4RX0A

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm265
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
376
structure length
367
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title A long-duration dihydroorotate dehydrogenase inhibitor (DSM265) for prevention and treatment of malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 132
structure length 367
sequence length 376
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rx0A00
1B4KA 1T0OA 4ZQCA 3I65A 3L0GA 3MHGA 2I1OA 2FB3A 1KFJA 1HFBA 1JCMP 1VLIA 3L21A 1LDCA 3P5ZA 1L2UA 2TPSA 5BW6A 3ZWTA 5BMWA 2A7RA 2WV8A 4K36A 2E77A 1BWLA 4GFSA 1WV2A 3L9CA 4UR7A 3ZWSA 2DZWA 1LRQA 4WY0A 3PSVA 3P8JA 1SW7A 1EB3A 5D38A 2OT0A 4A3UA 3W7GA 2Y7GA 3U2OA 4IXHA 4DPQA 3GX9A 2C0AA 5K4XA 1QPRA 5LGZA 3QJAA 3FYOA 3W1AA 4N9BA 1TPFA 3PSWA 1R2SA 5D2WA 5CGQA 1K7XA 4NUWA 2WNQA 4GUGA 1ICQA 2WOQA 1K03A 2PE4A 1JCJA 4DO5A 3LHYA 1X6UA 4UNKA 1DOSA 4K8EA 1NVMA 4MZ1A 3TA6A 1QWGA 3FJLA 4N9DA 2NWRA 1DORA 3VE7A 1B4EA 4JGDA 3DENA 4M19A 5J5RA 2QJHA 3HG3A 3NL6A 4TU1A 2C15A 1QAPA 2J88A 3KVKA 4UCGA 4JX6A 3W7OA 2BX7A 2JK2A 3FJ6A 2AGKA 1GG0A 3TQ0A 4UFKA 3TKFA 3DAQA 3B0UX 5DBTA 4O4WA 2E6FA 5DXXA 1H7PA 3HG2A 5EKYA 2WSYA 1RQEA 3TROA 5CZTA 3O8AA 3R13A 1JRCA 4HT3A 3P7YA 1T99A 3R89A 4DF2A 1TQXA 4UTKA 1ME9A 2Y70A 2C18A 3WJWA 1SSGA 2C14A 2A85A 2X16A 2P1FA 1KM6A 2Z6JA 4N02A 2FB2A 2Z2UA 1I2NA 4NX5A 3I7RA 1FDJA 1UUMA 3OA3A 4QJ1A 3TMQA 3NL2A 2X1RA 5EY5A 3NNTA 5AHNA 1K8ZA 1WOAA 2P10A 5LNSA 1LLZA 2YCEA 1F5ZA 5C6MA 1W5PA 4U4MA 4UFLA 1TPWA 5LNUA 3C2RA 4IGHA 4RV8A 4IUOA 4LVFA 3CIXA 2WO5A 4LY8A 3LM7A 3HJZA 1VHNA 4O19A 3W75A 4YCPA 3EWXA 1JUEA 2CZ5A 3THAA 2A4AA 4FXSA 3S8HA 4A22A 3LCHA 3LCWA 5C5YA 1IIGA 4X22A 3W76A 3TC6A 2J27A 2CLMA 3OIXA 5MHBA 3QF0A 3W6YA 1KFBA 2AQWA 4PL1A 5J5DA 3QPYA 4N4QA 3S42A 4A29A 2OCZA 2C13A 5G5IA 5DY3A 2XN2A 3MI3A 3C8FA 3GXNA 3L5MA 2E6DA 1V7YA 4Z0JA 1YXCA 5C55A 2J9YA 1PS9A 3E12A 3BVJA 3FFSA 2CLEA 3L66A 4CCEA 2Y89A 3LERA 3QW4B 2VFEA 1ZAIA 4JTUA 1KM4A 1F6PA 4X3ZA 4YCOA 3PUEA 3NQEA 5CPOA 3HPXA 4WUIA 4HSOA 3W83A 3DHDA 3SW6A 1WYIA 3L0KA 4Z0SA 4N6EA 1FWNA 1OFAA 1QDSA 3RLVA 1GZGA 3TQKA 2QR6A 3L2IA 3HPSA 4E2DA 3RNDA 3SSJA 4GWEA 1RV8A 3C2FA 1YLVA 2VEMA 4HNTA 2VKZG 2D73A 3DFQA 4ONVA 2R14A 1ZNNA 4AEOA 1D9EA 3QFEA 5AYZA 5FF3A 3LHUA 5FESA 4JTKA 4X2RA 3S5YA 3C52A 3PULA 4AXKA 4O14A 2JKPA 4UIOA 4MY8A 3W1MA 2DZVA 1K8YA 3B04A 5HUOA 3W71A 1SFJA 2ZQ0A 1HO1A 3MHFA 2ZRVA 2FIQA 3ABRA 1Z44A 4O54A 3UWWA 5IBXA 3UYCA 3NQ2A 1YYAA 1I2QA 3CQ0A 2PC4A 3QZEA 4MUZA 2QCFA 3USBA 1MEHA 5EA9A 3Q94A 2HS6A 3SGUA 1VC4A 4PA8A 5CPLA 1EP3A 2CLOA 5L6UA 1GTEA 3W74A 3C56A 4JTFA 1NEYA 1QOPA 3W7HA 3EKZA 3RFAA 4GUHA 2C19A 3W9ZA 3SJ3A 3QQ1A 3MI2A 2VFDA 3S9YA 3PBVA 3W86A 3GZ3A 4DF1A 3TDFA 4E0CA 5DN1A 1NFBA 3UPBA 2GJLA 3UPWA 5KZDA 4L4MA 4JYDA 3WFAA 5DCEA 3UQNA 5F2GA 3ABOA 3NQCA 4FX7A 1WBHA 3SECA 3Q2DA 1DVJA 1A5AA 3A24A 4OU1A 1H7RA 1W5QA 4R33A 2LLEA 4UTMA 3LRMA 1H7OA 3ELFA 2H3DA 3GB6A 5L9FA 1XC4A 3CWOX 1XFBA 1KM1A 1OX4A 2IQTA 4FX8A 1JCNA 3G1SA 4O57A 1YTKA 2QDGA 1F74A 3HG5A 4PL2A 4WXYA 3DFSA 3KVMA 1EWEA 3NVTA 1Q3NA 3MUXA 4HSNA 4PODA 5HULA 1AL7A 1CW2A 3LOTA 3NQ8A 4NT0A 3DFPA 4Q32A 2A1YA 3LRKA 3NG3A 1LCOA 2NWSA 1KTNA 3TV8A 3P84A 1LOQA 3QM3A 4BI6A 5K9XA 2BWGA 4A2SA 2FPTA 4FO4A 1QPQA 2J24A 3O6DA 2OZ0A 4ZQOA 5G2HA 5LGXA 5K3VA 1HUVA 5AHFA 1J5TA 2JBMA 5FEXA 4EF8A 2BTMA 4IXXA 1QNVA 2YDAA 1YPFA 4FNSA 3BW4A 2ZA3A 2ALDA 3ANYA 3G1AA 3UXDA 3W70A 3GXPA 1ME7A 5A8GA 1NF0A 3FYPA 4O11A 4TX9A 1OX4B 2EAWA 1FWRA 4IMDA 3N14A 4KFNA 3I7SA 1EP1A 1AK5A 1OF6A 4UTUA 2G96A 4RKAA 3PF3A 3P5YA 1VPXA 2J9ZA 2Y7DA 4UFJA 3NGJA 2RHGA 4C1LA 1LORA 4QNEA 2YYUA 4MIMA 2B7QA 1NF7A 3U6WA 1C8VA 1G4PA 3F4NA 1HTIA 1OFQA 1RZMA 4MYAA 2OMAA 1XUZA 3EWWA 1TPDA 1HG3A 3NQDA 3N19B 3IIPA 4QNWA 1WDWA 4OWGA 2ZZ1A 1LM1A 1GYNA 3C2OA 4JNMA 4ZQMA 3IIXA 3MYPA 1QFEA 3DBPA 4JTSA 3G1HA 2QCDA 4BWLA 4QAIA 3TW6A 4IOTA 3HO8A 5FEWA 2Y88A 1TPEA 1YDOA 4FNTA 1WAUA 1Z42A 3TK7A 4NU7A 3PWAA 1FCUA 3KHJA 1G67A 3FS2A 3FIGA 3NEVA 3W7NA 3GAKA 1UBSA 3D0CA 2ZRYA 1JUKA 2PCQA 3TC7A 1PL9A 3EX6A 5CG7A 3UWZA 5F2MA 3NPVA 1XDLA 4A2RA 2Z6IA 3P62A 5DLCA 4TIMA 3CEPA 1W8SA 4LS2A 2O7SA 5CKSA 3W2LA 2ATMA 3DFOA 2NLIA 3O15A 1UCWA 1GWJA 1W5MA 1Y0EA 3W7EA 3KAOA 4TMBA 4UFIA 1ZCOA 5G2WA 1MXSA 4IMCA 3DU0A 1FDZA 2R94A 2QCDB 5F4SA 2VEPA 1TV8A 3ATYA 4JS3A 4M7SA 3MHUA 1EUAA 5D05A 3LBMA 4AHPA 3W3OA 3R5EA 2GJNA 4MYXA 2GQAA 1IXQA 2W6RA 4O0ZA 3W7IA 4UTTC 1OFBA 2E5CA 1O94A 4WOQA 4MLRA 4RR4A 2RH9A 4LW7A 5I3FA 2I9EA 4QQ3A 1I4NA 3P8IA 3LRLA 2V2CA 4QSHA 1NAL1 1GOXA 1W31A 4NQ1A 1RQBA 5F1VA 5GVJA 4PH6A 3NPWA 3NXFA 2QUUA 4BF9A 4I7UA 3MBDA 4RCXA 3S0CA 4GNJA 3W7MA 2QUVA 3G1XA 4GRSA 1KTBA 1KW1A 4FIRA 5HWNA 1PHQA 3BGJA 1R2TA 2ZZ2A 3K30A 2PRHA 2G97A 4OBTA 3W7RA 1YDNA 3QYQA 4WXZA 3TSBA 1T8XA 4AH7A 1E51A 1EUNA 1X8FA 2BLEA 3VKJA 4KFOA 2ZTKA 4IMEA 2V9DA 3W7PA 3MBFA 3OBKA 1GVSA 4WZHA 3MP3A 3P67A 3CEUA 4YXGA 1A5BA 3N3MA 4JD4A 4OHQA 5T26A 3P61A 5LNRA 3LCGA 1V5XA 3DFNA 3STEA 3GR8A 1R46A 4DO6A 2EGZA 1PE1A 1Z41A 4M5PA 3GNNA 1WOBA 3R8RA 4GBUA 3GVGA 3IEBA 3BLIA 2ZRWA 1ZHAA 