4PBGA

6-phospho-beta-galactosidase form-cst
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
468
structure length
468
Chain Sequence
MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITCNGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 178
structure length 468
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pbgA00
4GI6A 3PZ9A 1G94A 2V3EA 3D5HA 3VTRA 3VMPA 2D23A 4NSBA 1PIFA 3M46A 1GCYA 2W62A 1V0MA 3S6TA 4CD4A 5A2CA 3BAIA 1J9YA 5BROA 3IJ7A 2J4GA 2PI6A 1NWRA 4D1IA 1XYZA 3ARYA 2VC9A 1KBKA 1R87A 1UA7A 3E1F1 1NWTA 3RIKA 3HU7A 4QLKA 3FAWA 1GNXA 2WZHA 4PTVA 4WLCA 1UA3A 4B3LA 5D4YA 1E73M 4GI9A 3CGTA 2D24A 1DWIM 3ZT5A 5ABFB 1ECEA 3VO0A 1G01A 3AIUA 2CITA 3BCDA 1ITXA 1CXLA 4W8BA 6A3HA 4J3XA 1VFFA 1VRXA 1GVYA 2WANA 3RM8A 4P8XA 4RE3A 3UG5A 3IK2A 3N17A 4UFKA 3VPLA 3UESA 1BYAA 1V3JA 1GOWA 1UR4A 2CPUA 5CLTA 1NH6A 2BXZA 2AAAA 3WF0A 3PBGA 1E6SM 5A2BA 2E9BA 4CD5A 2OYKA 1FFRA 2ZUMA 4CU6A 2BVYA 4J28A 2BHYA 3VMOA 1QNSA 2XTKA 3WD4A 1H49A 1U33A 1E3XA 5BXSA 4UCFA 1OINA 4TTUA 3CH9A 3B9DA 4X0NA 5C70A 4AEFA 1OGSA 4UQCA 3BMVA 2ZUNA 4AZIA 1V0LA 1NWSA 4W93A 3T09A 3W6MA 3WMBA 4U3AA 1E6NA 4B9ZA 2O9OA 1B2YA 1LG2A 1ZBCA 5IDIA 4DUXA 4J27A 1XSJA 2A3EA 1EO5A 3ZM8A 2Z1KA 4GI8A 2XHYA 1HKKA 1UD5A 1UUQA 1OD8A 3W53A 4FMVA 3AIWA 1BFNA 2DSWA 3ARUA 3AZTA 1QNRA 1W9VA 3GH5A 4UFHA 2X0HA 3AQUA 1EQCA 3VKKA 4CN6A 3CMGA 1GJWA 2C0HA 4W87A 3SUSA 3OZOA 2AMGA 4OZOA 2X0YA 1CIUA 1HN1A 1E70M 1E9LA 1JD7A 1C3FA 4W84A 2J7DA 1PAMA 4NZCA 1OM0A 2XFRA 2WLYA 3MANA 1EIBA 5AYIA 2VRKA 3KL3A 3RJXA 3UR7A 2PBGA 2CHNA 3WUFA 4PMXA 4HP5A 4ML4A 2VCAA 4P7RA 1V3IA 3U57A 3AYSA 3WF1A 3L4WA 1HJSA 4CD6A 3NSXA 1VEMA 2VRQA 2YOCA 3UERA 1MXGA 3WH6A 4BF7A 1WO2A 3VUPA 1FH8A 5CLWA 4HPHA 1GPFA 1JXJA 4U5KA 4PMVA 1ISVA 1I1XA 1OWQA 1KFWA 2IXVA 2GK1B 3SUUA 3GZAA 3OGVA 3WMSA 1UWRA 3VDHA 1HVQA 4XZBA 2WHMA 4D6GA 1J0JA 1SMAA 4QLLA 3WNOA 4M29A 4AY1A 4EE9A 1GOQA 5I24A 2G3JA 3WDHA 1PJ9A 4XB3A 1E3ZA 5JIPA 4PYSA 2EO7A 1PX8A 1WDSA 1PPIA 2WVVA 2ZUTA 2PWFA 2EPNA 5DF0A 2FHBA 3AOFA 5D9NA 2ZXBA 1GQIA 4AWEA 1C92A 4P7NA 3UETA 1NP2A 5A6SA 2WMIB 1XYFA 1FH7A 2DSUA 1V03A 4H8HA 1JFHA 3THDA 4TX8A 2V3FA 4UFMA 4TX6A 4M81A 1TVNA 2D20A 3PHAA 5A6BD 1W1PA 1BYBA 1H2JA 2EPOA 5E6ZA 6TAAA 1JZ5A 5A69A 2ZX6A 2CKRA 1G1YA 5C71A 4U2YA 1B0IA 2WHLA 2RGLA 3OLGA 4ZXOA 3NSMA 1VF8A 5ABGA 2X09A 2GVYA 4UFLA 2ZUVA 5A8QA 3W38A 1SFSA 3WY1A 1JZ2A 4EAMA 5BWFA 2WBGA 5TD4A 2Y8VA 2J7GA 4GKLA 3CMJA 2YL9A 3VGFA 4Z2IA 4F66A 4MNLA 3SCWA 4IM4A 1JYNA 1BAGA 2GJRA 2Y2WA 1E6ZA 2GJXB 3PZMA 4B3KA 2YBUA 2BV9A 3ARVA 1E5NA 3EDEA 3WH9A 3WN6A 1VEOA 1EGZA 4E4PA 3L2MA 1X6NA 3BAXA 4D71A 3K1DA 4LPCA 2D1ZA 4JFWA 3F5JA 3W28A 2NSXA 4TVCA 3B9EA 1C8YA 5LA1A 5BYWA 2WLZA 2F2HA 2QV4A 2YDRA 3LPGA 4M8UA 1XH2A 2WSPA 2CEQA 1U30A 1CENA 3AHYA 4QCEA 3L2LA 4LX4A 3LPOA 2WC3A 4ATLA 1JAKA 1C91A 4HMEA 1B3ZA 4Z2GA 3FXYA 3B9AA 2A3BA 3J7HA 4H41A 1CTNA 2JIWA 4BZYA 4BQ4A 4ZENA 2FH6A 2CIPA 2PWDA 3AIBA 4N0RA 3WQ4A 1XD1A 1EA9C 1M01A 1L0PA 5JIWA 4CCDA 1E4NA 1H3GA 4JZ5A 4D6DA 1BTCA 2VURA 4H8VA 1LJYA 2VX7A 5D8WA 3ZR5A 1NOUA 3GNRA 3QOKA 4F9JA 1EHNA 2VX5A 4OIFA 2V5CA 1UWQA 1IZKA 1CWYA 4PMRA 3CIVA 5JBEA 2XG9A 1UKQA 4JFSA 1WZKA 4MB1A 2G3MA 2F8QA 3BH4A 5ABEA 3WQVA 3A6OA 3SCTA 3LPPA 1JGIA 3QHOA 1XSKA 1QNQA 2J77A 2WWDA 3WFLA 4B9YA 1HL8A 4UQBA 1QHZA 1PX4A 3AMKA 1JYVA 1H09A 4ACZA 4QAWA 1TVPA 4MB4A 1B3XA 1CXIA 4R27A 2WMJA 3UR8A 3BLKA 4D6HA 3MUIA 1EOKA 1JZ6A 2XFYA 5EB8A 1GQLA 2VOTA 1UHVA 3WH7A 2UY2A 1PZ2A 5JUVA 4UFJA 1HJUA 1MW0A 3AHZA 3VU2A 1B1YA 1KXTA 4FLSA 5FD0A 4D6JA 4BCEA 1BQCA 4PTMA 1FP8A 4JCMA 2J25A 1W3KA 1HL9A 3LMYA 3EYPA 1QI2A 1DWJM 3ARPA 3AROA 3K4AA 2BNJA 3WL1A 3TA9A 1OGBA 2WKGA 3D3AA 1PEZA 3VINA 2WK2A 4AEEA 2GFTA 1DWFM 2YDSA 2XM2A 2QMJA 3VD7A 2BFGA 3VIOA 1GOOA 4AZHA 2EPKX 2OYLA 4JCLA 4JKLA 1WDQA 4JIEA 4PCSA 3U5UA 4NI3A 3O2LA 4AD0A 1GQKA 4CKQA 5FOOA 2J62A 4AIOA 4AZGA 4PMDA 1VB9A 1MW1A 1DEDA 1EDGA 4PTWA 3AIEA 3BSHA 1J0HA 2ESCA 1W91A 3AIQA 4MAVA 1ZJAA 5FCZA 4AZCB 2WB5A 3AXIA 1XHGA 3SCQA 2FGZA 1M7XA 1UD6A 1B90A 1C8XA 3WL0A 3CHEA 2WMKA 3WKZA 1VJSA 1H11A 4B16A 2BY0A 1C90A 4W8LA 3OLDA 2VQUA 1C93A 4WKFA 2A3CA 4W85A 2WZEA 4UTFA 4M82A 5CJ5A 1KXVA 3TTSA 1FH9A 1JNEA 4GZEA 1GVIA 2ZE0A 2DPEA 3RM9A 1E0WA 1TG7A 5AY7A 2DIJA 1KCLA 5A6AA 5AC4A 2EEXA 3CUJA 1JFXA 1TFVA 3CHDA 4JL2A 3ARZA 3W37A 3KZSA 3CUHA 1W1YA 2G4FA 1JAEA 2ZUWA 4GIAA 5JBFA 4PSRA 2O92A 4E2OA 1BGGA 3AXHA 1X6LA 3VD5A 2EQDA 3F5KA 4HU8A 2YLLA 1L8NA 2WSKA 2WMFA 4TXEA 3ZSSA 4D1JA 2XSBA 1SMDA 1UD3A 3M7SA 4JL1A 4W7UA 1MW2A 3U7VA 3VIKA 3W29A 2DDXA 4DWSB 2J75A 3NSNA 1EQPA 3BC9A 3FAXA 5HOSA 3KEHA 3U7BA 1UH4A 4ZFMA 5CG0A 2WMHA 3MUZ1 3ZT6A 1V6UA 2D3LA 3GBDA 1EH9A 2YLAA 2AOSA 1US3A 2D22A 3ECQA 9CGTA 4X9YA 2W66A 3MKKA 3GDBA 4KH2A 1B30A 2ZXQA 3W6LA 2WVUA 1RP9A 1R85A 2Y4SA 3AS2A 1QHOA 1GOMA 2PWGA 4UQEA 3AMGA 3OB8A 1ZBKA 1E4LA 1XD0A 4ZEPA 5HNNA 1R7OA 3NCOA 5HDRA 1QNOA 4AIEA 2VZVA 3SURA 2FHFA 3SCPA 2VO5A 3VGHA 3W24A 5I5RA 2ZX7A 2YDQA 3GM8A 5ABHA 5CGMA 4CD7A 1NOWA 3TTQA 3GNPA 4ZXLA 3VIIA 1PIGA 1NWUA 1Q6GA 1J10A 2ZX9A 3ZOAA 2BY1A 2TAAA 3EMCA 3N04A 4AYSA 3IAPA 2G3IA 