5AB3A

S.enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
247
structure length
241
Chain Sequence
b'MIIPALNLIGGTVVRVVRLHQGDYARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGVSLEQLVETYLPVGLKHVLCTDISRDGTLAGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar cubana str. 76814
molecule tags Isomerase
total genus 78
structure length 241
sequence length 247
chains with identical sequence B, C
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ab3A00
4EWND 2DZSA 3TR2A 4RX0A 4JTFA 3HGRA 3PF3A 5EA9A 1C8VA 1KTBA 2CLLA 3V1PA 3QMTA 4MY9A 1TQJA 3W70A 3LTSA 1G67A 1GEQA 5LNRA 3DXIA 3BW4A 5CSSA 3LM7A 3W3OA 3LLFA 2O7QA 5IBXA 3DBPA 2CZFA 4M19A 1QDSA 1DHPA 2B4GA 1ICPA 1JQVA 3W1AA 1IIGA 3W7JA 1TMHA 1UUOA 2BLEA 3EX2A 3G1YA 2ZZ7A 3LRKA 1KLYA 4JTUA 2P1FA 2E6AA 1QOPA 4IPIA 3L21A 5D38A 3CU2A 5C6MA 4YXGA 4Q33A 4DBEA 3PUOA 3W7DA 1D3HA 3ANYA 2FDSA 3DAQA 3O16A 1E51A 4Z0JA 2WSRA 2Y7EA 2NLIA 1UCWA 4O10A 1DJQA 3P81A 3HOJA 3LTPA 1W8SA 1PE1A 2GVGA 5HJLA 5TBOA 2YW4A 2EF9A 2WNQA 1JVNA 4UMBA 4RXFA 4MFEA 2H6RA 1LP6A 5FEZA 5C55A 2R14A 3LCFA 3NAVA 2Q3RA 3R89A 1H63A 1WX0A 3O07A 5G2HA 3SIZA 3PULA 5G2WA 4GJ1A 4BK9A 2NUYA 1MSSA 3G24A 3QZEA 3L67A 1EWDA 2Z6JA 1F05A 1WA3A 3QSRA 4LY8A 1VQTA 3E0IA 1RQHA 4XUGA 3QM3A 5DN1A 3TFXA 3R13A 1IIHA 4ICNA 2UV8G 4ZQMA 3LCWA 3R5EA 1SUXA 4N02A 3FYPA 4R34A 3NQ2A 1YADA 3S6DA 3W1QA 1XUUA 4PTNA 2ZZ6A 3ATYA 3OVPA 4N9DA 4AH7A 1TYGA 3WK1A 4A2SA 3W1TA 2J24A 2DZWA 3VNDA 4DO5A 2Z2UA 3PBYA 4JX6A 3CWNA 5D2TA 2GQ8A 3EX1A 4QM1A 1QWGA 4LRSA 3HMJG 3OIXA 3A5VA 4LU0A 4DO6A 5HINA 4ZMGA 1TPDA 4DF2A 1QPRA 4JY9A 2ZDRA 4ONVA 4HSNA 1VHNA 2V0TA 4DPQA 3LXCA 8TIMA 1TPB1 4EIVA 2B7NA 3BLFA 4GUGA 3G0UA 3B0UX 3GVGA 1WQ5A 1Z48A 4QQ3A 3LLDA 3VKJA 3OHIA 1BEUA 1QNVA 4YMZA 4LNYA 4WJEA 1ZAIA 5HUPA 4NJIA 3EXTA 4BI6A 2NXHA 4IJBA 4POCA 4JXCA 1R30A 3TSBA 3U2OA 1WBJA 2GUUA 2QCFA 2FPVA 4IMGA 2V2HA 3HF3A 2DJXA 2Q8ZA 4O4WA 5D2XA 1XBYA 3HO8A 4AHPA 1O95A 7TIMA 2VEPA 1QCWA 4QISA 4CCCA 3ABSA 1VCGA 3BG9A 4AXKA 3NL2A 3HG5A 3QEZA 2I9EA 1TTJA 5EBUA 1YXYA 1KFKA 1SPQA 1KM4A 3HG4A 1KM5A 4KFNA 3B4UA 5E93A 1DBTA 5J5RA 4NJJA 4K8HA 3W9ZA 4XKYA 2PC4A 1ICSA 1YTDA 4BWLA 4MY1A 2HTMA 4FXSA 3PG8A 4XZ9A 1DOSA 4M6QA 3LCLA 4FNSA 3WJXA 1KM3A 3E49A 3M9YA 3NG3A 3NZRA 5DY2A 4I7UA 3SGZA 3OG3A 2C13A 3S8HA 3THAA 1GG0A 4CQ9A 3SFKA 4JD4A 1JR1A 4QNEA 3ABRA 2A7RA 1GT8A 2F7FA 1V5XA 4Y6GA 5HR6A 3A23A 4IX0A 4QJ1A 3W2NA 5I3IA 2QEZA 3IIPA 2V5LA 3LBMA 3NXFA 3UPBA 1GVQA 3NQCA 3B05A 2EKCA 2J88A 5K9CA 1AMKA 3KVJA 1H62A 1W5NA 1HFBA 2PRMA 5I3GA 1JUKA 4IQLA 4TO8A 4LW7A 2JBMA 3MO7A 2BXVA 3TSDA 4QAIA 3UZJA 2LLEA 3PVFA 1VRDA 2NV2A 1OFAA 2OT1A 4WQ6A 4M6PA 1XUZA 4FNTA 5K2ZA 1IF2A 3TIMA 1FCVA 1R47A 4LS2A 2X30A 3NQFA 4OV9A 1LOLA 1S3HA 4UFJA 4QITA 2J9XA 2J9ZA 2Y63A 3PS7A 4XKYB 2ZCGA 1O60A 5DCDA 3IIVA 1ZALA 2QAFA 2C3ZA 1H7XA 4NJHA 3PBUA 3MBFA 3NQMA 5FI8A 3W2LA 3L5LA 4FXRA 3R8RA 4HNVA 3W2MA 1JUBA 1DVJA 5K7JA 3L66A 3G1AA 1OK4A 2PCQA 1P0NA 1LM1A 1EUAA 1R46A 1XFBA 1LLZA 3CB8A 5KSWA 5HWNA 5MHBA 2VFFA 3GDRA 2ZZ3A 2DJLA 2C0AA 2DZTA 2XFWA 4PFMA 1KV8A 4I7WA 5HULA 4ZQNA 1HUVA 3PC0A 3B03A 3FEMA 3LB0A 1TPWA 3O05A 4FHAA 1CW2A 4GFSA 4UTJA 5J5DA 4DPPA 1SO6A 2ZZ5A 5AN7A 3LCIA 4MY8A 2A5HA 3OEXA 3UY8A 4FIRA 5G1TA 5LNUA 4RZ4A 3W1XA 1OYCA 6TIMA 3FJLA 1U5JA 4TU1A 3GZ3A 4GBUA 1PL9A 2A2IA 2BX7A 4LTSA 1CI1A 2RHGA 4UFIA 1UB3A 1H5YA 2RH9A 1VCFA 3O63A 4HPJA 2WSQA 1ICQA 3NA8A 2C16A 4O0ZA 4UFLA 3QPYA 3NR0A 4FNQA 3THQA 1KBJA 3N73A 2QCNA 1H50A 1H1YA 3LXAA 2FIQA 4JYDA 3L5MA 2NUXA 4N6FA 2DP3A 4WOQA 5U7SA 3A22A 4JTIA 5FEXA 1JCMP 4RCXA 4UTKA 5G4EA 1GVOA 3NPWA 1FY6A 4Y8FA 4WXYA 2Q3OA 2C1HA 1W37A 2W79A 1XI3A 3DGRA 5D2WA 4ZQPA 3W85A 2RDTA 3C0JA 4BI7A 4N9BA 5AOUA 1X1ZA 3LXBA 4KKXA 3C52A 4P2VA 1QPOA 4TMCA 1HO1A 2WPBA 2J27A 4O19A 1MXSA 4NNAA 1DV7A 1XBZA 1GJPA 3G3MA 2BTMA 3GAYA 1OX5A 3HPSA 1X6UA 2AAMA 4MZ1A 3TXVA 2Y70A 3DFTA 1Z42A 3MJYA 4K39A 3HIJA 3LHUA 3LGEA 1KLZA 4X9SA 3UWYA 5D33A 3DFPA 3W86A 4CNNA 2ZYFA 3W7OA 2PE4A 3BG3A 5IM51 4N9EA 1OX6A 1WXJA 3CQ0A 4ZQCA 4PA8A 4NZJA 1TJRA 3ATZA 4UTIA 3W87A 3ZWSA 5D30A 3MP5A 1KM2A 3NQ7A 5K3VA 1LDCA 3MBDA 4UR7A 2H3DA 5G5IA 4OT7A 3JS3A 1GYLA 3SZ8A 1VYRA 4WY0B 4DELA 2ATMA 2GQ9A 3GAKA 3O8AA 1VH7A 3G0SA 3BG5A 1FQ0A 2I14A 5DXXA 3T78A 3TROA 5H2ZA 3DH7A 1TRIA 1JCXA 2YGYA 3DKJA 5K9XA 1DQWA 4S2CA 3C2RA 5AC7A 4JDYA 1K8ZA 5EMUA 3QYQA 3W1PA 4Z1BA 1D3GA 3RK8A 1K7FA 1F7BA 4QIUA 4TIMA 5C5YA 3P8IA 1TSIA 5HWJA 3W2UA 3W73A 2DZPA 4FX7A 4Y9AA 3PBWA 3L68A 1XM3A 4DF0A 3LV5A 4MIMA 3TJLA 4O0KA 1HG3A 2V81A 1B57A 4XBSA 4E2BA 1OABA 3OVQA 2WV8A 3GDKA 3LRLA 4OHQA 2E77A 3W76A 3UXDA 1SW0A 1H7WA 1A5SA 1G4EA 4GUIA 2X1SA 3RLUA 1PIIA 5AHEA 3LCHA 3PY2A 3M5ZA 3S1UA 2DZVA 1FDZA 1VYSX 2D73A 3TW6A 4TX9A 2CLMA 4OQVA 5I3JA 2VFEA 3N9SA 1HL2A 2NX9A 3S5OA 3FLUA 2HS8A 5TIMA 3CTLA 5K4ZA 4Z1DA 4K8EA 4NNBA 3MMTA 5AHNA 3EKZA 1TTIA 4GRSA 4FX8A 2VEKA 4WOZA 5EY5A 2RDUA 1OFEA 2ZTKA 3QQ1A 1MEHA 2ATSA 2JGQA 4NT0A 1EP3A 1C9DA 3IIOA 1B4EA 2GVLA 3PSVA 3PSWA 1F76A 3F1QA 1OFRA 3WJSA 1M5WA 2OX1A 3OVRA 2B7QA 4O11A 2VEIA 1S5VA 5FEPA 2QDGA 1JJKA 5CZSA 3TAOA 3NNTA 3LHWA 3EXSA 