3RMJA

Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
307
Chain Sequence
TNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDFEAVNAIAKTITKSTVCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIHMEYKLKMKPKQVIEAAVKAVKIAREYTDDVEFSCEDALRSEIDFLAEICGAVIEAGATTINIPDTVGYSIPYKTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQVECTVNGLGERAGNASVEEIVMALKVRHDLFGLETGIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSETYEIMSAESVGWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Removal of the C-terminal regulatory domain of alpha-isopropylmalate synthase disrupts functional substrate binding
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords 2-isopropylmalate synthase
total genus 128
structure length 307
sequence length 321
chains with identical sequence B
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rmjA00
5LNWA 4IMFA 4LOCA 1RQEA 1YXYA 2HMCA 1OABA 3PUDA 3Q94A 1TPH1 1D3GA 5DY3A 1SPQA 4E2DA 3LB0A 3W23A 3L0KA 1JJKA 3KVJA 5LNSA 1UUMA 1QAPA 2CW6A 1H7PA 2AAMA 3F03K 4NX5A 1O94A 1GG0A 3UWZA 5F4WA 3KRSA 4O1CA 3NA8A 1DL3A 5L9FA 3TKFA 3OVRA 4PODA 2CLOA 2RHGA 1GVSA 1H7NA 2YPIA 3IVUA 4KKXA 4QJ1A 3NM3A 3LHYA 1JCJA 2GPTA 3O05A 3W7EA 4LRTA 1X1OA 4CQAA 1TPC1 2QJGA 3LGEA 3NQFA 1B4EA 1WOBA 2H8ZA 3IGSA 2QCEA 5I3KA 3HBLA 1SO6A 2E6YA 2GUUA 3DFNA 3VE7A 2WKJA 3GXPA 4IPJA 4FHAA 1H7XA 2YW4A 1MEIA 1JCLA 3G22A 2FTPA 3NNTA 4OBTA 1DJQA 1AG1O 3BK0A 4ZQMA 1NFBA 1KM6A 4CNOA 3LCWA 5D30A 2ATSA 3B04A 3LCLA 4A29A 3W1QA 5LKYA 3SGZA 3UWVA 1JQVA 2CLMA 4JTKA 2I1OA 3WFAA 1I4NA 2Y62A 4AHQA 2EHHA 2DJLA 5G2WA 5F2LA 4R53A 2E5CA 1QPOA 3T44A 5C6MA 5IBXA 2QCMA 1O5KA 4LVDA 3SECA 3NG3A 3UWYA 4GC4A 1W3NA 4FNUA 4QQ3A 3GDKA 1W0MA 4UMAA 2ISSA 4Y96A 4LVBA 3ZWTA 1H7OA 4O10A 5CSSA 1CI1A 1RV8A 5AB3A 4EVZA 1LRNA 1VLWA 5CPLA 5AHLA 4H3DA 2QUVA 2ZA2A 3O6YX 4BWLC 1XFBA 2WSRA 4QITA 4WOZA 5G1YA 2EPHA 1XDLA 1A53A 2V81A 3IRDA 3NQ7A 2RDUA 3NQAA 4UFMA 4O28A 3S1WA 3M43A 4L4MA 1VJIA 4O54A 3LI0A 3BARA 5F1UA 3RK8A 3GAYA 5LNVA 4N9BA 5KITA 4CLMA 3GVGA 4XKYA 1VGAA 2AQWA 3IVTA 1K7FA 4YXGA 2OX1A 4CCCA 4PA8A 4NVTA 1F2JA 4CQ9A 1BWKA 4AHPA 1OFDA 1W5PA 1X6UA 3QRHA 2WSQA 1I45A 1UJPA 3NQGA 3NQDA 3GIYA 3G8RA 3W7MA 3NQMA 1I8JA 1KM5A 2X1UA 3HPXA 1KTBA 1X8FA 1TQJA 2C0AA 3LHWA 3G1AA 2GVJA 3O16A 4OE7A 5LHEA 5CZ0A 2QJHA 2A7PA 3TX9A 3UXAA 5CZSA 3P84A 3M16A 3B4UA 4FNRA 1I2RA 1AL8A 4JN6A 2I14A 4DF1A 4JIPA 4O0ZA 1QFEA 4LTSA 2RKXA 3EWZA 5KMYA 4O16A 1WBJA 5C5YA 4HKPA 3WJWA 1OG0A 4ZMGA 2CWNA 1LRTA 1TPFA 1N8FA 3SJ3A 4XKYB 5D37A 4ZQNA 4JX5A 4RLIA 3QF0A 1G4SA 1GVFA 4IXHA 3T78A 3TCEA 3THAA 3NAVA 4ZQOA 1O4UA 2X30A 4JY9A 4OQVA 1HG3A 1QNVA 2FFCA 4FX7A 3ANYA 4O12A 1FWNA 1OFEA 3N34A 3VKJA 3W7RA 3LHVA 2FDSA 3CWOX 3RFAA 2NLIA 4K38A 4UMCA 5K7JA 3M5YA 3DI0A 1RQBA 4PEKA 4U4MA 2H90A 4H4IA 2QCDA 4E2BA 1A5SA 3UWQA 1VPXA 3TSBA 1X1ZA 4EIVA 3NPWA 4TR9A 3DENA 3N9SA 3GDRA 1FXQA 4WXYA 2VFFA 3LOTA 3RU6A 3V1PA 4LVFA 2HS6A 3A24A 4G1KA 3N9RA 3KOFA 3MYOA 2J9ZA 1NF0A 2EKCA 3W7HA 8TIMA 2W79A 2JKAA 5K2ZA 3HGJA 1JCYA 1MO0A 3NPVA 1GWJA 1ZCOA 1ME8A 3W83A 1AW5A 3UD6A 1LOSA 1O5XA 1P0KA 3SIZA 1DV7A 1ZJIA 1G4EA 2E6FA 5D33A 3FFSA 3B03A 3G1DA 2Z2UA 4MOZA 1TJRA 2OMAA 4DBEA 3STEA 4UMBA 4MKNA 3BPWA 1K02A 4X22A 3BV4A 2E5DA 1KM3A 2X1SA 1JVNA 3PAJA 3RMJA 5D2WA 3W1TA 1GQNA 4LS2A 3TQKA 1CW2A 4RZ4A 4DEFA 1NEYA 1TPEA 1XBXA 2TRSA 2VEPA 1IXNA 2V2CA 1FCBA 3HG3A 4O57A 1Z41A 1OX4A 4M7SA 1YPFA 1OYAA 2VFDA 4XQ6A 1BKSA 1H7WA 1K3UA 3WJXA 4X9SA 3NL6A 4DBDA 2ZQ0A 5BMXA 2ISVA 4IX2A 1DQXA 4EF9A 4P61A 3TSMA 2Y7DA 3I7RA 4O52A 4XTIA 1XUUA 1GPWA 1P1XA 5D2YA 5CGQA 5FEXA 3DGRA 3R12A 1T0OA 4M19A 3VNDA 3G0XA 3O8AA 2CZ5A 5LNUA 2PC4A 3FJ6A 4LVAA 4JTTA 1VH7A 4K37A 1TRDA 4S2CA 4OV9A 4LS1A 3E12A 1LLWA 2J27A 4XBKA 1HFBA 4JTFA 1OJXA 3TE9A 4MIMA 3A5FA 3KVKA 3M44A 4UIOA 2QAFA 2G97A 2FB2A 1TTIA 1SSGA 3TROA 1PE1A 1R46A 3L68A 4HSOA 3CLMA 4LC8A 5BMWA 2VEKA 1TV8A 4LWWA 5K4XA 1JQXA 4GUJA 2GVLA 1AW1A 3G1SA 5FEWA 3HO8A 3KAOA 4N9DA 4JTLA 3NQ6A 1C8VA 3D0CA 3B06A 4R34A 1Q6RA 3OIXA 5DBTA 1QO2A 1S5TA 5D05A 4RKAA 1F73A 4JDYA 3NL2A 5HWNA 3W1RA 2KZHA 2TYSA 4ML9A 3ELFA 3UPWA 2E1DA 2YFNA 3DFQA 3I7QA 2NX3A 3LRKA 4XZ9A 4IXXA 1LOLA 3SR7A 3KVMA 1G7VA 3P74A 1OK4A 2QJIA 2LLEA 3HGOA 1GJPA 1WX0A 1WA3A 2WQPA 3FKKA 1W3TA 1ONRA 3BO9A 3EX3A 2Z6JA 3IIXA 3LM7A 1VQTA 1OFBA 4UFHA 1YXDA 1GYNA 1ICPA 1LORA 1SU5A 1JRCA 4TO8A 4WOQA 4UUIA 1IGSA 1F05A 1DJNA 3QMRA 5CPNA 3TFCA 2V82A 4NZJA 5J5DA 2J24A 3W75A 4NX0A 3M5ZA 1TTJA 3Q2DA 4JXCA 3CPRA 1H1ZA 4J9JA 2CFFA 5F2GA 4ADTA 4LRSA 5G1TA 4R33A 5MHBA 4PL1A 3QEZA 3EX6A 4K7YA 1WOAA 1EP1A 2C6QA 5KSWA 4JIQA 1R2SA 3SI9A 1ADOA 5K9CA 2OCZA 1L2UA 4GXMA 4BFAA 3B0PA 1VHNA 3GZ3A 4AEOA 2Y7GA 2BZNA 4UTMA 2WPBA 5E93A 3G24A 3S1XA 4Z1AA 1GTEA 2VC6A 1SZEA 1EWDA 3PVFA 2FQIA 4X3ZA 2FIQA 2Y89A 4GNJA 4JTSA 3N19B 3NZRA 1QDSA 4YMZA 3P7YA 1I2OA 3A22A 3KHJA 2C18A 2X16A 3C56A 5BOOA 4UR7A 1FDYA 3BW4A 3CT7A 1PHWA 2ATMA 3NL5A 3TQ0A 1KFLA 4BWLA 2NX1A 3KRUA 3BG3A 3M5VA 1NF7A 3PUEA 2FPVA 3LCXA 3E9AA 1LROA 1LRQA 2QUUA 4DPQA 4Q32A 1KM0A 4RV8A 4IJBA 1ZAHA 1SW3A 4NZFA 3DFTA 5HINA 3O6CA 2XN1A 3LHUA 3TIMA 2J88A 3F4WA 3EKLA 3P5YA 3NO5A 1QR7A 4RJEA 