3RMJA

Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
307
Chain Sequence
TNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDFEAVNAIAKTITKSTVCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIHMEYKLKMKPKQVIEAAVKAVKIAREYTDDVEFSCEDALRSEIDFLAEICGAVIEAGATTINIPDTVGYSIPYKTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQVECTVNGLGERAGNASVEEIVMALKVRHDLFGLETGIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSETYEIMSAESVGWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-isopropylmalate synthase
publication title Removal of the C-terminal regulatory domain of alpha-isopropylmalate synthase disrupts functional substrate binding
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 128
structure length 307
sequence length 321
chains with identical sequence B
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rmjA00
4P61A 4OBTA 3LV5A 1BKSA 1B9BA 2PC4A 5D02A 1DJNA 1TV7A 2A7RA 1GQNA 2WV8A 4E0CA 2NUYA 5KZEA 5HWNA 1UASA 2A7PA 2X1TA 3W83A 1R2SA 3D0CA 1WDWA 4UFMA 2R14A 4J9JA 4UTHA 1G4SA 2XN1A 1H7PA 3UXDA 3WK1A 1GG1A 2GQ8A 5LNRA 1DHPA 3C56A 4GUFA 4K38A 2E68A 2ZTKA 3QPZA 4M6VA 1JJKA 4RJEA 3TSBA 4LV9A 4NNBA 1SFJA 4KWWA 3A9IA 3TCEA 4YMZA 3KX6A 4R53A 3H55A 5CPNA 2OZ0A 3STFA 1KV8A 4UFIA 3RMJA 3PG8A 1H62A 3CWOX 4OWGA 4E38A 4HSNA 3W2NA 1TREA 5CZJA 4W9TA 4AAJA 3GKAA 4MYXA 3W1QA 5AC6A 3UWUA 3W7DA 3EWBX 1XC4A 3OEXA 1AMKA 1FWWA 2VELA 3RLUA 1AW1A 2QKFA 3BW3A 1UUMA 1VCVA 4LOCA 5TQLA 3W84A 5G5IA 2E77A 4Y96A 3FA5A 4XZ9A 3UWWA 5KMYA 3IIPA 2J88A 3C2FA 4PTNA 2ZZ3A 3I68A 4LS1A 3OG3A 4X2RA 3NPWA 3IIXA 2CFFA 4LC6A 3U8GA 4NX0A 1FWRA 1LM1A 2PE4A 3L2IA 3A21A 3M7WA 3SGZA 4E2DA 3BG3A 3EWUA 3L0GA 4RXGA 4WQ6A 4TMCA 1SO3A 3HG4A 2XN2A 4LS2A 3KVMA 3A24A 2JGQA 5CZSA 1QPOA 2QCLA 4MOZA 1A5CA 3IVSA 4NJKA 5DN1A 4IMCA 4HNTA 1JCJA 1QAPA 3LHZA 1W54A 1B4EA 2NXGA 3PF3A 4DF1A 3V75A 4NZJA 3FS2A 3LCIA 4FX7A 4O4WA 3FKRA 3DFPA 3C6CA 2RH9A 2CLHA 1JQXA 4Z1DA 5LGZA 1YLVA 2CZDA 2V2DA 2TRSA 1ZFJA 4Z1BA 2CLKA 3KAOA 5CZ0A 1XUUA 1KFCA 2ZA1A 4IWWA 1OX6A 3TH6A 4MZ8A 3M5VA 3PBVA 3LBCA 2V2HA 1W5PA 1X8FA 3G1SA 1OFPA 4K37A 5EPDA 4MLJA 2AGKA 1ZAJA 1ALDA 5DY3A 4ONVA 3LGEA 1SO6A 4FNTA 2E6AA 3GDMA 4I7WA 4O18A 3W88A 4NVTA 2Y7FA 1G7VA 4O1DA 3W1LA 4Z0JA 3O07A 5CSSA 1EP1A 2C1HA 5D30A 4PCFA 2YX0A 4JTJA 1W3NA 1DOSA 3KFTA 1QFEA 2QCEA 3NA8A 3S5OA 4OE7A 2DZSA 2YW3A 1FWSA 2J27A 1L6WA 1SFLA 4UFLA 2QCNA 4YCOA 1BWKA 2QUVA 5AB3A 3AJXA 1Z41A 1OF6A 4O16A 2GJNA 3N34A 3HMJG 3G1DA 5SWUA 1W5NA 3B4UA 1KM0A 1YTKA 5FF3A 3MW7A 1I2PA 3P82A 1KFJA 1MXSA 2C14A 3GAYA 2GQ9A 6ALDA 3DHFA 1NF7A 1J2WA 1ONRA 1H50A 3HF3A 3DKLA 2X1UA 3AO0A 4NJJA 1XBYA 3N73A 1MEWA 3L21A 4O28A 2BLEA 3SW6A 1ICPA 5BMWA 3C3NA 1VGAA 2ZYFA 3QQ1A 4A22A 4O54A 2QCDA 2A2IA 1W1ZA 1TSIA 3LCXA 3GLCA 5MHBA 1TRIA 1F05A 3V1PA 3TJLA 4NJGA 3TW6A 1YADA 1YTDA 4UNKA 4RK8A 3W7CA 2DORA 3IIOA 3NQ7A 3IEBA 2Z6JA 3IIZA 4QNWA 1F5ZA 2J6XA 2NX1A 2PRMA 1FX6A 3P61A 3NQGA 3T4CA 3WFAA 3GAKA 4S1FA 3UZJA 3RF9A 1F2JA 3P67A 4JY8A 4LRSA 4LTSA 4TO8A 5KITA 5AC8A 1H5YA 2H6RA 4HIBA 3FIGA 1X1OA 1RVGA 1Z48A 3M1ZA 1OFAA 3FYPA 3UYCA 1K8YA 3W1UA 2C18A 4RZ4A 1H63A 2DZPA 3NQEA 1PL9A 1ZCOA 1XBXA 4A2RA 4NZFA 4UUIA 2C13A 3ABQA 3TNOA 2VEIA 3LCFA 3NR0A 4XTDA 2DZUA 5DBTA 5HNRA 1S5VA 2VFIA 3E96A 3PC0A 4ALDA 1TPC1 3M16A 4M19A 3M6YA 3QYQA 4ADUA 1W0MA 3PUDA 4JTGA 1H7XA 1LYXA 3LCHA 1WX0A 4MVAA 1FBAA 2X30A 3R89A 4FHAA 5LNUA 2V9DA 3SECA 5KZMA 1SW7A 5FEWA 2WSQA 2C19A 4RZ6A 4L4MA 2QCGA 5LNSA 2QAPA 3WJSA 3NPVA 3L0KA 3NQ6A 2ATSA 5FESA 4OT7A 4JGDA 4ZQNA 3TC7A 3LDVA 4AHQA 2A0NA 4BI7A 1O5KA 1G4PA 1PHQA 4TMBA 4O52A 3LHTA 1QPNA 2EAWA 2RFGA 1KFKA 1WOAA 3PUEA 4AWUA 1C29A 2VFHA 5FEZA 4O4VA 3P62A 3C2VA 3T55A 3S1UA 3ZWTA 3W7IA 1A5SA 1OFEA 2V81A 1M5WA 4O53A 5D2YA 2XFWA 5G2WA 2A6NA 1T96A 4WY0F 3NDOA 2OMAA 5HMSA 1HUVA 5BOOA 1XBVA 2QCHA 3HIJA 2BX7A 4MPQA 1KLZA 1K3UA 3NO5A 4XBKA 1KFEA 4AH7A 1GWJA 3UD6A 3GYEA 1EX5A 2NV2A 3OVPA 4QIUA 4QITA 5FF2A 4KFPA 4N2YA 2QCFA 5F4XA 3NPXA 4Z0SA 2NX9A 4FIRA 3EEGA 3W71A 3QPYA 1ZY9A 3WK2A 1T99A 5EKYA 1W31A 3VE9A 1G4EA 3HGOA 1I2NA 3L68A 3DZ1A 1OK4A 1HO4A 1NAL1 3IVTA 3IGXA 5C5YA 4I7UA 4UR8A 1LTDA 2FJKA 4WY0A 1B57A 1VH7A 3MO7A 5HINA 3Q2DA 3UWQA 2WJZA 1C9DA 3N3MA 3GXNA 1BTMA 2EHHA 2CLEA 3M9YA 3LX9A 1H60A 1M6JA 3UQNA 3TU9A 3EXRA 1GYLA 3KVJA 2CU0A 4RCXA 1OJXA 3F03K 5J5DA 4YXGA 2ZRYA 2P0OA 4OV9A 1JUKA 2PCQA 3W2JA 3MHUA 5KTLA 3HPXA 3CIXA 4DBEA 3M5YA 3WJXA 1OF8A 2EKCA 5I3HA 3G3DA 3S1VA 4DBDA 2BTMA 3IGSA 3YPIA 3W86A 3WK0A 4PH6A 4KFNA 3DGRA 1FDJA 3PVFA 3FKKA 4CQAA 2FPVA 4JTTA 3G22A 2KZHA 1FWTA 1GVOA 4Y8FA 1W3TA 3NQVA 3TUUA 1WYIA 4O13A 2YCEA 4FIQA 3LLFA 1DQWA 1VYRA 4GUIA 2OT0A 4AF0A 2Y61A 3W2UA 5HR7A 2NUWA 4MJZA 5I3FA 3NM3A 2Y7DA 4JYEA 1TMHA 2VENA 1O60A 3M47A 1KBJA 1K7FA 1Z42A 2CLOA 1F76A 3LCLA 3O8AA 2ABBA 2NX3A 2ABAA 3ZWSA 2RDUA 4M7SA 3QW3A 2OX1A 1KM3A 4ZQMA 3WJZA 1JULA 1H7WA 4JX4A 3UWVA 1LLWA 3NAVA 3NG3A 4MZYA 3SY5A 4M6QA 1UB3A 3DFTA 4OQVA 3SZ8A 3W76A 3W1AA 1VJIA 2NUXA 2VEMA 3EWYA 3L5LA 2CLFA 3RFAA 3BVJA 4ZQPA 4HSOA 4BI6A 1KFBA 1QPQA 1LOSA 2A7NA 3PB0A 1SU5A 2G95A 2GJLA 3B05A 4GUJA 3WJWA 1OHLA 4N6FA 2ZCGA 3C0JA 2GVJA 4GXMA 1UJPA 