5LSMA 5GVJA 3Q37A 4HPXA 3A24A 5CPLA 2ZRVA 4O53A 1OF8A 4RXGA 3I7QA 3PWAA 1PS9A 4O14A 3GXTA 4M5PA 2R94A 1SFLA 2VFIA 4PCFA 1FWRA 3TC6A 4M7TA 3TW7A 4DBDA 3EKLA 4O57A 2YZRA 1FDJA 1Q6LA 2G97A 2VXNA 3FA5A 5BNKA 4WUIA 2ISWA 3DFNA 2QUTA 1F6KA 3JRKA 1KA9F 1ZAJA 5L9FA 5KINA 3G1FA 1W0MA 4HT3A 3GXNA 1TPUA 1ZAHA 4JN6A 3L0NA 4ZZ9A 4ML9A 4RJEA 3M16A 2AQWA 2P0OA 5DY3A 2FPTA 2HSAA 4ORMA 1OX4B 5FF7A 1AK5A 5EKYA 1LOQA 2X1RA 4R53A 2XN2A 5FEWA 3TA6A 2E68A 1DJNA 1GZGA 1YPFA 3O6YX 3IIZA 1SSGA 2DZXA 5KZMA 5KITA 3CLMA 1TV8A 5AHLA 4OWGA 3SR7A 1TREA 3BW2A 5G4WA 1GYNA 4MPQA 4CQ8A 3W7EA 3GX9A 1L9WA 2B0MA 2CLHA 3IGXA 1LORA 3R12A 4MLJA 4AMAA 2F84A 2R91A 4UNKA 2Z0IA 1NAL1 2QJIA 1EP1A 3C3NA 4KWVA 4UMCA 3W2KA 2YYTA 1XDMA 3E02A 1VR6A 3CHVA 4J9JA 4ADSA 4Q32A 1V7YA 3IGUA 3N9RA 5C54A 4RV8A 2GQAA 4A3UA 5AHFA 4UTHA 4FF7A 1L6WA 2OMAA 4IMDA 4Z1AA 3SGUA 2NZLA 3W74A 3LDVA 1G7VA 4BI5A 1SZGA 2VC6A 1RD5A 3TV8A 1LCOA 4XTIA 1FUYA 3AJXA 2YSWA 3D0CA 4NJKA 4AHOA 1L2UA 3PG9A 4X2RA 3MYPA 3UD6A 3EEGA 4C1LA 2Y62A 4YWIA 1MO0A 3GB6A 1F74A 4JTKA 2Y6ZA 3FKRA 1FX6A 3M5YA 3W7CA 3F4NA 3B0PA 3O1NA 4G1KA 1OF6A 4MJZA 1T0OA 2EGZA 2ISSA 1MEIA 3MHFA 2OZ0A 4DF1A 3G1DA 5KTLA 2YW3A 3C2FA 3LHZA 2OCZA 3LCXA 1SSDA 3WK2A 2PRLA 2V82A 3GIYA 5KMYA 4E38A 1TQXA 1SR9A 4O4VA 3I7RA 3MP3A 1LYXA 2X2GA 3GKFA 5K4XA 5AFDA 4NX5A 1P4CA 1DQXA 4MUZA 3ZS4A 3M6YA 5A8GA 2NX3A 1FXQA 4NVTA 1XXXA 3UXAA 1OFPA 4GXMA 1AW2A 4P61A 4RLIA 5DELA 2ZZ2A 3P7YA 2GOUA 4O54A 1EWEA 3VE7A 3MWAA 4UC5A 3B04A 1W3IA 3PB0A 1L6YA 5FESA 3BVJA 1ME9A 4Y90A 4A21A 4JTLA 1GG1A 3NPXA 1VJIA 3VI2A 1UASA 2QR6A 4I7VA 3W83A 1ALDA 1H51A 4MKNA 4AWTA 1TCDA 3GK0A 2HMCA 2ZA1A 3P8JA 1TV5A 1W56A 2Z1BA 1GOXA 2NV1A 2ZRXA 3MUXA 4FO4A 4R7JA 5CZTA 1DORA 4TMBA 4LRTA 4JTJA 1Q3NA 1FDYA 1LRNA 4ZVJA 2WNZA 5D05A 2V8ZA 3GLCA 3GXPA 1K7EA 1OYAA 1TPC1 2YFNA 2C14A 2O7SA 2QCGA 5HUOA 2A1YA 1P5BA 2CWNA 1X7FA 1O94A 2YDAA 2QUUA 1W5QA 5C2XA 1QFEA 2CLFA 2ABAA 3HGOA 1NSJA 2QCDA 5CPNA 3NM3A 2EHHA 4LS1A 3H53A 2C18A 2A7PA 1I2NA 4EF9A 4TR9A 3SECA 4LVGA 1KW1A 3VCRA 1CX9A 1K03A 2RDWA 2QUVA 5BOOA 1H7RA 2TMDA 4K37A 4LVBA 4OV4A 4JNMA 3FKKA 1MEWA 3LBCA 1BWLA 2DU2A 3W7GA 3TQ0A 3TCEA 3BV4A 1Y0EA 3Q58A 3NZ1A 1VS1A 3M5VA 3C2EA 3KAOA 2PRHA 1WV2A 4CQAA 3EWWA 2VFHA 4JTHA 4E2DA 5D09A 4O28A 1FWSA 3MI6A 4K7VA 3NPUA 4LV9A 1WAUA 1YLVA 1LBLA 1YPIA 4R33A 4UR8A 2JKEA 5CSRA 1IXOA 5F1UA 3W75A 3KVMA 3G1XA 3NQVA 3K30A 4AF0A 4OBTA 3ZFHA 4A2RA 1X8FA 1HTIA 3P67A 3UY7A 2G96A 2EAWA 1QPNA 1XBVA 1G7UA 3G18A 3TJXA 3W84A 3M41A 4HIBA 4GUFA 4PH6A 3STGA 4ZQRA 4UTTC 2QCDB 2BSLA 1LBFA 3W22A 3A21A 3O15A 4IXHA 3T40A 3G1HA 2ZRUA 3NPVA 3CEPA 3OA3A 3C56A 4IUOA 2GPTA 1LZOA 4GUJA 1SU5A 2NUWA 1RQEA 4K36A 3QW4B 3PUDA 3IVSA 1NF0A 4IPJA 3BGGA 4UTUA 4EVZA 4JS3A 2WKJA 4AEOA 3RF9A 2A21A 4FNRA 5BRBA 5I3FA 3GDTA 2JKPA 1JRBA 3W88A 3TDFA 3LHTA 3TXZA 4OU1A 1K7XA 4NXKA 3VE9A 3TU9A 5BMWA 2VFGA 2Y88A 1KM6A 1WOBA 3UWQA 2JK2A 1OFOA 1VC4A 4LOCA 5L6UA 3HPXA 3FIGA 4XTDA 3LOTA 3WJZA 2ALDA 1I2QA 2ZTJA 3KHJA 4O16A 4MOZA 1BWKA 1SO3A 1VCVA 3W7KA 2ABBA 1G4TA 2RFGA 3NM1A 2CLEA 2A7NA 1X1OA 2VFDA 4Z1CA 1B3OA 4E0CA 1S5WA 3P61A 3GDMA 3QW3A 4DO4A 1J4EA 3T7VA 5F4XA 5U4NA 3KRZA 4D2JA 5CPOA 3QMRA 2CFFA 5DBUA 1C29A 1YTEA 3I6RA 3S5NA 4CNPA 1NF7A 3GYEA 2Y7FA 2CZEA 5LNWA 3E12A 1BKSA 3LV6A 2C19A 4AAJA 5AHMA 3HG3A 1W5MA 3TSMA 1XBXA 3H55A 3O6CA 1FCBA 4S2BA 4FEZA 2ZRZA 1UBSA 2YPIA 4YL2A 4IMFA 4U28A 1PCKA 3O06A 2VOMA 4AVFA 1PCWA 2A6NA 1LLWA 1TPVA 1TRDA 5E1QA 2PURA 1JULA 3A9IA 1A5CA 2QF7A 5D03A 3TC7A 1GWJA 3CIXA 5HNRA 1AG1O 4YCPA 4O1BA 1ZCOA 3ABQA 3DFOA 3SSJA 2FTPA 1R2TA 3DENA 1WOAA 3G8EA 4LVFA 3DFQA 3NQ6A 4X22A 4JYEA 2CLOA 5CZJA 1IXPA 2ZQ0A 4WXZA 1SW3A 4JICA 1G6CA 4GUHA 3NVTA 2FJKA 3SY5A 2YYUA 2QJGA 4FB7A 1ZNNA 1H1ZA 3MI3A 1MZHA 4UXDA 5D2YA 3WJWA 1ONRA 3GR8A 4WX2A 4PC8A 3RU6A 1R2SA 1QPQA 2CLIA 2A4AA 4O50A 3P5YA 4UUIA 4U4MA 1VGAA 5EYWA 4IMCA 1Q45A 4MLRA 4MZ8A 2NX1A 3DHFA 1NVMA 1VZWA 3QC3A 3LRMA 3P74A 5D2VA 5FF2A 3QFEA 3KFTA 1RPXA 3W7QA 4N6EA 1TB3A 1GVFA 3P84A 4JY8A 3AO0A 1KTNA 3S5YA 1SZEA 3WFAA 4BFAA 2G5WA 1RQBA 3DU0A 1FWTA 1YDOA 1Q6RA 1SZNA 1TPH1 2NWRA 4MFDA 4XBKA 5LHFA 1SZFA 5A5WA 4LWWA 4GE8A 1TJPA 3N19B 3NQDA 4OGZA 3W7NA 3BPWA 1TV7A 3Q2DA 2Y89A 3C2VA 3M43A 3NYZA 3LI1A 2E5CA 2CZDA 4HSOA 1FCUA 5FF3A 1YXCA 3BLIA 3M44A 4O12A 4HHPA 1FBAA 4XWUA 2QCCA 3W1NA 3L9CA 3L2IA 1FXPA 5EPDA 1U83A 2E09A 2B7PA 3CPRA 3IIXA 2NWSA 4HNTA 4UTTA 3FJ6A 1AL7A 1LRTA 4UFKA 1G4PA 1OVDA 4MYAA 2VELA 3DZ1A 1I2PA 1LBMA 2TSYA 3W7RA 3ELFA 5LHEA 3S5ZA 5AB3A 4C1KA 4K7YA 5F2GA 1VLIA 1KM1A 4N2YA 3N3MA 3W2JA 2BZNA 3F4WA 1IXQA 1T99A 4IGHA 3MP4A 2ZFAA 2BWGA 1YDNA 2G95A 4ORIA 3HPZA 2HS6A 3W23A 4BR1A 3UYCA 2TYSA 2CLKA 3M0ZA 1JQXA 3W1RA 2H8XA 3R2GA 2GJNA 2ISVA 3ZWTA 3U8GA 1AL8A 4LC8A 1XCFA 2ZA3A 4JX5A 1WDWA 3UWZA 5AC8A 1TTPA 3G1SA 3BO9A 3S9YA 3JR2A 3B8DA 3B0VC 1JCNA 2YXGA 2E1DA 1W54A 4JGDA 2V9DA 4BF9A 1W3NA 1XDLA 2IQTA 3HJZA 3KOFA 1SW7A 3MW7A 1I45A 3GDLA 3T4CA 2VENA 4IX2A 5CPMA 1R2RA 3S1WA 1KTCA 2Y7GA 5AYXA 3I65A 3H54A 3E96A 3QPZA 4UIOA 1AW5A 5AYZA 1F5ZA 4UTWC 4Z08A 3EX3A 1W3TA 1UJPA 1B4KA 3IEBA 1GPWA 3L5AA 1ZENA 