2WV8A 1K03A 1GTHA 3LI1A 1DOSA 4WZHA 1O95A 4FIQA 4XUGA 2CLKA 3G1YA 3T4CA 3W1PA 3M1ZA 3TUUA 2BLEA 1K7EA 1XUZA 4OV4A 4ADUA 3R89A 3C2RA 4Z1CA 4IMDA 4H6KA 3BLEA 4PL2A 4FNQA 2YDAA 4GUFA 1KM4A 4HSNA 2C16A 3E96A 4WD0A 2E68A 7TIMA 1X7FA 1MEWA 4JD4A 2DORA 2CLLA 1KFCA 5AYYA 3LHTA 2DZSA 1RR2A 5D2XA 1A5CA 5AHIA 5A8GA 1XCFA 2H8XA 3P60A 3SGUA 1BTMA 3LBCA 3W86A 3CQ0A 1ML1A 3W2JA 3GLCA 4Z08A 3ABRA 1ZAJA 1SUXA 3P8IA 1YPIA 4O1DA 3MJYA 2ZFAA 2VEMA 3RLVA 1VCGA 3BLIA 2BX7A 2Y6ZA 4AF0B 5AHNA 3M6YA 3NQEA 2G95A 3W1AA 1SSDA 1ME7A 4UTWC 3LERA 1EEPA 1JR1A 3W71A 3TFXA 4UTHA 3GR8A 4Y6GA 1FUYA 4O4VA 5D32A 2PRHA 4MYXA 1KLZA 3L0NA 1PCWA 5DY2A 5KZMA 2Z6IA 1EUNA 1TPDA 2ZZ2A 3A9IA 3ATZA 2G96A 4M6VA 3P8JA 4WX2A 4NNBA 3LX9A 4O17A 5HJLA 2QF7A 3C52A 3UY7A 4LV4A 4WY0B 1W8SA 5IM51 4NQ1A 4WUIA 2ZZ5A 3QM3A 2Q8ZA 2A1YA 5BW6A 2NUXA 3NOEA 2JGQA 1VC4A 4PH6A 2C1HA 4JX4A 3I68A 4IPIA 1XC4A 5C2XA 2V0TA 3IIZA 5AYZA 3W87A 3B8DA 2WNNA 4R7JA 1W5OA 4ALDA 1GZGA 4O53A 1EB3A 4N6EA 2BXVA 3QMTA 4EOUA 1XL9A 3EB2A 4LT9A 5DBUA 3TR2A 3W85A 3LTPA 2Y63A 1A5BA 4GRSA 4ZQPA 2J6XA 3QQ0A 4K8EA 3S1UA 1F76A 1SZNA 4MFEA 4UCGA 3H53A 3GKAA 4XWUA 4OT7A 4PC8A 4IGHA 1IXQA 3I6RA 3PB0A 3R13A 1QWGA 4YCOA 2QCDB 1D9EA 2CLIA 5H91A 1OFRA 2JGYA 4MZ1A 3DBPA 3TXVA 1SZFA 4M5PA 4Z1BA 5FF4A 2V8ZA 3LCIA 4NUWA 3LXAA 5AYXA 2H3BA 2V9DA 2NUYA 4UNLA 4FIRA 4UTTA 2VOMA 1KFKA 1GVRA 1G6CA 4UC5A 2E6DA 3TC7A 1XI3A 3K30A 2FLIA 3NQ2A 3W22A 3C3NA 1OF8A 5AHFA 4UTJA 5HULA 4FXRA 3S6DA 1FQ0A 3QJAA 4RK8A 3G0SA 4BR1A 1OK6A 1HO4A 6TIMA 3MBDA 2F84A 1RD5A 3O15A 2QEZA 3HQ1A 1EP3A 4O4WA 3HOJA 1YDVA 1ZY9A 1FBAA 4MPQA 3OVPA 2H3DA 2C19A 2Y61A 2YYUA 5G2IA 3PC0A 1TPVA 2NXHA 3DKLA 3TQVA 1NAL1 5K9XA 4NJGA 3BW2A 5F4SA 4EF8A 4MYAA 4UFKA 3BGJA 3W07A 1G69A 2RDTA 1IXPA 4Q33A 4K39A 2E77A 2QCGA 1JULA 2YGYA 1P4CA 4TMCA 3O1NA 3M7WA 1Q6LA 3MMTA 1KM2A 4OU1A 3M0ZA 2GVGA 1TYGA 4O50A 1W54A 4O8RA 3A5VA 3FA5A 1QPQA 2EGZA 3PSVA 3TK7A 3PF3A 1F7BA 4N2YA 4DELA 4FB7A 1UCWA 1S5WA 3W7JA 3STFA 4DF0A 5DXXA 4UTLA 1G4PA 5CSRA 5KZDA 1DQWA 4UFJA 5F4XA 1PHQA 1Z48A 2QCFA 3W2LA 2Z1BA 1OFQA 4RCXA 2A21A 2R91A 4O1AA 1LBLA 1P5BA 4D2JA 3PULA 1OFPA 3W1UA 2A7RA 3NR0A 1VYPX 3SFKA 6ALDA 3NM1A 3SW6A 2CU0A 5EL1A 5LGZA 4IOTA 5FF2A 1PS9A 2OT1A 1BEUA 3S1VA 4QM1A 5K4ZA 3IGUA 3M41A 4HNNA 4TMBA 3KXQA 5FF0A 2YZRA 3W7PA 1SFLA 3B05A 5E0KA 1DORA 5C54A 3EX4A 3GX9A 1H1YA 2NXGA 5I3GA 3S5OA 3MI6A 1TSIA 1Q6OA 2E09A 3FLUA 4PCFA 3R8RA 2YSWA 2ZA3A 5AHEA 3DZ1A 5AFDA 3ZWSA 1N55A 3GXTA 3UNDA 2WJZA 1K8ZA 3C6CA 4OGZA 2BTMA 1W5NA 3G1HA 4P2VA 3GNNA 3UXDA 3W7GA 1QMLA 2ABAA 5CZJA 1TTQA 4AXKA 3PS7A 5FESA 1B9BA 4MZYA 3P67A 3C4UA 3W7LA 2A6NA 5KZEA 2NWSA 4FX6M 3C2FA 2CZEA 3F1QA 4JX6A 1CX9A 4A22A 3W3OA 1T8XA 2P10A 1LDCA 4A21A 5D04C 3QW4B 4O15A 2ALDA 2OJPA 5HWJA 4UTUA 1GYLA 5LHFA 1SW7A 3GDLA 4ZVJA 3ZS4A 4CCEA 4UR8A 1PCKA 3DU0A 3THQA 1W56A 2A5HA 4ORIA 3ABQA 3UQNA 3NEVA 1ZFJA 5G4WA 3LXBA 1NVMA 1XM3A 2FB3A 2VKZG 4CQ8A 4HNUA 2O7QA 2FPTA 1VZWA 3LXCA 3W88A 4AMAA 3T7VA 2JBMA 3L9CA 3TNOA 3PG9A 1HL2A 3U6WA 4JTHA 2Q3OA 3N3MA 5G2HA 3MHGA 2JKEA 4MFDA 1H51A 4A3UA 3LTYA 1M5WA 2RDWA 2IQTA 1H60A 3WK3A 1VCVA 3PM6A 4ONVA 1GVQA 1Q3NA 4UFLA 5HQEA 1RPXA 1G7UA 2PE4A 3TV8A 5CG7A 3WJSA 1WV2A 2ZZ4A 4MLRA 2W6RA 4O11A 1ZAIA 4NU7A 3G1VA 2W0UA 5D09A 3L65A 4JTGA 3HG4A 1L9WA 3LV5A 3L21A 3PBUA 2B4GA 3EWWA 2ZTKA 2CLFA 4UTKA 3FYPA 3AJXA 1OFOA 3W7DA 3GKFA 2F7FA 1I2QA 3CHVA 4LY8A 5AHMA 3JR2A 4LUIA 2UV8G 4KFPA 4BI7A 1KBJA 4S1FA 4YLWA 3FEMA 3QSTA 1S5VA 4S2BA 1VR6A 1YDOA 3G0UA 5I3JA 3C8FA 5HNRA 4N6FA 1N7KA 5J5RA 3LRLA 1TPUA 3MHUA 1TTPA 4A2SA 3LDVA 4GFSA 2DJXA 5AC7A 3I65A 1HTIA 1XBVA 3FS2A 4IUOA 4NNAA 1MSSA 3S9YA 1PV8A 1JCMP 5LSMA 3TDFA 4E0CA 3IVSA 4IMEA 1B3OA 3U8GA 1JRBA 1VHCA 2QAPA 1H63A 2GQ9A 3OHIA 3W1NA 4JS3A 4IMCA 2V30A 4GUGA 4HIBA 5HR6A 4K8HA 3WK2A 1H50A 2V2DA 2ZZ6A 1LYXA 3W70A 1H5YA 1SQ7A 3UY8A 2ABBA 1YADA 3CWNA 1TQXA 1AMKA 4MJZA 3CEPA 3F4NA 1YLVA 4DO5A 1OF6A 3MI2A 5A5WA 2ZCGA 1KA9F 2QDHA 3G3MA 3E0IA 4Z0JA 3NQCA 2RH9A 2VFGA 1UBSA 3W7KA 5U7SA 1FWRA 1IXOA 2PURA 3KFTA 3S42A 2DZTA 1SO4A 1F5ZA 4QIUA 3L67A 1XDMA 4JYFA 1U83A 4CNNA 4PTNA 1KM1A 3O06A 4ZQRA 3L5AA 3RF9A 1WAUA 2CLHA 3NPXA 3PUOA 2Q8LA 5HWMA 1LBFA 4M6QA 1F74A 1ME9A 3EWXA 3QSRA 4DO4A 3FJLA 4WQ6A 5C55A 3HGRA 3PB2A 1TV5A 1K8YA 4JNMA 1R47A 3W2NA 3Q37A 1W3IA 3NVTA 2DZUA 2XFWA 3Q58A 1TCDA 2Q3RA 2NWRA 3L66A 1KV8A 2WOQA 3R5EA 1UB3A 3STGA 1FWSA 3AO0A 3PY2A 4LUJA 5HMSA 4YWIA 4K7VA 4RR4A 2DU2A 3DHFA 3VE9A 2BSLA 2ZRXA 1SO3A 2A85A 3UWUA 2QCNA 5TIMA 5EKYA 4UXDA 3YPIA 3E49A 1GEQA 4JTUA 3CU2A 1GVOA 1FX6A 2AGKA 3PBWA 1C29A 1TV7A 3GB6A 3LBMA 3LHZA 2R94A 4HNTA 1YXCA 2DP3A 3S8HA 3O07A 4AHOA 4KWVA 4UTTC 2ZRVA 2WO5A 3MBFA 1OX4B 3PBYA 4JEQA 2Y85A 2WNQA 4FNPA 3QC3A 5L6UA 3W1LA 3LCHA 3BGGA 3QPYA 3DXIA 2DZVA 2H6RA 3EEGA 5FI8A 5D02A 3TSDA 1VCFA 1GOXA 2YW3A 1SR9A 3LV6A 1HUVA 3A23A 1QOQA 1H62A 4HNVA 3EKZA 2VENA 3W7NA 2V5LA 2NV2A 1ALDA 3R2GA 3FOKA 1LTDA 3HMJG 1DBTA 1FY6A 3W73A 3S5NA 2ZYFA 1A5AA 2R14A 2Y7EA 3PG8A 3INPA 4JTEA 5GVJA 3QPZA 1I2PA 1JCXA 2TSYA 3MP3A 4AAJA 3W72A 3NGJA 3P81A 3ABSA 4KWWA 3IIPA 4YL2A 1Q45A 5T26A 3G1FA 3CM4A 4JGDA 1J2WA 5CKSA 2P1FA 5FF7A 3VFLA 3LCFA 