5AB3A

S.enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
247
structure length
241
Chain Sequence
MIIPALNLIGGTVVRVVRLHQGDYARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGVSLEQLVETYLPVGLKHVLCTDISRDGTLAGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar cubana str. 76814
total genus 78
structure length 241
sequence length 247
chains with identical sequence B, C
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ab3A00
5LNRA 1TJRA 3TK7A 3MJYA 5LHFA 4N4PA 4AH7A 2E68A 3L65A 1FQ0A 4MZ1A 3QMRA 4A3UA 2FPVA 2GQ8A 3NZ1A 2ZFAA 3TH6A 4DELA 2WSQA 4GXMA 3W7RA 1H51A 3SY5A 1ICSA 5J5RA 3WJSA 3KVJA 3Q94A 3G1VA 5D04C 1SO4A 3ANYA 3CHVA 4OT7A 7TIMA 2JGYA 3ABQA 3TQVA 4IOTA 3G0SA 4H4IA 1QPOA 1KFJA 5MHBA 4ADTA 1KW1A 5HQEA 5HNRA 5LKYA 3B03A 2QCLA 3LHZA 5L6UA 5F4WA 3L0NA 4RLIA 4GRSA 3W73A 4LS1A 4O13A 4DO6A 4UTTC 4JTGA 2QR6A 4MJZA 3W1AA 1LRQA 3OG3A 1IIHA 3INPA 2C0AA 3QJAA 1ZENA 3JR2A 3TC6A 1H50A 2ZZ5A 2IQTA 2QCGA 4NZFA 2A7RA 4O28A 3M5ZA 1X7FA 1BTMA 3BG5A 3QEZA 4HKPA 2GPTA 3A9IA 3UPWA 1QMLA 1OX6A 1WAUA 3QMTA 4GUHA 4PFMA 4ADSA 4CCEA 3NO5A 1VCVA 3QW3A 2DZPA 3W3OA 4CLMA 4AF0A 3QPYA 3VCRA 1DOSA 2G95A 4O14A 4UNKA 1YXDA 4FNQA 4IWWA 3TW7A 1LRNA 4MKNA 4NJIA 1S5VA 3W7CA 3F03K 4O4VA 2ZZ2A 4S2BA 4MVAA 5TIMA 4QNEA 4UTHA 5DLCA 2H8XA 3ZS4A 1UUOA 4O57A 3NXFA 2QKFA 5DCEA 3L2IA 3FIGA 1W3NA 4QNWA 2V5BA 2NV2A 3RF9A 1TV7A 2QCDA 2F7FA 1Y0EA 1MEWA 1RQHA 5K3VA 1GVSA 5D32A 1KFEA 1K7FA 3F4NA 4A22A 3T55A 4NU7A 1KFCA 3QW4B 5EYWA 1K8XA 3HOJA 3DXIA 1H7PA 3KVLA 5D2VA 2VEPA 1YDNA 4Z1DA 3WFAA 3M6YA 1I2OA 4JR5A 1JCYA 4O1BA 3ATZA 3KRZA 3UYCA 4IJBA 3HGRA 4LVDA 2J9XA 4HSNA 3W7EA 4ZVJA 3E0IA 1EWDA 4ML9A 3MP4A 4N6FA 4QSHA 1YDVA 2ZBTA 4ICNA 3HBLA 3D0CA 1XXXA 1KM1A 3HF3A 4JTSA 1OFBA 4OU1A 3VI2A 2JK2A 3G8EA 1HFBA 1XCFA 2GVGA 5DXXA 1H63A 4NJJA 3LCLA 1SPQA 4RZ6A 2CLLA 2ZTKA 2XN2A 3V75A 1G4TA 3FJ6A 3NQ2A 4IX2A 3TMQA 3UNDA 3L5AA 3GDKA 4O0KA 4CCCA 1DV7A 1KV5A 1ME8A 3NQ7A 3S5OA 3W1RA 3IVTA 3PUOA 2QJGA 1OX4A 1P4CA 1UB3A 2YDAA 3S5NA 3TROA 3UY7A 4UTTA 2EKCA 1PV8A 3P62A 2CLEA 4K7VA 5CZTA 1FDJA 2GVJA 3NQFA 3DH7A 4GJ1A 4AAJA 1KLZA 4O16A 2PRMA 5HJLA 3JS3A 4CQ8A 2Y85A 3S1UA 1OF8A 3IVUA 3THQA 4WOZA 1OG0A 4N4QA 1DJQA 3TXZA 3BPWA 3MP5A 2QCMA 4IMGA 2DZWA 2P0OA 4BK9A 2ISWA 3P81A 3GAYA 3HG3A 4LOCA 3GDTA 1OF6A 5LSMA 4EVZA 2NWSA 4Y9AA 2R14A 4E38A 3LBMA 1RD5A 2W0UA 1SZNA 5K9DA 3GXNA 1M7PA 4LTSA 1KFKA 3R5EA 4RXFA 4XKYA 5I3GA 4JN6A 1ZAJA 1W56A 2C13A 1RZMA 3EWZA 1K3UA 4TX9A 1JCLA 1EUNA 1TPDA 3LDVA 2E6AA 3MHUA 4N9DA 3TQ0A 3G1HA 1HTIA 1GOXA 3T7VA 5EA9A 4CQAA 3LCHA 2VFHA 1S3HA 1JQVA 3TA6A 3DI1A 1F6PA 5AC7A 1FDYA 2WNNA 3W2MA 1EPXA 3B8DA 3EX3A 5H91A 3PWAA 3E12A 3VE7A 2W79A 3NQ6A 5T26A 1JVNA 3NOEA 1T99A 3W7DA 1XM3A 1YLVA 3OVQA 1WDWA 2DZXA 3GDLA 1L9WA 1T0OA 1QR7A 3EEGA 3P7YA 4FXSA 4CNNA 4LUJA 1Z42A 1TTIA 3LHWA 1TIMA 1KFLA 3R89A 2VEIA 1MXSA 1YPIA 3EXSA 1H62A 1XC4A 2A21A 3W1LA 4O52A 1TPFA 4PA8A 3PC0A 3CT7A 4PEKA 3PG9A 4QM1A 2Y88A 3N3MA 1FWWA 1LDCA 2EGZA 1QDSA 5D02A 2BWGA 1F6KA 1R2SA 4IX0A 4S1FA 3RFAA 5CPMA 3GB6A 4K38A 5DBTA 4I9AA 5AYYA 3M41A 1JR1A 2ZCGA 2QJHA 3E96A 2ATSA 4DF1A 2OZ0A 2QCCA 3R8RA 1XDMA 4AB4A 5HUPA 4PCFA 3CTLA 5EY5A 5CGQA 3W2KA 4BF9A 3N2XA 5EMUA 3UWWA 3A21A 2X1UA 3GLCA 3NM3A 4FIRA 1UASA 3LBCA 4HNVA 1W5PA 3M0ZA 1J2WA 3HGSA 3B0PA 1LCOA 1HO1A 4L4MA 3BW4A 4Z0JA 3STCA 1KM5A 2JKAA 3OIXA 1OK6A 1NSJA 2ZDRA 4JTFA 4DBDA 2EHHA 2E5CA 1K7EA 3IVSA 1GVOA 4WQ6A 3CM4A 5FF7A 4QITA 2ISSA 3G1DA 5AC6A 3L68A 5A5WA 3LCGA 2NXHA 3GDRA 4YL2A 1XFBA 4Q33A 2NV1A 4UFHA 4RX0A 4ZQRA 5FEWA 4UFMA 3G0XA 4LWWA 4XWUA 2EF9A 3W7NA 1RQBA 1RQEA 1W1ZA 3TW6A 3GVGA 1XBYA 4A2RA 3P60A 3LCIA 3BVJA 3KFTA 1W37A 1VYRA 4HNTA 2E5DA 1OABA 1XUUA 1YADA 3NPVA 4UR8A 4IMDA 3LHVA 1NEYA 5AHEA 4LS2A 4NNCA 2Z2UA 3OEXA 1NFBA 3P84A 5F2IA 2GVLA 3C4UA 1JRCA 2VC6A 3LTYA 5I3HA 1HG3A 1PCWA 4E2DA 1K8ZA 4QIUA 2G5WA 4UUIA 1DL3A 1PIIA 3IGSA 5CPNA 1OFRA 5LGZA 2X2GA 2RDWA 3Q2DA 3T4CA 3N9RA 3WJZA 4AF0B 2WSYA 3M44A 1FXPA 2R91A 1GTEA 2Y7EA 1F7BA 5CSSA 1ZAIA 3IIXA 1LOQA 2A7NA 1H7WA 3CEUA 4ORIA 3P8JA 1ICQA 5CPOA 2C16A 3EKZA 2VFGA 1SW7A 3F1QA 3DFOA 2C15A 3HJZA 5LZLA 4UNLA 5BOOA 2QCDB 2HMCA 2Z1BA 2Q3OA 4GNJA 2X30A 1XBZA 3LXBA 4FO4A 3DU0A 4N9CA 3EWBX 3DFPA 4AWUA 3DI0A 2VENA 1WBHA 4N9BA 4FEZA 3G22A 2NXGA 2A5HA 5FI8A 3BLFA 4JICA 3FOKA 1LRTA 3P80A 2VEMA 3O05A 1R47A 1Q45A 3PBVA 1SO6A 4K6AA 3QM3A 3SFKA 3NL2A 3W83A 5D37A 3W7JA 1YXYA 4LC8A 1EWEA 2CWNA 1L6SA 1TTQA 1SZGA 3OHIA 2ZRWA 1NF7A 4JGDA 4MY8A 3EWWA 4IPJA 1TPVA 1KFBA 3N34A 3NGJA 4G1KA 4ZZ9A 4MLJA 3DFSA 4NUWA 3A5FA 4GC4A 2E5BA 3WJWA 4EF8A 1B57A 1L6YA 3L0GA 2NXIA 2YPIA 3GK0A 5LNVA 4HIBA 3S1XA 3B0VC 4Y96A 2J6XA 1TPB1 1LTDA 2BZNA 5IBXC 4AEOA 3NQVA 1CW2A 3MMTA 1FWNA 1HUVA 4YWIA 4DF2A 2E09A 3C61A 3FJLA 1M5WA 3W7LA 3GYEA 1A5CA 1WX0A 1Q6RA 3A5VA 4EWND 4ZQPA 1OX5A 1LLWA 2AGKA 1OX4B 3M5XA 4HHPA 2Y89A 3QZEA 3EX1A 4ORMA 3MI3A 1QNVA 1SW0A 2EAWA 3NNTA 4JIQA 5HR6A 5AFDA 4MLRA 3IIZA 3R2GA 5KITA 1G4SA 1WOAA 3W1TA 1LOSA 3GKAA 2PRLA 1FX6A 2RH9A 2YFNA 1Z48A 1DORA 3DHFA 3M1ZA 3EWXA 3TQKA 2WSRA 4WXZA 3CEPA 2E1DA 4NX5A 2H3BA 1J5TA 3KXQA 