4PBGA

6-phospho-beta-galactosidase form-cst
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
468
structure length
468
Chain Sequence
MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITCNGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 178
structure length 468
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pbgA00
3VIKA 4JIEA 4OUEA 1LWHA 4PUDA 2QMJA 5HNNA 4D6CA 3T0AA 4QDMA 3VDAA 3WEZA 4JAWA 2VT0A 2XVPA 2J7CA 4M8UA 5TD4A 2EPOA 2VVSA 4EK7A 3VVGA 1ZL1A 3SCPA 1XSIA 5F7UA 2WBKA 1KGWA 2CKRA 3II1A 4PCTA 2C8NA 3WD1A 1QI5A 2ZXAA 4DWSB 2C0HA 3VPLA 4D6GA 2VC9A 4CUCA 4LQ1A 4AZ7A 3ZJ8A 1KFWA 1GOQA 1FH8A 5E6YA 1KWGA 3BAWA 1Q6DA 1HT6A 5BWFA 3WF4A 3ZM8A 4KRTA 4RE4A 1UKTA 3FAWA 4Z2GA 1AMYA 2O92A 2WC4A 4GO9A 4QLLA 3THCA 4NSBA 3EDFA 2BXYA 5HXMA 1V0KA 4BQ4A 5IFTA 5FKYA 2CITA 2BFGA 2EO7A 1C8XA 4KGJA 3GBDA 1J0HA 5BXPA 2D3LA 1FH9A 4W89A 1CXLA 2YA2A 2EEXA 4ATDA 2CETA 1NOWA 3CHDA 1J9YA 1IV8A 5I6SA 4TVCA 3RIKA 5BROA 1HKIA 4U2YA 2A3AA 2BS9A 3ZSTA 1GHSA 5I79A 3WSUA 2G3NA 3TP4A 2F61A 1QBAA 2GJPA 1UR0A 1WDPA 1VFUA 4MADA 2XFYA 4FLOA 4TOQA 2VI0A 1V03A 3RM4A 2HISA 4B9YA 2D24A 2EJ1A 1Z32X 4J3VA 1PIFA 2ZXDA 4CKQA 1H1NA 1BHGA 2X09A 2UY4A 3THDA 4AEFA 1HJUA 2JF6A 5GNZA 5E6ZA 4HOWA 4YPJA 1QI3A 4DM2A 1E43A 1WZKA 3AMCA 4TXEA 5FIPA 1ECEA 1K6AA 1OINA 2QLYA 1KQYA 1UH3A 2MANA 3IJ7A 2O9RA 3VTRA 4B9ZA 5EBAA 3UG3A 3W82A 4AZGA 3GM8A 1TCMA 4QFUA 4CU7A 3K8LA 1BG4A 4PMZA 1R87A 5CJ5A 2XFRA 1KXQA 4ACYA 4TTUA 3VGBA 3GNOA 3RMEA 1XRVA 4HU8A 5GPRA 4H41A 3K4DA 4UFMA 3OGRA 2VX4A 2BY1A 2XVNA 2PB1A 5A8QA 3M7SA 1A3HA 4GI9A 3WELA 2ZX7A 1CGXA 2D0GA 3VD4A 1WKYA 4ZE5A 2YL9A 4CVUA 1UKSA 4Z2KA 2V3EA 3HMCA 1HIZA 4AY1A 4DWSD 2OWXA 1LQ0A 2YIHA 4WKFA 2EXOA 2O9OA 1CPUA 5ABGA 1AVAA 3SCQA 2ZX6A 1B30A 2PWEA 4HTYA 2DIEA 4GZEA 2JE8A 1KXVA 3GTNA 6A3HA 1KXHA 4NRSA 1W91A 2RGLA 1HNYA 2VO5A 2OLHA 2DT0A 3DHUA 2GJXA 1WZMA 4UQAA 5HPCA 2A3HA 1J0YA 1JYVA 1W1YA 1ISYA 3CTTA 2C7FA 2FGZA 2DQXA 1V02E 4U3AA 3SUVA 4AD2A 3VD3A 1US2A 4P7RA 3CZJA 5DFAA 1UWIA 2WLYA 1TA3B 1E73M 2YA1A 3PTQA 2A3BA 4D6HA 4PMYA 4F66A 3IANA 1CLVA 1GOMA 1EQPA 2W67A 4LPCA 2ZXQA 1QHOA 1R86A 1WP6A 1HVXA 2V3DA 5HPOA 1GQKA 4H04A 1W3JA 1GOOA 3ARSA 4RL3A 4TUFA 3ZJKA 1CXIA 4AWEA 5A95A 4X0NA 2CESA 2CPUA 3DECA 1C91A 4ZENA 3WUGA 3DYPA 4GO8A 4HP5A 3ALFA 4J28A 2VRQA 2YBTA 2WMGA 2DH2A 4KRUA 3AQUA 2CEQA 3BAXA 2D0HA 3WMCA 1TVPA 1W32A 1CXEA 1UD3A 1JI1A 3WIJA 2VR4A 4TVDA 3VMPA 2WW5A 2YL5A 3SCWA 2GUYA 3MUAA 3AYRA 1OGGA 1EDQA 2Y4SA 1EHAA 4CN4A 5EFDA 1KR0A 5LA2A 2X0YA 2XTKA 1N82A 4M56A 3FXYA 4GI8A 2E4TA 3WNOA 3AJ7A 3WD3A 4MAVA 1B9ZA 1ITCA 2G3IA 4HZ7A 3FHAA 1HJXA 2J7FA 3MMUA 1BFNA 3QHMA 4CVWA 3WNMA 1QNPA 4OJYA 1E6RA 4PTXA 3L2MA 4Z2LA 2BVDA 2F2HA 3TA9A 3U5UA 5A8NA 1XYZA 4P7NA 4URIA 3W53A 3KL5A 5C8BB 2CCRA 3W37A 5AY7A 2PWDA 1BLIA 2X05A 1CENA 1Q6CA 2NT1A 2DSKA 1X1NA 2DT2A 3L4TA 4V27A 3PZQA 4XB3A 4NF7A 2V38A 3OZOA 2WYSA 5A2CA 5FL0A 1DTUA 5CPQA 5A6LA 4AD5A 1CEOA 3W26A 3HN3A 4B3LA 2WSKA 5I2UA 4K68A 2PBGA 1KR1A 4CN1A 3NDYA 2J4GA 4JFVA 4E8CA 6TAAA 1HKJA 2ZUNA 3N18A 2ZX5A 5BRPA 3N9KA 1L8NA 2CKSA 1VEPA 1BAGA 3KL0A 3OGVA 1LL7A 3OG2A 4AYSA 4QCEA 3NSNA 2XJ7A 2E0PA 1KBKA 4ATWA 4JKKA 1VJZA 4P8UA 3WL0A 3L4VA 1G1YA 3AS3A 4BQ2A 5ABFB 3EYPA 4JCMA 4L4PA 3VDHA 1BPLB 3MUY1 3VNYA 1UR9A 2VMFA 1PX8A 2CBIA 1HXJA 3VO0A 1PJ9A 4ACZA 3OLEA 3WNPA 1E4IA 4PMRA 2WMFA 4H8UA 1UWSA 2XYLA 1GUVA 3F5JA 4FLSA 4GINA 1K9FA 4D1IA 4YHEA 1DWFM 1UOKA 3UESA 3S2CA 3M46A 5IDIA 3SUUA 1M01A 5JBEA 4QP0A 2DEPA 4U3CA 1EGZA 3WQ5A 1OT1A 4MAZA 3VX0A 2J47A 5CQ1A 1V08A 4MB1A 5E0CA 4CD5A 5D4YA 4TX6A 5FD0A 4HA4A 1WE5A 1CLXA 3IAQA 2E9MA 3FY1A 3AMGA 5ABFA 1E3ZA 1KCLA 4KGLA 4P7LA 2QF8A 4W87A 1HL8A 1E0VA 2WVVB 4D1JA 1WCGA 2EPKX 3WD0A 4YN5A 2VR5A 2J7GA 4JL1A 5DT7A 4FMVA 1DWAM 2D20A 1DP0A 3W0KA 1RP9A 3QOMA 2BV9A 3AS1A 2GDUA 1PIGA 3MUIA 4D6JA 4MNMA 2PWFA 2JEQA 3VMNA 1G5AA 3AIVA 3KZSA 4E8DA 4XUYA 1UYQA 1EH9A 2D3NA 1XGZA 5A3HA 2WCGA 2JALA 3MMDA 4OBSA 1J12A 1W1PA 3VGGA 3AIUA 1UKQA 1CDGA 3AIWA 1WDSA 3F5LA 5C70A 3GH7A 3T0BA 3VIJA 4Q22A 3CBWA 2JIWA 1I1XA 3WD2A 5E0FA 1UKOA 2OSXA 1EQCA 4CN6A 2WMIA 1HN1A 4WJXA 4IM4A 4WSJA 4W7VA 2XVGA 2UY5A 5CLTA 7A3HA 4UFIA 4CCEA 3VIMA 1JDCA 1CECA 1J0ZA 4W7WA 2WM0A 4WKHA 5AYBA 4AC1X 2D1ZA 4J3TA 3PZUA 2XVKA 4UOQA 3S6TA 1FHLA 5A2BA 4OIFA 2J8GA 4N42A 3PBGA 4M81A 4PN2A 4ZEPA 2ZX9A 4PYSA 4AZBA 4WLCA 3TTYA 5DT5A 3MMWA 1KXTA 1KB3A 2XSBA 2A3EA 2GVYA 3ZOAA 3WH9A 3PTKA 1UWRA 3ZT5A 1FH7A 2WVUA 4PMQA 4W7UA 2Z1KA 2OSWA 1E71M 1GHRA 3T2OA 5I0DA 2WVSA 2B31A 4BF7A 4YHGA 5A6SA 3AICA 3UCQA 3EDJA 1E4LA 2J7HA 3AXHA 3LPPA 1J01A 5CPTA 4AD0A 1UZ1A 2DPEA 2DIJA 1MW1A 1XV8A 3SUSA 2WC7A 1V3IA 4AIUA 3VIGA 3N11A 3FW6A 4MB5A 1X6LA 3W6LA 2WLZA 5A6MA 4D71A 3AIBA 4TTGA 1RPKA 4UR9A 2VNCA 2ZUSA 5A6BA 1PZ2A 2BY2A 3WNLA 3U7VA 1VFOA 4CD8A 3WDHA 3CZEA 1ODUA 4BA0A 2Y8KA 5IFPA 2J7BA 2E40A 2PF0A 1YQ2A 1VBUA 1GNXA 3VM5A 3FN9A 5HOSA 3KE0A 2XPKA 1YHTA 5JIWA 4BS0A 1NWRA 1R7AA 3LMYA 5DF0A 2YDRA 2Q8XA 1V0LA 3AS0A 1VJSA 3PTMA 1PBGA 2XSAA 2GK1A 1VFMA 2V5CA 4MB3A 4B3KA 1W9DM 1RH9A 3MKKA 5CZKA 4E4PA 2VL4A 1K9DA 1UA7A 2FH6A 3WH8A 