1WQ5A 5HUOA 1OFRA 1N7KA 2Y6ZA 3QMRA 4RR4A 4Y6GA 1FCUA 1KFLA 1VC4A 5D38A 3I6RA 3MMTA 3TFCA 5FEXA 2Q8LA 1S3HA 1EUAA 4UTKA 3M5ZA 1JRCA 2JGYA 2ZDRA 3E49A 3JRKA 3PBYA 3LI1A 2YSWA 1IXQA 3G1HA 3CB8A 2CZEA 3L9CA 4PEKA 4LVAA 5F1VA 4FF7A 4LUJA 3P60A 4O19A 4M7TA 3SJ3A 3VCRA 4HPJA 3TAOA 1X6UA 1Q6RA 4GBUA 4CCEA 4Q33A 2ZRUA 1UBSA 5G1TA 1EWDA 1QOQA 1FCQA 3DXIA 3IV3A 3DFNA 1W37A 5LGXA 1EWEA 5K9DA 3TSMA 4RZ5A 3CWNA 4RV8A 1L2UA 3P5ZA 1FXPA 1G6CA 1W56A 5E1QA 4G1KA 1D3GA 4K39A 2DZVA 5FEPA 5AFDA 1R2TA 2AQWA 1VZWA 2VFEA 3DFSA 2HSAA 4FB7A 4UTTC 3SFKA 5FI8A 3RLVA 4XUGA 5F1UA 1SQ7A 1HTIA 1IXPA 5HWJA 5TBOA 1OFBA 4IMFA 1GYNA 1AW5A 5D2TA 3N19B 1KTBA 5I3IA 4XQ6A 1H1YA 4IJBA 1ICSA 1XI3A 1SPQA 3O6DA 1TPDA 4XTIA 3GDTA 5HULA 4BWLC 5C6MA 1XDLA 1WAUA 3ZR4A 3TSDA 3I7QA 3TC6A 2V0TA 1Q6OA 2YYUA 1PE1A 5F4SA 1FCBA 1JUEA 3R12A 4S2CA 4HN4A 3RU6A 3GDKA 2ZZ1A 1KTCA 1I8JA 3I7SA 3M43A 4FNUA 3IRDA 3INPA 3F1QA 3PM6A 4AVFA 1EPXA 5K9XA 3USBA 1ZAIA 3EX6A 2CWNA 4AMAA 3W7EA 4K36A 2QUTA 4O50A 4O57A 3NPUA 3NQMA 1R2RA 3LTSA 1P5BA 3STCA 1EIXA 1OABA 1ME9A 2A21A 4Y9AA 1EP3A 4BFAA 1H7NA 5CPMA 2YXGA 4IUOA 4YLWA 2W0UA 5CPOA 2ZRVA 3TQVA 1W5OA 5F2IA 1LZOA 3B0PA 3B06A 3G3MA 2QCDB 3KVLA 1IXOA 3UWYA 4D2JA 5GVJA 3MHGA 3NQAA 4KKXA 3TA6A 3GDLA 3O63A 3W74A 1JR1A 4CLMA 1I2RA 1I2QA 2QCCA 1DORA 4C1KA 5HWMA 2TMDA 1V5XA 1NF0A 1ML1A 1AW2A 3BARA 4M5PA 4LVBA 1XM3A 1KM2A 1QR7A 3ELFA 5T26A 1H51A 3M5XA 2FDSA 2CW6A 4A3UA 1O95A 1RQBA 1YYAA 2Y70A 2H8XA 2Z0IA 3HQ1A 2QEZA 1XL9A 3DI1A 3W6YA 3QF0A 5BRBA 3P8JA 3W7OA 5K4XA 3L5MA 4AEOA 1QPRA 5E0KA 2BXVA 1TQXA 3LXAA 3OA3A 4GUHA 4EWND 4OV4A 3FLUA 4XWUA 3G1VA 3O6YX 3NL6A 5D2VA 4ZMGA 2VC6A 3KRZA 1VHNA 4CNNA 3W9ZA 4MLRA 2YFOA 3S42A 2A6LA 1GVRA 3GXTA 4UC5A 3G8RA 1KV5A 2VOMA 1TPUA 3QQ0A 3NXFA 1VQTA 3LHUA 4JTEA 1LP6A 2X2GA 4GWEA 2QJHA 1RPXA 2JKAA 1LRTA 4PODA 4IPJA 3GIYA 4K6AA 1F6KA 1B4KA 3IGUA 1IF2A 4MUZA 2O7QA 2QAFA 2J24A 1YXDA 3KVKA 5F2LA 1S5TA 1TPEA 4LT9A 1ME8A 3VI2A 4O1AA 4IXHA 2ZA2A 5EY5A 4U28A 2NWRA 4YCPA 1VLWA 2H3BA 4DO6A 1YXCA 1XKYA 3GX9A 5AOUA 1FQ0A 2DZTA 1U83A 3H53A 3P81A 1KTNA 2ZTJA 5D33A 4WX2A 4NXKA 3Q37A 1FCVA 5L9FA 2QJGA 2EGZA 3LCGA 3EWXA 3LXCA 1P0NA 2JBMA 1ME7A 3QEZA 3CT7A 1XDMA 2ISWA 4IXXA 5F4WA 3SI9A 2Q8ZA 3LM7A 4JTUA 3PY2A 3NL3A 3GKFA 4UTLA 2GOUA 5LHEA 3A5VA 4JX5A 4DPPA 3W7GA 2Z2UA 1BEUA 3HO8A 4EVZA 1T0OA 3TIMA 3TKFA 4X3ZA 2FPYA 4CQ8A 4PL1A 5LNVA 4N02A 3O06A 5HJLA 4UTJA 1LCOA 3E0IA 3TAKA 3LTPA 3N2XA 4ZQRA 3NOEA 1KM6A 4ADSA 4WUIA 2E6DA 4N9DA 5EBUA 4AHOA 4WY0B 3W7NA 3H54A 1XCFA 3W1TA 4AWSA 2DZWA 5EYWA 3KOFA 3TFXA 4CCCA 1TCDA 3BGGA 1TPVA 4LW7A 4Y90A 4WOQA 1NEYA 4POCA 1EEPA 1K7XA 1W8SA 2TPSA 4NQ1A 2FFCA 1X7FA 3IIVA 1KM1A 4UMCA 3L0NA 4AB4A 3N14A 1VPXA 3PULA 4O12A 1GOXA 3T44A 2C3ZA 3S5NA 3EX1A 4HT3A 4JDYA 2GVLA 1SSGA 2CZFA 3TMQA 3UNDA 1IIHA 5DCDA 3W23A 2GUUA 1OFOA 2A4AA 3DAQA 5FF7A 3KRSA 1TIMA 3CQ0A 3W7MA 2NWSA 2E6YA 5LSMA 4B5NA 3PSVA 4LVFA 2IQTA 1FDZA 1N8FA 4FNQA 1ZJIA 3FJLA 3O1NA 1XUZA 3G0UA 1DJQA 4JTIA 2PRHA 2FTPA 3W7LA 4AF0B 1W5QA 3HPSA 1DBTA 3GR8A 2Q3OA 3BLFA 3BGJA 3VNDA 1PVNA 3MBDA 4NJIA 2W79A 5KSWA 3GZ3A 1BWLA 1MEHA 1VRDA 4LV4A 2YR1A 3VE7A 3EXSA 2GVGA 3PWAA 4GJ1A 2ZRWA 5CG7A 3NZRA 5HR6A 1GZGA 1SZGA 1GEQA 5U7SA 1EUNA 4N9BA 1TTQA 4K8EA 2FLIA 4JD4A 1SW3A 1RV8A 2Y7GA 1GVQA 2I9EA 1Y0EA 1MEIA 3TMLA 1TB3A 2TYSA 4IOTA 4LNYA 4Z08A 2GPTA 4ZZ9A 3NYZA 4YL2A 2W6RA 5D09A 4FO4A 1SZEA 2V30A 5G4WA 3QM3A 5D2XA 2VFDA 5L6UA 2YYTA 3MP3A 4K7YA 1QO5A 2TSYA 2QUUA 1J5TA 4PC8A 1XFBA 1YPFA 2E5DA 2ZRXA 4NX5A 3OBKA 1R47A 3M41A 3C2OA 2CZ5A 5I3KA 5HQEA 1GVSA 5IBXC 3MYOA 4GFSA 3TR2A 1Z44A 2H8ZA 2NLIA 3MWAA 5D37A 2CLIA 1TQJA 3QMTA 1OYAA 3FYOA 3MYPA 3DI0A 4X22A 3CHVA 2PRLA 3GDRA 2FB2A 4N4QA 1FY6A 3LXBA 1WV2A 3EWWA 5CPLA 4FNRA 2ISVA 5D32A 3S6DA 1PIIA 3TE9A 3I7RA 1XBZA 3CIWA 3CLMA 5K7JA 3LLDA 4IMDA 1DL3A 3GK0A 5AYYA 3BG5A 2DP3A 1TV5A 4UTWC 4NNCA 5G2HA 1S5WA 3TQKA 1GVFA 3O6CA 3TX9A 1PHWA 4UTMA 2DU2A 4HNVA 3LHWA 3W1RA 3DKJA 3RK8A 4QQ3A 2QJIA 1SZFA 2I14A 3E12A 3HB9A 5DBUA 3SR7A 5AYZA 3U6WA 1PCWA 2F7FA 4CQ9A 1LDCA 4A2SA 4JNMA 1WOBA 2RKXA 1RR2A 1I45A 3NGJA 3S1XA 3VKJA 3PBWA 3A23A 1A5BA 5DXXA 1JCNA 3QW4B 5I3GA 2B0MA 5LKYA 1DKWA 3W7JA 4MIMA 3NVTA 2VFGA 4GE8A 4GNJA 5DY2A 1B3OA 2OJPA 1IGSA 5TIMA 2FB3A 1Q6LA 3W1XA 3QZEA 3S5ZA 3DU0A 4K8HA 1TJRA 3L66A 1GTEA 1Q45A 2WNZA 1LRNA 2Z1BA 3THAA 1UCWA 1SUXA 3B03A 1XXXA 3W7QA 4FXRA 3EX4A 4O0ZA 5C55A 4JEQA 1R46A 2ZZ5A 4UTTA 2O7SA 4O15A 2J9XA 1NSJA 2NXIA 3BLIA 2RDWA 3CM4A 3R8RA 3O15A 3STEA 4P2VA 1SO5A 1AL8A 2A5HA 1LBFA 4ORMA 2ZRZA 1JQVA 4NUWA 5HUPA 3ABSA 5C54A 5IM51 3EWZA 3PB2A 1ZHAA 1L6YA 4BWLA 3DENA 3MBFA 2WNQA 4JTLA 1ADOA 2VKZG 4ICNA 2V2CA 5H91A 3W1PA 4JDBA 3HG5A 4CNOA 5DLCA 2P1FA 4JICA 1K8XA 5D2WA 3VFLA 1H1ZA 1YDOA 2NV1A 2PURA 4R33A 2C15A 7TIMA 4JXCA 1JUBA 1LBLA 3MI2A 3G1YA 1NVMA 4JTFA 3BPWA 1W5MA 2WNNA 3TV8A 4JTKA 4WJEA 4JN6A 5BMXA 1TO3A 1VLIA 4O17A 1HO1A 3FFSA 3LV6A 3E02A 1A53A 4O1BA 1TPWA 3N9RA 1JCXA 2ZZ4A 3HGJA 5CKSA 1WBHA 2I1OA 2YPIA 4LVGA 3NQDA 5K3VA 2X1RA 1TTPA 3QH2A 2R94A 3W07A 4HKPA 2B7NA 5AN7A 1T8XA 3U2OA 5D03A 4N4PA 4S2BA 4YWIA 4MY9A 1AG1O 3UY7A 4MJMA 1KA9F 1VYPX 1QDSA 3T40A 3RNDA 4EF9A 