5AB3A

S.enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
247
structure length
241
Chain Sequence
MIIPALNLIGGTVVRVVRLHQGDYARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGVSLEQLVETYLPVGLKHVLCTDISRDGTLAGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar cubana str. 76814
molecule tags Isomerase
total genus 78
structure length 241
sequence length 247
chains with identical sequence B, C
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ab3A00
4UMCA 2DJLA 3IVUA 4FX8A 4KFOA 4A29A 5BNKA 1C9DA 3QMSA 1JCLA 4H6KA 4JGDA 1FX6A 4ADSA 1YPIA 5AYXA 4JY8A 4JXCA 3W7QA 4IMEA 4GUIA 1TJRA 4UCGA 3A22A 5HMSA 1EUAA 5AYYA 2C0AA 3W87A 1JJKA 3QC3A 4A22A 4FX6M 4MKNA 4CNNA 2CW6A 4MFDA 3UQNA 5EPDA 1UCWA 3HGJA 4XUGA 3BG5A 1IGSA 3SJ3A 1JCXA 1YYAA 3G1SA 3GNNA 1IIHA 3O16A 3WJYA 1XFBA 2EPHA 4LS2A 2ZZ4A 3IIXA 2TSYA 3I7QA 4NNCA 5DXXA 3KVJA 1TPDA 1W54A 3TAKA 3UWUA 2CFFA 4CCCA 3H55A 1KLYA 1X7FA 4AF0B 3T55A 1W31A 2ZZ1A 4Q4KA 2ZTKA 5H2ZA 2W6RA 1K7EA 2CZDA 3IGUA 2Y7DA 1PHQA 4JIPA 1W37A 4NJIA 3N2MA 3GDRA 3UXDA 1JCMP 1K3UA 5CPMA 3DBPA 3F1QA 2JKPA 2RDWA 3CQ0A 1OK6A 5AHFA 1RZMA 4N9DA 3RMJA 4RXFA 1L2UA 4GUGA 3S5ZA 1H61A 4EVZA 1ZAIA 3UWQA 4JN6A 4NVTA 3KAOA 4XKYB 3WK3A 2PC4A 1GYLA 4LV4A 3HGOA 1G7VA 2AGKA 3P67A 4HNTA 1WDWA 3FJ6A 2QR6A 1IXPA 3O6DA 4CNPA 4JTIA 5AHLA 4M6VA 4UFKA 2ZRVA 5DBUA 4WY0A 5E93A 1LLZA 3PM6A 5F4XA 5CKSA 5FF7A 3HBLA 3GIYA 2QEZA 1EPXA 2HMCA 4EF9A 3L66A 5J5RA 1UUOA 2ZCGA 4BFAA 1QPRA 1VS1A 2FTPA 5DCBA 1DORA 4AHQA 4D2JA 2C3ZA 4DO4A 2CLLA 2DZTA 2WJZA 1THFD 2DU2A 3C2VA 3QMRA 1VHNA 4ZZ9A 2WV8A 2CLFA 3ZWSA 4LTSA 1JUEA 2X1TA 2Y6ZA 4NJHA 1VYPX 3SGUA 1AL8A 5CSSA 3NQAA 3V1PA 2GQ9A 3W1AA 3N2XA 4K7YA 1BEUA 2I14A 4TR9A 4LVFA 1KFLA 3B05A 3T40A 3PY2A 3PF3A 2NV2A 1JR1A 4UC5A 5CPOA 5AN7A 3SR7A 1QDSA 3DXIA 1SFLA 4MFEA 3V75A 4DO5A 3L5AA 3TUUA 3HF3A 1DQWA 1P0NA 4MLRA 3L68A 1EP3A 4BI5A 4AHPA 4MOZA 2VXNA 3EX3A 2ABBA 1KW1A 3E12A 5HWMA 1QCWA 3C2RA 4O1BA 3HG4A 4LOCA 1P0KA 3P80A 3DGRA 3C4UA 3CEUA 1MZHA 4DF0A 1YXYA 4UIOA 4EWND 4Y6GA 1C29A 2QCLA 2NWSA 3ZWTA 4MZYA 2QCNA 4O19A 4LVDA 2E77A 4KKXA 3QMTA 3KX6A 1TTJA 2E6FA 2F7FA 3NQ2A 3PBWA 1UASA 3L0GA 3B04A 2ZTJA 1KM6A 1MEHA 4DPPA 3MP3A 3M1ZA 3A5FA 4WUIA 3NEVA 2CZEA 2JKAA 1HL2A 1GTEA 3MMTA 4ALDA 2P0OA 3EXRA 4LNYA 3M44A 3NGJA 5D04C 4UFLA 4UTKA 3LM7A 3LTYA 2R14A 3FLUA 5FF4A 3GR7A 2B7OA 2XFWA 3TK7A 3E9AA 3QEZA 4DEFA 3TQ0A 1QPNA 1JCJA 1SW7A 4IJBA 4XWUA 2W79A 1WAUA 1XBYA 1B3OA 4K6AA 1Z41A 2VFFA 3ABRA 1ICQA 5TQLA 5AFDA 2OCZA 5L9FA 5D05A 3ATYA 3FFSA 1OX4A 2QKFA 3EX6A 2G5WA 1QMLA 3UPWA 4ZVJA 1Z42A 1O95A 1H60A 1JRCA 2YYUA 3EWWA 1G4TA 4OWGA 1W5NA 4FNSA 2Q8LA 1VHCA 3B0UX 4UTTC 3NPVA 3L67A 3MJYA 3NM1A 3G0UA 1GOXA 5IBXC 2VOMA 4JS3A 2E09A 1FBAA 2WSQA 3W74A 1FCVA 1W3TA 4M7SA 3NXFA 2FPTA 3W9ZA 5K9DA 1WQ5A 3I65A 3LBMA 4WQ6A 3RLVA 1TPEA 3W2JA 5LKYA 5I3JA 1PL9A 3QSRA 4PA8A 5D38A 2CLIA 3W1PA 1VLWA 3W1RA 4HPJA 4WOQA 1K7FA 3LCIA 2RKXA 2O7SA 4QAIA 4N9BA 5DXYA 3UXAA 4GXMA 4HNNA 2WNZA 3O05A 3LV5A 4R7JA 3WJZA 2YFNA 1SO5A 4MVAA 3F03K 2QCDB 1GVFA 3PB2A 3TA6A 3W7NA 3DHDA 3INPA 3ZFHA 3PB0A 4I7VA 3L9CA 3G1DA 3LHVA 2H3BA 3HG5A 1GTHA 5KZEA 1TPWA 2QCHA 3NQCA 2JBMA 5BMXA 3GZ3A 1EB3A 4TIMA 3N34A 1P1XA 3W7JA 4HNVA 3CIWA 3A21A 2Z1BA 3P8JA 3QRHA 5FI8A 4JTLA 3N3MA 3E02A 2Z6JA 1W8SA 3OIXA 4JTTA 1I2NA 3RFAA 8TIMA 3M5XA 2V5LA 3R8RA 4UFMA 3TXZA 2FIQA 3M9YA 3PR2A 3W7DA 3MHGA 4UMBA 2ATSA 1KM1A 1F2JA 1WOBA 1HFBA 2WPBA 5DN1A 1ZENA 4FHAA 5HQEA 2WO5A 4FF7A 4GRSA 3KHJA 3QW3A 4OV9A 5F1UA 1NSJA 4XZ9A 3TJXA 3BVJA 2CU0A 1F6PA 3STFA 1FWNA 1LOSA 3BGGA 1CI1A 5G4WA 3KVMA 1DKWA 3BK0A 1LROA 3FKRA 3W7LA 2B7NA 3W88A 4UFHA 2DZPA 1OFBA 5KZDA 1QO2A 2YX0A 5LSMA 1YDNA 4M7TA 4LT9A 1OFQA 1WBJA 5HUPA 4QNWA 4JYDA 3GR8A 2QJHA 3FIGA 1VR6A 5HJLA 1U83A 2ZZ5A 3L65A 4UTJA 2V9DA 2B7QA 2Y88A 2Y70A 4Y8FA 5BOOA 2ZRYA 1GZGA 1EP2A 1N8FA 5LHEA 4O4VA 2Y63A 4R53A 2YDAA 3W1TA 1MEWA 1JVNA 3MBDA 2V2DA 3BW3A 2NXIA 2WSYA 3TCEA 3O6CA 4UTHA 4UMAA 1EEPA 2EGZA 3R5EA 3NR0A 3WJWA 4R33A 4AWTA 3D0CA 1W1ZA 5CZTA 3P5YA 1EIXA 1ZAHA 1LBLA 3PC0A 1GG1A 4CCEA 4X3ZA 3TH6A 4POCA 2GVGA 2FFCA 4OBTA 2V8ZA 2DJXA 5DCEA 4CQAA 3DU0A 2C13A 5C6MA 5F2LA 5LGXA 3LHZA 4GJ1A 1W5MA 1TMHA 3OG3A 2QJIA 3O15A 4X9SA 6TIMA 1H51A 4O4WA 1TQJA 1I2OA 4FNUA 4JNMA 1H5YA 3QFEA 4AMAA 1AK5A 4LRSA 4OU1A 1F5ZA 3G0XA 3GAYA 4JDBA 4RR4A 4UUIA 4QQ3A 4ZQCA 2CLKA 4M19A 1H7XA 4Y9AA 4DBEA 1FXQA 4E2BA 2EHHA 1RR2A 3DZ1A 3G1XA 3S1XA 3ZR4A 3SY5A 3EWZA 2BX7A 2NLIA 2B7PA 4QNEA 1DQXA 1GVRA 2G96A 4KWWA 4XQ6A 5F2MA 5FEWA 4P61A 4N2YA 2NX3A 1OFOA 4MYAA 1H7WA 1QR7A 1M5WA 2QAFA 2YPIA 3NQEA 4PCFA 3QM3A 5LNRA 4ZL1A 4IX2A 3PUEA 1OF6A 3M0ZA 3CT7A 5CZSA 3NM3A 2C6QA 3QSTA 1XBZA 3CPRA 5K7JA 3LERA 3M5YA 3HOJA 5DCDA 4FIRA 1AW5A 4O16A 1TJPA 4JX4A 1XM3A 2YW3A 3QPYA 2VFDA 1LDCA 3U6WA 2DZWA 1OX6A 5AHEA 3W85A 1G69A 1OX5A 4AVFA 3W76A 4KWVA 3U8GA 1GVOA 5EKYA 5K2ZA 3LCLA 5CPLA 3N14A 1WV2A 4E0CA 2ZRXA 2QCCA 4C1KA 1KM3A 3ELFA 4NJKA 2D73A 3GK0A 4Y96A 1TRIA 1XKYA 3RF9A 2CLEA 3R12A 4Z0SA 4AWSA 5DY3A 2NZLA 5AC8A 1PIIA 1M6JA 3Q58A 3F4NA 3VCRA 3SFKA 1KBJA 3S1UA 1C8VA 2W0UA 4O57A 1QPOA 4X22A 