3EDKA 3WDJA 1HJQA 1UQZA 1ZBVA 1UD5A 3A4XA 2E3ZA 4NRRA 8A3HA 1KGXA 1E1FA 4U31A 1HJWA 3GZAA 1HL9A 3FAXA 3NDZA 2Y5EA 4Z2HA 5A8MA 2G3JA 1H2JA 4JCLA 3CZKA 1NM9A 3WQ6A 1HP5A 3WMSA 5KEZA 4FK9A 2J7EA 5CLWA 3L4YA 4WSKA 3T2QA 3U57A 5C71A 4MJ2A 4W85A 1BYAA 1OB0A 1E0WA 3WD4A 1ZB5A 1B0IA 2YDSA 1L0PA 1ISZA 3GXFA 2UY2A 3KWXA 2CHNA 1TMQA 1WB0A 1H09A 1Y7VA 4U2ZA 3A3HA 2PWGA 3NCOA 4DM1A 2GJXB 1V6WA 3VUPA 1UWTA 4DUWA 2TAAA 1VIWA 1BVZA 1I75A 1XH0A 4MNJA 3BCFA 2UWFA 2IXUA 1G9HA 4KH2A 1W2PA 3POCA 5I78A 1DHKA 1VEMA 2W62A 2VTFA 4N0RA 1LL6A 1MQRA 1NWUA 3GXIA 1OWQA 1NP0A 1JZ4A 3WNNA 3WF3A 2FHFA 1VB9A 1BYBA 5D9MA 1IZJA 1OM0A 4H7VA 2YLLA 1XD1A 3N17A 5M03A 2VQTA 1C8QA 2YL8A 2OWCA 1MYRA 2XHYA 1CXFA 2DDXA 5JBFA 2Z1SA 3PZOA 2FHCA 1OGBA 1B3ZA 3ALGA 1KQZA 3WBAA 1QI4A 3OLGA 2VX7A 2XWEA 3WF2A 4UFJA 1BQCA 2X2YA 2J62A 1H11A 4CCDA 5JBDA 3GYCA 4AD3A 5D8ZA 5I77A 3EBVA 2D23A 3VIPA 4AZHA 3T08A 3QR3A 2WHLA 1EIBA 1TR1A 1JIBA 1W3HA 4W8LA 2JEPA 1WDRA 3CUGA 2F8QA 2XWDA 1FFRA 1JXKA 4KMQA 3O6AA 4MJ4A 3UG4A 1DWJM 1DEDA 4TVUA 1E72M 1UHVA 4ZFMA 1JYWA 4ATLA 2WZHA 4HZ8A 5CPSA 2IXVA 5ECUA 1QHPA 2ZIDA 5D9NA 1XSJA 2VRJA 3VDBA 1V3MA 4W84A 1WAWA 1ZBWA 3CIVA 3AIEA 1OIFA 4D6EA 1V3HA 1JD9A 2ZXBA 5DO8A 4PMUA 3LPGA 2X8RA 1ITXA 3BLKA 1J10A 4M82A 2XVLA 2QPUA 1UH4A 2J7DA 4UZUA 4AEEA 2W91A 4HU0A 1V6XA 2GDVA 3PZTA 3BLPX 3DYOA 5CGTA 1W9VA 1W9UA 2G4FA 3WF1A 4GXPA 1MW2A 2VX5A 3PZIA 3WMBA 5A1AA 3AOFA 1XCXA 1JNDA 3MU7A 4CU6A 1E55A 3ZR5A 5D8WA 3W27A 6CGTA 3W29A 3W24A 3EMQA 2D2OA 1UG6A 2O9TA 2BVTA 3VNZA 4UFHA 3W28A 1CIUA 1H41A 3QGVA 3AI0A 1BGGA 1A47A 4XX6A 1MW0A 3PZNA 3AHTA 4BCEA 5CSUA 3CHFA 4GZJA 3TOPA 1NOFA 2PBOA 3VGHA 3PZMA 3A47A 1W9BM 3N04A 4AD4A 1RD6A 5CSYA 1H4PA 4ZXLA 3K8KA 1E6NA 4UQDA 2VZOA 1B2YA 1WDQA 2JFEX 2NW0A 4HPGA 1OD8A 1PZ3A 1ZS2A 3CUIA 4Y7EA 2OYMA 3CPUA 1FFQA 2WCSA 3I3DA 3WDIA 4ACZB 1VF8A 1JZ8A 3AZRA 2FGLA 4UOZA 1V0NA 4Z2IA 4P8XA 3WBEA 1UH2A 1GVIA 2AOSA 3CUHA 4J3WA 4GIAA 2WVTA 4MDPA 1OSEA 3RCNA 4OOZA 3OLDA 2ZUWA 4BQ5A 4P8WA 1EO7A 1XH2A 1E70M 3FHQA 3GXDA 2CIPA 3VU2A 2EPMX 3WH6A 1XD0A 3KL3A 1GORA 5HBFA 4IPNB 1E9LA 2WWCA 2YBUA 4UZSA 5A8OA 2CNCA 2WHKA 2WKLA 1UKPA 4X9YA 3CGTA 3VINA 2WCAA 3BSGA 4FLRA 5LYRA 1H49A 1E6PA 1JZ2A 1WZAA 3VILA 1QNQA 2YLAA 3DYMA 4LX4A 2YKKA 1WO2A 4MNKA 4U5IA 1BF2A 3MANA 4UQBA 2XG9A 1GJUA 3T09A 4J27A 1E5JA 4M80A 3JUGA 2Y2WA 3G6MA 1IT0A 3AMLA 1OIMA 3W6MA 3FNDA 1O6IA 1M7XA 3B9EA 1MXDA 1GQIA 4W93A 1PX4A 2YOCA 2VVNA 1CZ1A 3AZTA 1LLOA 2W61A 3SCUA 5EB8A 3ZJ6A 3POHA 1W9XA 3A4AA 1U30A 1B3XA 1JI2A 2BNJA 3QOKA 3WFLA 4XV0A 5CGMA 3IK2A 4S3KA 4GQRA 4PBGA 4PMDA 1UR8A 3OA5A 3AS2A 4FLQA 1EXPA 4QLKA 3BAYA 2W92A 2BY0A 5D9OA 4KWUA 3M07A 1BYDA 3SCSA 2QMKA 3WENA 2DSVA 4A4AA 1QOXA 4D6FA 3SCTA 1O7AA 1QVBA 2E8ZA 1MVYA 1HX0A 3BAJA 2WMIB 1ODZA 1GW1A 1UR1A 3BMWA 4MB4A 1JZ6A 2V5DA 4WKAA 3N1AA 2V3GA 3BAIA 3VD7A 1PX3A 3OB8A 3WEMA 1M03A 3B8SA 3ZJ7A 3CLWA 2VJXA 1BVNP 2HVMA 3BH4A 4AZ6A 1SMDA 1B3YA 1FP8A 5CG0A 2XGBA 4PMVA 5M17A 2JF7A 3BCDA 4R5EA 4JFUA 3BXWA 3AXIA 3EDEA 2DSUA 5IHSA 1R8LA 2PC8A 3GH4A 1V02A 3GXMA 5HDRA 3ARVA 1CNVA 3T0DA 1JF5A 1JNEA 1GPFA 3DHPA 1C3FA 1B31A 3SIMA 2WB5A 4PEEA 1LWJA 1E6ZA 1X6NA 3WDRA 4AIEA 4QAWA 2ZOXA 4BZYA 2WK2A 3MS8A 3VGFA 3ARUA 1JF6A 4J7RA 4PSRA 2CXGA 3ARYA 1DWHM 5BYWA 3J7HA 4TX8A 5A69A 1Q6FA 3ZT7A 4B15A 1FP9A 1E6QM 3MV11 2VRKA 4ML4A 2WANA 4OZOA 4WIWA 3BGAA 4HPHA 3EMZA 1B3WA 1WZLA 5GNXA 3WKZA 1JL8A 1E0XA 1NWTA 3F4VA 3ZT6A 2AMGA 5LA0A 4AXNA 1J18A 2D22A 3ARZA 2A3CA 3ZMRA 3CMGA 7CGTA 4PMXA 1GOKA 3PHAA 1Q6EA 2OSYA 4AZIA 4W5UA 4CD6A 1MWOA 4JFTA 1EDGA 3MUZ1 3APGA 2XIIA 3AISA 3AROA 3MSDA 4JKLA 2ZE0A 2WBGA 3K4AA 1UD6A 2BHUA 1BGAA 4JHZA 1TUXA 1UWQA 3WL1A 2VQUA 3WFZA 3BMVA 4UQEA 2CHOA 1CGUA 3O2LA 4EAMA 1KWKA 2GK1B 4UTFA 4V28A 4PRWA 1W9PA 2ESCA 3N15A 1TFVA 3NIYA 1Q6GA 3NJ3A 1CTNA 3UETA 3D5HA 1QI2A 3L4WA 1JYNA 3N13A 1HJSA 1ZJBA 3VIFA 2EPLX 3CO4A 4AW7A 1LL4A 2J75A 3VIOA 5FL1A 1HF6A 4CD7A 3CZ8A 2ZWZA 4MTVA 1JZ3A 1E56A 1ESWA 2AAAA 4ZE4A 3IJ9A 1EOKA 3ZR6A 9CGTA 1UD4A 5JIPA 3D3AA 2W66A 3GNRA 4CU8A 1G01A 3SCVA 3T2PA 3ARRA 5LA1A 3CMJA 2J79A 3ARXA 5I24A 3AHXA 5BXRA 2YDQA 5ABHA 1W1VA 3W25A 5EFFA 1UA3A 1XCWA 3AFBA 4RE2A 4W8BA 4C7FA 2BHZA 2ZUVA 1D2KA 4HZ6A 4M29A 3RO8A 1NWSA 2CYGA 4HMEA 5KZ6A 5BXSA 1K9EA 3UERA 1UQYA 5IHRA 2DH3A 3WY1A 3GDBA 2W63A 1FOBA 5AC4A 3AYSA 3UR8A 3TTSA 2BXZA 3L4ZA 1C8YA 2WHJA 3CUJA 2YL6A 1PPIA 4HOZA 3I3EA 3L4UA 2G8ZA 1JAKA 2VCAA 4UFLA 3SUWA 3WDQA 4DWSA 1V3KA 5A6BD 3CH9A 4X0VA 5CXPA 1G94A 3WQ4A 1W2VA 3OZPA 2J77A 2DT3A 1VRXA 4JKMA 1W3KA 1IZKA 3VD5A 1QNSA 2W4XA 5E09A 2ZUTA 2QPSA 1ZJAA 1SMAA 2ZICA 3SCRA 1H0IA 2BY3A 3WUEA 1QPKA 3W81A 1QW9A 4R27A 4HMDA 2O9PA 3AHZA 1SR0A 1E40A 1CGWA 2J25A 3MO4A 3LPFA 4HOXA 1C90A 3K1DA 3OLIA 3ECQA 1JYXA 2E9LA 3GNPA 1GOIA 2WNWA 1JG9A 4NI3A 5ABEA 3ZO9A 1B90A 3VD9A 1HKMA 1JAEA 2RGMA 3KEHA 1GVYA 1JDAA 2DGAA 1W1TA 3G6LA 5FCZA 3WF0A 3AZSA 3SEPA 1U2YA 1MQPA 4P7OA 3VMOA 3U7BA 2W5FA 1JGIA 1V6YA 2VX6A 2WWDA 4DUVA 2CBVA 1MFVA 2VCCA 3NYDA 2E9BA 3VIHA 2XUCA 1F4AA 2BHYA 4PMNA 5I3DA 3OGSA 4F9DA 1JFHA 3RJXA 1SYTA 1KCKA 5AC5A 3QHOA 4UOJA 1TVNA 1RP8A 