4CNPA 5HUOA 1VS1A 1VLIA 3L2IA 4N4PA 2G5WA 1XBZA 1GG1A 4M7TA 4QSHA 3GDMA 3EXSA 3W2KA 3OBKA 3WJZA 3W76A 3IV3A 1KW1A 1HO1A 4Z0SA 1Z42A 1SO5A 5FEZA 2TPSA 1U5JA 1OHLA 2ZRWA 1YTDA 4HN4A 3M9YA 1B57A 3LRMA 1FCVA 2FJKA 2B7QA 4JYDA 1AK5A 3NDOA 4TIMA 5F2IA 3STCA 3PR2A 4LVGA 2FPYA 3P5ZA 4JY8A 3HG5A 4ICNA 5D2VA 1AL7A 4DPPA 2C13A 3G8EA 3P61A 3QMSA 3DFSA 3N73A 2X2GA 2B7PA 3MI3A 4IX0A 5G4EA 1PIIA 3M47A 3GYEA 2JKPA 1UASA 3BVJA 1W37A 4NJHA 2ZRUA 3CIWA 4C1KA 1D3HA 1ZHAA 5EA9A 2BWGA 3MWAA 2ISWA 3IEBA 3NQ8A 2EAWA 3NXFA 4HT3A 3DFPA 2E5BA 3NL3A 1O60A 2A7NA 1UUOA 3CB8A 4Y90A 2ZZ7A 2O7SA 1VYRA 2VXNA 4MVAA 1MEHA 5BNKA 2NV1A 3NPUA 3C0JA 3IIVA 1AW2A 2DZXA 5IBXC 4YCPA 4JR5A 3QH2A 4OWGA 4A2RA 1EA0A 4LNYA 1OX5A 4QNEA 1W1ZA 1FDJA 3MUXA 4ZL1A 3L5LA 5FF3A 1LP6A 2NX9A 3UZ5A 3ATYA 3QW3A 4AB4A 4X2RA 2CZFA 5SWUA 1B4KA 1SFJA 5KTLA 1VYSX 4KFNA 1JUBA 5DCDA 2HTMA 2OZ0A 2CLEA 4JDBA 4I9AA 4LS0A 1KLYA 3PBVA 3MP4A 5AC8A 4GJ1A 1YYAA 2VFHA 5CPOA 2DZPA 2OT0A 2ZDRA 4I7VA 3TMLA 2ZTJA 1JUEA 3E02A 4TU1A 4WJEA 3WJYA 4O0KA 2E6AA 2V5BA 4K6AA 3BG9A 4LV9A 3USBA 3B0UX 4HPJA 1YDNA 2YR1A 4GBUA 5DCEA 3TAKA 1DKWA 4BF9A 3SZ8A 1FWTA 4FX8A 3FYOA 3W7QA 4FNTA 1KTNA 3QYQA 3T55A 2ZBTA 3GXNA 4I7UA 3DFOA 5HR7A 4QNWA 3UPBA 3UYCA 3W7CA 4OHQA 1P0NA 3QQ1A 1THFD 1F6PA 5TQLA 5ABTA 3W9ZA 1W31A 1J5TA 2NXIA 3RNDA 3SY5A 1LZOA 3G18A 3JS3A 3TU9A 2NZLA 3EWUA 2PRLA 2Z0IA 5LGXA 1V5XA 3OA3A 2C3ZA 4HHPA 3N2XA 2QCLA 2J9YA 2B7NA 4N4QA 4GE8A 3P80A 1GT8A 1RZMA 2A2IA 2QKFA 4MJMA 4FXSA 1Z44A 4LC6A 2R8WA 3T40A 3W1MA 2XN2A 2NUWA 3A21A 4HPXA 4JTIA 1TO3A 4K36A 1K8XA 4DQWA 1S3HA 1SW0A 4AWTA 3LCGA 3CTLA 4GUIA 1T99A 4O13A 2I9EA 4LW7A 1ZENA 4IMGA 2XN0A 3W1XA 1K7XA 3TJXA 1IF2A 3UZJA 1XKYA 2GJLA 3UWWA 2C14A 5FEPA 5F1VA 3C61A 4AH7A 4Y9AA 3ABOA 3GR7A 1PVNA 2A6LA 4NJJA 2YXGA 4UTIA 1Q6QA 1PL9A 3W2UA 4N02A 2PRMA 4MY1A 4UFIA 1SZGA 3V75A 4RX0A 2HS8A 1I2NA 3U2OA 3H55A 1QOPA 3DKJA 2YFOA 3L5MA 2ZRYA 2ZZ3A 4IQLA 4C1LA 1A50A 3DHDA 3HGSA 4FEZA 4NJKA 5HUPA 4ADSA 5DN1A 2X1RA 3LTSA 4RZ6A 3CEUA 1TPB1 1DVJA 4MUZA 3EWBX 3P62A 2J9XA 1BWLA 3O6DA 4MZ8A 2TMDA 1ICQA 1LM1A 1RQHA 1FXPA 4L4LA 3LLDA 1TJPA 4FF7A 2CZDA 3EXRA 3DH7A 4GWEA 3TW6A 3C2EA 3QZEA 4POCA 1W5QA 2DZWA 3S0CA 4M6PA 3CIXA 1TIMA 1OVDA 3HB9A 1KFBA 1EWEA 2A4AA 4DO6A 3GNDA 4Q4KA 1KBIA 1OX6A 1TREA 5TBOA 3TC6A 3W74A 1JCNA 4O1BA 3SSJA 3P82A 4UNKA 3TH6A 3VI2A 1MZHA 1EP2A 3DAQA 4W9TA 4B5NA 2ZRZA 4BK9A 2YYTA 4TX9A 3VCRA 1QPNA 4NNCA 5I3HA 1L6WA 1ZALA 5EPDA 1IIHA 1F6KA 1L6YA 1LBMA 3W6YA 3FKRA 2QR6A 5G5IA 1XXXA 3MW7A 1KV5A 1W5MA 3NYZA 1TB3A 3GAKA 4ZZ9A 3M5XA 1NSJA 4U28A 5AC6A 3G3DA 4MY8A 3WK1A 1FDZA 1YTKA 5EY5A 1TMHA 3S5ZA 1EPXA 2YX0A 1OFAA 3EX2A 4KFOA 5F2MA 5BRBA 3C2OA 1KFEA 3IGXA 2GJNA 3RLUA 2X1TA 5DCBA 3MYPA 1YTEA 5U4NA 3O63A 1M6JA 1WXJA 4NJIA 3NZ1A 4NT0A 3EX1A 1M7OA 2D73A 2GQ8A 3LLFA 1H61A 5CPMA 3OEXA 4N9CA 1TRIA 2VELA 3KVLA 2Y88A 3OVQA 5LZLA 1LCOA 3H54A 4NXSA 4XTDA 1WBHA 1G4TA 1KTCA 3C2VA 5K3VA 4O19A 4DXVA 5D03A 5AN7A 4IWWA 4RXFA 3ZR4A 5EMUA 1ZNNA 2VFIA 3HPZA 4AF0A 3PWAA 3G1XA 5D38A 4ZQCA 3KRZA 4FO4A 1L6SA 4LU0A 2ZZ1A 2C15A 1QCWA 3MO7A 5CZTA 2A0NA 5D2TA 4N9EA 4EWND 1KFJA 2WNZA 2YCEA 4WY0F 1WDWA 3MHFA 4GUHA 2RFGA 2JK2A 1IIGA 3QFEA 3W7OA 3EXTA 4AWSA 1V7YA 1G67A 1QPRA 4JTJA 4AWUA 3TAOA 5E1QA 3KX6A 3W7IA 1R30A 1T96A 1R2RA 5DELA 2VEIA 5AOUA 5K9DA 3TMQA 3MP5A 4ORMA 5H2ZA 4Y8FA 2Y70A 5I3FA 1DHPA 4QISA 3ZFHA 4RZ5A 1FWWA 5EYWA 4MLJA 3N14A 2QUTA 3B0VC 3PSWA 1FCUA 1TPWA 2QCCA 3HPSA 4NXKA 1WYIA 3S5YA 3EWYA 2ZA1A 4RXGA 5LNRA 2QDGA 1VRDA 1LOQA 1LLZA 1QO5A 2VFEA 2HSAA 2WSYA 3HJZA 1M7PA 3N2MA 1R2TA 2PCQA 4AVFA 4I7WA 4WY0A 4JYEA 4CCDA 2Y7FA 1H7RA 4Z1DA 4BI6A 3JRKA 2EF9A 4PFMA 2V2HA 1ICSA 3HF3A 1EIXA 3W2MA 4E38A 1XBYA 3BW3A 1MXSA 3BLFA 2GOUA 4MY9A 3GK0A 3BG5A 4UTWA 4WXZA 1OYBA 3TW7A 1OYCA 1C9DA 3CC1A 4QAIA 1RVGA 2GQAA 1J4EA 3FIGA 3NQVA 1WQ5A 1EUAA 4JICA 5DLCA 1Y0EA 2B0MA 3DI1A 4O18A 5KINA 2P0OA 2QCHA 3TJLA 4XBSA 5I3IA 3WK0A 5EBUA 4BI5A 5DXYA 3TXZA 3HIJA 3I7SA 3W84A 3TA6A 1JUKA 2B7OA 3OG3A 4O14A 1FCQA 3IIOA 3GDTA 1EX5A 3L0GA 4DF2A 1E51A 4FNSA 3HG2A
chains in the Genus database with same CATH superfamily
2FHCA 1RQEA 5E0CA 4U3CA 1OABA 5JH2A 4ZXLA 5JXQA 1FKXA 4CN1A 3B9AA 1TPH1 1DYSA 2WXDM 5DY3A 1SPQA 3NTYA 4QHRA 1TIWA 3UG5A 5CJMA 4YPJA 4L61A 4AIBA 3MSGA 4NX5A 4FXFA 2OXNA 3TYAA 3UWZA 4O1CA 4MKSA 4TV6A 5L9FA 3Q4DA 4OVXA 3T0CA 1JZ6A 4B3KA 2YPIA 2Z24A 4QEHA 3LHYA 2VOTA 1JCJA 5TAOA 2GPTA 3B4YA 1X1OA 3I4EA 4B4FA 3QGKC 2WZTA 4MMWA 2G3JA 1B4EA 2Z29A 1BGGA 4YYCA 3OB8A 2XVGA 4FI4A 4IPJA 4H00A 1EQCA 3HFTA 3ZOAA 4X0VA 4GNKB 4OBTA 2ZXAA 1U5VA 3ME3A 1J9YA 3VKAA 1KM6A 4CNOA 3U2EA 2CITA 3LCLA 1ODUA 1PZ3A 5LKYA 4GIEA 1UW9A 3UWVA 2CLMA 5I02A 1R3YA 4AHQA 1HJSA 2EHHA 3FHAA 4R53A 1RSCA 2OZ3A 3AHZA 3BGAA 4LVDA 4J28A 4DXXA 1W3NA 1EJWC 1E40A 2I5QA 2PF8A 3S2CA 2HISA 4CVUA 5DMMA 3GVQA 1S5NA 5CSSA 1NQKA 1WDRA 4CCZA 5CPLA 2VWTA 4H3DA 2ZA2A 3WL0A 1OG6A 5G1YA 3WD4A 3WENA 2WJDA 3BAJA 4GO8A 1V3KA 1A53A 2V81A 3KZPA 4ZO6A 5REQA 4UFMA 4O28A 4JHMA 2DT2A 4ZENA 3NCOA 4JTAA 2PLMA 3S6OA 1QI2A 3DG7A 4IF2A 3RK8A 3ZYZA 1I1XA 3OO2A 2WVVB 3IV8A 4WDTA 1IZKA 4FLQA 4CLMA 4XKYA 4H9UA 1VGAA 2AQWA 3IVTA 4NKCA 