4RX0A

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm265
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
376
structure length
367
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title A long-duration dihydroorotate dehydrogenase inhibitor (DSM265) for prevention and treatment of malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 132
structure length 367
sequence length 376
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rx0A00
5KZEA 1JUKA 2CLOA 3GKAA 3NGJA 5FF2A 3V1PA 3R8RA 2DZXA 1G7VA 4OU1A 4XZ9A 3PBVA 2Y7EA 4O1BA 2JKEA 3LHVA 2NXGA 4M7TA 3S9YA 3NL2A 2TYSA 3DKJA 1PE1A 4O1AA 3NPWA 2QUUA 1Q6QA 2QJGA 4NT0A 5G1TA 4AHPA 5BW6A 2QCFA 3HPZA 3P81A 2YPIA 1XC4A 4BI6A 1VHNA 3T55A 4TMBA 4LC8A 2VFDA 2B7QA 3PVFA 2YYUA 3Q94A 3LRKA 1W31A 3W7HA 3EX1A 1OJXA 4UIOA 4DF2A 3EWXA 4LY8A 3TFCA 1IIGA 2WQPA 5AHMA 2HSAA 1CI1A 1SW3A 3B05A 3L5LA 4ZQMA 1WQ5A 1N7KA 3G8RA 1W5NA 4O13A 5EYWA 2H3DA 3M44A 1A5SA 4NJJA 1SZNA 3G3DA 4AMAA 3LERA 5D05A 3DFPA 4HIBA 3OBKA 4PH6A 2QCNA 2ZRUA 4NJIA 3AJXA 4LV4A 3N9SA 3B4UA 2GVLA 1C29A 1LBFA 3VFLA 5AHLA 3NG3A 2TPSA 3CEPA 1LLWA 3N34A 3QJAA 4N6EA 1O94A 3VNDA 4LVFA 2DZUA 1TPEA 3LM7A 3TSDA 5AOUA 4IOTA 1H51A 1I2NA 1THFD 4PL1A 3QPZA 1H7RA 1G69A 1LP6A 1UCWA 5LHFA 5I3FA 3E0IA 3TJXA 4QITA 3MBFA 3UWYA 5KZDA 1TV8A 2PRLA 1JCXA 1VYSX 4TMCA 4JIQA 1GJPA 1KFLA 2CLIA 1H1ZA 4O57A 3P84A 5G4WA 3DHFA 1MSSA 4FNRA 3VI2A 3RF9A 1OFOA 3A5FA 4MIMA 4A29A 3QMRA 3TQVA 3KFTA 1HG3A 2O7QA 4P2VA 1LDCA 4DPQA 3VE7A 3W7MA 1X8FA 4RZ5A 1DV7A 4Y6GA 3FYOA 3ELFA 2NZLA 4OGZA 1W5MA 2RHGA 1XDLA 1AL8A 1AK5A 3DI0A 2FTPA 2YCEA 2V82A 1P0KA 1L9WA 1XUZA 1SW7A 4K36A 4CCDA 3UD6A 2DJXA 4PFMA 3U8GA 1LORA 3NM3A 1TCDA 3GDTA 1OFDA 3ABOA 3BG3A 5DCDA 3O07A 2EF9A 4GBUA 3HGRA 1DQXA 1DHPA 4MYXA 1NVMA 4B5NA 2VFEA 4Z0JA 3W1QA 1F05A 2BZNA 1UBSA 4NZFA 3UYCA 3CIXA 1G7UA 2B0MA 2Z6JA 1KTBA 3HGJA 1B9BA 3GNDA 5DY3A 1PCWA 2V5BA 2ZZ7A 3QSRA 4XTIA 6ALDA 3I7QA 4GXMA 1FX6A 3O1NA 3GDLA 5EY5A 1GVQA 4K8HA 3W7CA 5EL1A 5HMSA 3W1RA 3T7VA 1XBZA 1ZJIA 3IVUA 1CX9A 2VEIA 1VRDA 1RPXA 2JKAA 3ABQA 1H61A 4YCOA 3D0CA 3O6YX 3R5EA 1SUXA 3LLDA 3N3MA 4LS2A 4ZQPA 5HINA 3QF0A 1W3IA 1EP3A 4RX0A 1Z48A 4GUFA 3DHDA 5CSSA 1TPC1 1RQEA 3B04A 4XTDA 2Z2UA 4XKYA 1N55A 1VYPX 4UMBA 2ZDRA 1QDSA 1VC4A 3W2NA 1KM2A 1NF7A 1KM3A 2FDSA 3GDMA 1ZAHA 1H7WA 2NUYA 3GNNA 1W5OA 5BRBA 5DN1A 4JD4A 1G4SA 4KFPA 2LLEA 1D3GA 3M9YA 2FB3A 4N9EA 3ZWTA 1JJKA 4NUWA 2HTMA 4FIRA 3W7QA 3UWVA 3O15A 2QJIA 5K2ZA 5AC7A 4GC4A 3THQA 4JN6A 1SZFA 1VS1A 3HPXA 3KAOA 1YXDA 4IQLA 3SR7A 3LOTA 1EB3A 4FNSA 5G2IA 3O8AA 1TJPA 5LNSA 4JDYA 1G4PA 2C0AA 1B4EA 3PF3A 3KX6A 2VEKA 1IXPA 3QW3A 1YTEA 4QIUA 2E6DA 4K38A 3RK8A 4NJGA 1IXOA 3O6CA 3LCFA 4K7VA 2RH9A 3IVTA 4UTUA 1FDJA 4WZHA 3L5MA 2ZZ1A 3QC3A 2ZRVA 2X1SA 2J24A 1ZCOA 2WNQA 4O15A 5DCBA 5GVJA 4M6QA 1VHCA 1KV8A 4MY1A 4O28A 4KKXA 5FF4A 1LTDA 2YZRA 4E38A 1U83A 1XDMA 1TTQA 3L0NA 1DQWA 1P5BA 3VE9A 1JR1A 5FEXA 1M7PA 3S1WA 1TPWA 3Q2DA 3LTYA 5FI8A 1O95A 1ADOA 1UUMA 4PODA 3MI2A 3ZWSA 4I7WA 2YW3A 1TTPA 3NQ6A 3N2MA 5F4XA 2R14A 3T40A 4MZ1A 4HNVA 3W7IA 4KFOA 1VZWA 1X6UA 1C8VA 2A2IA 4OE7A 5E93A 3LHYA 3MJYA 3GB6A 4FX8A 1S5WA 4BR1A 3DFQA 1PHQA 4ADTA 4WD0A 1AG1O 3B06A 3S0CA 1PCKA 3LB0A 5F2MA 1R30A 1TTJA 3LGEA 1MXSA 4IUOA 1TQJA 2Q8ZA 3G22A 1SZGA 3E12A 1J4EA 4LRSA 3WJYA 4QNWA 1W8SA 3QW4B 2DZSA 3LBMA 3PUOA 5AC6A 4FXSA 5DXYA 3QFEA 3MMTA 3F03K 2ZRWA 2VFGA 4AF0B 4FX7A 2WSRA 3HB9A 5FF3A 4FIQA 1DBTA 1KW1A 1DJQA 1UB3A 2G96A 3C2FA 4YCPA 2O7SA 3RNDA 5FEPA 5HR6A 1EP2A 3LLFA 2QCCA 2YGYA 2A0NA 5H2ZA 3KRUA 2AQWA 5AHNA 3LTSA 3Q58A 4HN4A 2ZA2A 1SZEA 3LV6A 4RR4A 3SGUA 3GDKA 4NNBA 1JQXA 3W1LA 1W54A 5D2VA 4O0ZA 2J88A 1YPIA 3I6RA 4FXRA 2QCEA 3IVSA 4QJ1A 1TPFA 4HT3A 3LTPA 3IV3A 3S8HA 4G1KA 1SR9A 4JEQA 2C19A 3A21A 1XBYA 1TSIA 4YWIA 3SZ8A 4WY0F 3L0GA 3S5NA 3MHUA 1FDZA 4HNTA 2UV8G 2FPYA 3UZJA 5K7JA 4N4PA 1G4TA 4UFLA 4ORMA 5IBXA 4NX5A 5AYZA 4WQ6A 5KINA 4N9BA 4MZ8A 3FKKA 1FY6A 4FO4A 4MPQA 4OWGA 2J9ZA 3F4NA 4H3DA 4R33A 2Y7DA 5LNVA 3C6CA 2ISVA 3L65A 4LUIA 4O52A 5CPLA 3GX9A 5AHIA 4DELA 2A5HA 5T26A 3W2UA 1M5WA 3LXCA 2YFNA 5KMYA 4E2DA 2C3ZA 5CKSA 1A5CA 5F2IA 4O4VA 1I8JA 1W5PA 2C13A 3OHIA 5G5IA 3W75A 3QRHA 3GLCA 4K37A 3TV8A 1KTNA 3THAA 1SO6A 3W2MA 1IXNA 1IF2A 4FNPA 4JTEA 1W3NA 4ML9A 1KLYA 1I2OA 2PURA 3M7WA 3P8JA 1KM5A 3EWBX 5KSWA 3MP4A 3HJZA 1C9DA 5K4XA 1D9EA 3DFOA 1Z42A 3SJ3A 3W9ZA 1ALDA 5CZTA 1JVNA 3EEGA 1VLWA 2QCGA 5K9XA 3KVJA 3UWUA 1SO4A 3EX3A 1O60A 2BTMA 2E77A 4AH7A 4UMCA 3W7JA 2QUTA 4JTHA 4JTTA 2QKFA 1UASA 3N9RA 3IIVA 4O53A 4JTKA 4Y8FA 3W70A 1JRBA 5CG7A 4IMFA 3W7EA 4ORIA 2FFCA 1AW1A 3MYPA 5E1QA 5EPDA 2ZZ4A 3TMLA 5LSMA 4UTLA 3BARA 4RJEA 5BOOA 1GOXA 1GZGA 3LXAA 5C54A 1WBHA 2V0TA 2VC6A 1TPB1 3IGXA 1G67A 1YADA 3FFSA 1EUAA 4LTSA 4Q4KA 4S1FA 3MYOA 3NZRA 1RR2A 3E49A 3HMJG 3JRKA 4ZMGA 1JRCA 3S1VA 3RLVA 4U28A 1V5XA 5DELA 2E5CA 1FWNA 4QM1A 4ZVJA 3P60A 4UMAA 3R89A 2ZFAA 1PS9A 4QSHA 3TNOA 5K4ZA 1NEYA 3BW2A 2FLIA 5TBOA 3IIPA 2ZRXA 3PWAA 2Y63A 1TB3A 5DCEA 3W23A 2H3BA 1K03A 4UR8A 4K39A 2C15A 3QPYA 3W7LA 1Q3NA 4IXXA 5D02A 1EP1A 1L2UA 2J27A 3GIYA 1W56A 