4IFOA

2.50 angstroms x-ray crystal structure of r51a 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase from pseudomonas fluorescens
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFAPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title The power of two: arginine 51 and arginine 239* from a neighboring subunit are essential for catalysis in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 122
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4ifoA00
4DI9A 2Y1HA 3V7PA 1VFLA 3LNPA 3MVTA 4LCQA 4WGXA 3NEHA 1EJWC 4C6MA 3MSRA 2O4MA 4LAOA 2HBVA 3A3WA 3IPWA 4H00A 4NI8A 4GZ7A 2OQLA 4QS5A 1P1MA 2VHLA 4L9XA 3IJ6A 3URNA 2HPIA 2GSEA 4GBDA 1FKXA 1GKRA 4XAYA 2QS8A 4QSFA 4LALA 1NDYA 4CEXC 4LANA 4LAMA 4H9MA 1I0BA 3GU2A 4CEUC 1XRFA 2OB3A 4IFKB 3OVGA 1FWEC 1EJSC 2WJDA 4F0LA 2D2HA 3S4TA 1J79A 1A4LA 1NFGA 2P53A 3E3HA 1A5MC 4PCNA 1A5KC 4JOMA 3S2JA 3TN6A 4IQJA 1NDWA 4IFOA 2Z25A 4IG2B 3CAKA 3LSBA 4C6KA 1R9ZA 1GKQA 3GTIA 2DVUA 4I6VA 4KERA 3SFWA 1P6CA 4C6OA 3DC8A 4EP8C 3PNUA 3MVIA 4H9UA 4L6DA 4ERGA 2VM8A 4E3TA 4KESA 1J6OA 4C6EA 1WXZA 4C6NA 1UMLA 4XD5A 4NG3A 1ONXA 4UB9A 2GOKA 1EYWA 4NP7A 1M68A 4CNUA 4D8LA 3T81A 4CQBA 1A5LC 3MPGA 2HBXA 1QW7A 4XD3A 4YIWA 4V1YA 4DLFA 4G7EA 4H01A 3QY8A 4DIAA 4EPBC 4TQTA 3D6NA 3OODA 4ERAA 2Z29A 4DYKA 1ZZMA 3PANA 1UBPC 2R1KA 2A3LA 1UIOA 3ITCA 5HMDA 4LCSA 2ADAA 1K70A 1YMYA 2FVMA 2WJFA 3A4JA 4QTGA 4H9XA 4PE8A 3GU9A 3GTHA 3MKVA 1YRRA 1EJTC 3SO7A 3URBA 4AQLA 2DVXA 4HK5A 2Z4GA 2F6KA 3CJPA 1R9XA 4GY1A 1DPMA 2QT3A 3LY0A 4GYFA 3O0FA 4WHBA 4C6JA 1KRCC 4AC7C 1E9YB 1PB0A 2IMRA 2Z24A 3URQA 1FWIC 3K4WA 4XAGA 1A5OC 3EWDA 4CQCA 3GTFA 2PUZA 4XAZA 3MDUA 1S3TC 2FTWA 4GK8A 1EF2A 2P50A 4LFYA 1YNYA 3IV8A 1KRMA 3F4CA 3IGHX 3B40A 2HNHA 4KEUA 1GKPA 4P5UA 5HMEA 4J5NA 2OOFA 4IF2A 1J6PA 2GWGA 2FTYA 1V77A 2VUNA 3LA4A 4CNTA 4LAKA 1RK6A 4IGNA 3GUWA 4C6PA 1EJVC 2CZVA 1M65A 3EWCA 4HK6A 3MDWA 1V4YA 4KQNA 4C6CA 1FWHC 2Z28A 4QRNA 2EG6A 3AUOA 1EJUC 1V79A 4B90A 1RA0A 2XIOA 4LCRA 3UR5A 1EJXC 5FSEC 1NDZA 3NQBA 3RYSA 4RDWA 1EZ2A 4IH3A 4C60A 2G3FA 3LGGA 4HA0A 4IGMA 5E5CA 4G2DA 4CQDA 3HTWA 4C6QA 3WMLA 2PGFA 1W1IE 1FWCC 2HQAA 2OGJA 1XWYA 1YIXA 3ID7A 1YBQA 4INFA 1O12A 2PGRA 1ITUA 4PCPA 3UBPC 1E9ZB 4HK7A 3PNZA 4IFRA 2Z7GA 4LH8A 4ICMA 4KEVA 3CS2A 4C6BA 3R0DA 3S2NA 3NURA 3E2VA 3QGKC 4V1XA 5G4HC 2FFIA 3F2BA 2RAGA 3QGAC 2UZ9A 3S2LA 3E74A 3LGDA 3B0XA 3O7UA 1R9YA 4B91A 4GY7A 4H9YA 3RHGA 2W9MA 1UIPA 2I9UA 4GX9A 4KETA 3E38A 3TN4A 4C5YA 1RJPA 2FVKA 2PLMA 2Z2AA 3B0YA 2EG8A 2Q01A 4KIRA 5AKQA 1ADDA 3TNBA 1K1DA 2WJEA 4WVXA 3DCPA 1O5RA 3WYZA 2AQOA 2E25A 4C5ZA 3RN6A 2D2GA 4CNSA 3T1GA 4PBEA 4KF1A 4G7EB 3AU6A 2BB0A 3IRSA 1RJQA 2R1LA 3UPMA 2PAJA 4RDYA 4R7WA 4EPKA 4IFKA 3UF9A 4EPDC 2YB4A 2QPXA 4PBFA 2GZXA 2VC7A 1PO9A 3ISIX 5FSDC 4C6FA 1POJA 3S2MA 3T8LA 1RJRA 4OFCA 4HJWA 4DO7A 3C86A 4BJHA 4BY3A 3GIQA 1FWGC 2D2JA 4IG2A 4QROA 3JZEA 3GU1A 3GG7A 3MTWA 3GRIA 3E0FA 3F2CA 3URAA 4DNMA 2AQVA 2DVTA 1PTAA 3OOQA 3N2CA 1EJRC 1KRAC 1XGEA 4GY0A 1FWFC 4B92A 4DLMA 1WXYA 1P6BA 1V51A 1A4MA 3LU2A 3TN3A 4XD4A 1FWBC 2EG7A 2YXOA 4GC3A 2Q09A 5A6TC 2Z00A 4M51A 5CH9A 4GXWA 2ICSA 3F4DA 3LS9A 3K5XA 2HPMA 4C6IA 4LEFA 3RCMA 4ERIA 3IARA 3PAOA 1FWAC 3K2GA 1JGMA 1XRTA 2AMXA 2WM1A 2Z26A 3FDKA 4R85A 3WZ0E 1KRBC 2ZC1A 2R1NA 4XAFA 4H9ZA 1M7JA 4GX8A 4KEZA 3QY6A 2UBPC 3G77A 3TN5A 1FWJC 4I6KA 3A3XA 3FDGA 1KCXA 3MJMA 2BGNE 3HPAA 4RE0A 3EGJA 3QY7A 2VR2A 4EPEC 3DUGA 2R1PA 2R1MA 4J2MA 4ZSUA 4DZHA 1NDVA 1RK5A 4C65A 3E0LA 2O4QA 1HZYA 2I5GA 1K6WA 4C6LA 3LSCA 5LXXA 4GOAA 3GIPA 3OU8A 2VC5A 3ICJA 4F0RA 1J5SA 1FKWA 4J35A 1I0DA 4RDZA 3OQEA 2KAUC 4R88A 1YBQB 2QVNA 3OJGA 5HMFA 2ANUA 2YZ5A 1IE7C 4QS6A 2Z2BA 1RAKA 2OODA 1ITQA 3F2DA 4C6DA 3FEQA 4Z42C 4UBPC 3BE7A 3UR2A 4BKNA 1QXLA 3GTXA 3KM8A 3AU2A 2E1WA 4RZBA 3PBMA 2Z27A 4DI8A 4MUPA 4XD6A 4DZIA 1FWDC 1PSCA 3IACA 1POKA 1BF6A 1V7AA 3ORWA 1A5NC 4H9VA 4RDVA 2GWNA 4F0SA 3HM7A 4H9TA 4ZSTA 1ONWA 1RA5A 2YB1A 4B3ZA
chains in the Genus database with same CATH superfamily
5CZSA 3U8GA 3CHEA 1JDEA 2CERA 1G5AA 1FDZA 5HA7A 4NAFA 3ATZA 2HBVA 3DFNA 2VFIA 3REQB 2OQLA 4YPJA 2F6UA 3OIXA 1S5MA 3BJSA 4GQ0A 4DYEA 2D73A 5BMWA 3M44A 3FA4A 3VKCA 4KWOA 4TVUA 3UR7A 2R94A 4FLQA 2J8TA 1G69A 2DSVA 2BASA 2AKZA 4OVXA 3A5VA 1J01A 3CMJA 4GQBA 3PR2A 4DN1A 3POCA 3DAQA 3OZPA 5GNZA 3CAKA 3DOPA 3N2MA 4LUJA 1D2KA 4QISA 5FAGA 3SFWA 3NOYA 2WJZA 3RF9A 3WNPA 1DWHM 2QJMA 1GVYA 1CCWB 1EYEA 2WSPA 5CCZA 1WP6A 2BGSA 2JIWA 1UH3A 3LDVA 3KDOA 5CJNA 3WF3A 3PUDA 3T81A 1RV8A 3DI0A 3CUGA 3N2OA 4LTSA 3STPA 3TCEA 1Q8JA 3BGJA 1FWRA 4B3KA 3N14A 2VEGA 2YXXA 2JBMA 5FL1A 1MUMA 5IHSA 5A8OA 4KIEA 2AAAA 1E43A 5C70A 1IIGA 2GJXA 1M7PA 4JIHA 2E8ZA 3B04A 1W2VA 4GC4A 1E0TA 3LXAA 2DQWA 1U1JA 3GXPA 5KZ6A 2J8FA 2CITA 1OFOA 1JVNA 2R14A 2X1TA 4UTTC 5DCEA 1CGVA 1DJIA 4GKTA 2A3EA 3WBEA 2ISFA 2YLLA 2JGYA 1WB0A 4PULA 2GUBA 4IJBA 3STGA 4DBEA 1W3LA 1YXDA 1A5CA 4Z2IA 1S5WA 1A5OC 3LHVA 3P8IA 1OGBA 3W82A 1F2JA 3NG3A 2XH4A 1Z6KA 4P8XA 7REQA 3GXTA 3MDUA 1PKMA 3UZXA 5MKGB 3H22A 2QF8A 4HCDA 2P1FA 3UY8A 1PYMA 4HNOA 1KRMA 2PWUA 3K13A 1NP0A 1YHTA 1KFWA 