4CCCA 2PP3A 1F2JA 1J0JA 1W5PA 1ZPTA 1I9CB 2WSQA 2Y4SA 4UR9A 2FVLA 3C0SA 3KRBA 3NQGA 3W7MA 3G8RA 2MNRA 1KM5A 3MKVA 3K1DA 1X8FA 1EC7A 1HP5A 1TQJA 2XSBA 4XD6A 2GVJA 2NT0A 3EGJA 5LHEA 2A7PA 3UXAA 4G5DA 3M16A 3B4UA 1U1HA 1AL8A 4G2DA 3REQA 2I14A 4DF1A 1MW0A 1DIEA 2RKXA 1E6XM 4DVOA 3ARXA 1GKRA 4XD5A 1JZ2A 1TPFA 1N8FA 4XKYB 5D37A 1DIKA 2WWDA 1FWDC 2ISFA 3T78A 3U7BA 4NAFB 3THAA 1O4UA 2X30A 1DEDA 3VNJA 1Z7AA 2FZDA 1ITUA 4O12A 2XFYA 4DZHA 1JEZA 3BOLA 2ZVRA 3MKCA 5XIMA 1E1CB 2VX7A 3H7VA 1V0NA 3PTMA 4DUOA 3CT2A 3RFAA 3N12A 4E2VA 4XD4A 1H41A 3M5YA 1SFTA 3VIMA 1ZRQA 1DJIA 5FD0A 3C5QA 2YB4A 4MB4A 3UWQA 1U33A 3TSBA 3VZZA 3NPWA 2X0HA 2XGZA 4TR9A 2VR5A 3DENA 3PBMA 5I06A 3AYVA 1FXQA 2YBUA 2ZXQA 2HS6A 4G1KA 1XH2A 4MNJA 3MYOA 1V6TA 3TOPA 1PO9A 3CQJA 2JKAA 2QW5A 5K2ZA 1R8LA 3HGJA 3RILA 3VCCA 1AW5A 3UD6A 1U22A 1O5XA 2QPXA 1DV7A 1G4EA 2VZTA 4DBEA 3W4RA 3CMFA 3DN5A 1X38A 3BV4A 3MY9A 2X1SA 1JVNA 5AVHA 2GGIA 3W1TA 3ITLA 2PDLA 1F3XA 1F4HA 4UTFA 1NEYA 4L80A 2VEPA 1S1RA 4CNSA 1HGWA 1FCBA 1HKIA 1BRLB 4QRNA 3QN3A 3RX3A 3AXIA 3J7HA 3EPNA 1OYAA 4KMQA 2XVLA 2CBIA 1BKSA 1K3UA 3WJXA 3EDDA 1MVYA 2ISVA 1PBGA 4EF9A 4P61A 1SGJA 3RO8A 3TSMA 1Q65A 4XTIA 1ZB5A 5IXEA 3ALFA 1PUDA 2P8BA 4M19A 3G0XA 1KR0A 3OP2A 2AL2A 5KZ6A 3VIGA 3E2RA 3VK5A 1N2VA 3H6OA 3N17A 4LS1A 3CYVA 1LLWA 1HFBA 4JTFA 4MIMA 5EMLA 3M44A 1IV8A 4NSBA 1F8IA 3R0KA 2GJPA 2O9RA 3BAWA 2ZKMX 5ECVA 4LC8A 3GSMA 4L56A 2VEKA 4X63A 1VFHA 5K4XA 2BY1A 2DPEA 3GBDA 1Z6KA 2GVLA 1AW1A 2GSJA 3G1SA 3HO8A 2I16A 3D0CA 1Q6RA 3OIXA 4OUEA 1S5TA 5D05A 4PMZA 2E0PA 2YCLA 3QHNA 5AZ1A 4GC3A 2FYMA 2YFNA 4YTSA 2OSYA 4J2PA 3WX7A 1RLCL 4U3AA 3MVTA 4PSPA 1OK4A 4IFOA 3KOZA 3AAMA 3MMDA 3GHTA 3U0HA 3BO9A 4H19A 3ZLHA 2MUCA 3LM7A 3KL5A 1OFBA 2XIJA 4UFHA 1OZQA 1I60A 3MB9A 2R1LA 4MDOA 1RVKA 1JRCA 1F05A 3QMRA 1KRCC 3W37A 1UD3A 2V82A 2J24A 3VC6A 5HA7A 3CPRA 3WH5A 3MA8A 4ADTA 1JYVA 3NZGA 1VFTA 4PL1A 3MUCA 1UKSA 3F2CA 2A3EA 1K70A 2C6QA 5KSWA 3AOFA 2O4MA 4AWEA 3SI9A 2EJ1A 3KBSA 2OCZA 1L2UA 2ACUA 2O9PA 2NV9A 2Y7GA 2X09A 2WZHA 3VA8A 1J93A 1GVYA 4XISA 4GQ0A 3S1XA 4ZB2A 1IT8A 3F4DA 3WDPP 2FQIA 1XPYA 2XZ7A 1IZJA 1RD6A 1HKVA 1Y5WA 3VD7A 3W01A 3NZRA 5CJ5A 1L0PA 4PCTA 3KP0A 2VDIA 2OU4A 2HE8A 4BEUA 1TE1A 3A22A 4OTKA 3RITA 2X16A 2YL5A 3PWGA 1ZBVA 4L9YA 4UR7A 3GR4A 3WNKA 4AYGA 3NL5A 4BWLA 1NF7A 2HZGA 1KXQA 2JIWA 2PI6A 4DPQA 4RV8A 3LNMA 3VUPA 3A64A 3DCPA 5C9RA 2E8YA 4RDVA 1JDFA 3AI0A 2XN1A 1B54A 1KFWA 4PMUA 2J88A 3EKLA 3NO5A 1QR7A 2PMQA 1W9BM 2X41A 4HMEA 1DJYA 3TUUA 3W1PA 1C7TA 1ZJAA 3WF3A 1XUZA 4OV4A 3SDOA 1XLLA 4BA0A 1SJCA 1CXHA 5ENLA 3ZIZA 4H6KA 3BLEA 3SADA 4QG6A 4PL2A 1JL8A 4D6FA 1MXGA 1UWAA 1UUQA 2YOCA 4ATWA 4PB4A 4HSNA 3WBEA 4PE8A 1MEWA 1MUWA 2DORA 1Q6FA 3BSHA 2Z7KA 3WG6A 3ZSSA 1YNYA 2QJJA 1RR2A 5AHIA 1TWWA 5A8GA 3P60A 1BTMA 4M51A 3W86A 3CQ0A 2D2OA 3W2JA 4B4HA 1ZAJA 3P8IA 1YPIA 3MJYA 4HNCA 3RLVA 3UGVA 3F4VA 5CH9A 4AF0B 3FA3A 2XVPA 1Q5MA 2G95A 3W1AA 2P3ZA 1XLIA 1SSDA 1OIFA 1JR1A 4GQQA 4CKQA 4UTHA 4IPNB 2PP0A 2ZUTA 5C71A 5D32A 2PRHA 3L0NA 1PCWA 4J27A 5KZMA 3ECQA 2Z6IA 1EUNA 1TPDA 2ZZ2A 3A9IA 3ATZA 5DFAA 3AWNA 4WX2A 1S2TA 1A5LC 3GS6A 3TQPA 4IP5A 4GCXA 2OVLA 5IM51 1H09A 2RJGA 1V51A 3RO6A 1TUFA 5CBBA 1PWLA 3PZQA 3OLEA 2Y2WA 5C2XA 2V0TA 2ACRA 3B8DA 2NLYA 3DC8A 4W93A 4EOUA 1BXBA 4L1WA 1XL9A 2ZUMA 1EHNA 4LT9A 4HU8A 4WKFA 1VBJA 3NEHA 1LWIA 3VDAA 3VKKA 3CAKA 3BXWA 3PWIA 3B3DA 2OYMA 3OIHA 1GKPA 3S1UA 1F76A 3WN6A 3GKAA 4BF7A 4XIMA 3H2OA 4GXWA 2W63A 1UH4A 3WUFA 2YL9A 1SZFA 5FF4A 3LCIA 4W4QA 1X1NA 4F2BA 2H3BA 4FIRA 4ZO8A 3W25A 2E6DA 2A3HA 2XSXA 3FAXA 5HPCA 4HOXA 4PTWA 1BGAA 5A8OA 7REQB 4KBXA 3WLLA 3MCMA 5HULA 4FXRA 3QJAA 4RK8A 3SCSA 2VZVA 5E09A 3RCNA 2XWEA 5F7UA 1OK6A 3E2VA 4M29A 1HO4A 2F8QA 3O15A 4M56A 3GU2A 1W1A1 3HOJA 1E3ZA 2YXOA 2CETA 4MPQA 2Y61A 5BCAA 2NXHA 1MRQA 3TQVA 1LL4A 4F0HA 1ZTVA 3BW2A 5F4SA 3SN1A 3WY1A 4TXEA 3M0KA 4UFKA 3SCRA 4DM1A 1G69A 5C70A 1W9DM 3UGRA 1JDAA 4DUXA 4TMCA 3FA4A 1KM2A 3HMCA 3KOXA 2GVGA 4GLEA 4O50A 2FZMA 3CQKA 1F7BA 3N15A 4DELA 4KETA 1XIMA 1MZRA 3W7JA 1K9FA 4GK8A 5HXMA 2L5HA 4X60A 3LNPA 2QPSA 1RK5A 3W2LA 2Z1BA 1OFQA 4D6HA 4Q22A 2R91A 1MQQA 2OWXA 5C9XA 3THCA 3RM4A 3KBVA 2A7RA 3NM1A 3SW6A 3ALGA 3GM8A 4IOTA 1UD4A 2VCCA 3IGUA 5FF0A 3AUJA 4U10A 3B05A 4AYSA 2DFAA 3DYPA 5C54A 1V6WA 1EHAA 1H1YA 3N2OA 4EK7A 1Q6EA 3S5OA 4CNUA 4GQBA 1FWGC 4JIHA 3DESA 1Q6OA 1C7SA 3MVIA 3UG4A 3UJEA 4AZCA 5AFDA 3E2QA 4EKJA 1K8ZA 4FMVA 3GXFA 3AYTA 3W7GA 3QVQA 2ZUWA 4AXKA 3NSXA 5FESA 3GE7A 3I3DA 4FX6M 2DUZA 4HMNA 3F1QA 4JX6A 2FZBA 3AALA 1T8XA 2VC5A 4A21A 4B15A 3QW4B 4O15A 1GYLA 2QXWA 4ZVJA 4CCEA 1PCKA 5AKQA 5T9BG 3RRXA 3UQNA 3VNYA 1RXOB 1T5AA 3LXBA 1EFZA 1NVMA 5FJTA 4RNFA 1S2VA 1JZ3A 2I9UA 2OOFA 3W88A 3ZXWA 3T7VA 3URQA 1EL3A 4F3HA 4LEQA 2AOSA 2VX6A 2Q3OA 3ARSA 2Z4GA 5G2HA 3WNNA 4ASTA 4E3VA 1WPCA 3GZAA 3LTYA 1J11A 3R7MA 2RDWA 2IQTA 1D8CA 5E70A 4KH2A 3AXXA 3W82A 2WC7A 1V93A 5CG7A 2ZZ4A 2W6RA 2PLJA 1R85A 1ZQ5A 4I8DA 3UERA 3RGTA 2QGHA 3GTNA 3T2OA 1KGUA 4DJFD 4LY8A 1I2QA 5AHMA 4UOQA 4PTMA 4KFPA 4BI7A 4URIA 2HV5A 4PUMA 3GIQA 2BY2A 2F6KA 5MF5A 5I3JA 5AZ0A 2CCRA 3C8FA 3GH7A 2F6UA 5J5RA 3LRLA 3MHUA 4DM2A 2Z1WA 4GFSA 2DJXA 