4PBGA

6-phospho-beta-galactosidase form-cst
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
468
structure length
468
Chain Sequence
b'MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITCNGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 178
structure length 468
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pbgA00
3EMQA 4D6EA 1PX3A 5M3WA 2PWGA 3WH9A 4B3LA 5A8NA 3VM5A 4ACYA 3K46A 1MQRA 2VURA 1PBGA 1E6RA 1C8QA 5D8WA 1BSIA 1UZ1A 3CHEA 1X6NA 4R5EA 1DWFM 1CECA 1EDGA 1JF6A 1UA7A 3TTYA 4ACZA 4MNKA 2OWCA 3VILA 1GQKA 1JGIA 3ARQA 3KL5A 1VJZA 3RJYA 3MKKA 3MMUA 2VR5A 2OLHA 4KMQA 3OIHA 1JXJA 1NOUA 3AHVA 4XV0A 1E70M 3OA5A 3W81A 4MAVA 1ZBCA 1G01A 1E15A 3WBAA 1DWAM 1C7SA 5TD4A 1UR1A 4E2OA 1QNOA 3VOCA 2OYLA 1O7AA 1LL6A 1CXKA 2X05A 4PSRA 3T2QA 3ZT6A 1KWKA 1JYXA 1H0GA 1GORA 2WKGA 1W1VA 2Y8VA 4AZHA 3W0KA 5A6MA 3W25A 1GNXA 3VNYA 1VENA 3CMGA 1CGYA 1MXDA 1C92A 3QHMA 1WNOA 5CJ5A 1M03A 1VRXA 2C7FA 3U7VA 2DT3A 4W7UA 1VJSA 5I6SA 3T0DA 3WDQA 2ESCA 4J3SA 1CLXA 1OWQA 1QW8A 1HVXA 4CD5A 1KGWA 4CVWA 1P6WA 3M07A 1UZ4A 4PYSA 3QHNA 2X0HA 1WZMA 1UWQA 2GDVA 4CKQA 3NSNA 3RM4A 2FGLA 2VRKA 1JNDA 1HN1A 3VDAA 3GNOA 3WUGA 1UR8A 1E3XA 2WCSA 4PMOA 4F8XA 4AIUA 3SCOA 1UD8A 4PMRA 3N11A 1CDGA 3RMEA 3VDHA 2AMGA 1PIFA 3LPGA 5DF0A 1UYQA 3CLWA 5AYIA 2XYLA 3K8KA 3OZOA 1EH9A 2CBVA 1HKMA 2WANA 3W6MA 1JDCA 1CEOA 4HPHA 2JEPA 3WFZA 1W9XA 5ABFB 2WB5A 2J78A 4H8HA 5BRPA 1HT6A 4HZ6A 1GHSA 2YA0A 3VGHA 3WL0A 3L4YA 4NSBA 2WZIA 1HP5A 5A69A 1WPCA 1US3A 1WB0A 4KGJA 2VVSA 5CZKA 2VI0A 3WD4A 3OLIA 4R27A 2OYKA 3MUIA 1NOFA 3SEPA 4TOQA 4UQDA 2XWDA 1R87A 2EPMX 4D6GA 1W3KA 3SCSA 2ZX8A 1HJSA 5A6JA 4GQQA 1UA3A 4AD5A 2ZXAA 1M53A 2DIEA 2X09A 5A94A 1XD0A 4M8UA 1LWHA 2ZUNA 2XVLA 1FH9A 1XD1A 4CD7A 2JEQA 4AZ6A 3M46A 2ZWZA 2FH8A 1RP9A 3AXIA 1J0HA 3ZT5A 1MW3A 3I3EA 3FNDA 3HU7A 2DT1A 1GUVA 1G1YA 2VVNA 5CQ1A 1TR1A 4PBGA 3RJXA 2XTKA 4AD3A 4JL1A 1SYTA 4M24A 1ISYA 4OJYA 4HU8A 2X8RA 1JFHA 2EBNA 4TVUA 3O6AA 5BXPA 3IJ8A 2DSKA 3WUBA 4ZXOA 2YDQA 4KRUA 1RD6A 2RGLA 4J3UA 1FH8A 6TAAA 4NF7A 2WSPA 4UNIA 2W5FA 3ARRA 1KXTA 4EKJA 1V0MA 4HOWA 1J9YA 1W9UA 3W27A 5FL1A 1BGGA 4F79A 1QNRA 1BG9A 2BVYA 2VMFA 4S3JA 1H5VA 2X0YA 3WFLA 4PRWA 3T08A 3SCRA 4OOUA 2YBUA 4CCDA 1NWSA 3B9EA 7A3HA 3WQ5A 2VZVA 5CXPA 4D72A 2CHNA 3WH5A 3VUPA 3M6DA 4F66A 2J79A 4AD4A 1TA3B 3VO0A 3VD3A 4AIEA 2PWEA 4X9YA 3VDBA 4MDPA 1J12A 3WN6A 1PZ2A 2ZE0A 4HZ7A 4UR9A 4GIAA 2E9LA 1I1XA 1CZ1A 2FDMA 2V38A 4MB3A 3AIQA 4PMXA 3GH5A 3OZPA 4IM4A 2J62A 4U3CA 2E9MA 3AXXA 4IPNB 2EPLX 3KE0A 3PHAA 4U5IA 3SCTA 1WZAA 1JAKA 2XGIA 5BYWA 4HOXA 3BSGA 4P7OA 1CGTA 4JFWA 2OSWA 3FY1A 3OGSA 1UKSA 1CENA 5GNYA 2XFRA 3BAXA 2CITA 4M1RA 3CZJA 1JZ2A 1XSKA 4W5UA 1TE1A 3NSMA 2ZIDA 3W28A 2FHFA 4W8BA 2G41A 4UQBA 1ZBKA 2V5DA 2IXVA 5CG0A 1TCMA 2CCRA 3SUUA 1VBUA 3WNMA 1VFUA 5D9MA 1EHAA 3WD2A 4GZEA 1H11A 3WNNA 1GVIA 2WZHA 4MB5A 4EE9A 1AQ0A 3CUFA 3OLGA 3J7HA 2W67A 3AHTA 2WC4A 1CIUA 2ZOXA 3AIBA 3VIKA 5M03A 1W9VA 4TX8A 1JXKA 4FLOA 2DSUA 3VNZA 1TMQA 2WWDA 3PZOA 1PEZA 4GXPA 4ACZB 2CBUA 4A4AA 1H0IA 2GSJA 4D6FA 4UOJA 4W8AA 4DWSD 1FA2A 3K1DA 4ZXLA 1W1YA 4JFUA 3BC9A 2VZTA 1W3HA 3QGVA 5E09A 2CERA 2YL6A 4JCLA 4UOQA 3D5HA 2YBTA 3VGBA 2J25A 3WNLA 2WVSA 3POHA 1PIGA 4CU7A 3ZSSA 2BHZA 5KZ6A 1LJYA 2YA2A 1NWUA 3RM8A 2D0HA 2OSYA 3WL1A 3G6MA 1V02E 4DM1A 2GVYA 1QPKA 3RPMA 1PPIA 3PZ9A 1BYDA 3OBAA 4CD8A 1NOWA 1E40A 3SURA 1YQ2A 1VFMA 1CXIA 1Q6DA 2D3NA 4NI3A 4DWSA 5HOSA 1CNVA 3AS2A 1XCWA 4AZCA 4L4PA 3T0BA 3SCQA 1W1TA 3RIKA 1MYRA 3WEMA 2OWXA 1WDSA 3WDPP 2VNCA 3CUJA 3ALFA 3QOKA 6CGTA 2C8NA 2GJPA 5HXMA 2WLYA 4QCEA 4BZYA 2J7CA 4S3KA 4GINA 4YN5A 3WUFA 3MANA 3VX0A 3II1A 3CPUA 2EJ1A 1VF8A 1R7OA 4P7NA 4QAWA 5GNZA 1VEPA 1K6AA 3CO4A 1H4PA 4KH2A 5FIPA 5C71A 1U2YA 2BFGA 3F4VA 4JHZA 1QNQA 5AC5A 5JIPA 2YA1A 3WDRA 3SCPA 3UR8A 5HPCA 2O92A 1K9DA 4Z2LA 4M56A 5A1AA 5LA1A 5E0CA 4KGLA 1UD4A 1E56A 3AYSA 1GONA 1H3GA 1E5NA 5BROA 4D6HA 4GZJA 3AQUA 1WP6A 1QBBA 4CCCA 1ZB5A 3OG2A 4JZ5A 1TFVA 5A2CA 5I3DA 2YDSA 2GK1A 3W38A 1OD0A 1U33A 1TG7A 3VPLA 4C7DA 1R7AA 1UOKA 5FD0A 4QLKA 4W89A 3CZEA 1XV8A 5DFAA 1ISWA 4W87A 2QPSA 4W86A 4PMNA 1BYBA 4F9DA 2PBOA 4CD4A 1JDAA 1C93A 3PZIA 3ALGA 1RH9A 3FHAA 2YL8A 2ZUSA 2WNWA 1DEDA 1QOXA 1NQ6A 4UZUA 4UFJA 1BTCA 1HJUA 1JZ4A 4PMDA 2E0PA 3B9DA 5E0FA 2BVTA 4MPKA 2DSWA 2CEQA 2G4FA 3CZGA 1E4IA 1CGWA 1WE5A 1J0JA 5JBDA 3WH6A 2F8QA 5FCZA 1M04A 2BY2A 4LPCA 1B3VA 4J3TA 3AIWA 4LX4A 2WBGA 1JI1A 2PC8A 3U7BA 1WO2A 4AZ5A 2VUYA 3BMWA 1B3ZA 3HMCA 4IISA 5E6YA 3AMLA 4HZ8A 5JIWA 2VX6A 2XVPA 1OB0A 2WSKA 5A2AA 1EDQA 1V6WA 4XZBA 1ISVA 2G3JA 1UWSA 1UWUA 2WKLA 2VZUA 2WBKA 1E6XM 4U33A 5CLWA 4QP0A 1HP4A 1ITXA 3AZTA 1QI5A 3DYMA 3UG4A 2E3ZA 2EPNA 1EIBA 4AEEA 4BQ5A 5E6ZA 5A8MA 4DM2A 1J0KA 1V3IA 4P7RA 2DPEA 3PZUA 4UCFA 1ODZA 3NUKA 4JFVA 1DTUA 1UR0A 2BVDA 3MUZ1 3HJEA 1US2A 5IFTA 5BXRA 4ZEPA 4WKAA 2XSBA 1F4AA 1UH3A 1H09A 2CKSA 3VKKA 4P7QA 3ARTA 1ZL1A 4FF5A 5A6BD 8A3HA 2EEXA 2XVGA 1D3CA 2VRJA 5D9OA 1JF5A 1BAGA 1ZS2A 2VTFA 5LA2A 2OYMA 1QNSA 2XWEA 4HP5A 2WW5A 3HN3A 1GOOA 4GPNA 4AISA 1CBGA 3GBEA 4H2CA 1HJVA 4J27A 1MW0A 2Y24A 4TTGA 