2J6XA 3RU6A 3STEA 1LLZA 1QAPA 3DU0A 1CW2A 2DJLA 4I7VA 4IGHA 1JUBA 2C6QA 3TDFA 4WX2A 2PRMA 5HR7A 3HO8A 3L9CA 2VKZG 3OA3A 4GJ1A 3ZFHA 4OV9A 3N73A 4RCXA 1EA0A 1WX0A 3KVKA 3IGUA 1U5JA 4EF8A 1O5XA 4Y9AA 1BTMA 4ALDA 1P4CA 3LBCA 3KXQA 3CHVA 3HGSA 1QPOA 3DAQA 4O12A 3DFSA 3OG3A 3PB2A 4ZZ9A 4EIVA 2ZA3A 4ICNA 2XFWA 3OVRA 1R2RA 2GQ8A 2ZZ3A 3C56A 3NQFA 5LNWA 4FHAA 3M5XA 1QO2A 4Y90A 2RFGA 3P8IA 4O14A 3LI1A 1QO5A 4E2BA 1H62A 5D2XA 2X2GA 1KFCA 1GG1A 2WNZA 4A3UA 5DLCA 1DORA 4IXHA 4M6PA 4UTWC 3BG5A 1YPFA 3NQ7A 2CFFA 2RDTA 2Y7FA 2CLLA 3W1MA 1EUNA 4JYDA 1X7FA 1OX5A 3NZ1A 5D2YA 3IGSA 1JCYA 3GR7A 4Z1AA 3TK7A 3PS7A 1QWGA 4CQ9A 3MP3A 3TFXA 3FJLA 4JYEA 4R53A 4S2CA 5D03A 1IGSA 2QR6A 4UTHA 4RXGA 1NSJA 1X1ZA 1TREA 1W1ZA 4RXFA 3N19B 1H50A 3EX4A 1XL9A 2FPVA 1PV8A 3BLIA 5DY2A 4CCCA 5BMXA 2NUWA 4UTTC 3H54A 4ZQNA 4GWEA 3ABSA 3HPSA 1O5KA 1HO1A 1KTCA 5FEZA 1WXJA 1NF0A 2Z1BA 4NZJA 4EF9A 1SU5A 4N6FA 1Q45A 5AC8A 1GVSA 4LWWA 1TV5A 1XUUA 3L21A 2E5BA 4UXDA 4R7JA 1KFKA 1FCQA 3CM4A 3L67A 1YDNA 2ABAA 1HUVA 4DBEA 1OYCA 2CLKA 4H6KA 3LCIA 3S5YA 3TW7A 1G4EA 2QEZA 2YXGA 1D3HA 4MFEA 3W85A 5LZLA 3HF3A 1NAL1 1GVFA 1YTDA 1KM6A 1H7OA 3QEZA 2OCZA 1JULA 2PRHA 3DH7A 3TX9A 1IXQA 1LZOA 3E96A 1SW0A 4BI5A 4EWND 5DXXA 3IEBA 4NJKA 3W74A 2QDHA 1ICQA 4TR9A 5CZ0A 1SSGA 3H53A 1OFRA 2F84A 3LHWA 2F7FA 4UTWA 4LUJA 1TIMA 2H8XA 1A5AA 8TIMA 2X1TA 2YW4A 3W1XA 2NX3A 1PL9A 5D2TA 4A2RA 4DO6A 4MJZA 3TXVA 1BEUA 3S5OA 2C18A 4M5PA 3M5VA 2XN0A 1R2TA 4Y96A 1V7YA 3YPIA 5FEWA 4UTMA 4DXVA 5D32A 1OK6A 2X30A 4CQAA 3U6WA 4NQ1A 1WYIA 1MO0A 3B0VC 2X1UA 4Q32A 3L5AA 1QCWA 3TSBA 2E6YA 1LRNA 2NXIA 3GXTA 4JX4A 1VLIA 2VFHA 3GR8A 3NQEA 2FIQA 3MHFA 3SFKA 2QAFA 5BMWA 1K7FA 3PM6A 4LV9A 4YLWA 3CTLA 1R2SA 5D37A 2Y7GA 1F6PA 3L68A 3HIJA 1TTIA 3UY7A 3W22A 4N9CA 3P67A 4M19A 3P61A 4FNUA 4O1CA 1TPH1 1BWKA 5A5WA 4O4WA 1FWSA 1W0MA 1JCMP 1ZY9A 4CNPA 1GVOA 3MI6A 1H7XA 1LCOA 1B3OA 3PSVA 3FJ6A 1KM0A 2GJLA 3ZR4A 1QPRA 3B0PA 5DBTA 4DO5A 4CCEA 2X1RA 4AB4A 2DU2A 3KRSA 2CLHA 3BW4A 2ZQ0A 3G3MA 3PR2A 4UFHA 1OYAA 3LX9A 2J9YA 4O1DA 3TAOA 1J2WA 4H4IA 1OFEA 3RLUA 4WXZA 3M5YA 3W73A 3W7NA 3BPWA 3B03A 3W7RA 3WK3A 3UNDA 3WJSA 5C55A 3C3NA 4PTNA 1GVRA 3S5ZA 1HFBA 2NV1A 4MLJA 5HUPA 2A7RA 2QCLA 1TO3A 4QQ3A 3C2RA 3W1AA 5CZSA 1VJIA 2ZYFA 1H7NA 3W87A 1H60A 3GK0A 3P7YA 2FJKA 3HG3A 3STFA 2CZFA 3C2VA 2Y89A 4BFAA 3LCWA 1OYBA 2Y62A 4IJBA 4PC8A 3ATZA 1TPDA 3NQCA 1PHWA 1QOPA 3W1PA 4TO8A 1GPWA 2YYTA 5G1YA 3ABRA 1TRDA 4POCA 1E51A 3GYEA 1VYRA 5C5YA 1SPQA 3O05A 1ZAJA 3JS3A 1WDWA 4A22A 1DKWA 3F1QA 4XBSA 1BWLA 3DFTA 3TMQA 3GAKA 5U4NA 3UWQA 2ZTJA 3BGGA 1ICSA 1X1OA 3STCA 2ZCGA 5HWMA 5D30A 1EEPA 4LVGA 2WV8A 3S1XA 2FPTA 1KBJA 4JTGA 4NXSA 1MZHA 4ZQOA 5L9FA 3EXTA 1IIHA 2E6FA 3TC7A 3W72A 4TIMA 1OVDA 3CB8A 2ISWA 2PE4A 3C2EA 3EWUA 4IMEA 5HJLA 4Z08A 5F1VA 4DBDA 3H55A 4MKNA 4AVFA 1ME7A 4AF0A 4C1LA 1TPUA 1GTEA 1GTHA 3W1TA 1JCJA 2DZWA 3QQ1A 4MUZA 1J5TA 1Q6RA 1K8ZA 4MY9A 3E9AA 2V5LA 3U2OA 2G5WA 1FUYA 3UPBA 3EWYA 1WA3A 2CW6A 1I2PA 4JX6A 4FNTA 4DF0A 3NQGA 4Z0SA 5CSRA 2Z6IA 2B7OA 3STGA 3M41A 3SGZA 1FWRA 1OABA 2A4AA 1KFJA 1QR7A 1OX6A 3C8FA 3EWWA 3DXIA 4WXYA 3NOEA 3V75A 3VCRA 3QSTA 4DPPA 1Z44A 3PBYA 1JCLA 1FCBA 1UJPA 1P0NA 4QAIA 2C14A 2P0OA 2DZVA 5LGZA 3G1DA 4FF7A 3DGRA 2E6AA 3NDOA 5AFDA 3T4CA 3P74A 4JY8A 3B8DA 2PCQA 2ZBTA 1PVNA 4BWLC 5F1UA 2FB2A 3M1ZA 4UNKA 2JKPA 3NEVA 4O0KA 1QFEA 4GNJA 3QM3A 4O16A 1KV5A 3MBDA 5CPOA 1GYNA 3T44A 3NPUA 3W2LA 3S1UA 4KWVA 3M47A 3MUXA 3TR2A 2V30A 3NO5A 2B4GA 4R34A 3UY8A 2W79A 4MVAA 3MI3A 2QCMA 5D04C 4ONVA 2WPBA 4JYFA 3INPA 4HKPA 3O06A 2ISSA 4P61A 5I3HA 3NPXA 2ALDA 5D2WA 3TU9A 2X16A 1EPXA 1WOBA 3MP5A 2G97A 5D33A 1SSDA 2H8ZA 1YXYA 1QPQA 4CNOA 5SWUA 2Y70A 3SW6A 1VGAA 4IMCA 3HOJA 4YL2A 1YLVA 3TW6A 4RV8A 3UQNA 3W7PA 2E5DA 4U4MA 2ZZ2A 3HG5A 3AO0A 4MFDA 3W1UA 2ZRYA 2GUUA 4UFKA 4LRTA 4N02A 2PC4A 3NR0A 2AAMA 1T99A 2H90A 4K8EA 1DJNA 2GVJA 3G1HA 1WOAA 2YFOA 4FEZA 1LBMA 1ZHAA 3Q37A 1AW2A 3LRMA 5AHFA 1GEQA 1B57A 4UCGA 1ZNNA 3TJLA 5FESA 4AWTA 1K7EA 2C16A 4NNCA 1F76A 5CGQA 2R91A 3GVGA 4N2YA 1FCVA 1FWWA 1AMKA 3BLEA 1F73A 3L66A 4JR5A 4OBTA 4X9SA 3HGOA 1EWDA 5K3VA 5TIMA 4RLIA 1HL2A 3CPRA 2R94A 3QQ0A 5HULA 3IIXA 4WOZA 5D09A 3NVTA 3W83A 4AHOA 2QUVA 5E0KA 1YTKA 3CWOX 3NQAA 1KBIA 2NWSA 2OT0A 3QH2A 2E1DA 1K8XA 3G1SA 4NX0A 2OJPA 2Y61A 4IMDA 1VCGA 3BW3A 3TIMA 2GQ9A 4UTJA 3PULA 1OG0A 1T0OA 3JR2A 2CLEA 3FLUA 1TRIA 3FOKA 3W2JA 4CLMA 2A85A 4AWUA 3OIXA 1S5VA 4JTIA 2DZTA 5K9DA 3PC0A 3SY5A 2VFFA 3BO9A 4PCFA 1OK4A 3PBWA 1KLZA 3A23A 3P5YA 3GDRA 4Q33A 1YDVA 2CZ5A 4K7YA 4DF1A 2DZPA 3RMJA 4CNNA 2A7NA 2Q3RA 3O6DA 4LNYA 3MWAA 3SECA 4ADUA 3BK0A 5I3KA 3NL5A 3T78A 2ZRZA 4JGDA 3NQ2A 2NX9A 3G18A 3L2IA 1K8YA 4O11A 3NM1A 3GXNA 4PA8A 4UUIA 5LKYA 1K3UA 4HNUA 1ICPA 1XBXA 3PUEA 2Y88A 4QISA 2HMCA 2GPTA 4L4LA 4OHQA 3IIOA 1ME8A 1R47A 5F2LA 3EXSA 1K7XA 3VKJA 1Z41A 3F4WA 3CQ0A 1Q6OA 1F74A 1FXPA 4IX2A 3HG2A 1XKYA 2WJZA 1AL7A 4BF9A 2Q3OA 2IQTA 5C6MA 1ZFJA 2GQAA 2QAPA 4L4MA 4GE8A 5H91A 4N4QA 4NU7A 3TH6A 3OEXA 3PBUA 5AN7A 1RVGA 2ABBA 3NL6A 4LT9A 2WO5A 3PY2A 3W7GA 1LOQA 1ZENA 1GYLA 2QJHA 2TMDA 1S5TA 4O50A 3W7KA 