2C3ZA 3SIZA 2GPTA 3S1XA 5I3IA 1YADA 4IJBA 3BG5A 4DO4A 1AW1A 1THFD 1JCXA 4KFPA 4PEKA 1NSJA 3CM4A 4R34A 1KFEA 3RU6A 2JKEA 4X9SA 4MKNA 1AW2A 1RVGA 5G1YA 3OHIA 1A5SA 1XL9A 1S5VA 3QW3A 4FNUA 5AOUA 3CU2A 4K7VA 1O95A 2TMDA 3O16A 5D2TA 1LP6A 2B4GA 4FNPA 3JRKA 4R7JA 1LRTA 3IGUA 1GG1A 3HQ1A 4ML9A 1VQTA 3KXQA 3ZS4A 1SUXA 5IM51 1KFKA 1XDMA 1MSSA 3NQFA 2CLHA 1H51A 3NO5A 5D2XA 4BFAA 2V0TA 3EWZA 4LT9A 3MJYA 5K9CA 3O63A 1GQNA 4RK8A 1H1ZA 1ZAHA 3HB9A 4XBSA 1OFEA 1YXYA 3M9YA 4D2JA 4IX2A 3HGOA 3CHVA 1L6WA 3UWYA 4GUFA 4WY0B 4NNBA 4XBKA 3UWVA 1Q6RA 5G4EA 3PUOA 5D2YA 1WQ5A 3LLFA 4BR1A 1W56A 4AB4A 1ADOA 1XCFA 1G4TA 4MLJA 1XBYA 4Z1BA 1ML1A 3DH7A 1XBVA 1LLWA 3LHTA 3Q58A 4O10A 3A9IA 4FNQA 1TO3A 2UV8G 3GNDA 3E96A 4TMCA 2WSRA 3BG3A 3VNDA 1SO5A 4NJKA 3G1VA 1DJNA 4I9AA 1FWSA 3HG4A 2Z0IA 4CQ9A 3HGRA 3DI1A 3BV4A 1DBTA 1RR2A 1I2RA 5AYXA 5F1UA 5EBUA 3C61A 3LB0A 1YPIA 4NX0A 5D09A 4QM1A 1X1ZA 1TTIA 2YYTA 5TQLA 3CT7A 3UNDA 2VFIA 3MO7A 3EX3A 4ICNA 5LKYA 1AL8A 4S2CA 2VEKA 1JCYA 4H6KA 1X1OA 3NZ1A 1A50A 1FXPA 3P60A 4ZQNA 1KV8A 2ZDRA 5HMSA 5K9DA 3CIWA 4K38A 3G1YA 3NA8A 4EWND 1TRDA 3W7DA 4NNAA 2NX1A 3YPIA 4EF9A 1W5NA 2ZRUA 1IIHA 2NZLA 5LHEA 2GVLA 5DXYA 3EKLA 3GR7A 2CZDA 3TAOA 4CNOA 1I45A 1R2RA 1YTEA 3EXTA 1FBAA 3G8RA 1L6SA 1F7BA 1AG1O 4AWUA 3W7QA 1SZNA 4WX2A 3P81A 3R12A 1TJRA 1WBJA 1XKYA 5G1TA 1H5YA 5AC8A 1SPQA 2A21A 4LC8A 2E09A 1N7KA 3W1UA 3G8EA 4NZJA 1ZALA 3TU9A 3N34A 2FDSA 2B7PA 4KWWA 3Q37A 2YW3A 3KRZA 3NL3A 1EA0A 2KZHA 3DXIA 1OFPA 4DPPA 4O1DA 3PBYA 2CLIA 1K8XA 1S5TA 5D03A 1GEQA 3TR2A 3JR2A 1TPC1 1U83A 3C2VA 1SW0A 3NQAA 2Q3RA 3W7LA 4JR5A 2E5DA 4PFMA 3UY8A 4ZVJA 4UFHA 3LTYA 4CQ8A 2VFHA 2CWNA 3MWAA 2H90A 1DQWA 3TCEA 4M7TA 4K6AA 4NXSA 4XZ9A 4LVDA 2A6LA 1QO2A 1LROA 4JXCA 1L9WA 3NYZA 4Y8FA 3F03K 4WD0A 4OQVA 3W23A 4DELA 3S5ZA 4CNNA 2ZZ3A 3KRSA 4GXMA 2V81A 1SZEA 6TIMA 1P1XA 4LTSA 1A5CA 1TIMA 3STGA 3S5NA 2R8WA 3QMSA 1OYBA 4O12A 4DBEA 4EVZA 4QIUA 2C16A 3W72A 4LVBA 3LCXA 4MY1A 2A0NA 4LV9A 4EIVA 4RXFA 3B03A 4P2VA 3FLUA 3T44A 3NM3A 3OVQA 3B4UA 4LU0A 4RXGA 1SR9A 4RZ6A 1HL2A 2DORA 5F4XA 2ZTJA 4FEZA 4PTNA 1FCBA 1TSIA 4IPIA 2NUWA 2V30A 3NAVA 3IVTA 1WA3A 4Q4KA 4FNRA 3NL5A 1UUOA 1H7WA 2BSLA 3EB2A 4OV4A 2ZZ6A 3W1TA 3LCFA 3M44A 1OK6A 3FA5A 3VCRA 1N8FA 2NXGA 4AVFA 2NUYA 1K7FA 1TV7A 1CX9A 2QCNA 4PCFA 3NR0A 3HIJA 1EIXA 4JTIA 1CI1A 2WQPA 2F84A 2GQ8A 1K7EA 4FXRA 3BARA 3TUUA 5AN7A 5HR6A 4JTGA 1K02A 4QITA 3V1PA 4N9CA 4AMAA 2G5WA 3DGRA 1F6KA 1OHLA 5KZEA 1QOQA 1W1ZA 3IIVA 1KM0A 3TFCA 1YXDA 3W87A 5AHIA 4Y6GA 3FKRA 3W2JA 1SO3A 1PV8A 4MFEA 3UY7A 4L4LA 1DJQA 1C29A 1XBZA 4O1AA 1OG0A 3G3DA 3NQMA 4CCCA 2Y61A 2ISSA 5DY2A 2A6NA 5EPDA 4UMCA 3TW7A 3T78A 4JX5A 2RDUA 2V5BA 3LHVA 4LS0A 2H8XA 4MOZA 3WJSA 3STCA 2CLKA 5HINA 4AF0A 3BK0A 3EX1A 1I2OA 3C3NA 4JEQA 4NZFA 3OEXA 4FX6M 5A5WA 1L6YA 3M47A 5BNKA 3P80A 4AWTA 3PG8A 1XBXA 1ZAJA 5HUPA 2CZEA 3INPA 3L65A 2QJIA 4HNNA 4W9TA 3CPRA 1VRDA 4O28A 2DJXA 2DZUA 3N9SA 3UWUA 1TTQA 3KOFA 1VYSX 1GVRA 1VCVA 3PC0A 8TIMA 1FCVA 2X30A 3LV6A 3THQA 4K7YA 4E2BA 3LDVA 2FFCA 2FJKA 1K3UA 1UB3A 1VGAA 1FCQA 4O0KA 5I3KA 4LUJA 2TRSA 3WK0A 2NV1A 4JIPA 1OABA 4NNCA 3EWBX 1G7VA 3M41A 5D30A 4IWWA 1DL3A 1VZWA 1ZY9A 5KTLA 3SR7A 1SSDA 1S5WA 4O4VA 3S6DA 1QMLA 1LOLA 3FKKA 3KX6A 3SY5A 2PRMA 4AF0B 2DU2A 2H3BA 4BK9A 3M6YA 2ATSA 5U7SA 4N4PA 2CW6A 1EWDA 2GVJA 3T7VA 2H8ZA 4YL2A 3GDTA 4FF7A 1VHCA 2QKFA 3UWQA 2QEZA 4KKXA 5C54A 3P74A 1IXPA 1LBLA 3GIYA 4GJ1A 4YLWA 1TQJA 1M6JA 1QPOA 2EPHA 1GJPA 3A23A 2HTMA 4LRTA 5G4WA 2E68A 5FEPA 2RKXA 2JGQA 2XN1A 4UMAA 5DELA 3R2GA 4JDBA 1H50A 1EPXA 3BLFA 3A21A 1TTPA 3S1WA 3MP5A 3BW3A 2VENA 5FF7A 4JDYA 5AFDA 4JIQA 2BXVA 1MEWA 1Q45A 1BKSA 2ABBA 3VI2A 2VXNA 3NDOA 3W2UA 3LXBA 1Z48A 3RLUA 5FI8A 2ZBTA 5CPMA 1XI3A 2Q8ZA 3GKFA 3PAJA 3O6YX 1PCWA 2PRLA 2QAPA 3H54A 1GPWA 2ISVA 3NQGA 4ZQRA 3KVJA 3GXTA 3W1QA 3NQ6A 4MZ8A 5E0KA 1X7FA 1FX6A 5KITA 4O16A 1W3NA 1G4EA 1XXXA 2FPVA 3LXAA 3NQ7A 3TFXA 4UC5A 5C2XA 3W88A 4JY9A 3W85A 3A5FA 5KINA 2EKCA 3GDKA 3IVUA 3W2KA 3GDRA 3GK0A 4IMFA 1G7UA 1QO5A 1H60A 1OK4A 1TTJA 3BG9A 2ZA1A 3V75A 5AHEA 3HBLA 1Q6LA 4JTHA 1SZFA 2CLFA 4HPJA 1XUUA 1F73A 2FTPA 3BLEA 3RMJA 1B9BA 4R53A 4N2YA 4LNYA 4DBDA 2DJLA 1J2WA 2WPBA 3TX9A 1AW5A 2F7FA 2WJZA 4G1KA 1SZGA 4CCDA 2ZYFA 4GC4A 4JTEA 3HPZA 3S1VA 2QF7A 2VOMA 1RPXA 1GVFA 3SI9A 3EXSA 1TV5A 3M43A 1DQXA 4O53A 3PBWA 3PVFA 3O05A 1KFLA 4UTLA 1TPH1 1B57A 5KMYA 2RDTA 3CTLA 4OV9A 1DHPA 2GVGA 3A22A 4XWUA 3W1RA 2VC6A 1DKWA 3I6RA 5I3HA 2FPYA 1OFRA 2EHHA 5FF0A 3EEGA 2X2GA 1JRBA 3STFA 1ICSA 1SO6A 3BW2A 4UFMA 3W2NA 2QDHA 2OJPA 4Y9AA 3UD6A 2NXHA 2WNNA 4LC6A 4Z1AA 3GDMA 3N2XA 3LHWA 4UNLA 4MJZA 5TBOA 3G18A 2JKAA 5E93A 3TJLA 1C9DA 4I7VA 5H2ZA 5I3GA 4CNPA 3PM6A 3UXAA 2X1SA 5D02A 2GOUA 5BOOA 1T96A 1SO4A 2YR1A 1OYCA 1EX5A 2H6RA 1SFLA 4WOZA 2ZA2A 3BGGA 2Q8LA 2I14A 1LRNA 1ZFJA 5F4WA 3MI6A 5CPNA 3T55A 1S3HA 4O8RA 4ORMA 4E38A 4WY0F 6ALDA 4AHOA 1N55A 1W37A 5DCDA 2CFFA 1FWWA 1KFCA 2ZZ4A 3FEMA 3VFLA 7TIMA 3S1UA 2A7NA 3WJZA 1M5WA 1GT8A 5H91A 2DP3A 3W22A 3LBCA 5E1QA 1LYXA 3G1FA 2VFFA 5FF4A 2W79A 1TMHA 5LNWA 1SW3A 2G95A 1KM3A 4YMZA 1OYAA 4UMBA 3TQVA 