5CG7A 4O54A 1BWLA 2C3ZA 3A23A 4UTMA 4TMBA 1O5KA 4DO5A 4Y6GA 4ZMGA 3AJXA 2YXGA 1YDOA 3EXRA 3FFSA 2J27A 4UFKA 1A5AA 1TTJA 5F2LA 2C18A 5E0KA 1V5XA 1SFLA 4XKYB 3SIZA 3NM1A 4FX8A 3M5YA 4YMZA 5AYXA 1THFD 2P1FA 3C0JA 3CPRA 4Z1BA 4O12A 5DY3A 3C2VA 4NQ1A 3FLUA 3LRKA 4TIMA 3FS2A 2RKXA 1PVNA 1SFJA 5EKYA 2R94A 2DZVA 5KZDA 1SO3A 3HG4A 1FCUA 2GOUA 1OVDA 5K2ZA 2WNQA 5G4EA 1EP2A 1TV8A 1IXQA 3NPXA 1FY6A 3P82A 4JTKA 5F2MA 4UIOA 4O8RA 1K02A 4FHAA 1KBIA 2ZA1A 1ADOA 4UMBA 4WXYA 4UTKA 1S5WA 3PSVA 3T44A 3B05A 1GTHA 5FEPA 5C6MA 3BARA 4GUGA 4O4WA 3TMLA 3S5YA 2NUWA 5DELA 2B7QA 4RR4A 1WOBA 3C8FA 2YW3A 1T96A 1A50A 1P1XA 3I7RA 1UCWA 3FKRA 5DCDA 1FWRA 3TKFA 1LORA 1RV8A 5IBXA 3N73A 5BRBA 2YGYA 1FDZA 2B7NA 4DQWA 1VZWA 3NG3A 4MY1A 3S1WA 3FYOA 3O6YX 5TQLA 4FIQA 4M6QA 4LVBA 1FBAA 2Q8ZA 3IGUA 4E2BA 4MY9A 3B0UX 3W07A 1A5BA 3TAOA 3HG5A 4Z08A 2QAFA 2XFWA 1SSGA 3L67A 3BGJA 3E9AA 3MUXA 4LVGA 4GWEA 2NUXA 3PBYA 4PL2A 5FF0A 2GQ9A 1ME9A 1QAPA 1VLWA 3HPZA 3THAA 2NWRA 3MBDA 1PHWA 1B9BA 4HN4A 5U4NA 3KX6A 4LUIA 4Y8FA 4X2RA 1G4PA 2TPSA 1K7XA 2HTMA 4UCGA 3O1NA 1V7YA 4AVFA 3DFNA 4FXRA 3WK2A 1GYLA 3DFQA 1L6WA 4HPJA 1O95A 1QCWA 3W75A 2A85A 1ME7A 2YYUA 4IQLA 1N55A 3MP3A 1FUYA 5BMWA 2V5LA 2J9ZA 1R2TA 1A5SA 1H60A 1RR2A 3OVPA 1I45A 3UZJA 3PS7A 2AQWA 2VFDA 4TR9A 4CNOA 2FDSA 3MHFA 4KFPA 1T8XA 5HWMA 4UTWC 2CZ5A 3U2OA 2VEKA 4NT0A 5EBUA 2Y7DA 3I6RA 4FF7A 5FEZA 3VE9A 1KA9F 1I2RA 3G24A 3QQ0A 4C1KA 4QAIA 2J88A 3PR2A 3TXVA 4JTJA 4JYFA 2YX0A 2FLIA 5D09A 5EL1A 2V81A 3MI6A 5J5DA 3BW3A 5LNSA 3M7WA 3KHJA 2ABBA 3W1NA 3QRHA 2OT0A 5I3JA 1IGSA 4FX7A 4J9JA 1E51A 4JTEA 5D2XA 1JQXA 1LM1A 4AWTA 4OQVA 1P0KA 3N9SA 3OA3A 4AMAA 3G1SA 4RZ5A 3HPXA 3C52A 2ZRZA 4BI7A 3DKLA 4C1LA 3NQCA 3G1AA 1EP3A 3QH2A 1ZJIA 1ZAHA 3LRMA 3NEVA 4FNRA 3N19B 3GNDA 1G4EA 1KTCA 2Y7FA 1EB3A 4KFNA 5KMYA 1JJKA 3S6DA 1FWTA 3ZFHA 4TO8A 3TNOA 3B06A 4AHPA 3AO0A 4OV9A 1X8FA 5K9XA 4LVAA 2Z6IA 1L2UA 3O63A 5AN7A 3W1XA 3SECA 4OV4A 4DEFA 4CNPA 4JY8A 3GR8A 4RKAA 5AHLA 3LM7A 4I7UA 3W72A 4YXGA 2ZRYA 3G8RA 1TCDA 1C9DA 1VH7A 1JUEA 3GXPA 4O10A 3WK3A 3O8AA 2A4AA 1TRDA 5D2WA 4O17A 1LROA 3TV8A 1BKSA 1DVJA 4R53A 2PE4A 5K4XA 4OWGA 4JY9A 1VYPX 4YLWA 4Q4KA 2ZZ7A 1YPFA 3LCFA 1EP1A 1F05A 3TJLA 2V2HA 1GG0A 4X3ZA 1GPWA 3CU2A 3MBFA 1O94A 4LW7A 4XTIA 1JCMP 1VYSX 3EX4A 2YSWA 1TSIA 3B4UA 4UTWA 3NR0A 2P10A 1XKYA 5K4ZA 4AHQA 4ZQNA 5AOUA 1AW2A 5D2TA 5HINA 5FF4A 3CC1A 4IXHA 1VHCA 1I2QA 4HSOA 3NPWA 4LRTA 2B0MA 3UWQA 2FQIA 1IXNA 3QYQA 3BW2A 4NXSA 3RNDA 1TMHA 1O60A 1ZNNA 2QUUA 4LC6A 2FJKA 4WZHA 3PULA 1Q6LA 3QSRA 4GFSA 5AHNA 1ML1A 3V1PA 2QUTA 2ZZ6A 4BFAA 4UXDA 1GYNA 1XUZA 1OYAA 4X9SA 4MZ8A 1JULA 3TFXA 1AW1A 3G1YA 2Y6ZA 5AHIA 3W7HA 2X1RA 5D05A 1QPNA 1DQXA 2FB2A 5LGXA 1MZHA 2YW4A 4Q32A 3NQ8A 3RK8A 5I3IA 1GT8A 4B5NA 3BGGA 4JTTA 2CW6A 2VFFA 2FFCA 2DP3A 2V8ZA 2VELA 3LERA 2JKEA 2I14A 1I8JA 3LV6A 4EOUA 5DXYA 2DZUA 3EX2A 1QOQA 5D30A 5CZJA 3TX9A 1TPUA 2ALDA 3W7MA 5C5YA 1OFQA 5C55A 1DKWA 1OFEA 5C54A 3KRSA 1PCKA 1G6CA 4M7SA 4WJEA 4ONVA 3GX9A 4NXKA 4OE7A 3CLMA 4JDYA 4O1AA 4D2JA 3A22A 2X16A 1CI1A 1W5OA 3GR7A 3TFCA 3DAQA 1FCVA 3TSDA 4KWWA 2OT1A 3LCXA 4K37A 3H53A 4AWSA 4WY0A 4MIMA 5KSWA 3C2FA 2TSYA 3GZ3A 1TB3A 3W2JA 3CIXA 1X1OA 3N14A 1IXOA 3QPZA 3CWOX 2OMAA 2VFIA 3A24A 4LRSA 5I3KA 3W7KA 2Q3RA 3EXTA 3F4WA 3TE9A 2ZYFA 3HIJA 3FYPA 3W1UA 5GVJA 3S8HA 5G2IA 4JTUA 4U28A 5CZ0A 1HO4A 2VOMA 3PB0A 3NQDA 5FF3A 1KM3A 2DU2A 2RHGA 2ZTJA 5G1TA 1IXPA 1H7RA 4MYAA 3O6CA 5KZEA 3VFLA 5CPLA 3CQ0A 1DQWA 4O18A 3LHUA 1W0MA 3QMSA 3KAOA 2V9DA 1CX9A 2ZZ4A 3T78A 1X1ZA 2NLIA 1U83A 2V82A 1MO0A 1P5BA 4XUGA 3ZWSA 1OYBA 3M43A 1YTEA 1OFAA 3W70A 3TR2A 1B4EA 1G7UA 3W84A 3H55A 4I7WA 1SU5A 3L5MA 3WK1A 3G3MA 6TIMA 3S1VA 2WQPA 4FX6M 4ZL1A 4O19A 4KKXA 4TU1A 5K7JA 1ZY9A 3NAVA 3MYOA 2KZHA 3Q37A 5CKSA 4Z0SA 3TU9A 1MEIA 2UV8G 2A1YA 2PURA 1PHQA 3Q58A 4UTJA 1EIXA 3W7IA 4O0ZA 3KRUA 3TIMA 4M7TA 3STFA 2V2DA 4KFOA 4JDBA 3NQGA 2GQAA 1VRDA 4H3DA 4XQ6A 3PAJA 5KINA 3S42A 5C2XA 3W76A 1KM6A 3W88A 2NX1A 2OX1A 4RCXA 1W5QA 3SI9A 1O5XA 2TMDA 2WV8A 2VFEA 4POCA 1VLIA 5LHEA 1YTDA 1R30A 3K30A 3G18A 1H1ZA 3VKJA 3C56A 5FESA 5D33A 2FIQA 1QOPA 1SO5A 4PL1A 2BXVA 2QF7A 4IXXA 4UTLA 1G67A 3PBUA 3WJYA 1LLZA 1OK4A 1Q6OA 5D03A 1LP6A 3NQAA 5ABTA 2TRSA 4M5PA 4LY8A 4FB7A 3W74A 3YPIA 3NQEA 3O07A 3USBA 3C3NA 5KZMA 1NVMA 2GJLA 6ALDA 2A0NA 4E0CA 4ZQMA 3G0UA 3W7OA 8TIMA 3DFTA 1I4NA 1NAL1 2ZRUA 2HSAA 3W7PA 3NL5A 1H7OA 4RV8A 1TTPA 1DBTA 1SUXA 4O53A 1D9EA 4JTLA 4LS0A 1SSDA 4NJKA 4RJEA 2DJLA 3DHDA 3C2OA 2Y70A 3NVTA 3PBWA 1ICPA 3VNDA 5FF2A 5EPDA 4ADUA 1U5JA 3LTSA 3QSTA 4WUIA 4JEQA 5FEXA 1VQTA 3L21A 4N2YA 2QCNA 2X1SA 3IGXA 1VC4A 1YXCA 4O11A 5BMXA 3MWAA 3LI0A 2CZDA 4UTIA 2E6YA 3GKFA 3M16A 4JYEA 2QDGA 2V30A 1RPXA 4TMCA 4A21A 4N9EA 2O7SA 4UMAA 5IM51 3MO7A 5A8GA 1F76A 1AG1O 3RLVA 5KTLA 3BLEA 3HGJA 3PF3A 2QCFA 4JIPA 4WOQA 4OHQA 4JTHA 2A7PA 5HR7A 3UQNA 4PC8A 3E49A 3GIYA 3NL3A 3PVFA 4DBEA 2DZSA 2OCZA 3W2UA 4QISA 5F1VA 3HMJG 1D3GA 4A2SA 3TJXA 2ZA3A 5L9FA 3SW6A 5D2YA 1TO3A 1H61A 1ALDA 1LOLA 1KTNA 3ELFA 5K9CA 4NZJA 3DBPA 4R7JA 4ZQOA 2HS8A 3GNNA 4NJHA 3WK0A 1BWKA 1XDLA 4K36A 