5J5RA 1ML1A 4X22A 3MO7A 1T8XA 4AAJA 3EKLA 3TQ0A 3E02A 3LHZA 3NQDA 3M0ZA 2RDWA 1GQNA 4E0CA 3PG9A 4UNLA 1GG0A 5I3GA 2YDAA 1T96A 4W9TA 3RFAA 4JICA 3TXZA 3PSWA 1RD5A 4Z1CA 3N14A 2BWGA 1QOQA 3CLMA 3I68A 3A22A 3G0UA 1LROA 1OFQA 4XQ6A 1YYAA 4JS3A 4XBKA 3BV4A 4TU1A 1W3TA 4Z1DA 4J9JA 1HTIA 2EGZA 1OFPA 1ZAIA 3S42A 2EKCA 2YX0A 3C2OA 2V81A 3USBA 1Q6LA 1SO3A 4MJMA 3UXDA 7TIMA 3G1YA 3LCHA 5MHBA 3UWZA 1KFEA 1XM3A 1Y0EA 2JBMA 2BSLA 1FDYA 2V2HA 1EIXA 2CZDA 2R8WA 3NXFA 2NLIA 4O8RA 3LHTA 3QYQA 1A50A 3A5VA 3OVPA 4MYAA 4UFIA 3LXBA 2CZEA 1JCNA 2BXVA 2VEPA 4UC5A 1VR6A 4IPJA 5EBUA 1RV8A 4UR7A 4JY9A 1OF8A 2I1OA 3WK0A 3R13A 3KVMA 3W84A 1A53A 5LNUA 4XWUA 5AYYA 3W88A 3TUUA 5U7SA 3EXRA 2W6RA 4O18A 2OMAA 4Z1BA 1BKSA 4MLRA 3NYZA 4AHQA 4HSOA 5L6UA 2JK2A 3UXAA 1RZMA 2BLEA 2W0UA 1AW5A 2EHHA 3HG4A 2BX7A 4FNQA 4GUHA 4DO4A 4RZ6A 4RKAA 2DP3A 2GJNA 3W7OA 1VCVA 4KFNA 3OVQA 4HSNA 5HWNA 1W5QA 3W3OA 3WJXA 2J9XA 3FIGA 3R2GA 4OT7A 5KZMA 4AEOA 3W6YA 1KFBA 2V2DA 3EB2A 1O4UA 3NAVA 1JQVA 2E09A 3DI1A 4UTTA 5CPNA 4XUGA 3DKLA 1EWEA 1TV7A 4WUIA 3EX2A 2ZZ6A 2VOMA 5FF7A 2TRSA 1S3HA 1F7BA 2NXHA 3PUDA 1KM4A 3P80A 4UTKA 1SFJA 2H6RA 4X2RA 1GT8A 4XKYB 2YR1A 2QF7A 3BVJA 3P62A 5G2WA 4O10A 1VQTA 2JGQA 1TJRA 4QNEA 1LRQA 5A8GA 3NA8A 2DORA 1OF6A 3TE9A 4LW7A 4YXGA 4WOQA 1YDOA 2V2CA 1M7OA 3G24A 4PL2A 4LVBA 4ZL1A 4LC6A 1TPVA 3G8EA 1WBJA 2C1HA 1I4NA 4JTFA 4NNAA 3BLFA 5CPMA 3A9IA 5F2GA 2VEMA 2QCDB 1NFBA 5FF0A 3G1XA 4N9DA 3ZS4A 3MHGA 1A5BA 3TSMA 3O16A 3W71A 3KRZA 1EX5A 1P1XA 1W37A 4M6VA 2QCDA 2Y6ZA 2Z0IA 3GXPA 3G0XA 4OV4A 1FCUA 4O17A 1H7PA 2QDGA 3L0KA 4NXKA 5HUOA 3QMSA 3PB0A 3IRDA 4FX6M 1WAUA 4IWWA 1FXQA 4LU0A 5I3IA 3BGJA 2WSYA 3WK2A 1SFLA 5CZJA 4MOZA 4AXKA 2XN2A 2I9EA 4JDBA 3NQMA 1I2RA 5LNRA 2B7NA 2RKXA 3ATYA 2WNNA 5EA9A 3P82A 1F5ZA 2A6LA 3BG9A 1LBLA 4IPIA 4C1KA 4M7SA 3W7DA 3FEMA 2WSQA 3TA6A 2CLMA 1OX4B 5LHEA 2A1YA 3M16A 3B0UX 4GUGA 1GWJA 3C61A 2OZ0A 4EOUA 4KWWA 2ZTKA 2CWNA 1OX4A 6TIMA 4WJEA 1RQHA 4EVZA 3C4UA 3M43A 2QCHA 4CQ8A 3LHUA 1I2QA 5IBXC 2ZZ5A 3CIWA 1DL3A 1XFBA 4JTSA 3SIZA 1RQBA 3M6YA 2VFIA 5C2XA 4LOCA 5HNRA 3LCGA 2Q8LA 3W07A 2VXNA 4HHPA 1QMLA 4LS1A 5HQEA 4JNMA 1MEWA 4D2JA 2GOUA 5HWJA 4TX9A 3FKRA 4UTIA 3PAJA 4I7UA 1ONRA 1L6WA 1MEHA 2TSYA 4LVAA 2Y85A 3FS2A 1SO5A 3G1FA 5DBUA 3W2KA 2RDUA 3TKFA 1PIIA 5I3JA 2ZA1A 1HO4A 1R46A 3QMTA 3GKFA 2VELA 3R12A 4GUJA 1YXCA 2NWRA 4MY8A 1FBAA 3DENA 4LVDA 4YMZA 3LRLA 4JIPA 3SI9A 4IX0A 2GVGA 3LCXA 3LCLA 2CLFA 5K9CA 1ME9A 3HQ1A 1OFBA 3M5ZA 3I65A 4UFMA 3N2XA 1LOSA 1VCFA 3G1VA 2A21A 1FWTA 5EKYA 4RZ4A 1QPNA 3EX6A 3SSJA 2D73A 4ZQCA 1L6SA 4BI7A 1DVJA 2HS8A 1XBVA 2I14A 3FA5A 3UZ5A 4ADSA 1H63A 2HS6A 2FQIA 3DBPA 3TCEA 1I45A 4O19A 3PG8A 4OQVA 2V8ZA 4PEKA 1UUOA 2NX1A 5G4EA 3NL3A 4ZQRA 1LM1A 3DFNA 1TMHA 3HBLA 2B7PA 3LI0A 4I9AA 5IM51 1B4KA 1SQ7A 1OFAA 3G1AA 5AHEA 4DQWA 3LDVA 2EAWA 3NNTA 1H1YA 3S6DA 1ZALA 4HPXA 1JUEA 3K30A 5LGXA 3GZ3A 2XN1A 2NUXA 3FYPA 1DOSA 4X3ZA 3TAKA 5EMUA 4GRSA 2EPHA 4LS0A 4IMGA 1WV2A 4NJHA 4MZYA 5BNKA 1F6KA 2P10A 3KOFA 3QZEA 5D38A 5F4WA 3O63A 4A21A 1TQXA 3KHJA 5TQLA 2OX1A 2E68A 4JTUA 3GAYA 3C52A 3C0JA 3WJZA 2ATSA 2A6NA 5KITA 3CWNA 1XCFA 2KZHA 3EWZA 3G0SA 4JTLA 5AB3A 5J5DA 4O54A 2YSWA 5KTLA 3CC1A 2NV2A 2ATMA 2A7PA 3UWWA 3TROA 1VH7A 3CT7A 1MEIA 4WY0B 4A2SA 5F4SA 1LRTA 3LV5A 3W86A 4NVTA 3TQKA 1FQ0A 3I7SA 4WY0A 2WKJA 4UFJA 2OT1A 2CU0A 1XI3A 3DZ1A 4S2BA 3A24A 1VPXA 3UPWA 3TC6A 1KA9F 3I7RA 2WOQA 4JTJA 3ANYA 3WK1A 3W76A 1N8FA 4BK9A 2VENA 4FB7A 3W1NA 1XXXA 4HPJA 4HNNA 1M6JA 4AWSA 4GUIA 3MW7A 1KM1A 4JX5A 1OHLA 4BWLA 3KVLA 2AGKA 2G95A 4RK8A 5G2HA 1H5YA 5AYXA 3CU2A 1K02A 1LOLA 1F2JA 4JXCA 3CEUA 1TYGA 1QNVA 2V9DA 3WJWA 4GFSA 3NPVA 5ABTA 4K6AA 3NQVA 3EKZA 4DEFA 1LYXA 3NQ8A 3WFAA 2JGYA 3P5ZA 1L6YA 1G6CA 3IIZA 2P1FA
chains in the Genus database with same CATH superfamily
4B5UA 3Q65A 1E9IA 1GJUA 2CLOA 1PKYA 1EKOA 5FF2A 3V1PA 4AWEA 1BVNP 2DIEA 4O1BA 3ITTA 4LJ3A 4CN4A 4M7TA 1SFSA 3S9YA 2TYSA 2V69A 1XGDA 5G1TA 5BW6A 2PCEA 3MWCA 1UD6A 1WDQA 3HPZA 1XSKA 4PBFA 3OLDA 2P76A 2VFDA 5EB8A 1HL9A 1YNQA 3FVDA 1W31A 5J8LA 1BVWA 1K4GA 4G56A 1WO2A 5D9PA 5AHMA 3LSBA 1XQLA 1X8CA 1SW3A 4ZQMA 1WQ5A 1C93A 4Z2HA 1W5NA 4TV5A 2VQTA 3WNPA 1RY8A 2PA6A 4YTTA 2OZ3A 2QPXA 1Q6GA 1L2QA 2AMGA 3OW1A 1YX1A 4HIBA 4EACA 3MKVA 1DJYA 3VOJA 3BJFA 2DQXA 2I7GA 2H9AB 4NJIA 1CGVA 4LV4A 1N82A 3HJEA 2ZOXA 4NZ3A 4JQ4A 4YN5A 4Q8QA 1LLWA 4HCDA 4N6EA 3GW3A 5IDIA 3OTRA 2I5QA 2DZUA 1TPEA 4EANA 4NP7A 1QW8A 5I2UA 1JZ6A 2ZE0A 3QPZA 3TOPA 2GJXA 1H7RA 1E4NA 2P5NA 2W92A 3K8MA 3M0VA 3TJXA 4JQ2A 3XINA 4QITA 4GK8A 4LFYA 3MA8A 1J01A 3AS1A 3EDEA 1M7JA 2FYMA 4E2VA 4O57A 3PZMA 1MSSA 2E9MA 4N0RA 1XIHA 1V6XA 3A5FA 2Z26A 5JBEA 3KFTA 2D2GA 2Z4GA 3APTA 1LDCA 3M07A 4NKCA 1R9ZA 1OIFA 5H8UA 2XUCA 2INFA 3A4XA 1A47A 1KQYA 1XH1A 1AL8A 4WEVX 1H11A 4GLEA 3SRHA 3WLHA 1P0KA 4PMXA 2UY2A 4E6MA 1XUZA 1EQPA 1OZMA 3H24A 4CCDA 2DJXA 2V5JA 2ZVRA 3IJ9A 4B5WA 4GH1A 1J0KA 4MB5A 4AD0A 3ABOA 3BG3A 3T9PA 2YDSA 4GBUA 1KC7A 1T6MA 5I0DA 1DQXA 3UZZA 2PTWA 3T07A 2E9BA 3OLIA 2VFEA 3XIMA 3PWIA 2B81A 6REQB 3UYCA 1V6UA 4D9PA 4UQEA 2NV9A 4US5A 6REQA 2GK1B 1BTCA 