4HNNA 4LV4A 4O13A 4X3ZA 1PHQA 1Q6QA 5D04C 3TQKA 4LUJA 5I3KA 3NQEA 4UNLA 3TAKA 2VEMA 4GWEA 3S42A 5FF0A 1A5AA 3C8FA 3T55A 1RR2A 2E6DA 1KFLA 2FFCA 4O18A 1NFBA 1RVGA 5F2MA 2ZZ1A 4I9AA 3NQAA 4OE7A 4ADUA 1OFDA 3SJ3A 2JGYA 3TFCA 1I2OA 3PR2A 3N14A 1P1XA 1T96A 3BLEA 3I68A 2YFOA 4JTGA 4L4MA 1EA0A 3W1MA 4LUIA 2ZBTA 1FCQA 2H3BA 3UWUA 2A6LA 5I3HA 4A29A 3QMSA 4KFOA 3PB2A 4H3DA 5BW6A 1UUMA 1EP2A 4HNUA 3KVLA 4AHQA 4PODA 1W31A 1I8JA 2YX0A 2TRSA 5T26A 4JTSA 4LVAA 1W5OA 1W1ZA 2P10A 3W1UA 3P5ZA 3UWVA 4K38A 5SWUA 3N2XA 2NXGA 5H91A 3NL3A 2E6YA 2QCLA 3G3DA 1JCLA 4UCGA 1QOQA 4O1CA 1G69A 3KRSA 1N7KA 1Q6OA 5LGXA 2X1TA 2DZUA 1H7PA 3EB2A 3IVTA 4RR4A 4YCOA 1TPEA 1A53A 2A0NA 3G1VA 4CCEA 2FB3A 3TKFA 4WD0A 4B5NA 4Y96A 1GVRA 2QKFA 3N2MA 1YXDA 3M5XA 3KXQA 4ALDA 4NU7A 1XC4A 4UFMA 3LX9A 1O4UA 2C6QA 3EX4A 3L0GA 3TH6A 1G4SA 1ME8A 2KZHA 3V75A 4DQWA 1EPXA 3KX6A 2FLIA 4Z0SA 1EEPA 3EWBX 1S5TA 1N8FA 2ZZ4A 5DLCA 1QMLA 2ZRWA 5E0KA 1VYPX 2XN0A 1KFJA 2XN1A 2W0UA 3HB9A 3N34A 4JTTA 1KFCA 1F73A 1M6JA 3IVUA 1QAPA 3I7SA 3L0KA 4GNJA 1KFBA 3ZR4A 4IXXA 3NQ8A 4O15A 3DFSA 3NEVA 3PAJA 1K8XA 1EIXA 2OT0A 3W6YA 1OFBA 5LGZA 3B06A 1VHCA 3DI0A 3TX9A 2EPHA 3HQ1A 4IWWA 3QH2A 2V30A 4NQ1A 3BARA 4CCDA 3TQVA 2CZ5A 4ZQOA 3O6DA 5HWMA 1I4NA 5LNVA 2QCEA 1AW1A 4LVDA 1O5KA 3MYOA 3HG2A 3IV3A 3E9AA 3INPA 3RMJA 2WSYA 3UPWA 2V2CA 5AC6A 1ME7A 4EF8A 5BMXA 3DKLA 3QSTA 4AB4A 3NL5A 4H4IA 5F4SA 3G22A 5D32A 3CIWA 1FWWA 3W7IA 1OK6A 3NGJA 5K9DA 3C61A 3W07A 3M1ZA 3S1XA 4PL2A 5G2IA 4M6VA 4S1FA 4Q4KA 1T8XA 3FFSA 4FNUA 3C6CA 2V5BA 3FOKA 5F1VA 3FS2A 5DCEA 3ABOA 4O1AA 3QRHA 1DKWA 3HGJA 3BK0A 5CKSA 1RZMA 2E5DA 5CGQA 1KFEA 5FF4A 4CLMA 4JIPA 5ABTA 2H90A 1LRQA 1EB3A 1VLWA 2B7OA 1W5PA 3LI0A 3WK3A 5F4WA 3PBVA 4L4LA 4RKAA 1PV8A 1VPXA 4MJMA 2C15A 3BW3A 3C2OA 2JKAA 4NXSA 3IRDA 1O5XA 4O8RA 4FX6M 4RZ6A 1QR7A 1EUNA 5F2LA 1ML1A 3EXRA 1ZJIA 3TNOA 5D02A 1WBHA 5KZEA 3TUUA 4HN4A 5CG7A 1SO5A 3NOEA 4UTLA 4FIQA 1YYAA 1IGSA 5AHIA 4UMAA 2Y85A 4JYFA 5DBTA 3LCGA 3QQ0A 4UTWA 3MI2A 4JR5A 1OJXA 3QJAA 3W71A 2W6RA 3TMLA 3RFAA 1K02A 3S1VA 3W7LA 1J5TA 5IBXC 4KFPA 4NJGA 4JIQA 1YTKA 2QJHA 4LS0A 5DCBA 1JRCA 1FWNA 2Q8LA 3QF0A 3G8RA 1JCJA 3CWOX 2ZA2A 4O17A 1KV5A 3M47A 4O1DA 1Z41A 4EOUA 3LHVA 2CW6A 3RNDA 4UTMA 3NO5A 3W7HA 5LKYA 3T44A 3USBA 4W9TA 4AWUA 3STCA 3SI9A 2TPSA 2R8WA 4QNWA 4LC6A 4WY0F 4NUWA 2GJLA 4WY0A 5AYYA 3NL6A 3FYOA 2WQPA 1I2RA 2I1OA 4N4QA 1TIMA 1A50A 1N55A 1H7NA 1LROA 3PM6A 4DEFA 5F2IA 3KRUA 1BTMA 1F6PA 4AF0B 1M7PA 1H7OA 2WJZA 1NEYA 3G0XA 3STFA 4FNPA 4MVAA 1SFJA 3UNDA 1H61A 1K3UA 3GNNA 1D9EA 1PHWA 3CT7A 2V2DA 1M7OA 2NXIA 1YDVA 1SQ7A 2Z6IA 4MYXA 5EL1A 3L65A 3EWXA 3STEA 1RV8A 2X16A 2GVJA 2QCMA 5LZLA 1OG0A 5HMSA 5DXYA 2WNNA 3SW6A 4ADTA 2Y7DA 5CZ0A 3P62A 4UFHA 2FB2A 3PUEA 1HO4A 4NZFA 5LNSA 1TPFA 1L6SA 3EWUA 2WO5A 3TE9A 1ZHAA 3W7PA 1DL3A 1TTQA 2FPYA 3NQGA 4PL1A 2E5BA 4M7SA 3A5FA 1JCYA 3LTYA 3DHDA 1B9BA 3F03K 1F2JA 1XL9A 4LT9A 5TQLA 5G1YA 4KWWA 2AGKA 3W72A 2J6XA 4CNOA 4HKPA 1PVNA 3KVKA 1OFQA 3GR7A 1IXNA 3NDOA 3TK7A 4JEQA 2DORA 4H6KA 1JUEA 2X1UA 1THFD 3W7MA 1QO2A 1QO5A 4DXVA 1KBIA 3CEUA 2QDHA 4N4PA 1XKYA 3GNDA 3GKAA 1OYBA 3EWYA 4RK8A 5HR7A 2QCHA 3MHUA 4JX4A 3S0CA 3HGSA 3Q94A 6ALDA 3CM4A 2CU0A 1A5BA 3EWZA 1K8YA 3TMQA 3UZ5A 1LOSA 4AWSA 5KZDA 1SO4A 4RZ5A 3WJYA 3MHGA 4PEKA 2OJPA 1TO3A 3CC1A 3LHYA 3BGJA 4A22A 4NNCA 1P0KA 3WK0A 3RLVA 3P80A 3UQNA 3IGSA 4MZYA 3YPIA 3LERA 1GTHA 5D37A 1ZFJA 3P82A 4IOTA 4YLWA 2H8ZA 4NX0A 4JDBA 1GVSA 2E6FA 3P60A 3HBLA 2ZRYA 3M7WA 2YCEA 1H60A 2Y61A 2WOQA 1ADOA 4WZHA 1KM0A 4IMEA 3EX6A 1OX4A 2J9YA 4K6AA 1GQNA 1WYIA 3C4UA 4QSHA 4BWLC 4JTEA 1J2WA 4GC4A 3UWWA 3OBKA 2QAPA 5HQEA 2A85A 3W1LA 1ZY9A 3DI1A 3VFLA 4O52A 1GTEA 2VKZG 2YR1A 1EX5A 1LTDA 2FQIA 4ZL1A 4N9CA 3U6WA 1OHLA 4XQ6A 2RKXA 1Z44A
chains in the Genus database with same CATH superfamily
4AZ5A 4JIRA 3PF3A 5EA9A 1XG4A 1EC8A 1KTBA 1E3XA 3QMTA 1TQJA 1M65A 2VC9A 3OLEA 3BW4A 1JCTA 2W62A 3LM7A 3UWEA 4M19A 1JQVA 3LPFA 3A4XA 3W1AA 1UC4A 1TMHA 1UUOA 2BLEA 3CQHA 3G1YA 4GY7A 3LRKA 1W9VA 3GS6A 1IGWA 1W3KA 3KOXA 4IPIA 3CU2A 5C6MA 1E9LA 1XS2A 4C6PA 1W3JA 2WK2A 5DF0A 2FDSA 4E4UA 3I6TA 4Z0JA 3T09A 1RD6A 3VNMA 4O10A 2V69A 2YW4A 2TODA 4YVVA 4H8NA 1HJUA 1XYCA 1JVNA 3GQYA 2H6RA 1TUXA 1LG1A 4W86A 1LP6A 2I5QA 4RDVA 4IIDA 3IS4A 5C55A 2R14A 3WELA 3R10A 1KCKA 1WX0A 5G2HA 3PULA 4GKTA 1UD2A 4BK9A 4ZO7A 1MSSA 3QZEA 3L67A 1EWDA 2Z6JA 4FOKA 3WLRA 2GWGA 1FH8A 5D8ZA 4XUGA 3U7VA 2GSEA 1EJVC 2GJRA 4ICNA 3IANA 1K1DA 1IQ8A 1PDYA 3LCWA 4AFYA 4KT2A 3NQ2A 5AVHA 3W1QA 4PTNA 1H3GA 2ZZ6A 3ARSA 1XJBA 4HCDA 1TYGA 3TN4A 3HN3A 2DZWA 3SCPA 4KEUA 4BQ4A 3FXGA 4X2PA 1XSKA 3A5VA 4LYPA 2JALA 4DO6A 5CH9A 2Z24A 5HK4A 4ZMGA 2ZDRA 3NZQA 4HSNA 1AQMA 3CASA 4KW2A 3BLFA 2RJGA 1H11A 3GVGA 1WQ5A 3OHIA 1BEUA 1QNVA 1ZAIA 3EXTA 1WBJA 2HBVA 4GVFA 1H4PA 4YIWA 1JI2A 1CXHA 3BQ5A 2I17A 1XIIA 3EB4A 4A8IA 2ZC1A 3GIQA 2DUXA 2INZA 2VEPA 5BROA 3BG9A 4U3AA 3CH0A 5LA2A 4AXKA 3BOXA 1A49A 2E8ZA 2VYOA 2Q02A 1ISWA 3WDQA 1TTJA 4Q8PA 3OIHA 4B5WA 1KFKA 3B4UA 5E93A 3R7MA 1DBTA 1OZMA 5J5RA 4K8HA 4XKYA 1VFLA 2EJAA 4QE1A 2PC4A 1AD4A 2HTMA 1GQIA 2YXXA 4C7DA 