3RMJA

Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
307
Chain Sequence
TNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDFEAVNAIAKTITKSTVCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIHMEYKLKMKPKQVIEAAVKAVKIAREYTDDVEFSCEDALRSEIDFLAEICGAVIEAGATTINIPDTVGYSIPYKTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQVECTVNGLGERAGNASVEEIVMALKVRHDLFGLETGIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSETYEIMSAESVGWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Removal of the C-terminal regulatory domain of alpha-isopropylmalate synthase disrupts functional substrate binding
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords 2-isopropylmalate synthase
total genus 128
structure length 307
sequence length 321
chains with identical sequence B
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rmjA00
1I8JA 5AHEA 1XBZA 4IGHA 2QCCA 4E38A 1H63A 4UCGA 1M6JA 1KTCA 2TMDA 4LV9A 3W2MA 1W5PA 2X1TA 1W0MA 3C0JA 4MY1A 3R12A 3IIZA 1TREA 1NEYA 4A3UA 4RX0A 2QCHA 4M6VA 3PG8A 4JTKA 4Z0JA 3UXAA 4FXRA 4IXHA 4LU0A 1LCOA 4BR1A 1LORA 1SFJA 1Y0EA 2JK2A 2H8ZA 1Q6QA 4MLJA 3UWQA 1TV7A 2R14A 3T40A 3MBFA 5LZLA 4Y90A 3S5NA 4RKAA 3W7CA 4LVGA 3NZ1A 2RFGA 5IBXC 2PRHA 2C3ZA 3W7LA 1FWRA 4Y9AA 3TC7A 5CPMA 3QF0A 1R2TA 3KAOA 3TMLA 1PHWA 3T55A 4IX0A 4K39A 3WK1A 2Z1BA 5A8GA 1LBLA 4U4MA 2J9ZA 4BWLA 4FNUA 1HO1A 2YZRA 1W3IA 5J5DA 4FIRA 4MYAA 2EAWA 5F4SA 1P4CA 1SZGA 3L65A 1DJQA 4RXFA 1ZAIA 3BLIA 1GVOA 3CB8A 2V82A 1TV5A 5FF0A 1W54A 2QUUA 3G1SA 1MO0A 3G3MA 5HUPA 3MYPA 4AVFA 5DN1A 2CLOA 4JN6A 3LHWA 4JEQA 3DHFA 3LI1A 3RMJA 4PA8A 4A29A 4CQ8A 3W7KA 1L6WA 1H61A 2ZRXA 1TQXA 5G2HA 3GXTA 3O6CA 3JR2A 4ZZ9A 5TQLA 1QOQA 5EMUA 3HG4A 3MHGA 3TKFA 1O5XA 2NX9A 4LS1A 1IXNA 4LW7A 4UFKA 1KLYA 4JTIA 1H7RA 4GE8A 1ZFJA 3PB0A 1IIGA 2QDGA 4LC6A 3PBWA 1JCJA 1Z48A 1F5ZA 3NO5A 4RZ6A 1YXDA 2G96A 4GNJA 4R33A 3LM7A 2DZVA 3BW4A 2DZXA 5C5YA 3W23A 3G18A 2RHGA 1OABA 4OU1A 4NVTA 1GG1A 3CTLA 3G1HA 4FIQA 3GR7A 4IMDA 1T0OA 4WZHA 4N6FA 5FEPA 4E2BA 4UTWA 5LNWA 3HIJA 4LWWA 3GKAA 1CI1A 4CQAA 1DORA 3TAKA 2C13A 3B03A 4JX6A 1LROA 3S0CA 3RLVA 1U5JA 1WBHA 4Z0SA 4AF0B 4PFMA 2X1SA 3O6YX 3QSTA 5CKSA 3KVMA 1DV7A 1X7FA 3G24A 4ZVJA 1G4PA 3P5ZA 1DQWA 2NV1A 4AWTA 1FWNA 2H3DA 2V9DA 5KITA 1N8FA 2A6NA 2GQ8A 2CLHA 4JTEA 1AW5A 1HL2A 2C0AA 3GR8A 2FJKA 1F74A 1SZNA 2Y61A 2RDUA 4OT7A 1FCVA 1FDJA 3GDRA 2CZEA 2GPTA 5KZDA 2NXGA 1KTBA 1K02A 2Q3OA 1F05A 3OG3A 1LRNA 5BRBA 3C52A 3S1WA 1IXPA 3CEPA 4O52A 2E77A 3BV4A 3NXFA 1YDOA 4K8HA 3F4NA 1A5AA 1F7BA 5G4WA 3LXBA 1TPC1 3FKKA 1W56A 2FB2A 2A7PA 1BWLA 3B0VC 1GZGA 2X1RA 3MJYA 4WUIA 1R47A 5HUOA 3I7QA 3E02A 5KINA 5MHBA 3N9SA 4O15A 4GWEA 5LKYA 3O06A 1J4EA 3S42A 3W1XA 5LSMA 1K8YA 3NZRA 3P81A 4B5NA 4JTHA 4IWWA 5C2XA 3DFOA 4DPPA 4IMGA 5E0KA 3W07A 3P8IA 3O16A 5LNUA 2W6RA 4O0KA 2BTMA 2R91A 1GT8A 4X9SA 3MP3A 4CLMA 4PTNA 5AYZA 2J88A 4AHPA 4RV8A 5FEZA 5D03A 4Q32A 3B0UX 2XN0A 1TPVA 4FNPA 3LX9A 3PR2A 1W8SA 2A1YA 2QCGA 3TMQA 5H91A 3NQGA 2R94A 4O19A 4RZ5A 2ISSA 3KRUA 3LXCA 5D33A 3IIOA 2F7FA 2V2DA 5AC6A 5CG7A 4XWUA 4JX4A 5K3VA 2I14A 4FX8A 1G7UA 1FCUA 2BZNA 1GJPA 3G22A 5CPLA 1YPIA 4N9BA 1B4KA 4QSHA 2QCFA 3L5AA 2PC4A 2YYUA 4JIPA 2AAMA 3W9ZA 2NX1A 4HPJA 3GVGA 5G1YA 1GVSA 3CM4A 3HBLA 4HPXA 3E49A 3THQA 3PBUA 3ELFA 1VGAA 1WYIA 3PBVA 2R8WA 3NEVA 4QAIA 4N9CA 3TSMA 1V7YA 3P80A 2I1OA 2RDTA 3IGUA 3BLFA 1JQXA 3KFTA 4EF9A 1ZALA 3S5OA 1OK6A 3H55A 4UTMA 1L6YA 4IPJA 1X6UA 4K36A 1WA3A 3K30A 2WSYA 3LCWA 4PCFA 5F2LA 3TA6A 1WQ5A 2NWRA 2PURA 2ZZ6A 5AHFA 4UTWC 4WXYA 1XC4A 3NQCA 1UUOA 1OFPA 3QSRA 2ZTKA 5FESA 2BX7A 3DKLA 1CW2A 4Z1CA 2NLIA 3SFKA 3CLMA 3QPZA 1XFBA 3G8EA 3BG5A 4ALDA 2GJLA 4KFNA 4NNAA 1YPFA 3GDLA 3WJWA 3PUDA 5D37A 4O1DA 4O53A 4UMAA 1PE1A 1KM4A 2FPYA 4FB7A 4O10A 3TK7A 3W75A 1H5YA 4NJKA 1G4SA 2Y89A 2Y70A 4WD0A 2YFOA 1BKSA 2EPHA 1FBAA 3KVKA 3LB0A 1G67A 4UIOA 1Q45A 5LNSA 3DXIA 3E0IA 1JCNA 1FDZA 3CT7A 3AO0A 4JDYA 3L66A 1EB3A 1OVDA 3FJLA 4DF1A 1NSJA 1TJPA 3IIPA 4XQ6A 4O57A 2ISVA 4G1KA 4KKXA 2W0UA 4CQ9A 1GYNA 2ZA2A 5SWUA 4EWND 1D9EA 1G7VA 3CEUA 4LT9A 2ZDRA 3TV8A 1TQJA 4BI7A 1RV8A 2A7NA 1H50A 3EXSA 2FQIA 1H1YA 4XBSA 1L6SA 3EWBX 3KOFA 2F84A 2ZFAA 1NF0A 1H7PA 1LZOA 5J5RA 4IPIA 1E51A 1IF2A 3PSVA 2DZUA 2QUVA 3W74A 1RR2A 1OX5A 1VYSX 3DAQA 3HGSA 3PVFA 1VJIA 1B57A 1GVRA 3STFA 1OFOA 3FYOA 4BI5A 4FNQA 3SIZA 3TQ0A 4O8RA 3M44A 4U28A 3W7EA 3P74A 4JY8A 4WOZA 4MUZA 3BLEA 3EX6A 3UWYA 4OBTA 3C2OA 3MW7A 1FDYA 1VCGA 3R89A 4LVDA 2ZA3A 4UR7A 1T99A 1X1OA 3EKZA 5F1VA 2BSLA 3EB2A 4UNLA 3M0ZA 1I2NA 2WSQA 2ZA1A 4PEKA 1XXXA 1TPDA 3GXNA 3UY7A 1A5BA 3SY5A 3DH7A 4DBEA 4LC8A 1OX4A 1LTDA 2NV2A 3BGJA 3IGSA 1P0NA 3DBPA 4UFMA 3NYZA 2XN2A 1GTHA 5EKYA 3HJZA 3M1ZA 4JY9A 4MJMA 2DJLA 1DJNA 1KFJA 1KM5A 2YDAA 3NL2A 5EBUA 2QCDA 3M47A 2RKXA 1EA0A 3GX9A 1WX0A 1Z41A 2CLMA 3ZR4A 2P10A 2ISWA 3FYPA 2C18A 4GUFA 1WAUA 1PCKA 3N9RA 4DF0A 3N19B 1GQNA 2ZRWA 5DCDA 3C2FA 3U6WA 5AN7A 1KM2A 3O8AA 4N9DA 4EIVA 4N4PA 4HNNA 3W1RA 3O63A 2A5HA 1U83A 4HNTA 3CC1A 1AW1A 3M5VA 1PIIA 3THAA 2KZHA 4PL1A 4UTJA 5DELA 3IVSA 1MSSA 1LLZA 1S5WA 4NJHA 4UTUA 3UNDA 1OFDA 1VZWA 3IEBA 4MOZA 3JS3A 3NPUA 3LHYA 1KFCA 