1AW5A 2V0TA 1Q6QA 4MFEA 1B3OA 4ALDA 2J9YA 1FWSA 3LI1A 1ZCOA 2XN1A 3QF0A 4O15A 1TRIA 3STGA 2ZRXA 4RK8A 3PG8A 1FCQA 4XBSA 2CLKA 3LXCA 2ZRVA 2VKZG 2ABAA 3W7QA 4DO4A 3STEA 4GUFA 3EKLA 3SJ3A 4ZQCA 2WJZA 3ABRA 1EX5A 1GVFA 4IMEA 4K39A 3RLUA 1Z44A 1W8SA 3CIWA 3R12A 1GVQA 1TQJA 2QAPA 5G2HA 1C8VA 3OVRA 3P8IA 3TDFA 2DZTA 2YYTA 3O06A 3B04A 4I7VA 3G1FA 4PTNA 2W6RA 3DKJA 4OGZA 1TPWA 4UC5A 3EB2A 3UPBA 1GVRA 4AXKA 5DBUA 1WXJA 2NUYA 3W85A 4DF0A 1N7KA 4IMCA 5HUOA 4FNPA 3GXTA 2ATMA 5U7SA 1EUAA 1KV8A 2NX3A 2C6QA 2RFGA 1VJIA 1B4KA 1W54A 1XBVA 4HT3A 1F5ZA 2PRHA 4LVFA 3UZ5A 2RDTA 1LBLA 2BX7A 3LHTA 5AC8A 3H54A 4PODA 1KBJA 2JBMA 4IPIA 4XBKA 3NA8A 2YZRA 5AHMA 4WY0B 2NZLA 4JNMA 1VGAA 2FPTA 1QO5A 1W5NA 2F84A 5LNWA 4K8EA 2RDUA 1PE1A 2YR1A 4IMFA 2PCQA 1TJPA 2E6FA 3NZRA 2HS6A 1OHLA 1EEPA 3IRDA 3NYZA 2E77A 4FNSA 3IIPA 3JRKA 1G69A 2Z6JA 3TSMA 2WNZA 2H90A 3NDOA 2CLHA 3E02A 1JRBA 4O1CA 5LNUA 2B7OA 1QO2A 1XBXA 2FPYA 3UWZA 5F4XA 4MUZA 4BI5A 2BLEA 4MJMA 2JKPA 1SW3A 1O4UA 2B4GA 2YCEA 4NNBA 3C2RA 3TCEA 3NQMA 3TSBA 1AMKA 4UMCA 2Q8LA 1SZFA 3L66A 3S5ZA 1VCGA 1PL9A 5DY2A 1XL9A 4XTDA 5G4WA 2H6RA 2C19A 4QQ3A 3ATYA 2BTMA 3W87A 5H2ZA 4JX4A 1G7VA 3BLIA 2QJIA 3RMJA 1SZEA 5HWNA 4LV4A 2CLMA 3W2NA 5G1YA 3NL6A 1W31A 3W86A 4LV9A 4UFJA 5TBOA 3LCWA 1SR9A 1GEQA 2QUVA 1LZOA 2TYSA 1D3HA 4O1DA 1TPEA 4JTIA 3HO8A 3BG9A 1OJXA 3FEMA 3HQ1A 3CWNA 4BI6A 3WJXA 5E93A 2Z0IA 1H5YA 3SR7A 4PH6A 4CQ9A 2AAMA 1VR6A 2QCHA 1ZFJA 2X1TA 4YCOA 3LRLA 1OFPA 5F2GA 2FB3A 2D73A 4JYDA 3PB2A 3W1PA 1TREA 4JD4A 3SGZA 4DPQA 3MHGA 2QCEA 2A6NA 1NF0A 3EWUA 2ZA2A 2WPBA 1M7OA 4M6PA 1QPQA 5SWUA 3BK0A 2J24A 2I9EA 2ISVA 1GWJA 3PUEA 4MFDA 4EIVA 3P5YA 3O15A 3W1QA 4DXVA 3ZWTA 4FNTA 4LNYA 5DN1A 1WYIA 3W6YA 1FXQA 3PM6A 2E6DA 1FCBA 4R34A 3P74A 4KWVA 4N02A 4Y90A 2G97A 3DGRA 4LT9A 4MPQA 3M5VA 1J4EA 4U4MA 1YTKA 1UBSA 3W23A 3W9ZA 1K03A 1W3IA 2CZFA 3ABSA 1KLYA 3S9YA 3DENA 3LB0A 2V2CA 3TC7A 3O16A 4UTUA 3QFEA 1GG1A 1OFOA 3P5ZA 1KM0A 3BG3A 3UWUA 2QDHA 1IIGA 2VXNA 3QC3A 3U6WA 1Z41A 4AHOA 2Y62A 3HGOA 4UFIA 3T40A 2G96A 1YYAA 4JX6A 2JGQA 1TYGA 4UFLA 1RVGA 1H7NA 3L0KA 2Y63A 4FNUA 2CLIA 5BNKA 1A53A 4A29A 1JCNA 1C29A 3FKKA 3M47A 2Y7GA 3I7SA 2DORA 3LTPA 1LBFA 3GDMA 3W71A 1WQ5A 4GBUA 1K8YA 4JX5A 4MOZA 4YCPA 3UD6A 3NPUA 1F73A 4RZ4A 4DPPA 5E1QA 3LLFA 3W1MA 3ABOA 1WA3A 2C14A 3GAKA 1JUBA 3C6CA 3G3DA 3IV3A 3FA5A 1ZHAA 3M9YA 4X22A 4BWLC 3CB8A 3IEBA 2EPHA 1JCXA 1LBMA 2H8ZA 4K7YA 3MYPA 1DHPA 5G2WA 1UJPA 5DCBA 3W22A 1VHNA 2C1HA 1X6UA 1GZGA 4HNUA 3C2EA 1MEHA 3O6DA 4UR7A 5I3FA 1AL8A 2QEZA 1M6JA 1P0NA 3R13A 3UWVA 2LLEA 3QQ1A 2NX9A 4GUIA 3BV4A 4JS3A 4O50A 1ZALA 4LU0A 4HNNA 2DJXA 1W5MA 4MZYA 1H1YA 4WD0A 1BEUA 1QWGA 3I7QA 1TV5A 2ZZ1A 3LV5A 2WOQA 3OBKA 3IIVA 3S0CA 3I65A 3P61A 3IIOA 4WY0F 2FTPA 1W3TA 1VS1A 2WKJA 1QFEA 1WBJA 3LOTA 3LHYA 4N6EA 3HG2A 4NNAA 4WX2A 1R46A 3SSJA 5D38A 1SQ7A 1JCJA 3LXAA 4R33A 2O7QA 1VPXA 4CCDA 3LX9A 1F74A 1OFDA 4NX0A 3W7GA 3P67A 1AL7A 1IF2A 4P2VA 2GJNA 1VCFA 3UXAA 1UUMA 4JXCA 1GJPA 1TQXA 4GUJA 2PC4A 2GUUA 3PY2A 3I68A 4L4LA 4W9TA 2CU0A 5BW6A 4S2CA 2ZQ0A 4H6KA 1KM4A 3UWYA 3UY8A 3ZR4A 4XZ9A 1KTBA 2Y61A 1S5TA 1R2RA 5G5IA 1PS9A 5CZSA 1HL2A 4BR1A 1LYXA 3L9CA 4NJGA 3MW7A 4Z1AA 2ZZ3A 2CLFA 3KVKA 1F2JA 2B7PA 3LGEA 1JUKA 2H3DA 5CSRA 3EWYA 3LLDA 5AHFA 3PSWA 2CLOA 3W2LA 2CFFA 2YFOA 4GE8A 1XI3A 4IUOA 5F4SA 3DZ1A 4NVTA 3UXDA 2OJPA 3SZ8A 5HULA 3PUDA 4MYXA 1GQNA 1MSSA 2CZEA 1WV2A 4QJ1A 1AK5A 4Z1CA 1H7XA 5F1UA 3BO9A 4RXGA 1QPRA 3HPSA 1I2PA 3TAKA 2XN0A 5HMSA 4HPXA 1DJNA 3KVMA 1TPH1 3EX6A 3G1XA 3SGUA 2A2IA 1OYCA 3U8GA 2A6LA 1Q3NA 2R8WA 5HWJA 3N2MA 4IGHA 4M6VA 3RU6A 3KOFA 2WO5A 4BWLA 3MI2A 4M19A 4OBTA 2BSLA 4K8HA 1N8FA 5AB3A 4P61A 2I1OA 1KM2A 3L5LA 3TUUA 3HB9A 4EF9A 5AYZA 1TPC1 1ONRA 1I2NA 1EA0A
chains in the Genus database with same CATH superfamily
5LNRA 3TK7A 5C9WA 3SCUA 3UG5A 4NZ1A 3FCPA 3VPLA 3L65A 4HK6A 3QMRA 1OWQA 2GQ8A 2ZFAA 4CKQA 1K1DA 1OB0A 2IXVA 4PSPA 1JFHA 3A64A 3KVJA 4PMOA 3WMLA 3ANYA 1UQYA 2JGYA 2PD9A 3OZMA 4IOTA 4H4IA 1QPOA 1CB2A 3AHVA 5DEZA 5HQEA 3PAOA 2YB4A 5LKYA 2HVOA 2QCLA 3S6OA 4O13A 3CUHA 4P7NA 2QR6A 3EB3A 1ITCA 4AD0A 1B2YA 3INPA 2C0AA 3E0WA 3M5ZA 3QYSA 3OP2A 4KCTA 4LAUA 4ZTXA 3H2OA 4N42A 5JH1A 2X8RA 4IIBA 4RW5A 3R0UA 3U4FA 2DSUA 3ZVIA 2PLMA 2J78A 1VCVA 3W3OA 4AF0A 3QPYA 1G5AA 4LXFA 3V7PA 2J75A 3F5JA 1HKMA 3MB9A 4D6JA 1FA2A 1X96A 1NDYA 5FA5A 5DLCA 3MSYA 4UTHA 5JXQA 3ZS4A 3AS2A 1O12A 2QKFA 2PC8A 2ZICA 1Q6DA 4KRTA 3FIGA 2BOGX 4QNWA 2CHOA 2V5BA 3RF9A 2PODA 1MEWA 3QR3A 1RQHA 5K3VA 3KP0A 4EP8C 1GVSA 5D32A 3GNOA 3WNMA 4MTVA 3WQWA 3F4NA 3HPFA 4NU7A 3ZJ8A 5A6BA 5LXEA 6PTDA 5M5DA 3M6YA 1I2OA 1JCYA 4HOWA 2XVPA 4O1BA 3UYCA 4BQ5A 4XZNX 3IPWA 4ZVJA 1EWDA 1TWZA 4PFHA 4QSHA 3P2VA 1JL8A 1JDFA 3VM5A 4RZ6A 1OC7A 2XN2A 3TMQA 3RJXA 1JXJA 3IAPA 3UNDA 2OQYA 2WZIA 4AFYA 1ME8A 2ANUA 3NQ7A 1XYMA 4J1OA 4U5IA 4BA0A 1ZSXA 3IUIA 3S5NA 4H8HA 1PV8A 5E6YA 1UZ1A 3C3UA 3DH7A 4AAJA 2QJMA 3UXLA 3WN6A 1FH7A 2VZVA 3THQA 3DUGA 3MP5A 3GNXA 3UJ2A 3CHEA 3RCMA 2BVYA 1W1YA 3T08A 2P0OA 4LCRA 2ISWA 5RUBA 2AQOA 2WM0A 3GVQA 2NWSA 2OQLA 1P6CA 4PE8A 3WL0A 3TTEA 1JYVA 1CWYA 