3RMJA

Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
307
Chain Sequence
TNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDFEAVNAIAKTITKSTVCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIHMEYKLKMKPKQVIEAAVKAVKIAREYTDDVEFSCEDALRSEIDFLAEICGAVIEAGATTINIPDTVGYSIPYKTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQVECTVNGLGERAGNASVEEIVMALKVRHDLFGLETGIDTTQIVPSSKLVSTITGYPVQPNKAIVGANAFSETYEIMSAESVGWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-isopropylmalate synthase
publication title Removal of the C-terminal regulatory domain of alpha-isopropylmalate synthase disrupts functional substrate binding
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 128
structure length 307
sequence length 321
chains with identical sequence B
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rmjA00
5IM51 1LROA 4PA8A 3WK0A 5LGXA 2YCEA 2HMCA 3O6CA 1QR7A 4NU7A 3HG3A 2NXHA 4UTWC 1N7KA 3W1TA 1P5BA 3M1ZA 1VLIA 3C2EA 1VHNA 1DJQA 2CLFA 3C8FA 1AMKA 3HPZA 1ZCOA 1GEQA 3FFSA 1EUAA 2VFDA 1TCDA 3W7QA 4QITA 3W22A 1QMLA 1X8FA 4K36A 2YW3A 1ZAHA 3EWWA 1FBAA 2D73A 4ML9A 4RV8A 3NEVA 5L6UA 1VJIA 4AAJA 1HFBA 4OE7A 4RX0A 2NZLA 2QEZA 1GVRA 3OG3A 4UTIA 1WOBA 3QEZA 2P10A 5D2YA 3PWAA 3WJXA 1JVNA 3LHUA 4QM1A 5BMXA 1OX4B 2A4AA 3GYEA 3N3MA 1G4PA 2I9EA 3ANYA 1TV5A 4O52A 3G22A 3M44A 4YXGA 5G2IA 2YGYA 5HR7A 1QOPA 5AC6A 1SQ7A 4JGDA 1K8XA 1ZFJA 3P5ZA 4GRSA 1W37A 4XWUA 1JUBA 3IVUA 5DCDA 4AHQA 4HPJA 1AW5A 1L6SA 2I1OA 3LXCA 3BG9A 2NX9A 4LS1A 5KZDA 1K8ZA 5FEWA 3W7JA 5K9DA 4CQ8A 4N6EA 1L2UA 5AHEA 4YWIA 5F2IA 1VCVA 2QUTA 4R34A 3ZWSA 1PV8A 3QQ1A 2ZZ2A 4CCDA 4LVFA 3S5NA 2EKCA 2A0NA 4JX6A 1QPOA 1W5PA 2W0UA 2EAWA 1I2OA 1K7XA 3BLIA 4WJEA 4ALDA 4MLJA 4DO5A 2VEPA 5K4XA 3VCRA 4JICA 1QFEA 2GJNA 4NVTA 2B7OA 4JR5A 1LBFA 2Q3OA 3C56A 2GOUA 2AAMA 2WNZA 3GXPA 4O19A 3W2JA 1FCBA 1MO0A 4ZQPA 4UR8A 3DHDA 2QCEA 2WOQA 5E93A 2RKXA 3NL2A 3NQGA 3UWWA 1FWSA 5LSMA 3LLFA 1ICSA 3I65A 1LRNA 1OJXA 4DBDA 3LCHA 3W7NA 1FXPA 2NV2A 3TC7A 3EEGA 1NVMA 4O53A 3AJXA 3QFEA 2BX7A 3W75A 4FHAA 5HWNA 4TO8A 4GUFA 4EF9A 3HIJA 1V5XA 3B4UA 3C2OA 4WY0F 3EKZA 2XFWA 2YW4A 3TSBA 3CQ0A 2QKFA 1CX9A 1W1ZA 3NM1A 4O8RA 1W3IA 2X2GA 4AVFA 2Q8LA 1W0MA 5AYZA 4RR4A 3M43A 2NWRA 3N9SA 1EP3A 3VKJA 3OVRA 1NSJA 4OHQA 1EA0A 5KZEA 2NUXA 1TJPA 5CPMA 1TPB1 2Z1BA 3IGSA 5BNKA 3E02A 4N4QA 5D2XA 1QWGA 5G1YA 2WSRA 2GPTA 5AHFA 1UUMA 1GWJA 1YTKA 4IXXA 1KTBA 5E1QA 5BMWA 1FCUA 4NZFA 1W5MA 3W7HA 2Q8ZA 3O8AA 1TRIA 1QOQA 3I7RA 4IMCA 3RF9A 3OVQA 5AHLA 4MFDA 1QNVA 3B05A 4XBKA 4BI6A 1ICQA 2NX1A 3B03A 3CT7A 3O1NA 3MBFA 3W7GA 3L66A 2J27A 3WJSA 1Q45A 1Z44A 2X1RA 5D30A 4TX9A 1ALDA 1LP6A 4DEFA 3DAQA 3T7VA 3N14A 3NDOA 4QAIA 1A5CA 2DZPA 2VEIA 4XTDA 3IVTA 4GFSA 3N73A 1LOSA 3TFXA 4ADUA 3EX2A 5HINA 5FEXA 3SI9A 4IMDA 4HNTA 1XBYA 3ZWTA 3L2IA 2DORA 5FF7A 3G0XA 3W7CA 1FY6A 2VFFA 3K30A 2OJPA 2J9ZA 3LTPA 3NA8A 1W8SA 2W79A 3PUOA 3ZFHA 3NAVA 3BLEA 4ORIA 1M7PA 2VXNA 3DFTA 2QJHA 3GK0A 3S8HA 2CZDA 1DHPA 2ZA2A 1W5OA 4MZ1A 1TPEA 1SFJA 4JTUA 3UPWA 1RQBA 3LCFA 3CIXA 3HGSA 5AOUA 3LGEA 1QDSA 4HPXA 1LCOA 4RZ4A 3STCA 3P82A 4K38A 3P81A 1DL3A 3BW3A 1OK4A 1XBVA 1LBLA 1W5NA 3DKJA 3QH2A 2CLEA 3C3NA 5AC8A 3UWVA 1I2NA 3MYPA 1NEYA 3H53A 4RZ6A 2EF9A 1ONRA 3B04A 2V0TA 3O05A 1LZOA 4U28A 5HUOA 4MY8A 2CFFA 1Z42A 4WY0B 4K8HA 2C0AA 4M7SA 4ICNA 1A5BA 2NV1A 1T96A 1O60A 3W1MA 5K3VA 4AMAA 4IMGA 3R89A 1FDZA 2CU0A 5KZMA 4O11A 4RCXA 3W1LA 5CKSA 5A5WA 2CLKA 3AO0A 3PG9A 1YTEA 4MKNA 5DBTA 2Z6JA 5KMYA 3W23A 3I68A 1RZMA 1G7VA 3L68A 3FJLA 1NAL1 4N9DA 3LHVA 2XN1A 5D33A 3GZ3A 2JKPA 1D3GA 4PCFA 4YLWA 3TUUA 4IMEA 3MHUA 1DJNA 4HN4A 4RKAA 1OABA 3C2FA 3UD6A 1SO4A 3QW3A 3G8EA 3TMLA 3N2MA 4PL1A 1ICPA 3KOFA 3HG2A 4TU1A 1QPRA 1LLZA 5I3JA 1JULA 1KM5A 4LY8A 3BW2A 1L6YA 5DLCA 1RR2A 5I3HA 2YPIA 1FWTA 5KINA 2JBMA 4NXSA 3G1VA 4DF0A 1UB3A 5CZ0A 3A24A 3PR2A 1LM1A 2B7QA 3S0CA 3TAOA 4UFJA 1NF7A 2QR6A 4O17A 2A7PA 1JR1A 1D9EA 1X1OA 4FNUA 4M5PA 2QDGA 3FOKA 3UNDA 2Z0IA 3NQ7A 3GB6A 5KITA 4UMCA 2Y7EA 4W9TA 4C1KA 1ZAJA 4FNPA 3NL5A 1M5WA 2HS6A 2QDHA 1KFBA 3DENA 1JUEA 1ME9A 1CI1A 3G3DA 2QF7A 4NJKA 4UTTA 1OX5A 4LRSA 4A3UA 4DPPA 1E51A 2W6RA 4JTIA 4DO4A 3NXFA 4IOTA 4IX0A 3DH7A 5FF4A 3W7RA 5AC7A 1OF6A 1X6UA 2DU2A 3QPYA 3UY7A 2CZ5A 3T55A 1OK6A 4MOZA 3W9ZA 5EBUA 3DXIA 3G1HA 1GT8A 4UMAA 3UPBA 3TCEA 3PULA 4LVBA 1TTPA 2ATSA 3GAYA 2HS8A 3I6RA 2DZTA 5EKYA 3TH6A 1VZWA 3A23A 1WAUA 3GDKA 4JYDA 3BGGA 2A6LA 2DZVA 3C52A 1H62A 3M0ZA 3HGOA 4LV4A 2G95A 1K02A 1F05A 3E96A 3GDMA 2YR1A 3S1VA 3PB2A 1JJKA 5DN1A 1BKSA 3R13A 4JY9A 4IUOA 1OFBA 3G18A 3PAJA 4GXMA 4ORMA 4QNEA 1ZALA 2ZZ1A 4NX0A 3I7SA 3QM3A 5I3FA 2PE4A 1G4TA 3L9CA 2C16A 3OEXA 1QAPA 3EXRA 4MY1A 3G0SA 3IIOA 2DZUA 1IIHA 5H2ZA 1OF8A 3W7MA 3KRZA 1VYRA 3GNDA 4D2JA 4OGZA 4CLMA 2TMDA 4DBEA 3O07A 4GWEA 4NJGA 3PB0A 1CW2A 1H60A 1MZHA 1GZGA 2YXGA 1O5XA 3LRLA 1H1ZA 4AF0A 3GXTA 3Q94A 3YPIA 1P4CA 1F2JA 1KFLA 1IXQA 4UFKA 4CQAA 2E1DA 1H7NA 4XTIA 4KWWA 3H54A 2Y61A 1ME8A 4PEKA 2V2HA 5CG7A 3BK0A 4O14A 3C2RA 3SW6A 5FF2A 3TK7A 3TSDA 3BO9A 5L9FA 1AL7A 1GTEA 1SW0A 1HL2A 1LTDA 2QJGA 3H55A 3P8IA 2QJIA 2FQIA 2F7FA 1WOAA 3ATZA 4HT3A 2R91A 1TRDA 4Y96A 