1TZ7A 2J75A 3AMGA 3BLPX 4GO8A 3ZIZA 5I79A 3GTNA 1V6XA 1AVAA 1Q6GA 4PCTA 1PZ3A 1QHPA 5DT7A 1WDPA 3ARWA 5IHRA 1J11A 1EO5A 1KGXA 4KRTA 4PCSA 4W93A 4AWEA 4QCFA 1N82A 2YIHA 3CHFA 2QLYA 1WKYA 3AIVA 3SUSA 5A6BA 3PTKA 1E5JA 1GOKA 1MXGA 5A6SA 3AYRA 3ZJ6A 2DSZA 2WCAA 2XFYA 5HNNA 3BGAA 1J0YA 2BY1A 1V08A 2XM2A 2WMHA 4D71A 1GW1A 3OLDA 4ZFMA 1GCYA 3NDYA 3GXDA 4H8VA 1OD8A 2J7BA 2ZX9A 2Q8XA 4H41A 5CGTA 3ZJ7A 4Z2GA 3ARUA 1TUXA 1GOWA 5CPQA 2D24A 1E0XA 3WQ8A 1F4HA 3VIFA 2D0FA 4FLSA 2JF6A 1ECEA 2WYSA 3VMPA 2QMJA 3MUAA 1EOMA 1W9DM 5FKYA 3WF2A 4B15A 3AMKA 5BWFA 3VDCA 5GNXA 5HBFA 3WQ4A 4BQ4A 3UG5A 4OIFA 2YL9A 4RE2A 3PN8A 2VCCA 4XB3A 3BAJA 1JIBA 2WLZA 1LWJA 1Y7VA 1H1NA 2JE8A 4JKLA 3AMDA 3ZT7A 2W63A 3VIMA 1V0KA 4M80A 3BXWA 3VINA 1ZU8A 3LPOA 1B3YA 1FP8A 1HF6A 3UG3A 1E0VA 3SCWA 2NT0A 1EXPA 4U31A 2GJXA 1E55A 4OBSA 4M82A 1GOQA 2X2YA 3ARPA 3AIUA 1UH4A 3N17A 4DWSB 3WD3A 3G6LA 4AZCB 1IZKA 3ARSA 2A3CA 4AZIA 1QI0A 4V2XA 4D6CA 3RCNA 1BYCA 3IAPA 2YKKA 2EQDA 1KR0A 1LF1A 4PMQA 4YPJA 3APGA 3S2CA 4GKLA 3WENA 1UQZA 3SUVA 4AXNA 2D20A 3UESA 3VIOA 4RE3A 2W4XA 4E4PA 5IFPA 1XH1A 1V6YA 3W6LA 3WF1A 1UD2A 4D1JA 3VX1A 1JYWA 5FOOA 1NARA 3L4WA 4AD1A 2V3FA 1W9BM 1S46A 1HVQA 4J28A 4J7RA 4PMZA 2ZUWA 4FLQA 3QR3A 1WDRA 4PMVA 3FXYA 4X0NA 3AXHA 1E4NA 5AY7A 2EO7A 1UD5A 2O9OA 5CPTA 1JG9A 1JNEA 4WF7A 1EQCA 4FLRA 1GJWA 1WDQA 1I1WA 1UR2A 5I24A 1C91A 4M29A 2GK1B 3ZJ8A 3PZVA 2AAAA 3W29A 2W61A 3CHCA 2XM1A 1SMAA 3F5LA 4MDOA 5CLTA 3ECQA 3UCQA 3WD0A 4MAZA 5EFDA 3RM9A 2PWFA 1Q6CA 4EAMA 4A3YA 3VVGA 3DYOA 4DUVA 3VIPA 4AZ7A 2J77A 5EMYA 2EXOA 2VQUA 4QLLA 2D22A 2E8ZA 2D3LA 2WK2A 4PUEA 4W84A 4QFUA 3L4XA 3CUGA 2J8FA 3NJ3A 2CBIA 1J0ZA 5I77A 1DWHM 2GFTA 2V5CA 4AD0A 4PUDA 1JYVA 2DH2A 1TVPA 1E4MM 1UUQA 2OWWA 4GI6A 3VM7A 1KXVA 4B16A 2D1ZA 1G0CA 1SR0A 4P8VA 4ML4A 1UWIA 3S6TA 1E43A 1AQHA 2O9TA 4OBRA 1BGAA 3WMCA 2WAGA 1LQ0A 1ZJAA 3JUGA 1V02A 2WMIA 4OUEA 3VMNA 3WH8A 3BH4A 2CETA 1HIZA 3M7SA 4MNMA 2VCBA 3THDA 1FP9A 5E70A 4X0VA 4U2ZA 3LPPA 1LL4A 1QVBA 3A6OA 5CSUA 1BVZA 1XSIA 2WVVA 4UFHA 1NM9A 3KL0A 1GQIA 2WCGA 1ESWA 3W82A 3AZRA 3N1AA 1UD3A 3WQVA 1Q4NX 2O9PA 2WMKA 1IT0A 2CIPA 3KEHA 6A3HA 3WIJA 1V3JA 2G3MA 5LYRA 3TA9A 2Y4SA 3T0AA 1VEOA 1JL8A 3EDDA 4U5KA 2NW0A 3BCDA 1PX8A 1UKPA 2Y8KA 3AMCA 4BS0A 5AYBA 1WZKA 3CZKA 5D4YA 3WDIA 1XGZA 2YJQA 3VD9A 3GZAA 3U5UA 2CPUA 1OIMA 1XH2A 5A8QA 3BAKA 4TUFA 3K8MA 4JKKA 5JUVA 1C7TA 1EO7A 5C70A 4QLJA 1PX4A 1H49A 4AEFA 3A4XA 3VIGA 1KCKA 4V28A 1JZ5A 4HTYA 1DWGM 2W92A 2UY4A 2B31A 4U2YA 1ISZA 1AMYA 1OGBA 3ZMRA 1HJXA 3W53A 4CU8A 4Z2KA 1CLVA 3L4TA 3N9KA 4GQRA 1CYGA 1UKQA 4V27A 1NP2A 4GO9A 4WKHA 4XZWA 3TTSA 1LLOA 1GHRA 4K68A 4JIEA 1LG2A 3BMVA 4MTVA 1E71M 1HL9A 3PZTA 1B9ZA 2A3EA 4AZGA 1BLIA 1CXFA 2WMJA 1NP0A 2D0GA 3MO4A 3IJ9A 3WSUA 1KWGA 4HA3A 4WSKA 1XCXA 2WVUA 4TX6A 1OM0A 3QHOA 2RGMA 2QF8A 3CZ8A 1UD6A 2FHCA 2WHMA 3WKZA 2E4TA 4AD2A 3T09A 5ECUA 4W7VA 1C90A 3ZR6A 3AS3A 2O9RA 4TVDA 3L4VA 1Z32X 4CN1A 1KXQA 2WWCA 1E6PA 2FH6A 1HXJA 5HPOA 2PWDA 3CMJA 3WF4A 4HPGA 1XH0A 3DECA 2DQXA 4D6IA 3IK2A 4BA0A 3GH7A 1V3MA 1V3LA 4KWUA 5IXEA 1E1FA 2EPKX 3UERA 2ZICA 4LGXA 3W24A 4J3XA 4BCEA 2TAAA 2ZUUA 5IDIA 3MS8A 3VMOA 3SCNA 1BHGA 2Z1SA 1M7XA 1ZBVA 3PTMA 1BVNP 2D23A 2ZX6A 3W37A 1ODUA 1W3LA 3IANA 5D9PA 2HISA 1CTNA 4W85A 4D6DA 2W91A 4M81A 1WZLA 4AY1A 4AMCA 5D9NA 3BAYA 1K9TA 1UG6A 2WZEA 4IUGA 3E1F1 1J01A 1QI2A 1W1PA 7TAAA 3THCA 4L4OA 3WY1A 1B3XA 1Q6FA 3FN9A 2VOTA 4NRRA 3IAQA 1VFFA 1CXEA 2GJXB 3PZNA 1B31A 1C8YA 2VZSA 5FL0A 2J47A 1MVYA 4ATWA 2J8GA 3FW6A 4CU6A 3K4AA 4UQCA 4DUXA 3RO8A 3A47A 2JALA 5A3HA 1EA9C 5C8BB 3BAIA 1VFOA 1XRVA 1GQJA 1FFQA 2NT1A 2DSVA 3VD5A 2PBGA 5I2UA 4MB1A 3SUTA 3CUIA 4YHEA 4UTFA 1K9EA 2IUZA 4TTUA 2Y2WA 2BXZA 1AQMA 1JFXA 1E6NA 3GBDA 2BY0A 4UFLA 1UKTA 4LYQA 3GNPA 1FHDA 4B9ZA 1MQQA 1V3KA 4P7LA 4XX6A 3SCVA 2HVMA 4UFMA 2XUCA 1SFSA 2QHAA 1E3ZA 4W5ZA 4BQ3A 1EGZA 2ZXQA 2WM0A 3EDKA 4H04A 5JBEA 1MFVA 1IV8A 3BCFA 1QW9A 5BCAA 1KGUA 3AHYA 3UETA 3TTOA 1VEMA 2CBJA 4Z2IA 1GOMA 4LYPA 2WXDM 3OLEA 3SCUA 3WMBA 1V03A 1VAHA 3GYCA 2XVNA 4W88A 1KFWA 1L8NA 4CN4A 3MU7A 4B9YA 4GI9A 2PB1A 3NCOA 5ABHA 4PTMA 2JF7A 2VX4A 3FAXA 4CN6A 2J74A 5IHSA 3DC0A 1VBRA 1KBKA 5A2BA 3LPFA 4Q22A 3VGEA 1QHZA 1H2JA 2JIEA 3VIJA 2OSXA 4PSPA 2CYGA 3MV11 4AC1X 3DHUA 2CNCA 1E4LA 4B3KA 1CXLA 1V6UA 1OT2A 3N04A 4H7VA 3ZQ9A 4BQ2A 1MQPA 4UFIA 2ZX5A 4Q7NA 4MNJA 4CVUA 2XIBA 2BHUA 1M01A 4MJ2A 1Q6EA 2YL5A 4HMDA 1CXHA 4NZCA 4LQ1A 4HU0A 1UR9A 1UKOA 2JIWA 2QV4A 4URIA 3A3HA 4EK7A 1B3WA 1FHLA 1DWJM 3DHPA 1YHTA 1GVYA 2VZOA 2XSAA 1W2VA 1E6QM 3GH4A 2VCAA 3CHDA 4XUYA 3QOMA 1HL8A 2WHJA 4WKFA 1OIFA 3N12A 2WMIB 2XFFA 1EOKA 3AJ7A 5ABEA 4WLCA 4CGTA 2PF0A 3A4WA 1BPLB 4QDMA 1LL7A 1UWRA 3MMWA 2G3NA 2WMGA 1CGXA 2J4GA 2XVKA 5A8OA 1G9HA 2WVVB 3CUHA 2WC3A 4PEEA 1B30A 1WCGA 1BF2A 3KL3A 3WUEA 3K4DA 3OGRA 1ITCA 4JAWA 2UY3A 4P8UA 1JD9A 8CGTA 4UQAA 1BQCA 1FOBA 3A4AA 4WIWA 3CTTA 2X1IA 3POCA 4H8UA 1WAWA 3EDEA 4AZBA 3WBEA 3VIHA 4JKMA 3AHXA 4WSJA 3EDJA 1SMDA 1O6IA 1DHKA 3AFBA 3TP4A 3N18A 1J10A 3ARYA 2G3IA 3GXMA 1OINA 1W2PA 2DT2A 4OZOA 3KZSA 2GUYA 3O9NA 3BLKA 1B0IA 3EMCA 1E9LA 