5AB3A

S.enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
247
structure length
241
Chain Sequence
MIIPALNLIGGTVVRVVRLHQGDYARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGVSLEQLVETYLPVGLKHVLCTDISRDGTLAGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar cubana str. 76814
molecule tags Isomerase
total genus 78
structure length 241
sequence length 247
chains with identical sequence B, C
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ab3A00
3L67A 2NWSA 4ML9A 5CSRA 5FESA 3HGSA 4UTTC 2WJZA 1XUUA 4KFPA 2VKZG 1W56A 4PH6A 4OHQA 1Z44A 3O63A 2ZA3A 3W1MA 2R14A 3BG3A 1WBJA 3N2MA 4Q33A 3BK0A 3UWZA 1VYPX 4JTHA 3G1FA 4IWWA 4PC8A 4K8HA 2H8ZA 3MMTA 2NWRA 4RK8A 2J6XA 2C0AA 4O53A 3NPWA 3UZJA 3SI9A 1MEWA 4WY0B 5A5WA 1VCVA 2BLEA 1YPFA 3UD6A 3A9IA 4O28A 4K38A 4UTWC 3PS7A 3O6DA 3TFCA 3VE9A 5EYWA 1YDNA 2VEPA 1WA3A 1DL3A 2HTMA 4RJEA 2OJPA 4CNNA 1LLZA 3NL3A 3SY5A 2VFEA 1SR9A 1I2PA 2QF7A 1FQ0A 4HPJA 4CCCA 4O12A 1T99A 3LHTA 3B4UA 5KZEA 3JRKA 4IMGA 2RKXA 4GUIA 4YCPA 1S5TA 4GC4A 2KZHA 5F4XA 2CWNA 8TIMA 3VKJA 4UNKA 4K7VA 2QR6A 3W2NA 3LHYA 5TBOA 4AAJA 5BMXA 3Q37A 2E77A 4QJ1A 3IIXA 3IVSA 1XDLA 3PBYA 3EXSA 1OFOA 1GQNA 4QNEA 1KFKA 2PRLA 1YXYA 4RZ6A 5LHEA 3H55A 1P4CA 2JKAA 3NQMA 3BLIA 3G1SA 3C2VA 4TU1A 2ZZ1A 3DAQA 2P0OA 3TK7A 1KTBA 1YTEA 2QCEA 3LTYA 3EX6A 2BXVA 2Y61A 4DF2A 4UIOA 3C2OA 2EF9A 5HWMA 1H7RA 2V2CA 1K7XA 3VFLA 2YCEA 4QQ3A 4ONVA 1C8VA 1TV5A 4JTLA 4M6QA 4O15A 3SJ3A 2NUXA 3DHDA 4DBDA 1SZFA 4GNJA 3B03A 3HB9A 4X22A 4JTJA 4P2VA 1GVFA 4GUGA 3LRMA 1TREA 4GXMA 2HSAA 2YXGA 4LWWA 4IQLA 4A21A 4HSNA 4LU0A 2CLOA 3P84A 2PE4A 3L5LA 5I3IA 1QFEA 4J9JA 1JRCA 3QPYA 5D05A 3NPVA 3B0PA 3NQGA 3W07A 2W0UA 3LRLA 3NL6A 1DQXA 4UR7A 3GZ3A 3ZR4A 1FCQA 3N14A 3A22A 1VHCA 3NVTA 3Q94A 1EB3A 2YYTA 5F2GA 3TJLA 1IXQA 4AEOA 3W7CA 3I6RA 5HWJA 4FF7A 4P61A 3SZ8A 3NPUA 4HKPA 4IPJA 1K8XA 3M47A 4A22A 2Y88A 2QAFA 3LV5A 2ABBA 5DN1A 3SW6A 1PL9A 2EHHA 1G4TA 2G96A 4JTEA 2V2HA 3OVRA 1OFQA 3QH2A 4FNQA 4NNBA 1BEUA 2JGYA 2Y70A 3INPA 3QMTA 1SFJA 3CEPA 3TMQA 3BG9A 1DQWA 2JK2A 4MVAA 5F2IA 4Y9AA 1Q6QA 1IXPA 1OFDA 2H8XA 3HG2A 4GUHA 1XM3A 4NNCA 4FX6M 3P82A 2CZEA 1OYAA 3I68A 1L9WA 5HUPA 3LXAA 1QPQA 1QCWA 1W1ZA 1RQHA 1SU5A 1TTQA 4JEQA 4UTKA 2A85A 2G5WA 4MPQA 4KFNA 5BRBA 4BI5A 2G97A 4AF0A 1AW1A 4GWEA 4OV4A 4O1AA 2G95A 2WOQA 3QSTA 1GG0A 3ZS4A 2J9ZA 2WKJA 4JTGA 3IVTA 2NLIA 4ZVJA 4X3ZA 4K37A 3ELFA 1OX5A 4RKAA 3LXCA 1JR1A 1KW1A 1QNVA 7TIMA 4PEKA 2A4AA 2F7FA 2YW3A 3N73A 1PHWA 3PBVA 4QISA 1F6KA 1TSIA 4UFKA 1EWDA 3PC0A 5H2ZA 1TQJA 3NO5A 2OT1A 3E9AA 1OK4A 1KFJA 1ONRA 4BI7A 4RR4A 3IIVA 1N7KA 4JX5A 1MXSA 2R91A 1FXPA 4NVTA 2C16A 1ZALA 4LV9A 3SECA 4C1LA 4A2RA 1ME9A 4K36A 5AC7A 1TPEA 3FEMA 3SGUA 1FY6A 2RDWA 4S2CA 4GJ1A 5I3HA 3DI1A 4CQAA 1N55A 5J5DA 2WSRA 3NQAA 4OBTA 5EL1A 3QQ1A 1YXDA 2Z0IA 2C3ZA 1GYLA 1GEQA 3A5VA 3DBPA 1H61A 1J2WA 3MYOA 2FTPA 3OEXA 2CLIA 4ADSA 4YLWA 3QW3A 1YADA 1VPXA 4ADTA 4IMFA 2C18A 3K30A 3T7VA 1HO4A 5D37A 4LW7A 4QITA 2Y63A 3QYQA 4IUOA 3TIMA 1ML1A 4FIRA 3CIXA 4IXXA 1R47A 4UTTA 4FX7A 2DJLA 5FF4A 1LCOA 2QCGA 1SW3A 1I4NA 5BW6A 4LC8A 3QM3A 2ZZ7A 5DY2A 1O5KA 4AVFA 3BW4A 2EGZA 3LCFA 5G2IA 3KVJA 2QCMA 3PVFA 3P8IA 4W9TA 2DZPA 4ICNA 2YGYA 4UTWA 1DHPA 1DORA 4IX0A 2QDGA 1XL9A 1XKYA 1FWTA 1B4KA 1G4SA 3D0CA 2DZXA 3DH7A 1KFCA 3EWBX 1TRDA 4I7VA 4UC5A 1LRQA 2FPTA 2X1RA 4PA8A 3U2OA 4CLMA 3NG3A 1RZMA 2QDHA 3I65A 2CLFA 4CQ9A 3PSWA 4I7WA 1YXCA 5D33A 2UV8G 4QIUA 2V82A 4KWWA 1G7VA 1A5SA 5CPNA 4UFIA 4E2DA 1E51A 3PAJA 5FF2A 4AF0B 2FB3A 3MHUA 1Y0EA 4AHQA 3TR2A 4JNMA 3QW4B 3EWYA 3R13A 3W7DA 3W76A 1N8FA 3DI0A 3LTPA 1GVOA 1T0OA 2TSYA 5T26A 2FPVA 1OFAA 1BKSA 3F4WA 3PUEA 3W3OA 1PS9A 1FDZA 5DCEA 2X1TA 2X1SA 1HTIA 4N2YA 1J4EA 6ALDA 3L0KA 2O7SA 1F5ZA 4I9AA 3EKLA 3TXZA 3V1PA 3STCA 3GVGA 3B06A 3I7QA 2YFOA 2B4GA 3PWAA 3GDLA 1QOQA 1H7XA 2CZDA 2E5DA 1ICQA 1X7FA 1LLWA 4IX2A 1FBAA 2AQWA 2IQTA 3CTLA 1TV8A 3MBDA 4ZQMA 3LHUA 3FLUA 4AXKA 1OFPA 4LVFA 3F1QA 1QPOA 4K39A 3TROA 2PRHA 3B0UX 4BWLA 5D09A 5CZ0A 3BV4A 2C13A 4XBSA 1S5WA 2Z1BA 1WOAA 2ABAA 4O0KA 1R30A 2A6NA 3KRUA 3L0GA 3CPRA 2Z6JA 3DHFA 5LNUA 1KV5A 3EKZA 5HULA 3W88A 2E5BA 3HOJA 1VCGA 3LERA 3OVQA 4AHOA 1GZGA 4TO8A 4R53A 2WO5A 1GOXA 2ALDA 3L68A 1DBTA 4TMBA 3CEUA 3THAA 1ZNNA 3O06A 4CQ8A 1KM5A 3Q2DA 5CPOA 4JDYA 1ZJIA 3F03K 3TQ0A 3UNDA 5I3FA 1PVNA 1TPC1 2TYSA 4JY9A 1OX4A 2A7RA 3L5AA 3N3MA 1AMKA 3UZ5A 2V30A 1H62A 4UFJA 2AGKA 5E0KA 2QCLA 5FEWA 3EWXA 4N4QA 2Y85A 5C6MA 3C8FA 3HPSA 2I14A 3L2IA 2O7QA 3CHVA 3QZEA 5BMWA 5AHFA 4MKNA 3WJYA 1U5JA 2VFIA 3ABSA 4UXDA 4WXZA 1UB3A 3M16A 1VRDA 2YW4A 3M5VA 2NUWA 4O17A 1F74A 3N34A 2A21A 3CLMA 3GLCA 4LRSA 3P60A 3PY2A 2RFGA 3T55A 2XN2A 1G6CA 2WPBA 1FDYA 3PB2A 1SO6A 4RXGA 1ME7A 1XUZA 1ZAHA 1I8JA 4M7TA 2VFHA 3WJZA 3HGJA 2QEZA 1Z41A 1H7WA 4FEZA 3RNDA 1M6JA 3LV6A 5KITA 1A5BA 1FWNA 2CLHA 3TSBA 1OYBA 3W1NA 3MBFA 3WFAA 4YL2A 4ZZ9A 4ALDA 5HR6A 3N19B 3BVJA 5AYZA 3GDKA 2WV8A 1LBMA 1L2UA 5LZLA 3VI2A 3W7LA 1B4EA 4AWSA 1CI1A 1FX6A 2YZRA 1AK5A 1GTHA 2ZA2A 1S3HA 4LT9A 4N9CA 2FJKA 1FWRA 5TIMA 1H5YA 5DCDA 2J9YA 5D2WA 2WNNA 3BLEA 4ZQPA 5F2MA 4HNNA 4LRTA 