3WZ0E 1M7PA 4XKYA 5I3GA 2AOSA 1KR1A 1UD3A 4RZBA 1W56A 4XD5A 1N8IA 4OVXA 3APGA 3PANA 4ZXOA 4ZCWA 4J3SA 3PZIA 1DJHA 1GOXA 4CNUA 3LCHA 2VFHA 5CH9A 1KCKA 2JF7A 2QT3A 5AC7A 4A4AA 2PGEA 1EPXA 3EX3A 1J0KA 3NQ6A 3WH9A 2VX7A 5T26A 1ZJHA 4L56A 1TELA 2C79A 1HJSA 1YLVA 1WDWA 1L9WA 3K8MA 3EEGA 3UGVA 1Z42A 4AISA 2CESA 3QV9A 1XLDA 2PF8A 2XWDA 3FV9A 3AHXA 5REQB 1MXSA 3DG3A 1MUWA 1H62A 1F4AA 4KWOA 4JNYA 1AODA 2DIJA 1HNYA 4GJIA 1JAKA 3PC0A 4DRSA 1FWWA 4G6CA 1LDCA 4F0LA 1QDSA 3GM8A 5D02A 2OTDA 3A3HA 3RFAA 3GB6A 4KEVA 2GSEA 2CBJA 1VBUA 4FMVA 3V0TA 5EMJA 2PTXA 3E0LA 1LWJA 3E96A 2C0HA 2RJHA 2YXXA 1XDMA 4B5WA 5DRIA 4BF9A 3VABA 5AY7A 4AX7A 5EMUA 1Z7AA 1MDRA 5H8PA 1OGGA 3ITLA 4QLKA 2D3LA 4J28A 1LCOA 3SADA 3TEVA 1X38A 2J79A 1HO1A 4L4MA 3BW4A 1KM5A 2BHZA 3ES8A 2ZDRA 4DBDA 3CM4A 1NWTA 1AD1A 4YVXA 4QITA 4HA0A 2ISSA 2KAUC 3G1DA 3GS6A 3KEHA 1EL3A 5A5WA 5M3WA 3LCGA 1QXLA 1Q6FA 4Q33A 1YW1A 4UFHA 1BRLA 3G0XA 4XWUA 4QE4A 5HATA 3LGDA 3QZ6A 4B91A 3EOUA 4ROQA 3AXIA 3P60A 5CBBA 3BVJA 2X0SA 1RXOB 5CXPA 4DO7A 3AICA 4HNTA 2G3FA 2E5DA 3RILA 1YADA 2OFJA 3NPVA 4LS2A 3CS2A 2Z2UA 3OEXA 5F2IA 4CVWA 5E9XA 4PMJA 4TVCA 2DW6A 1JRCA 2VC6A 3LTYA 1PCWA 3BJSA 3LNMA 1RJPA 2G5WA 4GMEA 4JFVA 1DL3A 1PIIA 2ZVRA 4CQBA 2X2GA 3ARPA 1A0DA 3FHAA 4QLJA 3WJZA 3UVAA 4C6OA 4PN2A 4J3TA 2R91A 1GTEA 1RH9A 1ZLPA 2FVLA 4S3EA 3RX2A 1DE6A 2NVDA 3WQCA 1TJ2A 1OIMA 5E0FA 3IK4A 2C16A 4C90A 1XJBA 1V3LA 1XGDA 3DHUA 3F1QA 4GGHA 3A4JA 3DFOA 4GG9A 3KDNA 4UBPC 3HJZA 5LZLA 1Q8JA 4NAEB 1XLJA 5BOOA 2HMCA 1J18A 3SRFA 1XBZA 4DYJA 4IIHA 1MW0A 4Q8PA 4OFCA 1U5VA 3BLOA 2VENA 4N9BA 2GVEA 3PNUA 3SO7A 4AYGA 4I6KA 3TYEA 3P14A 4JICA 3WDIA 4L5ZA 1SO6A 4E8CA 3QM3A 2YLLA 2G41A 3KDOA 2ZRWA 3U7BA 2NT1A 2E40A 1TPVA 2XIOA 2XUCA 4F2BA 1KFBA 4MLJA 3DFSA 2BOFX 4GC4A 2E5BA 1B57A 1L6YA 5LNVA 3WNOA 5E6ZA 3B0VC 4CQCA 1TPB1 1LTDA 5IBXC 4AEOA 3NQVA 1TZ9A 5JIWA 3TONA 4YWIA 3FJLA 4H9XA 3GC5A 1WX0A 3A5VA 4EWND 4ZQPA 4M8UA 4U2ZA 2IW0A 2GUBA 1M3UA 3F4CA 3AMKA 4HHPA 3NSXA 3SURA 1E0WA 2JIEA 1MUCA 3VX0A 3DC0A 2EAWA 3NNTA 5AFDA 4MLRA 3IIZA 4I8YA 5KITA 1WOAA 1AZ1A 2EO7A 2PRLA 1FX6A 2RH9A 2YFNA 1Z48A 1BFNA 2VZTA 3GUGA 4MWAE 1QK0A 3NXLA 3VIFA 3OG2A 3EWXA 1K9FA 4WXZA 5GJMA 4NX5A 2H3BA 2OLSA 1J5TA 1BWLA 3PPHA 1MFUA 3IJQA 3ZT5A 1XHGA 3FXYA 1EXBA 4ZMGA 3AJXA 1AD4A 2XM1A 3GY1A 4S3GA 4UFKA 1ECEA 1FRBA 1TTJA 2XM2A 4I5UA 4P7OA 4PMUA 5E0KA 1TX2A 1DIEA 3M5YA 4LAOA 1P0DA 1QNSA 3C0JA 1TA3B 2XINA 4BY3A 5DY3A 3C2VA 3LRKA 3WNNA 2RKXA 4DAIA 1B31A 3NFUA 5EKYA 3WD3A 3GBDA 3HG4A 1FCUA 2GOUA 1OVDA 4JHZA 3B0YA 5TNVA 3UZYA 5G4EA 1NOWA 2ZE0A 2VZUA 3VIPA 4UIOA 3QHMA 4L6OA 4O8RA 4FHAA 4ZO9A 1KBIA 3I3BA 1CDGA 4R7WA 1ADOA 3T0CA 1EDQA 2Q6ZA 4HPGA 3B05A 1GTHA 1X39A 3MQTA 4WJ8A 4XZMX 2WMGA 2PZ0A 2QJJA 1EHNA 2B7QA 3WMBA 1WZKA 3QFWA 1P1XA 5DCDA 3EA2A 4UQ9A 4GYPA 4F0MA 2R24A 3N73A 5BRBA 4R5EA 3V0UA 4GINA 3S1WA 1EF2A 3VIKA 1KWKA 3FYOA 4GY1A 3AYTA 3TAOA 2V5DA 3CHDA 4AVNA 1MW2A 4Z08A 2QAFA 2DT1A 1E9IA 1XYFA 1K4GA 1XW8A 3DECA 4LVGA 3E9AA 3G2GA 4PL2A 2EPMX 5FF0A 5GJNA 2ONEA 3WIJA 1E6RA 1Q13A 2WANA 3THAA 2D0GA 2NWRA 1GEHA 3MBDA 2OGYA 1A5NC 2WVSA 4PR4A 3BL3A 5U4NA 4MM1A 3R79A 3ITVA 4J3UA 1K7XA 4C6FA 3D3AA 2CWXA 3CO4A 4HPNA 3DERA 4FXRA 3QC0A 3MVIA 3DFQA 1O95A 3ARXA 3AJ7A 5HJXA 2Z7KA 1ZUAX 1HL8A 1N55A 1HKWA 1DTNA 3VNZA 1RR2A 2AQWA 4TR9A 3UU0A 2YL5A 2QIIA 3MHFA 3PK7A 1R87A 2VD8A 1FWFC 3H2EA 5HWMA 4AIBA 4GQGA 4NHVA 1GOMA 2EG7A 4NT0A 5EBUA 1LLOA 3DBNA 2QULA 3S2JA 5FEZA 3J7HA 1AJZA 2OYMA 3POCA 2OYKA 2VRKA 3PFMA 2E7FA 4YU1A 1AJ0A 3VM7A 1DJWA 2J88A 3PR2A 4D6EA 3TXVA 1RK5A 1HL9A 3GC2A 1MMFA 2C1IA 2OWXA 2VT0A 2G4JA 5D09A 4BEQA 5EL1A 1MW1A 1J6PA 1PIGA 5I3JA 5BOFA 1IGSA 1MRAA 1CGWA 4W8LA 1D7FA 1CNVA 5D2XA 3A4XA 1P0KA 4PBFA 5CC3A 4J3VA 3G1SA 4UWMA 3DKLA 4C1LA 4M6UA 5GNYA 3QH2A 3NVDA 3LRMA 3CMFA 4GXPA 4FS9A 3NEVA 4FNRA 1G4EA 1CGYA 1KTCA 3BUVA 3NJ3A 2IS7A 2CBUA 2D24A 2J77A 3SUSA 2CPUA 1W1TA 4DJED 2WHKA 3VCNA 5A2BA 3W72A 4G56A 4YXGA 1UD8A 4O10A 4BEUA 4B4HA 2VI0A 3QR0A 5BROA 4AUBA 3F2DA 1WZAA 3SY8A 3PZOA 4IGNA 3TV8A 1BKSA 2X09A 2JFEX 3QTPA 1P6BA 4JY9A 3PP7A 1Y5WA 2OZ8A 4W7WA 2V2HA 1TUFA 2GWGA 5FCZA 4ZO8A 5JUVA 1GPWA 3NEHA 3CU2A 3MBFA 3W37A 3SEPA 1JCMP 1ZBKA 2YSWA 2YDQA 3OYZA 1E6NA 3O3RA 1HKJA 4YVVA 5HINA 4D71A 5FF4A 1VHCA 1I2QA 4HSOA 3NPWA 2B0MA 4NXSA 1O60A 4Z2HA 4WZHA 2OSXA 5JBFA 4GFSA 1KXVA 3BCDA 2FFIA 1XUZA 1OYAA 2XIQA 3WKZA 4X9SA 1F9CA 3G1YA 3TYZA 3ARTA 1LG1A 2NQZA 4JCLA 3U5YA 4ROPA 1HGYA 4TX6A 3GRIA 4GISA 1MZHA 5I3IA 4B5NA 4HYRA 1M01A 5JBDA 2VELA 4GQRA 4NASA 4M0XA 1E0VA 1I8JA 4P8XA 2DH2A 1XLLA 5D30A 1UG6A 1FVPA 2X1IA 4BF7A 5C55A 4GX8A 5BWAA 1UA3A 4JIEA 1G6CA 1X8CA 3MMUA 4HMNA 4KQNA 3RAOA 3TOYA 8XIMA 4O8AA 3A22A 4B2DA 1CI1A 1W5OA 3C8NA 2BVDA 4FOJA 3VOHA 4Z17A 6ENLA 3TYBA 3TFCA 3TSDA 3LCXA 3GFYA 1FWEC 1EA9C 4O0QA 1JYNA 4Z2KA 4AWSA 2HXTA 4WY0A 4MIMA 4XIAA 1NOFA 2FHFA 1PAMA 3GZ3A 4NL1A 3W2JA 3W26A 3QPZA 3CWOX 1ZB5A 3A24A 3K1GA 4D6GA 5I3KA 2Q3RA 2DEPA 3MU7A 3AQUA 3W1UA 5GVJA 4B16A 4JTUA 4U28A 3G1RA 3WQDA 1NQ6A 1UBPC 2NT0A 4DI8A 2R1MA 2INFA 4GI6A 4DWSC 3OYXA 5AC5A 3MSRA 1KQZA 1XD0A 5I78A 2ASHA 1IXPA 