2CBJA 3ZSTA 3ARSA 2WYSA 2GDUA 2QMKA 2E8YA 5IFTA 3WUGA 3GTNA 1NOFA 4UQDA 3WF2A 2WCAA 1LLOA 3BCFA 4H7VA 1J0KA 2XWDA 3VM7A 3GH4A 3WQ5A 2BVDA 4U33A 4CUCA 3AIVA 4QCFA 1WZLA 5DT7A 2ZXDA 3PZUA 2QF8A 1D7FA 3WF3A 3WEZA 4J3VA 3VILA 3CUGA 3MSDA 3CZJA 5EBAA 2PF0A 3BMWA 3O9NA 3GXMA 3S2CA 2UY5A 5E09A 3MSGA 4ZE4A 3ZT7A 1SR0A 4V27A 2DT0A 3N15A 3CUIA 2JE8A 3QGVA 4JFVA 2XVLA 4J3UA 4CD8A 2NT0A 1E6PA 2BS9A 2VCCA 2ZICA 3L4VA 3VGBA 3L4TA 3I3DA 4D6FA 1K9FA 4PCTA 4J7RA 4HOWA 1AMYA 3NYDA 2HVMA 1C7SA 3BAKA 3DHPA 4GQRA 4TOQA 3WEMA 5A8NA 1CLVA 2OSXA 4JHOA 5E0CA 2WC7A 4TTGA 4W86A 3FY1A 5I77A 1V3LA 5CSUA 3EDJA 3RJYA 1OGGA 3VX1A 1OIMA 4LYQA 4PBGA 5BRPA 2YL6A 1AQ0A 3N11A 3VVGA 3ARXA 1SYTA 5GQBA 4UZSA 4IUGA 1MFUA 1Q4NX 3K8KA 5DT5A 4UOJA 4MB3A 3VGDA 1UR2A 2WMIA 1B3YA 4W7VA 1VEPA 4P8VA 1BSIA 1CDGA 4MADA 3O6AA 2DEPA 2WC4A 3T0BA 1JIBA 3VIHA 1JZ3A 1ZB5A 1UG6A 4MNJA 4PMQA 1CNVA 2A3HA 2X8RA 3L4XA 5LA0A 5A6JA 3AI0A 2W61A 4KGJA 2YBTA 1O7AA 2XGBA 1AQHA 1FOBA 3WBEA 4OBSA 4UOZA 4UNIA 1GOIA 1D3CA 4HZ8A 2DH3A 2F61A 1VAHA 3WNNA 1OT2A 2OYMA 3AHVA 3VD4A 1XV8A 3DECA 3ALGA 3EDKA 1UD4A 4PMNA 1GJUA 3IJ9A 3MU7A 1LF1A 2VT0A 1QW8A 1UKOA 4DUVA 1UKPA 2DSKA 1KB3A 1M04A 3KL5A 1GORA 1EXPA 5EFDA 2WVVB 1E6QM 5DMYA 1BGAA 2GJXA 4WK9A 3IAQA 1MWOA 3RPMA 1US2A 3W0KA 1V3HA 3NDYA 4N42A 4TVUA 3AJ7A 1GHRA 4FLQA 5HXMA 4B15A 1WB0A 5D9MA 4C7DA 3N13A 3QHMA 5A95A 4X0VA 3HJEA 3AICA 1GUVA 1V3MA 1B31A 4URIA 3AISA 1HXJA 2CHOA 5EMYA 5GPRA 5A8PA 1QNPA 4PTXA 2JEPA 1XRVA 5A94A 4Y7EA 1WNOA 2J7FA 3BXWA 3EBVA 1DWHM 4IPNB 7TAAA 5D8ZA 2CESA 3EDFA 4YN5A 2O9PA 4AZ6A 4EKJA 2E3ZA 1W3JA 3APGA 3DYPA 1TZ7A 3OG2A 1YQ2A 4HZ7A 2XVKA 3CUFA 1JF6A 1HKIA 1O6IA 3ZIZA 2QHAA 4H8UA 2W91A 2D2OA 3AYRA 3AS3A 3GYCA 1UZ4A 1F4HA 1MXDA 2YIHA 1R8LA 2OLHA 2XJ7A 2YKKA 3N18A 3W4RA 1B9ZA 4PMZA 4CU7A 3WD2A 3VIFA 2DSZA 3RM4A 2WNWA 3TONA 2VX6A 3QR3A 4F9DA 1W9UA 2FH8A 2PC8A 3ARTA 4XV0A 5BRQA 1JZ4A 1IV8A 3VDBA 2YJQA 4PRWA 2J7CA 1W3LA 3W25A 4DWSD 1WE5A 4CN4A 1PZ3A 2WVTA 2G8ZA 2OWXA 3VIJA 5D9OA 3UCQA 2JEQA 3U5YA 4JAWA 5BXRA 4MB5A 4MNKA 2XIBA 3SCNA 5A3HA 2WKLA 1LWJA 4S3KA 1H1NA 1E1EA 1KGXA 4MNMA 1IZJA 2CBUA 1DWGM 3BAWA 3II1A 5E6YA 1HNYA 1E40A 1A47A 2DIEA 2VMFA 2XUCA 1JYXA 2WBKA 3SCOA 3SCVA 1KXQA 4AD2A 1MQPA 1UKTA 3I3BA 4U31A 1Z32X 4K68A 3GBEA 3BLPX 3SUWA 1ODUA 3GH7A 3FN9A 2UWFA 3OIHA 1RP8A 4BA0A 2B31A 4KMQA 1NM9A 1RPKA 2WZIA 5GNXA 2C8NA 2VTFA 2A3AA 2J47A 1CZ1A 5A6BA 5M5DA 1NARA 5E9AA 4WSKA 1RH9A 4CN1A 2CBVA 1TA3B 4AISA 1JYWA 3WQ6A 1AVAA 1JNDA 1UWTA 3UEQA 8CGTA 1GW1A 4A3HA 4P8UA 4CVUA 1UOKA 2GSJA 1CXKA 2NW0A 1E55A 5LA2A 1BLIA 2V3DA 3SIMA 1FHLA 3KL0A 3WNPA 1JD9A 1Q6CA 1I1WA 4TVDA 1MQQA 4PMUA 1V02A 3L4UA 4MDOA 5CQ1A 4AXNA 1K9DA 2D0GA 4YHEA 3I3EA 1HJQA 2XVGA 4ACZB 5EFFA 4D72A 4P7OA 2RGMA 4PSPA 3RILA 3PZGA 1FP9A 2YL8A 3A4AA 5GNZA 2J8GA 2Q8XA 1HJWA 3ZJ7A 2ZIDA 4W8AA 3CZ8A 2QPUA 2O9RA 3MUY1 4AZCA 5ECUA 6CGTA 2PWHA 1W9DM 3VGEA 1V0KA 2DH2A 2DT2A 5HBFA 2WCGA 2IXUA 1MYRA 1QW9A 5IHSA 5D9PA 2CETA 2ZXAA 1JDDA 3FW6A 4UFIA 4R5EA 3L4ZA 2ZUSA 4UR9A 3UG4A 3ZJ8A 1EDTA 1V6YA 1V02E 3SCRA 1E4IA 3EMZA 3TP4A 1LQ0A 4YPJA 3WDIA 4MJ2A 4ACYA 1W9PA 3AXXA 1QBBA 2VVSA 2W5FA 2V5DA 1CXEA 3GXDA 1ESWA 1ZU8A 4UQAA 3HMCA 2XPKA 1LWHA 3G6LA 3WENA 1OD0A 1KR0A 5M3WA 2WCSA 1CYGA 3AS1A 4CCEA 1WDPA 1C8QA 2J79A 4V28A 1CXFA 4NRSA 1J01A 3W82A 2XVNA 4EANA 1LG1A 1FFQA 2E4TA 4J3SA 3WELA 1NQ6A 1XCXA 2G41A 4HZ6A 4L4OA 3T2OA 2XYLA 3VGGA 4AZ7A 1BYCA 1NP0A 1W1TA 3WQ8A 2J78A 1HF6A 1UH2A 1KQYA 2QLYA 3SUVA 1ITCA 3BGAA 5ABFA 5CXPA 1HKMA 4GINA 4W5UA 4F79A 1HKJA 1HT6A 3PTQA 2VJXA 4PMYA 1QHPA 4AIUA 2VZSA 1D2KA 2VQTA 1G5AA 1YHTA 4OJYA 2CYGA 1BVZA 3G6MA 2CKSA 3WD1A 1DHKA 1EOMA 1A3HA 4U5IA 2DGAA 1V6VA 4PUEA 3CO4A 5FIPA 2VCBA 1VFUA 1U2YA 2WHKA 1UR0A 2VNCA 1BPLB 3JUGA 1CGVA 1WZAA 4HPGA 3CHCA 4J3TA 1M53A 4M56A 3WDPP 4D6CA 3ZJ6A 5A6KA 1V0NA 1E15A 2X1IA 2WVSA 2ZWYA 1V6XA 2XGIA 4D6EA 3ALFA 3PZTA 2E9LA 3QHNA 1AQMA 5I79A 4PN2A 1BVNP 4WF7A 5A8OA 1DP0A 4UQ9A 2VL4A 3WNMA 3WNLA 3OZPA 3VIGA 2ZWZA 5A1AA 2VR4A 5CPSA 1BG4A 2VZOA 1V3KA 5E0FA 2EJ1A 4V2XA 1UKSA 1OT1A 3QOMA 2PB1A 2VX4A 3UG3A 4HU0A 1G0CA 5GNYA 1OB0A 2JF6A 1HIZA 3B8SA 1K9EA 3WH8A 4NRRA 1W2VA 1QI4A 5FL1A 3A4WA 2WXDM 4AZ5A 2W67A 5I3DA 2E9MA 2ZX8A 3CZGA 4OOUA 4AD3A 4WKAA 1MW3A 3RCNA 3POHA 2CXGA 2J8FA 3KE0A 3VMNA 2WHJA 1E56A 1UWIA 5HPCA 1R86A 2BHZA 4JFUA 2Y24A 2BVTA 2WMGA 1HX0A 2XSAA 2YA0A 1UQYA 1H41A 3AMLA 1P6WA 3WH5A 1E6RA 4KRTA 1KXHA 2EPMX 3PZVA 3CZLA 2W4XA 4MPKA 3EMQA 4Z2KA 2WW5A 1PBGA 1WAWA 4AC1X 1EHAA 1QPKA 1S46A 4M1RA 2XVPA 5AYBA 4YHGA 4HOXA 3M6DA 1Y7VA 3GNOA 1X1NA 4GQQA 5IHRA 2GK1A 1F4AA 1ISWA 3VD9A 3KWXA 4KWUA 1ZBVA 2D0HA 2C7FA 3VDAA 1CLXA 3CZEA 1HJXA 3MV01 3VD3A 5A6LA 2JF7A 3PTKA 1MQRA 2YL5A 1OIFA 1UR8A 3N1AA 2DSVA 7CGTA 1Q6FA 1J11A 1VBRA 4E8CA 1W2PA 2VUYA 4XUYA 2WM0A 4ATDA 1GHSA 5BXPA 4LXFA 3WFZA 1GOKA 2EXOA 1K9TA 3POCA 1JDAA 4QFUA 4IISA 1E5JA 4AZBA 2VI0A 4GO9A 3WBAA 3NIYA 2XFFA 4GPNA 5BCAA 1E71M 1BF2A 3OA5A 4FK9A 4AD5A 1WDRA 3PZNA 1QI0A 5I0DA 1WZMA 3WEOA 4FF5A 4W5ZA 5FKYA 1JXKA 4W7WA 4DWSC 3MUAA 4S3JA 4MDPA 5IXEA 2ZUUA 4C7GA 3IANA 1EO7A 2CCRA 2OWCA 