4HN4A 4UTTA 1H61A 2YFNA 2ZCGA 2ZRZA 2Y62A 3FOKA 3IGXA 1P0KA 3LI0A 3O6CA 1KTCA 2B0MA 2GUUA 3UZ5A 4AHQA 5EYWA 1JVNA 3P82A 4DF0A 3SZ8A 1TPVA 4AWSA 1KA9F 1G6CA 4LVGA 1GVOA 3O06A 3LCLA 4DXVA 3DKLA 1WXJA 2V8ZA 4BI7A 4Y96A 3C2EA 1D3HA 3M16A 3MYOA 2E6YA 4UTHA 3EX4A 5IBXC 5HWMA 2DZSA 1QCWA 1IXNA 1P5BA 2Y85A 5I3JA 2V2DA 1KLYA 4O1CA 1VCFA 1JJKA 3TJXA 3HGSA 1P4CA 3SGZA 3LXCA 5CZJA 2YZRA 3EXRA 3L68A 1I2PA 1VH7A 3LX9A 3TNOA 3W73A 4ZMGA 1F2JA 1G69A 3B05A 3CC1A 3LTSA 3JS3A 5DCBA 1LTDA 3M1ZA 3GDLA 1D3GA 5CSRA 3NQVA 3G3MA 3E9AA 4RLIA 3T40A 4ADTA 3I7QA 4LV4A 3RK8A 4QISA 4LRSA 3H53A 2YFOA 4EOUA 3NPXA 2J6XA 1JCLA 1P0NA 3IIZA 4NJGA 4H4IA 4DQWA 3O07A 3TIMA 1TYGA 2RFGA 4UTIA 1RD5A 4JTTA 1OX5A 1TJPA 5K7JA 4IQLA 2YGYA 4HIBA 5CZ0A 1YDVA 4LOCA 4XKYA 4GUIA 2QUTA 2ZZ5A 2YPIA 2J9XA 1KBIA 3KVLA 1PHWA 3E49A 1GTHA 1JUBA 3DHFA 1PVNA 2NUXA 2A2IA 1JR1A 4HPXA 5CZSA 3NOEA 3LHZA 1H7NA 3DKJA 3NZRA 3LLDA 2ZZ7A 3I68A 5HJLA 5LSMA 1H63A 1JULA 4TO8A 1EEPA 5BRBA 2YX0A 1O5XA 4N9EA 1H1YA 4B5NA 1FUYA 1PCKA 2YXGA 4HHPA 2B7OA 4RJEA 2QCHA 3U8GA 1LZOA 1OFDA 3TH6A 1R47A 2FQIA 1B3OA 3E02A 4N6FA 3G0SA 1FXQA 1EP2A 1ICPA 1MZHA 3ABSA 1OJXA 2Y7FA 1IF2A 4IX0A 2CZFA 3W1XA 5AB3A 4M6PA 4XKYB 5FEZA 5D2VA 2WSQA 1FQ0A 2WKJA 2NV2A 5EMUA 4Z1CA 4GUJA 1FY6A 4M6VA 4CQAA 4H3DA 5ABTA 4O1BA 1ALDA 1XM3A 3HMJG 3QSRA 4OT7A 3N9RA 3W07A 2A5HA 3UZJA 1J4EA 4LVAA 2BZNA 4LWWA 4MY9A 3L67A 1GVQA 3C0JA 3KFTA 3QRHA 5LNVA 2FLIA 4LUIA 1TREA 2C6QA 1UASA 3ZR4A 3W1NA 4XTDA 4BWLC 5AC6A 2EF9A 2JGYA 4FIQA 1VR6A 1VCGA 3W7KA 1RQHA 4NJHA 3QMRA 1LBMA 2OX1A 4P61A 5HR7A 4XUGA 1GYLA 3G24A 1UJPA 4IPJA 4UXDA 4O18A 4K37A 4HNUA 3M5ZA 3WK2A 2A7PA 2O7QA 1ME8A 2QCMA 2AAMA 1TCDA 3DZ1A 4K39A 5K2ZA 3TMLA 5LHFA 5D37A 4NVTA 3WK3A 1JQXA 3LV5A 4UTWC 4ZL1A 2V82A 3RF9A 3DFTA 3A5VA 1VJIA 4UUIA 2Z1BA 4O50A 3N2MA 2DZXA 3ATZA 4MPQA 4KWVA 1O4UA 1AMKA 3W7JA 4NJIA 4ZZ9A 4MJMA 5FF2A 3W1PA 3QMTA 1KBJA 4WJEA 3W7CA 4O52A 1M7PA 1O5KA 3MW7A 3WJYA 2GQ9A 2TYSA 2XN0A 1LOSA 3ABQA 3KRUA 4ALDA 4CLMA 1KV5A 4JYEA 3PY2A 4ADUA 4ADSA 4S1FA 4DEFA 5AHMA 2VFGA 1H7XA 3W1LA 1FWTA 2V2HA 3BO9A 3TXZA 3PB2A 4HKPA 4PC8A 1OFOA 1PIIA 2QJGA 3TAKA 3QC3A 2B7NA 4NXKA 3VE9A 2Y6ZA 1IGSA 3F4WA 2CU0A 2OT1A 3ZFHA 2E1DA 1OVDA 4XQ6A 3CWNA 2YSWA 5EL1A 3B0VC 2QCLA 1KM5A 5AC7A 3L5AA 1VYPX 3CLMA 4JY8A 2QCEA 3IIOA 3QH2A 2QAFA 2QCCA 4WQ6A 3TE9A 4ORIA 3HOJA 1M7OA 3M0ZA 4Y90A 4NJJA 1W54A 3O1NA 3LGEA 3M5VA 2NXIA 1BEUA 1W3TA 2NX9A 1W5OA 1W3IA 4FB7A 2XFWA 2RDWA 1IXOA 1TB3A 3OVRA 4I7WA 3G1DA 3M7WA 5HQEA 3M5YA 3GAYA 4U28A 1BWKA 5U4NA 2Y63A 2DZTA 2NX3A 2YW4A 2Q3OA 2VEIA 1QPNA 3LTPA 1VS1A 1QR7A 4A21A 3PG9A 1F05A 5KZMA 1I8JA 3PS7A 4K8HA 2ISWA 2X1UA 3L5LA 2E6AA 2WNZA 4J9JA 3EWUA 4BI5A 1KM2A 3IV3A 1VLWA 3NM1A 4Z1DA 4MFDA 1F76A 1SU5A 2VELA 3GYEA 3H55A 1A53A 4JTLA 1DV7A 4JTJA 5HWJA 3AJXA 4AAJA 1LBFA 2W0UA 4UTWA 3TXVA 3IVSA 1Q6QA 5AHLA 3OVPA 4JICA 1FDYA 3TSMA 3C4UA 5SWUA 3CB8A 3MMTA 4UR8A 2X1TA 4YWIA 1ZJIA 3B0PA 1TPB1 1G4SA 1WX0A 3LCIA 2V5LA 3QEZA 3LI1A 4Q33A 2ZFAA 3GKAA 3PBUA 1SQ7A 1U5JA 4MZYA 5TIMA 3AO0A 3SFKA 3GLCA 3T4CA 2PURA 3E0IA 1TRIA 3B06A 3W84A 4JN6A 2CLLA 1R30A 3G0UA 1Q6OA 3PR2A 5F2LA 5D04C 5BMXA 1YTDA 5LZLA 2DZPA 3N73A 4O17A 4RZ5A 5G2IA 1O60A 3PUDA 3L0NA 4JYFA 1TPUA 3IGSA 3B8DA 3F1QA 4Z08A 1H62A 1W0MA 3EWYA 4MVAA 4RZ4A 1OX6A 3W2MA 4S2BA 5K4ZA 3HGJA 3EX2A 4RX0A 3QSTA 5CSSA 4JX4A 5D32A 2Y7EA 1KLZA 4FHAA 4IMGA 1BTMA 1MO0A 5HNRA 3C6CA 3BPWA 4O13A 4GE8A 4OGZA 5AYYA 2E5BA 5D33A 3QQ0A 3G0XA 2ABAA 4M6QA 3TSDA 4OE7A 3IRDA 5KSWA 5F2IA 3HF3A 5DBUA 3PB0A 4HNVA 2ZRXA 3QPZA 2QCGA 1ONRA 1HO4A 3WK1A 4C1KA 4TR9A 4ZQPA 3G22A 3MP4A 2C1HA 3DI0A 3S5OA 4UTJA 3M5XA 3NPUA 2HSAA 4LS1A 1JQVA 1VYRA 2TSYA 4XTIA 2HS8A 2P0OA 1MEIA 3WJXA 1OF8A 1ZENA 2HMCA 4O15A 3OG3A 4POCA 2R91A
chains in the Genus database with same CATH superfamily
1B4KA 5A1AA 5FA5A 3RCNA 3CH0A 5IDIA 2DSUA 4GCXA 1FP8A 3TN3A 3M64A 3A4AA 3SM0A 4H6RA 3D3FA 3ANUA 2E77A 4HBKA 4K3ZA 1WV2A 5TNVA 4UR7A 1LRQA 1W9BM 4BCEA 5A2BA 3GIPA 4LEQA 1MXDA 2Y7GA 3U2OA 4J35A 4U5KA 3H4XA 5K4XA 2NQJA 1GOMA 3W1AA 2VX5A 3OP2A 1R2SA 5D2WA 1IHIA 1LL6A 3H8AA 2WNQA 4D6EA 4GUGA 3AUOA 1K03A 4OVXA 2PC8A 4H9ZA 4DO5A 1R5YA 2X09A 3LHYA 1X6UA 3TQPA 1NVMA 2WKLA 3FJLA 4FLSA 2ZICA 2NWRA 4NILA 1DORA 3VE7A 2Y5SA 1L0PA 5GJNA 4R7OA 4M19A 2VD9A 1UR0A 3D46A 4TU1A 4C65A 2V5KA 3KVKA 4IM4A 3W7OA 2BX7A 3FJ6A 4NZ3A 1GG0A 4UFKA 4NAEA 3TKFA 3DAQA 3SN0A 3VNJA 4PRTA 2WSPA 4O4WA 2F9RA 2E6FA 3K4AA 5EKYA 2QNEA 3UR7A 4HGXA 3TROA 4KERA 1UR8A 5CZTA 2E9LA 1XCWA 4HT3A 3FDGA 1P48A 2GGHA 3HQPA 4JHZA 3WJWA 1G0CA 1SSGA 3DGBA 1UP2A 1Z7AA 2P1FA 1GQKA 2DV0A 4NYYA 2Z6JA 4S3KA 4WLCA 3I7RA 3A4WA 3TMQA 4DZHA 1EDQA 4GK8A 2ZXAA 1K8ZA 3ZM8A 4HZMA 2GVEA 1HX0A 3M0MA 2P10A 4PMJA 1LLZA 2YBVA 2I56A 1F5ZA 1P0DA 4NAEB 1A49A 1TPWA 3GFYA 4IUOA 5CLWA 2BDQA 3ITVA 4LAKA 3HJZA 1VHNA 3W75A 3WH9A 1UWRA 1D8WA 3MKVA 4YCPA 2FFIA 2PLJA 3EWXA 1JUEA 2ZX9A 4ZB0A 2CZ5A 4MMWA 2VL4A 3H12A 4U31A 3GH4A 3S8HA 4WHBA 4X22A 3W76A 1JYWA 5H6HA 1UKSA 3OIXA 3QF0A 4EP8C 2CERA 1PKMA 5J5DA 2C13A 1RLCL 4TVDA 3GXNA 1VFUA 3UXLA 3AXXA 1UD2A 1YXCA 4G8TA 2W67A 3DEQA 1PS9A 