2YDRA 3FS2A 1AD1A 1MSSA 1EF2A 1GZJA 3GH5A 1XRSA 3TDFA 2QF8A 1A0EA 1T6MA 1E3XA 5BYWA 4BY3A 4IMEA 1B3OA 2FTWA 1OC6A 1H63A 1VP5A 4K8GA 1EBGA 1E1FA 2XSAA 3PZTA 4IGMA 3W1NA 1MXDA 3TZNA 2EO7A 4HZ7A 4W84A 4J40A 4FP1A 2BHYA 4GUGA 3H7RA 1POKA 1R3SA 1OT2A 3D5HA 4K8HA 3OPSA 1LYXA 1UWQA 5C7VA 3UY8A 4F0MA 3CWNA 3S2MA 4M1BA 1GEHA 3P3BA 4ATDA 4DO5A 4Z2JA 3SUWA 4L9ZA 4F0LA 3W81A 2J8GA 1EGVA 2O4QA 2YZ5A 2QDHA 2BY3A 3ABZA 4CN4A 3G3MA 3AHYA 1S38A 3CMJA 1Z8AA 2G41A 5U7SA 1IXOA 3KFTA 3P6LA 4GVIA 4DBUA 1S5MA 3OG2A 2J7FA 3PZNA 1F5ZA 1LQAA 3L67A 4JYFA 1U83A 4CNNA 1KM1A 1EBHA 4ZQRA 4JN7A 1ITXA 1ESWA 4CN6A 1R86A 2PD9A 2UWFA 1KBKA 2Q8LA 3VXGA 2OTDA 4KCTA 3WL1A 4DO4A 1CGXA 3FJLA 1FP9A 3T0DA 4WQ6A 3UZZA 2R24A 3UXKA 5CQ1A 4D1IA 3GD6A 4ZSTA 4IPLA 5I78A 2J8TA 2DZUA 1VIWA 3OU8A 3Q58A 2PDCA 2WOQA 3AU2A 4R9OA 3STGA 4MF4A 1QNRA 2OKTA 3FDKA 2Y8UA 2CYGA 3IAQA 3RJYA 2YDQA 4YWIA 2DU2A 3DHFA 4FALA 1SO3A 3LSBA 2FGZA 3QGAC 2QVNA 3QZ6A 1KXVA 3CU2A 3I3EA 1V6YA 2AGKA 1R87A 2HXUA 3WD2A 4CD6A 5HMDA 2QJMA 1MDRA 4R5EA 3O07A 4AHOA 2WO5A 1FHDA 2O92A 2GJRA 2Y85A 5DT7A 3GU1A 2WNQA 3W1LA 1AUSL 3G6LA 4G7FA 3EEGA 4JIRA 3TSDA 1VCFA 2WAGA 1HUVA 4JTDA 3C8NA 4W87A 4QG9A 5EFDA 2V5LA 1ALDA 2D24A 2REQA 3FOKA 3HMJG 1FY6A 5PTDA 2X2YA 3T42A 5CBJA 3DIPA 3GDBA 2VYOA 5DRIA 1JCXA 2Y8KA 3CZKA 4LANA 1XC6A 4V27A 1PKYA 3W72A 3ABSA 2WVTA 2GSHA 1VFLA 1IWBA 1YKWA 4MTVA 5T26A 2PDNA 3LCFA 4S3BA 1VLIA 4CQDA 5IDZA 2PP1A 4WLCA 1R3VA 3M0HA 2P88A 2BFGA 3OBAA 4H7VA 1KXTA 2G37A 1Z42A 4NASA 4DWSC 2EPLX 3BWWA 6TAAA 4EPKA 1O5RA 2J8FA 2RJHA 2J79A 3BE7A 1O5QA 3LRMA 1FCVA 4JYDA 1AK5A 3A4XA 1V77A 3PR2A 2FPYA 3P5ZA 1ONXA 4DPPA 3P61A 1KCKA 3DFSA 3V7PA 3N73A 2X2GA 3MI3A 3TNBA 3CBWA 3LZ5A 4L7ZA 5G4EA 3GG0A 1DE6A 1DTNA 4R27A 4C5YA 3GYEA 4EANA 1G94A 1W37A 1H11A 3M0LA 2WMHA 4H8HA 4MB1A 1MDLA 2RGLA 2BWGA 1LL7A 3IEBA 4TOQA 2KX9A 4F9DA 1KR1A 3MUIA 3MUAA 4TQTA 3GC2A 2A7NA 3CB8A 4Y90A 1KB3A 1XYZA 1TE6A 2VZSA 4A8NA 2OEJA 3IIVA 1OBAA 4FK9A 4YCPA 4JR5A 3WF0A 2ACSA 4QNEA 2OSXA 2DW6A 4WGHA 3KTSA 4W88A 4A3YA 4H9MA 1K6WA 4PUDA 3LS9A 3AZRA 3ATYA 3VGEA 3KP1A 3CHCA 1BXCA 2X05A 2CZFA 4G1NA 1VYSX 3W24A 1KLYA 3W38A 1EDQA 2O56A 3MP4A 5AC8A 4IQDA 4Q4PA 4EPDC 5CPOA 2DZPA 3RPDA 4I7VA 3SRDA 9XIAA 3E02A 1TA3B 4WJEA 4O0KA 2E6AA 1L2QA 1YDNA 2NW0A 3R11A 5DCEA 3EOUA 3TTOA 3EA1A 3EMCA 4NZ1A 2PWHA 1AQHA 4O8AA 1RLDA 2G3FA 1XYMA 4BEQA 4QNWA 3UPBA 3MWCA 3W7CA 1P0NA 2WMFA 2R1NA 1W31A 2DSWA 2WHJA 5IOBA 1XDJA 1ZS2A 5LA2A 1TFVA 3TU9A 4C6FA 2XU2A 3PJWA 2REQB 5LGXA 2YL8A 1TVPA 3OA3A 4M82A 3BJFA 4CNTA 1XJBA 4HHPA 3N2XA 1N8WA 3FW6A 1J0ZA 3EEZA 3WEZA 1E9ZB 4WVXA 4MWAC 4GE8A 1C90A 5CZKA 1M53A 1HF6A 1S46A 1TV2A 1QOXA 3UFYA 3W1MA 2XN2A 1KCZA 1YDYA 3VKBA 2VMFA 2QUNA 1K8XA 4DQWA 3L4YA 1S3HA 5EB8A 5A1AA 1UP2A 1PPIA 3GFZA 3LCGA 4GUIA 4ZB0A 2Y5EA 1ECEA 1KWGA 2HEJA 2CNCA 1Q7QA 2XN0A 3EBVA 5E0FA 3H12A 3E0WA 5JIWA 5RUBA 1XKYA 2E40A 3UXIA 2E4TA 2GJLA 2YLLA 3TYDA 1A3WA 2QMJA 1OC5A 3C0QA 4Y9AA 3VPLA 1BQGA 2A6LA 9XIMA 5C8BB 2FHBA 5B80A 1EGZA 4EX4A 1CEOA 4GGBA 4N02A 4DJED 5BROA 1EJXC 2WSPA 2J7CA 3PZGA 3WUBA 3UVAA 2X40A 4XG1A 4JFUA 1A50A 1NARA 5DN1A 1FWCC 3GTFA 4RZ6A 3CEUA 1EOKA 1E73M 4IH3A 4OUIA 1KD0A 3PP7A 3CYJA 3WQWA 3CZEA 4IIEA 4OOZA 4MZ8A 4LUYA 3WNPA 2TMDA 1ICQA 1Q4WA 1QHPA 3OTRA 4HNLA 1XWYA 1FWBC 3LLDA 3EXRA 4XIAA 1Q2RA 4GWEA 3WLKX 3MUY1 2PCEA 2WBKA 3S0CA 2AMGA 4M6PA 3LGGA 5GQBA 4GISA 4UB9A 4Z2KA 6A3HA 1OVDA 3HB9A 2A4AA 5D9NA 1KBIA 3HPFA 3TC6A 4O1BA 4XZWA 2JIEA 4A8LA 1ISZA 3RYSA 1DWFM 3DAQA 4XAYA 1XCWA 4HMCA 4LCRA 5EPDA 1F6KA 1LBMA 3FKRA 2QR6A 5G5IA 2YB1A 1GQLA 1KV5A 1W8GA 1NSJA 5AC6A 1FDZA 3T6CA 1QNSA 1EPXA 1GUVA 5FAGA 1RCQA 5F2MA 4Q4MA 5BRBA 5C9WA 1HL8A 3IGXA 3RLUA 3MYPA 4JQ4A 1DE5A 3UEQA 1M6JA 5BU6A 3IJ6A 1M7OA 4C7DA 3OEXA 4N9CA 2WC3A 4ZA0A 1UA3A 2VELA 1R5YA 2Y88A 3UCCA 3TOYA 1LCOA 3N18A 1KKOA 4XTDA 1WBHA 4XZLX 2HROA 2BVDA 2Z1XA 4DXVA 5D03A 5AN7A 3DFYA 1UQYA 3EPOA 5HMFA 5FAJA 1J8VA 5I03A 4UOZA 4ZQCA 3KRZA 4FO4A 2ZZ1A 1QCWA 1VAHA 3S2JA 1M65A 5D2TA 1VFMA 3I6EA 2J6VA 3VNZA 1TV3A 1WDWA 1XH0A 3MHFA 3H2MA 1IIGA 3WQVA 3EXTA 2PDMA 4DI8A 4HZMA 1V7YA 2UY3A 1VBHA 4I9TA 3JU2A 3TAOA 5E1QA 4H9YA 3KX6A 3W7IA 5AOUA 5A2BA 5K9DA 4J5NA 2VO5A 2WCSA 1DHPA 5GJMA 4RZ5A 4MLJA 4G56A 3NSNA 4AX6A 4DHGA 1EZ2A 3B0VC 1FH8A 4ENLA 3ZMRA 3PK7A 2PZ0A 1LG1A 2UY5A 2ACQA 2ZA1A 4RXGA 2J13A 1VRDA 4L6OA 1YX1A 3IRSA 1LOQA 4Y9MA 1JAKA 4LF2A 3IPWA 4X9YA 2XFFA 2WSYA 4AVFA 3T8QA 4WY0A 2FH6A 4NY2A 1B2YA 4H9ZA 1UHVA 4I5RA 3ZVIA 3CL7A 5LA0A 1BLIA 2EF9A 4PFMA 2EG8A 2V2HA 3HN3A 4FOKA 4E38A 3OZMA 4RPPA 4MY9A 3UETA 3GK0A 3BG5A 4UTWA 1NELA 3H2EA 3VVGA 1IWAA 1OYBA 2HVOA 2C79A 1C3FA 1IEQA 4OKDA 1OYCA 1RVGA 3L4ZA 5CSUA 2GQAA 3PN8A 3QOKA 3WBXA 1EUAA 3KW3A 3B8WA 4P7RA 5DLCA 5A6MA 3PUGA 3DI1A 4XAZA 4O18A 5KINA 2ZICA 2XGBA 4TTUA 4BI5A 2D69A 4H9TA 3W84A 4B5XA 1JUKA 5CLTA 4DJEA 2QT3A 3IIOA 4DN1A 3T1GA 3R94A 3RRAA 5CPTA 2WZEA 5EMJA 1E51A 4YTQA 2OFJA 4IMFA 2GGEA 5REQB 4W5ZA 4RV3A 4Q8OA 4LX4A 4Z2GA 4GCAA 1S1PA 3BLLA 1PEZA 4W8LA 3WKZA 3KVJA 1E0VA 1GW9A 1QAPA 2GVEA 4Q8UA 3BAXA 4HD5A 1RJRA 2DIKA 2GVYA 3NA8A 4NHVA 1Y5VA 3VKCA 2ADAA 4W7UA 2G3NA 2CLOA 4QLKA 2NT1A 2JEQA 4MUPA 3V16A 