4A3YA 1E72M 5CZKA 3WDRA 2DT1A 3HN3A 4HOZA 5KEZA 1CGWA 1Q6DA 4ATWA 4LGXA 4KRUA 1QI3A 2JIEA 4U2ZA 2ZOXA 3AMDA 4HA3A 3AIRA 3PTMA 3PZQA 4RE2A 2J7EA 4NF7A 4KGLA 4Z2LA 2VVNA 3NJ3A 4PMOA 1KWGA 5I23A 4Z2JA 2VR5A 1CGXA 2QPSA 1VIWA 3OBAA 1W3HA 3WDJA 4CGTA 5I6SA 1UD8A 3CTTA 1G9HA 1ODZA 1TE1A 1VFOA 5KZ6A 1XCWA 3CLWA 2DQXA 1Q6EA 1H0IA 2PBOA 4M80A 4WSJA 3WSUA 3MS8A 1ZJBA 1ZBWA 1QOXA 1E1FA 3SEPA 3MMWA 5I78A 4W89A 4QDMA 1J18A 3W27A 1HVXA 3ARWA 3T08A 1H0GA 1E4MM 3WQWA 1KCKA 4GXPA 5FL0A 3LPFA 4HMCA 1JG9A 4RE4A 1JI2A 1JZ8A 1ZL1A 4WIWA 4DM1A 1B3WA 3F5LA 5IFPA 5DFAA 2J7HA 3DYMA 1J0ZA 1QI5A 3W26A 4FLOA 5LYRA 3AMCA 4BQ3A 3DHUA 3A47A 2V38A 3CBWA 1B3VA 3K46A 4AMCA 4MTVA 4A4AA 4QP0A 4P7QA 5CPQA 1R7AA 5BXTA 1TUXA 5JBDA 2W92A 1VFMA 1OCQA 1I75A 1XH1A 4JFTA 1JF5A 3A3HA 2G3NA 1VBUA 1MVYA 3AHXA 1H5VA 1CBGA 1UZ1A 2EPLX 4BQ5A 3GXFA 4BS0A 4AD1A 1JZ7A 4OKDA 2D0FA 3VIPA 1CGYA 4HA1A 4XX6A 4QLJA 1JDCA 3DYOA 3WIJA 3T2PA 1W1VA 1W9XA 3OGRA 7A3HA 3N9KA 3VDCA 2E0PA 4GZIA 3W81A 2CERA 3VM5A 1EDQA 1UR1A 1DWAM 4U3CA 2FHCA 4FLRA 1M03A 2HISA 3NDZA 4LQ1A 1CGUA 1CPUA 3TTYA 1TMQA 2OSYA 4Z2HA 3MMDA 8A3HA 3ZQ9A 1CGTA 3OGSA 4JHZA 1KR1A 1KGUA 3ARQA 3BSGA 3TTOA 1KGWA 1E6XM 4HA4A 4CU8A 2VZUA 4GO8A 1UYQA 4C7FA 4EK7A 3T0AA 2V3GA 3AS0A 3RDKA 1OSEA 1UR9A 3VNZA 5A8MA 3PZOA 5DEZA 1W9BM 4W88A 1WKYA 4H04A 3SUTA 3CHFA 3A4XA 3AZSA 2Z1SA 2J74A 1JL8A 4OUEA 3WF4A 1JI1A 2CNCA 4D6IA 3WUBA 2E40A 2GUYA 1WCGA 1CXHA 3DC0A 1J12A 1RD6A 1ISXA 3FHAA 4MJ4A 2FDMA 1TA3A 3WD3A 1HP4A 2WAGA 3BAJA 1FA2A 4JKKA 1XH0A 3CPUA 5AC5A 3ZO9A 2WPGA 3THCA 5I2UA 3AFBA 3T0DA 5CGTA 2UY4A 1LL6A 3BAYA 5M17A 3SCUA 4F8XA 1TCMA 1XC6A 2MANA 1V6WA 2VZTA 1HP5A 4JKMA 4Q7NA 2BXYA 3VIMA 5C8BB 1DTUA 1VENA 1WPCA 5M03A 3F4VA 5A6MA 3OLEA 4UZUA 4GZJA 3ARRA 3ZMRA 1MFVA 2X05A 4BQ2A 3GXIA 1E0VA 1E0XA 2PWEA 3FHQA 2OWWA 3CZKA 1KQZA 2EBNA 4CCCA 4CVWA 4P7LA 1J0IA 3VOCA 1BHGA 1GONA 3FNDA 2BHUA 4PUDA 3OLIA 1V08A 1UWUA 1ZS2A 2XM1A 3ZR6A 1XSIA 1CEOA 5A2AA 4Q22A 3EDDA 3K8MA 4P8WA 2E8ZA 1UQZA 2GJPA 2DT3A 2X2YA 2JFEX 1ISZA 2Y5EA 3SCSA 1H4PA 3N12A 3PZIA 1LL4A 2XWEA 3TOPA 3WD0A 1E43A 1LL7A 4M24A 3L4YA 1C7TA 1HJVA 2NT1A 3T2QA 3ZJKA 3M07A 2Y8KA 4ZE5A 4AD4A 1OBAA 1TR1A 1UH3A 4L4PA 2OSWA 3MMUA 1BG9A 1IT0A 2D3NA 5CPTA 3WDQA 4PEEA 5E70A 4E8DA 4AW7A 2XIIA 4HMDA 1UWSA 3NUKA 4DUWA 4RL3A 3WUEA 4WJXA 4UOQA 1BYDA 3RMEA 1KBBA 3VNYA 2UY3A 4OOZA 3WMCA 1XGZA 1ISYA 1W32A 2W63A 2WWCA 2JALA 2VRJA 3MO4A 4LYRA 2GDVA 1K6AA 2J7BA 2O9TA 1KWKA 4XZWA 1PX3A 1VJZA 4H2CA 4WKHA 1QVBA 1J0YA 1UD2A 4OBRA 4TUFA 2FGLA 1QBAA 1GZJA 2YA1A 3K4DA 3VX0A 5F7UA 3IJ8A 2IUZA 3RO8A 5DO8A 3WNKA 5HPOA 1WP6A 4HTYA 2BY2A 3PN8A 3K8LA 4DWSA 2ZX5A 4LYPA 3AZRA 4DM2A 5CSYA 4IPLA 3MV11 1N82A 1GQJA 1CECA 3AHTA 4MAZA 4J3WA 2YA2A 1FHDA 2BY3A 2CBIA
chains in the Genus database with same CATH superfamily
3TLQA 4C91A 4EP8C 3PZ9A 1G94A 3W9ZA 1I8JA 3VTRA 3VMPA 2D23A 4NSBA 4UTMA 1PIFA 1GCYA 1XBVA 1JDEA 1V0MA 1W56A 6REQB 1R3SA 1S5VA 3I65A 1OFPA 1NWRA 3N19B 1XYZA 3ARYA 1KBKA 2XSXA 2QCFA 2ZRWA 4GVHA 1NWTA 3UF9A 2VFGA 1MUMA 3BGGA 1GNXA 1BXBA 3KWSA 3ITLA 4HNNA 4PTVA 3NEVA 1EJWC 1GYNA 1P4CA 1P1XA 1XLDA 1E73M 4I5RA 1LRTA 3OVQA 3AWOA 1KM1A 3N2MA 2D24A 2FZMA 4B5WA 2ZCGA 5ABFB 2WZTA 2RDWA 1TPH1 3L65A 1G01A 2A0NA 4W8BA 1ITXA 6A3HA 4JIIX 2QCEA 4H9UA 1VRXA 4QS6A 1QXLA 4RE3A 3IK2A 1IXPA 3EXTA 4FS9A 1E0TA 3QY7A 4S3GA 1OF6A 2MNRA 2AAAA 4RZBA 1FFRA 2ZUMA 2R8WA 3H2FA 5JQ9A 3LYEA 1QOPA 3FKKA 1VCGA 3TXVA 1TPVA 1OABA 1OINA 3GB6A 2WQDA 4X0NA 4AEFA 3TWBA 1M65A 1NWSA 3W6MA 3WMBA 4U3AA 3G5EA 2O9OA 2ISFA 1ZBCA 5IDIA 5EYWA 4JYDA 4S2CA 3SN0A 3ERPA 2PRLA 2A3EA 1ZZMA 1PKLA 1EO5A 3ZM8A 1HKKA 4O14A 3ABSA 3W53A 5FJIA 4NKCA 4AC7C 1BFNA 3AZTA 4GCAA 4B2DA 4CLMA 4UFHA 1EL3A 2HBXA 3HFYA 5LXEA 1JDFA 2C0HA 3FSUA 4W87A 1UP2A 4JTFA 2GJNA 3K13A 4H6KA 1BWVA 2ZC8A 1FWNA 1E9LA 2PCQA 1QPOA 2J7DA 1PAMA 5C7HA 2WLYA 3MANA 5AYIA 4AWTA 3RJXA 2PGEA 1XLAA 4UMAA 3WUFA 3SRFA 3Q45A 4HP5A 3MSYA 4P7RA 3AYSA 5G4EA 4QHRA 2B81A 4HHLA 1QK2A 5AC6A 1MXGA 4IXXA 4BF7A 3TIMA 1GPFA 3INPA 3I7QA 5LIUX 1MUCA 2Q8ZA 2H9AB 3TFXA 1DQUA 5LIYX 3LSCA 3GZAA 1YDVA 1TQXA 2GZXA 3O0FA 1HVQA 2VFFA 1A5NC 4QLLA 1IWBA 4M29A 4AY1A 2YB1A 1GOQA 2NX9A 3CIWA 3JZUA 4O8AA 1U83A 4RDWA 1F3TA 4XB3A 1FWTA 1E3ZA 5JIPA 1F76A 5H8PA 2PAJA 3MWCA 3TC7A 3UPBA 3MPGA 1EFZA 4LF2A 4HJWA 4DZ5A 3LHVA 4JTQA 4C1KA 2FHBA 3AOFA 2OELA 2ZXBA 4AVFA 4AH7A 1AJZA 3G18A 2OKOA 3H2NA 8XIMA 3IUIA 1XYFA 1FH7A 1JFHA 5CBIA 3SGUA 3THDA 3P74A 4NZ3A 5D30A 2WNQA 3HFTA 1TVNA 3G0SA 3WK2A 4C5ZA 3FV9A 1OX6A 3E49A 3MHFA 4WQ6A 5A6BD 1W1PA 2EPOA 4RV3A 3R2GA 3T4CA 2XIOA 5A69A 1FKWA 1AMKA 1PO9A 3PBYA 3U2ZA 3EOEA 4U2YA 1B0IA 1LUCA 2WHLA 3PJWA 5IM51 3OLGA 4ZXOA 4G5DA 1X8CA 4LH8A 3GC2A 1KV5A 2GVYA 1VHCA 2VGBA 1SFSA 3WY1A 4L6OA 2ZTJA 4JTGA 3TN5A 4I9AA 5LXXA 2YX0A 4KFPA 4F66A 1BAGA 1E6ZA 4OT7A 1ZHAA 4MWAD 3L5AA 3P61A 3WH9A 4K7YA 4XZHA 3WN6A 5DMMA 1NDWA 3BAXA 3SQMA 4D71A 1OEPA 2WNZA 4EX4A 3QR1A 3E38A 4JFWA 3F5JA 4H9MA 3GHRA 4I6VA 2DORA 2ANUA 1LRNA 2NV2A 3LNPA 3V1PA 5LA1A 3TYEA 2WLZA 3KDNA 4IP4A 2YDRA 1XQLA 3W7LA 3E96A 1U30A 1YRRA 1I2OA 1SR9A 1OZMA 