4NUWA 3CC1A 1KFCA 2NV1A 3FJLA 4Z1AA 1IXQA 1KLZA 3W22A 2VEMA 3NL2A 1G67A 3O8AA 3Q2DA 2E68A 3PVFA 2ATMA 3BGJA 5AC6A 3DFQA 1ML1A 4O50A 3BARA 2YCEA 5H91A 1D3GA 2C19A 1A5CA 1JCNA 5DBTA 5A8GA 5HNRA 1FUYA 1SO3A 4JD4A 3QF0A 3TXVA 4RCXA 2Y7EA 4YWIA 4E38A 1G7UA 4JX6A 4L4MA 3PBYA 3IGSA 3LV6A 4IOTA 3VE7A 3DHFA 5F1VA 4I9AA 5U4NA 1X8FA 3EKZA 1SPQA 3IV3A 4ADTA 2ISSA 3MYPA 1NFBA 1YLVA 1PV8A 4LU0A 4UTUA 1FWTA 1GVQA 3T44A 3LLFA 1VZWA 1GG0A 1OYCA 5SWUA 4ORMA 3W73A 2A1YA 3W2UA 4TMBA 3LGEA 4EIVA 1DJQA 5GVJA 1TPC1 2QUTA 5HULA 5HR6A 1OFAA 4OHQA 5DELA 3NYZA 4K38A 2X1RA 3W1LA 2E1DA 3SECA 4UFIA 2J9YA 3W1UA 3TKFA 4O54A 3LHUA 4E2DA 3EXSA 4JTEA 1XI3A 1NAL1 1HUVA 4UR8A 1VCFA 2X2GA 4BI6A 2R8WA 3QPZA 4FNQA 2FQIA 3MP4A 4HNUA 1OJXA 1LM1A 3AJXA 1SO4A 1RQHA 2ZDRA 1RVGA 3QJAA 3T4CA 3TV8A 1I8JA 5FF3A 3HB9A 3K30A 1GWJA 1SZGA 3KRUA 4IXHA 3GX9A 4MZ1A 4UTTA 4O12A 2QCGA 4M6PA 5EYWA 4TO8A 1L9WA 4N4QA 2GVJA 1LLWA 3G8EA 4N4PA 5IBXA 3PUOA 3WFAA 3DFNA 3EXTA 4JYFA 1D9EA 3LB0A 4GFSA 4UTIA 2OZ0A 2TPSA 3GLCA 2A7RA 4RZ4A 1ZALA 1H7PA 2ZZ6A 1LCOA 3B8DA 3L0NA 2TMDA 3L21A 3PBVA 1YDVA 3UZJA 3ANYA 3R2GA 4RV8A 2P10A 5I3KA 2FDSA 3HPZA 5D09A 1FCQA 2CZ5A 5LNWA 4WOZA 5KITA 2QDGA 4O0ZA 1LOQA 4PH6A 3W1QA 3MI2A 4O18A 4PODA 5A5WA 1QFEA 4Y90A 3TX9A 3W3OA 3IVSA 2TRSA 3M41A 3MHUA 4EF8A 1GYNA 1OHLA 4GNJA 3W7IA 2B0MA 3M7WA 4BF9A 4MY9A 3TMLA 3S1WA 3UPBA 5DY2A 1IIGA 4DBDA 3Q94A 3GVGA 2O7QA 1VPXA 1KA9F 2WNNA 1SSDA 3M5VA 4HIBA 1W3NA 1JQXA 3OEXA 4FNTA 2ZA1A 4Z08A 1TQXA 1PE1A 2A85A 3CM4A 3GDKA 5AHIA 3P84A 3GAKA 1TO3A 2PURA 4IPJA 4RZ6A 3KOFA 4HKPA 2EAWA 5LZLA 3ZS4A 2OT0A 3NQFA 1FWRA 3QZEA 3LXAA 2TYSA 2QUVA 2VKZG 4DF1A 3W7KA 1DBTA 3H53A 5G4EA 1LBFA 4NJGA 1UB3A 1TPFA 3W1XA 4LC8A 4UXDA 4O0KA 1TREA 2ZRWA 4LWWA 5HWNA 3TROA 3N73A 5G1YA 2H3DA 3WK2A 1LRTA 1ADOA 3KVKA 1VCGA 1FDJA 1XUZA 3CEPA 3RU6A 2B4GA 1HG3A 3STGA 2V2HA 3SGZA 1FCBA 4MLJA 2C16A 1K8ZA 2BXVA 1FCUA 4PL2A 3LHYA 1SUXA 3NPUA 4ONVA 3P7YA 1WXJA 3VE9A 5FESA 5EBUA 1W56A 1OFDA 1IXNA 1A5SA 4IMCA 1FDYA 3W2KA 4CCDA 1OF8A 1Q45A 3BLEA 1ZJIA 1M7PA 4RK8A 5T26A 3P61A 2E5CA 2YR1A 2Z6IA 1NF0A 4LC6A 3S1VA 5LHFA 4O14A 2X1SA 4IPIA 4ZQOA 2ZZ2A 3NQ7A 5D2VA 3G18A 3SW6A 3NL3A 4LVGA 2H90A 2ZYFA 2ZZ3A 3OA3A 2CLHA 2XN0A 4ORIA 3S0CA 3EWYA 4P2VA 2V81A 3NO5A 1W5OA 5ABTA 3Q37A 4YCOA 5F2IA 2ZRZA 3HQ1A 3W6YA 3LXBA 1TPH1 2BWGA 5D2WA 5CGQA 4CNOA 3W2LA 3KVLA 1X6UA 4PFMA 4PTNA 2AAMA 5C2XA 2J24A 3W84A 2R94A 4FXSA 3ATZA 1H50A 4WY0B 1G6CA 3UD6A 1NEYA 3C2EA 4BR1A 4O53A 2Y7GA 4MYXA 2VENA 1QOQA 1W5PA 1FY6A 1S5WA 2CWNA 1F74A 2HS6A 3G3MA 4UTMA 1PHWA 5I3FA 3VI2A 2ISVA 1K7XA 2NWRA 1A5BA 1CX9A 3LXCA 2WQPA 4MIMA 3TAOA 5EA9A 3UYCA 1GVSA 5CSRA 2GUUA 3W75A 1LRQA 5D33A 1T8XA 3W83A 1WBHA 1VGAA 3L0KA 2FJKA 4MY1A 3W7CA 5D30A 3TJLA 1L6SA 1I4NA 1ONRA 1ZCOA 4IXXA 4IWWA 3EX1A 5E1QA 3NPWA 1A5AA 3HG3A 1T0OA 2X1UA 2RDUA 1NF7A 4Q33A 4YLWA 3WJSA 3DFPA 1TPUA 2ZFAA 3G8RA 3R89A 1YTKA 3KFTA 3C8FA 3IIOA 4M5PA 2VFIA 3O06A 2YYTA 5F4WA 5TBOA 1R2RA 1JUKA 1KTNA 3M6YA 3YPIA 1TTIA 4HPXA 5IM51 3PS7A 3FYOA 4DF2A 2C1HA 1WOAA 1PCKA 1F05A 4U28A 1FDZA 3TQKA 4X2RA 5D03A 3M5ZA 3KXQA 1YTDA 2A2IA 4AHOA 2XN1A 4MJMA 5K9XA 3JRKA 5AB3A 4UTWC 4AH7A 3W1NA 1GPWA 3TE9A 1K02A 1LYXA 3P62A 1MXSA 1SW0A 4O8RA 4N9EA 2QDHA 3LX9A 3LHTA 4DPQA 4YL2A 4AF0A 1SSGA 4UNLA 3P82A 1X1ZA 3CTLA 4A21A 2E6AA 3THQA 4Z1BA 5C5YA 3MI3A 2A7PA 4RLIA 4WXZA 1PCWA 1SW3A 1UBSA 1W0MA 3W7PA 1RD5A 5G2WA 3FEMA 3OVPA 4O13A 4JIQA 5CZJA 4DQWA 2A5HA 3R13A 5KSWA 1KM2A 2Z2UA 4WD0A 4ZQPA 1V5XA 4XBSA 1OK4A 4K8EA 5G2IA 1OYBA 3B03A 4CQ9A 3VFLA 4XKYA 3C6CA 3MO7A 3NQ8A 2A4AA 3QW4B 2QJGA 5AOUA 3G1VA 4JX5A 3UZ5A 3W7OA 1L6WA 1GJPA 1YTEA 2JKEA 1KV5A 1YXDA 3BW2A 1YADA 4O1DA 4M6QA 3NZRA 2H8XA 1FWSA 3P8IA 3TU9A 4WY0F 3S5NA 1OX4B 2VFEA 4JTHA 4WZHA 4XTIA 4JTFA 3KRSA 3A23A 3T78A 4OV4A 4JTKA 1SZNA 1QNVA 1R2TA 2PE4A 1CW2A 1ME8A 1OFRA 2UV8G 2OT1A 3N19B 3STCA 3O6YX 1OFEA 4Q32A 5BMWA 2QCMA 1TSIA 2AQWA 3W86A 1GEQA 3TSBA 2ALDA 1JULA 1Q6RA 4JYEA 2Y85A 3MI6A 3QQ1A 4K8HA 4J9JA 2BTMA 1TPB1 3L2IA 3OVQA 1LZOA 1W3IA 3LOTA 2GQAA 3EKLA 1TV7A 4IQLA 3HGRA 3S5YA 3DKLA 1UJPA 2Z0IA 4JEQA 3GNDA 1XL9A 3NL6A 3W72A 5D02A 1RV8A 3HPSA 3W2MA 3BO9A 4NZFA 5G2HA 3W70A 3N9SA 2EF9A 3PWAA 5KMYA 5FEZA 2R91A 3DFOA 4TX9A 3TFXA 2OJPA 1ZAJA 2RFGA 3B4UA 3AO0A 1RQEA 2Q3RA 1XXXA 2HTMA 1OYAA 3G22A 4NQ1A 1K8XA 3T7VA 3STEA 3M16A 4IUOA 4K39A 2H6RA 4R34A 2VEPA 3S9YA 4KFPA 1KFEA 3LDVA 1B9BA 3EX4A 4I7WA 2DZVA 3IGXA 1Q3NA 2NXHA 1O60A 4LY8A 3TW7A 3ABQA 1N7KA 2WOQA 3GXPA 3TDFA 2YXGA 4CLMA 2CLOA 2QF7A 2E5DA 1H7NA 4ZQMA 3P74A 2X30A 1X1OA 1F76A 4JY9A 1F73A 2ZQ0A 2QAPA 3F4WA 4GWEA 5F4SA 4PL1A 3SSJA 4K36A 1DJNA 3PSWA 5HR7A 3GDTA 1I45A 1A50A 4BWLC 1F7BA 1DOSA 4AWUA 5K3VA 2GQ8A 3LRMA 3NQ6A 1EWDA 1HTIA 4JTJA 2OMAA 1Q6LA 5FF2A 3DENA 1B4EA 1ALDA 2YGYA 3NAVA 3A9IA 4LUJA 3IVTA 2J6XA 3NPXA 3CLMA 3PULA 3GKFA 3G3DA 1MSSA 3S42A 4HSOA 3EWBX 5CPNA 4AB4A 2C18A 2FLIA 3P60A 5HWJA 1UUMA 3RNDA 3BG9A 1O94A 1DHPA 1JCYA 1BTMA 1G4EA 1LTDA 5I3GA 4OQVA 3E0IA 1Z44A 4H4IA 1TPVA 1VYSX 3G1YA 1H63A 1AW2A 3I6RA 2WNQA 2VFGA 1KBIA 3S8HA 4N9CA 3HO8A 2GPTA 2V2CA 1AG1O 3EX2A 4DELA 