1PE1A 1SZGA 2NXGA 1K03A 4LTSA 4FXSA 4MZYA 2TPSA 4FNRA 3GXNA 1W3NA 4WOZA 4MIMA 5LSMA 1GVSA 1FDJA 2ZDRA 3M9YA 1OF6A 2C15A 1SW7A 1RQBA 3GDTA 1FXQA 2ZCGA 5I3JA 2V2DA 3FYPA 2VEKA 1H7PA 3IGSA 3MHGA 4Z08A 1JJKA 3GK0A 3ATYA 4LNYA 4XWUA 2NX1A 1I2RA 5DBTA 3JS3A 3W71A 1LM1A 4DEFA 1H1YA 1W5PA 1K02A 1BTMA 2JKEA 1FCUA 5D2VA 3W1LA 4Y6GA 5CPMA 3BW2A 4H4IA 2BWGA 1TPVA 3G1XA 4R7JA 4O50A 4OE7A 3C2RA 1ZCOA 3M43A 3N9RA 1TCDA 3THQA 1TJPA 2QJHA 4WD0A 5A8GA 1WQ5A 3TUUA 1R2SA 3A5FA 3NNTA 5LGXA 3CWOX 4O11A 2Z2UA 3UQNA 4WXYA 4G1KA 3S1WA 2X16A 1OX4B 1W31A 4JICA 2HS6A 4O13A 3SGZA 1X1OA 4YCOA 3LHZA 5KMYA 3PUOA 4DQWA 4MZ1A 3C61A 1NF7A 3E12A 4JTIA 3B0VC 1P0NA 2DORA 3W75A 5CKSA 5BOOA 3MI6A 5AC8A 1TPWA 4AHPA 4N6FA 4JTUA 2Y7EA 3BW3A 4MLRA 3HF3A 4B5NA 1TO3A 1QAPA 4ZQOA 4UTLA 2PRMA 3M5ZA 3MJYA 4O52A 4NJHA 3G1HA 2QCDA 3DZ1A 2DZUA 5AOUA 3NQ8A 4BWLC 1X1ZA 2ZFAA 3R12A 4LS1A 1W5MA 3YPIA 3W2JA 1OG0A 4Z0JA 3WJWA 5D2YA 4AWUA 5KSWA 4N6EA 3OA3A 1D3GA 1TTIA 4MFDA 1AW5A 1VGAA 3S5ZA 2GQ8A 3LI1A 1U83A 2ZRVA 4E2BA 3CC1A 2ISWA 5DLCA 1JVNA 3U6WA 4DF0A 5K4XA 2RH9A 1GVQA 1R46A 1UUMA 3BG5A 4M6VA 5G2WA 1H63A 5K9CA 2EKCA 2BTMA 2XN1A 2BX7A 1P0KA 1GT8A 1YYAA 3R8RA 4NJJA 4I7UA 4RCXA 3SFKA 3TAKA 4IMDA 5D30A 1F76A 3VCRA 2VENA 4O57A 3P80A 4GRSA 2B7PA 2ATMA 1KLYA 2E6YA 3ZFHA 5ABTA 2DZVA 3DFPA 3UY7A 2FIQA 1W5QA 2X1UA 1JQVA 1WV2A 1Q6RA 3G18A 2HS8A 3W22A 3L5MA 3W2LA 1QWGA 4LVAA 4Z1DA 1XXXA 3G24A 3LCGA 5J5RA 5DXYA 1A50A 3W70A 1OFEA 1BWLA 4JD4A 4XQ6A 1W5OA 3LBCA 4XUGA 3WJXA 3H53A 2B7QA 1K3UA 2FFCA 3LDVA 4U4MA 3GNNA 3NM3A 4QM1A 3W1QA 4HT3A 4WZHA 2A7NA 4O8RA 1LZOA 1I2QA 4LC6A 1OK6A 3T78A 2AAMA 3NA8A 4JXCA 4A29A 4KFOA 4MY1A 3UPBA 5KINA 1JUBA 2Y7GA 2RDTA 3CIWA 3UWUA 3GXTA 4IMCA 3P61A 5I3KA 4R34A 1VC4A 5C55A 4M7SA 3LHWA 5C2XA 5HINA 3A24A 1YDOA 3IGXA 3PBUA 3NQ7A 3P5ZA 3G3DA 3S42A 2VFFA 5AYXA 3QJAA 1TIMA 3E02A 5CGQA 1OF8A 4EWND 3C3NA 1W3IA 3NL5A 5FEXA 3TW7A 4FHAA 3P81A 1RVGA 3TQKA 1I45A 5DBUA 4AH7A 3P67A 5F4SA 1PV8A 1WAUA 5EMUA 4JDBA 5LNRA 5EBUA 1EUAA 1VZWA 1W3TA 4EIVA 3ANYA 4Q32A 3W1PA 3LCLA 2GPTA 1G67A 2TRSA 5G2HA 4RZ4A 3LCIA 3KFTA 5BNKA 3M44A 3TFXA 3NQFA 3MHFA 5LNSA 5DXXA 3DFTA 3STGA 1H60A 3NQCA 4S1FA 4IPIA 2QCDB 3NQ2A 4TX9A 4XBKA 3KAOA 4YWIA 4NXSA 1R2TA 4KKXA 1QO2A 2Y7FA 3G0XA 3W1XA 4POCA 5CG7A 3W74A 2LLEA 3UWWA 4ADUA 2JGQA 3O16A 2H3DA 2DP3A 3CQ0A 4M5PA 1XBYA 2Q3RA 1DJQA 3TNOA 1QMLA 3PG8A 2ZZ6A 3S1UA 2QUVA 5C5YA 1X8FA 3P62A 1TMHA 2FB2A 1ZAIA 3TCEA 1AL8A 4YMZA 3B8DA 1LROA 2GQ9A 1TB3A 5HMSA 4NXKA 2NXHA 2QKFA 1LRTA 3RLUA 1SSGA 3TC6A 5G5IA 1WDWA 5DELA 1EX5A 4X9SA 5HQEA 4XKYA 3W7HA 1ZFJA 1TYGA 4WOQA 4DPQA 1D3HA 3F4NA 3C0JA 3DXIA 4MZ8A 1A5CA 2ZQ0A 2D73A 3EXRA 1M7OA 1EWEA 5LNWA 1JUKA 3BPWA 3LTSA 1J5TA 2X2GA 4K7YA 4YXGA 3R2GA 2ZRYA 1K8ZA 3E0IA 2H3BA 3LHVA 2NV1A 1GVRA 4MY9A 1G4EA 1UASA 5G1TA 1KM0A 1F7BA 3UXAA 1TPFA 3Q58A 4FX8A 1LYXA 3WK1A 1KM3A 2GUUA 4UCGA 2ISVA 2YSWA 1RPXA 3W84A 3B05A 3CB8A 2CLKA 3HG3A 1I2NA 3PM6A 1TRIA 3DU0A 1NSJA 4CNOA 2DZWA 3DFNA 3C4UA 1IXOA 3GKFA 2QJGA 2VOMA 3S1XA 1ALDA 2VC6A 1FCBA 5CPLA 4CCDA 2P1FA 5DY3A 1B3OA 1RD5A 4UNLA 4UFMA 3W72A 1KM4A 1B9BA 4LY8A 4UFLA 4BR1A 3OG3A 1EEPA 1ZHAA 4DELA 1FCVA 4FNTA 1Q6LA 4MJZA 4JYFA 5E1QA 1A53A 1OYCA 5GVJA 3RMJA 1S5VA 3C56A 4JTTA 2R94A 2BSLA 5AC6A 3L9CA 3I7RA 5FI8A 5F2LA 4NJGA 3O6YX 3QC3A 2ZTJA 2ATSA 2YFNA 4O54A 1KV8A 2QCNA 4K6AA 2Y89A 3KVKA 3QMSA 4MFEA 3R89A 5LHFA 2CZFA 4MOZA 4M19A 4O18A 3M5YA 4JN6A 1M5WA 4UUIA 3IIOA 4XTIA 3KVLA 4UFHA 4HNUA 2V81A 3TSDA 3S8HA 1EUNA 3O15A 2Z6IA 3STEA 4EF8A 3GDMA 2Q8ZA 4NJIA 1QR7A 3BARA 1PCWA 3S5YA 1G7UA 2E1DA 3HPXA 2E09A 1BWKA 2VFGA 4Q4KA 3TW6A 4PODA 3NYZA 1SO5A 4PL2A 5AHIA 2FLIA 5TQLA 1KTNA 4OGZA 3W6YA 5G1YA 1XBVA 2VEMA 3KVMA 1KFEA 4X2RA 4ZQCA 4UMAA 3GYEA 1KBIA 3W2KA 1O4UA 2ISSA 2I9EA 1KM6A 5HJLA 4A3UA 2NV2A 2V5LA 4IGHA 5EPDA 4KWVA 1W37A 3W86A 5D32A 3H54A 1GYNA 3M6YA 4O19A 2RHGA 2Y6ZA 4L4MA 1TV7A 1G69A 1JCXA 2A1YA 3T40A 1KFLA 3PR2A 4ZL1A 1AL7A 4XKYB 5D38A 3E49A 4PCFA 3W85A 3S0CA 3VE7A 2NX3A 3B04A 4E0CA 4Y96A 2CFFA 1IGSA 1PIIA 1NVMA 3S1VA 4MYAA 4U28A 4DF1A 4D2JA 3NDOA 1VH7A 3W7KA 2QUTA 2FQIA 3LLDA 1SW0A 3BGJA 4LS2A 1YPIA 4RZ5A 1W54A 3TDFA 4O1CA 3FJLA 1GWJA 2C19A 3IV3A 2QUUA 5LNVA 3G0SA 4JYDA 2YYUA 1L6YA 3M7WA 1H1ZA 1UUOA 2CU0A 4Z1BA 4DO4A 1YDVA 3QSRA 4RX0A 1LBLA 4FNSA 3W73A 5CZJA 1XBXA 3KXQA 4PFMA 3W7QA 2A5HA 1C29A 1LBFA 2QAPA 4LVGA 4RV8A 1B57A 2YX0A 2BZNA 3USBA 4FB7A 1NEYA 4HSOA 3W7EA 3OBKA 1JCJA 3EWZA 4FNUA 3G1YA 3W7IA 1O5XA 4HN4A 3NQDA 2J27A 1SZEA 1KLZA 3QPZA 4JTFA 3W2UA 5FEZA 3SR7A 2DU2A 4O0ZA 1H51A 4FXRA 1QPNA 1JUEA 3O07A 3PULA 3PSVA 2OZ0A 5EY5A 4DPPA 4MUZA 3GB6A 3TQVA 5L6UA 3O05A 4H6KA 5AHEA 2QCCA 1NAL1 3G22A 5AFDA 3A21A 3E96A 2HMCA 1TPH1 3O6CA 4A2SA 2YDAA 3FKRA 1NFBA 1FWWA 4O14A 2I1OA 3DGRA 4GUJA 4LVDA 4C1KA 2VEIA 4N02A 4HPXA 1VYSX 3CU2A 1V5XA 3FKKA 5EA9A 3LLFA 3SIZA 4PTNA 3ATZA 2EAWA 3NR0A 1DV7A 2VELA 4OQVA 3NXFA 3HJZA 1F05A 3C6CA 3RK8A 3M41A 2E6FA 4UTHA 4JX6A 1Z42A 1T96A 1HO1A 3LGEA 3DENA 3MI2A 4XZ9A 3HIJA 3G0UA 1QOPA 1LORA 3FJ6A 2H90A 1JCYA 5AHMA 4UTUA 4Y8FA 2VXNA 3W1AA 4IXHA 1LP6A 2E68A 4QNWA 5HNRA 