1OX5A 4I7VA 3W7PA 2E5BA 3B04A 5AHLA 2YFNA 1K02A 3G1AA 4UMAA 3SSJA 4FNPA 2DZXA 3GB6A 4IPIA 3A22A 1O4UA 1LORA 2P10A 3Q94A 1PS9A 2JKEA 1VS1A 4N6EA 2Y88A 4O10A 3W85A 3R5EA 1EP2A 5LZLA 3G0SA 4LU0A 3HJZA 3R13A 3ATZA 2GQAA 3BK0A 5EA9A 2BSLA 2H3DA 3QJAA 2YDAA 3N2MA 3TDFA 1RQHA 3W7RA 3DFOA 4EF8A 2R8WA 1K03A 4I9AA 2E5CA 4KFOA 4IQLA 4AWTA 4O11A 3FJ6A 3TQ0A 3UZ5A 4MY1A 2Y89A 1E51A 3CU2A 4TU1A 4MFEA 2E1DA 2UV8G 3P8IA 3PSWA 1WXJA 5LHFA 4UFKA 2LLEA 3PS7A 3L65A 1PV8A 1TV8A 3KRUA 3NQ8A 4ADTA 2ATMA 2EF9A 2C6QA 4PL2A 2E09A 4WD0A 1JCMP 3UPBA 4BI5A 3HBLA 1F74A 5DELA 3W2LA 4X9SA 1QNVA 3OVQA 3LB0A 3LRMA 5E93A 4LRTA 3SIZA 1IXNA 3G8EA 3PBUA 2Z6IA 4DPQA 1LLZA 4FXSA 3LHYA 3LCWA 3MP5A 4IMGA 3LRKA 1M7PA 5AHIA 3NM1A 1MSSA 3QSRA 3PG9A 4HHPA 4R7JA 1OK6A 4BF9A 1MZHA 2NZLA 1YXYA 1R30A 2FPTA 1Q6QA 4WXZA 5K4ZA 1OFDA 3LRLA 5DCEA 3STGA 3W70A 3F4WA 5J5RA 1OX4B 3UXAA 1SSDA 3EX3A 4JR5A 1A50A 3DH7A 1A5AA 1OYCA 1G4TA 4TR9A 5AHFA 4QAIA 3ANYA 1TPB1 4UMBA 3C2EA 1M7OA 4ZVJA 1KM4A 1VYSX 2VEPA 4N9CA 5K9CA 2B7OA 3BW4A 4UFHA 1QMLA 4QISA 4QM1A 5AHMA 1GTHA 2OT1A 4FX6M 5FF4A 1LOQA 2FQIA 5KZDA 4EIVA 5KINA 4GUGA 4QJ1A 3QMSA 4JTSA 3W72A 3NQCA 4H3DA 3W22A 1YDVA 4NT0A 5H2ZA 3L67A 4LC8A 4ZL1A 4OU1A 3PR2A 4CCDA 4H4IA 4BK9A 1OYBA 3MJYA 2C16A 3GR7A 1YPIA 5I3JA 2F84A 1GG0A 1VHCA 3G24A 1JVNA 2D73A 3C4UA 3LTYA 5D04C 4R34A 1V7YA 1TPH1 1TPFA 5F2GA 4GRSA 3QRHA 4EOUA 3P80A 3GNDA 4NXSA 3BV4A 1HG3A 1AL7A 4WZHA 1D3HA 3BW2A 1OG0A 3LERA 3EKLA 1SR9A 4A21A 1YDNA 4JIQA 2V5LA 1G69A 4MZ1A 2ZA3A 3S1WA 1LROA 3WJYA 1O94A 2WQPA 3W7KA 3N9SA 2G97A 3W87A 4UXDA 4ZQOA 1JCYA 2JK2A 4OHQA 5U4NA 4XKYB 5AC7A 2Q3RA 4MFDA 3ABRA 3EKZA 3QC3A 3BO9A 4HNNA 3UY8A 1UUOA 1GJPA 3W73A 2C0AA 1H61A 4GC4A 1FXQA 5EMUA 3L5AA 2G96A 4RXFA 4K7VA 3S5YA 4UTUA 3MP4A 3DHDA 4QSHA 1RQEA 1CX9A 3BG9A 4E2BA 5G4EA 2E6FA 4RKAA 1KLYA 4DELA 2Y7EA 2HTMA 1N55A 3MI6A 1LBMA 1KW1A 1OX4A 1ZNNA 1KM5A 3QSTA 2WSYA 3KXQA 1ICQA 2HS6A 2WSRA 4UCGA 4HPXA 4ZQCA 3FEMA 3IVUA 4UNLA 5EL1A 3CEPA 3E9AA 3TK7A 3C52A 3NQ2A 1TJPA 2VEKA 4JYFA 2YGYA 5AHEA 2X1SA 1C8VA 3C61A 4AXKA 3EB2A 2AAMA 3C2RA 3TROA 3CC1A 3QFEA 1LRQA 4IX0A 3NZ1A 5C2XA 4FEZA 3G1XA 4UIOA 2WOQA 3W2KA 3NL2A 3MI3A 2QCMA 3GVGA 1H7RA 2V82A 2VFFA 3HGSA 2RHGA 1THFD 5IBXA 2WPBA 3FOKA 3O05A 1RZMA 4TIMA 3P7YA 4DQWA 2WO5A 1WBJA 2Y62A 2ALDA 1H7OA 2FIQA 1TTIA 2NXHA 1X1ZA 3LOTA 2ZBTA 1U5JA 3EXTA 4U4MA 4ML9A 4MY8A 1HFBA 4JIPA 3MHFA 4Z1CA 1MO0A 3JS3A 1DQXA 2ZZ2A 2ZZ6A 2RDTA 4H6KA 3TW7A 1F6PA 1G7UA 2CLLA 4L4LA 5ABTA 5A5WA 2QF7A 3EX2A 1CI1A 4M6PA 4UTWA 5CZTA 1PCKA 3JR2A 4XKYA 3NNTA 3LI0A 2B7QA 1QWGA 2HMCA 1QCWA 3M44A 4Q32A 3NEVA 2JKPA 5CGQA 4AHPA 4N9EA 2WKJA 2CLMA 4XBSA 3ABOA 5FF0A 1FWNA 1AK5A 3ZS4A 3CPRA 3CTLA 5K2ZA 1JCLA 3HG2A 2A1YA 2ISSA 3HPZA 1NFBA 4Q4KA 4WOZA 3O16A 1TYGA 3K30A 1F73A 1P1XA 3HOJA 3A5FA 1ZAHA 1EA0A 1LOLA 3G1FA 2X16A 3HGRA 6TIMA 4Z1AA 4MYAA 5F2MA 4QNEA 3PAJA 1K8ZA 1I2OA 5G2IA 5AHNA 1D9EA 2VXNA 4DXVA 3B0UX 4FNSA 3OVRA 2EPHA 2J9ZA 4LY8A 3W7HA 3C8FA 4LS0A 2A85A 1TTJA 2ZQ0A 3TXVA 4BR1A 3BLEA 1DV7A 1TRDA 4C1LA 1F7BA 2BWGA 4JTHA 4UFJA 4PFMA 2ZZ7A 3B0VC 1SZNA 1I4NA 3LHVA 3TJXA 3OIXA 4HNUA 1Q3NA 4MKNA 4DF2A 1EB3A 1G67A 3TXZA 1W3IA 2YZRA 5CSRA 3UWZA 3T78A 2BZNA 3NQFA 3I65A 4IGHA 2Y63A 5A8GA 1GPWA 3NL5A 3SGUA 5DCBA 4JS3A 2QDHA 3WK3A 4LVDA 4RX0A 4FX8A 3G0XA 3W3OA 1L6SA 3F4NA 4IX2A 2Y85A 4NJHA 1JRBA 3M0ZA 2OCZA 1QO2A 3G18A 2QR6A 3B8DA 1HL2A 4DEFA 2B7PA 1P4CA 1SW0A 3GXPA 4CNPA 2YW4A 4RLIA 3DBPA 4DO4A 3P84A 3CEUA 4O8RA 5BNKA 1WA3A 3P5YA 4NU7A 3S9YA 2V5BA 2B4GA 5DXYA 5LNWA 3LBMA 2G5WA 5AYXA 1DVJA 3DFQA 2DJXA 3Q58A 4O14A 1VCGA 4O0KA 3R2GA 1ZALA 1RD5A 4O1CA 4JY9A 1CW2A 4KWVA 1J4EA 2ZFAA 4WXYA 3W2MA 8TIMA 2R91A 4LWWA 1K7EA 4UTIA 3T7VA 4TX9A 1FDYA 4A29A 1P0KA 3THQA 4IMEA 2HS8A 2V8ZA 3W1MA 1OFQA 3W1NA 3PUOA 5BW6A 4JX6A 4PA8A 2J9YA 3UPWA 1OVDA 3OHIA 3S0CA 1KBIA 3ZFHA 2H90A 1ZENA 3P74A 4LUIA 3W75A 4ORIA 3GNNA 1VCFA 1VR6A 3KHJA 4UR7A 1FUYA 5D05A 4JYDA 2XN0A 3S8HA 3HG3A 4NNAA 2DJLA 5G1YA 1O5XA 1YTEA 3ATYA 4DF0A 1IIGA 1L9WA 4DO5A 4OGZA 1GT8A 1SO4A 2QDGA 1QOPA 3MUXA
chains in the Genus database with same CATH superfamily
4OBTA 3LV5A 4E0CA 3OO2A 5KZEA 4MGGA 3CMGA 3VOHA 2PMQA 2Y1HA 3ARYA 3ENLA 1R2SA 3S1GA 5M1TA 1G4SA 3UXDA 1DHPA 1H49A 2QGHA 1UZHA 2ZVIA 3GE7A 1DXEA 1NWUA 2VR5A 3CZLA 1GQLA 5C9WA 3TSBA 4LV9A 4Q4QA 4AYGA 4KWWA 2ZXBA 4I6VA 2IKHA 3TCEA 3B3DA 3KX6A 3TTEA 1E0VA 3LLXA 4R53A 3H55A 3CXOA 3GBDA 3RGTA 3A3WA 3PG8A 4OWGA 2EJAA 2OO6A 3W2NA 3R94A 3GHUA 4AAJA 1CNVA 4E2OA 2OLSA 3EWBX 2VO5A 4F9DA 5DO8A 1TE6A 3OEXA 1AMKA 5E6ZA 2VELA 3RLUA 2QKFA 3H70A 4PMNA 3ZJ8A 1UUMA 3OIHA 3ZMRA 4M29A 5JIWA 2WNWA 2RJGA 5ENLA 4XZ9A 5BU6A 3I10A 3OBAA 3L23A 4FALA 3OG3A 4GJJA 4WEVX 3GNXA 3UR2A 3VOIA 3RRAA 5JBDA 1LM1A 3L2IA 4C7DA 1LWIA 3BG3A 4TMCA 1ADDA 3E74A 5HJXA 2JGQA 5CZSA 2QCLA 4GD0A 1OZQA 2E1WA 2XISA 1UH4A 1XINA 3SRFA 3LHZA 2OLAA 4DF1A 4AD3A 3FS2A 3R4IA 1R3YA 3F7JA 2OB3A 2EO7A 3UGRA 2YCKX 3C6CA 2RH9A 3QV7A 2CLHA 1R0MA 5LGZA 1YLVA 2CZDA 2V2DA 2TRSA 3WQWA 4Z1BA 5M2FX 2PZ0A 3KAOA 1MMFA 1KFCA 2ZA1A 4C6KA 1OX6A 4PMQA 2PDCA 4B5UA 5CC3A 1W5PA 3NDZA 4KCWA 1Y5XA 2VOTA 3G1SA 1OFPA 2GYIA 1JDCA 3LGEA 