U4NA 3O6YX 3NL2A 3TC6A 1WDWA 2WOQA 4PFMA 4Z1AA 1X6UA 1O60A 2QJIA 2VEKA 4LV4A 3O06A 8TIMA 2G96A 1P1XA 3HMJG 3QM3A 5IM51 4HKPA 2QF7A 4IMGA 1OVDA 3NO5A 3A5FA 1JRBA 4OBTA 3TXVA 4LNYA 5HWJA 3NL3A 3S5NA 4LC6A 1KV8A 1ZAJA 2EKCA 1QPQA 4GUFA 3GXTA 1ADOA 3B03A 1KM4A 3P60A 1S5WA 3PVFA 1BWKA 3QJAA 4Q4KA 4AF0A 1VCGA 3O6CA 5LKYA 1H1YA 2FTPA 1NSJA 1W1ZA 3UWUA 2GVJA 4UFJA 1WAUA 4C1LA 5C54A 3OVRA 1KM2A 2NV1A 3BW4A 2VXNA 4RX0A 3QMRA 2QDGA 4JN6A 5F2MA 4S2CA 3INPA 4ZQPA 4L4MA 1FWSA 1YDNA 3NQCA 5MHBA 3TROA 1FY6A 2ZTKA 4JTKA 1Q6OA 1TRIA 3F03K 2Z6JA 3H53A 1JUEA 1C8VA 3LCWA 4UMBA 2GJNA 3K30A 1K7EA 2YW3A 3S42A 3BV4A 4OQVA 2WNQA 4YMZA 2ZFAA 1SZEA 4AF0B 3DKLA 4I7VA 3IIVA 2RDUA 3F4WA 3DI1A 1VHCA 1Q6RA 2J88A 5EBUA 1SUXA 4WJEA 4O10A 5I3IA 2B7QA 2ABBA 1GVFA 1TB3A 3NAVA 1F05A 4M7SA 4NU7A 1FUYA 5DN1A 1GQNA 1KM3A 3PULA 3PBYA 5C2XA 1F6KA 3TC7A 4YXGA 2C6QA 3NM1A 3U6WA 1UUMA 4PEKA 3VNDA 3GX9A 3LHWA 3MYOA 3QF0A 3C61A 4UIOA 3NNTA 4GWEA 1FQ0A 1TRDA 3ELFA 1LYXA 4NT0A 2E6FA 3Q58A 1DORA 1XI3A 2GPTA 5CKSA 3S5OA 3P82A 4JX4A 2ZYFA 3NVTA 4LS1A 1Z44A 4K36A 2YFOA 2CU0A 3G1VA 4O4VA 2WSYA 2FQIA 3DFQA 4MLJA 4X2RA 4O1CA 5CZ0A 1E51A 1TTIA 4R7JA 1SW0A 1PE1A 4N9DA 3LCIA 5HWMA 2V2HA 4JY9A 5LGXA 5CG7A 1RQBA 2C0AA 5LNUA 3RFAA 1G69A 2Y88A 1M5WA 3JRKA 2LLEA 3KVKA 3LTPA 4FO4A 3W7IA 5ABTA 3Q37A 3G3DA 1KTBA 4QQ3A 1TJPA 2J27A 3W7PA 1A5AA 1GEQA 2OCZA 4NNAA 3IEBA 3CWOX 3IGSA 4E38A 2F7FA 1W5PA 3HO8A 4AVFA 5H2ZA 5K2ZA 3N34A 5AHEA 1MXSA 6TIMA 3NQVA 1TMHA 3W1PA 3KVJA 5KMYA 3CM4A 3TQKA 2CLIA 4OU1A 4S2BA 2J9XA 2Z0IA 2A0NA 1MEWA 1YDVA 3W6YA 3W2JA 3F1QA 3TSDA 1WX0A 5FEWA 1OFRA 4Z1DA 2WPBA 2YCEA 4O0KA 1BWLA 3BG9A 3DFNA 4EWND 3LOTA 2WV8A 4MJMA 3GXNA 3HGJA 2FPTA 3PSWA 4AWTA 4FEZA 5LGZA 3STFA 1UCWA 4JEQA 2Y7EA 3SZ8A 3W1UA 3MP4A 4GXMA 1W8SA 1QO5A 1P4CA 3W7DA 3MWAA 3EX4A 2Q3OA 3LX9A 2FLIA 1OFPA 3B06A 4UNLA 4N9CA 3TAOA 1K3UA 2C18A 3GDTA 4MZYA 4ZQRA 1W5NA 2FPVA 2I14A 3KAOA 4Y90A 3W7CA 4N02A 5D2YA 2EAWA 2WO5A 4UTJA 1VR6A 1VYSX 3STGA 3C6CA 4K38A 1NVMA 1LRNA 1W0MA 1JRCA 3P8IA 2R91A 2YX0A 4U4MA 4UTWC 1LZOA 3HF3A 1JCYA 3FA5A 3DGRA 3LI0A 1GYNA 1F73A 1Z42A 3L67A 1KW1A 3NQ2A 4R53A 3RMJA 5AC7A 1O94A 1KBJA 3MUXA 3W1RA 5C6MA 1HUVA 4WUIA 4C1KA 4UTTA 1GOXA 6ALDA 2V2DA 5FI8A 1SU5A 3TAKA 1PVNA 3ABSA 1GTHA 1IXNA 1R47A 2DZVA 3W85A 3MI2A 2BZNA 4QAIA 1FDJA 3P84A 4QNWA 2YYUA 3R89A 3FYOA 4HIBA 4XBSA 3TFCA 3GKAA 3AO0A 1OFDA 4IMFA 2C1HA 3P8JA 2J9YA 1R2SA 3NQEA 4LUIA 4YLWA 1SW3A 1F7BA 1A5CA 1TQXA 4GUGA 1LORA 1IGSA 3RK8A 3FFSA 2CFFA 3G1DA 3T78A 1TPVA 4I7WA 2YZRA 2B7PA 2QCDB 3LGEA 4CQ8A 4CQ9A 3QSRA 4FX8A 2PE4A 4M6VA 1V7YA 4GNJA 3U2OA 1A53A 3EXTA 3ZWSA 1KFKA 3BARA 4KWVA 2E5CA 3NXFA 3UWYA 3UYCA 5F4SA 1H61A 1WV2A 4XUGA 4DXVA 4CNNA 2E1DA 4KWWA 4TO8A 1SFJA 1ONRA 1W5MA 4LVBA 3TV8A 2FB2A 4NX5A 1TREA 3OHIA 2VFGA 3RNDA 1PHWA 5AB3A 5CPMA 1XDLA 2GUUA 3E96A 1FX6A 1JCXA 1K8YA 3E12A 4FNQA 3DFPA 1YLVA 2Q8LA 2QCCA 3EWYA 2BSLA 3CC1A 2QCEA 4Z0SA 2E09A 4RCXA 3MHUA 4KFNA 4JS3A 2CLOA 1ICPA 4JX6A 3T44A 3QFEA 2W79A 4GE8A 5T26A 3G3MA 4IOTA 3WJYA 1O4UA 4O19A 3P80A 4RK8A 1K03A 1FCQA 4NNCA 1FXQA 1M7PA 3PG8A 4IX2A 1SW7A 4M6QA 2Y63A 4K7YA 4FB7A 2VKZG 3QRHA 3VI2A 3QC3A 4N6EA 1OFOA 3GLCA 1PCKA 1I2NA 4LV9A 4P61A 5LNVA 2NUWA 1R2RA 4CNPA 3MI3A 4JTGA 5EPDA 1J2WA 3M44A 3R8RA 1YTEA 1XBZA 3DENA 3G1SA 3N9RA 1M7OA 5AHFA 3SI9A 4UMAA 3GK0A 1R2TA 4ADUA 1OK6A 1HG3A 1TPC1 1K8ZA 3TQVA 5C55A 4RV8A 4ZQMA 1U83A 1S3HA 1KM1A 3PC0A 3W88A 1QPOA 2H6RA 4PC8A 3W70A 3HOJA 1YYAA 1I2QA 2OX1A 4AHQA 1SZNA 1X8FA 4NQ1A 3C2RA 3S1VA 1DV7A 1TV5A 1LM1A 4JTEA 5AC8A 1OYBA 4DEFA 4N9EA 5HWNA 3GIYA 5DBTA 1EP3A 4FHAA 2ZZ5A 4O13A 5FF7A 1VGAA 4BI5A 2A21A 3FLUA 1UASA 4O4WA 3UWWA 4JR5A 3O1NA 4M7TA 2HTMA 3KVMA 3LXCA 2J6XA 5IBXA 3LTYA 4LS2A 1XKYA 3GR8A 5CSSA 3TH6A 3HIJA 2NLIA 2XN0A 3FOKA 4Z1CA 3LCXA 1X1ZA 3C2FA 5J5DA 1XL9A 1L6WA 4UC5A 3G1XA 1FWRA 5I3HA 1DOSA 2RHGA 3S1UA 1TCDA 2I1OA 4FNSA 1T8XA 5EKYA 3QPZA 4HSNA 1RV8A 4UMCA 1RZMA 1VLIA 1XBXA 1VLWA 1LRQA 1AK5A 5A8GA 3NG3A 1LBLA 5DCBA 3STEA 5H91A 1WBJA 1DKWA 1VCFA 3E9AA 3USBA 2NWRA 3W7LA 1MZHA 1QOPA 2O7SA 1RVGA 3LHYA 3LRLA 4CNOA 3BW2A 3M1ZA 1IXOA 2ZA2A 1TYGA 1D3HA 1H62A 4QISA 2X1UA 4WXZA 2JK2A 2QUUA 3BVJA 5LZLA 4G1KA 3PUDA 1XXXA 4JGDA 1PIIA 4O14A 4NJIA 2UV8G 2ZRWA 4X3ZA 3GDRA 2Y61A 1VQTA 4ZMGA 3NQMA 4O12A 