4ZBCA 3MJMA 4FNSA 3BZJA 3NZRA 5BXSA 2DH2A 1JR1A 3GNXA 4IPLA 3VGHA 5GNZA 4QS6A 1I1WA 3CUHA 1JF5A 4FI4A 4A3YA 3NQBA 3W2NA 3GVVA 3LBMA 4MB3A 3K8KA 4WSKA 4S3EA 4PUEA 1SFSA 2J88A 1AMKA 2PRMA 1JUKA 2DW6A 4Q8NA 3QOMA 4TXEA 4LW7A 4MB5A 4PUWA 1NU5A 1QT1A 4MG4A 1TX2A 2Z00A 1PX8A 2J13A 4FLRA 4HK7A 3CYVA 2I56A 4WQ6A 4W85A 3PZVA 1XUZA 4FNTA 1R8LA 2A3HA 1K8CA 1IF2A 4PRRA 4D1JA 5G1MA 3VIOA 4OV9A 1LOLA 1S3HA 2CBIA 3B8TA 3SFWA 3PS7A 2Y63A 4XKYB 1O60A 4P7RA 2GDQA 4Q4OA 1FOBA 4IL2A 1PZ1A 1QNSA 1EA9C 1E4MM 1IEIA 2XIOA 2QAFA 2GLKA 1H7XA 1VFHA 4A8NA 3NQMA 5FI8A 3RO8A 4FXRA 4HNVA 4KEZA 1JUBA 5JXQA 1P0NA 1EUAA 1XFBA 1KR0A 3GDRA 2YB1A 2ZZ3A 1DEDA 4OJYA 1EQCA 3WNKA 1IWAA 3K4DA 5IOBA 3IJIA 2YZ5A 3AI0A 3NSMA 1HUVA 3L4XA 2VZVA 3EBVA 3KTSA 3FEMA 1DIOA 2QIIA 3ZXWA 5M17A 3LB0A 4FHAA 3VNYA 3GUGA 5J5DA 1SMDA 1SO6A 5AN7A 1VFSA 4LH8A 4MY8A 2E3ZA 1YQ2A 4HPNA 2ZOXA 4UZSA 1V93A 6TIMA 2R24A 3FJLA 1U5JA 3N4EA 4FF5A 4A4AA 4S23A 3WQ6A 1UWQA 1W2VA 1H5YA 3C0SA 2GJXA 3WBWA 1ICQA 3FGCA 5BU9A 2CESA 1OQFA 3NDYA 1JPHA 2QJNA 3NR0A 4MNMA 1QU4A 3H6OA 1KBJA 1KXVA 4L1XA 2VCCA 4RE3A 3GTHA 4QS5A 3LXAA 4H6RA 4NRSA 2DVTA 2PWFA 2DPEA 4PB5A 3A22A 4BS0A 4JTIA 5FEXA 2P50A 4CQBA 2W66A 4Y8FA 1N8WA 2W79A 1X38A 6XIMA 1MFVA 1X1ZA 4GIRA 2KAUC 1US0A 4P2VA 4TMCA 4KETA 3VMNA 2VUNA 5I79A 1LT8A 4GGBA 2PF0A 1FWDC 5A8QA 2BTMA 3HPSA 4LALA 1ISYA 3USZA 1CGYA 1X6UA 1S2CA 1QJWA 4QROA 1PZ0A 3GTNA 3TXVA 1Q7QA 1UMYA 3DFTA 1ONWA 5D33A 3W86A 3WUGA 3U3HA 4CNNA 2HROA 2ZYFA 3W7OA 3CMGA 5IM51 4PA8A 2XJ7A 4NZJA 1TJRA 3ATZA 2BMBA 1QTWA 5D30A 5K3VA 4OT7A 1PJ9A 6PTDA 1UWSA 2GJXB 4PUJA 3M0XA 2CYGA 4HP5A 1XYMA 3KHDA 7TAAA 3FGCB 2ONEA 1VH7A 1JZ7A 3ICJA 1RP8A 2G8ZA 2YGYA 1B5TA 3BL3A 2DSVA 4F2TA 5EMUA 1E9IA 1IZJA 1PTAA 3CPUA 1B0IA 5HNNA 1GK8A 4FX7A 1R86A 3E0VA 2E67A 4DF0A 4XAPA 3TJLA 2V81A 4NYUA 4E2BA 1OABA 1X8CA 3B97A 4U33A 3UXDA 2ZE3A 2HK1A 3GXIA 4AIEA 3RLUA 1PIIA 3H2OA 3C0QA 3LCHA 3IJ6A 3GIPA 1HN1A 1FDZA 1VYSX 2D73A 4A8RA 3TW6A 4OQVA 4OVXA 3WF0A 4HZMA 2VFEA 3N9SA 4LAKA 3OJGA 3VO0A 5TIMA 2IW0A 2VJXA 3MMTA 5AHNA 3EKZA 1TTIA 3CV2A 2J74A 3UPMA 5EY5A 1X97A 3UJSA 1CXLA 2J6VA 1MEHA 4GLEA 3KWXA 1EGVA 4NT0A 1EP3A 4ZE4A 3PSWA 3TEVA 4WDTA 3F1QA 3W4RA 1XIFA 2OX1A 3OVRA 4WDWA 4ICMA 1J10A 1MUMA 4ZB2A 5ABGA 3HQNA 3U5YA 1JJKA 1J0IA 1EX1A 1FP9A 1KQYA 3ZJ7A 3EXSA 2VQUA 3Q37A 3QV9A 4O53A 2IPGA 3W28A 3PWAA 4O14A 3OZOA 3KTCA 1SFLA 1FWRA 4DBDA 1S2VA 3LNMA 3HV8A 2OWCA 3WEZA 5M1TA 3UP8A 2GUBA 1W3LA 4M56A 3WQWA 1ZAHA 4HBKA 4ML9A 1EXBA 1Q85A 4ORMA 4AD1A 1EF3A 1U1HA 3V5CA 4ATWA 4DY1A 5A69A 5CCZA 2XN2A 3AMDA 1QW9A 1C90A 1GZGA 1MZRA 3IIZA 3LMYA 4IP4A 3AAMA 4IL0A 3CLMA 4WVXA 1TV8A 5CQ1A 1V6TA 2A3CA 2CKRA 2B0MA 2CLHA 3IGXA 4R3UA 3TZFA 4H7CA 4CD4A 2J7GA 4UNKA 3SN0A 5FL1A 2QJIA 1A0EA 2D69A 2OQHA 3W81A 5HPCA 5JU6A 1P48A 2P0IA 1VR6A 3CHVA 1RY8A 1V7YA 2WC4A 1W8GA 1E72M 3QN3A 1UWUA 1S2UA 3ABXA 4ACZB 4IMDA 2NW0A 3K2GA 2EPOA 3CUZA 3LDVA 1G7VA 4BI5A 2VC6A 3GDBA 1Q6EA 1FUYA 4DYEA 6TAAA 3SQMA 4FR6A 2PS2A 4R7WA 1E0TA 1TWSA 1GZJA 2ISDA 3GB6A 4D6GA 2XYLA 3M5YA 1NM9A 3W7CA 1IEWA 2OWXA 3ZLHA 2EJ1A 3B0PA 4G1KA 1XGZA 4DAIA 3MHFA 2DSZA 4DF1A 3C2FA 4BJHA 3LCXA 4QLJA 1SSDA 3WK2A 3MS8A 1EL3A 2PRLA 2V82A 1Q65A 1YW1A 4C90A 1SR9A 4DAFA 4ECLA 3K1DA 1E6RA 3IK4A 3GKFA 5AFDA 2BGSA 3RX4A 3UXLA 5B7YA 4IIFA 4ERGA 3E2RA 5CJ5A 2ZIDA 3UXAA 3GWQA 4GXMA 1J0HA 4BZYA 4RLIA 4UZUA 5DELA 4IQEA 4KIEA 4O54A 3VE7A 3MWAA 3PB0A 3VZXA 1E4NA 3WNLA 4ERIA 1R0MA 1Y5XA 1V0KA 3O0FA 1ME9A 2PTWA 3W24A 4A21A 4HA0A 4AY1A 1GG1A 4JNZA 3VI2A 2QR6A 3GRIA 4HHLA 3QOKA 3W83A 2HNHA 1S5MA 1ALDA 4FMVA 3RMEA 1VFMA 1CGTA 2HMCA 2ZA1A 1W56A 3MUXA 1ITQA 4J3XA 4LRTA 1Q3NA 1XSJA 1LRNA 5FA5A 1D7KA 1BQGA 1RSCA 3CIVA 1VJSA 5DMMA 2VZOA 2FZMA 4W5ZA 4BF5A 3MO4A 1BHGA 1IZCA 5LXXA 4EE9A 1TIWA 3BZGA 3D5HA 4P8VA 2O7SA 3GTIA 2QV5A 1BQCA 2CWNA 1O94A 3A3HA 3T4WA 3GBDA 1TWZA 1N8IA 1XINA 3GO2A 2EHHA 2WXDM 4LS1A 3H53A 2FVMA 3ZM8A 4EF9A 1VBJA 4TR9A 1KW1A 2Q01A 4GO9A 2O4QA 2ZWYA 3ZT5A 2R6OA 2RDWA 3BANA 1GUVA 4M1RA 2QXWA 4K37A 4JNMA 2MANA 4HTYA 1BWLA 1L2QA 3W7GA 3Q58A 4KH2A 3NWRA 3T1GA 3C2EA 1KCZA 3AQUA 3U9IA 5DRIA 2E7FA 3MMUA 4K7VA 3U5UA 3BAYA 3QGKC 1WAUA 1YLVA 3M0YA 2Y1HA 2Z2BA 4R33A 1CGVA 3VILA 5CSRA 4J2MA 3TYZA 3DG7A 4AF0A 1HTIA 2E9BA 3PZ9A 3QKZA 1XBVA 2WHKA 2PWDA 2XHYA 3GY1A 1HKMA 3M41A 4GA8A 5AY7A 4ZQRA 1RCXB 1W1PA 2UWFA 5GNYA 1LBFA 3W22A 4QHRA 1HT6A 3AMCA 4K2SA 4DJFD 1S2TA 2HE5A 2PDBA 4LBSA 5PTDA 1R38A 4W5UA 2GWNA 5ENLA 2ZE0A 3PUDA 5E0CA 5JH2A 4AD5A 4AEOA 1CB2A 3GDTA 1CGUA 1V6XA 2JKPA 4C6DA 1O5QA 1K7XA 4NXKA 3H2CA 4B91A 2O4MA 3GW3A 3TU9A 3PTKA 4R27A 1HJVA 2YL5A 3QZ6A 1G94A 1K4GA 3UWQA 2QPXA 3UEQA 2F6XA 1TE6A 3B8WA 3CZEA 2J66A 3ITOA 4KCVA 4YTQA 4HU0A 4DZHA 3LOTA 2ZTJA 4A3QA 4Z42C 4O16A 2TAAA 4MOZA 1BWKA 4DNMA 3QVQA 3UZXA 3ZO9A 4KERA 1NTHA 2ABBA 5GPRA 1BRLA 3B9OA 3VD3A 2AL1A 3MT1A 4GQGA 5IFTA 4H7ZA 2CLEA 3VKCA 1B3OA 4TTUA 3GDMA 4S3FA 3QW3A 3T0AA 3TTQA 3T81A 1G0CA 1YTEA 2E1WA 3ANVA 1NF7A 3FEQA 4DUXA 1MNSA 1EJUC 2C19A 4CD5A 3HG3A 1W5MA 3TSMA 3O6CA 1FCBA 4S2BA 1SZRA 2Y4SA 2ZRZA 4W7VA 4YL2A 3AMGA 3SCSA 1LLWA 3DOPA 3R4IA 3T0DA 1UKOA 