4FNTA 1YPXA 4Q6XA 4XAZA 1E0TA 3BAXA 1RCOB 1S2WA 4Z42C 2YL8A 4XSLA 2Y7FA 1G7VA 3W1LA 4XAGA 4MSSA 5I6SA 1XFCA 1EP1A 2C1HA 2YX0A 4PFHA 3WEZA 2QCEA 3NA8A 4OE7A 3UR7A 3OB8A 2OSYA 5EFFA 2YW3A 2R9RA 1FWSA 4IFKA 1SFLA 4UFLA 2QCNA 4IG2A 1BWKA 2W63A 5AB3A 5E6YA 1Z41A 1R3QA 1OF6A 2GJNA 2WBGA 3N34A 3G1DA 3JVAA 3B4UA 5FF3A 3UR5A 1WDQA 1KFJA 4Y9OA 4EPBC 4JQAA 1ZPTA 1PKMA 2YIHA 4EE9A 3MZ2A 3PWIA 3UA3A 1QT1A 1KO0A 4MAVA 6ALDA 2QNEA 1VF8A 3E2QA 5LXXA 1HKWA 1NF7A 1H50A 3BJSA 3HF3A 1P0DA 1F4HA 4I8YA 3N73A 4O28A 1XC6A 2BLEA 1C7TA 3BLDA 4A22A 4O54A 2QCDA 3HPAA 1Q7MA 2A2IA 3LCXA 3GLCA 2WSPA 1F05A 4LGXA 4NJGA 1REQB 4FR6A 4XISA 1PZ3A 4UOJA 5M3WA 4RK8A 3WLPA 4LY4A 1EO5A 2H9AA 2YCIX 3IIOA 1JFXA 1XJBA 1UKOA 2WZHA 2W62A 4BEUA 3MJMA 1CXHA 2NX1A 4WRHA 1HJSA 2F6UA 3A4JA 3GQYA 3UZJA 3P67A 4JY8A 1HIZA 4TO8A 4HCHA 1CLVA 2H6RA 4HIBA 4GGBA 2PGWA 4KERA 4RZ4A 2YCJA 4Z1YA 5FA5A 1ZCOA 4A2RA 4UR9A 1XD0A 4UUIA 1BG4A 2C13A 2VEIA 7CGTA 5C2GA 3NR0A 1RCXB 4XTDA 2DZUA 3GS6A 3B9DA 2VFIA 3M0LA 2JF6A 4FZIA 2CEQA 3AOFA 4LAKA 2XYLA 3CZ8A 3EDDA 2R1NA 1BYAA 3M07A 3GY1A 5G4HC 3LG3A 3S5SA 3LCHA 2REQB 1FBAA 4PTDA 5DQPA 4IP4A 2V9DA 3SECA 1PYMA 2OQYA 2WXDM 5LNSA 3AALA 3NPVA 4OKDA 2ATSA 2VGGA 2PDGA 1HL9A 1UD5A 3KWXA 1P7TA 2A0NA 4TMBA 3CPGA 2EAWA 4AWUA 1C29A 1HVQA 2VFHA 3K4WA 5FEZA 3ARVA 1M65A 3M0VA 3ZWTA 4EAYA 1L6FA 3VGBA 4WHBA 4O53A 5G2WA 2A6NA 3NDOA 3FDGA 1S5MA 2VCAA 4RDZA 5HMSA 1ZJBA 4A6GA 2QCHA 1BPLB 1K3UA 3NO5A 4PMOA 3PWGA 2PF0A 3UD6A 1R3VA 3OVPA 4QIUA 1CTNA 1EX1A 1GEHA 4XB3A 2QCFA 3BL3A 2YJQA 4AY8A 4Z0SA 3LBOA 4A3HA 3QPYA 1ZY9A 1DE5A 4KF1A 1JCTA 3VA8A 4E2VA 1Q66A 2PU1A 3KM8A 1G4EA 1RBLA 3HGOA 3TCSA 3T08A 1XGZA 3L68A 3OZPA 3WLQA 5HJYA 1OK4A 3IVTA 1XRTA 3W25A 3DX5A 3E38A 5HXMA 1WUEA 3MO7A 5HINA 1N8WA 4J3VA 1XQKA 2WJZA 3GXNA 5LA2A 4KRUA 1TZ9A 2PWEA 3UQNA 3EXRA 3VOGA 3VM7A 5J5DA 3H22A 2ZUMA 1NIUA 2ZRYA 3WMCA 4K68A 4OV9A 1JUKA 2BGQA 2PCQA 1RHCA 2CESA 1ZB5A 2O55A 2Y2WA 3M4HA 1NH6A 1OF8A 1HNYA 3IGSA 2XIQA 3W86A 3IWPA 5C8BB 5HNTA 1OQFA 3MKVA 3PVFA 3FKKA 4CQAA 5BXRA 2FPVA 1XGDA 2PWGA 4D1JA 4JTTA 2ACUA 2GGHA 4V1XA 1TX2A 3TUUA 3NYDA 3CUGA 1RY8A 3LLFA 1VYRA 3A4WA 3U2ZA 5ABFB 1UD6A 4F2UA 1RPKA 3W2UA 3FAXA 4XVEA 1TMHA 1O60A 4V2XA 3VDCA 1KBJA 1K7FA 1M01A 5DMYA 2OGJA 1EHNA 2ABBA 5HNUA 2ABAA 4M7SA 3VIJA 3BSGA 4MADA 1JULA 2F38A 4JX4A 3UWVA 1OB0A 1LLWA 5H1WA 1NQKA 4PTMA 4LEQA 1K9FA 4XBJA 3FY1A 3SY5A 1PTAA 3HZ3A 3EBVA 2NUXA 2VEMA 3EWYA 3CV6A 4BQ4A 5CLWA 1HXJA 2J7BA 1IT7A 1A5MC 3WQPA 4AW7A 1LOSA 5CPTA 1M68A 3HPFA 1VBUA 2GJLA 2O9OA 1E73M 1GOQA 4J35A 4GXMA 1A5LC 5I0DA 1GQJA 2Y6ZA 3GXDA 4Y6GA 4LCQA 1KFLA 1WKYA 1KBKA 2Q8LA 4ASTA 1VJSA 2I57A 1ITQA 3QZAA 1JRCA 2JGYA 2YSWA 3L9CA 1EQCA 4LUJA 1R85A 3P60A 1V6XA 4O19A 3SJ3A 3KDOA 3VCRA 3EA1A 1WDDA 2VDHA 4CCEA 2PB1A 1UBSA 4DN1A 1QOQA 1FCQA 3WQOA 1P1MA 2O56A 1W37A 1KXTA 3GIQA 1XRVA 3KOYA 4RV8A 5HMDA 1G6CA 1W56A 1ISXA 1CB7B 1CXFA 4G1KA 1J0IA 1D3GA 2DZVA 5AFDA 1HP5A 1VZWA 2VFEA 4GCXA 2WSKA 1BXBA 4UTTC 4C6MA 2NVAA 2ALRA 3D6NA 2J7EA 1SQ7A 5HWJA 2VWTA 1GYNA 3UJEA 4JTCA 2VYOA 1TKKA 4AEEA 1CYGA 3R58A 1QVBA 1XI3A 4LAOA 3O6DA 2PDXA 2J78A 9RUBA 1ODZA 3TSDA 3I7QA 2PEVA 4W5ZA 3TC6A 3PZGA 1E6XM 1CT5A 5GQBA 2IPJA 4ICCX 4J27A 3CZGA 1AZ1A 1KTCA 2ZX7A 3IRDA 1LQ0A 3PJXA 2CWNA 3KBVA 4NRRA 4K36A 4O57A 3LQLA 3NQMA 1R2RA 2XVPA 4LFYA 3UJSA 1P5BA 1OABA 3GFXA 2A21A 3NSXA 3N4FA 1CXEA 1DTNA 5CPMA 2YXGA 3GVVA 2Q6ZA 2OLHA 1XPGA 4YLWA 2ZRVA 4FMVA 3POCA 5F2IA 1LZOA 3V3WA 2QCDB 1DIOA 4QEEA 3KVLA 2XH2A 3NQAA 4KKXA 2O9TA 5IDIA 1I2RA 3ARRA 1DORA 4C1KA 3B8WA 1XYBA 2A3BA 3I4KA 1V5XA 3K4AA 3PFRA 3SGGA 3WDQA 4DYEA 1WPCA 3B9EA 1KM2A 3OHMB 3B4YA 4NAEA 1RQBA 3XIMA 3HQ1A 1PJ9A 1UR0A 2V5KA 3FV9A 3W6YA 2W91A 4NZ5A 3B40A 5BRBA 4JIEA 2QDDA 4GCAA 2F6KA 3S9ZA 4AEOA 1ODUA 2ZUSA 3KBJA 2BXVA 3T8QA 3G1VA 4IJCA 2Y8VA 2YBTA 2VC6A 4NRSA 2IQ0A 3MC5A 1I6NA 3W9ZA 3WD1A 3ZM8A 3L2LA 1K77A 3NZGA 2GDUA 4PMDA 3WD3A 2XVKA 3G8RA 3ITVA 1TPUA 4JTEA 4GWEA 3CUIA 2JKAA 2EG8A 3RYSA 2GUBA 1EDGA 3P6LA 3GIYA 1IF2A 2QAFA 2XJ7A 2G3IA 2BFGA 4W93A 1OCJA 1QK2A 2RAGA 3VI2A 3VDBA 4IXHA 2ZA2A 1VLWA 3FVMA 2VX5A 1P7TB 4MHBA 4DO6A 1XKYA 1DIEA 1U83A 2ZTJA 4F0SA 2EGZA 3LCGA 2Y4SA 3VD5A 3WKZA 1P0NA 1XDMA 2ISWA 5E9AA 5F4WA 3U0HA 3NL3A 1TR9A 3A5VA 2PUZA 1AQ0A 2FMNA 5T9BG 4YHEA 1KRBC 2DSUA 4X3ZA 4PL1A 3PP7A 4OZOA 5HJLA 4PCTA 4JBRA 2EQDA 4MNKA 1OGGA 3TAKA 3NOEA 2Q71A 1UWUA 3W0KA 3GNRA 1JPMA 2R1MA 5EBUA 4ZOCA 4B3KA 2HE5A 3DG6A 4IIFA 2GFTA 1UA7A 2GSJA 2Z1XA 5HK4A 4ZTYA 4KEZA 3URQA 4Y90A 3HV9A 2WKLA 4C7FA 1MW1A 2ON3A 1EEPA 3EWDA 4MUPA 3L2MA 3ME3A 2FFCA 1PXGA 1B3WA 1X7FA 4UMCA 1RUSA 1VPXA 3PULA 1GOXA 3W27A 1RD6A 1SSGA 5BRQA 4Z17A 2CZFA 4ZXLA 5DCDA 4L1XA 3QLDA 1HW6A 4PEEA 5LSMA 1BXNA 1CIUA 4LVFA 2IQTA 3QZ6A 4FNQA 3FJLA 4KW2A 3JZEA 1ZQ5A 2XIOA 3LY0A 2PRHA 2PFHA 3KBMA 3ZJ6A 2PBGA 3D46A 1DBTA 2Q3OA 1QNPA 4XAPA 1RP8A 3MBDA 3U9IA 1W9VA 2X40A 1QNOA 5D9NA 4D6IA 1GKQA 1JYXA 4GJ1A 3KL3A 3NZRA 4TTUA 2PTDA 5U7SA 4YTSA 1GVQA 3KTSA 4IF2A 4MWAE 4AY1A 2IUZA 4LNYA 4L4PA 3WN6A 2QHAA 4REQA 4ZZ9A 3N2TA 2XGBA 3NYZA 3TC3A 4AMCA 1FRBA 3HN3A 5AKQA 3OJGA 1B3ZA 2OOFA 5CSUA 5JXQA 4HGXA 3BZJA 3WDIA 1TIWA 1IT8A 1E4LA 5L6UA 