4AXKA 4ICNA 3C61A 3LRKA 4KFNA 4LUIA 2YFOA 3IIVA 1BWKA 3USBA 2BZNA 3OBKA 4L4LA 1NVMA 2VEKA 6ALDA 2DP3A 3LHWA 5LNSA 4LVAA 3SIZA 3PG9A 3TSMA 2XN2A 3CWOX 3TNOA 5K4ZA 4FX7A 2QUUA 1SU5A 3H54A 1ICSA 4XTDA 5F2GA 2QCDA 2WSRA 4GE8A 3LCGA 3EWXA 1J5TA 4GC4A 3MYOA 3GXNA 3LI1A 1EP1A 3C52A 3TR2A 3PSVA 2HS8A 4XBKA 4RXGA 4N6EA 3UNDA 1KM5A 3DAQA 3DFTA 4UTLA 3SI9A 5D32A 5LNVA 3JR2A 1B4KA 4WXYA 3S6DA 3A5VA 2A21A 2P1FA 5E0KA 1U5JA 3GDMA 4YMZA 5AYZA 3BLIA 3C56A 1GQNA 4NU7A 1TTPA 2V30A 1RQBA 4LS1A 1TCDA 3FA5A 3JS3A 1VLIA 3TMQA 4PEKA 2GJLA 2WKJA 1VH7A 3W2NA 1ZNNA 3TC7A 1EX5A 1BWLA 1PVNA 4NNAA 3ABSA 2J9ZA 3MUXA 2JK2A 3NL5A 4RKAA 4IMGA 2ZA2A 1GT8A 5FEPA 1OVDA 4FXRA 3W71A 3BLFA 4BI7A 5FF0A 2GOUA 3GYEA 3O63A 4N6FA 3L5MA 1G4SA 1H62A 2EKCA 1JRBA 3BW4A 5LGZA 5KZMA 5HINA 3HPXA 1HO1A 3BG3A 3NQVA 3RK8A 1TV5A 1QAPA 3LLDA 1E51A 1T96A 4MZ8A 1AL7A 5D2YA 4QM1A 4QSHA 4FO4A 4IMFA 4RJEA 3GKAA 4JDYA 4IMDA 4QIUA 1HO4A 4UFJA 2DZSA 2PRHA 3P5ZA 1R47A 4A2RA 3UWZA 4ADUA 1ZFJA 3GXTA 1XDMA 2QCFA 1XC4A 3HGSA 3U2OA 1S5TA 1JQVA 3I68A 4K37A 5AC7A 4S2BA 1LP6A 4NJJA 1L6YA 5AHNA 2NUWA 4A3UA 3WJXA 5G5IA 2LLEA 1Z48A 2RHGA 1N55A 2I1OA 4GBUA 3I7RA 1WX0A 1OG0A 3IEBA 2QCEA 2BLEA 3P81A 1H7RA 1TRDA 3SZ8A 4DXVA 3TQVA 3GDLA 5HUOA 4WJEA 3KRZA 3FYPA 1QOPA 4NZJA 2Y7FA 2G97A 1A53A 1ICPA 1QO5A 1SZEA 1AW1A 4JTUA 5I3IA 4HSNA 2C14A 2Y61A 3UY7A 3MBFA 3MWAA 4FNRA 4I7UA 4A2SA 3IIZA 5C54A 1DVJA 4B5NA 1YDOA 4UTWA 3E96A 1H1ZA 3C3NA 3HMJG 1EUNA 1XBVA 3HIJA 1VRDA 2DZUA 4NX5A 2ABAA 1QWGA 3RLUA 2GJNA 1Q6QA 1Q6OA 5D2XA 5BW6A 2ISWA 3BPWA 4FEZA 4NXKA 1IF2A 4O15A 1S5VA 4Z1DA 3THAA 1TYGA 2NX1A 1VQTA 1QPQA 2E5BA 2VC6A 3C2FA 4W9TA 4WX2A 4YCPA 2J9XA 1MEIA 2YSWA 3DFSA 3O1NA 3W7GA 3DI0A 3G1FA 3QQ0A 3W23A 4N02A 3LCHA 2I9EA 4O10A 4AAJA 3M47A 3FOKA 5CG7A 3IIPA 3NDOA 3W7RA 4JR5A 4O1CA 2J27A 1P4CA 2NUXA 4BK9A 3NQGA 5BRBA 2V0TA 4JTSA 2YW4A 1K03A 1TB3A 3LCFA 4QITA 2ZA3A 3IRDA 2Q8ZA 5D2TA 3W7EA 5EY5A 1KTBA 1RPXA 3PUDA 4Z0JA 3MHFA 2NX9A 4HHPA 3GB6A 4YXGA 1J2WA 4ZQRA 4O17A 5MHBA 4NT0A 3TSDA 4GUHA 3L5LA 2HSAA 5KINA 4HT3A 4Z1CA 1VCVA 5K9CA 1WA3A 3NZ1A 4EOUA 2C15A 1TIMA 1T99A 4AEOA 3G1HA 2VFHA 4NNBA 3E49A 2ZBTA 4QJ1A 3TFCA 1LBMA 2RDTA 2NUYA 3HJZA 1SZFA 3DI1A 3PG8A 2Y62A 4TU1A 2NXGA 3A24A 4S1FA 4LRTA 4JICA 2VELA 2FPVA 1VYRA 3W07A 1R30A 3MP5A 5FEXA 1V7YA 4H3DA 1P5BA 1TTQA 2OX1A 1I2RA 3CB8A 3C2OA 1DV7A 1ZY9A 4UR7A 2FPYA 4FNPA 2JGQA 3DKJA 4OE7A 4PC8A 2E6YA 2A0NA 4U4MA 1ME9A 3TC6A 1W5QA 1FWWA 3I7SA 4MUZA 4OGZA 1H1YA 1I2QA 1M7OA 5L6UA 2DZXA 4MPQA 1FXPA 1XBXA 4RX0A 1MO0A 1TV8A 2CZFA 3B06A 3M43A 4DO6A 1D3HA 2GVLA 4ZMGA 4ML9A 5I3HA 5K4XA 1R2SA 3QYQA 1FQ0A 3QH2A 1Y0EA 1O5KA 4LW7A 2KZHA 3G1AA 3PBUA 1J4EA 3S5OA 3G24A 4LS0A 2H8ZA 2J88A 2CLMA 3NVTA 4CQ8A 5J5DA 3WK1A 5AHMA 3OHIA 3TW6A 1ME7A 1XCFA 2F84A 3NA8A 1ZHAA 2BSLA 1EWEA 4IX0A 1VC4A 1XDLA 2FB2A 4C1LA 1O4UA 3LBCA 4FB7A 4BWLA 3HG2A 3FKKA 4O11A 1SO6A 1OABA 2Y89A 2G95A 2PRMA 1I2PA 4LV9A 5EL1A 2PRLA 1YPFA 3LI0A 1EA0A 3WK0A 2Q3OA 1OFPA 1WYIA 3UWYA 3C0JA 1KV8A 3NOEA 2RH9A 1G4PA 2PCQA 2A6NA 1JUBA 2V5BA 3W1MA 1YXCA 5EMUA 5TIMA 1XUUA 2VEIA 3NQMA 5DLCA 4RZ5A 1B57A 4OT7A 3CU2A 2V82A 1SFJA 5U7SA 4GUJA 1S3HA 5KTLA 4JTGA 1F6KA 4FIQA 3BV4A 4IGHA 3VNDA 1KTCA 1KFKA 3LCWA 2ZZ7A 3W7HA 2IQTA 3LTSA 4O1AA 1H7OA 1O5XA 2FB3A 2ZRUA 4QISA 4K7VA 1SR9A 5LNUA 1KFJA 2A6LA 4GUFA 1R46A 4UNKA 2A7NA 1KM4A 3B0PA 3OVRA 4G1KA 1LOLA 4O28A 1DL3A 1LRNA 3FS2A 3N9RA 3NNTA 1VJIA 4MY8A 1KM0A 2DORA 4NX0A 4O52A 2JGYA 3O07A 4NXSA 3UWVA 1BKSA 3EB2A 3G0SA 3NG3A 3B0VC 5C55A 1SQ7A 1K8YA 4LVBA 3CIXA 3LTPA 4TMCA 2E6DA 1PS9A 1KFBA 4HN4A 3VKJA 3UY8A 3DH7A 3TIMA 5CZ0A 5G1TA 4ZQNA 1LORA 3ABOA 1IXOA 3MW7A 4S2CA 2X16A 5D37A 3EWUA 3CWNA 3LCXA 3NQDA 3CHVA 3EEGA 3W7MA 1AMKA 3UWWA 3LRLA 4MJZA 3PAJA 2YZRA 7TIMA
chains in the Genus database with same CATH superfamily
4UMCA 4KFOA 3UCCA 1XYAA 4H9UA 1P0EA 1QPKA 3K5XA 3RXZA 4JXCA 4IMEA 4GUIA 1IT7A 5HMSA 3WLOA 1W6TA 2P8CA 1JJKA 3QC3A 2WHLA 4TQTA 2QPSA 4MFDA 1U1HA 4EANA 5I2UA 5EPDA 3UW6A 2J66A 4S3KA 3BG5A 3H7RA 3SJ3A 1PXGA 1JCXA 1YYAA 2PSNA 1VRXA 3GNNA 2O0TA 3WUGA 2VC5A 4EK7A 4LS2A 3W29A 2P50A 3IIXA 2TSYA 3I7QA 4S3AA 3DYPA 4Q7BA 4HNCA 1KCXA 4REQB 4DWSA 4HA0A 3HM7A 3GNRA 2GJXB 3NFUA 3VDBA 3P6LA 1M7XA 4DY1A 3KBJA 5H2ZA 1JDEA 2W6RA 1K7EA 3VGGA 2CZDA 2E8YA 2Y7DA 3IGUA 3R0DA 1TELA 1W37A 4HU4A 5C9WA 5HDRA 2EPOA 4ZO8A 4A05A 1JCMP 1A3HA 5CPMA 2JKPA 1UH2A 4TV6A 2XGZA 4LB3A 5IDIA 1L2UA 1UZ1A 2OSWA 4D6IA 1XKJA 4GIAA 3S5ZA 1ZAIA 4CKQA 4XKYB 2DQXA 2PC4A 1GEHA 3EWCA 3HGOA 3MMWA 2AGKA 5REQA 5HPOA 1IXPA 4C6DA 4BZYA 4CNPA 1K9FA 2ZRVA 1RK5A 3WBAA 4WY0A 3MKVA 5FF7A 5FJOA 3HBLA 2XJ7A 2PDKA 1Y65A 1EPXA 4EPKA 3MDWA 1UMLA 3UXKA 2G4FA 4WVXA 3L66A 5J5RA 4ACZA 1S46A 1UUOA 2ZCGA 2XVPA 4C6PA 3CL7A 1NM9A 1NTHA 4D2JA 2DZTA 3WIJA 1T6MA 4ZZ9A 4R27A 3N04A 2J8GA 1AL8A 5FA5A 3CAWA 1HW6A 4OECA 3W1AA 1BEUA 1KFLA 3MDUA 4FK9A 4MNLA 3AAMA 1TZZA 4YYFA 3SR7A 3DXIA 1ZJAA 3N25A 4DO5A 2FFIA 1P0NA 2OKOA 1HJSA 1W3JA 1C90A 3GH4A 3T07A 1HIZA 2DSUA 1KW1A 5HWMA 4O1BA 3C2RA 2DIJA 4RDYA 1DJWA 4DF0A 1XC6A 4DI8A 2NWSA 2G0WA 1MNSA 3RUBL 1YEYA 4LVDA 2CHNA 1L6FA 