4LX4A 1DJZA 4QG6A 2WC3A 4PB5A 1B3ZA 3P0WA 4FF7A 3FXYA 3B9AA 3J7HA 4H41A 5DQPA 4ES4A 4ZENA 3PM6A 3KHJA 2FH6A 3AIBA 5BMWA 3C3UA 3WQ4A 1TE6A 1EA9C 1JQXA 1S5MA 3LQLA 4E5TA 4MY8A 4CCDA 4UBPC 1LOQA 1OFAA 3KS5A 1XF0A 2ZBTA 3G3MA 2VURA 2QVHA 3GNRA 3QOKA 4F9JA 1QDSA 4Y8EA 3CL6A 4LUSA 3QY8A 1HKWA 1S3HA 2XG9A 4RDZA 3QC0A 2C1GA 4QSHA 1TV3A 1MZRA 4FR1A 4JTCA 4MB1A 2GVEA 2F8QA 1S5WA 4C6JA 3WQVA 2GJLA 2J77A 2QCHA 3GU2A 1GOXA 3F2BA 1QHZA 6ALDA 1JYVA 2D2HA 4OWGA 1DXFA 1US0A 2OOFA 4QAIA 4K2SA 1THFD 4DAIA 3BLKA 2X42A 4DZHA 1UHVA 3WH7A 4G1NA 4XISA 4OVXA 1PTDA 2PDJA 5C7VA 1HJUA 7ODCA 4DY1A 3HIJA 4YMZA 4D9PA 1UIOA 4GOAA 3MVIA 3BTNA 1XKYA 4AX6A 3LMYA 2NVDA 3ARPA 3AROA 2BNJA 1YPIA 1TTJA 2ZA3A 1RJQA 3EAUA 3D3AA 2AAMA 5C55A 1P0EA 1HZYA 1YKWA 3QV6A 1E9YB 2QMJA 3VD7A 4HSNA 3VIOA 2NLYA 4MWAA 2EPKX 2OYLA 4S23A 4XUGA 4PCSA 4JIEA 3M47A 4NI3A 3O2LA 4I9JA 3WLSA 4CKQA 4LNCA 2B7OA 1VC4A 3W7GA 2ON3A 1J0HA 1Q8AA 5HMSA 4LCSA 2PDLA 1ZJAA 4AZCB 1AL7A 1JRCA 1ZCOA 3AXIA 3B0YA 4O0QA 5BU6A 3TMLA 3CK5A 3B8UA 1UD6A 4OQVA 3S9IA 3LD5A 2BOGX 3QV8A 5MF5A 3W01A 4XKMA 2XU2A 2NQJA 2A3CA 4M82A 1KXVA 1P0DA 3TTSA 5LSMA 3PR2A 4FXJA 1JNEA 1KRCC 2OX4A 1J96A 2IPJA 4ADUA 2EEXA 4IPPA 3E6EA 1TFVA 1N2VA 4ZB0A 4GD0A 1S1RA 1IEVA 3CUHA 1JAEA 3P81A 5FJOA 1JRBA 1XUUA 4PSRA 4WOZA 5JBFA 3VUSA 3BO9A 5CEWA 3LCFA 4TXEA 2VOMA 4K36A 2XSBA 4KRZA 5TNVA 3EX4A 2O7SA 4AHPA 1YPXA 3NSNA 1EQPA 2GGHA 3FAXA 3BG9A 2WMHA 2A2IA 3SW6A 3S5NA 1H7PA 2GOUA 3GNXA 4EPEC 1SW3A 1GVQA 2D22A 2OTDA 3BJFA 4ZO8A 3E0FA 2LLEA 2O55A 1B9BA 2RDXA 3CC1A 1DVJA 3GDBA 4I9TA 3W6LA 4PODA 1Q6RA 2DUAA 1RP9A 2X1TA 1QHOA 1GOMA 2FIQA 3NXFA 2YCEA 1J5SA 3S2JA 2VDIA 1MZHA 1EEXA 1VRDA 4GUJA 3TZFA 4WZHA 3NCOA 3V0UA 5FAJA 3D0CA 4XO7A 3QLLA 4LRSA 4Q32A 3WJSA 4I6KA 3I68A 3W75A 3VCNA 3W24A 2QKFA 4IX2A 5I5RA 3E2QA 2PZNA 5ABHA 5CGMA 4G56A 4GIEA 4ZXLA 3PANA 3N2TA 1Q6GA 4M5PA 2RJHA 2ZX9A 2BY1A 3RPDA 3GTHA 3WMLA 4CEUC 4XBSA 5HAOA 1P7TB 3H24A 1XIJA 2CBJA 3B8VA 1P43A 4LNYA 4EXQA 5T26A 3BWWA 1EUNA 2WYSA 3GKAA 1DBTA 3WUGA 3STFA 1M9HA 1NOFA 2ISSA 4IT1A 5HMFA 4YYFA 4Z0JA 2QPXA 2XWDA 3VM7A 1MO0A 1L6FA 3LUTA 4HCHA 3GIYA 5DT7A 3PZUA 5LIXX 4J3VA 3CUGA 1A5KC 4FSAA 5EBAA 3UBPC 1AW1A 1H60A 5AHMA 4UB9A 3N15A 2EAWA 4JFVA 4GC3A 2VCCA 4KWOA 3N2BA 1MNSA 3GHSA 3M64A 4GMEA 2CU0A 3L4TA 3HZ3A 4DBUA 4PCTA 4J7RA 1AMYA 3IV3A 7XIMA 3VOFA 1E1CA 5JH2A 3WEMA 3ATZA 1CLVA 2OSXA 1F8IA 5E0CA 4W86A 5I77A 2QYGA 1O68A 3TCEA 2HROA 1B3OA 1XIFA 3W2LA 2OG9A 1OIMA 4C6NA 4H6RA 3T6CA 3BCJA 4O28A 3WZ0E 5GQBA 1Q6OA 4IUGA 3DAQA 3K8KA 5DT5A 1YPFA 2WMIA 1EC8A 4W7VA 5G2HA 4GYPC 1CDGA 2ZZ5A 3O6AA 2DEPA 4XZLX 3T0BA 1JZ3A 3KTCA 1UG6A 3M5VA 4F48A 4LVFA 2X8RA 1XLBA 2CLLA 1XXXA 5DRIA 1XIGA 1FOBA 1V51A 5LHFA 1UJQA 4ZMGA 4UNIA 3M43A 2DH3A 2F61A 1VAHA 4INFA 4TU1A 3VD4A 1XP3A 2NX1A 3S1GA 1ZENA 1R3TA 3IJ9A 5CC3A 4LF1A 2DZBA 1UKOA 3RU8X 3T1GA 1K7EA 3OTRA 3P6LA 5DMYA 1GK8A 1QU4A 5C6MA 1KKOA 2QIWA 1U5HA 4D8ZA 4WK9A 1IHIA 1MWOA 3RPMA 3AAMA 1US2A 3NDYA 4TVUA 3AJ7A 5K9XA 1GHRA 3W7PA 1GVFA 1LROA 4JYEA 5HXMA 1I60A 1SSDA 1TWIA 1WB0A 4ZFCA 5D9MA 4C7DA 3N13A 5A95A 3MUXA 1AH4A 1G67A 1B31A 4QIUA 1RBLA 1RY0A 5I07A 1D3HA 3HG2A 1BXCA 3S2MA 1TPDA 4DJFD 3W70A 4O0KA 4XAGA 1IIHA 1JCLA 5H2ZA 1LORA 1A5BA 1YDNA 2J7FA 1KFLA 3B4YA 4LVGA 2YPIA 1FWAC 3W1UA 2TRSA 5AHIA 4N9CA 7TAAA 1I0BA 4DBDA 5F2MA 3GDTA 3EDFA 4AZ6A 1CI1A 1TPEA 4UXDA 3IPWA 4H7CA 1TZ7A 3DUGA 1YQ2A 3IVSA 2B7NA 2NUXA 1D8CA 1HKIA 1O6IA 4PC8A 3ZIZA 3DBNA 3IARA 2D2OA 2P88A 2XIQA 3AS3A 1S1PA 4KQNA 1UZ4A 9XIAA 1R8LA 4MG4A 4V1XA 2DSZA 4DZIA 2VX6A 1ONEA 2VYOA 4WVXA 5BRQA 1DIKA 1EEPA 1W3LA 4DWSD 4YWIA 3RX3A 1KTNA 3F1QA 3S5SA 1XYAA 4BWLC 3UCQA 3U5YA 4JQ4A 2GUUA 4PR4A 4IQDA 2XIBA 2F9RA 4ROQA 1KBJA 3SCNA 5A3HA 1H1NA 1IZJA 2CBUA 1DWGM 1MEWA 2YB4A 3DFSA 3LSBA 1E40A 2Z7GA 3HA1A 4M3PA 2DIEA 2NX3A 2VMFA 2WBKA 2CWXA 4PRRA 1FWGC 2OB3A 2NVAA 4AU0A 5E0KA 4U31A 4K68A 3GBEA 3S2LA 4E2DA 2FPVA 1EX1A 2R1NA 5GNXA 3HM7A 2HS6A 3E2VA 2EHHA 3DEQA 2J47A 1DPMA 2PDQA 3FCPA 5FEWA 3GSMA 4WSKA 4IMCA 3MUCA 4LUSB 3PK7A 1KBLA 2CBVA 3NPXA 4C90A 3CL8A 1JNDA 3R8HA 1GW1A 3W1TA 1P48A 2FFIA 2V3DA 4HHMA 3TH6A 4C6MA 1Q6CA 4NT0A 4NJHA 1V02A 3G2GA 5CQ1A 4AXNA 1K9DA 3Q2DA 2NQHA 4DEFA 3S9ZA 4YHEA 1HJQA 2XVGA 1W1ZA 4DLFA 2G5WA 4P7OA 3WBYA 3H70A 3VKAA 3DC8A 4HQVA 5GNZA 2J8GA 1HJWA 3S1UA 1P0KA 3CZ8A 4O1EA 3LI0A 4GGHA 2Q6ZA 2Q8LA 4I8DA 4A3UA 2E28A 3VGEA 3GFZA 4O18A 4JTKA 2DT2A 3G0UA 2EG6A 1QWGA 5AHFA 4QQUA 2R91A 1QW9A 3P60A 3BSMA 3R0KA 2D2GA 1XIMA 3GG8A 1X6UA 2ZXAA 5HQMA 5FF7A 3S6DA 5DCDA 2ZUSA 3ID7A 4UR9A 3UG4A 2FJUB 2X40A 3W2UA 3KBMA 7REQB 4H9ZA 4GX8A 1A49A 3EMZA 4GJ1A 4IIEA 3NL6A 2PDBA 4XD6A 3U6WA 1OYCA 4X9SA 3ZYZA 2VVSA 3GHTA 2W5FA 3B9OA 1CXEA 1ZU8A 5I3FA 1U1UA 1VFSA 3GVRA 1A5AA 1FWJC 2WSYA 1UWAA 5M3WA 3WQDA 5FJTA 5AYXA 3JR2A 4NI8A 3KCOA 4IL0A 2J79A 4X60A 1O66A 3GUGA 1J01A 3CAVA 5KSWA 1FWBC 2A79A 3S1VA 4B5SA 4FNUA 2QJIA 4EANA 1EJVC 1PHWA 3WELA 4LS1A 1NQ6A 1XCXA 4L4OA 3ENLA 4N4QA 4C6EA 2OX1A 2XYLA 1JQVA 3TSBA 1HF6A 3OO2A 3W7OA 1CB2A 4OTKA 1TR9A 4KIRA 3LQGA 3OG3A 1UZHA 1S39A 4LU0A 4XD4A 3RHGA 5PTDA 1SPQA 1MI3A 4CNOA 