5F2LA 4P61A 4EVZA 4N2YA 3IIZA 5AYYA 3SECA 3P62A 4LVDA 1OX6A 1KBIA 5TBOA 3PC0A 1H51A 1TO3A 1I2PA 1F6KA 2LLEA 3M16A 3NPWA 3IRDA 1FUYA 2GVGA 2FLIA 2YYTA 2F84A 3GVGA 3W2UA 2BWGA 1ZJIA 3G24A 3L5AA 3S1WA 3GXNA 3GDLA 1TB3A 5CZJA 4LVAA 1H63A 1ZHAA 4BWLA 1W56A 2P1FA 5U4NA 2ISSA 3IV3A 1MEWA 2PRHA 1KM6A 4UR7A 4LS2A 4Q33A 2C13A 2FFCA 1JCMP 3A22A 3BPWA 3RLVA 2E5DA 4JYFA 1I2RA 1H7RA 3UWQA 1KM3A 4RK8A 4AH7A 3G1SA 3SZ8A 1JQVA 3KVMA 3IEBA 1MSSA 3W7PA 4O16A 3KX6A 3MHFA 1KLZA 2VFEA 1K8YA 3A5FA 3GDRA 4NQ1A 3QRHA 3SY5A 3IIVA 2C6QA 3M6YA 3CU2A 3FIGA 5CSRA 3LCLA 4ZVJA 2OX1A 3M5ZA 1EX5A 4JYEA 1GG0A 3G1DA 4O50A 4I9AA 1M7OA 3NL6A 3GR7A 3TXZA 3BG5A 4A2RA 1P0NA 5F1UA 3NQ6A 1XBZA 1YDOA 3QMSA 3HBLA 3TNOA 1WBHA 2ZBTA 2C14A 3R2GA 3W85A 3ZS4A 3HJZA 4JIQA 4FNTA 2AQWA 2QCFA 1SW7A 1RQHA 2J9XA 2FDSA 1KBJA 5AHIA 4AEOA 4GJ1A 1RVGA 4MVAA 3UWZA 4N4PA 1JUKA 4QIUA 2V82A 1O95A 5EMUA 3CPRA 5CZSA 2BLEA 3S6DA 4MPQA 2CLOA 2IQTA 1OX4A 3JS3A 4EF8A 1VYPX 2C15A 3MJYA 4FX8A 1MEHA 2FB3A 4MZ8A 5CPNA 4E2BA 1LLWA 4CNNA 4GUHA 1H61A 5H91A 5LNRA 3W86A 2Y70A 4ADTA 4GE8A 1K7EA 1RPXA 4WZHA 2QCDB 1OHLA 3PY2A 2CW6A 4S2BA 2TPSA 3QSRA 4LC8A 5D03A 3LV5A 2HSAA 3LBMA 1R46A 2E6YA 3GX9A 2FPYA 1MXSA 3EX4A 5J5DA 1SO5A 3UXAA 1TPFA 2GQ8A 2TSYA 3G0UA 2J24A 1A5SA 4MJMA 1PIIA 2B7PA 3GIYA 3W7DA 3S1UA 5T26A 3PBWA 4N9BA 4Y6GA 4C1LA 5J5RA 1Q3NA 1B57A 3QMTA 5FESA 4LT9A 4MUZA 2A21A 1FCVA 4ADSA 3PBYA 1EP2A 1O5KA 1R30A 3LDVA 1DOSA 1RD5A 4JTEA 3CB8A 1XUUA 2ZZ3A 3TE9A 2ZRUA 3G8RA 3MHGA 4RJEA 1XFBA 2Y7GA 4FXSA 1X7FA 1VPXA 4R7JA 1H50A 3BW4A 3P74A 3P7YA 4DPQA 3LM7A 2YFOA 3W1AA 3LXAA 3NQMA 3N19B 5TQLA 4O15A 2A5HA 3NQ8A 3FKKA 4JTHA 2VELA 2I14A 3FLUA 4ZQNA 5F4XA 2ABBA 4HIBA 5D32A 2C3ZA 1D3HA 3C2VA 3RNDA 3CIWA 3FEMA 1HO1A 1UCWA 3BVJA 1AW1A 3UZ5A 2FTPA 4WOQA 2QCHA 4O1DA 3W1PA 3KVJA 2QCGA 4JS3A 1F6PA 4O10A 3B0UX 1TTQA 4FX7A 2WV8A 1R2RA 4Q32A 5FEZA 3VE9A 3NQDA 3LX9A 1TQXA 3QW4B 1PHWA 4Y9AA 3PSVA 4ZL1A 2VEKA 3TSMA 4LU0A 2BTMA 4WUIA 1U5JA 3NQEA 3CWOX 3P60A 2A1YA 3EXSA 2GJLA 3TR2A 2J6XA 1JRCA 2HTMA 3NQCA 3PG8A 2E5BA 4Y90A 4O0KA 2C18A 2ZRZA 3UWUA 1R2SA 1C9DA 1J5TA 3P8JA 5D38A 2DZWA 2EPHA 4E2DA 1QPNA 4UFLA 4UTHA 3EKLA 3UYCA 3DFPA 2NUYA 1TTJA 2NXGA 3ABQA 1PVNA 3L0KA 1XUZA 3NGJA 5LNVA 2YZRA 2H3BA 1K7FA 5CPLA 3W2LA 5TIMA 3S9YA 3OBKA 2ZA1A 4PFMA 4QJ1A 3SFKA 3M47A 1FXQA 2RHGA 3THQA 3NQAA 4AWUA 4Z0JA 1ZNNA 3DI1A 4IPIA 3ABRA 5C5YA 1EPXA 5G2WA 4WX2A 3WK3A 1SO6A 3DKLA 4K6AA 3DHFA 3LCGA 1AG1O 1VC4A 2ZFAA 5LNWA 4A21A 1KM2A 4OBTA 1KM4A 1TPVA 3P5YA 5LNSA 3THAA 1I8JA 5CSSA 1DBTA 3W83A 3WJZA 3EWZA 3FJ6A 4PC8A 2H6RA 2GVLA 2NLIA 3U2OA 3L65A 4QNWA 3TW7A 4CCEA 2VEMA 3ABOA 1EP1A 3T44A 1S5VA 1W3NA 1BWKA 1I2QA 4O1CA 3PBVA 3UY8A 1TSIA 5LZLA 4BK9A 2VC6A 4O12A 3RK8A 1YLVA 4AB4A 4BI7A 3B06A 4LUJA 2WPBA 2NWSA 3O6DA 3HPXA 5G4WA 1ME7A 5FF0A 5D02A 4UCGA 3W3OA 2ZZ7A 5IBXA 3C0JA 4Z1CA 3NM3A 5C6MA 3BV4A 3C61A 1XL9A 3CLMA 5DXYA 1F5ZA 3W07A 2Y88A 2DZSA 4G1KA 3L5MA 4UIOA 3NNTA 2X1TA 4WY0A 2Z2UA 4UFIA 4KFNA 4JX4A 2V2CA 3W7EA 3NL3A 1GTHA 4U4MA 4UTMA 4BF9A 4JIPA 3WFAA 1P1XA 1YXCA 3WK2A 1H7WA 4GC4A 1GJPA 3QF0A 1GVQA 3QMRA 3HPSA 2RDTA 2PCQA 3ATYA 5AHMA 1IIGA 2VFIA 5D37A 1R2TA 3LHYA 4O4VA 3S5OA 1W3TA 1SFLA 1VS1A 3O15A 1I4NA 3SJ3A 5LHEA 4WD0A 4L4LA 5AB3A 1XDMA 5DBUA 4GUJA 6TIMA 2DZXA 2VENA 2WKJA 4UTLA 3DFNA 3F1QA 3FYOA 1SZNA 5F2MA 3P61A 4AXKA 4IXHA 2NUWA 3B0VC 2QCLA 1H5YA 4O0ZA 3UWYA 1KFEA 3W1UA 1KFCA 4E38A 3W6YA 5AN7A 1OFRA 1TV7A 2V81A 1N55A 1I45A 4HHPA 4K8EA 2E09A 3NPUA 4A29A 5MHBA 1IXNA 3Q2DA 3TXVA 1H7XA 3GAKA 4NNAA 2A7NA 2DJLA 3EWUA 4AHPA 1GPWA 1W54A 1UUOA 4DF2A 1VCFA 1Q6OA 3O16A 4HNVA 4OQVA 3QC3A 1MEIA 3CWNA 1TJRA 2DJXA 2CZFA 1ADOA 4UMBA 1B3OA 3L0GA 3INPA 4P2VA 4LVGA 2ZZ4A 5HNRA 2OZ0A 5DY3A 5IBXC 1G6CA 3W74A 2JGQA 3W1NA 1JCXA 1KV5A 1L6WA 3KVKA 2QAPA 2ATMA 3KHJA 4FX6M 5CZTA 4DXVA 3KXQA 5HULA 3LTSA 3F03K 3IIXA 4JTSA 3OIXA 2E77A 1XBXA 1TIMA 4RXGA 3W7IA 3TJLA 2Y7FA 7TIMA 4FO4A 2GQAA 2KZHA 4OU1A 3TJXA 1S5TA 2Q3RA 2RFGA 1U83A 4UTWA 1S3HA 2R14A 1W31A 4HSOA 2V8ZA 4XKYB 3T78A 2CLLA 3NVTA 4MYAA 3HGRA 3W2KA 1XXXA 2FPVA 3RLUA 1UJPA 1DORA 2WSQA 2Y63A 5LNUA 3G1YA 1OFOA 3KAOA 1SUXA 1V7YA 1YPIA 1KLYA 1F76A 4UTTC 4Z0SA 4MJZA 4AWTA 2GUUA 2ISVA 3S42A 1XDLA 4OV9A 1BEUA 1VLWA 1FQ0A 2ZRYA 3LHZA 4TR9A 1GOXA 4NZJA 1H7PA 2RDWA 4FEZA 3M7WA 3KVLA 2FB2A 5CGQA 5K9XA 3NO5A 5D09A 3EX3A 4CNOA 3PSWA 4LC6A 4TMBA 3CC1A 3MO7A 4Z1AA 1DKWA 1LYXA 5C54A 3MBDA 3N9RA 5I3IA 1LBMA 3S5YA 1B9BA 4LW7A 1PL9A 2CLIA 4Z08A 3EXTA 2CZEA 2J88A 2G96A 3KRSA 3TIMA 1J4EA 1L9WA 4LUIA 2PRMA 3LBCA 3P84A 1BTMA 1YXYA 3EWXA 3NYZA 1Y0EA 1ZY9A 2ZA3A 3SGUA 3MMTA 1IXOA 1DQWA 4IPJA 3NQFA 1FX6A 1O4UA 1WV2A 3L5LA 1G69A 1VQTA 4DQWA 1FDJA 3TKFA 3UQNA 1NFBA 2V5BA 3C6CA 2GQ9A 1XCFA 1O94A 2OCZA 4MLRA 4ZQRA 1HUVA 1R47A 4GUGA 1KTNA 4FB7A 3A9IA 4M6VA 4GNJA 5G2HA 4OV4A 5C2XA 2ISWA 1SPQA 2ZTJA 2H8XA 4UUIA 4XQ6A 5LGZA 1KFJA 1OFDA 2C1HA 4NJIA 3DI0A 3E49A 1C29A 2JKEA 1OG0A 2Y89A 1SSGA 4UNKA 4M7TA 4DO6A 3NZRA 4UFHA 1VHCA 5BOOA 1A53A 3TA6A 2TYSA 5AYXA 5K2ZA 1UASA 2BXVA 3ABSA 5ABTA 2CLHA 1HG3A 4JDYA 5LKYA 3GR8A 3E0IA 4O4WA 5EPDA 1XI3A 3TMQA 2Y62A 3BLFA 3TQKA 4NJHA 2WJZA 5D2WA 4J9JA 1EEPA 