4PBGA

6-phospho-beta-galactosidase form-cst
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
468
structure length
468
Chain Sequence
MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITCNGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
total genus 178
structure length 468
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pbgA00
5M3WA 3WQVA 3VGFA 3VPLA 2J7HA 3AI0A 2XVGA 1MWOA 3CUIA 3WFLA 3A4WA 3NSNA 4PMVA 3VTRA 5E09A 1HX0A 1SYTA 1QI3A 3T0BA 4WKFA 1J9YA 4AZCB 1KXVA 2E8ZA 3AYRA 4P8UA 4R27A 3ZJ7A 1GW1A 3VU2A 1HKKA 1ODUA 1XGZA 2CCRA 2J62A 4P8XA 3LPOA 3BSGA 2PWGA 5A6MA 1X6LA 2EJ1A 4PTMA 2W62A 2GSJA 1CXKA 1C92A 5LYRA 2YLLA 1ZBWA 4DWSD 3OGSA 2Y4SA 5D9NA 2WCAA 3VDAA 1VEMA 2BFGA 3PZOA 3OA5A 4OIFA 2Y2WA 4W86A 4WJXA 2EPMX 1FHLA 3THCA 4WLCA 4D6EA 2VR5A 1E71M 2PWDA 3GBEA 1V6WA 3AS2A 1BVNP 2IXUA 3MUIA 5A2BA 2ZIDA 5CG0A 2DSVA 1E6RA 2WCGA 5E0CA 4BZYA 3WDIA 4F79A 1MFVA 2J47A 4JKKA 3APGA 3OZPA 1NP2A 1GONA 1UUQA 1N82A 3WF4A 1WZAA 4P7RA 1G94A 4CCEA 1UKSA 1DWAM 4FK9A 2W66A 1HKIA 4B15A 1PJ9A 1M04A 1HJXA 2NT0A 4TVDA 2WHMA 3W53A 1YQ2A 3RO8A 4D1IA 2XVNA 2XHYA 5A8MA 2E40A 1GJWA 1HL9A 1TVPA 3AZSA 3L4UA 2J7EA 5A8OA 3RM4A 2V3DA 1J0HA 5EBAA 5I5RA 2YJQA 3DYPA 3ZSTA 4HTYA 3VX1A 4QLKA 4TUFA 1V6VA 3WBAA 2J7CA 1UWRA 3WL1A 1CWYA 3UR7A 5I78A 1EA9C 3KL0A 2O92A 1FH7A 5I3DA 1G1YA 1JI1A 1HJSA 5C71A 3FHAA 1D3CA 3OIHA 4U3CA 3L4ZA 1UQZA 3M7SA 1E0WA 3NYDA 4U31A 1DWIM 2XFFA 3WQ6A 1H5VA 1WZMA 4PCSA 3VNYA 2B31A 3BCFA 4KWUA 1ZBCA 2QMJA 3OGVA 2BY1A 2RGLA 4MTVA 2BY2A 3BAJA 1BAGA 2VUYA 1S46A 4B9YA 3S2CA 2AOSA 1KGXA 5EB8A 4FLSA 1KFWA 2XUCA 5GNXA 1NH6A 1FH8A 3HJEA 5GNYA 4R5EA 4J3TA 4W7UA 2WC4A 3GNPA 4XZBA 3AMLA 2E9MA 1H4PA 4AYSA 4EE9A 3A4XA 4GO8A 4BS0A 4W8AA 3IJ8A 2UWFA 3WH7A 1B3YA 4W8LA 4JFVA 1E70M 2G3MA 1OCQA 2CBVA 4HOZA 4MNMA 2G41A 1UA7A 3SUTA 2EQDA 1BFNA 4MPKA 3OGRA 3W37A 4HU8A 1V02E 3S6TA 2E0PA 2WMJA 1V02A 4PSRA 2UY3A 1LLOA 1UZ1A 3WUEA 1KR0A 4GZEA 4OZOA 2WVVA 3K4DA 4JFWA 1B90A 3GXFA 4J3VA 2WMHA 2ZOXA 1OB0A 1FOBA 5D9PA 2VX4A 6TAAA 4BF7A 3EDFA 4J3XA 1OINA 4GQQA 3WN6A 4NF7A 4JKMA 2DIJA 3M6DA 1ISXA 4MDPA 1V3IA 4GPNA 5A6SA 1PZ3A 5CPQA 4WKHA 3VIOA 8A3HA 3VMOA 4C7FA 5A6JA 3AS3A 2BVDA 1EGZA 3AMKA 1GOQA 2PWFA 3PZGA 5HPCA 3VIFA 3EDKA 3WENA 5I24A 5BWFA 5ABEA 2ZUWA 4MAVA 4FLOA 2WM0A 4UFHA 3BH4A 4XX6A 1UQYA 3AFBA 3CLWA 3AMCA 3AIEA 4JL1A 1C8QA 1WDSA 3VD4A 2VJXA 1UYQA 3CUHA 1W3LA 4M29A 2CHNA 2CBJA 4U2YA 2ZX6A 2XFYA 5FKYA 2EPKX 1KXQA 3CMGA 2FHCA 3A47A 3ECQA 1B2YA 1BG4A 2YDRA 1Q4NX 2GVYA 2JEQA 4AIUA 1GQJA 3UEQA 2WB5A 1UD4A 4AEFA 1JZ6A 3BAXA 3VNZA 1WNOA 1QHZA 3RMEA 3VVGA 3AIVA 1W9XA 1QNOA 3GXMA 2W5FA 2XG9A 1ISZA 3EMZA 1V0NA 1M03A 4AWEA 4NZCA 2D1ZA 1RD6A 3CMJA 1HT6A 4ZE5A 3CIVA 5EFFA 2O9OA 2FHBA 2OYLA 4H8VA 3WEMA 3VM5A 1JFXA 3WNLA 4UQEA 3U5UA 1ITCA 2BHZA 1HL8A 2C7FA 1JXJA 1VJZA 3AHZA 2VX5A 4N42A 3CUGA 1C8XA 4D6HA 4W85A 1CDGA 5CSUA 3W24A 2DT0A 1BPLB 3A3HA 4ZENA 1E4LA 2EPLX 1JAKA 2X0YA 3BAKA 3WDPP 1VB9A 3MSGA 2DEPA 3EDJA 4EK7A 4JFUA 1ZL1A 4KRTA 1DWJM 3RM9A 3PZNA 2XVKA 1TA3A 1W2PA 2X0HA 3BCDA 3PTKA 3TTOA 1UD8A 2D0GA 2YL5A 5A94A 2WVSA 3AROA 1LL6A 1KQZA 1QBAA 2XWEA 4CU6A 1Q6CA 3AHXA 5EFDA 3QOMA 1BYDA 3GM8A 4BQ4A 2BVYA 4GI9A 2V3FA 3CZKA 1V6YA 1JNDA 2XYLA 1G01A 2V5CA 3DC0A 3ARWA 1V03A 3W0KA 2CESA 2XGBA 4GZJA 2X05A 4P8WA 2WHJA 2VRKA 4W88A 3L4VA 3TTQA 4PTWA 2VVSA 5E6ZA 4D6CA 1JNEA 4FLRA 2FH8A 3JUGA 1WAWA 2VVNA 3PN8A 2BY3A 1EIBA 3K46A 1R86A 3POHA 3VGGA 2ZE0A 1OSEA 1XH2A 1B3VA 2VCBA 2W4XA 3EYPA 4UQ9A 3AHTA 1DP0A 4P7OA 4PMNA 2CPUA 1C90A 2V38A 2VZOA 1SMDA 3B8SA 3NSMA 1B31A 1ISWA 1W3JA 2GDUA 1BF2A 3ARPA 3CHFA 2ZICA 4X0VA 3W6LA 2AAAA 4UQDA 3SUSA 1RP8A 5HDRA 2OSXA 1LG2A 3FN9A 4W5UA 1UD2A 2ZX7A 2YBUA 1MYRA 3N12A 3CHCA 5I2UA 2MANA 4ZE4A 5A8PA 4AZ6A 3SUVA 5FIPA 1K9TA 3VINA 5CGMA 4ZXLA 4FMVA 4S3KA 1VFFA 2Y8KA 4PMXA 1TCMA 1OWQA 1CGTA 2QLYA 1B3ZA 1TZ7A 3VDCA 1E3XA 2IXVA 1JD7A 3NUKA 3VDHA 1E4MM 2J8GA 4DWSC 4UOZA 1B3WA 2XGIA 2JF6A 1WDRA 2QV4A 3ARUA 1W9VA 4H8UA 5FL1A 1QNPA 1J0JA 3LPGA 2CXGA 2J77A 4HZ7A 3ZIZA 4BCEA 4PUDA 3CUJA 4CN6A 3OB8A 3ARXA 1BYAA 4W7WA 2WNWA 2CIPA 4WSKA 4D72A 4PMOA 5CPSA 1LQ0A 1CENA 1PX4A 1CLXA 1IZKA 2J25A 1XSJA 1QW9A 4U33A 3GDBA 5C70A 4PRWA 3IANA 3ZJ6A 1JDDA 2CKRA 4ZXOA 1BYCA 1H49A 4CN4A 5KEZA 3WKZA 4UQCA 1VAHA 4J27A 4M80A 2CYGA 2JIWA 3K1DA 1KWGA 3AZRA 3IJ7A 1HP4A 1OT1A 2ZX8A 3TOPA 1H1NA 1JFHA 2WBGA 2A3CA 2XTKA 1EO7A 4OOUA 1KR1A 3FW6A 1QPKA 4ZFMA 4BQ3A 4M56A 1PBGA 4C7DA 1CXEA 3PZUA 2ZXBA 3N18A 4PSPA 5A8NA 3AXXA 3AQUA 3CHEA 3QHOA 3N17A 1GVIA 2EPOA 4OUEA 1V3MA 2QMKA 1TFVA 3T0DA 2VQUA 2VO5A 2VT0A 3VGDA 3HU7A 5AYIA 4TVCA 1E6QM 4MB5A 2WVTA 3W38A 2WK2A 4LX4A 4PMDA 4A3YA 4CVUA 1I1WA 1UR9A 4U2ZA 4X0NA 4UQBA 4TTGA 3F5LA 4ATLA 2WBKA 1E4IA 3MUZ1 2D24A 2CERA 2GJXA 1ODZA 1BTCA 4TVUA 4QLJA 2AMGA 1BYBA 4AZIA 2J7BA 4AXNA 1GHRA 1UKQA 2VCAA 1EOKA 4AZCA 4UFIA 4WK9A 2HVMA 4GZIA 3LPPA 3WQ8A 2J8FA 1WDPA 3NDZA 3UESA 4DUWA 3AOFA 4CCCA 1UD6A 1U2YA 3TTSA 1W9BM 1UKPA 1F4HA 3OLDA 1V0KA 2DPEA 1HJWA 4W5ZA 4D6JA 1WZKA 1HIZA 3MANA 1E6NA 2YL6A 1WPCA 2XVLA 2D23A 1IZJA 4AW7A 1HNYA 2QPSA 3QHMA 4P7QA 