3WQFA 5D03A 2W63A 4PBGA 2DIJA 5T9CE 3DGBA 5HNRA 1AG1O 1E6XM 5HOSA 3OYZA 3SSJA 4KGLA 4Q8QA 3AXXA 1TMQA 2PPGA 1WOAA 3G8EA 3A12A 3LY0A 3DFQA 2QMKA 3ABZA 1OD0A 4GISA 1YNPA 1XH0A 1BRLB 3SY5A 6REQA 3AUJA 5FJOA 1ODUA 1YMYA 5D2YA 3MA8A 4WX2A 4PC8A 4PMZA 4IPPA 3RU6A 3LZ3A 5CJNA 1QPQA 4W7WA 2CLIA 3M4HA 3VIPA 2A4AA 4YTRA 3PZQA 4O50A 2CKSA 4U4MA 1VGAA 5EYWA 4PMNA 2BBFA 4MLRA 1QNRA 4FOJA 2DIEA 3U0HA 4DXXA 2ZADA 2F6KA 1B2YA 3LRMA 5MKGA 5D2VA 5FF2A 1FA2A 3HTWA 1UHVA 1TJ2A 3AO0A 4DLMA 4ZTXA 1ZJHA 3KTXA 8CGTA 3OOQA 1QW8A 3VTRA 2G5WA 2IXVA 3FDKA 1JAEA 1H09A 1JF6A 3BJSA 5LHFA 1SZFA 3H2FA 2ZXQA 1EZWA 1TJPA 1NY1A 1PBGA 3BMWA 2GSJA 3L2MA 1ZRQA 2HJPA 4AX7A 2VX5A 2ZXDA 3C2VA 3M43A 1WE5A 3NYZA 5I77A 4U5KA 2E5CA 2CZDA 4L6OA 1UKPA 5FF3A 1IEQA 1VPYA 3SIMA 3MZ2A 4NZCA 4F40A 1X6NA 4E4FA 4DJFC 1X96A 4HHPA 1FBAA 3VAVA 1XRFA 1WXZA 4HQVA 1FXPA 1I6NA 5EPDA 1U83A 2E09A 3UA3A 4W89A 3CPRA 3OBAA 1IHIA 3I3EA 1G4PA 4OECA 5M03A 2E0PA 3AROA 1I2PA 2TSYA 3ELFA 3N6HA 2UZ9A 5AB3A 4C1KA 5F2GA 4FXFA 4N2YA 3N3MA 4DVOA 2BZNA 2QLYA 4XZNX 3F4WA 1KXQA 2BWGA 1YDNA 2G95A 4ORIA 2OLAA 4B15A 2CLKA 2H8XA 4LC8A 2ZX6A 1XCFA 2ZA3A 4KCTA 1J6PA 1E3ZA 3HMCA 3HPAA 2NVCA 3BO9A 4XZLX 3B8DA 3AWOA 3E5PA 3B0VC 3L7RA 5A8OA 2E1DA 4Z2JA 4JGDA 9CGTA 2OO6A 4CGTA 1W3NA 4DBSA 4DX3A 1XDLA 3KOFA 1I0BA 1PZ3A 3PNUA 1I45A 3GDLA 2V5JA 4F0LA 3VU2A 1R2RA 4BQ3A 2X8RA 2VDGA 3WNOA 3EWCA 1TA3A 1WKDA 3QPZA 2WMFA 4JTRA 2NSOA 1AW5A 1XFCA 4UTWC 1M53A 2XWDA 4E8GA 3BSGA 1UJPA 3IEBA 4IQDA 4QQUA 1VFUA 1QW7A 2FGBA 1A5OC 2CHOA 2VEMA 5IFPA 1NWTA 1MW0A 3ARPA 3T55A 3NZGA 4GACA 1NFBA 2QUNA 4CEUC 4GX9A 2Y5JA 2ZZ1A 4I9AA 4NZ4A 3SN1A 1P1XA 4JTGA 4LPCA 4LUIA 2ZBTA 5I3HA 1XLLA 4A29A 4KFOA 3PB2A 5XINA 1E1FA 3VIIA 1VRXA 1W31A 4AVNA 2YX0A 2BY2A 4JTSA 1W5OA 6CGTA 3UWVA 1V08A 3MC5A 3G3DA 5DQPA 2XIQA 3EOEA 4JCMA 4MNLA 4CD8A 1Q6OA 2X1TA 2DZUA 1E9ZB 5DO8A 2YL8A 3PTDA 3VD9A 4WD0A 4B5NA 2OKTA 2IKJA 2C71A 4Y96A 1Q66A 1DIEA 1HKJA 1GVRA 4C6BA 1YXDA 3UG8A 3EGJA 4ALDA 5A6JA 3N25A 3EOOA 4UFMA 1E6SM 1O4UA 2C6QA 4HMNA 1ME8A 3V75A 1EPXA 3VOIA 1KO0A 2FLIA 4MKSA 1XLMA 4Z0SA 4O1FA 5DRCA 4GO8A 1QXLA 2FZ8A 2H9AB 2XZ7A 4KEMA 5E0KA 3GC5A 1VYPX 2QV4A 1KFJA 1NFPA 2W0UA 3N6QA 4YNGA 4JTTA 1QAPA 3I7SA 4GNJA 5LIWX 1POJA 3SCQA 4LEFA 1PTDA 3P93A 6XIAA 3NEVA 1O68A 3A3WA 2Q09A 4MHBA 4DI9A 1ZQ5A 2QNEA 3F2CA 5BZAA 4HCHA 1VHCA 3TX9A 1MDRA 3QH2A 4QBXA 4DJFA 3HV9A 2HPMA 1GORA 3BARA 4JL2A 2IMRA 3SY8A 1KKRA 1HKKA 5HWMA 5LNVA 4LVDA 1O5KA 5HMFA 4B92A 3E9AA 2OGYA 4WIWA 3RMJA 4J28A 4F9JA 5BMXA 4I5UA 3WDJA 4EPBC 2BHYA 3R94A 1FWWA 3W7IA 5HNTA 2CHRA 2FMOA 2YBUA 1SGJA 4NF7A 4PCPA 5T8GA 3FOKA 4P8WA 5F1VA 1XYBA 3ABOA 1V3MA 3HGJA 3BK0A 1DIKA 2AMGA 1RZMA 5CGQA 4FALA 5CBBA 1LL7A 4J3WA 4JIPA 2B7OA 1V3JA 1JZ2A 4FP1A 4YVXA 5F4WA 4AC7C 4ZODA 1FWBC 3I3DA 3PK7A 4L4LA 1PV8A 5A1AA 4MJMA 1RY0A 2Y8UA 3BMVA 1H0GA 1BYAA 4GIEA 1JZ4A 1TWDA 3AALA 3DYMA 2EG8A 1EJWC 2VR4A 3EXRA 2CPUA 1WBHA 4D6EA 1WO2A 4FIQA 1KWGA 3WMSA 1POKA 1IGSA 1EC7A 2WMIA 2Y85A 1T6MA 2HDJA 1WAWA 3MUIA 3QQ0A 4UTWA 1D3CA 1T7LA 1AA1B 1O1HA 4MAVA 2W6RA 1A47A 4JZ5A 4NAEB 3S1VA 4HVXA 1WDSA 1YTKA 2QJHA 1FHDA 1NOFA 5DCBA 1JRCA 1E0WA 4QLKA 3RCNA 2GDVA 2OOFA 5HXMA 4O17A 3G1RA 1Z41A 3KBSA 2CW6A 4MB4A 3RNDA 4Q7IA 3GHUA 1QNOA 3W7HA 4UTFA 3QY6A 3SCTA 4AWUA 3CK5A 4IJRA 3KZSA 4NUWA 5HBFA 1RHCA 2YA1A 2I7GA 1C9WA 5AYYA 1AODA 1I2RA 4ZFCA 3CBWA 1TIMA 2F8QA 1R9XA 1H7NA 3EA1A 2MNRA 1F6PA 1FKWA 1H7OA 4PMQA 4PCNA 3STFA 3G0XA 2P3EA 1A5LC 1ADSA 4MVAA 5C2CA 1SFJA 2ALRA 1K3UA 2J7HA 3UCDA 3CT7A 2WMIB 4XBJA 1M7OA 3EWXA 3STEA 3H2MA 5JBFA 3V18A 3SN4A 2GVJA 1U5HA 3SUWA 5HMSA 4DYJA 3IGHX 1WB0A 2VQTA 2QQ6A 2OO0A 1XRVA 2O0TA 2JF6A 2HV5A 1B3XA 1BF6A 3VDBA 2OEMA 3TE9A 3GH5A 1ZHAA 4JKMA 2F9RA 4AIUA 3RM4A 1AH3A 2HK0A 3VDCA 4G2DA 4HOWA 1XLJA 4JN8A 1XYAA 1E0VA 4PL1A 2P8BA 2Z1XA 5EU9A 3UXKA 1B9BA 1S5NA 5AYIA 2YCIX 4LT9A 4RE4A 5TQLA 4XO7A 3ONBA 4KWWA 4AC1X 4HKPA 4H2CA 1OFQA 3GR7A 3ISIX 3BLLA 2PWVA 4DXVA 1C7TA 3CEUA 5A6KA 5TNVA 3MANA 1KCXA 3GKAA 3EWYA 4RK8A 3B0XA 3QV8A 3S0CA 3WF3A 2CU0A 4WSJA 4Q8VA 2WZHA 4YHGA 5KZDA 4RZ5A 1TFVA 4HPGA 1TO3A 2XH2A 1WKEA 1NDZA 5EB8A 3IV8A 4M8UA 3UQNA 4IF2A 4MWAE 3RX2A 5D37A 1ZFJA 4JDBA 1GVSA 2E6FA 1F8IA 3M7WA 2WOQA 4WZHA 1KM0A 1GKQA 4K3ZA 3RGTA 1GQNA 1ZBCA 1WYIA 1EOKA 1Q5MA 3ZLFA 3UVIA 1IYXA 4MF4A 2UY4A 4AZGA 5H8MA 3VFLA 2PZNA 4TUFA 3U2ZA 1LTDA 4IIHA 4N9CA 2D0GA 3U6WA 3WG6A 2ZUTA 2DZSA 3KP1A 3TR2A 4B3LA 1KRBC 4RX0A 1J8VA 4S3JA 2R82A 2CLLA 4MY9A 3W70A 3LTSA 1GEQA 5LNRA 4X0NA 3DXIA 4W8AA 8RUCA 2VC5A 1GVYA 3W3OA 3LLFA 1R9YA 2CZFA 3DBPA 4BA0A 4BQ5A 3W7JA 1KR1A 2R1KA 3MSYA 1KLYA 2DEPA 4D6JA 4YS1A 5D38A 3L21A 1TZ9A 5E6ZA 3NFUA 3O0KA 4DBEA 1D3HA 4J2PA 3DAQA 3O16A 3SB0A 3KM8A 3B3DA 2WSRA 4PSPA 4ZOAA 4UNIA 5D9NA 1W8SA 1XG3A 1PE1A 5HJLA 2EF9A 2NQHA 3QQWA 4UMBA 4NILA 1M04A 3V5FA 3VOCA 4LBRA 2CHNA 3QHOA 4GH1A 3R89A 1GHRA 4QE4A 5G2WA 4GJ1A 3RLHA 1J01A 1R3VA 9XIAA 2NUYA 3G24A 4H7VA 3M7SA 1KRCC 3QSRA 4DZAA 3E0IA 1HGWA 1RQHA 3K5XA 4E8CA 5M5DA 2XSBA 1HL9A 3WDPP 3T0CA 4QCEA 4N02A 4I8YA 1EJXC 3VIJA 4L4OA 2Z1WA 3K4AA 3OVPA 3WK1A 3P0WA 1BWVA 3VNDA 2PWUA 2Z2UA 