3R8RA 5EA9A 1DOSA 4DPQA 3W7QA 4OGZA 1QFEA 1O94A 4QISA 1TTPA 3SGUA 1LBFA 2D73A 5DXXA 2FLIA 3HGRA 1ICQA 4IMFA 3DHDA 3B06A 2JGQA 3QW4B 4M6PA 1TB3A 4E0CA 2TYSA 4Z1AA 1OYAA 1EUAA 4QJ1A 5AFDA 5HINA 1XBVA 4X3ZA 3M16A 4XBKA 3BGGA 1B9BA 3TX9A 2X1UA 1KBIA 3C2RA 2WKJA 3LTSA 3CIWA 4IMEA 3DU0A 5F2GA 4DO4A 5U7SA 2WJZA 4O18A 1KFKA 3U8GA 3C56A 3C2VA 4QIUA 2QAFA 5KMYA 2EKCA 2OZ0A 4JS3A 4PL2A 2DJXA 1H51A 1NFBA 3TFCA 1XL9A 4NNCA 3KXQA 3HPZA 3G1DA 2GQ9A 5F1UA 2DORA 3A23A 3ZWSA 3LHTA 2XN1A 4AXKA 5DY2A 4FX7A 4FX6M 1O95A 2PE4A 3C6CA 4O0ZA 2DZTA 4O50A 1GYLA 1RQBA 3GKFA 1TPFA 2QJGA 5CGQA 3FLUA 1B3OA 2V0TA 4TR9A 3M7WA 5DXYA 5AHNA 4L4LA 3VE7A 1KW1A 3L21A 4LVBA 4RK8A 4BF9A 1ALDA 4TMCA 3TFXA 3W1MA 2DZPA 5D05A 4NX5A 5EPDA 1EP3A 3TQKA 3FA5A 4MIMA 1SU5A 2HTMA 2Y63A 5HWMA 1KBJA 3EWUA 2GOUA 2VFFA 3M5YA 4CNOA 2C16A 4ZQMA 1QAPA 3W7GA 1XDMA 5C54A 4N4QA 3TROA 3MHUA 5HWJA 3SI9A 1I2QA 4XKYA 1H7OA 1QWGA 5AYXA 3MO7A 1P5BA 3HQ1A 4N02A 1FUYA 5CPNA 1H7WA 5LHFA 1WXJA 2G97A 1YTKA 5DCBA 1AMKA 5HQEA 1N7KA 3CIXA 2E6DA 5AC8A 1KV8A 2CLFA 3LRMA 2PRMA 2FTPA 3QEZA 1EEPA 3BARA 1H7XA 4JYDA 2PRLA 3KVLA 1JCMP 3W7PA 2VFHA 3IRDA 3Q2DA 1YTDA 3L2IA 2B7OA 3I7SA 2WO5A 4HNVA 4WJEA 4PH6A 5EL1A 3WJXA 5HULA 3WFAA 2Y7GA 5D32A 2V5LA 4JXCA 2A85A 3BG3A 2V5BA 3B04A 4YMZA 3QM3A 1RQHA 4R53A 5CSRA 3TNOA 2A7RA 1QPQA 2EF9A 2E5CA 1TPWA 1VHCA 3W1TA 1VLWA 3GB6A 3OVPA 1ZENA 3G0SA 3B8DA 1MZHA 3QMSA 3N34A 1CX9A 1SW3A 4ADTA 3EX2A 1QPRA 2H3BA 2BLEA 1B4EA 4RZ4A 3PWAA 3PULA 4FF7A 2I9EA 3GK0A 1NF7A 1JCLA 4NXKA 4O17A 3USBA 4AWUA 2H6RA 1XCFA 3W84A 5G5IA 1HTIA 1ICPA 1K3UA 1LLWA 3MP5A 3OIXA 3C4UA 4N6EA 5D30A 2A6LA 4AHQA 1Q6RA 3UWVA 5K4XA 1OHLA 2ZRZA 3I6RA 1X1ZA 4JTSA 4GJ1A 1S5TA 4LS0A 2WNNA 3EWYA 2CLLA 3DI0A 5HJLA 3W87A 3WK3A 1AL8A 1G4EA 5AHIA 4NX0A 3DENA 1XUZA 3LHVA 4WXZA 3G1VA 3RLUA 2DU2A 4HNUA 1ADOA 2LLEA 1W5NA 1TTQA 2Z6JA 3W22A 4BI6A 3SSJA 1A5SA 2C15A 3FJ6A 1W3TA 1JR1A 4ZQCA 3QFEA 1YXCA 1RD5A 3TJLA 4XKYB 4UTLA 1I2OA 5I3JA 4EVZA 2RH9A 1Z42A 3T78A 1P1XA 5LGXA 3L5MA 4KWWA 5GVJA 2VC6A 3S1XA 1SR9A 3UZ5A 4NQ1A 1YYAA 4W9TA 3P7YA 3SZ8A 2Q8ZA 1R2SA 3PUEA 1QPNA 2QKFA 1H7NA 1SO5A 4DO5A 5L9FA 4TMBA 3CHVA 5F2MA 4H3DA 4A21A 1KM6A 3U2OA 1SUXA 5LNRA 1VPXA 3NVTA 3HG3A 4ORMA 1THFD 4JTJA 4Y8FA 5HR7A 1QMLA 5I3FA 1JQVA 4QNWA 2QDHA 3S1UA 2FPVA 1O60A 1YLVA 4Z08A 3I7RA 3UWZA 2E5DA 3N3MA 3NQFA 3P67A 1KTNA 2NUYA 1KM3A 5K4ZA 6TIMA 3UPBA 4OV9A 1UB3A 3GNDA 4MLRA 3NQ8A 5BOOA 3HF3A 2GJNA 1QCWA 3L9CA 2VXNA 3W7DA 1RPXA 5CZJA 4Z1DA 4NJGA 4O13A 1JUEA 3MBDA 4GBUA 1EWDA 4NT0A 4YWIA 3TC6A 3S8HA 4K7YA 4IXXA 1A53A 2QR6A 1SO3A 1TO3A 1M5WA 3PSWA 5AOUA 5KZEA 3LRKA 5I3GA 2ZBTA 6ALDA 4JR5A 4N2YA 4DQWA 1KM1A 3IV3A 1LOQA 4DO6A 3HGJA 1PCWA 3O1NA 5DBTA 3UD6A 3IVTA 4O16A 2VFDA 2G95A 4QNEA 3FOKA 4O11A 4AAJA 1SFLA 2JGYA 1XBYA 4QITA 2CW6A 2VEKA 1I2RA 2VFIA 4LOCA 5F2IA 3CPRA 3HB9A 4XTIA 2QF7A 1Q6OA 3ABSA 3NDOA 3HMJG 5EY5A 1UASA 3TCEA 2NXIA 2J27A 2FB3A 2OCZA 3O07A 5I3HA 3STCA 3NPWA 1OF6A 3TXZA 2H90A 1IGSA 1SZEA 3L0NA 3LHUA 5BNKA 1PL9A 2YX0A 2NXHA 3RFAA 3NA8A 1ZNNA 3N73A 4UMBA 3W1QA 1F73A 3DI1A 1QR7A 3LCFA 1I2PA 3HGOA 3VE9A 3B0PA 4UNKA 4M6QA 3F4WA 4WX2A 3G8RA 3HOJA 3SJ3A 3D0CA 1AW2A 4O12A 3G1XA 1YADA 1AL7A 2RDWA 3RF9A 4IOTA 5LHEA 2X16A 3DFSA 3ZS4A 1SSDA 1RQEA 5D02A 3P82A 5D2YA 1BEUA 3HG2A 3P8JA 3WK2A 4O1BA 5G2IA 3PUOA 5EYWA 4XUGA 2V2HA 3BW2A 5KZMA 4IUOA 1PS9A 4AWSA 1EWEA 5E1QA 4JDBA 4BK9A 3S5YA 2NWSA 2ZYFA 2H8XA 2IQTA 3JRKA 4S2BA 3TSBA 4JD4A 3TQVA 4TO8A 1LOLA 2WPBA 3ATZA 1F6KA 3GDTA 5FF3A 2FFCA 2QCEA 3EXTA 4P2VA 2BXVA 4TU1A 3KRSA 3W1AA 4FNTA 3VNDA 3L68A 1R46A 3M43A 2WV8A 4KWVA 5FF7A 3ANYA 3OA3A 4A2SA 3NQDA 2A2IA 1M7PA 3LCIA 3NL5A 2Z0IA 3H53A 3TW7A 4WY0B 1WDWA 4NNBA 4S1FA 5BW6A 3PY2A 3STEA 4MZ1A 1TPEA 5TIMA 4MFEA 2FIQA 4MYXA 5AC7A 5DY3A 4GUGA 4YL2A 1SSGA 2NUXA 1JCXA 2CZFA 4A2RA 1ZCOA 3UXDA 1W3NA 1VCFA 5FEWA 4JTLA 1G69A 1T96A 2YPIA 3L0GA 4R34A 1XI3A 3I65A 4XZ9A 1L2UA 2DP3A 3W86A 4NU7A 1WOBA 4UC5A 5ABTA 3ATYA 5HWNA 3A24A 4ZL1A 1VC4A 1O5KA 1YTEA 3TJXA 3MWAA 3UZJA 4O1CA 3W7OA 4ZMGA 2OX1A 4K7VA 1UCWA 3MI6A 3W85A 4MKNA 3DFTA 3W83A 2VFEA 4RCXA 2ZTJA 3C3NA 3NQ6A 5AYYA 1JVNA 2YXGA 3S1VA 1EP1A 1XBXA 4C1KA 2GVJA 3SGZA 2QAPA 2J24A 3GZ3A 3NQEA 4AF0A 4RR4A 3G1YA 1G4TA 4IQLA 3T4CA 2QJHA 2WNZA 4YLWA 2OT0A 1JRBA 3W76A 3QMRA 5I3IA 2WNQA 1G6CA 5K7JA 3B05A 2YW3A 4DELA 1DQXA 4JYEA 3W2JA 4HKPA 4HT3A 1XUUA 5HNRA 5G1TA 2ZZ2A 1OG0A 4OQVA 1LYXA 5K2ZA 1VR6A 1EX5A 1K7XA 2GQAA 3SR7A 4NJIA 3PAJA 1TRDA 2V30A 2HS8A 2Y85A 3M5ZA 1D3GA 1LP6A 4CNNA 1K7EA 4Y96A 1I45A 2TSYA 1ZJIA 1R30A 3EWWA 1W31A 3G1AA 2A4AA 5E93A 3W70A 1IXOA 3O05A 3VKJA 4ORIA 1W1ZA 5C6MA 3E12A 4NXSA 1C8VA 3KVJA 3LCXA 2OMAA 3NGJA 2A21A 1HFBA 2PCQA 3P61A 3TW6A 1TYGA 2QJIA 2AGKA 3BW3A 4LRTA 2B0MA 2DZWA 5AB3A 4JYFA 1IXQA 5BMWA 3Q37A 2GUUA 3CWNA 4UXDA 5K9DA 1VCVA 3BVJA 4WY0A 4D2JA 2YR1A 2JKEA 5D04C 3FS2A 3NQAA 3DFQA 4A22A 3I68A 3M41A 2J9XA 1SW0A 3TDFA 2Q3RA 3N2MA 1P0KA 3TH6A 3OVQA 2NZLA 4UR8A 1JRCA 2Y62A 3GAKA 4IX2A 4UFJA 4GXMA 3LLDA 2CWNA 3OBKA 4H4IA 5D09A 4AEOA 1UUMA 3NR0A 1ZHAA 1AG1O 1GTEA 2ZRUA 7TIMA 3TUUA 1DHPA 3IIVA 1PVNA 4O1AA 1GG0A 2YSWA 1H1ZA 2HMCA 3B4UA 3QW3A 3KRZA 4RLIA 