4HSNA 4PH6A 3W87A 1WDWA 3BARA 3KRUA 3SGZA 3LOTA 2YYUA 4WXZA 3DU0A 2DP3A 3DFQA 3NPVA 3N34A 3E9AA 1DQXA 3LLDA 2ZCGA 1QCWA 3KFTA 1PE1A 3CM4A 4N9CA 4H6KA 3NZ1A 3TFCA 3DGRA 1YTDA 1VYSX 1PCWA 2WO5A 3LCWA 1A5AA 3M5YA 3NOEA 3GKAA 5DCBA 3F4WA 1KW1A 5EA9A 2H8ZA 2QAFA 2B0MA 2Y85A 4AHOA 4JDBA 4BWLC 3TDFA 4ZQOA 2V5LA 2JK2A 4LWWA 3WK1A 3EB2A 4RXFA 4AWSA 3LRKA 2A7RA 5G4EA 4PTNA 5DY2A 1OFQA 4DF1A 3IIPA 1TYGA 1VGAA 1THFD 4UTUA 2WQPA 4M19A 1EIXA 3W84A 1FWWA 4A2SA 2YSWA 2B4GA 4UNLA 1X1ZA 3P67A 3VFLA 2V9DA 1M6JA 4JTGA 2PURA 1WQ5A 4FNSA 1GVFA 4YMZA 3U8GA 2PC4A 3DFSA 1RQEA 1SU5A 4FIRA 1Z48A 3W1QA 2ZZ5A 5HR6A 4O13A 5HJLA 2EHHA 4H4IA 3QZEA 3QQ0A 2YFNA 3STEA 1VR6A 3P80A 2X16A 1JCLA 4O57A 4PL2A 3LB0A 4IX2A 3LXBA 3R12A 4EWND 2A85A 4JNMA 1TPUA 2CWNA 1IF2A 3CEPA 4KFPA 1S5WA 2OT1A 3NQVA 2O7SA 4DELA 1TPC1 4TMCA 3W2MA 4LV9A 3MI2A 4O54A 3MP5A 5I3GA 1YYAA 1OFAA 5A8GA 5G1TA 2OMAA 2QCDA 1SR9A 4NNBA 3G1AA 1PS9A 3IVSA 2XN2A 2WSYA 1SO3A 4EIVA 4FF7A 3USBA 1B4EA 3PF3A 5FI8A 3CTLA 4FNRA 4EOUA 5KSWA 3BGJA 3W1XA 4LRTA 4X3ZA 1JQXA 3L21A 4LS0A 3B0PA 1F74A 4XZ9A 2J9YA 3D0CA 3SR7A 4XUGA 1FCQA 3W7KA 2UV8G 4MZYA 2ZDRA 4IMFA 4MFEA 1WYIA 3PUEA 4HKPA 4RLIA 2BZNA 5GVJA 5F1VA 1TPDA 1XKYA 4K37A 1J2WA 3VI2A 3DZ1A 4KKXA 3SIZA 4JTFA 1K3UA 3LRMA 1AW2A 4YL2A 5K7JA 1QPQA 4IJBA 3LCXA 3T40A 3M41A 1JCYA 2PRLA 1B4KA 1AK5A 2R8WA 1YDNA 2OT0A 4PODA 3PVFA 4M6PA 1GYNA 3O63A 1VCGA 4NUWA 2ZRVA 1KA9F 2FIQA 5G5IA 1EUNA 1EWEA 4I7VA 3PUDA 2FJKA 3MI3A 1YADA 4Q4KA 3HG4A 3M9YA 4K39A 4QISA 2Y7DA 3BG3A 3HGJA 2QUUA 3C4UA 4UC5A 5C55A 5F4WA 4Z1BA 2WNNA 1P0KA 3TV8A 3FKRA 4LTSA 3JR2A 3W1RA 1GVOA 4JY8A 4GBUA 3GNNA 4QQ3A 3TX9A 1KM0A 1FDYA 1EB3A 3UXDA 4BR1A 1NF0A 4ZQCA 4UTKA 3G1FA 3EWBX 2JGYA 2TRSA 4O18A 3RFAA 2GVJA 4ONVA 1KV8A 3HOJA 1LORA 2Y6ZA 1W5QA 1TV8A 3QYQA 4WOZA 4YCOA 1GYLA 3TC6A 3N2XA 4JTTA 2QCNA 3G3MA 1GG1A 5AHNA 4LNYA 2EGZA 4WQ6A 3T4CA 5BRBA 1T8XA 1SZEA 4CCCA 3MI6A 1PCKA 2X30A 4TIMA 2E6AA 1UBSA 3QJAA 3R8RA 3GDTA 5EY5A 3NPXA 1F7BA 4L4MA 3LERA 5KTLA 2NX3A 5D2VA 4X9SA 5AFDA 1JCNA 1ZENA 4H3DA 5DXXA 4MIMA 5D05A 3HG5A 1HO4A 3LTYA 4O28A 3W72A 4CNPA 1TTIA 3M5VA 4NX5A 3MUXA 1YDVA 2QCCA 2C19A 4KFOA 1KM1A 4I7UA 4OWGA 4N6FA 1K03A 3TQ0A 5HUPA 5CPOA 4POCA 5EYWA 5I3KA 2AGKA 1QO5A 3ZR4A 1ZAIA 1LRTA 3B8DA 1TPH1 1ML1A 1WBJA 2X1UA 1EWDA 2RH9A 3GLCA 3WJWA 3MW7A 3VE7A 1FWNA 1JCJA 4ZMGA 3QPZA 3EX6A 3HF3A 3Q58A 1G67A 4HNNA 2JKAA 5U7SA 1IXPA 4IWWA 1QO2A 3A5VA 2O7QA 4UXDA 2QUVA 4IQLA 1VH7A 3MP4A 2P0OA 3F4NA 2VFGA 2QCMA 2ZRWA 4Z1DA 1SZGA 4LOCA 3W88A 4ZQMA 5LHFA 1H7OA 4NJJA 3W7LA 1Q6QA 2A6NA 3DFOA 3FA5A 2Z6IA 4S2CA 3A21A 4N02A 3TROA 2VOMA 4OT7A 4A22A 4XBSA 4BFAA 1G4EA 4B5NA 2ABAA 5E0KA 4M6QA 4UTJA 4JTKA 3OA3A 3W70A 5K4ZA 2ZZ6A 4RZ5A 4Y8FA 3GKFA 4FIQA 4O1AA 4FXRA 1KTCA 2A2IA 4QSHA 3STFA 4E0CA 3NR0A 1GVSA 4BI5A 1OFEA 1C8VA 1JRBA 2E5CA 3IGUA 2V30A 1TPWA 4ZZ9A 3EX1A 1YXDA 2FPTA 4X22A 2YDAA 4FNQA 1SW3A 4R33A 3W2NA 3NG3A 2RDUA 3LI0A 1T0OA 5HWJA 1A50A 1LRQA 3S5ZA 1TREA 1OVDA 3OHIA 1Q6LA 2R94A 4K7VA 1SZFA 5DCEA 5FEPA 3W73A 3PS7A 1KFKA 5BW6A 4UFMA 1LDCA 5DELA 4AF0B 3NQ2A 3Q37A 1RV8A 2G97A 5F2GA 1WX0A 4WXYA 2E68A 3V1PA 2X1SA 1AL8A 2XN0A 2ZQ0A 2H3DA 2ZRXA 3DBPA 3TW6A 3HB9A 3MP3A 4JN6A 4KWVA 4JX5A 3FS2A 3V75A 3W76A 3MWAA 4YCPA 5FF3A 3U6WA 5HWMA 1TMHA 3CEUA 3M5XA 3RMJA 1F73A 3L0NA 5K9CA 1DVJA 3HO8A 4MY9A 4HNUA 1N8FA 1XC4A 3SSJA 3OVPA 3G1XA 3LI1A 2NXIA 3IGXA 3O6YX 1HTIA 1IGSA 2ALDA 3CHVA 1XM3A 3LCIA 3WJYA 1T99A 5SWUA 4NXKA 2G5WA 3TAKA 3UZJA 3E12A 3PBUA 2H90A 3HQ1A 1YPFA 3I7QA 3LV6A 3HMJG 4JD4A 1OYCA 1DV7A 2ZYFA 4CQ9A 3QSTA 1G7UA 4JXCA 3MYOA 2CLMA 1PHQA 1LOLA 3LHTA 2BSLA 3L67A 2B7NA 3S1XA 8TIMA 1OYBA 5HMSA 3PM6A 4X2RA 3R5EA 1BWLA 2WNQA 4GUIA 5EL1A 1SSDA 4O1BA 1G4SA 4JTLA 3TQVA 2YX0A 3W7OA 2VKZG 4XKYA 4R53A 3VNDA 4N9EA 4JEQA 1H1YA 3ELFA 1Z41A 3LHWA 3RU6A 1VRDA 4NT0A 3W71A 5HQEA 2V2DA 2E6FA 1FWRA 5F4SA 6ALDA 2E6DA 1OYAA 3EWYA 1TQJA 4S1FA 3TU9A 4NNCA 1Q6RA 1WA3A 5D04C 4I7WA 2ZTKA 2VFHA 3FYPA 4JTJA 4MYXA 1OFPA 4IGHA 5D2TA 3STGA 1LOQA 3O06A 1WXJA 3JRKA 1GQNA 4K7YA
chains in the Genus database with same CATH superfamily
1X8CA 4IICA 4PA8A 2HMCA 5ABGA 5HMEA 3QV8A 4UOJA 3HG3A 2QNEA 3CBWA 3GFYA 2PWGA 1N7KA 3W0KA 3W1TA 3M1ZA 1VLIA 1BRLA 3C8FA 4PUNA 2WZMA 3VTRA 1AMKA 3HPZA 1RBOB 2WC4A 4D71A 4U31A 1B0IA 1A3WA 4QITA 3RM9A 1RXOB 2XGZA 3ARWA 1JD9A 5AYBA 3TYUA 3UZYA 4RV8A 2DQWA 5L6UA 2DSVA 4OE7A 2NZLA 2QEZA 4H9ZA 3ZVIA 4BF5A 2PDBA 3ZXWA 4QM1A 5CQ1A 5BMXA 3GYEA 5C9WA 3N3MA 1HJUA 1TV5A 4REQA 1JDCA 4Z2KA 3ZT5A 4DLMA 1SQ7A 4FK9A 4MB4A 1K8XA 5T91A 4CD8A 1JUBA 5DCDA 1BSLA 2Z24A 1D3CA 4AHQA 4MTVA 3BG9A 1FWBC 1K8ZA 3W7JA 1MRAA 4CQ8A 5K9DA 4YWIA 1I0BA 1RD6A 1MNSA 3LENA 3Q65A 2ZZ2A 4LVFA 1LT8A 4JX6A 2R24A 4QG8A 1KD0A 1UC4A 1I2OA 4CN1A 1K7XA 2WNWA 4BQ4A 1CLVA 3ARPA 4HYVA 2VEPA 4HCDA 4PBGA 5K4XA 4Q8UA 3U4FA 3GTFA 3VVGA 2IQDA 2Q3OA 5KETA 3HQOA 3SEPA 4W7WA 1E72M 4AEFA 1YNPA 3ZJ8A 2FZMA 1FCBA 3UVIA 2VR2A 2J4GA 2ZE0A 4UR8A 5E93A 5BXRA 2PTWA 5CJMA 1DYSA 1R6WA 5LSMA 3LLFA 1ICSA 4LUTA 5DFAA 1OC6A 2GGEA 2J75A 3V5CA 1OJXA 3OBEA 1L8NA 4H6EA 1XD1A 2PB1A 1VBGA 3TZFA 1AZ1A 3NQBA 4AZ6A 1EOMA 5HWNA 1AH0A 1J12A 3HIJA 1GOKA 