1YDYA 2E6FA 2INZA 5A1AA 3WQEA 1UASA 4B3LA 3L0GA 4YWSA 2CESA 1CZ1A 3EDKA 3MP3A 3A5FA 2CZEA 2JKAA 4ALDA 4LNYA 4DZ5A 4HHLA 4GVHA 5D04C 1VPQA 3LTYA 5FF4A 3LSCA 4PMRA 5A6TC 1YRRA 1Z69A 3E9AA 2VUNA 4DEFA 2FVMA 1JCJA 3O3RA 4XWUA 3GWQA 1JXJA 4QXIA 1A0EA 1WAUA 1XBYA 1B3OA 1B3VA 1PKLA 1Z41A 3ABRA 4DJFC 5L9FA 1FWBC 3VTRA 3T9PA 2FJUB 3ATYA 2QKFA 3EX6A 1FWCC 2G5WA 4Z17A 4P7OA 4ZVJA 2PDXA 1H60A 1JRCA 2DSVA 2YYUA 4LEQA 4XBJA 2VZUA 3MS8A 4FNSA 2Q8LA 1EJ7L 2ODOA 1QTWA 1TVNA 4YNGA 1XIFA 3NPVA 1FH7A 2PDGA 4H8NA 1NQKA 4F4RA 5IXEA 4NZCA 3AICA 3VX0A 4D8ZA 2DT1A 4JS3A 1S5MA 1S39A 3G6MA 1EDQA 1FCVA 1G01A 4P8WA 3SY8A 1C8QA 4UCFA 2DUXA 4W93A 2PDFA 4AC7C 5LKYA 1PL9A 4MB1A 2CLIA 4WIWA 5BU9A 4HPJA 1PZ2A 3BZJA 2O7SA 4PUKA 4GXMA 5E5CA 1W9DM 1WZMA 1O1ZA 4UQDA 5JIWA 9XIAA 2YFNA 1SO5A 2EPKX 5CAKA 3EA1A 4PTVA 4KQNA 1B9ZA 1E6ZA 4QBXA 1EB3A 5AECA 4PBGA 2YCIX 1P1XA 3W7JA 4HNVA 4NZ5A 5FI8A 4JTLA 3Q45A 4LPCA 3E02A 3OIXA 4BY3A 2HQAA 4HOZA 2REQA 2V5LA 1EEXA 1M41A 1CXIA 4HU3A 1VIZA 2XGBA 4KESA 4UMBA 4DM2A 4ZCWA 2ATSA 2FZBA 1SZRA 4IP5A 4U31A 1WOBA 2WPBA 4PGLA 1V0LA 1TMQA 1PX8A 4FHAA 4GRSA 1W1YA 4OV9A 4A8RA 5F1UA 1XSKA 1SR0A 1NSJA 1VBJA 3WBYA 1F6PA 1FWNA 3BGGA 5G4WA 3WDJA 3FXGA 4QDMA 3NGFA 2R82A 2G8ZA 4GHRA 1LROA 4GY0A 2B7NA 3G77A 3AMCA 3VOGA 3QV8A 3SCUA 3CNYA 1QO2A 4BF7A 4M7TA 1OFQA 2HXUA 1WP6A 3WQ5A 3DOPA 2QJHA 3FIGA 1CGWA 4RPQA 5M03A 3VD9A 2DZBA 5BOOA 3S3GA 1GZGA 1EP2A 4DXKA 2J7BA 2RJHA 2UZ9A 1J2BA 7TAAA 1JVNA 5EMYA 2IPJA 1UKQA 4CN4A 3VMOA 2WSYA 3TCEA 4L6OA 2VDGA 2EGZA 3VIJA 2FMNA 3P5YA 1ZAHA 2R1PA 3KTSA 2HNHA 1KXQA 1V0NA 3TH6A 2OG9A 4CNSA 3SM0A 2V8ZA 1M68A 4Q4SA 3WH7A 2JEQA 5CLWA 3DU0A 3O15A 4O4WA 4QS5A 1I2OA 4C91A 2POZA 3N3TA 3R10A 3G0XA 3GAYA 4I8YA 4ZQCA 3W81A 2I16A 4M19A 4Y9AA 8A3HA 4C7FA 2PS2A 4AZ6A 3DZ1A 3FGCB 4PN2A 2BX7A 4IIGA 4IJCA 5MKGA 4TOQA 4S23A 4L5ZA 4N2YA 3B9AA 4PBFA 1Q4WA 4CU6A 4JTCA 1OFOA 4QG9A 3EDEA 5CBBA 1M5WA 1UZ4A 5LA2A 3NQEA 4PCFA 4ZL1A 4AEEA 4QCFA 3CT7A 5CZSA 1D8CA 4M6UA 4ZB5A 3ITGA 3CPRA 5K7JA 3LERA 2GDVA 4FIRA 4O16A 1XM3A 3BMVA 2DZWA 4AYSA 4GIYA 4LYRA 1O1HA 2WJDA 3Q65A 4MGGA 5EB8A 3VOIA 4PCSA 2Z27A 3W76A 2I17A 1TX2A 5EKYA 5K2ZA 2Y8KA 1BWVA 3LCLA 1AODA 1WV2A 3MB9A 1CBGA 4E0CA 1PO9A 3BLKA 4IISA 4IICA 4YIWA 4NJKA 2D73A 3GK0A 2TODA 1JXKA 1XRVA 2XIJA 1ZL1A 5DY3A 2NZLA 1XH1A 1QASA 3WQ6A 3IJIA 3ZSSA 2G3FA 3Q58A 4JTAA 2J62A 3VCRA 4BQ2A 2W0UA 1YIXA 3ECQA 3EMZA 4NYYA 5DMLA 3VGDA 4MAZA 1UOZA 1WDPA 1UC4A 3C0QA 1RLDA 1VJZA 3PVFA 2ATMA 2ZUVA 3I6TA 1ML1A 2PU1A 1JCNA 5DBTA 2R6OA 1SO3A 2J7DA 3TXVA 2Y7EA 4E38A 3UESA 5AVHA 1QI3A 4S38A 5U4NA 3EKZA 2JF7A 3Q67A 2ZVIA 3N9KA 3IV3A 2ICSA 4ADTA 2X42A 2PWFA 3LM3A 3CUXA 5AYBA 1FWTA 1GVQA 1PJ9A 1OYCA 5J04A 4ORMA 3VGEA 4C5YA 4JIHA 1RJQA 5GVJA 5DELA 4NRSA 2X1RA 4C6EA 2WBGA 5E0FA 4DAIA 1QU4A 3LHUA 1LL7A 3CZJA 4XV0A 5AC4A 2J13A 5BXRA 2CYGA 1VCFA 3WZ0E 5BYWA 3SUSA 3QPZA 3VNYA 4EACA 4AUBA 3T4CA 1I8JA 1V4YA 1PKYA 3HB9A 3CQKA 1GWJA 3KRUA 3GZAA 1EBHA 5H8UA 2QCGA 3JVAA 4TO8A 3B8WA 2DVTA 4ES4A 3PUOA 2ZX6A 3KL5A 2QVHA 1D9EA 3LB0A 1E1FA 1IEIA 1FFRA 2J25A 3TZFA 3B8DA 3SIMA 5XIMA 1B5TA 1VKFA 1YDVA 3R2GA 1DJXA 4K1GA 2PP1A 4E4FA 5CXPA 1FCQA 4B91A 4UOQA 5LNWA 2XGIA 3CGTA 4WOZA 3W1QA 4W5ZA 2TRSA 1XWYA 4HA3A 1UC5A 4GNJA 9RUBA 2YA2A 3Q94A 4F9JA 4WLCA 5I07A 1VPXA 1KA9F 1MW2A 2FGZA 2HCVA 3WLTA 3AHZA 4Q7NA 2ZA1A 4LAOA 1TQXA 4MPKA 5AHIA 3P84A 1XP3A 1W3LA 2EAWA 5LZLA 3NQFA 4GABA 1FWRA 4GXWA 3LXAA 2PWUA 4DF1A 3ONCA 3W7KA 2OWXA 3H53A 5G4EA 1ITQA 4NRRA 7A3HA 2ZKMX 1KRBC 5XIAA 4PTMA 3IPWA 4O0KA 3N4AA 3VDGA 5HWNA 1C93A 3KLLA 3OQEA 2D22A 3N73A 3MUY1 4DRSA 1ADOA 2NQJA 4B16A 3CEPA 1E72M 1HG3A 2C16A 2BXVA 2PBOA 1IZJA 3OB8A 1B31A 1R87A 1ONXA 4CD6A 4CD8A 2XIOA 2J7GA 1UR8A 2J4GA 3IGHX 3P7YA 2OQLA 4PTDA 4Z2IA 3T2PA 1X8CA 1FDYA 3W2KA 1Q45A 3TTQA 2IPWA 4C6NA 1E3ZA 3T81A 1RP8A 2QUNA 3ZM8A 4AZCB 4O14A 1JZ7A 4ROQA 1SFSA 2W5FA 3RJXA 1MDLA 2ZYFA 2ZZ3A 1HJXA 2VQTA 3T8LA 5FIPA 4WRHA 3LPFA 4FZIA 1FWJC 2CLHA 3T0CA 1MUMA 4WSKA 3S0CA 2ZXAA 3FK4A 3NO5A 1ZLPA 1TJ0A 4ZE5A 1XYCA 3UXLA 3GVWA 3N18A 3RN6A 1U33A 3LXBA 5D2WA 1UA3A 1Y5XA 1SGJA 4B4FA 1OIFA 4M1BA 4PFMA 4FLSA 2J24A 3EGJA 4S3DA 4ZGYA 1MDRA 5ECVA 2P0IA 1GHSA 1G6CA 3AXKA 2AQVA 4O53A 4MYXA 1QOQA 1W5PA 1FY6A 1EJXC 4LCQA 1Q8JA 1JYNA 1XSJA 1ZRQA 1VBHA 3G3MA 2GYIA 5I3FA 2ISVA 3VGBA 1CX9A 1LT8A 3KL3A 4MIMA 5EA9A 8XIAA 1GVSA 3EZ4A 5CSRA 2GUUA 3JUGA 1T8XA 3W83A 3L0KA 1R86A 2IXUA 3M46A 5D30A 1JNDA 5FL0A 3E2RA 3B0YA 2WZMA 1ONRA 4IXXA 3EX1A 1A5AA 3HG3A 1XCXA 1NF7A 3WLNA 5E6YA 1JF5A 3R89A 2J6VA 3D46A 3BCJA 2VFIA 2NT1A 2YYTA 1JYWA 4FP1A 2QDDA 3VNIA 2BODX 1FHDA 3FYOA 4DF2A 2PF0A 2XH2A 1FDZA 2OQHA 4B3ZA 2A2IA 4ZR8A 2XN1A 4AHOA 1Q4NX 1DIEA 1RBAA 4CVWA 2KX9A 5AB3A 2XVKA 1XIGA 1TE6A 3AROA 1LYXA 3P62A 3VNLA 1SW0A 1K70A 2AGTA 2R24A 3NURA 4N9EA 3LX9A 3BJSA 4IHCA 1E40A 2O4MA 4A21A 2E6AA 4LNCA 3FHQA 4AX7A 2VZVA 2A7PA 4JQ1A 2D0GA 1RVKA 4QEEA 3FEMA 4B90A 4MWAA 1B1YA 3OLDA 4E2OA 1XLKA 1R3QA 2L5HA 4K8EA 4WEVX 4CQ9A 5TD4A 3JZUA 4L4PA 5A8OA 3R79A 5M2FX 2A4AA 2V63A 2QJNA 5KEZA 4I5UA 2VTFA 1E4MM 1GJPA 1TWZA 4HYWA 1KV5A 1BPLB 1RH9A 2WMGA 1MRAA 