4UTIA 3GDKA 3SW6A 3FEMA 3L67A 3W7NA 5K9XA 1MEHA 1ME7A 1H60A 3GIYA 3Q58A 3EWZA 3GXPA 1EPXA 3C2EA 1ONRA 3HPXA 4LVAA 4RJEA 1SZFA 2Z2UA 2ATMA 2C19A 3BG9A 4QM1A 1W5MA 4AHOA 1W37A 2NUWA 1TTIA 1H62A 3WJYA 4ICNA 2Y7EA 4JICA 2O7QA 4Z1BA 3STGA 3V1PA 3NAVA 3W2NA 3OHIA 4LVFA 1MXSA 3ABOA 1GVFA 4HN4A 4ZQRA 3TSDA 2V81A 3QYQA 5CSSA 4BWLC 3W72A 4ZQPA 5CZ0A 3P62A 4IMCA 4JGDA 5LNVA 3GAYA 4M7SA 2UV8G 3R5EA 1QNVA 2QUTA 5KTLA 2YYTA 5G4EA 5K9CA 2B7PA 1FCBA 1I4NA 3GNNA 3HG5A 5FF2A 3UYCA 3TR2A 4BFAA 3HO8A 3QPYA 1OX4B 1YDNA 2OJPA 1A50A 3IIXA 5U4NA 3C61A 3ZWTA 3W71A 4UTTC 1S3HA 2VOMA 4Q33A 1QO2A 2E5BA 1OFQA 3A9IA 1SW7A 4XTDA 2CU0A 2E09A 2Z6IA 4UTKA 3TU9A 4HSNA 3EX3A 2GVGA 4JX5A 1FWSA 1VHNA 3LOTA 4JNMA 2HS6A 2YGYA 4P61A 1ME8A 2ATSA 3NQ7A 1LRTA 4X22A 3LBCA 4OV4A 4ADUA 2QCDB 4QQ3A 1OYBA 1OK4A 1FXPA 1FWWA 3LCHA 5C55A 2CLIA 1KA9F 1YDVA 1FX6A 2ZRVA 4WQ6A 3EX1A 1X8FA 3BPWA 2CLKA 2HSAA 4FO4A 4J9JA 3MI2A 4I7VA 2J9YA 3KHJA 1TJRA 1M7OA 3LV5A 5F4WA 3N2XA 1TPH1 5BMXA 5TBOA 4EF8A 3UWWA 1OFRA 3RU6A 1ZAHA 3W7MA 1F6PA 4K8EA 2QCMA 3NQ2A 4K37A 4PODA 2QCNA 3S5ZA 1GPWA 1C9DA 3LI0A 3QH2A 3QZEA 1LDCA 4CCEA 1QOPA 3NL6A 2YFNA 1K03A 3G3DA 3CU2A 2DZSA 1QO5A 1DL3A 1S5VA 1TPB1 1VYRA 1DBTA 4DXVA 1GOXA 1ZAJA 3LERA 1N55A 1FXQA 3W1NA 3PF3A 3W7IA 1SO6A 1GWJA 4Y6GA 3ZFHA 3UQNA 3YPIA 4N9EA 5D2WA 3NQMA 2CFFA 5A5WA 2CLEA 2WQPA 4FNSA 4MFDA 1OX6A 1SQ7A 1KFLA 1F2JA 1AK5A 1DVJA 3CWOX 3PC0A 8TIMA 3H54A 1PV8A 3W2UA 5DLCA 4LRSA 2TRSA 4PC8A 2WOQA 1T8XA 4WOQA 4AB4A 4UFIA 1A5CA 2TPSA 4GUHA 4UFHA 3NPXA 2X2GA 1FWTA 4FEZA 4LS2A 5L6UA 1JJKA 3M5XA 1ML1A 5DCEA 4CNPA 3OVRA 2ZZ4A 1GEQA 2E6YA 2P0OA 1UBSA 4UTTA 1VS1A 4NUWA 2JBMA 1QPOA 1Z44A 4ZQOA 4YCPA 1TPUA 1LM1A 2Q8LA 1KLZA 1EUNA 3QC3A 4UTHA 3RK8A 3W7RA 1BTMA 3GDMA 1VLIA 4NJJA 3S6DA 4WY0F 1TV8A 3LGEA 1V5XA 1VH7A 3QMTA 4RXGA 3O6DA 2YCEA 4DBDA 5LGZA 1HUVA 4OHQA 2Y7DA 3OEXA 3P5YA 4X2RA 1F76A 3AJXA 3MHFA 2CZ5A 5FI8A 1J2WA 3EKLA 3TXVA 4K38A 3IGXA 3NQVA 4I7UA 3LXAA 3NL3A 2VENA 3UY8A 1W5QA 5T26A 4E2DA 4H6KA 5D2VA 2C1HA 3NOEA 4LY8A 4UFLA 5CPOA 1FY6A 1OFAA 2B7NA 2YW4A 3E9AA 3A5FA 4ZQNA 5DBUA 3DKJA 4JTGA 3T44A 3IVUA 1JUBA 4MY8A 1NVMA 1VRDA 3NM3A 3NG3A 2C6QA 4TX9A 2B7QA 3ABQA 3LV6A 4HSOA 4TIMA 3DZ1A 3W6YA 2Y88A 1Q3NA 1KFEA 1D3HA 4LV4A 4MJZA 3F03K 3NNTA 5D2TA 3FIGA 3PM6A 4IJBA 3A22A 4Q4KA 1JUKA 2E1DA 4JTUA 3LLFA 2J6XA 3PG9A 4DF2A 2VEMA 1XKYA 3MMTA 3EXRA 1RZMA 5IM51 5I3KA 3VFLA 2ZQ0A 1MEIA 3BK0A 1WOAA 1ME9A 1Q6LA 2ZRYA 4JTTA 3LRLA 3WJSA 4O28A 1OF8A 5D2XA 3GYEA 3LBMA 3HPSA 4C1LA 2A0NA 3DGRA 3CQ0A 5AHMA 3MI3A 4O14A 3R13A 3W7JA 4GC4A 3PB2A 4M7TA 2ALDA 5FF4A 4AH7A 4AMAA 1OFBA 5CZTA 4FNRA 1FQ0A 3QRHA 4YCOA 1FCQA 2QEZA 3ABRA 1L9WA 3GLCA 1NAL1 3EEGA 1VYPX 4O4VA 5AHLA 3LDVA 4MZYA 1HG3A 3G0XA 2XFWA 3L5LA 4GUIA 3G1FA 3Q94A 2VEPA 1DKWA 2CZDA 4I7WA 3WJZA 1SPQA 4ADSA 3LTPA 2GVLA 3VCRA 3QQ0A 3QJAA 2NX3A 3PS7A 2ZCGA 1OFEA 1UJPA 3TE9A 2G5WA 2V8ZA 3SECA 1TCDA 1ZY9A 5HR6A 1PHQA 4YXGA 1KFBA 4UMCA 3R2GA 2FDSA 2EGZA 3QQ1A 1RVGA 3M9YA 4CCDA 4M5PA 2B4GA 1XDLA 2WSRA 1EIXA 3LCLA 3BO9A 1LOSA 4L4MA 4MVAA 4DEFA 1K8XA 3DFPA 1JCYA 4NZFA 2VKZG 2O7SA 5KSWA 5CZSA 1WV2A 2ABBA 4FXSA 4GUJA 1QDSA 3O15A 1YXYA 3G0UA 4KFPA 5FEXA 1HO4A 4S2CA 3W73A 2ZZ1A 3KX6A 2ZZ5A 3W2KA 2AQWA 4OE7A 1TTJA 4HIBA 4M19A 3V75A 2E68A 1LBMA 2QCLA 4POCA 4R7JA 3P84A 3T7VA 1C29A 1R2RA 4FHAA 1TIMA 1W5OA 2JKAA 3MP4A 2EHHA 1TSIA 1XM3A 1LRQA 1KV5A 4NZJA 4JIQA 4LUJA 3W2LA 3TAOA 3EX4A 4LTSA 3TIMA 5IBXA 2ABAA 1O4UA 3LTYA 2BWGA 4LUIA 1WBJA 3N14A 3PBYA 4O54A 3VI2A 2Y6ZA 1SO4A 3W88A 4CCCA 3EWXA 1J5TA 4ONVA 5H2ZA 1MEWA 2ZZ3A 5D38A 3LCGA 2VELA 1OYCA 3A21A 4OWGA 3NPVA 3WK0A 3C8FA 3FFSA 3DFNA 2P1FA 3LHZA 1KM0A 3W1UA 2X30A 2W79A 4I9AA 4KFOA 3S9YA 2VFGA 4UUIA 1JULA 4ML9A 4JTFA 3RNDA 4MPQA 2ZZ7A 4K6AA 2E6FA 2V2CA 3A5VA 1EP2A 5HMSA 3UPWA 1IIHA 4MY9A 1GVQA 5G2WA 3UWUA 1TMHA 3NM1A 3E96A 4HHPA 4O4WA 3MUXA 3W3OA 3FKRA 4GRSA 3W1LA 5F4XA 2C14A 2E6AA 2Y7FA 1VQTA 2JKPA 2FPTA 4MZ8A 4GFSA 3W7HA 4EOUA 2VEIA 3P60A 1K8ZA 3M6YA 1ICSA 3W1PA 3INPA 2OT1A 3L0KA 4LNYA 1BWKA 3MYOA 1TRIA 1OJXA 1K7FA 3F1QA
chains in the Genus database with same CATH superfamily
3H6OA 3KTCA 1Q66A 1W0MA 3C0JA 4LF1A 3LS9A 3WLLA 3R12A 1TREA 2PLMA 1BD0A 4M6VA 1OC6A 3GU9A 3EGJA 1V6XA 3UXAA 4DWSA 4YVXA 2OEMA 4LU0A 1Y0EA 2H8ZA 1Q6QA 4MLJA 3UWQA 1HJWA 2R14A 4FOUA 1W9VA 2J7DA 1NWUA 5LZLA 6XIMA 3ITXA 1XIMA 4Z42C 3H2FA 5IBXC 4Y8EA 1PBGA 4QHRA 1UR1A 1FWRA 2EO7A 5CPMA 3LGGA 4CQDA 3QF0A 2VEFA 1N8IA 3H23A 4NF7A 2DFAA 2Q71A 3EPOA 3WK1A 3U7VA 4M8UA 1J10A 5A8GA 3PTKA 2J9ZA 4BWLA 1HO1A 2YZRA 4JKKA 1NU5A 4JFVA 5F4SA 2BDQA 1PYFA 1P4CA 5E9AA 4RXFA 1UMLA 1B0IA 3KE0A 1DJXA 3OGSA 1BYBA 2IPWA 3PWIA 3E0FA 3OODA 3MYPA 1JYNA 2FGLA 4EXQA 3Q67A 1HJXA 2PDKA 2CLOA 4CN1A 2WJFA 3PJUA 5BXSA 2B81A 1QHOA 1E4NA 4CQ8A 1H61A 3CQHA 3EMZA 3UJFA 1U33A 2WMGA 1PAMA 1E0TA 3GXTA 4QG9A 3N2BA 2JALA 3WQOA 5TQLA 1RK5A 4UWMA 1J0ZA 1IHIA 2NX9A 4LS1A 2CHNA 1H7RA 4LF2A 3PB0A 4NAFB 5A8PA 1JCJA 4U10A 4C91A 2CESA 3UESA 3LM7A 4AYSA 4YTRA 1K9FA 3C3UA 4CU8A 3J7HA 2JE8A 2Z27A 4H8VA 3MZ2A 2WXDM 2DVTA 1GEHA 4NVTA 3GR7A 2V38A 1XLJA 4BQ3A 4N6FA 3FYYA 3AXHA 1DXEA 4XZWA 4E2BA 4UTWA 5LNWA 2CITA 1ZCCA 