1CCWB 3WQVA 3IV8A 2XH7A 1VENA 1B90A 2F6KA 3CQ0A 4D72A 1LL6A 1CX9A 1V6YA 2VVSA 3N15A 3NM1A 1V51A 4H2CA 3PUGA 1W0MA 1E5NA 5I79A 1HGWA 4LAKA 1XHGA 3OVRA 2NUXA 4RDYA 2I57A 3E02A 1XKJA 4PSRA 2WSRA 2P3EA 3F4VA 1YTKA 1V3IA 4TTGA 3EOEA 5E1QA 1MRQA 1FCUA 1V6UA 5TNVA 3WNKA 3O8AA 4B5SA 2HVNA 3BUVA 2C91A 4GZ7A 1IEQA 4LF1A 1MQRA 1A5OC 4FSAA 2NX1A 1FWEC 3CZEA 1CXHA 1PDYA 2J27A 3SSZA 4MKSA 1Q45A 1Z44A 5D30A 1QI5A 4HZ8A 1CDGA 4GQRA 4DEFA 3MQTA 3N14A 3UYIA 3NDOA 2FZNA 3GS6A 4QAIA 1VBRA 2DZPA 4Q8QA 2VCCA 4C6JA 2VUNA 1Z6KA 1W2PA 1LOSA 1R9YA 4ADUA 3EX2A 3KOZA 3EDFA 3S6TA 3FAWA 3WBWA 1GVIA 3TWBA 1R7AA 5T9CE 3W7CA 1FY6A 1DJGA 3K30A 2ISDA 4FOJA 3LTPA 1RJRA 3NA8A 2CNCA 3EPOA 3ZFHA 5EMKA 3BLEA 4I8YA 4ORIA 1XG4A 3OLIA 2QJHA 3SCNA 4IL2A 1W5OA 1TPEA 1UH3A 1SFJA 4JTUA 1RQBA 1VBJA 1FWHC 5BOFA 2ZADA 1UWUA 3BSHA 1PWLA 3STCA 3P82A 2D3NA 1J93A 2PDNA 4K38A 2NT0A 1ZZMA 2IKJA 1AQMA 4PYSA 8CGTA 1TFVA 1OK4A 2EQDA 1LBLA 1W5NA 3DKJA 1EBHA 4OBRA 4PCNA 1W1PA 1JF6A 2CLEA 5AC8A 1I2NA 1TJ0A 3E0WA 1NEYA 2EF9A 4Q8MA 1ONRA 4I5RA 3GC4A 1RLDA 4HA1A 3AYSA 2INEA 4MY8A 3M0KA 1TV4A 2PGEA 1Z42A 1EJUC 3S1GA 3AHXA 4K8HA 2W4XA 3WNNA 4NKCA 1AVAA 2NV1A 5K3VA 4BS0A 4O11A 4HU3A 3CMFA 3W1LA 1BYCA 2CLKA 3VAVA 3P0XA 1U5VA 4MKNA 4NILA 2Z28A 1XLAA 3W23A 3I68A 3O7UA 3L68A 3FJLA 4N9DA 3LHVA 3W28A 3KZPA 3GZ3A 1D3GA 4PCFA 4Q7BA 4IMEA 4DBSA 3P93A 2DT1A 3MHUA 1DJNA 4JTDA 3VKKA 5E6YA 3G8EA 4KBXA 4DB7A 2NT1A 3TMLA 3RILA 3VKAA 4W84A 3KOFA 3HG2A 4KWUA 3SGGA 1KM5A 1TCMA 3VU2A 3UGVA 2JBMA 3G1VA 1JFHA 1UB3A 2HVOA 3BZGA 2B7QA 3G6LA 7REQA 3PHAA 3OVGA 4AY7A 2A7PA 1X1OA 4DZAA 3JW7A 4EXQA 4PUDA 4L65A 3UNDA 3URNA 2WJDA 1KXHA 4RE4A 3NSMA 3GXDA 4WJ8A 1R3TA 3QYSA 4ZFMA 2R6OA 1ZAJA 1BVWA 3EDKA 4FNPA 3UJEA 3PFMA 2QDHA 3VO0A 2R1PA 4PRTA 3G3DA 2QF7A 3L23A 4NJKA 1B1YA 4HA0A 1UIOA 1OX5A 4LRSA 1E51A 5CJNA 4DO4A 3M0MA 1QNPA 4DRSA 5FF4A 3GHTA 3QPYA 1SMAA 1OK6A 2OYMA 2IMRA 4UMAA 1OWQA 2V5JA 2DZAA 3V4BA 3C3UA 3PULA 1ZB5A 4LBSA 1Q6CA 3I6RA 4W93A 3OA5A 3TH6A 4NAEA 1C8YA 1OQFA 3A23A 3P3BA 1EJVC 3GDKA 2DZVA 1H62A 1ODUA 2G95A 3RG6A 3GDMA 2YR1A 1KQYA 2V68A 1DIKA 3R25A 3VMNA 2C1IA 4LAUA 3R13A 3L2MA 1M3UA 4IUOA 4R27A 1W6TA 3B8WA 3SCSA 3G18A 3PAJA 2MANA 3RMEA 4ORMA 4H9UA 1RHCA 3LPOA 2Q02A 3I7SA 3QM3A 3T0BA 2PC8A 3NIYA 3TYDA 4AEEA 1QAPA 3AICA 4MM1A 3E2RA 3IIOA 3APTA 4KGJA 1JAKA 3NDZA 4CLMA 3O07A 1XICA 5CGMA 4XIMA 3ENLA 4NJGA 2AAAA 2KAUC 4D6GA 3WF1A 1GZGA 2YXGA 3LRLA 1H1ZA 1ONEA 3C5QA 3WLOA 1UWSA 1C8XA 4ZOEA 4N0RA 5TF0A 2BODX 4PTXA 4XTIA 2NVDA 4LYQA 4US5A 4PEKA 1ME8A 3H70A 2A3LA 1V3MA 3BK0A 3WH9A 4B3LA 1ZBCA 3VOHA 4GX8A 1HL2A 1LTDA 3VDCA 2QGYA 3VD9A 2H9AA 5RUBA 3UT0A 2XSBA 4B5WA 3P8IA 1WOAA 1PKNA 4QJ4B 7ODCA 1QNQA 4Y96A 4EVZA 3Q45A 2I5QA 5AYYA 4LVDA 3DERA 3PC0A 3AU2A 1KO0A 3M16A 3IRDA 3UCQA 1NARA 2QVNA 1ZJIA 4Z2IA 1XLGA 3CK5A 3L5AA 3CJPA 3DESA 2JQXA 3GG7A 4PB3A 1ZHAA 2IPFA 4BWLA 4HVXA 4LYRA 2ISSA 1MEWA 1P6WA 1KM6A 5E09A 2HK1A 3BPWA 4Q33A 3GIQA 2E5DA 5DX7A 3KBVA 3LBOA 1QJWA 1I2RA 3UWQA 1R9ZA 4O8AA 3SZ8A 1JQVA 4Q7NA 1MSSA 2ZXBA 1B9ZA 3GTXA 3MHFA 1JNDA 3BAWA 1HXJA 1TVNA 1XPYA 2OXNA 3WNOA 2YLAA 5H8MA 3BLKA 3SY1A 1K8YA 4P7LA 3A5FA 3BSGA 3DCPA 3MSRA 3CL6A 5LIYX 4MDOA 4JHZA 3CU2A 4A8LA 4W89A 3EDEA 3LCLA 3BURA 2B31A 3FHAA 1CB7B 3TXZA 1K70A 4V1YA 3QMSA 1XRTA 3VZYA 3HQNA 5EGRA 4HNLA 4J3SA 2CWXA 2AQWA 2QCFA 1UD8A 2DUAA 3L4XA 4RW5A 2YXOA 4XAYA 3E2QA 1AUSL 4MVAA 4N4PA 3CHEA 1O95A 4UQEA 3T81A 3QHOA 2BLEA 1FH9A 1BVZA 4I6KA 2CLOA 4V28A 1HVQA 2IQTA 1OX4A 3RCNA 4EF8A 3QOMA 2IUZA 3GVQA 3OU8A 3KL3A 1MEHA 4Q4OA 2BGNE 4MZ8A 5CPNA 1LLWA 3LLXA 3POHA 2O9TA 1OGGA 1QU4A 1RPXA 4KGLA 3PPGA 4A3RA 2WHMA 4FLQA 1OHLA 4KERA 2CW6A 4MGGA 1AH4A 3FHQA 4FOKA 2HSAA 3E0FA 1MI3A 5J04A 3P6LA 1MXSA 5J5DA 4GD0A 1TELA 4LFYA 1UROA 4HHLA 2J24A 1B3XA 5FJJA 4MJMA 3OLEA 2B7PA 3CL7A 3NYDA 5T26A 3ARZA 5J5RA 1Q3NA 3KW3A 2WHKA 1E70M 3DOPA 4F9JA 4MKVA 3PBYA 1O5KA 1AQ0A 1DOSA 1RD5A 1RCXB 3CB8A 1JD7A 1XUUA 1E4MM 2GSJA 2ZZ3A 2QV5A 2E9BA 1UD2A 4C60A 4ILSA 4FXSA 4RDZA 4BCEA 3P7YA 4WHBA 1J11A 3LXAA 4ZO9A 1KBBA 1QOXA 3N19B 5TQLA 2A5HA 3FKKA 3SUWA 4Y2WA 1NWSA 5M17A 3AYVA 3FLUA 1Q7QA 4PUWA 3C2VA 1RCOB 3CPUA 3UF9A 1JAEA 3BJFA 1R38A 5IFTA 4O1DA 2X0SA 2QCGA 3L4TA 2R9RA 3O0FA 4GGHA 4MWAE 1NU5A 1QTWA 1ITQA 1U30A 3VE9A 3NQDA 3QW4B 4W5UA 4WUIA 4KW2A 2A1YA 1MWOA 3EXSA 3LUTA 1TMQA 1V0KA 5CSUA 5HA7A 2J6XA 2HTMA 1MYRA 3A4AA 1BKHA 4ZTYA 3K8LA 2EPHA 5C8BB 1QPNA 1UP0A 4LYKA 1VFSA 3UYCA 3KP1A 1TTJA 2NXGA 3ABQA 1RJQA 3L0KA 1XUZA 4DJFC 5I07A 1OEPA 1NWRA 4QBXA 3OBKA 1E1FA 3SFKA 1W3LA 3M47A 3B3DA 1FXQA 2DW6A 3MPGA 2RHGA 1UG6A 4HPNA 4AWUA 2O9PA 4YNGA 4NRRA 4IPIA 5C5YA 3GVWA 3WK3A 4AX7A 1J2BA 1ZJAA 2C0HA 3DKLA 3LCGA 4MPKA 4QS6A 1AG1O 2QV4A 2VX7A 5CC6A 4S3FA 3AALA 3U7VA 2VEGA 3VFCA 2Z00A 5CSSA 2ACRA 1FVPA 1DBTA 3SB0A 3WJZA 5I0DA 2NLIA 3U2OA 2G4JA 3AAMA 4I90A 4MHBA 3T44A 1TV3A 1QHOA 1MDLA 4K68A 4CQBA 3ABXA 2VQUA 4HA3A 3CUXA 3RK8A 4JN8A 4FLSA 2VRKA 4DX3A 3GXIA 4GVFA 3O6DA 3AS3A 1GZ1A 4Q8PA 2YDSA 5CPSA 1FWIC 3SN4A 3C0JA 5C6MA 4MB5A 3CV1A 2XZ7A 1M04A 4XZLX 3NVDA 3UU0A 3IJ6A 4KFNA 4JX4A 1GTHA 4R85A 4UTMA 1Y5VA 1ISZA 1K77A 4XBJA 3WK2A 5HPCA 3N04A 3QMRA 4N7QA 