3MP3A 3TTYA 2E5DA 2ZRXA 1NQ6A 2CZ5A 3T4WA 5D9MA 1EBHA 3LUTA 2DT1A 2H8ZA 4KCUA 3ZLHA 3KCJA 4HYVA 1BKHA 4Q4MA 3A13A 1QRQA 2Y24A 4C6EA 3QMTA 3FYOA 4NF7A 1MRAA 3MSGA 1MZRA 4EXQA 3G77A 4X22A 3SCNA 1JGIA 2FB2A 2WWDA 1L8NA 1A5UA 1HKMA 1IWPA 4N4QA 5D9PA 2FMOA 2VC9A 3LXBA 2OXNA 2FYMA 3EWWA 1VJZA 1C90A 3CZJA 5D32A 4B91A 2GWGA 3IUHA 1NDYA 3S6DA 2PDUA 2YA1A 3I7RA 3LK6A 3CIWA 3LLDA 3L4WA 1B30A 2F9RA 3O6CA 1V0NA 3TX9A 4UTMA 4L64A 3LHWA 4XSMA 4ATDA 2PGFA 1NDWA 2QJIA 3IK4A 1V08A 5FSEC 1A47A 5A8PA 1UQZA 1MW2A 1FKWA 1RA5A 4ROPA 1WOBA 4GBDA 2FGBA 4QBXA 4DWDA 1I45A 3S1XA 1E40A 3EEZA 3UXKA 3PBWA 1FKXA 3A23A 3EOEA 3RM8A 1JI1A 5DXXA 2XIBA 4IGNA 3WF0A 5I3GA 2B0MA 4H1ZA 5LKYA 1UPPA 1SMDA 5ABEA 1M03A 4J3ZA 1R8LA 5HMFA 4JKMA 5TAOA 4DZIA 4GNJA 1B3VA 5DY2A 4ZTXA 2WHKA 3QZEA 3S5ZA 3DU0A 4HMNA 4D6HA 1TJRA 1HZYA 5FL1A 3OZMA 1Q45A 2XPKA 1LRNA 3EA3A 3THAA 1NOFA 1SUXA 3OZOA 1UP2A 1EHAA 4GYKA 3HQOA 3CL7A 3CASA 4GX8A 2PSNA 2J9XA 1NSJA 4KEUA 3GTFA 3R8RA 3O15A 1Z69A 1LBFA 2E9LA 4Z2JA 4AZ7A 4X63A 4LYQA 2QMJA 5IOBA 1UR8A 1ZHAA 2XU2A 4BWLA 4L9ZA 1WKFA 4K1GA 3MBFA 4YNGA 1ADOA 3GC5A 4ICNA 2V2CA 2IPGA 3GO2A 3R8HA 4CNOA 4HP5A 3FHQA 2CBVA 1XRSA 4FLOA 3N18A 1V8EA 4KRTA 3AS0A 2NV1A 2PURA 7TIMA 4JXCA 1VBHA 1LBLA 2DUXA 3QR3A 3MI2A 3UZZA 1TZZA 3VIIA 4JTKA 4JN6A 5BMXA 1VLIA 1TWSA 4O17A 4XZMX 3LV6A 1I0DA 3C8NA 4O1BA 4HPNA 5FJOA 1U33A 2V63A 3TNBA 2G3JA 2I1OA 5A8QA 4LCRA 2X1RA 2INZA 3GVRA 3N1AA 1N8IA 2E25A 3EA2A 3G6LA 2OZTA 4N4PA 3DGBA 5BRPA 2W3ZA 5EGRA 4OUEA 4C90A 3UY7A 2ZWYA 4QCFA 1IR2A 4GI8A 1VYPX 2CHRA 3TYBA 1YE6A 1GOKA 4I7VA 4OVXA 3B04A 5A6TC 4UMAA 2DZXA 4IPIA 1OC5A 2HVOA 3N2OA 4X0VA 2WMIA 1ELSA 2QV5A 2PC8A 1OIMA 3TYEA 4UQEA 2EKGA 4JFVA 3G0SA 4ACZB 4HD5A 5A3HA 3AZRA 3E0WA 1HT6A 3ARZA 2YA2A 2GQAA 3BK0A 3GC4A 2BSLA 3QJAA 5CBBA 3TOPA 3W7RA 2R8WA 1N82A 5JH1A 1KB3A 1VIZA 3SY8A 4M1BA 4O8AA 1UWTA 1V3IA 1D7FA 4JQ4A 1NELA 3GG7A 4AWTA 2XVGA 2QXWA 2YOCA 4I5RA 3CU2A 3UCQA 3CO4A 2UV8G 4GQQA 3PS7A 5REQA 4Z2LA 1TMQA 3HBLA 3E6EA 1F74A 5EB8A 1KGUA 2X41A 1T7LA 3LRMA 3HTWA 4O1EA 4X9YA 3SIZA 3G8EA 4F0LA 2V5CA 4F2BA 2CNCA 3BXWA 5BU9A 2BOEX 3AQUA 2BG5A 4R7JA 1ISZA 4BF9A 1X96A 3E0LA 2B31A 5B80A 1FWCC 4KIEA 3W70A 3WBWA 1OX4B 1TWWA 4GZJA 3WLJA 3DH7A 4KMQA 3ZR5A 4QAIA 4R5EA 5AHFA 3MPGA 2JQXA 1NWTA 1CLKA 2D2HA 1ONEA 4UMBA 4NILA 4A35A 1E6PA 3N6HA 1EZWA 5CAHA 2RDXA 3C2EA 1KM4A 4KGLA 2B7OA 1DXFA 1ECQA 4UFHA 1QMLA 4QISA 4JZ5A 4QM1A 5AHMA 4Q6JA 1GTHA 4FX6M 5FF4A 1AFSA 3T2OA 4DBWA 1OEPA 2E4TA 3PPHA 2D2JA 3WYZA 4MM1A 1C93A 2XZ7A 3E2RA 2QIWA 3UW6A 1E9LA 4H4IA 1KCLA 3ABXA 3GR7A 5I3JA 2F84A 3ARXA 3G24A 2D73A 2PDWA 3C4UA 4WKFA 3LTYA 1JZ4A 4JNZA 2RGLA 1E6ZA 2F6XA 3BICA 1H3GA 1V7YA 1TPH1 1U30A 3QRHA 4R85A 4Q4PA 2HRWA 4JAWA 3BV4A 1D3HA 1OG0A 3PZVA 4GY0A 1FOBA 1ADSA 3EKLA 1UD8A 4S3JA 3ITGA 4JIQA 2V5LA 1G69A 1XW8A 2DQWA 1AD4A 3O9NA 1V3MA 1LROA 4REQB 4PMXA 4A05A 4QROA 3W7KA 1UA3A 3W87A 1VFOA 1SVDA 3HQNA 2HBXA 1W1TA 3ERPA 3BO9A 1UUOA 1GJPA 3W73A 3GDBA 4R7OA 2C71A 4GC4A 2CIPA 2G96A 3ALGA 3S5YA 2VZTA 1PDZA 1GKPA 1CX9A 5G4EA 3RO8A 4B9YA 1CXKA 1F07A 2SFPA 3HFTA 4RKAA 4DELA 5M03A 2HTMA 3MI6A 4GG9A 1VPYA 3GFYA 2INEA 4C6FA 3OLDA 5DMMA 1VKFA 3KXQA 2WSRA 5T8GA 1HKIA 1FHLA 1A5OC 3CEPA 3QOKA 3T8LA 1TV4A 1BD0A 4HOZA 5DRCA 1F9CA 4B3LA 2GZXA 3UEQA 5I07A 4HPHA 1DJYA 5AHEA 4M56A 1C8VA 4AXKA 3AIRA 1XD1A 1QNRA 1Z32X 1LRQA 3ITCA 3M46A 3BOLA 4JN8A 3NL2A 3MI3A 3GVGA 1PKYA 2W27A 1J10A 1THFD 2WMKA 2WPBA 4LBRA 1Q7QA 1RZMA 4TIMA 3VZYA 3F5LA 3Q65A 4IQDA 2XM1A 2YL6A 1T41A 3GUGA 2WO5A 4TX8A 2C1GA 4WF7A 1RY0A 2E0PA 3QGAC 2FIQA 3H26A 5JU6A 4B5VA 3LOTA 2FZMA 1X98A 3WIJA 4Z1CA 1DQXA 2QUMA 4CN4A 3TW7A 4DRSA 3RPMA 4F4RA 4I3GA 8A3HA 5ABTA 3D47A 4M6PA 3WQFA 3O2LA 1JG9A 3JR2A 4W88A 2B7QA 4GIRA 1QWGA 1QCWA 1XLJA 1IEWA 4KT2A 4WR3A 4N0RA 1JAEA 1P43A 5CGQA 4AHPA 4N9EA 2WKJA 3A4AA 3VK5A 3KWSA 2MUCA 1MQPA 1W9DM 3KUMA 1ZSXA 3CPRA 1UWAA 3GG1A 1JCLA 3MKCA 2ISSA 4RL3A 4LF2A 5EU9A 3ZT5A 3K30A 3M0HA 1UZ1A 1P1XA 3A5FA 1ZAHA 4F40A 4UTFA 1EA0A 3G1FA 3HGRA 3P93A 4ZGYA 3M0JA 3VO0A 1IYXA 4CN6A 4ZB0A 1D9EA 1CPUA 4GNVA 3IK2A 2AQOA 3OVRA 2EPHA 4LY8A 3SIMA 3W7HA 2A85A 4CCZA 2ZX5A 3TXVA 1DV7A 4IMAA 4HZMA 1TJ2A 5A8NA 1TR1A 4LB3A 3QQWA 5M5DA 3B0VC 4XD6A 1UWRA 4K8GA 1SZNA 1I4NA 2D3LA 3EPOA 3APYA 4C6DA 1W3IA 2YZRA 1M7JA 3B8TA 3N13A 1C7SA 3APTA 3NQFA 5I2UA 2DGAA 2FH8A 3OTRA 1LWJA 5DCBA 3WBAA 2Z1WA 2QDHA 1BFNA 3W3OA 2BV9A 4HYRA 1QO2A 3OPSA 4CNUA 4DEFA 2JF7A 4W86A 1SW0A 3WH7A 3GXPA 2CHOA 3REQB 2VT0A 4K1WA 4ZR8A 2YW4A 4RLIA 2VRJA 4HA4A 4DO4A 3S46A 1YX1A 2WMIB 3HFYA 2PDMA 1VFSA 4XD4A 5AECA 3AMCA 2G5WA 4S3BA 2VR4A 2DJXA 1FWEC 1W3LA 4O14A 2VUYA 3N4EA 5FD0A 1RD5A 4O1CA 1B54A 4NZ1A 1CW2A 3LN3A 1NDZA 3PPCA 1CGTA 4QG6A 2R24A 4WXYA 5D8ZA 2X0YA 4GYPA 4A29A 2YCLB 1F8MA 3ZVHA 3TOYA 3ZT7A 2V8ZA 4JX6A 3LEPA 5BWAA 3UPWA 3OHIA 3S0CA 3WH9A 4LUIA 5T9CE 3GNNA 4UR7A 1FUYA 1F3XA 3IPWA 3HG3A 5LXEA 4NNAA 1IIGA 1L9WA 3SUSA 3FGCA 1SO4A 4P8XA 1F4AA 4D6CA 4LUTA 2J7DA 1UROA 1DJNA 2TODA 1TV7A 2A7RA 2G0WA 1UKTA 2WV8A 3BDKA 3DC0A 5FJJA 1R3RA 1V03A 4LAMA 4CEXC 1Q6GA 3SN0A 3D0CA 4UFMA 1EJSC 2DVUA 4V27A 1H7PA 2GQ8A 1E1CB 2B81A 3FW6A 1LF1A 1E4MM 2E68A 2ZTKA 