3VKKA 3WH7A 1CYGA 4B16A 1UWUA 1QBBA 2GSJA 4AIOA 4H8VA 1H5VA 1MQQA 2VOTA 2WMKA 5GNYA 1BSIA 2NT0A 1AQ0A 5I23A 4AD1A 3M6DA 4PCSA 1H3GA 5E70A 1UR4A 2GJRA 2ZWYA 1EDTA 1DWIM 3GH5A 1XHGA 1XH1A 3VIIA 1ISWA 1TE1A 1S46A 1JZ5A 2CBUA 3WUFA 3W4RA 1CGTA 3BC9A 4JL2A 2D0FA 1V3LA 1CWYA 1GOWA 3WQ8A 1BYCA 4IUGA 3F5KA 1I1WA 5GQBA 4QLJA 4F79A 1FA2A 3WQWA 2WZEA 5DMYA 2XM1A 1PAMA 4EANA 2WHMA 1C7TA 2EQDA 1LJYA 4A3YA 1QW8A 3UG5A 3NSMA 2EPNA 5A6AA 1LG1A 4XZWA 2XM2A 4J3SA 4S3JA 2VZVA 1U33A 1D7FA 1E6SM 1K9TA 3N12A 2Y8VA 5M5DA 3TTQA 1NP2A 1KBBA 1JD7A 3RJYA 8CGTA 1OGSA 5A94A 1P6WA 1HJVA 4GQQA 4U5KA 5IXEA 4D72A 3ARTA 3L2LA 1ZU8A 3ZSSA 4PTVA 3GBEA 2IUZA 1OCQA 1TA3A 4HA3A 1E1EA 1US3A 3CUFA 2J8FA 3SUTA 1MW3A 2BVYA 4H2CA 4PTWA 4D6DA 1EO5A 1GCYA 1E4NA 3UR7A 1WPCA 2ZUUA 4GKLA 3CHCA 1QI0A 4H8HA 4UNIA 3RDKA 4W86A 3E1F1 1EA9C 1ZBCA 3SURA 4CD4A 3AHVA 4LYRA 1ISVA 1VFFA 4W8AA 3VOCA 1MXGA 3A4WA 1OT2A 1C7SA 1HVQA 1B1YA 2WMJA 1UUQA 3I3BA 1FHDA 3A6OA 1AQHA 2VZSA 3WNKA 2DSZA 1E6XM 1GJWA 4IISA 2E8YA 1QNRA 3PZ9A 4M1RA 4UQCA 1J0KA 1GQJA 4JFWA 3AIRA 2FH8A 3U5YA 4L4OA 1XC6A 1UR2A 4AZCB 4A3HA 1NQ6A 2PWHA 3K46A 4MNLA 4PUEA 4F9JA 1LF1A 1BG9A 4J3XA 3ZIZA 3SCNA 1E3XA 4OKDA 1E4MM 4M24A 3UEQA 2UY3A 4DUXA 3AMDA 1NOUA 4P7QA 1VBRA 5A2AA 4UCFA 4CGTA 1QNOA 1V6UA 1UD8A 3DC0A 1C92A 2OYKA 3RM8A 2VZTA 2WMHA 1CXKA 2GFTA 3BAKA 3O9NA 1PEZA 3RPMA 3WQVA 2YA0A 1SFSA 3VDCA 1MFUA 1B3VA 2VURA 4C7DA 5A8PA 4JZ5A 5BXTA 2VZUA 4EKJA 2G3MA 2PI6A 4UQ9A 2WC3A 5EMYA 1TG7A 1UD2A 2VUYA 2X1IA 4E2OA 1E15A 4MDOA 1V6VA 2FHBA 3TONA 1J0JA 1QHZA 4AZCA 4W88A 4NZCA 5M3WA 3WDPP 3ARWA 4GPNA 3ARQA 3AXXA 4W5ZA 5BCAA 1LG2A 3MV01 4QCFA 5FOOA 4BQ3A 3WUBA 2XFFA 3HU7A 3RM9A 2V3FA 4Z2JA 3SCOA 2WXDM 2DSWA 2VCBA 1H0GA 4LYQA 3VX1A 2CERA 4CCCA 1ISXA 4GZIA 5A6KA 1W3LA 3AMKA 1C93A 3EDDA 4PSPA 1CBGA 2XGIA 3L4XA 4LGXA 4OBRA 1EOMA 4WK9A 3CZLA 3K8MA 7TAAA 5JUVA 2OWWA 2WKGA 3B9DA 3AHYA 2XIBA 1F4HA 3MSGA 3TTOA 1VAHA 1NARA 4JFSA 1JXJA 1BTCA 5AYIA 1J0IA 1WNOA 3VM7A 3PZVA 2WZIA 1CXHA 2Y24A 4MPKA 1HP4A 3PZGA 3OBAA 3NSXA 2ZUMA 3ARPA 3LPOA 4GI6A 1XYFA 1VENA 1ZBKA 5D9PA 4WF7A 1TZ7A 4HA1A 4PTMA 3B9AA 1JZ7A 1NH6A 3IJ8A 1JFXA 2DT1A 1HKKA 3WEOA 3OIHA 1GQLA 1E5NA 1DWGM 2QV4A 3QHNA 2WSPA 5E9AA 3AIQA 4PMOA 2YJQA 4JHOA 1JDDA 1R7OA 4C7GA 4OOUA 1V3JA 1EHNA 3W38A 5DEZA 4U33A 3VGEA 1UZ4A 1R85A 1CGYA 4AISA 2WPGA 4IPLA 4ZXOA 2WVVA 1OBAA 1OD0A 2CBJA 1GONA 2WAGA 4V2XA 3WH5A 3EMCA 1J11A 1CGVA 3HJEA 2G41A 2J78A 5I5RA 3NUKA 3RILA 1VEOA 1XSKA 4EE9A 5A6JA 1GZJA 1M04A 2NSXA 4LYPA 4XZBA 2EBNA 1G0CA 2QHAA 4P8VA 1M53A 4HMCA 3WN6A 2OYLA 4UFKA 4Q7NA 2ZX8A 4J3UA 1D3CA 2FDMA 3BSHA 3IAPA 1AQMA 1KGUA 5BRQA 3ZQ9A 4DWSC 3VGDA 3CZGA 2X0HA 3PN8A 4LXFA 4RE3A 2J74A 4AZ5A 1Q4NX 2JIEA 4AMCA 4D6IA 3CHEA 1V0MA 4FF5A 4F8XA
chains in the Genus database with same CATH superfamily
4JIEA 4PUDA 2QMJA 3T0AA 5FEPA 5HR6A 3KCOA 4Y90A 2XVPA 5TD4A 2ZE3A 1AODA 2VVSA 4K3ZA 4OT7A 1KFJA 3CHVA 3ITYA 4EPBC 2EHHA 5DMNA 3WD1A 1F5ZA 1QI5A 2IPJA 2ZXAA 4DWSB 3XISA 4IJRA 1U5HA 1XQLA 1S5VA 4S3DA 2ZC8A 1FWJC 5E6YA 4WY0B 1WX0A 1MRQA 2OU4A 1HT6A 3T7VA 3ZM8A 3FAWA 2R1LA 2F38A 3THCA 3WLHA 3FS2A 1HKWA 1LUCA 5IFTA 2CITA 4I9JA 2BFGA 3GB6A 3A3WA 1J0HA 2OKOA 4FX6M 1H1YA 2XH4A 1IV8A 4S3GA 1S2AA 2YW3A 3RIKA 3VNIA 3W7IA 1HO1A 1R38A 5AVNA 3NGFA 1YTDA 5I79A 2GPTA 5EGRA 3HG3A 3TP4A 2F61A 3KBSA 3H8AA 1UR0A 1WDPA 4TOQA 2Y5SA 5CPOA 2QUNA 4B9YA 3DKLA 4J3VA 1O5XA 2DUXA 5GNZA 4AEFA 2WNQA 4YWIA 2IS7A 4WX2A 2FMOA 3EXRA 3ZVIA 3KBNA 1ECEA 3P0WA 5D33A 4GH3A 4ZO7A 3VCCA 2Q3RA 4H9TA 4MWAC 3MHUA 2YPIA 3K8LA 1DJNA 2TSYA 1YEYA 3P5YA 2XFRA 3DFQA 2G4JA 1Y8BA 1KXQA 5I3KA 3GNOA 4IFOA 3B9OA 5K7JA 1UWAA 4H41A 3RGTA 4XZMX 4QNWA 2BY1A 1X96A 1HKVA 2XVNA 1I2RA 2X1SA 2PB1A 3M6YA 7ODCA 1A3HA 1EXBA 4IIDA 3EWZA 2D0GA 1KCXA 3HMCA 7PTDA 1LQ0A 2YIHA 3TR2A 4DNMA 2EXOA 5HJLA 1YXCA 4PEKA 4MZYA 2YCLB 2ZX6A 2QW5A 4GZEA 3B97A 2C14A 4LUYA 1XDMA 3B40A 1QU4A 4NRSA 4CQBA 3HTWA 3LCWA 3W6YA 4FPSA 3F03K 1DIOA 2OLHA 4M7SA 2POZA 3Q4DA 3UJFA 2A3HA 1J0YA 1KFCA 2WJZA 1DQXA 1ISYA 3CTTA 3TQ0A 3G1VA 2DQXA 3ATZA 3M5XA 1V02E 4IGSA 4MY8A 5AECA 1M5WA 4C5YA 5KITA 1E1CB 3TYCA 3CZJA 3OIXA 5HINA 5CBIA 4L4MA 4GISA 1U1UA 3N4AA 5G4EA 2DVUA 2MUCA 2ZXQA 5D03A 2BP1A 2V3DA 3CQIA 2QAFA 1GQKA 3HQOA 1I60A 1GOOA 1W8SA 3PJUA 4RL3A 4WJEA 5A95A 3HQ1A 4R9XA 2AL1A 1LRNA 2CESA 2CPUA 4DZIA 2E1DA 3BQ5A 3LMZA 3LTPA 1C91A 3W74A 3A22A 3DYPA 4F0KA 3QMSA 1W3TA 8XIAA 3FYYA 3GDKA 2DORA 4KCVA 2QNEA 2TPSA 4KRUA 1XX1A 3AQUA 2D0HA 1W32A 1CXEA 1UD3A 2HJPA 4NHVA 4G2DA 2WQDA 4GE8A 3MYPA 2WW5A 2YL5A 2B4GA 4GXWA 2ONEA 4GUFA 3AYRA 3MUAA 1OGGA 2BLEA 4H19A 1EDQA 2Y4SA 2BG5A 3TOYA 3UQNA 4DLMA 1GGOA 2RJGA 1QASA 4L6DA 4CN4A 2XZ7A 3KBMA 2VDHA 5HK4A 9RUBA 2E4TA 3FVMA 3WNOA 1YIXA 3IACA 4AX7A 1T6MA 2P76A 4IGHA 4PRTA 1ITCA 3UWUA 5CC3A 3FHAA 4GQBA 3W7JA 3GK0A 2VWTA 4PTXA 1TKKA 2BVDA 2F2HA 4KWVA 4QE1A 3R8RA 3TA9A 3SAZA 5A8NA 4FOUA 4UMCA 3KL5A 1M68A 6XIMA 3UZWA 4J1OA 2A21A 1BLIA 2DT2A 3PZQA 4NF7A 3W01A 2V38A 3PSWA 2WYSA 1DTUA 1W3NA 1Q8AA 4R34A 3PWAA 4B3LA 2NVAA 2PWUA 3HN3A 5FJRA 4K68A 1BWKA 2PBGA 4CN1A 1FWGC 3RLVA 2PDLA 