3HURA 4LB4A 3R8HA 4AZCA 3RILA 1FHDA 3OYZA 5CPOA 3IJ7A 4PCNA 1XRFA 1YNQA 3DHDA 1XIEA 4HK5A 1WYIA 4N6EA 2FYMA 3RLVA 1GZGA 4LCSA 4FP1A 1ISYA 4AFYA 1ONWA 1RV8A 3C2FA 2NVAA 2PLMA 6CGTA 3LBOA 1UYQA 4JTQA 2D73A 1PWMA 1OCQA 2I7GA 1KBBA 3P3BA 5AYZA 3AWOA 7CGTA 2OXNA 4AXKA 4LF2A 5HAOA 1HNYA 4YIWA 2PWEA 4UIOA 4GVHA 4R5EA 4AZCB 1SGJA 2C71A 1E5NA 5HUOA 4QQUA 1POKA 1SFJA 3P93A 4HU3A 1XLKA 5DEZA 2ZRVA 3TLLA 2VM8A 3UWWA 5GPRA 4KT2A 1OC6A 3UYCA 4Y7EA 2ZX5A 3UCDA 4MUZA 1Z3NA 2QCFA 1MEHA 4HA4A 2HS6A 3H24A 3SGUA 3SURA 4PA8A 3T0BA 2YA0A 3GWQA 4ACYA 4BQ2A 1E6ZA 2CLOA 3W74A 6REQA 3C56A 1EOMA 1A5OC 4P7RA 4E4PA 2DEPA 4CD4A 4JHMA 3M0YA 4FMVA 5CPQA 3QQ1A 3MI2A 3S9YA 4WKFA 3R94A 3W86A 1E71M 3XISA 1NFBA 3T8LA 5I09A 3WFAA 4HB7A 4MNKA 3NQCA 5CAHA 3PTQA 4HMDA 4D71A 1WZKA 5M17A 3SECA 9CGTA 2X8RA 1BF2A 1U1JA 3B0XA 5CCZA 3A24A 4QBXA 4R33A 5IRPA 2LLEA 2OX4A 1H7OA 3ELFA 1JPKA 1MW0A 4LY4A 5L9FA 4HP5A 1PX3A 2FZBA 1LLOA 2F61A 3V0SA 2QDGA 3HG5A 3OU8A 2A3EA 2VEFA 4WXYA 1XLJA 3KVMA 1A5LC 4C1NA 3MUXA 3SY8A 1CW2A 3W00A 4M0XA 3NQ8A 3NO1A 4Q32A 2A1YA 2G3JA 3NURA 2NWSA 1KTNA 3P84A 3QM3A 4W7UA 5BWAA 1V6XA 4Y9PA 3L23A 2BWGA 3O0KA 2NQLA 2J24A 4DM2A 3EWCA 2F6UA 1J5TA 3MY9A 1UD4A 4GNVA 5M03A 2H9AB 3GHSA 2YDAA 1YPFA 1MW3A 3UXDA 3W70A 1ME7A 3H2NA 1WZAA 1US0A 4UQ9A 1FWRA 4IMDA 3I7SA 1XGZA 4PMQA 4QXIA 1EP1A 1AK5A 4KW2A 2VGBA 1VPXA 2XSXA 2WM1A 1GONA 5E5CA 4PCPA 4OJYA 4X63A 4A3RA 3U6WA 3WQCA 4MG4A 1V0KA 1OFQA 1WB0A 2OMAA 2XSAA 2YCJA 1EC9A 1IEWA 4QNWA 3N11A 4IF2A 5CGMA 1HL9A 1LM1A 1UR3M 3B9AA 2CLPA 2XIMA 3DBPA 1EHNA 1GKPA 2QCDA 4V28A 4QAIA 1S2CA 4IOTA 3GUWA 4TXEA 2Y88A 4MB3A 3UG3A 3F7JA 4FNTA 3POHA 4HTBA 3UNTA 1Z42A 4QR6A 4J2MA 3TK7A 4GD0A 3KHJA 1G67A 3GAKA 4L7ZA 1XSIA 4B90A 5A2CA 2ZRYA 4JTRA 4Z2JA 4GYJA 4F9JA 3TC7A 4NG3A 4QP0A 1PL9A 3EX6A 3U57A 3A9BA 1KCXA 2D3LA 4QE1A 3WQGA 3GHTA 5DLCA 3N6JA 1C91A 1W8SA 4RW3A 1KQYA 2O7SA 1V02A 1PBGA 3W2LA 3VZYA 2CKSA 2NLIA 3MV11 5FAGA 3UGVA 3QC0A 3H2FA 1B30A 4PZVA 4TMBA 4GZEA 5CEWA 1JXKA 4XZHA 5G2WA 1MXSA 4IMCA 3DU0A 1FDZA 3VIHA 1UIPA 2QCDB 2VEPA 1TV8A 3KTSA 4MTVA 4JS3A 3WLNA 3QXBA 3MHUA 5PTDA 1TG7A 1OEPA 3LBMA 1V3LA 1ZGDA 4PE8A 1X97A 3MDWA 4MYXA 3KS5A 4KETA 1DXFA 4MUPA 3KBVA 1X8CA 2E5CA 2FTYA 4MLRA 1WDQA 1G01A 3KBNA 4Q4RA 8A3HA 2PDFA 6A3HA 4GZIA 2XH7A 4NQ1A 3RR1A 2BVYA 4H8HA 4ATWA 3V35A 2QUUA 4I7UA 2GUBA 2W61A 2BGSA 4Y9NA 3ZJ6A 3E2RA 4FIRA 3OGVA 1C92A 2ZZ2A 3EDJA 2PRHA 4FLRA 2Y24A 4AH7A 1FHUA 1E51A 2BLEA 3BQ6A 4HCLA 2UWFA 4KFOA 2ZTKA 1ZJBA 3S6OA 2HDJA 3OBKA 1T41A 3CASA 2QDEA 4DJEA 3CEUA 1A5BA 5T26A 1YBQB 4FLOA 5LNRA 3WN6A 1OBAA 1V5XA 3STEA 5B7ZA 1XGDA 3GR8A 1R46A 3WBXA 2Z1VA 3GZAA 2EGZA 4IPPA 1PE1A 1V79A 3MANA 3KZPA 1RBOB 4M5PA 4NSBA 3GNNA 3R8RA 2Z00A 3IEBA 1XLDA 4Q8OA 4Q8WA 5GNXA 6TAAA 3EA1A 4JBRA 3WY1A 5CGTA 1YADA 1THFD 4RDVA 4PEKA 2Y5JA 4I6KA 3RU6A 4Y9OA 2PFHA 4X9SA 3PFRA 3CMFA 1ZLPA 1HF6A 3E2VA 4FNUA 1Z6KA 5AOUA 4K7VA 3VX0A 3KL3A 1O95A 2JALA 4H04A 4FNPA 1VBHA 1L6GA 1LRTA 3HQ1A 4CEUC 5LA2A 5IM51 2Q09A 3CPGA 1FWBC 1P0EA 1B90A 3NQFA 4IMAA 1H51A 1JDDA 4BFAA 3S83A 2V0TA 2BY0A 1HP4A 4RK8A 1H1ZA 3GTHA 2UBPC 3H21A 4XBSA 1OFEA 4C6PA 4AD1A 3M9YA 1CGUA 4D2JA 3CHEA 1AD1A 3HGOA 3WNPA 4WY0B 4NL1A 3BMXA 1OB0A 4F8XA 3A3XA 4FPSA 5JH1A 1WQ5A 3LLFA 1KXTA 3KOXA 4AB4A 3SRDA 3THUA 1S2VA 3G2GA 2WCSA 5A6AA 2XGIA 4BY3A 1W9PA 2FVKA 3BL3A 4QDMA 1IWPA 3TTOA 1RBAA 5EFDA 1ML1A 3N13A 4A35A 4JFWA 4I9TA 5C71A 4RE4A 3NQBA 4FNQA 1J11A 3ZT7A 3XINA 2UV8G 1QNSA 3E96A 3B9OA 4TMCA 2WSRA 2ZWZA 3VNDA 1DJNA 2IKHA 4I9AA 1FWSA 2QQ6A 4Y2WA 1KWKA 2O4MA 3HGRA 1E3ZA 3DI1A 1ADSA 3BV4A 4X60A 1RR2A 1XIJA 2D3NA 1AQMA 2VCAA 2O9PA 4HOXA 4NX0A 4D8ZA 1MUCA 3CK5A 3RR4A 2OSXA 3WD4A 2YCIX 2TODA 2VFIA 4KRUA 3I10A 2EPLX 4YYFA 1EO5A 5LKYA 4S2CA 1JCYA 4I9JA 3NZ1A 3UCQA 3BLPX 3P60A 4ZQNA 3QQWA 2W92A 4OKDA 4KH2A 3CUHA 3YPIA 4EF9A 1W5NA 2ZRUA 4AY8A 5LHEA 4A8IA 4JKKA 4DJED 1PIGA 1H5VA 1VP5A 4YWSA 1MNZA 1R0MA 1V6YA 3OOQA 1BHGA 4AW7A 3G8RA 1F7BA 4AWUA 3TN6A 2GSHA 1XPGA 1SFSA 3H70A 4NAFA 3WFZA 4IICA 3CL7A 2J7HA 3W1UA 3NDYA 3MDUA 4ES4A 2FDSA 1QUMA 4E3VA 4HK6A 2KZHA 3DXIA 3PHAA 3VX1A 3W53A 5ABEA 1GEQA 1E70M 3TR2A 4IUGA 1R3SA 5JH2A 4PR4A 4GQGA 3ARSA 5E6ZA 2D2GA 1RJQA 2NVCA 2PGWA 1KCKA 3E5BA 1XGEA 2NQ5A 2H90A 5EGRA 2ZUUA 3TCEA 4QE5A 3BUVA 3OTRA 4XZ9A 3ZSSA 1QO2A 3VIMA 1L9WA 2OQYA 2ADAA 3W23A 4DELA 1A0CA 4J4KA 3VIPA 3KCJA 1LG2A 2ZZ3A 1YW1A 1SZEA 1JF6A 3GTNA 1R87A 4C6LA 4LTSA 3RPDA 1IE7C 2HBXA 2PDKA 2YCKX 2WAGA 3MUY1 3S5NA 1OYBA 2Y8UA 4EVZA 2PDGA 4R88A 2WC4A 4LV9A 4EIVA 2TAAA 3FXYA 4RXFA 2HVMA 1M9HA 3B03A 4P2VA 2OQLA 5GQBA 2INZA 1XIGA 2WZEA 3NM3A 3B4UA 4RDYA 1TIWA 2DORA 5F4XA 2ZTJA 4FEZA 2JF7A 2R1KA 1FCBA 3ZYZA 2XVGA 1A80A 1GVEA 2V69A 1UUOA 1H7WA 1YNYA 3PANA 4G56A 2JFEX 2HQAA 1DJHA 2NXGA 4ZXLA 1ONXA 2QV4A 4OUEA 3F4VA 3AIEA 4S38A 3MCOA 3KZSA 3NR0A 1CI1A 2F84A 4RNIA 3TUUA 3WNNA 1JXJA 3EPOA 1KFWA 1M53A 3V1PA 2WXDM 1F6KA 2HBVA 4C90A 1V7AA 1W1ZA 3A47A 3AICA 1CTNA 2DVTA 1BQCA 1PV8A 4MFEA 4IG2B 3UY7A 4ASTA 4D6CA 1U1HA 1DJQA 1UP0A 2E8ZA 3T4WA 2ISSA 3TW7A 4XAPA 3DYOA 4MOZA 2PPGA 5E0CA 4P7OA 5HINA 3V5OA 3TZFA 1EDTA 1EO7A 