3KUMA 3KW3A 2QGYA 4EE9A 2OOFA 3M0KA 3I6RA 3NQEA 4NILA 4M6PA 1WBJA 1NELA 2QDDA 5HPCA 4IGNA 3VABA 3TR9A 1EJVC 3PBWA 3UD6A 4HK6A 3UXKA 3USZA 4ROPA 4LF1A 2BHYA 1IGWA 2Q8XA 3KBWA 4M6VA 2VX5A 2DZBA 3WF2A 1ISVA 3WQ4A 3CHCA 2WMHA 4AWEA 4C60A 3T08A 4NAFB 2G3FA 3CWNA 4DBUA 1RQBA 1D3HA 5IHRA 1RVKA 2KX9A 2OGJA 4ZODA 3W7DA 1YTDA 3R13A 3C3NA 3P84A 3TQPA 3R0DA 3GWQA 3CUXA 3E2VA 3U0HA 1RQEA 2FFIA 4B5UA 2ZC8A 3BPWA 2ZZ1A 4RNHA 2KZHA 1UBSA 1LDCA 3MJYA 4TX9A 4RR4A 4TTGA 4N02A 4FLSA 1LG2A 3WENA 2B81A 1R9YA 4B91A 1ZENA 2VR5A 5FOOA 4ADSA 1HTIA 1ONEA 2PDJA 3TN4A 1M3UA 3IWPA 1DVJA 1FHLA 1Z32X 2WHMA 1XQLA 1ADDA 4MG4A 4JFUA 1GCYA 3RN6A 2BHZA 3QHOA 1JCJA 4UR8A 3NDZA 1GJWA 4DAFA 1KR1A 3SSZA 4M8UA 1KFJA 4ES4A 1MZRA 2BP1A 1YNPA 2E3ZA 4PEKA 4YLWA 2GJXB 3AXKA 5DMNA 1POJA 3G1XA 2OX1A 4HOZA 4OFCA 4ZE5A 1TJ2A 4MNMA 1EDTA 1BXBA 1BVWA 4BY3A 4AY1A 2DH2A 4NXKA 4ML4A 4N7QA 4F2UA 1H3GA 2VD8A 1XIHA 3LRLA 1MFVA 5DXYA 1VYRA 5ABEA 3QFEA 4N9BA 3GG8A 3EEZA 3G1FA 5FD0A 1KM1A 4YYCA 4GY0A 1FWFC 4RPPA 3BCFA 4M82A 1H7NA 7REQB 5IFTA 1XBYA 2NVAA 3WX7A 2R24A 3KZSA 1X7FA 1KV8A 1XYCA 3L21A 5HWJA 4WJ8A 4M0XA 4GC3A 1VGAA 3O15A 2Q09A 3D47A 1HJXA 1QNSA 3T2QA 4N4PA 3CC1A 1JZ6A 1NWUA 2PDKA 1W9UA 1UC5A 5D9NA 3SEPA 4NUWA 4W9TA 5U7SA 2Y4SA 5I07A 4ZO9A 1EKOA 4B16A 5JIWA 2QV4A 1ICSA 1O95A 4TUFA 2ZQ0A 4RE0A 3W6YA 2VR2A 4YTRA 4PGLA 1XGZA 5KSWA 4JHOA 4C65A 1LL4A 1HZYA 3BW3A 1VR6A 5LXXA 2Y2WA 1TVLA 4FI4A 1NWRA 2WHKA 3GH7A 3S83A 2F7FA 2X05A 1IWPA 2VO5A 1OSEA 2OSYA 2WPGA 1E3ZA 1TB3A 1VPQA 4DO5A 4NAEA 4BKNA 2GVGA 2P76A 3AQUA 3WH9A 3VIHA 2ZICA 1K03A 4Z1BA 4PB5A 2R6OA 2CLKA 3RRAA 4BCEA 3WCZA 2PP3A 1GOKA 1KTNA 3CT7A 3S2CA 2X30A 1B54A 1Q6GA 1LROA 3DBNA 4TX8A 1HP4A 3T42A 3VK5A 1YTKA 4G8TA 2ZRXA 1RPXA 3MSRA 5I06A 1F4HA 4QS5A 3VDBA 3LXCA 4GBDA 3GDRA 1SR9A 1JYXA 3L68A 2A1YA 2VX4A 4AZ6A 1EC9A 4U4MA 1C8XA 1CDGA 3AJXA 2ZUTA 1J0IA 1R85A 3ARWA 5C0QA 2R91A 3P14A 4AXNA 2X1UA 1E0VA 1EUAA 1F5ZA 1AFSA 4AZ7A 3B06A 2F6XA 7TAAA 5C9XA 4MDOA 5CGQA 2TPSA 1U22A 3TFXA 3NVTA 4NKCA 5T26A 2VQUA 1JCXA 4DJFD 3PY2A 5E93A 4QEEA 3LCFA 3L4ZA 1GQNA 1YNQA 1P6CA 4JNMA 4XZ9A 4C6OA 1LQAA 4MDPA 3WQPA 3ZLGA 1ZFJA 4ZOAA 1H62A 4XZWA 1VJSA 4XD5A 3RUBL 2E5BA 5BOEA 3A9BA 2HRWA 6A3HA 2WZTA 5CZKA 3OP2A 3PSWA 3AXHA 1J5TA 4W5ZA 1TPFA 4H6QA 2RDXA 3SCPA 3ZJ8A 4DIAA 1SU5A 1B9BA 4GWEA 3SCSA 2FGBA 4PB3A 1MSSA 1O60A 4UCGA 3LCHA 4V2XA 3TJLA 2A3LA 1A3HA 5LSMA 4KRTA 1FOBA 2PD9A 2RHGA 1JZ4A 1E73M 4QLJA 1DIDA 1QPRA 5AC8A 3CQHA 3HPZA 3NQ6A 3W2LA 5IRPA 3LQGA 1HX0A 3SO7A 4HU0A 4I9JA 4GY1A 1NM9A 3TSMA 1EP1A 3PZNA 1Z48A 4LV4A 4JIEA 4HU8A 1O66A 4JYEA 1VLIA 2G4JA 3VOJA 5U4NA 4GK8A 5FL0A 4FO4A 3A4XA 4E5TA 3NNTA 3IV3A 5DELA 4P2VA 3UR8A 1XLAA 5LNRA 2HV5A 4NAEB 2VUNA 4YMZA 5HUPA 3CL8A 4D6DA 3G0XA 1NQ6A 4L4OA 3N4EA 1U83A 3FK4A 1I45A 2VCCA 2VJXA 9CGTA 4V28A 4N4QA 2BXZA 1KQZA 1XIFA 4CQDA 5LIUX 5A95A 3TZNA 5AC7A 4BK9A 1UKQA 3A21A 2WMFA 4REQB 3UBPC 1TWSA 3CMFA 2DIJA 5A8QA 2PDIA 3PNZA 5G5IA 1JXJA 2ZXAA 3WDRA 2QV5A 1AD4A 2J77A 4Q4KA 3UG5A 1RD6A 3BANA 3RILA 3KOXA 3A12A 1PKYA 4J28A 2QNEA 4QCEA 4JTAA 4EX4A 4H04A 4D6FA 3TTOA 1TV7A 1UWAA 3M07A 3BC9A 2W9MA 4JTFA 4CD6A 1N8FA 1VJZA 4JKKA 4ZOCA 2ZRYA 1RJPA 3TR2A 1OGSA 3PWAA 4OGZA 3UG3A 3ZT7A 4KIRA 2OYLA 3CK5A 3BLIA 5KTLA 1AG1O 3PBUA 4BZYA 3GHSA 5I3IA 2NQHA 5BOOA 4GUIA 1B31A 4KF1A 3G24A 3HPSA 2BY3A 1VAHA 1TIWA 2CZFA 1TTPA 5HINA 1M6JA 2A2IA 5CC7A 4QLKA 4LF2A 2YB4A 3VGHA 3GHTA 5EYWA 4H8NA 1S2VA 1B9ZA 2OKTA 5EMYA 1GHRA 5D8ZA 3KS6A 4Q8OA 2VFHA 1NF7A 4IG2A 3LHYA 1XYFA 4IWWA 1OF6A 2DT1A 1K3UA 3ME3A 3TW9A 4JFSA 4UC5A 2AQVA 3GG1A 3AIEA 1KW1A 4OTKA 4ONVA 3BAYA 4BWLC 2VX7A 5AN7A 1L8NA 5H8PA 4L6OA 4Q8UA 2EG7A 3HF3A 2Y85A 4RLIA 2X16A 3QOKA 5A6TC 1AJZA 2YX0A 2FQIA 5C8BB 4HNTA 2IKHA 3CV2A 2EHHA 4WKFA 5A6BD 1H5YA 4TV5A 3G6MA 1KRBC 3VOIA 4U3AA 1PHWA 1M7XA 4F0HA 2PE4A 2PI6A 2OLHA 5DMMA 4I6KA 3FDGA 3VD3A 3MANA 2PBGA 3ZZ1A 2VYOA 3WD4A 1SMDA 2I5QA 4D6GA 2ESCA 1GEQA 5G1TA 5AYYA 4F0RA 4AWTA 1FKWA 4RDZA 3E6EA 3VGBA 1I2QA 3C2VA 2ALDA 5FJIA 1EWDA 4JFTA 5EY5A 4MF4A 2RKXA 1QI0A 2CCRA 1FUYA 4O53A 2VFEA 2J7CA 4DI8A 1H50A 4HNCA 1GORA 4AZHA 1POKA 3O6AA 4DB7A 3GFXA 1W5NA 1PX3A 2GWNA 2NT1A 1XRSA 2ZE3A 1C9DA 5DANA 1W1B1 3VDGA 1EIBA 1ZNNA 3F7JA 3KX6A 1NVMA 2BY2A 1LUCA 4JN6A 3I6TA 4WGXA 2I14A 3DBPA 1MDRA 1A47A 5GVJA 4Y9PA 3G1AA 4MFEA 2EPOA 1QNRA 3HPXA 4B4FA 4LS0A 2GSEA 4NQ1A 4AD2A 3UXIA 1VYPX 3T07A 2NLYA 1UPPA 3KVLA 2GSHA 4O14A 3VZXA 1EP3A 4PH6A 4F0LA 5HPOA 2Y7DA 2GUUA 4UOQA 4MOZA 2YBTA 5GNXA 2GQ8A 3QMTA 5DN1A 2RJHA 4UWMA 4UQAA 4IG2B 1TG7A 2XZ7A 4XX6A 3QV8A 2HSAA 3B8IA 2XFFA 4WY0A 2PBOA 1XUUA 2PPGA 3W1TA 4CGTA 1U30A 3E2RA 1EDGA 4JYDA 1Z41A 1BYBA 1DIEA 1YKWA 3V0UA 2BSLA 5J8LA 1FVPA 1GVFA 2VGFA 2ZZ2A 4V1YA 1DJXA 4GUJA 1FCQA 3LB0A 3M9YA 4IPLA 2DZPA 2E6AA 3OZMA 4AD4A 2G97A 4Q8PA 2J9ZA 5CJ5A 2FZ9A 2PZNA 1YMYA 2FVMA 2W62A 4U31A 3AZTA 5AYIA 1DKWA 1R9XA 1OT2A 1OG6A 3ALGA 2JIEA 3GSMA 3WO8A 4DHGA 3PFMA 3TOYA 5EMKA 3EDJA 1J2BA 1E9YB 4NY2A 3G3DA 2GGHA 3LZ3A 3BZJA 1YDYA 4O1DA 1L6FA 1NAL1 2DZWA 3WK3A 1OZMA 4JKMA 3MO4A 2OMAA 4HPGA 5DXXA 4HKPA 3RPTA 1W9XA 4ASTA 4JY9A 4S38A 3LXBA 9XIAA 