2RDTA 3WQ6A 4GCXA 1IIGA 2VFIA 1R2TA 4O4VA 3S5OA 3S46A 1VS1A 1I4NA 1JDEA 2HBVA 5LHEA 5AB3A 2D20A 3R7MA 1MFVA 1CZ1A 3WLQA 2BY2A 3RR4A 4J5NA 4TVCA 1ZGDA 4GH1A 3AISA 3U2ZA 1Q4WA 1WZAA 1SZNA 3VKBA 4JPGA 2HDJA 3WDIA 1EX1A 2VOTA 2ISFA 4Z2JA 3G1RA 4E38A 2GDVA 5EB8A 4J3VA 4TVUA 3H2MA 1TV7A 4E8CA 1I45A 1W2VA 4K8EA 3B97A 4EPEC 3TXVA 4EXBA 4ZXLA 1SJBA 2A7NA 3GM8A 1W9VA 1W54A 1UP3A 1R5YA 1VCFA 4D6EA 3USZA 1Q6OA 1S5MA 1NDYA 4NI8A 2QDDA 4HNVA 3TYZA 5GPRA 2CZFA 4LAZA 2IKHA 1FWAC 1XGDA 2ZZ4A 4IH3A 4M56A 4IIDA 5DY3A 1GGOA 1G6CA 3W1NA 1HKKA 2ATMA 5CZTA 1W3HA 1ZS2A 3LTSA 3F03K 4EPKA 4C6BA 1FTXA 1CXFA 4U10A 4JCMA 4R9XA 1R3SA 7TIMA 4FO4A 3TJ4A 5E0CA 3VIGA 2Q3RA 2RFGA 1S3HA 2R14A 4HSOA 4XKYB 3ZO9A 3T78A 2CLLA 3VC6A 5JBDA 3OYXA 3VNLA 3ZLGA 3BSMA 1J0JA 1DORA 4Q8WA 2ZUUA 5LNUA 1WZKA 3N18A 3KAOA 4LCRA 3SCVA 1AQFA 1F76A 4WRHA 3VNZA 1MVYA 2POZA 2WLZA 3KBMA 4B5VA 5HK4A 2RJHA 3S42A 4UOQA 4AZGA 3QZAA 3SCRA 2E4TA 2VEFA 3NO5A 4H7ZA 5D09A 5I5RA 1B2YA 4LC6A 3BJTA 1OINA 1JI1A 5I3IA 2CBUA 4I5XA 3WNLA 2CLIA 2QLYA 2PSNA 1Q4NX 2J88A 2G96A 3FEQA 3TYEA 5ECUA 3TIMA 4CN4A 1J4EA 4LUIA 4LYPA 3P84A 5C9RA 1VB9A 2HJPA 4AY8A 2DIJA 4DWSB 1HJXA 1EYEA 1ZY9A 3OOQA 4XD4A 2ZA3A 3SGUA 3GSMA 3MMTA 1IXOA 1DPMA 2DH2A 1CPUA 1A4MA 4UTFA 4DQWA 3WQWA 3FYYA 3UQNA 3VNYA 2V5BA 2OCZA 4RNHA 4MLRA 1QNSA 1UR8A 2Z1VA 1NTHA 3MT1A 4TVDA 2RUSA 4GNJA 4OV4A 5C2XA 1JI2A 1GZJA 3GUWA 1KFJA 1XIIA 3RRAA 1W1TA 2YL9A 3E49A 5T9BG 2JKEA 2BP1A 4C6QA 2Y89A 2J78A 3QY7A 3HV8A 3VNKA 1P0EA 1RP9A 3AMDA 5ABTA 2CLHA 3CV6A 1YQ2A 4DI9A 3GR8A 3EPNA 1XI3A 1YE4A 3BLFA 2YLLA 4NJHA 4DHGA 3IS4A 1CECA 4C6CA 1RP8A 1WDWA 1AQHA 1EJSC 4WXZA 3DU0A 4GQ0A 3NPVA 3B8SA 1RA5A 1DQXA 3LLDA 3T0CA 3KFTA 3E5BA 2WVVB 4YTSA 1E6ZA 3NZ1A 3TFCA 3EDDA 3SN0A 3WQCA 2WYSA 1YTDA 1AJ0A 1L0PA 3FJNA 2XGIA 3ITVA 1DJZA 1DEDA 3F4WA 3R6IA 4S3BA 4Q4MA 4YWSA 2B0MA 3I3BA 2Y85A 4AHOA 2INFA 1Q13A 1HVXA 4JDBA 2E40A 1PKYA 3MUY1 1ONXA 1VBUA 4JIRA 3MDWA 5G4EA 1WUFA 1OFQA 1S2UA 4UTUA 2WQPA 4MSSA 3Q67A 2Y24A 4J3WA 1PJ9A 3OZYA 4WCJA 1XLBA 1OIMA 2B4GA 4X0VA 4UNLA 5JVLA 3N4AA 2QUMA 5I03A 2V9DA 3VCNA 4JTGA 1WQ5A 4HU0A 2WM0A 1B31A 1KCZA 3SRKA 3A13A 4C1NB 2ZZ5A 4Z17A 3THDA 4PTMA 2EHHA 3RAOA 2YFNA 2J79A 3MMDA 1XINA 2PDHA 4O57A 2X0YA 1ISVA 4PL2A 4IX2A 3C86A 3R12A 2PGWA 2XTKA 1IF2A 2IKIA 3ARSA 1TX0A 1S5WA 4KFPA 1HJSA 2O7SA 1EXPA 4TMCA 3W2MA 3MI2A 5I3GA 1QHZA 1UH4A 4Q8VA 3QZ6A 1E3ZA 1SR9A 4NNBA 2GDUA 5A8PA 2PD9A 3KWXA 4UOZA 4EIVA 5CAHA 4TV6A 1VIZA 5FI8A 4EOUA 1P6BA 4LRTA 1UA7A 4GG9A 9XIMA 3T0AA 1F74A 1JDAA 1E6PA 3QFWA 3V7PA 3CUHA 1XLCA 1PZ1A 2UV8G 2ZDRA 4RE3A 1HT6A 5D9NA 4MFEA 4HKPA 3V18A 4RLIA 1EYWA 3H6OA 1VFMA 4K37A 3VI2A 4MB3A 4J7RA 4GH3A 2OKTA 4JTFA 2J6VA 3A9BA 4C6EA 2Q8XA 2DVTA 1QPQA 2Q6ZA 2NLYA 1KGXA 1AK5A 4UQDA 1V93A 2BOFX 2BGQA 2ZRVA 4XVDA 4PMUA 5FA5A 4DO7A 1V7AA 4S38A 3H4XA 4TQTA 1C7SA 3GNOA 5C55A 4Z1BA 2VDIA 3VIKA 4QLLA 3ITYA 4AIBA 3ZT6A 4PRRA 3FKRA 1O6IA 1GVOA 1B30A 1UWTA 2PP3A 1XYBA 1Q66A 2ZX5A 2NVCA 4G5DA 3RFAA 1VFTA 3OG2A 2Y6ZA 1I1XA 2VQTA 3N2XA 5AHNA 1NJJA 2EGZA 4WQ6A 1YE6A 5BRBA 4CCCA 4YTQA 1MUWA 2E6AA 4TIMA 1EJRC 4GACA 2P50A 1XIHA 1LQAA 4L4MA 3LERA 1CGVA 1GW1A 2VHLA 1NOWA 3QXBA 3GG1A 2O4MA 3FV9A 2ZIDA 3U0HA 3MUXA 2QCCA 3WLMA 1KM1A 2YOCA 4OWGA 2WQDA 1C7TA 3TZNA 5HUPA 4POCA 1LWIA 4S3EA 1XH1A 3N17A 1UR4A 1XLFA 1ZAIA 1NH6A 1LRTA 3HJEA 2ONEA 2VX5A 3B8DA 2XG9A 2RH9A 5CXPA 3MW7A 2BY0A 3U7BA 1FWNA 3MKVA 4ZMGA 4FPSA 4P8VA 1C91A 4OUEA 4S3GA 4CVWA 1HQTA 1QO2A 1M7JA 1F9CA 1V02A 2PCEA 3M7SA 3IJLA 2PU0A 3CMGA 2QCMA 4F0MA 4Z1DA 3I4KA 3PTQA 1Q8JA 4LOCA 1OADA 2WBKA 3WL0A 1UA3A 1H7OA 5HJXA 2XIIA 1RCQA 3DFOA 3DUGA 2VOMA 1BF6A 3WNPA 1G4EA 2V3FA 3KDNA 4B5NA 3WQ5A 3MV11 4JTKA 3OA3A 3ZVHB 1G94A 3W70A 5K4ZA 2ZZ6A 4Y8FA 4S3JA 1KTCA 1FHVA 3GNPA 4QSHA 1ITCA 4E0CA 1GVSA 4YVPA 4AX6A 2G3IA 4XZWA 2ZXDA 3ITCA 4PMOA 4AD3A 2O4QA 1X39A 1YXDA 2YDAA 1OG6A 1XIDA 1XYFA 1PDZA 2VUYA 3OB8A 1Q8AA 1TWWA 1YBQA 2OQYA 3W2NA 4EAMA 2RDUA 3LI0A 2NSOA 1T0OA 1CBGA 2VP8A 2FZ8A 4RZBA 1J0KA 4IL0A 4L80A 1AD4A 1HF6A 1JYNA 4F48A 2GJRA 3XIMA 1O5QA 1Z89A 1EIBA 4A4AA 3LGGA 2G97A 5F2GA 3UETA 2E68A 1QBBA 2BASA 1WUEA 1J0HA 3DBPA 4JN6A 4JX5A 2XISA 3WQGA 3SBFA 2PTXA 3GRIA 1YPXA 5AC4A 3V75A 1GQJA 2CITA 2PS2A 2PTZA 1DXFA 2VYOA 1I75A 3NURA 5HWMA 5IRPA 3M5XA 1HIZA 4GYJA 3HPAA 5K9CA 4ACYA 1N8FA 3PZVA 1K8CA 3CHVA 3B8IA 1XM3A 3B40A 1L2QA 1W9DM 1T99A 4ACZB 4NXKA 3TAKA 4PZVA 4F0LA 4LY4A 2W63A 2H90A 3HQ1A 1YPFA 3LV6A 1JPDX 2ZYFA 1ISWA 4CQ9A 3QSTA 3F5KA 3L67A 4WSKA 2B7NA 1PBGA 4H8VA 3R5EA 2XDFA 5I6SA 5JH1A 3D6NA 5EL1A 1SSDA 3AZRA 4O1BA 4IIBA 1G4SA 4XSLA 1KNWA 4DJDD 4R53A 2HXUA 4E5TA 2QJMA 1T40A 3W71A 3TOYA 2E6FA 4Q4RA 1F8IA 5CJ5A 2JE8A 1C9WA 1OSEA 2E6DA 1CENA 3EWYA 2XINA 1XRVA 1XH0A 3LGDA 3H7UA 2PLKA 1G5AA 2ZX7A 3FYPA 4GY0A 4IGHA 4PUJA 3GQYA 1LOQA 3W4RA 3EWCA 5IM51 3DFHA 4AU0A 5LGXA 1BXBA 3O6CA 2E28A 4XO7A 4P8UA 3C2EA 5CC5A 3RX3A 1DJQA 2CLFA 2KX9A 4L61A 1ZCOA 2CHOA 1GEQA 2B81A 1EUAA 3AIRA 2XGBA 2VFDA 1R3YA 3W7QA 3EWWA 1FBAA 1Z32X 2D73A 3FA3A 4ML9A 2QGHA 2GGJA 2BV9A 3NEVA 3LPFA 1VJIA 1OB0A 1HFBA 4WKHA 2D2JA 4L9ZA 1UWAA 1MUCA 1MXGA 1W8GA 3QEZA 2P10A 3PWAA 2YBUA 3OLDA 1JVNA 3H7VA 