2EXOA 3ZJKA 1JXKA 4CD5A 1OGGA 1ECEA 1UR8A 5I79A 2J78A 2UY2A 1KCLA 3ZR5A 5M17A 3SCRA 4D6FA 1V3LA 4D6DA 2E3ZA 4AD3A 4UOJA 1QHOA 1PIFA 4NRSA 5D8ZA 4W8BA 3BAWA 3UR8A 4A4AA 2OWWA 2CBUA 2J7GA 5CLTA 1LWJA 1RH9A 1VBRA 4LYRA 2A3EA 1VEPA 2WWDA 1UG6A 1VJSA 2VL4A 2WVUA 3OBAA 1UWUA 1HN1A 2EPNA 3PTMA 2ZUVA 4U3AA 4QDMA 3GNRA 3VM7A 3ARSA 1CNVA 1BGGA 3CBWA 3RIKA 1B30A 4TTUA 3WF3A 3WBEA 2NW0A 5GNZA 3F5KA 1TR1A 5DT5A 5JBEA 4LYPA 1V08A 3WF2A 4CD8A 4GIAA 2V3EA 1E0VA 2WKGA 3AIBA 1V0LA 3MKKA 2F61A 2X2YA 3OLEA 4XV0A 2JF7A 5ABHA 3AHVA 4GI8A 1E56A 1K9DA 3CH9A 1X6NA 3W29A 3MMUA 5CGTA 4JKLA 2Y8VA 3AS1A 3QR3A 2J74A 5I0DA 4WF7A 2O9RA 1JIBA 4XUYA 3WEZA 2DIEA 3VIHA 2Z1SA 1LJYA 3GBDA 1FH9A 3MMWA 3ALFA 3ZOAA 2VX7A 1KQYA 1B0IA 2JE8A 1VIWA 4ACZB 4B16A 4P8VA 2ZXDA 2VNCA 2FH6A 2WANA 2WKLA 4JL2A 2VRQA 1XSIA 1V0MA 1ZJAA 5A6KA 1H41A 1WDQA 4D6IA 1E55A 2OSWA 4CCDA 5AC5A 4F9JA 1VF8A 3W4RA 4QAWA 1JF6A 3CZLA 2VOTA 1DEDA 3SIMA 2XM2A 3D5HA 4CD4A 5BXTA 5M5DA 1UA3A 1GCYA 1W9PA 1E73M 1BHGA 2VZTA 2WZIA 3SURA 1I1XA 3W25A 2YOCA 2XWDA 3FNDA 3WMSA 1JD9A 3K8MA 3KL3A 2VZVA 2FHFA 3W81A 1E5NA 3WEOA 4AC1X 3WUGA 4D6GA 4IISA 1GNXA 4MAZA 4HA4A 2YDSA 1E0XA 3SCUA 3SUWA 1JYWA 1HVXA 3PZQA 1JI2A 4KRUA 1CLVA 2RGMA 2DDXA 4P7LA 4UCFA 4Q7NA 3AZTA 1B1YA 3ZR6A 3PTQA 1UKOA 1HVQA 2EBNA 2DT3A 2WC7A 3QGVA 5A6BD 1TMQA 4AMCA 5KZ6A 1OM0A 2GFTA 4QLLA 4WSJA 1B9ZA 3WH5A 3LMYA 5D8WA 3II1A 1TVNA 1BG9A 3ZSSA 5JBDA 3T08A 3VIMA 1CTNA 5HXMA 3SCQA 4L4OA 3UCQA 3POCA 4J28A 1LL7A 3ARYA 1PX3A 4PCTA 1LL4A 1MQQA 5CZKA 1LF1A 1OIMA 3U7BA 2GUYA 1WZLA 5A6AA 3DYOA 5A69A 3T09A 1FFQA 2CETA 1XCWA 4QP0A 4D1JA 4HOWA 1W1VA 2WMKA 1QOXA 2W91A 3GYCA 1L8NA 5LA1A 1HJQA 3UG5A 4MNKA 2WMIA 1JZ8A 4UZUA 3F5JA 2OYKA 4AD0A 3EDEA 1OD0A 4CN1A 3GNOA 3T2QA 4OBRA 1J0IA 4J3UA 1JDAA 3IK2A 4H41A 7TAAA 4CVWA 2V5DA 5BXPA 2YIHA 3SCVA 5D9MA 1US2A 1UWTA 4PMQA 1EOMA 3AS0A 4QCEA 2WWCA 1CYGA 1MXGA 4GQRA 3WQ5A 2W92A 3AYSA 3B9AA 3VKKA 4WKAA 1CBGA 5D9OA 3ARVA 4PEEA 2OWXA 2ZWYA 2JEPA 1JYNA 3A6OA 3WNOA 5LA0A 3D3AA 4DWSB 1CXLA 1QI2A 1A3HA 5CSYA 2W67A 2Q8XA 1NWRA 2J75A 2G4FA 4GXPA 1KCKA 4PBGA 3MUY1 3AIRA 4UFMA 2ZX5A 3OG2A 1W3KA 1L0PA 1MQPA 1ZB5A 4D71A 1AMYA 1GOKA 5DMYA 3KZSA 2NT1A 2PBOA 2VRJA 3VX0A 3IAPA 4EKJA 1KXHA 2VR4A 5DT7A 3DYMA 4P7NA 4AZ5A 4WIWA 2PBGA 5DEZA 3E1F1 4LXFA 3VGHA 3MO4A 3WY1A 5LA2A 1W1YA 3GH7A 2D3LA 1LG1A 3RCNA 1J11A 5ABFB 3W82A 3IJ9A 3QHNA 5E6YA 1CXHA 3SEPA 3WNNA 3RDKA 2E9LA 4H8HA 4LQ1A 1GVYA 3N11A 4YN5A 5JIWA 4AZGA 3OZOA 1W1TA 4JCMA 1UD3A 2EEXA 3UERA 2YL9A 1NOUA 5DF0A 3MU7A 3VD5A 3MS8A 4CUCA 3MV01 2WSKA 1CIUA 1NARA 5A8QA 5C8BB 2C0HA 3VIPA 1UD5A 3M46A 4ZEPA 3W6MA 4RE2A 3FAXA 3SCNA 1AVAA 3PZIA 1J18A 3VIGA 4ATWA 1U30A 3KL5A 2XVPA 3N15A 3L2LA 3LPFA 1JL8A 4UOQA 4DM1A 1QNRA 2OLHA 4V2XA 1FFRA 3AMDA 1UH4A 2WCSA 2QF8A 2WLYA 1SFSA 1E43A 3PBGA 2DSWA 4JHOA 2D20A 4YHEA 4V28A 2A3BA 2DH2A 2G3NA 1KXTA 4MDOA 4PTXA 1HF6A 2WLZA 4M24A 3ARZA 1QNQA 1BSIA 3DECA 5ABGA 2WAGA 2VMFA 1PX8A 3RM8A 3WMBA 4Z2HA 3SCOA 3RJXA 1W32A 4Z2LA 1GORA 2GJXB 4IM4A 3L4WA 1QVBA 4JFTA 4PN2A 2V3GA 1KWKA 1E40A 4F9DA 3L4YA 1FP8A 1KGUA 4PMYA 3GTNA 2CITA 3BMWA 5BROA 3K8KA 3QOKA 5IHSA 3L4TA 1XC6A 3CTTA 2ZX9A 2X8RA 3BXWA 4UQAA 3N04A 2DGAA 4JZ5A 1G0CA 4H7VA 3B9EA 5IDIA 1OIFA 2E8YA 1ISVA 4HU0A 4URIA 1CECA 2XM1A 3IAQA 4BQ5A 5A1AA 1KBKA 1EDQA 3VIKA 2DH3A 4KGLA 2D2OA 4EANA 2VC9A 2J7FA 1QI4A 1UH3A 3WQ4A 1K6AA 3AICA 2IUZA 3PZVA 1AQ0A 3J7HA 3O9NA 1WP6A 4XZWA 1GQIA 5CJ5A 1JZ2A 4KGJA 3ALGA 2A3HA 3PZ9A 3CGTA 4M82A 5HBFA 4MNJA 2WYSA 3WD4A 2ZXQA 3O2LA 5AC4A 1ITXA 1H09A 1US3A 2WMIB 4Z2KA 1EH9A 1K9EA 1RP9A 1KGWA 1C8YA 2GDVA 3TTYA 7A3HA 1SR0A 1FP9A 2ZUNA 4H04A 1JGIA 4MB1A 1XHGA 4AD5A 1PAMA 3GZAA 2YDQA 1ZJBA 2JALA 1DWFM 1GOIA 4TOQA 1IV8A 3WF1A 5BCAA 1NM9A 1BVZA 2DSZA 2GJRA 2PC8A 3OLIA 2PB1A 3VMNA 2YL8A 1XH1A 4MADA 5EMYA 3W27A 3VGBA 4AY1A 3WIJA 2TAAA 1VRXA 1I75A 3N9KA 4UZSA 1W3HA 2G3IA 4RE3A 2BY0A 3EDDA 4DUVA 1GOMA 3WH9A 5CPTA 2G8ZA 3PZMA 1Z32X 2F8QA 1W91A 3SUUA 3VIIA 1JYVA 3EMQA 2OSYA 3RILA 3FAWA 3A4AA 5CXPA 1OGSA 3EMCA 2ZUSA 4U5KA 4FLQA 1QW8A 4JFSA 3MMDA 2YBTA 4DUXA 3N13A 1YHTA 2Y5EA 3VIJA 4Z2GA 1EO5A 3KE0A 4MJ4A 4AEEA 1QNSA 3T2OA 1CGVA 3U5YA 4PUEA 5BXRA 4W87A 3VGEA 3EBVA 1GOOA 1F4AA 3ARRA 4NI3A 3WF0A 5I6SA 1JZ5A 3F4VA 1XYZA 2DSUA 2VZUA 4PYSA 3NSXA 3BC9A 1UWSA 3I3DA 4E8CA 3FXYA 1JZ4A 5GPRA 1XD0A 1R8LA 3SCTA 5I23A 4GKLA 1CXFA 4GO9A 4HA1A 1E6PA 2CHOA 4OOZA 3FY1A 1E1FA 4YHGA 3UETA 3WD1A 4CKQA 2O9PA 3MUAA 2WW5A 4OKDA 1V3HA 3MSDA 1DWGM 1UOKA 1DWHM 1UH2A 1E5JA 1HKMA 3ARQA 1VBUA 2DQXA 5HNNA 1M7XA 1XYFA 4MB4A 4LGXA 3WNKA 3WMCA 2CEQA 3CHDA 3ZT5A 1H2JA 1NOFA 4HP5A 3VO0A 1QBBA 3WELA 4FF5A 1W2VA 4GINA 7CGTA 1OT2A 1A47A 4AD2A 2D0HA 1R87A 3WDHA 4HMDA 4GI6A 2X1IA 1CGYA 3WUBA 1EHAA 3TA9A 2BNJA 3NDYA 4Z2IA 4M1RA 4NSBA 1JZ7A 3WDQA 3G6MA 2BXYA 4MNLA 4CD7A 3ZO9A 4PTVA 4HA3A 5IHRA 2XJ7A 3BSHA 1CPUA 1CGUA 1GQKA 2FGLA 1HKJA 4YPJA 1M01A 3T0AA 3BAYA 3THDA 4L4PA 1WE5A 1UHVA 1P6WA 5A2AA 1XD1A 1WKYA 5DO8A 1PZ2A 3GXDA 3I3EA 4BA0A 2J4GA 2ZUUA 4M81A 6A3HA 2D0FA 3GXIA 4C7GA 3SCWA 1J0ZA 5I77A 4HPHA 3UG3A 2CNCA 1E15A 1J10A 1K9FA 1Y7VA 