5FSEC 3CWNA 5CGTA 4C6CA 3EX1A 4Y9MA 1JDEA 3SCNA 3HMJG 4C5YA 3ZT6A 3CT2A 3CWHA 3DHUA 1TPDA 1UKTA 2ZX5A 2YLAA 2YXOA 5T9BG 3FJNA 1XGEA 5FIPA 1VD6A 1XGDA 2V0TA 4DPQA 1E1CB 2CIPA 3KBNA 2VEGA 3L12A 3C86A 5CC3A 3G0UA 3B0UX 1Z48A 4QQ3A 3LLDA 2XM2A 4YMZA 3I4KA 4WJEA 4JQAA 3R8HA 2NXHA 3FDGA 4IJBA 2XISA 2GUUA 4JIIX 3OGSA 1C92A 3JW7A 1F6YA 4L9YA 2Q8ZA 2QPUA 1UR1A 5D2XA 2FVKA 1E55A 2POTA 3Q65A 2VRJA 4AHPA 5E9XA 1BTCA 4U2ZA 4DZ5A 4QISA 2VURA 4PUMA 3NL2A 3O2LA 4YTUA 3WQ5A 2QJJA 5ABFA 2PTXA 2I9EA 3UF9A 4ASTA 3N2TA 3CJPA 1KM4A 3QGVA 3WQ4A 1KM5A 3LA4A 3LPGA 4NJJA 2V68A 3W9ZA 2E40A 1ICSA 1FHLA 1RUSA 1YPXA 4XZ9A 1DOSA 3E0LA 2V3GA 3WJXA 1KM3A 3E49A 2NQ5A 2C13A 4Q3MA 2O92A 1QK2A 3ZQ9A 1E1EA 1GEHA 4PTDA 4JD4A 1XCWA 1GT8A 1V5XA 4Y6GA 2FTWA 4PBEA 4QJ1A 2QEZA 1GVIA 1ONXA 3UPBA 1HJXA 1XLDA 1W5NA 2WZTA 4LB3A 1HFBA 1NDYA 2HVMA 4D6CA 2WBGA 4XSLA 4QCFA 4TO8A 3WH6A 3MO7A 2BXVA 3UT0A 4JQ2A 5A6LA 3UZJA 1PKNA 3PVFA 1FTXA 4GVHA 2XIJA 4QG9A 3ITLA 1OFAA 3VGBA 3IACA 1EKOA 1NQ6A 1XD1A 1DJIA 1R47A 4JTQA 4MPKA 2D20A 2J9ZA 1MDLA 3IIVA 2FH8A 4WF7A 4P8XA 3MSDA 5AYBA 1UZDA 3DESA 3PBUA 2VNCA 3LSBA 1GONA 3W2MA 1DVJA 5K7JA 3G1AA 3HQPA 1OK4A 1TX0A 2PCQA 2UBPC 3TR9A 4HNCA 4GYKA 1LLZA 3BICA 3BURA 4GQQA 4M51A 5IRPA 4NRRA 4A05A 4GK8A 4I7WA 1MQQA 1RJPA 3RLGA 1IR1A 1YIXA 3WLHA 4HA3A 1JPMA 1D8CA 4MUPA 1W6TA 4FIRA 5G1TA 4DHGA 2EEXA 3KEHA 4RZ4A 3N18A 3W02A 1IT0A 3HQOA 2XGZA 3GZ3A 4GBUA 3VMOA 2A2IA 3WD4A 3URQA 4TVCA 2C16A 5A8MA 3QPYA 1W9BM 4FAMA 5DT7A 5DT5A 2QCNA 3CAWA 7ENLA 1VF8A 4PMJA 4JYDA 2QDEA 3L5MA 2NUXA 1JCMP 3KBMA 5E09A 4WXYA 1W37A 4ZQPA 1XKJA 2RDTA 3C0JA 3ZT7A 3OBEA 4KKXA 3APTA 1QPOA 3E5BA 1HO1A 2WPBA 2J27A 4O19A 2YCLB 1MXSA 2BV9A 1GJPA 2UY2A 2IXUA 1N2VA 1CLXA 2EPLX 1CGWA 1BXBA 3T8LA 2Y70A 2V5KA 3TNBA 3MSRA 3PTMA 1JGMA 2CCRA 1KLZA 2OTDA 1JDFA 4M3PA 4X9SA 3UR5A 1FFQA 1CCWB 1X7IA 4TV6A 5BXPA 4N9EA 2Z1VA 1W1B1 4FZIA 1MW1A 4UTIA 1PKMA 1ECQA 1EFZA 4QJ5B 3ZWSA 3MP5A 4HZ6A 4E5TA 1LDCA 3MBDA 5G5IA 3GH7A 2ACQA 2IKIA 1VBUA 1GYLA 3DG6A 3AYRA 4WY0B 1MI3A 4M24A 3MTWA 2ATMA 1GKPA 4F0KA 3XISA 3BG5A 3VFCA 1TELA 1OSEA 5DXXA 3T78A 3TROA 2WM1A 1JCXA 3DKJA 5K9XA 1DQWA 3C2RA 3IAPA 5AC7A 2I16A 3LEPA 1JPIA 2GOKA 3W1PA 4EPDC 1D3GA 3R8GA 3AXMA 3B0YA 4K68A 3D46A 4TIMA 4F3HA 2R1NA 2C1IA 2WKGA 4Y9AA 4I5XA 3F2DA 3JZUA 3L68A 3LV5A 3WBAA 4PMRA 3BAIA 3OVQA 2WV8A 2BGNE 2E77A 3W76A 1H7WA 4HN8A 3MPGA 1G4EA 3OU8A 3CPGA 1VBGA 3H21A 2VL4A 4H9ZA 3A64A 3S1UA 1XRSA 3CTTA 1V3LA 4WK9A 2I9UA 3GBEA 4HGXA 1B90A 5EFDA 5EFFA 1HL2A 2NX9A 3LENA 3S5OA 3WKZA 1U30A 5K4ZA 1BGGA 1KQZA 4GOAA 3S6TA 3UGRA 1P7TA 1Y5WA 3PTQA 4EAMA 3TYEA 5BOEA 1NWSA 4FX8A 3WUBA 2GFTA 2PP3A 2RDUA 2ZUNA 3QQ1A 2JGQA 1NP2A 3KZPA 3R79A 3PSVA 4LAZA 3BV7A 3WBEA 1RCQA 1F76A 1TR1A 1PIFA 1E6QM 3WJSA 1M5WA 2PWEA 1P6BA 4O11A 1O12A 3I4EA 3SAZA 3ZLGA 2VEIA 4L1WA 4PE8A 1I9CB 3QKEA 5ABEA 3CMJA 3GXDA 3LHWA 4DB7A 4GC3A 5GVJA 3QY8A 5CPLA 1R7AA 2ZRVA 3KBJA 3LQLA 2OZTA 1JDDA 5ECUA 3FXYA 2R94A 3TN3A 4PCFA 5C70A 3H4XA 3TC6A 4M7TA 3A4WA 3TW7A 3RYSA 4NYYA 4RNIA 2DZAA 1JFXA 2FZDA 3EKLA 3MKVA 4LFYA 3FA5A 4CN4A 5BNKA 4PN2A 3RRXA 5A6SA 1PTGA 4EXBA 3PFMA 2YA0A 5I02A 3R6IA 4B3ZA 5KINA 3D6NA 1W0MA 1ELSA 4HT3A 2Y8KA 3L0NA 4ZZ9A 4RJEA 1WKFA 2P0OA 5DY3A 3OW1A 5XIAA 5EKYA 5B80A 4DZIA 2XGIA 1MRQA 1LOQA 2X1RA 4ES4A 5FEWA 5I03A 4RW5A 4AD0A 1DJNA 2CBVA 1YPFA 3O6YX 2FH6A 4MWAC 2EBNA 5KZMA 1EJRC 4LAUA 1HKVA 3BW2A 4B5TA 3DX5A 1GYNA 1UR0A 3GX9A 2IPWA 3CS2A 1XIMA 2XVNA 4MLJA 3NSXA 5I23A 1MQRA 2Z0IA 2Z25A 1NAL1 4UQAA 3ID7A 3N1AA 3C3NA 4KWVA 1K6AA 3W2KA 2YYTA 1XDMA 2OXNA 4ADSA 3N9RA 4LSBA 2WPGA 2GQAA 2ZUMA 1S2AA 4LEQA 4A3UA 5D9PA 4FF7A 1L6WA 2OMAA 4Q8TA 3SGUA 2NZLA 1ZJAA 3W74A 1A0CA 1RD5A 3TV8A 1LCOA 3AJXA 4PTMA 1YX1A 3D0CA 4AHOA 3F4CA 1ZJBA 4C1LA 4LNCA 2Y62A 2VD8A 1DIDA 4REQA 1MO0A 4JTKA 3HZ3A 1E5NA 5A6TC 3B9DA 3RRAA 1YBQB 5DMNA 3RN6A 3VPLA 3O1NA 4S3KA 5FAJA 2VGFA 5REQB 1CZ1A 5IHSA 3G1DA 2Z28A 3SUUA 3VYLA 5BWAA 3PPHA 2OCZA 3H12A 5KMYA 5AC4A 3R25A 3QR0A 4O4VA 5ECVA 1I60A 2X2GA 3BLPX 2G3IA 1ZSXA 2R1MA 2YDSA 1JXKA 1DQXA 2SFPA 1PWMA 3CV7A 3AOFA 3RPDA 1XXXA 1OFPA 1Y65A 2WCGA 4P61A 5H8PA 2ZZ2A 1EWEA 3KBVA 3B04A 1L6YA 5FESA 4XX6A 2BFGA 3BVJA 4PTXA 3KL5A 1JEZA 3FHQA 3OGVA 1UASA 4UQBA 3V35A 1K6WA 3WZ0E 1H51A 4AWTA 3UW6A 1Z89A 3FAXA 1TV5A 4DM1A 2VRKA 4FO4A 1QATA 3EDKA 1FDYA 4REQB 2PD9A 1UP0A 2NQZA 2WNZA 5D05A 1OC5A 2MUCA 3GLCA 3CHDA 1AFSA 1HQTA 1UKSA 4MDOA 2VR5A 1F3XA 4TX6A 2ZX7A 2BS9A 2O55A 5E0FA 5BRQA 2A1YA 4PFHA 1P5BA 1X7FA 2YDAA 2QUUA 1W5QA 2ODOA 4WLCA 5FAGA 1DXFA 1QFEA 1CGXA 2QCDA 3NM3A 1CXFA 3ALFA 3T8QA 1SJCA 4C1NB 1JD7A 1X39A 4LVGA 5IXEA 3AYTA 1WCGA 1WUFA 1DXEA 3AISA 1H7RA 1UD3A 2TMDA 4X0VA 1WZMA 5LIKX 4QAWA 3TQ0A 3MCNA 3BV4A 2REQB 1Y0EA 3BSMA 4KWSA 4GXPA 3M5VA 3KAOA 4L4PA 3EWWA 1H0IA 4E2DA 4LBUA 4GGHA 4QXIA 4MWAA 2HQAA 3G2GA 2BG5A 1QHOA 3RAOA 5LIUX 4LV9A 1YPIA 1JZ3A 3RR4A 1R87A 1WDDA 1RLDA 3DFYA 1DJZA 1QK0A 4HOXA 3V5OA 1WZLA 4PCTA 1XC6A 3CL7A 2PU0A 3OA5A 3FNDA 4OBTA 1ONEA 1X8FA 4FPSA 2XINA 2EAWA 1QPNA 2Z1SA 3G18A 2XH4A 4HIBA 1A5NC 4PH6A 4OKDA 3S6OA 3DBNA 4NZ5A 2QCDB 2BSLA 3A6OA 3G1HA 1OC7A 