3UESA 4NZFA 5A5WA 3M47A 3P80A 5HMEA 4WDUA 4YTRA 1J2BA 2CZEA 3INPA 2DSKA 3MA8A 3S5SA 1BGGA 2BGQA 3CPRA 3UR5A 4J3WA 1GVRA 1BFNA 1B2YA 4K7YA 3DBNA 2FFCA 3PZVA 3DC0A 1UB3A 1VGAA 1FCQA 5I3KA 5A8PA 2XVNA 4LUJA 4H1ZA 1RJPA 2TRSA 5C7VA 1CENA 3RCYA 4AY7A 1OABA 1EGVA 1LWJA 1RPKA 4C6CA 5D30A 9XIMA 4IWWA 1VZWA 3Q67A 3S6DA 3VDCA 4XIMA 1Q63A 4GKLA 2BV9A 2H3BA 1L8PA 1XRTA 4LYPA 3R7MA 2P5NA 4FF7A 1VHCA 2DIEA 4DN1A 1E4LA 3VCNA 3UWQA 2QEZA 4KKXA 1IXPA 1LBLA 4GJ1A 2ACQA 4GQQA 1E0WA 3AJ7A 1IR2A 2EPHA 4LRTA 4FOUA 3KLKA 1SMAA 1QT1A 2G41A 2E68A 1TZZA 2JGQA 2ZKMX 4UMAA 2PDWA 4JDBA 3WF3A 3P0WA 1PIFA 4U3AA 2VENA 1ZJHA 4JIQA 2ZVIA 1ZUAX 3WQOA 2D2OA 2OPJA 1MEWA 2Q01A 3ITOA 3UF9A 2VXNA 3NDOA 4S3FA 3KL5A 5FI8A 3VC5A 2PGRA 4QS6A 2ZBTA 1DTNA 2Q8ZA 4IP4A 1J0YA 5LA1A 4PUJA 5MKGA 3GG1A 3H54A 3RM8A 3KVJA 2J47A 2EXOA 3PZQA 5KITA 1G4EA 3G77A 2FPVA 1XH2A 3KM8A 5HPCA 2J75A 4HJFA 3W88A 3W85A 4HZ6A 4WSHA 3A5FA 5FAJA 5KINA 2PTZA 5BXRA 3HN3A 1KC7A 1QXLA 3IVUA 1DIDA 1RP9A 2XIBA 4K68A 1FH9A 4RE0A 1QO5A 4D6HA 1E3XA 4JTHA 4DRSA 1WAWA 3BSHA 5EMLA 4HPJA 4RDWA 1E56A 2FTPA 1ITQA 3WUFA 1B9BA 2C8NA 4R53A 2XFYA 4N2YA 1E1CA 2NSXA 2PGFA 1EJSC 3TX9A 2F7FA 3BCDA 4A6GA 2PDHA 5MKGB 1SZGA 2X7WA 2ZYFA 4H9YA 2C79A 3DUGA 4EANA 2VOMA 1GVFA 3SI9A 2XFRA 1KGXA 2QJJA 3EXSA 3M43A 1DQXA 2IKGA 4F9DA 1LWHA 3GU9A 1KFLA 1GQJA 2IW0A 5KMYA 3CTLA 3A22A 2QMJA 1NWUA 4XWUA 3V5CA 1XIFA 4PTDA 3S9ZA 4QCFA 2C7FA 2PU0A 1JRBA 4KESA 3EMQA 5DMMA 3SFWA 3W2NA 4HQVA 2XM1A 3II1A 3UD6A 2YL6A 2NXHA 4Z1AA 3GDMA 4WJ8A 2Y2WA 4PTVA 4UNLA 2AGTA 2PP0A 1E1CB 2JKAA 3WQVA 1TJ1A 4WGXA 5H2ZA 1VBGA 4CNPA 2YCLA 3UXAA 1J5SA 5D02A 1CB2A 1A47A 1T96A 1SO4A 4K8GA 4J27A 4NIRA 5DF0A 2Q8LA 1UZDA 5ECUA 4JN7A 3K1GA 3KOYA 4UR9A 5CPNA 3E38A 3LENA 1BYDA 4AEEA 3RPTA 4HYVA 4V33A 3RU8X 3MQTA 2CFFA 2XH4A 1KFCA 3FEMA 2HK1A 5T9CE 4EACA 5HBFA 3S1UA 3GH5A 5H91A 2DP3A 3W22A 3N2OA 1RLDA 3WF4A 4JFTA 1LYXA 2OO0A 3G1FA 4BZYA 1Q7MA 1JZ2A 2W79A 1TMHA 3HZ3A 3TQVA 4C5ZA 2YFNA 5T9BG 2SFPA 2YCLB 4GIYA 3WBAA 2HK0A 4IIGA 1KTCA 1XX1A 2XZ9A 4FLQA 4W8LA 4XSMA 3P82A 4NY2A 3S47A 3P6LA 3SZ8A 3UG4A 2JE8A 4LVGA 2IKIA 3LCLA 1NH6A 4DXVA 3CUFA 1D3HA 3WLPA 3EX4A 3FX4A 1B31A 3SAZA 2ZADA 4HYWA 2Y85A 4ZO6A 1F61A 4O1CA 1KKOA 1VCFA 3TJXA 1LUCA 1DIEA 3MMWA 4JIHA 1B1YA 5CZJA 2PF0A 3L68A 1I2PA 2F6XA 3TNOA 3W73A 1CGTA 4ZMGA 1G69A 4W8AA 1Y8BA 3M1ZA 1D3GA 3N18A 2D2JA 1R3VA 1NJJA 4JFVA 3WH6A 4RLIA 4RNHA 4E2OA 2AOSA 4HD5A 4ADTA 1DIOA 3N04A 1OD0A 3I3DA 2WPGA 1RVKA 3NPXA 2VDHA 2Z1KA 3BGAA 3ARPA 4DQWA 1NOFA 1I0BA 1XSKA 4PSPA 2VRKA 1E0TA 1CGVA 4ERGA 1TYGA 2RFGA 4UTIA 3N6HA 4HIBA 4B3ZA 1LUCB 2BOGX 4LOCA 2Z29A 1FRBA 1K77A 1KBIA 4M1RA 3T0TA 3JW7A 3E49A 1ZU8A 2QDDA 1HGWA 4XO6A 5AVNA 2EQDA 2WLYA 3TJ4A 2OEJA 3NZRA 2GL5A 3GDBA 3LLDA 2ZZ7A 2FZNA 4ZR8A 3U5YA 2Z7GA 3I68A 4JCLA 4H8UA 1JULA 1V0NA 4EAMA 3UA4A 1FWIC 4N9EA 5JBEA 3U8GA 1R47A 2FQIA 4N6FA 1FXQA 1EXBA 1EP2A 3C0QA 1OJXA 1P0BA 2Y7FA 1IF2A 5AB3A 1HKWA 3FSTA 5FEZA 5D2VA 1FQ0A 4YVXA 2GDUA 3QGVA 4GA8A 4CQAA 1PKYA 2XINA 4WSJA 5CC3A 4GHRA 4N0RA 3R58A 4OT7A 3SCOA 1W2PA 1XP3A 1CT5A 4PTWA 4HHHA 3E2SA 3L67A 3C0JA 1K6AA 3KFTA 1UWSA 3VAVA 2FLIA 3L2MA 1UASA 4XTDA 3CGTA 2WZHA 4BWLC 5AC6A 2EF9A 4XG1A 1GQIA 4O1FA 3QMRA 1LBMA 2OX1A 4GPNA 3VDAA 4XUGA 1GYLA 1J18A 1PX4A 4WJXA 3ONCA 2A7PA 2O7QA 1ME8A 1MUMA 1TCDA 4K39A 5D37A 1H09A 1JQXA 3PZUA 3DG7A 3BAKA 1GHRA 4UUIA 2Z1BA 1XFCA 4O50A 2DZXA 1U22A 3OHMB 2CC0A 3HPFA 4I5UA 1E6XM 3QMTA 4GGBA 4WJEA 4L56A 1O5KA 1W8GA 2J7FA 4JFSA 3WJYA 1TMLA 1LOSA 1UWAA 3ARQA 4MJ4A 4CLMA 4UOZA 4H7CA 2VFGA 2R1MA 1FA2A 1OT2A 3BO9A 5BZAA 4PC8A 1OFOA 1PIIA 2QJGA 1RJRA 3QC3A 2PDJA 4IGSA 1X1NA 2HE5A 5REQB 3F4WA 2WZIA 2CU0A 4Z42C 3VIJA 3VD5A 3ZFHA 2Q6ZA 2E1DA 1EJTC 4G7EA 4XQ6A 2W5FA 2YSWA 3B0VC 2QCLA 3H26A 1KM5A 3L5AA 1J6OA 5B7YA 3NSMA 3GW3A 4ZSTA 3CLMA 4DYJA 4DNHA 2QGHA 4IFKB 4CEXC 1XLEA 1M7OA 3M0ZA 4NJJA 4RUBA 1B9ZA 1YQ2A 2NXIA 1NOWA 3NWRA 1W3IA 1QW9A 1XH1A 2PLKA 4TOQA 2X40A 5D8WA 5FJTA 2IXUA 3GAYA 4AC7C 1BWKA 2DZTA 1F07A 3FJNA 1QPNA 4GMEA 4G7EB 3LTPA 3M0VA 5KZMA 1Z8AA 1WKYA 2AMXA 2QGYA 3MMUA 2YL9A 4AIOA 2PEVA 4BI5A 3TCSA 1H11A 3IV3A 3NZQA 3QV7A 4Z1DA 4IZGA 3AXIA 4QS5A 1F76A 2D0FA 3HFYA 3B9DA 1GOIA 4JTLA 1DV7A 4PMUA 1M7JA 1M3UA 2V3EA 2DIKA 5HWJA 3WG6A 2E7FA 3PZ9A 1BWVA 4PMRA 2VZTA 1V3KA 3IVSA 3N4EA 3GVVA 1BG9A 5G4HC 1PSCA 2VWSA 4F4RA 1IGWA 3C4UA 1EOKA 4G5DA 1SJDA 1BVZA 2CESA 4UR8A 4YWIA 2HVNA 1Q4NX 2PTDA 1YX1A 3SUTA 3LCIA 1HKJA 3VIGA 5HXMA 4H6QA 3PBUA 3URBA 4I6VA 4MWAB 3VNLA 4JL1A 2PURA 3VU2A 5M5DA 3W84A 3R0UA 2A3LA 3RLGA 1BSIA 1R30A 3G0UA 1M04A 2O92A 1PDZA 2WB5A 4TX8A 5F2LA 1YTDA 4W8BA 4XX6A 1TPUA 2WWCA 3B8DA 3RX2A 4Z08A 4ATDA 1RSCA 4MVAA 3KP0A 2WJDA 3W2MA 2DSZA 4ERIA 4H6EA 3AC0A 4ICCX 1NY1A 5FCZA 4P7LA 5DRIA 2WM0A 4EWJA 5A8NA 3TWBA 3UR8A 2EPOA 2PUZA 1UR9A 3EPNA 2GZXA 3DHUA 2DZBA 2ABAA 5KSWA 3IRDA 3O9NA 4XV0A 1DWJM 1CXIA 3HF3A 3I6EA 3MWCA 3C2YA 5TAOA 1ONRA 2PDIA 3VA8A 5IFPA 4ZENA 3S5OA 1IWAA 3AS1A 4LUSA 3EZ4A 5A69A 2HSAA 1R7OA 3ZLFA 1VYRA 2P0OA 3R6IA 3CUGA 3V7PA 1ZENA 2DVUA 5J04A 3OG3A 1JL8A 1T0OA 4JQ4A 5JU6A 2FB3A 1KFJA 2CKRA 4DY1A 1JCMP 