1J8VA 2A4AA 1G4PA 3CASA 4Z1YA 3KCLA 3M44A 3BE7A 4ZOAA 5HR7A 1QOPA 2XM2A 2E1WA 4C6KA 4HJFA 2D2GA 1I1WA 1XLEA 4HPJA 4LUTB 1AW5A 2I1OA 4LS1A 1JFXA 5DO8A 4LSBA 1L2UA 5AHEA 2QUTA 4R34A 3WKZA 3I10A 2VC9A 1PV8A 3QQ1A 3ZWSA 5C7VA 3S47A 2EKCA 2XSAA 4KPLA 2W0UA 2EAWA 2QT3A 1TJ1A 4WJEA 1XIGA 4ALDA 4MLJA 4E2OA 3VCRA 4JICA 1QFEA 2A3CA 1X96A 3L12A 1LBFA 3T4WA 3NSXA 4HQVA 1GOWA 2GOUA 2AAMA 1D7FA 2QZRA 5HMFA 4OOZA 2BOEX 4K8GA 2Y8UA 2RGLA 2G4FA 3S4TA 2WOQA 4LBRA 3NQGA 3I65A 1T41A 1BF2A 4DBDA 3W7NA 1GOMA 1FXPA 3C0QA 3RJYA 4O53A 3QFEA 3GG8A 3THUA 3AHYA 1MNZA 4EF9A 2ZUVA 3B4UA 2PDGA 4PMZA 1SJAA 4ERAA 2YW4A 2X2GA 3VXGA 4RR4A 2NWRA 3N9SA 3TR9A 1OGSA 5I09A 3U5UA 1EP3A 1UH2A 3VKJA 4PMJA 3A4WA 4DJFA 1S1PA 5CPMA 1TPB1 1E1CB 4GO8A 3QV7A 2Z1BA 2BG5A 1SR0A 4N4QA 5D2XA 3AFBA 4HMEA 3JZUA 2A3AA 5G1YA 1GWJA 3M0IA 2GK1A 4NZFA 1Q6FA 2D0FA 1F4HA 3MTWA 4X63A 4ZENA 3OVQA 5AHLA 1E6QM 3AYRA 4MFDA 4IG2A 3TTQA 1V79A 1ICQA 1KRBC 4CD5A 3IJ9A 1OCQA 1UMLA 2OR2A 5D9OA 2X1RA 2PWEA 1XLIA 1QI0A 1LP6A 3T7VA 3VIHA 4K1GA 4C6FA 2O0TA 4IFKA 4GFSA 2C79A 5C9XA 1R3RA 2BHZA 4DI8A 3PBMA 2CBIA 4ZB5A 1U33A 4W88A 3SI9A 4IMDA 4B2DD 2OKOA 3JZEA 1XBYA 3LN3A 3ABZA 2XIMA 5FF7A 3G0XA 4Y9MA 2J9ZA 1ZL1A 1GQLA 1M7PA 1S2WA 3DFTA 2EPLX 2AL2A 5CG0A 3S8HA 3UPWA 4ICCX 1R0MA 2Q01A 3HGSA 5AOUA 4GK8A 3PJXA 1QDSA 1OC5A 5FIPA 5LYRA 1VFOA 1UD5A 2XU2A 4FOUA 1XBVA 4D1IA 3WBYA 4HTBA 3C3NA 2F38A 3MSGA 4W8BA 3CQIA 2ZVRA 1EZWA 3B04A 1Q7ZA 2V0TA 3HN3A 4F9DA 3W01A 2CFFA 4WY0B 4M1BA 3ARYA 2ZUWA 1O60A 3W1MA 1CLXA 4IMGA 2J8GA 1FDZA 3ES7A 1HKWA 3MSYA 4LUSB 5A5WA 2OZ8A 5LA0A 1JXKA 1YTEA 1NWUA 4DYKA 3IJDA 2WM1A 3DYMA 2Z6JA 5KMYA 3KL0A 5DRCA 4RPPA 3EDJA 5D33A 3MUCA 3R10A 4YLWA 5LXEA 4HN4A 3NDYA 1V0LA 3K5XA 3LQGA 2HWGA 1ICPA 4KEUA 4BA0A 4TU1A 1JULA 1E6RA 4LY8A 1L6YA 1E3XA 3D5HA 3WBXA 3MVIA 4HZMA 1FWTA 4ERGA 2G37A 3GBDA 4DF0A 2EEXA 1LM1A 3CAVA 4H8HA 4P8XA 3GBEA 2PLCA 4EAYA 3TAOA 4UFJA 2QR6A 3AMCA 4M5PA 2QDGA 1OD0A 5CLWA 2REQA 4NG3A 3TN6A 3H26A 3RHGA 4C1KA 4XX6A 4QHRA 3R94A 1M5WA 3DENA 3WL1A 4A3UA 4DPPA 3PK7A 2DQXA 3L2LA 4MNLA 1ZP4A 5ABFB 4GLEA 3NXFA 4IOTA 5IOBA 5HAOA 4WKFA 2VGGA 1X6UA 2DU2A 2CZ5A 3W9ZA 5EBUA 3G1HA 3QGVA 1XD0A 4US6A 2BXYA 1TTPA 2PDPA 3WFZA 2HS8A 2QW5A 3AXMA 3DG3A 5EKYA 3RXZA 4NAFA 4ASTA 2BVDA 1SGJA 1A0CA 7CGTA 4UQCA 5LIUX 1JZ7A 3HGOA 3PJUA 4PMDA 2V38A 1K02A 1F05A 1P1MA 2WCSA 3E96A 4WEVX 3UCDA 5A3HA 1JJKA 4RDVA 1CGXA 2D0GA 4IIGA 3SRFA 1BKSA 4V33A 4INFA 3ZSTA 2Z1SA 2ZZ1A 2WKLA 3F2DA 3KHDA 4NX0A 5I3FA 2PE4A 3OEXA 3REQB 4MY1A 3G0SA 3LSCA 5ENLA 4GO9A 3QVQA 2VZTA 2WCAA 1FHLA 4NZ1A 3QQWA 4J3UA 4M3PA 2FTWA 2GGHA 1UOZA 4GWEA 2VURA 4ZE4A 1H60A 4XD6A 3VOCA 1O5XA 4AF0A 3VNIA 4AIEA 4AZCB 1F2JA 5AC5A 2EG8A 3A12A 4GYPC 1KFLA 5CZKA 2UWFA 2QYGA 4GPNA 3IK4A 1IHIA 1W32A 5FF2A 3OP2A 3TK7A 4QLJA 3BO9A 3CZGA 5L9FA 4XG1A 3N2TA 4LCSA 2QJGA 2VWTA 1UQYA 5HOSA 3NCOA 4ZA0A 2XVGA 3RO6A 2R91A 2WMIB 4P61A 4N2YA 3T8QA 2P53A 1VD6A 3LM3A 4YTUA 1TO3A 2EG6A 1I2PA 1F6KA 4H7VA 3EOSA 3GVGA 6TAAA 1RBLA 2X09A 1LQ0A 3GXNA 3GDLA 5CZJA 4LVAA 1YNQA 4Q3MA 2WWDA 1NIUA 2P1FA 2XPKA 3MO4A 5U4NA 4OTKA 2PRHA 4UR7A 2C13A 3A22A 1S5NA 3EMCA 4S3DA 1UKQA 1H7RA 3OIHA 1KM3A 4RK8A 4AH7A 4FS9A 3PNZA 4DWSD 3G1SA 5M2FX 1JIBA 3KVMA 1H0IA 2DUXA 1QW9A 3FGCA 1HKVA 3W7PA 3T42A 3M0YA 4QTGA 3VZZA 4F0SA 3AQUA 3WSUA 2Z4GA 5D9MA 1XF0A 4NQ1A 3QRHA 3SCWA 3CYVA 3O6AA 3T9PA 3TJIA 3VNJA 3RITA 1GHRA 2C6QA 2CIPA 5ABEA 4ZVJA 3M5ZA 1EX5A 1GG0A 3M0VA 3CTTA 2J7HA 1M7OA 3NL6A 3BG5A 3TVAA 3WH5A 4BEUA 1XDJA 3NQ6A 3HBLA 3W29A 5M1TA 4B91A 1WBHA 2ZBTA 4MF4A 3JU2A 5CBJA 3R2GA 5DF0A 4I9MA 2C8NA 4JIQA 4FNTA 2FTYA 2XSXA 4JQ4A 3BAYA 3WLLA 2A79A 1KBJA 3EEZA 5LA1A 3HM7A 4PMQA 4AYSA 4ZB2A 5EMJA 2V82A 5JIPA 1NP0A 2GSEA 2AKZA 3E38A 5A8OA 2OEMA 3LZ5A 4QRNA 4MPQA 3LPPA 3JS3A 4YIWA 2C15A 5DQPA 1EDTA 4QDPA 1UKSA 3TN3A 2WB5A 1TA3B 2AOSA 3HZ3A 1H61A 3UR7A 5LNRA 3ZM8A 3KLKA 1FH8A 1DXIA 4EXAA 5REQB 1RBAA 3DGBA 3WUFA 2GVYA 2QCDB 3PTDA 1L6FA 3QSRA 4GX9A 2I16A 3LBMA 3IPWA 4DWSC 2E6YA 1M41A 3AU6A 3GX9A 1BHGA 2HE8A 5BU6A 1SO5A 3UXAA 1TPFA 1ZBKA 3IJIA 4DJEC 2TSYA 2PDMA 3KBNA 3EA1A 4ZSUA 4HSHA 4LGXA 3AUJA 3E0VA 3GIYA 3PBWA 3FXGA 4Y6GA 4PRWA 8A3HA 3ALGA 1JPMA 5ECVA 1B57A 1UC5A 1YMYA 4OOUA 4J35A 1Z8AA 2D2OA 1FCVA 3K8MA 4U5KA 4JTEA 3GW0A 1IZJA 4HHHA 3DX5A 3SQLA 1TVPA 5FKYA 1DTUA 1XFBA 4JFWA 1H50A 3CUFA 3BW4A 3W1AA 3GXMA 4FLOA 4ZQNA 5F4XA 3B8UA 4CEXC 2C3ZA 4P7RA 3U3HA 3V16A 3RNDA 5DRIA 2QPSA 3FEMA 1UCWA 3PAOA 2DSZA 3CHCA 3UZ5A 3VD3A 2FTPA 1VKFA 3T2PA 1JGIA 1XIEA 5C9ZA 2UY3A 1TTQA 4DVOA 4FX7A 1BFNA 3GXFA 2FGBA 4IP4A 4Q32A 5FJPA 5A2CA 1TQXA 5MF5A 3QOKA 3EKGA 4Y9AA 3AXKA 3PZQA 4LU0A 4HNCA 3F4DA 3CWOX 3P60A 3WLRA 7ENLA 2NVAA 3QLDA 1KWGA 1JRCA 2YCJA 4B16A 3R0KA 2E5BA 2C18A 1R2SA 2CBVA 1C9DA 2OWXA 1TR1A 1J5TA 3P8JA 5D38A 2DZWA 2WANA 3CV7A 5C9UA 4B5XA 5IDZA 3EKLA 3LA4A 3DFPA 3VNMA 4DN1A 5HJYA 1ITUA 3ZLFA 2DT0A 5LNVA 4JFSA 1K7FA 5CPLA 5TIMA 3CO4A 3S9YA 3S6OA 2WMGA 3AHZA 1M68A 2XWEA 3W81A 5A94A 1KCLA 3WD2A 4Z0JA 3OBAA 4CU8A 2POTA 3CAWA 4WX2A 3S83A 5FL0A 4K6AA 3QKZA 4Q4SA 5A6BD 1VC4A 2ZFAA 7A3HA 2ZUNA 2FZDA 1KM2A 4OBTA 1W1A1 1N8WA 1UR1A 3THAA 2J74A 5CC7A 3E1F1 1E6SM 