4BQ2A 1UWIA 1LWHA 1H0GA 3RJYA 5AY7A 2DT1A 4AD1A 4B3KA 2VURA 1TUXA 2PF0A 1AQHA 4AD4A 5D4YA 1J0KA 1Q6FA 1C7SA 5AYBA 1MW0A 1HXJA 5JUVA 4UFKA 1E3ZA 1D7FA 2A3AA 2BHUA 3WDRA 4ML4A 1R7OA 1MXDA 4AIEA 3K8LA 2WHLA 1NWTA 1GJUA 4Q22A 3VOCA 4CU8A 2OYMA 5E9AA 3UG4A 2YA0A 1GHSA 1WB0A 1CGXA 1JYXA 4JIEA 2QHAA 1V3JA 3AISA 1VENA 3MV11 4W89A 1DTUA 3ZMRA 4UFJA 3AXIA 3B9DA 1H11A 1XV8A 3DHPA 4IPNB 1E6XM 4AZ7A 4W93A 4OBSA 1O6IA 1FHDA 1D2KA 1VEOA 2WC3A 1NWUA 4KMQA 4UNIA 1OGBA 1NP0A 2YA2A 1J01A 1UR0A 4AZHA 4F8XA 5A95A 2CBIA 4AISA 4J7RA 2D3NA 4UR9A 2WPGA 5A6LA 3ZQ9A 3ZT6A 2ZUTA 4DWSA 2WSPA 1NQ6A 1R7AA 2PWEA 3WD0A 1SMAA 2YKKA 2XIIA 2ZUMA 2BS9A 3I3BA 5GQBA 4W84A 2XSBA 5BXSA 3AIUA 2XIBA 4JHZA 4MB3A 3CO4A 2YLAA 1ISYA 1VFOA 5E0FA 3PZTA 5FOOA 2E9BA 1J12A 4DM2A 2XPKA 3WUFA 1ZBKA 4HMCA 2EO7A 4ATDA 2NSXA 1EDTA 1E72M 5HPOA 4OJYA 3ZT7A 4HOXA 1UKTA 3SCSA 4HZ8A 3ARTA 4QCFA 1E1EA 1GZJA 1Q6EA 4AZBA 3BLPX 4B3LA 6CGTA 1TG7A 3CUFA 1IT0A 1J0YA 1GOWA 4TX8A 3HN3A 1E6ZA 3NJ3A 1ZBVA 4IUGA 1C7TA 3NIYA 4TXEA 2BXZA 1QI5A 2DT2A 4CGTA 1PPIA 3VD3A 5BYWA 1VFMA 4E4PA 5E70A 1PIGA 2QPUA 1EQPA 3K4AA 2ZXAA 1E9LA 2JIEA 4IPLA 2E4TA 4A3HA 3WSUA 1U33A 2VI0A 1VFUA 4E8DA 4M8UA 1E4NA 4RE4A 2UY5A 3W26A 1C3FA 2D22A 4E2OA 2VCCA 5TD4A 3GH4A 1JF5A 1H0IA 2WMGA 3AJ7A 5DFAA 3AXHA 3CPUA 1QHPA 1BGAA 3L4XA 1C91A 1WO2A 2WVVB 2WXDM 1MQRA 4J3WA 4CD6A 3L2MA 2WZHA 3ZM8A 1CGWA 5A2CA 1GUVA 1EXPA 1B3XA 5CQ1A 2WHKA 1H3GA 5HOSA 1BQCA 3WD2A 5BRQA 1W9UA 5JIPA 2BHYA 3CZGA 1JDCA 2Z1KA 3PHAA 5FCZA 3BMVA 2F2HA 4AIOA 4S3JA 4ACYA 4UTFA 1AQMA 1EHNA 2ESCA 2DSKA 1ESWA 1JZ3A 3SCPA 2J7DA 1UZ4A 3WNMA 3U7VA 1XH0A 3KWXA 2PWHA 2XFRA 4PMZA 5M03A 4V27A 2G3JA 3WL0A 2Y24A 1HJUA 3AMGA 4PMUA 1OBAA 2VQTA 3WDJA 1WCGA 1G9HA 3O6AA 1MW1A 5A3HA 1ZU8A 2VTFA 1PEZA 5ECUA 2X09A 1EDGA 1Q6DA 4JCLA 4X9YA 2FGZA 3FHQA 4Z2JA 2YA1A 1JAEA 4XB3A 2XSAA 1X1NA 4PMRA 3BGAA 2FDMA 2VZSA 3VD9A 2PI6A 3KEHA 1TA3B 2CKSA 3U57A 1GQLA 1QI0A 1W9DM 1DHKA 3OLGA 1GPFA 3WQWA 1MW2A 1CXIA 1Q6GA 5IFPA 2WMFA 4Y7EA 4NRRA 3VUPA 4QFUA 2BVTA 1CEOA 1E6SM 5FD0A 2GK1A 4UFLA 1XRVA 4B9ZA 5ABFA 1KBBA 4N0RA 5IFTA 2OWCA 4J3SA 3WH6A 3AIWA 4CU7A 3VD7A 3BLKA 4HZ6A 1R85A 2GJPA 1C93A 4KH2A 1UWQA 1UR4A 1EQCA 3N1AA 4MJ2A 2O9TA 3VILA 3WFZA 1FA2A 4F66A 4LYQA 3RPMA 3ZJ8A 3TP4A 2WZEA 1V3KA 1G5AA 2HISA 1MFUA 4EAMA 3W28A 5FL0A 5A6BA 4LPCA 1XCXA 1V6XA 3CZEA 1CZ1A 1NOWA 2BV9A 3NCOA 4K68A 3DHUA 1RPKA 4ACZA 2W61A 3HMCA 1KB3A 3BAIA 3T2PA 1HJVA 2JFEX 2GK1B 2W63A 2J79A 3AIQA 5JBFA 3VDBA 1NWSA 1UR2A 4TX6A 1HP5A 2ZWZA 2C8NA 4RL3A 4HMEA 3VMPA 1OD8A 4W7VA 3WNPA 1W1PA 2VX6A 3G6LA 1JG9A 2UY4A 4JAWA 1O7AA 1M53A 5CLWA 1BLIA 3CZ8A 8CGTA 1XSKA 3TONA 3M07A 1MVYA 4H2CA 5IXEA 4U5IA 3GH5A 4HPGA 9CGTA 5BRPA 3WD3A 3AHYA 1ZS2A 1V6UA 3WH8A 5F7UA 1TE1A 1MW3A 1UR1A 3CZJA
chains in the Genus database with same CATH superfamily
3MYOA 3GO2A 2XVGA 2C1HA 2AGTA 2Z6IA 3WFLA 1V7YA 3NSNA 1IEVA 1Q3NA 3ANUA 4ZB2A 2QJGA 4WKFA 1J9YA 1KXVA 3AYRA 1AD4A 1EIXA 4YTRA 1GW1A 1HKKA 1XGZA 3WBWA 3W71A 4K39A 1KRAC 3QPZA 4W9TA 1VYSX 4Z0SA 4C5ZA 2VDHA 4R7WA 3C86A 4DWSD 3EX1A 3OGSA 5AHEA 2Y4SA 4F48A 3PZOA 5CC5A 2ZRZA 5B80A 1WXZA 2ALRA 2Y2WA 4W86A 1FXPA 2AQWA 4FX6M 2VR5A 1T8QA 1E71M 1W31A 3GBEA 2PP1A 4HPJA 1BVNP 5AHLA 2DQWA 4F79A 4XIAA 1MFVA 4EXBA 1HQTA 4UR7A 4CNNA 3QQWA 3WJWA 5CJMA 1RLCL 3APGA 4IQEA 1GONA 4ZQRA 1G94A 4CCEA 2ISFA 1PIIA 2W66A 1PJ9A 1M04A 1HJXA 3MDUA 4IIBA 2RJGA 4AXKA 3W7OA 3LCXA 1YQ2A 3EB4A 3N14A 2ACSA 2E40A 4UR8A 1TVPA 3ES8A 4FXJA 2Z26A 1ZP4A 2J7EA 4DZHA 4FS9A 2INEA 3MVIA 4O15A 4CLMA 4KCVA 4OECA 1PTDA 4HNCA 2PDFA 2GQ3A 4GGHA 1V6VA 1UWRA 5HATA 5CG7A 4F3HA 3TYCA 5I78A 2EGZA 1OX6A 4NZ1A 1FH7A 1G1YA 1HJSA 2DV0A 3N34A 1D3CA 2JKAA 2XH7A 1KBIA 5I3JA 1DWIM 4AIBA 1VS1A 3VNYA 3ITLA 4KWUA 3CYVA 3TVAA 3M47A 3BAJA 1BAGA 1S46A 4KIEA 3VZYA 2NVDA 1KFWA 2IQDA 3HJEA 3IIZA 1NDYA 4J3TA 1ICPA 4ZR8A 1N55A 3GNPA 4AYSA 3RK8A 3A4XA 3B40A 4W8AA 3WLIA 3MCMA 4Z1BA 5T8GA 1THFD 1E70M 5FI8A 1A5CA 4MNMA 1K70A 1HO1A 4DBSA 2DIKA 1BFNA 2P88A 4IIFA 4DJDA 1A50A 4MPKA 3W37A 1R3QA 4HU8A 2R1PA 3E3HA 1OC5A 2E0PA 2WMJA 2ZA2A 4PSRA 2E68A 2UY3A 1K8CA 3S3GA 2B7NA 3GXFA 3PK7A 3S2MA 2WMHA 2ZOXA 2Q8ZA 1FOBA 4NKCA 2VX4A 3CPRA 2YPIA 4ICMA 3R7MA 3N2XA 4J3XA 5HNTA 4GUFA 1TWZA 2QGHA 1VIZA 1Q2SA 5CPQA 1NJJA 4WKHA 3W74A 1SW3A 2BASA 3VMOA 5A6JA 2BVDA 3AMKA 1GOQA 2PWFA 3UWYA 5MKGA 4CQDA 5HPCA 3H8AA 3WENA 6PTDA 5I24A 5BWFA 5ABEA 2ZUWA 1FBAA 4FLOA 2WM0A 1CT5A 3BH4A 4XX6A 1UQYA 3CLWA 3AMCA 4JL1A 4WGXA 1C8QA 4GJJA 4QJ4B 3DKLA 2H8ZA 4KFPA 4LW7A 3CUHA 1W3LA 2OZ8A 1EL3A 3D3FA 3A47A 4LCSA 2XN1A 4I6KA 4NAEB 1JCMP 2YDRA 2GVYA 3CQKA 2A7NA 2I5IA 2GQ8A 3LX9A 3R0DA 3TQKA 3DI0A 1UD4A 3VZZA 3GVWA 1QHZA 4CQCA 1OEPA 1QNOA 2W5FA 5EU9A 4PUKA 2VGIA 3BG3A 4ZE5A 1QPQA 3MI3A 4JQAA 2V2CA 2FHBA 1GGOA 2OYLA 4HCLA 9XIAA 3VM5A 5C2XA 1HKWA 2J88A 4UQEA 4JIPA 1ITCA 2YZRA 4Q8TA 2C7FA 4JY8A 2C71A 4DJDD 3UPMA 4HSHA 1XQLA 5CSUA 3RX3A 1XXXA 2FVLA 1WXYA 4ZENA 4G7EB 1D7KA 4TV6A 2PLKA 2X0YA 3BAKA 4FX7A 4CNPA 2A6NA 3IGUA 2ALDA 3I7RA 2IQTA 5G2IA 1AJ0A 4IXXA 2XVKA 5H6HA 5H8MA 3AUJA 1H60A 2PODA 1TA3A 1F2JA 3F2BA 1LLZA 2A3LA 