1B30A 3SGGA 1CXHA 4F66A 4WHBA 3BTNA 2I5QA 1AZ2A 2ZWZA 5JXQA 3AI0A 4S3FA 4WY0F 4Q8NA 1WZAA 2OTDA 4JTHA 4AYGA 3VYLA 2OSXA 3T2QA 1UG6A 2V69A 3T78A 5KZ6A 3WQ4A 2ESCA 2UV8G 5I78A 2JQXA 2OT1A 3STCA 4Q32A 2QCMA 2WSKA 2AQWA 4IFKB 2ALDA 2O9OA 1JULA 1J0HA 3A3XA 4OUEA 3MI6A 4TVDA 4J9JA 1OWQA 2BTMA 1B3WA 4DYJA 1BQCA 1LZOA 2GQAA 5FKYA 3HGRA 3S5YA 3UA3A 4V28A 1XL9A 5D02A 1RV8A 4KEVA 4ZB2A 5CBJA 2G4JA 2EF9A 5KMYA 4DB7A 5FEZA 3PPFA 3WKZA 1XISA 1PTAA 3FDGA 4C6FA 3AO0A 2XTKA 2Q3RA 1JYXA 3QV7A 1XINA 3T7VA 4C6MA 1GKPA 3STEA 4IIBA 4AU0A 1HVQA 4IUOA 2H6RA 4R34A 3U4FA 1M65A 4JL1A 3BICA 1KFEA 1K4HA 2EBNA 2GZXA 3GFZA 1R3SA 2QUMA 3LGGA 1OCNA 1N7KA 3TDFA 3SCRA 3VOFA 4CLMA 2QF7A 3CV6A 6XIMA 1H7NA 2BVDA 3URAA 2Z29A 4N42A 2Y2WA 4J2PA 2ZQ0A 5I6SA 2A3HA 5F4SA 2WWCA 2XG9A 1VB9A 3AYRA 5CEWA 4JCMA 3WEZA 3VC5A 1JPIA 3AFBA 3AHXA 4DYKA 4JTJA 4PUEA 1JI2A 1UKPA 2QHAA 1B4EA 1V3IA 3NAVA 2YGYA 3NPXA 3ENLA 3CLMA 1MSSA 2PDHA 5CPNA 5EU9A 2C18A 4X61A 2FLIA 4C7DA 4DWSD 1DJZA 2VEFA 1WKFA 1HL8A 3ARRA 1N8WA 1JCYA 1BTMA 1Q65A 1G4EA 1LTDA 4OQVA 1E1CA 3DUGA 2MNRA 4H4IA 1TPVA 3G1YA 1ECEA 3AS1A 3GTXA 1MQRA 4KIEA 4PMXA 3DC8A 3M0YA 3EX2A 4AXKA 3C61A 2CBIA 4NL1A 4KFNA 3WL1A 4KERA 2VCCA 2YFOA 4LUIA 1BWKA 4AD1A 1J9YA 4GVGA 3OBKA 1NVMA 4GFIA 1UKSA 1BXNA 2VEKA 2NQHA 2DP3A 1ZBCA 2PLCA 3PP7A 1JF6A 3SIZA 2WCSA 3PG9A 1TA3B 3TSMA 2XN2A 5RUBA 3TNOA 1VFSA 5D8WA 3VKCA 3LPPA 4QLKA 1BSLA 2QCDA 2WSRA 5GNXA 3WNLA 3W27A 1J5TA 3MYOA 2YCLB 3LI1A 2F2KA 1WUFA 1XPYA 3CUIA 1H09A 3PSVA 1OG6A 5HOSA 2AL2A 4XBKA 1KM5A 3CH0A 3DAQA 2AKZA 1J93A 1B0IA 4HZ8A 3RHGA 1R6WA 4QP0A 2GLKA 1CGXA 2D2GA 3A5VA 2A21A 5E0KA 4LUTA 4YMZA 3M0LA 5HATA 3BLIA 1BG4A 1QBAA 2WNWA 1GKRA 1HJQA 4H9YA 1ZNNA 4C6QA 1TR9A 1V6XA 3E3HA 1F4AA 3NDZA 3U0HA 1V6YA 4IMGA 2WMHA 2ZA2A 1OVDA 4FXRA 3BLFA 4BI7A 2BGQA 5FF0A 1YHTA 3GYEA 2BVTA 3L5MA 1G4SA 2Y8UA 3WF1A 3HTWA 3RK8A 3T0BA 3WCZA 3B4YA 4PUJA 4MZ8A 5CJNA 3GQYA 4G6CA 4DWSC 4QSHA 3THUA 4IMFA 4RJEA 3GKAA 1PZ1A 3GHUA 4P7LA 3W28A 3P5ZA 1R9ZA 2G37A 2ACQA 7REQA 4RNJA 1GOOA 4HVXA 3ZIZA 4KCUA 3BLLA 1BYCA 3ZJ6A 3VKBA 2Q6ZA 1JQVA 1LP6A 4NJJA 5BOEA 4CU7A 2HE5A 2VO5A 2I1OA 3WLLA 4Q8UA 2QCEA 2BLEA 3RYSA 2HRWA 3GDLA 3KRZA 2Y7FA 2G97A 1ICPA 1SZEA 1EOMA 4JTUA 1E0UA 3CAQA 3RLGA 3OVGA 1A5OC 2H9AB 3MWAA 4LAMA 4FNRA 3AISA 1GOKA 1RALA 3KBWA 1FKWA 3TW9A 2IMRA 1VRDA 3N15A 2DZUA 4NX5A 3SAZA 2VCBA 2HPIA 3MCMA 3ZVHB 4NKCA 4HOWA 5CCZA 3AJ7A 5D2XA 4JHOA 5BW6A 1VEPA 4NXKA 4O15A 4Z1DA 4Z42C 3THAA 2E5BA 4YCPA 4W9TA 4WX2A 3MSYA 3WDHA 1MEIA 2YSWA 4QQUA 1XLGA 3O1NA 3QQWA 2FTYA 4PRRA 5JBDA 2F6UA 4D6FA 1XDJA 3L12A 2D24A 2V5DA 4B4HA 2OX4A 4JEJA 2GWGA 4TUFA 1FWHC 1JIBA 4O10A 1O66A 2AQOA 1Q6CA 2J27A 3E38A 2V0TA 3ZJ7A 1TB3A 2ZA3A 1VAHA 3KUMA 3IRDA 2V5JA 2Q8ZA 3M0HA 5D2TA 3MUIA 1RPXA 1X96A 3AS0A 4C5ZA 3PUDA 1W9PA 4YXGA 3BGAA 5T9CE 1O12A 4L61A 2XFRA 1PEZA 3TSDA 3L5LA 3RO6A 4D6JA 5K9CA 1WA3A 1XLFA 3NZ1A 4RNHA 2GUYA 3CMFA 4AEOA 4KCWA 1V7AA 4K3ZA 3RPMA 1LBMA 3HJZA 1SZFA 4PSPA 2DPEA 2F6KA 1DWFM 3ZXWA 3TCSA 4LRTA 1I75A 4JICA 2VELA 2FPVA 2O9TA 4ZB0A 1PTDA 4H2CA 3W07A 3MP5A 5FEXA 4E8CA 4H3DA 1P5BA 2BS9A 2OX1A 1I2RA 1WUEA 2DH3A 3CB8A 4IP4A 4ZXLA 2WSPA 2PMQA 4EAMA 1QRQA 1V02A 4QSFA 3V36A 1BHGA 2JGQA 5BZAA 4OE7A 2E6YA 2A0NA 1ME9A 4KETA 1FWWA 3G1RA 4P5UA 3QY8A 1I2QA 1G9HA 4AVOA 2VHLA 1A49A 3CHFA 5C2CA 2GVLA 3ZYZA 4ML9A 3MMDA 1R2SA 1AH3A 3ARVA 1HP4A 1FQ0A 1O5KA 1UZHA 1KO0A 3G1AA 3W82A 4NIRA 4GBDA 3PBUA 1J4EA 3WLQA 1IEQA 3HJEA 2J88A 2CLMA 2QF8A 4EXAA 4RL3A 3TW6A 1XCFA 1EX1A 1U22A 3NA8A 3LNMA 1ZHAA 1EWEA 1VC4A 2WK2A 1LWIA 4C1LA 3KBVA 3POCA 2ZIDA 1SO6A 4DXXA 2WVVA 2PRMA 5EL1A 2CC0A 1ZSXA 3K4DA 3LI0A 2RAGA 3WK0A 4KH2A 3MY9A 2PCQA 2A6NA 1JUBA 3CS2A 3NQMA 5DLCA 4I9JA 4RZ5A 2W92A 3UZYA 1B57A 2PP3A 1Q85A 2V82A 1HT6A 5DEZA 3IJDA 4MKSA 2ZUSA 4GUJA 1S3HA 5C9UA 3RIKA 3MV01 1CXFA 3AU6A 1KQZA 1KFKA 3LTSA 2DEPA 1O5XA 1IV8A 4K7VA 1SR9A 2A6LA 3WLRA 1CGYA 1HJWA 4XZHA 3T05A 3FJ4A 3D47A 5JBFA 3PZNA 4QFUA 1MW1A 3WQFA 3WH6A 4NX0A 2OGJA 4AXNA 3O07A 4L9ZA 4U5IA 1BKSA 4X2PA 3EB2A 3IJ7A 6A3HA 3NXLA 3GTIA 4QROA 3LTPA 2E6DA 1PKMA 3VKJA 1GZ1A 1MUCA 3TIMA 5CZ0A 4ZQNA 3ABOA 4FI4A 3WNNA 1I9CB 5D37A 1QNQA 3QYSA 4JNYA 1XD0A 3CHVA 5D9PA 4GISA 4UR9A 1AMKA 3S2LA 3NSNA 1UYQA 2PI6A 2PWVA 2YZRA 2GGEA 7TIMA 3L2MA 2FH8A 3N12A 1PWLA 1N82A 4O8AA 2VVNA 2WHJA 3MPGA 1C9DA 3QMSA 1JCLA 3RGTA 5FJJA 1FX6A 6REQB 4JY8A 4J4KA 3R0UA 4P8VA 1TJ2A 4GY7A 2A3BA 4UCGA 2WAGA 2BFGA 2PF8A 2C0AA 1D3CA 3ITCA 3W87A 4C90A 4H00A 4MKNA 2CW6A 2NVAA 2Z1KA 3E0VA 4H9XA 1KFWA 3G1SA 4V27A 1RJPA 3O16A 3WJYA 1XFBA 5LXXA 4R7WA 2IXVA 2ZZ4A 3KL0A 3IUIA 3KVJA 1TPDA 1W54A 5CH9A 3LGDA 4PB4A 4WCJA 4ZTXA 4Y9NA 1JNEA 2QLYA 1E9LA 3L4ZA 4UOZA 1KLYA 3LBOA 4DJDA 2I5GA 4AF0B 2HISA 4RUBA 2O4QA 1Q2SA 2ZZ1A 4HK6A 4X60A 2X2YA 3VM5A 3UR2A 1PHQA 1KGUA 1LL6A 1XLJA 1V08A 3N2MA 3VU2A 3GDRA 3CZGA 3CQ0A 1OK6A 2PTZA 5HMEA 4GUGA 4KGLA 3VDAA 3BQ5A 3REQB 1H61A 5A69A 3UWQA 1O68A 5CQ1A 3GU2A 3EOLA 4Q4MA 2Z1SA 4GZ7A 4LV4A 4PBEA 3FJ6A 4WSJA 2BHYA 4UFKA 1AA1B 1ZUAX 2XIQA 1HN1A 1LLZA 1IZCA 1P0DA 2YB4A 2GK1A 2WHMA 3GIYA 3K8LA 4XO6A 1NH6A 4MTVA 2DUZA 4EF9A 