1F6PA 1G4PA 4NJJA 3W2UA 4N4PA 1W3NA 3L2IA 3L9CA 4DQWA 1MEIA 3S5ZA 4O1BA 3W7EA 1JQVA 3N9SA 2V9DA 5K4ZA 1K7XA 1OFAA 2R8WA 4UCGA 3TSMA 1X1OA 2E6DA 5LHFA 3H54A 5G2HA 2TRSA 1KA9F 4Q32A 2YR1A 4W9TA 1RD5A 2J9ZA 1GJPA 1QCWA 2VFIA 4NJHA 1KM5A 4JYFA 1DQXA 4LVGA 4HHPA 2A7PA 3HQ1A 3A24A 3HGOA 5TIMA 1RR2A 4A3UA 2RH9A 3DXIA 1MSSA 3LHTA 3S5YA 5AN7A 3I68A 3Q2DA 1XM3A 1WBHA 1GPWA 3TE9A 1WA3A 5CPLA 2FJKA 5F1UA 5HMSA 1M6JA 1NEYA 1EWEA 1G67A 2V0TA 2VEPA 3T7VA 2ZZ1A 1QMLA 4FNPA 4DPQA 4CCDA 3LV6A 1THFD 3C52A 1WYIA 4LU0A 1XUUA 4CLMA 2PRHA 2Z2UA 1PV8A 3NOEA 2ZZ4A 4QITA 4UFIA 2H3DA 2KZHA 3G8EA 5K9DA 1K7FA 5HUPA 1H63A 4UXDA 1JCMP 4N4QA 3EWWA 1OFEA 4WY0A 4PA8A 4TIMA 5DCEA 4YWIA 1L6SA 4RLIA 3T4CA 1RPXA 2YPIA 3C3NA 3W7JA 1LLWA 1H60A 1EUAA 2V30A 2BTMA 4DPPA 2FPYA 5D32A 1LROA 4ZL1A 2ZA3A 3QYQA 3IGXA 1ZJIA 3IIOA 3SW6A 4N6FA 3PAJA 2VOMA 2B7NA 3PBWA 5I3JA 5G2WA 1VCVA 1W5OA 3WJSA 1W31A 3RF9A 4IPIA 4HNTA 2X1RA 2XFWA 3V1PA 2CZFA 5DXXA 3SFKA 3TR2A 3P61A 4JTTA 3N14A 4WY0B 5E1QA 2V5BA 3L0GA 3LRMA 4QIUA 4XQ6A 1I2OA 3R5EA 3STCA 2WKJA 4EF9A 4MKNA 5AYZA 4HNVA 4QNEA 4MZ1A 1YTDA 4LC8A 3O15A 7TIMA 3LXAA 3G0UA 4DBDA 4POCA 2A5HA 2RFGA 4CCCA 1PHQA 1XUZA 1B4EA 4A2RA 2QAPA 1JUKA 3KXQA 1VYPX 3G1YA 5K7JA 1HO1A 3R12A 2ZRUA 2C15A 3P67A 1UB3A 4NJGA 1EB3A 1QNVA 2C16A 5LNWA 4YL2A 5HNRA 4O8RA 1A50A 1H1ZA 2JKPA 3CWNA 5G4WA 3NGJA 3S6DA 4ADSA 4GUJA 3MP3A 1G4SA 2E77A 5F4WA 4DF1A 3CPRA 5KITA 1KLZA 3A9IA 1AMKA 1G7UA 4Z08A 3FYPA 4AHPA 4MY9A 1B9BA 3W72A 3KRSA 4LVAA 1LDCA 1UJPA 1AG1O 3P5YA 4LOCA 5HQEA 1SQ7A 3IRDA 2Y70A 4PH6A 4MY1A 3C2OA 3W7RA 2CLHA 1KFEA 3P81A 4LTSA 1L2UA 4A21A 2YYTA 2YFNA 4HSOA 4JTLA 1Y0EA 1JR1A 3NZRA 4ML9A 5K3VA 1TPEA 3M0ZA 1LP6A 1ICQA 3UPBA 4UTLA 1EEPA 1KFCA 3HPXA 3NA8A 3L66A 1FDZA 3BLEA 4ZZ9A 3W86A 4H3DA 3TSBA 5DY2A 2TYSA 3UWVA 2E68A 3HGSA 2RDTA 3YPIA 1LCOA 1KTNA 1F5ZA 3N73A 1JUBA 3CEUA 1IIHA 4N2YA 3LHVA 4K8EA 3S0CA 4KKXA 2Y6ZA 3PY2A 2GQAA 2QCFA 1OJXA 3HG3A 2PRLA 3UWQA 4NZFA 3TU9A 4DBEA 3LI1A 4ZVJA 1ME8A 4E2BA 2ZTJA 5FF4A 4UTHA 3JR2A 1EUNA 4NXKA 3I7SA 1V5XA 1G4TA 1I2RA 1EWDA 3SJ3A 3QEZA 4Z1BA 2DZTA 3IV3A 5AHIA 3LXBA 4UTWA 5AHLA 5BMXA 1G7VA 1NF7A 2XN2A 4WY0F 1QO2A 4WXYA 3HPSA 3W1MA 4O16A 4OGZA 5DLCA 3LBCA 3N3MA 3U8GA 3LLFA 1ZCOA 2BWGA 2I9EA 2NUXA 3G0XA 4GFSA 2VFEA 2R14A 1FWNA 3KOFA 3HG4A 3G1HA 4MYAA 3MJYA 4JTFA 1TTPA 2P1FA 2DU2A 3EB2A 1L9WA 3LV5A 5FF2A 2NWSA 3DAQA 4AAJA 3W83A 5D2TA 4EOUA 3OG3A 4E2DA 4A29A 4EF8A 3KX6A 3QQ1A 4MVAA 2B7OA 5HR7A 1OFQA 1R30A 1WOBA 2X1SA 3PG9A 3DFOA 3SY5A 4J9JA 3KRUA 1QPRA 3VE7A 1LOSA 2ALDA 4WX2A 3M5YA 3FEMA 2CZ5A 1QPNA 3M9YA 3UY7A 1XC4A 1YADA 2DZUA 3EXRA 4O15A 4UTIA 3A23A 4UR7A 4ORMA 4FX6M 2NV2A 4E0CA 2ZRYA 3HPZA 5SWUA 3O8AA 5D09A 3O05A 3E0IA 5CZSA 1PCWA 3OBKA 3DI0A 4JYDA 3GXPA 3NQDA 2CLKA 3OEXA 1I4NA 4MPQA 2TSYA 1JCJA 1TTJA 4AWSA 2QUVA 4K7VA 3LERA 3DHFA 1TPFA 2JGQA 4H4IA 4JX5A 2F84A 3DH7A 3W74A 3T55A 4FXRA 4RKAA 3BLIA 1VHNA 2OZ0A 1XFBA 3HJZA 1OG0A 1Z48A 4LRSA 3FKKA 1RQEA 4WOQA 2FFCA 2NXIA 5HULA 2EHHA 1SZFA 3GVGA 3LHZA 4MZ8A 1LRTA 1JCNA 3UNDA 1VH7A 5DELA 3HB9A 1IXQA 5HJLA 1BTMA 1DJQA 2RKXA 4JIQA 2QEZA 2DZXA 3C56A 4PODA 2QJHA 3LDVA 4NNBA 1TIMA 1OABA 4ZQCA 5D37A 3C0JA 4AEOA 3TX9A 5FESA
chains in the Genus database with same CATH superfamily
4HA4A 1OWQA 3IIZA 3FAWA 3PZQA 2XSAA 1S38A 1S5VA 1AVAA 4FR1A 4TU1A 2IPFA 4AIBA 5AFDA 1UYQA 2EEXA 3B9EA 3DU0A 1XLBA 1K9DA 2YLLA 3B8DA 1B3OA 4BA0A 5A8PA 2MUCA 4M51A 3KHDA 3DYPA 3GG7A 2Y7DA 4HHHA 1UG6A 4HN8A 1FKWA 1LF1A 1TR9A 3QQ0A 1J0ZA 3CEPA 2A6NA 5HUOA 1OZMA 2JKEA 2G4JA 5T8GA 5FJOA 3EAUA 4R27A 1KBKA 1X38A 2QMKA 2FHCA 2NVDA 2GVLA 3PBVA 5LSMA 2ZCGA 1HFBA 3F2CA 1GQKA 4HOZA 1SFTA 5GQBA 1KFBA 2PDFA 1OF6A 4L61A 4L64A 3TXZA 3BCJA 3BK0A 2H90A 1GHRA 4M1RA 4IMCA 2PLCA 2UY5A 2OT0A 1NDVA 3OVQA 5D9MA 3SR7A 3QFWA 3DYOA 2PDWA 3SCWA 3EWUA 3DBPA 2OT1A 1NAL1 3E74A 5DBUA 1FVPA 2O4MA 4C5YA 3SIZA 2CETA 1NTHA 4OT7A 4MAZA 3EA2A 2Y8VA 5FF3A 1XLHA 3SN1A 2C3ZA 3ZWTA 4AIOA 4FMVA 4WDXA 4H9ZA 3CZEA 1W54A 3MO7A 4S3FA 2ZZ6A 5HINA 1JYWA 3APGA 4WF7A 1ADSA 2ZXBA 3NPXA 3HV8A 1HKMA 3U2CA 1S3TC 4IPJA 4H19A 3FXGA 1E72M 3DDMA 4NUWA 2YDAA 4TMBA 1U30A 5B7YA 4NZ4A 4M8UA 2FMNA 4K8GA 5F1VA 1FWAC 3NR0A 4JXCA 1VBRA 2W0UA 2WM0A 2BGSA 4ZENA 4DF2A 3CBWA 1Q45A 2PWGA 3VD3A 3Q65A 3MS8A 3W2LA 3CZLA 3HV9A 2H8ZA 