2ZZ5A 2B7OA 1GTEA 3HGOA 5FEPA 1GG1A 3EB2A 1YTKA 3NAVA 5I3GA 4O4VA 1L6WA 3W7NA 2W6RA 3DKJA 5FF3A 1KFBA 3UWQA 1WXJA 3ABOA 5LKYA 3T44A 1C9DA 3MO7A 5KZMA 4AWTA 1P5BA 3LI0A 4Z1CA 3NOEA 1KM2A 1UCWA 1VQTA 1LTDA 3P5YA 4S2BA 1ZENA 4MJMA 1OJXA 1HFBA 1ZAJA 1DJNA 2V9DA 5G4EA 1ICPA 3M5XA 3W7GA 4JGDA 1EA0A 4DO5A 1SO4A 2WSQA 3IRDA 3W23A 1KA9F 1TTPA 1WOBA 3U8GA 4ORIA 3W7RA 2YR1A 3UY8A 3TC7A 3BLFA 2R8WA 4HHPA 3S6DA 1YTDA 1RR2A 2ZZ2A 2OX1A 5AB3A 3ABRA 5K2ZA 3QFEA 1Q6OA 4AMAA 1O95A 1WBHA 1VLWA 3NZ1A 3UPWA 1DVJA 3EX4A 3IGUA 3LXBA 5K4ZA 2WSYA 1O60A 3KOFA 3IIZA 4XTDA 2XN0A 4JTKA 4N9EA 5SWUA 4OU1A 2C14A 2QCFA 2TMDA 2GVGA 1FUYA 3GR7A 2XFWA 1CX9A 1H50A 1MEIA 1HG3A 3IEBA 2GJLA 2CLMA 3RU6A 3BO9A 3W7OA 1GJPA 3S5OA 3C52A 4BF9A 4GFSA 3GAYA 1JQXA 4N9BA 4O1BA 2JKPA 1TQXA 4HNVA 4EVZA 5KZDA 3W1TA 3TJXA 3CWNA 3RFAA 5F1VA 3L21A 2ZBTA 2V8ZA 3S9YA 2RDUA 5AHNA 2X30A 5F4WA 3M1ZA 5CZTA 1AG1O 5CZSA 2JBMA 2FDSA 5U4NA 3EXTA 5FF7A 2CLLA 1XFBA 3W2MA 4JR5A 2ZRUA 1OX6A 3NZRA 2F84A 3L66A 3KHJA 4L4LA 2J9XA 3S5NA 1SZNA 2EPHA 2OCZA 5IBXC 3G1DA 4ZQNA 4JIQA 2PCQA 1TJRA 1ZY9A 4BFAA 2PURA 5DCBA 4GE8A 2W79A 3UYCA 1F2JA 4EOUA 3HG4A 5D03A 1UBSA 4RXFA 3HQ1A 1CW2A 3EEGA 1T8XA 3FIGA 1L6SA 4GBUA 1DOSA 3LCHA 3MWAA 1VJIA 3EX2A 4OV9A 4GUFA 4N4PA 3IIPA 3MP5A 3ABQA 4WY0F 1VR6A 4JTSA 3FA5A 4NU7A 3N9SA 2WNQA 3DFSA 4WJEA 1LOLA 1M7PA 3L65A 4Y90A 3RLVA 3PG9A 3GKAA 5H91A 4UTMA 1AW2A 5FF0A 3KRSA 3PUDA 4WUIA 1K7EA 3JR2A 1OFBA 3TXVA 1RV8A 3LOTA 3VNDA 3W9ZA 1SSDA 5AN7A 2ZRWA 5E93A 2CZ5A 3M0ZA 4UMCA 3EX3A 5K7JA 2GQAA 3L0NA 3QQ0A 4MY8A 1FWSA 3C2FA 2J88A 1EP2A 1MEHA 1SFLA 2H6RA 2YPIA 4OT7A 5AYYA 5HWNA 2OMAA 3O1NA 3NQVA 1JULA 2B7NA 5KTLA 1XCFA 1V7YA 1LOQA 3TMLA 3OHIA 4MYXA 3UXDA 3GAKA 4WX2A 4IMEA 2NX9A 3MW7A 3LRKA 2A7PA 1VCFA 1Q45A 4NT0A 4TMCA 4UTIA 4LS0A 3ZWTA 3O8AA 2ZZ4A 5D2TA 3G3MA 2GJNA 1K8YA 4IOTA 1Q3NA 1XI3A 2GOUA 3TSMA 2WQPA 6TIMA 2Q8LA 2OT0A 3QEZA 4Z1AA 1ADOA 2ZRZA 3KX6A 4K8EA 1H7NA 4AB4A 1SQ7A 2C1HA 1I2OA 1LRNA 1XDMA 1KBJA 1HL2A 1W0MA 1IF2A 2E6AA 1KTCA 3QRHA 4NUWA 3DFOA 1THFD 1ICSA 1HUVA 5C54A 3V75A 2VFDA 3CT7A 4ZMGA 4NNAA 3P7YA 1EP3A 3G1AA 3TU9A 3HBLA 3NQ6A 3P74A 1SPQA 3MP3A 2V0TA 3LCXA 1EPXA 4FIQA 3KRZA 3T4CA 3EWWA 3SSJA 3NL2A 1VS1A 1EP1A 3TX9A 4O4WA 5L9FA 1K7FA 1OABA 3FFSA 2P10A 4R33A 1DKWA 3NEVA 4RLIA 1VHNA 4JYEA 2DJXA 4ORMA 1MSSA 3QMRA 4HNTA 3G8RA 4BI6A 2J24A 3FOKA 3GIYA 1PCKA 1GPWA 4HIBA 4JY8A 1NF0A 3OIXA 1TPB1 2FPYA 3AJXA 1F6PA 2A0NA 2ZYFA 4IJBA 2E5CA 4LV4A 4JIPA 3TH6A 1EIXA 3UWVA 3EWUA 3PBWA 5K9DA 4UR8A 1PHQA 3PF3A 4FNPA 3LBMA 1D9EA 1MO0A 3G8EA 4LUJA 4O16A 3HPZA 1P1XA 3WK0A 1SO3A 3DFQA 4EF9A 4CNPA 4PL1A 1LDCA 1SUXA 2NZLA 4WY0A 3NGJA 1IXNA 1W8SA 2Y7DA 2A6LA 2CW6A 2Q3OA 4JS3A 3TV8A 2ZRXA 4QAIA 3WK2A 4DBEA 2C6QA 2ZA1A 1W5NA 3MUXA 3HGRA 4NZFA 1QPRA 1H7OA 3FYOA 4JX4A 3I7SA 5EKYA 1Z48A 5IM51 3W83A 3DKLA 2PC4A 4NZJA 3TAOA 4LVBA 3STFA 2E6DA 3RF9A 3BGGA 3TKFA 1KM1A 2Y62A 1F73A 4DXVA 4DO6A 3NPXA 3TE9A 4NJKA 1UJPA 3IVUA 3HMJG 4OWGA 3W1UA 1OVDA 4LOCA 3QF0A 4Z0SA 3W7JA 1IIHA 2GVJA 1YLVA 2B0MA 3AO0A 1ME8A 4QSHA 2QJIA 3R5EA 1IIGA 3GX9A 2GVLA 3LM7A 4WQ6A 3MYPA 3NQEA 4E38A 2QCHA 3LCWA 1RQEA 4BK9A 3GXPA 5K3VA 5D04C 5K9XA 4N9DA 1TPDA 3GNDA 3W7MA 4CCEA 1QO5A 5HR7A 3CM4A 3MP4A 4M6PA 1G4PA 3G1VA 5U7SA 3N2XA 5F1UA 3WK3A 4O1DA 1R2RA 5D2XA 2CLEA 3WJSA 5AHLA 1JCMP 1VYRA 2WNZA 3HG5A 1XC4A 3C2EA 3NM1A 3MI3A 4NX5A 5LGZA 1WX0A 3EX1A 3PB0A 1TTJA 5MHBA 5D02A 3W1RA 2NXIA 4H3DA 4NQ1A 2ZZ3A 5IBXA 3FS2A 1JCNA 2DZTA 5HUOA 1JRBA 3OVPA 3GR8A 5G4WA 4MLJA 4ZQRA 1QDSA 4O10A 3ZWSA 1TPUA 3HO8A 3W7PA 4LUIA 1OFRA 3W87A 2V5BA 3P8JA 1MZHA 4TIMA 4UMBA 1VLIA 4UTJA 2DZSA 5CSSA 4FO4A 1A5AA 1JCLA 3LX9A 3UWYA 1XBZA 3LB0A 4NX0A 2ZTKA 2A2IA 3A23A 3TA6A 4TR9A 1LOSA 1O94A 3GDRA 1WYIA 1OHLA 1X6UA 2NUYA
chains in the Genus database with same CATH superfamily
3L67A 2A3BA 2NWSA 3FAXA 4ML9A 4UTTC 1XGZA 2WJZA 1R8LA 1XUUA 1XCWA 1YX1A 1HF6A 4KFPA 4OHQA 1NELA 3O63A 3T6CA 3W1MA 3CHEA 2FKPA 4DBSA 3WQ5A 3TN3A 4PC8A 5LIXX 2PTZA 4JTRA 4CNTA 4HNCA 4NSBA 5T91A 1OG6A 4ICMA 4R9OA 5A5WA 1MW3A 4UTWC 3O6DA 2HISA 1YDNA 3LY0A 2HTMA 1QBAA 2DSKA 3SY5A 2DPEA 4ROPA 1E4LA 2W27A 3B4UA 4REQB 5KZEA 3ERPA 4DUWA 4DZAA 1DEDA 4GUIA 1S5TA 3NJ3A 3OTRA 1OZMA 2KZHA 4YU1A 3W2NA 4Q6JA 2PBGA 1OCQA 2ZUMA 4AD1A 1XIIA 4AAJA 2QLYA 2E77A 4QJ1A 4RNHA 3EXSA 4Q4PA 3RR4A 2F9RA 4CEXC 4AD0A 2PRLA 2P3ZA 1E0VA 1YXYA 3VOFA 1TMQA 3PTKA 3ARZA 3DAQA 3T4WA 3R8GA 3VNYA 3DYPA 4EPDC 1ZRQA 3EX6A 4LUYA 3MB9A 3N29A 3C2OA 2J77A 2EF9A 4ZO7A 1TWDA 4DM2A 4KPLA 3BURA 3O6AA 3WLJA 3B03A 4OBRA 2OG9A 3EA1A 4I9MA 4X22A 3GFYA 1XLDA 3GFXA 3EDFA 4LU0A 4F0HA 3T07A 3MUZ1 4YTSA 1NH6A 4BF7A 2YCKX 4J9JA 3AHXA 3G5EA 1UKQA 3B0PA 1DWHM 4L65A 1QPKA 3A22A 1LL7A 3VGEA 3QPEA 3BOLA 3C5QA 1S2VA 3T9PA 2Q8XA 2DW6A 2X7VA 2OO6A 4UR9A 4Q3MA 4D6GA 5CPTA 1NU5A 3SAZA 2DUZA 1YQ2A 3B0XA 3SW6A 2EHHA 4PRTA 3VNMA 1OFQA 1P7TA 1BEUA 2JGYA 5CC5A 3INPA 1SFJA 4PMNA 4G5DA 3CEPA 4PMXA 3BG9A 5F2IA 3M0LA 4ZXOA 2J13A 1IXPA 1OFDA 1XM3A 4NNCA 1JAKA 1XGEA 5D9PA 4TVDA 5HUPA 1CGWA 1H0GA 2FYMA 4Q4OA 1WDPA 3OZMA 2IUZA 4QDWA 4UTKA 4UOJA 4MPQA 2YL9A 3ONBA 1NOUA 