4EE9A 3ISIX 4BFAA 1OD0A 4JCLA 2FTPA 4BS0A 5DCBA 1A5MC 1DORA 1SFTA 2G3NA 3BSHA 1R9YA 2DVUA 2GSHA 2C3ZA 4DO4A 1EFZA 3CUJA 4AW7A 1R3YA 3QMRA 2X1IA 4IM4A 2DT3A 2WV8A 1KCKA 3ZWSA 5MKGB 4LTSA 4P7RA 2X1TA 4NJHA 1OZMA 1VYPX 5FJUA 3W38A 5CSSA 3SUVA 2HWGA 3NQAA 1PBGA 2GQ9A 3GE7A 3N2XA 4K7YA 4N7QA 3MZNA 4J3SA 4R9XA 3PF3A 2NV2A 3C8NA 4WDTA 4M29A 3TVAA 5AN7A 1QDSA 3RCYA 4MFEA 3V75A 4JTRA 3URNA 3TUUA 4M82A 3WDQA 2X7WA 1PDZA 3U3HA 1EP3A 4BI5A 4AHPA 1WDQA 2VXNA 4ML4A 1S2UA 5DRCA 3E12A 1UWRA 1IEVA 3L4XA 3KDNA 1QCWA 3DGRA 3C4UA 1OC5A 1UJQA 1S2WA 4DVOA 1BXCA 1UP2A 4RE4A 2Y1HA 3OGVA 2PPGA 4Y6GA 2QCLA 5HA7A 3ZWTA 4UB9A 4H7CA 2QCNA 3KP1A 5A6SA 1W1A1 2VR4A 4F40A 4QTGA 4JKKA 2E77A 4KKXA 2YOCA 4RE0A 1RSCA 3CPUA 2OQYA 4PUNA 4L7ZA 5M5DA 3B04A 2ZTJA 1KM6A 8RUCA 1TUXA 3M1ZA 2P0OA 4ICMA 3M44A 3NGJA 4UFLA 1A5KC 2VEGA 2A3CA 3D5HA 1KBBA 3TN6A 2V5KA 2XFWA 4B15A 1QPNA 3NDYA 4IJBA 2C7FA 2W79A 2VFFA 1ICQA 2X0YA 2E8ZA 3GNOA 3ARUA 1Z3NA 5A6BD 4PTXA 5ECUA 2V5CA 4EXBA 3PZOA 1QMLA 4PB3A 1K1DA 4PMYA 1Z42A 1O95A 4KWUA 3EWWA 3BOFA 3M0VA 1G4TA 4OWGA 1W5NA 3I3EA 4FSAA 1VHCA 2J8FA 3KS5A 1FWIC 3VKKA 3WUBA 4C6CA 3MJYA 3NM1A 4ZOEA 2E09A 1JZ5A 3OZYA 4M51A 1ONEA 3RPTA 1FH9A 4WJXA 1QI2A 2J75A 4M7SA 3GSMA 1Q8AA 4WQ6A 1TPEA 3PFMA 4LGXA 5I3JA 4MMWA 2OO0A 3FEQA 1VLWA 3SFWA 3GHSA 3CYVA 1Q7ZA 4WOQA 3NO3A 4QAIA 4N9BA 2I56A 4DN1A 3UXAA 4HNNA 2WNZA 4X0VA 1I0DA 3LV5A 3WJZA 1JZ2A 3WH8A 3F03K 1VBRA 5JU6A 3PB2A 1SVDA 3I6EA 3SADA 2V3EA 4E8GA 2I57A 3EEZA 3ZFHA 3PB0A 4I7VA 2PDMA 3L4WA 3G1DA 1GYMA 3LHVA 4DJED 1ODUA 3VCCA 1B2YA 5HAOA 1CXLA 2PWEA 3NQCA 1VFLA 3MJMA 2PUZA 3A21A 2NQ9A 3P8JA 5EMMA 5I02A 2Z6JA 5A6MA 2GUBA 4HJFA 3RFAA 3M5XA 3R8RA 3TXZA 4UFMA 3M9YA 2OODA 3BAJA 3MHGA 1Z89A 3B9DA 4LUSB 4Z2HA 4QAWA 1ISYA 4WGXA 3IJ6A 3W26A 2HJPA 1P7TA 4FF7A 3GY1A 5AZ1A 1RK6A 3QV6A 3O2LA 4ZE4A 4XZIA 2Y4SA 3BVJA 3STFA 1LOSA 5D9MA 2GGGA 3CL8A 2OYKA 3APYA 1REQB 3KVMA 1F8MA 4FLQA 3BK0A 3FKRA 3W7LA 3V35A 5A8MA 1UH4A 4XZMX 4DBUA 4DLFA 1MQQA 1RLCL 2QVNA 2YX0A 3R25A 4W8LA 5FAJA 3ZZ1A 1V03A 1VR6A 5HJLA 1ELSA 2ZZ5A 3L65A 2V9DA 2B7QA 3UZWA 2IW0A 4H01A 3FXYA 5FOOA 1N8FA 5LHEA 2Y63A 1UWAA 2YDAA 4YVPA 4PEEA 1A4LA 4KCVA 4IJRA 2ZVRA 3BW3A 2NXIA 3VD4A 3UR5A 1K9EA 5FJRA 3FW6A 4UTHA 5GPRA 2PDCA 2WVUA 3QTGA 4PCNA 1W1ZA 5CZTA 2ZADA 1LBLA 4S3JA 1GG1A 1JPHA 5CJMA 3GG8A 4X3ZA 3EPMA 4HNLA 4E2VA 3CL6A 2GVGA 1SYTA 3D3FA 1ZB5A 3BURA 5DCEA 1OGGA 3FN9A 5F2LA 1W5MA 3OG3A 4AG0A 3V5OA 1H51A 4DZAA 1TQJA 4FNUA 4AMAA 1H4PA 2GGJA 4NG3A 4RR4A 1AQHA 2GGHA 3WLPA 3WEMA 4XZWA 3VXGA 4C6IA 1FXQA 5A6AA 5D4YA 4E2BA 2EHHA 1RR2A 3G1XA 3S1XA 2B7PA 1TWIA 5F2MA 3FCPA 4P61A 2EG6A 2NX3A 4L1XA 1CLKA 2WWDA 1H7WA 1M04A 3CQIA 5LNRA 1OC7A 3PUEA 3FJNA 4V2XA 3OIHA 4GX9A 1EDTA 1EF3A 1OEPA 5HMFA 2FZ8A 1ISWA 2C6QA 3QSTA 3RILA 1KRCC 2J79A 4GJJA 5CC7A 1XBZA 3BOLA 3UNTA 4JX4A 1PDYA 1OBAA 4BCEA 1LUCA 2XWDA 3KWSA 3SDOA 1OX6A 4B5WA 1WDSA 2RJGA 1IGWA 4AVFA 4OJYA 5LXEA 3AYTA 3M0MA 3I10A 3U8GA 1EIBA 3N14A 2QCCA 1Y7VA 4XKMA 1BF2A 3ELFA 2Z2BA 4Y9MA 3MTWA 3RF9A 3R12A 5AC8A 3QN3A 1ZU8A 1PIIA 5FAGA 1EXPA 1V3LA 3F4NA 4FS9A 3UP8A 3MVIA 3S1UA 3PPHA 2OFJA 4MWAE 4X22A 4Q4RA 1KFCA 1IXQA 3NL2A 4JFUA 1ZBVA 2VX5A 1G67A 4QLLA 1MVYA 3OW1A 5CAHA 5AC6A 5E9AA 3DFQA 1L0PA 1DWIM 1GOWA 2YCEA 1DXEA 3BARA 2C19A 1F3XA 4L65A 5HNRA 4PMVA 1RAKA 3W6MA 2OU4A 4RCXA 3CMJA 1G7UA 3LV6A 3TTYA 3VE7A 1R8LA 5F1VA 1EDGA 1KRAC 4MWAB 5CC6A 5KETA 1UW9A 1NFBA 3KM8A 2DSWA 4LU0A 3T44A 2XUCA 3LLFA 2BHZA 2P76A 5SWUA 1CT5A 2A1YA 3L4YA 4TMBA 1TPC1 1J0IA 5HR6A 1OFAA 4OHQA 3H2MA 1O7AA 3AYSA 3SECA 1RBOB 3WUFA 4GH3A 3QV9A 3QOMA 3W1UA 3MWCA 3TKFA 1B3XA 4UQAA 4INFA 4NAEB 2DSKA 3EXSA 1J5SA 4DUOA 1XIHA 2FHFA 4CNUA 3BANA 3AHTA 2X2GA 4HJWA 1R9XA 3ARQA 4BI6A 2R8WA 4CN6A 4ZSTA 4UZSA 4FNQA 3MP4A 4HTYA 1CB7B 2PGEA 4LYQA 1ENUA 1SO4A 4NY2A 5CC3A 1RQHA 2ZDRA 1MMFA 1RVGA 2VL4A 3QJAA 3TV8A 5BRQA 2YL5A 1SZGA 3KTXA 2E7FA 3PZGA 4HZ7A 4IXHA 3GX9A 2R1LA 4O12A 5FACA 2GVJA 1DIKA 3G8EA 5IBXA 4F2BA 4UOJA 1JZ4A 4IPPA 4AIEA 4JYFA 4UTIA 5GJMA 2C1GA 4ZTYA 3A4AA 2XSBA 3GLCA 2A7RA 4RZ4A 3ABXA 2ZZ6A 3T6CA 2A3LA 1BTCA 4RV8A 5I3KA 2HBXA 2FDSA 5D09A 2VUYA 2CZ5A 1J0JA 1NFGA 1KKOA 4D8AA 5KITA 2QDGA 4PH6A 2G50A 4O18A 4PODA 4C65A 2DW7A 3SBFA 3IVSA 3W3OA 2ASHA 1UR3M 4XK2A 4EF8A 1GYNA 1QNRA 4BF9A 4H41A 1W9UA 1MUWA 1Q5MA 1RD6A 2WMIA 1A5UA 2Z24A 3GVGA 3UJFA 3OU8A 1UPMB 2ACRA 2WNNA 4XG1A 3M5VA 4QLJA 4DO7A 2VOTA 3LG3A 1W17A 1JAEA 2GJRA 2OZTA 2A85A 1HP5A 3GAKA 1TO3A 1E3XA 2VWSA 2PURA 3KOFA 2UWFA 3LSBA 3A47A 2QUVA 4AD0A 4B9ZA 3H2EA 2OLHA 1W8GA 1C7TA 4U3CA 4NJGA 1QOXA 1TPFA 3W1XA 4GKLA 1UD6A 3EDFA 3GG7A 3TROA 1DIDA 2H3DA 2X09A 2DSZA 2B4GA 1Z32X 1CWYA 3S47A 3SGZA 2JIEA 3NOYA 5A95A 1GORA 5M17A 4B5VA 1FCUA 4PL2A 2NW0A 1SUXA 1GVYA 3JU2A 1VJSA 2J78A 3OO2A 1SJDA 4JN8A 3H8AA 2VX4A 1W56A 1OFDA 1A5SA 4BEUA 3GBEA 4CCDA 3BLEA 1V79A 1EJTC 1V3MA 4RK8A 5T26A 3P61A 3HQOA 1R7AA 1XIIA 4QG8A 1NF0A 3SO7A 4LC6A 3S1VA 5LHFA 1JAKA 2Z7KA 3IAQA 4ZQOA 2ZZ2A 3NQ7A 5D2VA 2NVCA 3G18A 3S6TA 4KBXA 2CBJA 3NL3A 3OJGA 2QS8A 4LVGA 4BF5A 1WAWA 3A4JA 4IG2A 1LL4A 4Z2JA 4ORIA 2FMOA 4P2VA 4IQJA 1W5OA 5ABTA 