1H7RA 2W61A 1RK6A 3O6CA 1ISYA 1XLBA 4O18A 1W0MA 4FR1A 2V9DA 3THUA 4RW3A 2NQ9A 3GSMA 3WNLA 4P8WA 2HRWA 1P5BA 3ZWSA 3RLGA 2O9PA 4F3HA 1CXIA 2PDCA 3L4UA 3EWDA 1B4EA 1E71M 2R1KA 4H04A 1BSLA 4JHOA 1KGWA 1GKPA 3G3MA 3S1VA 3TQPA 2WQPA 2POZA 4FX6M 4KT2A 4ZL1A 4KKXA 1XSJA 5GNXA 4TU1A 3VZYA 4GA8A 2QHAA 1TJ0A 3N4AA 3QGVA 5CKSA 3UETA 1ZL1A 2XZ7A 2X41A 3EDJA 5E09A 3PZGA 1DHKA 3QKZA 3Q58A 3A12A 4J35A 4GI8A 1XLKA 1BQGA 3L7RA 3NQGA 1VRDA 3L12A 3S42A 3AXKA 1KM6A 2ZVIA 4DLFA 3JZEA 4MGGA 1DXIA 4J3XA 4D6CA 3KOZA 1V3MA 4C5ZA 2TMDA 1QK2A 2OOFA 1VBJA 4ZO6A 3L4TA 1SO5A 4PL1A 4LBUA 2QF7A 1WZMA 4IXXA 3GIPA 4MNJA 3IGHX 3WJYA 1POJA 1OK4A 5D03A 5EMLA 1LP6A 3H26A 3NQAA 3TVAA 4CD8A 2D0HA 3W74A 3UCDA 3NQEA 3O07A 3NZPA 2GJLA 2A0NA 3BJTA 3G0UA 4XVDA 4HHMA 2A3LA 2JIWA 1NAL1 5CQ1A 1WKEA 4MG4A 2A3HA 3I4KA 1TTPA 1RSCA 2F61A 3P6LA 3TR9A 1HXJA 4RJEA 3SCVA 3L4VA 3DHDA 3NCOA 2Q71A 3MUZ1 1ICPA 2CYGA 3VNDA 3S9ZA 1AZ2A 4C1NB 4ADUA 3IV8A 2E1WA 3TYCA 3MS8A 2HROA 2XGZA 3AS0A 4N2YA 1Y8BA 1J10A 1YXCA 1PTAA 1GHRA 4W84A 2ACQA 4MWAA 3LI0A 2VX6A 2CZDA 4TQTA 1YNPA 1UOZA 3GFZA 3FVMA 1EBGA 5HNUA 1UR8A 1ISWA 3WCZA 1E5JA 1LWHA 2VC9A 4MB5A 2YL9A 5ABFA 5IM51 2SFPA 3QHOA 3QGKC 1W9DM 4HOZA 3BLEA 2PZNA 5ENLA 4JIPA 2A7PA 2PDQA 1RY8A 3UQNA 1ELSA 2AQVA 4DZIA 3GIYA 3PVFA 2HWGA 3A3XA 2OCZA 5IFTA 3W2UA 1RA0A 2INZA 3GXIA 3B9EA 4F4RA 3UESA 2OO0A 2ZA3A 4TUFA 2XSAA 1KTNA 3WLIA 1CGTA 4EPDC 2VHLA 2VO5A 2VUNA 2HS8A 4NJHA 2V69A 2NQJA 2X42A 2I5GA 3PPGA 4RK8A 3ARQA 3VKDA 1IR1A 1HJUA 2ABAA 2GDVA 1I1WA 3ABRA 4IMEA 1AUSL 4K39A 3RLUA 1Z44A 1W8SA 4U10A 1TQJA 4MHBA 9XIAA 2QXWA 3P8IA 5ECVA 2XIBA 2PF0A 3TCSA 1UWIA 3COTA 4I7VA 4HJWA 3G1FA 3VVGA 3VD3A 3DKJA 1YE6A 3BCJA 4OGZA 4JIIX 3V5CA 2ON3A 3I6TA 1E4LA 4QCEA 1WXJA 5A6TC 1XQKA 3W85A 2EG8A 4IMCA 3GHTA 2ZUVA 5U7SA 2J47A 1EUAA 2UZ9A 1KV8A 3ABZA 1Q2SA 2PWUA 2RDTA 3SAZA 3WFZA 3WBAA 5IDIA 1CB7B 4PODA 4IPIA 4XBKA 4DXXA 3T6CA 5T9CE 4FSAA 2YZRA 1J6OA 4OZOA 1C8YA 1LUCB 3AHZA 3VX1A 2F84A 4K8EA 2RDUA 2OQHA 1PE1A 2YR1A 1F3XA 1TJPA 3NZRA 2GGGA 1EEPA 4FNSA 2DVUA 3JRKA 2Z6JA 3TSMA 2H90A 4O1CA 1W17A 4RV3A 4EWJA 1TWWA 4XISA 2JKPA 1E1FA 2G8ZA 2R1LA 2XDFA 3BGAA 3WF0A 2YCEA 3C2RA 3TSBA 1F6YA 4FOUA 1V0NA 1UR9A 5DY2A 2AL2B 4XTDA 2C19A 1I0DA 5LYRA 5H2ZA 5D9NA 4E4FA 4LCQA 1DEDA 1XH1A 3DDMA 3R94A 5DMMA 3BLIA 4ICCX 4EK7A 4LV4A 3W2NA 3GHRA 4GBDA 3QV6A 7CGTA 4UOZA 1RD6A 3U2EA 1NU5A 1WCGA 3MA8A 3HO8A 4JKMA 4F48A 3BG9A 4HBKA 1XYCA 4XSMA 4HA4A 3ERPA 2ADAA 3H23A 4PH6A 1ZFJA 3ALGA 3CL8A 4JYDA 4KS0A 3PB2A 3N2BA 2PDHA 2GL5A 2DDXA 2VGFA 3RO8A 3SGZA 3D46A 3UCCA 3UCQA 1JPMA 3KS5A 2ZA2A 2WPBA 3TWAA 4HA3A 4DM2A 2ISVA 4FXFA 4MFDA 3O15A 1S5MA 3W1QA 2JALA 4LNYA 4EPBC 3W6YA 4JTAA 3PM6A 3AU2A 4AIUA 1BHGA 4Y90A 3DGRA 2BDQA 4UZUA 3DOPA 4MPQA 2CKRA 4L1WA 3W29A 3LZ5A 4J27A 3DG7A 2PWGA 3T07A 4MPKA 3CIVA 3LB0A 2EKGA 1AVAA 2WJFA 4N0RA 2PP3A 3MV01 3O16A 1Y65A 3E1F1 4P8UA 2HNHA 4AD1A 1HKVA 1KM0A 2I9UA 2QMJA 1HGWA 3ZJ6A 2Y62A 4YVPA 2EQDA 3HGOA 3IWPA 1I6NA 3DYPA 2JGQA 1E0TA 1POKA 4DWSB 2F2KA 3S2CA 4A8IA 3V5OA 4F9JA 1C29A 3FKKA 1LBFA 1VJSA 4JX5A 1UR3M 4MOZA 3N25A 2XH2A 1F73A 4Q4SA 4KH2A 1H3GA 1HQTA 3W1MA 3NYDA 2C14A 3GAKA 1RBLA 4TV5A 1SFSA 3XIMA 4AZCB 4BWLC 3S47A 2EPHA 1JCXA 1EPVA 2H8ZA 3B40A 3FNDA 5G2WA 4OUIA 1UJPA 3QZAA 3W22A 1VHNA 4NYYA 4CQDA 4J4KA 3C2EA 3O6DA 3WLPA 1M6JA 5CZKA 2LLEA 3N11A 4J7RA 4XUYA 4H83A 4O50A 1X1NA 4XAFA 1ZALA 4LU0A 3CPUA 3GNRA 1GQJA 4XD4A 3WUBA 2XZ9A 3I7QA 4JIRA 2WOQA 3OBKA 3MKVA 1W3TA 1OT2A 2WKJA 3LM3A 4IISA 1QFEA 1DQUA 2OEKA 3VKCA 1IV8A 4JTDA 4WX2A 1JZ4A 5D38A 3RMEA 3LXAA 1VPXA 5A8QA 3AOFA 3O7UA 3H7RA 4NX0A 3W7GA 3EA3A 3BQ6A 3KBJA 4X61A 4B5VA 2GJNA 1XIDA 2J7EA 1GYMA 2PC4A 1JZ6A 2GUUA 4B5XA 3I68A 1XYBA 4D6FA 4W9TA 2CU0A 4J2MA 5AC4A 2BY3A 2GK1A 2IPJA 3KOWA 4XZ9A 3MCMA 5G5IA 1EBHA 1PS9A 3A47A 1RP8A 5CZSA 1FP9A 3QBUA 4BR1A 1K9TA 3IJIA 4NJGA 3MW7A 4Z1AA 5HNTA 2XTKA 3KVKA 2B7PA 3LGEA 4DBWA 1JUKA 2H3DA 3N17A 5CCZA 3LLDA 3OGSA 5AHFA 1ODUA 2CLOA 1TR1A 2ODOA 4LUSA 1ZP3A 2R9RA 3EDEA 5F4SA 4W93A 4XD3A 2OJPA 3SZ8A 2HK1A 1MW3A 5HULA 1XS2A 1IEXA 3PUDA 3WLHA 4M24A 4H9UA 1BWVA 1MSSA 1Q65A 4RXGA 3HPSA 1C8XA 1CBGA 5HMSA 1RHCA 1FHUA 3BWWA 6REQB 1E43A 3SGUA 2A2IA 1OYCA 3TTYA 1CXLA 3GXMA 2VDHA 2G3NA 2A6LA 1Q3NA 1M41A 4IGHA 4M6VA 4ZFCA 3MI2A 1CYGA 3LMYA 3OZYA 1Q6GA 3EWCA 4WJXA 2I1OA 1ISZA 1A80A 1VKFA 4KIEA 5AYZA 2Z24A 1TPC1 1ONRA 4FI4A 1ZP4A 1LL4A 1B3YA 4AEEA 2WVVB 2BMBA 4MKVA 4AH7A 4CD4A 1FQ0A 2FPVA 3NZ1A 2W9MA 3TTQA 4QG8A 1S38A 4IQDA 3KHDA 2W66A 3N9KA 4GXMA 3W7RA 1TJ1A 5CLWA 1CLXA 3G1VA 2GWNA 4XAPA 1SO4A 3CHVA 4OT7A 2XH4A 4LYKA 3G0SA 1QI3A 2DT3A 1KCZA 4GLEA 3RCYA 4Z1YA 1B3ZA 3S46A 1SR0A 3E5BA 2BY1A 3DN5A 3IACA 3W73A 3AZSA 3SUTA 2D23A 4LS1A 4XK2A 4AZBA 3WFLA 4JTGA 3W1AA 1XF0A 1WNOA 1LRQA 3WQFA 2Y5SA 1HZYA 1Q4WA 3QJAA 3JR2A 3RM4A 2IQTA 2QCGA 4NZFA 1S39A 5A8PA 1EYEA 1GORA 1XLEA 1BTMA 5HDRA 3QEZA 2GPTA 1OSEA 2VX5A 4G9PA 1HJXA 4GUHA 1PUDA 4PFMA 5IXEA 4CCEA 2DZPA 4PCTA 2HBVA 4IFRA 4GZ7A 2YKKA 2G95A 3ZJKA 3TW7A 1LRNA 4MKNA 3USZA 4NJIA 1S5VA 4O4VA 2WMFA 1XIEA 1UPMB 2VRJA 4QNEA 3LPGA 2P3ZA 4PMRA 1S2AA 4PB4A 