3BXWA 1L0PA 5DCBA 2YCEA 1HW6A 3LHWA 4O28A 4JL2A 1S2AA 1XLEA 3ERPA 4PUUA 1B5TA 1HKWA 1XS2A 4O0KA 2SFPA 4UXDA 1C90A 4ZFMA 3NAVA 4A8NA 1Q6QA 2BXVA 4GJJA 2J88A 1E4NA 5HNRA 4BEUA 2FZBA 4KRZA 1LUCB 4HCLA 1X96A 1TX2A 2VCAA 5J04A 4E4UA 3PF3A 3HOJA 4ALDA 1KBBA 3TA9A 1MXSA 2Y61A 1KKRA 4R7JA 1W1IE 4YCPA 4L4LA 3LPGA 3QRHA 1IQ8A 4MVAA 2PGRA 3H26A 4PCPA 3QPEA 4MNKA 3BJTA 3E0IA 4GYPA 1E15A 7ENLA 3LI0A 4PZVA 4LGXA 4G7FA 4XUYA 3SR7A 2A6NA 4GQQA 3S2NA 3SBFA 2YDRA 3GG0A 2HK0A 4US5D 1KFEA 2G5WA 1UD6A 4LVFA 4HOWA 2PZ0A 2Q71A 1AZ1A 3G0SA 4C7FA 4NJJA 5D2WA 2AKMA 2E40A 4WY0B 4UMAA 4HD5A 4JTLA 3DYOA 4C91A 4FOJA 2DORA 2B7OA 4URIA 1VHNA 3TC6A 1XC6A 3WEZA 3GVWA 1O5XA 1E9LA 2V30A 3PPHA 5HANA 2VGIA 3BG9A 3UZYA 1JR1A 4LB4A 4X3ZA 3VKBA 3UPMA 3EX6A 1XIJA 3NZGA 1JD9A 1QAPA 3KWSA 3QF0A 3QYSA 3W2KA 3W7JA 1AW1A 1U5JA 4AX6A 4NRRA 1AA1B 2FH6A 1GJUA 3APGA 2E1DA 3QFWA 1BVNP 2WB5A 2Z1BA 2V5BA 1EO7A 2ABBA 4AZIA 1C3FA 3T78A 1HFBA 4CU6A 3F2CA 4JTKA 4HB7A 1EJRC 3USBA 4O16A 3NPWA 3CWHA 1OGGA 4O50A 4JTTA 3QC3A 1P6BA 3LHUA 3WL0A 4IUOA 2DH3A 1N2VA 1G67A 2B0MA 3HQ1A 2YPIA 2ZX6A 4QXIA 2VFGA 1HO4A 1CWYA 1J9YA 1IIHA 3KOYA 4XZBA 3TTSA 1CNVA 1LL6A 1EH9A 3A5FA 2WKGA 1LZOA 4HHPA 3NZQA 1YLVA 1TV3A 1O68A 3LERA 3W88A 2YFOA 4GBUA 1DBTA 1IT8A 1EL3A 4KEZA 1H49A 3SQSA 1FWJC 1UQZA 4FX6M 2ZE0A 4IGSA 3IGSA 1XL9A 3ABSA 4WKHA 2JF7A 1YPIA 4DF2A 2VEPA 4C6LA 3WQWA 4JIPA 3QSRA 2OJPA 2VC5A 4AD0A 4I9TA 4Q4SA 3DFPA 2CW6A 4DXKA 4IP5A 3EMZA 4RXGA 4FXRA 3V18A 3BSHA 3SZ8A 4FSAA 4RV3A 4Z42C 4ZOEA 5A8NA 5CGMA 1DJQA 4N9CA 4NF7A 3C61A 1VBUA 2Z27A 4M19A 5DCDA 2OT1A 4ZQNA 2VEFA 1KC7A 2FZNA 1RA5A 3VGEA 3UFYA 4V33A 1QO5A 3WLHA 1OCBA 3DYPA 4TIMA 1E71M 1VQTA 1NJJA 3AMLA 1ENUA 3ZFHA 3FJ6A 1UWRA 1Q6LA 3OEXA 3IJ7A 1VH7A 1W8GA 3S6DA 2WZMA 3AS3A 3H23A 4YWIA 2QS8A 3B0PA 1Q6DA 8CGTA 4TXEA 2HXUA 5CPTA 5I23A 5A2AA 5AOUA 4H9MA 3IGUA 2E67A 1WX0A 3OVPA 2UV8G 3W9ZA 4FB7A 4ZZ9A 3CEPA 1ELSA 2WHLA 3I3DA 3IIOA 4NIRA 1D8CA 1F6YA 1NFGA 3ES7A 3FJ4A 4LVAA 4Z17A 1A5MC 3RX4A 1QHPA 5GNYA 4IFOA 2XVNA 2GVYA 4K1GA 4W84A 4H9UA 4GZIA 1TV2A 3W81A 1NARA 1M9HA 4J40A 2GPTA 2IQ0A 3M5ZA 2NQJA 2V2DA 3PAJA 4KCTA 1W91A 1YDNA 1B3VA 2PTDA 4LB3A 2HVOA 1V3LA 3W00A 1LLWA 5H6HA 2PRHA 5I3HA 3CUZA 1KCLA 3WH8A 3ZT6A 3GC4A 3SUWA 1SW0A 4UTUA 4DF0A 1X6NA 4CD7A 1FHVA 4HMNA 4C1NB 1XV8A 2H8XA 4NJHA 3DHUA 3EXRA 2XN2A 2Z29A 1W3HA 1V0LA 4M81A 1UBPC 4H3DA 2RGMA 3WLJA 1T99A 4NZ3A 1ICQA 5CBBA 4Q4RA 5TD4A 3QZEA 3DESA 3L0NA 1GHSA 4NZ5A 2CETA 1W54A 4RW5A 4GG9A 4MB3A 2IPFA 1YRRA 1EJTC 3ARVA 4CQAA 2XWEA 1F3EA 2OZ0A 4DJEA 3HURA 5C9WA 4UFKA 1L6GA 5FKYA 1ZRQA 3VNLA 1JUEA 3BLKA 1P1XA 2W92A 3P3BA 1CI1A 3GHUA 4UOZA 3F03K 3B9AA 1A0CA 4A2RA 3LCXA 1ZAJA 4U5KA 4GH3A 4LT9A 5EMJA 4FS9A 4AY7A 3M47A 1ME7A 4HBKA 1F8IA 1EHNA 4PMRA 1EBGA 1R47A 5FEXA 3A4WA 4CNTA 2V68A 3R8GA 1B2YA 5F1VA 4PTWA 3V1HA 2H90A 2EPLX 2AGTA 3FGCA 4DM1A 1V6XA 3F5KA 4GPNA 3AZRA 4I9MA 1TWIA 1KGWA 2J7BA 2WZEA 5AHIA 4L64A 4OECA 1WCGA 3C0QA 3RYSA 1PE1A 3LYEA 5H91A 3N34A 4HA0A 1FWNA 3W72A 3VD9A 2HVMA 4IGMA 3R4IA 1G4PA 1OT1A 3TMLA 2PEVA 1ITUA 5D03A 2W3ZA 4KRUA 1Z9AA 1MDLA 4DZAA 1W8SA 3PTQA 3PTKA 2BGQA 4C6BA 3OLIA 1GOIA 2IPGA 3PPFA 1SO3A 1KXVA 3S42A 1ALDA 3AIQA 3S2LA 4OV4A 1DJWA 2XGIA 5BRPA 1DXEA 4PRRA 5CSRA 1VIWA 4PMVA 4HVXA 1E1FA 1F05A 4JX4A 3SY1A 2FVKA 4XSLA 3MBFA 4IX2A 5HK4A 1W3IA 5CKSA 3KLKA 3CL7A 4R7OA 4Z2JA 3KTCA 3O63A 3T1GA 2QKFA 1QATA 3TNOA 4AWSA 1V6YA 3A9IA 5DF0A 5D8WA 3I3BA 3RNDA 1E6NA 3MV11 2GZXA 5I78A 1CLKA 2XZ9A 5FSDC 3NWRA 3NGJA 4DO7A 4UFJA 3FHQA 4GI6A 1VCFA 3R2GA 1HG3A 3ZVHA 4QNEA 5AECA 2I5IA 4XISA 3H53A 2NUWA 4S3CA 4PUDA 3IIPA 1X1ZA 4UMBA 1XLBA 2ZADA 2PDWA 1YXCA 4FALA 1XP3A 4R34A 1JPIA 1YTEA 1XSIA 1VBGA 2ZCGA 1GVSA 4IX0A 1JFHA 1DQXA 3C52A 2YIHA 1XYAA 3UJFA 1EUNA 1OG0A 3BWWA 1ADSA 4MSSA 4QJ4B 2HEJA 3VGFA 3WF4A 1B3XA 1K8XA 2Y63A 3E49A 4ERIA 4F8XA 1J8VA 3GVRA 1GVEA 3K2GA 1B3WA 1CECA 2X0SA 3W7LA 4AVFA 1HJSA 4LVBA 2R1NA 3A3HA 4H9ZA 3MKCA 3H6OA 1BYDA 3FGCB 1W1ZA 3TV8A 4ADTA 3HPAA 1XDLA 2GVEA 3MA8A 4QDPA 4H4IA 4S3GA 3UZZA 4KFNA 5K9DA 3G5EA 3WLIA 1FFRA 1OFAA 1OX4A 3GIPA 3NQVA 1EB3A 3C2EA 1AL7A 1VFHA 1AL8A 1TMLA 4QS6A 4J7RA 3W7HA 5M5DA 3YPIA 2TAAA 1R8LA 2WO5A 3GDLA 1BGGA 3RG6A 3SADA 3UESA 1XLGA 4M6UA 3NUKA 1NFPA 1AJ2A 1XIDA 1KKOA 1R3WA 3CUJA 4H9VA 2RFGA 4AUBA 3WEOA 1XCWA 1FX6A 4ZSTA 4HTYA 1TELA 1EOMA 1JZ5A 3HV8A 2OG9A 1TCMA 4P7NA 1FXPA 3CHVA 3VGGA 4C6MA 2O4MA 1ZBCA 4G1NA 1LLOA 1IV8A 4LUTA 4AD1A 1CW2A 1K77A 4DX3A 1J10A 1UD3A 2FMNA 2VZTA 4QG6A 3PJUA 3KBMA 3GUGA 5F4XA 2NXIA 4HA1A 1CYGA 3GS6A 1I0BA 2ZVRA 3ZIZA 5CC3A 3IIZA 5D9PA 2REQB 3EWYA 3EPNA 3RJXA 1R38A 4Y9OA 4FOKA 9RUBA 2O0TA 1HL8A 4Z1AA 3ZVHB 1G4TA 4DUVA 3C2OA 1MO0A 4XUGA 1LYXA 2PC4A 4PBGA 4WSKA 4J3XA 3ES8A 3AJ7A 3E9AA 2ZYFA 4UCFA 2D23A 5EB8A 2IKGA 3SGUA 1S2CA 1QW7A 4D1JA 3WNLA 4J3ZA 4H01A 1GZ1A 1X1OA 1XXXA 5HR6A 1GQJA 3PG8A 2DEPA 2RDUA 4XZLX 2GDVA 3K8LA 2WKJA 3UVIA 4XTIA 3SCRA 3M5YA 4YJ5A 3PBYA 3BCDA 4A29A 4X0NA 2PF0A 3N4AA 4AQLA 1GYNA 2ZXDA 2XH2A 3K8MA 1DPMA 1OBAA 1C92A 3LY0A 5E6ZA 3DIPA 3TSBA 5DLCA 3W27A 4S23A 4OBTA 4QX4A 1SZRA 3UXLA 4PR4A 2WKLA 3TVAA 2CPUA 