4YCOA 5JVLA 2ZRZA 3W6YA 1TPH1 1AH4A 5CGQA 3KVLA 1JD9A 1X6UA 4AQLA 5C2XA 3QR1A 4GGBA 3W84A 4FXSA 3U4AA 1H50A 4JPGA 3R43A 1CYGA 1CIUA 5CSYA 4Z2GA 1OCQA 4KEZA 3CHCA 2OGYA 2PTXA 2VENA 1CEOA 1MZRA 3CUHA 1S5WA 4JFSA 1F74A 1KNWA 4UTMA 2HVMA 1ONWA 1PHWA 1W1VA 1KRMA 1A5BA 2WVSA 1EGVA 3W75A 4LQ1A 3TA9A 3N4FA 4R3UA 3W7CA 5ABFB 3SCTA 3IJQA 5ABEA 1Q63A 4IWWA 5E1QA 4AFYA 1GQLA 1MQPA 2X1UA 4PFHA 3ZR5A 1LWHA 1NP0A 3WJSA 3DFPA 4JQAA 3G8RA 4XIMA 4A3QA 3O06A 1U2YA 1KTNA 3M6YA 1TTIA 3GRIA 3R94A 2PB1A 1B54A 3PS7A 3S2MA 3SCSA 3HV8A 2VT0A 1WOAA 1NY1A 3FY1A 3KXQA 1NOWA 1OM0A 4IIEA 2PAJA 3NWRA 1GPWA 1K02A 3ZLGA 1M03A 3UPMA 1MXSA 3ITYA 4REQA 2Z2AA 3L2LA 4XSLA 2CITA 3VOJA 1F3EA 2GJXA 3MZ2A 4OIFA 1HKVA 2CCRA 4Q4OA 1ODZA 4Z1BA 3VD5A 3TP4A 2FZDA 1ZJHA 3H4GA 1JFXA 4BKNA 1UR1A 1W0MA 5G2WA 1UKOA 4HCHA 4O13A 4JIQA 1PUDA 2PEVA 5CZJA 3N11A 5KSWA 1KCLA 4WD0A 4MJ4A 4XBSA 4JFVA 5G2IA 3GC2A 4J28A 1S1PA 2A3AA 4XKYA 5A2BA 1V77A 2DIKA 4L6DA 2ZXDA 4JX5A 1L6WA 3UBPC 1YTEA 1V0MA 2FGBA 3KRBA 1FHLA 3MV11 2C71A 2V67A 2VVSA 1E0XA 4M24A 1LT7A 2XFYA 1XG4A 1OX4B 2Z28A 4ZFMA 2YDRA 3ITLA 4LBUA 3UGRA 1SZNA 3WO8A 1CW2A 1M01A 2UY2A 4YPJA 2PZNA 3N19B 4OBRA 5A3HA 1GEQA 1FA2A 2PDBA 4JYEA 3NTYA 2Y85A 3CQHA 4K8HA 3FVMA 1TPB1 3L2IA 3OVQA 1TV7A 4JQ4A 1DWJM 3DKLA 3W37A 1UJPA 2OEJA 2Z0IA 4JEQA 3NL6A 2EO7A 4GVFA 4PYSA 3W72A 3BXWA 3HPSA 3BO9A 5G2HA 3DC0A 3W70A 4PTWA 2YA1A 3PWAA 3VZZA 1EGMA 3IUDA 4FR1A 3DFOA 2PWDA 1XPGA 2W9MA 2OJPA 1CXEA 9CGTA 1XXXA 3QPEA 1OYAA 4HYVA 3G22A 4NQ1A 1V02E 1A3XA 1RA5A 5J8LA 1XH2A 4ZFCA 2OLAA 3U7BA 4KFPA 2YLAA 1D8WA 3LDVA 1F4HA 1E1EA 2PCEA 3OZOA 2NXHA 4X9YA 1O60A 1XGEA 3TW7A 3GXPA 4PRWA 2CBUA 2E5DA 2X30A 3KW3A 4W89A 1JYVA 4HYRA 1J12A 3GU9A 3ITVA 4B92A 2PDQA 1F73A 3GTFA 4QDPA 2Y8VA 4OFCA 4OZOA 3PZIA 3BLOA 4MADA 4GZIA 3PSWA 4FLOA 1E43A 3VIPA 4EPEC 1L8PA 3N6JA 1EWDA 2OPJA 2OMAA 4S3BA 3EKGA 1R5YA 1LQ0A 3IK4A 1ALDA 3A9IA 3F5JA 3GKFA 3QR0A 4DJDD 3CT2A 5HWJA 1J79A 3WY1A 1TVLA 4R85A 4QHRA 1DJYA 3TYDA 4H2HA 1O94A 1DHPA 3P93A 2QV4A 5I3GA 4YTQA 4Z2LA 2PDJA 2BNJA 5M3WA 3NIYA 4S3GA 1VYSX 4U5KA 3K8MA 3I6RA 1CTNA 3HO8A 2GPTA 4Y7EA 1AG1O 4DELA 3WSUA 4ICNA 5DANA 2W61A 3CHEA 3PBMA 1VFHA 1AH0A 3CK5A 1DQUA 5T9BG 3F2BA 1EH9A 4L4LA 2PTDA 4JQ2A 2MANA 4HMEA 3QZAA 5LNSA 4LVAA 3LLXA 4RW3A 2I5IA 3M0IA 1LJYA 3CBWA 2ALRA 1G5AA 2XZ9A 1J10A 1AQFA 2AAAA 2VCAA 4FX7A 4BJHA 4IF2A 2QUUA 3H54A 2Z1WA 4PR4A 4GE8A 4AIOA 4J5NA 3U7VA 3DN5A 2JE8A 2QPUA 2E28A 1EP1A 5CJ5A 3IARA 5DQPA 3WENA 4EX4A 4RXGA 5JIPA 1E6RA 4UTLA 3SI9A 4IPLA 4BQ4A 3PBGA 4AD5A 1NDYA 5A6KA 4GACA 2PDNA 4I90A 1U5JA 2UY4A 3GDMA 5AYZA 1GQNA 1EC9A 4NU7A 1HKWA 1TTPA 2QYGA 2GFTA 1DTUA 2P3EA 4PEKA 1YMYA 3TC7A 1EX5A 1W2VA 2WYSA 2ZUNA 2XVLA 3ES8A 1BWLA 4NNAA 4YHEA 2J9ZA 3M07A 3VZYA 2XYLA 3W02A 3VINA 1GT8A 4HMNA 5FEPA 3CZEA 5AYIA 3LS9A 4CD5A 1PYFA 4N6FA 1H62A 3KE0A 3W24A 3N6QA 2BVYA 1JPKA 4LANA 5HINA 3NQVA 3GW3A 1Q7QA 3S2JA 3I4KA 5LIYX 4HP5A 1T96A 1R38A 1BAGA 1X97A 1DE5A 2WANA 4DJDC 3L4VA 3H2CA 2HROA 4IMDA 4QIUA 5BOFA 3S5SA 2ZX7A 4Q8OA 3AWOA 1O5RA 1FWDC 2BOEX 4A2RA 2JF6A 4RZBA 1QK0A 3SRKA 1XDMA 2QCFA 2XH0A 3HGSA 2J7EA 3MANA 1EYWA 3WELA 3AIEA 5AHNA 2NUWA 3TN5A 3WJXA 2LLEA 1Z48A 2RHGA 4GBUA 4NI3A 3I7RA 3UZZA 3K46A 3NEHA 1V3JA 2ZC8A 4LFYA 3P81A 3H6OA 3SZ8A 2O56A 1GQIA 1OCBA 2ZXBA 3K4AA 1QOPA 3A9BA 1A53A 1OD8A 2C14A 2IQ0A 1W3KA 2V68A 1DVJA 2I9UA 1AJ2A 1YDOA 3DCPA 4B5NA 5IDZA 1H1ZA 3HMJG 3N2BA 2W27A 3W00A 4OBSA 4FEZA 1J0YA 1VQTA 2VC6A 4AD2A 2J9XA 5CC5A 3DFSA 3P0WA 1W1TA 3AS3A 1LWJA 3QQ0A 4LAKA 3T2OA 4D6CA 3FGCA 3VK5A 1GOIA 3FOKA 4I6VA 2ACSA 3IIPA 3NDOA 4KIRA 3W7RA 3WFLA 4BK9A 5BRBA 4YTSA 3RLHA 3LCFA 4QITA 3TWBA 3WD3A 2P5NA 3W7EA 5EY5A 1KTBA 1AJZA 3DX5A 3WFZA 4US5D 1H0IA 3MHFA 4FOUA 4O17A 1KBKA 2X7VA 3RX4A 3RRAA 2HSAA 9XIMA 3BE7A 1VCVA 1IE7C 3FSUA 4EOUA 2ANUA 5GQBA 2VFHA 4NNBA 1JFHA 3TFCA 1J0KA 2NUYA 3RM8A 3DI1A 3KCJA 1W1B1 1WPCA 4TU1A 2NXGA 3A24A 3RRXA 4NYUA 3KBMA 3B8UA 3PUGA 5A8NA 4HB7A 1HKKA 1QW9A 1KWKA 4A3RA 4G56A 4GNVA 3ZQ9A 3FAXA 5EFDA 1ZY9A 4U33A 1TWDA 2FPYA 4FNPA 2GSJA 3TOPA 4PC8A 4HHHA 4U4MA 4JHZA 3TC6A 3WNOA 2NT0A 1RJRA 4MUZA 1WDDA 1IWBA 1VF8A 2DZXA 1XLBA 3WD1A 4GYJA 4RX0A 4KRUA 1OQFA 1MO0A 4QJ4B 3BOXA 3B06A 2BXYA 2WMFA 3OGSA 1Y0EA 3PPCA 4LW7A 1KXHA 1WB0A 3N4EA 3G24A 1UROA 3DGBA 4GO9A 2H8ZA 4LS0A 2VM8A 4W8AA 2DGAA 4GKTA 5AHMA 3HV9A 3OHIA 1BRLB 4GCAA 2A3EA 4HBKA 1IYXA 3B9EA 1QNSA 1UHVA 2BSLA 1XDLA 1OGSA 4FB7A 2BDQA 1B3ZA 1RUSA 4O11A 3OBAA 1QHPA 5E9XA 1OABA 2Y89A 2ZX8A 4LV9A 3WD2A 4MAVA 1YPFA 3CV2A 2XSXA 1EA0A 3DG7A 4BQ5A 2Q3OA 4G2DA 1WYIA 4FXFA 1CGUA 3C0JA 1KV8A 4H7VA 4OUIA 4TV5A 3TONA 2RH9A 2V5BA 4E4PA 4QEHA 5TIMA 4MNMA 1XUUA 1I1XA 1EJSC 3HURA 2OO6A 4OT7A 3CU2A 1JGMA 3O0KA 2DW6A 5U7SA 3P14A 2C0HA 4DWDA 1F6KA 1YBQB 4FIQA 3BV4A 4IGHA 3VNDA 4MKVA 3W7HA 1J0ZA 2DT0A 4L80A 1JGIA 3VMPA 2ZRUA 3BJFA 2PGRA 5LNUA 4GUFA 4UNKA 2CEQA 4IIHA 1KM4A 1TZ7A 1XGZA 3B0PA 1S2TA 2E9LA 3RU8X 1LOLA 1UR4A 1DL3A 1LRNA 3IK2A 3S83A 4JOMA 4JFTA 3B0VC 1GNXA 3HA1A 5C55A 1K8YA 3C3UA 3BUVA 1UA7A 4TMCA 4XVEA 1R3RA 4UWMA 3TEVA 2FTWA 3UY8A 5G1TA 3WNPA 4AZ5A 1LORA 5B7ZA 3MW7A 