3CO8A 1H5VA 3HIJA 2BY2A 4IPNB 1CI1A 1WZMA 1K9TA 2EKGA 5FL0A 3WF3A 4HU0A 2J62A 4JX6A 4F3HA 3RLVA 4Z0SA 2HISA 3PTQA 1XLKA 2FTYA 4D9PA 3KVMA 3URBA 1X7FA 2NV1A 1HF6A 2GUBA 1AJ2A 3CXOA 4ML4A 4PN2A 1S2WA 2H3DA 2QIWA 4QBXA 4G5DA 4DJDC 1HL2A 3NYDA 1SZNA 1FCVA 3TVAA 1W9BM 1Q8AA 2NXGA 2Q3OA 4AEFA 4HGXA 1NWTA 1TIWA 1ZBKA 3KOYA 5LXXA 1PTGA 1JYWA 4PSPA 4L9ZA 1A5AA 2Y5SA 1K1DA 2FB2A 3B0VC 1V0NA 1GHRA 2INFA 2IMRA 3LBOA 2V63A 1R47A 1A0EA 1S2CA 3BAIA 3DFYA 4YTSA 2QHAA 1BF6A 1UR9A 1B3YA 1XLLA 3FSUA 1P48A 3QY6A 3S42A 2XFFA 4GNVA 4NRRA 3WBEA 5LSMA 3P81A 2OGJA 4JTHA 5C2XA 4D8LA 4JN8A 1KRAC 3S9ZA 4HZ8A 4ZFCA 1C91A 2JFEX 4REQB 4L9YA 4LB3A 5BXPA 5FSEC 3AMLA 3SN4A 1E56A 4WVXA 1Q4NX 2FMNA 4ZBCA 1JYVA 5BROA 2Z7KA 2VT0A 4QGCA 1FKXA 2ZUTA 3AC0A 4AHPA 4B5TA 4KIRA 3KEHA 5CBIA 1W8GA 3TMQA 1V08A 1EX1A 2X0YA 4E8DA 3GZAA 1JZ7A 4H6EA 1F3EA 6PTDA 1C7SA 1S1PA 4B4HA 5CG7A 4JX4A 2I14A 1XX1A 2BZNA 3G22A 5CPLA 1B4KA 1BVWA 4U3CA 4JIPA 2NX1A 3BZJA 3ECQA 3T0CA 2ACRA 3CZ8A 3R0UA 3PBUA 3WNNA 2R8WA 3PTMA 4NSBA 4RL3A 3VUPA 1X6LA 2O92A 1XS2A 3ZOAA 3P80A 2I1OA 1O5RA 3S5SA 5I6SA 1E1CB 3S5OA 4UTMA 1OQFA 2SFPA 1WA3A 1QT1A 2WSYA 4PCFA 1EBHA 3TA6A 4MF4A 1R3SA 1N82A 3FJ4A 1YNYA 3CPUA 3U7BA 3PJWA 3WD4A 4PMNA 2B31A 3SFKA 1A0CA 4JQ2A 3SCWA 3S9IA 1JDEA 2X05A 1N8WA 4M1RA 5BOEA 4HOWA 3FA3A 3EB3A 2FPYA 3CUZA 5FCZA 5D9PA 2DIEA 2Y89A 3PANA 3POCA 3H26A 4D6IA 1FBAA 1TR1A 2A3EA 1UOZA 4KWSA 2VVSA 1GOIA 2CETA 3WBWA 4L6DA 4Q8OA 3AO0A 3D3FA 3STPA 5MKGB 3BOLA 2WNWA 4H19A 1OVDA 2HE8A 3FJLA 4DF1A 1FOBA 3C0QA 2ZUUA 4GINA 4HZ6A 4O57A 5JIPA 4KKXA 1QNPA 1XLAA 3BAYA 1GYNA 2ZA2A 1XICA 4EWND 1W9XA 4BZYA 2INZA 1G7VA 3CEUA 3UJEA 5F7UA 1RY8A 1TQJA 4JQ3A 8RUCA 4L6HA 1MDLA 2HK1A 2FQIA 5CJMA 1EZWA 4ZE4A 4XBSA 4QG8A 3KOFA 1NF0A 5GQBA 2DZUA 3PSVA 2QUVA 3BTNA 1OX5A 3WLMA 2G50A 3DAQA 3HGSA 3GQYA 1UIPA 4Q8VA 1E9ZB 3FYOA 1WP6A 3SIZA 2YBTA 4MB4A 3ZSSA 3A47A 3W7EA 3P74A 1UKPA 3SJNA 4NL1A 3RM4A 2VO5A 1US2A 1H1NA 2FGBA 4EXBA 3GTHA 1T99A 3EKZA 4EX4A 2BSLA 1DWAM 2NQ5A 3UWEA 3V18A 2OLHA 2ISDA 3GXNA 2E3ZA 4IQDA 3GBEA 3SEPA 2NQHA 3EDJA 4UCFA 3AS3A 2XN2A 2GSHA 3N4AA 4CQBA 4MJMA 1U5HA 2DJLA 4XD3A 1Z8AA 1JZ6A 5EBUA 4GO9A 4BQ2A 3GX9A 1UC5A 3MKCA 1VB9A 1UJQA 3WLHA 3SCUA 2ZX7A 2IS7A 3FYPA 1WAUA 3N9RA 4DF0A 1CENA 4E4UA 3GHUA 1KQZA 2WZEA 2BASA 2WWDA 3O63A 4JTQA 3TYEA 3VOIA 4HNTA 3CC1A 2VR5A 2ACQA 2KZHA 4PL1A 4UTJA 1UD3A 1X38A 1POJA 1GVYA 4UTUA 1KRCC 3UNDA 1OFDA 4GXWA 4AXNA 3NPUA 1W9UA 1EFZA 1KFCA 5EA9A 3KTSA 2X40A 3BC9A 1POKA 1R3WA 4O1EA 1UH4A 1QFEA 1BSLA 3UG3A 5FSDC 3GHTA 3HGRA 3TOYA 3UJ2A 4A8NA 2E9MA 3QW4B 1EKOA 4Z1AA 1GCYA 3SRHA 4AZGA 3NEHA 3LLXA 3WUBA 2X1UA 1KBIA 4DAIA 4IMEA 3HJEA 4LPCA 4C7FA 3GU1A 2WJZA 5U7SA 3P2VA 4DYEA 3U8GA 3VMPA 5JBFA 4JS3A 3AWNA 4PL2A 1IZKA 2DIKA 2ZXQA 1NFBA 3WQCA 5HBFA 4DJEC 2E8YA 5F1UA 3A4AA 3BANA 4AD5A 3LHTA 2XN1A 7CGTA 1RBOB 5DY2A 4FX7A 3WO8A 2PDGA 1O95A 3CZJA 1GYLA 3T0TA 3MSRA 2V0TA 1OWQA 4Z2IA 3M7WA 1RJQA 4DZAA 6ENLA 3FA4A 4L4LA 3VIFA 3V4BA 1GQLA 3MSGA 4LVBA 4RK8A 5CQ1A 1R87A 5CZKA 1A4MA 4TMCA 3W1MA 4NX5A 1SU5A 2HTMA 1CXLA 3IARA 4W7VA 2NV9A 3AS0A 2GOUA 3VCNA 2VRKA 3R1ZA 4R27A 5C54A 1I6NA 4GCXA 3AIUA 3MHUA 3ITGA 1VJZA 1QWGA 4HNCA 3MO7A 1E6ZA 5IRPA 4GGHA 3V16A 2XWDA 4Q8UA 3FX4A 1H7WA 1WXJA 3GHRA 4LX4A 5DCBA 1H11A 7TAAA 3CIXA 2E6DA 3OZYA 2CBIA 5A8OA 2PTXA 1I1XA 3BOFA 1JCMP 5CGTA 3Q2DA 5AVHA 4XK2A 3SQSA 2B7OA 1SMAA 1KBKA 1DE5A 3I10A 1W1B1 5EL1A 3WJXA 3WFAA 4KW2A 4HN8A 5AYBA 3GVRA 4UQCA 1MRAA 2V5BA 4G7EA 4YMZA 2WK2A 3QM3A 1RQHA 2OO6A 3B9DA 2XDFA 1VLWA 3GB6A 3OVPA 4H6RA 3G0SA 4IFKB 4LAOA 3LPOA 3IANA 3B8DA 1TE1A 1MZHA 4GIAA 1GUVA 1EXPA 1WKYA 1CX9A 5DT7A 1QPRA 2H3BA 4L80A 2OYMA 4RZ4A 1B4EA 2GGHA 2XINA 1GORA 2C1GA 3GK0A 2I16A 1RD6A 2EPLX 3CV2A 4O17A 3TTSA 3HM7A 4XZNX 1TWWA 4XIMA 3AYTA 3A12A 1XCFA 2G3IA 3BLDA 4HHHA 1A4LA 2RGMA 3W27A 2XVNA 2QLYA 1M01A 3PZMA 3MP5A 1NP0A 1PSCA 3OIXA 4N6EA 4ZO9A 4HCHA 2DV0A 2QPSA 3WLTA 1ZTVA 1XLBA 2RGLA 1KBLA 4C6OA 1NFGA 3DYPA 3VNKA 2XH4A 4XIAA 1BYAA 1G4EA 4NX0A 3LHVA 3E0VA 3PZ9A 3VTRA 4QS5A 4HNUA 4HA0A 1W5NA 2Z6JA 1DQUA 3PPHA 4S39A 1EJVC 1YXCA 3U0HA 1RD5A 3BE7A 2QIIA 4EVZA 4AX6A 4KGLA 1JCTA 1PEZA 1EL3A 3F4DA 3CUGA 2GGGA 3S1XA 1SR9A 5FKYA 4E2VA 5I02A 1XIEA 4NQ1A 4W9TA 3P7YA 3QHOA 1TKKA 4H9UA 2W27A 5BWAA 2QKFA 1H7NA 5I03A 3IRSA 1DXFA 5L9FA 3SUSA 4FR6A 1UPPA 4TMBA 3VABA 3L4XA 3FAWA 4H3DA 1UG6A 5F2MA 4J3SA 1L6GA 3U2OA 4F0SA 3HG3A 1THFD 2IXUA 1QMLA 1JQVA 1J01A 3EBVA 3S1UA 2FPVA 4Z08A 3I7RA 3UWZA 4GYKA 1EOMA 1AFSA 3NQFA 2FH8A 4GI6A 4C6IA 5HMDA 5K4ZA 3VINA 4HK7A 4MLRA 3NQ8A 5HPCA 1DJYA 3B9AA 4GVIA 4KEMA 1PZ0A 1QCWA 3RJYA 2BY3A 5I24A 1AQ0A 2I9UA 4Z1DA 3PZVA 3UEQA 2E1WA 4IISA 1GOMA 4DJDA 3GUWA 4QE1A 3UT0A 4FALA 3R8HA 2Y0FA 1SFTA 2VEGA 3LNPA 3PSWA 1Z6KA 3KLKA 3DGBA 5XIMA 3RHGA 1TE6A 3SCRA 3T4WA 1JDDA 1CXFA 4N2YA 4DQWA 3IV3A 1LOQA 3IAPA 5LA0A 1FH7A 3O1NA 4G1NA 1MW2A 2OWXA 4C6MA 5C9UA 4AAJA 4BHYA 3M0YA 1ONWA 4BJHA 2O9TA 4IPPA 3B8IA 1I9CB 2VFIA 4LOCA 1ZU8A 4IICA 1ZB5A 1FHUA 5EY5A 2NXIA 1KWGA 3AXXA 1F8IA 3VCCA 1OF6A 1RSCA 4ZGYA 1OZQA 2PI6A 4P7QA 1FWCC 3UJSA 1PL9A 5KZ6A 1ITUA 2WHJA 1ZNNA 3W1QA 1GZ1A 5M1TA 4IIEA 2BOEX 1I2PA 4E4PA 1UZHA 