1FX6A 4WJ8A 5EY5A 4PTWA 2OSXA 3PJUA 5EL1A 1CDGA 5A8PA 3T7VA 2GK1A 2O4QA 1ZJIA 1CX9A 2VEIA 3RX4A 2JKAA 1UBPC 4YCOA 3O6YX 3R5EA 2X0HA 3E0WA 4H9XA 2WXDM 5HINA 1K4HA 1QK0A 4UOQA 1KCZA 3U2ZA 4RPQA 4XTDA 2WJDA 2ZDRA 1QDSA 4GQQA 1VC4A 1FKXA 4U3CA 2ZUSA 4IISA 1Q4WA 4AUBA 3GDMA 4D6GA 5DN1A 1G4SA 4FR6A 1J8VA 2LLEA 3GUWA 4N9EA 5HDRA 2V3FA 4WSJA 4QLLA 2HTMA 3O15A 3BV7A 3AHZA 3NUKA 4H8VA 3H26A 1YDYA 1D7KA 2BXYA 1CGXA 2PGFA 4JN6A 1W3HA 4IQLA 3B8SA 3SR7A 2ALRA 1XD0A 3LOTA 4IPLA 3KM8A 3QGAC 2XIQA 2C0AA 3KTCA 4JFTA 3U3HA 2PU0A 1U22A 1NIUA 3RK8A 4V15A 4K7VA 2ZZ1A 1LF1A 3A47A 3PFRA 5DCBA 2IUZA 3CYJA 5HJXA 3VIFA 4PRRA 1VHCA 1W9VA 2X7VA 3ZR6A 4KKXA 1F61A 3CHEA 3N1AA 2OWXA 4IIEA 3AI0A 4MB3A 5LA1A 1RJRA 1JR1A 3RO6A 4GH3A 3S1WA 3H2NA 2XIIA 3Q2DA 2F6UA 4AZ5A 5FI8A 4GO8A 1ADOA 3VKCA 1EO5A 5EMYA 2YW3A 1W1PA 3NQ6A 1PIGA 2HWGA 4LEQA 5M03A 2R14A 2PZ0A 3T40A 4MZ1A 4MB1A 3OPSA 3EMCA 4CNUA 5E93A 3MJYA 3CQHA 1BGAA 1AA1B 3D6NA 1GONA 4LBSA 1U1JA 5EFDA 4WD0A 4KCUA 3S0CA 4R85A 1PCKA 3LB0A 3MMUA 4DJDA 3FSTA 1EZ2A 2FHCA 3S2JA 3MZNA 1JPHA 2BMBA 3SCPA 5C8BB 3G22A 1SZGA 1J4EA 2FFIA 1W8SA 1TX2A 3V36A 2DZSA 2YL8A 2OODA 3LBMA 3PUOA 3MCMA 4FXSA 1E0TA 2PDQA 2QW5A 2ZRWA 4KESA 4FX7A 3HB9A 1UKTA 4M56A 3RLGA 1DBTA 1JGMA 1KW1A 3W0KA 1UB3A 4YCPA 3UESA 1Q7ZA 3RNDA 3RO8A 4Q8PA 5HR6A 1EP2A 4TX6A 1HKIA 2QCCA 2YGYA 4CD8A 3KRUA 2WMIA 1Q2RA 3FHAA 3Q58A 5LYRA 2ZA2A 3UEQA 1RBOB 1I1XA 1JQXA 4J27A 5CPQA 2J88A 1YPIA 4F2TA 3LU2A 3LN3A 3IVSA 3GUGA 1TZ9A 4HT3A 4KRZA 3U0HA 3OA5A 2VC5A 1SR9A 3EKGA 1UD8A 2ICSA 1BG4A 1T5AA 1NU5A 3VGDA 4YWIA 3SZ8A 2WSKA 2VCBA 4LSBA 1JYXA 4MKSA 2FPYA 5K7JA 4JBRA 2YBVA 1JCTA 2WKGA 3UZXA 5IBXA 5KINA 5XIAA 4N9BA 3U9IA 1YPXA 4H3DA 3B40A 4HA3A 2XIBA 3VNMA 1EF3A 4JIHA 4LUIA 4O52A 3EPOA 1S46A 5CPLA 3UG5A 3WQVA 5T26A 3LXCA 5KMYA 5CKSA 1KXHA 1HQTA 3R79A 3VYLA 3PZVA 5G5IA 4GY1A 4GZIA 3W75A 3QRHA 3HQOA 3PTMA 4K37A 3BOFA 3OLGA 4WK9A 1KTNA 4IIBA 3AIRA 1XC6A 4M24A 1W3NA 3I4KA 1ENUA 3WSUA 4HBKA 1D7FA 3K4DA 2PURA 1M3UA 5K4XA 1KRMA 2HK1A 4TVDA 4HCHA 5DMMA 1VFHA 1SJBA 2BHZA 4RW3A 1E9ZB 1FWCC 4C5YA 1V77A 4HJFA 3GXDA 4CN6A 3IJDA 3SCTA 1CIUA 3VIGA 5D9OA 4HOZA 3EOSA 3TYBA 1AD4A 2X8RA 4S3BA 4RJEA 1PYMA 1WBHA 2VC6A 3VDBA 3IGXA 1NWUA 3FFSA 2ZX5A 2CBUA 4S1FA 1Z3NA 3HMJG 1W1TA 3JRKA 1Y65A 3S1VA 3RLVA 2DT3A 2E5CA 3LNPA 4LY4A 4HMNA 1J6PA 3PPHA 4ZVJA 3F7JA 3P60A 3PBMA 4Q4RA 5K4ZA 3BW2A 1QATA 3IIPA 4Y9OA 3QN3A 1R9XA 3CAWA 5DCEA 3H4GA 2HE8A 3W23A 5AZ1A 3WF3A 3QPYA 1EP1A 1L2UA 2J6XA 4KQNA 3STEA 1AH4A 4DXKA 3WEMA 4IGHA 2VRKA 3LEPA 2C6QA 4G2DA 4ZSUA 2QHAA 5ABEA 1S5MA 3HO8A 2A3CA 4GJ1A 4C65A 3N73A 1TR9A 4K2SA 1WX0A 3KVKA 3IGUA 1U5JA 4GIAA 4H7VA 1BTMA 2ZUNA 2VX6A 3LBCA 1F3TA 5DO8A 4NZCA 2VO5A 4GINA 4O12A 3OG3A 4PZVA 4LH8A 1TMLA 2XFWA 1Y8BA 1DXIA 1R2RA 3NQFA 5JIWA 4Y90A 4XAGA 4ATLA 3GHSA 3P8IA 4W84A 1QO5A 4E2BA 1H62A 5D2XA 1KFCA 1GG1A 3BSGA 1CXEA 4IXHA 3AJ7A 3BG5A 1YPFA 1EUNA 4JYDA 1X7FA 4LAOA 2V3GA 1OX5A 4F2BA 2WBKA 5D2YA 2GVYA 1E15A 3PS7A 3TK7A 1TA3B 2DT1A 1QWGA 4CQ9A 2GDQA 2BVYA 5HXMA 4JYEA 4S2CA 4KMQA 5D03A 2QR6A 4RXGA 1TA3A 5I03A 1X1ZA 4HOWA 4ATWA 2FJUB 2IPWA 1BSIA 2J25A 4CCCA 2WQDA 3UCCA 3H54A 4ZQNA 3SCVA 1JZ2A 3KLKA 1E4MM 1CXLA 1O5QA 1GOMA 5T91A 4QJ4B 3HPAA 4I8YA 3GH4A 5AC8A 1Q65A 2PWEA 1H09A 2QNEA 1XUUA 4PCTA 3L21A 2E5BA 4R7JA 4S39A 3RX2A 4V33A 2QV4A 1MRAA 1YDNA 4H6KA 3J7HA 3IJ7A 4Q8OA 4ROPA 1D3HA 4Q8UA 3W85A 1GVFA 1YTDA 3UFYA 2IXVA 3QEZA 1JULA 2EG6A 4Q8TA 3DH7A 4GX9A 3E96A 1BFNA 4IPPA 1KRAC 3VINA 3NFUA 4NJKA 2VP8A 3S1GA 3WQ4A 3OBAA 1ICQA 4XUYA 3G6MA 3AXKA 2DW6A 2FZ9A 2YKKA 1DPMA 1ZLPA 3LPFA 3WN6A 3ONBA 2NX3A 3T0AA 3AXMA 4KRTA 4DO6A 1IT0A 4MJZA 1IEIA 3TXVA 1XIBA 3S5OA 2C18A 1QI0A 1DQUA 3PBGA 4M5PA 4Z2GA 4BS0A 1NP0A 1DJXA 5RUBA 1UKQA 2QGHA 2ASHA 1V7YA 3YPIA 5FEWA 4E4PA 3WMSA 1P0BA 4Q6XA 4DXVA 3E1F1 2X30A 4CQAA 2W4XA 1XIDA 1XYFA 4Q32A 4NY2A 4JIIX 3WQFA 5MKGB 3SFKA 2QAFA 4V2XA 1B9ZA 2HROA 3WMBA 5BMWA 4LV9A 2FHFA 1MW3A 1XRFA 1R2SA 5D37A 1H3GA 2PEVA 3HIJA 2J7EA 1NARA 4O1CA 1ODUA 5A5WA 4O4WA 5A6BA 1FWSA 3BAXA 1JCMP 3VVGA 2BODX 3FJ6A 3E0FA 2P3EA 1IEQA 4KGJA 4YVVA 3UT0A 4RNIA 3B0PA 1DIOA 3VNYA 5CC5A 3PZGA 2DU2A 2E28A 3PUGA 1YE4A 1A5UA 3M5YA 4GYKA 3WK3A 3C3NA 2GJPA 2WHKA 3D47A 2QCLA 1YEYA 2D2OA 4QQ3A 3W1AA 2ZYFA 4I8DA 3BL3A 1UP0A 3HG3A 3NZQA 1E56A 3STFA 4GI6A 2EQDA 4W7WA 2DSWA 3OGSA 3GXIA 3AYTA 3LCWA 4MWAA 4GC3A 1PZ2A 2NSXA 4P8WA 4F48A 1PHWA 2R1LA 4F0KA 4GVHA 3DCPA 4HYWA 5AYIA 5C2CA 2PP3A 4NHVA 2JQXA 1W1IE 3DIPA 4B9YA 1E51A 3GYEA 3SY1A 1E6PA 4XZIA 4KEUA 1XINA 1DKWA 4WSKA 1TJ0A 4QR6A 4XBSA 4GYPA 1DIKA 3ITOA 5U4NA 2RGLA 4FAMA 1EEPA 4RDWA 4LVGA 3S2CA 3BE7A 2OWWA 1B3YA 3EXTA 1VP5A 2Z2AA 3QTGA 4A8LA 2QMKA 1E5JA 5FJOA 3CB8A 1O1HA 2PE4A 3QTPA 2W66A 5D4YA 2D69A 4DWSD 1IR1A 3CV7A 3H55A 4MKNA 4AF0A 4C1LA 1TPUA 2VGBA 4AEFA 2WHMA 4H6RA 3W1TA 2DZWA 4MUZA 1RBAA 4DJED 1J5TA 1D3CA 4B5VA 4MY9A 2V5LA 3U2OA 2G5WA 3CUXA 2J78A 4DJFC 4XKMA 3EWYA 4C6OA 1WA3A 3I4EA 2X05A 1JYNA 3CHDA 1O5RA 4DF0A 3NQGA 1ONEA 4FMVA 5LXEA 2GGHA 3VDAA 1EJ7L 1I1WA 1H1NA 3L4VA 1KFJA 1WDPA 2PGRA 3EWWA 3DXIA 5A3HA 4M29A 3NOEA 3V75A 1JCLA 1FCBA 