1UD8A 2YL5A 2QUMA 3E5BA 1KQZA 4GX9A 4Q4KA 5EMJA 4CU6A 3NQ6A 3IS4A 1TPUA 3QOMA 2PDLA 1GT8A 1O94A 4GI9A 3CZKA 3T44A 4Y8FA 1RVGA 3PUOA 1S5VA 2R91A 3BLDA 4H9MA 3VXGA 1UBSA 2PDHA 4P8WA 4W88A 3THAA 4JIHA 1EP1A 4LAOA 2VVSA 1GYMA 2UBPC 3MKVA 2H90A 3QFEA 1TO3A 4C1KA 1DQUA 2HWGA 1TZZA 1TTQA 1YADA 4JQ3A 3LHWA 3R11A 1C90A 3TUUA 3W1AA 3CT7A 2GDUA 1QK2A 4TIMA 3CHFA 3B05A 4JTTA 1S38A 2AAAA 4JNYA 1RP8A 1QDSA 4DAFA 3W7JA 3B9NA 2HCVA 4G1KA 3SUVA 3UPBA 1K9TA 4XZMX 5CGMA 3GE7A 4FMVA 4S3KA 2Y8KA 3CV1A 2O7SA 3MCOA 2OOFA 3VDCA 2IXVA 1EYEA 2OFJA 2OEKA 4GJ1A 4DJEA 3NQCA 3LRKA 1W3TA 3DUGA 3CK5A 1SFLA 3LPGA 4QS6A 4CN6A 4BCEA 4PUDA 3CUJA 5BOFA 2Z24A 1BYAA 1XLJA 2VDGA 2WNWA 4D72A 4IFRA 4H00A 3TR9A 4Y8EA 1F73A 1H7XA 1KM5A 1PX4A 2IMRA 4UMCA 5FF0A 4Y90A 3GDTA 3GDBA 1OFEA 3ZJ6A 4ZBCA 4ZXOA 1I2PA 4CN4A 2R1LA 1VAHA 2DVTA 2CYGA 5HULA 1XFCA 1VH7A 3UR5A 4IICA 3LQLA 4Q8OA 4DPPA 1DXFA 4DF2A 2XTKA 2YXGA 4TMBA 2ABAA 4Y96A 4NX5A 3M5VA 1L2UA 5TIMA 3W1UA 4ZFMA 4N4PA 1RCOB 5DN1A 4C7DA 4FIRA 2QS8A 4IQLA 2PURA 5EL1A 4MWAB 1F05A 5A8NA 4DB7A 3AQUA 3QHOA 2NXGA 2PSNA 2I9EA 5HMEA 3KTSA 3UT0A 2AL2B 3EGJA 3S5NA 1V3MA 2AQOA 2HPMA 3T0DA 1H7PA 3NOEA 2VGFA 3FOKA 3SY8A 3W38A 3QLLA 2BZNA 5G4HC 2R94A 1JUKA 2FFCA 3A13A 4HHLA 4ATLA 1E4IA 2OZ0A 1A80A 1U22A 5REQA 4HJWA 4LS0A 4TVUA 3WQGA 5FESA 2LLEA 4AXNA 1EOKA 1RBOB 3LYEA 3WQ8A 1IGWA 3HV8A 5AYXA 4CNUA 7ODCA 3P60A 2V30A 5ENLA 2EG7A 1V7AA 2ZZ7A 2PDUA 3QKEA 1HJWA 2YW4A 1HIZA 1ADDA 1WPCA 3B3DA 5L6UA 3WJYA 4YTQA 1C9DA 1UJQA 1PTAA 1BKSA 3QZ6A 1BWLA 1KFJA 4XO6A 4OGZA 3R79A 4O0QA 1EGVA 4FI4A 5I79A 5FJOA 2J78A 2X16A 4S23A 3FX4A 4D6DA 4AD3A 1PIFA 4NRSA 3EPNA 3LM3A 4I5XA 2OWWA 1S2WA 3UR2A 3UZXA 4B92A 1IEWA 4N7QA 3NL2A 2L5HA 2Q71A 1Q7MA 2QCMA 4S3FA 2WVUA 3G1XA 5CAKA 2ZUVA 3DESA 2YYUA 4XD4A 3SFWA 1BGGA 2VFIA 3R43A 3RIKA 3HFTA 4Y9PA 4TTUA 2PZNA 2WSQA 5GNZA 5DT5A 1AMKA 1GVEA 3RHGA 4CD8A 1P43A 1QWKA 4E0CA 2X2YA 4LVAA 3EXSA 3OLEA 3OODA 1K9DA 4XD6A 4LYKA 2CLLA 4LUIA 3AS1A 3QR3A 4YS1A 1VCVA 3OOQA 2C6QA 1W3NA 1OG0A 4E3VA 1LJYA 3SI9A 3ZOAA 1E1CB 1KQYA 2JE8A 4WX2A 1QOQA 2FZ9A 4RLIA 4GQGA 3V75A 1SFJA 1IT8A 2CZEA 3PBVA 4XSMA 3T8LA 3C0LA 1H41A 1WDQA 4CCDA 4WZHA 2DVXA 1EJUC 4QAWA 3CZLA 2INZA 3CLMA 3L23A 1SZEA 3SIMA 1OX5A 2UV8G 1ZTVA 5M5DA 1E73M 1BHGA 3ITGA 1I1XA 4E4UA 3W25A 5FACA 1FCUA 4KEMA 3BZJA 2XWDA 3FNDA 2AKMA 3K8MA 1DJYA 1O4UA 5KTLA 4G5DA 3DBPA 3AU2A 3W81A 5LHEA 1YMYA 1XG4A 1E5NA 3WEOA 3WUGA 3WLNA 1HKVA 2R24A 3HJZA 2RJHA 3CAKA 3KVKA 4M0XA 4KETA 2EF9A 2RGMA 3SGUA 4P7LA 1OYAA 4UCFA 1T40A 4I8YA 1IF2A 2FDSA 5GJNA 3NPWA 3QGVA 5BU9A 5A6BD 1TMQA 1KFLA 4GG9A 2YFOA 2CXEA 4ZSTA 4F2UA 1P1MA 4PULA 1TVNA 3CH0A 4J2PA 1BG9A 2Z7GA 3XISA 3GW0A 1CTNA 4FNPA 5HXMA 2H6RA 4HYVA 4M3PA 3R13A 1KV8A 4J28A 3ARYA 2PWVA 3T07A 5CZKA 3Q94A 1LF1A 2ZFAA 3U7BA 3DYOA 3STPA 3T09A 4HVXA 5A69A 1FFQA 4QP0A 1D8CA 3KLKA 3GYCA 4A3RA 3M41A 1L8NA 3R10A 3NQEA 3M7WA 3UU0A 1JZ8A 4UMAA 4UZUA 5ECVA 1OD0A 3VAVA 3T2QA 1R2TA 1JDAA 1WXJA 1V5XA 1ENUA 4CVWA 5K9CA 2DZPA 2VR2A 2V5DA 3IUHA 1NFPA 4M6QA 1UWTA 2V6AA 1N2VA 4PMQA 3AS0A 4MZ1A 4QCEA 1HGYA 4L1GA 2C0AA 2OQLA 3C52A 3SN1A 4F0LA 4FEZA 3M0IA 1RPXA 3ARVA 1LRQA 2OWXA 5J5DA 1KD0A 3TNOA 4GFIA 5LA0A 3D3AA 3KHJA 2G4FA 1OYBA 2QCNA 4IXHA 3HG2A 3MUY1 3AIRA 2ZX5A 3C56A 3L0KA 2V82A 2AL1A 2NT1A 4XKMA 4H8NA 5F2GA 4O1AA 2VRJA 3USZA 2Y7DA 3HGRA 4GISA 4LY4A 1X1ZA 4EKJA 1GZGA 1TTJA 2OX4A 1XC4A 3TC7A 1FVPA 1TRIA 2VR4A 4BJHA 3R0UA 1Q8AA 1HG3A 3SSJA 1JJKA 2Z2AA 2OJPA 2P53A 2QAFA 2Y85A 4UTIA 1LG1A 1UP0A 5ABFB 3USBA 3W82A 3QHNA 4AB4A 5E6YA 4K3ZA 3WNNA 4A2RA 4TU1A 1S5NA 1GVYA 3N11A 4YN5A 1N8FA 4AZGA 5HR6A 1EF2A 1JCLA 4JCMA 1UD3A 3UERA 5BMXA 5DF0A 4R53A 2OQHA 2VENA 4RXGA 3MV01 3QSTA 2WSKA 4LF1A 4O28A 5CSSA 3QKZA 3V5CA 1NARA 4BF9A 4AYGA 5C8BB 2C0HA 4KWWA 2PU1A 4HPXA 1UD5A 3M46A 3VK5A 4ZEPA 5EKYA 3PZIA 3U9IA 3L0GA 3QQ0A 4NXSA 3VIGA 4DRSA 5C9ZA 4WGHA 1DQWA 3RR1A 4UOQA 3APTA 1T7LA 4V2XA 3EOOA 3N19B 4GZ7A 1VBHA 3GXNA 3FV9A 1O95A 2QF8A 2WLYA 2GSHA 3EB2A 3IIXA 4ORMA 3WMLA 1E43A 4JHOA 5U7SA 5E0KA 3W73A 2A3BA 2HV5A 3W7IA 1YNPA 1HF6A 4PB3A 3BW4A 3M0KA 2VMFA 3HA1A 3RM8A 4RNIA 3RLVA 2ZVRA 3NA8A 1WV2A 3SCOA 3SAZA 3VKBA 1GORA 1TIMA 2ATMA 4PMJA 4YVPA 1XUZA 1E40A 3W75A 1FP8A 1YPXA 4MY9A 3CL8A 4PMYA 2CITA 3URAA 3L4TA 4IMDA 1XC6A 4BY3A 3K13A 3W7CA 5DXYA 5G5IA 2E6AA 1VKFA 1GEHA 3HQ1A 3C2YA 2I17A 2X8RA 3BXWA 1SJBA 4JZ5A 4US6A 1G0CA 2IQ0A 2FJKA 3B9EA 2QCLA 2H9AA 3KVLA 2KZHA 3FJLA 4AWSA 5HMFA 1CECA 5A1AA 1KBKA 1EDQA 3W1LA 1YRRA 5I3KA 3VIKA 2VC9A 2J7FA 4PL2A 3NPXA 1QI4A 3A9IA 1UH3A 1FTXA 4AY8A 4R34A 2IUZA 4ZQPA 1AQ0A 4L61A 3DIPA 4LAZA 1K4GA 2A3HA 3PZ9A 4ONVA 3BZGA 4AAJA 3LI0A 3UVIA 2R1KA 1YPFA 5AC7A 1ITXA 1H09A 4EPKA 3MB9A 4FP1A 4C5YA 3BDKA 4WOZA 5K3VA 5BMWA 1HL2A 4H04A 1E51A 1JGIA 1I2RA 4PBFA 3GZAA 1YNYA 4OV4A 4FHAA 4H9ZA 7REQA 1NM9A 4FXRA 2YL8A 1E1CA 4MADA 3W27A 1TMLA 3VGBA 1VRXA 3H2AA 4ES4A 4UZSA 3LBMA 5T9BG 2G3IA 3D46A 3IGXA 1KM1A 1X38A 1XYBA 3G77A 3PZMA 3P3BA 3STEA 4GBDA 2XGZA 1YEYA 3FAWA 4JTCA 1ZNNA 2PRMA 4O11A 4BWLC 1CW2A 4U5KA 4FLQA 2NQZA 3TYAA 1EGMA 4DUXA 1YHTA 3ZVHB 5BWAA 4MJ4A 4AEEA 