3GH5A 3QR3A 5LIXX 3G8RA 3SUWA 4NRSA 5LA2A 4E3VA 4IOTA 3T8LA 3GSMA 3VD9A 3TTEA 1XDJA 5I78A 3HG2A 5EYWA 2Y8VA 4XUGA 4XZHA 2V2HA 4O1FA 1I60A 4WDUA 2AKMA 3IUIA 3LMZA 3JUGA 3DFHA 4JDBA 1UOKA 4NIRA 3RYSA 1M53A 2H8XA 2XVLA 1DIEA 4JD4A 3TQVA 1GOKA 5A94A 2R1PA 1JG9A 3ATZA 4OFCA 2YDQA 3GDTA 5FF3A 4XVDA 4FNTA 3VNDA 1C8XA 1OC7A 2PDMA 4GX8A 3WH8A 3ANYA 2OXNA 3VDBA 4OBSA 4QAWA 3NQDA 3NL5A 2EJAA 1V0LA 2QVNA 1MW3A 2Z0IA 1CGVA 1HL9A 1WDWA 2FZMA 3AAMA 1FFRA 3VGHA 4FXJA 4C1NB 5AECA 3PY2A 3STEA 1AQFA 2PF0A 5TIMA 2PP1A 4MYXA 5HPOA 2Y1HA 3MKKA 2NUXA 3QR0A 4PTMA 1YX1A 4A2RA 1OG6A 1WZLA 1W3NA 2AL2A 4JTLA 3AI0A 1CDGA 3S4TA 1G69A 4F79A 2YPIA 1ONEA 3RAOA 1XI3A 4XISA 3I65A 2GJXA 4KT2A 3AROA 3T0AA 1WOBA 4A3YA 2Y2WA 5HWNA 1QHPA 3CASA 3TJXA 3SURA 3MWAA 1KCLA 1M41A 3W85A 4MKNA 3DFTA 3GM8A 2WCAA 1REQB 2VFEA 2YL5A 4RZBA 1JVNA 3S1VA 4C1KA 1WXZA 3FDKA 7REQA 4GLEA 1A3WA 2GFTA 4MWAA 4K8GA 3GZ3A 2VRQA 4WGXA 3SCNA 4RR4A 4DBUA 5LA1A 2QJHA 4YLWA 1JRBA 3A9BA 3QMRA 4TVUA 2CBUA 4IJRA 2PLCA 5HATA 2F2KA 2YW3A 1ZBVA 1UZ4A 4HKPA 3KBWA 2ZICA 4XD4A 3SCPA 5G1TA 4GA8A 2ZZ2A 2WB5A 5K2ZA 1K7XA 2GQAA 4RDWA 3TYUA 5E5CA 1TRDA 2NLYA 3BUVA 3WH5A 2OZ8A 2J7FA 1CGXA 2TSYA 1R30A 1TJ1A 3D6NA 3G1AA 1OSEA 2OSWA 3CWHA 2DH3A 1OADA 4QJ5B 2MANA 4HJFA 4AD0A 1LWJA 1P1MA 1LF1A 3VKJA 4ORIA 2CERA 5C6MA 4QLLA 1HFBA 2Q6ZA 3P61A 3H7RA 4K3ZA 2AGKA 2B0MA 2DZWA 5M17A 1NQ6A 3CQKA 1MFVA 1SMDA 4PFHA 1MQRA 4UXDA 3BVJA 4E4FA 4WCJA 4AZCA 4LAMA 3WLNA 2YR1A 5D04C 3DFQA 4MKVA 3SCSA 3FCPA 1SW0A 3NOYA 1O66A 3WEOA 2Q02A 4LY4A 3GAKA 1LL6A 4UFJA 2V5KA 3OBKA 3OG2A 1T7LA 3NR0A 1PO9A 3TUUA 5JBDA 3WEZA 5ABFA 4YYCA 4TX6A 2YSWA 3COTA 5IXEA 2HMCA 2D22A 2HZGA 4RLIA 3GDKA 3AU6A 1WDPA 1U1JA 3BMXA 1JZ3A 1D8WA 3GIYA 4QR6A 3Q58A 3EWZA 4DHGA 5DMYA 3ITTA 4GH3A 1C3FA 4JTAA 3M4HA 1JDCA 1SZFA 2OKOA 2Z1SA 4S3FA 4KQNA 1PX4A 2ATMA 5A95A 4C6QA 1H41A 3P0XA 4OOUA 1GPFA 1EYEA 1S2VA 3TEVA 1W37A 2NUWA 4JICA 2HBXA 2O7QA 4Z1BA 3NAVA 1PTAA 2POZA 1EJXC 1MXSA 4HN4A 2Q8XA 2V81A 3WDHA 4J28A 3QYQA 1T8QA 4CD6A 4ES4A 4BWLC 1XH1A 2JQXA 1TWIA 2O56A 2UBPC 4B5UA 2QMKA 2V3GA 3GFXA 4IIBA 1XPGA 4JGDA 3GAYA 1VJSA 2UV8G 3R5EA 5KTLA 3BZGA 3G5EA 2F6UA 2PWGA 2WVUA 3DG7A 3E0WA 3QPYA 1A50A 3B9NA 3RJXA 3GC4A 1TJ2A 1LL7A 3OLIA 2CWXA 1S3HA 2CXGA 2QYGA 2GDVA 1SW7A 2VNCA 4MADA 3HZ3A 4UTKA 2E09A 3EDDA 1JXKA 2GVGA 4JX5A 5CCZA 1V6VA 3PZGA 1ME8A 3NQ7A 3KOWA 3LBCA 4OV4A 4ZA0A 3C0SA 1UH2A 2W62A 3QFWA 1ITXA 4ZE5A 4NYYA 3LCHA 3EPNA 3VPLA 3M46A 1XPYA 3H7UA 2NSOA 3CS2A 1X8FA 4IFOA 1XLFA 1KC7A 3CAKA 3II1A 2J9YA 1BFNA 4YHGA 3E5PA 3BL3A 3N2XA 3THCA 1R3VA 4LYKA 3W7MA 4MAZA 4PODA 3NQ2A 1HZYA 1ZBWA 3S5ZA 1IR2A 1T41A 1GPWA 4ILSA 3ZMRA 5CPQA 2D1ZA 4LNCA 4B15A 2VM8A 1ECQA 2QT3A 1S5VA 1MW1A 1DBTA 3F2CA 1WKDA 3AXKA 1TFVA 1XLEA 2YXXA 5IHRA 2F2HA 2J6VA 4A3RA 1GWJA 3URQA 3A64A 4N9EA 4HJWA 5ECVA 2CLEA 2X7WA 2WQPA 4FNSA 1LQ0A 1DVJA 3ZT5A 2IPGA 8TIMA 5ABEA 2ACSA 3CUXA 3VD5A 2TRSA 2OOFA 1LWIA 4UFIA 1HKWA 1PB0A 1FWGC 4FEZA 2HVNA 4PMZA 3AS1A 4CNPA 3OVRA 2HJPA 4ZOCA 2E6YA 3WL1A 4RE3A 3KWSA 1UBSA 1R5YA 5HA7A 1KLZA 1V7AA 2EG7A 3GTNA 5J8LA 3TQPA 3RK8A 1D7FA 3K8LA 2QV4A 3S6OA 4MNKA 5CLWA 5EMMA 3GDMA 1CXIA 1JPDX 3RU8X 1ESWA 4WJ8A 1TV8A 1V5XA 1JI1A 3T81A 4C5YA 1XF0A 1UKTA 2YBVA 1HP4A 1V77A 2WMIA 1M1BA 3LPFA 2J7BA 1F76A 1ZGDA 2BP1A 3Q45A 4YTTA 2CZ5A 4XAGA 5FI8A 1J2WA 3EKLA 4JKLA 3IGXA 4FOKA 1ZJAA 3R8GA 4QQUA 2FVLA 4LUSB 3KM8A 4LY8A 1OFAA 2YW4A 4AVOA 4G2DA 4JTGA 3G6LA 2VGFA 4AZ7A 4MY8A 3WNPA 3NM3A 5EMYA 1UD2A 1SVDA 4TX9A 4IIFA 3VYLA 4Y7EA 2Y88A 3RO8A 1Q8JA 1EO5A 1KFEA 1D3HA 4LV4A 4XB3A 4MJZA 3E0LA 1QUMA 4IJBA 2ZUMA 4IF2A 1XLIA 5C2GA 2VDGA 2E1DA 3ARYA 3LLFA 4CD7A 5E0FA 5GNYA 4DF2A 2VEMA 2EPOA 5A6AA 1XKYA 4FOJA 1RZMA 1MEIA 2X2YA 3S46A 5I07A 4OIFA 1ME9A 1MQPA 2PDNA 2W3ZA 3IK2A 1IE7C 3GYEA 3HPSA 2A0NA 1UR3M 3WDPP 1Q2RA 3RM9A 2ALDA 5FF4A 1OFBA 5CZTA 1FQ0A 3N29A 3V5OA 4AZBA 2QEZA 4Q6JA 1XIHA 3GLCA 3S6TA 1XGDA 1JNEA 1YRRA 2D3LA 1VYPX 1EH9A 3TONA 3WQGA 5AHLA 3LDVA 3G0XA 3ONBA 4KRZA 4GUIA 2BOGX 3G1FA 1GW9A 4ADSA 3FAXA 3VCRA 3QQ0A 1F3TA 4F2TA 3EOEA 3PS7A 2C8NA 1UJPA 2G5WA 4YXGA 5DRIA 1RVGA 2ZWYA 3DHUA 4M5PA 2B4GA 5FD0A 3LCLA 3ZXWA 3KUMA 3ANUA 3IJDA 3DFPA 2WJEA 4LCQA 5FJIA 5KSWA 2ABBA 4GUJA 4LGXA 1QDSA 1YXYA 4W87A 1MUCA 1DTNA 4FR1A 4AD4A 1RPKA 2VC9A 2P8CA 4S2CA 2XUCA 3W73A 4AZ6A 1YE6A 5E09A 1AA1B 4KBXA 4M19A 3RILA 3ID7A 5BRPA 1LBMA 2QCLA 2CNCA 2V69A 3P84A 3APYA 1XW8A 1XYMA 2R1NA 3FGCA 3T7VA 1R2RA 2JKAA 3MP4A 4G9PA 5RUBA 1XM3A 3E5BA 1LRQA 4D6CA 1QHZA 1KV5A 3W2LA 3TAOA 2DIJA 2RJHA 3EX4A 1VFFA 2ABAA 2J8GA 4L5ZA 3LTYA 3F4CA 4LUIA 1WBJA 3N14A 4W89A 3PBYA 4NI3A 4ICMA 1YHTA 1QASA 3AIEA 1SO4A 1NOWA 3RMEA 3EWXA 3OYZA 4ONVA 4HMCA 1J93A 2J25A 3LCGA 1OYCA 4O8AA 1SJCA 3D3AA 4E8CA 3CZLA 3WF2A 4I9AA 5DX7A 1JPHA 3L4UA 2WANA 3S2NA 4C1NA 1JULA 4ML9A 9CGTA 4J3WA 1E0WA 4GO8A 4K6AA 5T91A 4F2UA 1Y5VA 4IH3A 1O68A 3A5VA 4ERIA 5A6BD 3WQ6A 4JBRA 4MY9A 5DO8A 4F66A 2BXYA 1TMHA 2HWGA 4KF1A 3W1LA 2C14A 5FJJA 4C6PA 4B3ZA 5I3DA 1GOOA 3W7HA 4EOUA 3P60A 3N4EA 3M6YA 1QI2A 3K2GA 2J7GA 4CQCA 3L0KA 3ZLFA 3MYOA 2PDPA 5TAOA 1I8JA 2VQUA 5A69A 1XBZA 3M0IA 2QCCA 4E38A 1H63A 3URAA 4UCGA 1T40A 3CK5A 2TMDA 