1KWKA 2DZSA 1A4LA 3WDQA 3SGZA 3Q45A 3ARRA 4C6QA 3ARTA 4E3VA 3O0KA 3QZ6A 2Z27A 3M5ZA 3PPHA 4NJKA 1K6WA 4RZ4A 5CZTA 2YCJA 2FZBA 3QHMA 2WZTA 2NX1A 1GNXA 3A22A 4LNCA 4QCFA 4B5TA 4IX0A 3A3WA 1GVSA 2WQPA 3IJIA 4Z0JA 1UR3M 1FCBA 3A9BA 3H4GA 2Z28A 2X8RA 1L2QA 5E9AA 5CBIA 2ZC1A 4LY4A 2HVNA 3S9YA 3MI6A 2I7GA 1US3A 3UJFA 3V16A 1I45A 1WXZA 3SUSA 3W71A 3VC6A 3L21A 4LAMA 4QFUA 1QI2A 5C7VA 5A8NA 4G7FA 2WNWA 1N8IA 4IWWA 2FZ8A 4M6PA 3UA3A 1H51A 3UY8A 3W02A 1T7LA 1AW1A 4TX9A 3FJLA 3IPWA 3KVLA 4Y9NA 4WD0A 2IPWA 5BXSA 2OSYA 5JQ9A 4UFLA 2WSQA 3AMKA 3OVPA 4PTMA 1R86A 3GVQA 1FHUA 3AWOA 2PDNA 2QZRA 1TUXA 1AD1A 1IWPA 1RSCA 3S2CA 4MUPA 1K1DA 1SSGA 4ALDA 4UBPC 5U7SA 3RN6A 1R7AA 5CGMA 4TV5A 4MG4A 1U1HA 2XGBA 5I77A 2JF7A 3VIIA 3NYDA 4KRZA 1VEPA 2FH6A 5CZJA 1V0NA 1UWIA 2UZ9A 2R9RA 4Y7EA 2G0WA 2BXYA 1CXEA 2D0FA 1WXJA 3T40A 3WF1A 1YW1A 3CB8A 1XGDA 1XFCA 1GG1A 1JXJA 1XBYA 4MUZA 1DJZA 3EOUA 2GDUA 4IM4A 2AMXA 2ZX9A 3TW6A 2V5DA 4GI9A 1R85A 1HO4A 3PHAA 7PTDA 1PIFA 3WLSA 1XLAA 4A6GA 1GZJA 3UGRA 3W2MA 4NYYA 2ZZ3A 4ADTA 1J01A 4RXFA 2DDXA 2ZA1A 3MYPA 4B2DD 2PCEA 2VWSA 3PB0A 3EX3A 2VEIA 3BGAA 3CQHA 3W7GA 3MBFA 5EMUA 1PZ0A 3W6MA 4GJ1A 4A8IA 4Z2JA 2V8ZA 1OX4B 2J7BA 5DY3A 2HSAA 3CAQA 4ZODA 3OW1A 1IT8A 3R43A 4QSFA 4HT3A 4IXHA 4PL1A 4YVXA 5LNSA 3EWXA 3NQ6A 3GXDA 2CLFA 1B3ZA 1DJHA 3I7QA 3DG6A 3OLDA 1W3TA 3TIMA 3GNDA 1TPH1 2V5LA 5I7GA 3WQFA 4YHGA 3BV7A 3M5VA 5HPOA 4WHBA 1S2CA 2WCGA 2VM8A 1UKSA 1V6XA 3W84A 3GH4A 4UQBA 2X1TA 2ZZ2A 4ZQNA 4DJFA 3R25A 1P0NA 2GOKA 3GQYA 4MNLA 1H7WA 3W2KA 3WLJA 1ZALA 3B0PA 3K13A 3W0KA 5HJXA 4DF0A 4O50A 6CGTA 1B1YA 3A3XA 4LS0A 2I5QA 1DIOA 4B92A 1Q85A 3TTQA 1LOQA 1S2TA 3TUUA 2NQJA 4PUMA 5HQMA 3OODA 3L68A 3A64A 4EPDC 2AKZA 3S4TA 3QN3A 3VGFA 5G1TA 1RQHA 4DO5A 3FAXA 4XX6A 4EAYA 4DIAA 3TWBA 5F7UA 2E7FA 3B9OA 2DP3A 1XIIA 4K6AA 8CGTA 4P7RA 3QMTA 5D30A 4ZEPA 1CCWB 3WH8A 2IQDA 3NL5A 4QLKA 5I3KA 1I60A 1NOUA 1MO0A 4JL2A 1FRBA 2X30A 3T8QA 1R5YA 2B4GA 2O9RA 4RZ6A 4HOWA 3EX6A 5D02A 3MP5A 2PDXA 3AHYA 1XYMA 1W37A 1TE1A 4LB4A 2HS6A 4M80A 4JICA 1I0BA 2CBUA 3VKDA 4QG6A 1N7KA 3KWXA 2CW6A 2WHJA 1QHZA 3TDFA 2PMQA 3V0SA 3S9ZA 3GD6A 3CIVA 1ZNNA 4FF7A 2TAAA 3UPWA 3B0VC 2PGWA 1HTIA 1ICSA 1BHGA 2WC3A 2Z1VA 1JCLA 3W1TA 4WQ6A 5F2GA 5CLWA 3UEQA 4GRSA 3K4WA 1VS1A 4D6HA 3FW6A 2VQTA 3DX5A 3LCFA 2WVUA 3MW7A 3C4UA 1FWHC 2G5WA 5ABEA 4W5ZA 4HTBA 5EFFA 2XHYA 2ISWA 3RO8A 1FH7A 2R1LA 5CPTA 1EJSC 1E6ZA 1O66A 5KZDA 4W85A 1D7KA 3O6DA 2O4QA 3ZVIA 2A79A 2GJXB 3WZ0E 2ESCA 2YA0A 1PS9A 2OPJA 3TN4A 5HR6A 2D2GA 4CQDA 3N04A 3DZ1A 3NQ7A 1FH8A 4OUIA 2DSWA 3HBLA 4LT9A 1A3HA 4QEEA 3ANYA 2YXGA 3LU2A 4M6UA 2VI0A 3WK1A 4K1GA 1DHPA 4A22A 1CI1A 3BZGA 5K9XA 4IQLA 2WLYA 3C2EA 2QDHA 3WQPA 3UWEA 1TMLA 3MBDA 4F2BA 4KEMA 1TJ1A 3WQ4A 4CCEA 1FCVA 1F3TA 3MHGA 1FXPA 3FIGA 3S5SA 3HPAA 1XRFA 3E02A 3T2QA 3QMSA 2GZXA 3UFYA 5E0CA 4PRTA 2J8FA 1BYBA 2ASHA 1ZP3A 4FAMA 5KTLA 5I2UA 3QV6A 3FK4A 4LW7A 4L6OA 4X0NA 1GG0A 2HQAA 3MT1A 2VQUA 3M16A 4HU4A 4J4KA 1V3HA 3EB3A 2ACQA 3VUSA 8RUCA 1BVWA 3A47A 1BKSA 4WZHA 4EXQA 1EDGA 1E9LA 4R34A 2F8QA 3G24A 4LY8A 2PDQA 4QM1A 5A2BA 3CNYA 4JNMA 3M4HA 2XM1A 4LAOA 2NQ5A 1UWTA 4GXPA 3SCSA 1XYBA 2ZZ7A 3MUCA 5TQLA 3VOGA 3BW3A 3PK7A 5FSEC 4GVFA 4EIVA 3FYYA 4ZA0A 4XD4A 2BDQA 2NXGA 1Q7ZA 4YYCA 3I6EA 4EXBA 1J0JA 1U33A 1AMYA 3ZJKA 2CERA 2E6AA 4MJZA 5D03A 1TZ7A 3ECQA 3BLDA 1UWRA 2ZDRA 1X7IA 4NX0A 3TONA 1IZJA 4DUWA 3WFAA 2VZSA 1FDYA 2XPKA 2WVVA 3P0XA 3DHDA 2Y5SA 4RDZA 3EDKA 2ZUWA 4Z1AA 1X6UA 1NDYA 1F6YA 4JCMA 1XRVA 4G5DA 1P1XA 3HMJG 4Z17A 4PCNA 1S2VA 2QF7A 3NO5A 5DEZA 3AHVA 3A5FA 1K9FA 3VKCA 3QLLA 3GFYA 1QI5A 2EKCA 3ITLA 1QPQA 4GUFA 3B03A 1ISVA 3P60A 4D6FA 3PVFA 1XH1A 1UP2A 3QGAC 1E0VA 1XIGA 4LYQA 2FTPA 4E4FA 4Y9MA 3SUTA 3MUZ1 3H2OA 3UWUA 4QE1A 2DQWA 5C54A 4ATDA 1XCXA 5F2MA 4YN5A 1FWSA 1YDNA 1EFZA 1TWSA 3ID7A 3TROA 1FY6A 5DF0A 2FZDA 2QULA 1OY0A 5DMYA 3WUFA 5REQB 3H53A 4C1NB 2ANUA 3SCVA 3LCWA 4UMBA 4IL0A 2VZOA 5ECUA 2YW3A 4OQVA 4US6A 2WSPA 4RNFA 4AF0B 3ABZA 3BAWA 3IIVA 2WCAA 1CPUA 4G56A 3F4WA 1VHCA 4XD6A 4D6IA 2PTXA 2G8ZA 4LCQA 1UW9A 5I3IA 2B7QA 1TB3A 3A4AA 1KM3A 2E67A 2D1ZA 5C2XA 2C6QA 3NM1A 5GNYA 4JQ3A 5C9RA 4PEKA 3VNDA 1VJSA 4L65A 3LHWA 1T40A 5EMLA 3UZWA 1WB0A 2GK1A 2VGIA 4GWEA 1TRDA 4GIRA 3ELFA 1VENA 1EXPA 3CQIA 1XI3A 2GPTA 3I3DA 2FGBA 2ACUA 1PUDA 