5IM51

Crystal structure of designed two-component self-assembling icosahedral cage i53-40
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
208
structure length
208
Chain Sequence
STINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQPEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGTWMVDKKLVTNGEWDEIARLTREIVEQVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Designed Riboflavin synthase
publication title Accurate design of megadalton-scale two-component icosahedral protein complexes.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 72
structure length 208
sequence length 208
chains with identical sequence 2, 3, 4, L, N, P, R, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01081 Aldolase KDPG and KHG aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5im5100
2UV8G 1YTKA 2ZFAA 2GJNA 2YYUA 3OG3A 5LGZA 4Z08A 1TPVA 3C2FA 1SU5A 3MJYA 5I3KA 1S5TA 1SZEA 5HR6A 1GT8A 4IMCA 1GVFA 2VFDA 3M7WA 3NDOA 2QF7A 1WXJA 4JTTA 1KM3A 1KTNA 4O12A 4M5PA 1H63A 2H8ZA 1A5AA 1Z42A 2CLMA 4ORIA 1R46A 4JTLA 4IXXA 3GB6A 2FQIA 3TW6A 3O07A 3C61A 1TPFA 3NOEA 3W7DA 5H2ZA 3GDRA 4IQLA 4NNBA 2NUXA 5BW6A 4P2VA 3P84A 1I2OA 5CSSA 2Y7GA 3TMQA 3KOFA 5GVJA 4L4MA 3PG9A 3P60A 3G3MA 2ZA1A 2Y7DA 1OF6A 4IPIA 2WO5A 4HN4A 1EP1A 2VKZG 2QCDB 3M0ZA 1K8XA 3HPZA 4UMAA 4HIBA 2DORA 3EX3A 5G5IA 3W76A 2YR1A 4BI5A 2QEZA 1XBVA 2XN0A 3EB2A 1PCWA 3W2KA 2A7NA 3UZ5A 4MUZA 4NXSA 3TV8A 1B4EA 3BV4A 4BFAA 1FCQA 3LCLA 4C1LA 4DF0A 3O16A 3HOJA 2E6YA 3QMTA 5FF4A 4Z1BA 2QUVA 3QZEA 4X22A 1QPQA 2JKEA 3PM6A 3SFKA 5KTLA 2R91A 4ZQRA 3I6RA 4PL2A 3GDTA 5H91A 4XQ6A 3IGXA 3O1NA 1GOXA 1H1ZA 1FUYA 3DKLA 2QDHA 3LCHA 2A7PA 5LSMA 1DQXA 1ICQA 3CU2A 4A29A 1XFBA 4YXGA 4N9BA 4X3ZA 4RZ5A 2XN2A 2A5HA 1KW1A 3UWYA 1ME9A 3FKRA 1H5YA 1VYPX 3NGJA 3PSVA 3G18A 4UFHA 3TIMA 1YDNA 4UTKA 4GUJA 4G1KA 3TX9A 1W56A 5CSRA 3NQVA 4KWVA 2WOQA 4ONVA 3MI2A 3TR2A 1O5XA 3W1RA 3CM4A 1TV7A 1SUXA 4HNNA 1FDZA 1DV7A 1EUAA 1PV8A 4AHPA 3GR7A 3P8JA 2ZDRA 1OFBA 3WK3A 3NL6A 4M6QA 2CLFA 3GLCA 3P80A 5D09A 3TMLA 1HL2A 4BI7A 1KLZA 4EF8A 3UQNA 3QMSA 4O52A 3PB2A 1AW2A 3RLVA 1QOPA 1VH7A 3PBVA 4ADSA 1W8SA 4AHOA 1EPXA 3HG3A 4Y6GA 1GQNA 4M7SA 2YW4A 4HT3A 1EEPA 1QCWA 5C6MA 4OE7A 2NUYA 4XKYA 5C54A 4JDYA 4TMCA 1Y0EA 3G1HA 1JQVA 3E49A 3L5MA 1KTBA 4JX6A 1ALDA 5EKYA 4POCA 2OT0A 2C13A 3QEZA 5K7JA 1O95A 5KINA 3LHZA 4UTJA 3HBLA 1M6JA 2OT1A 1M7PA 5FEWA 6ALDA 1TPH1 2X1TA 2PRHA 1BTMA 2A6NA 2E6FA 1P5BA 4NUWA 2F7FA 5D2WA 2LLEA 3DGRA 5LHFA 3IIPA 1IXOA 1FWTA 4LUJA 4ZZ9A 3P61A 2FB3A 2R8WA 2YSWA 4WOQA 5L6UA 1XBXA 3W1AA 3QPZA 4TU1A 1JJKA 1YDOA 3MBFA 4MLRA 3NL2A 4LTSA 2QKFA 4I7VA 5DCDA 1K7XA 3GYEA 3IGUA 3R13A 4BR1A 3DFTA 3W1MA 3EEGA 1KFKA 3G3DA 5D2YA 3EKLA 1JCNA 1AK5A 4UFJA 2RKXA 2QAFA 1ZHAA 3NM1A 2B7NA 1EWEA 4AHQA 4FNSA 1R47A 3W23A 2ZRZA 4S2BA 5HUOA 3PF3A 1O4UA 3CB8A 1K7FA 1NSJA 3UPBA 3CHVA 2WJZA 4MVAA 3GK0A 2YZRA 3AJXA 3MW7A 2GJLA 3M47A 4EVZA 1P0NA 4JYDA 3FYPA 1VCVA 3NPWA 1LROA 2WV8A 3PUEA 1OFDA 1NEYA 3NQDA 4DPQA 3T78A 2J88A 4GUGA 3TC6A 3P8IA 3TW7A 5CPMA 1OX5A 3EXSA 1HO4A 1OFPA 5KSWA 5D37A 4NVTA 3TUUA 3LI0A 3DAQA 2C16A 3OEXA 3T7VA 3UNDA 2ZQ0A 5I3FA 1HTIA 1HG3A 1A5BA 2VEMA 4MYAA 2W0UA 4JR5A 3L9CA 5F1UA 3KRUA 1A5CA 2QUTA 3SECA 2C6QA 3SZ8A 1SPQA 4N9DA 2BZNA 3M44A 1F6PA 3FJLA 4E0CA 3S5NA 4IMDA 4MZ1A 2R14A 5I3JA 2GUUA 4Z1CA 4E38A 1ZJIA 4DO6A 1VHCA 2F84A 3ATZA 2WSYA 2AQWA 4PCFA 5A8GA 3CEPA 1KM6A 3P62A 2QJIA 1Q6OA 2DU2A 4GXMA 1KM2A 4AH7A 4N2YA 3DH7A 5HMSA 3HO8A 3LERA 1FCUA 3LCIA 3OBKA 4IMGA 3W22A 4LVGA 3FYOA 4TX9A 3L65A 1XUUA 2Z6IA 4IXHA 5D30A 2EAWA 4WY0B 2V8ZA 3TAKA 1C8VA 4IX0A 4O11A 4O16A 4JY9A 4LW7A 2B4GA 2WNNA 1DQWA 3GXNA 1YLVA 3L5LA 3W74A 1PS9A 1IIHA 3S1VA 1T96A 1OABA 2DZXA 4K38A 4M6VA 8TIMA 4PH6A 5DY3A 3OVPA 3W88A 2AGKA 2BWGA 1F2JA 3HMJG 3PBUA 3DU0A 1LLWA 2YFOA 5F4SA 4UUIA 4UC5A 3FFSA 3PG8A 3DKJA 3I65A 1RQEA 1VGAA 3LCGA 1KFJA 5G2HA 2A85A 3LHUA 2FDSA 4U4MA 4NT0A 3QW4B 3MO7A 2Y7EA 4JDBA 1H7RA 1DJQA 4NJHA 2Y63A 3QRHA 3ABOA 5F4XA 3V75A 1OX6A 3GXPA 1QOQA 5D04C 1OJXA 5CG7A 3O6YX 2ISVA 3B0PA 