2DT0A 2P53A 4NNBA 5TNVA 3KRBA 3O0FA 3O6AA 4DZAA 1XIGA 1FH7A 3A9IA 4H6EA 5CXPA 2D69A 1KV8A 4UFIA 3SUTA 3E5PA 3SCTA 2V68A 1KCKA 3DFHA 1VEMA 2IW0A 4OTKA 3QTPA 2WKGA 1S2VA 4W9TA 4LUSA 2VD8A 3W7DA 2CCRA 1KXQA 1XC4A 3ZSTA 1ECEA 1E1FA 2D22A 1VPQA 1AMYA 3R79A 2E77A 1EJWC 4Y96A 3UWWA 3V5FA 3IIPA 4UQCA 4PTNA 3KTXA 1UKPA 4LX4A 4LS1A 4X2RA 4LC6A 4NX0A 1UH3A 1FWRA 4E2DA 1DJHA 1BHGA 2QQ6A 4RXGA 3WF1A 4YTTA 3HG4A 2XN2A 2BVYA 4LS2A 1IHIA 3E1F1 2HROA 2RJHA 4W87A 4ZB2A 1XIJA 4GK8A 2J25A 3U2CA 1GK8A 5CBIA 1V6TA 3IVSA 1QAPA 3G1RA 3IANA 4QDMA 4C6BA 3MWCA 3VM5A 3LCIA 2WM0A 4UZUA 2XIJA 3CL6A 3DFPA 3LNMA 1GONA 2OFJA 1PPIA 4S3GA 1ITXA 4XZLX 1Q2RA 1NM9A 3II1A 4W7VA 1MUWA 5CZ0A 3P3BA 1RP9A 4RPQA 3T1GA 4BZYA 2ACQA 3BMXA 1EA9C 4JTRA 4AC1X 2KAUC 3VXGA 3U4FA 4MLJA 4CD5A 4WVXA 4ONVA 2VX6A 1SO6A 3VGEA 4EAMA 1AJZA 1Z6KA 1T5AA 4NL1A 4I7WA 1J93A 1UP3A 3W88A 4NI3A 1DYSA 3CQKA 1EC7A 4QJ5B 4O1DA 4Z0JA 3O07A 1ZJHA 5D30A 4PCFA 4G8TA 4JTJA 1W3NA 3GG8A 2XWDA 1DOSA 1LJYA 3EOSA 3KFTA 4HZ6A 2ZE3A 9XIAA 2DZSA 3GH4A 4MPKA 2JALA 3W26A 3S2LA 3BANA 1Q4WA 4AYSA 2W9MA 1XIMA 1YNPA 3WDJA 1W5NA 2AMGA 1I2PA 3C0QA 3IUDA 1B1YA 2WHLA 2FZ8A 1MXSA 2C14A 3CL8A 3GAYA 2GQ9A 4YTRA 4H7ZA 1QNSA 2IXVA 4Q8NA 3QR0A 3H23A 2WAGA 4WK9A 1A5KC 3V5OA 5BMWA 2ZX8A 3C3NA 1MXGA 1AQMA 4W8AA 4C60A 3GVWA 1HKKA 1W1ZA 4PZVA 3COTA 1TRIA 3V1PA 2INFA 3G6MA 5EFDA 2J4GA 5ECUA 3R0KA 4U10A 5C9RA 3IEBA 2XG9A 2ZX6A 4QNWA 1F5ZA 1FX6A 3NCOA 2F2HA 1KNWA 3GAKA 5C2CA 3RF9A 2WC7A 5KITA 1H5YA 4Q4SA 3TTQA 2WM1A 1NFGA 3TZNA 4B4FA 5A6SA 1RVGA 1OFAA 4KWOA 3VNMA 1RBAA 1JF5A 1K8YA 1M41A 3GD6A 3W1UA 4FXFA 3W38A 1XLMA 3NJ3A 3FX4A 1RJRA 3T0DA 4WDTA 3TNOA 3LCFA 4MNJA 2I17A 1S5VA 1XICA 3TTOA 4J5NA 1BRLA 4ALDA 4M19A 3WEOA 4OOUA 3M6YA 3ZZ1A 3QYQA 1OC7A 3ITYA 3RMEA 1EOKA 2YB4A 3ZJ7A 3AJ7A 3R89A 3WQ5A 5KZMA 1SW7A 3ARQA 3NTYA 4L4MA 3WBYA 3NQ6A 4OT7A 3TYZA 4PCNA 4AZCA 4J40A 4GO8A 4MJ4A 1JAKA 1BF2A 1O5KA 4BI7A 5FCZA 3LHTA 4FP1A 1H2JA 1KFKA 3U7BA 1Q4NX 1JD7A 3C2VA 1PEZA 3T55A 3S1UA 3VC5A 4RV3A 5D2YA 1T96A 1DQUA 2GOKA 4XK2A 2OYKA 2VHLA 2OMAA 3HIJA 2BX7A 4L6HA 4MPQA 1KLZA 4XBKA 4ZE4A 1GWJA 4MG4A 2NV2A 3OLGA 5FF2A 5DRIA 4FIRA 4HQVA 3T05A 3WK2A 3FSUA 3GSMA 3ZVHB 3CHFA 1T99A 5EKYA 1PAMA 1UC4A 1HO4A 1NAL1 4H8NA 4WY0A 2Q09A 3T9PA 1J0YA 1VH7A 4HN8A 4PMUA 1U1UA 3WENA 1OCQA 2PLJA 1BTMA 2QW5A 1H60A 1JDFA 1U5HA 1M6JA 3VDAA 5BOEA 5A2AA 2GWNA 1GYLA 3WLHA 1OJXA 3TYDA 1CEOA 4YXGA 3VMNA 1XLFA 2P0OA 3NQBA 3W2JA 2WZTA 3MHUA 3WF3A 2BXYA 3N04A 3CIXA 4DBEA 5I7GA 3WJXA 1K9EA 1XHGA 5HPOA 1SFSA 4PR4A 3DGRA 3OODA 1FDJA 4LYPA 1BG9A 2KZHA 1U22A 1FWTA 2PAJA 5JUVA 2HXTA 4GQ0A 2Z26A 4FIQA 3GHSA 2PDYA 3WX7A 3VIPA 5HR7A 3TQPA 5I3FA 4AXNA 4WDUA 1OCBA 3SJNA 5EBAA 1G5AA 1Q63A 3M47A 1GYMA 5HQLA 2C91A 3LCLA 3O8AA 3JU2A 4B16A 4I6KA 1SJAA 4PUDA 3QW3A 4ZQMA 4D1IA 1HJUA 4W7UA 4EANA 2P3ZA 3ZT6A 3NAVA 3PNUA 1UB3A 4OQVA 2BXZA 1QOXA 5DT7A 3NZQA 4NSBA 4ILSA 3MUIA 1GZ1A 3BVJA 3MCNA 4AD4A 2FHFA 4HZ8A 4JCMA 4M81A 3WFZA 3L4XA 3RRXA 2ZCGA 1U1JA 1SFTA 3TYAA 4R88A 1OFRA 3QMRA 4JFTA 5D38A 3MMTA 2ZWZA 3GUWA 3TFCA 5C9UA 2ACSA 4IGSA 3JRKA 3LI1A 1IXQA 4PEKA 3WNLA 4M7TA 4AQLA 4HPJA 3TAOA 1QHOA 3AIVA 3VOFA 1EWDA 1JEZA 4GVGA 6XIAA 3OQEA 3NGFA 5LGXA 1EWEA 5K9DA 3VCCA 3RJXA 3CWNA 3P5ZA 2GGEA 2Z25A 2VEFA 3SO7A 4K39A 4EPEC 1P6CA 2AQWA 2DEPA 1BVZA 1OY0A 1K1DA 4H8UA 3CJPA 3DHUA 3I3DA 4QLLA 5F1UA 3F5JA 1HTIA 3EDFA 1OFBA 3AXIA 1V0MA 3N19B 4WSJA 1KTBA 4IJBA 4CQCA 3VZZA 4BWLC 1A3XA 3GW3A 3OGVA 3PZQA 4GIAA 2V0TA 4AFYA 4S2CA 4Z2GA 3UERA 3K5XA 4AIEA 3GDKA 2XVNA 1EL3A 4FNUA 3F2CA 3QXBA 1EPXA 5C70A 3USBA 3IJIA 3EX6A 1FA2A 2J7HA 1YE4A 3NPUA 4U3AA 1RLDA 3TJ4A 3WFLA 4BY3A 4BFAA 3E0VA 2G41A 3VNZA 1W2PA 4X0NA 3MMUA 3TQVA 5GNYA 2YXOA 3B0PA 3LMZA 1LQAA 4W85A 4R9XA 3CYJA 3MHGA 1XLIA 5FJUA 4DIAA 1E71M 3TA6A 4JHZA 3W74A 4CLMA 1GKRA 4UQAA 1I2QA 5LA1A 5HWMA 2OKTA 2TMDA 4U2YA 5EMMA 1ML1A 3BARA 4LVBA 3CK5A 3ZR6A 3N4AA 1H51A 4H01A 4P8VA 4Y9PA 2NVDA 3UNTA 2CW6A 2H8XA 1NOWA 2QEZA 1AODA 4NI8A 4A8NA 4BQ5A 3QF0A 2I16A 1HKVA 3OA3A 4Q4OA 2A3LA 2NSOA 4OV4A 2XSXA 1PX8A 3FLUA 5A6LA 2X05A 4ZMGA 4MB5A 2IMRA 3BMVA 1RA0A 4C5YA 4Q7NA 3QQ0A 1VQTA 3G5EA 3PNZA 4J3WA 1LP6A 1CXIA 2R1KA 4PODA 4LBUA 2VX7A 1B4KA 3WY1A 2O7QA 1JNDA 4TX6A 4IHCA 4QAWA 3A3XA 4TTGA 4U31A 1Q65A 1Q13A 1OD8A 1W9XA 4O1AA 2NWRA 4YCPA 4AZCB 4HHHA 2OELA 3B8SA 1YXCA 1E4IA 2DZTA 2CBUA 3A6OA 3S2CA 2Z7KA 2XINA 2NT1A 2Y8KA 1FCVA 3VIKA 4G7FA 4W89A 5L9FA 2QJGA 3MB9A 2PDBA 3LXCA 5GJMA 5BXTA 4IXXA 3SI9A 1ZP3A 2EPOA 4JTUA 3GKFA 4H19A 3URBA 2GOUA 4Q8OA 1BEUA 1XYLA 2W92A 1T0OA 3TKFA 2FPYA 3BQ5A 1CB2A 3WDHA 2WWCA 8XIAA 2ZXAA 4JIIX 3OOQA 3QY6A 3E0IA 3VTRA 4AZBA 4S3AA 5I09A 3N2XA 2ICSA 1S39A 4ICMA 1SR0A 4WY0B 1XCFA 4Q7BA 1PTGA 1JFHA 2DZWA 5EYWA 4DB7A 3PUGA 1ZCCA 3KOFA 4TVCA 2UBPC 2I5GA 3WD4A 4WOQA 1JYNA 1NEYA 3KOZA 4DBSA 1PKLA 1K7XA 2Z4GA 2OSXA 3BAJA 1ISWA 1RALA 4F79A 3T44A 1IV8A 3S5NA 5HQMA 1RBOB 1XYAA 4R7WA 4CD6A 4O1FA 4QE1A 3BCJA 3TMQA 1IIHA 2GUUA 1OFOA 2A4AA 2QT3A 1DWHM 1HP4A 3W24A 2D23A 3IJ9A 3W7MA 2NWSA 5CJ5A 1Y8BA 2E6YA 1M53A 4G7EB 1O1ZA 1WXZA 4URIA 1US0A 3SDOA 1HJQA 2PBOA 3PK7A 2GLKA 3MDUA 4E8GA 3HPSA 3GR8A 3PZOA 4I90A 3GZ3A 1MEHA 