3UBPC 3NVTA 4K36A 3E38A 2OYMA 4HA3A 4JNZA 3W27A 2IQ0A 3LZ5A 4GVGA 4ZE4A 3GTIA 4P7NA 2WC7A 2Z29A 2V2HA 1H49A 1WP6A 1W3KA 1VFFA 4OBSA 3TYZA 1M5WA 1X8CA 1FHDA 5FJRA 2C0HA 4FO4A 1QW7A 4GH3A 3Q37A 2Y8KA 1MW0A 5A6JA 1A5AA 1J6PA 2PLKA 3QV9A 1GOIA 3IEBA 3CWOX 2F7FA 3SQMA 1JZ7A 2HRWA 1O1ZA 3N34A 6TIMA 3FGCB 2CXEA 3KVJA 5BCAA 3T2OA 4B91A 3GG1A 3W2JA 3TSDA 4ZO6A 3LA4A 3R6IA 4Z1DA 2YCEA 4O0KA 4P7LA 4UQAA 2CIPA 1L8PA 4LCSA 2W61A 3GXNA 3HGJA 3PJTA 4JQ4A 4IT1A 4BQ4A 4YPJA 4ACZB 5LGZA 2L5HA 4JEQA 3MP4A 1QO5A 1P4CA 2BVWA 3BLPX 3BUVA 5EGRA 5H8UA 2OWCA 1VBHA 3ISIX 3AQUA 1KO0A 2E28A 4S38A 2C18A 3EPOA 2D3NA 4ZQRA 1W5NA 4Z2KA 4ZOEA 4Y90A 4D1JA 4N02A 2XVPA 2WO5A 3C6CA 3BCDA 3T05A 2G37A 3C0SA 2V5JA 5LIXX 4DJEC 2WW5A 5MF5A 1JRCA 2R91A 1KCLA 1G9HA 4U4MA 1ZU8A 4UTWC 1PYMA 4DJDC 3PTKA 1Z42A 4KEUA 3WLOA 3C86A 4NILA 3NQ2A 1RK6A 2DUXA 1KBJA 3WKZA 1L6FA 3M0JA 3I3EA 1W6TA 2V2DA 5FI8A 1BTCA 3BAYA 1US0A 4RDWA 1KXTA 3ABSA 4Q8NA 1IXNA 3MI2A 4YWSA 4AY8A 2YYUA 3QC0A 3DHUA 1NDZA 3FYOA 2QPXA 2OLAA 4AVOA 2YJQA 4DVOA 1BFNA 2ICSA 3TFCA 3URQA 4DYKA 3EOLA 1RH9A 2E8YA 4YLWA 3S46A 3GG8A 1KGUA 1LORA 2FVLA 3DUGA 4FOUA 4KRTA 2Y2WA 3T0TA 3E2SA 1V6TA 4CQ8A 4FX8A 4M6VA 3B9DA 3U2OA 1AODA 4JN8A 1IT7A 1E71M 3EXTA 2Z7KA 3BARA 4HCHA 3EBVA 4KWVA 1V7AA 3UWYA 4WIWA 1XIDA 3K46A 1H61A 1WV2A 2RDXA 4DXVA 4UQDA 4XD5A 1WKDA 1FP8A 4KWWA 1QUMA 1JI2A 5C71A 3RNDA 5CPMA 2IW0A 3FXYA 1XDLA 4CEUC 4FSAA 2GUUA 2XGZA 3E96A 4HZ6A 1JCXA 1K8YA 3IK2A 4FNQA 1W1VA 4QE5A 2QCCA 4Z0SA 4RCXA 1XLMA 1E4NA 5KZ6A 4KFNA 5PTDA 5FL1A 1XLEA 2VGFA 3H2NA 4FF5A 4LUSB 2W79A 5T26A 5CGTA 1O4UA 4IQJA 3ITXA 3PANA 1J93A 4NNCA 1KR0A 1Q65A 4JFVA 1FXQA 4YTTA 3UG4A 1SW7A 4FB7A 1GOQA 3HQOA 3QRHA 3VILA 1Q7QA 3MUAA 3WYZA 1PCKA 1GORA 1I2NA 2PWDA 2X05A 5LNVA 4LH8A 3F2BA 4CNPA 2C1IA 3MI3A 1X97A 3QR0A 4G9PA 4F0KA 1XBZA 3MSGA 3DENA 4S23A 3F7JA 5IFTA 3GK0A 4ADUA 3PZMA 4BF7A 4W7UA 4PTWA 4TQTA 4I5RA 4IH3A 4HVXA 3IACA 3W88A 4DZIA 2VUNA 3ZVHB 3W70A 2FTWA 3IAPA 3MQTA 3N6QA 1EIBA 4MB1A 1UWUA 1SZNA 3S1VA 2VRKA 1DV7A 1M41A 1IEQA 1WZMA 4DEFA 2YXXA 3GIYA 3Q4DA 2QDEA 2HWGA 4FHAA 4IG2B 4BHYA 1ZB5A 4O13A 5FF7A 1VGAA 1FHVA 4IP5A 3UWWA 2VCCA 1KGXA 3FSTA 3MUY1 5IBXA 1XKYA 4CD7A 3TH6A 3HIJA 4UTFA 5A6BA 2GFTA 1RD6A 5BROA 1L6WA 4UC5A 5I3HA 3RCYA 4QLLA 3S1UA 4AX6A 3OVGA 3OLEA 1T8XA 4HSNA 1ESWA 1B90A 3RCMA 1VLIA 3GRIA 5BXRA 4QBXA 1W17A 5CXPA 1VLWA 4H9UA 2WK2A 2EPNA 3L2LA 2Z1SA 1J9YA 1BRLB 4XUYA 4ZB5A 1IEXA 3GTXA 3STEA 2HJPA 1R9ZA 3H26A 4F0LA 2X0HA 2NWRA 3ZJ7A 2Q8XA 1MZHA 3NDZA 2Z4GA 1RVGA 3LHYA 4CNOA 1J12A 3BW2A 3EKGA 2YBVA 1IWAA 1FHLA 3CHCA 3QQWA 2BV9A 3VNYA 1H62A 2R24A 4QISA 2X1UA 4ZTXA 2QUUA 1HJSA 4DYJA 3NO1A 4Q4MA 5LZLA 3OYZA 1VJZA 8XIMA 4NJIA 4Q8UA 2Y24A 3W00A 3KS6A 1XICA 5A1AA 4O12A 3WF4A 1G4PA 1UC4A 4D1IA 5AECA 1W3NA 2QQ6A 3P3BA 1MEIA 3SDOA 2BODX 1JQVA 4QTGA 1X1OA 1HZYA 3H54A 5LHFA 5G2HA 1DWGM 2F61A 4Q32A 4Q8MA 5CAKA 3IJQA 3DEQA 2BB0A 2CNCA 2E25A 1EJWC 2HISA 1UD8A 3AALA 4JYFA 4HHPA 1VIZA 5TIMA 3DXIA 3LHTA 3S5YA 3VCCA 3I68A 9RUBA 1WBHA 1GPWA 4V28A 5F1UA 3QPEA 1NEYA 3ZT5A 3ARWA 3GIPA 1BYDA 2GGGA 4FNPA 3UYIA 3TQPA 4B3LA 3NTYA 2PRHA 2Z2UA 4UFIA 4QITA 3H2MA 3TWAA 1HL9A 4PUKA 2WM1A 4DRSA 4BQ2A 1XG4A 3TCSA 5DCEA 7ENLA 3UJRA 3N4AA 1LLWA 3H2CA 1U1JA 4CNTA 5D32A 4ZL1A 2ZA3A 3T09A 1ZJIA 4OJYA 3FN9A 3COTA 1UIPA 4E8GA 2VUYA 2B7NA 3KL5A 1QU4A 1KFWA 3JVAA 2J75A 1B9ZA 1J2BA 3TYDA 4LANA 3WJSA 1BPLB 4WDTA 3U4AA 4PMJA 5CSYA 2PUZA 3NQBA 4V1XA 1TVNA 1WPCA 3V1PA 2EKGA 2CZFA 2XGIA 3EYPA 3SFKA 3P61A 1KR1A 1PTDA 4PGLA 4UOJA 4C6FA 3VIFA 3L0GA 3LRMA 4QIUA 4XQ6A 1I2OA 3R5EA 3CUGA 4MM1A 1K77A 1NDWA 1R3SA 4LC8A 3O15A 3N2BA 3ZMRA 3FHQA 7TIMA 4ECLA 3OG2A 3BTNA 3RYSA 3LXAA 3LZ3A 2DT3A 4POCA 1IZKA 2A5HA 5H8PA 1B4EA 2YCLB 2BFGA 1VYPX 2OR2A 5K7JA 1HO1A 2A3CA 4WKHA 2ZRUA 2C15A 1I1XA 2GK1B 5HNRA 4DNMA 2ON3A 1IEIA 2B81A 3CTTA 1A50A 1H1ZA 4C6NA 4EKJA 2JKPA 1HKJA 3D5HA 1G4SA 3IAQA 4IIDA 4DBUA 3FJNA 4W8BA 4DI8A 5KITA 1KLZA 4Z08A 3W26A 3GC2A 1UJPA 3TN3A 5HQEA 1SQ7A 4MY1A 4U2ZA 3L4WA 3W7RA 3E2QA 1W8GA 2NQLA 3SO7A 4HSOA 1JGMA 2WMIB 4ML9A 3VDBA 5K3VA 3APYA 3KRBA 1SFSA 3IV8A 4DZHA 2VHLA 4IHCA 4DXXA 1EEPA 4AZ6A 3VDAA 4A3HA 3R0KA 1DTUA 4ZZ9A 3W86A 3TSBA 5DY2A 1GOKA 1ONXA 1W1B1 2RDTA 1F5ZA 1H5VA 4C6EA 1PTAA 4NI8A 3KOYA 4ZO9A 3L12A 1F4HA 1JYVA 4DJFD 