1OEPA 2X0YA 1UJPA 1TKKA 5LGZA 3G1DA 4FF7A 4PUNA 4D8LA 2ZBTA 5FSEC 4GGHA 3ZIZA 4DIAA 2FB2A 4UNKA 2JKPA 1QFEA 3RHGA 4GNJA 4REQA 3SSZA 4RNHA 1GYNA 3IV8A 3NPUA 3VUSA 3S1UA 5CPTA 3UETA 3VIPA 4KWVA 5JU6A 5CG0A 4UQBA 5D04C 2QDDA 5BU6A 3N04A 3EA2A 3OVGA 1ISYA 3OO2A 4E4FA 4NAEA 1LWJA 3TU9A 3WLJA 2X16A 1EPXA 2E9LA 2DSUA 3KTXA 1SSDA 1TWSA 1QPQA 1GKPA 4J1OA 2XH7A 3TYAA 4B4FA 3Q45A 3SW6A 1KRBC 1VGAA 4IMCA 3HOJA 4YL2A 2ZUUA 2WYSA 3TW6A 3IUIA 3H7UA 4YTSA 3UQNA 1XSJA 4CU8A 3AO0A 4MFDA 1PTAA 2GUUA 2FVKA 2AAMA 3M4HA 4Z2KA 3IAQA 5GPRA 1DJNA 4EE9A 1H0IA 4FEZA 1ZHAA 3Q37A 2FTWA 2WVTA 1B57A 4I9TA 5A6LA 1K7EA 2C16A 1R3QA 1DIEA 2PDFA 4HSHA 1F76A 2YJQA 5CGQA 3GVGA 3OG2A 4HNCA 1FWWA 5T8GA 1AMKA 4B90A 1F73A 3L66A 1EWDA 4AISA 4LUYA 4RLIA 1HL2A 2WZHA 3CPRA 4G1NA 5HULA 3IIXA 7ODCA 2QUVA 3CWOX 1JF6A 2NWSA 3WDJA 3M0XA 1SJAA 3AC0A 1CEOA 4NX0A 4PR4A 3CL7A 5AVHA 3M0YA 1TRIA 3FOKA 3OQ8A 2DZTA 3QLLA 5K9DA 4P7QA 2OKTA 1OK4A 1SGJA 4W8BA 1KLZA 4DY1A 1OINA 4BQ5A 4AMCA 1US2A 1XIMA 2CZ5A 1VBGA 4K7YA 4DF1A 2DZPA 3RMJA 4PMNA 9CGTA 2Q3RA 3MWAA 3BCJA 3GH7A 1J0IA 3BK0A 3NDZA 1S5NA 4I3GA 4JGDA 4XG1A 3POHA 3NQ2A 1U5HA 2NX9A 2NW0A 1KGUA 5CJMA 1NH6A 4O11A 5ECUA 3B9NA 1ZJHA 5E70A 2EPNA 1WCGA 5M3WA 3IUHA 2DSKA 3TW9A 3ITXA 2Y88A 4FLQA 2HMCA 2D3NA 1VBJA 3IIOA 1P6WA 1ME8A 5F2LA 1BF2A 4Q7IA 2FVLA 4I5RA 3VKJA 4OTKA 4GIRA 4GX8A 3REQB 1DXEA 1F74A 1FXPA 3LZ3A 4IX2A 3HG2A 4J3VA 1AL7A 4BF9A 3REQA 3VIHA 2QAPA 4GE8A 3JZUA 2CITA 2PDCA 4N4QA 4GCAA 3TH6A 4GZJA 3PBUA 2OLHA 2ABBA 2IPFA 3TJIA 1OBAA 4LT9A 3PY2A 1ZENA 2QJHA 4PMRA 4O50A 4XV0A 3EKLA 3SCSA 2X2YA 3E02A 2OZ8A 1GQNA 1X96A 1A5LC 4JHOA 3VNLA 3QHOA 4W9TA 3RFAA 2EJAA 3LGDA 2E1WA 1RD5A 1QOQA 1HKKA 3MY9A 3N18A 3W4RA 1E70M 4BZYA 2PBOA 4J9JA 1ZAIA 3S42A 4C60A 2V81A 3USBA 1Q6LA 2XZ9A 5IFTA 3UWZA 1Y0EA 3N11A 2FHBA 2V2HA 1FDYA 2AQVA 5FJTA 2R82A 4EPDC 2GYIA 3DG3A 4ACZB 3QYQA 1JPDX 3A5VA 3OVPA 3ARPA 1MDRA 1OADA 2BXVA 3MU7A 4ACZA 1VR6A 4I9JA 4UWMA 1RV8A 3VIJA 1B54A 5DFAA 4CGTA 4UZSA 1EL3A 4Y7EA 4BEUA 3KP1A 1BKSA 1X6NA 2XVGA 4W4QA 1GHRA 4C6JA 3NYZA 4DI9A 4HSOA 1N8IA 3UXAA 4CQCA 1BD0A 2NVCA 3MSDA 4HU8A 3KZSA 4GQBA 4S3EA 3LBOA 1AW5A 3FEQA 3WQCA 4RL3A 2JALA 3PANA 4FNQA 1S3TC 1C8QA 2ZUWA 4RZ6A 4DO4A 1A5KC 3W3OA 3FAWA 5LIKX 4FZIA 1GKRA 4G9PA 1KFBA 1O4UA 3DI1A 2VVNA 4XUGA 3DKLA 1XYZA 4C5ZA 4WF7A 3WQDA 3P80A 3WLPA 3GE7A 3BSMA 3BVJA 5H6HA 2BOEX 1PEZA 3MPGA 4FOUA 4O10A 2FZ8A 3B8VA 3UJRA 4M0XA 1OF6A 3WD4A 4MDPA 4GNKB 3ZLHA 1EBGA 3W29A 3AMLA 2O4MA 1TWZA 3NSXA 5E6YA 1QW7A 4ZL1A 4LC6A 4DWSA 4B91A 5H1WA 1AFSA 1DJGA 1VPQA 2XFYA 2YLAA 1VFOA 4DM2A 2QCDB 4DJEA 4E8DA 3G1XA 3MMDA 3ZS4A 3GFZA 1PIFA 3W38A 1HJQA 3FDKA 3CIVA 3L2MA 1W9DM 2QCDA 2GLKA 3GXPA 1UROA 4FI4A 1RLDA 4C6FA 2DEPA 2QDGA 3ARQA 1MNSA 5HUOA 4CN1A 3CB3A 5JQ9A 3IRDA 3AXIA 3BGJA 2WSYA 4HP5A 3WK2A 3TTQA 2V67A 4MOZA 3KS6A 1H0GA 3KEHA 3WFLA 3U7VA 3TEVA 4JDBA 1X7IA 1PJ9A 2GZXA 1QXLA 3AHXA 1Z7AA 3P82A 1F5ZA 4S38A 3G1RA 4IPIA 3N6HA 1Q6FA 4AIEA 4M7SA 2I5IA 4OFCA 1OX4B 5LHEA 2VX7A 2UY4A 4GUGA 3WFZA 3LNMA 1PYFA 1OX4A 3ME3A 6TIMA 1E71M 1FVPA 1M03A 4QROA 4CQ8A 4JNYA 3W37A 1AODA 3LHUA 1Q6EA 4YWSA 1JNDA 3VGHA 2WZMA 1HGWA 3MUIA 4F4RA 3SIZA 2PDBA 3MV01 5C2XA 1WZMA 2Q8LA 1E0UA 4JNMA 2DVTA 3VX1A 2PDIA 1A4LA 4KRUA 4TX9A 3FKRA 3PAJA 4CEUC 1BRLB 1W2PA 3E2SA 2JE8A 4PMQA 2TSYA 4LVAA 3F5JA 5A8QA 3G1FA 4D6FA 4U5KA 5I78A 2NVDA 1PX4A 2E67A 2G8ZA 1BRLA 4YHEA 3GU1A 3GKFA 5C9RA 1R86A 1NOFA 3LUTA 4PUDA 1SMDA 3LRLA 3SI9A 4GIYA 4IX0A 2GVGA 1E73M 1ZBKA 3LCXA 5K9CA 1UP2A 4KS0A 2RUSA 1TFVA 3V5CA 1BQCA 3WBYA 2J77A 4J3ZA 2OSWA 4AZIA 2HVMA 3EX6A 2HS8A 4BQ2A 3EPNA 3FA5A 3N12A 3B9EA 3UZ5A 3PZNA 1EBHA 3EMQA 3KP0A 3WLIA 1WXYA 5I02A 1I45A 3KCLA 2V8ZA 1EJVC 4PUWA 1UUOA 2NX1A 1E1CB 3NL3A 4AX7A 3APGA 3SY8A 1SFTA 2OLAA 3GBDA 5AHEA 1E1CA 2AQOA 4RDZA 1S2AA 3LDVA 4X9YA 4Q8MA 3S6DA 5M17A 4HPXA 1JUEA 2GWGA 3GZ3A 2NUXA 3UVAA 4X3ZA 2CKRA 3R8HA 1D2KA 5GJMA 2CXEA 1JXKA 4MZYA 5BNKA 1Q2SA 2EG8A 3DECA 2GGJA 3KOFA 3L4ZA 2BB0A 3QGVA 3O63A 1TQXA 4KH2A 3KHJA 4V28A 4LAKA 5JBFA 2DIJA 3LZ5A 4Q4SA 3RM8A 3GAYA 5KITA 3CWNA 4HK5A 2KZHA 1G1YA 1GNXA 1GYMA 5A2AA 1V79A 2VRJA 3UZWA 1JF5A 5KTLA 2PTXA 2ATMA 2A7PA 4HHLA 3FX4A 3R6IA 1VH7A 4B92A 1MEIA 4WY0B 1K9FA 3IK4A 1KGXA 5F4SA 4GKTA 3LV5A 3WQWA 3ANUA 1TZ7A 1UC5A 2WANA 4J4KA 1DWJM 4HU3A 4WY0A 3QV8A 2OT1A 3V4BA 4DB7A 2XZ7A 1ISXA 1XI3A 4H41A 1MFVA 3E2RA 4KBXA 1VPXA 1JYVA 2PWFA 2RJGA 3I7RA 4F0HA 3DFYA 7A3HA 1JIBA 4W89A 1JPKA 2J7FA 4HPJA 4PUJA 1K9DA 4ZOAA 3UA3A 3CAQA 4QRNA 3VNJA 4DHGA 5KZ6A 3NIYA 5FJRA 3SURA 3ITCA 1H5YA 3CU2A 3ABZA 1LOLA 1F2JA 1AMYA 2KX9A 4HQVA 5DMLA 1HX0A 3OLEA 3CASA 3VIMA 4UBPC 3NO1A 1E6XM 1NDVA 2PDMA 1G6CA 3IIZA 2PD5A 4ZTYA 3LMZA 3GKAA 1JD7A 3R8RA 4JTAA 1XRTA 2DZXA 1P1MA 2BBFA 2ZXQA 2JKEA 3LHVA 2NXGA 1OM0A 3N13A 3DKJA 1Q6QA 2QJGA 1NDYA 1TJ1A 1EIBA 2WM0A 3DHUA 3L2LA 3P81A 1MFUA 3TCSA 1XC4A 4C6CA 4KCWA 4OVXA 3QGKC 2DH3A 1XIJA 1ZL1A 3Q94A 3LRKA 3GU9A 1OJXA 1W8GA 3WLOA 1B0IA 2FDMA 1W1VA 2Z00A 3EWXA 2A79A 1IIGA 4XVDA 1SJDA 2IKJA 4UZUA 3L5LA 1N7KA 1ONXA 3G8RA 4O13A 5EYWA 3AWOA 1KBKA 4P7RA 4JIEA 4NJJA 5D05A 4JCLA 3VM5A 