1I2QA 1F6KA 4NQ1A 4WJEA 3W1NA 3I7RA 3EX1A 3LHVA 5EY5A 2FB2A 1OVDA 1X1ZA 1GWJA 5U4NA 3W1TA 4A21A 1LOQA 5K3VA 2CW6A 1TPC1 5F2LA 1MEHA 5DCBA 2X16A 2WSRA 4EIVA 4RJEA 3ZWTA 5IBXA 1FCBA 4IGHA 3SSJA 3E9AA 3WK1A 3W3OA 4HNVA 1IXNA 3BW2A 2HSAA 5AHEA 1F74A 4LC6A 3VI2A 4IUOA 4LNYA 1WYIA 2J6XA 1Q3NA 3PC0A 2VFHA 2NWRA 2V5LA 3G1XA 1TV8A 2X1RA 3U2OA 1EB3A 3BG3A 3K30A 4GRSA 2QCLA 3DFNA 5CZSA 4MOZA 2Q3RA 2ZTJA 1GVOA 2GPTA 4N4QA 5C55A 2VOMA 4X9SA 1OFEA 3HPSA 1PHQA 3M1ZA 3TQ0A 5DXXA 1JRBA 1R2RA 3SGZA 3T40A 1SO6A 2HS6A 3INPA 4WD0A 3FIGA 4C1KA 4M6PA 4MY9A 3S1XA 3I7QA 4JICA 1W5OA 2QCMA 4JS3A 5LNSA 2CLKA 3QC3A 2BXVA 3TROA 2DZUA 1FBAA 2J24A 3KHJA 3P7YA 1SW7A 3NQEA 1L9WA 3S5YA 3KAOA 2C0AA 4KFOA 1HFBA 5KITA 4BF9A 3GKAA 3THQA 1FY6A 3F4NA 5G2WA 3NXFA 4JIQA 4YWIA 1VRDA 3G24A 3U8GA 5MHBA 1SW0A 2DZVA 1K8ZA 1R30A 4PL1A 4ZQOA 4JTGA 1OK6A 3CLMA 1T0OA 1UUMA 3W7KA 2ZZ1A 1H7NA 1BEUA 3UYCA 4E2DA 4FF7A 3N34A 1KTCA 1PIIA 3CIXA 3O63A 2VELA 2QJHA 3A24A 1S3HA 4MZ8A 4AMAA 3NPVA 3E0IA 3C2OA 5DELA 2H3DA 5E0KA 4ZQMA 5CZJA 3P5ZA 4LUIA 4OWGA 4M19A 2NXIA 2Q8LA 3HQ1A 3DHFA 4UFIA 1LOSA 4AF0B 3UZJA 1RZMA 1SZGA 4XZ9A 5EL1A 1PL9A 2PE4A 2FPVA 4R7JA 1AG1O 3NZRA 5CGQA 3W1QA 3L21A 1YPFA 3OVRA 3E96A 3LRMA 1TSIA 4DF1A 1MEWA 3M5ZA 4AXKA 5HR7A 4NX5A 5SWUA 4DBDA 3QMRA 3ELFA 2X1UA 2E5DA 3C2VA 3LV5A 3GIYA 1KV5A 1P4CA 5DBTA 1YYAA 1EA0A 2A1YA 3EX2A 3HPXA 5AHNA 2VFFA 1W3NA 1ICPA 1RVGA 2RDTA 3LTPA 4HNUA 3WK2A 2XFWA 3F03K 4DQWA 3NM3A 1RV8A 3NQMA 3DFOA 3LTYA 4Z0JA 1ML1A 2CLHA 4BWLC 1U83A 4UR8A 3C2RA 3GXTA 3MBDA 4QISA 1G4TA 1H62A 5D05A 3NZ1A 2CFFA 4O14A 4FX6M 3W7IA 2QCNA 5I3IA 1NVMA 1JCJA 4O53A 3RMJA 1KV8A 3LI1A 4M7TA 1L6SA 3TQVA 4HKPA 3GDLA 1DL3A 3LHWA 4JEQA 2CLEA 1R2TA 4QITA 3SY5A 2ZZ4A 2CLOA 2BX7A 4ML9A 3HF3A 1GVSA 3MHFA 2ZRYA 4S1FA 5FEPA 3EX6A 3PVFA 4CCEA 4JTFA 1E51A 2D73A 3HGOA 3PAJA 2V30A 2ZZ6A 5K2ZA 5BOOA 3NQGA 3MHGA 4N6FA 3RFAA 3KRSA 1O5KA 2TYSA 1LTDA 3ZWSA 2VFIA 2J9ZA 2H90A 3OVQA 1EX5A 3MI6A 1SZNA 3M5XA 3KXQA 3M41A 2JBMA 4JTEA 5F1VA 1X1OA 3G0SA 3KRZA 4GBUA 1HUVA 3NQ2A 1IXPA 2JGYA 1F7BA 3C2EA 1D3HA 3UD6A 2NX3A 2YCEA 5IBXC 2YGYA 3RLUA 4LVAA 1TQJA 3A23A 4KKXA 1CW2A 1G67A 1LBLA 2OJPA 4IPJA 1SO3A 4O13A 2KZHA 1W1ZA 3LXAA 5DCEA 5DY2A 4AB4A 4LRTA 1WX0A 1TIMA 2YXGA 3P81A 3G22A 3BARA 4Y8FA 1OFAA 5FESA 2BSLA 4PTNA 1X7FA 3TE9A 3IVSA 3HIJA 2A0NA 1H51A 4LVFA 1SSGA 1GYLA 5C5YA 3W75A 1YDVA 1ZY9A 2V81A 4UXDA 1GTEA 4MLJA 2YX0A 4FXRA 1MEIA 1A5SA 4O0KA 5E93A 3MMTA 2CZFA 4NNAA 2GVLA 1ZFJA 1TB3A 1UASA 2CWNA 1XDLA 4CCCA 4JY8A 3W7LA 3QF0A 3NR0A 3BGGA 1Q6RA 3IEBA 1LRNA 3N2XA 3L67A 5D32A 1W5QA 1FCVA 4RZ6A 4MZYA 3TSDA 1GTHA 3MP4A 1KFBA 1NFBA 4WX2A 5D38A 1K03A 3TNOA 5FF3A 3LCFA 2G95A 3S9YA 3TDFA 5KZMA 2C15A 4JX4A 5AOUA 4AWUA 4BK9A 5CKSA 1XBYA 1GYNA 1FDJA 2O7QA 2CLIA 4UNLA 4FIQA 4AWSA 4UNKA 3B0VC 1WAUA 3B05A 2DZSA 4O57A 1GEQA 1RQHA 4NX0A 1OYAA 1TV5A 4H3DA 1LOLA 4UTIA 1TMHA 2P10A 3M5YA 5EPDA 5HNRA 3FA5A 1BWLA 3S6DA 1WBJA 3L2IA 4RXFA 1OX4B 2CZDA 4JXCA 4FNUA 3C52A 3I7SA 1VYRA 4LS2A 1J4EA 1RQBA 3BLFA 2WNQA 4WQ6A 5EBUA 5AYXA 3BO9A 1Q45A 4FHAA 4QIUA 3THAA 2ATMA 1JUBA 2HTMA 4ORMA 4UCGA 4ICNA 3NO5A 1KFEA 4N4PA 3GZ3A 3V1PA 1SR9A 1H61A 3ABRA 3LCXA 4Q4KA 3S8HA 3E02A 1KFCA 3WJZA 2GQAA 3UY8A 3UXDA 3H54A 3LRKA 1W37A 1C9DA 1H1YA 1JCYA 3L0GA 3H53A 3QSTA 2JKPA 4MFDA 1FQ0A 4HSNA 3PB0A 4UTMA 5LNWA 4JGDA 4PODA 2H8XA 4A2RA 2ZA2A 3W7EA 2Q3OA 4O18A 4O4VA 2E77A 2DZPA 4FB7A 1DVJA 3KVLA 3FEMA 3CWOX 4LOCA 4RZ4A 3EXRA 3GDMA 4UTWA 3ZFHA 3G1SA 3G1FA 4FNQA 3JR2A 4UFLA 3BW3A 1XUZA 4K8HA 5AB3A 4MY1A 2VFGA 4FX7A 2JK2A 2WNZA 1MO0A 3W87A 1V5XA 3HG2A 3EWWA 1K02A 4UMBA 4FO4A 4UFKA 4WY0F 4UFMA 3LOTA 2CZ5A 4OV9A 1QMLA 5E1QA 2ZZ2A 5C2XA 1FWSA 4WUIA 1SFLA 4D2JA 2QCHA 4FIRA 3CT7A 3DFQA 2BLEA 3W7MA 1JCLA 3G1AA 4HPJA 3EX4A 1P1XA 1I2PA 4I7WA 3D0CA 3UWZA 2V9DA 3F4WA 3FJ6A 2EF9A 3SIZA 1CX9A 3LTSA 3W86A 1G4EA 3O6DA 3RK8A 4DPPA 2RFGA 2C3ZA 3BLIA 3BPWA 5KZDA 4J9JA 4QM1A 2C18A 3TXZA 1TPEA 2FPTA 2ZZ5A 1GVQA 3CWNA 3MHUA 4JTSA 4JX5A 2NX1A 1VJIA 4JIPA 2EGZA 2OX1A 3H55A 3C3NA 6TIMA 5LNVA 4DO4A 2VENA 1ZNNA 