1QNSA 1C29A 3U5YA 1L6FA 4IGSA 3VGEA 3W07A 1GOOA 1G7VA 5M2FX 2QDDA 3ARRA 3UWUA 3OEXA 1GK8A 1JZ5A 3TSMA 3JZUA 3BC9A 3TYZA 5CH9A 2XFWA 1JZ4A 3SRHA 3RU8X 3OIXA 1R8LA 2I57A 1BF6A 5KMYA 1GTEA 4GKLA 4QDPA 1K02A 3BTNA 3SJ3A 5IDZA 3DH7A 3IGSA 2BXVA 4HPNA 3DENA 3DCPA 4L9XA 1S2CA 1DWGM 4Q4PA 2DZWA 2DQXA 3KUMA 1XYFA 3IACA 4MB4A 1WA3A 3WNKA 2V5KA 1DIKA 1M7JA 3WMCA 3ZT5A 3CHDA 1TPWA 1NOFA 1XIJA 5KZMA 1W1ZA 3T0TA 4FF5A 1W2VA 3LLXA 2BB0A 3C2OA 2E1DA 5LNRA 1CGYA 5FJTA 3BE7A 1EHAA 2ZRXA 3PVFA 3WDQA 1OADA 4MZ8A 3SQSA 1Q5MA 2GYIA 3OA3A 1P0BA 4JYEA 1EP2A 2GVEA 3P7YA 3U3HA 5A2AA 1XD1A 5DO8A 1TX2A 2ZUUA 1XLLA 6A3HA 4C7GA 3SCWA 1J0ZA 4O1DA 4HPHA 2ATSA 2Y7FA 3EWBX 1H0GA 5AY7A 2YDAA 2DT1A 4GWEA 1CI1A 3LNPA 1TUXA 5BOOA 2PF0A 1PO9A 3PJUA 3DDMA 2F7FA 1Q6FA 2GOKA 3GNDA 3VCCA 3JU2A 4IFKA 3WQFA 2YX0A 4JTLA 2D69A 4CEXC 2E25A 5K4XA 5HNUA 4KWOA 3VNLA 3R8RA 5TQLA 4CNOA 1A49A 3ABZA 4GUHA 3QFWA 3MSRA 3VOCA 4CU8A 3W2LA 3IUDA 3V0TA 4J9JA 4AVNA 3LHUA 3QY8A 3TSBA 3HG3A 2CLHA 4RX0A 4JIEA 3AISA 4W89A 2ISSA 3M0XA 1BTMA 3DFNA 3AXIA 4JNMA 3DAQA 3DHPA 1R5YA 4RE0A 2PDXA 4WXZA 3PWAA 2WSYA 4OBSA 1D2KA 4HCDA 4QM1A 1ML1A 4D8AA 4KMQA 3B8IA 3NZQA 1AZ1A 4FO4A 2YA2A 5KZDA 1J01A 5A95A 2CBIA 2ODOA 4L5ZA 1IGSA 4J7RA 3LXCA 2FTWA 4UR9A 2WZMA 2OX1A 3OBKA 2ZUTA 2Z1WA 4JICA 1UOZA 1R7AA 2F9RA 3W1XA 4KBXA 1FWIC 3KWSA 1FXQA 2BS9A 1DJGA 2B7PA 3NQ8A 3RFAA 1G4TA 1J5TA 1KM3A 3GHTA 2OT1A 3OP2A 3O6YX 1OZMA 4JHZA 4ALDA 3LXAA 3CO4A 2GVLA 5F1UA 4A8LA 1ISYA 3CAQA 5E0FA 4AMAA 3NQGA 1ZBKA 3G24A 4HMCA 5HK4A 1UIPA 2ASHA 1UP2A 2NV1A 2NSXA 4MZYA 3HB9A 4I9MA 3KDNA 3SM0A 3FYYA 1GZJA 5FA5A 4O19A 1YIXA 6CGTA 3CUFA 1IT0A 3B97A 2J66A 3T81A 1KM0A 4JS3A 5AKQA 3FJ4A 3HN3A 4DEFA 1ZBVA 3CV7A 4IUGA 5AYYA 5G1TA 2BXZA 1A0CA 1QI5A 5HANA 3VD3A 5BYWA 5D2VA 2FFIA 5REQB 1XJBA 1VFMA 1BQGA 5K9DA 1AD1A 2ZXAA 3WLQA 4LALA 3BURA 2PDYA 3B8TA 1U33A 3T78A 4E8DA 2DUAA 2ZYFA 5K7JA 2RAGA 2UY5A 3W26A 1ZALA 4CNTA 3U0HA 1X39A 2DORA 4KCTA 3NAVA 4IPIA 4Q7BA 3Q45A 1MEIA 5D2WA 3TFXA 3H2FA 3TH6A 4FA3A 5DFAA 2NWSA 1BGAA 1SJCA 1F8MA 1F61A 3ZM8A 2WZHA 1GUVA 3CQIA 3SZ8A 1E0UA 2WHKA 5HOSA 3KS6A 4X22A 5BRQA 5C0QA 4C6LA 1W9UA 1VFTA 2NLIA 3PHAA 1LRTA 1OX4A 2DZUA 4AIOA 4M7TA 4UTFA 1EHNA 1QASA 1HGWA 1XL9A 3KS5A 3O0FA 2J7DA 4HMNA 1T96A 3TZFA 3LSCA 3KM8A 4PMZA 1VD6A 1EZWA 4PMUA 3TK7A 3GHSA 1RK5A 3BLFA 1P0NA 4UTLA 1WCGA 4KCUA 1G9HA 3KBNA 3O6AA 5A3HA 1UW9A 3MUCA 2VTFA 5ECUA 5AB3A 3I4EA 1NEYA 2YA1A 4KF1A 3LQGA 2Y5SA 1ICQA 4PBEA 1BEUA 2FDMA 2YW3A 3ZYZA 2RDXA 1QI0A 1AL7A 4O0ZA 4ZSUA 3A3WA 3WQWA 4IX0A 4Y7EA 2RFGA 4QFUA 3RCYA 3CASA 5FJJA 1CEOA 4J40A 2ZTKA 1XRVA 1FHUA 4B9ZA 1KBBA 4N0RA 1FDZA 4J3SA 3WH6A 3GVRA 1PZ0A 2VEMA 4U28A 4CU7A 5U4NA 1X96A 4MHBA 4DNHA 3KAOA 4LS1A 3VILA 3P5ZA 3WFZA 1FA2A 5MHBA 4LYQA 3ZJ8A 3LK6A 2WZEA 4L80A 1ONEA 3UZZA 2HISA 3W28A 3M5ZA 4HNOA 5MKGB 3WLOA 3ME3A 1RBAA 3NL5A 3C8FA 3HGJA 3BAIA 3W7NA 4QJ3B 2P3EA 3B0VC 1OHLA 4GH3A 4C6EA 2CHRA 1DIDA 4F0MA 1UR2A 1FWSA 1S5TA 3H4XA 4HMEA 3VMPA 3WNPA 1W1PA 3Q4DA 3E0VA 2UY4A 1R30A 4JAWA 1M53A 4HQVA 3T7VA 4F0RA 1NTHA 1VBJA 1SU5A 2O7QA 3GH5A 9CGTA 3WBXA 3WH8A 1ONRA 1UR1A 3EWZA 5M3WA 3WQVA 1SO4A 3P82A 1OVDA 1REQA 1EPVA 3AI0A 1MWOA 4UIOA 1H7WA 4DJFC 3ZLGA 2QKFA 4R88A 1SYTA 1SO5A 3T0BA 3ORWA 1TPEA 3QJAA 4Q8PA 4P8UA 3ZJ7A 4RW3A 1A5AA 3S1XA 4H01A 3TSDA 3A5VA 1FWDC 1O5RA 2FMOA 3KOXA 3W9ZA 3BSGA 2GSJA 1CXKA 3UQNA 1C92A 5LYRA 4KESA 1ZBWA 3REQA 4AQLA 3VDAA 3OA5A 4OIFA 4WJXA 2EPMX 1LT7A 1ME8A 3QQ1A 2YR1A 2Y7EA 4WLCA 4D6EA 4EAYA 4UC5A 3MSYA 5FSDC 3G1YA 3MUIA 2QVHA 4KERA 3CQHA 5C6MA 2ZIDA 3AWNA 3DEQA 1E6RA 5E0CA 4WD0A 4BZYA 1DPMA 3A21A 4G9PA 3BQ5A 3P74A 3OZPA 1NP2A 1EB3A 1UUQA 2FTPA 1FY6A 1WZAA 5TAOA 1BSLA 3DZ1A 4FK9A 3QY6A 3W3OA 1DJIA 5HQEA 3DFHA 2NT0A 2YCIX 4NAFA 2WHMA 4Q8UA 1WKDA 1VPYA 3AXMA 4LRTA 3CMFA 2PEVA 1GJWA 4OHQA 5A8OA 3RM4A 2V3DA 1U83A 5I5RA 3EPOA 3DYPA 4H6EA 4QLKA 3LNMA 3WBAA 5I03A 4HN4A 4LAKA 1CWYA 3P67A 1EA9C 1G4PA 1R3VA 1ZCCA 3KL0A 2O92A 3TJIA 4KT2A 3DOPA 1JI1A 5C71A 2WV8A 1P5BA 2XZ9A 1YXYA 3OIHA 4U3CA 4GUGA 1UQZA 4U31A 2E28A 2XFFA 3WQ6A 4C65A 2HTMA 4PCSA 1KBLA 5HNRA 1K8ZA 3H2NA 1TV4A 1US0A 4GNVA 3PBWA 3VC5A 2BY1A 3O16A 3HV9A 2BSLA 1TPDA 1HTIA 4E4FA 1KGXA 4Z17A 1NH6A 1B9BA 4IIDA 3PBMA 3AMLA 1H4PA 1ZFJA 4POCA 1WDWA 4EE9A 4GO8A 1B3YA 1IEXA 2V69A 2G41A 3W1NA 1FWCC 3AALA 1AG1O 1DYSA 1OJXA 5DCEA 1TV2A 3C0SA 2DJLA 4FOUA 4PODA 1V02A 1VYRA 4QISA 3ABXA 3BVJA 1LLOA 2X7VA 4Y9OA 3GVGA 1UZ1A 3WUEA 2PDPA 5AFDA 2NX3A 1KR0A 4GZEA 4QG6A 2HE8A 3HG5A 1B90A 1ICSA 2WJZA 1AL8A 4S3DA 3KDOA 1OB0A 2E77A 4WDWA 4BF7A 4GQQA 3NM3A 4GLEA 4JKMA 1ISXA 4MDPA 4Q7IA 8A3HA 2PTDA 1V93A 2EG6A 4C6IA 2FGBA 1WDDA 3VIFA 4NUWA 1W8SA 1RQBA 3BWWA 3LHYA 1XLBA 3AIEA 3VOFA 2W6RA 1Y8BA 4YTSA 2PDJA 1WDSA 2RDUA 2DZAA 3GX9A 3KP1A 1UUOA 1UYQA 4UCGA 1KV5A 4DX3A 4JN7A 4QE1A 1F6PA 4QIUA 3WJXA 3N2MA 3B0XA 1BWKA 3ECQA 3QC0A 3O63A 5H8UA 5AZ1A 4NJJA 1AW1A 1GQJA 3UEQA 3TJLA 4AX6A 3RF9A 3VNIA 1WNOA 1XISA 3SR7A 4I7UA 3NQDA 2X30A 4GRSA 2XG9A 3GXMA 1YPIA 1ISZA 1QO2A 5EY5A 1M03A 3EKZA 4RDWA 3HQOA 3R2GA 3L7RA 3MP4A 4KPLA 1WUFA 3CMJA 1HT6A 4A6GA 3CIVA 3QN3A 