4LV9A 3W2MA 3WF1A 5DF0A 3UNTA 1W5PA 3I4KA 1PZ1A 4MY1A 3OQEA 1QI3A 1SJBA 2QCHA 4RX0A 4DXXA 3PG8A 3UFYA 4JTKA 5KEZA 1IZJA 3AMGA 4HA3A 3MBFA 4QROA 1ZS2A 4HHMA 1M65A 3NZ1A 3TJIA 3CNYA 4ACZA 4OBRA 2RFGA 3PZIA 3WY1A 3I6TA 3E38A 3THUA 2PRHA 4Q4PA 2C3ZA 3W7LA 2AOSA 4Y9AA 5HANA 2OZTA 1H2JA 4PMRA 4V28A 2QJMA 3HFTA 3KAOA 4GQBA 2OWCA 4ZENA 2Z1BA 1L8NA 4U4MA 4FNUA 5J5DA 1MI3A 1QOXA 3KWXA 2WCGA 1MQQA 3QV9A 3VNMA 3U4AA 4JTCA 1YDYA 2V82A 1A5UA 1TV5A 2FVMA 1CGWA 3PAOA 2A3AA 3G3MA 5HUPA 3ARRA 1E15A 1HXJA 4UZSA 3B0XA 3CGTA 3UR5A 1TG7A 2J8TA 3LHWA 4JEQA 2QVHA 3LI1A 4A29A 3VUSA 3W7KA 3SN0A 4DBSA 3CL8A 3JR2A 4ZZ9A 3HG4A 2ZOXA 1GYMA 2CBJA 3NSXA 2BGNE 5DANA 1IXNA 3TR9A 1RHCA 4UFKA 4JTIA 4INFA 4OVXA 4QEHA 3GH4A 4GE8A 4EWJA 1Z9AA 3S2LA 2QDGA 4LC6A 5DMNA 3USZA 3WLRA 2PDCA 4RZ6A 1MMFA 3OLGA 1YXDA 1L8PA 3H4XA 3BW4A 4PB5A 3OIHA 2R1MA 3W23A 1OABA 1OY0A 2REQA 1AZ2A 3CTLA 1O5QA 2O9OA 1IEXA 4WZHA 3Q65A 1KGWA 5FJUA 4LAZA 4GVFA 4WEVX 2DSKA 3GKAA 2HEJA 4FZIA 4L4OA 3GG0A 2CYGA 3EA2A 1X96A 2C13A 1LROA 1WBHA 3QHMA 2J7HA 4I8DA 2X1SA 3P5ZA 1DQWA 3FN9A 4H1ZA 1SM9A 1FWNA 2G4FA 2DGAA 1CEOA 1N8FA 2IUZA 3LK6A 4H7ZA 4R7OA 1F4HA 1G94A 3GR8A 2QPUA 4OT7A 4PTDA 2OSXA 1OCBA 2GPTA 3HPFA 1UHVA 4HK5A 1LRNA 5BRBA 1MWOA 2OX4A 3CEPA 4O52A 4KESA 3S1GA 2ZDSA 1QNOA 1YDOA 3VDCA 2IW0A 4K8HA 3F4NA 5G4WA 4JHOA 3LXBA 1W56A 1BWLA 3NWRA 2W5FA 4HPNA 3ES8A 3THDA 4WUIA 3MUAA 2PGEA 2E8ZA 3E02A 3N9SA 4O15A 1PYMA 3ZJKA 4WIWA 4GWEA 2RAGA 5LKYA 1J4EA 3H2OA 2PDYA 3W1XA 1K8YA 1K9EA 3NZRA 4RV3A 3DESA 4IWWA 4YYFA 5JUVA 1QNSA 3VD4A 3WN6A 3O16A 5LNUA 5CSYA 1JDFA 2BTMA 1E6NA 1GT8A 3T07A 3RLGA 4PTNA 1XG3A 1QI0A 4UQBA 2AGTA 1WO2A 4AD3A 3LX9A 4GI4A 2P50A 1TV4A 1GONA 4O19A 5IOBA 1R8LA 3IIOA 3H8AA 2F7FA 1JZ8A 2OLSA 3AHZA 3W28A 3A4WA 1W2VA 2UY3A 4D1JA 4GACA 2QCFA 4GYJA 4HPJA 3P3BA 3GVGA 4NILA 3CM4A 4HPXA 2F9RA 2I56A 3THQA 1UKOA 4LFYA 5EBAA 3ELFA 2J78A 1WYIA 2VDHA 5FL1A 1S5NA 1V7YA 3OO2A 1AUSL 4GD0A 1OCNA 2OFJA 3LMYA 5B7YA 3E2SA 1EZ2A 3KFTA 2DT0A 1ZALA 4HU4A 1L6YA 4IPJA 1RBAA 4RNJA 4BS0A 3LCWA 5F2LA 1WQ5A 1ISZA 2JIEA 2BHYA 2ZZ6A 1XGEA 5HQMA 3ZVIA 4W7WA 2D69A 5DT5A 1UUOA 1OFPA 4YNGA 4MM1A 3QSRA 2ZTKA 1XFCA 2YJQA 5FESA 4UQ9A 4XD6A 3DKLA 1CW2A 4PCPA 2NLIA 4PMOA 3CLMA 4Z2HA 3G8EA 2Z00A 2BMBA 1D2KA 1C93A 3WJWA 5D37A 1TV2A 6TAAA 4O53A 2A3CA 4WGHA 3WQ5A 4FB7A 4O10A 4NJKA 2Y70A 3AICA 4WD0A 2EPHA 1YKWA 3W02A 5TNVA 4OUEA 1RP9A 3DECA 2VGBA 2VR2A 3E0IA 3AUJA 3KBJA 1XCXA 3L66A 5LIUX 1YE4A 1TJPA 3IIPA 5CPSA 2ZUSA 1W3JA 3MB9A 1YW1A 2ZDRA 4BI7A 4PMUA 2R1LA 2F6XA 2PZ0A 2NT1A 2Y24A 3T2PA 1XH0A 2F84A 2ZFAA 4JQAA 1H7PA 1R9YA 3PZTA 2VCBA 1E51A 1NOUA 4I6KA 3W74A 5DRCA 4PCTA 3UGRA 3BWWA 1OGSA 1PXGA 3GRIA 4GKLA 4XKMA 4O8RA 3IJ7A 4Q22A 1ONXA 3EX6A 4H04A 2YZ5A 3C2OA 3MW7A 1VCGA 2ZA3A 1X1OA 4UNLA 1U5VA 1XXXA 3QGKC 3VKDA 1J0KA 3UY7A 3SY5A 3DH7A 1IR1A 1BG9A 3DX5A 1EA9C 1LTDA 5HMEA 3IGSA 3CZEA 1F07A 2FZ8A 3GIPA 2PDBA 4JY9A 1DJNA 1KFJA 5CJ5A 2YDAA 1FWAC 2QCDA 3D5HA 3GNXA 3M47A 1WX0A 1IEWA 8A3HA 3PFRA 3EDEA 1Z41A 1S38A 1GOQA 2XPKA 2ISWA 1PCKA 2X8RA 2ZRWA 2OQLA 3C2FA 4PCSA 2J47A 3PNUA 4Q4SA 4N4PA 2XM1A 2D0GA 4HNNA 5AZ1A 2YL6A 1RCQA 1GKQA 4H7CA 1XYLA 3NVDA 3H2MA 3THAA 1G5AA 1MSSA 2ICSA 4JNZA 3IEBA 2BHZA 2NSXA 3PNZA 3BH4A 4WR3A 4C6FA 3W7QA 4OGZA 4U5IA 2D2JA 1O94A 4QISA 1TTPA 3SGUA 2YCJA 2FLIA 1ICQA 5ABHA 1TVNA 1TZ7A 5BU9A 4M6PA 3QLLA 1NJJA 1XBVA 4X3ZA 3QY7A 4J5NA 1B9BA 3AIQA 3ARVA 1WDQA 3TX9A 3C2RA 1JAEA 2WKJA 3CIWA 4Q8QA 3U2EA 2BY1A 2Z29A 1TX0A 2WMJA 4HYWA 5F2GA 1A5LC 1IQ8A 1J18A 4PGLA 4DIAA 4QIUA 3QV6A 2OZ0A 2DJXA 3MSYA 4PUDA 2DUXA 1VENA 3VIGA 5FJPA 4ZTYA 5HMFA 3TFCA 3BDKA 1XL9A 3AUOA 1JD9A 3G1DA 2YLLA 1XLMA 3ZWSA 4AXKA 4FX6M 2J79A 3WG6A 1OD0A 1TPFA 2QJGA 4PB4A 1CWYA 2RDXA 4RPPA 4M80A 3VE7A 1SJAA 4M29A 4G56A 4CNSA 4BF9A 3VNIA 5C7HA 4KCVA 4P7OA 2DZPA 5D05A 4AEEA 3TQKA 3FA5A 1VPYA 4UB9A 5HWMA 3MJMA 3F5LA 1KBJA 3RR1A 1NTHA 3NUKA 1XLDA 2DDXA 1E3ZA 2DUAA 1VFUA 1I2QA 3ITOA 3BMVA 4GNKB 1E70M 3TP4A 1EBGA 2PDWA 4IG2A 4WLCA 1AMKA 5HQEA 4AMCA 2BGQA 2WM0A 1ZJBA 1A5MC 4R7WA 3QEZA 4GQQA 1PDZA 4JYDA 3KVLA 2QJNA 3AHXA 1VRXA 3CJPA 1YTDA 4AIBA 3I7SA 1A5KC 4WKFA 4PH6A 2VJXA 4MWAD 5D32A 3V3WA 2V5LA 3LQLA 2J66A 2XG9A 4WSJA 3O2LA 4TTUA 4R53A 2EF9A 4AWEA 1VHCA 3W81A 4C65A 2WKGA 4YHEA 5GPRA 1EGVA 1ZL1A 3BJSA 4EP8C 2OG9A 2QMJA 3RX4A 1SW3A 4E8GA 2BLEA 3O7UA 4LBSA 1S2AA 1MNSA 4W7UA 2XZ9A 4W5UA 3MO4A 3VKAA 2ZWZA 3USBA 1EGZA 4AWUA 1W1A1 1E6PA 1RBLA 2I7GA 4E6MA 5G5IA 2WKLA 1ICPA 1K3UA 3UERA 5E0CA 2Z4GA 1V3LA 1KCZA 5M5DA 5D30A 4DZIA 3DBNA 2A6LA 1VEOA 4AHQA 2PTDA 3CBWA 5K4XA 2OVLA 2WYSA 2OEJA 4JTSA 4GJ1A 1S5TA 3H12A 4LS0A 3EWYA 3DI0A 5FAGA 1OGBA 2DU2A 2YXOA 3XIMA 1V0KA 1ADOA 2LLEA 1HIZA 1E4IA 5C71A 4IL0A 1LT8A 1A5SA 3SSJA 1W1YA 3ARSA 1W3TA 1JR1A 2MNRA 1LJYA 1XRFA 3TJLA 1Q85A 2NVCA 3AZSA 4UTLA 4R88A 5A2CA 1I2OA 3O9NA 4TX8A 2RH9A 2JF7A 1Z42A 2G3MA 4KWWA 2VC6A 3UZ5A 3MVTA 1YYAA 4HMNA 3SZ8A 1TA3B 1R2SA 1QPNA 3NIYA 4Q4RA 3U3HA 1FH9A 3NSMA 3A13A 1BWVA 2FZ9A 3ZZ1A 1UR8A 3H7VA 4CN6A 3VU2A 1A5NC 1KM6A 3BSGA 4F4RA 1VPXA 4KCUA 2D2OA 7XIMA 4Y8FA 5HR7A 5JQ9A 2O55A 2VZUA 3EAUA 3M0LA 1BQGA 1YLVA 3UZWA 3GR4A 3P67A 3LEPA 4FLOA 3DOPA 