5D33A 5A5WA 1F73A 2YW3A 2YFNA 3IV3A 4MIMA 4BWLA 4H4IA 4FNTA 1F05A 4FNPA 4R53A 4HHPA 1I2NA 4XTIA 1UB3A 1GPWA 1VS1A 1KLYA 3UWVA 2E5BA 2E6AA 3JS3A 4K39A 3HGRA 3QQ1A 1H7PA 2X2GA 4EOUA 1JRCA 5D2XA 4CNOA 1N7KA 3W72A 3PR2A 4JD4A 5G4WA 3ZS4A 5I3HA 1GVRA 1QO2A 3O05A 1G7UA 4UR7A 1W3IA 4RR4A 1G69A 1LRQA 3S1WA 1I2RA 2O7SA 1SW3A 3QPYA 5CZ0A 2E09A 3RU6A 1ZALA 1Z44A 1TCDA 1OG0A 3M5VA 3W7PA 1D3GA 1S5WA 4EWND 4XBKA 3TSMA 5AHLA 4MFEA 3NL5A 1N55A 5KZEA 1X6UA 4N9CA 3W71A 4JYFA 5DXYA 1WOAA 1TTPA 1TPWA 4X2RA 3RNDA 5G4EA 5CPOA 2C14A 1AW5A 2GOUA 1TYGA 3DI1A 3HGSA 4GWEA 1SFJA 5D02A 4R34A 5EMUA 2QCDA 4ZQCA 2Z6JA 3QQ0A 1WQ5A 3T4CA 3GAKA 3KFTA 3TJXA 2J9XA 4XBSA 4LV9A 2YYTA 5LZLA 2DJLA 1DOSA 3Q37A 1YXYA 3NG3A 3Q2DA 2VEPA 3PY2A 3MYOA 5TBOA 1EP3A 1IGSA 4O15A 1O60A 4UTTC 2QCEA 5TIMA 1B4KA 3NPUA 3S5OA 3EKZA 1JCXA 5F4WA 3T44A 4CNNA 3W1LA 2DZTA 1A50A 1B57A 4K7YA 5G2IA 2V2CA 4AVFA 3NAVA 2NXGA 4AEOA 3CIWA 2NV2A 1NF7A 3LB0A 2P0OA 5L9FA 1VCGA 1KBJA 4GE8A 3DENA 1G6CA 3W1UA 3R5EA 1TPDA 5HUPA 2HMCA 3R2GA 1YPIA 5AN7A 1JULA 1WA3A 2NLIA 3C4UA 3Q94A 1KA9F 1H7XA 3SJ3A 4MY8A 1LBFA 4YL2A 1T8XA 2RHGA 4U28A 3PULA 3I68A 1TJPA 5AFDA 1FWNA 1PCKA 4K36A 3B0UX 5HJLA 3KX6A 3UXAA 4RXGA 2EPHA 5D2VA 2HS8A 4TMBA 1XXXA 3W7HA 3GDKA 4LU0A 2Y61A 3W9ZA 1ICSA 5K9XA 3DI0A 3QJAA 4ZVJA 1IXQA 3KVJA 3TFCA 1H60A 1Z41A 3OA3A 4JYEA 4UTWC 2NXHA 1WBHA 4FX8A 3O6CA 4GJ1A 5BNKA 3TC7A 3N73A 3W2UA 1JQXA 5CZTA 2DP3A 3BG9A 4NJGA 4NJIA 3TH6A 4OU1A 2V0TA 2W79A 3EWBX 2FFCA 2E68A 3W2NA 4PFMA 2NX9A 1R2SA 4LV4A 4O28A 4JNMA 2CZEA 1YXCA 1ADOA 1PE1A 3OIXA 4FNRA 3BLEA 1VPXA 3IGSA 5K9CA 3TU9A 1JUKA 5BMWA 1FXQA 2EKCA 5I3GA 3B4UA 4O1AA 1GG1A 5IM51 3M16A 1RPXA 2ZRWA 4RX0A 1LBMA 5AHMA 1OX4A 3SW6A 3VKJA 4O10A 3PWAA 2Y62A 1QNVA 2ZZ3A 1QAPA 3PUOA 3G1YA 2V2DA 1QFEA 4FEZA 3MI3A 3USBA 3PS7A 1AW1A 4QNEA 1QO5A 4XWUA 3FKKA 5AHFA 1EWDA 3IVTA 4I7UA 5AC6A 2CLLA 4CLMA 4TR9A 4CQAA 4JTUA 1W0MA 3L68A 4UMCA 2RDUA 5LNUA 1JR1A 1PVNA 3P5YA 1VZWA 1I45A 1QDSA 3UWQA 2RH9A 1IF2A 3MP3A 1ZAHA 1J5TA 3G1VA 3IIZA 2I9EA 3DFSA 5KMYA 3SGUA 1WOBA 4ALDA 1AMKA 4ZMGA 1VR6A 4JTKA 7TIMA 2Y7FA 1SO5A 4A3UA 1N8FA 3ANYA 4NU7A 4GUHA 3N9SA 3BGJA 2B7QA 2OMAA 3DXIA 4WXZA 4O1DA 1G7VA 1OFRA 1OYBA 2R94A 2V82A 4AAJA 4OT7A 3CPRA 2A21A 5FF2A 1LP6A 4YLWA 5G1TA 1OFOA 3HG5A 3GVGA 2B0MA 4CQ9A 1F5ZA 1UJPA 2ALDA 2PCQA 4K8EA 3G8EA 2C19A 2J9YA 2BTMA 3NQCA 1CI1A 2Y70A 4W9TA 2ISSA 4BI6A 2QDGA 3WJYA 3T55A 3P74A 4PEKA 4NZJA 1K7EA 1ZAIA 1WV2A 5FI8A 4Y9AA 3W73A 1B9BA 4MJMA 4O0ZA 2TPSA 4N6EA 1RR2A 1QPNA 4WY0A 3AO0A 3NA8A 2ZCGA 1LZOA 3R89A 2FPYA 2A4AA 1LYXA 5K4XA 5F2IA 1S5VA 1ZCOA 2WKJA 4YCOA 1F76A 1YTEA 3SI9A 3VCRA 3W7NA 3IIXA 1VYSX 1ME8A 3W70A 3STFA 3DZ1A 4KWWA 4UTUA 3SR7A 2Q8ZA 3PBWA 3A21A 2FJKA 4NNCA 3GAYA 5F2MA 1Q6LA 1PHWA 5DN1A 1LRTA 4QNWA 3L0KA 4JTIA 4I9AA 5K9DA 3ATYA 1K3UA 3A5FA 3WJXA 4O54A 4RLIA 1H50A 2C1HA 3DFPA 3A5VA 4IMFA 2DJXA 5AYZA 5LGXA 1ZAJA 4E2BA 3F1QA 4DEFA 1TO3A 3QW3A 4QSHA 3W7RA 3WFAA 3NPXA 1XDMA 2YPIA 3VFLA 3W07A 1G4SA 4RKAA 1V7YA 3TXVA 3W7OA 4Z0SA 4YMZA 1RD5A 4LWWA 3NYZA 3STGA 1DORA 2A6LA 1SSDA 4IMEA 3NQ8A 4HSOA 3LRLA 2CU0A 5BMXA 3R8RA 3W7QA 3TA6A 3W83A 2H6RA 1W3TA 3ZR4A 4AWTA 1LORA 3TFXA 5ABTA 3N9RA 2ZRXA 3N2MA 4UTTA 1YXDA 1OYCA 2G5WA 1UBSA 5LNRA 3B8DA 4QJ1A 1U5JA 3STEA 2GVGA 2WPBA 2I14A 3TQKA 5K4ZA 1I8JA 4O50A 5F2GA 1VLIA 3MP5A 3PSWA 1TPUA 2VEIA 4LS0A 4QAIA 2E1DA 1EIXA 3ABSA 4KFPA 1XCFA 1J2WA 1WDWA 5AC7A 2XN1A 4LY8A 3B04A 3PBYA 1TTQA 2NUWA 2TMDA 1IIGA 1QR7A 2QAPA 3FOKA 4IWWA 4JTHA 2X1SA 4RCXA 2Z0IA 2FTPA 4IX2A 4LS1A 3W85A 4JTJA 4O8RA 4DELA 5HWNA 2ZA3A 3UPWA 3PUDA 3WJWA 3GNNA 1THFD 2A2IA 2QCGA 5U7SA 1W5MA 1D9EA 1FX6A 4WZHA 4K7VA 4LRSA 4Y90A 3EWUA 3MWAA 2V2HA 4MYXA 3QSRA 5EA9A 2TSYA 3CEUA 3L66A 1M7OA 4Q32A 5FF7A 4QQ3A 4LVBA 3DBPA 3M6YA 3LBMA 3NL3A 3W1PA 4UIOA 1AL8A 5HWMA 2FIQA 1XI3A 3QYQA 5AYYA 2H3BA 3NEVA 3M43A 5J5RA 3CC1A 2RDWA 3W2LA 3LLDA 2ATSA 2ZYFA 3KVMA 4IOTA 5D03A 3LM7A 1L6WA 4NJJA 2ABBA 4OV4A 1MXSA 1OK4A 3UWUA 4Z1AA 1TRIA 4N02A 3S5ZA 4GNJA 3LGEA 2Y89A 2JKAA 2X30A 2VC6A 2TRSA 1TRDA 1DJNA 5D2TA 4N9EA 