2YCKX 3B8IA 4KKXA 2XIMA 4PYSA 5CC6A 1B3VA 3ZR6A 1U22A 2YOCA 1MDLA 2FHBA 2ZTJA 5FF4A 3KCLA 1S5MA 4B3KA 4I9MA 3SGGA 3GNPA 2INFA 3I7SA 2YL8A 3SRKA 2W9MA 4Z1BA 3QHOA 1LQAA 1LWHA 3PNUA 3IV3A 1ECQA 3V36A 4UTWA 5AHLA 2WLZA 4WY0F 1QO2A 2VWTA 1M1BA 4WXYA 3WLLA 2GUYA 3H6OA 4AYSA 4DJDA 2O9PA 3LBCA 3UA4A 1ZCOA 1W2PA 2NUXA 3D47A 3G6MA 3PJXA 2X2YA 3HG4A 3WDPP 4JTFA 3UCDA 2FGLA 1PZ3A 3OLGA 2P1FA 3LBOA 1D7FA 1CNVA 4AAJA 3E0LA 5D2TA 3OG3A 4OVXA 2DFAA 4JIHA 4MVAA 3WNOA 3TA9A 1RLDA 3ONBA 1R30A 4L1WA 3SY5A 4IQDA 4P7OA 3KRUA 1QPRA 4B4HA 1ZUAX 1LOSA 2PD5A 2F6XA 3M5YA 3FEMA 4F0MA 3LMYA 3UY7A 1YADA 1GW1A 4HYVA 3EXRA 4O15A 4UTIA 3VU2A 4FX6M 2NV2A 3O8AA 1NH6A 5HAOA 4MWAE 4WKFA 1UWSA 2AGTA 5CZKA 3NQDA 1GKQA 3OEXA 4BZYA 1JCJA 2QUVA 3R4IA 4W87A 3IJLA 4ZXLA 3T55A 1OC7A 1YHTA 2HVMA 5EFDA 1ZLPA 3POHA 4RKAA 3BLIA 1AZ2A 4B9ZA 2IKIA 3HTWA 3CL6A 3FKKA 1JDFA 1E43A 4WOQA 2FFCA 5TF0A 2XWEA 2EHHA 2HV5A 3CLWA 1G94A 1ODZA 3GNRA 2FTYA 1JCNA 3UNDA 5HJLA 1DJQA 4IFOA 3ES8A 3QOMA 1XLCA 1FWGC 4Z2IA 3DHPA 3C56A 4PODA 1HIZA 3LDVA 4NNBA 1ZBCA 4ZQCA 1OD8A 4W84A 3TX9A 3P6LA 5CC5A 5FESA 1MFVA 5EB8A 4FIRA 4A3QA 1Q7MA 2ZBTA 2RJGA 4ORIA 1GQIA 4JTUA 1F8MA 1MEHA 3LBMA 3OIXA 3GDLA 3BMXA 3LNMA 1TPB1 4RL3A 4WVXA 5I24A 5JH2A 2DUZA 3CLMA 3EDDA 4DNHA 1E0WA 3B04A 3ZZ1A 2FGZA 4PCFA 1O12A 4QROA 4XBJA 1LBFA 3AUJA 1AL7A 3VXGA 1E3ZA 4YTQA 3W37A 4IMDA 3VC5A 3TNBA 1A80A 1HL2A 3ZO9A 9XIAA 2PS2A 3CUXA 4FNRA 1HJWA 1AQ0A 1YPXA 4HHLA 5CAHA 2BG5A 1XSKA 1WQ5A 4RW5A 1W5QA 2Y62A 4DO6A 2V5CA 3OQEA 2GVGA 2I5GA 1IR1A 2VZVA 1SR9A 4ZO7A 2RDWA 4UUIA 1SO3A 3URAA 3TCEA 3ZM8A 3W81A 4XKYB 4YTSA 1JEZA 1JG9A 4KH2A 1E70M 2EPHA 2OJPA 4JTSA 4BWLC 1YE6A 4PRRA 3W7MA 2C7FA 4CD8A 4N9BA 3AXMA 2VT0A 1GVIA 5JXQA 3N2XA 4XTDA 3PBUA 5FEPA 3DOPA 2OMAA 4HNCA 2XZ7A 5GNZA 2HBXA 4D2JA 1P0KA 1H7PA 3B4UA 3FS2A 1MXDA 1PJ9A 5K9CA 1VZWA 3ATYA 3L5AA 3MVIA 4K68A 2VOTA 1WAWA 4DUXA 3ARXA 3K8LA 1SO6A 1K9TA 4PUJA 3N9KA 3E5PA 2PDJA 3P62A 6REQB 2EXOA 1D3GA 3BWWA 4EACA 2YBUA 3MY9A 1W1A1 2GUBA 1O6IA 4PUEA 4WJXA 5LA1A 1XCWA 2QCHA 1G1YA 4H2HA 3KCJA 9CGTA 3ZS4A 4RDYA 5E0FA 3M07A 4AXNA 5XINA 2C91A 1HP5A 2AL2B 2BS9A 4Q4PA 2QVHA 2Y1HA 5DRIA 4UTKA 3BE7A 3SY8A 2Z7GA 2BHZA 3WL0A 2ZVIA 4PTNA 3G5EA 3I6RA 4IZGA 4ZCWA 3PF3A 5A5WA 5AZ0A 2PC8A 3WJXA 1OEPA 1YMYA 1FFRA 4RDVA 5KZMA 1TZ9A 3U3HA 4AH7A 1UA7A 5CJ5A 3GO2A 3OBEA 3WD3A 2X2GA 5ENLA 1UMYA 2VFDA 2W91A 3IVTA 4BR1A 4DUOA 1M7JA 2POTA 2OZ3A 4MY8A 2V82A 1E0UA 1JVNA 1W2VA 1SR0A 3OGSA 1B3XA 3SQLA 1KCZA 3C5QA 3II1A 2A2IA 2CHNA 2V63A 3NJ3A 2Q8ZA 2VELA 4TOQA 3EDFA 5D05A 5EA9A 2B0MA 1MWOA 2YL6A 2IUZA 1VRDA 5D9PA 5LNRA 3VDGA 3FV9A 4U5IA 4KMQA 3CQJA 2E8ZA 3TTOA 1B57A 1WDQA 2PDBA 4MJ2A 4ZQOA 4FOKA 2OWWA 4E6MA 4MFEA 4GA8A 3EOEA 1SZRA 1KD0A 1Q6CA 1KV5A 4F4RA 4QSHA 2QGYA 2H8XA 3O63A 5AOUA 1H4PA 3R8HA 3AZRA 5L9FA 2O55A 2VX5A 1PXGA 3GR7A 1ADDA 1VC4A 3UZJA 3JS3A 3CQ0A 1OB0A 1IF2A 3EGJA 2VFHA 3B0UX 1MUWA 3WLQA 3CHDA 2DIEA 3B05A 4OE7A 2WXDM 3UQNA 4Z2HA 2PGEA 4IXXA 1DHKA 1OK4A 3CIWA 5F4XA 4RXGA 1I2PA 2WJFA 2DUAA 4XVEA 1ISYA 2V38A 3L4YA 5CSRA 1YTKA 5A8QA 2EGZA 2P3ZA 5ABFA 4LBUA 3I65A 1QPKA 1CB2A 2XYLA 4UQ9A 5D8ZA 1TJ0A 3U7VA 4AZGA 3QSTA 4DWSA 4D6JA 3W7NA 1YQ2A 1CLVA 4P2VA 4C6MA 1W3IA 4AD0A 3SUWA 3VO0A 1UZ1A 3M6YA 2CLLA 2WZEA 1EF3A 3N18A 3OOQA 4C7FA 3UJSA 5EL1A 2FHFA 3EDJA 3GDKA 5CPOA 1FBAA 1EYEA 3AXHA 4L56A 1OFBA 3GR4A 4PUDA 2WSKA 2P0OA 3BLFA 3M0KA 5H8MA 3GBDA 4JDYA 1VRXA 2PDIA 4QRNA 2A1YA 1UBSA 3ZLFA 1J18A 1IGWA 7ODCA 3KM8A 2QLYA 3LN3A 3HFTA 4HNUA 2VFFA 2FMOA 4LEFA 1V0MA 4XO6A 3UF9A 2VD8A 4DLFA 4O1EA 3V4BA 5CPNA 1XPYA 3UR7A 3IUIA 2WYSA 4L9YA 3PSVA 4LGXA 4AB4A 3LQLA 4GINA 1P0DA 4GBDA 2IXVA 2HVOA 3TTSA 4JTQA 1YEYA 5AHNA 3RU8X 3W1LA 3AUOA 3CUJA 5C9UA 1A5BA 1ZENA 1VFSA 4Z1YA 3VKJA 4O1FA 1QFEA 1ZAIA 4XB3A 1F2JA 3CWHA 4O54A 1EPXA 3MTWA 5BRBA 3VYLA 1AW2A 3QY7A 1C9DA 3W82A 3BC9A 2XH4A 5C2GA 2JKAA 3IIPA 1EDTA 4PMRA 4XZMX 1SO5A 1XISA 3UXAA 3ZFHA 2HNEA 2GQ3A 2PDKA 5BU6A 3LS9A 4IP7A 4BI7A 4A8NA 4YNGA 4HYRA 3G1RA 1OYCA 3UZXA 3H22A 1UH4A 4F0HA 2R94A 2YA1A 1LLZA 3FSUA 4XIAA 3NFUA 4WGHA 2ZE3A 3L0KA 1F74A 5BRQA 5CPQA 4QDPA 1FOBA 3P0WA 3NL6A 1XIHA 3W01A 3DC8A 4D6DA 5DQPA 1XV8A 3LRKA 4H9VA 2GYIA 1SJCA 2PDLA 4E8DA 3IVSA 2GQ9A 2UWFA 3GNNA 1TPDA 1D9EA 1R3QA 1CX9A 4TVDA 3N6JA 3G1AA 4IISA 3QR3A 4JNYA 