1NQKA 1QJWA 5I09A 4CNSA 3WKZA 3RG6A 4XISA 2J7EA 4AF0A 3GC2A 3ZS4A 3BMXA 4JTGA 1REQB 3WQ4A 5CCZA 1JR1A 4L56A 3AQUA 4DWDA 2A4AA 2F7FA 1VFSA 3N73A 3L2LA 3PBVA 3QTGA 4UFKA 1MW1A 5A94A 1KC7A 2EPKX 2HK1A 3LQLA 4RL3A 1FRBA 3IIVA 3W00A 4JX5A 3MY9A 2R91A 1GZJA 2YZ5A 4K36A 4K2SA 5ABEA 1TPEA 4TXEA 3SGUA 1ZP4A 1B3XA 3F5KA 4GJ1A 4S3DA 4XO7A 3IK4A 1C8YA 3QQ1A 3UF9A 4FP1A 2NQZA 2Z0IA 2BASA 1H61A 4NZ5A 2QJNA 3OEXA 6XIMA 3VMPA 3QW3A 4GABA 4IMFA 3K30A 2XH4A 4GIRA 5D37A 4LW7A 1E4MM 2IKHA 2WC3A 3QYQA 4XSLA 1PJ9A 2WQDA 3ITYA 4IXXA 4CD7A 4JNZA 3V0SA 2DJLA 2D2JA 1SW3A 4S3JA 1I4NA 4ATWA 1GGOA 3I3EA 3H21A 5DY2A 1FP8A 2DDXA 4GNVA 4AVFA 3H6OA 5D8ZA 1HJVA 3KVJA 3P8IA 3H7UA 3W0KA 1GOWA 1MI3A 4RDWA 2DZPA 1XIBA 4CQDA 1DIEA 2PDLA 1W9VA 4I5RA 3UJSA 3WLLA 4IX0A 1XL9A 1XKYA 3IUHA 2YJQA 2PDWA 4DUVA 3DFHA 2DZXA 3DH7A 1B3ZA 2RJGA 1KFCA 3QV9A 4I7VA 2OTDA 2PDCA 1QNSA 1E9IA 1FWFC 2QDHA 3I65A 2Y5JA 1XHGA 5D33A 2OWXA 2V82A 1NIUA 1RY8A 1NWUA 3VOIA 4DLMA 2ZX5A 4UFIA 1XLEA 1OC7A 3IAQA 1XFCA 1TUXA 2VD8A 3K13A 4M56A 1R3WA 2ZIDA 5A6AA 1XPYA 4HK7A 3FVDA 1MDRA 4ILSA 3W76A 3LM3A 4F79A 1XYCA 2WJDA 1GVOA 3CAWA 4XD4A 5T26A 3DHPA 2WW5A 1BKSA 1GKQA 4UQDA 1PS9A 1FDZA 2X1SA 1D2KA 4BEUA 3W29A 3V1PA 3I7QA 1NOFA 2B4GA 4JIIX 3AOFA 2E5DA 3MBDA 4HCLA 3FLUA 2RUSA 4LVFA 2PDKA 4RPQA 3DC8A 3DBNA 4G7EB 3LEPA 1A49A 4ZR8A 3K46A 5D09A 5CZ0A 4W89A 4F9JA 1S5WA 1EPVA 3DOPA 1KR1A 5LNUA 2PWGA 1HZYA 1K8CA 3CB3A 2CEQA 3W88A 2E5BA 1IZCA 1XR2A 2Y1HA 4C6QA 1ZGDA 4B91A 2WO5A 6REQB 3OLIA 3L68A 4TMBA 3WX7A 1ECQA 3SRDA 1XIJA 2HCVA 4Z2LA 3UNDA 1O1ZA 3TQ0A 3EOUA 3GHSA 1EJ7L 4OUEA 2PGRA 4WDUA 5HDRA 3M0HA 1BQGA 1TPC1 4X61A 2A7RA 3BAYA 3UZ5A 2V30A 1QI0A 2FGBA 4OBSA 1VEOA 5GNZA 3CUZA 1R5YA 4NKCA 3EWXA 2Y85A 5C6MA 3N2TA 3HPSA 4DZ5A 4AIOA 1JI2A 4AWEA 4C6DA 4QFUA 3L2IA 3T8LA 2O7QA 4RE3A 1GVEA 4MKNA 3WJYA 1U5JA 2VFIA 4ZB2A 1DYSA 4QJ3B 5ECVA 4GK8A 4UXDA 4WXZA 1UB3A 3N34A 2A21A 3EWCA 2XIOA 2RFGA 3POHA 1MFUA 3IPWA 4H7CA 4Q4RA 2GGEA 4IH3A 1HKIA 3PB2A 1SO6A 3PZTA 1EL3A 4E8CA 1K6AA 5DF0A 1XUZA 1I8JA 3SADA 2R24A 4W5UA 3H26A 2CLHA 1PSCA 1OYBA 2HBVA 2W92A 1S1PA 4DVOA 4ZSTA 2J8TA 1SGJA 3WLIA 3BVJA 1W1YA 1S39A 5ABFB 1UA3A 2ZC8A 1L2UA 5LZLA 1RBLA 3W7LA 4QX4A 1B4EA 3AICA 1CI1A 1XLCA 1Y65A 3UXIA 5BWAA 3CAVA 3CZJA 4D6EA 1UYQA 3AXXA 4H83A 3ES7A 1H5YA 1EQPA 3R8HA 4JFSA 1UROA 4GC3A 5D2WA 1MUWA 1BVWA 3WQDA 4LAUA 3EMZA 1C90A 3W38A 1VFFA 2E1WA 4LRTA 3ZM8A 4TUFA 3N6QA 2NXGA 4UB9A 4PSRA 1JDFA 2A3CA 3KWXA 4YIWA 1FDJA 2C15A 4IG2A 1RQBA 2Z27A 3KW3A 2WM1A 2ZCGA 2ZWZA 3FYPA 2VEKA 1H7PA 3IGSA 2I9UA 2AKMA 4KESA 4LNYA 3SQMA 2NX1A 1I2RA 5DBTA 2H9AB 4P7QA 3HFYA 3JS3A 3W71A 1LLOA 1H1YA 3WNPA 2HRWA 2JKEA 3BQ5A 3UCDA 5TD4A 1BGAA 4ZEPA 3VIJA 3W1LA 1XQKA 2REQA 2NT1A 2ACSA 4H4IA 4IF2A 1TPVA 3G1XA 4JPGA 4R7WA 2ZXBA 4GQQA 3H4WA 2VURA 3JUGA 4M29A 3EPNA 2WM0A 2AL1A 3H8AA 5LGXA 1UR1A 3UQNA 2ACUA 1XIDA 4WXYA 1KBBA 1V3IA 3ZO9A 4DRSA 4LY4A 1Z32X 1YHTA 4CQBA 5FSEC 4O13A 3SGZA 1EOMA 1S46A 3BL3A 4DWSD 4EKJA 3O0KA 1DP0A 4YCOA 1UWIA 3U0HA 2XM1A 1NF7A 2DZBA 4MG4A 2VTFA 3W27A 5CKSA 4RDYA 3KOXA 2BY0A 2YXXA 4B5NA 1TO3A 3CL6A 1V02E 4CEUC 3G1HA 1G5AA 2QCDA 5AOUA 3NQ8A 1AQMA 1QVBA 3FGCA 3CYJA 3ORWA 1OG0A 5ENLA 5G4HC 4KRUA 2DVTA 3OA3A 1D3GA 1AW5A 1VGAA 2OODA 3MA8A 2P88A 2WMFA 5A6MA 3ITOA 1CXFA 2MUCA 4XZIA 4DF0A 1GVQA 5CAKA 2YXOA 5G2WA 2GJXA 4R85A 1LT8A 2Z4GA 4NJJA 2A3AA 3V35A 4I7UA 1JCTA 1XLGA 3AIVA 1TZ9A 4QR6A 3P80A 4ZOEA 3RU8X 2DT3A 1F4AA 2VGBA 2ATMA 2DH3A 4B3LA 3BOFA 3RUBL 5T9BG 3ZFHA 1KCXA 3RAOA 1JQVA 1K6WA 1Q6RA 2WBKA 2DVUA 1XXXA 3UPMA 1KNWA 4H2CA 1TJ1A 1VFHA 3LCGA 3GY1A 4XIMA 3UG4A 5JU6A 4XUGA 5LIWX 4PUNA 4M80A 1VBUA 4QM1A 3E0WA 3MVIA 1CGVA 3OQ8A 1AFSA 4U3CA 2YIHA 1I2QA 4WKAA 4MJ2A 1WKYA 3LENA 1W17A 3A6OA 4KFOA 5KINA 3UPBA 4QLJA 2Y7GA 2RDTA 3CIWA 3GNXA 1DXFA 2W61A 1VENA 4R34A 4M7SA 5C2XA 3VZZA 1HKVA 3BAKA 1GHSA 3P5ZA 3G3DA 5CXPA 4Z2GA 4JIHA 3WD3A 5FSDC 5CGQA 3VOJA 5FEXA 2XIIA 3TW7A 2PEVA 8XIMA 3E74A 1H3GA 3VNZA 2GOKA 1W6TA 1PV8A 4JDBA 5AZ1A 3U4AA 1W3TA 3CAQA 4GXPA 2GPTA 4DAIA 2TRSA 5FIPA 4FOUA 4J3ZA 2VUNA 3TFXA 4W88A 5LNSA 3DFTA 3QOMA 1RLCL 5HANA 1BLIA 2FZ9A 3CQIA 3C86A 1HT6A 1KGUA 4H04A 4DJDC 5CG7A 2LLEA 4ADUA 3O16A 3H2MA 3OLGA 4FALA 5HXMA 2Q3RA 1E1FA 3XIMA 4A4AA 3R79A 4P7LA 1M03A 1YRRA 4IFKA 4Y9PA 3MSDA 1TZ7A 4W8AA 2R9RA 5HMSA 2NXHA 2IXUA 4PMOA 2YA2A 1LRTA 5G5IA 1GOKA 3H7RA 4X9SA 1M68A 4KS0A 2BGSA 3JW7A 1RY0A 3DXIA 2ZQ0A 4B3ZA 1EWEA 4YN5A 4K7YA 3R2GA 2BGNE 3WMSA 3MTWA 1Q7MA 2ZRYA 4AXNA 5E09A 1N8WA 2NV1A 2JALA 4LCRA 1X6NA 1A0DA 4C1NA 2QULA 3UXAA 3Q58A 4NF7A 3IJLA 2HNEA 4FX8A 5I78A 3WK1A 2GUUA 2XM2A 2YSWA 3V36A 3ES8A 3B05A 3HG3A 3DU0A 1QHZA 1E72M 4GJIA 3G1RA 3MUCA 2DZWA 1UKOA 1B3VA 1IXOA 1MFVA 3WL1A 2D69A 3IS4A 5CPLA 4CCDA 2P1FA 4UNLA 3W72A 1B9BA 4NIRA 2QV5A 4DELA 1FCVA 2WB5A 4MJZA 4JYFA 2Y8KA 5E1QA 1A53A 1OYCA 1E55A 3E0FA 3NGFA 1EJXC 4NY2A 1FFRA 2PC8A 4GCXA 4DNMA 1KXVA 5AC6A 4LEFA 3I7RA 1US3A 5F2LA 3LNMA 2ACQA 4M8UA 4MFEA 2Z2AA 2CZFA 4LGXA 1WAWA 4JN6A 3IIOA 3B0YA 1EYEA 1BD0A 3ISIX 4NAFB 3DUGA 3KOZA 1XSJA 4XZWA 2C7FA 3BARA 3ITXA 4HHHA 3SQSA 2E09A 2V63A 1BWKA 4Q4KA 