1M5WA 2WQPA 1TJRA 2VXNA 2GQ8A 1FXPA 1DHPA 1B3OA 4ADUA 3OHIA 1TTJA 1OF8A 3EWXA 2OZ0A 4MJZA 3NQAA 4HNTA 3HG4A 2EHHA 1OFQA 3R12A 2OCZA 3LHYA 4AF0A 3CTLA 4RK8A 2QCFA 4UTHA 1YTDA 1XL9A 4GUFA 1DBTA 3M9YA 4NXKA 3W2MA 4A2SA 4LC8A 1VCFA 3W7CA 1W54A 4PC8A 3FS2A 1DKWA 1H7WA 1KFLA 4LT9A 3CQ0A 3BW4A 1QWGA 4OBTA 3IIOA 1LCOA 1VC4A 3N14A 2ZRVA 3TKFA 3O8AA 4CNPA 4EF9A 3C6CA 5CPNA 4DBEA 3TAOA 3UWWA 3G0XA 1FWRA 4A22A 2E5CA 3MUXA 3P82A 4WXYA 1GJPA 3A22A 4O1BA 3KVKA 4PA8A 3GKFA 2Z1BA 3C0JA 4NJKA 3C56A 1MSSA 1KM0A 4KFNA 5CPLA 3L5AA 1VHNA 3QM3A 3LLFA 4O17A 1P0KA 3IVUA 2B7PA 5EYWA 4OGZA 1VLWA 1GZGA 4HPXA 1Q6QA 3BG5A 3LXBA 3N3MA 3WJSA 2NV1A 2NWSA 2ZZ7A 1BKSA 4WOZA 3E12A 1TQXA 4MKNA 3TK7A 5HINA 2G97A 1OHLA 4OQVA 4XKYB 2VEKA 3JRKA 4ZQPA 4DF2A 2J27A 4RV8A 1NF0A 3O15A 1EUNA 1TREA 4JN6A 3TCEA 3HB9A 1W31A 3LV6A 1A53A 1L2UA 3RF9A 3BVJA 3W2JA 4L4LA 1AL7A 1KBIA 1L6YA 1NAL1 3IRDA 3B06A 1I4NA 1HO1A 3LBCA 3U6WA 3NQ6A 1G4PA 4NZFA 3C8FA 5HQEA 5TQLA 3GNDA 3ABQA 3GR8A 2ISWA 2QUUA 3A9IA 5G1YA 1SQ7A 2QCCA 5BRBA 3W84A 4IJBA 5HWJA 4XTDA 2DZWA 3NVTA 3HJZA 3TJLA 4OHQA 1JUEA 5LHEA 5J5DA 3LDVA 3Q58A 3VE7A 3LCWA 1KM5A 4ADTA 3LHTA 1ME7A 1LLZA 2Y6ZA 2FLIA 2AAMA 5FEXA 3S1UA 1MZHA 3W7JA 3O06A 5FEZA 2I1OA 1Z48A 4H6KA 2A7RA 2ZTKA 2VFEA 4TIMA 2W6RA 3W7GA 1LDCA 5HULA 1W5PA 4K37A 3QFEA 4P61A 3LXCA 1K8YA 2E6DA 1O94A 5LKYA 5FF0A 2V5BA 2WSQA 1QPRA 3L0NA 1QPOA 4Y96A 4O4WA 4ZQNA 1H7OA 3FLUA 3N19B 2IQTA 1TPB1 1ZENA 5AC8A 4GC4A 2QJGA 1C29A 1SZFA 4CCDA 1LM1A 1XC4A 3LX9A 3IIVA 2ZBTA 1SO4A 3B03A 1FWWA 1KM1A 4XUGA 4TO8A 3BK0A 3QH2A 2ABAA 4MPQA 4O1CA 1JVNA 4GFSA 3UY7A 2PURA 2PRLA 2NZLA 3EWYA 3NQFA 4O19A 3MYPA 3GX9A 2YDAA 4B5NA 1UUOA 1GG0A 3VNDA 2B7OA 3G1DA 4ZL1A 2ZRUA 1XKYA 2G96A 3G8RA 5AHIA 2Y85A 3WK0A 4DXVA 4Q33A 1BWKA 4GUIA 3EXTA 3YPIA 3S42A 1VQTA 5T26A 3W6YA 1ONRA 4LVDA 3VE9A 1XBZA 4K6AA 3NNTA 4R33A 3HGJA 2Y88A 3STCA 3S0CA 5DLCA 1XM3A 3NQ7A 2Z2UA 2GQ9A 4YCPA 1TTIA 1W5NA 2PRMA 1X8FA 2PC4A 3W1XA 1JCMP 2P1FA 4CQ8A 4UTLA 1YADA 2JGQA 5DBUA 4Z1DA 1FDYA 3EWZA 2GVJA 1EP2A 3DHDA 1UCWA 3P67A 1KM4A 3TSBA 4DO5A 4S2CA 3G0UA 2QR6A 1T99A 4FXSA
chains in the Genus database with same CATH superfamily
2ZUUA 1XYAA 1QI2A 1YTKA 2YYUA 5DO8A 3OG3A 3FHQA 3CNYA 3WD3A 1SZEA 5HR6A 1GT8A 3SUSA 1GVFA 5TD4A 3HJEA 5CZKA 2X0SA 2V5KA 3VINA 4M5PA 1UC4A 4DBSA 1VIWA 3H2FA 3WBXA 2DUXA 4JTLA 3GFXA 3TW6A 3PFMA 1E6QM 3NOEA 3W7DA 3BSMA 4IFKB 1C8QA 2WZEA 4NNBA 7PTDA 5CSSA 1XRSA 3GHSA 1HW6A 1YEYA 3PFRA 3CV6A 3PG9A 2HRWA 2Y8VA 3G3MA 2WVUA 1TWDA 1OF6A 3AYRA 4WGHA 2WO5A 4XKMA 2QCDB 3EA2A 4H8HA 2BY1A 2DORA 3E38A 3W76A 2YR1A 4BI5A 2B31A 1XBVA 1PCWA 4MUZA 3EDFA 3LCLA 3SRDA 2PGEA 3O16A 4NZ5A 1B5TA 1PXGA 3MB9A 3QMTA 4DNHA 3PZGA 1IEQA 1QPQA 5D8WA 1QHPA 1VF8A 5KTLA 1CXFA 1B9ZA 1AH0A 2R91A 4ZTXA 4ZQRA 3HFTA 2Y4SA 4TVCA 4KMQA 3QTGA 2QDHA 2ODOA 3WMBA 2JALA 4QROA 1J0YA 4DWDA 4E8GA 1ICQA 4B16A 4CEUC 4YXGA 4N9BA 3QGVA 5BWAA 2G41A 5HAOA 1KW1A 3UWYA 1J10A 3FKRA 1H5YA 3HPAA 4PCPA 3NGJA 4I9MA 4UFHA 4IIHA 3RYSA 1XFCA 2FZBA 4PUUA 3CHDA 4ONVA 3MSDA 4GFIA 3U7VA 4GKTA 3P8JA 2UBPC 2ZDRA 4P7NA 1S2UA 1OFBA 2XPKA 3NL6A 4M6QA 2QJJA 5CC7A 1TMQA 4BI7A 4EF8A 2A3CA 5A6BA 5A6MA 3DBNA 3KP1A 1W8SA 3WG6A 4KGLA 1UD3A 4AIUA 4HT3A 1QCWA 2HXTA 1HT6A 2VR2A 5C54A 3BMWA 3RCNA 3G1HA 3CIVA 6XIAA 4EPEC 4KEMA 5DMNA 2CHNA 5EKYA 5ENLA 1OGBA 1LG1A 3AWOA 1HJQA 3LHZA 2V3DA 1GQKA 2GVYA 2OT1A 4LEQA 4CU6A 4F2UA 2J75A 2AL2A 3OODA 4NUWA 2QV5A 3PJUA 5E6YA 1IXOA 2PF0A 4XAYA 2R8WA 1OCNA 3QPZA 1JJKA 4HTYA 3MBFA 4MAVA 4MKSA 4MLRA 3UGVA 1DPMA 2HZGA 3DFTA 3KE0A 5D2YA 1JCNA 3WQEA 1CGUA 4UFJA 4CD5A 1MXGA 2RKXA 1UKPA 2QAFA 4C65A 2OYKA 3R0UA 1LL7A 3W23A 2CCRA 2OELA 2DV0A 1GZ1A 4S2BA 1JD7A 1TMLA 3CHVA 3QY8A 4P5UA 4MVAA 1Q85A 3MTWA 5MKGB 3T4WA 3GQYA 1P0NA 4HOWA 1VCVA 2QW5A 3PZVA 2WJDA 4ZTYA 1S2AA 1MQQA 2J88A 4A8NA 3UR2A 5CPMA 1OX5A 1VFSA 3GU1A 3EXSA 4NVTA 1JYVA 4ATWA 3DAQA 3UNDA 1A5BA 7ODCA 4B5UA 4JR5A 3LYEA 5F1UA 3KRUA 1ZBWA 1US2A 5FJPA 1SPQA 3NZQA 2BOFX 4E0CA 1PBGA 5I3JA 1UR1A 5BU6A 4AIOA 4E38A 2WSYA 2W27A 4MNKA 3P62A 2DU2A 1S2WA 5GPRA 