1DP0A 1V6VA 2XIIA 3SUWA 3ARVA 1UHVA 3VD7A 1V3HA 1XYFA 2QPUA 5EB8A 3SIMA 2XJ7A 1JI2A 2PI6A 1OSEA 2DEPA 3PBGA 5CSYA 2DDXA 4FK9A 5I0DA 3T2PA 3U57A 1CWYA 1J0IA 3CIVA 3IJ7A 5CPSA 1KB3A 3L4UA 4JL2A 3EBVA 3WDJA 4UOZA 5DO8A 1BYAA 3CBWA 1UQYA 2A3AA 3F5KA 4AYSA 4RL3A 3ZJKA 4E8DA 2DT0A 5BXTA 2AOSA 1QI3A 4YHGA 5A95A 3PTQA 1X6LA 3GNRA 1I75A 2ZWYA 3NDZA 4HA1A 1ZJBA 3WD1A 2BS9A 4JFSA 1OT1A 4BF7A 1TVNA 5GPRA 1B90A 4ATDA 2DGAA 1E73M 1VB9A 2CESA 5BXSA 1UH2A 3GXIA 1QNPA 3AZSA 1ZBWA 5AC4A 3B8SA 2D2OA 4ZENA 2VQTA 1GJUA 5M5DA 1W32A 2BXYA 3VTRA 2WHKA 3AICA 1H41A 1JZ3A 4N0RA 4P8WA 3AROA 4OOZA 4W8LA 3ARZA 4A3HA 1R8LA 3RILA 3WEZA 1KQZA 2YLLA 3MV01 5I23A 4J3WA 2EPOA 2XPKA 2YOCA 3VGDA 3AIRA 1OBAA 4ZE4A 1C8XA 3ZO9A 2V3DA 1XC6A 2UWFA 3RDKA 1PJ9A 1UWTA 3UEQA 3AOFA 2J7EA 4NRSA 2WHLA 3L2LA 1EDTA 1G5AA 3CH9A 1U30A 3EYPA 2C0HA 3OGVA 4CUCA 1D7FA 4ZE5A 5EFFA 2XG9A 3TOPA 1KXHA 5DMYA 4UFKA 1JYNA 2VL4A 1QBAA 1E6SM 3AISA 3NSXA 3AIEA 1KBBA 4UZSA 2VO5A 2E40A 2A3BA 2V3EA 1CGUA 2ZUTA 1A47A 1E72M 2WMFA 2GJRA 1HJWA 4RE4A 2VR4A 1BG4A 1W9PA 1L0PA 4PTXA 4HMCA 4D6JA 4PN2A 2WVTA 5LA0A 4OKDA 3T2OA 4AW7A 4TXEA 3PZMA 1R86A 5D8ZA 3LMYA 3ZR5A 2VX5A 3FAWA 3O2LA 3WQWA 2BNJA 1OGSA 1GPFA 4HA4A 5ABFA 2V3GA 2F2HA 3WDHA 2IXUA 2WC7A 3BAWA 3EMZA 5GQBA 1K9FA 3UR7A 2F61A 3MSGA 1NWTA 4LYRA 4AIOA 4DWSC 2Y5EA 3L2MA 9CGTA 3NYDA 1VIWA 1CGVA 3I3DA 3VGFA 3N15A 2VT0A 1E1EA 5F7UA 1HKIA 1OCQA 1EHNA 2ZUMA 2E9BA 1QI4A 3WEOA 2VJXA 5A8PA 1HKKA 5A6LA 5DEZA 1OGGA 1HJQA 1XYZA 2PWHA 2QMKA 1GZJA 3GDBA 5I78A 3W26A 2FHBA 4LXFA 2CKRA 1E0WA 4N42A 3FHQA 1A3HA 1V0NA 1B2YA 1JZ7A 4Y7EA 4CCEA 1R85A 4GZIA 2UY2A 2CHOA 1CPUA 2ZXBA 3MMDA 2MANA 1GOIA 3WNKA 1X1NA 3ARXA 3GM8A 4C7GA 1DWIM 4JHOA 1J18A 2A3HA 4F9JA 1G94A 1MW2A 1E6ZA 2BY3A 5KEZA 3CGTA 4UQ9A 3NIYA 1KQYA 3WQ6A 3AS0A 3VD4A 1PAMA 3W4RA 1FFRA 1JZ8A 1LG1A 4JFTA 1MW1A 4Z2JA 3GXFA 2ZX7A 1QHOA 1XSJA 3WF3A 2J7GA 3WMSA 1KR1A 1HNYA 1D2KA 2WPGA 5ABGA 3D3AA 2J7FA 3EDFA 4D1IA 5A6KA 2VC9A 2ZXDA 3K8LA 4HMEA 4C7FA 4MB4A 5HDRA 2G8ZA 1NWRA 3BSHA 2GDUA 4P8XA 4TVCA 2YDRA 3MUY1 3AI0A 1W91A 3DYPA 3ZOAA 2FGZA 3N13A 4PTVA 2VRQA 1HX0A 4IPLA 1V0LA 4UQEA 3WH7A 4U3AA 2E8YA 3AHZA 2Z1KA 4MJ4A 4HOZA 5I5RA 3ZM8A 4WK9A 3ZSTA 3PZGA 2W66A 7CGTA 5EBAA 2BV9A 3U5YA 2YLAA 2BHYA 2XGBA 3B9AA 1KCLA 5JBFA 4WJXA 1BFNA 2DH3A 1TA3A 5CGMA 1JZ6A 4MNLA 3WF0A 3F5JA 3KWXA 1GQLA 1JDDA 1RPKA 3PZQA 3VIIA 3WNPA 2JFEX 1B1YA 3AS1A 4E8CA 2W62A 1MFUA 1HKJA 4GI8A 2XHYA 5A6AA 4PMYA 1FH7A 1NH6A 2DIJA 3TONA 1UR4A 1ISXA 4JCMA 1RP8A 1C3FA 4MADA 5E9AA 2CXGA 3OB8A 2VX7A 1JAEA 2UY5A 4ATLA 3VGGA 1W3JA 4FMVA 3WNOA 1MWOA 5BRQA 1JD7A 3VU2A 1EQPA 3TTQA 3MSDA 4PMUA 2ZUVA 1IZJA 3L4ZA 4Z2HA 4W7WA 4CD6A 2J7HA 5DT5A 3CZLA 1XHGA 3WELA 4EANA 4DUWA 2NSXA 2J7DA 3I3BA 4PTWA 5M17A 4J3VA
chains in the Genus database with same CATH superfamily
3CS2A 4FALA 2QDHA 1PX3A 1OK6A 3DFYA 3WH9A 4NY2A 2QUNA 3K46A 1JUKA 6REQA 5CBJA 5AB3A 3CHEA 1DWFM 1CECA 1EDGA 1UA7A 5CKSA 1KV8A 3GUGA 3TTYA 1XC4A 4ACZA 4IJCA 3B9OA 4OQVA 4CCZA 2CLOA 1JGIA 2A7RA 3ARQA 3RJYA 1GVFA 1MRQA 2VR5A 1IF2A 1DORA 3KDNA 3OIHA 1JXJA 1CB7B 3OVRA 1V4YA 2XIMA 3LCWA 4NX0A 7REQB 1SO5A 3W81A 2PA6A 1JUBA 4MG4A 2ICSA 3ZZ1A 4NKCA 4WDTA 1OG6A 3W7LA 1TWSA 1IT8A 1F6KA 1XFBA 3WJYA 2E6YA 2NXHA 4Z1CA 3VOCA 1O7AA 1JCTA 1LL6A 3T78A 3IJQA 3E0IA 3OEXA 4IJRA 2WKGA 4LSBA 2ACQA 4AZHA 3RYSA 1PKLA 3FGCB 1FCVA 3ZLHA 3CMGA 5DBTA 4IQLA 4O14A 5CJ5A 1WNOA 1NFGA 2NQHA 1SZGA 3WK1A 1QW8A 1HVXA 1KGWA 2P0IA 1RBLA 4GIYA 4PYSA 2QW5A 1LBLA 1Z6KA 3G1YA 2FGLA 5IOBA 1R6WA 2QIIA 3VDAA 4DO5A 4ILSA 3GNOA 3WUGA 1UR8A 3QYQA 1L6GA 4XTDA 3C4UA 5F2GA 4KF1A 3B03A 5EBUA 4JPGA 1QO2A 2HDJA 1HO4A 1CDGA 3RMEA 1PIFA 2OZ8A 1Q6OA 3V1HA 1UYQA 3NZPA 1EH9A 1JDCA 2HE8A 5KETA 3D6NA 1W9XA 3IV8A 1A0DA 3WG6A 3LI1A 1J96A 4H1ZA 1S2VA 3S1WA 2WZIA 1WPCA 4Z08A 1DHPA 3OLIA 3WQPA 2OYKA 3V3WA 3WQCA 4TOQA 4UQDA 3U48A 4MJZA 2A6NA 1QO5A 2YYUA 4C6DA 4DYEA 2ODOA 4JGDA 3OHMB 3G77A 3LB0A 1UP2A 2ZXAA 4NXKA 1KRAC 5K3VA 3T0TA 1LUCA 2DIEA 2X09A 4O4WA 3W1NA 4GH3A 1FH9A 3KFTA 4CD7A 1UJQA 1YYAA 1R9ZA 1JQXA 4AZ6A 3WJXA 4IG2B 4MJMA 1XIGA 3VKJA 1VYPX 4FP1A 1RP9A 4ERAA 1MW3A 4EPKA 3I3EA 3VC6A 3FNDA 3N9SA 3M0MA 1S5VA 2DT1A 1EF3A 1A3WA 1GUVA 3SQLA 1G1YA 4IUOA 5AYZA 1I9CB 3UY7A 1JFHA 4YTUA 1O1ZA 3TVAA 4WY0B 3F4CA 4TVUA 3L0NA 5J04A 3IJ8A 4N6FA 3KRZA 4HHHA 3TEVA 4KRUA 1RD6A 2RGLA 3TR2A 4I5UA 3VKDA 4PA8A 4NF7A 3W2JA 2ON3A 2W5FA 3ARRA 1KXTA 2FTPA 4EKJA 1V0MA 4GBDA 4HOWA 3DKLA 3UF9A 3W27A 5FL1A 1BGGA 3TX9A 3L67A 4MY9A 3VKBA 2VHLA 3T08A 2YXGA 2HZGA 4CCDA 2ZYFA 4V1XA 1TIWA 4KW2A 5EY5A 2PLKA 3M6DA 3V0UA 3LN3A 4AD4A 2J27A 2ALDA 2HVNA 4Q4RA 4LOCA 3VO0A 3CIXA 4HSHA 3GZ3A 4MDPA 3WN6A 1K3UA 1IEXA 3QMRA 4C6EA 1I1XA 2DZVA 2FDMA 4EPEC 3AIQA 3N6QA 3JRKA 4PMXA 4GFIA 5L9FA 4IPNB 1JAKA 5JH2A 3GSMA 4A05A 4JQ4A 4ADSA 2FZBA 4OT7A 4P7OA 5I7GA 1CGTA 3GIQA 1DIEA 1RJQA 1BXNA 1UKSA 5HNUA 2QIWA 3BAXA 3CZJA 5CGQA 3MC5A 4AY8A 1JZ2A 4RCXA 4E8GA 3W87A 3QGAC 1TQXA 2YFOA 4W8BA 3NVDA 4R7WA 1RUSA 3U0HA 3RR1A 1ZBKA 2V5DA 4DJDA 3BARA 5CG0A 1AZ1A 3SUUA 2RJGA 3WNMA 1JRBA 2WQPA 4HCLA 4LBRA 3GTHA 5BZAA 4EE9A 3CUFA 