2Q09A 2HMCA 1F73A 3HOJA 2VP8A 4IXHA 4AIUA 2REQA 1OHLA 1CW2A 2BB0A 5I00A 4PCFA 2PTYA 4IQEA 2QF7A 1MSSA 3V1HA 2IPFA 5BU9A 4DX3A 2EG8A 1V6VA 4AVNA 3P84A 1Q6LA 4PTDA 1QPQA 4MFEA 4Z1CA 1CB7B 1P1MA 3IK4A 3UGRA 4GA8A 4M56A 3B8TA 1V0NA 3VKDA 2HZGA 3G0XA 3PZTA 3THQA 2E9LA 3KZPA 2V2CA 1AQMA 5I79A 5A8OA 5CPNA 5F4XA 3WNMA 5G1YA 3W74A 4LAOA 3VIGA 5FEXA 5GJPA 2NXGA 3R6IA 2EJ1A 3PC0A 4V2XA 1UKSA 2GVGA 1OT1A 3WO8A 2CLIA 3GUWA 4MGGA 1G0CA 1XIEA 1OB0A 2YYUA 2JF6A 1OC5A 1AW2A 2WXDM 4XBJA 5LNRA 2G0WA 1Z3NA 2ZX8A 4I7UA 3RCNA 1L6GA 2J8FA 3KE0A 1A5SA 5HPCA 1TZZA 1R86A 4O19A 2ZZ7A 2Y24A 2VGIA 2HEJA 2YA0A 1UQYA 2JKAA 1H41A 1DIEA 1WYIA 4AFYA 3P5ZA 3AMLA 2WM1A 2WW5A 4AC1X 2GQ9A 3N14A 3MDUA 2Z2UA 5TQLA 4HOXA 2CXEA 1Y7VA 4GQQA 1X1NA 3MI3A 1IZCA 3VD9A 1ZBVA 2D0HA 2ZDRA 1CLXA 2INFA 3CZEA 3STEA 2QUNA 2JF7A 3PTKA 2BLEA 3LRLA 4WSHA 4BK9A 1IR2A 3V5CA 3VC6A 3QLDA 1WUFA 2Z27A 3RLGA 4XUYA 2YXGA 1QWKA 3UJEA 4YVXA 5EA9A 1DHPA 1K9TA 2E7FA 3GX9A 4QFUA 5SWUA 3KAOA 2PDIA 4DJDC 3NIYA 4GPNA 3O7UA 2EKGA 5C9XA 3N73A 1RQBA 1QJWA 1F3EA 4AD5A 2ACUA 4IGMA 3WEOA 4FF5A 5FKYA 4DHGA 1VFHA 3S5OA 3NFUA 3EXSA 3FVDA 1K7FA 1E1CB 5FF0A 4MDPA 4C7GA 2I9EA 1EC7A 1AQFA 4A3YA 2ACQA 5CZKA 1F07A 2YSWA 1E0UA 1R38A 4HOZA 5KEZA 3H2OA 4KRUA 4L9YA 4IIHA 4H9TA 2PGFA 3AMDA 1VHNA 3PZQA 3NGFA 3BPWA 2C91A 2V67A 3KOWA 1GZ1A 3MY9A 1S3TC 3B40A 4G1KA 3OBAA 2FMOA 1TX0A 4IIGA 3CTTA 2QCCA 1ODZA 4GVIA 2F7FA 2PBOA 3UW6A 4M80A 3R0DA 4A8RA 1QOXA 3MMWA 3IRSA 5I78A 1GVEA 4W89A 2VFHA 1HVXA 1QNVA 1KCKA 2C1HA 4RZ6A 3LPFA 1R3YA 1JI2A 1ZL1A 1TRIA 5I3IA 4WIWA 5IFPA 3DYMA 2ZRXA 3NQDA 3DHUA 2I5GA 3A47A 2XN2A 4WHBA 3L2IA 4ICNA 1F3WA 2V69A 2EGZA 4GZ7A 1EZWA 3PBMA 4LVDA 3UZZA 3ITXA 4WEVX 4AMCA 2JBMA 4P7QA 3PPGA 4LWWA 5BXTA 1TUXA 2HS8A 1OCQA 2W92A 1Z9AA 3TE9A 1MVYA 1OQFA 3LG3A 1UZ1A 4B91A 3GXFA 2HNEA 2D0FA 4O50A 3KFTA 5FF4A 3AYTA 1EJXC 1W9XA 4R3UA 4AB4A 3MWAA 3N6QA 1K77A 3B05A 4IIBA 4ADTA 1BRLA 2QT3A 3QPZA 2EKCA 2CERA 3BV4A 4DBSA 2OZ3A 3NDZA 4KERA 3IIPA 2OSYA 4FHAA 4ALDA 3OVGA 4F0HA 3A3WA 2WJFA 3OGSA 3FYOA 1KGUA 3OBEA 3TTOA 4LJ3A 4HNOA 1UYQA 4EK7A 3T0AA 3RDKA 1UR9A 1IF2A 3MO7A 4A8LA 2PDGA 3VNZA 1GZGA 3PZOA 1XYBA 4FR6A 2OJPA 3CHFA 5DCEA 1DE5A 2J74A 1JL8A 2GUYA 3OEXA 1CXHA 2DVTA 4PCPA 4AEOA 4JTEA 4MJ4A 4LANA 4FOKA 3IEBA 2JKEA 3M0YA 3WD3A 4LFYA 4QRNA 2VR2A 2J13A 1FA2A 1JUBA 2WO5A 4JKKA 3CPUA 3ZO9A 1ALDA 1TTPA 2FZDA 3LY0A 3QMSA 3BAYA 3GTXA 4RV8A 1EC9A 2ALDA 4F8XA 1HP5A 4M1BA 4Q8OA 4JKMA 4GIRA 2BXYA 5M03A 1Q63A 3OLEA 4GZJA 4LBUA 1XG3A 2DZXA 4BQ2A 3GXIA 1E0VA 2Z29A 1DL3A 1OC7A 2NQZA 5HANA 2OWWA 2EBNA 4CVWA 3QM3A 4P7LA 4O10A 4X2PA 2PSNA 3DFOA 3OLIA 2J9YA 4HN4A 1UWUA 4UTIA 4GACA 5A2AA 1CEOA 4NXKA 2E8ZA 3EX3A 2GJPA 5I3KA 2DT3A 1MRAA 4XAYA 4L1GA 3W1RA 2OO0A 1O95A 2R9RA 2E1DA 3L4YA 1C7TA 4DELA 3T2QA 1O5XA 3ZJKA 1QFEA 4GABA 1I2RA 3N29A 3NWRA 3CH0A 3QR0A 4M19A 4ZVJA 1SO3A 3DH7A 3NUKA 3LBMA 4W4QA 3NZPA 4YS1A 3KXQA 3WUEA 4WJXA 1YDYA 2CZVA 4PB4A 3VNYA 2HCVA 1BWLA 5TAOA 3VABA 1LQAA 4PUJA 5TBOA 3DHFA 5H8UA 4IMFA 4Y2WA 1GTHA 4S3BA 1K6AA 3A24A 2O9TA 4BKNA 1PX3A 1VJZA 2VDGA 1J0YA 4YLWA 2FGLA 3QKZA 5F7UA 1QCWA 4UTTA 1PS9A 5HPOA 2IUZA 3BZGA 5DO8A 4NAFA 1R3RA 3PN8A 4WY0A 3AZRA 3EOSA 2F84A 1VQTA 4POCA 4M6QA 1EBGA 2E68A 2OODA 3N2XA 1KFBA 1EWDA 2BY3A 4GI6A 2V3EA 4Z1BA 5C9RA 1ADSA 3W88A 5U7SA 1GEHA 2PP3A 4XSLA 3U3HA 2BODX 2QR6A 4NIRA 1J9YA 4JXCA 3ORWA 3WQFA 1T7LA 2P0OA 4OV4A 2PGWA 2ATSA 3C0SA 3RPTA 3E1F1 3W00A 1I6NA 3NQ2A 2H3DA 3HU7A 3TQ0A 4JTLA 4BF5A 1TPC1 4L4LA 2WJDA 3KW3A 4WLCA 4FALA 4B3LA 1RLCL 3C56A 3CGTA 1SZGA 1C9DA 3FJ6A 4F3HA 1KTCA 4PRTA 2I7GA 2P3ZA 4ML9A 3STCA 2CITA 1SJAA 1VFFA 1K02A 3BQ5A 3W7DA 2ISDA 1GVYA 2WANA 3RM8A 4P8XA 4NNBA 4RNHA 3UG5A 4UFKA 3VPLA 3EX6A 5M1TA 3U4AA 5HA7A 4OV9A 3UESA 3T55A 3LMZA 3W2KA 2VM8A 1XRTA 3UA4A 1ZCCA 1JGMA 1UUMA 2BXZA 3RNDA 3PBGA 1E6SM 1EP2A 1RALA 2E9BA 2OYKA 2BVYA 1R30A 4J28A 2ABBA 3QGAC 3UXAA 3ZFHA 2OZ8A 1Q3NA 1T96A 2PTXA 2YFNA 4RDYA 1U33A 5BXSA 4UCFA 4TTUA 5C70A 2ZADA 5TF0A 4YYCA 4AZIA 4PBEA 4IUOA 4B9ZA 5EMUA 1LG2A 1AW5A 3GD6A 3EWUA 3LCGA 4YTQA 2A4AA 4L80A 3LBOA 2Z1KA 3C2RA 1NJJA 2XHYA 4J1OA 1UUQA 1IEXA 1OD8A 2OEKA 3UPMA 1HG3A 3ARUA 1M41A 1W9VA 3P82A 2X0HA 3UVAA 1EQCA 3VKKA 3EA3A 3E0LA 3SUSA 4MWAC 2AMGA 4OZOA 2X0YA 1CIUA 1HN1A 4IG2A 1C3FA 2XGZA 4W84A 3T81A 8RUCA 1UC4A 4WY0F 3THUA 3A22A 3DG7A 2XFRA 1XI3A 1IGWA 3ANYA 1K6WA 3LENA 3NA8A 5KINA 4V33A 3GVGA 4B92A 2P1FA 4JIHA 4ML4A 2VCAA 4RNFA 2UBPC 4MUPA 5HWJA 3IRDA 1ME7A 4CD6A 3NSXA 2VRQA 3A9BA 4QISA 3UERA 3P7YA 1WO2A 3P2VA 3VUPA 5MKGA 4NJJA 3DI1A 2DJLA 4HPHA 2NSOA 5I02A 4U5KA 4PMVA 1ONWA 2W79A 1VJIA 2HQAA 2ZDSA 4WDTA 3SUUA 4E0CA 3NQEA 1UWRA 5D02A 1IWPA 3VDHA 4XZBA 2Z2BA 2ZZ1A 4D6GA 1J0JA 4IICA 3W1QA 4I3GA 4LS0A 6TIMA 5I24A 5BRBA 2G3JA 3IIZA 4KBXA 1ZSXA 2EO7A 4GYFA 1X1OA 4HYVA 3LGGA 1PPIA 4MLJA 4JICA 1R6WA 2WVVA 4IJCA 1FX6A 4N9DA 1NIUA 3HGRA 2I56A 4Z42C 5D9NA 3GVQA 3GR7A 3W1AA 4FNPA 3KOXA 1B4KA 3TOYA 1FVPA 3FYPA 3HQPA 4AVOA 4TX8A 2V3FA 4PUMA 3GVVA 2VD9A 4M81A 2C18A 3WJYA 3B0VC 2V6AA 3HG4A 1XLKA 3C6CA 4H9XA 3GR8A 4RK8A 5E6ZA 4JY9A 4LEQA 1A5CA 1XDMA 3ISIX 