6TAAA 3H70A 1QPRA 5BRPA 1XQKA 3N9KA 1L8NA 1R2TA 1XIFA 1D8CA 1PO9A 1BRLB 2QGHA 3TV8A 1R9XA 1X97A 4DJDA 5BMXA 4JKKA 3GNXA 1S5TA 4P8UA 4EPEC 2NV1A 1G1YA 4EWND 4A3RA 4BQ2A 1TPVA 4F48A 5ABFB 4NILA 3G8RA 1ME8A 4TU1A 3MUY1 5KTLA 1I2OA 1PX8A 3CB3A 3W83A 4FOJA 2GQ3A 4MJMA 3CM4A 3NPXA 3S3GA 1DXFA 3LXAA 4H8UA 1UWSA 3F5JA 4FLSA 4GINA 4XBJA 3M46A 4AF0A 5IDIA 4RV3A 4QP0A 1OT1A 4N4QA 3W75A 4CNUA 4MB1A 5E0CA 4CD5A 2EKCA 3SSJA 1YBQB 1WE5A 3EWBX 5CJNA 3W1LA 1FWCC 3ABOA 1RQHA 2ODOA 1A50A 1TTIA 4P7LA 3PJWA 2WVVB 1WCGA 3LV6A 3Q67A 4I6KA 2HROA 1DWAM 1DP0A 3W0KA 4YVVA 2PDKA 3OBEA 3H24A 4OQVA 3M47A 3F2CA 4HHLA 3DESA 4YMZA 2GGGA 1SSDA 3N6JA 4B2DD 3K1GA 4D6JA 4MNMA 2PWFA 4IX0A 3LZ5A 1G5AA 1VD6A 3WBYA 2ZYFA 4XUYA 1UYQA 5A3HA 1XM3A 5J04A 2WCGA 3PG9A 3VGGA 1TSIA 2ZA3A 5AYXA 2E25A 3ITCA 1I1XA 3WD2A 5E0FA 2PDCA 1UKOA 4S3BA 4H9MA 3TN3A 2P10A 4CN6A 3RG6A 1JPMA 2VDIA 1GW9A 2UY5A 4TO8A 2RAGA 7A3HA 1H50A 1OFBA 4RNFA 4MYAA 3QYQA 4WKHA 3NG3A 3KW3A 5C7VA 1FHLA 3LCFA 4NNCA 3LQLA 3VOHA 3DFYA 4ZEPA 2QDEA 4JTFA 3CQKA 4AZBA 1JRCA 1KBJA 3W7CA 1KXTA 3LN3A 4AVNA 2A7NA 1A49A 3LYEA 2ALDA 1Q63A 4W7UA 1DJWA 1E71M 4QE4A 5HAOA 3IJQA 4IMFA 1XKJA 3T2OA 2WVSA 3EKZA 4G6CA 1TJPA 4M6VA 2YZ5A 3ES7A 4Y9OA 3R12A 2J7HA 4F2TA 1A5UA 4AD0A 2DPEA 1R3YA 4LCRA 4DBUA 2X1RA 3PPGA 2IPWA 5IBXC 2ABBA 3O1NA 3E38A 3DOPA 2ZC1A 2V5BA 4B5SA 4UR9A 2FJUB 2VGBA 3H7VA 2G0WA 3NM3A 1GOXA 1TPUA 4QHRA 3C8FA 4AAJA 4IP4A 2A4AA 1K8CA 4GGHA 4CD8A 2GUBA 2Y8KA 3GNNA 4IFRA 5IFPA 3FFSA 4ALDA 1GNXA 3COTA 1NELA 4AC7C 4AWTA 3NZGA 5D2WA 1MEHA 4BS0A 5DF0A 1TTQA 3UWVA 4A35A 3G1AA 1O5KA 3AS0A 3PTMA 2XSAA 1A53A 1ONEA 4MB3A 4FNTA 1K4GA 1RH9A 1TZZA 3MKKA 3OJGA 3YPIA 3BOXA 1UA7A 1F2JA 3EDKA 5HATA 3WDJA 4PB4A 1ZBVA 5FF4A 3QXBA 2D73A 3W7OA 2E3ZA 4FOKA 4HK6A 4QBXA 1N55A 3W00A 3N9SA 4U31A 1OX6A 1OYAA 3GZAA 2QQ6A 5K2ZA 1ZJHA 5EMUA 2QIWA 4Z2HA 4HU3A 1PVNA 3HA1A 3ANUA 3T6CA 4B4HA 1NM9A 1BKHA 4HHMA 4E2DA 4IQEA 1ADDA 1TPEA 4KWWA 3BG9A 4YTUA 2INZA 1OB0A 2VDGA 3SFWA 1B0IA 1ISZA 3GXFA 1MUMA 3SN1A 2UY2A 1XL9A 2PDXA 2CHNA 1ELSA 3OW1A 3G2GA 1RLCL 1JCXA 1H09A 5AC6A 4IL0A 4KESA 3NCOA 1UWTA 4PTNA 5M2FX 1XH0A 4MNJA 2UWFA 1TV4A 4GVFA 4TR9A 3K30A 2DFAA 4LUIA 2E77A 1DHKA 2BDQA 1OWQA 4WVXA 2O56A 3WNNA 2H6RA 3BW4A 1BYBA 1IZJA 5M03A 1J79A 1XD1A 2GGHA 2HDJA 4MWAB 1ZJIA 3ENLA 1F07A 4Z0JA 2OWCA 2HS8A 1MYRA 2XHYA 4ILSA 1CXFA 5JBFA 2Z1SA 4M51A 1X1OA 3WBAA 3C8NA 1QI4A 3LSCA 3WF2A 3O8AA 3LLXA 1BQCA 2X2YA 4CCDA 2C16A 3P93A 1WOAA 3EBVA 4YNGA 1M3UA 2DZPA 4AZHA 1EIBA 2XN1A 1GEHA 2JEPA 2OG9A 1JXKA 4JTJA 2OMAA 4MJ4A 2V68A 4C1NB 5FJIA 1K4HA 1VBHA 1F6PA 1X6UA 2G50A 3M9YA 1KV5A 1G4PA 1TPWA 3URNA 2ZIDA 4JHMA 5DMLA 1WAWA 1ZBWA 4L56A 3AIEA 3LU2A 4D6EA 1QOPA 3STEA 2VWSA 3HJZA 2ZXBA 5DO8A 1TPH1 4PMUA 1UH4A 4UZUA 4AEEA 4CQ9A 1IR2A 2W91A 4H6QA 4O17A 2GDVA 4ZR8A 1ZNNA 1PL9A 3ABQA 4Q7IA 3MDWA 4YCOA 3HMJG 3DYOA 4JX4A 1DBTA 1W9VA 1W9UA 3WF1A 2VX5A 4GMEA 1GKRA 1U1HA 3WMBA 4EF8A 1RA0A 1XCXA 4CU6A 3LCXA 3ZR5A 4KF1A 6CGTA 3W29A 1UG6A 2A7RA 3LZ3A 5BU6A 4DUOA 1ZAJA 1TV2A 1CIUA 1OYBA 4GUJA 3EB3A 4XX6A 5CSUA 3CHFA 4GZJA 3TOPA 2PFHA 2PBOA 4JTRA 1JR1A 3ITTA 1W9BM 1RD6A 3MB9A 3FJ6A 5CSYA 2HXTA 1F61A 4L7ZA 4QGCA 1E6NA 1UUMA 3A24A 2VZOA 5LSMA 1B2YA 1OD8A 3E5BA 1ICPA 2RKXA 4UTHA 2OYMA 3CPUA 3B8DA 3E9AA 3UZZA 4Z2IA 4UOZA 1V0NA 3M0LA 4P8XA 3A23A 3C6CA 3W85A 3BLDA 4O57A 4GIAA 4CNNA 1DPMA 1KFEA 4OOZA 2QJJA 4P8WA 4CQ8A 3IK4A 3O0KA 1EO7A 2YXOA 1E70M 3MKCA 1RCQA 4EX4A 4IPNB 1UC4A 2YBUA 2PEVA 4UZSA 3SGGA 2WHKA 3N4FA 3CWNA 3EPMA 2QKFA 3GAKA 3MQTA 1TO3A 1EPXA 1H49A 4EACA 2YLAA 5CC6A 3O05A 4K8HA 4LX4A 4OU1A 1BXCA 1GJUA 3T09A 2DVTA 3JUGA 3S83A 7REQA 5L6UA 4IMCA 4MJZA 3V5OA 1IYXA 1W6TA 3ZLHA 3G1XA 1O6IA 3SJ3A 3B9EA 5D30A 1GQIA 1THFD 1CZ1A 2PTDA 3AZTA 4Q8MA 2NUXA 2W61A 4BHYA 2HSAA 4JTIA 2BX7A 2Q02A 2W0UA 4MVAA 3KVMA 5AC8A 2ZRZA 4QS5A 3A4AA 3PANA 4LC6A 3QOKA 5LIUX 1CB2A 4GQRA 3OA5A 1XKYA 2YFOA 3AS2A 4FLQA 3BAYA 2W92A 4O1DA 4DBEA 3PVFA 4KWUA 2PUZA 4JQ2A 3UNDA 2OGYA 1QOXA 1OK6A 1MVYA 4S3CA 1HX0A 1DOSA 2WMIB 7XIMA 4IGNA 4MG4A 4K1WA 1IWBA 3BMWA 3TKFA 3KM8A 1PX3A 3P60A 3WEMA 4FB7A 1SGJA 3QZEA 3V0TA 3BXWA 3AXIA 3EDEA 3QMRA 2DSUA 4O13A 4NUWA 2WSRA 3QPEA 4NT0A 1IIGA 1JF5A 1NU5A 4C6CA 1KFLA 3P84A 1C3FA 3PAJA 1QJWA 3HG5A 2AL2B 3SIMA 3WDRA 4PEEA 1E6ZA 1SM9A 4QAIA 1QFEA 9XIMA 3H2EA 2OOFA 2Z0IA 1H7XA 3VGFA 1EF3A 3V1HA 4J7RA 4PSRA 1DWHM 1LOQA 3J7HA 4JNYA 1Z3NA 4HJWA 4PUNA 4XZHA 5A69A 1P7TB 4B15A 3MV11 4ML4A 4WIWA 4J9JA 3EEGA 3BGAA 2QEZA 2XH2A 3N25A 4X63A 1EJWC 1E0XA 1B4KA 1NWTA 1E9YB 3W02A 1JDFA 2AMGA 1OADA 1J18A 3ARZA 3C86A 4WDXA 3ZMRA 4PMXA 4ZO8A 1Q6EA 4MKVA 4AWUA 1V5XA 4AZIA 1EJVC 1LM1A 2AKMA 1J6OA 1EDGA 1Y5XA 3GXTA 3APGA 3NEHA 5TQLA 1V7AA 1VJIA 4NAFA 3MSDA 5DMMA 4XG1A 4JKLA 3P3BA 2RJHA 1Z7AA 2ZE0A 1VYPX 1UD6A 3K4AA 4JHZA 2BHUA 2VC6A 3ICJA 4UQEA 1CGUA 4LBUA 3APTA 4EAMA 4FO4A 1GZGA 2IMRA 3PPHA 3FK4A 1FVPA 1KWKA 2XH0A 3M44A 3M43A 3V0SA 3D6NA 4V28A 2YCJA 4PRWA 3G24A 3BO9A 3BVJA 1Q6GA 5BOEA 1VKFA 3STFA 4ENLA 4ROQA 2F6UA 3RRXA 1ZJBA 1RZMA 4AW7A 2JKPA 4GUHA 4CD7A 3MA8A 3CZ8A 1RJPA 2ZWZA 5CH9A 2ZZ4A 1I2NA 4MTVA 