3GFYA 5HNNA 1OX4B 1TMHA 3AISA 1JI2A 4WEVX 4Z2LA 1EFZA 1VBJA 3TJIA 2FTWA 1V08A 3TIMA 1H5VA 3TKFA 1V3HA 3FA5A 3W7QA 1K8YA 3W7CA 3VUPA 1DXFA 4BQ5A 2Y24A 2J7EA 1LL7A 5FJJA 3P93A 1UCWA 1A5SA 2IKIA 3A4AA 1WUEA 3INPA 3VGDA 3W7NA 4L1XA 2WANA 2XG9A 2PRLA 4MZYA 5EA9A 4ZEPA 2JK2A 1CTNA 1W9VA 3GNXA 1S3HA 3WIJA 3LGGA 1R6WA 5BCAA 4LUTB 5E5CA 3BZGA 1E6ZA 1A0EA 1OQFA 4EIVA 3MHGA 2PGFA 1I2OA 2HQAA 3ID7A 2I1OA 4EXAA 3HA1A 1RBLA 4JBRA 5CBJA 2D24A 1CB7B 4H8VA 1HF6A 2VOMA 5C2GA 5E09A 2PTYA 5G4HC 5C2CA 4E2VA 5SWUA 3W2NA 1UKSA 1GOOA 4ROQA 1EDQA 1UD8A 1ONRA 1ICPA 3OLEA 4HNUA 1BXCA 3C6CA 6TAAA 3NPVA 2OEKA 1J2WA 3W2MA 2DZTA 5FACA 3CAWA 1QBAA 1BSIA 1XM3A 2EG8A 3LLFA 2Q01A 3WQEA 1BXNA 2C16A 2X41A 4Y9NA 4KS0A 4LRSA 2Y7GA 1N8WA 4WXZA 4GYPC 1EXPA 4CNSA 1FRBA 1QI3A 1VP5A 4QAIA 3R12A 3IRSA 4GYKA 1Y5WA 3KS5A 5G2HA 4O8RA 1XH0A 3GM8A 3PZ9A 4R7WA 2X1RA 4KW2A 2W61A 4P8UA 3NO1A 4TU1A 1QT1A 4GFIA 4B5XA 4PBFA 4MJMA 2WK2A 3F5JA 4K8GA 2EQDA 4A2SA 4GZJA 3P7YA 2EKGA 3WBAA 3WDIA 2VXNA 2PWDA 3PJTA 1US2A 1SGJA 1IWAA 3F1QA 3NL5A 5HUOA 2YR1A 1LWJA 3H70A 4JDYA 3HB9A 3N2CA 5ECUA 3SY5A 4B92A 4DYJA 1C93A 3LN3A 3O1NA 1F61A 4A8RA 1FP9A 4FNQA 1OFEA 2MUCA 1DHKA 1UH2A 3WH7A 4KCVA 3MSYA 3VMOA 2PP0A 1WKEA 2XIBA 4AZ5A 1TV8A 3MI3A 5JBEA 4O1BA 3GH5A 1K7XA 4V15A 2FZ8A 4MY8A 3G1SA 3BMVA 2OELA 3XIMA 1RUSA 4UNKA 5ENLA 2V5CA 3U9IA 5FESA 2X0YA 1XLCA 1KTBA 4UQ9A 4WJEA 2WVTA 3FEMA 1GOQA 2VVSA 4KCWA 3P5YA 5XIMA 1DJHA 2J74A 2OX4A 4Y90A 1BG4A 4IPIA 4UR7A 3UERA 2GQ9A 2VCBA 2PDFA 5PTDA 2VDHA 2Z2BA 3OBKA 2ZXQA 3G8EA 1G0CA 3G1DA 3BAJA 1NOUA 1RHCA 3CXOA 1DWFM 4ZQRA 3EKGA 3BE7A 4P8WA 2Q3OA 3AU2A 4OZOA 2G41A 3PWIA 1S5NA 2WNWA 1F8MA 3IACA 4JX5A 1TWZA 2PCQA 2QCLA 4JHZA 4F40A 3B8UA 3B9NA 1GG1A 4MZ8A 1B3OA 3V75A 2YBUA 2V3DA 2D3LA 1P4CA 3CIVA 1QNOA 3MVTA 4ATWA 1EJWC 4IQEA 4KPLA 4PB4A 4G1KA 4AH7A 2HNEA 5BXSA 1RBAA 1Y7VA 1ZBWA 3RLUA 3THUA 4L9XA 3URNA 1ZLPA 1V8EA 3ZOAA 5M1TA 1Z89A 1EO5A 1IR1A 1S39A 2BOEX 1R87A 3QQ1A 3PUEA 1R2RA 3AI0A 3BSMA 4NASA 4FX7A 3MSDA 3UT0A 1DQWA 1FXQA 5DQPA 2Y70A 4YS1A 1GT8A 3E3HA 1RZMA 4PCNA 4JOMA 1EA9C 4IQJA 4CU7A 5XIAA 3EBVA 3VM5A 4DM2A 5T91A 3TE9A 1SW7A 3OVRA 3K8KA 4I6VA 1UKTA 1THFD 3M41A 3N3MA 2PU1A 4OBSA 1EGMA 5GJPA 3FS2A 3PBGA 3CZLA 3EX1A 4MWAA 3RLHA 5K3VA 1JUBA 4UB9A 1Z44A 2DSWA 4XSMA 4OOUA 3NVDA 4JIIX 3WLMA 3CGTA 3W73A 4RUBA 3MPGA 1UKPA 1KM0A 3BURA 5CPLA 4J3VA 2CLIA 2Y8VA 4NJKA 8XIMA 1D3GA 2YZRA 2RGLA 4US6A 1ZZMA 3RFAA 1DTUA 3FFSA 3PANA 3NQMA 4IP4A 1BGAA 3W2JA 4LCSA 2ADAA 3EOUA 1D7KA 1UQYA 4QTGA 1W3TA 2E5DA 3D0CA 1H11A 2WVUA 4QCFA 2YGYA 1WZKA 3O16A 4J2PA 3JS3A 2GQAA 2OT0A 1PS9A 3AAMA 2NQ9A 2GGGA 1XFBA 2C13A 3ZS4A 4UQBA 5LHFA 5BRQA 3LRKA 2YA2A 1PVNA 3GR8A 2VR4A 3E2SA 3BG5A 3TDFA 2V3GA 4WDWA 5CJMA 3OHMB 2E28A 3WF0A 4QIUA 3PVFA 4Q6JA 2YDQA 1KBLA 1J6PA 3WFLA 2FPTA 3DFYA 3H7UA 1U2YA 1U5VA 1IEIA 4BR1A 1H4PA 4BF9A 1DXIA 3RPMA 1KM6A 1E6SM 3QMRA 3GXIA 4GNKB 3IEBA 2XSAA 1QPQA 1UZ4A 2A6LA 1DJNA 3KOWA 4QRNA 3DEQA 3BLDA 2A7PA 1LP6A 7CGTA 2HVNA 1US3A 2DW6A 3FLUA 2XU2A 3CAQA 2PGEA 2BVDA 3P74A 3GNRA 1PV8A 1PJ9A 3EOEA 2OU4A 3B0VC 4X9YA 5JU6A 1BWLA 2DUXA 3ARYA 7A3HA 3WJYA 3W86A 1QI4A 5LNUA 3FYPA 4GQRA 2J62A 4O18A 3DFOA 2EO7A 3WQ5A 2UZ9A 1UH4A 4XKYA 1H60A 2VZOA 1V0MA 3TC7A 1OEPA 2NX3A 1M5WA 4W89A 4AC1X 3AIWA 4PN2A 2ONEA 3EWXA 3W28A 3HGSA 1Q5MA 3E38A 4WGHA 3C3UA 2DJXA 2XM1A 1OC7A 4MWAB 2TYSA 1XLFA 1W9DM 2PDUA 3B9OA 3EKLA 3R25A 4WVXA 1YPXA 1O5RA 1DJZA 4C5ZA 4F4RA 4HHLA 3T4CA 1BEUA 2D2GA 4K68A 1EA0A 4I5XA 3W7OA 1R2TA 1EHAA 4WOZA 1F73A 2ZTJA 2HE5A 1I8JA 4L5ZA 1XDMA 4J3WA 6TIMA 3C0LA 3OA5A 1HQTA 3S2MA 1PZ2A 1HL9A 1GQKA 5CSSA 2G96A 2O9TA 3BVJA 5ABTA 3CQJA 3VMNA 3RR4A 3NCOA 3S1WA 1REQA 3AROA 3E0FA 3WQ6A 3DGRA 4JTGA 4DNMA 3NOEA 4FP1A 2NV1A 3G1YA 1IZKA 1Q6CA 1UJPA 4CD5A 1Q6RA 2V2CA 4LUSA 1OIFA 2AOSA 1XYLA 4QE4A 3B8TA 3OG3A 1UJQA 2CLMA 3PFRA 3W1PA 3GLCA 3B05A 4FPSA 2G50A 5BXPA 4GO9A 1LOQA 3MCMA 2BTMA 4XBJA 2GDQA 1TRDA 4KH2A 4KMQA 3FDKA 5FAJA 3T4WA 1IHIA 4Y96A 1WAWA 3WNMA 3R6IA 2XHYA 3AFBA 5BZAA 1NOFA 2J9XA 1G9HA 2E5CA 2ZA3A 1ZALA 1TQJA 4TVDA 1F74A 3BAXA 1R3SA 3CQ0A 4MPKA 3MI2A 2UY2A 4ZSUA 1KV5A 4N42A 1K6WA 2WC7A 4PUNA 1CGUA 5A6KA 2I56A 1HVXA 4O17A 1HJWA 5C2XA 1WOAA 5A8MA 3LQLA 2FDMA 1FP8A 4ZTYA 3WQGA 1CLXA 1IWBA 5EBAA 3HN3A 4MKVA 3UXAA 4UUIA 3KEHA 5LGXA 3NXFA 3FEQA 4QG8A 4UBPC 4O10A 1MUWA 3CO8A 4FZIA 2OFJA 4RZBA 1VS1A 5FI8A 4MUPA 3ZMRA 1PSCA 2X2GA 2ZA1A 3ARQA 4UZUA 4L9ZA 4XKYB 1A5NC 3FVMA 3L4YA 2ABAA 3HM7A 4M6QA 4MY1A 2PWVA 2DZVA 2YXGA 4B3ZA 4MKNA 3EA2A 3HJZA 5AC4A 5HNTA 3N2BA 3OZYA 4LCQA 3N6HA 3OA3A 4G6CA 3SAZA 4LAOA 5TAOA 4JIQA 5HQLA 3NQDA 2VHLA 3SUTA 4UQEA 2CEQA 1UWQA 2J8GA 4Z1CA 2XGBA 2CWXA 3SRFA 1G1YA 2IW0A 2QCCA 1TYGA 2AMGA 1NY1A 1I75A 1XYZA 4HCHA 3RM4A 3I6EA 3KL3A 5ABGA 2VEKA 4CEUC 4MLJA 1L6SA 3SURA 2ZZ7A 3B3DA 4JZ5A 3PK7A 4WDTA 3ITXA 8A3HA 1NDWA 1ZQ5A 4L7ZA 4AEFA 3FA3A 2DSZA 3WNOA 1REQB 5FJPA 3WUGA 2C0HA 3GVVA 4P61A 1J12A 3WJWA 4XIMA 3P60A 4LUSB 4NG3A 4RW3A 1KWGA 3MU7A 2NV9A 4R3UA 2Y8UA 4DELA 4CQBA 3VDCA 3BSGA 1QK2A 4UQCA 5LA2A 4HPHA 1TZZA 2NUXA 5C71A 3UZ5A 4Y8EA 4P7LA 4ERAA 3MKKA 2DP3A 3THCA 