2CZDA 1P0NA 3LLFA 2QJNA 3E02A 1JCYA 2ZRYA 5C71A 3KCJA 2RGLA 3VCCA 3HJZA 5ABGA 5DY2A 2VEKA 3VFCA 3O6DA 4RKAA 2ZUVA 1VCFA 3H23A 4EAMA 5BWFA 1Q7ZA 3D47A 1DJNA 4JX6A 1A5MC 5HATA 1JJKA 4Z2IA 3TW6A 1JYNA 2CW6A 4HJFA 2GJXB 3PZMA 2OFJA 4F2UA 3KRZA 3T42A 5E93A 2YBUA 3LCXA 3UCDA 5T9BG 1VEOA 2BG5A 1X6NA 3HF3A 2V2DA 4Y9MA 1PKNA 5CBJA 3K1DA 2QUUA 3IJIA 4WUIA 5H6HA 2NSXA 3QC3A 5U4NA 1PB0A 4OECA 1REQB 5TIMA 2VDHA 5GVJA 3UU0A 1IE7C 5BYWA 3EWZA 3MZNA 3LPGA 4M8UA 3RFAA 3WK3A 4IHCA 2CEQA 1XBYA 3U2EA 1WV2A 3AHYA 3UR5A 4QCEA 4C6QA 2A21A 1GKRA 1YIXA 4UCGA 1JAKA 1C91A 2B7QA 3MCOA 3VKBA 2J66A 3ITCA 4BZYA 3B8WA 1DJWA 1K3UA 2PP0A 2UZ9A 4JTSA 4N0RA 4CNTA 3PJXA 4NVTA 3GFYA 4LEFA 1KM3A 2TYSA 3CQHA 1FTXA 1H3GA 1W3IA 4NZ1A 1VP5A 4H8VA 1BTCA 5D8WA 5DY3A 3ES8A 1UWQA 3OZMA 5MHBA 2PLJA 3KP1A 3C2OA 2I5QA 3TMQA 4YTTA 3GZ3A 1UKQA 4UTUA 4B4HA 1EP3A 4FNQA 3VNMA 3LPPA 3QHOA 1XSKA 2EF9A 1QNQA 3CO8A 4FIRA 3ZR4A 2WWDA 2VEGA 3WFLA 4B9YA 1NDYA 4UQBA 1PX4A 5G4WA 1H09A 1JCTA 4ACZA 4HHPA 4MB4A 3VKJA 5LHEA 4L1XA 3UR8A 3MUIA 5I03A 3DERA 3SR7A 1GQLA 5I3HA 5JUVA 1IEWA 1MW0A 5AB3A 1KA9F 4F4RA 1KXTA 1RA5A 1R2TA 1BQCA 1XW8A 2MUCA 4PTMA 3AXKA 1FP8A 3WLQA 1W3KA 3G1AA 1TV5A 2V30A 4OBTA 2ACRA 2BBFA 5DANA 3IIVA 3WX7A 4UR7A 3UQNA 1OGBA 5I09A 3IACA 5DXYA 4J4KA 2X7WA 1PEZA 2GFTA 2NV1A 1WKEA 1DWFM 2YDSA 4RW5A 2FZ8A 4WCJA 3PY2A 1O4UA 2BFGA 1TIWA 3WQEA 1LWIA 3W83A 3H26A 4AZHA 4IIDA 3KHDA 4LYKA 3G1SA 4JKLA 4X2RA 3U5UA 5J8LA 1OK6A 4QROA 4AD0A 3EB4A 3H2CA 2J62A 4AIOA 1QW7A 1A53A 1EUAA 3AIEA 4C1NA 1IR1A 3SECA 2J9ZA 5F2GA 2OGYA 1W91A 1YTDA 3AIQA 2PDPA 4GK8A 4MAVA 4DF1A 4LAUA 2RDTA 3T4WA 2Z0IA 3M0ZA 3N4FA 1XHGA 2FGZA 4IFKB 2WMKA 1LLWA 2WZMA 3VOGA 1H11A 3VOHA 4UTKA 4W8LA 3SJ3A 1XL9A 2O7QA 2NQ5A 2H8ZA 3LM7A 4BY3A 4WKFA 3NURA 2WZEA 4WR3A 5HWNA 4V15A 3BOXA 1UZDA 6REQA 4GZEA 3LZ5A 3OPSA 1Q85A 3H53A 1TG7A 5AY7A 2DIJA 1KCLA 3DENA 4DUOA 1JFXA 3CHDA 4JL2A 3BDKA 1GQNA 1W1YA 2ZUWA 4N6FA 1NEYA 3PS7A 3SN4A 1P0BA 1EP1A 4UTHA 1BGGA 3AXHA 5AZ1A 4XTDA 4GY0A 3KOFA 2A3LA 1ZP4A 3K30A 1XPYA 4HU8A 2YLLA 2WSKA 2O0TA 5FF3A 5HJLA 1SMDA 1UD3A 3M7SA 1M7OA 4W7UA 4E38A 5FESA 2DDXA 2J75A 1TJPA 4TV6A 3KS6A 4WY0B 4Y9AA 3KEHA 2HDJA 3M4HA 1RBOB 3ZT6A 1GKPA 1V6UA 5CSRA 1G4EA 4LY8A 3Q65A 3LCLA 3NR0A 9CGTA 4H6EA 4X9YA 4IPJA 2OR2A 4WXYA 3MKKA 4PTNA 2ZXQA 2R6OA 2Y4SA 1SJDA 4LUIA 4UQEA 3AMGA 2CC0A 1ZBKA 3M5YA 5HNNA 5F2LA 3IJ6A 3MZ2A 3WLHA 1IGSA 4GBUA 3ES7A 3PG8A 1QNOA 1BTMA 1FWEC 3T44A 2VZVA 3KVLA 4Q7IA 2Y7GA 5D33A 3HGOA 3WYZA 2ZE3A 3VGHA 4F0SA 2YDQA 2E5DA 4OGZA 1FWHC 3UJ2A 3OHMB 3PPCA 4JNMA 3BZJA 1NOWA 3VIIA 1FXPA 3W1MA 4C6KA 3GE7A 3SFKA 3CWOX 1A5OC 1HGWA 2INZA 4H7ZA 4S3CA 1EA0A 2W9MA 4LRTA 1XLJA 3N04A 2A6LA 2XH2A 4UIOA 3ZSTA 2GDUA 1X7FA 2QMKA 5IFTA 2NVCA 4MY1A 1UP3A 3PWIA 4HD5A 4Y96A 2WCAA 3BCFA 2I17A 3GH4A 3W7QA 3PPFA 4U33A 2Y85A 3AIVA 3L0NA 2TPSA 2QF8A 5AHNA 3WF3A 3B9NA 3BMWA 3O9NA 3CNYA 3UP8A 1EWEA 3K5XA 4ZE4A 2V9DA 4GCXA 3E5PA 2XVLA 4J3UA 3UJSA 2OLSA 5AC7A 4D6FA 4DYKA 1PKYA 4HOWA 2QJJA 4JS3A 1DJIA 2RH9A 2R1PA 3DHPA 2KX9A 4GQRA 1TPFA 4JHOA 2C16A 4WOQA 4GYKA 3V75A 4F0LA 1RZMA 3UWZA 4TTGA 2C13A 1RAKA 1V3LA 5CSUA 3RJYA 3VX1A 3OYZA 4LYQA 3HPZA 5CPLA 1AQ0A 3N11A 4J5NA 3VVGA 3S47A 1MFUA 1Q4NX 3GW0A 4G2DA 4DNHA 1OG0A 1C29A 4MB3A 3VGDA 4Q4OA 2C6QA 1FBAA 4PL2A 1EXBA 3OIXA 1B3YA 2OEMA 4E2VA 4MADA 2WC4A 3VIHA 4MNJA 2YZ5A 3T8QA 5MKGB 1D8WA 1F3XA 3RU6A 3FS2A 1S5TA 3M44A 3MDWA 4KGJA 1AQHA 3WBEA 4OBSA 4UOZA 5CC6A 5C9UA 1TPWA 1W1IE 3IUDA 1GYMA 1OT2A 2VEPA 3T05A 3NZGA 1Y65A 2OYMA 2J6VA 3ALGA 1SZNA 2FTYA 1UD4A 4PMNA 1GJUA 1YE4A 4ZBCA 3DBPA 2VT0A 2NUYA 4O57A 1UKPA 2DSKA 3WLLA 3G8RA 1M04A 3KL5A 3LNMA 1GORA 2QDEA 1EXPA 3WK1A 2WVVB 4TMBA 1WA3A 3N25A 1E6QM 1VBGA 5HUOA 1J4EA 3TXZA 2A5HA 2P8BA 2QGYA 3NQ6A 3LEPA 8TIMA 4NYYA 3XIMA 1YNYA 4B15A 3UXDA 3HJEA 3AICA 4URIA 1DV7A 2DZVA 3QZEA 4EOUA 4TR9A 3W87A 1IXOA 2V68A 1QNPA 3AU6A 2PPGA 3P5YA 3W3OA 1HFBA 4WXZA 3B4UA 3IWPA 3WJWA 1RJRA 3AALA 4X3ZA 1VPQA 2HJPA 2YCKX 4UTWA 4RLIA 1W3JA 3APGA 2Y8UA 4O1CA 4OE7A 3TJIA 2FB3A 1ZGDA 4HZ7A 3PUEA 4H8UA 2W91A 5XINA 1TKKA 3AYRA 2JKPA 1N8IA 3N18A 1XLIA 3C61A 3WD2A 4TQTA 3EWCA 5IBXA 5M2FX 2WNWA 2W6RA 3TONA 3QR3A 4DJDD 1W9UA 4EF8A 2Y7FA 4LCRA 4XWUA 3DN5A 4G9PA 1R3WA 5F4SA 3OBKA 4XV0A 1JZ4A 2YJQA 4PRWA 1X96A 4O1AA 4EWND 2J7CA 2P5NA 3M41A 1ZQ5A 2OWXA 3VIJA 1AD4A 1VFLA 4QJ4B 3D6NA 5BXRA 4X63A 4UUIA 1EIXA 3BL3A 1TJ2A 4S3KA 5AYZA 3DOPA 1E1EA 2Y88A 3II1A 3T0CA 1HNYA 4I7VA 1NFGA 1WX0A 4IMAA 3QGKC 3W86A 1L6WA 1A47A 1KW1A 3WLTA 4EAYA 4YCPA 1JYXA 1PTAA 2NV9A 4PCNA 1MRQA 3SCOA 3SCVA 1Z7AA 3IGUA 1F2JA 3FVMA 3NZ1A 1UKTA 4Q8MA 3U48A 3E0WA 3I3BA 1Z32X 1X7IA 4QDPA 3BLPX 3QXBA 5C9WA 4MMWA 3SUWA 1W3NA 2BASA 3SQLA 4LVAA 1XKJA 1XICA 4IGSA 4FXRA 4GBDA 4N9EA 2A3AA 3V7PA 5FJPA 2EG7A 3GC5A 1RK5A 3HG3A 3TYAA 5D09A 4QITA 1TA3B 2J88A 3WQ6A 1AVAA 8XIAA 8CGTA 2HK1A 4CVUA 1UOKA 3NQ7A 1YMYA 3TFCA 4PUKA 1VFTA 5LA2A 4QE1A 1OFEA 2BGQA 1BLIA 3SIMA 1FHLA 1LBMA 3PWAA 5FA5A 5REQA 2E1WA 1HTIA 4DXVA 4Y90A 3L4UA 4MDOA 3C4UA 1QUMA 3S8HA 5AN7A 1IEIA 3NDOA 4ACZB 4IOTA 4D72A 4XZNX 2E67A 2YL8A 3A4AA 2B4GA 5AOUA 