3EWZA 3QTPA 3ORWA 4PC8A 1KCKA 2GVLA 4N42A 4QNWA 3TW7A 4UZUA 5HQMA 3K8KA 2VEMA 3ABOA 4HGXA 1XR2A 4U2ZA 1I2QA 4KCWA 4O1CA 4FXFA 1TSIA 5LZLA 3W37A 1PZ2A 2J7GA 2VC6A 4O12A 2PDWA 4JKMA 1YLVA 4AB4A 3B06A 4LUJA 1UD4A 1VFFA 2BVYA 3HPXA 4MAVA 2DFAA 1OZQA 1UQZA 5D02A 1UMYA 1GOIA 1V77A 2V6AA 3S9IA 4YTTA 3QBUA 3C61A 3CLMA 4JFVA 1DWHM 1F5ZA 2DZSA 4G1KA 3L5MA 1YKWA 3NNTA 3ITLA 1C93A 2AQOA 2V2CA 3NL3A 3QF0A 3HPSA 4GVHA 4X9YA 5AHMA 5GQBA 3IARA 3GH4A 2FMNA 3TYAA 3GH7A 1XG3A 1SFLA 3O15A 3T05A 3QY6A 3SJ3A 3GYCA 4WD0A 3PPFA 5FAJA 3WQ4A 5HXMA 2V69A 1XDMA 6TIMA 2DT3A 4GUJA 2DZXA 3ONCA 3WDRA 4AW7A 3FYOA 4IQDA 3NZQA 5F2MA 4TTUA 4WDWA 3BLDA 2NUWA 2CBJA 3B0VC 2QCLA 1EDQA 2D1ZA 3RUBL 3W1UA 4V2XA 1KBLA 2FHBA 5AN7A 2W91A 2V81A 4CVUA 2W62A 3NPUA 1IXNA 3Q2DA 4QSFA 1H7XA 3GAKA 2ZDSA 1LUCB 1IWPA 4AHPA 4PUEA 1GPWA 5LXXA 2WZTA 4HOWA 3O16A 3ARVA 1VRXA 2NQ9A 3QC3A 4IJRA 1TJRA 1AH3A 4QGCA 4UMBA 1B3OA 4LVGA 3EB4A 1H41A 4UB9A 1D7KA 1PZ3A 4FF5A 1JCXA 1L6WA 3KVKA 1KKRA 4DXVA 1K9DA 4NYUA 5I78A 1UYQA 3KXQA 1YHTA 2E77A 6A3HA 1B3ZA 1XBXA 2QPXA 3W7IA 4V1XA 3RJXA 2I17A 3KP0A 2GQAA 4OU1A 1S5TA 1U83A 2Z7KA 3V0UA 4HYWA 4HPHA 4B5TA 1S2TA 5LIWX 1I0DA 4HN8A 1J96A 1FRBA 3W2KA 2FPVA 3B4YA 2WW5A 3QHMA 4GVIA 4C5ZA 4IJCA 3VOGA 4H19A 2WSQA 3WX7A 1EHNA 2XJ7A 3VA8A 1FKWA 1F07A 3SFWA 3OQEA 1OFOA 4M24A 1PYMA 1SUXA 5XIMA 4UTTC 4Z0SA 3VIJA 3NXLA 2JIEA 3UJRA 2J47A 4JHMA 3ZYZA 2GUUA 3CO8A 3ES8A 4JQ2A 2WC3A 1BEUA 3VYLA 1VLWA 1FQ0A 3APYA 3H7RA 3LHZA 3LPGA 1E9YB 2RDWA 3BJSA 4FEZA 3M4HA 2GGGA 3VILA 4EE9A 3MO7A 2DSKA 5A6KA 5C54A 1BVNP 1LBMA 4KQNA 5GNXA 4LW7A 1PL9A 4Z08A 4DJDA 1V6TA 3HURA 3KS6A 3VGBA 2OSXA 3CZ8A 2PRMA 3LBCA 1B54A 1Y0EA 1HN1A 1PX8A 3IJ7A 3GUGA 4W5ZA 3ZT7A 3WMBA 3PP7A 3L5LA 1VQTA 2PMQA 3OGVA 1V4YA 2PBGA 3SDOA 2YZ5A 1NFBA 3C6CA 3M0XA 4Q7IA 1O94A 2AKMA 1HUVA 1KTNA 4EANA 4M6VA 5G2HA 3FDGA 2ISWA 1SPQA 5E9XA 4UUIA 5LGZA 4PFHA 4NJIA 2CZVA 1C29A 3V0SA 4B3ZA 4U2YA 2F2HA 1SSGA 3SO7A 4M7TA 1CIUA 5BOOA 1A53A 2WXDM 5AYXA 1UASA 2BXVA 4IQEA 1HG3A 2YL8A 5LKYA 3ZJ7A 3WLPA 2ZXAA 3QGAC 5TD4A 3W87A 4HK7A 5FJTA 4ZCWA 3KRUA 3LOTA 4XUYA 3N34A 3E9AA 2WK2A 1FA2A 1QCWA 4JBRA 4KEMA 1P6CA 4N9CA 1W1YA 3CM4A 3BOLA 3MA8A 3QPEA 1QW8A 2HK0A 3SADA 4CNUA 1R9XA 3E6EA 4PUMA 5AECA 4QR6A 2Z2BA 1DIOA 5TAOA 3DHUA 3AS2A 4FP1A 5DCBA 1UD3A 2PAJA 1KW1A 5EA9A 2QAFA 2VD8A 1FFRA 5CBBA 1IWAA 3N6HA 3OYZA 3D3AA 4DAIA 3TDFA 4ZQOA 3K1DA 4G9PA 4FLRA 4LWWA 3CV2A 3WK1A 1ZU8A 4JL2A 3EB2A 4RXFA 2PDYA 3LRKA 2VGIA 2RGMA 1C8QA 4DF1A 1M9HA 5XIAA 3WD0A 3WBAA 1XH2A 4J27A 3W84A 1JG9A 4A2SA 1IT7A 4TUFA 5D8ZA 1X1ZA 4GIYA 2CERA 4YMZA 3U8GA 7PTDA 5LIXX 4KIEA 4A8NA 4EK7A 3DFSA 2HRWA 1A5LC 4HMCA 4CD6A 3W1QA 1PAMA 1XIBA 2HZGA 2DSUA 3ANUA 5HJLA 1VR6A 3P80A 1JCLA 3WLHA 4J4KA 3VOFA 2BS9A 3VOIA 1T6MA 1NM9A 4W7VA 1TPUA 2CWNA 3AIUA 5C2CA 2WBGA 4XAGA 1E6NA 3NQVA 4DELA 2VZVA 3GY1A 1XSKA 4LV9A 3IJ8A 3KTCA 3MP5A 1ZBWA 5A8GA 3UEQA 2GQ3A 4H6RA 2J7EA 1JZ2A 5BRQA 1JPIA 3CAKA 4H00A 3FN9A 3USBA 1B4EA 2ASHA 4FNRA 5KSWA 3EOOA 3L21A 4PULA 3B0PA 4IPLA 3AYTA 3M64A 4XZBA 4DNMA 4IMFA 1WYIA 5J8LA 1CXIA 4CU7A 5GVJA 3SM0A 3QR0A 5F1VA 4JKKA 4IFRA 1IGWA 3DZ1A 3OPSA 3W26A 1ECEA 4XZNX 3EZ4A 3R11A 1AW2A 3CGTA 2ZVIA 5CGTA 2VT0A 1JCYA 4W4QA 1GYNA 4NUWA 1VCGA 1EUNA 2ZUMA 1XX1A 4PR4A 2FJKA 1U5HA 5CPQA 2IPJA 3ISIX 3MI3A 3M9YA 4K39A 3WD4A 3DG7A 4AISA 1P7TB 2QUUA 3C4UA 2WCGA 1GHSA 1P48A 5F4WA 2YKKA 2CPUA 1P0KA 3TV8A 4Q6JA 3JR2A 1YIXA 1XW8A 4OJYA 1VJSA 1EBGA 3CZLA 5FAGA 4GBUA 4B4FA 4QQ3A 4GBDA 1KM0A 1FDYA 4LALA 3B8VA 4BR1A 1NF0A 4ZQCA 4UTKA 5CLTA 3DIPA 4Z42C 4PTWA 3LQLA 1W5QA 1TV8A 1HP5A 3QYQA 3L4YA 3TC6A 4JTTA 4HU8A 4GMEA 4BY3A 2XM1A 3GTHA 3MZNA 3T4CA 1SZEA 1PCKA 4DWDA 4P7OA 1TMLA 3QJAA 3R8RA 1HJQA 1F3XA 3NPXA 4NL1A 5KTLA 2NX3A 4RNIA 5AFDA 1JCNA 1JNEA 1JZ4A 1UZDA 1TTIA 1N82A 3M5VA 2OPJA 4EP8C 5MKGA 2HBXA 1YNYA 2EJAA 1UD6A 1E40A 1QO5A 1F4AA 1OBAA 2OLSA 1Q2RA 1WBJA 3WJWA 3UR2A 4XIAA 3VIOA 4UNIA 1NFPA 3QPZA 3EX6A 3Q58A 4L56A 1G67A 1MDRA 4IWWA 4Q4QA 1PZ0A 1H09A 4IQLA 1B5TA 4E3TA 3BDKA 1SZGA 3W88A 3LK6A 2ZICA 3FSUA 1C92A 4NJJA 3ZJKA 1ENUA 4M6UA 4WDTA 3U2EA 1I6NA 2Z6IA 3TROA 3WY1A 2BXZA 4BFAA 5I77A 1EHAA 1H3GA 4Z2GA 4GY7A 3OODA 4X60A 2PDIA 1U2YA 4M8UA 4FIQA 4O1AA 2ADAA 4FR1A 3V0TA 4C7DA 3CUIA 4A3HA 1W91A 3NR0A 2X41A 1UZ4A 4C6MA 1C8VA 1JRBA 3IGUA 3K1GA 3RO8A 1Z9AA 1YRRA 1TKKA 4GYPA 3R4IA 3RIKA 1RUSA 4ZZ9A 3EX1A 2DW7A 2X7VA 1GK8A 1PX4A 3VGGA 3CUJA 4B90A 1MMFA 5HWJA 1A50A 4JQ3A 1OY0A 4MG4A 1LRQA 3S5ZA 1TREA 2J8TA 5HANA 3WF3A 1RSCA 1TJ2A 3V5OA 3OHIA 2R94A 5FOOA 1SZFA 5DCEA 5FEPA 3K46A 3CS2A 4B15A 5BW6A 3Q37A 3RRXA 5DMYA 3A3XA 3KWSA 3FK4A 1IV8A 1R3WA 3HMCA 3H4WA 1SJDA 1I9CB 2ZQ0A 2H3DA 3W00A 4KWVA 1E9ZB 3RM4A 1R8LA 2WPGA 1JYVA 3EBVA 5EFFA 1TMHA 2IXVA 3GVRA 3OJGA 4Y9OA 3HO8A 4MY9A 2PWHA 1ODZA 2Z1WA 1KBKA 4GKTA 2G3JA 3OVPA 3UA4A 3IGXA 3NEHA 4LUYA 1HTIA 2ALDA 1XS2A 4U5IA 3T1GA 5SWUA 3UZJA 3E12A 5DEZA 4O0QA 1TR9A 3I7QA 3HMJG 3UP8A 4DYEA 4JD4A 1G7UA 3KLLA 1PTDA 2CLMA 3H21A 8TIMA 2BSLA 4PUKA 3PM6A 4X2RA 1Y7VA 5A95A 2WNQA 4JTLA 3TQVA 1A3XA 5CH9A 2I5IA 2QMJA 1S2AA 3W7OA 5JIWA 4XKYA 2INZA 4QDMA 4N9EA 4MNKA 3LHWA 3AWNA 4MWAB 4P7NA 1FWRA 1OZMA 