4YTTA 1E56A 1L6WA 4AY8A 1ZRQA 3QFWA 4LY8A 3RU6A 4JIQA 3EWYA 3OOQA 2W66A 5BWAA 4CU8A 3SCVA 4QSFA 3T2PA 4KFPA 1XGEA 3ARXA 3PSVA 3H23A 3E2QA 4FNUA 1UA3A 1IR1A 4RE2A 2V81A 4JX6A 3L65A 4A8IA 3NM1A 2BB0A 1KM1A 2ZUVA 4BWLA 2A7PA 5T91A 5C9UA 3U2CA 5F2LA 3G0SA 3WY1A 2I56A 3GDBA 3E2VA 3AYSA 3UR8A 2BXZA 5G2IA 3SQMA 2WHJA 3I3EA 3PBVA 3C56A 2NQ9A 2G8ZA 1JAKA 3SUWA 3PTDA 4PCPA 2VFIA 3WQDA 1V3KA 5A6BD 3CH9A 3PK7A 1F3EA 3S6OA 3WJSA 3WQ4A 3M41A 1H63A 4ML9A 4U4MA 2DT3A 1FX6A 3CL8A 3G1RA 5FJOA 4HYRA 3LB0A 4XZ9A 4WD0A 4PUMA 1NY1A 1D7KA 1ZJAA 2ISDA 1SMAA 4L9YA 1LZOA 4G7EA 1RVGA 1H0IA 5XINA 1OZMA 2ZADA 4NASA 3WUEA 3CT7A 1QW9A 2V0TA 5CKSA 1CGWA 4IWWA 2J25A 3GNDA 1KO0A 1YE6A 3H2OA 4N2YA 1H61A 1KC7A 3E0IA 1PDZA 3UPBA 1CW2A 2E9LA 3WLMA 5B7ZA 3GNPA 1A80A 4LT9A 2WNWA 1TJ1A 1JG9A 4GH1A 2QDDA 4J5NA 1F3TA 1HKMA 3KEHA 1JDAA 9XIAA 1AK5A 1S3HA 5FCZA 3WF0A 4DBWA 1U5JA 1O94A 4X22A 3U2OA 2ZZ6A 4WOQA 3KRUA 2FMNA 3EEZA 2YDAA 2CBVA 5FA5A 4AU0A 4IH3A 5F4XA 1F4AA 2BHYA 4K37A 1O95A 4DZAA 5FAJA 4F9DA 1TV8A 2BSLA 3P8JA 3W86A 3RJXA 4H1ZA 2ANUA 3UXDA 2OGJA 1XLCA 2GZXA 2Y70A 3NQCA 4UOJA 3QY6A 3WH7A 2DZVA 4H8VA 3N2XA 2VOTA 3GU2A 2HBXA 3HIJA 2YXGA 3VK5A 2A0NA 2FZ8A 3L5MA 4OBTA 4DXVA 5I23A 3OPSA 1A5MC 5FEZA 3VNJA 4FXJA 3TZNA 1UR4A 2ZWYA 1EDTA 4FR6A 1AZ1A 3H4XA 1WAUA 3VIIA 1TE1A 1S5WA 5D02A 3V75A 1VYSX 4MHBA 1JZ5A 4DWDA 3BC9A 4DO7A 4XIAA 3NQAA 2X1UA 3UXLA 4XD4A 3R89A 4FF7A 4QLJA 4KWOA 2QDGA 4F79A 2WZEA 4LOCA 5DMYA 3UZJA 4Q8OA 1C7TA 1AW5A 4GCAA 2GGIA 4Z1CA 1JPKA 3IV8A 5HANA 1SR9A 1TREA 4J3SA 4IPJA 4S3JA 2VZVA 4Y6GA 2WKJA 1ONWA 4UTWC 1EX1A 3TTQA 5DELA 1OGSA 4B5NA 4U5KA 4D72A 1XI3A 2R82A 3ARTA 3T55A 3QGKC 1MO0A 1PIIA 1GG0A 1TA3A 2Z1XA 3Q58A 4R7WA 3S2MA 4O0KA 1E1EA 3MCNA 1S5NA 1US3A 2BVYA 3C61A 2QT3A 1E4NA 1XINA 1WPCA 1QI0A 3TIMA 4H8HA 4PA8A 1JUBA 3B0YA 3RDKA 4MKNA 3JVAA 3AHVA 3P2VA 4XKYA 1XLIA 1KM0A 4W8AA 1MXGA 3CAWA 3WQCA 5DANA 2WMJA 3FKRA 2HPIA 4Q4PA 4P5UA 4L5ZA 5FJUA 4N9EA 5T9BG 3PJTA 3LHTA 4GFSA 4JTUA 1VFLA 1MNZA 2DSZA 3PZ9A 4JFWA 1GQJA 3C52A 5EA9A 3BURA 3WLSA 3LCGA 3FA3A 3LEPA 4A3HA 2Z2AA 1NQ6A 2CWNA 4LVBA 4MNLA 3LQGA 4J3XA 3U8GA 1E3XA 3QC3A 5CCZA 1MZRA 1BEUA 1NOUA 2HBVA 1UBPC 2VFGA 2Y85A 4JN7A 5A2AA 1I2QA 2BWGA 4PFMA 4UCFA 3BOFA 1UD8A 2OYKA 3RM8A 2VZTA 1MEWA 5J5RA 1CXKA 2GFTA 3O9NA 1GVEA 3EAUA 2BZNA 2SFPA 4IL2A 3JZUA 1J5SA 4NX0A 4O14A 3VDCA 3LY0A 2VURA 2Y7GA 1WXYA 4Q4KA 5A8PA 5BXTA 4EKJA 4DB7A 3RYSA 5U7SA 2VEFA 1GVQA 1P0BA 5HA7A 5DLCA 3TSBA 1V6VA 4DN1A 2NQHA 5M3WA 1T96A 5H8PA 1AG1O 3W88A 1PWLA 1M41A 3SRDA 1FWBC 5C54A 3EA2A 5AOUA 2Z1BA 3D0CA 1IEQA 1AW2A 2VCBA 1FQ0A 4CCCA 1F05A 5KZMA 1IT7A 2RDTA 1C93A 4PSPA 3W7MA 2XGIA 3L4XA 4IICA 3NQ2A 3N2TA 1IHIA 4MMWA 4G8TA 4C6OA 1O12A 3AHYA 3SO7A 3C2FA 3TNOA 1FCBA 3IGSA 4FA3A 2GL5A 5BOOA 4O12A 2QCFA 1BSLA 1BVWA 1OJXA 2WZIA 3VNDA 4QS6A 3OBAA 1O1HA 2ZUMA 5H8UA 3T42A 3VKJA 4GI6A 3LHWA 1ZBKA 3CAKA 5FJTA 1TZ7A 2OZ0A 4LAZA 4LUTA 1TV3A 4EXQA 3MP3A 1GQLA 1E5NA 3W70A 2WSPA 4PMOA 2C71A 5CAHA 3IVSA 3IGHX 4ZOBA 2YX0A 2C13A 1V3JA 4JBRA 1EHNA 2C19A 1UIOA 3V3WA 2IKHA 1F7BA 4HT3A 1OBAA 1OD0A 3WH5A 3RLHA 3WBXA 1J11A 3HJEA 2J78A 1IEWA 3RILA 2PDMA 3SRKA 3AALA 3TYUA 3KBJA 3W7QA 2QF7A 1XIGA 1MRAA 1DKWA 1M04A 3LGEA 4N9BA 3H7UA 3JR2A 1XIHA 4L80A 4GK8A 3CWOX 3CEUA 2IQ0A 4J3UA 1KRMA 3OZYA 1AQMA 3H21A 1KGUA 3EB2A 5C5YA 1I8JA 2OB3A 3FEQA 4YVPA 4LTSA 1EZ2A 3T4WA 3QLLA 2QCMA 2PE4A 2QAPA 3RX2A 4I9AA 3RX3A 3KBWA 4JDYA 2DZSA 4AZ5A 5HULA 1REQB 4AMCA 4GCXA 4GG9A 4D6IA 1V0MA 4JTDA 4FF5A 4F8XA 1RD5A 2H3BA 2HK0A 2XIQA 3GE7A 1Y5WA 2VEGA 3RU8X 3WJXA 1S2VA 2J7CA 4M8UA 4OECA 4MGGA 3SCPA 5F7UA 4EPKA 1KGWA 3KTCA 1FTXA 2CKRA 2ZFAA 4PCTA 4X2RA 1K02A 1X7IA 3D46A 5HJXA 1PUDA 4LQ1A 3F2BA 1KFWA 1ZAIA 2FQIA 4HYWA 3UR5A 1Q6DA 4TV6A 5BWFA 5REQA 1Z89A 3WF4A 4Z2GA 4KRTA 2FPVA 3CH0A 4IG2B 3F7JA 3OVPA 4NSBA 3HBLA 2P8CA 5TF0A 3GBDA 4IOTA 4JTAA 4ATDA 3CHDA 4KPLA 5BROA 1L8PA 1ZSXA 2A3AA 4XO6A 3UJRA 2GQAA 1GHSA 1R6WA 3A3XA 4IQJA 3BE7A 4UBPC 1JCNA 3L7RA 2Y61A 1JVNA 4JXCA 4Q4RA 1CB7B 2VI0A 1QOQA 2DW7A 3PJXA 1EJUC 2NWSA 4Q6JA 1Z32X 4EXBA 2HQAA 1LRQA 2X09A 4UB9A 1HJUA 3RXZA 2A79A 4YPJA 1WZKA 4TXEA 5IBXA 2ACSA 1XLLA 3B03A 1UH3A 5U4NA 1SW0A 3IJ7A 2O9RA 2DUAA 3UG3A 1XC4A 4DJED 3GM8A 3B3DA 1TCMA 4YWSA 4QFUA 2GQ9A 4KIRA 1H51A 5CJ5A 3A64A 2ASHA 1IWAA 5JU6A 4ACYA 3VGBA 4XIMA 4YYFA 1XRVA 4HU8A 1RCXB 4UXDA 1VPYA 1CLKA 1Q8JA 5EKYA 4Y9AA 3OGRA 2VX4A 3HPZA 3S2LA 5A8QA 3LCIA 3GSMA 4GI9A 3E0FA 5AB3A 2ZX7A 1CGXA 4ZL1A 1UCWA 4CVUA 2FVLA 2XIJA 1KRBC 4DWSD 1Q13A 3QFEA 2GLKA 4GGBA 2Z25A 4RK8A 3SCQA 2PRLA 3I65A 4US6A 1V7YA 3ERPA 3IPWA 1FCUA 4HTYA 5HUPA 3UWWA 3MT1A 2PDJA 2GUUA 3DC8A 6A3HA 1W91A 2E1WA 2RGLA 3NZRA 5T26A 3U48A 1R30A 1A5SA 3DHFA 2CFFA 3HURA 2HCVA 1C9WA 3RPDA 2POTA 3NQ7A 4GYPA 4XAZA 5DCBA 4JQAA 1XIEA 2Y5JA 2FGZA 2I5IA 4E4FA 2HK1A 4AD2A 2WNZA 3VD3A 2CWXA 4BI7A 4P7RA 3M5VA 3GVQA 3F4WA 4C6LA 4ZA0A 4PUWA 4A2RA 3TW6A 4Z1DA 4D6HA 4PMYA 3GR7A 4F66A 3SY8A 1GOMA 1O4UA 3GG7A 1C9DA 2W67A 4NNAA 4ZOAA 3CL6A 4LPCA 4C6MA 5HPOA 4H04A 3P0XA 4QEHA 4BR1A 4OWGA 2VENA 4CEUC 1CXIA 4AWEA 2V5KA 2XGZA 1DIEA 3BARA 3DECA 