4LAUA 3J7HA 2CLMA 3AHTA 2PLMA 5GJNA 5AC6A 4MZ1A 1CIUA 5LNWA 3GFXA 4MWAC 2ZOXA 2BASA 5M03A 1W9VA 2VGIA 2DSUA 4GXPA 2PDLA 2ONEA 3Q58A 2X7VA 4W8AA 8XIMA 1W1YA 3N34A 2VD9A 3BC9A 3FS2A 3OQEA 5C2CA 1IWAA 1FTXA 2P76A 2YL6A 4NU7A 3D5HA 1U1JA 3VGBA 3WNLA 2V81A 3POHA 1R3YA 3SGUA 1PIGA 2CU0A 2C1HA 1NWUA 3RM8A 2D0HA 3EOEA 3IIZA 1TV3A 1JGMA 4LAOA 1V02E 4DM1A 3VC5A 2ZE3A 1L2QA 3W6YA 2ZZ6A 3IIPA 3BURA 1P7TB 1NOWA 1DIOA 3QY6A 4ZQMA 2D3NA 3SR7A 3GDRA 1XCWA 1VGAA 3S5SA 1SFLA 3RIKA 1OG0A 2XZ9A 3SGZA 2VNCA 4IF2A 4Z1AA 2XH2A 5EMJA 5EGRA 3AO0A 3CYJA 1BWVA 4X63A 2V2DA 3W74A 1OZQA 2CLPA 2J7CA 4HTBA 1EP1A 2Z0IA 3MANA 3KM8A 1TMLA 3BLDA 3CPUA 2YZRA 4B4HA 3LG3A 4OE7A 3N3MA 1G4TA 1RQHA 5GNZA 3CO4A 1H4PA 4KH2A 3WCZA 1PB0A 1FWBC 4QJ1A 5JIPA 3OQ8A 4AF0A 2EKGA 2PDKA 1K9DA 2QCDB 4M56A 4JQ2A 3PPFA 4PFMA 5A1AA 1RAKA 3UYIA 2IPWA 1UBSA 2QR6A 2NX9A 4DJFA 2W9MA 3QPYA 4WR3A 2AGKA 3AQUA 1SW7A 3ZFHA 3OG2A 5AOUA 2ZA1A 1U33A 1TG7A 4A3UA 1LRNA 1R7AA 3LGDA 4I6KA 5DCEA 3BG9A 3CZEA 3M0YA 1G4EA 5DFAA 3ZXWA 3RPDA 4NNBA 1ISWA 2V82A 2J6VA 4W86A 4F9DA 5EMKA 3PZIA 3ALGA 1HG3A 3FOKA 1IZCA 4UFJA 1BTCA 2E0PA 1XCFA 2VDGA 2CEQA 3CZGA 4NXSA 4JTQA 5JBDA 2ZRYA 4FX6M 3WH6A 3PTDA 4LPCA 4H01A 3CUXA 1TYGA 3AIWA 3MDUA 2YCKX 3ES8A 3EX3A 2PC8A 3U7BA 2BDQA 4AZ5A 1B3ZA 1LDCA 1TPH1 4O17A 3T44A 1OYBA 3G8EA 4B5NA 4E0CA 1EDQA 4CNNA 4XZBA 2TSYA 2G3JA 1UWSA 4HSOA 3L5MA 3A13A 3CJPA 1ITXA 4M5PA 1NF7A 2DZWA 2EPNA 4BQ5A 1TWIA 3BW2A 3DFTA 3UNTA 5A8MA 1J0KA 1V3IA 5REQB 3E0WA 3APYA 4MVAA 4XKYB 4A2RA 4H7CA 4JFVA 4BF5A 1EBHA 5BXRA 1AJZA 2ZZ3A 4DNMA 1UH3A 3UW6A 1H09A 4R9XA 3ABRA 4L1XA 2CKSA 4QEHA 3UXIA 4INFA 1XF0A 3ARTA 1GVEA 4FF5A 4XAGA 4GCXA 2EEXA 1M1BA 3B8TA 3TJXA 1JF5A 4X9SA 2VTFA 4M7TA 1LORA 4UC5A 5D02A 1AL8A 1QNSA 2GQ8A 2P3EA 2A21A 4HP5A 3BLEA 3FKKA 2WW5A 4GPNA 1HJVA 3PK7A 4O15A 4TTGA 5FA5A 1TZ7A 1VFLA 5DANA 3UU0A 2RUSA 1PKYA 1VP5A 3EGJA 4JTEA 1Q6GA 1G4SA 1FWFC 1KGXA 3W1MA 2CWXA 1N82A 3THUA 2Z1WA 5A6BA 1XLEA 1MXGA 3S4TA 3GUWA 2BGQA 2DSZA 3VK5A 3BGAA 1PKMA 3IUHA 4M19A 1Q65A 1VQTA 3HPAA 3NDYA 4EF8A 3MO7A 4ZQCA 1OD8A 5HR7A 3MUCA 2Q8XA 2OGYA 3SN1A 3ZJ7A 3TQ0A 1M7JA 3WLKX 4M7SA 4AHQA 1GOWA 3WQ8A 1F4HA 3BUVA 3DX5A 2JF6A 4TMCA 1UCWA 4QISA 2GGGA 1W9DM 3WF2A 4LS0A 5BWFA 5XIAA 5HBFA 3WQ4A 1Q8AA 3UG5A 3PFMA 1JIBA 2WLZA 1LWJA 3G1HA 2Z2UA 2JE8A 4JKLA 4POCA 1KBLA 1EP2A 3ZT7A 2W63A 3TFXA 1QFEA 1V0KA 3KTSA 1UP3A 3ITCA 3BXWA 4RPPA 1ZAJA 2DY3A 1SM9A 1JPIA 3R43A 2A4AA 3ARPA 4QRNA 3WD3A 5GJMA 4C6LA 3TR9A 3DI1A 3ARSA 2DVTA 4O54A 4I5RA 3IAPA 3H21A 2PWUA 1KR0A 4RPQA 4YPJA 1UQZA 2AQOA 3E0FA 3SRFA 3LBMA 4RE3A 3KOFA 4J40A 3MA8A 3SSJA 5G4WA 1XH1A 3W6LA 3WF1A 4D1JA 4RDYA 2DU2A 3UWVA 5JXQA 2FZ8A 4QNWA 5DY2A 3MJYA 3WLHA 4AD1A 2OELA 1W9BM 1S46A 1FWSA 4FLQA 2GJNA 2DVXA 3H53A 1F73A 3SRDA 1WDRA 1SZNA 4ZO6A 4X0NA 1BQGA 1REQB 1XFCA 3N6HA 3TMLA 3S6DA 3C56A 3GTIA 2EO7A 1PO9A 1E0TA 4KT2A 5AHLA 4WF7A 4MOZA 4FIQA 1GJWA 3W70A 3R11A 1C91A 4N02A 2HK1A 3NURA 3CYVA 3W88A 3KBNA 3HQOA 3ECQA 3W9ZA 3WD0A 4MAZA 3PF3A 3RM9A 2PWFA 3RCYA 1AFSA 3VVGA 2PD9A 4IQJA 4J2MA 2GSHA 1F6PA 2INFA 3C2OA 5MKGB 3QM3A 3L4XA 1QCWA 2J8FA 5I77A 1DWHM 2V5CA 1E9IA 5HA7A 1KFBA 4MLRA 1GG0A 3O6YX 4BKNA 5AZ1A 3BMXA 3KLKA 4NVTA 3TW9A 1U5VA 5CZ0A 5KMYA 2I56A 3NOEA 3IUDA 3U2OA 4ML4A 1K7EA 1UWIA 1DOSA 4OBRA 3NNTA 1VYSX 4YS1A 1F5ZA 2DJXA 3JUGA 3T81A 5K7JA 3QR0A 3VYLA 4DUOA 3M7SA 2VCBA 5F4XA 1P0KA 3QC3A 1JULA 4EIVA 1ENUA 2WVVA 3CEPA 4FZIA 3V0SA 4UFHA 1CLKA 3CPRA 1EJXC 3UZWA 1NM9A 3PWGA 1ESWA 3N1AA 1UD3A 3FEQA 3W7OA 1RLDA 3WQVA 1Q4NX 2O9PA 3AYVA 2WMKA 4UXDA 2CIPA 1Q7QA 3VKAA 2Y7FA 5FF0A 4LUSB 1L6YA 1TWDA 2Y4SA 4OV9A 3HIJA 1IGSA 5DX7A 1IXNA 4GY7A 4HU3A 3EDDA 1OYCA 4U5KA 1T6MA 4QG6A 1PX8A 4NYUA 4UCGA 1RA5A 5FF3A 2R14A 1P0NA 1JCYA 5C7VA 3RU6A 2XZ7A 5A8QA 4JKKA 3ITVA 4Y9MA 4AWSA 3UWZA 5C70A 1PX4A 1H49A 2HPIA 4AEFA 2V63A 4N9BA 1KCKA 1U1HA 1JZ5A 2FVLA 1XBYA 2ZC1A 4GYFA 3E74A 2NV1A 2UY4A 4JQ1A 1AMYA 1V51A 3NQFA 1CLVA 3IWPA 4JIPA 3I4KA 3P6LA 4ROQA 1HGWA 4GQRA 1DL3A 1NP2A 1S5MA 2DIKA 4J35A 3BMVA 1E71M 1HL9A 3R89A 3IEBA 2ISWA 4I6VA 1M7PA 4AZGA 3BLOA 1NP0A 2D0GA 2C19A 2PCQA 4C6MA 1IYXA 3HG5A 3IJ9A 4G7FA 5F2MA 1XCXA 4TX6A 1OM0A 4LC6A 2Z2BA 2DUXA 2YB4A 5I09A 3CZ8A 3DZ1A 2WHMA 2E4TA 1C90A 3NQMA 1V7YA 4MZYA 4CN1A 4IP7A 2WKJA 1DXEA 1F6YA 4GC4A 3RPTA 2E5CA 5HQLA 4PL2A 1HQTA 5D2VA 2VFIA 4BA0A 2J6XA 4REQA 1SFTA 2VFEA 4C1KA 4YWIA 4KWUA 4DN1A 2BXVA 2EPKX 1FHUA 3P60A 3HPFA 3UERA 4ALDA 3W24A 4US5D 3PJTA 2VFDA 1XLDA 5IDIA 4CNSA 3VMOA 3KVKA 2JGQA 2Z1SA 4WJ8A 3GQYA 3MY9A 1YDNA 1IXQA 1ODUA 1W3LA 2RDTA 3IANA 4H9ZA 3UJFA 4JYFA 4M81A 1WZLA 5D9NA 3UXKA 1UG6A 3EPMA 2ZKMX 2TYSA 4CNUA 3A4JA 3CQIA 2J24A 3TAOA 5M1TA 3WY1A 3UXDA 4QE5A 1XUZA 2VOTA 4NRRA 3STEA 2L5HA 2NUWA 2J47A 5F2LA 1MVYA 3SZ8A 1V8EA 2J8GA 3LCIA 4UQCA 5A3HA 1RY8A 1T96A 3BLFA 3IGXA 3MKCA 4M51A 4MIMA 1UR3M 1Z89A 2IQTA 4YHEA 1FBAA 3G1XA 1BF6A 4C6BA 2WM1A 3GBDA 2BY0A 1XG3A 2Z2AA 3IRDA 3PANA 4P7LA 4LVFA 1VPXA 2XUCA 1E3ZA 4ENLA 4KQNA 3A22A 3GVGA 1EGZA 5AHIA 3EDKA 4KWVA 1ZALA 1H5YA 4H04A 5DELA 1WAUA 3T8LA 2QPXA 1EC7A 4H6QA 4OVXA 3SSZA 4EPDC 1XYCA 2VGGA 