2VI0A 2DH2A 5KETA 1GNXA 4GFSA 1SZRA 3L9CA 3MKKA 3AHVA 3VGEA 1SW7A 4E4UA 5D38A 3LZ3A 2OT0A 3FGCA 3PTKA 3W7GA 2WLZA 4AIEA 4ECLA 3L4YA 3GX9A 1AQHA 3QJAA 4LUSB 1LQAA 1MQQA 1CXHA 4EXAA 3PSWA 5CQ1A 1ZB5A 5CGQA 4GC3A 3UJRA 3J7HA 1XR2A 1UH4A 2Z1XA 2X42A 2WOQA 1Q6CA 3ITTA 3PAOA 4B2DA 1JCJA 5M2FX 4GABA 1DWHM 4K8EA 4MZ1A 1CXEA 3TA6A 1QWGA 4I9MA 2E1WA 3VKBA 4PTMA 3RDKA 2PDCA 5J5RA 3NL6A 4ZTXA 4KEVA 2YJQA 3VVGA 1TR1A 4WSKA 4NKCA 4UCGA 3GE7A 4MAZA 2VCCA 3TZNA 2HPMA 1EJ7L 2PTWA 3FGCB 3B0UX 3ARVA 2J7CA 4PMNA 2FZMA 1JI2A 2PZNA 3HG2A 3MZNA 2X0YA 2W91A 3P7YA 1KRAC 4DF2A 1TQXA 1NDZA 2OZ8A 1PWLA 3N15A 3CYJA 2PP3A 2IPFA 2FB2A 1YRRA 4GIAA 3B8VA 4Q6JA 4KIEA 5AHNA 1QW8A 2DDXA 4ZO7A 1RCXB 4AYSA 4EX4A 5C6MA 2E40A 1V6WA 1W5PA 1ZS2A 4U4MA 3U0HA 3WDQA 3C2RA 4IGHA 4RV8A 3FYYA 1OINA 2VYOA 5MF5A 1ZTVA 2VC7A 4LY8A 4B5UA 3BSGA 4NHVA 3RPMA 3APGA 2PODA 3GO2A 4FXSA 2BY1A 1BTCA 4A22A 5C5YA 1IIGA 5FKYA 1TJ2A 5I79A 3VCCA 3WQFA 3MO4A 2AQWA 4N4QA 3S42A 4GY0A 4US6A 5G5IA 2XN2A 3AS3A 4D6GA 3SCSA 3L5MA 1V7YA 4Z0JA 5C55A 4B5TA 1FH8A 2WHKA 1J79A 3LERA 3QW4B 7REQA 2VFEA 2W27A 4JTUA 1S38A 1KM4A 3PUEA 2R1NA 3HM7A 5JMUA 3AIWA 2WC3A 4WUIA 2XISA 3SW6A 3G6MA 4MWAE 4Z0SA 1U30A 1FWNA 4UQEA 1OFAA 1UC5A 4XK2A 4HA1A 3L2IA 5FOOA 3HPSA 2WMIA 3QTPA 1TWSA 3SSJA 4GWEA 1FWEC 1B5TA 4LFYA 2VDIA 4EXBA 3NSNA 3VOGA 4Z2GA 2OOFA 2AKZA 3EB3A 5JIWA 3QGAC 3LHUA 5FESA 4B2DD 2VGIA 1XYBA 3C52A 3IK4A 2P3ZA 5DANA 1V3JA 3NXLA 1R3RA 4XD4A 3KRBA 3H6OA 1XLGA 3W1MA 2AQOA 4MB4A 2CHRA 7REQB 3B04A 3WQPA 5E9XA 2ZQ0A 3ABRA 2FIQA 4O54A 3XIMA 1U5VA 3FK4A 2VQTA 2WMHA 3UW6A 2R6OA 1UPPA 3CQ0A 2PC4A 3QZEA 2YDSA 3F2CA 1A5MC 1UC4A 2YA1A 2WMIB 4P7NA 1JZ3A 2PWGA 3T09A 1EP3A 1XPYA 1GTEA 1AJ0A 2J7DA 4JTFA 3F5LA 5BXTA 1H0IA 1QOPA 3W7HA 4KWOA 3RFAA 2PTYA 3W9ZA 2ONEA 2ICSA 3IJ9A 4W88A 3RRXA 1WDRA 1Q7QA 2J4GA 5C0QA 5DN1A 3WQDA 4QLKA 4H9VA 3CMJA 3MVIA 4LF1A 2FMNA 1WBHA 3Q2DA 2W63A 1BG4A 4FAMA 2PWFA 2FH6A 3NZPA 4FX8A 3RIKA 3OB8A 4IJRA 1UZHA 2WVUA 4H7ZA 4PL2A 2DT1A 5I03A 3T81A 1EWEA 3CAKA 3T2QA 1MYRA 2ASHA 3K5XA 3ZVHA 1LCOA 3TV8A 2PTXA 4UZSA 4A2SA 1QPQA 2OZ0A 4ZQOA 4AZ6A 5G2HA 4DB7A 1HUVA 5AHFA 1HKKA 4AX7A 2G3IA 1ZBWA 4EF8A 4LJ3A 2ACRA 2BTMA 3PN8A 1AUSL 1OGBA 3N1AA 4FNSA 4G1NA 3HTWA 1H4PA 2ALDA 3ANYA 4ZFMA 3RLHA 4W86A 1FKXA 1SJAA 1UR1A 3GXPA 3S9IA 4DZIA 4UQBA 1HW6A 4TX9A 1E0UA 2WVTA 4WK9A 3VXGA 3FHQA 4KFNA 3PBMA 1OF6A 1E6NA 4UTUA 4YHEA 1MWOA 3WDPP 1WXZA 4C6JA 3NGJA 1LORA 3GM8A 3BC9A 2YYUA 1K9TA 4JTDA 4QEEA 2YXXA 1C8VA 3BJSA 1G4PA 3F4NA 1HTIA 1RZMA 4MYAA 1K8CA 1C3FA 1XUZA 5H8PA 1HG3A 1QBBA 3RUBL 2GK1A 2ODOA 9RUBA 3N19B 2INEA 3IIPA 3N9KA 2HJPA 2GDVA 1R3WA 3C2OA 1M01A 2L5HA 3F4CA 4IHCA 2DY3A 1QFEA 1Q5MA 4XUYA 4BWLA 3A4XA 4L9XA 1TMQA 1PZ1A 7TAAA 3VDHA 3PWAA 3FS2A 3FIGA 2AAAA 3VPLA 3QZAA 4FR1A 5D8ZA 3KCLA 3LGDA 1L6FA 1KCLA 3LQGA 5F2MA 2A79A 5CSUA 1EDGA 1JPMA 3WYZA 5BXPA 5CKSA 1XLAA 2BP1A 3DFOA 1UCWA 2GK1B 3GG0A 4CN1A 3U2ZA 4H83A 2VZSA 1BXNA 3TTYA 3QYSA 1ZCOA 1HP5A 4J3TA 5F4SA 2YZ5A 3H23A 2XWDA 2XJ7A 4H7VA 4M7SA 2E0PA 1EUAA 4HOZA 5C8BB 2GQAA 3TWAA 3W7IA 4UTTC 5BU9A 1OFBA 1O94A 2RH9A 1H3GA 2AKMA 5AYBA 1W31A 1GOXA 1W9DM 8RUCA 3WLRA 1C7SA 1CCWB 3NPWA 3NXFA 1LT8A 4BF9A 4RCXA 3MBDA 1WKDA 3SQLA 1MDRA 3W7MA 2DZAA 3G1XA 3CZEA 1FKWA 1KW1A 4V27A 2HROA 5HWNA 1PHQA 1R2TA 4KS0A 1V77A 3WNMA 2YBUA 1YDNA 3AOFA 1H1NA 3VKJA 4L1GA 3ISIX 3UFYA 2V9DA 1GCYA 3MP3A 4QG8A 3N3MA 4ZOBA 1HL8A 3P61A 3QN3A 2UY2A 3LCGA 3FEQA 1GHSA 3DFNA 5JVLA 3TYZA 1YDYA 5HQLA 1Z41A 5FJRA 1RALA 1WOBA 2X1IA 4GBUA 3GG8A 4XKMA 3GVGA 4DIAA 1UQZA 1N8IA 2ZRWA 1ZHAA 2C3ZA 3SIZA 2WVVA 3S1XA 3S2NA 5DRCA 4AISA 3KE0A 4IJBA 1NSJA 3CM4A 3KW3A 4EPEC 2IUZA 3FA3A 5G1YA 1A5SA 3DERA 1FP9A 1XL9A 1S5VA 3QW3A 3I3BA 3BURA 2TMDA 5D2TA 2PAJA 1K4GA 3WSUA 3JRKA 3SCUA 3B8IA 1S39A 3F2BA 3QKZA 1JZ6A 4QLLA 1GZJA 2EPKX 1KFKA 1XDMA 3SDOA 2VDGA 3E6EA 2RDXA 5AECA 4LT9A 3MJYA 5K9CA 4FOKA 4B5SA 1GQNA 1W3LA 1ZAHA 3HB9A 2OB3A 1YXYA 1OGGA 4HN8A 4BEUA 3VOIA 3PWIA 3RM9A 1L6WA 3E74A 3PUOA 1W3HA 1ZRQA 2GGIA 5AYIA 1G4TA 3FNDA 1E55A 3BDKA 3PJTA 3BOLA 1XBVA 1C7TA 1HJUA 1ZBVA 8CGTA 4QTGA 1HKVA 4GJIA 4O10A 2XG9A 3A9IA 4XSLA 3A64A 1VJZA 4QJ5B 3G1VA 3CAVA 5ABHA 3HG4A 3DYMA 2Z0IA 4CQ9A 2HV5A 3SCTA 1AH0A 1XC6A 2PMQA 4S3GA 1SMDA 1A5UA 3BWWA 3PPCA 3RITA 1ZSXA 2R1PA 3GC4A 4AYGA 5AYXA 5BWFA 4LAMA 1GZ1A 3AWNA 5EBUA 3C61A 3IUHA 2WK2A 5D09A 1TTIA 2YYTA 3OO2A 5TQLA 1D7KA 4DI8A 3CT7A 3UNDA 3MO7A 1CGWA 4A3HA 1VB9A 1NARA 2O9RA 4IQDA 1JGMA 5A6LA 4H6KA 2B31A 1FXPA 1MI3A 3QOKA 5HOSA 2ZDRA 3R10A 1Y65A 4QROA 4K38A 3G1YA 3NA8A 4EWND 2DIJA 1BKHA 2GVYA 4NNAA 3W7DA 1GKRA 4UZUA 4E6MA 4V2XA 1AMYA 5DXYA 1POJA 1I45A 3EXTA 1OY0A 4KBXA 1JEZA 5FJOA 1MQRA 3RX4A 3ZR5A 4LAUA 2VEGA 3EEZA 1UKTA 1XKJA 3GUGA 2PDBA 5IHSA 1SZNA 3VIOA 4WX2A 3R12A 5I2UA 4AU0A 1GGOA 1H5YA 2YKKA 3EAUA 1N7KA 3QZ6A 4NZJA 9XIAA 3N34A 1VENA 1E4IA 2YW3A 4QX4A 3NL3A 1EA0A 1OD8A 1UH3A 2EPMX 4DPPA 4O1DA 1EKOA 3MVTA 4MNJA 3IAQA 4L1XA 4QG6A 4JEJA 3JR2A 3UXKA 1TPC1 1A3XA 3NQAA 3QHOA 4JR5A 3OLIA 4PFMA 3UVIA 4NP7A 4XAYA 3N2TA 2VRQA 4ZGYA 2WJFA 3ZXWA 2CWNA 3DN5A 2NT0A 4M7TA 4DAFA 4H9UA 3QV6A 4JXCA 4JIEA 