1LQAA 2NUYA 1KM3A 4PULA 5D4YA 5AKQA 2ZVIA 3HF3A 2GJNA 5IHSA 1XIFA 3L9CA 3R0DA 1R7OA 2VXNA 2YCLA 3HV8A 4NJGA 4ZSTA 3MBDA 1EWDA 3TC6A 5E70A 4ACYA 1SO3A 3ORWA 4WSKA 1M5WA 1VPQA 1XHGA 5AOUA 3LRKA 5I3GA 1AZ1A 4F0LA 3CUJA 3VD7A 3L2LA 4JTRA 2XVKA 3GBDA 4DO6A 4O16A 4GY1A 2G95A 4HOXA 1EJ7L 3F2DA 4O11A 1SFLA 4GZJA 3WUGA 3M07A 2P88A 4J1OA 3N04A 1VAHA 3CPRA 2DQWA 1VBUA 4GHRA 1UD6A 3NDOA 4FI4A 4KRTA 2OCZA 2WMFA 3NPWA 4I8YA 3GU2A 2H90A 3SO7A 4P8WA 3LHUA 1KXTA 5HNNA 4F0KA 3A6OA 4GZIA 3NA8A 7REQB 1WAWA 1US0A 4DXKA 4UNKA 1REQA 3HOJA 3SJ3A 2EPMX 1AW2A 2RDWA 5G1MA 2X16A 2D3NA 1RQEA 4YVVA 5D2YA 1BEUA 3P8JA 5G2IA 3RN6A 1DIOA 3UYIA 4IUOA 2I17A 1TVPA 1EWEA 3QOMA 1VEMA 4WF7A 3WD2A 3WD0A 1W1IE 2GWGA 1J0YA 2EG8A 3F4VA 4TO8A 3KHDA 3H70A 1F6KA 2VOTA 2QCEA 3MWCA 2BXVA 4TU1A 5CC5A 3L68A 1R46A 3WMBA 4S3DA 1XYBA 2WV8A 4KWVA 4DWDA 1VFOA 1KBBA 3CAVA 3GTIA 2OPJA 1KR0A 3EMQA 1Z89A 3ZVHA 3CT2A 4WY0B 3WF4A 3VM7A 1Y65A 3BOXA 5BW6A 4P8VA 1QNRA 2WSKA 3HMCA 2FIQA 4YL2A 1ZRQA 2CZFA 2FHCA 2YA1A 4LUTA 4KCTA 1JDAA 3ALFA 1T96A 1TJ0A 3L0GA 4R34A 1IEIA 4GCAA 1L2UA 1B1YA 4NU7A 4UC5A 5ABTA 4DJFA 2R6OA 3A24A 3GC2A 3W7OA 5LXEA 2OX1A 2WC4A 3GD6A 4K7VA 3TLLA 2PA6A 2PODA 5D9OA 3W83A 3U57A 4IIDA 2ZTJA 3NQ6A 5AYYA 2YXGA 1XBXA 2GVJA 4JFTA 1CXHA 2VX4A 3EDKA 3NURA 3IJ8A 3SGZA 1E0UA 1BXNA 4L56A 3B8SA 4XZIA 3T2QA 1YBQA 2HRWA 3W76A 1G6CA 2OR2A 4V15A 1F6YA 3KRBA 1X97A 4QG6A 3VD3A 1XUUA 1KNWA 2WHKA 3EWCA 5HNRA 3SFWA 2PWDA 3HURA 4MG4A 3MPGA 3NQBA 2QDDA 1OG0A 2BY0A 3PN8A 1VR6A 2HV5A 5T9BG 3BAKA 3CV1A 1MRQA 4KMQA 4NJIA 3RPMA 4G6CA 4JQ4A 1XYFA 2P5NA 4GFIA 2V30A 4RW5A 1ELSA 3TTOA 3SN1A 3QY8A 1I45A 4HP5A 4WDXA 3VOCA 1IWPA 1W31A 1Z69A 4KETA 2A4AA 1TZZA 2VC7A 1PX3A 3MA8A 2Y4SA 1W1ZA 4NXSA 3LCXA 2A21A 2PCQA 1TYGA 3CHEA 3BW3A 1K70A 3VNLA 5AB3A 5C7VA 5M2FX 2P0IA 3Q37A 1CNVA 4Y9OA 2GUUA 1VCVA 2OU4A 2HNEA 1HVQA 3WMCA 4HA1A 3OVGA 3PHAA 3FS2A 2NQJA 1GVIA 1Q7QA 4A22A 3I68A 3FEQA 1M68A 2WMHA 4XO6A 2DVXA 3UA3A 2Z2BA 5C2CA 2Q3RA 3N2MA 1WZAA 3TH6A 2Y62A 4I5UA 4OZOA 4H4IA 3REQB 1DWHM 4AEOA 4Q8TA 1XD1A 1ZHAA 1AG1O 1BAGA 1GTEA 1Y5XA 5BXTA 4QJ3B 1QTWA 4O1AA 2HVOA 1L6FA 3OZMA 3VOGA 1GG0A 4DNMA 3GNPA 5I06A 1P0DA 4WK9A 1UWQA 1HKIA 3AIVA 5DQPA 4AIEA 3GXPA 1HJSA 4PMDA 1ONRA 3HN3A 4RJEA 1AH0A 2VGIA 2DH2A 2C19A 2PSNA 4HZ7A 2INEA 2PZNA 3R11A 1W5MA 3QZ6A 4NY2A 5A8QA 1MFUA 4D6JA 3GYCA 1H62A 4ZO6A 1EF3A 3W29A 1OGGA 4H8NA 1A80A 3TOPA 3ABOA 1GVFA 4A05A 5CSSA 1UR4A 2GOKA 4GG9A 4ZEPA 1W9DM 7A3HA 2QXWA 4IMCA 5LNVA 2JF6A 2FZDA 2YYTA 2AAAA 4WSHA 3NXLA 3UYCA 3GNNA 3HO8A 1OX4B 1YDNA 1EDQA 4C6EA 9XIAA 4LUYA 5U4NA 1X7IA 3C61A 3PPCA 3BLKA 4M24A 4UTTC 3OBEA 2VOMA 4Q33A 1QO2A 2IXVA 3RCYA 1OFQA 1RK6A 3TN6A 2Z6IA 1ISXA 4NZ4A 3AYSA 1VHNA 2YGYA 4P61A 3RPDA 4LBRA 1LRTA 4DRSA 1GGOA 4U31A 4BEUA 1E4LA 2QCDB 4QQ3A 4ACZB 1BXCA 1JYXA 4JN7A 1FWWA 2VCCA 3BGAA 2ZRVA 4WQ6A 3EX1A 4MB1A 2CLKA 4FO4A 1FH8A 3R94A 3MI2A 4K1GA 4QFUA 4HTYA 1M7OA 3LV5A 2C91A 5BMXA 2BODX 1OFRA 4K37A 5AZ0A 3GC5A 1KFWA 4N7QA 2QCNA 1KWKA 3ISIX 1CECA 3QZEA 3AISA 3W4RA 3LZ5A 3NL6A 2YIHA 1K03A 4EACA 4MDOA 1LUCB 3GUGA 3MUY1 1W6TA 2QUMA 3LERA 3VNYA 4AZHA 1B31A 3W1NA 1ODZA 2V68A 1VFTA 2DW6A 1SO6A 4Y6GA 3ZFHA 2CIPA 3ARPA 3UQNA 2DY3A 3YPIA 4UBPC 3BCJA 4MFDA 1KFLA 1F2JA 3CWOX 3PC0A 3CMGA 1AODA 5DLCA 4TOQA 1TWSA 4JIIX 4PC8A 2WOQA 3T1GA 3G2GA 4URIA 4WDWA 3T2OA 3ITCA 2D24A 3RX3A 3ME3A 4LS2A 1UC4A 2GSJA 5DCEA 4H9VA 2WBGA 2IKGA 2XGIA 1CB7B 2DUZA 3B40A 3BICA 3BMWA 4ZQOA 1F4AA 3CPGA 4UTHA 4XAZA 3B3DA 3GG8A 2GQ3A 3W7RA 1QJWA 1V93A 1BHGA 2WQDA 5BU6A 3LGEA 2XIBA 3VIPA 4FAMA 3QMTA 2V5JA 3CV6A 3L12A 1VFHA 4DBDA 1I0DA 4EK7A 3QR1A 4BQ5A 3OEXA 3P5YA 4GYPC 4X2RA 4YIWA 3AJXA 1GVEA 3MHFA 3P0WA 3H22A 1CLKA 7ENLA 1V6WA 3GIQA 3TXVA 3LXAA 1EC8A 1KCXA 3K5XA 3SUVA 1W5QA 2CEQA 4YTQA 2C1HA 3NOEA 4UFLA 2HPMA 1MYRA 5CPOA 4QX4A 1S2UA 3E9AA 3CO4A 5FJRA 1K9DA 4QEEA 1NVMA 1MUMA 3GE7A 4UTFA 2PWEA 3IS4A 1XP3A 5C9WA 4HSOA 4TIMA 3DZ1A 3T05A 3AALA 4PUUA 3W6YA 3QZAA 2CCRA 2DW7A 4U33A 3F03K 3NNTA 3FIGA 1L2QA 3PM6A 3IUHA 3PBMA 2C1IA 1AD4A 1JUKA 4JTUA 4F9DA 3S83A 4C7DA 1CGYA 1E0VA 3EXRA 3VFLA 4KEVA 2QJJA 1WOAA 2BB0A 4Q8WA 4ZB2A 4M1BA 4B9ZA 4X60A 3E1F1 3WFZA 4ZO8A 3WJSA 5D2XA 1OF8A 3TA9A 3S3GA 4HCDA 3KCOA 4IMAA 4O14A 4WHBA 3W7JA 4LEQA 4AMAA 1FRBA 1AH3A 2ZE0A 4FNRA 3WDQA 1DYSA 2E0PA 2XGZA 1LQ2A 3U9IA 4AG0A 4IM4A 3UP8A 1E1FA 3QOKA 1DTUA 1VEPA 1YNQA 1HG3A 3MUCA 3L5LA 1YNPA 1UR0A 2VEPA 1C8YA 2VGGA 3SAZA 2GVLA 3QJAA 4PE8A 1UR2A 4MNMA 2V8ZA 1TCDA 4KEZA 2FDSA 3QQ1A 1YMYA 3WENA 1XIIA 1SZRA 4CCDA 3SCVA 2WSRA 3T0BA 1WPCA 2Y8KA 4DEFA 3N6JA 2HXUA 1WV2A 4FXSA 3O15A 3SB0A 3H21A 5H8PA 3HU7A 2HDJA 1JZ2A 2PB1A 2ZZ5A 4YU1A 2VMFA 2WHMA 1Z3NA 3PPFA 1TR9A 3V75A 1FWDC 5EMKA 2E68A 3ZSTA 1W3HA 4POCA 1Q6FA 3M0VA 1C29A 1TIMA 2EHHA 1TSIA 4D1IA 1VKFA 3L7RA 4US5A 4LUJA 2V3FA 3S2MA 5IBXA 3ZVHB 3ARUA 1O4UA 4GXPA 2BWGA 1G0CA 5A6LA 1PKLA 1V03A 4O54A 3WQFA 3TTQA 2XM2A 3Q4DA 3ZJ7A 2RUSA 3VXGA 5A8NA 4JIRA 4Y9PA 1Y8BA 2ZZ3A 4PTWA 2YA2A 4IG2B 3NPVA 3WK0A 3C8FA 3XISA 3DFNA 2PGRA 2W4XA 2FFIA 2YB1A 3LHZA 1KM0A 4KFOA 2VFGA 4UUIA 1V3KA 2WM1A 1JZ5A 2ZZ7A 3CZKA 2V2CA 1DXIA 4A8IA 1ISYA 1EP2A 2A3LA 3UPWA 3QC0A 3GXMA 