3S1VA 3TTOA 2OEMA 1XIBA 3H4WA 4LVBA 2WXDM 1V03A 2FJUB 1EYEA 1L8NA 4CN4A 3IGSA 2PB1A 1HTIA 2YPIA 4GHRA 4Y8FA 3RK8A 3NCOA 4F0SA 4PTMA 3NR0A 2JF7A 3MYPA 2IPJA 4C6PA 1KBJA 3FAXA 3OTRA 1WXJA 3TKFA 2JIEA 2VEMA 1JPMA 1E4LA 1T0OA 4B3KA 1R46A 1V6UA 4O8AA 2EKCA 6TIMA 5J5RA 1MQPA 1GOXA 4ZQPA 2ZX5A 3DFOA 4CVUA 7ENLA 3C3NA 3LHTA 1KLZA 4MJ2A 1Q6EA 3CM4A 1QAPA 3GG0A 1XIFA 4RZ6A 4CEUC 2JIWA 1A5UA 2AL1A 1L9WA 2HNEA 4HK7A 3QLLA 2P0OA 1YHTA 4KFNA 1VBGA 4R53A 1E6QM 1YLVA 2O7SA 2VCAA 3CHDA 1BTMA 2REQA 3QOMA 4XBJA 1ME9A 2WHJA 2WMIB 5ABEA 1XS2A 2PF0A 5EU9A 3QPEA 1T8QA 1UWRA 2G3NA 2OFJA 1THFD 2ZDSA 3CUHA 2WC3A 1WCGA 3PSWA 1V6TA 1EB3A 1ITCA 3YPIA 4LW7A 2UY3A 4P8UA 1JD9A 4UQAA 3RCMA 1BQCA 4WIWA 3THQA 4C60A 3CL6A 2X1IA 2PC4A 3POCA 4TV5A 3UP8A 4HU4A 1R3SA 1VLIA 4KCVA 2QJNA 1WAWA 3EDEA 2FQIA 5DXYA 4B2DD 4JKMA 2WV8A 3AHXA 4WSJA 2GGIA 3AFBA 5CH9A 3N18A 4XZ9A 4M0XA 2G3IA 1W2PA 3F4WA 1YPXA 1EJ7L 3B0VC 4PL1A 2GUYA 4P2VA 3W1PA 3BLKA 1KCXA 1B0IA 3EMCA 2VGFA 1E1CA 4Q4QA 2P8BA 1TRDA 1LM1A 2VFGA 3ENLA 4D8LA 2XIIA 2DZSA 3L7RA 3P14A 3VABA 1OEPA 3VD7A 3GVWA 5AYYA 5EB8A 3R0UA 2XJ7A 4AUBA 2VENA 3C0LA 3W71A 2DDXA 3PC0A 3RLHA 4LAKA 3LMZA 4IFKA 5C9XA 3GAKA 3IJ7A 2ISFA 5CPSA 3L4UA 3WDJA 1Q6RA 1UQYA 5IBXA 3B06A 4X61A 5C6MA 5FESA 5HMSA 2E1WA 3HV8A 2FZNA 2WNNA 1QI3A 1AUSL 3PTQA 2CHRA 5T9BG 4JQAA 4AF0B 3M5VA 1X7IA 3C2FA 1ZJBA 2BS9A 4JFSA 1O5RA 1XLJA 2BTMA 1S2CA 4L80A 1OT1A 5GPRA 1KFCA 3GTXA 4ATDA 4NJKA 5CPLA 4DF0A 5BXSA 4O1DA 3VXGA 1T40A 4RX0A 4DO6A 1ZBWA 1TZ9A 3NZRA 4UTKA 4ZENA 1AW2A 2VQTA 5M5DA 1W32A 2ZBTA 2OZ0A 3WLTA 1Y65A 1H41A 2XN0A 1F2JA 2IKGA 1ITQA 1KQZA 2YLLA 2ZCGA 3DKJA 1T99A 4ZFCA 3R0KA 3VGDA 3AIRA 4QITA 1C8XA 3ZO9A 1XC6A 3S83A 3OBKA 2V5BA 4PUWA 3UVAA 2J7EA 4NRSA 3RRAA 2H8XA 3CH9A 3PBWA 2PS2A 3EYPA 3OGVA 2DZUA 3LEPA 5EYWA 2XG9A 4EWND 1JYNA 3LYEA 3GIPA 4LUTB 3NSXA 3U8GA 2A7PA 1PCWA 4UZSA 2VO5A 3NL6A 5LNVA 2E7FA 2Y70A 1U5JA 3OZYA 2A3BA 2QT3A 4PULA 2ZUTA 1M41A 2WMFA 3W7DA 1HJWA 3S6OA 1LCOA 4D6JA 5LA0A 3L0GA 4OKDA 4JTFA 3PZMA 3ZR5A 2VX5A 5C7HA 2HMCA 3VCCA 5C2GA 4IZGA 2BNJA 2IMRA 1DJHA 5ABFA 2V3GA 3WDHA 4Q8MA 5G4HC 1W1B1 3TWAA 4LYRA 4AIOA 2PODA 3NYDA 1IT7A 1CGVA 3PAOA 5FACA 5HJXA 1P1MA 3ANUA 1HKIA 3D46A 1IIHA 3UWWA 1QI4A 4DJEA 1HKKA 2BOEX 3VE9A 3G1DA 1LROA 5I78A 1X1OA 3I65A 2EHHA 3HG2A 4K7VA 1J2BA 4GFSA 1FWRA 1DBTA 3UNDA 2J66A 1LT8A 4HNTA 1X8CA 5I3JA 2UY2A 2CHOA 4MFEA 3GX9A 1X1NA 4C7GA 4JNYA 1G94A 1W54A 1XLFA 5KEZA 4D2JA 3CGTA 4GISA 2FYMA 3WQ6A 1PAMA 4LYKA 3H2FA 3R25A 1LG1A 2H3BA 3WMSA 4IPJA 4ADUA 3W83A 3HBLA 3D3AA 4C6OA 4D1IA 3O7UA 3FEMA 4MB4A 1NWRA 2AGTA 3B8UA 5LIWX 3TIMA 2YDRA 3MUY1 1BRLB 1A5AA 1FWGC 4FSAA 2FGZA 4FNUA 2YXOA 2VRQA 4IPLA 1V0LA 4NG3A 5AZ0A 5HWJA 1DXIA 2QCLA 5I5RA 3ZSTA 3TMQA 5EBAA 3VOIA 2E09A 2BHYA 4YL2A 3B9AA 4NYYA 2PFHA 3W7NA 3R94A 3EEGA 4NJJA 4WJXA 2DH3A 5CGMA 5TF0A 4L9XA 3QPZA 3CQHA 1GQLA 2EF9A 3L68A 1P4CA 3UPMA 3C5QA 3DG3A 3WNPA 2JFEX 1B1YA 3KBVA 4GIEA 3V1PA 5FEWA 3HOJA 4GI8A 1RCQA 1Z48A 3IVUA 3MSYA 4ADTA 3R10A 4G8TA 3O63A 3ITLA 1ISXA 1RP8A 3WBYA 3NQCA 5E9AA 4ZBCA 5BW6A 3OB8A 1WDWA 4LAMA 1LLZA 2UY5A 3VGGA 2GLKA 4US5A 1MWOA 4Z1DA 2Z1VA 1GKPA 3KP1A 3VU2A 1EQPA 4ZZ9A 3VFLA 4PMUA 2PPGA 1IZJA 1TZZA 3H54A 3N2OA 4LRSA 5DT5A 4F3HA 3IGUA 3T7VA 4EANA 5KTLA 1ADSA 1Q6QA 2J7DA 5HMEA 5M3WA 2PWGA 3DGBA 4QQUA 3M0LA 5A8NA 1O94A 1ZUAX 3W7JA 1MQRA 1PBGA 1ZNNA 3H7VA 4KIEA 4JTCA 2VWSA 4UTMA 4HNNA 1C29A 2DW7A 5D30A 2OWCA 1TRIA 5B7YA 1GQKA 3KL5A 4UNLA 3KBWA 4A3RA 1R38A 3S8HA 1NOUA 3T42A 3UD6A 3V36A 4XV0A 1E70M 3N25A 2DW6A 1AJ0A 4MAVA 3WZ0E 3LSBA 2G95A 2X1UA 2PDYA 3TCSA 1MDRA 1RPXA 3HFYA 3UWYA 5DMMA 1XQLA 1OFAA 3CV6A 4K3ZA 5TD4A 1UR1A 2VEGA 3S1GA 2R91A 1KM2A 2VEFA 1H60A 4WRHA 2X05A 2BSLA 1JYXA 1FY6A 1GORA 3QC0A 3C0QA 2DZAA 1GNXA 1KV5A 3VNYA 1VENA 1MXDA 3LSCA 1M03A 3U7VA 4W7UA 1VJSA 5I6SA 4K8HA 3WDQA 4J3SA 1CLXA 5HQEA 4MSSA 1Q2RA 1XPYA 4HHLA 1LYXA 2Q02A 4QR6A 1WZMA 3SI9A 2GDVA 4XD4A 4CKQA 4JIQA 3RM4A 4R88A 3SW6A 1HN1A 1TX2A 1TJ1A 1OFQA 1KM3A 5K9XA 4F8XA 4AIUA 3N11A 3C2VA 3TA6A 4GVGA 3S5OA 4GX8A 1PHQA 5AYIA 4GQBA 3K8KA 1HKMA 3SY5A 3E3HA 3W6MA 9XIAA 3G1SA 3GC4A 4I9JA 2PDPA 4HYWA 1L2UA 4M1BA 2J78A 1DE5A 1RJPA 3CWHA 1HT6A 1KTCA 2FFIA 3WL0A 4C65A 1US3A 4HCHA 2HPMA 2VI0A 3WBWA 3RF9A 3SEPA 2XWDA 1PYFA 1R87A 2FZMA 3H12A 1V93A 5A6JA 3VOHA 2YDAA 3HA1A 3BGJA 4S3FA 4GLEA 1FWDC 3BG5A 1M53A 5A94A 1RK5A 1QRQA 1LWHA 1OC6A 1XD1A 1J6PA 2JEQA 4IIBA 1YE4A 5DCDA 2RDUA 4MYXA 2FH8A 1RHCA 4O0QA 1J0HA 3LD5A 2QEZA 3NQGA 5LKYA 1VFTA 3HU7A 3MP5A 4RNJA 1TR1A 3RJXA 2XTKA 4R33A 3P62A 4AD3A 1SYTA 1ZCOA 4HU8A 4Z0JA 4QXIA 1FUYA 1KM1A 1O5QA 6ENLA 3WUBA 2YDQA 4BEUA 3M0JA 4GMEA 3W7MA 1FH8A 2WSPA 1YRRA 1A5NC 4A29A 2IKJA 1N8IA 1J9YA 1W9UA 4GG9A 3ZVHA 2VMFA 4S3JA 1ICSA 2X0YA 3GNDA 2PRHA 4CQAA 3AU2A 2GGEA 5IM51 1TCDA 3K4WA 5G1YA 5G2WA 4OOUA 4QTGA 5HJLA 4LCQA 1NWSA 4ICCX 3BSMA 3WQ5A 4D72A 2CHNA 1DQUA 3VUPA 2J79A 3TC7A 1DPMA 4MGGA 1Y5VA 3NA8A 4X9YA 1TPDA 3NL3A 2Z27A 4GIAA 3G0SA 2V38A 1TPB1 3GH5A 3IV3A 4U3CA 4WDWA 1RXOB 2EPLX 1NJJA 4MUPA 3FXGA 4PODA 4AH7A 4PUNA 4JFWA 2OSWA 3FY1A 3ZWSA 4WGXA 3O05A 3QTPA 