1SO5A 1A3XA 5TQLA 1TFVA 2WHLA 3VYLA 3W6YA 2VEMA 2GJRA 3KVMA 1UZDA 4HZ6A 3URNA 3E5BA 2G8ZA 5IRPA 2ISDA 2I9EA 5HJLA 1C9WA 1SJBA 4IGHA 3WDQA 3KUMA 2VC9A 4HU4A 2YDQA 1W37A 1X39A 1SVDA 3H54A 4F9DA 2RHGA 4C60A 1XH2A 4J3XA 3COTA 3WNNA 1YDYA 1H09A 1GW1A 3ZVIA 1SMDA 1MQPA 4XKYB 3T0DA 4PCFA 1UIOA 4QTGA 1VIWA 3S0CA 2WVUA 4H8NA 3DG3A 4IQEA 1UOKA 4LCSA 2JIEA 1ZUAX 1UPMB 2J4GA 4U28A 2YB4A 4HNLA 3FAWA 4D6FA 2QUTA 1TWZA 2FQIA 5CPSA 2VVNA 1M1BA 1YPIA 1JNDA 1W54A 1UH3A 3BJTA 3GO2A 1GWJA 3URBA 1GHRA 2HXTA 3KL3A 4PB3A 5BXTA 4M1RA 5FJIA 1QBBA 3SUVA 2VR5A 3B9EA 3CWHA 2ALRA 4IUGA 4C7FA 4AYSA 1BFNA 1XBXA 3KXQA 1BYCA 1C29A 4LVGA 3H70A 4RV8A 1FVPA 3WO8A 3N2BA 3W37A 2YX0A 1CTNA 3LU2A 2BZNA 3USBA 4FB7A 3ITCA 4HSOA 4JBRA 4RNJA 3W7EA 5HMEA 6PTDA 2XGZA 4Q8OA 3EWZA 2W3ZA 5A2AA 6CGTA 2OGYA 1WZLA 1O5XA 2WCAA 2J27A 4GIEA 4H9XA 3W2UA 3SR7A 4O0ZA 4LF1A 1WKEA 3WMBA 4JN7A 2BXYA 5IDIA 3O07A 2OX4A 2DW7A 4PBFA 3SO7A 1E6NA 1IEQA 4UQCA 2IPJA 3WNMA 3LS9A 4NI8A 2QCCA 4FZIA 1ZS2A 2POTA 4GVFA 2HMCA 3V3WA 1BYAA 4S3AA 1G01A 3O6CA 2PF8A 3P93A 3UT0A 1J0IA 1FWWA 3ARUA 4V33A 2I1OA 2I56A 4UQBA 1VIZA 5C2GA 4C1KA 9XIAA 2X7WA 4N02A 4B92A 4GX9A 1DV7A 2ZVRA 2VELA 4ZE5A 5A8MA 3EPMA 3ANVA 2XSAA 2JQXA 3NXFA 1RBOB 1F05A 3C6CA 3RK8A 3GIQA 4AC7C 2E6FA 1Z42A 3LGEA 1HO1A 4HU0A 4E3VA 3DENA 4LUSA 3MI2A 3TLLA 4JNYA 1K4HA 3BCJA 3GUWA 1QOPA 3I3DA 1HP4A 4L6OA 3WNKA 4UTUA 1JDCA 4Y8FA 2VXNA 3W1AA 3S83A 1IYXA 2E68A 3R0DA 2WANA 3ZXWA 1SJAA 6TAAA 1GTEA 4QCFA 5FEPA 1QWKA 5I3GA 1K4GA 4FXJA 1P0BA 3W7NA 1MNSA 5FF3A 1EO7A 1I1WA 4H9YA 1BWVA 1V3JA 2RDXA 1WXJA 2X09A 3LGGA 4QG8A 5A6BA 2E8YA 3ABOA 3AXMA 3MO7A 4D8LA 3B8VA 3LI0A 3IJIA 4OUIA 1UCWA 2EPMX 1R3SA 2QHAA 1O66A 2YCLB 3VIIA 2I17A 3AYRA 5G4EA 5E0CA 4I8YA 3AALA 4EXQA 1GQKA 1KA9F 5KEZA 3U8GA 4ORIA 2QJMA 4QJ4B 5I77A 2R1NA 3VIKA 1ENUA 3A9BA 1XPGA 2R8WA 3H7VA 3TJIA 1ZQ5A 2HPIA 3ITGA 2VZSA 1LUCA 4EK7A 2INEA 3ME3A 1WBHA 3OU8A 3NZ1A 3UPWA 1DVJA 2IS7A 3EX4A 3CUHA 2B81A 5K4ZA 2Y2WA 1RUSA 4DHGA 4JTKA 5SWUA 1BG4A 4YTTA 3WLSA 2GVGA 2G4FA 2XFWA 1UKPA 4AZIA 4HOWA 4S39A 4B5TA 5IHSA 1TMLA 3OHMB 1PKYA 3C52A 3GAYA 1JQXA 4O1BA 4PMZA 5FJUA 3ARVA 4CKQA 5KZDA 3UNTA 3L21A 5JUVA 1Z89A 3GVQA 2EG8A 3CNYA 3I4KA 2JBMA 2WKLA 4AU0A 5FF7A 3W2MA 2ZRUA 3GW0A 1OX6A 1UWQA 1DJWA 1YBQB 1BPLB 1SZNA 2EPHA 2OCZA 2PF0A 4YTQA 3RIKA 5IBXC 4OIFA 1XYLA 1HVQA 3U2EA 4Q7IA 2PDXA 1FP9A 1CGTA 4RW3A 4P8XA 1DJXA 1ZY9A 2NSXA 1NP2A 4K8GA 3IRSA 3TCSA 1F2JA 1YPXA 2WWCA 4HA4A 4EOUA 3HG4A 1PKNA 3MUY1 4HK6A 4RXFA 1CW2A 1RCXB 3ZZ1A 3FIGA 3MSYA 3GH7A 1EOKA 2W4XA 1V02A 4FLOA 3UFYA 2IKIA 1ZLPA 4N4PA 4DAFA 3MP5A 1DIDA 2HDJA 4Q4SA 3VOGA 4ZBCA 3FA5A 1XG3A 3DFSA 4YYFA 1LOLA 3L65A 2VR4A 1RVKA 4UTMA 4KH2A 4ACZA 4WUIA 2PPGA 2ZUTA 3B4YA 1N82A 1SSDA 3QY7A 3VDBA 1T8QA 3EX3A 3L0NA 2J88A 2VDIA 3WD2A 1SFLA 4E5TA 3F5JA 3FJNA 3S2MA 5DT7A 5HWNA 2OMAA 2PSNA 5CC6A 4JTCA 3OHIA 4MYXA 3GAKA 3A47A 4WX2A 4QDPA 3H2FA 3LRKA 2A7PA 1Q45A 4XVDA 3ZWTA 4GQ0A 4BZYA 1TKKA 4IOTA 1QATA 4IFOA 1JEZA 2Q8LA 4FK9A 2OT0A 2CC0A 3T2PA 4MB1A 3VDGA 1U33A 4IQDA 1ADOA 1OGSA 3WBWA 4FLSA 4ZENA 4HTBA 4AD3A 1SQ7A 2C1HA 1I2OA 2BB0A 1LRNA 1I6NA 1W0MA 4PB4A 1IF2A 1KB3A 1KXHA 2VRQA 5BXPA 3DIPA 1THFD 3WEMA 3W24A 3L4UA 1FWIC 1SR0A 5GQBA 3CUIA 3E2VA 4ZMGA 3ZOAA 1NQ6A 3HU7A 4NNAA 1EP3A 3G1AA 1ISYA 3HBLA 4XZLX 3PANA 1SPQA 2V0TA 3LCXA 2XISA 2WKGA 2NQ5A 3EWWA 1JGIA 4NRRA 3VILA 4V27A 4O4WA 4HK5A 4XAZA 2HV5A 1FHVA 1DE5A 2P10A 4R33A 3ZJ8A 2DJXA 2HE5A 4HNTA 1XIMA 1PCKA 1GPWA 3UWEA 4HIBA 2WAGA 1AH4A 4JY8A 4GCAA 1V6VA 1YIXA 3KP0A 4AIUA 1A4MA 1TPB1 2A0NA 2ZYFA 3SB0A 2E5CA 2D2OA 5HK4A 4ACYA 3UWVA 3PBWA 5JBFA 1TELA 2CXEA 4H8HA 1D9EA 4DX3A 3S4TA 1IHIA 3BSHA 3WK0A 3URAA 3AZTA 4PEEA 1LDCA 3ZJ7A 4W8LA 4FOJA 2NZLA 3NGJA 1ESWA 1UR2A 2Y7DA 2O92A 2CW6A 4WKFA 3MDWA 2Q3OA 4QAIA 1EZ2A 3VIMA 3FN9A 1EC8A 3UG8A 1QHOA 1WUEA 1H7OA 4S3FA 1VFUA 4HA0A 5IM51 4QS6A 3W83A 3TAOA 3STFA 2E6DA 3BGGA 2Y62A 4DXVA 3NPXA 1NWSA 3IVUA 2VX6A 3HMJG 1UUQA 2J7DA 3VNJA 3NDYA 3FA3A 5DQPA 3QF0A 5HOSA 1YLVA 2B0MA 4AY8A 1AMYA 1AZ1A 4ZSUA 4IFKB 2GVLA 4HZ8A 1E3ZA 1JXJA 1X98A 1A5LC 1FWAC 2E28A 3GXPA 3WH9A 1Y5XA 1JZ4A 4N9DA 4BS0A 3ZJ6A 3GNDA 3W7MA 4CD5A 5IOBA 3SN4A 4KCTA 1QI2A 5U7SA 4S3BA 4IGSA 3H23A 2I16A 5JH2A 1IZKA 4H41A 3NEHA 4HHLA 3VD7A 3HG5A 1JG9A 3C2EA 3NM1A 5LGZA 1V6WA 3W1RA 1EHAA 4AZCA 4J2MA 4ATLA 3OVPA 2PP3A 3GR8A 4MLJA 3MO4A 2V38A 1TPUA 3HO8A 4OOUA 5I6SA 3W87A 1R9XA 3S5SA 4TIMA 3ZT5A 2ZX6A 4L4OA 5CSSA 1IR2A 1A5AA 2A79A 1ITCA 3LN3A 4NX0A 1H1NA 3A23A 1BXCA 1BKHA 1PTGA 3NYDA 1OHLA 5DMYA 4JFWA 2NUYA 1WNOA 5MF5A 4NYYA 1BF6A 3AS0A 3QR0A 2A3LA 2VKZG 1Z44A 2EG7A 2R14A 2VRJA 2OSYA 1WXZA 3BG3A 1R85A 3VD4A 2W62A 1U5HA 4JTHA 1EDTA 4IWWA 4DJEC 5A6LA 4GYPC 3NPWA 3SI9A 1L8NA 3TFCA 4O28A 3VE9A 4MGGA 2VEPA 4RJEA 5D4YA 3AHYA 1YMYA 2VFEA 1SR9A 1I2PA 4Y2WA 4GPNA 1V4YA 1T99A 3ZLHA 3JRKA 2WMHA 4GC4A 4O0QA 3MDUA 2HPMA 5F4XA 3VIFA 2CWNA 3SCUA 1X96A 4AZGA 4OTKA 4K7VA 2QR6A 3M0KA 1FHLA 4H2HA 1R0MA 2W5FA 1JPIA 4PUMA 3IVSA 2VCCA 1XDLA 4J3UA 1OFOA 3EOEA 4KWUA 4QNEA 1QI4A 1UR0A 3N12A 3QV7A 5LHEA 3H55A 3NQMA 3BLIA 1KTBA 1YTEA 5GJNA 3LTYA 1KBKA 