3OBKA 2FKPA 3OOQA 4PH6A 2R1KA 4WKAA 3VC6A 4D71A 2Z29A 4UCFA 2PODA 1V6VA 3L4YA 2GVLA 4PN2A 2O9PA 3HPFA 3VMNA 2PSNA 3VNDA 4JFSA 4J28A 3CQKA 3GVQA 2V5DA 3LM7A 1V8EA 3BC9A 4IOTA 3KOWA 3O0FA 1THFD 1WPCA 2YDRA 2ZC8A 1P6BA 3OYZA 4D72A 1ESWA 1UCWA 5XINA 5B7YA 3KLLA 2HQAA 1EDTA 2WC7A 1MQQA 2EJ1A 3UWYA 4CU7A 3RJXA 1DXFA 3AXXA 4RE4A 1UH4A 1TIWA 3F2CA 3B3DA 3DC0A 1KFLA 2CLIA 1KBBA 2QT3A 5C70A 1YKWA 4ICMA 4XD6A 1ZUAX 4FNRA 3VI2A 3RF9A 1OFOA 4MIMA 1DWFM 4A29A 3TQVA 1HG3A 2GJRA 2AOSA 3CL8A 2VL4A 2J7GA 4RZ5A 2QJJA 4D6EA 4IIGA 2YDQA 3VD3A 3AIBA 3OGVA 3DI0A 3WQEA 2YCEA 4QX4A 4ACYA 1T41A 2CHOA 5JIPA 1JI2A 4AW7A 1EYWA 2A3HA 1V02E 4DUVA 4EXAA 3I3EA 4H01A 1K1DA 1PXGA 3UGRA 3OGRA 4LYQA 2EF9A 9XIAA 3HGRA 1MI3A 3QHNA 1GUVA 1NVMA 5ENLA 2NVAA 4Z0JA 1UJQA 1F05A 1UBSA 4NZFA 3CIXA 2OQHA 1G7UA 2B0MA 2F2KA 5BWAA 4L7ZA 4GZ7A 1KTBA 3HGJA 3GNDA 3QOKA 2V5BA 3QSRA 4XTIA 2WCGA 4PMZA 3ITYA 3W7CA 1TR1A 3W1RA 1XBZA 3IVUA 1EJXC 2CLPA 2JF6A 1VRDA 4WSHA 1H61A 4W7VA 2CKSA 3U7BA 2J7DA 4LS2A 1EP3A 3DHDA 2OZTA 4XB3A 5CSSA 3CPGA 1RQEA 3O7UA 1SZRA 3PZTA 1AJZA 2UZ9A 1NF7A 1C91A 3ZVHB 3TTSA 1ZAHA 4JFUA 4DJDC 1H7WA 2NUYA 4GCXA 3SN0A 4JD4A 3EA1A 1LLOA 2EXOA 4NAFB 4EXBA 3UCDA 4FIRA 3W7QA 1BLIA 3WUBA 3ARZA 4ZO7A 5HBFA 5AC7A 4J3TA 4NAFA 5E6ZA 2XG9A 1J0YA 3V5FA 1G94A 4RZBA 4ZSTA 1SZFA 1VS1A 3OYXA 1YXDA 1F9CA 1EB3A 1XS2A 5LNSA 2KAUC 4TVUA 1B4EA 3KX6A 2VEKA 4QIUA 3UG3A 3O6CA 2WMJA 3PNUA 4C7GA 2RH9A 4B3ZA 2CBJA 1R3WA 1VJSA 3QC3A 3LY0A 4M3PA 2ZRVA 2WMHA 4L9ZA 2WNQA 1ZCOA 1R0MA 3N15A 1XD1A 5GVJA 4CD4A 1SR0A 2GFTA 2Z7GA 4MJ2A 4O28A 1RP8A 1FWEC 1W9XA 5FF4A 4IFRA 2VWTA 1LTDA 2YZRA 4E38A 1U83A 2DZBA 4AZHA 2J8TA 1XDMA 1GJWA 3EB3A 3AU2A 1DQWA 3ARVA 1P5BA 1ZTVA 3VE9A 3UCQA 1R3VA 5HNUA 5CLTA 4JL1A 5IXEA 2NQ9A 3WNMA 4PODA 4IP5A 3ZWSA 2PDWA 4I7WA 1TTPA 4FXFA 3SN4A 1V51A 3DC8A 3N2MA 3Q4DA 1WAWA 2YL6A 1U2YA 1KXVA 3GG7A 4UR9A 3SEPA 2WVUA 4Q8VA 1X6UA 2A2IA 5ABFB 2DUAA 3KL3A 3F4VA 4TQTA 5LIWX 1S5WA 1WUFA 1B90A 1NM9A 2I9UA 1R30A 1PZ1A 4HN8A 5C7VA 3LGEA 3ABXA 4IUOA 2AL2B 2Q8ZA 4QNWA 3ID7A 1V3KA 3WBWA 1BXCA 3W81A 2VFGA 3LLXA 1VB9A 4DZHA 4KETA 3DHPA 2W3ZA 4HTBA 4LYRA 3C2FA 3FDGA 1VRXA 1XW8A 2E0PA 2PDYA 1XLLA 3ALGA 5AY7A 5H2ZA 1KKOA 2PDKA 1V03A 4GJJA 4AD2A 3H4WA 3M0IA 4HN4A 3KBVA 2ANUA 1SZEA 3LV6A 3WENA 2XJ7A 2PD9A 1CB2A 1UIPA 1W2VA 2J6VA 3I6RA 1U30A 4W87A 3RCNA 3LTPA 3BAJA 1B30A 3IV3A 1YQ2A 4R3UA 4G1KA 2C19A 3WBXA 3A21A 3T0BA 1UPPA 4KW2A 4WY0F 3QZ6A 4YJ5A 1A3WA 4HNTA 1XLIA 3VMOA 1OC7A 1QASA 4UFLA 4KCVA 4IGSA 4ORMA 4ZB5A 2XIJA 1Y5VA 4FO4A 4OWGA 1EHNA 4R33A 3U4FA 2DT0A 1GQIA 5A8MA 5ABGA 1XRVA 5LNVA 5DX7A 3L65A 3POCA 4MUPA 4DELA 2IQDA 2A5HA 3C0QA 2OU4A 5CGMA 4IMAA 3KL0A 2C3ZA 1J0JA 3RUBL 4AIBA 1A5CA 5FCZA 3F2BA 3QLDA 1H49A 1I8JA 1I75A 2C13A 3TWAA 1HJXA 3OHIA 1S2UA 4GVGA 1X38A 4KGLA 1X6LA 1E0XA 3W2MA 4NZ4A 3LSCA 2QVHA 2C91A 1IF2A 4FNPA 4BEQA 1BPLB 2Y4SA 4JTEA 4ML9A 4LALA 3B8WA 8CGTA 2J4GA 3WLMA 1R6WA 3AZSA 1MQRA 3MP4A 3HJZA 1VEMA 1C9DA 3DFOA 1ALDA 8XIMA 1JVNA 2WB5A 1JPIA 4HU4A 4AH7A 1CCWB 3V1HA 1ZCCA 3T42A 3QPEA 4IFKA 2XISA 4Y8FA 4F0RA 3W70A 4UOZA 4B16A 2J62A 3EDKA 3AALA 2V6AA 3K5XA 2UY3A 1V6WA 1PWLA 3TMLA 5LSMA 4UTLA 2POTA 1GZGA 3LXAA 2G41A 3HFTA 3SUWA 1TZZA 1EUAA 2ZWYA 3ARUA 4FLSA 4I5XA 4RNFA 4L5ZA 3NZRA 3E49A 3AIWA 1L6FA 2PZNA 4QE5A 5CBIA 3F5KA 4KEZA 3FY1A 4ZCWA 5DELA 1BVZA 4A4AA 3R7MA 4FS9A 1W1YA 2ZFAA 1PS9A 1WDRA 2Y5SA 1QRQA 4S3AA 3CMFA 3L4TA 1QJWA 1V3IA 2ZRXA 4ES4A 4XIMA 1TX0A 1XFCA 1TB3A 3SUUA 1K03A 3MZ2A 1WP6A 4US6A 3W7LA 1Q3NA 3GIYA 2ADAA 4G7EA 1CW2A 1JUBA 4WX2A 1P0DA 4GY7A 1Q6DA 3L9CA 2F61A 1S1RA 3ITGA 4RCXA 3RAOA 4EF8A 3WLRA 4WDTA 1QHPA 3CHVA 1QPOA 5FJUA 4GBDA 2J47A 4AX6A 4GXWA 1S1PA 2NT0A 1IV8A 4EWJA 2G50A 3E74A 3BWWA 2BHUA 3IS4A 4GQRA 5I23A 1HZYA 2Y24A 4A3UA 4DUXA 3M0KA 2CFFA 2RDTA 3ARWA 2PDLA 3WD3A 3N29A 1SYTA 4ZENA 3MP3A 3TFXA 1OQFA 1TREA 3IAPA 4F9DA 2QJNA 1H50A 3EX4A 2INZA 3BLIA 3UJFA 5DY2A 3UYIA 2VM8A 4UTTC 3MVIA 3ABSA 1CXKA 4L80A 3MT1A 5FEZA 2Z1BA 1KXQA 4B5TA 2WBGA 1Q45A 3OHMB 3LG3A 3SFWA 1ZGDA 2VD9A 1LWHA 1HUVA 4Y8EA 4DBEA 1OYCA 2CLKA 1G4EA 2BOGX 2YXGA 4HK7A 5HNTA 4GVFA 3W26A 3UW6A 4QTGA 2XVPA 1LZOA 3FYYA 1SW0A 4BI5A 1CGTA 3T2PA 2DY3A 4XISA 5JVLA 5CZ0A 4J2PA 4S3DA 5IHRA 2WKLA 1RK5A 4E5TA 1GK8A 4HZ8A 3VGEA 4UTWA 1FH7A 2PS2A 1A5AA 3UR5A 3W1XA 3U4AA 3CZJA 1EC8A 4NG3A 1HVXA 2QYGA 2VUNA 4LAUA 4RUBA 5I24A 1VD6A 1REQB 2XH0A 4GIEA 1REQA 2W91A 2W5FA 3KZPA 4NQ1A 1MO0A 1QI4A 4GACA 4M81A 5LIUX 2EPKX 2E6YA 4GI9A 1ZBCA 2OO6A 4TVCA 2VFHA 3GR8A 2FIQA 2Z27A 4EPKA 2VRQA 3PM6A 4YLWA 4G7FA 3GTXA 4XAFA 3WQ8A 2JFEX 4ZE5A 3CZGA 4N9CA 4EK7A 4B3KA 4FNUA 1TPH1 4CNPA 2VMFA 2V5CA 1KM0A 3RR1A 4XK2A 4L56A 1EGMA 4INFA 1OT2A 2BOFX 1FP9A 5DBTA 4JTCA 3RILA 4DO5A 4EP8C 3DN5A 2X1RA 4AB4A 1P43A 1Z9AA 2BV9A 2VWSA 5T9CE 3NWRA 3PR2A 4H6EA 2WC3A 1OYAA 3LX9A 1R5YA 4IQJA 2JF7A 4H4IA 1UYQA 3W53A 3W73A 3W7NA 1P48A 1TWIA 4W5UA 3M7SA 3BPWA 4JKMA 3QHMA 5C55A 3S5ZA 2E7FA 4D1JA 5DF0A 2AGTA 4MLJA 1HVQA 1TO3A 4PB5A 2Z24A 3W87A 1AJ2A 3P7YA 4R27A 4JHZA 2Y89A 4M1BA 3PFMA 3CJPA 1OYBA 5T9BG 3K1DA 4PC8A 3V0SA 3NQCA 1QOPA 3W1PA 4UTFA 4UQ9A 1A5MC 