4AH7A 3QHMA 1FCUA 3CYVA 3W22A 4LVGA 4Q8VA 1AVAA 1B30A 4WIWA 3VMOA 3ABXA 2VCBA 2EAWA 4K1GA 2V8ZA 2TODA 5IHSA 1XC6A 4LW7A 4YPJA 1YLVA 2PFHA 2CLPA 2G3NA 2O4MA 3VUSA 4LANA 2NSXA 3W88A 2AGKA 1Q13A 1OZMA 2R1PA 1LLWA 2YFOA 5F4SA 4RE4A 4NI3A 3FFSA 3DKJA 3RPMA 2VZVA 3FJ4A 2W61A 2POZA 1BG4A 5H8UA 4U4MA 1DXIA 1G5AA 2J7EA 1GORA 1TVPA 3QRHA 2XHYA 1KR0A 3CASA 3V75A 2Z28A 4UOQA 4DJDD 1TZ7A 1BGGA 3FN9A 2DW6A 2FGBA 3CMGA 3I7RA 4MPKA 3EX1A 1X1ZA 4PUNA 1XIEA 4F40A 4Z2JA 1TUXA 2CW6A 4IM4A 2ONEA 2X16A 4EIVA 2H9AA 2V68A 4RJEA 3VOGA 4DI9A 3KBJA 4RZBA 3ZWTA 4GVHA 1R86A 5AYIA 1K8CA 3RX4A 2DSVA 1PTGA 1EGMA 4HNVA 3HU7A 1I60A 3M0VA 1W1PA 1IXNA 4UWMA 4V1XA 1K70A 2HSAA 2X09A 3CZLA 4IUOA 4HYRA 3SJNA 1FRBA 2YBUA 1WYIA 2J6XA 1RSCA 2V5LA 4Q7NA 1JZ2A 4U2YA 1GUVA 1V8EA 4CU8A 2QCLA 1N2VA 2QVNA 4MOZA 2Q3RA 5A3HA 1QNOA 3LNPA 3B9NA 3NDZA 2X7VA 2VRKA 4EAYA 1R2RA 3SGZA 4PMDA 2HS6A 4C1KA 1QNSA 2DIKA 1AZ2A 3I7QA 1ONXA 2HNEA 1QXLA 3TROA 1W9VA 2J24A 3P7YA 5JU6A 1L9WA 4H6QA 2C0AA 5DRCA 4GIAA 4QS6A 4DWSA 1KBBA 3F4NA 3FGCB 4YWIA 5MHBA 3UJEA 2BBFA 2DZVA 1K8ZA 1UD2A 4PL1A 2OOFA 4JTGA 4D1IA 4R7WA 1PWMA 1T0OA 5GQBA 1GOMA 2MUCA 3WDPP 1H7NA 1EH9A 2OX4A 2V5JA 4KESA 1PIIA 2Y5SA 3CIXA 1S3HA 1BFNA 2QJNA 4AMAA 3NPVA 3E0IA 5A6AA 2H3DA 5E0KA 1UHVA 3N4FA 4LUIA 1IT8A 3MVTA 1DWIM 1PYMA 3ANUA 2ANUA 2Q8LA 1KQYA 3KBSA 2XH7A 4JIRA 4GGHA 5A1AA 1SZGA 4XZ9A 1PL9A 4CNSA 4Q6XA 2GDQA 4ZE5A 4P8WA 3R6IA 3OVRA 4KERA 4DF1A 4DBDA 4NYYA 1TWWA 5DBTA 1YYAA 2PUZA 3EX2A 1H41A 5AHNA 4B3KA 2VFFA 1JYNA 5AKQA 1ICPA 1WCGA 3F03K 3NM3A 2XJ7A 3BOXA 3LTYA 1ML1A 2CLHA 2DFAA 1B3YA 4LBSA 1H62A 5D05A 3F2CA 4O14A 3HQPA 1HP5A 5GNXA 2VX4A 3W7IA 3FY1A 3GDLA 1DL3A 3N25A 2Q6ZA 3H2NA 4F2BA 1QBBA 4DJDC 2C1IA 1OGGA 1Q66A 2ZRYA 3AFBA 1EHAA 4LAZA 4CCEA 2ACSA 2YCKX 3OBEA 1H49A 4ZO8A 3PAJA 3GS6A 4GVIA 2AGTA 5K2ZA 4JNYA 4YYFA 2OZTA 3MHGA 4QJ5B 3KRSA 2VFIA 4AU0A 3OVQA 4AD4A 2VMFA 2QZRA 3GXMA 1SYTA 2WMJA 1SZNA 3SCUA 2RJHA 4B3ZA 4IG2A 4I6VA 4X2PA 3DDMA 1X1OA 3KRZA 1HUVA 1NWTA 3SUTA 3CJPA 3UD6A 3R43A 2YCEA 5IBXC 3S4TA 1P48A 4A3HA 4QFUA 4KKXA 2J13A 1CW2A 2VC9A 3ARRA 2OJPA 4IPJA 4W84A 4JAWA 2UY5A 3FDKA 3WLPA 3WEZA 2X05A 1NP2A 2HXUA 1OFAA 3S2MA 3UESA 4UOZA 3IVSA 2UY2A 1M03A 2Q8XA 3NOYA 3HIJA 4A3QA 2UY4A 1GYLA 5ECUA 5BCAA 5C5YA 3W75A 1JD9A 1VD6A 1UP2A 3TN4A 2XM2A 5BXSA 4FXRA 1A5SA 3RIKA 1LJYA 5E93A 3C2YA 3DN5A 4NNAA 2EEXA 3S2CA 4J35A 2J47A 4W88A 3WQ6A 2QUNA 3N6HA 4ZENA 1EF3A 3W7LA 3QF0A 3NR0A 1XLEA 3BGGA 3ENLA 3IEBA 1MUCA 4B9ZA 1W5QA 2X40A 3U5YA 1UKTA 1NQKA 3TSDA 1OG6A 3BJTA 1OBAA 3LCFA 2G95A 1TIWA 3WEOA 2XG9A 4AWUA 4BK9A 3R8HA 1B54A 5JMUA 1WAUA 1RQHA 3EPMA 2WCGA 3OA5A 4YVXA 2YCLB 2ZWYA 3MDWA 4H3DA 3CPGA 1TMHA 3WQDA 3M5YA 3UP8A 3G6MA 2WMIB 3I7SA 3N11A 4LS2A 1BVWA 2EBNA 1M1BA 3WQVA 2G3IA 2WNQA 1WZKA 3CQHA 3KTXA 2VR5A 3BLDA 2PDXA 1VEPA 2HTMA 3BMXA 4RPPA 2QIIA 3WEMA 1HF6A 2Q71A 4ZSTA 4PCNA 1WB0A 3FAWA 2FGLA 2ICSA 3E02A 3VGBA 3WJZA 2C71A 4I8YA 3GFYA 3UXDA 4PMXA 3H54A 1H1YA 2IQDA 4PFHA 3L0GA 2XM1A 2AKMA 4YTRA 1XHGA 5HPOA 2GJRA 4HSNA 3PB0A 3RJYA 3QV6A 1T7LA 3EZ4A 2ZA2A 4O18A 5CC5A 3OGVA 3KVLA 3FEMA 3GU9A 3EXRA 5CQ1A 1QNPA 3ZFHA 1X8CA 3JR2A 3BW3A 2PPGA 4A4AA 3OPSA 5CGMA 3H6OA 1KXHA 4XIAA 2ADAA 3JW7A 4FX7A 5FIPA 4E4PA 4J4KA 2WK2A 4WRHA 3UEQA 1V5XA 3VYLA 3C0LA 4UMBA 5M2FX 4WY0F 1HGWA 4A05A 1CCWB 1QK0A 4H6RA 4IIBA 2QCHA 3CT7A 1JCLA 4DJED 1EIBA 3W00A 3E0LA 4REQB 5IDZA 2FJUB 3OLGA 3F4WA 4Z17A 1PIGA 4X63A 4A8LA 1UA7A 3U7BA 2NQHA 2C3ZA 4PZVA 1XGEA 4R3UA 5KZDA 4J9JA 1HXJA 4Q8PA 3CWNA 2BXYA 1LQ2A 2EPKX 1VJIA 2WC4A 3H55A 3OZMA 4UZUA 3PJXA 2PTYA 3F2DA 5A5WA 1F73A 1KR1A 4NRSA 1F05A 4Q8TA 1I2NA 1XH1A 1UB3A 1VS1A 2J8TA 1W8GA 1F4HA 4K39A 3HGRA 1H7PA 1HNYA 3IACA 1RAKA 4Z1YA 3PR2A 4N7QA 3IJDA 1Z9AA 1GVRA 5I3HA 4JTAA 4CVWA 4DJDA 3GVQA 1T5AA 1SVDA 2WZIA 4CD7A 1LRQA 1JFXA 3WFLA 3RU6A 3EOSA 3KCOA 1Z44A 2E40A 4PCSA 3AYSA 3M5VA 3RGTA 4XBKA 4AD5A 5DXYA 1TTPA 1ZP4A 4X2RA 5AVNA 5CPOA 1AQ0A 2BGQA 5HQLA 5CG0A 2YCJA 2YL5A 3CAQA 3VNYA 2GOUA 1UR9A 1B90A 3RR4A 1X6LA 4YHEA 1SFJA 5D02A 1ZGDA 4PBFA 2QCDA 4ZQCA 2W62A 