1Y7VA 3HURA 3L2IA 2VL4A 2NV2A 1UC5A 2HPMA 3R0DA 2QCDA 3KUMA 3KWSA 4K2SA 4EKJA 2WMKA 4A05A 2O0TA 3AYRA 1KFCA 5PTDA 1XICA 1US0A 1XRTA 4GACA 5M1TA 3HOJA 3MV11 2OZ3A 3E6EA 5D2VA 1YDNA 4F2TA 2VM8A 3ATZA 4IJBA 4XKMA 1R0MA 5H8UA 1A47A 1C7TA 3E0IA 3WBWA 4ZE5A 2B31A 3MP4A 3CNYA 3I6EA 2ZBTA 4ICNA 3UBPC 1XXXA 3HF3A 5C2GA 1QTWA 1HFBA 2GVGA 1W9VA 4NJJA 3AISA 1IEVA 2NQLA 1SPQA 3V75A 5IFPA 4C6NA 3NSNA 1RVKA 3BJFA 4JIHA 3GDKA 5B80A 1KV5A 4H01A 1OD8A 3TYUA 3S5OA 3BCFA 5HQLA 3W1RA 4MUPA 1UW9A 5D4YA 3PUOA 1GCYA 1ITUA 1UB3A 3UY7A 3DGBA 4UTTA 4AY1A 4AU0A 5MKGA 3P62A 1E15A 2CLEA 3U7VA 4DN1A 5CZTA 1FDJA 2GVJA 3NQFA 4B5TA 4JPGA 2PDWA 1UKQA 2PRMA 3GTNA 3EPNA 1TZZA 2FMNA 3IVUA 2FHCA 2G3IA 1XX1A 1K8CA 4YTQA 3GTHA 3TXZA 3BPWA 1TE6A 4AZ5A 4IMGA 3B8TA 3CZ8A 2DZWA 4BK9A 3GUWA 1OF6A 1C9WA 1VRXA 4C6MA 1A4LA 1OZMA 3LBMA 3SQMA 1RD5A 3O2LA 4E2VA 2W0UA 1SZNA 4LTSA 2OOGA 4RXFA 4RNHA 4JN6A 2ZXAA 2VX4A 1T41A 4Q8WA 3EWZA 3EDDA 1K3UA 3GXFA 4TX9A 1EUNA 4LAMA 4Q8TA 3LDVA 4RPQA 3MHUA 4N9DA 3TQ0A 3G1HA 3E2VA 4ERIA 1P0EA 1SM9A 4HGXA 3S3GA 1KRMA 3DI1A 2WNNA 3MC5A 4ECLA 2J8FA 2QNEA 3E12A 5FACA 1NELA 1JVNA 1LQ0A 4DJFA 1L8PA 4FXSA 2YCKX 2C91A 4JQ3A 3VIHA 1TIMA 4DNMA 1KFLA 3PZQA 4WKHA 2VEIA 2BV9A 3SDOA 3VKBA 4QS5A 1XC4A 2A21A 2J25A 1H4PA 1TPFA 2YCLB 3CT7A 4R9XA 3PG9A 3N3MA 4NYUA 2BWGA 3KCLA 1R2SA 2VWTA 4D8AA 4RE4A 1CGXA 5CPMA 6XIAA 1YQ2A 2R82A 4I9AA 5AYYA 3M41A 4QXIA 1JR1A 3WQVA 1SVDA 2PWVA 2ATSA 4ZB0A 2DVXA 2QCCA 5CLTA 1EH9A 5HUPA 3ITCA 4Q4PA 3CTLA 3W2KA 3N2XA 3A21A 3T8QA 1UC4A 2X1UA 4D8ZA 3GLCA 2WMIB 1EDTA 1W5PA 3M0ZA 1J2WA 3B0PA 2OB3A 1Q7ZA 4A8LA 3UF9A 3STCA 4HNLA 4H6EA 4B3ZA 1NSJA 3FYYA 4JTFA 2EHHA 2E5CA 1EOMA 1WDQA 4ZOBA 1CXFA 3IVSA 4YNGA 4WQ6A 1QHZA 5FF7A 3LQLA 5GJPA 4FXJA 4JHMA 3FA3A 5FJOA 2BOEX 3HV9A 1XFBA 2V3FA 3PJXA 3L4WA 3XISA 1EKOA 1P7TA 1XRFA 5FEWA 4LWWA 4IH3A 1GZJA 3CK5A 4GCAA 3GVGA 3TW6A 1OC5A 1W37A 4GCXA 4HD5A 1XUUA 3MDWA 4UR8A 4IMDA 5AHEA 4E2OA 3PTDA 1NFBA 4YTTA 1EDGA 1HG3A 1K8ZA 4PCSA 3E2SA 1GVYA 4A3RA 4MWAD 1UP3A 1PJ9A 5CPNA 4FLRA 4M81A 5LGZA 3RRAA 2OO6A 4AF0B 3QPEA 2WSYA 2Z1VA 1FXPA 1F7BA 5CSSA 2Y8VA 3IIXA 3VMOA 3IJ8A 3MKKA 3EKZA 2VFGA 3LMZA 3VYLA 3CV1A 2C15A 2V38A 4UNLA 4Q7BA 2Q3OA 4GNJA 3FK4A 4H19A 1REQA 1GKRA 3LXBA 2O55A 1SYTA 4FO4A 1GOKA 3EWBX 3UZXA 5I02A 5AVNA 3DI0A 3W4RA 1WBHA 1G94A 3BLFA 2PFHA 3FOKA 1LRTA 4CD7A 4UQBA 1Q45A 2DV0A 1VBHA 3W83A 5AECA 3CQKA 5D37A 2E28A 3H2AA 4S39A 2CWNA 1P43A 2CNCA 2YBVA 3GG7A 1KBLA 3OHIA 3BXWA 3OLEA 4JGDA 3CO8A 3BTNA 3OB8A 4IPJA 3L2MA 4S3KA 4NUWA 3LU2A 1E0UA 2IMRA 1E56A 2YPIA 4Y96A 1GOOA 3QLLA 2Q09A 2PWHA 4REQA 2VYOA 4IG2A 2QPXA 1ADDA 3WNPA 3CBWA 2CC0A 3EB4A 3MMTA 4CU6A 1HUVA 3FHQA 3APYA 3W7LA 3GYEA 1A5CA 1DXFA 2G4FA 2XH0A 3I4EA 1OX5A 1K70A 1KBBA 4WGHA 2Y89A 3P93A 3LPPA 1OT1A 3MI3A 5HR6A 5C7VA 3GVRA 1DORA 3DHFA 4NIRA 1FTXA 3TQKA 1H11A 3CEPA 2E1DA 5DMLA 1GOQA 4LFYA 4WRHA 2QW5A 2WZEA 3IK2A 4S3JA 1A5OC 4U3AA 5F7UA 2C3ZA 4TMBA 1O5KA 3FXGA 4V15A 2QZRA 4JQ2A 4DO5A 4JTRA 3DCPA 2QPUA 1UYQA 4YYCA 3RPTA 3FFSA 4B4FA 3EOLA 1A5AA 2VRQA 5F2LA 4XKYB 4YWSA 3NM1A 3VD7A 4YMZA 2Q02A 1THFD 2P1FA 2BGQA 4Z1BA 4JOMA 4CD5A 4AVOA 4WCJA 2FZ9A 3FLUA 4TIMA 3ARVA 2VGGA 2R94A 2DZVA 2ZX9A 2WNQA 3FVDA 1JPDX 3REQA 1EP2A 1TV8A 3NPXA 3GTIA 3P82A 1UD2A 1BGGA 5FJJA 1S5WA 1HT6A 5FEPA 4PMZA 3BARA 4GUGA 4PMDA 3WLJA 2GSJA 4Q4MA 5DELA 1OBAA 4WDXA 3ZOAA 3C8FA 2YW3A 1T96A 3I7RA 1JCTA 2XSXA 1O5RA 8CGTA 1FWRA 3IANA 3TKFA 2PLKA 1LORA 1RV8A 3LZ3A 1G01A 1IT7A 3EDFA 3M0HA 3VKAA 1FDZA 1JNEA 2B7NA 4DQWA 3NG3A 3B8SA 7PTDA 4I9TA 3ITXA 1C92A 5I06A 2VOTA 3IGUA 4E2BA 4AC1X 3W07A 1A5BA 3HG5A 3FAXA 4GYFA 1QU4A 3BURA 2E0PA 3AIQA 3PTKA 1UIPA 3S2MA 3WLQA 5I00A 2NUXA 4QP0A 1ME9A 5E9AA 3HPZA 1PHWA 1UR4A 2ZUUA 1N8WA 1QBBA 2E4TA 1QHPA 4X2RA 4KBXA 1F61A 1RPKA 1OGSA 3AMCA 4B92A 1B0IA 3BAJA 3WK2A 3W6LA 1L6WA 1C91A 4HPJA 2PI6A 5FIPA 3KWXA 1IHIA 1IWPA 4IQLA 4IL0A 3MP3A 5BMWA 4W87A 2X7VA 1A5SA 3CH0A 3UZJA 3W53A 3PS7A 4LB3A 2XIJA 1GQKA 3RG6A 1DYSA 2FDSA 3V5FA 4KFPA 1AQHA 2Z7GA 2WAGA 2I56A 2HV5A 4AC7C 3VC6A 2CZ5A 1BRLB 4A3HA 4L4OA 4KETA 1E40A 2YCIX 1QNPA 4FF7A 1E4IA 1KA9F 3B97A 3MZNA 1FKWA 3G24A 1XFCA 1BXBA 1E4MM 4JTJA 2I17A 2FLIA 4EAMA 4PUNA 3MI6A 4J3ZA 4F0HA 3M0JA 3BW3A 4EPKA 5LNSA 3M7WA 5AZ1A 2GGHA 2XG9A 1DWHM 2OT0A 1SJDA 1ISVA 4JTEA 2C1GA 1LM1A 4AWTA 1VPYA 4OQVA 3SRKA 3OA3A 1ITXA 3UWEA 3MMDA 2J62A 3E38A 4GKLA 1YKWA 4MB4A 3NQBA 1Q5MA 3SBFA 1EYWA 2J8TA 3G1AA 1H49A 3GIQA 4OBSA 2PBOA 1WDSA 2PD5A 3GNDA 1PBGA 4KFNA 3S6DA 3GVVA 4KRUA 4HA1A 4Q22A 4OV9A 1X8FA 4IGSA 2Z6IA 3O63A 3W1XA 1W2PA 1Z8AA 4IT1A 1F3WA 4JY8A 4RKAA 3WDQA 2PWDA 3WNKA 1PWLA 1CXHA 3ZQ9A 4C6CA 7ENLA 1WDDA 3UXKA 1V3JA 3WK3A 3O8AA 1IR2A 3T8LA 3DC8A 4S3FA 2J13A 4INFA 2XU2A 2OVLA 3IUHA 4LY4A 2ZOXA 4P7LA 3LCFA 1V02A 1J0IA 1F05A 4QCFA 3TJLA 1KKRA 2GSHA 3UYIA 2OYLA 5IOBA 3K46A 3WH5A 4LW7A 4XTIA 3GTFA 4AWEA 3WMCA 3B4UA 4UTWA 3NR0A 1VBGA 2DGAA 2WC4A 3UJRA 3ITOA 1XKYA 1ZBCA 4MDPA 4ML4A 3AXHA 3WLOA 5AOUA 2HNEA 1K77A 5D2TA 3R8GA 3T0AA 3C5QA 3DHPA 3CC1A 4H6QA 4IXHA 4LRTA 1L0PA 3UWQA 2FQIA 1IXNA 2HZGA 3QYQA 5BYWA 4F66A 3VNKA 1Z32X 1JZ5A 