3HU7A 4TO8A 4US5D 1MNZA 3NSMA 4OBSA 5C5YA 1SPQA 3O05A 3N4EA 3JS3A 4A22A 4H9ZA 5GJPA 3CUGA 2CC0A 2ZTJA 3BGGA 1ICSA 1X1OA 3STCA 1WUEA 5HWMA 5D30A 1SMAA 3A13A 4W88A 4HPNA 2Y8VA 4MB4A 3TC7A 4TIMA 1OVDA 3BCDA 1MW0A 3A3HA 3C2EA 4XIAA 4Q7NA 3CZ8A 4K1GA 4UQDA 4IMEA 5HJLA 2DUXA 4AVFA 1DTUA 1QI3A 3HQPA 1JCJA 3VZZA 3E9AA 4GKLA 3RXZA 3RCYA 2J7BA 1EC7A 5CXPA 3VILA 5GNXA 1V7AA 2HNEA 2B7OA 2Z6IA 4Z1YA 1JEZA 3M41A 1UQZA 3BAKA 5A1AA 4KCTA 3V18A 2A4AA 2F38A 5I09A 1IZJA 2WCAA 2AKZA 2ZX9A 5FL1A 3N9KA 3VCRA 3QSTA 1ISZA 3TLQA 2PDXA 2REQA 1P0NA 4PMVA 2R6OA 2C14A 2P0OA 2E40A 5CC3A 5I00A 3P74A 3B8DA 1FP8A 4BWLC 1PWMA 3CLWA 1J2BA 5F1UA 3RLHA 4AXNA 3NEVA 5KETA 4O16A 1Q63A 2X40A 4LYKA 4DBUA 4CNTA 4ZB2A 1XHGA 2ZIDA 3MUXA 3TR2A 1M65A 2GWNA 3NO5A 2B4GA 2W79A 5I7GA 2Q6ZA 3S47A 4YYFA 3BXWA 3INPA 1OG6A 3A3XA 4HKPA 4P61A 4LF2A 4BCEA 4ERIA 3NPXA 5C2GA 1K9TA 3DGBA 2WNWA 3TYCA 3WUGA 1CB7B 1MZRA 5DRIA 1PPIA 2BHYA 1YXYA 4XAZA 4YVXA 5H8MA 1EDGA 4MWAE 1K8CA 3VUPA 3VPLA 3DYOA 3OZOA 4PUMA 1DYSA 4RV8A 5BCAA 4U4MA 2ZZ2A 3V3WA 4LCRA 3NR0A 1FH8A 4HYRA 1QI2A 4W7UA 1LBMA 3T8QA 5AHFA 3GD6A 1GEQA 2OEMA 1ZNNA 4AWTA 2YA1A 4GFIA 2HDJA 4NNCA 2V38A 2R91A 4N2YA 2QLYA 1FCVA 2ZX6A 3BLEA 4OBTA 5C9XA 4X9SA 3HGOA 3QY7A 1UWSA 3STPA 2R94A 4XD5A 3QQ0A 3U2CA 1UR9A 1E9LA 3QC0A 4LB4A 4X2PA 1E4LA 4AHOA 2F6XA 2OT0A 4CKQA 3GTIA 1K8XA 1KQZA 1B3WA 3U2EA 3ISIX 1XLKA 3KDNA 5A6JA 3GR4A 3BW3A 3T2QA 1G01A 3PZQA 2GQ9A 1UZ1A 1XLCA 4UTJA 4PUKA 1XIEA 1OG0A 1T0OA 2AKMA 3JR2A 2CLEA 3WH7A 3TTEA 1S5VA 4D1IA 3SY5A 4BF5A 1AH3A 4GA8A 1EJTC 3VZXA 3PBWA 2OG9A 3P5YA 2PC8A 3AUOA 3WUFA 2VOTA 3OODA 4IQEA 3K8KA 4ADUA 2DSVA 4C6BA 1UMLA 2UWFA 4LANA 3TN5A 1IEWA 1UOZA 2QIWA 1CENA 1RJQA 4HTYA 5GNZA 1EXPA 4HZ6A 1K3UA 4HNUA 1ICPA 3R25A 2FZDA 3PUEA 4JKLA 1F4AA 4LAZA 1Q66A 5A95A 2PFHA 3GVWA 4L4LA 1AD1A 3V0UA 3TN6A 1K7XA 2AMXA 3CQ0A 3EOEA 2X7WA 4PB3A 1FWAC 1R87A 3QKEA 3T81A 1KKRA 1XKYA 4H7ZA 3IJIA 1WE5A 2GQAA 2VURA 1EYEA 5H91A 4NU7A 1GPFA 4XD4A 3WDQA 5AN7A 2VCAA 4F8XA 3BQ6A 2GJXB 4DO7A 1UP3A 1MWOA 1TVLA 3KOZA 4GI8A 1S5TA 3FNDA 1GOKA 3W7KA 4QG9A 3MO7A 1M7XA 1T8XA 3QR3A 4AAJA 1ZP3A 3NQDA 2RDWA 3EB4A 3BLKA 4H2HA 2IMRA 3PG9A 4UNLA 1GG0A 3WKZA 4PTMA 3PSWA 1I6NA 2BGSA 2J74A 2XH2A 4HCLA 3CLMA 2VC9A 3A22A 3G0UA 4IGMA 4XBKA 3BV4A 4Z1DA 4DM1A 2EGZA 2YX0A 2ISFA 3MTWA 4P7OA 3LCHA 7REQB 1KFEA 3GTFA 2HNHA 3VC5A 2CZDA 1VBHA 2R8WA 5M1TA 2VD8A 3LHTA 1UR2A 7REQA 3E0VA 2WVSA 4MYAA 2VGIA 4DJEC 1XCWA 4UFIA 4IT1A 4XZMX 1QWKA 1MXGA 2O0TA 5CJNA 4IPJA 1UZDA 1RXOB 5HPOA 2IKHA 2B31A 1OF8A 4JY9A 3S4TA 2XDFA 4MTVA 3W88A 3EXRA 4XO7A 4O18A 2JK2A 4XZWA 4KEMA 3WQ5A 1L8PA 3ZSSA 3KBNA 4TOQA 4MADA 1DJIA 2BX7A 4B5XA 4RKAA 2DP3A 3K2GA 3W7OA 3PWGA 1ADDA 2J9XA 4OT7A 3WDIA 4AEOA 1DJHA 3M46A 3NAVA 2E09A 5CPNA 2V63A 1TV7A 3EX2A 2ZZ6A 2VOMA 2HJPA 2TRSA 3AUJA 3BGAA 4UTKA 3W82A 5PTDA 2QF7A 1Q6CA 2DGAA 1CECA 1EH9A 3KTSA 3GTNA 1UKPA 5MF5A 5A8GA 3NA8A 1FWFC 2Z1VA 1EDQA 4I90A 4PL2A 1SM9A 5CQ1A 4LVBA 3G8EA 1CLKA 4JTFA 4JTDA 3BLFA 3UBPC 1GQJA 5F2GA 2VEMA 1EOMA 3LPPA 5FF0A 4N9DA 3MHGA 1HP4A 1Q13A 3TSMA 3KRZA 1QBAA 4U5IA 1P1XA 4GHRA 2Y6ZA 3VXGA 3BURA 1A0CA 3BMWA 2C8NA 2Z2BA 1TWWA 1J93A 2J75A 3L0KA 4NXKA 7PTDA 3PB0A 1Q85A 1OC5A 2FGLA 4BQ4A 5I3IA 1SFLA 5CZJA 4AY8A 4AXKA 2YBTA 2I9EA 3CH0A 3QZAA 1I2RA 5LNRA 4ROQA 4C7DA 2IS7A 1ZQ5A 2PUZA 3XISA 5BXPA 4RE3A 1A0DA 3S6TA 3BAYA 2A1YA 1Q7QA 4QCFA 4U3AA 3C61A 4EOUA 2J66A 1GKQA 4MG4A 5CH9A 4KWWA 2ZTKA 1MXDA 2QCHA 2QUMA 1OY0A 2CXGA 3ZYZA 4EXQA 1S2CA 1DL3A 1XFBA 1VFTA 1UD3A 4LOCA 4NILA 2Z1XA 1QK2A 3W07A 1QMLA 4JZ5A 3EA3A 4UTIA 3U5YA 1ONRA 1L6WA 3VGFA 3CGTA 3TYDA 1RPKA 1PKLA 1PIIA 5I3JA 3L4WA 2TODA 4IFOA 3I3DA 1VIWA 1YXCA 2NWRA 4HK6A 1FBAA 1XYCA 1OD0A 3KOYA 3DENA 3TYEA 4YMZA 5EBAA 2X1IA 1TE1A 3WELA 4F40A 1M1BA 5A6BD 2YCIX 2XYLA 3EPMA 4YVPA 1JDFA 3HQ1A 1OFBA 3I65A 1KNWA 4UFMA 5D9MA 3WIJA 2PDJA 3APYA 1B1YA 4MHBA 2G3NA 4LUSB 2WMIB 1R9YA 4JCMA 2XIOA 1ZB5A 3AZRA 2D73A 4ZQCA 3QV7A 2J13A 3SN1A 4BI7A 4Y9NA 2HPIA 1I9CB 4LUSA 1NFPA 4L6OA 3SBFA 5HQMA 4ADSA 1H63A 2HS6A 1J18A 2GUBA 1OGGA 3TCEA 4O19A 4OQVA 5BU9A 4BF7A 3CUZA 1HL8A 3I10A 5B7ZA 5IM51 8A3HA 3AIQA 4TUFA 4DQWA 2EAWA 3LMYA 3VABA 3ES7A 3UU0A 5LGXA 3L12A 2XN1A 1DOSA 2X42A 3FV9A 4MWAD 4LS0A 4NJHA 4ZFMA 5C71A 5EMLA 2YL5A 1M01A 4J7RA 5FOOA 1U5VA 3TNBA 1KWKA 1QT1A 2E68A 2OX1A 4JTUA 4H9TA 3BCFA 4C6QA 1ZS2A 3OZPA 5DRCA 3WJZA 1NOWA 1X97A 1XCFA 1HJWA 2GSHA 3G0SA 5AB3A 4O54A 1XLAA 1K77A 1E43A 3MDWA 5REQA 1RAKA 3TROA 2YXXA 1IT7A 1LRTA 3ALFA 3S83A 4XZNX 1YBQA 4NVTA 1TUXA 3U5UA 1KCLA 1FWBC 3WH9A 2WKJA 1RBLA 4QS6A 2CU0A 2W27A 4QG6A 3DZ1A 4L4OA 3A24A 1R3SA 1IZKA 3TC6A 3QQWA 1F07A 4GPNA 1PDZA 3MSRA 3TN3A 3ANYA 3IJQA 3TVAA 1N8FA 4Y2WA 4IM4A 3W1NA 1XXXA 4PGLA 1GHSA 4AWSA 3MW7A 4IG2B 3RITA 3KVLA 2AGKA 1C3FA 2G95A 4RK8A 5G2HA 3F4DA 4IG2A 4M6UA 4MPKA 1TYGA 1QNVA 2V9DA 4GFSA 2J8FA 1KCXA 4DEFA 1LYXA 2G3FA 3WH6A 1C9WA 5KZEA 1JUKA 5A6SA 3NGJA 1T8QA 1G7VA 4OU1A 3PBVA 2Y7EA 3CS2A 1GQLA 1U1UA 4AD3A 4PMOA 1PE1A 4NI3A 4D6DA 2IPGA 4O1AA 3NPWA 2DH2A 4NT0A 4AHPA 5EMKA 2PTYA 1Z69A 3TP4A 4BI6A 1VHNA 4TMBA 2HISA 2JEQA 3PVFA 2YYUA 