2FPYA 5A5WA 4S39A 4HMCA 3WSUA 3QM3A 4X63A 1GVQA 3V36A 2XIQA 1D7FA 4NRSA 1K6AA 1MFUA 1HNYA 4MIMA 5D9MA 1BHGA 1YDOA 2OZTA 1JL8A 2QT3A 1ECEA 6REQA 3I4EA 4LBSA 3W85A 2VGGA 1LOLA 5H8MA 3NYZA 1KRCC 1PB0A 4JCLA 4B5TA 3K4WA 4W87A 4D6EA 1GTEA 2IPJA 3H2FA 1MQPA 4C7GA 1S3TC 3ECQA 2NVDA 3D3FA 2D2OA 3SRHA 5DT5A 1YNYA 3KRSA 1OIMA 4TVCA 1PIIA 3PULA 3TLLA 3VNDA 3AYVA 3B40A 5C9RA 2C1GA 4MUZA 2VFDA 4OE7A 5C9ZA 3BLOA 1TV4A 5HMEA 1E0WA 5DMLA 3N2TA 1HJQA 3LGEA 1EPVA 1RQHA 2OWWA 4JDBA 1VFSA 4PRWA 5IDIA 2WLYA 2R8WA 3OYZA 1UR0A 2XPKA 3L12A 3LM7A 1XKJA 1W6TA 4PL2A 4R53A 4W7VA 5H1WA 5IBXC 4PMXA 5TQLA 1NDZA 4C1KA 1IEWA 2VNCA 4ZENA 1FHUA 4ZQCA 3CYJA 3L4UA 4YYFA 2P3ZA 2DSKA 1H0GA 2X8RA 5F4SA 4C6QA 2J7GA 4ICNA 4DUOA 2PODA 3UW6A 1ZP3A 1O12A 4LRTA 5HOSA 2ZUUA 5FF0A 5G1YA 2A7RA 4IFRA 1GTHA 4JPGA 4DWSA 5DFAA 2Y89A 4V1XA 3IK4A 3IAPA 3ENLA 3M43A 1E5NA 1J96A 3W24A 4QQ3A 4WDXA 4AY8A 4QAWA 1T40A 3B0XA 4FXJA 3MCNA 4U5IA 3MUAA 1S38A 1K7EA 3L4WA 4QLLA 2WMJA 2DT0A 2Z2AA 1E0XA 5I2UA 4ZQOA 3TWBA 2XISA 3UCDA 3LPOA 3S46A 4DJED 5K4XA 5CAKA 1IEQA 3KWXA 2CLLA 3GR7A 1ISXA 1FCVA 1K7FA 1WQ5A 4DJFC 3QKZA 2BB0A 2OGYA 2DZXA 4Q33A 2CYGA 1MI3A 3WL1A 4IFKA 5BNKA 2C3ZA 3PPCA 2CZ5A 2ZKMX 5HJLA 3CZJA 1W5QA 2VP8A 4L1WA 2WQPA 3TWAA 4HJWA 4ZXOA 1SJDA 5CQ1A 1N7KA 3GHRA 1GJPA 3PS7A 1TMQA 3GU1A 6REQB 2B7QA 1R2SA 4I5UA 3B9EA 4IM4A 5K4ZA 2TSYA 5HATA 3IJ8A 3W70A 3ZSTA 4O11A 2OZ3A 2VQTA 1LLZA 1XI3A 3LU2A 4H83A 2MANA 1XLMA 3AXMA 3KBNA 4J1OA 1ADOA 1GPFA 1MVYA 1PKNA 3F5LA 5L9FA 3R0KA 3VMPA 3F4DA 3ATYA 2PF8A 4A22A 3B0UX 1LF1A 1H0IA 2AMXA 4RX0A 1NF0A 2AQWA 1RH9A 3KTSA 4JY8A 1H7RA 3UJRA 1FH9A 3RU6A 2V9DA 1Y5XA 2PDPA 3QY6A 2F38A 4Z1DA 5CC6A 1CXIA 2VC9A 1E72M 4NSBA 3MW7A 1T0OA 3M1ZA 4D71A 4MJ2A 3H21A 3H24A 1IR2A 5AHNA 1R3YA 4JTSA 1ISWA 1OFRA 1WZMA 2W79A 2VENA 4HIBA 3PM6A 3LPPA 1UR4A 1CGXA 4J35A 3PZTA 4R88A 2ZUMA 3C5QA 3BAKA 4O0QA 3OBEA 1UR2A 3T09A 3WG6A 5DY3A 3WD3A 3WD2A 4ML9A 1F6KA 3MSGA 3EDFA 4IPJA 4DWSB 1NIUA 2V0TA 2P10A 3RX3A 3O9NA 3DN5A 1OC5A 3OVQA 1YPFA 3NQ7A 3WELA 1KD0A 4JICA 1FWDC 4D2JA 2DV0A 4L6HA 3M0LA 4WY0F 4AG0A 1MW1A 4XZMX 1AJ0A 4MZ1A 4EAYA 1EEPA 4IMGA 1ONWA 2YB1A 5EU9A 3PSVA 1UD5A 3GXMA 4DI9A 5EL1A 3MB9A 4KWWA 1US0A 3LCIA 4GVGA 4GIRA 4PYSA 3RPDA 2XN1A 5FJTA 3HGRA 2JKEA 1XPGA 3IJ6A 3LBCA 5HJXA 1JCLA 3AALA 3H2NA 3KFTA 3KRBA 1O7AA 4UFHA 4LBRA 4EVZA 4WSJA 2BVTA 3AYRA 3BLFA 1IXPA 1W37A 3CQKA 3WDPP 1GVOA 3TW7A 1I2NA 4IFKB 3NPUA 1RCQA 2NSOA 2D2HA 1V03A 1WYIA 4FK9A 2HWGA 3P67A 4X61A 5F7UA 3VE9A 3R8RA 2EF9A 2VRQA 1VRDA 2CXGA 2PTZA 2W0UA 3PWGA 2INFA 1BWKA 3J7HA 1R9ZA 2PLJA 3VNMA 3KE0A 3V35A 7PTDA 2CC0A 2Y7FA 3MVIA 1UASA 4WD0A 3NFUA 3TOPA 1UKOA 3EA1A 3EOOA 3VKDA 3OTRA 3AS1A 4O15A 3QGVA 1MYRA 2ATMA 1M68A 4CNUA 4D8LA 4H6RA 3EX4A 4XD3A 1XLHA 1A3WA 2RUSA 1J0HA 3AHVA 1E6XM 2A0NA 1TJPA 4H7VA 4TQTA 1W1VA 1M04A 3KVMA 1FWTA 1BKSA 1UP2A 4TTUA 3G1RA 2Z1VA 4K3ZA 2CLEA 5IDZA 3CEUA 2FHBA 1X38A 4S2BA 5C6MA 1TPB1 3VIPA 1ZHAA 2VTFA 1E56A 4B4HA 4X2PA 1L6WA 1P0EA 3AXIA 4MADA 5CPMA 2Z4GA 3EPMA 4MWAC 1W9BM 1WDWA 2OSWA 1GNXA 4MJZA 3O6YX 5KZEA 2Z24A 4LYPA 3U5UA 2CHNA 3ZXWA 1E40A 5D4YA 4B9ZA 2EJ1A 2NSXA 3O06A 3KVKA 4B2DA 1EEXA 3S1GA 2TMDA 3EKZA 3VIJA 1F6PA 3BJFA 3VD7A 3GKAA 3LD5A 3VAVA 3QQWA 4FR1A 2XVKA 3GIYA 2F84A 3UXDA 1RK6A 2H3BA 4M24A 3TW6A 1O1HA 2E6YA 3KOFA 3I4KA 1ECQA 2O92A 2WMKA 2VGBA 2QUNA 3OB8A 3VUSA 1EJUC 2OVLA 3T2PA 3TYZA 3GE7A 3CNYA 3M0VA 2OTDA 4LJ3A 2BG5A 2PDLA 4M1RA 4LEQA 1EGZA 2Q3RA 4F0MA 3DC0A 3HU7A 1YIXA 3CU2A 4MGGA 1C8VA 3KHDA 5HR7A 1A53A 2C1HA 2BWGA 3U57A 3W1NA 5AC5A 2RH9A 3E96A 3H4WA 2VWSA 3MP5A 4A3HA 3VIMA 4HSOA 4W86A 2P0OA 3LBOA 3UJ2A 2OCZA 2G3JA 2YYTA 4WUIA 3GDKA 3MZ2A 1JYNA 1O5KA 2YL6A 4ZMGA 5RUBA 3TUUA 3RIKA 2EGZA 3DZ1A 3O7UA 1PAMA 2DUAA 1HGYA 3ZLFA 4PL1A 4JEJA 2P0IA 3G18A 4AD3A 4QNWA 3PB2A 4QDMA 2PLMA 3DKLA 1XPYA 2QCEA 1EIXA 3AHXA 5AKQA 2HROA 5GJNA 4Z1YA 3WYZA 2E25A 1Q63A 4NJGA 4IHCA 2W63A 3QH2A 5DX7A 1OX5A 1A49A 1LG1A 1ZAIA 3AU6A 2CZDA 2VFFA 4JR5A 3TMQA 4CKQA 2QPSA 1UUQA 2WVVA 1D9EA 1W17A 4IPPA 2CU0A 3ZR4A 3CM4A 1OABA 2QDHA 2WCAA 3TA6A 3GZAA 1PKLA 2ZZ5A 3QPZA 2GSJA 3AMKA 1JPHA 4UOJA 3CUIA 1RP8A 1XC4A 1BD0A 1PTAA 2DVTA 1VENA 1FA2A 3Q67A 5FF3A 4EK7A 3SRKA 4PTNA 4DEFA 2Z1WA 1K02A 3WDJA 1V51A 4LUYA 1T8QA 5LIXX 7TIMA 4WK9A 3JUGA 3RXZA 9XIMA 5TNVA 5JXQA 2OLSA 5LA0A 2PGWA 1V5XA 1PCWA 3L4XA 3K5XA 6CGTA 4GUFA 1VJIA 3PAOA 1U5HA 1XRVA 1XRTA 4IPNB 5ABHA 4MY9A 2ZXBA 1JQXA 3NZPA 1YADA 1HJUA 3W53A 1SZGA 1QPKA 3ZVIA 3WK0A 5EPDA 2CHOA 3JU2A 4MB5A 3M0IA 3E0LA 3UYIA 3NSXA 1QVBA 2BVWA 4OBRA 1C8YA 3A64A 3G1HA 1KFKA 3TYBA 1VCGA 4LAZA 2PB1A 2KAUC 2WWCA 3B03A 2FH8A 3O07A 1WUFA 4PSPA 3MBDA 3SRDA 1E4MM 1BLIA 4HMDA 3TTYA 1UUMA 3RM9A 1RSCA 1BTCA 1JCMP 5FEWA 4CU8A 3PBMA 2XIIA 1KGUA 4XWUA 4B5WA 3O3RA 4NYUA 1CGWA 4E8CA 1V3JA 2PWEA 2C71A 1XISA 1VBHA 4P7OA 3VIKA 1WO2A 4E3VA 2NW0A 2Y1HA 1W5PA 3C56A 4WDUA 1AQ0A 3BLLA 1B3YA 3BDKA 5A6LA 3RJYA 2D0HA 4U10A 2E77A 2QF7A 4P7QA 4ZQPA 3W25A 3UNTA 3IK2A 3MHUA 2FGZA 2YBVA 4MWAE 1H2JA 3N3TA 4LYRA 3VNJA 3VNIA 2CESA 1EGVA 1ZTVA 3THQA 4LC6A 5A2BA 5I5RA 3ZWTA 2HCVA 2X0HA 1CX9A 1EPXA 1M1BA 4ZO8A 