2O4QA 1IIHA 4MB3A 4H8UA 2NQ9A 1CZ1A 4HHPA 4CEUC 3W3OA 2J7EA 2PPGA 1KGUA 3CL7A 4YJ5A 3GWQA 1JXJA 1VQTA 2JKPA 2FPTA 1QWKA 4DBWA 4GFSA 3HQNA 5A6TC 4E3TA 1BGGA 3VM5A 1BWKA 2ZXAA 2Z1VA 3WFLA 1E9LA 4LEFA 3CUFA 3UETA 3DCPA 3EB4A 4S3BA 1M6JA 1PIFA 1OD8A 3IJLA 3VIHA 2VUNA 4FP1A 2WZMA 1IWBA 1DWIM 3RRXA 4PMYA 2OYLA 2QW5A 1E6SM 1XIDA 5T8GA 5ENLA 1NEYA 4A3UA 4JFWA 3LM3A 4I3GA 5GJNA 4Z0JA 5C9ZA 1ZZMA 3OTRA 1LORA 1SFJA 1F3XA 2JK2A 2OWWA 1QRQA 2XTKA 1TV7A 3T40A 2HPIA 4Y90A 3S5NA 4RKAA 3W7CA 4LVGA 4Q3MA 4DN1A 3K4WA 4B9YA 2PEVA 1ODUA 1BGAA 2MUCA 3IPWA 1P7TB 1NOFA 4GI8A 1R2TA 2VL4A 1XLHA 3TMLA 3NDYA 4NZ3A 3K8KA 3T55A 1MVYA 4K39A 3WNKA 1KXHA 3KL0A 3PTDA 4ZR8A 1W3IA 3OLEA 4FIRA 4MYAA 4QSFA 4IFKA 1SZGA 2PWVA 1UMYA 3AQUA 4LBUA 3BLIA 1PTDA 4GH1A 3CB8A 4QS6A 3GXIA 5FF0A 4D8ZA 1W54A 2QUUA 4GJJA 4S3EA 1Q6DA 3NZPA 5CGMA 1ITCA 3DHFA 3GTXA 4YS1A 4X9YA 1L6WA 1DJGA 1GKPA 2Z25A 2ZRXA 4DX3A 1W91A 1TQXA 3O6CA 1E4MM 3W26A 2XZ7A 2TODA 1QOQA 5EMUA 4NI8A 3TKFA 4DB7A 4QDWA 2E9BA 4Y2WA 3I3BA 1EF2A 4CCZA 3PBWA 4ZXOA 3WH6A 1Z48A 1F5ZA 4MAVA 3QBUA 2G96A 4NYUA 4J2PA 1R7AA 2DZXA 1V6TA 5C5YA 1EOKA 5JBEA 3G18A 2RHGA 4Q8MA 3VGGA 4P8XA 4OU1A 3MY9A 1GG1A 4MJ2A 4IMDA 4PUWA 4DAFA 1ZSXA 1CXEA 7PTDA 4TVDA 3TW9A 3W6LA 1HKKA 4EPBC 1CGUA 1G01A 1CPUA 2I5GA 1P7TA 4ZCWA 4CQAA 3PWGA 1DORA 3TAKA 4HYRA 4LAUA 1HKVA 1V0MA 3B03A 3S0CA 1FP9A 5HK4A 4J27A 4PFMA 4PTVA 3O6YX 3T8QA 1DV7A 4ZVJA 3G24A 5TD4A 1G4PA 1SJDA 3FJNA 2NT0A 4AWTA 1HX0A 3AHVA 2GGJA 2A6NA 1UYQA 2CLHA 4NKCA 4RDZA 1SR0A 4JTEA 4AISA 4C60A 2FJKA 1DIDA 2DT2A 3H2NA 3M7SA 1TX2A 2RDUA 4P8UA 3UR8A 1XV8A 4ROQA 2NQZA 3GDRA 2CZEA 4LCRA 5KZDA 1KTBA 3DC8A 4BCEA 3OG3A 2OOGA 3C52A 3NXFA 1MUWA 1TPC1 2A7PA 1DWGM 5FIPA 3MJYA 3NTYA 3L4TA 5KINA 2WC7A 4C6KA 5MHBA 1M7JA 3OQ8A 2XJ7A 1R6WA 2V67A 3ICJA 3UJRA 4LB4A 1X8CA 4B5NA 3DFOA 3RXZA 4LCSA 4GY0A 5E0KA 2IQDA 2W67A 3W07A 3P8IA 2W6RA 4O0KA 3VGFA 2R91A 4KWOA 3TZNA 3L2MA 2HNHA 4X9SA 4CLMA 4B5SA 3PZUA 3W6MA 2J88A 1XR2A 5FEZA 5D03A 4KERA 4O0QA 3B0UX 5HOSA 2NW0A 1GOWA 1TPVA 4FNPA 3PR2A 5H91A 2R94A 2ISSA 4V27A 3CTTA 4DYKA 3KRUA 2BGSA 1LUCA 5BZAA 2HE5A 4AZCB 5M03A 4F8XA 5XIAA 5AC6A 4MPKA 4XWUA 5K3VA 4FX8A 1G7UA 1FCUA 1GJPA 1YPIA 4N9BA 2PC4A 2YYUA 4WDTA 3EYPA 2GGEA 4LJ3A 4WKHA 1GVSA 3F7JA 5G1YA 3HBLA 2O9PA 3PBGA 3E49A 1J12A 5JXQA 1Q63A 3ZYZA 4EAYA 4B3LA 3PBVA 1CB2A 3TSMA 2WWCA 2YBUA 2TAAA 3RDKA 2RDTA 3W53A 3BLFA 4IQJA 1JQXA 2NQLA 1X6UA 4K36A 5BWFA 4OJYA 3KS6A 2NWRA 4I5RA 5I77A 4UTWC 4WXYA 1XC4A 3NQCA 2OZ3A 3FDGA 4DUWA 2W63A 5IFPA 2C71A 3QPZA 3LSBA 4ZOEA 4ALDA 2GJLA 1JGMA 4NNAA 1AMYA 2QGYA 1UW9A 4O1DA 1PE1A 1KM4A 5A2AA 4HPHA 3B9EA 3W75A 1H5YA 2YFOA 1BKSA 4J2MA 3BAXA 4PCNA 4UIOA 4X2PA 3GVWA 5LNSA 3DXIA 4S3JA 3CT7A 4HPGA 4JDYA 1RALA 2XVPA 4MWAC 1NSJA 3S2JA 2QQ6A 1DIKA 4XQ6A 4W8LA 4IZGA 4G1KA 2W0UA 4CQ9A 5SWUA 3E2QA 2BVTA 1W1TA 1J0HA 4GIYA 3TV8A 1RV8A 3MUZ1 1V3MA 4XAYA 4DM2A 1H1YA 3P6LA 3EWBX 1LZOA 2F61A 4IPIA 1MNZA 1KXVA 1RR2A 3FY1A 1VYSX 3PVFA 4JNYA 1B57A 1GVRA 2FH6A 1OFOA 1OB0A 4BI5A 4FNQA 1H0GA 3TQ0A 4U28A 2OO0A 4UOQA 4JY8A 1O6IA 4MUZA 1J2BA 3RPTA 1KKRA 4PBGA 4LVDA 2XH0A 3FK4A 1JF6A 1QBAA 1I2NA 2WSQA 1K6WA 2W9MA 2WCSA 4H9ZA 1TPDA 3TYDA 1A5BA 1UKQA 2HROA 2FGZA 4F0HA 4B3KA 1R9ZA 2NV2A 1P0NA 3N1AA 5EKYA 2XSBA 1QNQA 1UROA 3NL2A 2Y8UA 4A35A 1WE5A 1VBGA 2WZTA 1EA0A 3QPEA 3WKZA 1JGIA 3WLKX 2UY2A 1A3XA 4H2HA 4DWSD 3ZR4A 2P10A 2C18A 1ZUAX 4PRWA 4NAEB 5AN7A 4Q4OA 2GVEA 4GOAA 4Q7IA 2CHOA 4EIVA 6REQA 1AW1A 1VFSA 4GX9A 1PIIA 1NDYA 2ZX8A 5I09A 4DJFC 3IVSA 1S5WA 4W4QA 3ENLA 3N9KA 3SCOA 1QW7A 2GUYA 4MOZA 3JS3A 3R8RA 1ZP3A 1GQJA 5JH2A 1GHSA 4DPQA 1UP0A 2ADAA 1LBFA 1Q6GA 3WQ4A 3MCOA 5DXXA 1I75A 1HN1A 3B06A 2JGQA 4E0CA 1TB3A 2TYSA 4QJ1A 5AFDA 5HINA 3M16A 3GNRA 4XBKA 3BGGA 2PU1A 1RA5A 3CIVA 2BXZA 3EEZA 2VWTA 5CBBA 2PTYA 1KFKA 3RCNA 3C56A 1V6YA 3OA5A 5KMYA 4PUKA 4Q4QA 3OZOA 2G0WA 1PWLA 3HPAA 4HNLA 3KXQA 3W01A 2PDFA 5A1AA 1E40A 2HK0A 2DORA 3CH9A 1XGZA 5DMLA 5I0DA 3C6CA 4AY8A 4IHCA 1SYTA 3WUEA 1RQBA 1A49A 3QVQA 3AXMA 5GNXA 1F9CA 1SFSA 2D0FA 3L21A 1NH6A 4L1WA 2VWSA 2G37A 3BJFA 1DJIA 4H01A 5EPDA 2Y63A 2XFRA 1V3JA 3EWUA 5A6JA 4ZQMA 1QAPA 2WVVA 3TROA 5HWJA 2PTZA 4XKYA 5AYXA 4A8RA 1P5BA 3HQ1A 2D23A 4N02A 3AOFA 5LHFA 1YTKA 1C7TA 1W17A 4CGTA 3DEQA 1RXOB 2PRMA 1TA3A 2QZRA 3W24A 1IWAA 3KP1A 3WYZA 3TLQA 4B4FA 1EEPA 1H7XA 2HBVA 3T42A 2PRLA 3W7PA 1PKYA 2QDEA 4PEEA 2DQXA 3BLPX 4HNVA 3QV7A 4IP4A 1ADSA 4W85A 1XRVA 4GKTA 4AU0A 4NZ5A 3GVQA 1RVKA 2RJGA 5CSRA 2A7RA 1UWSA 3RIKA 1Q2SA 3W1TA 4AZIA 1LLOA 3QKZA 1DP0A 1QK0A 4FPSA 1DEDA 3UXIA 4I9JA 4ZODA 2NVDA 1UD4A 3EX2A 4ECLA 2Z1WA 3PWAA 4QDPA 3PULA 1XD0A 4C7GA 3U2ZA 2DT1A 4Z2GA 3KBVA 3AYVA 4FLSA 1JZ4A 5JU6A 1UWAA 4A8LA 3OBAA 2XGBA 3TJ4A 4C90A 3ITYA 2HXTA 2H6RA 2ZX5A 1EC7A 1EYWA 4XG1A 4N0RA 3QGVA 3QV8A 4Q8PA 3ZO9A 1C9WA 1PJ9A 2DSVA 4Z2KA 3UWVA 3JW7A 3I6RA 1P6BA 4TV6A 1CIUA 2YCLB 1KRBC 2CLLA 3UG5A 3W87A 3WLOA 3ZQ9A 1AL8A 5AHIA 5D9NA 1XUZA 2PWHA 2QPXA 3UBPC 1EJUC 4XX6A 4WXZA 5I2UA 1VIWA 3ANVA 1TTQA 4ZO7A 1BVNP 1QATA 2XFYA 4BI6A 3U5YA 2C15A 3FXGA 3FJ6A 1EJSC 5A6MA 4V2XA 3FGCB 3A4XA 4US5D 4L6OA 1X1NA 1ADDA 2F38A 5LGXA 3L5MA 5GVJA 4Q7BA 4PUMA 4GBDA