3CEPA 3OA3A 4GHRA 4KF1A 2D3LA 2XZ9A 4P5UA 1SU5A 1PSCA 2XGBA 3QW4B 3EOUA 1FKXA 2OQLA 2PFHA 3BGGA 4EVZA 1JAKA 4Z2LA 4FNRA 5BRBA 1V51A 5I3FA 3W88A 3EDJA 3LHTA 3TXZA 3SDOA 3AZSA 4M81A 3VE9A 2OGJA 2VFGA 4GIYA 1VC4A 1WZKA 5J8LA 5L6UA 1GJUA 2FJUB 3UVAA 3CL6A 3FIGA 3BLOA 4B5UA 3IUDA 3KHJA 3MKKA 4C7FA 4S3CA 1SO3A 1JXJA 1EBHA 1J9YA 4F2UA 1PEZA 1GOKA 1G4TA 1HIZA 5BCAA 1EGMA 2A3AA 2QULA 2J7EA 1JNEA 3UU0A 3IARA 1S5WA 4HU4A 3PZTA 3P61A 4DO4A 2DUZA 3OG2A 5U4NA 3S2LA 5HJYA 3ZVHA 3UZWA 1E6NA 3CYJA 3QR1A 3S5NA 1EF2A 1C8YA 3RM9A 5LNWA 1ITCA 3E12A 1BKSA 3LV6A 4EK7A 5AHMA 3EMQA 3R0DA 2Y8VA 3H55A 6ENLA 1E73M 3KW3A 4FEZA 4AG0A 2PLCA 2YPIA 3GVQA 4IMFA 1TV2A 3H24A 2VOMA 2WKLA 3AHZA 3AC0A 4JN7A 4AVFA 3AXHA 4MSSA 1TPVA 1TRDA 2PURA 4J7RA 3HFYA 3SURA 1A5CA 2DY3A 2YJQA 1MUCA 1V79A 3TN6A 3QLLA 4YCPA 4PUDA 3AICA 3B9AA 3PBMA 3GSMA 1OY0A 3ABQA 3DFOA 1XYFA 3MUY1 4C6EA 1QBAA 4ZXOA 2QVHA 2ZQ0A 4F66A 1E43A 1BG4A 4AZCB 2F2KA 3CQJA 4DWDA 5C7VA 1WXYA 4UXDA 3GR8A 3LLXA 5BXTA 1BD0A 3N15A 2W5FA 3GD6A 1R2SA 2J4GA 4I6KA 3P5YA 4Z1YA 1QOXA 3ZVHB 2DUAA 3UCQA 4IMCA 4H9YA 3E0WA 3THDA 3E74A 1A5UA 3W27A 4N6EA 1GVFA 4JFVA 3S5YA 3LBOA 1OD8A 1A4MA 1TPH1 1E0XA 3WX7A 2BY1A 4GE8A 1UKQA 3N19B 2PMQA 4ZSUA 4KCUA 1B3ZA 3NYDA 2GZXA 1VBRA 3JZEA 4OUIA 3W7NA 3Q2DA 4JTAA 2GUYA 2Y89A 3N4FA 3K13A 1E4LA 3LI1A 1EO5A 3WNMA 1EDGA 1VFOA 2GL5A 2X0YA 2QCCA 3U4FA 7REQB 1MYRA 3TCSA 4JHMA 2FKPA 5BRPA 1G9HA 1AL7A 1LRTA 1CWYA 2EG7A 2WMJA 3TA9A 1VEMA 3DZ1A 1MXGA 4W4QA 4MMWA 1S46A 2D22A 2DGAA 4J1OA 3HPZA 5FSDC 3H4GA 4ZFMA 3W23A 3UYCA 3GG7A 1JQXA 3ZWTA 3PHAA 2GDUA 4JX5A 1EC9A 5LIXX 5HJXA 1DJYA 5AC8A 3S9YA 4GJJA 3JR2A 2OEKA 4V28A 2YXGA 4GZ7A 2IQTA 3QGAC 3UETA 1Q13A 2JF7A 1C91A 1CXIA 3WQDA 3S1WA 2Y7GA 4R9OA 1Z69A 1UR3M 1IWBA 3I65A 1KB3A 3MDWA 3T2PA 2OZ8A 4UIOA 5AYZA 2ZUWA 4Q8WA 3P3BA 1MNZA 1SJBA 4I90A 3RCYA 3N6JA 4LV4A 1AJZA 1Q8AA 1Q6QA 3RDKA 3TQKA 1HJQA 4J4KA 1VB9A 2XIIA 4GWEA 1P6CA 3IUIA 4M0XA 1UIPA 1KFLA 2FFCA 2V5DA 4Z2IA 4ZEPA 2OVLA 2VVSA 3U2CA 1TVNA 4OE7A 2WZMA 4ADUA 3ZR5A 2JGYA 4LF2A 2OG9A 4LQ1A 1T96A 3KDNA 4B16A 4X61A 3W1MA 1W1TA 3BQ6A 2OWWA 4K1WA 3SUSA 1AH0A 1ZTVA 1V77A 4H3DA 4L6HA 1UUMA 3WD0A 3VIHA 4HNUA 3KVLA 4AHQA 1I8JA 2XU2A 3EWDA 2WANA 1W1ZA 3MWCA 4KIRA 3XIMA 4KWUA 5C7HA 3N2XA 2NXGA 3NL3A 1UH4A 4IGNA 2WCAA 4ZTYA 1B30A 4JHOA 5AZ0A 1JCLA 2YL6A 3SGGA 1EXPA 2VX7A 1P43A 2XSAA 3NDZA 1R6WA 1N7KA 3MVTA 3IVTA 4YCOA 3VDAA 3G1VA 4QGCA 1CLVA 1TR9A 3DUGA 2VMFA 1ZU8A 1E71M 1Q4NX 4G6CA 3N2MA 4NU7A 1XC4A 1QI5A 1J0YA 4XVDA 1JYVA 1G4SA 4F4RA 2KZHA 2O9RA 4IQJA 3KX6A 4ZXLA 1DHKA 3EWBX 1N8FA 2AGTA 2CNCA 1QMLA 4WGHA 3HB9A 1LQAA 1KFCA 1F73A 1M6JA 3IVUA 4EWJA 1P1MA 3L0KA 3TONA 3ZR4A 3K8LA 3BAXA 2WAGA 4QDMA 3DFSA 5EMKA 3PAJA 1W91A 1K8XA 2OT0A 3W6YA 2DSKA 1CB7B 4V33A 1W9PA 3GVRA 3VC5A 3P6LA 3HQ1A 2J25A 4IWWA 4AISA 1J18A 4ACYA 4NQ1A 4UBPC 3TQVA 2CZ5A 1IEVA 2DT2A 1I4NA 1BSLA 4Q4QA 1UUQA 1XF0A 1PIGA 3MYOA 3ES7A 3OQEA 4S3DA 5CLTA 2WSYA 2V2CA 2BXYA 2E4TA 4AB4A 1KRAC 4HB7A 1G1YA 4GFIA 3C61A 3W07A 4LXFA 4PL2A 3K4WA 3ITCA 3CUFA 4S1FA 5CBIA 3TW9A 2FFIA 3QRHA 1DKWA 5HA7A 4L5ZA 4ZR8A 5FF4A 3MQTA 5ABTA 4B4FA 1LRQA 1MXDA 1VLWA 3OLDA 1EIBA 1VFTA 4RKAA 2C15A 4L61A 5D9MA 3IRDA 3SBFA 3RXZA 2O9PA 4FX6M 4RZ6A 2VR2A 3WQEA 4IICA 5D02A 4IFKB 2DFAA 4HN4A 5CG7A 3SCWA 3A9BA 1KC7A 5JH1A 3AJ7A 4Q8UA 5AHIA 4UMAA 4NY2A 3EAUA 5DBTA 3CZGA 2F61A 4BKNA 3LCGA 1ZUAX 1TWWA 4YHEA 2OSWA 4JR5A 4XO6A 2ICSA 5EBAA 3SCRA 4QX4A 1K02A 2X42A 1Z3NA 3W7LA 1J5TA 5HMEA 3KCLA 3DG3A 4NJGA 2DQXA 5D9OA 2Z26A 1H1NA 2DVUA 4ZB0A 3CWOX 2ZA2A 2A3LA 1KBKA 1AH4A 3A3XA 4EOUA 4U31A 4AZHA 3AIVA 4UTMA 4ATDA 3NO5A 4WCJA 5LKYA 1DJWA 3T44A 2VRQA 3BWWA 1OT2A 2WNWA 1UJQA 4XVEA 2IKGA 2D1ZA 2R8WA 4V2XA 3T08A 4LC6A 2AOSA 3XINA 1MRAA 4CD7A 2GJLA 3NL6A 1FWEC 4N4QA 4ZA0A 4ENLA 2NT1A 3LPOA 3SADA 4DEFA 2AKMA 3KRUA 3GW0A 4AD4A 4H41A 1JYNA 4W8BA 3U7BA 4FNPA 2R1PA 1MUWA 3PP7A 1L8PA 4E3VA 4TVDA 2NXIA 1YDVA 3VINA 2D2GA 2ANUA 4U3CA 3KL3A 1V7AA 4F9DA 2X16A 2OEJA 5LXEA 4QP0A 3UZZA 5LZLA 2WNNA 4TTGA 4JFWA 1VKFA 3P62A 3NVDA 5A6AA 4LCRA 3EMCA 3TTSA 4AYSA 3EWUA 2WO5A 1J6OA 2BVWA 2PBGA 3B4YA 1PYMA 1DL3A 3UG4A 2FPYA 3E1F1 1GQLA 4RDZA 1QI2A 1WP6A 2E5BA 3A5FA 2PF8A 4IIBA 5GQBA 5BYWA 3DHDA 3F03K 3OB8A 1WNOA 5G1YA 1T40A 4D1IA 1XR2A 4EANA 3UZYA 2Z7GA 3W72A 4O8AA 2VCAA 2OB3A 3BAJA 3ITTA 3NDOA 3TK7A 3D47A 4JEQA 3C0LA 2B31A 2X1UA 3NUKA 2EXOA 3EPMA 4AZIA 1EO7A 3ES8A 2QDHA 4XAFA 3IPWA 1XKYA 5C9ZA 1OYBA 2QCHA 3WQ8A 2J7BA 4W8LA 3Q94A 1OCJA 3M07A 2E28A 1A5BA 3IJQA 1K8YA 2VEFA 2OQYA 3TMQA 3UZ5A 3ZSSA 3THUA 1LOSA 2YBTA 4AWSA 4RV3A 2BY0A 4MB1A 3MHGA 4BEQA 2FHBA 3LHYA 3VD7A 4LJ3A 2ZX9A 1ZBKA 4A22A 3PN8A 3UJFA 2NSXA 1YE6A 8A3HA 1F8MA 3YPIA 1SJDA 4LUTB 3P82A 4YLWA 4PR4A 2PDJA 1AZ1A 1Q2SA 4ILSA 2ZRYA 3AIEA 4S39A 3RHGA 5KZ6A 2YCEA 3MUCA 1OEPA 4H6QA 3B8IA 3DFHA 3C4UA 4BWLC 4JTEA 3AZRA 4CD6A 1DWIM 3CNYA 2QAPA 2DT0A 4O52A 3B9EA 2RAGA 5CC7A 2FQIA 1JDCA 4WDXA 1WDRA 1M41A 1ISVA 4EWND 4JTFA 3WQCA 2PDLA 2I5GA 1UG6A 4IFRA 2ZXBA 3TTOA 1J5SA 3AS0A 3WLKX 1XV8A 4QG8A 1H2JA 1HZYA 1IIGA 3EX2A 2CERA 3SCVA 2G3NA 1YEYA 4XKMA 4ACZA 2ZZ7A 4JTUA 