3QQ0A 1TZZA 3T4CA 3KWXA 3GAKA 4BY3A 2J9XA 3S2NA 3W81A 4D9PA 4RPQA 1GK8A 3Q37A 1YXYA 2Y24A 2IXVA 1V0NA 3WH8A 5TBOA 1QRQA 1IGSA 1FTXA 1O60A 3A4AA 3S5OA 2CIPA 4K1WA 1JCXA 3MKVA 2Z1WA 3W1LA 2FVMA 4EAMA 2HV5A 3G5EA 1HN1A 4IGMA 1L0PA 2P0OA 1KO0A 4GE8A 1TKKA 3RILA 1P7TB 5HUPA 2HMCA 5DQPA 1YPIA 3LQLA 4L1XA 1BKHA 3VO0A 1JULA 1WA3A 1H7XA 3SJ3A 4MY8A 5DRIA 4AEFA 1EO7A 1POKA 2PP3A 4GVFA 3LBOA 3PULA 2YCIX 1S1PA 2OEMA 4IZGA 5AFDA 2NVDA 4LALA 4AVNA 5HJLA 3CL7A 4NG3A 4M6UA 3P3BA 2HS8A 4TMBA 1VAHA 2D3NA 2DQWA 3VILA 3DI0A 3QJAA 4ZVJA 2WWDA 1IXQA 3ZT5A 1MW0A 3W82A 4UOJA 1H60A 4UTWC 1WBHA 4FX8A 3O6CA 4CD6A 1XIBA 4CKQA 1JQXA 1EYEA 1MQRA 4OU1A 2V0TA 4LUSB 2FFCA 1EPVA 3W2NA 3K46A 2E4TA 3F5LA 3T2OA 4O28A 1Q2SA 4S38A 4HA1A 9XIAA 3B4YA 1PE1A 4FNRA 4GIEA 2PZ0A 4D6GA 3WLMA 3BLKA 1VPXA 1R5YA 5K9CA 3TU9A 1JUKA 4XG1A 3WH9A 3B9DA 4GHRA 5I3GA 5IM51 2BHYA 4RX0A 1LBMA 2PBOA 3V7PA 1SR0A 3SW6A 1XGZA 4XD3A 2Y62A 1SJDA 4A3YA 3NIYA 3G1YA 1HJUA 3MI3A 3CQKA 4QNEA 2GJXA 4MNMA 4XWUA 1I75A 1DIEA 1N8WA 1GW1A 4D8ZA 5AC6A 1PTAA 1JZ5A 3ERPA 2NW0A 4CN6A 5LNUA 1JR1A 1VBHA 1VZWA 1CXLA 1QDSA 1RBLA 3UWQA 4AD0A 5GJPA 1ONEA 1UWRA 4MAZA 1NDVA 3MP3A 3G1VA 4KWOA 1ZRQA 1JPIA 2ZOXA 5DMLA 3BL3A 3ITOA 1AMKA 4ZMGA 1VR6A 2XIQA 1CXEA 1FWGC 2HEJA 1BVNP 1N8FA 2L5HA 3N9SA 2CXEA 1J6OA 2B7QA 3E2QA 1UD5A 3NTYA 4O1DA 2DT1A 1O1ZA 4Q4OA 3AIVA 1G7VA 3DG6A 2R94A 5CPTA 1D7KA 5DMMA 3BSHA 2V82A 2XGIA 5FF2A 4Z42C 1MMFA 4YTQA 3BDKA 3HG5A 5A6SA 2JEQA 1QK2A 1G9HA 3AC0A 4G6CA 2I16A 2F6XA 2ALDA 3VFCA 1A0EA 1UMLA 2J9YA 1CI1A 2Y70A 1XD0A 4BKNA 3ORWA 1E3XA 4B15A 1NH6A 3P74A 4IISA 1E1CB 4UB9A 4LBRA 1AJ0A 4DHGA 4Y9AA 1B9BA 2C1GA 3PJWA 1OY0A 4N6EA 4WJXA 3VD3A 1QPNA 3QGKC 3K1GA 3NA8A 3B0YA 1J11A 4MB1A 1LZOA 3R89A 1J0JA 1S5VA 1Y8BA 4YCOA 5HBFA 1A3WA 3SI9A 3WDRA 2HVOA 3W70A 2BVTA 2C0HA 2FMNA 4C6EA 2FJKA 3GNPA 4D72A 4NNCA 3BAWA 3D3FA 1DIKA 5DN1A 3L2LA 3SSZA 1LRTA 1CECA 4DUOA 1E9YB 1YMYA 3ATYA 5K9DA 2IPGA 4O54A 1H50A 3A3XA 3ARWA 2D0HA 3VIOA 3GFZA 2Z7GA 3CH9A 4KBXA 2VD9A 3HZ3A 4E2BA 3F1QA 4DEFA 4IL0A 4F0KA 4I90A 4IL2A 3LZ5A 5JBFA 4C1NA 7REQA 2YPIA 4UQCA 5GJNA 4W7WA 3TXVA 4DXXA 3QR3A 3NYZA 4KH2A 2RGMA 1SSDA 4GKLA 3W29A 4IMEA 3S2JA 1NFPA 2CU0A 1JZ6A 3W7QA 3MV01 2EJAA 1BYBA 1V93A 3N9RA 3A4WA 2G5WA 4IP5A 5LNRA 1V3MA 3B8DA 4WSJA 2YA2A 2GVGA 4G2DA 2I14A 3THUA 4EWJA 4O50A 5F2GA 1S46A 1TPUA 2VEIA 2QGHA 1XCFA 4GXPA 4QCEA 5AC7A 2WZTA 4QEHA 1JPHA 4GCXA 1TTQA 1XIIA 1XLDA 2QAPA 3FOKA 3AZRA 4JTHA 4LYKA 3KZSA 1BXNA 2EG8A 3H7RA 1VBGA 3VNLA 4WDWA 3W85A 4JTJA 4H9YA 3U0HA 3PN8A 5MF5A 3B97A 3BV7A 3PUDA 3WNNA 5C70A 3SN0A 1RCQA 3GTHA 3P14A 2DUAA 3VCNA 1EA9C 3V4BA 1THFD 2A2IA 3S6TA 3TYCA 5I6SA 4WZHA 1GKQA 2FHFA 3EWUA 3BCDA 3MWAA 2V2HA 2PDIA 5EA9A 3AMGA 3C3UA 5GJMA 3V3WA 2QVHA 4DUXA 4EANA 4QQ3A 4LVBA 1FWFC 3J7HA 3NL3A 4G5DA 5CC3A 2OU4A 2FIQA 2H3BA 2R9RA 4DJEA 3M43A 2RDWA 3LLDA 1X97A 1XSJA 2ZYFA 4H8VA 3DHUA 4YVVA 4Z1AA 1TRIA 4N02A 4CVUA 2OSXA 4DB7A 6PTDA 3EOUA 2X30A 4XAZA 1TRDA 1DJNA 5D2TA 3E1F1 4N9EA 1ZCCA 2VXNA 4PUWA 4B2DD 2GQ8A 1DHPA 1L6FA 3HV8A 4FZIA 5M1TA 1RCXB 3NQAA 3IJIA 3R12A 2OCZA 1BQCA 3KS5A 3QGAC 1XL9A 4GUFA 1DBTA 1KBKA 2OFJA 1XF0A 3GVVA 1GONA 4IJRA 3SB0A 3ZSTA 2XH2A 4LC8A 4IIGA 3W7CA 1E72M 3AUJA 1W54A 1UH3A 3F4VA 3MANA 4OBTA 3IIOA 4ZSUA 1LCOA 1FHDA 3CPUA 4X9YA 3N14A 2PLCA 3THCA 2NLYA 4GD0A 3TN3A 3CZJA 4A22A 3P82A 4WXYA 2D69A 1GJPA 5I3DA 1XDJA 4URIA 1DIDA 2VQTA 3C0JA 2OLAA 4XBJA 3LLFA 2PDQA 2J66A 1W3KA 4XZMX 1EDGA 1MW3A 3WJSA 2VI0A 4QE5A 4IP7A 3E12A 4B5WA 1TQXA 3GIQA 3TK7A 1ZQ5A 5FL1A 4BF7A 1BYCA 1W9DM 2BS9A 3A3WA 4ZQPA 3WF4A 4WGXA 2PWVA 5XIAA 1D3CA 5AYBA 1SMDA 3TCEA 1ZBVA 1PIFA 2J7DA 1A53A 1L2UA 1YBQB 1E6SM 3RG6A 3RF9A 1CLKA 4KRTA 4ASTA 1AL7A 5FACA 2PF8A 3DERA 3UJSA 3IRDA 4E8CA 3MQTA 1HO1A 2HISA 2GYIA 3A47A 5D9NA 3U6WA 4K68A 4J3ZA 1KXQA 1UR4A 4NZFA 5TQLA 3WUEA 1IWPA 3AMLA 1A5UA 1SQ7A 5BRBA 3DFHA 2YIHA 4LUTB 4IJBA 4XTDA 1J5SA 2CPUA 3IJ8A 3TJLA 2HE8A 5J5DA 3VE7A 4OTKA 4ADTA 1ME7A 2Y6ZA 1OT2A 2FLIA 3GYCA 5CAKA 4AXNA 1JDFA 2VDGA 4L80A 5FEZA 1WAWA 5ABHA 3AXHA 4TIMA 4A8IA 