1VFHA 1AMYA 3BQ5A 2E8YA 3GG8A 1KGUA 2W91A 1M68A 3V1PA 2JQXA 2ZZ6A 4BFAA 4UXDA 3TFXA 3UA3A 4WKAA 3C2YA 4FPSA 2Y6ZA 4QJ3B 3W7HA 4GD0A 1QPNA 2W4XA 2VQTA 2GJXA 1EC9A 3H4XA 3NQ8A 1OCNA 2CW6A 3UPMA 1A3XA 2FFCA 2DP3A 2JKEA 3E5PA 3LV6A 3ARWA 4GXWA 4MJ4A 3UR2A 2XGBA 4EOUA 4AEFA 1QOQA 2W67A 5I03A 3F4DA 1XGEA 2Z1WA 4J2PA 3W7MA 5C0QA 2V68A 1OFEA 1OG6A 3KRSA 1PCKA 5BXPA 4XIMA 4J3WA 2DZAA 4PRRA 4M7SA 4ILSA 5I6SA 4ONVA 3CAVA 3CLMA 2ZDSA 2X16A 5A69A 1FOBA 3B9AA 3XINA 3LPOA 3CL7A 2P3EA 3DAQA 1H1NA 4K37A 4LYQA 1CGUA 3H53A 4EANA 3C2FA 1TB3A 3DG6A 3CIXA 4B9YA 1U1UA 4LRSA 3W7KA 3F4WA 3TE9A 3T0DA 3I3EA 1RLCL 2IPWA 2E25A 3A9BA 4QG9A 5XINA 3S8HA 5HBFA 3II1A 5AYBA 4Q8UA 1JYWA 3GO2A 4HPHA 1TMLA 1JIBA 2VWSA 1ZZMA 2OSWA 1XSKA 1KM3A 4GZIA 3QY6A 4D8LA 3JUGA 3LN3A 1TMQA 1AQFA 3D5HA 5KZEA 1OIFA 3VFLA 3VDHA 4W7UA 1SJBA 1DQWA 1MDLA 3UA4A 3KAOA 1X1ZA 1KB3A 1YTEA 3U3HA 3TR2A 4BCEA 1OCQA 4CN6A 3W84A 1Y5XA 1SU5A 2PGFA 3L5MA 4ZOEA 1JAEA 4PTVA 1E3ZA 3NAVA 3ORWA 2ZIDA 3Q37A 2OLAA 4KWUA 4Z0SA 1E55A 4WDWA 4IJRA 1P0BA 3B8VA 1MI3A 2A1YA 3N2OA 2PURA 2F38A 2P76A 1EIXA 3W7IA 1EZWA 4L6DA 1E70M 3FX4A 2V2DA 4JDBA 2JF6A 5A2AA 5GQBA 4H3DA 2HJPA 4XQ6A 3PAJA 3W76A 5J8LA 2QDDA 1PZ1A 2OX1A 4GI4A 1IWBA 4YHGA 1O5XA 4KGLA 2JE8A 1KBKA 4DB7A 2FMOA 5LHEA 4HTBA 1R30A 3VKJA 2CLPA 3KBMA 5FESA 2FIQA 3TZFA 4US5A 5IDZA 4UTLA 2X0HA 4YIWA 1IEQA 3U48A 4W5UA 2REQA 4H9ZA 2YXOA 3R8HA 3SCWA 2DUAA 3W38A 1M04A 2ZX8A 1OD0A 3AIRA 1L2QA 4FB7A 3VU2A 3C86A 3FJNA 5D9PA 1M53A 4QBXA 3C3NA 5KZMA 1NVMA 1VIWA 3ZM8A 4I9MA 2VZSA 3W7OA 3DFTA 3AALA 3H4WA 2IXUA 1JFXA 3VIOA 3NL5A 2HCVA 3BSHA 4MDOA 4RV8A 3L4ZA 1D9EA 3RHGA 4PYSA 1UUQA 3IRSA 3BAKA 4D1JA 4NJKA 2DJLA 3F2CA 1V3HA 4Q8MA 3NVTA 4Q8OA 5FF2A 1U5JA 3MO4A 4JEQA 3WENA 4GIEA 2VGIA 5JIPA 7A3HA 5BMXA 2D69A 5EBAA 3GKFA 3M16A 4JYEA 3FJ4A 1P6WA 4NI8A 3PN8A 3ENLA 4LEFA 4K68A 3RU8X 3WH7A 1RPXA 4TMCA 4N9EA 3QQWA 4IM4A 2O7SA 3VGFA 2HE5A 4DNHA 1NFPA 1AG1O 3RLVA 3PF3A 4DJFD 4ZEPA 1QW7A 5LIYX 4JTHA 4S3CA 4PC8A 4W88A 1QI4A 3PPCA 4QRNA 2DZSA 2Z2BA 3VMNA 1FWBC 1X7IA 5F1VA 1E9ZB 3LQGA 2OXNA 2BY0A 3I10A 4RNJA 1LOLA 1UR1A 4NZJA 4US6A 1CIUA 4R7JA 4ZQOA 3GNNA 2CETA 2V0TA 1E73M 1Q6QA 4MFEA 3LLXA 2BXYA 1FWSA 3DYMA 4Q8VA 4PB5A 4XBSA 2CLKA 3HFTA 3LXCA 4JEJA 3STEA 1JD9A 3SJ3A 4ZQCA 3BSGA 2EPLX 1EX5A 1J2BA 3NZQA 4QFUA 3UEQA 4MADA 2WZHA 1GVQA 4KRZA 3CQHA 4HZ7A 5HPOA 5G2HA 3VGBA 3WQGA 1LQAA 3OZOA 4FF5A 2YYTA 4ATDA 3O06A 4Z2JA 4GIAA 3APTA 4PTNA 1I60A 3UPBA 4ZR8A 3PTQA 1DIOA 1WKYA 2HK0A 5XIAA 1N7KA 5HUOA 1XYZA 1Z6KA 2BGSA 1CTNA 1XH2A 1WAWA 5A6MA 3NO1A 1XBVA 2PRHA 1VEMA 3S6TA 4JQ1A 2BX7A 2PU1A 1RJQA 1QNRA 3H54A 2JBMA 3AIEA 3NA8A 4JL2A 5C2CA 1TV4A 4WY0B 1M7XA 2NZLA 4H1ZA 4JNMA 1VGAA 1R3YA 3SCSA 1QO5A 1W5NA 2DSVA 1BG9A 2QYGA 3H24A 4Q8QA 2PEVA 5EFFA 3A4WA 1SMDA 1S5NA 1JRBA 3W25A 2J7HA 2B7OA 3WYZA 4BI5A 5F4XA 4MUZA 1ENUA 1DPMA 5KETA 3CZJA 2B4GA 1KRBC 4IIGA 4LH8A 1AMKA 1SZFA 3B4YA 1XL9A 5G4WA 3WF4A 1KCLA 2H6RA 4KCWA 2GYIA 3AHTA 1PZ0A 3W87A 1QPKA 4PTXA 4R85A 3QHNA 4JX4A 3F5LA 1NWSA 1SZEA 5HWNA 3WD4A 5G1YA 4H8VA 4URIA 4U33A 4PMQA 5HAOA 3W86A 4UFJA 4JQAA 3JZUA 4DZAA 2WZMA 2TAAA 4MB1A 1GEQA 2QUVA 1LZOA 2TYSA 4WDUA 1D3HA 3HJEA 4DJDD 3OU8A 1V0LA 4DZHA 4S3DA 4Z2LA 1KXTA 1O1HA 3R58A 1OM0A 4PRWA 3NSMA 1V4YA 2WMJA 1UIOA 2Z0IA 1V3KA 3IS4A 1EJSC 4CQ9A 1LF1A 2X1TA 1P1MA 2FB3A 4HU3A 4UQEA 4M80A 5A6JA 4JD4A 3MHGA 2QCEA 4V27A 1BG4A 4H9VA 2D2OA 3ALFA 5FL0A 5B7YA 5SWUA 1EJTC 1QNOA 2I9EA 1GWJA 3SB0A 4EIVA 4X60A 4DXVA 2FDMA 4G8TA 3UR8A 3SCOA 4GQBA 5DN1A 2OZTA 1FXQA 2E6DA 1FCBA 4W8BA 3MT1A 2G97A 4LT9A 1K03A 3ABSA 4ATLA 2ACRA 4BKNA 2BVTA 2V2CA 4UQCA 3TYAA 5HNNA 3WG6A 4UTUA 1FWGC 2WSPA 1GG1A 3P5ZA 3I3DA 3NO3A 1VFLA 2VEFA 2Z00A 2VXNA 3QC3A 2IUZA 1X6NA 3KLKA 3SRHA 3WLNA 3VILA 2FTYA 1EJWC 3LNPA 3L0KA 1H7NA 4FNUA 4Z2IA 2CLIA 1UKPA 1XDJA 4PBGA 2PGWA 4TX8A 3T09A 4A29A 5IHSA 4ZENA 1SMAA 3M47A 3LTPA 3ME3A 3GDMA 3W71A 1BF6A 3DIPA 4GBUA 3SCNA 4HNCA 4MNMA 4YCPA 3QKEA 2AL1A 5BXRA 1VPQA 5E1QA 1Q63A 3ABOA 1V51A 1UKOA 1WB0A 4HN8A 4DM1A 1IT8A 3B8UA 1EJUC 3PFRA 1LBMA 4HZMA 4K7YA 4TTUA 3N4EA 4MWAB 4L1GA 1W91A 4MNLA 2C1HA 9XIMA 3BAYA 1GZGA 3QOMA 4CN1A 1AL8A 3R13A 4TXEA 3QQ1A 2NX9A 4GUIA 4NAFA 3H21A 4MMWA 3IJDA 1BVWA 1TFVA 3GU1A 3QOKA 4HNNA 2YBUA 2IKGA 5ABFB 1W5MA 4MZYA 3M0XA 1UH2A 1QWGA 2PAJA 2E8ZA 1TV5A 2Z4GA 3IIVA 3S83A 3KBNA 3I65A 4WY0F 4V33A 4L64A 2F6UA 2FTPA 1VS1A 2ZX7A 2OLHA 2PS2A 1V6VA 3LOTA 4PTDA 4N6EA 4HNOA 2OWCA 1H5VA 2H9AA 1UD6A 4CCDA 1H0IA 3RR4A 5A94A 1S3TC 1F74A 5H6HA 2PTZA 2FHBA 4Q7IA 3SUVA 1VCFA 1UUMA 4JXCA 3ID7A 1GJPA 2PDYA 1U5HA 1PB0A 3PY2A 2HXUA 4L4LA 4NZ3A 2P8CA 1QASA 5BW6A 1NOUA 3UWYA 2QJNA 1S5TA 5EMMA 3L23A 1DWAM 4LQ1A 3TC3A 1HL2A 2GJRA 3R7MA 4LAKA 3M6DA 2ZZ3A 1TZ7A 3GFXA 3D47A 1R9YA 3EWYA 3WDHA 1BXNA 3PSWA 3ZR5A 4IUOA 2V5CA 1VFUA 1Z69A 1Q6CA 3UXDA 2PDBA 1XLMA 3NWRA 4MYXA 1K6WA 3VIMA 2CZEA 5IHRA 3BO9A 1QPRA 3TAKA 2O9TA 4HHHA 2XN0A 4HPXA 4JFTA 1RA5A 1DJNA 3KVMA 3EX6A 5FAGA 2QVNA 2VC5A 5HWJA 1AH3A 2WO5A 4M19A 5FJPA 2BSLA 1H2JA 4K8HA 1N8FA 4Y9NA 3QLDA 1KM2A 4L9ZA 4EF9A 1YEYA 4WGXA 1KWGA 2AAAA 3BZGA 1TJRA 3MJYA 