3N2XA 3MP3A 1KD0A 3NOYA 1XSKA 2HJPA 4PCNA 3PG9A 2GWNA 3W28A 3JZUA 2FHFA 2G5WA 4UQBA 2IXVA 3GNXA 2CCRA 4GXWA 4NHVA 1SO4A 2OU4A 2ZRWA 1PIIA 1XYAA 4H8NA 3S1UA 3UZ5A 3KLLA 3WNNA 4MB5A 1SO6A 2OTDA 3XINA 1KTBA 4I9TA 3GHSA 3S42A 2E28A 4KERA 4FS9A 2WC4A 1A4LA 3AIBA 1KRCC 4TX8A 4FLOA 3TN3A 4QAIA 3UR5A 4DYKA 4HYVA 2HV5A 1TV8A 4F2TA 1H0IA 2GSJA 1X98A 2E5DA 4NX5A 4DWSD 3T9PA 3KOXA 3FYPA 2ABAA 4JFUA 1VR6A 2VZTA 1YDYA 5E09A 2CERA 3N2MA 3PBVA 4UOQA 5HULA 2J25A 3EWCA 2WVSA 5D32A 4GYKA 4CU7A 3ZSSA 3RMJA 1VD6A 3R4IA 2XN1A 1SQ7A 2OSYA 1S39A 2VEKA 1AK5A 3T4WA 5CC6A 5JQ9A 1QPKA 4LVDA 1CX9A 3VNLA 4N6EA 1KKOA 2XH0A 1UROA 1BYDA 1E40A 4X60A 1DJIA 5F1UA 1VFMA 1CXIA 4AVOA 1ICPA 4HVXA 3IS4A 4UTHA 3CQKA 4O1EA 4EOUA 4AZCA 4L4PA 4C91A 3SCQA 3LM3A 3WEMA 4XQ6A 1ZP3A 2C8NA 4LUIA 5HXMA 2D2HA 3HJZA 4XBKA 3PB0A 3O3RA 2JGYA 4QCEA 4JEQA 4S3KA 4GINA 2V5LA 3COTA 1R7OA 4P7NA 3BV7A 4RE0A 5FIPA 3F4DA 5C71A 1U2YA 1FWWA 3F4VA 4RZ5A 3CMFA 1FHVA 1QATA 3WDRA 3DHDA 3MWAA 4L7ZA 5LA1A 1TJRA 3CWNA 1VRDA 1S3TC 3IJ6A 1ELSA 1UD4A 2V5KA 1QASA 2B7OA 1H3GA 1UJPA 1ZJIA 4A21A 5BROA 3KTXA 4DY1A 3WMLA 4D6HA 1XQKA 4QX4A 4CCCA 4ZMGA 1ZB5A 4HBKA 1ONXA 4JZ5A 2GK1A 3R13A 3W38A 1OD0A 2QCFA 4NUWA 1XIJA 1EL3A 2IKHA 3W75A 4X2RA 3EKLA 4U4MA 3WLQA 4FXJA 4HJFA 3O0KA 3PUOA 3A3WA 3G22A 3TYCA 3LBCA 4W87A 2QPSA 5FF2A 4PMNA 1P0DA 2V8ZA 2A7NA 3LCFA 4JDYA 3W3OA 1EC8A 4QNEA 3LHZA 4YTTA 4GK8A 3FHAA 2YL8A 2WNWA 1NQ6A 3W7EA 1Y5XA 4S3DA 1HJUA 4PMDA 3QY7A 4XTIA 3B9DA 1TB3A 3MWCA 4MPKA 3LBOA 3E5BA 2VEIA 2V0TA 4WJEA 4ZO8A 2BLEA 1CGWA 1WE5A 3NPUA 2P1FA 4UTWC 3S2LA 1B3VA 5HQMA 1JI1A 2R6OA 4G7EB 5E6YA 3BMWA 3KCLA 5JIWA 1B9BA 2VX6A 1WUEA 2WSKA 3S5NA 1ISVA 3EB3A 2VZUA 3L5AA 1ZGDA 5LGZA 3AZTA 6ALDA 3DYMA 2E3ZA 5H8PA 5G5IA 4AEOA 4DM2A 4P7RA 4XBSA 3PZUA 4NAEA 3CHVA 3NUKA 1DTUA 4O50A 1UR0A 3H7UA 2ADAA 2BVDA 4HN4A 3MUZ1 4E2BA 3HJEA 1US2A 4UMAA 5IFTA 1TTPA 4WKAA 3STCA 5DY3A 2E6FA 3NPWA 1IEWA 4ONVA 3O0FA 3O6DA 4P7QA 3KXQA 1ZL1A 2GYIA 1TQJA 1EUAA 2AQWA 5D05A 8A3HA 5C5YA 3TCEA 3WJSA 5K9CA 3NG3A 5D9OA 4JR5A 4ZSUA 3UJSA 1BAGA 1ZS2A 2OYMA 1UB3A 1EJSC 4RZ4A 2XWEA 4AAJA 3HN3A 3S47A 4IX0A 2AL2B 4H2CA 1YBQA 1T41A 2J75A 3AMGA 3FJNA 4J2PA 3BLPX 5C9WA 1RD5A 3ZIZA 3GTNA 4JTUA 1AVAA 1QHPA 1JCMP 1IWPA 1WDPA 5IHRA 1J11A 2F6UA 4W93A 3CC1A 3L9CA 2YIHA 3SUSA 1WKYA 3PTKA 1A3XA 1LTDA 5D2XA 5A6SA 1JDFA 2ISDA 4HYRA 1OF6A 3AYRA 2G37A 4KKXA 2XFYA 4Q8TA 1I0BA 1U22A 4AFYA 1GKRA 2BY1A 4Y8EA 2G3FA 1V08A 2WMHA 1GW1A 3OLDA 2Z24A 4L61A 4LB3A 7PTDA 2TPSA 4H8VA 2OLSA 1G4PA 4IMAA 1ZY9A 3B8WA 4H41A 4O0KA 5AVNA 4DBEA 1WKFA 3LERA 4PH6A 2D24A 3PULA 3VIFA 1L6FA 2PU0A 5EPDA 4PCPA 2QMJA 2VC5A 3MUAA 3APTA 1K6WA 2EG7A 4LTSA 5CAKA 2NXIA 2Z4GA 3ISIX 3DGRA 3GO2A 4S39A 3PN8A 3T1GA 1G6CA 1Y7VA 3I6EA 2GSEA 3RX2A 3VIMA 1Z44A 1K03A 2NVDA 2OO6A 4W9TA 3UXAA 3T55A 1ZU8A 4RNHA 5FEXA 3SCWA 1I2OA 2GJXA 4O13A 1GZ1A 2F84A 1UASA 4NNCA 3H8AA 1UH4A 3N17A 4DWSB 3G6LA 4DZ5A 1IE7C 2NQZA 1E51A 4TX9A 3TK7A 4QS6A 1RA0A 3MKVA 4PMQA 4UTTC 3N2TA 3WENA 3M0IA 3SUVA 4AXNA 2ISSA 4Q8NA 4FNTA 3TAKA 5G2IA 3VIOA 1UBPC 4RKAA 4E4PA 5IFPA 3LTPA 1NDYA 1J8VA 1V6YA 4RV8A 3VX1A 3L4WA 4CQBA 2V3FA 3LENA 5CJNA 4JD4A 4J7RA 2R8WA 2ZUWA 1IIGA 3QR3A 2E5BA 5F2IA 4PMVA 3FXYA 3TNOA 4QJ4B 4KCUA 1H51A 3DOPA 3AXHA 2HE5A 3W86A 4FOJA 2O9OA 3N2CA 1EQCA 3C6CA 1RZMA 1Z3NA 3V7PA 1WDQA 2QS8A 4RDWA 3ANVA 4LVAA 5I24A 2AKMA 1RY0A 3PZVA 3W29A 3UFYA 3GDKA 4L4MA 4OGZA 4ZO9A 5CLTA 3W7QA 1F9CA 3FJLA 3REQA 3UCQA 1EGMA 4H7ZA 1Q6CA 2NWSA 4DF1A 3VIPA 2G96A 2J77A 3GB6A 2EXOA 5CZSA 2VQUA 2D22A 2E8ZA 2WK2A 4PUEA 4N9EA 1XLMA 3M0VA 4QFUA 2MNRA 2W6RA 5XINA 3DBPA 3B40A 4AD0A 4PUDA 1XLHA 3W7HA 1TVPA 4H00A 1UUQA 2ZDRA 3R6IA 3VM7A 1KXVA 2I5GA 4QS5A 4NZFA 4B16A 2D1ZA 3QLDA 4OV4A 1G0CA 1SR0A 3QZAA 4AG0A 3PS7A 4P8VA 1GW9A 1AQHA 1Q8JA 3WMCA 2WAGA 1ZJAA 3WH8A 3WLOA 3OHIA 1HIZA 4MNMA 4WSHA 1LL4A 1ZTVA 3A6OA 5BRBA 4FHAA 1SU5A 1ZENA 1P0BA 2R94A 3WQOA 3INPA 3VNKA 2VM8A 4XSLA 4DRSA 6A3HA 3WIJA 1Q4WA 1V3JA 4N2YA 1VEOA 3G3MA 1EYWA 4UMBA 1AQFA 2NW0A 2Y8KA 3GG8A 4L9ZA 1WZKA 5D4YA 1X97A 1RBOB 2YJQA 2A5HA 4MKNA 2QUUA 3CH0A 5JUVA 4MWAA 1H1ZA 1PWMA 4QLJA 4Q3MA 8RUCA 3A4XA 1KBIA 2Y5JA 1DWGM 4H4IA 1RCXB 1ISZA 1OGBA 4GIRA 1HJXA 4JTKA 5CC3A 3LDVA 5HR6A 3W02A 3N9KA 1GYMA 1CYGA 1UKQA 1O5KA 3QXBA 3TTSA 4K68A 4B5VA 4N7QA 2QCNA 4MTVA 2WSRA 1CXFA 2WMJA 3B0XA 3MO4A 3DUGA 1A5MC 3C86A 4O12A 3WSUA 3P5YA 3OG3A 3FFSA 4DO7A 3QTGA 2WVUA 1YXCA 3QHOA 2RGMA 2Y7DA 2QF8A 2Q71A 2FB2A 3TU9A 4LU0A 1AL7A 3LX9A 3NTYA 4AD2A 1TPUA 1S3HA 1D9EA 2OVLA 3L4VA 4QJ3B 3GFZA 1WXYA 1MEHA 1E6PA 2BOFX 2FH6A 5DMNA 1HXJA 3S2NA 3VNIA 3CMJA 3TC3A 3WF4A 4HPGA 1XH0A 3LXAA 2Y88A 2DQXA 1Q85A 3MI2A 2Y5SA 7ODCA 1IR1A 2Q09A 5LGXA 3DAQA 2R24A 1XDLA 4LUYA 3SCNA 1BHGA 3WX7A 3Q67A 3PTMA 1BVNP 4AMAA 2D23A 2AQVA 1B4KA 3SFKA 4W85A 2W91A 4AY1A 3FVDA 3GU1A 3H4GA 4AMCA 3M41A 3W72A 2OQHA 1J01A 3TYEA 1MI3A 7TAAA 3LRMA 3BL3A 3NVTA 1XRSA 2DFAA 3QV8A 3ZWTA 5CEWA 2J9YA 4PEKA 1CXEA 2Q01A 3PPHA 2WZMA 3FW6A 1DIKA 2PP3A 4CU6A 4MF4A 4DUXA 2BB0A 1UOZA 4H6EA 2JALA 4N4QA 1POJA 1EA9C 3E0LA 3TN4A 3GK0A 5CBBA 2QV5A 2G50A 4IL0A 1T8XA 