1IQ8A 1F74A 3ZJ7A 5DCBA 2ZIDA 3NPWA 5EPDA 1AJ0A 1R5YA 1J2WA 5J04A 2O9RA 1MDLA 3MUY1 4AZCA 5CZJA 3UWUA 4BEUA 4HN8A 1W9DM 1V0KA 3SN1A 5F2IA 2PDMA 5LGZA 4NJIA 5D9PA 4XO6A 3R11A 2E5CA 3VNKA 4ICCX 1QOQA 2E5BA 1JDDA 3LU2A 1J6PA 3L4ZA 3QTGA 1ZTVA 1WKFA 3ZJ8A 1H51A 3EA1A 5BWAA 1V6YA 3NM3A 3BURA 4YTRA 1LQ0A 4MJ2A 3IJDA 4B2DD 2D73A 3VNDA 3R8GA 3HG5A 1TPUA 3GXDA 1ESWA 4PULA 3G6LA 4MFDA 3WENA 2Y5JA 1OD0A 3CV1A 4LV9A 1H1YA 1H7OA 1PWLA 3AS1A 5D38A 4MWAE 2GSEA 3IVTA 3SSZA 1WDPA 1C8QA 5ECVA 1UUOA 3RXZA 3Q37A 4C1NB 1IWAA 1FFQA 1WBJA 3EPMA 3MKVA 3T2OA 1W5PA 4LAMA 3T40A 4A05A 4EWJA 3WQ8A 3EEZA 3ME3A 2J78A 3ABQA 1F61A 2GLKA 4YVVA 3QBUA 1KQYA 4BI5A 1IIGA 2ONEA 1XYMA 3SUVA 3BGAA 2NLIA 2X0SA 3VE7A 5L6UA 1EPXA 4R9OA 3PTQA 3PNUA 3W7KA 1QHPA 4R53A 3RF9A 3S2NA 3UZXA 2VZSA 4FAMA 2X1SA 1D2KA 2VQTA 1G5AA 3W22A 3C5QA 4OJYA 3OJGA 4AAJA 1DHKA 4WGXA 1I2QA 3BOLA 1H7NA 5FIPA 2Z1WA 3NL5A 3NL2A 3GG7A 2FMNA 1VFUA 1UR0A 3P8JA 4H01A 1RLDA 3JUGA 1JPMA 1WZAA 2E6DA 4Q33A 3V4BA 2AL2B 3L0KA 1I4NA 3MJMA 3WDPP 1FCUA 1W5QA 3M5XA 4QBXA 5A6KA 1E15A 3H2EA 4E3VA 2X1IA 3GAKA 4GIYA 2PLCA 2YCIX 3B0PA 1YBQA 4DBWA 5FACA 1RY8A 4B5XA 1P7TA 3QHNA 1FDJA 1BVNP 2KZHA 3TLLA 3HPFA 4UQ9A 3GLCA 1X39A 3EWBX 2ZWZA 3SFWA 1NAL1 5A1AA 3H12A 1BG4A 2VZOA 4JEQA 3JZEA 4CQAA 4ZQOA 1XFBA 3O1NA 4HU0A 1XQKA 3CB3A 3WH8A 1W2VA 1QI4A 4AZ5A 1RVGA 2W67A 3CZGA 4OOUA 1Y8BA 5J5DA 3H4XA 4AD3A 2YCLB 2ADAA 3EWYA 1JPHA 1MW3A 1KFJA 2DU2A 3C8NA 3LXCA 3GDMA 4BFAA 1UWIA 1F8MA 2BVTA 1HX0A 2XSAA 1BF6A 5AZ0A 2HV5A 2A6NA 3WH5A 1RPXA 4LSBA 4C6OA 1KXHA 1T8XA 1KFKA 4MPKA 3HO8A 3LGDA 4L1WA 3G1HA 3HQ1A 4E4FA 1EHAA 2ZFAA 3D3FA 3W73A 4HZMA 1S46A 5C9ZA 5AYBA 3M9YA 1XJBA 4HYRA 3GNOA 3CWNA 4KWUA 3VDAA 2HK0A 1HJXA 3A23A 3VD3A 5A6LA 2WNNA 3GAYA 1MQRA 1QTWA 3RLHA 1OIFA 4HA0A 3W7IA 2DSVA 3FX4A 1Q6FA 1J11A 1VBRA 1LT8A 3APYA 1W2PA 4Z1AA 2VUYA 2IKJA 1TV4A 3W23A 1GHSA 1W37A 3QQ0A 1JCMP 4LXFA 2J9XA 3MI6A 2EXOA 3QEZA 3PUGA 1DJXA 3IGHX 1E5JA 4GO9A 3WBAA 3N34A 2XFFA 3L66A 3I6EA 3ZVIA 2Q71A 3TYBA 3W1NA 4UTTC 3UY8A 5DXXA 3UNDA 3LDVA 3MYPA 2L5HA 3PZNA 4H8NA 5I0DA 4W5ZA 1JXKA 4JDYA 4W7WA 1W1A1 5DMLA 4S3JA 2ZUUA 4KFNA 1OG6A 4ZTYA 3OP2A 3SBFA 3M0KA 3PPHA 4LB3A 3RGTA 3LHTA 4HMNA 1NY1A 5CGQA 2D2JA 4A6GA 3CUZA 4HA3A 2J7EA 3V18A 2VVNA 3NJ3A 2CLMA 1PKMA 3B8IA 4S1FA 5I23A 4Z2JA 4IFOA 1CGXA 2QPSA 2V5LA 1VIWA 1ZRQA 2OO6A 3PUDA 4L9ZA 1VFOA 3UNTA 1H0IA 4WSJA 1SZFA 3KUMA 3P62A 3WSUA 4LAKA 2QUVA 1ZBWA 2J6XA 3O6YX 1X38A 1J18A 3BLEA 3CAWA 4IQLA 1E4MM 3MA8A 3WQWA 1JG9A 1BVWA 1JZ8A 3V5OA 3N4EA 1T6MA 3VYLA 1TZ9A 4L64A 1WUEA 4RX0A 3UWQA 4G6CA 1PE1A 1KRBC 1SZRA 4Q6JA 4Y9NA 4ECLA 3MTWA 2NXIA 4GJJA 4NJKA 4F40A 1TREA 3Q4DA 6XIAA 5T91A 4A4AA 4QP0A 1M68A 3CQ0A 1FDZA 1I75A 4JFTA 4J2PA 2G3NA 5BW6A 4LTSA 1VBUA 3AHXA 2BMBA 1H5VA 3V16A 4RJEA 1A0CA 4NJGA 3SI9A 4BQ5A 1JZ7A 4OKDA 3O15A 1DQWA 1P6CA 2RKXA 4QLJA 3DGRA 1JDCA 4NZ4A 3TQKA 1W1VA 3D46A 7A3HA 4XSMA 1GKQA 3VDCA 1IT8A 2E0PA 3W81A 2PDFA 3B0UX 2YGYA 2FHCA 3W1LA 4FLRA 2HISA 4LQ1A 1CPUA 4J3ZA 2PE4A 1EF3A 3O6CA 4QG9A 1SJBA 1QRQA 2WKJA 4GXMA 1KGWA 5HUPA 3AUJA 4GLEA 4EXBA 3GDLA 2IPGA 1OSEA 2CLEA 4K38A 5DEZA 4W88A 2B0MA 4CNPA 3SUTA 1JPKA 2VC6A 3W7EA 2Z1SA 1LLZA 4MY9A 4OUEA 3NQMA 1VD6A 3LCWA 4AMAA 1JI1A 5F4WA 2E40A 4NY2A 3H21A 2X16A 1J12A 1ISXA 4FO4A 6PTDA 1R46A 1ZAHA 3BARA 1AD1A 1SW7A 3BAJA 1R2RA 1V7YA 4N9BA 1XH0A 4GX9A 4XIMA 5AC5A 4GVGA 3T0DA 3OOQA 5CGTA 2UY4A 1A4MA 3TAKA 9RUBA 4MVAA 4U10A 2PD9A 2F2KA 3VIMA 1VENA 4HU3A 3NZQA 5A6MA 3I6RA 3CPRA 1EBHA 1AH3A 3BK0A 3ARRA 1MFVA 3FDGA 2X05A 5XIMA 3FHQA 3AXMA 1E9ZB 5C2GA 4HIBA 1J93A 1XUZA 3CHVA 4CCCA 2NQLA 2FKPA 5EMLA 1EX5A 2PMQA 1BHGA 2BHUA 1Q4WA 1HO1A 4HK5A 3MB9A 4H9YA 4Q22A 4N6EA 1UQZA 2Y5EA 3SCSA 1H4PA 3N12A 2IW0A 3LM3A 3WD0A 1E43A 3KBSA 1HJVA 3IJQA 3STGA 4XK2A 1JCXA 4IP7A 3XINA 7REQA 4KF1A 1FCVA 5BZAA 1UH3A 3TVAA 2OSWA 3MMUA 1IT0A 5CPTA 3WDQA 4J9JA 4PEEA 1B4EA 4AW7A 5REQB 4HMDA 4RL3A 4PE8A 3GK0A 1Q66A 1V77A 3RMEA 3ITYA 4NG3A 4ZOAA 1KBBA 4IMDA 1G4SA 3G1VA 4LAZA 3WMCA 3W7RA 2Y7EA 4F2TA 2WWCA 3W76A 1POKA 4DWDA 2RHGA 2J7BA 1KM2A 2C71A 1UD2A 4OBRA 1ZALA 3TC6A 4RE0A 2I1OA 7ENLA 2WPBA 3RO8A 4ONVA 1KNWA 2BY2A 1VLIA 1OY0A 3MP5A 3BQ6A 4JPGA 4LYPA 4DM2A 4BR1A 3MV11 2XFWA 1GQJA 3O16A 3KVMA 2HVNA 1SFLA 1AG1O 2PODA 4NNAA 1Q65A 4PA8A 4KPLA 4O0ZA 3D5HA 4I5XA 4DF2A 4P5UA 3M46A 3KRBA 4CD4A 3BW4A 2ISVA 3BAIA 5LNSA 3IJ7A 2R1KA 2PI6A 1V4YA 3FIGA 4I90A 2VC9A 5XIAA 2P8CA 3RIKA 3H2MA 3TWAA 3R13A 2TODA 1UA3A 4PL1A 3Q58A 3QFEA 4QG8A 3L67A 1ZNNA 1GVOA 1M5WA 4IGNA 4GI9A 5HWMA 2G4JA 5I3GA 3F4DA 3ZT5A 4HPNA 1ECEA 3VO0A 1LM1A 3AIUA 3DX5A 4J3XA 4A21A 2HTMA 3G1RA 3FEMA 5A8GA 3WJXA 4S3EA 3M5ZA 1SFJA 3WLJA 3S4TA 1CT5A 1V3JA 1GOWA 1K8CA 3N9SA 2VUNA 3RN6A 1UR4A 5CLTA 3RUBL 1NH6A 5A2BA 1SUXA 2ABAA 2R1LA 3UGVA 3EKLA 4CU6A 2PD5A 1X98A 3A13A 3VMOA 2XTKA 1Z69A 2YCJA 3WD4A 2XIJA 1B5TA 2QXWA 1H49A 1E3XA 3SY1A 2FDSA 3V36A 5JVLA 4O1DA 1QPNA 3DFHA 5BOEA 1UR3M 1OGSA 4UQCA 2ZUNA 4GUIA 1V0LA 4RR4A 3T09A 3E12A 3H4WA 1YBQB 4HB7A 2PDCA 1LYXA 3URQA 4R85A 3V0TA 3EX1A 4O8RA 2PS2A 1L2UA 2YR1A 1PDZA 3NTYA 3AIWA 4Y6GA 2PGRA 1TB3A 