3AMLA 1TZ7A 1UMLA 3WLLA 2FVLA 2CNCA 4CNNA 5ABGA 3BXWA 4GXMA 2V81A 1Q85A 2BHYA 5XIAA 2P88A 5C9WA 1TIMA 4D6JA 2DFAA 2R8WA 1KBKA 4RPQA 3O2LA 2HE8A 2C16A 4GI8A 4LVBA 1KRBC 3VO0A 1EJVC 3WMCA 4D9PA 1DP0A 4QDWA 2MANA 1FOBA 3VKDA 2WW5A 1TSIA 3S6TA 4HMCA 3IVTA 2XIIA 4FNRA 3NL5A 3CO4A 1HT6A 2Y0FA 5C9RA 5JQ9A 4J3XA 2ZZ6A 3LCFA 4GLEA 1FVPA 5E9AA 3FA5A 5DO8A 1N8FA 1VBRA 1CECA 4REQA 4Q4SA 1K7FA 1OC5A 1TV7A 1X7IA 5FIPA 1CX9A 4U2YA 4PCFA 3ZMRA 3AHYA 4LX4A 2ZXBA 2GQ8A 1K7EA 4HU4A 5HR6A 1XLIA 1K02A 4QITA 3TYBA 4AMAA 2G5WA 3CBWA 4A8LA 1QOQA 4JIIX 4YVVA 3V0TA 4Y6GA 1JNEA 1OG6A 2FZDA 2D2HA 4HMNA 1LT7A 3NQMA 3ZSTA 4R9OA 3EOSA 1HQTA 2RDUA 3LHVA 1EC7A 4D1IA 4HK7A 3PP7A 4M1BA 3WJSA 3K4WA 4ZODA 1CIUA 3T05A 4AF0A 3IK2A 3EX1A 3WH7A 3LMYA 3C3NA 5H8MA 4FX6M 2EO7A 1XBXA 3PG8A 4Q7BA 5EFFA 3EOUA 2PI6A 1BQGA 1TR9A 1Q6EA 2OKOA 4HNNA 4D6FA 1VRDA 3KUMA 3KOFA 5BRQA 3OBEA 3PC0A 8TIMA 1FCVA 3LV6A 2XVKA 1JCTA 2FJKA 1K3UA 3LLXA 4BQ4A 2WKGA 4MAVA 4YYCA 2PBOA 4NNCA 4KGJA 3M41A 1Q6FA 3AXHA 5CXPA 2ZXQA 2A3HA 3IAPA 4PMZA 4HMEA 1S5WA 3SY5A 4B4FA 1XISA 4AF0B 3H22A 2DU2A 3URQA 4BK9A 4J1OA 5BCAA 3MS8A 2E3ZA 2J66A 3WL1A 1CXFA 3T2OA 4H2CA 1KR0A 2VQUA 1YMYA 3DCPA 3GDTA 1TWZA 3B8UA 5C54A 5I0DA 2X2YA 1M6JA 4XZIA 3JVAA 3EYPA 1NP2A 3PJUA 3A23A 4S23A 1GPFA 5G4WA 5M1TA 4GI6A 3FY1A 1G9HA 4JL2A 4IFRA 4BEQA 4PB5A 2BNJA 3W26A 4K2SA 1EPXA 3BLFA 3A21A 1GW9A 3I4EA 1KBLA 4JDYA 5AFDA 7PTDA 4J3VA 2X0HA 1WDPA 3FSUA 4HZ8A 3W27A 5GNYA 1GORA 1P6CA 3AQUA 4XD6A 3AIRA 2WVSA 4F66A 1VFLA 1DJIA 3PAJA 1TX2A 2PRLA 1FWGC 1S2UA 3NQ6A 3B3DA 4F79A 4MZ8A 1W3NA 3WMLA 1XXXA 5LIKX 4IIEA 2WMJA 3WIJA 4JY9A 3NO3A 1YEYA 4GZJA 2YIHA 5G1MA 3GDKA 3FV9A 1EJUC 1NOUA 5EU9A 3GDRA 4IMFA 4J3SA 1MDLA 1H60A 1OK4A 4W85A 1QBAA 1Q6LA 1F73A 3E3HA 4UB9A 1W32A 2XM2A 4LNYA 3SBFA 4B91A 1A3WA 3ARZA 4DJDC 2FKPA 4GYPC 4CCDA 4JTEA 3GU2A 2OWWA 1TV5A 4O53A 5FJIA 3T08A 3PVFA 1MZRA 3O05A 4MSSA 1TPH1 1UZ1A 2V3GA 3T1GA 1DHPA 3W1RA 2VC6A 1N82A 5I3HA 4V1YA 3W38A 3VABA 1E43A 3OG2A 1C8YA 2OGJA 3EEGA 1GUVA 2X2GA 3MSYA 1ICSA 5FF0A 1SO6A 3S2MA 4CU7A 1IZJA 7ENLA 1ODZA 3DC8A 2DSWA 3LHWA 1EPVA 1PZ3A 2QUMA 4P5UA 5E93A 1C9DA 4WVXA 1ITXA 1X39A 4MNLA 1HN1A 2X1SA 4H8NA 4X2PA 1OYCA 1EX5A 2H6RA 2ZA2A 3BGGA 2I14A 5IOBA 1ZFJA 5F4WA 3MV01 4JKMA 4PUUA 5LYRA 6ALDA 4OUIA 1W37A 3F5KA 2F8QA 1XLFA 1RUSA 1GT8A 2OKTA 1AH4A 2GGJA 3BCJA 5FF4A 5LNWA 1SW3A 4A05A 4YMZA 4HN4A 4AD0A 4UTTA 1H61A 4DUVA 1EZ2A 1UZ4A 2WMFA 2ZRZA 3FOKA 3IGXA 3H4GA 3LI0A 2GUUA 3UZ5A 3UZYA 1P6BA 5A8OA 1JVNA 3ZZ1A 4DF0A 3AMGA 1KA9F 5A6MA 3O06A 4Q8UA 1CXLA 1XW8A 3DKLA 4CUCA 1NFGA 3MSRA 4BI7A 2I16A 3MYOA 2E6YA 2W9MA 4LCQA 1UWQA 4RDZA 1QCWA 3CIVA 4CQDA 3MZ2A 5A6TC 2Z7KA 3RHGA 1JJKA 1IZCA 4B3KA 7A3HA 3SGZA 1LG1A 1KNWA 2CBVA 2YZRA 3PZMA 1AH3A 1W1B1 5CLTA 1EQPA 3JS3A 2V3DA 2VT0A 3WBYA 5DCBA 1NM9A 3AYVA 3QFWA 3BLDA 1IWBA 3SCQA 1RH9A 4HPNA 3T40A 1ISVA 2P8BA 1SFTA 1EX1A 3I7QA 4I5XA 2JEPA 4RV3A 3N17A 5HATA 5HMFA 2FJUB 4HVXA 1ZP4A 4LRSA 3WL0A 2QXWA 4QFUA 3MCMA 3NJ3A 2ON3A 2QVNA 4NJGA 5TD4A 3VTRA 1M65A 4ML4A 1K1DA 3SCVA 5TF0A 2PF8A 1OX5A 1TJPA 5K7JA 2GWNA 2CHOA 1QWKA 2J7EA 4I3GA 1W9UA 4GUIA 2QUTA 1AJZA 2PDYA 3L4TA 2OG9A 1PVNA 1XLBA 4HPXA 4C6FA 3LHZA 1H7NA 3UETA 2O55A 1UHVA 3DX5A 2CZVA 1H63A 4JQ2A 2PCEA 4A3YA 2VRJA 1T8QA 1O5XA 1EA9C 4RJEA 1R3YA 1WZLA 1OWQA 4PUEA 4US5A 1OFDA 3GXMA 3ZJKA 3G0SA 3SRKA 2DT0A 5ABFA 2GSEA 1MZHA 3ABSA 2BFGA 3W1XA 2XWEA 4DBWA 4Z17A 2ALRA 4KRTA 2NV2A 2GGGA 2OLSA 1XIBA 4H3DA 5CPTA 4Y8EA 3HMJG 2RJHA 3OZOA 3LSCA 3BE7A 2XSBA 2QF8A 2PWUA 3H7UA 4Q6XA 3PK7A 4KCUA 4GO8A 3W07A 4KCWA 4LWWA 1EH9A 5GJMA 1GVQA 2P76A 3AIVA 1V0LA 3GTXA 4M6UA 3AFBA 1DE5A 2Q71A 3W7KA 4NJHA 1RBLA 5ABFB 3O7UA 4IPJA 4GZ7A 5T8GA 2OO6A 4K37A 2G4JA 4HNUA 3Q65A 3LNMA 2GUYA 3WBEA 4B4HA 2QCMA 2AAMA 2F38A 5K2ZA 3TMLA 5LHFA 4NVTA 3WK3A 3UERA 4DO7A 4Z2IA 3E1F1 3LV5A 2H9AA 4UTWC 3VNYA 3RF9A 1XHGA 3A5VA 3E0FA 1S5NA 2DW7A 3ATZA 3U5UA 4MPQA 1O4UA 1AMKA 1L8NA 4UWMA 3VK5A 5FF2A 5A6JA 3AIQA 1XYFA 2HVOA 3WUBA 2DVXA 1W1VA 3OGRA 3NVDA 3RRAA 2XGBA 3GVWA 3PY2A 4ADUA 1O6IA 1AJ2A 4S1FA 4DEFA 5JUVA 1HKMA 2HZGA 1XG4A 1H7XA 3BJFA 3TXZA 4HKPA 2JEQA 3UJSA 3TAKA 3KDOA 3MT1A 1TV3A 4J7RA 5D9MA 3AI0A 1ZBKA 3VE9A 1IGSA 4F0MA 1EC8A 3L7RA 2OT1A 4EXQA 3BAJA 4HJWA 2NQ9A 5HQMA 1XYLA 4RNJA 3CWNA 2VMFA 5CJNA 3H2CA 3IIOA 3QH2A 4YNGA 5A8MA 3SY1A 2ZUVA 2QCCA 5KZ6A 5BOEA 2ZIDA 4WQ6A 3VOHA 3RJXA 1CPUA 1W54A 1JFXA 3M5VA 2Z2BA 2BBFA 3LPGA 1F3WA 3V4BA 1E0VA 3FHAA 1IXOA 3ZLGA 2IPGA 1TB3A 4US5D 3WMBA 3GTIA 3FJ4A 3M7WA 2BHZA 1XLHA 4XBJA 4YPJA 4BA0A 4U28A 1QATA 4RE2A 4JCMA 2YW4A 2BS9A 2RUSA 1TVNA 2VEIA 4D8LA 4ACZA 2VUYA 1F05A 3NZGA 5E0FA 4IT1A 1HKIA 3PS7A 4K8HA 3L5LA 1RK5A 2E6AA 1M68A 3UPMA 1VRXA 5BRPA 2BHUA 3GRIA 1VLWA 3WLTA 4MFDA 3OW1A 3PPHA 1SU5A 1D7FA 3SCWA 1F9CA 3ALFA 4UOJA 1A53A 3RG6A 5DQPA 3THDA 2Q8XA 2I5IA 1PZ0A 2W0UA 4L5ZA 4GY7A 1Q6QA 4TX6A 5AHLA 3OVPA 1FDYA 4H19A 3LGGA 1ZP3A 2VP8A 5SWUA 3CB8A 4WR3A 3KEHA 2X1TA 3WO8A 1ZJIA 3B0PA 4AVNA 3LI1A 4P7QA 4ACZB 4MB1A 3GFXA 1LQ2A 2ZFAA 3WNLA 3GIQA 4WF7A 1U5JA 2OWCA 3SFKA 4YU1A 3E0IA 1DXIA 1TRIA 4UBPC 1O5QA 2ANUA 1E9YB 1XRVA 