4IMGA 2GGEA 4H4IA 4V1XA 1FCQA 1ZALA 2YBTA 3FSUA 5EMMA 3DG6A 3F2DA 3LDVA 4O54A 2CEQA 3BAXA 1XW8A 5AHFA 3WIJA 2VR4A 4TVDA 3SCWA 4CCZA 4DRSA 4DJFD 2J88A 3WJYA 4MUPA 4A3QA 5DCEA 3MJYA 4DO6A 3P5ZA 4M56A 4O18A 2Y63A 3CL7A 3S46A 3RFAA 3JU2A 2ZTKA 3MZ2A 2QVHA 4JTHA 4S2BA 4QR6A 4HZ7A 3NOYA 2X40A 4IT1A 1MI3A 5FF2A 1QNPA 2C91A 1E6RA 3EZ4A 1VHNA 1Q7QA 4V1YA 2P3ZA 1QCWA 5C8BB 3VDGA 4ES4A 2PWDA 1W17A 2HNHA 3BLIA 2X05A 2DJLA 5CPMA 1CENA 3CEPA 2NT1A 2DSKA 1X1NA 2ZZ7A 3L4TA 1SUXA 3Q37A 3M1ZA 3UZYA 5A2CA 3EGJA 5FL0A 4JX5A 5CPQA 5A6LA 1EF2A 1CEOA 2J24A 5T9CE 3NDYA 1JRBA 1UUOA 4E8CA 1Q45A 3EA3A 3N18A 4TQTA 1BKSA 3NQBA 3KL0A 4AYSA 3NSNA 1CX9A 2E0PA 2Z4GA 4ATWA 3C3UA 1O68A 1ICQA 4UR8A 5HMSA 5CEWA 5GJPA 4JCMA 3LK6A 4M3PA 3VDHA 1BPLB 3VNYA 5SWUA 4H9XA 1KCZA 4EPDC 3VO0A 1BD0A 1PKLA 1DL3A 4ACZA 4Q7BA 2Q3OA 1LORA 3EOLA 4N9DA 1ITUA 2XYLA 1ZHAA 4YHEA 1UOKA 3SR7A 3KVLA 2VELA 3S2CA 3LLFA 3MVTA 3W2UA 4WDWA 4IIEA 1M01A 3A9IA 5JBEA 3S5ZA 1EGZA 3W2KA 1BRLA 3VX0A 4JDBA 3QV6A 2QZRA 5IOBA 3RLUA 1CLXA 1S2CA 4HSNA 4LS2A 1A5LC 3AMGA 3CTLA 3KFTA 3NR0A 5ABFA 4DXXA 1KCLA 2QF8A 4Z1BA 3OYXA 4D1JA 4FNSA 3U2EA 3W2JA 5DT7A 3NXFA 3TDFA 2WZMA 4RZBA 5LIWX 5CC5A 4NXKA 3CU2A 1GQNA 3LGDA 1W37A 3N6QA 4US5D 4NNBA 4DXKA 2GDUA 4MYXA 3H2MA 1PIGA 2F6XA 3MUIA 3C0JA 2JEQA 5AKQA 4L1WA 2X41A 3AIVA 3OG3A 2E7FA 3OO2A 1XGZA 2HWGA 1SQ7A 1XUZA 5D2XA 1DJQA 3UJEA 5B80A 2JALA 4OBSA 2Z28A 1W1PA 1OEPA 1UKQA 3T40A 2OZTA 4HJFA 1WDSA 3GH7A 3VIJA 3CBWA 2JIWA 4X61A 1TELA 4E2BA 2OSXA 1EQCA 4KWSA 4HKPA 2ZRWA 3QZ6A 4W7VA 4OHQA 3KOFA 4GJ1A 1J0ZA 2PGRA 3ITVA 5E5CA 5AYBA 2D1ZA 2JKEA 4UOQA 4D8ZA 4OIFA 3W7LA 3PBUA 5CBJA 3HV8A 4PN2A 4PMJA 3MMWA 4PFHA 2Z6IA 3R43A 1KB3A 3SJNA 4L9XA 1NF0A 4CQCA 3PTKA 4RDWA 3TYBA 3SDOA 3ZT5A 4O1CA 1QTWA 2CC0A 1YDYA 2OELA 1PWMA 3HM7A 5I00A 2XFWA 5I0DA 4ECLA 4YHGA 4CNTA 3T1GA 1TPDA 3L68A 5DCDA 4DBSA 3S47A 1DQWA 1FCVA 1VS1A 1ZGDA 4AG0A 1KNWA 5AHLA 1E4LA 3TQVA 1LUCB 3LPPA 3PAOA 1HW6A 1RY8A 1RQBA 5CPTA 1OF6A 4N9CA 4MWAE 1JCMP 1UZ1A 4I8YA 4OV9A 3NQDA 1MW1A 2WC7A 4AIUA 3QR1A 1A4MA 2IPGA 3FW6A 3PBYA 3H7RA 1LTDA 2WLZA 2I9EA 4GQGA 3UVIA 4D71A 1PKYA 3S9IA 4TTGA 5KETA 2PDIA 4PH6A 3MZNA 3GD6A 3TJLA 1NDYA 2BY2A 3H2AA 4QEEA 3U9IA 4NJIA 4UTLA 1Z48A 3U7VA 1HGWA 3KUMA 3VZYA 3UJSA 3IGUA 2HRWA 3UJ2A 2J7BA 2PF0A 3I7SA 4M5PA 1R5YA 3BG5A 3C2YA 4WJ8A 4NU7A 4NL1A 1T0OA 3KE0A 1P0EA 1P48A 1NWRA 1R7AA 3LMYA 2W27A 4GY1A 5CJMA 2YDRA 1V0LA 2PSNA 1VJSA 4LNYA 1PBGA 1XRTA 5LXEA 1RSCA 4B3KA 1US0A 1YTKA 1SO4A 1TRIA 1IXOA 3LM3A 3CC1A 4IIHA 2QR6A 3SRHA 4AYGA 3NGJA 2VL4A 1K9DA 1J6PA 4HVXA 1HJQA 1UQZA 1YE4A 3QR0A 1VIZA 4ZTYA 3G22A 4NRRA 2AGKA 2ATMA 1U5VA 4ZQRA 3KRBA 1KGXA 1E1FA 2J9YA 3MVIA 1TQJA 3ONCA 3NDZA 4ZOEA 3ZWTA 2G3JA 4HNNA 1T5AA 1HP5A 3WMSA 5BW6A 2J7EA 4XAYA 3G0UA 3SQSA 5CLWA 2ZRVA 4WSKA 3SRFA 4LEFA 3U57A 2XN0A 3MSRA 1RJRA 1BYAA 3W1PA 1XYMA 4IQDA 1NDVA 4NZ4A 1TWIA 1W8GA 3GUGA 3M4HA 2QS8A 4HK5A 5FSDC 3R0UA 1XLBA 2VHLA 1L2QA 3URAA 5C2GA 1ECQA 2PF8A 2TAAA 4MSSA 1I75A 3BCFA 1G9HA 1GTEA 3C2VA 4KH2A 3C2EA 3V35A 1TVLA 2HXUA 4LUJA 3W2NA 2PP3A 1DJHA 1FWEC 2VTFA 1LL6A 4LWWA 4N4PA 2OR2A 2J6VA 4C6EA 2HNEA 1OM0A 4JICA 3NQMA 1QT1A 3MO7A 3N17A 4R9OA 1C8QA 1RLDA 1QWGA 2WSYA 1FKWA 4NKCA 1W5OA 3E74A 1KRCC 3U3HA 2DDXA 4LVDA 3OEXA 3S5SA 2FHCA 3WLRA 1VH7A 1OGBA 1B3ZA 1KQZA 4RNHA 1UB3A 3OLGA 3N9RA 2VX7A 4PZVA 4UFJA 2Z26A 3R5EA 2QCLA 5D8ZA 5I77A 4DO5A 3HGOA 3S5YA 4Q6XA 3GVRA 3ITOA 4W8LA 3CUGA 2XWDA 2CLIA 3RN6A 5CZTA 1DWJM 1J2BA 3DBNA 1JYWA 1MSSA 2EKGA 1OX5A 4HZ8A 3AU6A 5H1WA 3U6WA 1IT8A 1OQFA 2IXVA 5ECUA 4F4RA 3W7NA 1H60A 1TWWA 4DLFA 1V3MA 1GKPA 1RY0A 3CIVA 2P5NA 1OIFA 3L0NA 1UPPA 1VFHA 5KSWA 4PTDA 2XH7A 2X8RA 5G5IA 1F9CA 3S5NA 2QPUA 2J7DA 3L9CA 2C6QA 4O15A 2WZTA 4V33A 4XD3A 4HU0A 2VC7A 3B0VC 1W5PA 4GBUA 4AHOA 3OODA 5CGTA 4GXPA 3TJIA 1ZUAX 3DAQA 3WK3A 4XKMA 1PCKA 1JNDA 1FDJA 4HPJA 3R79A 5D8WA 4C1NA 4ZGYA 3W27A 1XIIA 3W24A 3WQEA 4FI4A 1NDWA 2Z24A 3ID7A 4UFHA 2A6NA 3QV7A 4FALA 3UY7A 1VCGA 1RV8A 3URBA 4L9ZA 4OE7A 4I7WA 2ZTJA 4JY9A 4AD4A 3FXGA 4HPXA 3U4AA 1SZEA 2B81A 3H55A 1K1DA 1UMLA 4MWAD 5EMLA 3QLDA 1LCOA 2JFEX 3WO8A 1ZS2A 1PZ3A 3CUIA 1FFQA 3WDIA 1XLDA 2FKPA 3ITGA 3TROA 1JZ8A 4K8EA 2PA6A 3PNUA 1UH2A 2WM1A 2ISFA 4J3WA 3RCNA 5C2XA 3OLDA 2ZUWA 4I9TA 4J40A 2ZRUA 4KEMA 4AF0B 3KVJA 4PUJA 2IW0A 4IMDA 3GXDA 4ERIA 2CIPA 3VU2A 3WH6A 1XD0A 1CCWB 4O4VA 4GRSA 3BCJA 3VCNA 2WCAA 4HN4A 2ATSA 3BSGA 4W4QA 4I90A 4QIUA 3ZZ1A 3INPA 3VILA 2NQJA 1WO2A 3WLQA 4UQBA 4P2VA 3GC4A 3CUZA 4M80A 3VXGA 4JY8A 2Y2WA 1KD0A 3G6MA 1QUMA 1DVJA 3HO8A 3FNDA 5HMFA 4OV4A 3RNDA 3MYOA 3IV3A 3MTWA 4W93A 4RR4A 1UBSA 3BQ6A 2VVNA 1YXDA 2Z2BA 2X2GA 3SCUA 5EB8A 1FWDC 3BLOA 3IWPA 3VOFA 3QV8A 2LLEA 3ZJ6A 1VFTA 2BNJA 3WFLA 3ES8A 5CGMA 5I3GA 4S3KA 3BJTA 1UR8A 3B8WA 5I3FA 2EAWA 4NIRA 4NI8A 1NDZA 1EXPA 2Z2UA 4GIYA 3LGGA 2Q6ZA 2BMBA 2HTMA 5K9CA 2DSVA 4D6FA 3E12A 3EWUA 3WK0A 2QYGA 3V36A 4MY9A 2W79A 2CLEA 3BAJA 1ODZA 1GW1A 1LDCA 1UR1A 3HQPA 3UR2A 4WDUA 2V5DA 1FDYA 2VFDA 3TTEA 2HVMA 1SMDA 1B3YA 1XXXA 3R2GA 2XGBA 4PMVA 2QCHA 2JF7A 1OX4B 2O55A 3M7WA 4XZNX 4R5EA 2B7PA 5IHSA 3TC7A 4X2PA 