5LHFA 1GPFA 4N4PA 3TN5A 1VEOA 2WJEA 4A3UA 2Z26A 3LENA 1LQ2A 1B3XA 4YJ5A 2WSQA 3E0FA 1H51A 3K4WA 4KIRA 2PDKA 4NZCA 4UOJA 1YIXA 5J5RA 3WJSA 4P5UA 3Q94A 5HXMA 5D04C 7TIMA 3GHUA 1FWAC 3TQVA 1KFJA 4Q6JA 5CPQA 1RCOB 3ZMRA 1NFGA 5HNRA 4F9DA 4HZ6A 1QW8A 3P0WA 5DO8A 3B03A 3LHZA 4RNFA 5L6UA 1E6SM 3L0NA 2BFGA 3CAKA 3SCPA 4IGMA 5CPSA 3R4IA 4DO6A 4UTTC 3WL1A 4MJZA 2PP0A 4GO9A 1HF6A 2D1ZA 3BICA 2ZZ5A 5G4HC 1GJWA 4Y9OA 3WX7A 4O28A 1X7FA 5BU9A 4H9YA 3BG5A 3SQSA 5KEZA 3N12A 1PTGA 3ZR6A 4JNZA 1QMLA 2WVUA 3VOGA 3VCRA 4QR6A 1DOSA 1YXDA 4FNQA 4M3PA 4IWWA 1MRQA 3T2QA 3KCOA 1LL6A 3W28A 1SZRA 3W7CA 3D3FA 1NARA 4S2BA 4MVAA 3UP8A 3AZRA 4IFKA 5LA2A 2H8XA 4O57A 2G37A 1SFTA 5DCEA 1W3NA 4UB9A 1KR0A 3WQ6A 5H8MA 1Y0EA 3VINA 3NIYA 3U57A 4GY0A 1WZLA 1K7FA 3R6IA 4ACYA 1MWOA 3QW4B 1KGXA 1R9XA 2PDUA 1YRRA 2C71A 1H7PA 2WCAA 2VEPA 3ITTA 1H0GA 4C7DA 2J9XA 2E67A 4R88A 3KP1A 4XX6A 4ML9A 3T9PA 4D6HA 4DUOA 2HPIA 1B3VA 3HBLA 3BAIA 3D0CA 1KM1A 1OFBA 1V03A 2JK2A 1XCFA 3B8IA 4Y9PA 5DXXA 4LBRA 4LEQA 3DESA 3LCLA 2BS9A 2CLLA 2ZTKA 3NQ2A 1EEXA 2CBIA 3GYCA 2CHRA 3VIIA 2WHLA 1DV7A 2WCGA 4E6MA 4PGLA 3BMVA 1LJYA 3WF1A 3IVTA 4HCDA 4JKLA 1F07A 3SCRA 2QJGA 1OX4A 1P4CA 3TROA 3T0BA 4K7VA 4OJYA 3WLRA 2YL6A 3T42A 4O16A 5HJLA 4HK5A 3JS3A 5HMEA 2Y85A 3S1UA 4CNTA 1GOIA 4WOZA 3RM8A 3EPOA 2PDJA 2QCMA 3GG0A 1W3HA 3FGCA 3P81A 2R1NA 4LOCA 3SN1A 3PJTA 4EVZA 5FD0A 4X0NA 4Y9AA 3RGTA 1FHLA 4E38A 3Q4DA 5K9DA 4CCZA 1C3FA 1DWIM 1KFKA 3OW1A 1JEZA 4TVDA 2C8NA 4IP4A 5AVHA 2DIKA 4GYKA 4WEVX 1JCLA 3H12A 2E6AA 1VD6A 2Z1SA 4LANA 4ZB2A 1U30A 3T7VA 3WF3A 5EA9A 4AW7A 5A95A 1JQVA 3HN3A 1FDYA 1F8MA 2GK1B 5H91A 3VE7A 1JI1A 6A3HA 2YA1A 3GDBA 2FKPA 3GW3A 1VFFA 3W7DA 1XM3A 2DZXA 3GDLA 1T0OA 3WDJA 1QR7A 3P7YA 3FEQA 4CNNA 4LUJA 1TTIA 2PBGA 3LHWA 3CHFA 3W0KA 4PMNA 1PX8A 2W27A 2WM1A 2Z27A 4LUSB 3R89A 1ECQA 3VNJA 6CGTA 4QS6A 4ACZA 5AYIA 3RITA 1DJXA 2O9RA 4AY8A 3TTOA 3OBAA 4P8VA 4PEKA 2Y88A 7TAAA 2BY2A 1S2WA 3AU6A 2EGZA 5FL1A 4NP7A 4QQUA 1JYXA 4IX0A 5CG0A 4K38A 4X9YA 3VOFA 1EJVC 4H7ZA 5M2FX 1ITQA 2QV5A 2IQDA 3NTYA 2E9BA 2V6AA 3BE7A 4GI9A 2CIPA 4NI3A 4AB4A 4WK9A 3LS9A 1EJXC 3RJYA 3CZEA 2OODA 3UWWA 2FH8A 4Y7EA 3NM3A 4FIRA 3HQNA 1UASA 3LBCA 4US5D 2X40A 1DE5A 4Z0JA 4HYVA 4C6QA 2JKAA 3CLWA 3WELA 2FTWA 3S1GA 4HVXA 1GVOA 1A4MA 4FLOA 3RX3A 4C6BA 1WKDA 3GDRA 4YL2A 2NV1A 1HVXA 4UFMA 2EF9A 3W7NA 1RQBA 1RQEA 1W1ZA 5AZ0A 1XBYA 3KFTA 4H7CA 3Q67A 1VYRA 1S2VA 4HMDA 2ZC8A 4AZIA 1U1JA 3LHVA 4B5SA 3RCNA 3WUGA 2XWEA 4NNCA 3P84A 5FJUA 5A6KA 1FH8A 1PPIA 3C4UA 4HOXA 4ZE4A 4P7RA 3MY9A 1GJUA 1NQKA 1NP0A 4E2DA 1PDZA 4UUIA 2QF8A 1X98A 2VCAA 3CTTA 1OFRA 1V0MA 2RDWA 5A8MA 3T4CA 4DBUA 1GUVA 4LBSA 4XZHA 4QDPA 3M44A 1XLHA 4LJ3A 4CVUA 2OKOA 1LOQA 2OG9A 4X2PA 1P48A 3CEUA 4ORIA 4MSSA 3GH7A 1ICQA 5D8ZA 1SW7A 4X63A 4A3YA 1W3KA 3E2RA 2QCDB 3H8AA 2X30A 3GH4A 1FFRA 4N9CA 4AWUA 1M9HA 1V3IA 2P50A 3WLSA 1S1PA 4FEZA 3G22A 1QNQA 2NXGA 1IZJA 2A5HA 3MUCA 1MFVA 2OSYA 4W8AA 4AIEA 2VEMA 3O05A 1MVYA 3PBVA 5BU6A 2CXEA 4QJ5B 1Q8AA 2C7FA 1Q7QA 5CGTA 4QX4A 3NL2A 2HE8A 3HQPA 4RE0A 4LC8A 1EWEA 1L6SA 1E0XA 1TTQA 4IQEA 3EWWA 4I90A 1XLGA 2OWWA 4V28A 1V08A 3A5FA 2ICSA 4JZ5A 4EF8A 3L0GA 3CUZA 3GK0A 3PBMA 4HIBA 4L65A 3S1XA 4DAFA 2J6XA 5C9ZA 3KW3A 5C71A 1UPPA 4IIEA 1FWNA 3M7SA 4DF2A 2E09A 3WQEA 4OBRA 1M5WA 2MUCA 5T91A 4IPNB 4UTFA 4OOUA 4CGTA 4YHEA 1Q6RA 5CC7A 3ZT7A 1YBQA 1LLWA 2AMGA 3OTRA 5MKGB 4BJHA 3BOXA 2HQAA 4ORMA 3OQ8A 4PUKA 1QNVA 1SW0A 4JIQA 2BBFA 3R2GA 1G4SA 1LOSA 3GKAA 3VNLA 3BC9A 3UT0A 4QDMA 1RY0A 4QHRA 5JQ9A 1AH4A 3KXQA 5A6SA 2FZNA 2YDSA 2XVNA 4I6VA 4ZO7A 1O66A 4Y6GA 4YTRA 1MNSA 3CUFA 2YXGA 1YDOA 3EXRA 1B54A 3M64A 1JXKA 1V5XA 1SFLA 4ZTYA 3WH8A 1ZBVA 3CPRA 2ALRA 5DF0A 4H2HA 4ZA0A 1D7KA 1CT5A 2IKIA 2ZUSA 4E3TA 4A8RA 1OZQA 1PVNA 3HPAA 5IRPA 1JPHA 1MQQA 1PTDA 3AAMA 1SO3A 4R9OA 5K2ZA 1A3HA 2Q01A 4C6KA 3GZAA 1IXQA 3VAVA 4UQDA 2Y5JA 2VR5A 1UWSA 3L4YA 5F2MA 4A3QA 2PDIA 3W02A 1K02A 2YCJA 3EKGA 3SQLA 2ZA1A 4GVHA 3EMZA 4WXYA 1R3QA 3PSVA 1XRVA 3AUJA 4O4WA 4FZIA 2NUWA 4RR4A 1BF2A 4Q3MA 1M03A 3TP4A 3FKRA 1B90A 3W00A 5FJIA 2Y5EA 2XPKA 3ARSA 4YTUA 5HPCA 3QY8A 1R38A 2F2HA 2YGYA 5ABEA 4MY1A 1AA1B 4ZSTA 1D8CA 4A6GA 5TQLA 4FIQA 3AWNA 1FBAA 5BOEA 4L7ZA 4V1XA 2BASA 4MY9A 3B0UX 5D8WA 1XRSA 3QV7A 3VUPA 1SSGA 3GTXA 4UZSA 3BGJA 5XIMA 1PX4A 4GWEA 2OEJA 2GQ9A 2PU0A 1WDRA 1QAPA 1V6WA 2DSZA 3GVWA 4JL1A 1B9BA 4HN4A 3CUGA 5A6AA 4Y8FA 1G4PA 2TPSA 2HTMA 4UCGA 1V7YA 3M0KA 1GYLA 3M0VA 1QCWA 4KF1A 1K6AA 2WWDA 3MSDA 1R2TA 2VFDA 4CNOA 1R85A 4H7VA 1R9ZA 2W3ZA 4JCMA 3T05A 4UTWC 1P7TB 4LUYA 3U2OA 2VEKA 3I6RA 1XV8A 3DEQA 3H4GA 4C65A 1I2RA 4TOQA 3TA9A 2GVYA 1TV3A 4CEXC 3MUAA 3V36A 1EO5A 3QQ0A 4PULA 1KO0A 1XH0A 3BOFA 1T40A 2YX0A 3PJWA 1VF8A 1FHVA 4XSLA 2V81A 3AZTA 3OGRA 3W1NA 2W63A 3E3HA 4CNSA 2Y24A 3EMCA 3RDKA 3HU7A 4FX7A 4J9JA 1E51A 4ZB5A 2EPKX 1JQXA 1OGBA 3TLLA 5DMNA 1YNYA 3PJUA 1U33A 4BF5A 3HPXA 1GW1A 3C52A 1EIBA 3WQ5A 1FWHC 2PDPA 3LSBA 4WHBA 2XIMA 3KCJA 3WO8A 3V3WA 1R7OA 1ZJIA 1HKIA 1BVZA 4AD5A 3MVTA 4HCHA 3S2LA 3N19B 4XZLX 1JJKA 7XIMA 4BQ4A 1FWTA 3H2CA 3ZFHA 3AC0A 3B06A 4AHPA 3AO0A 4LUTA 1EX1A 1L2UA 5AN7A