2A3BA 3AYSA 4WDXA 5BMXA 3TA9A 4ZXOA 2W4XA 5LZLA 3N73A 4LBSA 2RJGA 3L0NA 1OCNA 4AZIA 4X0VA 4Y9MA 4RPPA 3B9NA 2QZRA 5CH9A 1YBQA 1YE4A 1NDVA 4S2BA 5K4ZA 3EX2A 3CLWA 1R3QA 3QSTA 4PTXA 4HZ7A 2D0GA 3N3TA 4AD2A 1KLZA 1BTMA 5D9NA 5HNRA 3CWHA 4O13A 4GE8A 4HNOA 5AYYA 3WLOA 3QQ0A 4P8VA 3G0XA 1DJYA 3TSDA 2RGLA 2ZRXA 4BS0A 4Z2HA 4LBRA 2EJ1A 1HO4A 2XIOA 3WK1A 4ZQPA 2C1HA 3BAXA 3DDMA 4MM1A 4LS1A 1AQFA 1HJWA 1JQVA 4OOUA 2V5DA 4JHOA 2HS8A 4KCTA 1RA0A 1E9IA 2HMCA 4O15A 4POCA 4UQDA 4KWUA 2Z27A 1NIUA 3I65A 3KBWA 3L0GA 1UPMB 3CUZA 3MHGA 4N7QA 1HFBA 2D0HA 3L21A 1LDCA 4XO7A 1L2UA 1ISWA 2TPSA 4EKJA 5B80A 5AY7A 1LJYA 5BMWA 1V3HA 2WV8A 2NW0A 1GOQA 4K36A 3L4UA 3R4IA 3IJ8A 4PN2A 3ZWSA 4IQJA 1AD4A 4WY0A 4F2UA 3MUCA 3PSVA 3P8JA 2BXZA 1EB3A 2YL5A 4DHGA 4IXHA 4DPQA 5CG0A 5EMJA 4N9BA 3KBMA 4NUWA 1VKFA 2F6KA 2PE4A 1X38A 3VILA 1QI3A 4N9DA 2G4FA 3DENA 2OYMA 2I57A 1S2WA 3LK6A 1S1RA 2QJHA 1SJBA 4XISA 5AC5A 2V38A 3WDIA 2C15A 1P1MA 4JX6A 4X9YA 5ENLA 2JK2A 1EGMA 1S1PA 1TUFA 2Z4GA 2AGKA 3BZGA 4HPGA 3T0DA 2YB4A 3ARTA 1E9ZB 3CL6A 5J8LA 1Q6GA 5EB8A 2WSYA 1RQEA 4C60A 2QW5A 1JAEA 1FFRA 3O8AA 1UP3A 1WKEA 3R89A 4DXKA 1ME9A 2Y70A 1US2A 2C14A 8XIMA 1FWDC 4GYPA 3IWPA 5FJUA 1KM6A 4S3EA 2Z2UA 1FFQA 4NX5A 1UUMA 2GJXA 1TVLA 5EY5A 3NNTA 5AVHA 4XZBA 2DUXA 1Z69A 3A3HA 2XIQA 4U2ZA 2PDNA 3VUPA 5LNUA 1KRCC 1S3TC 3RX3A 4O19A 4DI9A 5DFAA 4ROPA 2R1LA 2PDUA 2PU1A 4L4PA 1R9YA 3LCHA 3LCWA 3VNMA 2J27A 1QU4A 5MHBA 1JIBA 2WSKA 3W6YA 4PL1A 3TVAA 3QPYA 4F2TA 4A29A 2OCZA 2QLYA 3SB0A 3AHXA 1U2YA 4YTTA 2GJXB 2FZ9A 1AQ0A 2E6DA 4FXFA 4XVDA 3I4KA 5I00A 4QEHA 3VGGA 3BVJA 4CCEA 2Y89A 2RGMA 1F6PA 2ZUTA 3VYLA 2PD9A 1DHKA 3CMGA 4Q22A 4HSOA 1EEXA 1UQYA 5D9OA 3W0KA 3W83A 3C0LA 3OJGA 4AUBA 1QDSA 1IEXA 1R3TA 3TQKA 2QR6A 3M0KA 1E0XA 1DQUA 3TYEA 4M82A 1V3MA 3K1DA 1VAHA 4E2DA 3RNDA 1E6QM 1DJGA 4PBFA 1YLVA 5I06A 4W5ZA 4HNTA 1DJXA 2VKZG 3DFQA 1M41A 4AEOA 1D9EA 3QFEA 5FF3A 4LXFA 2DQXA 3CQJA 3GG7A 1RXOB 4JTKA 3PULA 4M24A 3HV8A 3WLKX 3LPOA 1YE6A 4C6MA 4MY8A 3KWSA 4IL0A 3W71A 2PDLA 1HO1A 4G9PA 1QI4A 1Z44A 3AXMA 3NQ2A 1NQKA 1YYAA 3EB4A 3NTYA 2CEQA 3USBA 3EA2A 5C70A 3Q94A 1M7XA 1W1YA 5CPLA 2I5GA 5L6UA 3U4FA 3DECA 4IG2A 4XAGA 1A3HA 1SVDA 3WEZA 4DX3A 3WLIA 3TDFA 1WUFA 4MWAC 1P7TA 2DH3A 4KEUA 4AY1A 2GJLA 3UPWA 5KZDA 1E6RA 5DCEA 1JGIA 3UQNA 5F2GA 2QPXA 1DVJA 1A5AA 4OU1A 1H7RA 3LRMA 3GB6A 3OA5A 1XC4A 3CWOX 1XFBA 1KM1A 3VNKA 1SYTA 1QHOA 1JCNA 3G1SA 3QOMA 4O57A 3ARRA 1UROA 4PMVA 3ARUA 3OPSA 4NF7A 3DFSA 4DUXA 2J13A 2QT3A 4GX8A 2ZX7A 4PODA 1AL7A 2Y8KA 4ZBCA 3LOTA 3DFPA 3FAXA 4L64A 3E2QA 1DE6A 2PZ0A 3NG3A 5FL0A 2ISFA 4BI6A 3PZTA 3PPFA 2FPTA 1D8CA 2QMKA 3O6DA 3SN4A 3N2CA 2VC5A 1P7TB 4C7FA 4F0HA 5K3VA 5CAKA 2JBMA 1XYZA 5FEXA 1OM0A 1Y5VA 4QE4A 4QCEA 1XYCA 3BW4A 2PDXA 4QSFA 3W29A 4KF1A 3FYPA 4O11A 4XVEA 2BODX 3AHZA 1Q2SA 3N14A 1PYFA 3MU7A 2XFFA 3COTA 3UG8A 4DBSA 1GKQA 1JDAA 4UFJA 5C9UA 5CZKA 1BRLB 1R9ZA 1QPKA 2F2KA 3IPWA 1H2JA 4DJEC 2AL1A 3NQDA 2V5JA 2Z2AA 2G0WA 3CXOA 1WDWA 4OWGA 2XGZA 1UG6A 4JNMA 3IIXA 3MYPA 3AISA 1E1EA 3TW6A 4XZNX 5CBBA 3ME3A 5FEWA 1TPEA 3A6OA 3U7BA 4F48A 3JZEA 3AMDA 3LMZA 2P0IA 4P8WA 1XSJA 1E5JA 3NEVA 4HA0A 3W7NA 1UBSA 4GBDA 4IL2A 2PCQA 3QBUA 1WP6A 2PDPA 4A2RA 2Z6IA 3P62A 4TIMA 4C6OA 2XU2A 3IARA 4PULA 5IXEA 1LF1A 3KWXA 3CV2A 5EBAA 3WLHA 2WZMA 3G6LA 2P53A 1B54A 3PJXA 1Y0EA 3VMNA 4AXNA 3W6LA 1JYNA 4J28A 2VNCA 6ENLA 2R94A 3QTGA 4C6NA 3ARXA 1FWAC 3VIFA 3F5JA 3APTA 2I17A 2XHYA 4AHPA 1F8IA 1L2QA 1WE5A 2ZXDA 1QI2A 2GJNA 3BQ5A 1DWFM 2Z1SA 3CHDA 1CNVA 1NELA 3VDBA 1XINA 1XF0A 4RR4A 4B5WA 5I3FA 4QQ3A 1LL4A 3EDDA 3LRLA 3P8IA 2V2CA 4QSHA 1NAL1 2XH2A 2OELA 1RQBA 5GVJA 4KMQA 3TW9A 2PD5A 2ACSA 2QUVA 4M56A 3W6MA 2VJXA 2X41A 2G97A 2XDFA 4OBTA 1PJ9A 3W7RA 3QYQA 4WXZA 3TSBA 3ARWA 1F4AA 1X8FA 3EDEA 3UGRA 4IMEA 3W7PA 3MBFA 4CNSA 3E0LA 1GVSA 4WZHA 3P67A 4JD4A 4OHQA 2WBKA 2ZUWA 3OZMA 1QVBA 2HNEA 3ID7A 1SJCA 1KKRA 3EWDA 3NIYA 4ICMA 1WDSA 4DO6A 4J40A 1C9WA 3UZWA 1KCZA 3WD1A 1ZBCA 4IIDA 4WDWA 1KB3A 1EHAA 1PO9A 3BLIA 3CZJA 3KP1A 5I3IA 3BG5A 5GJPA 1AW1A 1KXVA 1KFEA 5E09A 2GLKA 1RVGA 4MKNA 2BOEX 2P8CA 1VF8A 3EGJA 3O16A 1KGWA 3TEVA 3MUIA 1UKQA 1VQTA 3KXQA 1SUXA 1ZCCA 4AZ5A 1LWIA 2CLHA 1EJXC 3NFUA 3NO5A 3SEPA 3O63A 1JD7A 4TV6A 1OT1A 3KTCA 4IX2A 4DLMA 3CHVA 3WLQA 3ICJA 4CQBA 4GUFA 3POCA 4LCRA 4XBKA 4JNZA 4BR1A 1W56A 1ADOA 1XCFA 4GFIA 4MLJA 1R8LA 4DWDA 2X0SA 4Z1BA 3MCNA 3DH7A 3WQ6A 1LLWA 3LHTA 3Q58A 5BU6A 1DJWA 4WGHA 1E40A 4ILSA 1TO3A 1Q4WA 2VR5A 4S3JA 3WZ0E 2CBJA 3BG3A 1HXJA 1X98A 3CB3A 4JN8A 4F0KA 2BY3A 3REQA 1S5MA 1JPDX 4C6KA 1CBGA 1I2RA 4WKHA 4XZMX 3WNOA 3LB0A 2C1IA 3WDRA 4QM1A 3LPFA 2EKGA 3T0CA 1TKKA 3T2PA 2VEKA 4P8XA 1X1OA 1A50A 1KV8A 2OLHA 3CIWA 3DOPA 1TRDA 3FVDA 4GISA 4XZLX 4DAIA 1IIHA 1KGUA 2NZLA 1VJSA 1G1YA 2GVLA 3PTMA 3EKLA 2CZDA 3TAOA 2EG6A 5JBDA 2PWVA 1YTEA 1CLKA 4BQ5A 3EOEA 1FBAA 2G3FA 1IT7A 4LAOA 4A8NA 3F2DA 3REQB 3WQWA 3AS2A 3WBWA 4TV5A 1TJRA 1WBJA 2OFJA 1XKYA 5G1TA 5AC8A 1IR1A 1J01A 4DWSC 2E09A 3G8EA 1ZALA 1Q8AA 1T40A 3VIKA 4KWWA 2GJRA 1Q65A 3KRZA 1KO0A 1DIKA 2VX7A 2ZC1A 3PBYA 2CLIA 3UWEA 1K8XA 4GGHA 5D03A 2D69A 2Q3RA 3W7LA