3GAKA 2NX9A 1TV7A 5RUBA 2Z1BA 4IPPA 4ZXOA 4BKNA 3AU6A 1ZAHA 2PF8A 2DW7A 2E3ZA 2V2CA 3TZNA 3AIVA 2ZWYA 1FCUA 3TJXA 3N13A 1K70A 2HS8A 3S8HA 5A6AA 4PTVA 4RUBA 4Q7IA 4DZAA 3ZLHA 2YB4A 4QP0A 1P6BA 2J79A 2Q3RA 1H7OA 4GH1A 4TMCA 1OBAA 1XCFA 1E6QM 3NPVA 1W9UA 5E5CA 1D8CA 2QV5A 3DECA 2ISFA 2PDMA 1GOWA 1FWIC 3NZPA 1EX5A 3NQFA 3DFTA 1WDSA 3EEGA 2A4AA 2ZRZA 3SJNA 2Y85A 1T0OA 1QR7A 3VIPA 3KUMA 1DWFM 1XSJA 4B90A 4HK5A 5I00A 1UZDA 3GNOA 4F8XA 2Y89A 5B80A 3DG7A 3W75A 4NG3A 3OZPA 1TJ2A 5G4HC 4BEUA 4PUUA 5C70A 4DZ5A 1ZJHA 4BJHA 4CU7A 3GIQA 1JPMA 2XN1A 5A69A 2ATSA 1T99A 3QW4B 1M7XA 3LUTA 5F2IA 1OX6A 3QH2A 4O28A 3RX3A 4IFKA 3S6OA 2WMGA 4AWEA 1A47A 4L4OA 3LPPA 3NSNA 5A6BD 1ML1A 5CBBA 3M5XA 1RJPA 3BURA 3WSUA 1Q6DA 1Q4NX 4LWWA 2BX7A 3L5LA 3VD4A 4LUYA 3O9NA 1VPYA 3W87A 3PJUA 4JYEA 1JPDX 3ABRA 4BI6A 3RGTA 3AMDA 3WLIA 1VBJA 4HMNA 3PBGA 1JCTA 3L2MA 5LA0A 2FDMA 3WMBA 5TAOA 1Q8JA 2NX3A 1WZKA 2A3AA 3BSMA 4NAEB 2R6OA 1QNSA 2BBFA 3WH9A 4AD1A 2OLHA 1QJWA 4H6KA 4RZ5A 4BWLA 3EOOA 3VM5A 2YGYA 2D24A 3RLHA 1PTGA 1IHIA 4AZBA 3ARYA 1ME7A 1NWUA 1C7SA 3KHJA 2QR6A 3NDOA 3L5MA 4HHMA 2PD9A 3GB6A 5I3FA 1PPIA 3KZPA 2TPSA 2BGNE 1E4IA 3SEPA 4EVZA 2CC0A 1TPUA 4G1NA 3AYVA 1XDMA 1KTCA 1LTDA 5IDZA 4F9JA 5FF0A 3PTQA 5KZEA 1XIMA 1E9IA 1ONEA 3NL2A 3TC6A 2WWCA 4ILSA 1HKKA 1PDZA 3SRFA 5LIUX 1O60A 5CG0A 4JTCA 4H8HA 4C6LA 2G96A 5GJPA 4HJWA 3T42A 1OVDA 3S83A 1GJWA 1LG2A 4OBTA 3WO8A 1QNRA 3GW3A 5CJMA 3NL3A 3S5NA 1OD0A 4LC6A 1JDAA 4Q8QA 2WPGA 3GXTA 1ADOA 2Z24A 4UR9A 1BWKA 3QJAA 1UP0A 3CV2A 5LKYA 2PLMA 4F3HA 4J3TA 1WKFA 3SUUA 3VABA 2QJNA 3U2EA 4GO8A 2QDGA 2PF0A 2PU1A 4ZQPA 2YZ5A 1V77A 2V69A 4LPCA 3U0HA 1B31A 3NQCA 4QQUA 2EQDA 3AJ7A 5C9ZA 2WHKA 2PGFA 1KQYA 4WRHA 1JUEA 1PZ1A 2XIBA 3MCOA 2J8TA 3S42A 2PTDA 3BV4A 3T07A 4W7VA 2WNQA 5IDIA 1JL8A 3WQ5A 1SZEA 3DKLA 2ZUTA 3CPUA 3UXKA 2XSBA 1Q6RA 5EBUA 3GTHA 1OADA 3AI0A 5I07A 1EC7A 3D3AA 4HYWA 1OGBA 3GHUA 4AMCA 4NU7A 5DN1A 4J3UA 4NKCA 3PBYA 3IJ7A 4C65A 4GY1A 1E1CA 1CT5A 1TE6A 1UUMA 1MNSA 3GX9A 2VVNA 3MYOA 3C61A 4I6VA 3C2YA 1TV3A 1FQ0A 5BRPA 5LXXA 1DORA 3FCPA 4K1WA 1AJ2A 2PAJA 4LS1A 2YFOA 2CU0A 1ZBVA 3G1VA 2VTFA 2XIIA 4DX3A 5CZ0A 3VIOA 1E51A 4R7JA 1E40A 4N9DA 1AZ1A 2VRJA 3HFYA 1X96A 3WY1A 1V51A 1TV4A 5LNUA 3JRKA 2E4TA 2LLEA 3PWGA 3KVKA 3LTPA 4PULA 7XIMA 3G3DA 1F61A 2J27A 4ZOCA 4HMCA 4AX7A 2OCZA 3REQB 4E38A 3IGSA 1ZP4A 3HO8A 1NIUA 2OU4A 4GX9A 2I9UA 5AKQA 1OCJA 5H2ZA 2XH0A 3WBWA 1BYCA 2XH2A 3F4VA 5AHEA 4KS0A 2O56A 3VD9A 4S3JA 3LSBA 3KTXA 8XIAA 2X42A 1XLLA 1A5MC 2HDJA 2VZTA 1ITCA 2CLIA 4OU1A 4S2BA 2J9XA 2Z0IA 1MEWA 3KW3A 4CD5A 1YDVA 4YHEA 3W6YA 1GGOA 2J7DA 4HZMA 1WX0A 1C8QA 3IK4A 4MADA 4XVDA 1XF0A 3VIGA 3LOTA 5M1TA 2PA6A 1V0LA 3DIPA 3PZVA 3PSWA 1DYSA 3STFA 2Y7EA 3WLMA 4GXMA 5HBFA 1J0KA 3MWAA 3EX4A 2ZUNA 2Q3OA 4ZO8A 3LX9A 2FLIA 4CQBA 5AZ1A 1R3YA 1VBUA 3AYTA 1K3UA 3BSHA 3GFXA 4LALA 3OZMA 3GDTA 4MZYA 3S2NA 4L9ZA 2I14A 2PP1A 3KAOA 2CLPA 3RM4A 4DJDD 3LEPA 3W7CA 1QRQA 1NOFA 2WMFA 4AQLA 1QI4A 1JF5A 4W89A 1LRNA 2QDDA 3P8IA 2INEA 1RUSA 3NWRA 4DJFC 2F6KA 4AEFA 4NP7A 1JCYA 4QXIA 3N4FA 1GYNA 4IUGA 4C7DA 3UCCA 3L67A 3L23A 4R53A 5AC7A 1A5UA 2PWFA 1HUVA 4R5EA 2XIQA 3I4KA 1UMLA 1MQRA 1GTHA 1R47A 3W85A 2ZKMX 4ZFMA 3U7BA 1P7TA 3WQ6A 1VEMA 4QNWA 3R89A 3K8KA 4LJ3A 2CWXA 1W1TA 3WD1A 4L1GA 5FAJA 4AZCB 4IFRA 5XIMA 2D23A 2GLKA 3K1GA 4MPKA 3ZQ9A 1MW1A 3BAJA 1S46A 2VL4A 3M0VA 2J9YA 4JIEA 3ZJ8A 3NQEA 1SW3A 3VOHA 1TQXA 1IGSA 5CQ1A 3FFSA 2CFFA 1UWAA 3LNPA 2J7CA 2B7PA 3MO4A 3L4VA 1DWJM 1EZ2A 2IKGA 4P8UA 3ITOA 1V7YA 5CEWA 1NWSA 4GNJA 5A95A 1A53A 1DJYA 4PR4A 3M46A 1T6MA 1Q4WA 2E5CA 2XISA 2ZICA 3UYCA 2PDCA 4IIHA 4JN7A 4XUGA 3H2FA 1JDEA 1Q2SA 1SVDA 3TV8A 1OINA 1PSCA 1N8WA 4DBWA 4Q8TA 4NX5A 3OHIA 4GYKA 2VFGA 3V3WA 4E4PA 2P50A 1LUCA 3WNPA 3B8UA 4WK9A 1V4YA 4HPNA 1KRAC 3ARUA 1QI0A 3CV7A 1GK8A 2CBIA 3E12A 1ZRQA 3DFPA 3RUBL 3WUGA 1Q66A 1UPMB 3EWYA 2BSLA 2I5IA 2E09A 5E6ZA 4CVWA 3MHUA 4F0RA 3ONCA 3BMVA 4JS3A 3B8WA 1Q2RA 4NASA 3RR1A 4IOTA 4LF2A 4NZCA 3P80A 4RK8A 3ITGA 4AD4A 1FCQA 3KBMA 2G3JA 4AD3A 1M7PA 3SRHA 4F2UA 3PG8A 1ZSXA 4NAFB 3EZ4A 4W7WA 3SSZA 2AOSA 3IJ6A 3VI2A 1EC9A 3GG0A 7REQA 4EPBC 1OFOA 5JIPA 2J78A 4G8TA 2BGQA 4P61A 2NUWA 1R2RA 1V02E 1JZ8A 4JTGA 4S39A 5M03A 4H8NA 3G1SA 3N9RA 3LYEA 1M7OA 3PNZA 4C6IA 3UCQA 5D4YA 1OK6A 4EPEC 1HG3A 