2E6AA 4YXGA 1N82A 1UR4A 4Q33A 5HATA 3PUOA 3ANYA 3UJ2A 4RL3A 4GI6A 1G5AA 1E51A 2ZVIA 2X2YA 2PTYA 3QY7A 4XZHA 1UCWA 4AD2A 4PMYA 5J04A 4FOUA 3P81A 2PEVA 5TBOA 4GBDA 4WHBA 2JEQA 2WNQA 3F7JA 4RXFA 4MFEA 4HHMA 4XSMA 5FEZA 3IJ7A 4B3KA 4D8LA 3H2NA 3ARRA 3NCOA 1LF1A 2Q3RA 3LQGA 4GCXA 2ZC8A 3SIZA 3M0IA 5H1WA 4EPKA 3S5SA 3WLTA 1BAGA 1F05A 1WA3A 3VOJA 2QIWA 1JIBA 1VQTA 4DUOA 4IP7A 4PCSA 3QM3A 4G1NA 1Z9AA 1IIHA 5C9UA 2UV8G 4R34A 1YADA 3UNTA 3ZSTA 2WSKA 1PKLA 4AEEA 3ATYA 4N9DA 4AH7A 4A2SA 3GC4A 2J24A 3URBA 5B7ZA 4DO5A 1HGYA 4JCLA 5D2TA 2GQ8A 4QM1A 4LRSA 3AHVA 4LU0A 4DF2A 1QPRA 4JY9A 2HISA 3RM8A 4XD4A 4UQEA 4LAOA 1T8QA 1VHNA 3SCOA 1RP9A 3WLOA 5DFAA 2BOEX 1TPB1 3NURA 1ZBVA 4XIMA 5GJPA 4XIAA 4GUGA 2P53A 2PODA 2PDQA 3AMKA 2WBKA 2YLLA 4LY4A 4GZEA 4AW7A 4NJIA 4JXCA 2D2OA 1K9TA 2VX6A 4EAYA 1UWAA 2RDXA 1V02E 4CVUA 1QI4A 2FPVA 2V2HA 5FJUA 4ZENA 3HF3A 5F7UA 3FA4A 4IZGA 2DJXA 3ANUA 1XBYA 2WHLA 4LYKA 3HO8A 2YDQA 3BGAA 1IR2A 2DV0A 3U2EA 2ISFA 1V6WA 3CMFA 4Q6JA 1QCWA 3CZKA 3UESA 3L4VA 3QEZA 1UOKA 3CUXA 5EBUA 1YNQA 1SJAA 1F4AA 1YXYA 4JQ4A 3TYDA 1XLBA 4KFNA 4N7QA 4DLFA 3HFTA 2PTZA 4H8HA 4Y9PA 1YTDA 4BWLA 2NQ9A 4MY1A 4FXSA 3QHMA 3PG8A 4M6QA 3VKKA 1MFUA 1VBHA 3VOFA 4GI9A 3SGZA 3B8VA 3S8HA 3M0LA 1B31A 3VXGA 3THAA 3CZJA 4FR1A 4OBRA 3LS9A 4QNEA 1J0KA 2A7RA 4G56A 3A47A 3SY1A 3K1GA 2GJPA 1DWJM 4E6MA 3P2VA 1J96A 3IIPA 2V5LA 3B9NA 3NXFA 2NQJA 4QTGA 1SM9A 2XSXA 2EKCA 5K9CA 2CBJA 2PWGA 4XAZA 4UOJA 5I5RA 1W9XA 4DUWA 3TSDA 4Y7EA 4QAIA 3HU7A 4EXQA 5GNXA 2PU1A 2W3ZA 1V6UA 5K2ZA 2Z4GA 1J79A 4NP7A 2DT3A 5C0QA 4HZ7A 4IJCA 2DH3A 4O0QA 2X30A 3FW6A 4JHZA 4A6GA 1QI3A 3N3TA 1CLKA 1V0MA 1RVKA 2ZCGA 4LX4A 1DTNA 1RBLA 5DCDA 3WLJA 1ZALA 2GK1A 4GD0A 3E2SA 4NJHA 1K4HA 4AQLA 3L5LA 3R8RA 5A3HA 1NARA 4W93A 3L66A 4HMEA 2YA2A 5AZ1A 3FX4A 4H6EA 1LM1A 1R46A 3CB8A 3WFLA 5MHBA 2XVLA 5BWFA 1M1BA 3N11A 4PFMA 1KV8A 3GU2A 3KOZA 5HNUA 2PC8A 2J47A 3PUGA 4US6A 1TPWA 3O05A 1CW2A 4GFSA 4DPPA 2QGYA 3ERPA 3LCIA 4D8AA 3LM3A 4XK2A 3UY8A 5LNUA 1NIUA 1OYCA 1CXKA 2PP1A 2BX7A 4L6DA 4UFIA 5C9XA 1E5JA 1UB3A 1DWFM 3LNPA 3RO6A 3VNKA 4HPJA 3U57A 3NA8A 3EOSA 4F0RA 4JIEA 5I06A 3BLDA 3THQA 1H50A 3TVAA 3S9IA 2FIQA 4N6FA 3V7PA 3VZZA 2DP3A 2GK1B 4WOQA 3CGTA 4ZOCA 4NAFA 3BC9A 3NPWA 5RUBA 3LGGA 2C1HA 1XI3A 3WENA 1WZAA 1GZ1A 5BU6A 4N9BA 2VO5A 4J3TA 3MUZ1 3C52A 3WFZA 3UFYA 3VNIA 1XBZA 3WLNA 4QLLA 4DRSA 3GAYA 4H00A 4U2YA 4FLOA 3MVIA 4KEVA 3AIRA 4CU6A 3E2QA 4RW3A 3WN6A 3WSUA 3WLQA 4GY0A 3KOWA 3MJYA 3GXMA 3LHUA 3SO7A 3WH9A 1LWIA 4XZIA 2PE4A 2VDHA 3BG3A 3CQ0A 1WXJA 3W25A 4ZQCA 2WMKA 3CH9A 3TP4A 1F07A 2PDHA 1FWCC 1VEOA 4AY8A 2WJDA 4JIHA 3AFBA 3W87A 3SJNA 5CAKA 1KM2A 3NQ7A 3EDDA 4UR7A 1U1JA 3JS3A 3SZ8A 3EMZA 2PDXA 3BUVA 4DELA 3GAKA 3O8AA 3G0SA 2OYMA 1FQ0A 4LCQA 2I14A 1EBGA 1CPUA 4MTVA 1TRIA 1Q6FA 1K77A 4E8DA 1CNVA 1FWAC 4QSFA 4S2CA 3QYQA 4NAFB 4Z1BA 3H7RA 3KS5A 3ARVA 3KLLA 1F7BA 5HMDA 4INFA 1TSIA 4EPEC 1HVXA 3W73A 4IIEA 2DZPA 2I5IA 1BXCA 1ZP3A 1RA0A 1GNXA 3FV9A 3MU7A 4O0KA 1B57A 4TOQA 3LRLA 4OHQA 4NZ1A 3GE7A 1SW0A 2DT1A 3WLSA 4J3SA 4GUIA 1CXEA 1T41A 5AHEA 4JEJA 3N2OA 1DP0A 1Q4WA 3PY2A 3SUVA 3VOHA 2DZVA 3GZAA 1LL6A 3NIYA 5I3JA 3W37A 3FLUA 2HS8A 3CTLA 4OUEA 1TUFA 3G6LA 3MMWA 4K8EA 3ITVA 3WF2A 2X7WA 1J12A 1UROA 4NNBA 3VKDA 5ABHA 2VEKA 5JMUA 4Z17A 4GYJA 2ZTKA 4LAMA 2VGBA 2ATSA 3KL0A 1C9DA 5A8PA 3F5JA 1B4EA 2GVLA 1E4IA 4GY1A 3WEOA 3EPNA 4YJ5A 1XLGA 4IGMA 5DMLA 3VDGA 4D6IA 2AMXA 4NL1A 1M68A 1V3KA 4HMCA 1S5VA 4JTCA 2QDGA 2BOGX 5CZSA 4KQNA 2HPIA 3TAOA 3TQPA 3NNTA 5LSMA 3WCZA 1Q8JA 2FHCA 3A24A 2RUSA 2BHZA 1FFRA 1UMLA 1OF8A 1XIBA 2BY3A 2DVXA 4KWOA 3I7QA 1PS9A 3GHSA 4C6FA 3GXTA 2KX9A 4C6OA 6A3HA 2POZA 2WYSA 4UOQA 5CPTA 3OYXA 3PPGA 2BODX 1FDJA 1Q6LA 2G97A 2VXNA 2ISWA 3S46A 3DFNA 2QUTA 1F6KA 1KA9F 4WEVX 1ZAJA 3GHTA 1FWGC 2I57A 3G1FA 4G5DA 1TPUA 3PAOA 3UCCA 3FHAA 3M16A 5IDZA 2AQWA 4UWMA 1GQKA 4KBXA 2HSAA 3NO3A 5I24A 1OX4B 5DX7A 1AK5A 1JI1A 1REQA 2X40A 4GCAA 5BOFA 1UA7A 4JFSA 3VMPA 4DM2A 4OZOA 3SRFA 3R1ZA 1KCLA 5JBDA 5CPQA 4NHVA 5MF5A 4OWGA 1GYMA 3SR7A 1TREA 1KFWA 5G4WA 4LYRA 4MPQA 1EZ2A 3W7EA 4CQ8A 3R12A 4AMAA 2PWHA 2F84A 1FHVA 2ZUSA 2R91A 1HKWA 3MUAA 4XZWA 4HU8A 2C0HA 3ZYZA 1HP4A 4Q8MA 5H6HA 1VJZA 2P8CA 3E02A 4J9JA 4O1EA 3JVAA 4RV8A 3UR2A 3W00A 3ZMRA 1XIGA 4JL1A 4U5IA 3W82A 4UTHA 2BHUA 1S1PA 4YTSA 4Z1AA 2OSYA 3L4UA 7XIMA 1SZGA 3GVWA 3II1A 4XTIA 2YSWA 2XDFA 1F9CA 1UD4A 2WC7A 2H9AA 4CEXC 4AUBA 3OZMA 1LWJA 1L2UA 3V0SA 3N29A 3PG9A 4X2RA 3UD6A 1A5KC 1V0LA 5KEZA 3WLIA 2E25A 3QYSA 4B9YA 2Y6ZA 2PB1A 4W84A 1B3YA 3JUGA 3FKRA 1FX6A 1M01A 2XVPA 1REQB 3F4NA 3NTYA 3AWNA 4MJZA 1T0OA 2EGZA 2ISSA 3WD2A 1MEIA 2OZ0A 4C6KA 3CO8A 5KTLA 2PP0A 4LUYA 2JE8A 5FJTA 3GIYA 3CUIA 3VIKA 2NLYA 3Q4DA 1R3TA 3I7RA 1DPMA 3MP3A 3UR7A 1LYXA 1RBAA 4NX5A 1P4CA 4RNJA 3Q67A 3M6YA 2NX3A 3VNJA 1FXQA 4NVTA 1L6FA 3VK5A 4D6DA 3AU6A 1OBAA 2GOUA 3WL1A 4GKLA 3F4VA 3SCUA 1OT1A 4Y90A 3M64A 3WDIA 3NPXA 3KDOA 3WQPA 1XLEA 3C8NA 4AWEA 1HJSA 2WMHA 1TCDA 4WJXA 4WR3A 2J79A 2Z1BA 1GOXA 2NV1A 4C6NA 1RA5A 1DORA 4TMBA 4QEHA 1HP5A 2FTYA 2EPNA 1IT7A 4X9YA 5E5CA 4ZVJA 1EH9A 4PSRA 4AZ7A 2V8ZA 3GXPA