3EMCA 4F79A 3L2LA 3UWWA 1YQ2A 1XRFA 1Q8AA 1DWGM 2WSRA 5D2XA 4ZB0A 1JDDA 1P48A 3COTA 5D04C 1GQLA 1VFMA 3UETA 2WVVB 3B4UA 4YXGA 2EPHA 3SI9A 4PUWA 6XIMA 3LCLA 1GW9A 3BGGA 2O55A 3WQOA 1C9WA 2F9RA 1OC6A 4DXVA 4LNYA 1GKQA 1X6LA 2I7GA 3GNPA 1NP2A 4JS3A 4QFUA 3W23A 1CBGA 2HISA 1UW9A 4C6NA 2VKZG 3EPOA 4IQLA 3QN3A 1G7VA 2FHCA 2HZGA 1EYWA 2PDGA 3N04A 4NP7A 4JN7A 5AVHA 1B90A 2GDUA 3PPGA 4XVDA 1DWIM 1V3MA 3SSJA 1AZ2A 4G7EA 3TTEA 4MNJA 3CUHA 4CUCA 3VKKA 3DHPA 3W29A 2YSWA 1KFLA 2X7WA 1QRQA 1UIOA 5FJRA 3ITCA 4S3DA 1KO0A 3AS0A 3T05A 1FBAA 4W7UA 1XG4A 3Q94A 4MYXA 1H63A 4D72A 1MRAA 4F48A 3G6LA 1VC4A 3WLKX 3U2OA 3XINA 1WDDA 1ZJIA 5A2CA 2WPBA 5HXMA 3D3AA 2OWXA 2X40A 1QOPA 2VI0A 1FWIC 1PDYA 5B7YA 3AYTA 3CTTA 1KXTA 3EWDA 3GTFA 2INEA 3WUEA 3MZNA 1X1NA 2ZRWA 4CVWA 5FEZA 3GW0A 2ACRA 2WC4A 2FDSA 1ITXA 1QWGA 3IGHX 3LOTA 4LV9A 3JW7A 1TFVA 4O1EA 4J5NA 1JF6A 1MQRA 4IF2A 2DW7A 2PD5A 3MQTA 5JUVA 5A8PA 1HVQA 1MXGA 3N9KA 3UWEA 4JKLA 4LAKA 1P0BA 1VFFA 1GVIA 2D22A 3C0JA 3UG4A 3S1UA 3H2AA 4M80A 4JQ4A 4J9JA 1IEVA 3WBWA 1MW0A 4HP5A 5F2MA 1GK8A 4JL1A 1JAEA 2WHJA 3CV1A 2V5DA 1HL2A 1RA0A 3NZ1A 1RBOB 1GVRA 1XLLA 1ZBKA 1EZ2A 1AH3A 1E70M 4OQVA 2PRMA 3EYPA 3SIZA 3KBJA 4ENLA 4Z0JA 4QG9A 4MWAD 1SFSA 3WQDA 1JCTA 1TKKA 1BG9A 5L6UA 2Z7GA 2ZFAA 4K2SA 1SVDA 1DWAM 2ZOXA 1MW2A 3NXLA 2NX9A 4NL1A 1Q4WA 1KA9F 2A4AA 3FOKA 2QLYA 4ZFCA 2V2HA 4AW7A 1BRLA 4A4AA 2DFAA 1SM9A 3PZIA 3N1AA 3FSUA 2WMIA 2JQXA 2CBJA 2CXEA 2ZUWA 4GY7A 1VYSX 1TVNA 3R10A 4RZ6A 1AW2A 3OLGA 1SR0A 1J0JA 2ZDRA 4JFVA 4KBXA 2XFRA 3MWCA 2GOUA 1WA3A 3S5YA 1S5TA 2D0GA 2Y8KA 5CPNA 2GFTA 2QCGA 2ZX9A 4G7EB 4E0CA 4IT1A 2A3BA 4N0RA 1DHPA 1LM1A 1PL9A 1MWOA 4CN4A 4RE2A 5DBTA 1L9WA 2QW5A 1WE5A 4UFMA 2WSKA 2CNCA 3MYOA 2DIKA 2IQDA 3T8LA 1TTQA 3GNDA 4LVDA 3WEMA 3C86A 1SYTA 2WW5A 4MAZA 1SPQA 2JF6A 2QVHA 4ZB5A 3WUFA 3LZ5A 4NU7A 4O12A 4JHMA 2Y5JA 1B4KA 3CZKA 3VPLA 1GEHA 1F3XA 3E0WA 3AIVA 3WUBA 3R0UA 1W1TA 1KRAC 1XBXA 3QVQA 1M41A 5BROA 1A4MA 2AL2A 3BQ6A 3IJIA 4XD4A 1FWBC 2R82A 2WVSA 2XWDA 1XKYA 5AHFA 2CIPA 1UZ1A 1MZHA 1PZ1A 2FVLA 3VOGA 3TZFA 3N9SA 1WXJA 4DPQA 2MNRA 1ODZA 3PZOA 4HYVA 4DBSA 1ZAHA 3KZPA 1X97A 5KZDA 2ATSA 1F76A 5ABFA 4UFIA 3UA4A 2BY0A 3BICA 3VXGA 3CWOX 2BGNE 4TO8A 2IS7A 3L4TA 3NA8A 1KM4A 5G4WA 3HPFA 2O7SA 1PTDA 4PFMA 2QEZA 3HO8A 5FIPA 1XCFA 3VVGA 5CAHA 2Y6ZA 1IYXA 2A3AA 3VNZA 1ZJHA 3NDOA 5I79A 1OADA 2G3MA 3DI1A 4GXPA 4X60A 2ISVA 2QVNA 5I02A 1DTNA 4UZSA 5TIMA 3F2DA 3RCNA 3U2EA 3UR2A 1JRBA 3E2QA 3GH4A 1H1YA 1BRLB 2NLIA 1GWJA 4XD6A 1ODUA 5BWAA 3T0BA 1OX6A 4MAVA 5JBDA 2WMIB 3GZ3A 3MHFA 1GQIA 3RLVA 4N9EA 4RDVA 2WOQA 4F0SA 3STFA 4AEOA 5K9CA 2AL1A 3FJLA 4H9TA 2BOGX 3IIXA 2TRSA 2OLAA 4CN1A 4Y6GA 4NVTA 2I16A 3NEHA 3PB0A 3LPFA 3QQ0A 3DFTA 3EOSA 3OLDA 3LEPA 2BDQA 2E9MA 2EJAA 3W7EA 1AODA 3DH7A 1JI1A 4CCEA 3K1GA 4LAUA 2XVGA 2V8ZA 1PZ3A 4ORMA 4UTJA 4QSFA 4LALA 4AYSA 1SSDA 3B97A 1ZP4A 4Q3MA 2OO0A 4LAMA 4R5EA 5XINA 3FN9A 1BPLB 3OVGA 2CLOA 3LUTA 5A3HA 1JPKA 1OK4A 1MXDA 1GG0A 1GZJA 1UD2A 3VX0A 2F8QA 3S2JA 4QJ5B 1DQUA 4KKXA 1W32A 3POHA 3TYUA 3LM3A 2G4FA 1AQMA 3P8JA 4ZBCA 4NNCA 2X7VA 4ERGA 1WXZA 2YA1A 3LMYA 2WZIA 1SQ7A 3G8RA 1T41A 2F61A 3WD0A 4Q22A 4U33A 2W5FA 3CASA 4WR3A 2J7HA 4XK2A 1A5LC 5E0KA 1VHCA 1H51A 2HBXA 2AL2B 4AHOA 1ZPTA 1OY0A 4A3RA 4XZNX 5BXTA 3GDTA 2VZVA 3PZUA 3EB4A 3WLTA 1KM2A 2VELA 3IANA 3SN0A 3TP4A 3N6JA 2DT2A 3WJSA 3CPGA 3H7RA 4TOQA 3IUHA 4CQ9A 5HMDA 1XW8A 2IUZA 1A0DA 3FKRA 2YCJA 4XV0A 1H7PA 3PZQA 5ABFB 1TRIA 3R1ZA 2QMKA 2QJJA 3PTMA 1QNVA 4PTMA 4HK5A 1XICA 1Q13A 2QCHA 4R9OA 3GDMA 3MV01 4IICA 5I3FA 3N15A 2W91A 2OO6A 1F9CA 3URQA 1OFBA 1Q6EA 1LT7A 4AISA 4HPNA 4O1FA 4PMNA 2C1IA 1EP2A 1W1YA 1JD7A 1UYQA 1EF2A 3ALFA 3QSTA 3ARZA 2J25A 1P0KA 5G2WA 3IUDA 3S3GA 1UP3A 1ZBVA 1MRQA 4U2ZA 4DRSA 2GWGA 3MMTA 4JEQA 2JEQA 2I9EA 4HHMA 3HIJA 2QQ6A 3KAOA 1I6NA 1VB9A 3S5OA 3BMXA 1R30A 1M65A 4XB3A 1V4YA 4CNOA 3B4YA 3UGVA 2Z28A 3T44A 3AUOA 3N9RA 4B90A 1P0DA 4Y9AA 4IISA 4ZCWA 4TV6A 3IJLA 1EX1A 3HG3A 1JZ2A 3KRUA 1ISZA 3MWAA 3W7GA 3VYLA 3HTWA 2WMGA 2V6AA 4K7VA 1YBQA 3U2CA 1EC7A 4E38A 1E9ZB 2CFFA 5F2IA 4WX2A 5CZ0A 5AFDA 3SN4A 3VC5A 3V5OA 1PTGA 3TJ4A 5C5YA 1TPH1 3PTDA 3QLLA 1Y0EA 2WNZA 1PBGA 4Q8NA 3RMJA 3QGKC 1JXKA 4WOQA 2YKKA 1M03A 3TQVA 3QGAC 5EBUA 2NV2A 5C7VA 4I7UA 4RXFA 1UR3M 1B3ZA 2QJIA 1W31A 3VCNA 3S0CA 1HJVA 3AOFA 3UJSA 5BWFA 1Q2RA 3RMEA 1SFJA 3TEVA 2Y5EA 3PUGA 3GBEA 3VZYA 1A5UA 4DO4A 3NSMA 2QCNA 2JEPA 4YCOA 5KITA 3DFSA 4B15A 2Q6ZA 3GBDA 2HJPA 4ZL1A 4PSRA 3P0XA 3IIVA 2ZIDA 3WLLA 4PMQA 5FF4A 3NO5A 3SW6A 2YCLA 1RJQA 1UWSA 3ZO9A 4BQ3A 3N73A 1B4EA 4M1BA 4JTUA 2VC7A 4WIWA 4AIUA 2OYKA 4L65A 2WNNA 3OG2A 4Y8FA 2Q8LA 2W67A 3R89A 1V6VA 1DWJM 2GL5A 4F2TA 1UR1A 2C6QA 2VRKA 1AUSL 2X1IA 7ODCA 3N12A 3MUY1 4CN6A 3VKJA 2WYSA 2Z1SA 4QR6A 4H41A 2WCSA 1QOQA 3BH4A 4Q4MA 5F1UA 3EXTA 4HQVA 4L4PA 4IMCA 3ELFA 3L7RA 4LY4A 8XIAA 2QR6A 3G2GA 1QI2A 3LTSA 1GUVA 1O6IA 1EQPA 2Z00A 4GXWA 3THDA 3OQ8A 3PC0A 4DWSD 4PTXA 3IRDA 5D2YA 3TYEA 4XAFA 1DYSA 3NJ3A 1U1UA 4BQ4A 3SQMA 3W1LA 3TN5A 3TYAA 1ESWA 3N2XA 1NU5A 4Q4PA 3P5ZA 1NOWA 2BFGA 1WDRA 4EPEC 5BXRA 2R1PA 3ZT5A 2V38A 4MTVA 1RK5A 