5D04C 2J27A 4B5TA 1BXNA 3S46A 2HNHA 2WM1A 3WEMA 4XZLX 1JFXA 5BRBA 1IXOA 2BHZA 3MP3A 1HL8A 2PD5A 3GLCA 3Q65A 1VJZA 2TPSA 1TV5A 1EA0A 3IWPA 2VX5A 4N42A 3CUGA 4D6HA 1CDGA 3UNDA 1DL3A 4LBUA 1BPLB 3A3HA 1MRQA 4LS2A 3RMJA 3PUEA 2PDWA 3TCSA 1JAKA 3IEBA 1XIDA 4IJRA 1G6CA 1QK0A 3OQ8A 3WDPP 3AU6A 1QXLA 3UVAA 2DEPA 4H7ZA 2PGRA 3ONBA 1ZL1A 1X98A 3PZNA 4BR1A 3MHGA 1LORA 3MWAA 3V7PA 1OX4B 1TV3A 1KFKA 2X0HA 3GTHA 1WUEA 3TROA 4L4MA 4MMWA 4XIMA 3AROA 1L2QA 1W5QA 3ZS4A 3KBSA 3AHXA 4XKYA 2DZTA 1P48A 2V3FA 4DF1A 1YDYA 3UWQA 3VE7A 2HXTA 4OE7A 2I16A 3B0YA 1B54A 2CESA 5DANA 3KCOA 3GK0A 2WOQA 3UJ2A 2WHJA 4MF4A 4O4WA 3MO7A 4PTWA 3B9OA 3DHDA 1ZCOA 5AVHA 4FLRA 2XZ7A 2FH8A 3JUGA 2E09A 1WAWA 4N6FA 4WJ8A 2QJMA 1AODA 4CNSA 1R86A 1GYNA 1XH2A 2W4XA 2VCBA 1RJQA 3EYPA 2V8ZA 1SPQA 3XINA 3AHTA 1Z89A 1EXBA 1TV8A 2GOUA 5KETA 2V38A 4IIGA 1SMDA 3R5EA 2YCLB 4P2VA 1W3JA 2QV5A 2VOMA 4B2DA 3D6NA 2I5GA 3W6LA 3LRLA 4WOQA 3MQTA 5HDRA 4WJEA 1POJA 2GGEA 1YXDA 1LG2A 4W5UA 3SQMA 3URBA 1MYRA 4NL1A 3BOLA 4QG8A 5FIPA 2WJFA 3VINA 2GUUA 4H9XA 2QCDA 1OWQA 5AVNA 2QLYA 4LFYA 5LKYA 2OQYA 1R3SA 1JD7A 3NUKA 3FVDA 2QJIA 2OGJA 1B3WA 4HYWA 2QV4A 3ARUA 1W9VA 3U4FA 2HMCA 1R9YA 3ITXA 2CXGA 2J77A 1TVLA 3CNYA 1JCYA 3EA3A 5A5WA 3AJXA 4GCXA 3OB8A 3A4JA 2V67A 1XLKA 3INPA 3CYJA 4I5UA 2QCHA 2FPTA 1T5AA 2GPTA 3TCEA 3WYZA 3S6DA 3Q37A 3TYDA 1XSJA 4GFSA 1JDDA 1F74A 4WY0B 2Y6ZA 1BYCA 3D47A 2NWRA 3N9SA 4J27A 3RG6A 3WJSA 2JIWA 3BK0A 2C13A 3K1DA 4NYYA 3ANYA 5CBBA 3PAJA 5FJUA 3AZRA 2Z0IA 3LM7A 3LA4A 1HP4A 3TOPA 4L4LA 1RLDA 3N6QA 4FX8A 3WK0A 2C3ZA 3GG1A 2VEFA 4OOUA 1KR1A 4DLFA 3W7KA 3V3WA 3MI6A 3CS2A 1DQXA 1TJ1A 1XGEA 3PZUA 2ZXBA 2AMXA 4JTQA 3N17A 1GVIA 1JDFA 1TFVA 2VQUA 5LXEA 2EKCA 1LDCA 2VT0A 1ZUAX 3HU7A 5AYIA 4TVCA 2A79A 4MB5A 2WVTA 1GG0A 1DBTA 4N9EA 4LX4A 2BBFA 3L66A 4X63A 4CVUA 2VDIA 3PANA 4YJ5A 3GKFA 2GJXA 1XI3A 1ODZA 4Z1YA 5D02A 1X1OA 1NDZA 1RZMA 3O15A 4JTSA 1GHRA 2OEMA 3CWOX 1UKQA 2VFEA 3NEVA 4AZCA 3L12A 4Q8WA 2VM8A 1TELA 3LPPA 1WDPA 4MKSA 2PZ0A 1GOXA 3AOFA 4CCCA 1UD6A 4DWDA 3TTSA 3NQAA 2J13A 1MI3A 3GAYA 1MDLA 5A8GA 4GNJA 3N2CA 1V0KA 4R7JA 2QIWA 4I9TA 4O52A 5CAHA 4W5ZA 4D6JA 4N02A 3MANA 1ZY9A 1VFLA 2YL6A 4HT3A 4G7EA 2Z00A 1UP3A 2D23A 1IZJA 3S5ZA 3PPGA 1HNYA 1LT8A 4X2PA 3QHMA 5LIWX 3SY1A 4YYCA 3HG4A 1KTNA 5T26A 2EXOA 4NZ3A 3DXIA 4MOZA 4U10A 2R1NA 4LUTB 1JXKA 1UR8A 1YXCA 3S9ZA 1A3XA 4XAYA 1TWSA 4KEUA 3S5OA 1O1HA 1V3LA 7XIMA 4UOJA 1H7OA 1IR1A 4GYKA 4A4AA 3UR8A 7PTDA 4NHVA 1AZ2A 4N4QA 1X8CA 2DZVA 4JN8A 2CBUA 5CLTA 2PDIA 1VBRA 4JTIA 2WPBA 5FAGA 3LOTA 3BPWA 2WWDA 3OBAA 1HN1A 2EPNA 2CFFA 1OK4A 3UJFA 3KRZA 1HO4A 1RJPA 2ICSA 2B7QA 1P1XA 2Q3RA 2OZTA 1XYCA 3WF2A 3AYVA 2V3EA 1F07A 3H70A 1V0LA 3CT2A 3NYZA 2PA6A 2PDQA 1O5QA 3MYPA 3GXTA 4GI8A 1E56A 3W29A 3Q2DA 4JKLA 1YYAA 3PJWA 5I0DA 4MUZA 1S1RA 1I60A 2O9RA 1XBVA 4RZ5A 1TE6A 3ABQA 4LBRA 5CZ0A 3MY9A 1FH9A 3ALFA 2VX7A 3I7QA 3PG9A 2NV2A 3UGRA 1POKA 3PWIA 1B0IA 1VIWA 4X3ZA 4P8VA 2ZXDA 1QJWA 2WKLA 2RUSA 2PFHA 1V0MA 2ON3A 1BKHA 2HQAA 2VFDA 4D6IA 2YFNA 4QSHA 4Q8NA 4UTJA 4C6NA 2ZC1A 1GVRA 4Y9AA 2VOTA 3LY0A 1DEDA 3C3NA 4QXIA 3GG8A 1XBZA 1IE7C 1PS9A 2OT0A 2YOCA 3S2NA 1X7FA 4RZBA 1XRSA 4XO7A 3TA6A 3MJMA 4Z08A 3KL3A 1Q13A 2I9UA 4GABA 4GOAA 4AC1X 4R9XA 3QGKC 4IISA 4MAZA 4Q4OA 4HA4A 3SUWA 1E0XA 1HVXA 3PZQA 3GC4A 3DKJA 4NJIA 5C9WA 1PHQA 1TPFA 5G4WA 5DCBA 3UXKA 1FDYA 4F40A 3ISIX 4R9OA 3ZR6A 1IHIA 1HVQA 1GKPA 4JIIX 5IOBA 3U48A 4AMCA 5KZ6A 2GFTA 2VEPA 5JH2A 3WH5A 2I7GA 5D8WA 1EYWA 3TWBA 4S38A 2J6VA 5I3HA 3ZSSA 3ELFA 3FIGA 4GC4A 3VIMA 2HS6A 1FDJA 3GFXA 3GAKA 1DV7A 1YE4A 3P0WA 4L4OA 3WQPA 4C6FA 3LCLA 4EPEC 1AQFA 2GGIA 2GGHA 1WZLA 4YIWA 3TXZA 2CETA 1XCWA 3HF3A 3VOIA 4HOWA 1W1VA 2W91A 1UCWA 4QQ3A 1V4YA 3BICA 1MEWA 3BJFA 4AWTA 4F0HA 1R3RA 2OB3A 2OYKA 4CN1A 4FF7A 1KM4A 2H9AB 4ML9A 4RPQA 2PLCA 3IK2A 1RV8A 2NXIA 1NSJA 5D9MA 1US2A 1LOSA 2WWCA 4WQ6A 2C15A 3S1GA 4GQRA 1NAL1 1W17A 1FWRA 2W92A 3WG6A 3AYSA 1J6OA 2G96A 3TW6A 3QTPA 4WKAA 1EWEA 4CQAA 3GU2A 4PEEA 2G4JA 1H62A 5AC6A 1QOPA 5FJIA 4S2BA 1PDYA 3ENLA 1A3HA 5CSYA 4WCJA 4MWAA 5D2YA 1JPMA 3NG3A 1KCKA 2EPHA 1W1IE 1OQFA 4PBGA 3BUVA 1U1UA 3LCFA 3WLJA 1W3KA 1L0PA 1MQPA 1YTKA 4AH7A 4GMEA 1UPPA 3HO8A 5DMLA 3M1ZA 4LUSA 3N6JA 4NU7A 1D3GA 2X2GA 3VX0A 4DO4A 3QEZA 4DJFD 2C18A 1H61A 1JPHA 3UZJA 1H51A 4GJIA 4AVFA 3BJSA 4LTSA 4WIWA 2PBGA 3EKLA 4ZFCA 2FPVA 3QSRA 3ITOA 5LA2A 1OC6A 2QUTA 4J2MA 1KC7A 3RCNA 2OGYA 3S9IA 3T40A 2O0TA 4JEQA 3CUZA 3JRKA 4I6VA 5EMUA 5TF0A 4RJEA 4YWIA 4RW5A 2HE5A 5XIAA 4O1FA 4A35A 4PUWA 4DO5A 1WKFA 1XLEA 1M7OA 3E74A 4IT1A 2EEXA 4B5UA 4US5D 3MU7A 4GC3A 1CIUA 4XAZA 4OT7A 3VNKA 4HGXA 3L68A 3WO8A 3SCNA 1AVAA 4GVIA 3TYUA 1J18A 3BO9A 5AZ0A 3OQEA 4ATWA 1XW8A 3KL5A 2XVPA 5ABTA 2NQ5A 3N15A 3CAVA 3LPFA 1JL8A 1T99A 2P10A 1VZWA 2BP1A 2GGJA 4LOCA 3AMDA 1UH4A 1WYIA 1XUUA 1UB3A 3PBGA 4MJZA 2DSWA 2QDEA 4GUJA 3S1VA 4KEZA 4R3UA 4PTXA 3NVTA 2WLZA 4DELA 4AF0A 1BSIA 2WAGA 1OK6A 2ZZ6A 5I07A 3RJXA 3TMLA 3TU9A 2HK0A 3E02A 2NQJA 2V3GA 1FCQA 1I4NA 1A5UA 1NF0A 1TPH1 4FR1A 3SGZA 1OFBA 3R12A 2ZX9A 3GVVA 5JQ9A 5LIUX 2YCKX 3F4NA 1DORA 2DGAA 5F2IA 4JNZA 