2PDNA 2ZUVA 1SJCA 1XLBA 2OEJA 4UIOA 2R24A 3EDJA 2ESCA 4DF2A 3E6EA 3TFCA 3H6OA 4H6QA 3WMLA 1W3LA 3GNRA 3CNYA 2ONEA 3VD4A 1A5SA 4IGNA 4TV6A 3PTKA 4PUUA 3LERA 3DFPA 1GOIA 3VOFA 2PDGA 2ZRUA 3AJXA 4P8UA 2J7HA 3UXKA 4C7FA 4H8HA 3B4UA 5HMEA 1ELSA 4HMCA 1C29A 1LBFA 3OZMA 3O0KA 3CEPA 3GXFA 3QJAA 1KD0A 3TSDA 4LX4A 3G2GA 4X63A 4PL1A 1G69A 1LP6A 5LHFA 2VR4A 4QJ3B 5I3FA 3E0IA 1DWGM 1NTHA 4ZGYA 3MBFA 3WL0A 1N8WA 4WJXA 4GABA 1D8CA 4L1GA 2PRLA 3WQGA 1VYSX 4TMCA 1TVNA 1H1ZA 1VFUA 3P84A 3E5PA 3DHFA 1WNOA 1E6NA 4ZOBA 5A2CA 1E1FA 1RD6A 4P2VA 4DPQA 4C1NB 1X8FA 3CHFA 3FYOA 1DJZA 4PFHA 3ELFA 2NZLA 4OGZA 1W5MA 2RHGA 3WF1A 2BY2A 4C1NA 1BAGA 2HBVA 1CLVA 2FTPA 1V3MA 4K36A 2P8CA 3UD6A 1HKJA 4PFMA 1LORA 3NM3A 4YS1A 1TCDA 2I5GA 1GCYA 5A6MA 1OFDA 3O07A 4QAWA 1U33A 4NZ1A 4MYXA 4B5NA 4IHCA 3M6DA 5IDZA 3NZPA 2BZNA 1P6CA 2Z6JA 1U1HA 6CGTA 1XLMA 2WZEA 1B9BA 4GYJA 6ALDA 1W1A1 3QXBA 1JZ4A 1HXJA 3GDLA 1JZ5A 1GVQA 1XP3A 1B5TA 1GOQA 1F4HA 1EGZA 4K8HA 1M53A 4BKNA 2POZA 1Z32X 4XZLX 2Z1SA 3U57A 1KCKA 3EWCA 3SRDA 4Q22A 2XWDA 3O2LA 1SUXA 4M8UA 5FSDC 2UBPC 3N3MA 3QF0A 4RX0A 1Z48A 4LCSA 2A3AA 4TXEA 3ANVA 1UWIA 1TPC1 4UQAA 2BDQA 1JDCA 4HJWA 2BS9A 3SGGA 3R0DA 5EU9A 1JPMA 3VD9A 2Z2UA 4XKYA 1N55A 3JUGA 2DZAA 1QNRA 3IK2A 4WDUA 9XIMA 2VJXA 5G4HC 4L64A 3W2NA 3W6LA 1OZQA 1KM3A 2FDSA 1HGYA 1IHIA 3M9YA 3PPGA 1JJKA 1DE5A 4NUWA 4E3TA 5JMUA 3UWVA 2QJIA 3VK5A 1JL8A 4GC4A 4PTDA 3THQA 2HBXA 4X0VA 1DJWA 3HPXA 3O8AA 1F3XA 4JDYA 1G4PA 3PF3A 5I5RA 3GC5A 1TCMA 4JIRA 1DWHM 3ZLFA 1IXOA 1H4PA 1US3A 4TTGA 3V35A 4UTUA 4K1WA 4WZHA 4Y9PA 1FOBA 1W91A 3T8LA 3UZYA 3WLSA 2X1SA 2J24A 3K4WA 3B8UA 1MDLA 3G5EA 4ZOCA 4MY1A 4O1EA 2VDIA 1Y7VA 4HA1A 4J3UA 1TTQA 3R58A 4GO9A 4MWAB 4QDPA 3L0NA 1PX3A 4IL0A 4LUTA 5FEXA 1M7PA 3KHDA 1TPWA 3K46A 1O95A 4MDOA 1UUMA 1YIXA 1UD5A 3EBVA 4KWSA 3CUHA 5F4XA 4P5UA 4HNVA 3W7IA 4KFOA 4MAVA 3AICA 5CC7A 3IGHX 3LHYA 3GB6A 2GL5A 4CU6A 3CL6A 6XIMA 3ZXWA 4HOXA 1PHQA 4ADTA 4DYEA 3MUAA 3WMCA 1TTJA 1MXSA 3CPUA 1TQJA 3AYVA 3UWEA 3E12A 4IF2A 3F2DA 4H9UA 3WJYA 2I57A 1UR4A 5DXYA 3MMTA 1A0EA 4AF0B 2WSRA 3L4XA 4ERAA 5CBJA 3TYZA 4JTQA 4OIFA 4HHMA 4F9JA 1DJQA 2O7SA 2FVMA 4JQ3A 5FEPA 4GVIA 4HYVA 5E0FA 4Q4QA 1R3TA 2J7CA 3LLFA 3GXMA 4KEVA 4B3LA 2J79A 3LTSA 4YPJA 4RR4A 2FGZA 3USZA 4NNBA 4RNJA 4PMJA 4MAZA 3W1LA 2G3MA 5D2VA 4I9MA 2QCEA 4QDWA 2Z7KA 4ZOEA 4QJ1A 3LGGA 1TPFA 3THDA 3S8HA 7TAAA 4JEQA 3TQPA 4DNHA 1GZJA 1POJA 3IARA 2XSBA 2NQ5A 1TSIA 4L6HA 3L0GA 3UF9A 1BQGA 2PWDA 4N4PA 2P53A 2E4TA 3TC3A 3V16A 1G4TA 1MRQA 1V0MA 5ECVA 3F5LA 4NX5A 5AYZA 2WAGA 4REQB 3FKKA 1FY6A 1C92A 2J9ZA 1FWHC 3C0SA 3C6CA 2ISVA 5AHIA 2DDXA 1M5WA 3OU8A 5LXXA 4QHRA 3RJYA 3AS3A 4E2DA 1NOUA 4FOKA 2ZUTA 4GGBA 5F2IA 4QG8A 1W5PA 4Q4PA 3TOYA 3GC4A 1QVBA 1OCQA 4OUEA 4NAEB 2A3BA 4PBGA 3GLCA 2VDGA 1SO6A 4GMEA 4H7CA 4QEEA 1OD8A 1XLEA 4MNLA 3QY8A 3M7WA 1GQKA 3N4FA 1V93A 1KM5A 3EWBX 1CGWA 5KSWA 1P7TB 1GVYA 1D9EA 1RA5A 1Z42A 3BZGA 3KBJA 4S3KA 2XH4A 4PMYA 1P7TA 3KVJA 3UWUA 1SO4A 1O60A 2BTMA 2E77A 4UMCA 2OO0A 3W7JA 4JTHA 4JTTA 1QBBA 4DAFA 3N9RA 4H9YA 3IIVA 3DUGA 4O53A 3A3WA 3K1GA 1JRBA 5C0QA 3W7EA 4ORIA 1VFSA 1AW1A 3MYPA 2WJEA 5E1QA 3GZAA 3NOYA 1WKDA 5C54A 2V0TA 1A3XA 2X0SA 1YADA 3R4IA 3S2NA 1QNQA 3MYOA 1RR2A 1BGGA 7ENLA 2PPGA 5F7UA 4ZMGA 1FRBA 4HGXA 5BYWA 3GQYA 4MF4A 3RIKA 3LQGA 3NVDA 1HJVA 2XSXA 3R89A 4UMAA 1LUCA 4S3JA 3CUFA 4QSHA 3TNOA 1FWDC 4QBXA 5TBOA 2ZDSA 3PWAA 3O9NA 2Y63A 3UNTA 2D0HA 2H3BA 4UR8A 4L9XA 4K39A 4YTRA 4IXXA 5D02A 3A12A 1LQ2A 2J27A 1LLZA 3PN8A 3DU0A 3NCOA 1XWYA 4I7VA 3TDFA 5HQLA 2WZIA 4F0SA 1UWQA 2VKZG 4GD0A 4H83A 4YU1A 3OA3A 3ZFHA 4OV9A 3WNOA 2C7FA 1EA0A 4CD5A 1O5XA 4Y9AA 3PPFA 1P4CA 3PJXA 1XG3A 1JXJA 5DT5A 3DAQA 2E25A 3R43A 3PB2A 4ZZ9A 4EIVA 2ZA3A 4URIA 2CHRA 3ARYA 3OVRA 3FA4A 4NRRA 4WGXA 2OVLA 4FHAA 3M5XA 2PP0A 2RFGA 2VGGA 2VZTA 3LI1A 4HZ7A 4W86A 2GGGA 5A6TC 2WNZA 5DLCA 2H9AA 1DORA 3AU6A 1BG9A 2OOFA 4UTWC 2PP1A 2Y7FA 3H2OA 3W1MA 3H8AA 4U2YA 4V1YA 3M64A 3A64A 1H5VA 2XTKA 3GR7A 2DW7A 4GI4A 1W3KA 4JFVA 4R53A 4DNMA 1OB0A 3VKBA 4UTHA 1R7AA 3AXHA 4IJCA 4IIDA 4KPLA 4RXFA 3VIOA 3N19B 1XL9A 2UY5A 1BHGA 3AAMA 3CMGA 1LG2A 5BMXA 2NUWA 3T05A 3HPSA 4ZEPA 4DUWA 1O5KA 2BASA 1IR2A 2GVEA 1KTCA 1WXJA 5I79A 2RGMA 2QS8A 2JIWA 4ZO6A 2C1GA 4N6FA 2Y8UA 3FXYA 1GVSA 1TV5A 4UXDA 1TUFA 4L61A 1FCQA 2INEA 3CM4A 5GNYA 3AMKA 3L67A 3HN3A 3O6AA 4G6CA 3BOLA 4NRSA 3KS5A 3TW7A 3LCIA 3PP7A 3IWPA 6TAAA 2QEZA 1NY1A 5LZLA 1NAL1 1KM6A 1H7OA 2OCZA 4YTUA 4HVXA 2PRHA 1PO9A 4CVWA 4EWND 5LIYX 5DXXA 1GVEA 4Z2LA 2NSOA 4TR9A 3T2OA 3R8GA 1WDDA 3ZR5A 5AKQA 3H53A 1DHKA 1OFRA 3LHWA 2ZE3A 3MV11 4LUJA 1TIMA 3CYVA 3SCWA 5D2TA 1BYCA 4A2RA 4KIEA 1FWJC 1R7OA 3M5VA 2XN0A 3SCNA 1R2TA 3WF4A 4UTMA 1YHTA 1Z89A 5D32A 1OK6A 3P0WA 3U6WA 4LYPA 3B0VC 2X1UA 1QCWA 4FR1A 5CCZA 1CLXA 3GXTA 1VLIA 1A5OC 2EO7A 2VTFA 5FAJA 1B31A 3JVAA 4M82A 4HNLA 3SO7A 1K7FA 1G5AA 1O66A 2XGBA 1F6PA 3L68A 2Y5EA 4CNSA 3W22A 3P67A 3P61A 4MKVA 4DWSB 1BWKA 1FHVA 5A8OA 1WKFA 2MUCA 1W0MA 4OBRA 2SFPA 1H7XA 5DMYA 3PSVA 2W61A 2F2HA 2GJLA 4NZ5A 1EA9C 2MANA 2QPSA 4CEXC 3KRSA 1O6IA 2CLHA 3BW4A 3G3MA 4HD5A 4HU0A 4UFHA 2J9YA