2PDQA 3PTKA 3PWAA 5CZKA 2G3MA 2AQVA 1BVNP 1SZGA 3CQJA 5IDZA 4N9BA 1TTQA 4K8EA 4EK7A 1SW3A 3ARSA 4HJFA 4X60A 1R7AA 1DPMA 1DJIA 4O0QA 4YVVA 4IOTA 4Z08A 4AISA 1QTWA 1NOUA 4YL2A 4HBKA 3RG6A 2V30A 4PB4A 3QM3A 2PWDA 1UKQA 4US6A 5D2XA 1S2UA 2OSWA 3KBNA 1QO5A 4DHGA 3NO3A 3RX3A 4FOUA 3KE0A 2QUUA 2BGSA 4NX5A 3POHA 4FI4A 4XIAA 1UR1A 4J3XA 5I3KA 5HQEA 3RJYA 4ERGA 1WZAA 1TWZA 4XZNX 2NLIA 3MWAA 2QIIA 2AL2A 5D37A 4AIUA 4P8UA 5CCZA 3WNOA 4YYFA 1E15A 3MYPA 1DJZA 1IR1A 3DI0A 3CHVA 3UPMA 4L1GA 1W32A 3BSMA 1FY6A 3L12A 1Z9AA 3WCZA 4MWAA 1PIIA 3WLTA 3CLMA 4DJFA 4DWSA 5G2HA 4HTBA 1PYFA 1PHWA 3ZO9A 4I9TA 2J8TA 4B3ZA 3CUXA 3AUJA 3JW7A 3RK8A 1SZFA 2I14A 3WLIA 2A3EA 4U5KA 4AWEA 4UQDA 1PCWA 4CQ9A 1VEOA 4JN7A 2QPXA 3LSBA 4A2SA 5A94A 4XO6A 1DIKA 5RUBA 4C6CA 3QW4B 4JCLA 4BF5A 1XV8A 3NVTA 4GJIA 5A8MA 1B3OA 2OJPA 1IGSA 2FB3A 3NSNA 3W1XA 2DDXA 3ITOA 3L66A 1GTEA 3B0XA 5IHSA 2WNZA 4S3FA 2Z1BA 2XGIA 3T42A 3VIMA 5IHRA 1K4GA 3W7QA 4FXRA 4O0ZA 2AKMA 4JEQA 2NXIA 7XIMA 2RDWA 2BY1A 3CM4A 3CZKA 2ZDSA 4YYCA 1GVEA 2A5HA 2ZRZA 1JQVA 4NUWA 5HUPA 3ABSA 5C54A 3OVGA 3AYVA 2WNQA 4RE0A 1DWIM 2QPSA 3N11A 4LYKA 5H91A 5FAJA 2P1FA 1EYWA 1W3KA 3R43A 1ZLPA 5D2WA 1Q2SA 5MKGA 1RSCA 2HZGA 3AISA 1GVIA 3V18A 4ZB5A 1DJWA 2C15A 4DNHA 3H8AA 3U4AA 1E4NA 3WLSA 3BPWA 3DCPA 2WNNA 4HPGA 2OWWA 3RLGA 3GH7A 4ZOBA 6XIMA 1TA3A 4PULA 4GYPC 3H2FA 3N9RA 4PMJA 1AA1B 4UZSA 5DX7A 1B2YA 1XLCA 2CXGA 2E8ZA 3IJDA 4M24A 3QH2A 2GGGA 2HVMA 3BOFA 2R94A 3W07A 3M0XA 4EPDC 2EG6A 2NQHA 4PYSA 3MCMA 1XLHA 3SCSA 4YWIA 3SCPA 1W6TA 4QHRA 4MJMA 1KA9F 3T40A 1L0PA 1RAKA 3QC0A 4ENLA 1OX5A 5AHLA 4QLJA 1K02A 1J18A 2Z28A 3GB6A 1M04A 3RR1A 2Z1KA 3VGDA 5A69A 3ABZA 1LORA 1EQPA 3MDWA 1VS1A 2Y88A 5AZ1A 4H2HA 4ZE5A 2WLYA 3WUBA 1EOMA 3GG0A 3HJZA 1ITCA 1ISVA 3WH8A 5EA9A 1UWIA 2V5JA 3N2MA 4QR6A 1Z7AA 4ACYA 4GI6A 2D0HA 4KFOA 2WMJA 3UCDA 4O11A 3TQ0A 2FGZA 3T07A 2Y89A 1E51A 3A47A 3ZOAA 3PSWA 4UFKA 1K8CA 3CUJA 1R9YA 1W91A 3HQPA 2NVCA 1EC9A 3L65A 1PV8A 4ADTA 2ATMA 4PL2A 4WD0A 2E09A 1JCMP 5DELA 3LPPA 3AXHA 5BXPA 2C79A 1IXNA 4B4HA 2Z6IA 2GUYA 4FXSA 2Z24A 4PUNA 2OTDA 1KGWA 2PTYA 4IMGA 1S3TC 3LRKA 3NURA 3VDGA 1R6WA 1OK6A 2NZLA 4WKHA 1QPKA 4H7CA 1R30A 1S2AA 2J13A 3GR4A 4C5ZA 2VL4A 3ARWA 5CPSA 1C8QA 3UXAA 3CPUA 3FAWA 1A50A 1A5AA 4EKJA 1G4TA 3LENA 4TR9A 4H7VA 3CGTA 1JZ6A 1R7OA 1WZKA 4DX3A 2WJEA 1JI2A 3RCYA 4ZVJA 1IEIA 4H9YA 1VYSX 2VEPA 4N9CA 5K9CA 5C7VA 2PZNA 2VGBA 3RAOA 1JZ5A 2OT1A 3KZSA 1LL6A 5KZDA 4WDWA 3FVDA 4NT0A 4MWAD 4JQ2A 3PR2A 1E55A 4CCDA 3Q67A 1BSLA 4KIRA 1OYBA 4LAUA 1E70M 3MJYA 1JL8A 4DJFD 1JVNA 4DWSD 3VIGA 1LUCA 4GVIA 3BC9A 1W9UA 5H8UA 3GNDA 3OBEA 4N42A 5G1MA 2YLAA 1AL7A 2FZBA 3BW2A 4ZCWA 3WG6A 1YDNA 4PTWA 2HNHA 5AZ0A 3UG8A 4H9XA 2ZA3A 3PZIA 2OX4A 1EGVA 1WO2A 2WQPA 2G97A 3W81A 4UXDA 4H41A 4RE3A 3GZAA 3WMSA 2J8GA 2WVVA 4XKYB 2GK1A 4YPJA 1V3KA 3H12A 4HNNA 5D4YA 4X61A 4TUFA 4YVXA 2OO0A 2I7GA 5EMJA 3LM3A 1UJQA 1PSCA 2ZC8A 2CKRA 4RXFA 4K7VA 4UTUA 3DHDA 2BVTA 4PUUA 4AIBA 1RQEA 1E6RA 4PN2A 4I9JA 3N6QA 3VOJA 4IGMA 6ENLA 1LBMA 1V0KA 3B8IA 3EOOA 1ZNNA 3U5UA 1KM5A 3QSTA 3BTNA 2J77A 3TW9A 4HHMA 5DANA 1O5QA 4HCLA 1ZGDA 1ZBWA 4ZQCA 3DERA 4UNLA 1KR1A 1TG7A 1R38A 5EMLA 5CC6A 1N2VA 1E56A 3L7RA 3C52A 4KRZA 1BF6A 4QX4A 4JYFA 1CDGA 3ARUA 3C61A 5FL0A 3KBSA 4GI9A 3N9KA 2PDKA 1QW9A 1XISA 3O3RA 4IX0A 3K2GA 4A4AA 4TV6A 3W2KA 4DO7A 2VFFA 5E9XA 4D8LA 3HGSA 5E0CA 1B5TA 1OC6A 5KEZA 2GJXA 3P7YA 1WBJA 1H7OA 1TTIA 2NXHA 1U5JA 1R3TA 1QXLA 3WQGA 3MHFA 1R5YA 3RU8X 2E7FA 3UG5A 3WBXA 4W8LA 1J8VA 2HK1A 1UMYA 3QGKC 1TJ0A 1F6PA 3R0UA 1AJ2A 2FHCA 1DWAM 4NZCA 5A5WA 3EDJA 1CI1A 4UTWA 5CZTA 4MNMA 3NNTA 1GQKA 2HMCA 2ACRA 4CEUC 3GTXA 2X1IA 1E5JA 2I56A 2JKPA 3PPGA 1GUVA 4PMYA 3O7UA 5B7ZA 4GY7A 3ZSSA 5FSDC 3ABOA 1FWNA 1AK5A 5DMLA 5GNXA 3WD0A 3ZS4A 3OYXA 1XX1A 3HG2A 4PGLA 4Q4KA 3O16A 1TYGA 1O1HA 1SJCA 1K9TA 2X16A 2OWCA 1UZDA 1OADA 1J0HA 2BY2A 1XYFA 4ZO7A 4Z1AA 3NOYA 4QNEA 1GOWA 4WGHA 3KLLA 2QVNA 2J6VA 3U7VA 7TAAA 4H6QA 3B0UX 4JFWA 4FNSA 3ARPA 4QDPA 2G4FA 3BLEA 4B5XA 3WF4A 3KP1A 1AUSL 3A4XA 4EPKA 3NFUA 5JIPA 3VFCA 3CTTA 4JTHA 2DIEA 3RHGA 3WDRA 2ZZ7A 4F0HA 1TA3B 3FA4A 3LSCA 3PANA 4MKNA 3THDA 4DF2A 4HNUA 3KEHA 1EB3A 1G67A 3VD7A 2YBVA 4BQ2A 1QK0A 2OEJA 3OG2A 3AS3A 5A8GA 4BEQA 4NHVA 1QU4A 2PD9A 3W02A 4E3VA 4M1RA 1NFPA 1XGEA 4IZGA 4LVDA 4L1WA 3TA9A 3B9NA 3R7MA 4FX8A 2RGMA 4GVHA 3F4NA 2O0TA 2Y85A 1JRBA 3M0ZA 3UJ2A 2BVDA 2QR6A 3B8DA 1ZRQA 4J7RA 1HL2A 1PX3A 3S2NA 2WVUA 4CNPA 1S38A 3UCCA 1J5SA 3BSHA 4IIDA 2R1PA 3P5YA 4NAFA 1H0IA 1ZBCA 2B4GA 4WLCA 1LT7A 4Q8WA 5FJTA 1BLIA 2OYMA 2PGEA 5AYXA 2R1LA 6CGTA 3QKEA 1DVJA 3K13A 3GU1A 2AL1A 2DIJA 4JY9A 4LUYA 1X7IA 2CLPA 4ATLA 4KWVA 1J4EA 2WANA 3W2MA 1J01A 3SQSA 4UTIA 4IPLA 1P0KA 3IAQA 3MSRA 1OFQA 3W1NA 3PUOA 5BW6A 2ZXDA 3UR8A 1QJWA 5BOFA 3W6MA 4OJYA 5I24A 3PBGA 1TCMA 1YBQA 1ZENA 1VCFA 4ZXOA 5KETA 1IEXA 3S8HA 4F8XA 3NEHA 2DJLA 5G1YA 3ATYA 1TJ1A 4DO5A 4OGZA 1WNOA 3N25A 4HOXA 2VD9A 1U5VA 4ZO6A 4P61A 1S5NA 2PC4A 4CQDA 4QLKA 2WC4A 1H11A 2UY3A 3MTWA 1UIOA 2NUYA 4FR1A 5HWNA 1UASA 2HNEA 4ZBCA 4DJDA 2R14A 4J9JA 1OWQA 2XN1A 3WK1A 1GG1A 5XIMA 1TVLA 3MANA 1UQYA 1VENA 4K38A 3CV1A 4M6VA 4RJEA 1SFJA 1FTXA 4C65A 