3EZ4A 1YKWA 1QDSA 1VFOA 1FFQA 1OX4A 2NT1A 4PB5A 3LRLA 3U6WA 3L66A 2PBGA 3DBNA 1H1YA 4ZA0A 1E9ZB 3R8RA 3V16A 3P0XA 4PRTA 3KUMA 3A24A 2BXZA 2QGYA 3O06A 3B8VA 4ECLA 4DBWA 4JN8A 5BNKA 3GNPA 1MQQA 4B5UA 1V3KA 3O07A 4XX6A 5FJIA 3A12A 4H2HA 4W5ZA 4BQ3A 2ZXQA 1O66A 2GGHA 4RR4A 2QAPA 2PZ0A 5CJMA 2OX4A 1MFVA 4OWGA 3KS6A 1WXZA 3UETA 2CBJA 2WO5A 4PR4A 2NQ5A 3OLEA 4IH3A 3SCUA 3AALA 3DHFA 1EZWA 4W88A 1S2TA 1P6BA 2HS6A 3RR4A 2FKPA 4PBFA 3LV5A 2GQ9A 4OTKA 2A79A 2OEJA 3DC0A 3QEZA 1KBKA 2D2GA 5DLCA 1QHZA 1H2JA 3VIJA 3JU2A 2CYGA 1LBFA 4AC1X 2CNCA 2JKEA 4GGBA 1GK8A 3N04A 4H7VA 3CIWA 4UFIA 5XIMA 4GNJA 2GQ3A 2WJDA 5BOEA 3EX4A 1M01A 5HWMA 4GCAA 1QR7A 4IL2A 3K2GA 2YCIX 4XVEA 1YDOA 3SADA 1VS1A 3GWQA 2QV4A 4L1GA 4QDWA 3A3HA 4WHBA 4EPBC 4E6MA 2F6XA 4O1CA 1DWJM 1Q7MA 1QMLA 3DDMA 3T6CA 1R3TA 2B4GA 3HGSA 4XUYA 4WDXA 1HL8A 4RNFA 1NSJA 3TZFA 4NIRA 4MHBA 1PS9A 1HW6A 4QDMA 3MMWA 1CGXA 2J4GA 2XVKA 3DFQA 4ERIA 5AN7A 4PEEA 1PYMA 3W1UA 5DMLA 4C1NB 1QPRA 3OGRA 3QV9A 1W3IA 4Q8OA 1YNYA 1M9HA 4TIMA 2OOFA 2CW6A 4UIOA 3A4AA 3NGFA 4H8UA 4BEQA 2Z29A 3WBEA 1A4MA 1O68A 4H9XA 3EDJA 4JX6A 4OECA 3TLLA 1SMDA 1O6IA 4LY4A 4UTJA 1CB2A 4MUZA 2DT2A 4U28A 1R47A 5EA9A 3S5ZA 2CZ5A 1DP0A 1PWLA 3RRXA 5KITA 3B9NA 3ARVA 4AU0A 1KM0A 2P8CA 1DJZA 1T7LA 3BJFA 4HPXA 1JI2A 2PI6A 1OSEA 2DEPA 2INZA 3PBGA 5DRCA 4IGMA 2GPTA 5I0DA 4BJHA 1WBHA 1MZHA 4JL2A 4QROA 1JQVA 3GU9A 4IICA 3B97A 5DO8A 4IFRA 1UMYA 3PUGA 5FJUA 2QCCA 3UA3A 3GTFA 1W8SA 1R3VA 3LM7A 5E93A 5G2HA 4BI6A 4Y90A 2Y6ZA 3GNRA 1W5MA 4RDVA 1I75A 2QXWA 3NDZA 2QF7A 1UZHA 1NFBA 2XSXA 3PNUA 3KBJA 2ZC8A 2Y61A 2JK2A 7REQA 4DYJA 3U4FA 3NAVA 5TAOA 2OKOA 4LBSA 3ELFA 5K2ZA 3P84A 4LUJA 3U2CA 4B3ZA 5AC4A 3QJAA 2D2OA 1IEQA 3BZJA 4LALA 3M0XA 2BXYA 3ONBA 1GTHA 1D8WA 2WHKA 4P8WA 4WEVX 3AROA 4OOZA 4A3HA 1R8LA 3ORWA 5CZTA 4J3ZA 4NZ3A 4LRTA 3A5FA 5I23A 1QPOA 2YOCA 2QJIA 1JRCA 2ZZ4A 5HWNA 1KFEA 2PP0A 4ZE4A 3QZEA 3BTNA 4HD5A 3AOFA 3GW0A 2AAMA 4GJJA 4NASA 2VFHA 3DENA 1G5AA 4FX7A 2QZRA 2EJAA 4CUCA 1D7FA 1WDDA 5DMYA 4UFKA 1LT7A 3CT7A 3OYZA 1M68A 4ZL1A 3AIEA 1KBBA 1V77A 4FX8A 4O52A 5A6TC 1E72M 3C52A 4RE4A 1TJ0A 2V68A 2VR4A 3FKRA 1O4UA 1W9PA 4DZHA 1OX5A 4HMCA 3Q94A 3WK0A 1VCVA 2YYTA 3T2OA 5JMUA 4V1YA 2X42A 3CB8A 2OT0A 3FA5A 4CQ9A 5AHFA 2VUNA 1OGSA 1GPFA 4HA4A 4FF7A 2WC7A 5AHEA 3W2NA 4CEXC 1K9FA 4G2DA 2CZEA 2F61A 4BF9A 4DWSC 2Y5EA 1XJBA 5LHEA 2VT0A 1E1EA 5F7UA 1TELA 1NIUA 2PRLA 1EHNA 2ZUMA 2E9BA 1EJRC 2NQ9A 5DEZA 1YNPA 2PWHA 1KFJA 2QMKA 2I5IA 3A21A 3G1RA 4XK2A 1RVKA 4N4PA 1MDLA 2FHBA 5B7ZA 4LXFA 2WZTA 2CKRA 2VD8A 3HPXA 1ECQA 3EXSA 3N19B 2C16A 3FHQA 4GQGA 2C13A 5CZJA 1UZDA 3GC5A 1JZ7A 3QRHA 4CCEA 1R85A 1IHIA 3R1ZA 3P61A 4IG2A 1F8IA 3WNKA 1J18A 4LNCA 1MW2A 4UQ9A 3VFCA 1YBQB 1KQYA 3AS0A 4C6FA 3VD4A 5TNVA 2NUXA 1K02A 2EPHA 4JFTA 3MCNA 4Z2JA 3LHWA 2VEPA 1QHOA 2I14A 1P1XA 1GEHA 2JQXA 4F48A 4WY0A 1D2KA 2WPGA 1PUDA 3LGGA 1O5XA 4GOAA 2NZLA 3UZYA 1OFRA 2ACSA 1KM4A 2TRSA 2ZXDA 4A35A 2OR2A 2ABBA 4YIWA 2C0AA 4P8XA 1A0CA 2GZXA 3U3HA 1BWKA 4UR8A 3KBSA 3AI0A 1W91A 1HKWA 3M4HA 2AKZA 4GH1A 3ZOAA 3LNMA 1ZHAA 3I6TA 1KA9F 3CNYA 5CG7A 1Q66A 4UQEA 2J13A 2OZ3A 2Z1KA 1M7OA 3EWUA 1QOPA 2YFNA 1N8WA 4XISA 3U5YA 2X41A 5JBFA 1QU4A 3EB2A 1SO3A 1NY1A 1XRTA 3GG7A 1BFNA 4X3ZA 5J8LA 3A9IA 3WF0A 2VKZG 3V5CA 4YU1A 3O8AA 1RPKA 2OZTA 3LXBA 3EOLA 2V67A 4YTRA 2B7QA 1W1A1 3B4YA 4PMYA 2FVKA 4JIHA 3NPVA 1BWLA 2HS8A 4HNVA 2DIJA 1XKJA 4F0MA 3TONA 1QWGA 4JCMA 1C3FA 2Z26A 4Q8UA 1VZWA 3C8NA 3G8RA 3DCPA 3GC2A 3LTYA 3F2DA 1ME7A 4ATLA 1Q3NA 1XIMA 1W3JA 1FWAC 2E25A 3WNOA 4JDBA 5BRQA 3Q37A 4K39A 3B8IA 5EMLA 1UC4A 3L4ZA 3WLMA 4F0KA 2I1OA 4XKMA 3RO6A 3RGTA 1XHGA 5LIUX 1GJPA 3VOFA 3WELA 1GTEA 4XZMX 3TV8A 3W2KA 5AKQA 4PTWA 5M17A 2QCEA 3S2JA 1MNSA 3C8FA 4ACYA 4LBUA 5D8WA 2HROA 4R5EA 1X6NA 5LSMA 1EPVA 4MNKA 3VILA 2YCLB 1VJZA 2AMXA 2QGHA 3MKKA 2OLHA 1NQKA 4AX6A 5T26A 4KMQA 2ZQ0A 3WK3A 3OA5A 1ZCCA 3MBDA 4AVNA 4BWLC 1ZBCA 2X0SA 1G01A 3A64A 2ZZ7A 2OQYA 1JCXA 4Q8PA 3GXNA 5LXEA 1W17A 1DE6A 4C5YA 3OVPA 4XAYA 3VUSA 3FSUA 2RDXA 1CXKA 3M43A 3HQPA 4PSRA 4O53A 3T2QA 1KWKA 1SFJA 1H0GA 1MRAA 5A6MA 2Z1BA 1P7TA 1XLCA 3DERA 3QKEA 2HBVA 1Z41A 5E0KA 1C92A 1ZLPA 1GVOA 4E2VA 1VRXA 2DT3A 1TWZA 2V6AA 2ESCA 1OWQA 3KDOA 4J1OA 4UTLA 4B5WA 4CVWA 2NX1A 3M07A 4RJEA 3QHNA 3TYUA 3SBFA 1WV2A 1OC7A 1UWQA 3MTWA 1NU5A 3W1TA 4NILA 2I57A 3C2YA 3EA1A 2VRKA 4XAZA 1JNDA 1V79A 3KHJA 3EPOA 2WCSA 4YCOA 5CAHA 4C1LA 3CTLA 3UGVA 3MBFA 3VOJA 1R2RA 3RNDA 3LPGA 3NFUA 4K2SA 3DU0A 2QCDA 3LHYA 1DJXA 4TQTA 5H6HA 3LOTA 2JEPA 4HPJA 1H7WA 2WB5A 1UPMB 1XR2A 4M3PA 1HZYA 2ISVA 1L8PA 3ABSA 4HZ6A 3BGGA 2YA0A 4E4FA 1HP5A 4YVPA 5A69A 1WB0A 4KGJA 5LXXA 2VVSA 5CZKA 2JBMA 1E0UA 3DFPA 1NDVA 4D6GA 1W3KA 1L6SA 3SCSA 1JUEA 1QPQA 1Z7AA 3FVMA 4O10A 3UWQA 2D69A 4GQQA 3NEVA 4AD5A 3FDGA 1AD1A 4J9JA 3B0PA 3E5PA 3MUXA 4MWAB 1XD0A 4M8UA 4LEQA 3ERPA 3EWZA 3L5LA 5FEPA 3H55A 3W1AA 4ICMA 2PDFA 1FXPA 2ZWZA 3ZT5A 3KBMA 3N6JA 3VOGA 4NZ5A 4HHPA 4CNPA 1P48A 3W2MA 4PBGA 4I9MA 4M24A 1ISYA 4OJYA 2DV0A 2X8RA 2XISA 3O6AA 5BXPA 5ENLA 4L64A 4OU1A 4ZXOA 4DAIA 4J3UA 4C6JA 2VOMA 4KCWA 3LS9A 2NVAA 4UNIA 5DCBA 