2Y61A 1BF2A 4PTMA 4D8AA 2OLSA 5RUBA 4JQ1A 3NSNA 1I9CB 5D9OA 5CZKA 4IICA 3AYTA 4AEEA 5HWMA 1H7RA 2V2CA 4YJ5A 5CC7A 4QQ3A 3GVRA 1C8VA 2DIKA 4QLKA 3SJ3A 3AMCA 2SFPA 3ZQ9A 3ZT7A 1UC5A 4P2VA 3QR1A 4GUGA 1Y8BA 4GXMA 2GSEA 1DTUA 4IQLA 4K3ZA 1P43A 2CLOA 4M51A 4E2VA 1RA0A 1G9HA 3P84A 1NFPA 3RPDA 3WLRA 2EQDA 5H8MA 3PTDA 4F66A 3NL6A 1A80A 5ECUA 3GZ3A 3ZR4A 1FCQA 2QJJA 2PLCA 3C0SA 3NVTA 2YYTA 1DJGA 4TV6A 1M41A 4L1WA 3CHCA 2PP1A 3I6RA 4ML4A 4C90A 1RD6A 3QVQA 3MJMA 3L12A 1CXIA 3AYVA 4IPJA 3LG3A 4C6PA 4D71A 3MMUA 1TWIA 2Y88A 4L6DA 2PGFA 2PWFA 2ABBA 4ZE4A 1PL9A 2WMIB 2G96A 3SCPA 3CQJA 4LYPA 5F7UA 1FWDC 1GVYA 2WJFA 4C6FA 3D3AA 3D3FA 1CCWB 3V4BA 3OZPA 2GQ3A 4C6IA 1DQWA 3O2LA 2NSOA 3VKDA 4Y9AA 3N1AA 4KWSA 1VKFA 3HG2A 4GUHA 3V5FA 3GTFA 1IQ8A 4FX6M 3P82A 2CZEA 4C6JA 1E1CA 2E3ZA 4Z17A 3N11A 1J96A 2EPOA 3IANA 1EF2A 1QCWA 1W1ZA 2OU4A 3KZSA 2G5WA 5D8WA 3GW3A 1E0WA 2P8BA 3UVAA 2G97A 4WJXA 2DV0A 4WEVX 1OBAA 3TN6A 4CU8A 2Z26A 2EJAA 1TV3A 5M03A 1WZMA 2BOFX 3SBFA 2J9ZA 3N17A 3E3HA 4ZVJA 2O4QA 4TQTA 1TZZA 2ZWYA 4K37A 4R5EA 1OX5A 3LXCA 2Q71A 5CJ5A 3VFCA 7TIMA 3AIQA 3K1DA 3EGJA 2YW3A 3IWPA 3WQEA 4JCLA 4QISA 1F6KA 2C1IA 8A3HA 1FA2A 3PC0A 1TQJA 3WBAA 1NWTA 1OQFA 3E9AA 4B15A 2Z00A 1TA3A 1OK4A 1KFJA 4KCWA 3U7BA 3W53A 3AMKA 3L4YA 1FXPA 2C16A 4PB5A 4LV9A 3SECA 3TC3A 3NSXA 1WE5A 2AL2A 3FEMA 3AZRA 5I3HA 3DI1A 4CQAA 5AVHA 2G3IA 3L23A 3HURA 2GGIA 3KCOA 1Q6DA 3CL7A 5I24A 2YKKA 1WDQA 4YLWA 2XIQA 4ZXLA 2OGJA 3ABXA 4CD6A 5C2CA 3T7VA 1HO4A 4RV3A 3FVMA 1LWHA 4IUOA 1DQUA 1L8PA 3E5PA 4OJYA 2DGAA 4UTTA 1CEOA 4QJ5B 5FF4A 1E1EA 3PTQA 1BSLA 3I10A 5BW6A 1GJWA 3T2OA 4HMNA 1PYFA 1O5KA 3ITLA 3BW4A 2EGZA 4A3HA 2QCMA 3PVFA 2AGTA 4W9TA 3AWNA 3WQ6A 2AMXA 4QG9A 2AKZA 4UTWA 2E9MA 1DORA 3NIYA 3TZNA 1G4SA 1MQRA 5DMMA 3EWBX 3VKKA 1BQCA 1ZB5A 5A95A 1TRDA 1UWRA 4UC5A 2X1RA 3U2OA 4CLMA 3NG3A 2AQVA 4FI4A 1VBHA 3CMGA 1YXCA 4OKDA 4HZ7A 3APYA 4N0RA 4A3QA 3VC5A 3VU2A 2ZUVA 1GQLA 5CPNA 3EDEA 1ZJAA 1E51A 2I5QA 3T05A 3PFMA 1QOXA 5T9CE 1CT5A 1Y0EA 3MHUA 3WH5A 3V1HA 3QW4B 3W7DA 2DSWA 1N8FA 1JZ8A 5G1MA 3DI0A 2CERA 4RE2A 4G2DA 3R1ZA 3PUEA 4C6LA 4RE0A 5DCEA 3RJYA 4IIFA 1Q8JA 2PDFA 1HTIA 3TXZA 3BSGA 4GX8A 3VNIA 3IJQA 3GVGA 1W3KA 3UBPC 3HZ3A 3BLPX 3DERA 1IT7A 3R6IA 4MMWA 1KCKA 1VB9A 3TYUA 2CZDA 1X7FA 1LLWA 4IX2A 1FBAA 3CTLA 3NWRA 4J5NA 2FHBA 1UR8A 4KGLA 1JPKA 2VEGA 2Y5SA 4GFIA 1NM9A 1MMFA 4UQEA 2Z1BA 1WOAA 3GYCA 4R3UA 2ABAA 1VBJA 4IP7A 1OINA 3RRXA 1KV5A 3GTHA 5CSYA 5HULA 5CBIA 1JNEA 4TO8A 4R27A 4R53A 3FDGA 3W6MA 1J0HA 3THAA 3TZFA 1O1HA 2D0HA 3NSMA 3ZLFA 4CQ8A 5CPOA 2V3DA 4JDYA 1ZJIA 1IEIA 5I3FA 4WDWA 3AS2A 4D1JA 5A6SA 3EB3A 2C79A 1LWIA 3VDAA 3SY8A 3L5AA 5M3WA 1AMKA 2G3NA 4RPPA 4AD4A 4DWSB 2AGKA 5E0KA 1XLIA 1A5NC 1N8IA 4N4QA 4M6UA 3C8FA 2I14A 3CL8A 1QI3A 1VEPA 4HGXA 1QW7A 3V5CA 4JTDA 1XV8A 5BMWA 2F38A 4CN4A 1DPMA 1HN1A 3QXBA 1Z8AA 3W02A 4UQAA 3HA1A 1VRDA 2YW4A 2CKSA 4O17A 1F74A 5JIWA 3CLMA 3V16A 3UR7A 3P60A 3U2CA 2P50A 1NDZA 4GGBA 1L0PA 1PKMA 4YHEA 1HNYA 4M7TA 3UGVA 5JIPA 2QEZA 2NVDA 4FEZA 3LV6A 5CBBA 1FWNA 1YNYA 3CHDA 1S2UA 5I02A 3A4XA 1FWCC 1Z6KA 3WFAA 5DFAA 3VKCA 4ALDA 5HR6A 5AYZA 3GDKA 2CKRA 2WV8A 3MWCA 2PBOA 2XWEA 1FX6A 1GTHA 3URQA 1CNVA 1UMYA 4LT9A 2PTXA 2WCSA 1DWGM 1CECA 2FJKA 1FWRA 4JTQA 3UR8A 3BANA 4KIEA 3VO0A 5M2FX 1MRAA 4YVXA 5DCDA 2J9YA 5BROA 2WNNA 3BLEA 4ZQPA 3TYDA 2GYIA 4C6OA 3MS8A 2O9RA 3GH5A 3QGVA 5LIKX 1SZGA 3EPOA 2QPXA 4FXSA 3RM9A 4MZYA 1S3TC 1W3NA 4WOZA 5FJRA 4MIMA 1GVSA 1QW9A 2FGLA 4HBKA 3M9YA 1SW7A 2R1KA 3TNBA 5I3JA 1QNRA 1E6QM 5GJPA 3VX1A 1E56A 1JJKA 2WVVB 2XSXA 3T81A 1F3EA 4YTUA 1K02A 1FCUA 5D2VA 3REQA 2X40A 4H9ZA 4D9PA 5CPMA 2NQ9A 1YE4A 1UW9A 2EPNA 1A5MC 3M43A 3WBXA 2FTWA 1ADDA 1KXQA 2QJHA 5A8GA 1WQ5A 3RLHA 1R2SA 4AEFA 1B9ZA 3QBUA 3UZYA 3S1WA 3ZSSA 1OX4B 2E7FA 1RSCA 2HS6A 4MZ1A 4PUWA 3C61A 3E12A 3L7RA 3QKEA 1OZQA 4PMUA 4QLLA 3MI6A 4AHPA 3BW3A 5FCZA 3HF3A 3R43A 3H2CA 4ZQOA 1WPCA 1MZRA 3MJYA 4NAEA 1A5OC 3DDMA 5EU9A 3NO1A 3WEZA 2DZUA 3FA4A 3BLDA 4GMEA 2CETA 4LS1A 2GK1A 3GTXA 4DI9A 5KSWA 3GQYA 3GRIA 1ZL1A 4EP8C 4AZ6A 2DT0A 1UQZA 4YVVA 3UP8A 4CN6A 3KOWA 4Y9OA 1R46A 1UUMA 1YEYA 1C3FA 1H63A 4TTGA 2X41A 2EKCA 4PTDA 2XN1A 1OEPA 5CAHA 1GT8A 3SFKA 4LBUA 4IMDA 1M9HA 2VENA 3QN3A 5EB8A 1M04A 2VO5A 2QF8A 2B7PA 4P8WA 2OLAA 1R3RA 2E6YA 1LQ0A 3NZQA 3T08A 3N4AA 2DZVA 3DFPA 3RMEA 3UY7A 1WV2A 4A35A 2HS8A 1B54A 1NFGA 1D8WA 2XFYA 1MYRA 1A50A 3W70A 5D9MA 4DBWA 1BWLA 4F8XA 5PTDA 2CLPA 4XQ6A 1W5OA 2O55A 2VYOA 3WJXA 4F0RA 2B7QA 8XIAA 2FFCA 3GNNA 4WZHA 3HFTA 4WSKA 3AHZA 3B8WA 4FSAA 1DJHA 1OK6A 3AMGA 1S2WA 2AAMA 5A3HA 4A29A 4DM1A 1O68A 1QNPA 2FH6A 5I3KA 1E70M 1PZ0A 3ONCA 3LHWA 4DJFC 4JTAA 1JPHA 4LALA 5AYXA 3BOXA 1ITXA 2XH0A 3QJAA 4WVXA 4UZUA 3VGGA 4FHAA 3P81A 1IEVA 1RVGA 3VNLA 5DX7A 4J7RA 4K68A 3P67A 2V5CA 5JXQA 5LNRA 1EUAA 2F6XA 2PI6A 2VEFA 1E40A 1J10A 4Q32A 1TV2A 1AD1A 2YBUA 5BU6A 3KFTA 1UMLA 5BNKA 2YL5A 3NQFA 3UXLA 1UD2A 4OOZA 1H2JA 3OYZA 1H60A 3UVIA 4LQ1A 4S1FA 3NQ2A 2BVTA 3CK5A 3OP2A 4NXSA 1QK0A 4KKXA 1QO2A 4MF4A 5MKGA 3SCTA 1CXHA 3WLPA 2RAGA 3MSRA 3CQ0A 4M5PA 1XBYA 1PO9A 3PG8A 3IK2A 3S1UA 3WF2A 2WHMA 