3NXLA 7TAAA 4H04A 4QJ1A 1CLKA 2PGFA 3LGEA 1VB9A 1WOBA 3BZJA 1OCBA 2H8ZA 1ZU8A 2WW5A 3ITGA 2Q71A 5I3KA 2GUUA 3IAPA 3VE7A 3GBEA 4FHAA 3TR9A 4OZOA 4RDZA 3SB0A 4JEJA 3G22A 4HBKA 2FTPA 2PC8A 1ISWA 2EKGA 3KLKA 2QJNA 4MKVA 3DOPA 4WJ8A 5EMMA 3BK0A 4ZQMA 3B04A 2OKOA 3W1QA 2WVUA 2QLYA 2BODX 3QV8A 3S6TA 1PX4A 1I4NA 2O9OA 1H0GA 4L5ZA 4EPEC 3HZ3A 5G2WA 1QPOA 2Y0FA 1E6NA 3PZUA 3VGGA 2V38A 3BURA 1O1HA 3SECA 4B9YA 2Z2BA 4FNUA 4QQ3A 4E3TA 5JUVA 4AW7A 1R7OA 1BVWA 3ZWTA 4I6VA 4O10A 1CI1A 1RV8A 3T05A 1LRNA 1J0YA 4XKMA 4F9JA 2PDHA 4BWLC 2WSRA 4WOZA 1F8MA 4Z17A 4JTQA 3D47A 1F4AA 3UZXA 1E4LA 3JZUA 3M0MA 4H8NA 3S1WA 1VJIA 3BARA 2PWGA 4E8CA 4N9BA 3BUVA 2JF7A 2WK2A 3MCNA 3FXYA 2CLPA 2J78A 3GVGA 3K4DA 2OX1A 1D2KA 2C1IA 3CIVA 1M03A 4X0NA 4PGLA 1OFDA 1I45A 1UJPA 2NQHA 1OD0A 3W00A 3NQMA 1I8JA 3HPXA 5FJPA 3LU2A 3G1AA 1IZCA 2QJHA 1F61A 1TKKA 3TX9A 1QHOA 5CZSA 3P84A 8RUCA 2VDHA 3R25A 1BHGA 1YNPA 2Z27A 2VURA 4O0ZA 2PLKA 1Q4NX 3EWZA 1WBJA 5CAHA 1Q7MA 5C5YA 3PPGA 5HMEA 1RUSA 3NJ3A 1LRTA 3POCA 3SJ3A 4ZQNA 2J7EA 3M0XA 1GVFA 3CUFA 4IXHA 3TCEA 3NAVA 1W9UA 4ZQOA 1QBAA 3URNA 4JY9A 2VZUA 1HG3A 3RLGA 4QR6A 1FWNA 3N34A 1P6WA 3A13A 3PZVA 1WXYA 4L4PA 2CEQA 3VKJA 4Z2LA 3VNMA 3S9ZA 3W7RA 3MT1A 1XINA 1BVNP 2ZWZA 2V63A 1NIUA 2YCKX 3ZJ7A 2H90A 1FOBA 2WKGA 1UIPA 4EIVA 4AD0A 3TP4A 3IK2A 3N9SA 2PDWA 4LQ1A 1LL6A 4WXYA 1XLCA 4DLFA 5JBDA 3ITOA 3CAQA 5BWFA 2J9ZA 2EKCA 4YN5A 2W79A 4MPKA 4G8TA 3NPVA 2PTZA 1P0KA 4OBSA 3SIZA 2E6FA 5D33A 1XRTA 4MOZA 2Z2UA 2OMAA 3WLIA 4HOZA 1K02A 3SGGA 1R38A 2E5DA 3RMJA 4JQ3A 4HA3A 3CO4A 2CWXA 1QW9A 1EO7A 1CW2A 1F9CA 4RZ4A 1TPEA 1US0A 3L4TA 1IXNA 4A4AA 3BSMA 2W66A 3N1AA 2V2CA 3UJ2A 4UQDA 1Z41A 3FHQA 4Q8WA 3DGBA 3B0YA 1ZLPA 4M7SA 5BXPA 3NDYA 1EKOA 3VO0A 1H7WA 2DY3A 4X9SA 3RHGA 4AZGA 5BMXA 3SRFA 4LCQA 1DQXA 1UKQA 4F79A 3QYSA 3I7RA 1P1XA 3BSGA 1ISYA 1CDGA 3TCSA 1OGBA 4LYPA 5LNUA 2HK0A 1HKMA 2PC4A 4PCPA 3FJ6A 4L1XA 4LVAA 3R4IA 4IGSA 4K37A 4D6DA 4CD5A 3AU6A 1TRDA 2FFIA 3E12A 5HANA 3WQOA 4MSSA 3N4AA 3CZLA 4UIOA 4R7WA 2QAFA 1SSGA 3TROA 3EOSA 5LIUX 3L68A 4C60A 2WQDA 3DYMA 4LWWA 3S2LA 1CLVA 5FEWA 4Q8NA 2QDDA 3KAOA 4JL2A 3A4JA 5GNZA 3LUTA 1F73A 5LYRA 2W92A 4JDYA 3VC5A 3UJRA 3W1RA 4B5UA 4FOJA 1CXEA 3QY8A 3UPWA 3LRKA 1VRXA 1LOLA 3H2AA 1E6PA 3KVMA 1JPKA 1RJPA 1M01A 2QJIA 3HGOA 1GJPA 1WX0A 1WA3A 4HNOA 2XH0A 2WQPA 1CGVA 4JQAA 1ONRA 4N42A 1M7JA 3EX3A 2Z6JA 3IIXA 1GVIA 2XPKA 1YXDA 1LORA 3HJEA 3SCWA 1SU5A 8A3HA 1KQZA 1KGWA 4QX4A 2PF0A 3T81A 5CPNA 1GYMA 4NZJA 5CGTA 1QI0A 1JNEA 2HBXA 3M5ZA 1TTJA 4DZIA 4YTUA 4JXCA 4NZ3A 4EXBA 1J18A 1H1ZA 4J9JA 5G1TA 4R33A 1US2A 1B3VA 3EX6A 2ZE0A 3CMGA 2PS2A 1HKKA 3N6HA 1EP1A 4AISA 1DJXA 3UCQA 4PTXA 1ADOA 3M07A 4GXMA 1XG3A 3VMOA 4AEOA 4HCDA 3BQ5A 2BZNA 5HDRA 4UTMA 3FGCB 2QIIA 5E93A 3A6OA 1Q63A 1GTEA 2OQYA 3WDHA 1EWDA 1A5UA 1ONEA 4X3ZA 2FIQA 2Y89A 1NP2A 1UR4A 3N19B 3P7YA 4Z1YA 3ARYA 3C56A 4ICCX 3GTXA 3VIJA 3CT7A 4B90A 3P0XA 1MW1A 1PHWA 1CENA 4BQ5A 1SZRA 1KFLA 4LPCA 3MMUA 3KRUA 3TJIA 4HPGA 1NOWA 3PUEA 1J10A 4IP4A 4MNKA 5DMYA 3BLKA 3LCXA 2QUUA 4Q32A 8XIMA 3OGSA 3G1RA 4NZ4A 4J3WA 5HINA 3UCDA 3CV1A 4RJEA 3MPGA 1GTHA 4CD7A 2DSUA 4PB5A 3E0FA 4XUGA 4KERA 2GDQA 3G1YA 4S39A 1Q13A 1K7EA 2HJPA 1POJA 3R89A 3WNMA 3URBA 1MI3A 4GA8A 3KS5A 1VFSA 2YDAA 3T0BA 3EWCA 3AIEA 1J6PA 4P7NA 1X7FA 4JD4A 3RX2A 1KFCA 3V5CA 2BMBA 3CPUA 3L4VA 2WLZA 2DIJA 2DZSA 4HA4A 3B40A 1XCFA 4P5UA 3L4WA 3TYZA 4HGXA 2GFTA 3ZM8A 1SUXA 3SUTA 2X42A 2XM2A 4FLOA 3UJSA 1EJ7L 2X1IA 4Q3MA 1VCGA 4QDPA 1EA9C 3BLIA 4LSBA 3WO8A 2Y6ZA 3M6YA 2PDBA 4ERGA 1A3HA 1ME7A 3M6DA 3LERA 5D8ZA 1JPMA 3D3AA 1XIGA 3UNTA 3BAYA 5DY2A 2G96A 4M6VA 1A5KC 3P8JA 4DB7A 1SMAA 4NNBA 4JIIX 4O17A 3SCOA 4DZ5A 4AC7C 3CH0A 2NVAA 4WY0B 1JXJA 3FYYA 1QK0A 1WXZA 4NQ1A 4WUIA 2Q8ZA 4S3FA 5BW6A 2NUXA 3RR1A 1DJHA 5I07A 2HDJA 1XQLA 2AL1A 1W91A 1XC4A 2JFEX 4LALA 2EQDA 4LXFA 1W5OA 1IT0A 4O53A 1P6BA 2IW0A 3E6EA 3MANA 4MNMA 5DBUA 3LTPA 4JKMA 1A5BA 1QI5A 5D9PA 4ZCWA 4V1YA 2I17A 1SZNA 3DFHA 1O1ZA 3FNDA 3W0KA 1DWAM 1H3GA 1MWOA 3H53A 1QNOA 4ACYA 4IGHA 2GUBA 3R13A 2UBPC 1XLMA 1D9EA 3CS2A 1AJZA 2CLIA 2P76A 4JHOA 4C90A 1NOFA 2X7VA 3DBPA 2VGGA 3TXVA 4PRRA 2GZXA 4M5PA 4Z1BA 3WEMA 2J7DA 5FJJA 3UVIA 4NUWA 2IPJA 5FACA 5AYXA 5H6HA 3SM0A 2NUYA 3SUSA 2VOMA 2HRWA 2VD9A 4UC5A 4C91A 3W22A 3C3NA 3C2YA 2XIOA 5AHFA 4QLLA 4UTJA 2BNJA 2R6OA 3VX0A 4R88A 1UD2A 3G0SA 1BSLA 3W28A 4QE5A 2F84A 1RD5A 3UYIA 1NM9A 1JPDX 4JQ2A 4WHBA 3VOJA 1EP3A 3PPFA 3WQ6A 4DWSA 3WMSA 3U57A 3F2BA 3COTA 4KRZA 2OG9A 2DSKA 2G4FA 2NQ9A 2JE8A 1TPVA 1JXKA 2AAAA 5K9XA 1XYBA 2IUZA 2ZVIA 3DECA 4NJGA 3FXGA 1AFSA 4EF8A 4MYAA 5G1MA 2XIMA 1W1PA 3JZEA 4Q33A 1VENA 2X7WA 2YGYA 1P4CA 1LF1A 3O1NA 1R3QA 3WBAA 1CXLA 3A9BA 1UR1A 2BGSA 4C7GA 1E0UA 5CG0A 1QPQA 3PSVA 3TK7A 3PF3A 4N2YA 3AMGA 4FB7A 1NDZA 1UCWA 1HW6A 4QXIA 4B92A 2FJUB 5CSRA 5F4XA 4HHLA 3ORWA 1Z48A 1G1YA 2QCFA 3GXIA 2VGBA 3SURA 3LQLA 4BQ3A 4D2JA 3PULA 4UBPC 1J5SA 2CBUA 3W1UA 3D6NA 2BHZA 2DQXA 4OJYA 3R1ZA 4KEUA 2ZUUA 3ZQ9A 1XIBA 2FDMA 5EL1A 3EDJA 5FF2A 1YPXA 3S1VA 3VABA 3ZJ8A 4QROA 3M41A 4HNNA 2YZRA 3TTSA 4N0RA 3R43A 3GX9A 5I3GA 1PTGA 1AQFA 3FLUA 3R8RA 2PDUA 2ZA3A 2ZXBA 3GXTA 3UNDA 2WJZA 3GXMA 