4GVHA 1K8ZA 2EBNA 4JFTA 4RV8A 1WE5A 4ZQMA 2PP0A 2OB3A 1QPOA 4K2SA 4GYFA 1YYAA 3R58A 2OX1A 3F4DA 1LM1A 2QPSA 3N6HA 3AMLA 4MKVA 3UJ2A 5AC8A 2DVUA 4N9EA 5HWNA 2WMJA 1CGVA 2YLAA 4NZ1A 3OQ8A 2ZZ5A 4H8VA 4C6KA 2FKPA 1XP3A 3VX0A 4BI5A 4O4WA 5BZAA 3ITYA 1UZ4A 3O1NA 4IQEA 5M17A 3PZ9A 3M6DA 3LXCA 3HPFA 1TG7A 3GR8A 3VNLA 2NLIA 1A5KC 1ELSA 5J5DA 1XL9A 3EDEA 3VGGA 1FWRA 3SAZA 5A2CA 2MANA 1TCDA 4FNSA 3WDRA 2XVLA 5EKYA 1PB0A 1GVEA 3TTYA 1RZMA 1XBXA 3AZSA 4WDUA 2REQB 3EWCA 1RBOB 1AK5A 3LM3A 2PDYA 5DCBA 3PP7A 1ZCCA 1WBJA 1VCFA 3E9AA 2O7SA 1OIFA 3QV7A 1NELA 4LYRA 1XSIA 3POCA 1IXOA 1TYGA 4BEQA 3BAIA 4OZOA 1XXXA 2E0PA 4O14A 3M7SA 4LBRA 4X3ZA 3GDRA 4QEHA 2Y61A 4JZ5A 1LWJA 1VQTA 4WJ8A 3PJWA 3NQMA 5FA5A 2WMKA 4N4PA 3QYSA 1U5VA 4O0QA 1L0PA 2CPUA 4DQWA 2V5KA 4MJ4A 2R8WA 1U5HA 3SCQA 2H9AA 5H6HA 2TRSA 1UR9A 4D6GA 3GE7A 8A3HA 3S2MA 1RD5A 4HD5A 4H2CA 1UD2A 1QCWA 2EJAA 1A4MA 4UOQA 4PMOA 4EK7A 1KM5A 2FVMA 1EX1A 3CL8A 1DWAM 1Q6EA 4UZSA 3A24A 3HGOA 1RR2A 2CHRA 2RH9A 5DRCA 1MSSA 4G7EB 1C9WA 3KP0A 3Q2DA 1UR8A 1WA3A 2FJKA 2PDUA 2PPGA 4REQB 2QJMA 4WSKA 1DJIA 1XPGA 2GDQA 4LU0A 5HPCA 4W88A 2ZZ4A 1AJZA 3NOEA 4ZOAA 3G8EA 3LGGA 5HUPA 4UXDA 1OFEA 4TIMA 3KTCA 2BY2A 4YWIA 1P1MA 4QHRA 1L6SA 4IIFA 3D3FA 2JF6A 3C3NA 3W7JA 1H60A 1EUAA 3PZNA 2BTMA 2FPYA 3QYQA 1LJYA 2GWNA 4GOAA 1UOKA 1TIWA 4N6FA 1DIDA 3NEHA 3PAJA 4LFYA 2Q01A 4Z42C 3PBWA 1X6NA 4PMUA 3RAOA 5BYWA 2OOGA 3ZYZA 3AIEA 4B5SA 1H11A 3WDIA 5CC7A 2YDSA 1VCVA 2ADAA 1HX0A 1O5QA 1KCKA 1W31A 3UESA 3BZJA 1O1HA 1ITXA 3TR2A 4JTTA 4WY0B 2V5BA 2GL5A 3ZT6A 2ONEA 1BAGA 1EGVA 2WKJA 3VOIA 3LGDA 1BQCA 4AZ7A 4EF9A 4JFWA 1YTDA 4B5WA 2EPMX 4U5KA 2AAAA 1GCYA 4DBDA 5HMEA 2RFGA 3CUHA 4CCCA 4ROQA 4A2RA 1JUKA 3ITCA 3R12A 4B4FA 4DWSD 1UB3A 4NRSA 4DAIA 2C16A 3M0HA 1F4AA 4XISA 4MNKA 2AKMA 1E6NA 4PB3A 4GY0A 4Q8VA 1R87A 3OO2A 4F2TA 3NGJA 3OU8A 2BVYA 3MP3A 3KEHA 3ITVA 3SB0A 3CPRA 3AIUA 1AMKA 3FYPA 4AHPA 3W72A 2ZUVA 1LDCA 3P5YA 1V6VA 4PH6A 4X60A 2D0HA 3GXMA 4LTSA 4L4PA 1L2UA 3M0LA 1Y0EA 1TWZA 1CXFA 4WLCA 3M0ZA 4LSBA 1ICQA 3UVIA 4YS1A 2XFRA 1KFCA 2GGEA 4RPPA 3HPXA 1UC5A 1FDZA 3BLEA 4JTRA 3SCUA 3UWVA 3WD4A 1KTNA 4RZBA 3N73A 1JUBA 3UJEA 3KLKA 5FOOA 3CEUA 1IIHA 3LHVA 2Y6ZA 2FZNA 3BOFA 2HPIA 3HG3A 4DBSA 2PRLA 3WD0A 3TYUA 4DBEA 4UTHA 1AFSA 5CPSA 1PZ2A 2FFIA 3PZIA 4QJ5B 1V5XA 4A05A 4GMEA 2VR4A 4D72A 3SJ3A 3QEZA 2DIKA 1REQB 3VKAA 1VFLA 1H41A 5AHIA 2GDVA 5KEZA 1BF6A 3GVWA 3HPSA 5FJUA 4KWSA 1PO9A 1D2KA 3RDKA 1I0DA 3LLFA 3CT2A 2BVTA 4GFSA 1A3XA 2E9LA 1ISWA 4QCEA 2R14A 5HK4A 3KOFA 2WZIA 3G1HA 3MJYA 1CGTA 1LG1A 4L9XA 4KCTA 3CQKA 4JIIX 2DU2A 3EB2A 4O8AA 1L9WA 3LV5A 3OBAA 4H6EA 3DAQA 1MQPA 1GW9A 3NUKA 4EOUA 3R8GA 3RMEA 4E2DA 3M0YA 4A29A 4EF8A 3QQ1A 1JPIA 4J28A 3WUBA 2G3IA 5HR7A 1MZRA 1OFQA 4IIGA 1AJ0A 1WOBA 2X1SA 3OZYA 4J9JA 1QK2A 2PBGA 3TJIA 1WCGA 4XO7A 3IGHX 4DY1A 4XD3A 2UBPC 2PDPA 3AMGA 4HJFA 1EKOA 2VX6A 3VGDA 2DZUA 4BY3A 1UA3A 3U2ZA 4UR7A 4E0CA 3WNNA 5D09A 3N1AA 1MI3A 2X0SA 3GXPA 1HXJA 4MWAA 1I4NA 4GC3A 4C6OA 1VB9A 3MCNA 1TPFA 4H4IA 1FP9A 2XUCA 3WX7A 4KCWA 3TN6A 4JFUA 3TYBA 1VHNA 6PTDA 4OFCA 5C2CA 3HJZA 1OG0A 4LRSA 2HE8A 1EOKA 1DWHM 2FVKA 1F9CA 1XQLA 2NXIA 5HULA 1MMFA 3GWQA 3WMSA 4LQ1A 1C8YA 4MZ8A 1YNQA 1VH7A 4GABA 3HB9A 4NIRA 4UQCA 1IXQA 2OKTA 4XAZA 1UR2A 4JIQA 2QEZA 3WLKX 1CECA 3QV8A 5CCZA 4TTGA 3C0JA 2ZX7A 1RHCA 1EOMA 3DERA 1EBHA 3QBUA 3W1NA 3W1XA 3VCNA 1TSIA 3QGVA 3E49A 4CD6A 4HNNA 3RXZA 4PUWA 4KEZA 5MKGB 4A3RA 4UQEA 4M5PA 3MZ2A 2I57A 4XIMA 3LCHA 2TODA 4K3ZA 2YB1A 2VD9A 5LXEA 4R7OA 1YBQA 4Q4RA 4Y6GA 4UCFA 2E1WA 1W9XA 4GQ0A 5I79A 5E0KA 4HPXA 4E2VA 2R1MA 1NARA 1QNQA 3VDCA 1Q6GA 3ME3A 3LHUA 3WLPA 2WBGA 1SYTA 3BLLA 4NZJA 3SRDA 5K4XA 2ISVA 4GYPC 3RLUA 4JIPA 4XK2A 3ZSSA 3RJXA 2E6YA 1HVQA 4NRRA 4GQBA 1L6GA 1BF2A 1U5JA 3G8RA 3BO9A 5A8OA 3WK0A 1IXPA 1JZ3A 4LVFA 3EWBX 3RRAA 1WNOA 5IBXC 3TEVA 1XGEA 4H8UA 4X9YA 3LQGA 4YU1A 4XG1A 4Q7NA 4XWUA 3PPFA 2FH8A 2G97A 4B5VA 3GBEA 3WLRA 3WK2A 3IIXA 4JTIA 4O1AA 3ARPA 3NM3A 1IEWA 3C8FA 3L4UA 1GVRA 3FJ6A 3W7QA 2VEFA 4J3SA 2J7EA 1Z41A 2ZRVA 3ABQA 3BQ6A 4GPNA 3ZLGA 3FDGA 3N25A 3TMQA 3VINA 2JEPA 1XIEA 1IYXA 2C14A 3M43A 4MOZA 4UB9A 3U5YA 3OJGA 1XKJA 4Y9AA 4UNKA 4F40A 2D73A 4MLRA 2PP3A 3BJSA 3H7RA 4OHQA 3RLVA 4L80A 3CZJA 3VMOA 5BU9A 1NQ6A 1UD5A 1M68A 3NO3A 3T9PA 3VM7A 2QJGA 1SJDA 