3HV9A 2GWNA 3LXCA 1CLXA 1K8YA 4XVDA 2E6DA 1LT8A 5LKYA 4AZHA 3QTPA 1XD1A 5FF0A 2V5BA 3ME3A 1HVXA 1KRCC 2NQ5A 2J7BA 2VZOA 3CHCA 4HMDA 2IQTA 1ZENA 4JZ5A 1FKXA 1WXZA 5AC8A 4GC4A 1VIZA 2QJGA 3VIMA 1C29A 3QC0A 3LX9A 1XC4A 4WKFA 2UY3A 2ZBTA 1TG7A 4W8AA 3R58A 2ZWZA 2ABAA 1JVNA 4GFSA 2INEA 2PURA 3N18A 4TTGA 2FMOA 2DZBA 1VENA 4F66A 3K1DA 3G1DA 4ZFCA 2YCLA 3PTKA 2IMRA 4MJ4A 3WK0A 2OZ8A 5T91A 1UKQA 1KCXA 5CBIA 4W7VA 5T26A 3A9BA 3VE9A 2WMIA 4R33A 2EPLX 3NQ7A 5DLCA 1OIFA 2GQ9A 2YKKA 1KRBC 3SQLA 2ZXAA 2PC4A 3W1XA 3D3AA 3SURA 5H8PA 1YADA 1UCWA 1BVZA 1HIZA 3VDHA 1WDPA 4S2CA 3N13A 5CSYA 2XIBA 2ZFAA 2PDMA 1C8YA 3HM7A 4UCFA 2D23A 1EQCA 2NQLA 1BPLB 3M7WA 5BOEA 3CH0A 1UR8A 3CZ8A 4M80A 3UJRA 4P7RA 1H63A 2H8ZA 1A5AA 4GO9A 1QJWA 1R46A 2X7WA 1VEOA 4IXXA 2FQIA 3URAA 3P6LA 4BJHA 2WBKA 1LQAA 4JL1A 5H2ZA 4PULA 4PBEA 4LAOA 1A80A 1UD4A 1UR3M 4GY7A 2Y8KA 2J7GA 2Y7GA 3MJMA 3CUFA 1OD8A 1POJA 1KB3A 4LJ3A 4L4MA 4ZOAA 3DYOA 4TV6A 4YTSA 1WKDA 2Y8UA 1L2QA 3NWRA 1ZB5A 5G5IA 4REQA 3VOIA 2XN0A 2ZUVA 4YS1A 4NXSA 1A3HA 1E9ZB 4BFAA 1FCQA 2CESA 3L4ZA 1ISWA 3HOJA 2E6YA 4D1JA 5T8GA 4IPNB 3QZEA 1Q5MA 2BVYA 4X22A 1MDLA 2G4JA 3SFKA 3VD7A 4AD3A 4JKKA 1C7SA 4RE2A 3R10A 4HTBA 1GOXA 3DKLA 3KZPA 1EFZA 4HJWA 3ZLHA 1QHOA 2G37A 4S23A 1U5VA 3FJNA 4GCAA 4JEJA 3L4YA 3POCA 1I0BA 2NSOA 4PUJA 1XFBA 4L6DA 2EPMX 3SUWA 3N2OA 1GHSA 5C9UA 1E40A 3TX9A 4MF4A 4KWVA 4CNTA 2WOQA 1PZ0A 3WUFA 1UJQA 1R3SA 1O5XA 3CM4A 1TV7A 3PK7A 3Q4DA 4HNNA 1PV8A 4AHPA 2X0YA 1H09A 1U22A 4Q8WA 3VGHA 1EJUC 1TUFA 1EJSC 4D8LA 1ITUA 3A4XA 1OB0A 3FVMA 3KWSA 2CLFA 1B31A 3GLCA 3TMLA 1E55A 1MRAA 3QMSA 4RE0A 1AW2A 1JEZA 2BOGX 3RLVA 4ADSA 4KF1A 1VBJA 3HG3A 1R0MA 3QYSA 4W89A 4P8VA 4D6HA 1EEPA 1DIOA 2C79A 2WZHA 4US5D 3LK6A 4H6EA 3TTQA 3E49A 3L5MA 1KTBA 3M0HA 4JX6A 1EC9A 4POCA 1IZCA 5K7JA 1O95A 2WVVB 1XR2A 3H7VA 1M7PA 3PWIA 4PYSA 2A6NA 2E6FA 3HN3A 3DYMA 2LLEA 5LHFA 3GU2A 3IIPA 4LUJA 3QZ6A 1XBXA 3W1AA 2XVGA 2FZ9A 2YL6A 1E3ZA 1XIGA 1EKOA 3GYEA 3R13A 4HCDA 2D1ZA 1KKOA 1KFKA 3LEPA 4AD1A 3CV1A 4H9VA 2WNWA 3URBA 1VJSA 1AK5A 2GLKA 1LWIA 1ZHAA 3NM1A 2B7NA 3RJXA 1EWEA 2YZ5A 4EPDC 4FNSA 4Q7BA 3AHVA 2XIMA 3PBMA 3T0AA 3S1GA 1D8CA 1O4UA 3CB8A 3KOYA 4UQEA 3UPBA 2REQB 4YWSA 2YZRA 3OGSA 3FX4A 2ZUMA 2GJPA 4JYDA 3FYPA 2FKPA 1MYRA 3NPWA 3N04A 4OKDA 3EPNA 4ZOBA 3DUGA 3LPPA 3OIHA 3L12A 4H41A 3P8IA 2EXOA 4B2DA 5D37A 2OYMA 1E73M 3TUUA 3F4DA 4AD2A 1ECEA 3T7VA 2ZQ0A 3IV8A 1QW8A 1A5CA 2QUTA 3PNZA 1X6NA 3SECA 2C6QA 4N9DA 2BNJA 3FJLA 3DEQA 2NQZA 3SO7A 4IMDA 1QASA 2GUUA 1Q8JA 2C91A 3K13A 2VTFA 4DO6A 1TA3B 2AQWA 3PHAA 3CEPA 1KM6A 3T8LA 1C91A 5HMSA 3HO8A 3TVAA 2VUYA 4P7LA 2E7FA 2WHMA 3FYOA 4JFWA 1XUUA 2GUBA 4IXHA 3UF9A 4Z2GA 3TAKA 1HGYA 4RDWA 1TJ1A 4JIEA 4O16A 5H6HA 2P8BA 4LUYA 5D4YA 2WNNA 2MNRA 4GQBA 3GXNA 3MSGA 1W1B1 2PCEA 4IQDA 3UERA 1ISZA 1TR1A 1UP0A 1OABA 2YDQA 3PTDA 5I07A 3T05A 1R38A 3A12A 1ADDA 2WJEA 3HMJG 4W93A 1WXYA 2NT1A 2VO5A 2YJQA 3E5BA 1CDGA 4AC1X 4UC5A 3PG8A 3I65A 3W25A 5EBAA 3HPFA 3SCVA 2I5IA 1KFJA 5G2HA 4J5NA 2FDSA 4FLQA 3N2BA 4NT0A 3PPFA 3MO7A 3MKKA 3R4IA 4JDBA 4ZA0A 3GC5A 4ZR8A 2PTXA 2QXWA 3ABOA 3ZR6A 5F4XA 1VRXA 5D04C 3S83A 1OQFA 4Q4MA 2VVNA 1EXPA 1M41A 3B0PA 2JIWA 5EY5A 1RH9A 3TP4A 5FKYA 1OVDA 2WM1A 3BH4A 4F0SA 1H3GA 2OO6A 4S3CA 3RRAA 1E1CA 3W1TA 1O1HA 3MCMA 1LOQA 1TPC1 4QAWA 3WLHA 3LN3A 5TAOA 3GBEA 1FCBA 4BS0A 3GNXA 4UR9A 3GHRA 1HQTA 1W91A 4US6A 2O56A 4H7VA 2W5FA 3WH5A 3BOFA 3TOPA 3KL0A 1FH9A 1OC6A 3FSTA 3KOXA 3MUIA 3WLSA 2E8YA 4HU4A 3M46A 3PZNA 4LNYA 2DH2A 3NXLA 4DLFA 4HGXA 1Q3NA 3PC0A 3PJTA 3CV2A 4ECLA 1CENA 2VZSA 1EB3A 2DZAA 3BG3A 3K4AA 4TX6A 4IHCA 4GRSA 3BQ6A 3DFNA 3LY0A 1MQPA 3MMWA 1GVOA 3KDNA 2VOMA 3TQ0A 5DXXA 1JRBA 3T40A 1SO6A 2FTYA 3B8IA 3SGGA 3V16A 4QTGA 3CT2A 4M6PA 4MY9A 2DIJA 1ODZA 4JICA 1W5OA 2QCMA 1EJVC 4XSMA 4JS3A 5BXRA 2WM0A 3QC3A 4C6FA 2R1NA 3NQEA 2XSAA 1GOWA 3QZAA 3TA9A 1HFBA 1IV8A 5KITA 4IGSA 1B3ZA 1DWGM 1QI4A 5G2WA 1V6WA 4FI4A 5A6KA 3IUDA 1YIXA 1SW0A 5CJNA 1R30A 1GKRA 3UYCA 5LA1A 1JGIA 3MMUA 5E0FA 2BGNE 1YW1A 1KTCA 2VELA 1KQZA 3M0XA 1OSEA 3QPEA 4UQAA 4MZ8A 