1QW9A 3L2MA 4YTUA 3GNOA 2DSUA 1JNDA 3VINA 1DIOA 1RLDA 4WJXA 3WKZA 3H4XA 3E0VA 1WZAA 3OQEA 3SCTA 4HYWA 1YBQB 1LTDA 2YZ5A 3GK0A 3I7QA 3C8NA 2ZTKA 1VZWA 1PWMA 4DZIA 3NO3A 3EZ4A 3HBLA 4HZMA 1V7AA 4CNNA 3EWUA 1TIMA 2A21A 3MUXA 1XG3A 1E5JA 5E6YA 4FIRA 4RZ4A 1XYBA 3TCSA 4F0KA 3ZQ9A 4JQ2A 4IIDA 1QW8A 1CENA 3V7PA 4HSHA 4IMFA 1OWQA 2UWFA 3OGSA 3LBMA 5FF7A 3OYXA 1JPDX 5M17A 4Z0SA 3DDMA 4O4WA 1JGIA 3O8AA 4XAYA 1QHOA 2PDYA 1HUVA 4LSBA 2YCLB 4HU3A 4AMCA 3QR0A 4DJDD 1IEXA 4CEXC 2WXDM 4KT2A 4XTDA 3BLPX 3DYMA 2ZWZA 3UVAA 3P61A 1WOBA 1RCXB 1TWDA 2XJ7A 1UR9A 2GGEA 2YCIX 1TX0A 3MUIA 3EWWA 1TPWA 3LSBA 3WBXA 4AFYA 1CXFA 1KCKA 4EWND 4KERA 3IJDA 4L6DA 3WQCA 2QIWA 1FH8A 1W1PA 3KTXA 1ZCCA 2P8BA 4DUWA 1UZDA 1UMLA 2EXOA 1W3NA 3AIRA 3L2IA 4AVOA 4AYGA 3B9DA 2YL9A 1Q4NX 3AZSA 4HYRA 3RAOA 3QW3A 2GK1A 4AAJA 1TE1A 1IXNA 3HGOA 5LNWA 1X8CA 3RM8A 1J11A 4YIWA 4B9YA 3CPUA 3T55A 2YL5A 1XBZA 1EWEA 1XLIA 4XAPA 4HN8A 4DYKA 3AUJA 3VOCA 4GNVA 5TF0A 4KGLA 4FA3A 3P82A 1K70A 3U4FA 1R5YA 4S3KA 4GI8A 3ITYA 4H9XA 5GQBA 5D32A 4AIOA 3S5NA 3NL2A 3BOXA 1XR2A 5J5RA 2HE8A 1IT7A 2YA0A 2OR2A 3URBA 2QUMA 1X98A 4H7CA 1A5BA 3AO0A 1W9PA 1RP9A 4UTHA 2PUZA 3V16A 4GH1A 5KZMA 2ZBTA 4GUHA 4RNFA 3APYA 2YYUA 3AHZA 4UMCA 3F4CA 4FF5A 4KEUA 1QO2A 4CQ8A 1EF3A 4REQA 1CIUA 3K4DA 1PXGA 2VEIA 1VKFA 4PUEA 5C55A 4GRSA 1LORA 1W3KA 2QPUA 2BS9A 3GXFA 3AMGA 3DGBA 3LMZA 5HAOA 1V7YA 1VCVA 3MDWA 2ZRZA 4HSNA 4KQNA 3ONBA 4C6CA 4JTDA 3CB8A 1V6UA 4NI3A 3CZEA 3GVGA 3I7RA 1EJXC 3R11A 5MF5A 1S2UA 4H19A 2B4GA 4GIYA 1AK5A 2VWTA 3GXNA 3HZ3A 1EQCA 3NDYA 2ZX7A 1V6WA 1RY0A 2IQTA 2P8CA 2W27A 4G2DA 5JQ9A 4I7VA 2CKSA 3SCVA 1KCZA 2BODX 1XWYA 2AAMA 1S2WA 4WRHA 3NEVA 4ZXLA 2Y88A 3KL5A 1KM3A 3W84A 3W3OA 5K9XA 4ICMA 3RK8A 3G0UA 1GW1A 2PLCA 2PWGA 5LXEA 4ZGYA 4LW7A 4GJIA 4IXXA 2NUYA 1HP5A 1UWIA 1VFOA 3TQKA 3E74A 2DZUA 3MP4A 4JQAA 4D6HA 1UB3A 4AEEA 3BL3A 1K9DA 3MUZ1 3P0WA 4GINA 4I8YA 5HBFA 1R0MA 1WV2A 1K9TA 1HT6A 5HJYA 3MT1A 4M29A 3BTNA 4AIEA 1CXEA 4MLRA 1J0ZA 4UTFA 3ANYA 4TMCA 2BY1A 4BI5A 2GK1B 1K9FA 1HN1A 2FLIA 3QTPA 1K4GA 2VURA 4PMDA 1SJCA 1E6RA 3HV9A 2X1SA 1R7OA 4B2DD 1JG9A 4IIHA 1BYAA 3QYQA 4DNHA 3IAQA 1JDAA 1OFPA 4U2YA 4C6FA 1GGOA 1Y65A 4IIEA 1AH4A 2ACQA 2X2YA 4C7DA 3ZR5A 5DT7A 1S5VA 3BUVA 3QLDA 3ITVA 3MTWA 2YW3A 5FJUA 3FCPA 4IZGA 3WNKA 2J7DA 4V27A 1LRNA 3V0TA 3HFYA 1KQYA 3S6OA 2XN0A 3Q65A 5GJMA 4AZGA 1V0KA 1LBLA 1RR2A 2YXOA 3ARTA 3QOMA 4OU1A 3WY1A 4AWUA 1IT0A 3RX2A 4M51A 1R46A 2HPMA 4NZJA 1QMLA 4I7WA 1TJ1A 2BOFX 3H8AA 4B5SA 4ZQMA 1MNSA 5HWNA 3MMWA 3W1QA 3WMCA 2VL4A 2NQZA 2ZUVA 3EGJA 2NWRA 1CB2A 3KP0A 4QHRA 3NTYA 1U1HA 3VFLA 4GGHA 4Q7IA 3P80A 2QUTA 3IJ9A 1I0DA 2IKJA 2J27A 3W7IA 4KWUA 3MCOA 5HMFA 2XIMA 4LXFA 4G9PA 4KFOA 4C6DA 5F2GA 1QR7A 3ZJ6A 1CXLA 5EFDA 2B31A 2E9LA 1FCUA 2PCEA 3TYDA 5A69A 5BRBA 4G5DA 3WLSA 3FXGA 4ATDA 2ZA2A 1XSJA 5DMYA 3BO9A 1C7TA 1NWSA 4XO7A 3VO0A 1MEHA 4AZCA 2QZRA 4BF7A 1MQQA 2ON3A 3A3WA 1E1EA 4NI8A 3M0JA 1KTCA 3EDEA 1GKRA 4JNYA 1BWVA 2QGHA 3KBVA 4FEZA 4K8HA 4TR9A 1NDYA 2UY5A 3H2EA 3T2OA 3VC6A 5JMUA 3SCWA 4X9SA 4LY8A 1EJSC 1DIKA 3M5VA 1LT8A 5FCZA 4GABA 3S4TA 5HDRA 4WKAA 5CPQA 2Z6JA 1DJYA 3NR0A 4RL3A 2J6XA 3OO2A 2BVYA 2OSXA 3Q58A 5CG0A 4EAMA 4EP8C 3FSTA 3LNMA 4KESA 3PZMA 1L2QA 3S6TA 5JVLA 3GR4A 3STCA 4OUIA 2GOKA 5E1QA 2QAPA 2VOTA 2EAWA 2IXUA 2EBNA 1SO6A 1TQXA 3KCLA 4LOCA 4OOZA 3S9IA 2F2HA 4DLFA 1YE6A 4KCUA 2WLZA 3WDHA 1MEWA 4DBWA 1ZJAA 1XSKA 1RD5A 3LV5A 1BVZA 4EXBA 4O8AA 4GNJA 4JFWA 3UNDA 3BARA 4NX5A 3D46A 3B8SA 2JE8A 4YVVA 1W2PA 1PHQA 5AYZA 4CD8A 2WJFA 1XD0A 4MKSA 2C14A 3GU9A 1TTJA 3V5CA 2A3CA 4L61A 4OIFA 1OVDA 1YDVA 3W1XA 4D6CA 2OOGA 5IM51 5HWMA 1UG6A 1PPIA 1EC8A 5E0CA 4C6JA 2XIJA 4ADUA 4W88A 4LUIA 3DG3A 2FMOA 1B57A 3NGFA 3FAWA 1TPUA 2VC6A 2XYLA 4HJFA 3UYCA 1DE6A 1T8XA 2JKPA 1EOKA 3FW6A 4XO6A 2E6DA 3T0AA 1DL3A 1JZ3A 3QTGA 3SUUA 4PUMA 1GKPA 3H54A 2XVLA 3AICA 1CPUA 2BV9A 2FTYA 5DEZA 3QBUA 2VX6A 3WK2A 3GUWA 3T40A 3MUCA 5BMXA 2H8ZA 3GVQA 1TJ0A 2E8YA 3UWUA 1UD4A 2V82A 4CLMA 2WM0A 4QJ1A 3WH5A 3UCQA 1L2UA 2JALA 4AZCB 2DU2A 4IH3A 1QWKA 4E8DA 4AHPA 3CB3A 3O6DA 1HKMA 1L8PA 2QJHA 3EX2A 5A6SA 3WJXA 1FWCC 3U2ZA 5I09A 1ZJBA 1WDQA 3SIMA 4AMAA 2H3DA 2HDJA 2WAGA 2GJLA 1I9CB 3U3HA 2YLAA 3PHAA 4XZHA 2ZVIA 3M7WA 1Y5VA 4OV9A 3VX1A 4EACA 2BX7A 1XIBA 2DUZA 4M5PA 5DO8A 4FAMA 4YTQA 2BLEA 2D69A 3O6CA 2PWHA 3QXBA 2CBUA 2I9UA 1C29A 3O2LA 4YN5A 3ABQA 3SCUA 3CYVA 3V1PA 1SJAA 3CIXA 1VD6A 3UJEA 3SECA 1T5AA 4H6EA 4CVUA 2PDBA 1SFTA 2ZZ6A 3E5BA 1QDSA 1K1DA 2WJEA 1JYVA 2C7FA 4GKLA 2W66A 3MO7A 5D02A 5EGRA 3HMJG 1SZNA 1CXHA 3SJ3A 3VDHA 1RLCL 2PTWA 4L9YA 1SFLA 4X2RA 1JNEA 4EPKA 4MM1A 5AB3A 2QPXA 5A6MA 3CBWA 3ZLHA 3CHFA 5B7ZA 5M3WA 3PN8A 3NYDA 3CHDA 4BJHA 3ZJ7A 4RNJA 4UIOA 2E9BA 1W3JA 3G3MA 3JZEA 4P7RA 3VM7A 3UQNA 4NJIA 2PDHA 2D3NA 3SUVA 2OEJA 4H2HA 3FYYA 4IIGA 4HNNA 3W6MA 3L4VA 1X39A 2QIIA 1SSGA 1ZUAX 1RCOB 3EEGA 1GOWA 5LNSA 1CT5A 3LK6A 4LS2A 2ZX8A 1SJBA 3H2OA 5IXEA 2FYMA 5E9AA 3W75A 1QUMA 1Z8AA 3AMDA 3WFZA 3S5ZA 1XGDA 3NL3A 3QV7A 5I03A 3DXIA 1TR1A 1U33A 4D6JA 3LS9A 2BNJA 4JTRA 2ISDA 3ARRA 5B80A 4YNGA 4C6IA 2Q8ZA 1E0UA 1AQHA 3WZ0E 3CT2A 