1J18A 4S2CA 5PTDA 2X16A 3MT1A 3TYCA 3EWUA 4F2UA 2Z00A 4G7EB 5ABGA 3KCOA 3OG2A 3GTNA 3LRLA 2OWWA 2EPLX 3WMCA 3RPDA 1P6BA 5HPCA 4MJZA 3PAJA 1FTXA 4GGHA 4J7RA 1HXJA 1SJBA 3M64A 5GJNA 3SN1A 4A29A 5E70A 5BNKA 3T0AA 4H6KA 4ADSA 3MO4A 5AYXA 3KOZA 3A22A 5LA0A 1EUAA 4P8UA 1RP9A 3FSTA 4LYPA 4A22A 4XB3A 4CNNA 1YNYA 1UCWA 3HGJA 4XUGA 1IGSA 4DIAA 4CEUC 1WKEA 1IIHA 4C60A 1XQLA 5DXXA 2DT2A 3ZJKA 2CFFA 1X7FA 1CGTA 2VX7A 4AISA 2Q09A 1IZKA 1OSEA 3WBEA 1HGYA 2WKGA 4ZOCA 2PA6A 5C0QA 1W31A 4Q4KA 1W3HA 4TX6A 2WZEA 3AHYA 4AZCA 4LYKA 3CJPA 4JIPA 3K2GA 1E6SM 3C86A 3QY6A 3UXDA 3VO0A 1D7FA 3DBPA 4GYPA 3F1QA 1ZPTA 2RDWA 3E74A 5AHFA 3H70A 2GGIA 3IRSA 1CDGA 3RITA 1WZLA 2ZWYA 4MB4A 3H12A 4EVZA 1JCTA 3GG1A 4NVTA 4GH1A 4FR6A 1W2PA 1GYLA 3V0UA 2ZX5A 4AY7A 5EGRA 4NAFB 5C9XA 3P67A 4HNTA 1WDWA 2QR6A 3O6DA 1E6XM 2CIPA 4M6VA 1BF6A 3QXBA 2HEJA 3PN8A 1TX0A 1W91A 3NZQA 3WH9A 1H3GA 2XM2A 2PBGA 3AXMA 1EJWC 3BMXA 1QPRA 2DUAA 3CV1A 4L4OA 2X05A 2C79A 4U2ZA 3GYCA 5HJYA 1XRFA 1THFD 4C6BA 3EOOA 3SCNA 1JUEA 1VFMA 4LBRA 3A4XA 4X63A 3AMKA 1ZBKA 2DFAA 3SGUA 3V1PA 4LVFA 3RCNA 3B05A 1GJUA 4UC5A 1JR1A 5CPOA 4CUCA 1S2CA 1SFLA 1NWUA 5JUVA 1DQWA 4MLRA 4J1OA 1TMLA 4Y2WA 1F3TA 2PDPA 3QOKA 4B5UA 3BSGA 2DY3A 1UR9A 4H04A 4F0KA 4LOCA 3P80A 1H5VA 1MZHA 1KGXA 1NELA 2QIWA 4UIOA 1C29A 5I00A 4MZYA 1GKQA 2NQLA 1S38A 4O19A 1NDWA 2P88A 5T8GA 3QMTA 3KX6A 1TTJA 2NV9A 2FHBA 3PBWA 4J27A 1VBUA 4H6RA 1EZWA 1MEHA 2ISFA 4YS1A 1GTEA 1C91A 3EXRA 1EQCA 1LG2A 3V0SA 4U2YA 3BAYA 4UTKA 2G3IA 2R14A 1JL8A 3FLUA 3TK7A 3QEZA 3CAVA 4ENLA 3NSXA 5TQLA 2O9RA 2OCZA 5D05A 3SCVA 3FFSA 3OOQA 4PSRA 1XLHA 3LA4A 4HHMA 5A6BA 1OB0A 1JZ6A 3IV8A 3B97A 1Q6FA 3WF2A 3B0UX 4N0RA 3BCFA 3BJTA 3G0UA 2WCGA 2EXOA 3WLIA 5IBXC 3CZ8A 4YTTA 1FBAA 1Q66A 2WSQA 3W74A 5DRIA 1A0CA 3ABZA 2NQ5A 3AXHA 1BYBA 4MDOA 3NXFA 4FXJA 2FPTA 5GNYA 2DIEA 3I65A 3RLVA 5CPTA 3W2JA 4IPNB 3DBNA 1EXBA 2ON3A 4PA8A 2JFEX 5D38A 3W1PA 5DT5A 2PGWA 1E71M 5I03A 1K7FA 2RKXA 3S6OA 4A8IA 5DXYA 2WMJA 1YKWA 2X8RA 4WDWA 3ONBA 1I60A 4DNHA 4DX3A 3GO2A 3INPA 3L9CA 2ZE0A 1E0TA 2AOSA 2H3BA 3HG5A 2QPXA 4G1NA 5DX7A 2QCHA 2XIMA 3E2SA 5BMXA 4DJEA 3MSGA 4C7GA 1GONA 5C70A 4TIMA 4XZNX 3CIWA 3VNMA 2Z1BA 3QRHA 3N3MA 1W8SA 2BY0A 1PYMA 7ENLA 4TX8A 4JTTA 1NDVA 8TIMA 3AZTA 1UMYA 1N8IA 4EP8C 1UR2A 2Q02A 3W7DA 4H6EA 4I3GA 3PFRA 4L64A 5I5RA 1KM1A 3SN4A 1E0VA 1HFBA 2WO5A 1H49A 1DHKA 1LQ2A 3VNJA 5HQMA 3QKZA 3E2QA 1JDCA 1WDRA 3VX1A 4L9YA 1PX3A 5CPSA 4JBRA 4XZBA 1NOUA 4E8DA 3W88A 4Q22A 2DZPA 4GJIA 1CPUA 3GXDA 5KZDA 3HFYA 4J3TA 2EJ1A 3H22A 3ARSA 5LSMA 1YDNA 3H24A 4LT9A 5LIXX 4QNWA 5LIUX 3WQOA 4H7ZA 4JYDA 3GR8A 1ITCA 5I7GA 2POTA 4XAYA 4UTJA 3RR4A 2XWEA 4FF5A 2Y70A 4Y8FA 2PLMA 3HZ3A 3TNBA 1XIMA 4GO8A 3W1TA 4PZVA 1FVPA 2V2DA 4NI8A 5A2CA 2WQDA 3OYXA 2W66A 3R5EA 3NR0A 3WJWA 4R33A 4A8NA 4LUYA 1TA3A 3D0CA 3F4VA 1KQYA 3PC0A 2YBVA 4Z1YA 4CCEA 2PGFA 1WKDA 4POCA 3T4WA 2FFCA 2DJXA 2YCLA 3JZEA 2C13A 5C6MA 4JKMA 5LGXA 3LHZA 4GJ1A 3E5PA 1TMHA 1V3HA 3LN3A 4A3YA 6TIMA 1H5YA 5FJIA 2ZUWA 1RCOB 4GI4A 1AK5A 3T8QA 2Z4GA 2VDIA 1UWQA 1C9WA 2QJJA 1F5ZA 5BWAA 4JDBA 2XHYA 3B9OA 2R9RA 1H7XA 4DBEA 5CGMA 2QJMA 3L7RA 4MDPA 5I77A 5EBAA 3EPOA 4QNEA 2G96A 4KWWA 1TWSA 1I0BA 3GVQA 5FEWA 3GH5A 5HMDA 3GM8A 3WNKA 3QM3A 2GSEA 1V6VA 3WQ8A 1FOBA 3B8SA 3NM3A 1F8IA 4W84A 3BAWA 3M5YA 3HOJA 3R4IA 5DCDA 2J8TA 4GOAA 3WBWA 1AW5A 3QPYA 3GXIA 3VKAA 4KEUA 3SQSA 3W85A 2XM1A 3UA4A 3URBA 1OX5A 2ADAA 4H9ZA 4KWVA 1IQ8A 3U48A 1ZZMA 4C1NB 2VURA 3AOFA 3CMGA 1UUQA 4AEFA 3AIBA 3GS6A 1HKMA 4HCDA 4Y96A 1TRIA 3WLMA 2CLEA 4Z0SA 3SCWA 3BLPX 1GPFA 2J47A 4ZXOA 3IWPA 4HK7A 2YL8A 3SFKA 1JPMA 1PWMA 3QY7A 1C8VA 4H9MA 1OGBA 3WLJA 3AU2A 3CC1A 3SUTA 1H1NA 1KLZA 2H9AA 3W22A 2VEMA 4BQ3A 5LA1A 3P3BA 3O8AA 5TAOA 2E68A 4A6GA 2BOGX 3N6HA 4O50A 3F2CA 5H91A 1D3GA 5A8GA 3ZVHA 3TC3A 4JD4A 3U2EA 3VIIA 1TR1A 4B9YA 3PBYA 1NP2A 3AMLA 3DHFA 4I9AA 3DEQA 4Q8MA 1K9TA 4AD4A 1X8FA 1P6CA 1SPQA 3A64A 3WUEA 4D6EA 3BQ6A 1HF6A 2ISSA 3TJIA 1H2JA 1PV8A 1QWKA 1Q13A 3B8VA 1A80A 1VZWA 1GG0A 3E0WA 5D9NA 4ZO9A 1DJQA 1IT8A 2HBVA 2QUTA 2V3DA 3ARXA 4AD3A 2E1DA 2FHCA 4UFIA 4DJFD 3ICJA 4F0HA 3I4EA 4JTEA 1XI3A 3F5KA 3PK7A 3TWAA 4V33A 1HUVA 3GIQA 2WW5A 4UQEA 1LM1A 2E9MA 4ZEPA 1BYDA 4V15A 4AIUA 1WXYA 1H41A 4XD6A 2VI0A 5FF3A 2EG8A 3K30A 3NVDA 3O9NA 3SQLA 3XINA 3SRDA 4UTTA 2INEA 1U1UA 4F2TA 4M6PA 4HGXA 3M0JA 5EYWA 2R1KA 4KCTA 1L9WA 4N4QA 1LLWA 4N4PA 3VMNA 4UNIA 1P48A 3WFAA 3N2TA 1H11A 1F3WA 4JTQA 2TPSA 4H83A 4IP7A 4LH8A 4NILA 1LCOA 3L0NA 2TMDA 3TYAA 1K4GA 3R8HA 1F61A 3QGAC 3UZJA 2Q8XA 3ANYA 2P10A 4Z2KA 3HPZA 2WZIA 4HSHA 3V7PA 4GCXA 2GQ3A 1YW1A 4OTKA 4GQRA 2W63A 4HZ6A 1LOQA 3MI2A 1QFEA 2CXGA 1BVZA 3M41A 3CV7A 2PZ0A 2B0MA 1M3UA 1EOKA 2XSAA 4MY9A 3TMLA 4EAYA 3S1WA 3UPBA 5DY2A 1IIGA 4DBDA 4GQ0A 1P6WA 2O7QA 3UYIA 1E4IA 4PRTA 4XIAA 1SSDA 2E25A 4XAZA 5JQ9A 1W3NA 1JQXA 4FNTA 2F38A 1ISVA 1PE1A 3CM4A 3FDKA 3MKCA 4HKPA 4QDWA 2CKSA 3ZS4A 1J01A 2OT0A 3SJNA 3VDHA 4GD0A 2TYSA 2HK1A 2OELA 2VKZG 2NSXA 1W32A 4HOXA 3LMYA 3SCQA 3PWIA 4LC8A 4W85A 4Q8QA 2FDMA 1UD4A 1XX1A 3MUCA 1QJWA 2ZRWA 1LG1A 3IJ8A 3WK2A 1LRTA 4QE1A 3KVKA 1VCGA 1XUZA 3