3W7EA 5C55A 4LEFA 5EGRA 4DZIA 2Z29A 2E8YA 3G1HA 3PNUA 3G3MA 3IV3A 4OV9A 1DXIA 2DH3A 4KGLA 3G1FA 3FXGA 5G1MA 4KWVA 1LTDA 3WQ4A 1K6AA 4HYRA 3FKRA 2Z25A 1WP6A 5CJ5A 2FZDA 1JZ2A 3UZYA 2YYTA 4KGJA 3ALGA 3PPHA 4M82A 4JX5A 1BRLB 3QY7A 2EG8A 3FJNA 3WD4A 5LXXA 3NM1A 3EX2A 4H9UA 4NNCA 1US3A 1G67A 1TPB1 4S39A 4YLWA 3QR1A 1P4CA 1XIGA 1NU5A 5CC3A 4PCNA 1SVDA 1FP9A 1F7BA 5XINA 1R46A 1XHGA 3H7RA 3UY8A 4AD5A 1PAMA 1U5JA 3W87A 1P6BA 2JALA 1GOIA 4TOQA 4IMGA 3WF1A 5BCAA 1BVZA 2X1TA 2PF8A 3LG3A 4V1YA 4JX6A 2PC8A 4IP5A 4C6PA 1P7TB 3PTDA 1P7TA 4XISA 2NSOA 3WIJA 5JH1A 1I75A 4I90A 4IWWA 4ADSA 2W9MA 1T41A 6XIMA 5TBOA 4MM1A 1WX0A 4E2VA 1YE6A 3ITVA 5HAOA 2F8QA 4QS5A 3VIIA 5BU6A 3KVMA 3RUBL 3EMQA 4RR4A 1HUVA 3VFCA 4PEKA 3AYTA 3TFCA 1OCBA 4DXXA 4JFSA 1VRDA 4NVTA 3FSUA 1PUDA 4QE4A 1FWFC 3CWNA 5BXRA 4W87A 5LGZA 3ERPA 3TJXA 2E5CA 3JZEA 5D32A 5I6SA 3EWWA 3F4VA 1XYZA 4PYSA 3WLLA 1UWSA 4E8CA 1WAUA 3A12A 3SCTA 1ME9A 4IHCA 4HA1A 2CHOA 3RPTA 1XPYA 4YHGA 2WJDA 3GXPA 3H21A 3UETA 3WD1A 3NXFA 3H2OA 1XKJA 2YBVA 1V3HA 1FKXA 3S9YA 1WOBA 1UOKA 1RBLA 5K2ZA 3ARQA 5LIKX 3V36A 1KKOA 1H2JA 2PPGA 2V63A 3H24A 1YTDA 3C5QA 3WELA 3CIWA 3TW9A 4GINA 2HZGA 3WDHA 1UUMA 4AVOA 2ZZ3A 4PA8A 1M6JA 1XDLA 4KFOA 1VPQA 1E9YB 1S2UA 2BNJA 4NSBA 1JZ7A 3G6MA 3EA2A 4CD7A 3ZO9A 1MMFA 4H2HA 1M68A 2IKIA 3BSHA 1ME7A 1CGUA 1HKJA 4YPJA 1R6WA 3BAYA 1FWWA 4E2BA 4L4PA 4R85A 4C91A 3GSMA 3GR7A 2GDQA 3EX6A 4BA0A 2ACRA 3GXIA 5I77A 3UG3A 4PCPA 2CNCA 1K9FA 4TV5A 2OPJA 1Y7VA 3CPGA 1L6WA 1LWHA 3UG8A 1KW1A 1H1YA 4AHPA 4AD1A 4RZ6A 4C90A 3UA3A 3E5PA 4C1NB 4EWND 1J4EA 1J0KA 1NDVA 4LVGA 4YCPA 5JUVA 1ZENA 3N2TA 3DBNA 1R7OA 2F6UA 2VFFA 1LCOA 3IUIA 3K8LA 4GUIA 3NPUA 2X42A 2P1FA 1FCVA 1J2WA 3M64A 3AUOA 4WUIA 1FWAC 4BEQA 4Q22A 3SADA 2OYMA 4DJDC 3UG4A 3SGGA 2YA0A 3GR8A 4C6MA 1GHSA 2PLJA 1WB0A 4PB4A 5IM51 4JPGA 2HPIA 2QHAA 1V3JA 4FNUA 1DTUA 4YL2A 1FHVA 3A9BA 4UFJA 1EFZA 1H11A 4PCFA 5LIYX 1LBFA 1E6XM 4AZ7A 4W93A 3TLLA 1O6IA 1VEOA 3LBOA 2WC3A 5DRCA 4UNIA 1OGBA 2PS2A 1TPVA 6ALDA 3PWGA 1UR0A 3O07A 2CZVA 4S3EA 4AISA 3S42A 4YYFA 6ENLA 3W1MA 4C6JA 5A6LA 2B0MA 2VWSA 1NQ6A 2VFGA 4XD3A 2POZA 2XIIA 4GHRA 3JR2A 3PP7A 4UBPC 4O8AA 5BXSA 3EOSA 4GYFA 3MKCA 1DJHA 4MB3A 1F3TA 1L6SA 2RDTA 4B5VA 5FOOA 4WVXA 3WUFA 3PB2A 4I8DA 2WJEA 3QH2A 1S39A 4OJYA 2JKPA 4H6QA 1UKTA 3N2BA 4QCFA 2OEJA 1E1EA 1EC8A 3FGCA 1Q6EA 3IRDA 3BLPX 3NQVA 2QGYA 3ITCA 1KBJA 4QJ5B 1OFPA 2HBVA 4TX8A 1E9IA 1E6ZA 4HK6A 3S2LA 1GVOA 4CGTA 1PPIA 5LNSA 1I2QA 4E4PA 5E70A 3EKGA 4M6PA 4GNKB 4WDXA 2BOGX 2V5BA 1EQPA 5E1QA 2HDJA 4IPLA 2J9YA 4PL1A 3RLHA 5J8LA 3WSUA 2VI0A 4GVGA 2DY3A 4M8UA 3V35A 4RE4A 1JPDX 4FPSA 1VCFA 1C3FA 5F4WA 3CU2A 4E2OA 1R2RA 3I6TA 5TD4A 3GH4A 1K8YA 3VUSA 3N3TA 3ES7A 2WMGA 3SSZA 3TTEA 3AJ7A 2OLSA 3TR2A 3MBDA 3AXHA 2GUBA 3P8JA 2WVVB 3CB3A 4GXWA 5A2CA 3L2MA 1CGWA 3S2JA 4DLMA 3AO0A 1B3XA 1F3XA 5CQ1A 1AH4A 2E6YA 1H3GA 1BQCA 3PBUA 3WD2A 5JIPA 2BHYA 1JDCA 2VC5A 5FF2A 2F2HA 1CB2A 2KAUC 4S3JA 3B06A 5CPMA 2ESCA 3SCPA 1TREA 4UXDA 4UTMA 1XH0A 1TQXA 3KWXA 3W1PA 3UCCA 2Z7KA 3APYA 5D2XA 5M03A 4V27A 1VJIA 4L1WA 4FIQA 2V2DA 2Y24A 1HJUA 3QVQA 4A8IA 1OBAA 1S2VA 4UNLA 3CWHA 2VQTA 3WDJA 3CJPA 2H3DA 2HS8A 1AJ2A 4XKYB 4X9YA 2IPGA 2XSAA 4PMRA 3OVGA 3PSVA 2HSAA 1OF6A 1TA3B 3F4WA 1H63A 3RU6A 1KA9F 4MVAA 1DHKA 4K7YA 3P2VA 3O1NA 5I00A 3H6OA 2PWUA 1IT7A 4LUJA 2NUWA 1JEZA 2QW5A 3PAOA 5C2CA 5IFTA 1SM9A 4X60A 3WLSA 5I09A 3A3XA 4Y2WA 3BLKA 4E5TA 3UA4A 1R85A 2GJPA 2Z28A 3LU2A 3TYEA 1EQCA 2O9TA 3EWXA 3TP4A 1BD0A 4EAMA 1PKMA 2PTWA 1QU4A 4LPCA 2QVNA 3CZEA 1CZ1A 1NOWA 3NCOA 1W1A1 4K68A 2QIIA 3DHUA 1RPKA 3S83A 4LJ3A 3HMCA 1W1B1 4LNYA 2Y0FA 5AHMA 1HJVA 1PKLA 5H2ZA 2GK1B 3LN3A 2PD9A 3AIQA 1QPOA 5DLCA 3F4DA 2OCZA 4EOUA 1G4SA 5JU6A 2BDQA 2GL5A 3IPWA 3W85A 3T4WA 2P0IA 3G6LA 3PNZA 4BI6A 3CZ8A 4XZNX 2A7PA 4MFDA 1PKNA 1K7EA 4RV8A 1XSKA 3P14A 4GACA 1MVYA 3HGOA 4U5IA 6TIMA 5LZLA 4TO8A 4NT0A 3WD3A 1V6UA 2ZE3A 5F7UA 1MW3A 3NOYA 1RAKA 1RUSA 4FSAA 5IBXC 3VPLA 1GVQA 1LZOA 1GVFA 3GUGA 4PMVA 4DYJA 5E09A 3NTYA 1F8IA 3LXBA 3P81A 2F6KA 1W8GA 3EX3A 3KW3A 2PU0A 4AZCB 2E8ZA 2F84A 1LRNA 5EMKA 5HJYA 1X7IA 3VU2A 3W88A 2XISA 2J62A 3GR4A 3LPOA 5A6MA 2XDFA 3MWCA 6REQA 1X6LA 2EJ1A 4PTMA 1FWBC 1KKRA 3CQJA 5DXXA 4HNVA 3LTPA 2JBMA 1LP6A 2YLLA 2ZDRA 2WCAA 2VC7A 2BFGA 4IMCA 1QO5A 1GYLA 3EWYA 2FTYA 1FHLA 3THCA 3V16A 3Q67A 3R25A 3RXZA 2GWGA 5HWJA 2Y8UA 1V6WA 5EPDA 3UXIA 1MRAA 5C7VA 4XZ9A 1N7KA 2IXUA 5A2BA 5HUOA 3SFKA 4QG9A 2ZKMX 2BLEA 3NWRA 3WDIA 4MG4A 3TMQA 1Q7ZA 5H8PA 3TV8A 4US5A 3G8RA 5CJNA 3RGTA 1VLIA 4DUOA 3WF4A 2VD9A 5GVJA 3WBYA 1DWAM 4C60A 1HKIA 2D2JA 4AY7A 1TTPA 3A5FA 2X7WA 3QBUA 2PDMA 3W53A 2XVNA 2XHYA 3WX7A 1HL9A 4M7SA 3N25A 3I6EA 5EBAA 3T1GA 4ICNA 4IQDA 1UIOA 3ZSTA 3FA3A 3VX1A 1UMLA 2FKPA 3HPAA 4TUFA 2J7CA 3KZPA 3WL1A 4Q4SA 3KBJA 5EMMA 2NUYA 4ZO6A 4NIRA 4XBSA 4E38A 1MZRA 3CQ0A 1WOAA 1OABA 3KX6A 1M65A 3BGJA 3FHAA 1EF3A 4NZ5A 4RK8A 3PPFA 4J4KA 2PGWA 3M7SA 1E0WA 5D03A 1KM2A 1WZMA 3NQ7A 2REQA 2QMJA 4IQJA 4XSLA 2BOFX 4FNQA 3OGVA 1K6WA 2BY2A 1I8JA 3UZWA 4B9YA 3UGVA 2AOSA 1Q2RA 2YCLA 2F6XA 4QJ1A 1LBLA 4X2RA 1ONXA 5GNYA 4R5EA 1AJZA 