1ZAIA 2Y5EA 1AL8A 3CYVA 4YMZA 3TCEA 3B8DA 1LROA 3KE0A 4NXKA 2QKFA 3SRKA 4INFA 1XGDA 3PHAA 1EBHA 1Q6GA 3QY8A 1UZ4A 5DELA 3PJXA 5HQEA 1ZFJA 4DJFD 4MZ8A 4TV5A 1A5CA 2D73A 1C93A 1GOOA 2HEJA 3EXRA 2PAJA 3PJUA 1HKMA 1DWJM 1TWSA 3LTSA 4LYKA 3OODA 2GWNA 1EO5A 3VMOA 2PLJA 2H3BA 1Z69A 3LHVA 1HJQA 3WL0A 1I1XA 1EA9C 1UASA 1F7BA 3SJNA 1W9UA 1LYXA 5FAGA 2ISVA 3OZOA 1RPXA 3MCNA 3WD4A 3W84A 3PM6A 4GKLA 1OT1A 2Q09A 1EDGA 2ZE0A 4UWMA 1W1VA 2VZOA 1XRSA 3DFNA 2OR2A 3OGVA 3W28A 2QJGA 1ALDA 4KBXA 2VC6A 3WD1A 2PP0A 2BHYA 4UFMA 4GOAA 2PD9A 1KM4A 1BRLA 2PGEA 1EEPA 1A4LA 1AODA 3SRFA 3TA9A 4XK2A 3N3TA 4E3TA 1S5VA 2XTKA 3OIHA 3VKAA 2QV4A 3CO4A 3L9CA 2OQLA 5FI8A 4JFVA 5CGMA 5I2UA 3TOYA 4HYRA 3QC3A 5TAOA 2ZKMX 4HN8A 5A1AA 2QCNA 3II1A 5B80A 4K6AA 2Y89A 2Z1KA 3QMSA 3R89A 4M19A 4HTYA 4O18A 2ZUUA 2PDGA 3M5YA 1J01A 4XTIA 4UFHA 1J79A 1O7AA 3WFLA 1PXGA 4PTVA 2PDPA 5LXXA 3STEA 4EF8A 1PCWA 4GIAA 2E1DA 3UA4A 2EBNA 2VFGA 4PODA 3NYZA 1XP3A 5AHIA 2FLIA 1DJZA 2FVLA 1LQ2A 5FJOA 5DANA 1XBVA 2OZ8A 3QYSA 1M7XA 1H4PA 1WXYA 3BAJA 4UMAA 4RNFA 4FS9A 3VDHA 3W2KA 1O4UA 1T5AA 3UW6A 2QDDA 1KM6A 2NV2A 4KWVA 2OXNA 3W86A 4PTWA 3WLOA 2XIBA 4BQ4A 2XSBA 4MPKA 1GYNA 3M6YA 4H9MA 4ZOBA 2DSVA 3WYZA 5A6JA 1TV7A 1JCXA 4NZCA 4PFHA 3M46A 3U3HA 1AL7A 4M81A 3BAXA 3E49A 3W85A 1SFSA 2NX3A 3DFYA 4JFTA 1IWAA 1IGSA 1NVMA 4L64A 4PCSA 2O4MA 3NDOA 1MDLA 4XAGA 1VH7A 4XAFA 1KRBC 1OCJA 2P8CA 3IJ9A 1O12A 3OA5A 4RZ5A 4O1CA 3FJLA 1POJA 5C9ZA 4IPPA 2QUUA 2WJEA 2WPGA 5E5CA 1L6YA 1DJYA 3M7WA 1EJVC 1Z3NA 4MM1A 4WDTA 1UUOA 3S3GA 2IPFA 5E0FA 3BUVA 4WCJA 4DO4A 1YDVA 3QSRA 4FNSA 1K70A 3W73A 2QVHA 1E0UA 5CZJA 4PFMA 4HOXA 2A5HA 1LBFA 2QAPA 3JU2A 2FVKA 1B57A 3U7VA 4PULA 1EXPA 2DY3A 1YW1A 1NEYA 3VGHA 4FNUA 5H6HA 2HROA 3G1YA 7REQB 1OY0A 3W7IA 4LBSA 1XIHA 4L80A 4H19A 1PWMA 1KLZA 4FR1A 2MANA 1NARA 4IZGA 2DU2A 1V77A 1H51A 2F6UA 4MWAA 4EPEC 4FXRA 4H8UA 1BTCA 1JPMA 2NLYA 2R82A 4AX7A 2C91A 1JUEA 4B5UA 3PSVA 4DPPA 2ZXQA 4MUZA 1HVXA 2R1LA 4QAWA 3RILA 1PKLA 2OB3A 3K4WA 4RE4A 2DZAA 1D8CA 2FMNA 4DJDA 1W1PA 3FKRA 1BVZA 3WQWA 4JKKA 4V15A 3QR3A 4GUJA 1PDZA 4MDPA 1KCLA 5LA0A 3BE7A 5HMDA 5I5RA 4I5UA 1B3YA 1EH9A 1V5XA 4BQ2A 3ATZA 3NR0A 4AD2A 4OQVA 3KBVA 4TVUA 3WH7A 4MNJA 1TCMA 1T96A 3OLEA 2E67A 3B40A 3HIJA 3FJ6A 4MADA 3B9OA 2IPGA 1ISWA 3K8LA 3RJXA 5HNRA 1K9TA 2ZZ5A 1KR0A 2NW0A 4H9UA 4HMEA 1GG1A 3EB2A 4O4VA 3DKJA 1KFBA 1OB0A 3WNLA 3E0VA 3FHAA 2FHFA 3VDCA 3T44A 1C9DA 4JHMA 4AWTA 5CJNA 1C8QA 1KD0A 3VC6A 3TW9A 4Q7BA 2VWTA 3IAPA 1HXJA 1ZENA 1XW8A 4O1EA 3NDZA 1AH0A 3W7GA 2J8FA 4PMRA 1EA0A 4EAYA 2WSQA 3FYYA 1TTPA 3WDHA 1A3HA 2PS2A 4MUPA 3W7RA 2YR1A 3UY8A 1H5VA 1EGMA 1E43A 3BLFA 4GI4A 2RGLA 4JKMA 4F0LA 1YTDA 4UOQA 1YKWA 2ZC1A 4Q8QA 3ABRA 4NZ1A 1GONA 4AMAA 3OVGA 1VJZA 1VLWA 1TVLA 3PJWA 1XH0A 4KT2A 3IJ7A 4OECA 2XN0A 4OU1A 2C14A 3DEQA 4EXAA 1M65A 1FUYA 3GR7A 4XX6A 1MEIA 3H24A 2UY5A 3IEBA 2JE8A 3RU6A 3FSTA 3UG5A 3WG6A 1XYMA 5LYRA 2VOTA 3FJ4A 1T7LA 2JKPA 3E6EA 4HNVA 4AZHA 2Z25A 1ZBVA 5F1VA 3WQVA 2V8ZA 3S9YA 2RDUA 1RBAA 2X30A 5CZTA 3UESA 1VRXA 3I4EA 3S5NA 3ZVHA 1ZCCA 4ZQNA 4JIQA 1W9BM 2IPWA 1UIPA 3JVAA 1XX1A 2CHRA 1GORA 1FWGC 1VFTA 3F5LA 3WQCA 1Q6EA 3T0TA 1S5MA 4J28A 3L2MA 5GNYA 1HJUA 4YYCA 4S3EA 1DOSA 3WLKX 3LCHA 1R7AA 3MWAA 4MJ4A 4OV9A 4GUFA 3IIPA 4C5ZA 1J6OA 4LEQA 5GJMA 4ATDA 4NU7A 3GXFA 4WJEA 4A3RA 1PZ3A 3PG9A 4J3VA 4BCEA 1K7EA 3JR2A 1XLHA 5BWFA 3VNDA 5AN7A 3S2CA 4R7OA 5E93A 2D0GA 3WDJA 1V0KA 2GQAA 3AROA 1EP2A 1MEHA 3F2BA 2BY2A 3WQFA 2VHLA 4UZSA 3H22A 3NQVA 2YA1A 1JULA 5KTLA 3XINA 1MVYA 3ALFA 2YL8A 4GACA 2IXVA 1S38A 4O8AA 4TMCA 4UTIA 4LS0A 2ZZ4A 1VBRA 1UWUA 3QZ6A 5D2TA 3G3MA 1Q3NA 3TSMA 1A0CA 2X1IA 1BXBA 5FJTA 5BU9A 3SCSA 2VGGA 2ZRZA 4K8EA 3I3BA 1XDMA 1KBJA 3CUJA 5HNUA 1K9EA 1KTCA 2X0YA 4NUWA 1V0NA 5C54A 1EZWA 3V75A 2VFDA 1R3YA 3P74A 1QU4A 3T4CA 5CJMA 1EGVA 1XH1A 3HN3A 5I07A 3CGTA 3UZZA 3TX9A 1HKJA 3KP1A 5EMJA 5AYIA 1K7FA 1OABA 1XD0A 2J79A 1J93A 4P8VA 1DKWA 4RLIA 4BI6A 4LANA 1VJSA 2PGWA 1OGGA 4HSHA 5FD0A 3DC0A 1VAHA 2XDFA 1BXNA 1DHKA 4GI6A 2YCJA 1PEZA 3AJXA 1F6PA 4GQRA 2XFRA 3W01A 3TH6A 1EIXA 1V8EA 1N2VA 4JHOA 1XLJA 4ZOCA 1ZBCA 5C7VA 4UR8A 3CUGA 3STPA 1PHQA 1ZBKA 4KEZA 1JYNA 1EXBA 3RGTA 3TYBA 3G8EA 4Z2IA 1IEXA 1UWSA 3PZVA 2EEXA 1C7TA 2Z29A 4CNPA 3SCQA 4WGHA 4W86A 2VDHA 3U48A 1OC6A 1IXNA 1W8SA 2A6LA 3TV8A 4JS3A 4JQ2A 4DBEA 2C6QA 3PK7A 1CGUA 3TVAA 3G6LA 2WZHA 3LPPA 1FHUA 1W5NA 4REQA 1E6PA 2JF7A 4IMAA 2J6VA 3AXKA 4YHGA 2O9PA 3ABZA 4C7GA 4LVBA 4GH1A 3RF9A 3W25A 3TKFA 2WSKA 1KXTA 1KM1A 4G56A 1F73A 3OBEA 4DO6A 1Q7ZA 3TE9A 3VMNA 1UJPA 1ZTVA 3DG7A 3EAUA 1WB0A 2ISFA 2CPUA 1OVDA 1XSIA 4CD8A 4PYSA 4Z0SA 3W7JA 3AO0A 1H0IA 1AJ2A 2QJIA 3R58A 1QRQA 4LYQA 4PUEA 3SCWA 4M3PA 3LLXA 5IDZA 1HJSA 1PAMA 1DWIM 3TR9A 4LUTB 1TPDA 2CHNA 5HR7A 1I75A 1CGYA 3MZNA 2XIJA 1PX4A 4XD5A 1G4PA 4LX4A 3G1VA 5F1UA 3GVWA 1XLBA 3ARTA 4O1DA 5C9UA 1PPIA 3P0XA 3WJSA 1W2PA 1YNQA 3WLTA 2WNZA 2IMRA 4NX5A 1XC4A 4U31A 4TX8A 3EX1A 3OBAA 4LSBA 2NXIA 1ONXA 1V0MA 5IBXA 3FS2A 5HNNA 2KX9A 4MNKA 1KBLA 5G4WA 4ZQRA 2HE8A 3ZWSA 1GQIA 3T42A 3DESA 3W7PA 4ZA0A 2INFA 4LUIA 1OFRA 4Y7EA 3DCPA 1XRTA 2ZUWA 