4XSMA 1P6WA 3BG3A 2PWEA 3W22A 2VEMA 1DL3A 1E5JA 3KDNA 4IPLA 3Q67A 2Q09A 3GYCA 2P76A 3PPCA 3CS2A 1FKXA 3UXIA 1NJJA 3DG3A 4ZE5A 3HN3A 1TFVA 5DMNA 5AC6A 1XBVA 1H7RA 2YBTA 4Q33A 4UTUA 3T8LA 2J24A 5BOFA 2W92A 5I78A 1P5BA 1IV8A 2NSOA 3VFLA 3EX1A 1XYLA 4MGGA 1Y5XA 1B4KA 2QXWA 5CBJA 4LB3A 3CXOA 3B8VA 1ZBWA 3QPYA 4ZB2A 4TXEA 3CUFA 4US5A 1CENA 4CCZA 3AXXA 3W07A 3UNTA 4FNTA 3B8TA 1EL3A 4AC1X 3ITTA 2Z6IA 3FVDA 2NQHA 3S1XA 5DMMA 3PZTA 4L1XA 3TQ0A 2E5BA 1X98A 4RR4A 1LBMA 3WENA 3VZYA 5BOOA 1MRAA 3O0FA 4E3TA 4UFMA 4GJIA 2Y7FA 5FKYA 5DT5A 4JTJA 1R3WA 2PGRA 5FCZA 1TJRA 2BY3A 1UKOA 4BK9A 5D2VA 1HJUA 1TKKA 3HG2A 1OZQA 2IPGA 4GVIA 1CGUA 1AQMA 3F4CA 3CAKA 1ALDA 1J6OA 3MV11 3D0CA 3CL7A 2XINA 4RJEA 1V3KA 1KM0A 1PAMA 2ACSA 5FJJA 1I75A 2DZWA 4R9XA 3EKZA 2QVNA 3VA8A 4JHOA 1IEVA 3Q94A 3ICJA 1LL4A 1C90A 3THAA 3OB8A 3W38A 1IWBA 4AUBA 1QVBA 3TYCA 3KOZA 1OF8A 3CPGA 1OX4A 3CHEA 1OX5A 2UY4A 4DAFA 5M5DA 2ATMA 2ZUMA 3EXSA 4V33A 1DBTA 3I7RA 3IJDA 3THCA 4XAFA 3UZ5A 1O5XA 2P8BA 3SSJA 3C8NA 5G2IA 3EA1A 4I9AA 5KINA 1V3LA 5D2WA 1UH3A 2OODA 1EBGA 3W53A 1W1PA 3H21A 4CVUA 2E40A 2AL1A 5EU9A 1DXFA 4BQ5A 1H1NA 4MFDA 3KRZA 3VNMA 1GZGA 1W3LA 3FVMA 4TR9A 1JJKA 5GNXA 4LAZA 2WANA 1SGJA 3ABXA 3MMWA 6ENLA 1Q5MA 3L4TA 4NVTA 4OBRA 2NVCA 5DCDA 1H5YA 3U5UA 3R11A 4QS6A 2VP8A 4FZIA 3NYZA 1W1YA 5KSWA 1YPIA 1V08A 1RY0A 3M41A 2XSXA 1DE6A 2NLYA 3CT7A 4FS9A 4MB4A 4K8HA 2JGYA 2CLEA 3VIHA 4HSHA 4MF4A 4K37A 2HXUA 3HGRA 1O68A 1VPXA 4BFAA 4JTHA 3H12A 4U3CA 1JULA 1H50A 1T5AA 3LLXA 3FKRA 1UUOA 1TVLA 1KLYA 1M3UA 2YL5A 3PAOA 1U1UA 1SPQA 3C2VA 3UG8A 1POKA 2H3BA 3R13A 4GI6A 3W1QA 3B8SA 3SADA 4X9SA 3FNDA 1EQPA 3DKJA 5AYIA 4UTTC 4AXKA 3W76A 3WQ8A 3BAXA 1XD1A 3G18A 4FIQA 3GZ3A 3PB2A 5F2LA 3THUA 1UR4A 4Y8FA 4JKKA 4JY8A 5BW6A 3WNLA 4AEEA 3W23A 2FDSA 3WK3A 1S5TA 1EIXA 1WOAA 5I3DA 2DSVA 2DQXA 3SGUA 3VAVA 1GONA 1BLIA 2XZ9A 3CTLA 1OC5A 3NQAA 4PL2A 3ANVA 3UD6A 4JEJA 2X0YA 3WQDA 3FX4A 3THQA 4JIRA 2IQTA 3V0TA 1DJNA 3MC5A 1ZQ5A 1NWTA 4IICA 3TFXA 4LX4A 2YA2A 2VC6A 4M24A 4GBUA 2C13A 3H4XA 2DIJA 1ZJAA 2X41A 3L0NA 3SBFA 3NQGA 4HPGA 4O0ZA 4URIA 3PUEA 3CB3A 4AD5A 1L6YA 3D46A 4HMEA 4HZ8A 2P8CA 4AY1A 1D8WA 5D04C 2QUTA 3ENLA 1BVNP 4FX7A 4DO4A 1H7NA 4GXWA 1Q6QA 1X7FA 1ONWA 4C7GA 3TW7A 4ES4A 1H7XA 2EPKX 3W9ZA 2X16A 4GO9A 5EMYA 4O11A 4GUHA 2JE8A 1BWVA 1SZGA 2EJ1A 3USZA 3IWPA 4X22A 2VX4A 2PURA 4JDBA 3NVDA 1TELA 4O53A 3JZEA 2NXHA 1LT8A 3IANA 4RV3A 2XVKA 3PFMA 4D8LA 3WJWA 2IXUA 2OSWA 4H6RA 3WDJA 3NIYA 4B5NA 2WQDA 1QBBA 1KRBC 4GJJA 5BNKA 5TBOA 2R1NA 3O2LA 5BMWA 4UFHA 1NWRA 1AQFA 2P53A 3EWZA 1JQXA 2W6RA 1ZY9A 3N11A 5LHEA 3PWAA 2VRQA 4YJ5A 5FEZA 4RW3A 3GZAA 1TZZA 3UETA 3TJLA 3LCLA 3KBSA 1XH2A 4I5XA 5I23A 4HB7A 2XG9A 4ZOBA 4PBEA 2CZEA 1UQYA 1GWJA 1TX2A 1JZ6A 4OWGA 1VFTA 1ZL1A 7CGTA 2JIWA 2QUNA 1KRMA 3HA1A 2OQYA 3QY8A 3GXIA 5DXYA 3B97A 2QCMA 3NPUA 1E1EA 3ATZA 2WVSA 2OZ8A 4GISA 5E93A 3PTDA 3NDYA 1TTQA 4FLQA 3DCPA 3GKFA 2W66A 3NPWA 1NM9A 2DJXA 3WQCA 5C0QA 1MDRA 3BPWA 1E0XA 3XIMA 1AW5A 1EP1A 3B3DA 5D9NA 5T91A 5I5RA 4BQ3A 3KDOA 1O5RA 3MPGA 2PZ0A 1TA3A 5JH1A 4O1DA 2CESA 4GYPA 5C5YA 4PRWA 3LB0A 3OPSA 5E09A 1DVJA 3PUOA 2BY0A 2ZC8A 2YDRA 1YBQB 1XYCA 2QMJA 3BMWA 1A49A 1S2UA 1VPQA 2P10A 1M04A 3OTRA 1H2JA 3QKZA 3R2GA 2G95A 1TO3A 1HJXA 5A3HA 2OGYA 3BDKA 1S1PA 1T96A 3TKFA 2A7RA 5FEXA 2J13A 4AWUA 2POZA 2V68A 3UG5A 5E9XA 3VE9A 3GAYA 4MIMA 4AW7A 4AHOA 1N82A 3AXIA 5I3GA 4IUOA 4ONVA 1PKMA 3LENA 3QXBA 3CO4A 5GVJA 3F5KA 4GUIA 3U57A 4PB4A 1R9XA 3TMLA 1YXDA 2NVAA 4DM2A 2P88A 2BOFX 3NZ1A 3G1FA 3S47A 1O5KA 3MMDA 1WUEA 2A6LA 3UU0A 2JBMA 3RU6A 2PC4A 4HPJA 1PWLA 5U4NA 3FY1A 4YVVA 1WDWA 3I6TA 1J96A 3A4WA 4JFSA 1CXKA 1FWEC 4W86A 4S3CA 2PSNA 2J25A 1HKIA 4F9DA 2QJIA 3B9AA 3CO8A 2WMHA 1JZ5A 4HKPA 4IMGA 1JRBA 1AD4A 1XD0A 3TXVA 5HWJA 3L7RA 4GHRA 3AISA 3UERA 4P5UA 4HNOA 4LEQA 5D8WA 1KV8A 1ZAJA 5REQA 4C1NA 1EXBA 4B3ZA 4GK8A 3GU1A 1KM4A 1EJUC 3NZGA 3S2LA 2WVVB 4Q4KA 3E1F1 4AF0A 1VCGA 3O6CA 4M81A 1H1YA 4EANA 2OVLA 3VD5A 4OOZA 1N2VA 2VC9A 4JAWA 4C1LA 1KM2A 4RX0A 1C93A 3CK5A 2ZOXA 2J7FA 3R1ZA 2DSUA 3VNZA 4S2CA 3INPA 1XQKA 4L4MA 1E6XM 3LY0A 1JDDA 4N7QA 5MHBA 3CZKA 3BOXA 2ZTKA 3RM9A 1Q6OA 1TRIA 1B5TA 1QHOA 3GH7A 1EO5A 1C8VA 1ZPTA 1XINA 1WKEA 3K30A 3QY6A 5TD4A 1ISZA 2F38A 3MZNA 3O3RA 4I7VA 2RDUA 3DI1A 1SUXA 3ARSA 4WJEA