3BGAA 4AEFA 1NWSA 4M82A 4EACA 3NXLA 5CPNA 2OZ0A 3STFA 1CLXA 3CWOX 2J66A 2BOGX 3W00A 1ZBKA 3OGSA 4HSNA 2D24A 4E38A 3KS6A 5CZJA 4AZIA 4JKKA 4NP7A 5AVNA 3W82A 4IFKB 4D9PA 4CU6A 4IG2B 1C9WA 1FWWA 1BGGA 3BW3A 4JFUA 4S39A 5TQLA 4P7OA 4JHMA 5KMYA 2HISA 2HVNA 3FJNA 1PZ0A 2HQAA 3AMDA 3NPWA 3IIXA 3VNKA 3U8GA 4G5DA 3S3GA 4H8HA 3MA8A 2PE4A 3M7WA 1WUFA 3L0GA 2VVNA 4WQ6A 4U3CA 1PWLA 2OWXA 3NWRA 3A24A 1P6BA 2W61A 1QPOA 2VGIA 2CITA 2PTZA 2XH0A 1BXCA 3WD2A 3B9OA 3H2AA 4GIYA 4NJKA 5DN1A 4IMCA 4HNTA 1JCJA 2NXGA 3GWQA 3PF3A 4ZOAA 4HSHA 4ZODA 3V75A 4NZJA 3M0MA 2I5IA 4I8DA 3VX1A 2VP8A 3N3TA 2H9AB 1OCNA 1J12A 2ZOXA 4QSFA 1UR3M 5I5RA 1UZ4A 2V3FA 1XQLA 4PUEA 1ZFJA 3AIWA 3T0AA 3IGHX 3V5CA 4RUBA 1XUUA 3V7PA 4IWWA 3TH6A 3UJRA 2WW5A 3PBVA 4H83A 2BP1A 2Z1VA 2V2HA 2XSAA 5HANA 1X8FA 4FOJA 2OR2A 4L4OA 4K37A 5EPDA 2AGKA 4GYFA 2OKOA 4GGHA 2PDIA 3M7SA 1A0CA 1G0CA 2E6AA 7ENLA 3GDMA 1KKRA 4O18A 2YBUA 4NVTA 5BXSA 3VKKA 2ANUA 1XYZA 5CSSA 2WPGA 3TR9A 5D8WA 1EXPA 1XIFA 4YTUA 5I03A 3S5OA 1XYMA 1JZ8A 2J27A 1L6WA 2DFAA 2VRQA 2QUVA 4C6NA 3AJXA 3UFYA 2WVTA 3HMJG 3MZNA 4MF4A 1KM0A 3K8MA 3MV11 2PDHA 4D6EA 5GJNA 1EDQA 3K4DA 2YA0A 2CPUA 1E6NA 4I5UA 1A4MA 3FHAA 1ONRA 2E40A 4IQJA 3DKLA 2X1UA 2XDFA 3AO0A 3N29A 4NJJA 1XBYA 4AX6A 4AU0A 3SW6A 4W5UA 3HA1A 2DT3A 5MHBA 4HU3A 3TJLA 4IPPA 3TW6A 2CWXA 3E5BA 2XFRA 1V3JA 2DORA 5F7UA 3KOXA 3DYMA 3A9BA 2Z6JA 3SB0A 1X6NA 1XSJA 2J6XA 2W67A 3UP8A 2OZ8A 1X6LA 1BYDA 3T4CA 3WFAA 2DSVA 4S1FA 1DWJM 1G01A 4L9XA 4LTSA 2UY5A 2ZIDA 1KWGA 4MJ2A 2BHZA 3FIGA 1X1OA 1Z48A 1GOIA 4D6DA 2C18A 3SUVA 1Q85A 5HMEA 1WDRA 1B90A 2BOFX 3ZJKA 4FLSA 3ABQA 5A1AA 3EPMA 4A3QA 1V93A 1UBPC 4ZO8A 1XIEA 5HNRA 2ZUTA 2YLLA 1XPYA 1IEQA 2BNJA 3AMGA 4H9VA 1TPC1 3M16A 3TONA 4YIWA 1V0LA 5H8MA 1W0MA 1CGYA 3PUDA 4UBPC 4JTGA 4C6IA 1WX0A 4MVAA 4CN1A 5XIAA 4QQUA 4XX6A 3MVTA 2QCGA 4DYKA 1V4YA 2EPNA 1JDDA 3PJWA 5ABHA 2CBIA 2J47A 3L0KA 5FESA 4JGDA 2EJ1A 2WMHA 1NARA 2V69A 1QUMA 2HBVA 4DJDD 1G4PA 1PHQA 2BS9A 2RFGA 3PUEA 1WOAA 1MNZA 4P8WA 4XD5A 4O4VA 3P62A 1IWAA 3W7IA 1A5SA 3PJUA 1EF3A 1OFEA 1ZBVA 3UETA 4C6LA 1EKOA 4HK7A 1J0KA 5BOOA 3LZ5A 4E8DA 1EXBA 4P7LA 4GISA 4HA0A 3I4EA 2DW7A 1LT8A 3F4DA 3GYEA 3BAKA 4KFPA 3VD4A 4KWSA 3MMWA 3LGDA 3L4UA 5F4XA 3WLOA 2NX9A 3KZPA 3L4YA 4L56A 3W71A 3TWAA 2VZSA 3EGJA 3BAYA 4I5XA 3VE9A 4Q4RA 3VKBA 4QG9A 3IGXA 1YBQB 4E6MA 3GNOA 2E67A 4Q7IA 2CXEA 1B57A 4J2PA 3UWQA 2BGNE 1C9DA 3N3MA 4G56A 4IP7A 3BAWA 3LX9A 5A2CA 3TU9A 4FPSA 1XG3A 3KVJA 1E0WA 3BE7A 1I1XA 3F03K 3VNIA 5CH9A 1US3A 3SRDA 3ISIX 3SCUA 5KTLA 4DUOA 3HPXA 4YS1A 3D5HA 1NP2A 3G3DA 2WZEA 4JHOA 3YPIA 2REQA 3WK0A 3EMZA 4PH6A 1XDJA 1KWKA 4C6PA 5B7YA 1FP9A 1YDYA 1J0JA 2PLCA 4GLEA 1GVOA 4Y8FA 2BASA 1W3TA 3NQVA 1XSIA 2YCEA 2NQJA 1DQWA 4GUIA 2OT0A 1JF6A 1VBJA 2POZA 2WLZA 4MJZA 3F2DA 4GNKB 3NM3A 3VIHA 1UD4A 4JYEA 2VENA 5JH2A 2CLOA 4RDWA 2PPGA 4IT1A 4D8AA 2WJDA 3AHVA 7PTDA 4IL0A 2D2GA 3ZWSA 2RDUA 4MWAC 2G37A 2OX1A 1KM3A 3WJZA 4AD2A 3QV6A 2PGRA 1H7WA 2ISFA 4XV0A 3NO1A 3KP0A 2OG9A 3SFWA 4DJFC 4DWSC 4MZYA 4M6QA 3WMLA 3W76A 3QR1A 4GABA 3S6OA 2CLFA 3RFAA 3N15A 4BI6A 3AIEA 1KFBA 1FWHC 1QPQA 3DUGA 1E6SM 1E9YB 3DEQA 3LZ3A 2A7NA 1XLGA 3PB0A 3WH6A 1OHLA 5CBJA 2GVJA 3WQEA 1UJPA 3WZ0E 1WQ5A 4A3RA 4AX7A 4RR4A 1N7KA 2DZAA 3I6RA 5FEXA 3AU2A 1O66A 1S3HA 1EUAA 4UTKA 4C7GA 2VX4A 3M5ZA 4AD5A 2ZDRA 2ZVRA 3PBYA 2WYSA 3G1HA 3ITXA 2VVSA 2CZEA 4LVAA 3WNMA 4QS6A 5XINA 1VAHA 5JMUA 5LYRA 3KCLA 4GBUA 4DUWA 2ZRUA 4PMVA 4FLRA 2DIKA 5D9OA 3IV3A 3DFNA 2NV9A 4RZ5A 4NAEB 2PDNA 1XS2A 1FXPA 4IISA 2J7FA 5E1QA 3GVQA 4KEVA 1X8CA 3BAIA 4M8UA 1R2TA 2IKGA 3SBFA 2W5FA 2HSAA 1C8YA 5TD4A 1US2A 1XLAA 5FOOA 3W6LA 3SFKA 3IARA 5FI8A 3QGVA 4V1YA 1IXPA 4DY1A 5TBOA 1JYVA 4IMFA 3H2EA 1AW5A 1FWFC 5ABFA 1EDTA 1UW9A 4RNIA 4XQ6A 1SPQA 5H6HA 1O6IA 3ANVA 1TPDA 4XTIA 5C6MA 4J3UA 4V28A 1WAUA 3ZR4A 3WLRA 1HF6A 5CG0A 1VP5A 4UB9A 4CQBA 2YYUA 1PE1A 1JPHA 1JUEA 4JPGA 2HPMA 3R12A 4MKVA 2V3DA 2Z27A 3GHTA 3ICJA 1E43A 3RU6A 5CLTA 3SCQA 3INPA 2NLYA 1AJ0A 3F1QA 2ZUVA 3PM6A 3RR4A 1VBGA 2OQLA 4AMAA 3W7EA 4O50A 1MQQA 1W1B1 3GTHA 3N2CA 3EZ4A 3LTSA 1F61A 4M51A 5ABGA 2YB1A 4XZBA 3STCA 1ME9A 4MNLA 4Y9AA 2GGJA 3VGGA 1EP3A 1P48A 4M80A 1JDEA 1AQFA 3CLWA 3V36A 1KR0A 3GM8A 1PB0A 3QOMA 4IIGA 2VEGA 4U5IA 3B06A 3G3MA 3UG3A 3AZSA 4CUCA 1JNEA 1IXOA 1DIDA 4OECA 3QHNA 3URNA 5LA0A 3GDLA 1D2KA 3V0UA 3WLMA 2QCCA 1J9YA 1GJWA 1VIWA 4GQBA 4JQ3A 1AD1A 4HA3A 1V6YA 2EPLX 4M5PA 3ELFA 4UWMA 3VGFA 4AVNA 1TWIA 1YYAA 2Y70A 2NQ9A 2Z0IA 4DI9A 3DI1A 3KL0A 2DT2A 3M0YA 5HPCA 1VD6A 3W7OA 5K4XA 4S38A 2Q01A 5E09A 1QPRA 3RCNA 4XD3A 2VJXA 1NTHA 3LXAA 4GUHA 2X0HA 4MB4A 1DHKA 5D2VA 3F4VA 3ARTA 1GHRA 4WSKA 4Z2KA 2DY3A 1VHNA 4CNNA 3AU6A 4MLRA 1GORA 2YFOA 3SAZA 2A6LA 3RX2A 4AVOA 2J75A 4GACA 4P7QA 2VI0A 2EPKX 1KV5A 1EJ7L 3NXFA 3LHUA 4NASA 2P50A 2GJPA 2X2GA 4LANA 1P0BA 3CQIA 4IPJA 5KZ6A 4K6AA 1F6KA 2WZMA 2VDGA 4MUZA 3FK4A 3DC8A 4F3HA 1F3WA 3KVKA 2FZ9A 5F2LA 4BA0A 3T2PA 1S5TA 1ME8A 1X97A 4DM2A 6REQA 4MB1A 1AVAA 4HJWA 2H3BA 1CGWA 4H9UA 3W37A 1V02E 1VFHA 1FQ0A 3GX9A 3CUFA 4XO7A 3P81A 4B5TA 3N6JA 4WX2A 4YJ5A 3Q37A 3BCFA 1VFFA 1R3SA 2JBMA 1Z3NA 3G2GA 3CT7A 4ERIA 4E4PA 3QHOA 2Q8ZA 3PTQA