3TFCA 1I2QA 3UJEA 1F74A 3RHGA 4I8DA 4F79A 1QNRA 4EAYA 2BVYA 5REQA 4WY0F 2CLFA 4Q8QA 4MY8A 4XKYA 4HNUA 4PRWA 3SCRA 2PEVA 2YBUA 1W5QA 4WXZA 3IVSA 2R1MA 3GVQA 4CNTA 1K8XA 3B9EA 2VZVA 5LHFA 3G3DA 3WH5A 3O1NA 5HATA 1B54A 2GOUA 3F4NA 4HZMA 5MF5A 4XZLX 1TA3B 4GXMA 4AIEA 2PWEA 4KPLA 1J12A 5FAJA 1PZ2A 4DJDD 3AXKA 2E9LA 5G4EA 4JEJA 4GVIA 1G69A 4IM4A 2J62A 1QWKA 2E9MA 3BW3A 4O0ZA 3PHAA 4M6PA 3SCTA 2XGIA 4N9CA 1P6CA 2YBVA 3BSGA 5E9XA 4JTLA 3OGSA 1N2VA 3UWEA 2XFRA 1GG1A 2CITA 4MM1A 3GG1A 5D33A 1TE1A 5G1MA 1SZEA 2ZTKA 3GE7A 1UC5A 4FAMA 3QGKC 2PCEA 1TX0A 2C18A 4MZ8A 4QE4A 4UBPC 4ORMA 3BPWA 4ZOEA 1TCMA 4ZODA 2VP8A 2HCVA 3WJZA 5D9MA 1EHAA 1FX6A 1X39A 1H11A 4ZGYA 3Q2DA 2E67A 3OLGA 1VBHA 2PU1A 2W67A 3NQ7A 4A8IA 3USBA 4UTUA 4KWOA 2OQLA 3W2LA 3EWWA 2QVNA 2YW3A 3HPSA 6REQB 1SJAA 1FQ0A 1JXKA 5FF4A 4PGLA 4H83A 1VFHA 2C1GA 1PZ0A 3PZOA 4ACZB 2PWVA 4A4AA 5FJJA 5I07A 4DBSA 4D6FA 3NM1A 3LHVA 4UOJA 2OX1A 3H24A 1FA2A 9RUBA 1K8ZA 4GJ1A 3NO5A 3FV9A 3QGVA 2XH4A 4JCLA 2YBTA 5DXXA 4OBTA 3EX2A 4GNKB 3G1VA 5KZ6A 3ABOA 2BBFA 1LZOA 1CCWB 3BE7A 2WSQA 3WL1A 3G6MA 1A5BA 3CV2A 3KRSA 3RAOA 4DX3A 2GVYA 3WJWA 3PFRA 3RPMA 1MUWA 1PPIA 4DB7A 3IVTA 3OBAA 3SURA 1YQ2A 2RAGA 2RKXA 1Q6DA 3OOQA 5HOSA 1Q63A 2QDGA 1CNVA 3AS2A 2FMNA 3T0BA 5BWAA 1F3WA 3CXOA 1MYRA 2OWXA 3QKZA 2HXUA 3IK4A 1OFOA 4DJFD 5F4SA 3ALFA 3LA4A 3QOKA 1WKEA 6CGTA 3UPWA 1EA0A 3TOYA 2VYOA 2WLYA 1LQ2A 4MFDA 4YN5A 3WUFA 2HVOA 3II1A 3CV7A 3IUIA 3TSBA 1O12A 4L56A 2EJ1A 1VF8A 4AHPA 4Q8VA 1XWYA 5T91A 1VEPA 3H7RA 4H9MA 5U7SA 4IIEA 4JHZA 5AC5A 3SCPA 4JN7A 3GKAA 5HPCA 1VHNA 1X6UA 4NAFA 4Z0SA 3SGGA 2R82A 3VNDA 1SPQA 5E0CA 4KGLA 4G5DA 1RQEA 2V69A 1LP6A 2Y7GA 1E56A 1TUFA 3AYSA 1DJGA 1HKVA 2QUTA 2WNQA 4GWEA 1NAL1 2OOGA 2SFPA 1H63A 4GZJA 2PDIA 1QBBA 1B5TA 1JEZA 5A2CA 4FO4A 1XBZA 1XP3A 3AWNA 3VPLA 4I3GA 1FXQA 2PGRA 2QJMA 3MCMA 4JTRA 1DJQA 4C7DA 1J93A 3NXFA 5FD0A 4W89A 1CI1A 1XV8A 1EJUC 1EIXA 4D8AA 1BYBA 3DEQA 1JDAA 1C93A 5HAOA 3PG8A 4HN8A 5MKGA 4B92A 1LUCB 1RH9A 4FEZA 2ZUSA 4KEZA 1QOXA 3E2SA 5MHBA 4Y96A 3H2EA 3I7SA 2BVTA 3V35A 5HANA 2DSWA 2G4FA 1E4IA 1FKXA 3R2GA 3KVMA 4JYEA 1H7RA 4UB9A 3RFAA 5FCZA 4UUIA 1KM6A 2Q8ZA 3GDTA 4J3TA 4LX4A 2JKAA 1WO2A 1GYLA 1GWJA 2VUYA 3TQPA 4IISA 3HMCA 3K13A 4LF1A 3AMLA 4NZJA 2FPTA 2HSAA 4HZ8A 4LAZA 4KIRA 2DZBA 2E77A 2PMQA 2XVPA 6PTDA 2GUUA 5A2AA 3S9ZA 2WKLA 4XO6A 3TJ4A 4E2DA 4KEMA 4V15A 4U33A 1IXOA 4QP0A 4Y9OA 4ZTYA 2H8ZA 1QI5A 4ZQRA 3H6OA 3UG4A 1EIBA 3P67A 5E6ZA 4N9DA 2DUZA 4WOQA 4LUSA 3TROA 1ITUA 2DPEA 3UCCA 2PTYA 3B05A 3FDKA 3QFEA 3E6EA 1FKWA 1SW0A 4ZEPA 1F4AA 1FCUA 1PXGA 2WNZA 3P74A 1R30A 3HGOA 1H7OA 3H2MA 3JR2A 4M6UA 5A6BD 2INEA 4R7OA 2XVGA 2VRJA 4DZIA 1QTWA 3N9RA 4Y2WA 4P61A 4O18A 4LC8A 5LA2A 3M44A 2YGYA 3LZ3A 1A0EA 4AISA 3GBEA 4L1WA 2IPFA 4NZ4A 4J27A 4KFOA 2GWGA 4D9PA 3LU2A 3AWOA 4KEUA 3ZS4A 4GO8A 1ONWA 3PBMA 2HWGA 5I79A 1F76A 5LIXX 4KWSA 4W4QA 1PZ3A 1Z69A 2PP1A 5DT7A 3ARWA 1EO5A 3UA4A 4QCFA 4L4LA 1DJYA 2PTZA 2QLYA 3AIVA 3NPXA 4JICA 3AXMA 7XIMA 3ZJ6A 1DV7A 1OABA 1J0YA 3IJIA 1W5PA 1EF2A 4IMEA 1GVSA 4S38A 4ZB0A 3DFNA 2B81A 3LGEA 3HGJA 3FJ4A 1UPPA 4GUJA 4IQDA 3PJUA 4BK9A 3ARUA 1TUXA 2FMOA 1B57A 1QXLA 2Y62A 3H2AA 3GY1A 3HMJG 2D0FA 2XDFA 4FLSA 3STGA 1ECEA 3OU8A 2WYSA 2F7FA 3S1XA 3VA8A 1TTQA 1EOMA 2PDXA 5FKYA 3AMKA 2H9AA 3ITGA 3NQBA 4YXGA 2NWRA 5GNXA 4F2BA 4WXYA 4JTIA 3OODA 5HUOA 3ZVIA 4OIFA 2W79A 2YL9A 4XB3A 3BAJA 4LNYA 1H1NA 1LOSA 3AMDA 1VLWA 4QHRA 1EPXA 4E5TA 2GGJA 4Y6GA 1AW5A 3VINA 2F6KA 1HF6A 1FP8A 3UG3A 1HL2A 1EXPA 4EP8C 4OBSA 3N73A 2X2YA 4KESA 3OBEA 1XDMA 1LBMA 4MKSA 1RVGA 1FCBA 3GR7A 2ZVIA 1IZKA 1H7NA 3P0WA 2ZA2A 1QI0A 4V2XA 4D6CA 1EX5A 1BYCA 2YKKA 1EZ2A 3EXRA 2EQDA 1LF1A 1VIZA 2Y1HA 1H7XA 2ZRZA 4O8RA 3SECA 1EP3A 3KVJA 5CSSA 3CASA 2CLKA 3UESA 3DC8A 4R9OA 4LB4A 4P5UA 1EXBA 5JU6A 4AY7A 2C3ZA 5EKYA 2X2GA 1UD2A 5FOOA 3E49A 5LNUA 1HVQA 3UJRA 4J28A 4PMZA 3DESA 5FJTA 6XIAA 4GGHA 1AG1O 1E4NA 5AY7A 3D0CA 2X1SA 5CPTA 3MHGA 4Y9AA 1JNEA 1K4HA 1ML1A 1YDVA 3SIZA 4RXGA 4IX2A 3CAVA 4M29A 3V18A 3E2RA 3ZJ8A 3MT1A 3P8IA 3PPGA 5AC7A 4HK5A 1A80A 2W61A 1BEUA 3F5LA 1UW9A 2BMBA 5I03A 4DZAA 2PDUA 5EFDA 2Z6JA 3NQAA 4EAMA 2FTYA 4A3YA 5D04C 4IPIA 3TW6A 4J5NA 1IGWA 1VJIA 3W00A 2I9EA 1GGOA 4O1BA 1JYVA 4K1WA 2HTMA 1E4MM 4HA0A 2OWWA 4WZHA 1JCJA 4GI6A 1JJKA 5FF7A 4JTGA 2J9ZA 1PL9A 4A8RA 1FRBA 4LS1A 1UIPA 1J5TA 4EF9A 3EA3A 4LF2A 3S6TA 1E43A 1ZQ5A 2PDNA 4RZBA 3T8QA 5CCZA 4Q4OA 1BGAA 1S2UA 1LQ0A 1V02A 2WMIA 3VMNA 3BH4A 2CETA 1BVZA 1XSIA 1U5HA 4PUMA 1I2PA 3R0DA 3URBA 3KL0A 3BK0A 2WCGA 4JBRA 2Z7KA 2VWTA 5CPNA 3U9IA 4KWWA 4GA8A 1IT0A 2C15A 3HURA 2G3MA 4TR9A 5LYRA 1KFLA 4TU1A 4NJIA 1Z42A 1ZP4A 3CWOX 4S3AA 4XAFA 3Q65A 3AMCA 4FNQA 2I16A 1KNWA 5AYBA 3TYBA 4BS0A 3CZKA 4CQDA 1E9YB 1T5AA 3R8HA 1YXYA 3VD9A 3GZAA 5HK4A 3U5UA 3BAKA 4TUFA 3OW1A 4FOUA 1C7TA 3URAA 1EO7A 1XBVA 1J2WA 3F1QA 4V28A 4HTYA 3UVIA 2B31A 4ML9A 3ZMRA 1MEIA 3E2VA 3H23A 3W53A 3DXIA 1XBXA 4Z2KA 4YYCA 3L4TA 2O7QA 3QBUA 4PB3A 3BZGA 3OA3A 4V27A 3W1LA 2X16A 1XYLA 4NNAA 4XZWA 2GUBA 3LCGA 1YTEA 1LG2A 2W0UA 4L6DA 2EAWA 1BLIA 1HO1A 4A8LA 1DQXA 1S2AA 2X30A 2XFWA 1KWGA