2XH2A 3PJTA 4PTVA 1UKOA 1WA3A 3KBWA 5ABHA 5D04C 3MWCA 4I7WA 2FH8A 3WQPA 2ZTKA 1E43A 2VFHA 1OFPA 3STGA 1X1NA 3QTGA 5D2TA 3O06A 3JRKA 1PIFA 4K7YA 1GQNA 1Q7MA 1LROA 1V02E 2YCEA 1FP9A 1QR7A 4NU7A 1JEZA 1H11A 1DJIA 3HTWA 2R1MA 4UTWC 5H1WA 1VHNA 3FDKA 1Z69A 3H23A 4QFUA 1T5AA 3ALFA 4D6HA 1XCXA 4NZ4A 3H2NA 1AJ2A 4LXFA 4DM2A 1QMLA 1X8FA 1ZAHA 1BYBA 1BTCA 2YCKX 4LPCA 3F7JA 4AAJA 4RX0A 4DWSA 3OG3A 8RUCA 1WOBA 2OODA 5D2YA 4GIAA 4O1EA 2VDHA 3WJXA 4DJEA 3M0JA 4ZSTA 3L4WA 4HYRA 2PPGA 1XYLA 1Q5MA 5JBFA 1YW1A 4O52A 4R7OA 4YXGA 5E70A 5G2IA 2Y0FA 4F0KA 2MUCA 4RUBA 1FOBA 4JGDA 4EACA 1ZFJA 3P5ZA 4C91A 2HROA 2P88A 1UPMB 3IVUA 1OC7A 3WZ0E 3LXCA 2NX9A 3B8TA 5KZDA 5AKQA 4CNSA 5FEWA 1P43A 4GHRA 4NZCA 4N6EA 3KBSA 1QT1A 4KRTA 1VCVA 1V3KA 2FFIA 1KWKA 1M65A 1A47A 3S5NA 3OGSA 3VDHA 4JTCA 3OHMB 1XV8A 7XIMA 4XD3A 3BLIA 3PZOA 1VAHA 1XYCA 3GU9A 3U5YA 3R58A 4ENLA 3C56A 4QE1A 3BOXA 3ZZ1A 4QEEA 1MO0A 4ZQPA 1HL8A 2IPGA 2ZUTA 2RKXA 1WDPA 2WVVA 3NL2A 1DIDA 3WF2A 3UWWA 3FJ4A 3LNPA 4Q22A 1XQKA 3B9NA 2NQJA 3LCHA 4A8IA 3TC7A 4WKAA 3AJXA 2BX7A 4TXEA 1HW6A 3W75A 3W82A 4QS5A 3LY0A 4GUFA 1HKJA 3VDBA 1V5XA 2D2HA 3C2OA 4G56A 1ONWA 2OU4A 4MJ2A 1IEWA 3EKZA 4OIFA 1JDDA 3TSBA 2QKFA 1GEHA 4AVFA 5AYZA 2PWVA 3TWAA 2CKRA 3NTYA 1EO7A 4X0NA 3GH5A 1EA0A 5KZEA 1SFSA 1IQ8A 2IW0A 2OEKA 3R43A 4GI9A 5BNKA 1OGBA 1QWGA 2F2KA 2VX6A 2GPTA 4E8DA 1H2JA 1SZRA 1KTBA 5BMWA 4C1NA 1XLLA 3GZAA 1W5MA 4IUGA 3W7HA 2Q8ZA 1TRIA 1QOQA 1BD0A 2AL2B 3RF9A 3MDUA 4HCHA 4B9ZA 4UR9A 5EMLA 2WMKA 4BI6A 3EWDA 1GYMA 3O1NA 3MBFA 1TV2A 4L1WA 1QVBA 3WJSA 3DG6A 1JZ5A 4V15A 1U1HA 4GC3A 4UQ9A 4W85A 3DAQA 1J0IA 1RY0A 4MADA 1US0A 4XTDA 1U1UA 1NFGA 3TTYA 3OZPA 1XGZA 3N73A 1BGGA 3WQFA 3RN6A 3TFXA 3TYCA 3CAQA 5HINA 5FEXA 1UHVA 3GNXA 5DT5A 4H6QA 4HNTA 4AVNA 3ZWTA 3L2IA 2YCIX 2VFFA 2VRQA 2OJPA 4QE5A 1W8SA 3PUOA 1K4GA 3NAVA 3SJNA 4OVXA 2CZDA 2ZA2A 2QULA 4HBKA 3LCFA 2D24A 4LAMA 3G6MA 2UY5A 4HPXA 3MMUA 4IGNA 2YDQA 4MAZA 3P81A 2SFPA 4LEQA 1OIFA 4E4PA 3UWVA 1ZJBA 4J1OA 4DM1A 3MYPA 4RZ6A 4QAWA 3SCOA 4NZ3A 2C0AA 1DWIM 5A6BA 1J6OA 4AMAA 1H49A 3GHSA 4RCXA 4F2TA 3PZMA 3UFYA 2FZBA 2G3FA 4GISA 3NOYA 5DBTA 3WMCA 3RPTA 3IACA 2V3EA 1QASA 1WO2A 3O9NA 4U3AA 1UJQA 3PTKA 4C6DA 1G7VA 3W38A 4KF1A 2JKPA 1AODA 1F8MA 5A8MA 2CCRA 1RPKA 2R1LA 1IWBA 1O5RA 1LF1A 5I00A 2VTFA 3UD6A 5A1AA 4HA4A 2WAGA 2V5CA 1CGYA 4XZHA 1QPRA 1LLZA 5I3JA 1EH9A 3BW2A 4L4OA 4CNTA 2ACQA 3GDBA 3TN5A 2XFYA 5KINA 4IFOA 2E7FA 2EXOA 3A24A 1VFUA 3XISA 3MC5A 1NF7A 3WUGA 4GYFA 5HQLA 1JR1A 4FNUA 3FOKA 4P5UA 1ZLPA 3WUBA 1CNVA 3RX2A 3NQ7A 3AHVA 5FJIA 2G50A 3GB6A 2HNHA 4UMCA 2Y7EA 3ARTA 4GI4A 1HGYA 4YU1A 1JCTA 1HZYA 4JOMA 4UWMA 1JUEA 3WG6A 1ME9A 1CI1A 1L8PA 4UTTA 1W1VA 4Y8EA 4R88A 4ZGYA 3ZOAA 4JTIA 4KRUA 4IX0A 3W7RA 3BWWA 1OF6A 3N6QA 3UY7A 2CHRA 4MOZA 1F61A 3DXIA 3PZ9A 1GT8A 1R3QA 4KWSA 2ATSA 3FW6A 4H04A 1VZWA 3AXHA 2EBNA 1XRSA 4JYDA 1WAUA 3BGGA 2NQZA 1QPKA 3ZVHA 1GOQA 5E9AA 1V3JA 5AVHA 4LV4A 1A4LA 3VIFA 2XYLA 3LS9A 3ITGA 1T8QA 3VMPA 4PCPA 5JBEA 1OFBA 1VPYA 2PEVA 4GXMA 4E8GA 1VJZA 2GUBA 3AS1A 1BGAA 1J79A 1XLKA 1H1NA 3EXRA 3KBJA 2DZUA 1JZ8A 1UIPA 2OOFA 1OF8A 3W7MA 3D47A 3POCA 1PO9A 2E3ZA 1VYRA 3GNDA 2TMDA 1KQZA 1EJ7L 3MJMA 3PB0A 2AGTA 4S39A 1JL8A 4XISA 4L7ZA 3GXTA 5A6JA 1P4CA 1UR0A 1IXQA 3N4FA 4MMWA 4UFKA 2XVPA 4CQAA 2E1DA 3EPMA 3V5FA 3H54A 2X1IA 1JGMA 1EEXA 4O14A 3ITXA 3WLSA 3C2RA 2W92A 4HU4A 5HATA 2E8ZA 1AL7A 4W8LA 3N1AA 4EPBC 1GTEA 1Q85A 2OSWA 4LNCA 4PB4A 3FGCB 4UCFA 2F7FA 3ATZA 5E5CA 3AC0A 5F2LA 1JPHA 1K6AA 3KE0A 5CC3A 4ACZA 5TBOA 3CQKA 1M1BA 3GTIA 1FUYA 2GVGA 3ZR6A 2FLIA 2FVKA 1BG9A 2F84A 2YYTA 3DYPA 3W2UA 3T8LA 3AZSA 4WLCA 3WLTA 3S1WA 1XIJA 1TB3A 1GKPA 3IK2A 1W56A 3IV3A 3EAUA 4KEVA 2FFCA 1JCMP 3RLVA 1XYZA 4JYFA 4A8RA 4GINA 2UZ9A 4MNMA 1REQB 4D6FA 3IEBA 2OVLA 3OZMA 3R8HA 2X0HA 1OCBA 3SUTA 3PZGA 2VFEA 3G77A 1U22A 6REQB 3EA2A 3J7HA 2A3EA 3QR3A 4NYYA 4RNFA 3P14A 4C65A 4JYEA 2I9UA 4XAFA 5F1UA 3IAQA 4IZGA 4AZ5A 1JF5A 3TNOA 1KKOA 1R86A 1PTAA 2C14A 4ZXOA 3W85A 3ZS4A 1XQLA 4C5YA 4J3XA 3KM8A 2VGBA 1RLCL 3BL3A 1NELA 1SW7A 4ZOCA 2FDSA 4AEOA 4GJ1A 2OG9A 5IDIA 3K13A 1E4IA 2E25A 5BWFA 2X8RA 1JUKA 4LBUA 4HD5A 3CLWA 3PFRA 4L9YA 6ENLA 3E5PA 3CPRA 5CZSA 4QCFA 2PDJA 1VYPX 3MJYA 1XFCA 3WDPP 2GDQA 2YCLB 2FB3A 1FHUA 4CNNA 1DP0A 1DE5A 5H91A 3I3DA 5LIKX 1K7EA 5FACA 1K1DA 1MZRA 2DH3A 4G6CA 4RNJA 3WCZA 3PY2A 2QIWA 1Q6EA 4GQQA 4X61A 2TPSA 1LLOA 2VO5A 5B80A 3K4DA 1F3EA 3PZTA 4NF7A 4V27A 3WO8A 1WB0A 1IYXA 2OO0A 2PWUA 4FMVA 4IF2A 4ES4A 2YA0A 1CGTA 4PUUA 3MUZ1 5AY7A 3W7DA 4TX8A 2X05A 3I3EA 5E6ZA 3S1UA 4LB4A 4F0HA 3CL8A 4MUZA 2DEPA 2A21A 2FGZA 1EP2A 5B7ZA 1GONA 2DSWA 2AMXA 1VIWA 4GXWA 3TE9A 3G8RA 6XIAA 2JF6A 3UW6A 4RJEA 1PUDA 4M0XA 3TW9A 2YFOA 3MU7A 4GJJA 3MCOA 3UCCA 2YIHA 4JTHA 5C2GA 2VNCA 1PXGA 4HIBA 3VGHA 5FJOA 1LG2A 4DIAA 2G8ZA 1QK2A 3CIWA 1W9BM 1HO1A 1VPQA 2RAGA 4UBPC 5M5DA 3W1PA 3UVAA 2Z29A 3B0UX 3ZR5A 3AMLA 4WDUA 1XYMA 1XIFA 2NSXA 3WN6A 2Z2AA 5FEZA 4M81A 1E1CA 1K9FA 1PHWA 4ZL1A 4NI3A 2VEKA 3TSMA 1I60A 4KS0A 3C0SA 3AMKA 3VGFA 2GJPA 4AIUA 3ITOA 3TR2A 1CEOA 1QK0A 1V3LA 1H5VA 1KRCC 2QF8A 3NQCA 3AROA 4Y90A 4CEUC 2ZRZA 3UWUA 3BH4A 4AZHA 3GIPA 2Y4SA 4E6MA 3EB3A