3OVRA 1SZNA 1SO5A 2Y6ZA 4QSHA 2CW6A 3CMFA 4POCA 1FDZA 1DV7A 1KTCA 2HVOA 5GJNA 1T41A 5HDRA 3ARVA 3T0DA 1JNEA 1VPQA 3DHPA 1KM6A 3W7HA 2ON3A 1B31A 1X6NA 3R94A 1XICA 2ZOXA 4C6JA 3VABA 3FYPA 2WK2A 4BZYA 3P62A 1QDSA 5BYWA 1IZCA 2E5BA 2J9ZA 4NJKA 4TX8A 5BMWA 3E2RA 1WBHA 4DF2A 4FIRA 1E6QM 1EBHA 1SW7A 3EMZA 3UCDA 1WZLA 3KTSA 3T8LA 3WKZA 1S1RA 2OZ8A 4J2PA 3BPWA 3ZT6A 4AXNA 2FDSA 2D22A 2O4QA 1LP6A 2A3CA 3CMGA 3WLLA 1GOKA 2V5JA 5DBTA 3QBUA 3P67A 3MKVA 3UYIA 2OSYA 3PP7A 4W5UA 4JFTA 5HNUA 4DAFA 2YZRA 1XLFA 2DV0A 3AROA 3GUWA 1WBJA 4O1EA 3EWXA 2WSQA 1A3WA 2GSHA 1BGAA 1TUXA 1UWQA 3WL1A 3UP8A 3O2LA 3OVQA 1E0UA 4K7VA 4LV4A 2WQPA 3B8TA 3S2NA 2YYTA 1W54A 1PYMA 2DP3A 3N15A 2FZBA 1TFVA 5ENLA 4X3ZA 3BG3A 4ZBCA 2BTMA 2EPLX 3NDOA 3IJDA 1HF6A 3CAVA 4DBDA 1ESWA 4ZE4A 1EOKA 1UD4A 5JIPA 3D3AA 3CAQA 2FFCA 4FR1A 4HHHA 5F2GA 3MCMA 4JGDA 1FWSA 2H8XA 3K5XA 4OFCA 4H7ZA 5CG7A 2DZBA 2Q09A 1D3GA 4GJJA 4A8LA 4TX9A 4X60A 3O07A 1KFKA 3HQNA 4DZHA 1XYBA 5D2TA 5KZ6A 2QUTA 5BXSA 3GXNA 3T9PA 1UQYA 1NFBA 3FYOA 3C3NA 1FOBA 1PDYA 2V82A 3QY7A 5AC4A 1TQXA 4PGLA 3UU0A 3L4ZA 5PTDA 4A3UA 5K3VA 4PR4A 1ENUA 2P0IA 2VCAA 3GG8A 1YNYA 4LF2A 1NJJA 1FWAC 1G94A 1GVRA 2CLOA 2J77A 1W3KA 1YADA 2FB3A 1NVMA 4HNUA 2P0OA 4JNMA 3PBMA 5EY5A 4DF1A 5E09A 3SECA 2ZUTA 5HQLA 2HMCA 2ZICA 1X1ZA 2CZEA 3S1UA 3FA4A 2PD9A 4NX5A 1K8ZA 3MSYA 3W81A 3AHZA 1SR0A 1CI1A 4HOXA 5DN1A 3ZWSA 3DGRA 5F4WA 4B4FA 2R14A 3CPGA 4N7QA 4NI3A 4Y9PA 4X9SA 3VD9A 2RGMA 1GVYA 4WQ6A 1NEYA 4TMCA 2DGAA 1GG1A 1H7PA 3KDNA 3BANA 1FRBA 3AZSA 3SEPA 1MQPA 4P7OA 2OLAA 3CV1A 4K36A 3TZFA 3U7BA 1JGIA 2VX6A 1Q6QA 4IJCA 2P8BA 2WWDA 4AIBA 3Q94A 1MFVA 1PHQA 1ZENA 5DBUA 3VIHA 4ADUA 4C6FA 2XUCA 4Q8NA 2QIIA 3KP0A 3N2MA 1WQ5A 1QPQA 4MUZA 4UIOA 2WO5A 3O16A 1G67A 2IQDA 3QHOA 1DHPA 2ZA2A 1RP8A 3GKFA 2GSJA 4FX7A 1MQQA 3CASA 3IS4A 1VCFA 3C5QA 2WMKA 1A5BA 1CT5A 3QQ1A 2NT0A 1AQ0A 3GWQA 4F2UA 1WDDA 3M6DA 4PCSA 1H3GA 5D2VA 3SFKA 4KQNA 4PRRA 3GH5A 3MBDA 2BOFX 1Q4WA 1XHGA 1JCYA 3PUGA 1AZ2A 1WA3A 1G6CA 1S46A 1YPFA 2PDPA 4GNKB 4JL2A 4QJ5B 1GYLA 1V3LA 1GOWA 3WQ8A 4RPQA 2VM8A 4IXHA 2INFA 3H53A 4IUGA 2UZ9A 4GNVA 1I1WA 4JN6A 4O1FA 3HFTA 1FA2A 3WQWA 3LI0A 2EQDA 1LJYA 4A3YA 1OC7A 3RHGA 3UG5A 4DY1A 8RUCA 4XZWA 3LOTA 1D7FA 1K9TA 3N12A 4FNPA 1QO2A 1XIBA 3N34A 1KBBA 2NQ5A 3RJYA 4A8NA 1B9BA 3R8GA 3SSZA 2PURA 4L6OA 2GOKA 4FIQA 4O28A 4HA3A 3CUFA 3A12A 4H2CA 4PTWA 2XN2A 3NQEA 3P8IA 4LUSA 3W1UA 1OFQA 1F76A 2P50A 1BWLA 1UP0A 2VEIA 3CHCA 2GVJA 2GWNA 2FGBA 4FXRA 3VFLA 4W86A 3VC6A 3LCHA 7REQB 1ZBCA 2FPTA 1KV8A 4CD4A 3CV6A 1VFFA 1HTIA 4N6EA 4RZ4A 3KZPA 1UASA 1OT2A 2NV2A 1HVQA 1MNSA 3I3BA 1B1YA 1EX5A 3C2OA 6PTDA 3CIWA 4BI6A 1XISA 5C55A 3USBA 3UPMA 1YNQA 4NZ3A 1J0KA 2VYOA 3R11A 3DZ1A 4GC4A 3W07A 2EGZA 1PKMA 2FH8A 2QUVA 3UBPC 2D2HA 4AZCB 3CWHA 2X30A 3K46A 1V93A 2QUUA 2NXIA 2RDUA 3DFTA 4F9JA 3SCNA 5EBUA 4DX3A 2QCDA 4DPQA 2P88A 3SZ8A 2V30A 4P7QA 1MUCA 1VBRA 1AA1B 3LS9A 4NZ5A 1YRRA 2TRSA 4ADTA 2WMHA 3BAKA 2Z00A 5I3IA 1FWFC 4HNTA 4XO7A 4B2DA 1PEZA 1LWIA 3RPMA 1G4SA 1SFSA 1B3VA 4DO4A 4NAEB 4C7DA 4LAMA 2PI6A 2OCZA 1X7FA 3SN0A 1TG7A 4FSAA 1UD2A 1FXPA 2F2KA 1Z44A 4MDOA 2FZNA 4UTMA 1QHZA 4W88A 1KA9F 4NZCA 3WDPP 3ARWA 1LG2A 3WLOA 4RXGA 2NVCA 4BQ3A 3WUBA 3HU7A 3RM9A 2QGYA 2DSWA 4DPPA 1H0GA 4KIEA 3VX1A 5C9ZA 1ISXA 2ACQA 3AMKA 3FJ4A 1SFTA 4EWJA 1R3WA 4OBRA 1IEXA 3ABSA 2NX9A 3THQA 3K8MA 1SO3A 3QZAA 7TAAA 5JUVA 2WKGA 2QJIA 2XIBA 1F4HA 1RXOB 2P3EA 1TCDA 1ZAHA 2A85A 1VAHA 3GLCA 2KX9A 1JDEA 4LEQA 4RZ5A 3TMQA 5AYIA 4Y9MA 1J0IA 1JGMA 3LNMA 2OQHA 2OX1A 3T0TA 1I4NA 4NAFB 1TR9A 2W6RA 1UR3M 2ACRA 4AVFA 3IUDA 5I3HA 1XYFA 3FDKA 2QUMA 3SN4A 5D38A 4JTLA 5F1VA 5LIKX 4PTMA 3N3MA 2Y62A 3S1VA 1JFXA 3IUHA 4M6QA 4CNSA 1ITQA 3QHNA 1SZGA 3VC5A 3LXCA 2P1FA 4OOUA 4U33A 2Z29A 3GZ3A 1CGYA 2G5WA 4AISA 2CLFA 4IPLA 1UJPA 2VD8A 2CBJA 1UPMB 4DJEC 2WAGA 1XPGA 3ZVHA 4V2XA 1Z9AA 2PLMA 1ME9A 1BF6A 2G41A 5I5RA 2YB1A 3WLKX 1XLEA 4F3HA 4JOMA 2H9AA 3G1SA 3GR4A 2W9MA 3TXVA 1XRSA 3IJ6A 5A6JA 4U28A 2OZ3A 4JTEA 4UC5A 1G0CA 4H00A 4O16A 4HNLA 3VFCA 2V2HA 2OYLA 5F2MA 2ZX8A 4QJ3B 2FDMA 3M0IA 3BSHA 4DWSC 1KRAC 4DELA 4LXFA 4K7YA 1JEZA 4XAPA 3DGBA 1TZ9A 2JIEA 2JKAA 2X7VA 3MCOA 4LNCA 2O0TA 4OUEA 1LWHA 2ZRYA 5HNNA 1TV5A 3DG7A 4Q4QA 4LS1A 3VDAA 4LVAA 3HG2A 3G18A 2VT0A 4EK7A 3BGGA 3VVGA 3K2GA 4JIPA 1ZL1A 3G1FA 4K39A 3E6EA 3A5FA 1QNVA 3BUVA 4C90A 8TIMA 3PUDA 2V9DA 1RQEA 2C8NA 4G56A 5F1UA 1LBLA 1NAL1 5FEWA 3DH7A 5AFDA 3LX9A 2C0HA 4CUCA 4AZ7A 1MZHA 4FXSA 4NZ1A 3JRKA 3XINA 1KWGA 3W7KA 3ZXWA 3O06A 3AC0A 4P61A 1UKTA 2O92A 2CHRA 1REQA 2WC4A 5CZJA 4GO9A 3GDLA 3EDFA 3CO8A 2BXYA 4G7EB 5HXMA 1V0KA 3LNPA 2NQLA 1K8YA 3PY2A 4MZ8A 1EC9A 4GI4A 2EO7A 1C8XA 5D05A 4KGJA 1FH9A 1CXLA 2PP1A 3BV4A 2EEXA 1F73A 4N6FA 2CETA 1NOWA 5CPLA 5I6SA 2PGWA 4UCGA 4FX8A 2IKJA 1F8MA 2JBMA 4L61A 5JH1A 1TIMA 3NQ8A 3WSUA 2G3NA 3WZ0E 3LD5A 4I5XA 1KTNA 2HE5A 2V8ZA 4GYPC 3R13A 1VFUA 4MADA 1BQGA 2I1OA 2XFYA 3MW7A 4AMAA 3H2NA 1V03A 3RM4A 2FTWA 3AUOA 2EJ1A 1OFEA 4IG2A 2BBFA 2UY4A 4A6GA 3THDA 2JF6A 4HOWA 1QI3A 4DM2A 4JQ1A 4ZQPA 1E43A 3AMCA 3TEVA 4V15A 1K6AA 1OINA 2WPBA 2QLYA 1YLVA 1JUEA 