3GH5A 3AQUA 3CIXA 4CN6A 3CMGA 3SRKA 4LC8A 3GXTA 3GNDA 1OCNA 1EJTC 3OZOA 3QV7A 1KLZA 2W0UA 1E70M 3KLKA 2DIKA 4NZCA 1O12A 1OM0A 5G5IA 1EIBA 3APTA 2VRKA 3KL3A 1FHVA 2PBGA 1EKOA 1RVKA 4MJZA 2GSHA 4ORMA 3QW3A 3ITTA 4GH3A 4A2SA 4AYGA 4O1BA 3N6JA 3PBVA 4XG1A 3U57A 2DW6A 3WF1A 1HJSA 3LLDA 1VEMA 4QNEA 2VKZG 2YOCA 5D37A 3FK4A 3WH6A 5HNRA 1FH8A 2X2GA 4F0KA 3QRHA 1ISVA 1I1XA 1OC6A 2IXVA 4O11A 3OGVA 3WMSA 2YDAA 1TMHA 5LIWX 2WSQA 2DW7A 3C52A 3WNOA 2E6FA 4EE9A 4HBKA 2IS7A 3WDHA 1L8PA 4NQ1A 1XGEA 1U1HA 3UWWA 5I06A 3P93A 5HMDA 1H7WA 2R1MA 2GL5A 1XGDA 1Y5WA 1ICQA 1GQIA 1XS2A 4P7NA 3UETA 4L56A 2OGJA 3E0IA 2DSUA 3K4WA 4H8HA 1Q7QA 1H50A 2OOGA 3TYCA 2V5BA 1UOZA 2D20A 2PRHA 4KCUA 3LN3A 3BW3A 1H2JA 3WLIA 2CLOA 4A3QA 1JZ5A 3B97A 4GQ0A 4YL2A 2PDXA 1SZEA 2CKRA 4FX8A 1G1YA 5I7GA 3L68A 1FHUA 2VFIA 3NSMA 1VF8A 5C0QA 3G1XA 2DZSA 4UFLA 5A8QA 3W38A 3NO5A 2V82A 3ZZ1A 3MBFA 3BLIA 1GVSA 1O1ZA 3W7CA 2AKMA 2WBGA 3JU2A 2Y8VA 1PWMA 4GKLA 3LLXA 3CMJA 2YL9A 1A0DA 2FVLA 2GJRA 2HE5A 5D2TA 4XBKA 4KFOA 4ZQNA 5AVNA 2BV9A 3ARVA 5E9XA 4JNZA 1E5NA 3EDEA 4IPIA 4E4PA 1EGZA 1J5TA 2VEIA 4ZO6A 5E1QA 2PA6A 3KM8A 3GO2A 4LPCA 2D1ZA 3V35A 3W28A 4FOJA 3MP3A 2NWSA 3W6YA 4TVCA 2X7VA 3PVFA 1BSLA 3QZ6A 1XISA 3MBDA 4QX4A 4PUUA 4B4FA 4BI7A 1XLFA 3LV5A 3C2VA 3C0LA 1YNPA 3UXIA 2QDHA 1UPPA 4RNJA 2PTWA 4ATLA 3GQYA 1P6BA 5EBUA 4I5UA 5BOFA 3SRHA 4TMCA 4Z2GA 1CTNA 1MEIA 4BQ4A 3KTXA 2PWDA 3PP7A 4M6VA 1M01A 2OU4A 5DBUA 1L0PA 4HSHA 2DVUA 1E4NA 4HK6A 4JZ5A 4Q4QA 4D6DA 3S3GA 3W7NA 1R9ZA 5CAKA 5K7JA 3ZR5A 2QNEA 4QE4A 3E9AA 1EHNA 2VX5A 2V5CA 3QV9A 4ASTA 3W2JA 3SM0A 3CEUA 1JUEA 4NAEA 4MIMA 4JFSA 3USZA 3ZXWA 2G3MA 2GVLA 5D04C 1DIDA 3BH4A 5ABEA 3A6OA 3SCTA 5LGXA 1DKWA 4R7JA 3AMKA 3WLPA 3PB2A 5EKYA 1CXIA 1TJRA 3WBXA 4R27A 3UPWA 2WMJA 1EOKA 1JZ6A 3GG0A 5FAGA 2VOTA 2Q3OA 4DXKA 2UY2A 1PZ2A 4K1WA 4H6QA 2YBVA 4NZ5A 4UFJA 4S38A 3CL7A 3TNOA 3AHZA 1ENUA 3KCLA 1SGJA 4L61A 1B1YA 1E9IA 3HTWA 2XH4A 4BCEA 1QAPA 4ERAA 1TELA 4JCMA 2AQVA 1S2UA 2J25A 3R0UA 1ONRA 2VELA 2OZTA 4RXFA 1HL9A 3EYPA 4AHQA 4DVOA 1QI2A 1DWJM 4DO5A 3MI2A 2PDHA 3TA9A 2WKGA 4O4WA 4PUNA 1GGOA 3S5YA 1OFBA 1SFTA 1LCOA 4H00A 3V5FA 4AEEA 4A8NA 2XM2A 4AY7A 3C2EA 2IPWA 2BOEX 5LIKX 2R24A 4UTLA 3VA8A 5FOOA 1Q2RA 2QAPA 3G8EA 4AZGA 4ZR8A 1VB9A 1MW1A 1DEDA 3KLLA 3TKFA 3BSHA 5AFDA 4J35A 1T41A 7TIMA 2PUZA 4GISA 3KBNA 5FCZA 3SCQA 2QCDA 1M7XA 1XYLA 3EB3A 1C8XA 3WL0A 1XDJA 3CV6A 1O5QA 5JU6A 4B16A 3LX9A 1BWKA 1O60A 2NUWA 3OLDA 1NU5A 2VQUA 1C93A 4OU1A 4EPKA 4W85A 2CLKA 2HRWA 4ICMA 1VPYA 1FH9A 4EXAA 2ZE0A 2DPEA 3RM9A 4UTWC 2A7RA 2YZRA 3KBVA 1E0WA 3CV2A 2VWSA 3CUJA 1XC4A 3W37A 2FZ9A 1F6KA 3KZSA 1OFRA 2OQLA 2G4FA 1ZLPA 5AHEA 4NZFA 1GYLA 1PHQA 4E2OA 4FXFA 4MSSA 1YW1A 1X6LA 5IBXC 1W0MA 3F5KA 1UC5A 3ABRA 1MDRA 3L12A 4DO4A 4JYFA 2BGNE 1MW2A 1KC7A 4V1YA 3VIKA 4FA3A 1FCBA 3QH2A 4YTSA 3BC9A 3L7RA 4H9VA 3DFNA 1UH4A 5AC8A 5CG0A 3MUZ1 3LOTA 3ZVHB 2QV5A 4Q4RA 2YLAA 5HQLA 1US3A 4HHHA 3ECQA 3RLVA 4GNKB 1KM6A 2W66A 1B30A 3OZYA 1I9CB 4ZQCA 4RPPA 2WVUA 3AS2A 2EPHA 1OFQA 3PF3A 2PDWA 4L9XA 3OB8A 3AC0A 1E4LA 1XD0A 2VD8A 4ZEPA 3I4EA 3K2GA 4AIEA 2Y5SA 3CQIA 1RCXB 4JIQA 2VO5A 2V5KA 3LHYA 2BWGA 3CPGA 4AHOA 4CD7A 1CX9A 4P61A 3TTQA 3GNPA 1ZUAX 4HNVA 3M6YA 1PIGA 1NWUA 1SM9A 3TR9A 4IMEA 1RHCA 3VK5A 3G22A 4KEZA 4HNTA 1JUKA 1J10A 4J40A 3ZOAA 2QQ6A 2TAAA 4RW3A 4H2HA 3IAPA 2G3IA 4O16A 2FZBA 3FJ4A 3T07A 3T7VA 3GTNA 3BG3A 3VNJA 4UQDA 1FRBA 4HKPA 4ZCWA 3WF2A 2ZVRA 4H7VA 1J0KA 3SSJA 1TWSA 5KZMA 2GGIA 5JXQA 2BVDA 1DJYA 3MC5A 1WZLA 3CAKA 2Y7DA 3WEZA 3VILA 3CZJA 3LA4A 3GXMA 2HWGA 5E09A 3O63A 3U9IA 3ZT7A 1SR0A 2DT0A 3CUIA 3E2SA 2JE8A 4GXWA 4JTDA 3C86A 4CD8A 1KM0A 3C2FA 2IMRA 1IYXA 1E6PA 2BS9A 2ZICA 3L4VA 4YJ5A 1FWIC 3R43A 3VGBA 2XISA 4E2BA 3I3DA 3NYDA 3O3RA 1C7SA 4HSOA 1X97A 4EIVA 1K8ZA 5A8NA 3MCMA 1EGMA 1KM4A 2WC7A 4JIPA 2WJZA 2A7NA 2UV8G 3EDJA 4DZAA 4PBGA 2DQWA 1M7PA 5CAHA 3ARXA 1XLCA 3NQFA 4UZSA 5D2XA 3W71A 4EVZA 4EPBC 1UR2A 3M7WA 3CJPA 1H5YA 5CJNA 3R79A 5EY5A 3QSRA 1VEPA 3QY6A 3NOEA 1KO0A 1TWDA 1V93A 1ICPA 3UT0A 3R89A 4JTTA 4OHQA 3WLRA 2A3HA 3NPVA 5LA0A 3RCMA 3W7JA 5A6JA 4AUBA 1GW9A 5I3JA 2YW3A 3PTDA 5B80A 3MP4A 1A3XA 1D3CA 4HZ8A 2Y61A 3CXOA 2ZRVA 3UXLA 3WNNA 3GTFA 1Y5XA 1AH0A 2OZ0A 3DECA 3SGGA 3EDKA 4KKXA 5G2IA 3LS9A 1DXIA 1LF1A 4AY8A 3FA3A 5EMJA 5CC7A 4DUVA 3PULA 1KB3A 3FKRA 4QJ5B 2DFAA 3H7VA 1HL2A 3UYIA 1BGAA 3SY8A 3TK7A 2GJXA 3IAQA 4QM1A 3MHGA 3WQOA 3EKGA 3W0KA 1V3HA 4N42A 1KKRA 1W8GA 4FLQA 2INEA 1W5NA 4DNMA 1UCWA 5EL1A 1Z48A 4H4IA 1YADA 3AISA 4L7ZA 1HXJA 2OLAA 5EMYA 5GPRA 5DN1A 5JH1A 1REQA 5A8PA 1PYMA 2O56A 1SVDA 4PTXA 1HUVA 2JEPA 3UWEA 3NGJA 5A94A 1FY6A 4CNNA 1LQ2A 4Y7EA 2GUBA 2YXOA 1K4GA 4K7VA 4LBRA 3NQBA 4IPNB 3CQKA 5D8ZA 1LTDA 2CESA 4YN5A 2O9PA 2E3ZA 5LNVA 5T8GA 1WAUA 3LBCA 3RMJA 4IIFA 2F38A 3OG2A 1FKXA 4DI8A 4WX2A 3CUFA 3SQSA 1JF6A 1ELSA 1BKSA 4GNJA 4NUWA 1EYEA 4JHMA 3UJFA 2QHAA 1TJ0A 3NAVA 4N7QA 4L6HA 4OFCA 1IEQA 3S46A 3GYCA 2YKKA 1MXDA 3GIPA 2OLHA 4BHYA 3VCRA 1B9ZA 4E3TA 4JEJA 2FH8A 5RUBA 3ARTA 4RZ4A 1PZ0A 3VDBA 3DG6A 1WE5A 1PZ3A 3GDRA 4XQ6A 4HT3A 5D9OA 1R9YA 2JEQA 4JAWA 2Q02A 4MB5A