2BTMA 4U5IA 1W3JA 3UXDA 3GNNA 5CZJA 1K8CA 3HQOA 3PS7A 3W7LA 5KZEA 1F3EA 1GZ1A 3WFZA 4GI8A 2CZEA 2DT0A 3K1GA 2VJXA 4A22A 1JCTA 1IGWA 1EEXA 2P10A 3QTGA 2ALDA 1V0LA 3SY1A 2OJPA 5HWJA 4UTUA 5LHFA 1SW7A 3GDLA 3VNKA 1P7TA 3IJ7A 2GL5A 3DU0A 3PFMA 4HU3A 3OGVA 1ZBKA 5G4WA 4KCWA 1A5MC 1AH0A 2AKZA 2FPTA 1JZ4A 4AMAA 2JBMA 5A8MA 2E67A 4PMQA 4AIUA 3FGCA 3BZGA 3U6WA 1KGXA 3N6JA 3WH7A 1JPIA 5TNVA 4A3UA 1EIBA 1M5WA 7ODCA 4A05A 4AIOA 3EAUA 3WK3A 1GVQA 1Q3NA 4ACZA 4WEVX 5HQEA 1RPXA 3AS0A 3BCJA 2PE4A 4E8DA 2C71A 1WV2A 4MLRA 1TWZA 4O11A 3G1VA 2W0UA 3HG4A 1L9WA 3PBUA 4GD0A 4GZJA 2CLFA 3CV2A 1IWPA 4IG2A 1XYCA 3W02A 2XWDA 2P50A 2VRKA 1KBJA 1IEVA 6REQA 1V6UA 4KGLA 3PPCA 2VGIA 4YLWA 3QSTA 4NAFA 3VIKA 1XKJA 4LBUA 4QE4A 1S5VA 1VR6A 2HPIA 4IP7A 3SCQA 5HNRA 3HTWA 5EMKA 1HJXA 4MWAD 2HK1A 1QT1A 3LDVA 1XV8A 5AC7A 5E9XA 1XBVA 1V3MA 1A4LA 4BKNA 1JCMP 5B7ZA 2BOFX 4B5SA 3CUIA 7PTDA 2TODA 3U8GA 2QAPA 2NQZA 1KCXA 1EXPA 1E0TA 1XX1A 2J62A 4M6UA 4IMCA 1FHUA 4Q8VA 7XIMA 4D6EA 2ZZ6A 1H5YA 1SQ7A 4DRSA 2ABBA 1TUXA 1YADA 2Z7GA 4QS5A 4MJZA 3F4NA 2PBOA 3TZFA 2VQUA 1V3JA 5CAKA 5LXXA 1ITCA 2J77A 1KA9F 1XIIA 3LA4A 3KLLA 3FN9A 3E0IA 4XSLA 2VFGA 3LPPA 3AJ7A 1JI2A 3S42A 4NL1A 4MAVA 4R85A 4ZTXA 3AZTA 3PTKA 4IIHA 3EZ4A 3L5AA 4GH3A 4QP0A 3BJSA 3K2GA 1EGMA 1WAUA 4A8IA 1C92A 3B0XA 4S3KA 4UOJA 2WKLA 3K8KA 4Z2HA 3HGRA 3PB2A 1TV5A 1ECQA 1K8YA 4JNMA 4UQEA 1W3KA 3NVDA 2XFWA 2Q3RA 3CWHA 3VMNA 4MWAE 1VBRA 3ZVHA 3VUSA 2ZX8A 5CC3A 2WCGA 3GNOA 1E0XA 4AX7A 3VE9A 2ZRXA 4B3ZA 3UWUA 2QCNA 4Q6JA 5EKYA 3BLPX 3BL3A 4JTUA 3TYCA 1PDYA 5BXSA 2VHLA 1TV7A 3N25A 4Q8PA 1KCLA 1TMLA 1XLDA 4I8YA 4UZUA 1YXCA 2DP3A 1DXEA 5HPOA 5LIYX 4JEQA 3KHDA 5A8NA 3QC3A 3CO8A 3QPYA 2DZVA 5D02A 4ZB5A 3LV6A 4GHRA 1QOQA 2OZTA 1H62A 1OINA 1P43A 2VTFA 4B16A 5DQPA 3W7NA 2NV2A 1TJ0A 3KDOA 1LTDA 1DBTA 9CGTA 4P8WA 3W73A 3D3FA 3VU2A 2YCLB 1W2VA 2Y7EA 4QDMA 4JTEA 5GVJA 1OT1A 5HQLA 4M81A 3BMWA 1UR3M 1YEYA 2C7FA 4AAJA 3NGJA 1QI3A 4KWWA 1QASA 1HP4A 3G1FA 4RDWA 1J2WA 4NAEA 1NH6A 4JNZA 3NO1A 1WKYA 1H0IA 1D7KA 1VS1A 2VM8A 4N4PA 2G5WA 5JU6A 4IT1A 1P1MA 1ZBCA 4HYVA 5BXTA 2IPGA 3EXSA 2BBFA 3OBKA 4UQCA 3WJZA 2GK1A 2WWCA 4KIEA 1M41A 1HO1A 1UROA 4DYJA 4X2PA 1U5JA 2A3BA 3WQEA 4HN4A 4RNJA 4AZCB 1B57A 3C3UA 2FJKA 4NRSA 2YCIX 3CHFA 2VC9A 3CUZA 3STCA 3A4WA 4LVGA 4ICNA 1XSKA 4AQLA 2C13A 2OYKA 2ZIDA 3IUDA 5FA5A 2B7PA 4IX0A 3H7UA 3N2CA 4HMDA 1UASA 5ABEA 3BVJA 3E3HA 4NJHA 2ZRUA 4C1KA 5HATA 1M9HA 3WNOA 2ISWA 2PWEA 1J6OA 3TTQA 3NQ8A 4V2XA 4DIAA 3NXFA 4HT3A 3HM7A 1CPUA 3ARVA 2E5BA 2VVNA 1O60A 5CC5A 4LUTA 2V5CA 2ZZ7A 1M04A 5BOFA 3SCUA 5BNKA 1TCMA 4GH1A 1TWIA 4FR1A 2EPOA 4HCLA 2DZXA 3KDNA 3RR4A 3VD5A 3KBMA 3E5PA 1SR0A 1J2BA 2G4JA 1OX5A 3VOGA 1W1ZA 1FDJA 7CGTA 2IKHA 5FF3A 1LP6A 2NX9A 3VD9A 4CD4A 3QW3A 4X2RA 3GH4A 5H8PA 4WGXA 1SFJA 1KQYA 4CQCA 5DCDA 2HTMA 2OZ0A 3KOYA 1HQTA 1CXFA 3SFWA 1J12A 2DUXA 5HOSA 2OT0A 3QY7A 1W32A 2ZTJA 3WJYA 2VZOA 4LAMA 3QZAA 2X0SA 2NQ5A 1DKWA 4BF9A 1DHKA 1FWTA 4FX8A 3S4TA 3G2GA 3W29A 2ZBTA 3DG3A 4D6IA 3B97A 4JZ5A 4EAMA 3UYCA 4DXKA 1AA1B 5M2FX 3QQ1A 1THFD 5TQLA 5E5CA 1K9TA 1J5TA 4MNLA 1I6NA 1HN1A 2PWFA 2PRLA 4XZMX 2C3ZA 3RMEA 3VIOA 2QCLA 1E4IA 4M0XA 3CZ8A 1R9ZA 4N4QA 3CZJA 4W86A 2A2IA 5IDIA 2QKFA 4MJMA 3G6MA 1Z44A 4LC6A 1DIDA 3NQBA 1JDEA 1UOKA 1T40A 4JTIA 3CHDA 3LG3A 1DIOA 2BXYA 3OVGA 1DXIA 3H24A 3ERPA 2XHYA 4AWTA 4ERAA 2EXOA 3UZWA 3CTLA 2YBTA 2WZIA 1OEPA 2I9EA 1HKWA 1ZENA 4GYKA 4IIDA 1PX8A 2ZE3A 1NWSA 3UZJA 1KBBA 3KOWA 4JL1A 4HHHA 2G3MA 1O68A 4A8RA 4IL2A 2AQVA 3C61A 1Z9AA 4ROPA 4B91A 3JW7A 5AC5A 1PVNA 3ISIX 2PUZA 4LUSB 4XAPA 1ADDA 5CJNA 2PRMA 4XZHA 1T7LA 3GO2A 2WPGA 2ZC8A 1I2NA 4AZ5A 3U2OA 3H55A 1QOPA 3DKJA 2YFOA 3DG6A 4FPSA 3DHDA 4KW2A 4FEZA 1NWUA 1C8XA 1UIOA 2X1RA 2QIWA 2CBJA 3U7VA 3CL6A 3AMKA 2J9XA 2Q01A 1BWLA 1OCQA 1LM1A 4C6OA 4J3UA 1TA3A 3B8SA 4YTTA 3MQTA 1FWIC 1NWTA 3CV7A 3DH7A 1C8QA 2BS9A 2DT1A 1B1YA 1K6AA 4MJ4A 4POCA 4HPNA 4ZOAA 1CB7B 3L4UA 4DO6A 1DJWA 3GNDA 4Q4KA 1OX6A 2VVSA 1FRBA 3SSJA 2YL6A 3LYEA 1MZHA 1EP2A 4F2TA 4W9TA 5DRCA 2ZRZA 4BK9A 2YA0A 2QV4A 2Y24A 1BYAA 3BCFA 3UU0A 1QPNA 4NNCA 1QHZA 1L6WA 1ZALA 3F4CA 2XUCA 1AQ0A 4TVUA 3MW7A 1W5MA 4DUWA 3M5XA 4U28A 4MY8A 2FGLA 5EY5A 4IHCA 2YX0A 3AIBA 1KFEA 2GJNA 1J01A 4WK9A 5T9CE 2X8RA 3BTNA 3RCMA 3VILA 3NZ1A 4NT0A 3EX1A 4FXJA 3LLFA 2PTXA 1TRIA 2F2HA 1XYLA 5EGRA 3V18A 4HZ6A 4NXSA 5GPRA 4S3DA 4AUBA 1S39A 3KTCA 2PPGA 2VFIA 4AFYA 3HPZA 3PWAA 4ECLA 3H70A 5D38A 1M1BA 5I3DA 5CZTA 2A0NA 4MM1A 1KFJA 2WNZA 1REQA 1JDDA 1BSIA 4WY0F 4GUHA 4HK5A 3OQEA 3RIKA 3W7OA 1QJWA 3WLMA 5J8LA 4DAIA 4UCFA 1CYGA 4UNIA 1OB0A 1T96A 5DELA 1ZGDA 3APTA 2CXEA 3AYSA 2PGRA 3Q67A 4JHZA 1PIGA 3TMQA 5AVNA 2HE5A 1GCYA 1WAWA 4ORMA 1WZMA 3UG8A 2Y70A 5I3FA 3ZFHA 3BANA 1FWWA 5EYWA 1IR1A 4PMDA 3POHA 4CD8A 4AIEA 2QUTA 1FCUA 1HKJA 1TPWA 2JF6A 4NXKA 2CC0A 1MQPA 2C8NA 3CGTA 1ZJHA 2V3FA 1TWSA 2VFEA 2PCQA 5XINA 5I77A 4KEMA 4XO7A 5AECA 5HJYA 4QSFA 3TWAA 1RY8A 1J0KA 3LEPA 2G3IA 3TN5A 1RBAA 2WMGA 2VDGA 1UWRA 4AMCA 3AS3A 1ICSA 5A6BD 3HF3A 3EDFA 3O7UA 4K1WA 1JI1A 4I9MA 5FCZA 1GOWA 1XBYA 3BW3A 1MXSA 3F5KA 4ICMA 1RPKA 1GK8A 3U2ZA 1V0MA 3BLFA 2GOUA 3NUKA 3WLNA 2YDSA 3V1HA 3QC0A 3KEHA 