4E0CA 2MANA 3VTRA 2GVLA 4Z1YA 3W82A 4AZGA 1R3QA 3ZFHA 4CU7A 3HOJA 3EPNA 4PMZA 3AXMA 1EP1A 3KOZA 5HR7A 2XIMA 4TTUA 1XYAA 2C3ZA 4UFMA 3CV7A 1K7EA 4LJ3A 3HPAA 4ZQCA 3M7SA 3R8HA 3WELA 5EL1A 1QK0A 3TQKA 4KW2A 3PFMA 1F6YA 2REQA 2V3EA 1HIZA 3LI1A 4IPPA 4XK2A 2OWXA 1V6TA 3PUOA 3GHTA 1YPIA 5ABGA 4RJEA 3VYLA 1HUVA 3UD6A 1V77A 3VOIA 3OZMA 2DVXA 2JE8A 1JULA 1KXVA 3GTNA 1KXHA 1ALDA 1P0DA 1HNYA 2VO5A 3TFXA 4J2MA 4EP8C 2DT0A 2GJXA 1PHWA 1U1JA 1L6SA 1JPHA 1B3OA 3ELFA 1JYVA 2OOGA 4LV9A 2YXXA 1M7JA 5KZEA 3TSDA 4U3AA 2FTPA 3IUIA 5CSSA 5DFAA 1UWIA 2EF9A 3GHSA 1TA3B 1IXQA 1E73M 2E6DA 2A3BA 1R3RA 2AQWA 4OUIA 5E93A 3FGCB 4C6QA 3N73A 1QHOA 1TV7A 6REQA 3GXPA 4DHGA 1HVXA 2J6XA 1MXSA 5L9FA 3G77A 3UNTA 2QVNA 3ARSA 4TUFA 4IIGA 3GDRA 3ZJKA 4HCHA 4X0NA 4LCQA 3TK7A 4XKYB 4YJ5A 3VZXA 4ZENA 1WKEA 4I8DA 3GHRA 3ALFA 4J28A 2WMGA 2ZBTA 2ZDSA 3ONBA 2F9RA 4QITA 3WMCA 4C60A 2VP8A 3TN4A 2AAMA 3GU9A 5FACA 1TWSA 4FEZA 5AHNA 3VMPA 1RCOB 4WEVX 3L5LA 5LGXA 1EHAA 3IVTA 5EFDA 1KR0A 4NJJA 3FXYA 4GI8A 2NUWA 4O8RA 1EKOA 3S1WA 2FTYA 2G3IA 1HJXA 1IEIA 1BFNA 3QHMA 4CVWA 3CYVA 2AGTA 5LNVA 3EX3A 4OJYA 4O4WA 1O66A 1FHVA 3U0HA 1XYZA 2XINA 4P7NA 4ZTXA 3PWIA 4URIA 3W53A 3UF9A 4ZB5A 3F4DA 1EC7A 5T8GA 4E6MA 1ICSA 2QJMA 4XB3A 3TXZA 3SB0A 5JQ9A 1N7KA 3RK8A 1XLJA 1J93A 3W26A 2V6AA 3V18A 2J4GA 3NXLA 4JFVA 4PCFA 1XG4A 5KINA 2ZUNA 3I68A 2WV8A 2DY3A 4GKTA 2CKSA 1XDJA 3UT0A 4H9YA 3CQHA 4YU1A 3OG2A 3VNLA 2I9UA 3O6DA 2XJ7A 4D2JA 1KBKA 4G9PA 2RH9A 1LROA 1VGAA 2PU1A 1VJZA 1EB3A 3L4VA 3OP2A 5IRPA 1EYWA 1JJKA 3EYPA 3TUUA 4L4PA 3OYZA 4L6HA 4LAUA 4ZO9A 1HXJA 3W73A 2G3FA 4HIBA 3IJLA 3THAA 3EX1A 1HQTA 1PJ9A 3DI0A 3WNPA 1E4IA 3A21A 1EGMA 2WMFA 4JS3A 3B8VA 1AH4A 1TUFA 4IZGA 1HFBA 1K9FA 4D1IA 1DWFM 1QAPA 2Z27A 1RHCA 3SUUA 5MKGB 3TC3A 2OXNA 4LUTB 3WQ5A 5EU9A 2OVLA 1XIDA 2J47A 1V08A 4Q8TA 1EPVA 1EC8A 4TX6A 5FD0A 3NTYA 4HA4A 1R3TA 3ZLFA 3QTPA 4ZMGA 3IAQA 2E9MA 3FY1A 1E3ZA 4KGLA 4W87A 3W1QA 1HL8A 3CT2A 1XRFA 4YN5A 2PTYA 2QJNA 4JL1A 1UP3A 1QATA 5EPDA 3O3RA 2FJKA 4JPGA 4KS0A 2DZAA 3KDOA 1VCVA 1RP9A 1Z69A 3QPZA 3QOMA 3I4EA 2BV9A 3WQPA 1K7FA 3AS1A 2ZZ3A 2CZ5A 4LSBA 3GG1A 4HN8A 3VMNA 4JYEA 4XD5A 2DZWA 4H6EA 4IP7A 4HSHA 1M65A 3E0VA 4GXMA 3BW2A 4KCUA 1K70A 3AIUA 3AIWA 3F5LA 1F8IA 2ABAA 5C70A 4XTIA 4Q22A 3TN5A 1PTDA 1EEXA 4IFKA 3UZXA 4ZQMA 2YGYA 3GC2A 1HN1A 4IM4A 2XVGA 1SPQA 5CLTA 4UFIA 1NQKA 3KVKA 3AU2A 1VBJA 5HMEA 3VIMA 1U22A 4S38A 3S2JA 1CECA 4W7WA 2WM0A 4AC1X 1JCLA 1YDNA 3FCPA 4GUGA 3PZUA 3S6TA 3WMLA 1OFAA 4AVOA 3DKJA 2ZX9A 8XIMA 4PYSA 4Y9NA 1DJXA 3MY9A 3TTYA 2NZLA 1PKNA 4LBSA 4YIWA 2A3EA 4JTCA 3GVWA 3RCYA 3NAVA 1UWRA 1FH7A 2R24A 4O10A 3E0LA 4PMQA 3WQFA 1XJBA 2Z1KA 2OSWA 3UWEA 1GHRA 4ZCWA 2ZZ5A 2B31A 3RMJA 2D69A 3AICA 4QJ1A 3P74A 2GVGA 3KBVA 4DNHA 3EDJA 2ZA1A 5DY3A 3UWQA 4IIBA 3SBFA 3AXHA 3ITLA 1J01A 1OFPA 4Z08A 2DU2A 2DIJA 3I6RA 1XV8A 1V3IA 3NZPA 3VIGA 2V69A 3N11A 4MB5A 3W6LA 2VEKA 3R1ZA 2OEKA 3AIBA 2BVWA 4B5XA 2ZUSA 1D9EA 3H4WA 5A6BA 1KBIA 3DFHA 1G7UA 1VFOA 3WDHA 3V4BA 4BA0A 3GFZA 3FV9A 1YQ2A 1VBUA 2F6KA 3VM5A 3FN9A 1EP2A 1GVFA 1YHTA 1TJRA 3V0UA 4DI8A 3GU1A 2Q8XA 4WY0F 1A5OC 1TJ0A 2OT1A 1DIDA 2GK1A 1SJAA 1VFMA 2V5CA 3AAMA 3TJ4A 5CZKA 4E4PA 3WH8A 1K03A 3W84A 4LC8A 1UD5A 5A6TC 4ZFCA 3STGA 4H83A 3W1MA 1KM4A 1OC6A 3OBKA 1HL9A 3TC6A 1UW9A 2DZTA 2VOMA 1IE7C 1KW1A 4REQA 5A8MA 1H2JA 2XIOA 2B7OA 3LRLA 3F1QA 5KEZA 4KEZA 3WFAA 2NLYA 3MI2A 3T2QA 3W2MA 5C71A 1GTHA 4MJ2A 4B92A 4W85A 1XLHA 3VI2A 1P4CA 3DDMA 5D09A 1ZB5A 4GYJA 1OVDA 5LHFA 4R3UA 2E67A 1TMQA 4I5UA 3IIXA 3AUJA 3A3HA 3I6EA 3BMXA 5EYWA 4DM1A 5I03A 3VUPA 3QM3A 3W76A 5DQPA 4KKXA 3BK0A 2IXUA 3T07A 3H2FA 2RFGA 1KKOA 3LV5A 1XPYA 5I07A 3L66A 3POCA 5I78A 1VEMA 4G5DA 1SJCA 3GW3A 3RR4A 1MQRA 1NWUA 2V67A 3GXIA 1JZ4A 1NP0A 3FVDA 4ZB2A 4JIIX 2FHFA 1VB9A 1GYNA 4AHQA 3LHZA 3BL3A 3CV2A 5HWNA 2PGFA 2PDQA 2YLLA 2VQTA 2PLJA 3BWWA 2YL8A 4G1NA 3TE9A 5E1QA 4XZIA 3PZOA 2WOQA 2B7QA 4GC3A 1H5YA 5AZ0A 3EXSA 4EIVA 4ZO6A 5JBDA 4H8NA 3NL5A 1ZFJA 3R10A 1Q66A 4QRNA 1WDRA 2F8QA 4E3TA 1FFRA 3V7PA 4PBEA 1V4YA 3O6AA 3UG4A 5LGZA 1DEDA 4ZFMA 3DFOA 6XIAA 5HMDA 5CPSA 3QTGA 3STPA 5D9NA 1XSJA 4LCSA 4QG6A 4KFOA 1ZZMA 2BGSA 2YCIX 3PUEA 1V3HA 1VC4A 5EMJA 1JD9A 3LPGA 1RBLA 1ITXA 1EZWA 1JCTA 3BLKA 1J10A 5CZ0A 1KLZA 1IWPA 1V6XA 1OG6A 3RX4A 2PTXA 2G4FA 1MW2A 3QEZA 4XUGA 3PZIA 4CQDA 4JN8A 3AOFA 1EWDA 2I57A 4IUOA 1XBXA 1E55A 1K77A 1YNPA 1L6FA 3EMQA 1RK6A 1WUEA 2D2OA 2BVTA 2OEMA 1FUYA 2R1PA 1H41A 1TTPA 2J27A 1E51A 2GWGA 3AI0A 3QGVA 1EP3A 1ZTVA 3DX5A 1ONRA 1KFBA 1MW0A 5H2ZA 3AHTA 4BCEA 3FX4A 1NOFA 1AW1A 3VGHA 3M0HA 3WLIA 4NP7A 1NTHA 3ABXA 4Y2WA 4FHAA 3OQ8A 4A29A 3S5OA 3MUXA 4HPGA 1RA5A 2ISVA 3O0FA 2WCSA 3I3DA 4ACZB 1HG3A 3VA8A 1VF8A 3AZRA 3EOOA 3WBEA 3OTRA 4AWSA 2YYUA 2Z6JA 3KX6A 4XBKA 3CUHA 1A3XA 1PCWA 2WVTA 1OSEA 4MDPA 2NSOA 2E6AA 3URQA 3W87A 2PTWA 4AEOA 4MY1A 3W71A 3L0KA 3PM6A 2EPMX 4MFDA 4AUBA 4MLJA 3R25A 1E9LA 2WWCA 3O63A 4J4KA 1XBYA 2CNCA 1QMLA 2WKLA 4Z1AA 1UKPA 4X9YA 3VINA 1A0EA 2Q71A 4PE8A 2KAUC 5LYRA 3BICA 3E5PA 3GTXA 2HZGA 2YKKA 4MNKA 1M6JA 4U5IA 1BF2A 1YDVA 3REQA 2XG9A 3F4CA 4J27A 4GHRA 5FEXA