1JUEA 4W7UA 4RKAA 2WC4A 1CB7B 4GVHA 3IVSA 1TWDA 5CEWA 5J04A 3IJ8A 3WH7A 3OZMA 4XTDA 4DY1A 2FZ8A 2YGYA 4JGDA 3L5LA 4W8LA 4JFVA 2G3MA 1HZYA 1TSIA 1G69A 2CZDA 1OCQA 2CBVA 3NXLA 1A5BA 2EQDA 1O5XA 4AHOA 3OGRA 1TJPA 3S6TA 3B04A 1N8IA 4K8GA 4H4IA 1EJRC 1GEQA 1P0EA 1I0BA 4NQ1A 1RSCA 2QCDB 2JGQA 1QNVA 2WVVA 3K4DA 4JFWA 2NZLA 4J3VA 3SN4A 1PSCA 5D9PA 5EBUA 4QROA 6TAAA 3VNMA 4IF2A 1TQJA 4PRTA 4K36A 1OINA 4IG2B 3R94A 2DIJA 3M6DA 3PB0A 2QJHA 1V3IA 2W0UA 4GPNA 2A2IA 3BG5A 1PZ3A 4C7FA 3PULA 1JRBA 3W76A 2POTA 3AS3A 4ZGYA 1EGZA 3ZVIA 3GB6A 3OO2A 3EDKA 3RX2A 4H6RA 4I7WA 1QPRA 4QR6A 2QYGA 4UFHA 4PUMA 1TKKA 3S6OA 4HIBA 1D9EA 1YDOA 1PWLA 3VD4A 3EWCA 2J6XA 2VJXA 4NZJA 2INFA 2GLKA 4M29A 2CBJA 4MKVA 4U2YA 5FKYA 2EPKX 1KXQA 2Q09A 3CMGA 4XD5A 3PM6A 3HPSA 3V0SA 1KRMA 3H55A 4IJBA 2JEQA 4RNJA 2O4MA 1YDNA 3C2EA 4AEFA 2VXNA 1JZ6A 3BAXA 3VNZA 3RMEA 5AN7A 3AIVA 1W9XA 3GC5A 3EMZA 1V0NA 3GQYA 3ZFHA 4NZCA 3NNTA 3VFLA 1UROA 3QV9A 1R9XA 4IJCA 5EFFA 2O9OA 4JTUA 7REQB 1DE6A 4H8VA 4L65A 3U5UA 1OFDA 5I02A 3AHZA 1PYMA 1SZRA 4ZTYA 3IIVA 1GKRA 1JDEA 4W85A 3FGCB 3W24A 2DT0A 1T6MA 3OTRA 4XAFA 5CGQA 1JPIA 3LGEA 4WY0A 2REQB 3MHUA 2OTDA 4GX8A 3EPMA 3EDJA 4EK7A 4KRTA 3I6RA 1XG3A 2Q3OA 2MUCA 4PUUA 2Y70A 4QGCA 3PTKA 5AECA 3ABSA 2PCEA 2ZRVA 1RD5A 2VHLA 5LNVA 5A94A 4MY8A 1LL6A 1QBAA 5EFDA 4BQ4A 4JD4A 4HBKA 3W1RA 4H9VA 1ZRQA 4LAMA 2Q6ZA 1RY8A 3UWEA 1JNDA 3DC0A 4XBKA 2DZXA 3GY1A 2Y61A 3VA8A 4YXGA 2VRKA 3L4VA 2PRHA 2OR2A 3TTQA 4TX9A 2OKTA 2HVNA 3NQ2A 3C2VA 3QF0A 3FFSA 3N3MA 2VVNA 3PN8A 1XGDA 1V51A 3LTYA 3VGGA 3POHA 2ADAA 4OWGA 2OXNA 2IS7A 4MY1A 4UQ9A 5EMLA 4PMNA 4EF8A 2PP0A 2CPUA 4G2DA 2VZOA 1PYFA 3NSMA 1QCWA 1B31A 5AHFA 1ISWA 3BQ6A 1BF2A 2DUXA 3ARPA 4O1CA 2ZICA 4X0VA 1LOQA 1ALDA 4UQDA 3R4IA 2FB3A 1LBMA 3OZYA 3FN9A 1UD2A 2YBUA 5HR7A 4AZ6A 4JTRA 3FYOA 2Z2BA 3E2SA 4ZXLA 4C1NA 2Z4GA 1JCTA 1CGTA 3LV6A 1B3ZA 1TZ7A 4GIYA 1JQVA 1QUMA 3REQB 4L6DA 3BLLA 3MZ2A 1E4MM 2J8GA 2X40A 4UOZA 5IRPA 1WDRA 1RJRA 1K4HA 1OY0A 2QUUA 3KOZA 3BLOA 1QNPA 1AH0A 1J0JA 1J6PA 4XZHA 4IGMA 1TZ9A 1QTWA 4LEQA 3V1HA 4W7WA 3RRXA 2ISVA 3H2MA 1X97A 2CIPA 3C4UA 3ID7A 1ADOA 1CENA 1CLXA 2QUVA 1QW9A 4MKNA 1BWVA 3C8NA 2UZ9A 3IANA 1ZP3A 1FWTA 2CKRA 3KBMA 4HJFA 1H49A 2HVOA 5BNKA 5KEZA 2VKZG 3P0XA 5CBJA 3W72A 4AF0B 2BGSA 1PB0A 4M80A 2MNRA 1H7RA 4JTJA 1KWGA 1LUCB 3LHTA 4JTFA 5CZTA 2GJLA 1S3TC 4G6CA 1OT1A 4DVOA 4C6QA 1H1NA 1JFHA 1S2AA 1L9WA 2WBGA 1J79A 2A3CA 1FWGC 1EO7A 4O57A 2CU0A 4FOJA 2BODX 1QPKA 4BQ3A 1F9CA 1DJQA 1PBGA 5HA7A 1CXEA 1H50A 3FEQA 4PSPA 1AFSA 3W84A 2R1MA 3QW4B 3AXXA 3JW7A 4NP7A 2EPOA 3MJYA 2QMKA 4HD5A 3V5FA 3LCWA 3VGDA 1ADSA 3HBLA 1E6QM 2WK2A 3G3DA 4PMDA 1I1WA 4U2ZA 4LVFA 4UQBA 4TTGA 3F5LA 1XFBA 3NZRA 2WBKA 2D24A 2CERA 2XN0A 2E6DA 5KZEA 1H1ZA 4QLJA 2AMGA 1BYBA 2J7BA 4UB9A 2VCAA 4QNWA 4UFIA 4WK9A 1ITQA 2HVMA 3GTFA 1R0MA 3OG3A 3H7VA 3NDZA 1AA1B 1K1DA 1I9CB 4DUWA 3BLIA 3MZNA 2PDKA 5DELA 4NZ4A 4LVBA 1W9BM 5AYZA 3WQOA 4KS0A 4WDTA 2DPEA 3ZZ1A 2BG5A 2XVLA 3HMJG 4GVFA 4AW7A 4ERAA 2QPSA 4P7QA 3URQA 4IGNA 3QGAC 3ZJKA 3GU1A 2OZ3A 4CD5A 4UTUA 2UY2A 3IV8A 3N4EA 1KCLA 2HXUA 3OVQA 1IWAA 1DTNA 4Q3MA 3ZR5A 4BWLA 3SCRA 5G2WA 4D6FA 1O68A 5T91A 4ZVJA 1QHOA 4GQBA 3H7UA 5D8ZA 3BAWA 4K1WA 4GY1A 3RLUA 1Y5XA 4LSBA 2J7GA 3ZR4A 4PFMA 1LWJA 4BHYA 1RH9A 4A8RA 1VEPA 1UG6A 1VJSA 2VL4A 1CCWB 3KBVA 1JVNA 1XLAA 4U3AA 4QDMA 3GNRA 3ARSA 1W56A 1XLMA 3KBWA 1JQXA 5CC7A 4LF2A 4NJGA 3WBEA 2NW0A 4MSSA 3V1PA 2GQ9A 3F5KA 1OG6A 4GIAA 1U1HA 1E0VA 1Z3NA 3MKKA 2F61A 3BV7A 3GIYA 4JR5A 4XV0A 3AHVA 3CH9A 4O17A 4DJFA 4PZVA 1XIFA 5DBTA 5CGTA 1RALA 4WF7A 1JIBA 3TYBA 4IP7A 3WEZA 3VIHA 3IJLA 2F2KA 3KOYA 1A5LC 2DW6A 2X0SA 3MMWA 2DVUA 1Z44A 4RDYA 1QAPA 4IG2A 4C1LA 3S5SA 2FH6A 2VRQA 4JL2A 1ZJAA 3QZAA 1RK6A 3UXLA 5DMMA 3E49A 5AC5A 3OBEA 5CPOA 1JF6A 3FSTA 3LTSA 4XVDA 3BANA 2XM2A 3D5HA 4CD4A 4NAFB 4ZZ9A 1GCYA 1W9PA 4QE5A 1Q8JA 1EC7A 5HQLA 4ICCX 4PUNA 1AUSL 3NO5A 3ITYA 2V81A 5HJLA 3LEPA 3SDOA 4Q33A 1JD9A 4MIMA 4ROPA 3QV7A 3OYXA 3DFOA 4MFEA 3G8EA 1GNXA 5HMDA 2YDSA 3RYSA 4L1XA 1JI2A 1R3TA 3G2GA 5D37A 1YKWA 1CLVA 2DDXA 3NURA 4F4RA 4Q7NA 3FKKA 3AZTA 3EOEA 2VUNA 3PTQA 4O54A 5E5CA 1UKOA 2EBNA 3KLLA 4EX4A 2DT3A 2WC7A 3H4WA 1FWHC 1XBXA 1OM0A 4QLLA 1B9ZA 3QPYA 1KTBA 3G1DA 4UTTA 3II1A 4JDYA 4J5NA 3E2RA 5JBDA 2E5DA 4G7FA 3SCQA 4K1GA 3VYLA 3UCQA 1LYXA 1LL7A 3POCA 1PX3A 3H26A 2QZRA 4ZQNA 2FVKA 1OIMA 2WZTA 4HSNA 4CEUC 3LD5A 3KTCA 4IP4A 3ZXWA 4D1JA 2WMKA 1QOXA 4DN1A 3G0SA 4ZQMA 1HJQA 1HFBA 3UG5A 3BCJA 1DJNA 2WMIA 4MNKA 1X8FA 3F5JA 5PTDA 4AD0A 4K37A 3EDEA 4OBRA 1J0IA 2CZFA 4KEVA 1REQB 2DFAA 3L67A 2FZBA 4LUYA 3HFYA 2O4QA 3GW3A 2I5QA 3P8IA 2YIHA 4RDVA 1OFAA 3SCVA 1EOMA 1MXGA 2X1UA 4Y6GA 1KRBC 1VHCA 3IIOA 3QXBA 4WY0F 3DHFA 1CBGA 1YX1A 5D9OA 1YLVA 2JEPA 1JYNA 1V8EA 3CM4A 4Y9MA 4ZOAA 3IVTA 4IUOA 2AAMA 3WNOA 5L9FA 2V5JA 1QI2A 3CEUA 4FXFA 2W67A 3KP0A 3W23A 2Q8XA 1NWRA 4F2TA 5G4EA 3ANVA 4UFMA 4LV4A 2NVCA 3NL6A 3EX4A 1BXCA 1JPKA 1ZB5A 4D71A 1SUXA 1JULA 1GOKA 3KZSA 2PBOA 4OVXA 3STCA 3W7GA 1NFGA 2EKGA 4GIEA 4B2DD 2RDWA 4ZOEA 1OF8A 5DT7A 4P7NA 2HEJA 3DG6A 1EJXC 3W2MA 5DEZA 2VD8A 2XH4A 3Q58A