2CKRA 3CC1A 1J4EA 4IJRA 5CPQA 2DEPA 1JYXA 3WMCA 1JPHA 3AIWA 2GDVA 4DBSA 3IWPA 2D2HA 3WK0A 5EBUA 5M1TA 4L9XA 5ABFB 1EOMA 3HIJA 1EC8A 3I7SA 3SRKA 3GW0A 3VOHA 4F40A 7REQA 1UZHA 2I56A 3WZ0E 4F0SA 3BDKA 3IJ8A 1EX5A 4W89A 4ZFCA 3EWDA 2XIQA 1XYAA 5LNWA 5DMLA 4LOCA 1CXIA 1RP9A 3PUDA 1HZYA 2W67A 4LAKA 1TJ2A 4ZGYA 1BWVA 3L0KA 1XGEA 3QBUA 1KWKA 5LNSA 1UUMA 2CW6A 1WB0A 3F03K 2OEMA 1O94A 4J4KA 4AD5A 2XZ9A 4IL0A 4PODA 1B90A 2RHGA 1OM0A 3WUGA 1O12A 2A3LA 3IVUA 4HOWA 1GQJA 1TZZA 2GQ3A 3GQYA 4H6QA 1UR0A 2XH7A 1EJRC 4K68A 3W7EA 4LRTA 4CQAA 3TYEA 3NQFA 5C9ZA 1YQ2A 3LPOA 4LGXA 4XV0A 4D72A 1SO6A 4HCHA 3SN4A 2E6YA 3DFNA 2QMKA 5BRPA 2WKJA 2JALA 1H7XA 1AMYA 1U1JA 1JCLA 4QAWA 4GO9A 3NNTA 1AH3A 4JKKA 2HCVA 1JYWA 1CB2A 1DJQA 1AG1O 2PWUA 2WMKA 1FWJC 2ATSA 3BLOA 3ITCA 1FA2A 3VOIA 1W1IE 5ABHA 4JTKA 2I1OA 3GUGA 4YHGA 4U2ZA 3NWRA 1W3HA 2DJLA 1L6GA 1R0MA 3DC0A 5C6MA 5IBXA 1C8YA 2QCMA 1O5KA 4XVDA 4KRUA 4UQBA 4Q7IA 3NG3A 3UWYA 1PYMA 4Y96A 1BQCA 1V79A 5AB3A 2Z00A 1M68A 4EVZA 3P14A 3ITYA 1VLWA 2Z1SA 5AHLA 4E8GA 2QUVA 3O6YX 2PA6A 1IQ8A 1XFBA 2EPHA 2PLCA 1XDLA 4L4OA 3IK4A 2RDUA 3VZXA 3AIRA 3WYZA 4MADA 3M43A 4L4MA 4P7OA 4O54A 3LI0A 2W5FA 4IMAA 1TR1A 1A49A 5KITA 5A2CA 1HJWA 3R79A 4YXGA 2J7BA 4PA8A 4NVTA 4CQ9A 1BWKA 4AHPA 3QQWA 2AGTA 4KESA 3V5FA 3GIYA 4JKLA 1P48A 2X1UA 3BOFA 1KTBA 5FKYA 8CGTA 3LHWA 4PMNA 4OE7A 3AIVA 4E2OA 4PUWA 3SY8A 4RL3A 1FWEC 4H7ZA 1UR9A 1WP6A 4JN8A 1I2RA 4JIPA 2VRJA 4LTSA 4NIRA 1P0DA 5KMYA 2WHKA 4XX6A 2EBNA 3PPHA 3OLDA 4HKPA 3OLIA 2CWNA 3ARPA 1ZP3A 4AG0A 1W9XA 2BV9A 3T2PA 3QF0A 3HV8A 1JNDA 2IXUA 1QW7A 1QNVA 2FFCA 1HVQA 3E1F1 1IHIA 5C2CA 4LB4A 3WELA 5XIAA 5A3HA 1LWHA 2PEVA 3CWOX 3CZGA 3ICJA 2NLIA 4K38A 4UMCA 1VBGA 3DI0A 1RQBA 4OECA 1E0WA 2AMXA 1MUMA 2EG6A 3QPEA 4CEXC 2QCDA 4E2BA 1PDZA 2GSEA 1A5SA 1X1ZA 5I09A 2ZUVA 4J3TA 2VFFA 3RU6A 1V6VA 4DBWA 4JNYA 3A24A 4KWSA 5JMUA 1NF0A 3W7HA 4J2MA 1JCYA 1PZ0A 3KZSA 1ZCOA 1ME8A 2H9AA 1ZJIA 6ENLA 3B03A 3G1DA 2HVNA 2DZAA 4MWAA 3GY1A 4MKNA 2DVTA 1KM3A 3PAJA 4LS2A 4HQVA 4GQRA 2BY0A 3TQKA 2ANUA 3WD1A 4GJIA 4DEFA 1XBXA 5AC4A 1QVBA 3WD3A 5A6JA 4IFKB 2BVTA 1OGSA 1Y8BA 4C6BA 1EJUC 3VINA 1YPFA 3NO3A 3WCZA 4Q4QA 3ARQA 4C6MA 1JF6A 1PJ9A 4DBDA 2ZQ0A 3RXZA 3AUOA 3ANVA 4O52A 3WLPA 1Z3NA 1XUUA 1GPWA 3SQLA 6REQB 5FEXA 3DGRA 1PYFA 3LZ3A 3R12A 5A8QA 3VNDA 2YJQA 3O8AA 4GINA 4ERIA 4MWAB 1F3TA 3NIYA 2FHFA 3EA3A 1GW1A 4JTTA 1VH7A 3AMDA 1TX2A 4OV9A 4LYQA 2J27A 1XICA 4XBKA 3UR5A 4GGHA 3ARTA 4FA3A 1WKFA 3KVKA 3PTQA 1GOIA 2FB2A 2G97A 3VFCA 2QDEA 3V5OA 2HWGA 5FSEC 1PKNA 3AYRA 1XR2A 1PE1A 1R46A 5BRQA 5BMWA 3WH9A 1TV8A 4GUJA 4C6EA 3RN6A 2PTWA 5IRPA 3U9IA 1VFFA 4HYWA 4N9DA 3NQ6A 4E4PA 4R34A 1YW1A 2C91A 5DBTA 1YRRA 4RKAA 4HB7A 3NL2A 5HWNA 1B30A 2TYSA 2E1DA 4DJDD 3CHEA 4XZ9A 2EPMX 1M3UA 3SR7A 3QGVA 3VGDA 6CGTA 3RM9A 4HYRA 3O0FA 3W53A 1PZ2A 3V3WA 1W3TA 2PDQA 1VQTA 3NOYA 2R1MA 1GYNA 4JAWA 4FZIA 5GJPA 4WOQA 3QV7A 1IGSA 1DJNA 4S3CA 1RHCA 2Q09A 3WLQA 5C9UA 2CFFA 5F2GA 4LRSA 3MMWA 4JFVA 1TR9A 1WOAA 3AHVA 2AQOA 5H1WA 1XIEA 4JIQA 2B31A 3UR2A 3H22A 5K9CA 1VHNA 4JIEA 1W1TA 2QUMA 2WPBA 3B8UA 3OZOA 3G24A 4Z1AA 1Q2SA 1PZ1A 1H1NA 1VPYA 2EPKX 1SZEA 3PVFA 3BC9A 3PZOA 4D1JA 4JTSA 1VJZA 3OZPA 4YMZA 3VYLA 2PD5A 4M3PA 2C18A 4TVDA 4PUJA 5BOOA 1FDYA 3BW4A 3CJPA 2ATMA 3TQ0A 2GJXA 2NX1A 3HPAA 3BG3A 3M5VA 1R6WA 3ONBA 4LFYA 2FPVA 4AD3A 1R3TA 1LROA 1LRQA 2QV5A 1E6RA 1KM0A 1MNZA 1XLJA 1Y7VA 4IJBA 3SBFA 3IGHX 3HURA 3O6CA 3R6IA 3MSDA 2XGIA 3LHUA 3WDJA 2A3CA 3TIMA 3F4WA 3P5YA 1NDWA 3IANA 4LAOA 1XHGA 2WV8A 4WZHA 1O95A 4DYKA 1GKQA 1PX3A 2CLKA 3WLOA 3T4CA 4GVGA 5I7GA 2VC7A 3GC5A 4H9XA 1GGOA 4IMDA 3OODA 4IUGA 1S2UA 3ITTA 1OGGA 5LIKX 2XYLA 4FNQA 1PAMA 3P93A 3KBWA 1TG7A 2ZXDA 4IG2B 1KNWA 2C16A 2E68A 3R10A 4P8XA 1GOKA 4R7OA 2VX5A 4RE0A 1XF0A 4ZOBA 3RDKA 4GACA 5AYYA 9RUBA 2QGYA 2GK1B 2WMIB 3LBCA 1ML1A 3VNLA 4REQA 4GX8A 4Y7EA 5A6TC 1UH3A 3T9PA 1WDDA 1EXBA 2BX7A 3B9NA 3CQHA 2J4GA 3NQEA 1UR2A 3H23A 4UTWC 1J0IA 3W71A 4S3EA 2IKJA 3GR8A 4Y6GA 4MYXA 1ZL1A 1IEIA 3VDBA 3TW9A 5HQMA 4FR6A 4GJJA 1YNQA 1A0CA 5FJIA 5HJLA 2QF7A 3ZSTA 1YIXA 3C52A 3UY7A 5JQ9A 1W8SA 2ZZ5A 3QM3A 1P0BA 3NOEA 2EG7A 1E1CA 2NQJA 2JGQA 1VC4A 3EOLA 2C1HA 4JX4A 3UA4A 3I68A 4DJEC 1EC9A 4IPIA 5BZAA 3AHTA 3IIZA 2ZADA 5AYZA 2Y5JA 3W87A 5IFTA 2WNNA 4R7JA 3K4WA 1GZGA 2ZDSA 1SJAA 4N6EA 2BXVA 3QMTA 4W8BA 2VUYA 1W1YA 2HXTA 3H2FA 4LAUA 3W85A 2Y63A 1UKTA 4ZQPA 4GRSA 2J6XA 3IJIA 4K8EA 2W4XA 3A3HA 2IPFA 4MFEA 4UCGA 4LY4A 4XWUA 4OT7A 3M64A 1ZUAX 3O3RA 3I6RA 3UF9A 2Y1HA 1QWGA 2QCDB 3RM8A 1E43A 4WSKA 5AY7A 4PUKA 1Q85A 1XCXA 4H01A 3OBEA 1ITQA 1OWQA 4S23A 4B5WA 2V9DA 3OJGA 3OOQA 3GHRA 4PBFA 1G6CA 2PDPA 3K30A 2FLIA 2WJFA 3NQ2A 4L1GA 5I00A 4I5UA 3EKGA 2HVMA 1FQ0A 3NGFA 1OQFA 1XLEA 4FOUA 3GFXA 4BR1A 6TIMA 3MBDA 4AZ7A 4P8UA 3P0WA 3HQ1A 1PKLA 1UPPA 4O4WA 1YDVA 1W17A 1ZY9A 4JCMA 3OVPA 2C19A 1SJBA 3W26A 1UPMB 3A4AA 3PC0A 3STPA 1NOUA 4FAMA 4Q7BA 2INFA 1T41A 4XZBA 3BGJA 1Q6GA 1GQKA 4K39A 2E77A 2QCGA 1NTHA 1JULA 4W8AA 4HTYA 2UZ9A 1Q6LA 4AVNA 1UMLA 4HP5A 1A3XA 3ZT5A 3M0ZA 1TYGA 4NZCA 4C5ZA 3EYPA 4JTCA 3FA5A 4XVEA 1JZ5A 2G8ZA 3KM8A 2X0YA 2BGNE 5DO8A 1S5WA 3N6QA 3IUHA 3STFA 4DF0A 1XGZA 5DXXA