4PUKA 5I00A 4WF7A 4LC8A 1E9IA 4GLEA 4R27A 3G77A 3ANUA 3DHDA 1I2PA 2Z0IA 4QITA 3T0CA 1DJGA 3SUSA 4NX0A 2QCDA 3QV6A 3GXDA 2F2KA 1AMKA 5JH1A 1Q65A 3ARPA 1IXQA 3BV4A 2FKPA 2V3FA 3I3EA 4D9PA 1HGWA 4AXKA 3WNNA 4D8AA 5D2VA 2ALRA 3M0MA 2FB3A 1TWWA 4Z08A 1UWTA 2FFCA 1KB3A 1Z3NA 4IGHA 1XCXA 2DGAA 3S5SA 2UY4A 2HS6A 4GO8A 4CCZA 3O05A 5DRCA 4PTVA 3TU9A 4O1AA 3TX9A 1F3TA 1IXOA 2AGKA 1UA7A 4ZA0A 3FIGA 5LA1A 5FF2A 3TAKA 2VZSA 4ZE4A 3GQYA 2UY3A 4A3UA 5A6JA 4PA8A 1TV5A 2IXVA 3VNKA 2J66A 1XIEA 4IMDA 1AMYA 2YL8A 3CO4A 3WH6A 2Z6IA 2D20A 3WQVA 2OKOA 5LIWX 2RDWA 1EZWA 1JZ7A 2G8ZA 3GAYA 3MMUA 3IPWA 3H55A 4FNSA 3A13A 3VFCA 2NVCA 2XH7A 1P1MA 1J0YA 4JTEA 3VIIA 1ZCOA 5G1MA 2Z7KA 1FKXA 2A5HA 3GC2A 3T8QA 4JN8A 3AIBA 5A1AA 3DG6A 1VBRA 4XIAA 4JTIA 1QU4A 1OD0A 3NQAA 5D9OA 1N55A 4LANA 3N6QA 3WQFA 3GU2A 1MEIA 2OB3A 4W4QA 1FWEC 1LCOA 2FIQA 4J4KA 1J79A 4P8VA 4DJEC 2VRJA 2OZ8A 5AY7A 4C1NA 1QNPA 3W1MA 2P53A 2Q02A 4DWDA 3N13A 4ZR8A 4WCJA 1Q85A 4B3LA 5CEWA 2W4XA 3F4NA 1XINA 1CEOA 2BXYA 2PA6A 4RJEA 4E8GA 4W8AA 3WF1A 3CV7A 1GPWA 4YU1A 4Q8MA 3LG3A 2XSBA 1E3XA 2Y62A 4GI9A 4S3FA 1Z7AA 3DKJA 3GY1A 4GIEA 3EB3A 5CSUA 2FPVA 1K9EA 4GGBA 3WMSA 3FAXA 2GLKA 3R7MA 2RDTA 4K37A 1OD8A 1Q7QA 1JQVA 3QZAA 4S1FA 3OHIA 1A5AA 4RKAA 4N6FA 4PMJA 2Y7EA 1MMFA 3UY7A 2G37A 5LIKX 4W8BA 4Q7NA 1KFBA 3W71A 4PCSA 3THAA 1A50A 3CJPA 2QCDB 2WNQA 4BF5A 1CZ1A 2YFNA 4ZO6A 4D8ZA 4H7ZA 1LBFA 4UFLA 4PFHA 5A6AA 3QR3A 4GCAA 4AZBA 1M53A 4XAGA 2ISSA 4RK8A 1AD1A 1PX4A 4CQCA 4E2BA 5TBOA 4OKDA 4W85A 5HQMA 3NM3A 2P50A 3AWOA 4EOUA 4LFYA 3JR2A 3ITOA 2QCMA 3M6YA 1E6PA 5MHBA 2QUUA 3KOZA 3W37A 4UNLA 3ABXA 1V77A 3ITTA 3HG5A 1M01A 4D6IA 2VDIA 5AHMA 4FXFA 1AQFA 3P81A 5LYRA 2FJUB 3CV6A 3VILA 3W0KA 2CZVA 1F3WA 4UTWA 1P5BA 2YJQA 5KMYA 4RPQA 4EWJA 1CGTA 2EG6A 1LQ2A 3QPYA 4X0VA 1XDJA 4LCRA 5FSEC 1O5QA 3FNDA 3T0DA 2OYMA 2V5JA 2POTA 2GVLA 4MNLA 3UGRA 3O0KA 4GHRA 1K8CA 1V0NA 3T9PA 5BW6A 1RY8A 3ARSA 3K4AA 5BOFA 4NHVA 3G1VA 4X22A 4PMYA 4BA0A 3L66A 3NURA 3Q45A 3W4RA 5M2FX 1NH6A 1XJBA 5LHEA 2OEMA 4H2CA 5LIYX 3V5FA 2CKRA 2NT0A 1H7OA 2V67A 3FV9A 4I9AA 3M46A 1VF8A 2JFEX 2XM2A 1ML1A 4KFPA 1CGYA 1NEYA 2XH0A 3L9CA 3RHGA 2WSYA 3N19B 1SZFA 3EWZA 4EKJA 1XH1A 1Q7MA 4RZ5A 1I1WA 4Z2KA 3SDOA 5CLTA 2ZZ4A 1B1YA 3EOLA 3N25A 3APTA 3QW4B 1TE6A 4EANA 2AQOA 4FLRA 4HZ6A 4S3BA 2ZUSA 1NSJA 2E7FA 2NXGA 4MFDA 4FX8A 3S9ZA 2J4GA 2R1LA 3E02A 3CZGA 4FNPA 3NQFA 1OYBA 4FMVA 4PCTA 1P6WA 2VZUA 3RLGA 4RV8A 3W26A 1H7XA 1RJRA 3AMCA 1HXJA 2Z2UA 4GI4A 1JFXA 3IJQA 1ZGDA 1H09A 2D2JA 3VOHA 1UOZA 3M5XA 1BFNA 3EDDA 5G4EA 3RO6A 3D5HA 2QAFA 3I10A 3T0TA 5EMMA 2E4TA 4HA4A 3BW4A 4HA3A 1TSIA 1DORA 3CIWA 2QJNA 3GYCA 3SFKA 2Z1XA 4DLMA 3TXZA 3B8VA 3NZRA 3VCCA 1TR9A 3NL6A 2DZAA 1ZY9A 2NQ5A 3OBAA 4KWVA 1GOXA 4HU4A 1XUZA 2ICSA 4C90A 5BU6A 3MMDA 1OHLA 3C8FA 3RRXA 3WQ8A 4YTTA 2DZSA 1JCNA 2GVJA 3LI1A 3SCOA 1TCDA 3BGAA 3VU2A 3C4UA 5CLWA 3SY8A 4LYQA 4GA8A 3EXSA 3LTYA 3WJZA 3V3WA 1ZL1A 2CHRA 3T6CA 1SZEA 1LQ0A 2V69A 4FNRA 2R1MA 4J2MA 4ECLA 4FLOA 3U7VA 4DZHA 2HK1A 2D1ZA 3DERA 2GQ3A 3GX9A 1PYFA 1H7WA 4M56A 1SO4A 5HMSA 3W2UA 3HGJA 5AC6A 4U28A 3UWYA 3KRZA 2ZRUA 1F4AA 4KWSA 3HG4A 4Q8WA 3TH6A 4Z2GA 3BG3A 4AX7A 3GTXA 3KM8A 4H6KA 2J78A 3CH9A 4RE4A 5DY2A 5CPSA 3RR1A 3QR1A 4WLCA 5D09A 1SUXA 3TC3A 5AYXA 3L5AA 3W7MA 2QCFA 3VNYA 1SO5A 2C19A 4DVOA 2REQA 3WLPA 3DFHA 4G56A 4BI7A 1PUDA 5T8GA 4GACA 4B5NA 4KGJA 3W7KA 1YW1A 5T9CE 2FTPA 3UEQA 3AWNA 2ODOA 1XLJA 2DY3A 4MMWA 4NT0A 1V02A 3CLMA 4JIRA 5FEPA 2WQDA 3PUOA 4NNAA 2YW4A 4GZ7A 2HPIA 2XUCA 3AS2A 1VIZA 4NZ4A 1QTWA 3AHTA 3WD1A 1BQGA 1XFCA 1KBKA 1E4LA 4GYJA 3KCOA 4EF9A 4DXXA 1KWKA 1J18A 4E4PA 3LCWA 2O9PA 3N4FA 1TTIA 3SN1A 2E6FA 1P0NA 2BMBA 3L0KA 3CL6A 1TPC1 1A5KC 2J47A 3TN6A 3NQGA 2A7NA 4O0ZA 1KXQA 1UA3A 4ICCX 3TQ0A 3M0HA 3NQ8A 4YTSA 1YYAA 5LKYA 4AF0A 3VIFA 4C6EA 3PZGA 1MNZA 1ONXA 4OWGA 3LV6A 1FQ0A 3BOFA 1Z69A 4NNBA 1QCWA 4LYKA 4EPBC 1HKJA 3M16A 3VZZA 4DUXA 3R5EA 1TZ7A 4H8UA 4ACZA 3MI6A 1OYAA 2FZDA 3QKEA 5LGZA 2R1KA 4JTJA 3UWZA 3HQOA 5T9BG 2GGJA 3W38A 4ZO7A 2E09A 4LNCA 4Q7BA 4A35A 1T96A 1H1NA 3BLEA 3IVUA 2ZDSA 3QZ6A 3TLQA 1O1ZA 2PS2A 4O57A 4QM1A 2A3HA 2PDXA 2Z1KA 2F6KA 1R86A 3G22A 4GYFA 3RITA 2VDGA 4XBKA 3TFCA 2A79A 4CD4A 4A6GA 4DY1A 3W6LA 2G3IA 1R3VA 3C2FA 1WPCA 3VE7A 5FJOA 1ME8A 4Q8QA 3GFZA 4FXSA 3IV8A 2C15A 2QXWA 4R9XA 1YX1A 2HNHA 4P5UA 4K6AA 4D1IA 3TAOA 3KLLA 4N6EA 3LLDA 2OWCA 2PDNA 3WMBA 2HS8A 1GZGA 5I3KA 3II1A 3LHZA 3SGGA 4FIQA 3GDBA 2XFWA 4MHBA 1ITCA 3H7VA 1FWHC 8TIMA 4YHEA 4XG1A 2XIOA 3W7PA 2NZLA 3IVTA 2ZWYA 4OT7A 4O54A 4RDWA 1LWIA 4LWWA 4HZ8A 4DJDA 2IPWA 3VTRA 4IJRA 3CQIA 2QDGA 3FHAA 1KNWA 2G3NA 3WLNA 4UTMA 3WMLA 2QDEA 3ZJKA 3MC5A 3K1DA 4INFA 3DHFA 3N29A 2J79A 1BF2A 2VMFA 5D37A 3PG9A 2GJNA 1PEZA 3CAVA 1OF8A 4KEVA 4LX4A 2E0PA 1OB0A 1DV7A 1JAKA 3TXVA 1DEDA 3HJEA 5C7HA 4E2OA 1TREA 1TA3A 4HHHA 1WDSA 5J5DA 1JDFA 4M7SA 4I5RA 4DQWA 4AIBA 5H2ZA 1FDJA 4PMUA 1P7TA 1TPVA 4KETA 5ECVA 5IFPA 4PEEA 4JYFA 4C5YA 4BFAA 1ZU8A 4AF0B 5CGTA 3L5MA 3R43A 2C79A 3SGZA 4TX6A 4K39A 3A24A 4HNLA 4S3AA 3DCPA 3QMSA 4LVGA 3M0XA 1C7SA 5IBXA 1BKHA 1GYLA 4ACYA 2YOCA 4F66A 4GJ1A 4FNUA 1UC4A