3BJSA 4UTJA 2UBPC 5E70A 1J0KA 1JCLA 1Y5WA 3LX9A 4JAWA 1XBZA 2ZTKA 2A2IA 4RUBA 4D6IA 1VPYA 3GDRA 5M17A 1TVPA 1X6UA 5CSRA 4Q8PA 1A0EA 1EYWA 4DWSC 1OADA 4E6MA 4Q4QA 4HPNA 3ECQA 3N2MA 4Q33A 3BK0A 1GPFA 4C6MA 4K8HA 2H8ZA 3MMTA 2NWRA 3QTPA 4RK8A 1S5NA 3S9IA 2YLLA 1MEWA 2P76A 4WY0B 2FZMA 1VCVA 2BLEA 2VWSA 1YPFA 3A9IA 1TE1A 5A2BA 5FJPA 1Q7QA 1DL3A 3R11A 4CNNA 1LLZA 3NL3A 3HV9A 3I6TA 4O12A 4TOQA 1D7KA 4S3GA 3LHTA 1J11A 1KCZA 1R3TA 4IMGA 4W8BA 2RKXA 4FAMA 4QEEA 3GG8A 4YCPA 3SDOA 1ISVA 1REQA 8TIMA 1I0DA 4UNKA 4YPJA 1IT8A 2WYSA 5M5DA 3U5YA 5BMXA 2G50A 3N4EA 3TYEA 3VZYA 1GQNA 3TP4A 3V5OA 4L7ZA 2O9TA 1P4CA 3HPFA 3O9NA 2FDMA 4TU1A 2ZZ1A 3AAMA 2P0OA 1XYAA 4X63A 2BXVA 2XWDA 1U30A 1DIKA 5REQB 4DF2A 4DZIA 4GGHA 1YE6A 3KOYA 1LT7A 2YCEA 3V18A 4ONVA 4JTLA 1KO0A 3NO3A 3WF1A 1SZFA 4GNJA 3VABA 3HB9A 4JTJA 4E4UA 2WNWA 3LRMA 4Y8EA 4DXXA 1TREA 4LWWA 4MSSA 4A21A 4S23A 2BXZA 1Y7VA 1KRAC 2PE4A 3L5LA 3EZ4A 3QPYA 2QPSA 1ONWA 4B5SA 4W93A 4H9VA 3WUFA 2OWWA 4W7WA 4C6NA 2X0SA 3W07A 2W0UA 3QV8A 4UR7A 3NTYA 3N14A 1VHCA 3L4ZA 3N9KA 5F2GA 3S2NA 3PJTA 2PDUA 3RX3A 3W7CA 3M47A 4A22A 4KIRA 2E0PA 3WQOA 3OW1A 5CPQA 2V2HA 4ZTXA 3QH2A 3EOSA 2Y70A 5FOOA 3TWAA 4I8DA 1XF0A 2JK2A 4HYWA 4B5XA 4KQNA 1DXIA 2CYGA 3GUGA 2EKGA 3I68A 3ITVA 1W8GA 2IQDA 3TTOA 2G0WA 4LYRA 3CT2A 4IP4A 1SU5A 4JEQA 3AIRA 1AZ2A 4QRNA 4DB7A 2J75A 4GWEA 4B2DD 3QKZA 2G95A 3M64A 1GG0A 4ERAA 4X0VA 2WKJA 3VUPA 3IVTA 3BAIA 2NLIA 5BCAA 4X3ZA 3OPSA 2G4JA 4PN2A 1WDRA 4RKAA 4QQUA 1KW1A 3WLHA 1QNVA 5HATA 3KM8A 4PEKA 2PD5A 1AQ0A 3H2NA 1PHWA 4PUKA 1TSIA 1MW2A 5H2ZA 3UJFA 3GXMA 1AVAA 1CXLA 3H4GA 3KL5A 2I7GA 4AX6A 3TYCA 3VUSA 4QE5A 1MXSA 4NVTA 4L9ZA 3GE7A 1ZALA 3PZNA 4C1LA 5A2CA 1UQYA 5AC7A 4G7EA 1RALA 4MHBA 3RPMA 4BF5A 4C6BA 1FY6A 2RDWA 4PMVA 4S2CA 4KETA 2WSRA 3NQAA 4OBTA 3OZYA 1XIFA 5EL1A 5JBDA 2BMBA 1M7JA 2C3ZA 3DX5A 1GYLA 1GEQA 3R94A 3A5VA 3DBPA 3LK6A 1J2WA 3MYOA 2CLIA 4G6CA 5CC3A 2FZNA 6REQA 1R6WA 4WSHA 4Z2KA 1VPXA 3LNPA 4D6HA 4IP5A 2C18A 4GD0A 4QITA 4QHRA 2PZ0A 1M53A 2VGIA 1ML1A 3BICA 1R47A 3WFZA 3SQLA 4FX7A 1LCOA 4HHMA 3A4AA 2GFTA 3M6DA 2ZZ7A 1SFTA 2WZMA 2GDVA 3OO2A 1CIUA 4PSPA 1BHGA 4DJEA 4GYPA 1OIMA 3UZWA 4ICNA 2YGYA 3RRAA 1P7TB 1W9PA 4RZBA 2QDGA 3PNZA 4XZNX 2EPLX 3ITTA 1B4KA 3D0CA 4B4HA 4L9XA 5H8PA 5EFDA 2FVMA 4JIRA 4C6KA 3QY6A 1LRQA 1O6IA 2FPTA 4BY3A 1MXDA 1RZMA 1XLMA 3HM7A 3N25A 1CLXA 2UV8G 5BYWA 4BJHA 4UOZA 4AY1A 2QS8A 3AMLA 4KWWA 1A5SA 1XYZA 4E2DA 3PAJA 5FF2A 1L2QA 3PBGA 4V2XA 3D6NA 3WF3A 3HV8A 4AF0B 2FB3A 2XVPA 5ABFA 4PCTA 3SY1A 4AHQA 1WZAA 1TX0A 4JNMA 3EWYA 2HVOA 4GY7A 6A3HA 4ZO9A 4LFYA 3UZXA 4Q7NA 1T0OA 2FPVA 4I90A 3FX4A 3W3OA 1PTAA 4EPBC 1J4EA 6ALDA 2O7SA 3L0KA 1F5ZA 1JL8A 5FA5A 4Z2JA 3B06A 4QXIA 1TR1A 2F2HA 4E8DA 3PWAA 1QOQA 1H7XA 1NP0A 2PA6A 3B9DA 2IQTA 4MAVA 1TV8A 4QE4A 2QMJA 3VIPA 3LHUA 4M82A 3CAKA 4AXKA 2KAUC 1OFPA 4C7DA 3QFWA 3GC5A 3F1QA 1QPOA 4DY1A 3BTNA 4BWLA 3IV8A 2C13A 4XBSA 2Z28A 5EMLA 2H9AA 4O0KA 2A6NA 1VPQA 3L0GA 2Z6JA 1UHVA 3DHFA 3W26A 3OJGA 2PZNA 3EKZA 4C6CA 3HOJA 2ZVIA 4AHOA 4XZBA 2X42A 1Z9AA 4PUUA 2ADAA 2QIIA 2E9LA 1GOXA 3WELA 2ALDA 1NTHA 2OOFA 2P0IA 3Q67A 2V68A 4LPCA 4US5A 1ZNNA 3O06A 1KM5A 2PODA 3Q2DA 4Y9NA 3F03K 4LAMA 3FCPA 3VGBA 2UWFA 3U4FA 2TYSA 3N3MA 5I23A 3KHDA 4WK9A 4BQ5A 2QGYA 4UFJA 2QCLA 4HJFA 1TUFA 2GUBA 4ZOAA 1BYDA 2Z1WA 1XIGA 3AJ7A 3J7HA 3N4FA 2CBIA 2QUMA 3VCNA 3WBEA 3CHVA 3QZEA 2Q6ZA 3KL0A 5AHFA 2VJXA 3CZGA 3WNOA 3W4RA 1JIBA 1GVIA 3AMDA 5AECA 2BDQA 3EKGA 3M5VA 1Q13A 2PCEA 3PY2A 3CPUA 3T55A 2FH8A 2WPBA 1TWWA 2GDQA 1TV4A 4RXGA 1ZAHA 3QGAC 1H7WA 3RNDA 2OKOA 1M6JA 3TEVA 1A5BA 2WXDM 3TSBA 3GG1A 3LMYA 4GH3A 4ZZ9A 2WHJA 2FTYA 2HVNA 4FA3A 3WMLA 2CWXA 1UR3M 2VVSA 3Q65A 2V3EA 4C65A 3PZQA 2VX7A 3UGRA 4CN1A 2YZRA 2ZA2A 4UNIA 4N9CA 3N15A 3WLNA 1EGZA 1F61A 2OYKA 2Y24A 3K8KA 4F0KA 3GU9A 2HXUA 3GG7A 3BV7A 3M0YA 5IFPA 5BZAA 2YBTA 4HNNA 3ZLGA 4FNRA 3GXNA 5LSMA 3DGBA 2ZDRA 3FDKA 3GDTA 1FXQA 4OZOA 3S1GA 1KGWA 3CQHA 5E6YA 3TTQA 3MHGA 3CZEA 4CU7A 4MAZA 3PZIA 2PB1A 1SZRA 3RLGA 1LM1A 3CH9A 1W5PA 1PTDA 5I0DA 1BTMA 3AIWA 1F9CA 4XV0A 3MZ2A 4Y6GA 5KETA 3QHNA 4U10A 2VGFA 4DO7A 1ZJHA 2V3GA 4O50A 4CGTA 4OE7A 4KCUA 3THQA 4C91A 3OB8A 4JQ4A 2WMGA 4YS1A 5T8GA 3TUUA 3NNTA 3SCRA 4O11A 1BG9A 1SMAA 4G1KA 4QBXA 3B9NA 1KGXA 1W31A 3WH6A 4JICA 2TODA 3VVGA 3VM5A 3LHZA 5KMYA 3PUOA 4DQWA 1RPKA 4JCMA 4JTIA 3S2LA 2HK0A 4PRRA 4N6FA 2DT2A 1AQFA 2F61A 4NJHA 5J8LA 7TAAA 2ON3A 1X1ZA 3R12A 1EJSC 3K5XA 3W2JA 1HGYA 1JXKA 3ARSA 3WJWA 7CGTA 3KTXA 4AWUA 3PPFA 1WUFA 4FF5A 2BVYA 4J3WA 3GM8A 1CPUA 3LI1A 1U83A 1P48A 1CXEA 1V51A 2WWDA 1ODUA 2Z7GA 3KLLA 4PBEA 1RCQA 1XLKA 3O7UA 3VTRA 4E2BA 3LPFA 5K4XA 2RH9A 4KMQA 3KBNA 1OGBA 4F40A 5EBAA 3GXDA 2OPJA 1V08A 5K9CA 3S6TA 4WR3A 2BX7A 1VEMA 1YYAA 3R8RA 3BMWA 2GLKA 4F0MA 4RCXA 3TAKA 2HBXA 1V7AA 5D30A 2P3EA 1L6FA 1UP2A 4O57A 4GRSA 4QCEA 2X0HA 2C71A 4Z2HA 1S2AA 1NJJA 2A3HA 4Z42C 4G8TA 1CB7B 3KRBA 3B9AA 1IWPA 1BGGA 2X1UA 1CZ1A 3W22A 2QIWA 3L5MA 4JHZA 3W2LA 5BXSA 4LVAA 4Z1DA 5BRPA 2GSHA 2XH2A 3LUTA 1B3WA 1EHNA 5J5RA 5DXYA 1OFEA 1GOIA 1US0A 1GYMA 3H53A 2DUAA 1K3UA 3RX4A 4U4MA 3NM3A 3W1QA 4HT3A 2