3ZM8A 2E28A 3AS0A 1FH8A 4B91A 1ODUA 1W2VA 2DGAA 4O1FA 5CZJA 4OWGA 4RNJA 2YBTA 3HQ1A 4L56A 4KCWA 3NVDA 3UZJA 3EKGA 2PE4A 2FPVA 1FKWA 1YPFA 2CERA 3EDEA 4DAFA 2BG5A 1TSIA 4MWAB 1RBAA 5HR7A 1UBPC 3QMRA 3A64A 3C2VA 3AALA 5BXTA 3GVWA 1C7TA 2XSXA 2OLSA 2YL8A 1W3NA 4QEEA 3LTPA 2ACRA 1SM9A 3AZTA 2BP1A 1JG9A 2EQDA 4DQWA 3KTSA 1DE6A 1W3JA 3QFWA 3NQMA 1E15A 3DFOA 1A4MA 1U83A 3C2RA 3MUY1 1QNRA 3GXTA 3SCRA 3GG0A 3MBDA 4QISA 1G4TA 1K1DA 3ZJKA 3NZ1A 1QTWA 3CUJA 2VWSA 2OLHA 2QCNA 1JCJA 2VR4A 4O53A 1R3TA 4MG4A 1GOKA 4JNZA 4QITA 1OGSA 1R6WA 4MUPA 2HVNA 5H8MA 2CLOA 3HF3A 1GVSA 3L7RA 4S1FA 3T9PA 3PVFA 4S3FA 1A0DA 4JTCA 4ATDA 2PGFA 3NQGA 4V1YA 3WD2A 3RFAA 2WJFA 4Q22A 2H90A 1EX5A 2O9RA 2P76A 1DE5A 4JQ1A 3ZR5A 4CCZA 4ZO6A 2V67A 1J93A 3M5XA 4C6IA 5FSEC 3KXQA 2ZX7A 1CXIA 1Z7AA 3MC5A 3VDAA 3NQ2A 1IXPA 5HMDA 4XSLA 1F7BA 3I3DA 3C2EA 4JHMA 2NX3A 1IT7A 3RLUA 2J4GA 2XGZA 3DC0A 3NURA 3B0XA 2OYLA 1EZ2A 1WZLA 4O13A 1GGOA 3B3DA 1W1ZA 3LXAA 4H9ZA 5DCEA 3LPFA 2VUNA 1PZ1A 5C71A 2PGWA 1EJ7L 2Y1HA 3EDDA 2OEKA 2QMJA 3G22A 4DY1A 3H2OA 5D9OA 3BARA 2PLMA 4Y8FA 2BSLA 4PTNA 3TE9A 3E2VA 3WO8A 4PUKA 2OZ3A 4YU1A 2ZICA 1H51A 4LVFA 1SSGA 3WDIA 4UXDA 2YX0A 3H26A 3W24A 3LGDA 2CWNA 3E0WA 2WZMA 3BTNA 4LGXA 1ZL1A 2V3EA 4CCCA 4JY8A 1Q7ZA 4GY0A 1LRNA 3N2XA 4XV0A 5D32A 2DH3A 4NAEA 1FCVA 4LF2A 4RZ6A 1W6TA 1GZJA 1YX1A 2Z24A 4IPPA 5FF3A 1R3VA 3CUZA 3ARTA 3N4AA 4JX4A 1YBQA 4C6NA 1XBYA 1GYNA 2O7QA 3RM4A 4FIQA 3PPGA 4X60A 5BU9A 1UC5A 5BZAA 3SCSA 1E56A 4UTIA 2BHUA 3WIJA 5HNRA 4ROQA 4JCLA 3FA5A 2GDVA 1UG6A 1OX4B 2CZDA 4JXCA 1HX0A 4HHHA 5BXPA 7A3HA 4FNUA 3OGRA 1VYRA 3SBFA 4QJ4B 3T8QA 4NI8A 3BLFA 1GYMA 2EKGA 5EBUA 3E5PA 5AYXA 1Q45A 4FHAA 4QIUA 2ATMA 3TYZA 1JUBA 1A49A 2D2JA 4ORMA 4B5TA 3U4AA 3GD6A 3RITA 1M3UA 4I8DA 4N4PA 3GZ3A 4D71A 4F0MA 3A13A 2CC0A 3V1PA 1H61A 3EMZA 3LCXA 1TE1A 4AUBA 2ASHA 1R85A 4KETA 3LRKA 1W37A 3V5FA 2VDIA 1JCYA 1BLIA 4WCJA 3GG7A 3VIIA 3QSTA 3RU8X 4S3KA 1RP9A 4Y8EA 4PODA 1XISA 2Q3OA 1V08A 3QY7A 1GPFA 2DQXA 2E77A 4L9ZA 3R94A 3IK4A 4WSHA 1IZKA 3IJLA 4LOCA 4RZ4A 2JQXA 3GDMA 3R25A 1NTHA 3G1SA 3QQWA 4UFLA 5AB3A 4MY1A 1TFVA 4NY2A 4D6JA 4MGGA 1JFHA 1MO0A 1M65A 3V18A 4RDZA 3WLJA 4R7OA 4YHGA 3LOTA 1ZJBA 1QMLA 1QWKA 3ZLGA 3RXZA 4D2JA 5LA2A 3OW1A 4FIRA 2J79A 1CWYA 9XIMA 1PYFA 3V5OA 2Z00A 4EXQA 5GNZA 4I7WA 3D0CA 4KT2A 3KBVA 2X0HA 2EF9A 3LTSA 1Q4NX 3BC9A 3VGFA 1G4EA 1UIPA 1XCXA 3BPWA 3M0MA 3U48A 1HL9A 3LLXA 1EHNA 3GH4A 1MUMA 1TPEA 2ZZ5A 4CD4A 1K9TA 2NX1A 4JIPA 4UNIA 2OX1A 4NKCA 5IRPA 1ZNNA 4BEQA 1KXTA 5D33A 2YW3A 2YFNA 4NRRA 3IV3A 2A79A 4LBUA 1JI2A 4FNPA 3KL5A 4P8UA 3WLIA 4XTIA 1GPWA 1B3WA 1KLYA 3VOFA 5B7YA 2DEPA 1S38A 3QOMA 1UZ4A 2X2GA 1BYAA 3RRXA 4KRUA 1WNOA 5D2XA 4JD4A 4MWAD 4C6OA 1G7UA 1UR2A 1REQB 3UYIA 1W3IA 2ZADA 3S1WA 4AYSA 1UP3A 1V3LA 4JTRA 1D3GA 1S5WA 3VIFA 2CBUA 4NSBA 2OWWA 5KZEA 3CXOA 4MFEA 1N55A 3AZSA 4LPCA 4F79A 1X6UA 4N9CA 1E4NA 4FR6A 3C5QA 3M0KA 3S6OA 1KC7A 5G4EA 3UJFA 3OVGA 2C14A 2PTZA 3EDJA 1ZS2A 1U1JA 1QBAA 3HGSA 1HJXA 3GTFA 4GIRA 4MADA 5EMUA 3AU6A 1G1YA 3APTA 1V3IA 5HNNA 4Q7IA 7TAAA 4JTDA 3KFTA 1SGJA 2QULA 2YYTA 1NWUA 1IEVA 3QN3A 3P93A 3FYYA 4HPHA 1PUDA 3Q2DA 3PY2A 3MYOA 4GQQA 1EP3A 4O15A 1PO9A 4UTTC 1CBGA 2QCEA 1MDRA 2UZ9A 3RR1A 3EKZA 4JFVA 1PSCA 2VD8A 1J18A 4KGJA 3BE7A 5FJRA 2PDFA 1A50A 3TTYA 5G2IA 5ABEA 4GJIA 4AVFA 1RPKA 3MPGA 2XZ9A 4AEOA 1YHTA 2Z2BA 1XLJA 1KBJA 3DENA 2BB0A 1TPDA 4O8AA 4DVOA 4U5KA 3MU7A 3W02A 3TW9A 2NLIA 3C4UA 3JZEA 1ENUA 3K4DA 3UG5A 1V0KA 4I9TA 4G7EB 4ZODA 1T8XA 4C5ZA 2VZUA 3N2TA 2HE5A 4ZE4A 2A3AA 1PCKA 1Z8AA 3KX6A 3V1HA 4RXGA 2G4FA 5ABFB 4BHYA 4GZ7A 4LU0A 1ICSA 2ACQA 4IQEA 5K9XA 4OOZA 3TFCA 1Z41A 4JYEA 2NXHA 2P3ZA 2F8QA 3TC7A 2GGHA 3REQA 3BLPX 2GGIA 4FMVA 3BG9A 2DSWA 4NJIA 3TH6A 2NX9A 2HPMA 1R2SA 4LV4A 2RUSA 2CZEA 2WVVA 3AIWA 4HZMA 3N4EA 5BMWA 1RJRA 1FXQA 1WDQA 1ITCA 1GG1A 3L2MA 3M16A 1RPXA 1WZMA 3SQSA 5AHMA 1OC5A 2FVKA 5HJXA 1RA5A 1QNVA 3VKAA 1QAPA 1DWAM 3ZQ9A 4FEZA 2V38A 2XZ7A 3PZTA 1QO5A 4WSKA 1GVEA 2YA0A 4I7UA 2SFPA 2CLLA 4NILA 1S3TC 1FWIC 3L68A 2RDUA 1PVNA 1I45A 1R7AA 4MWAC 2P5NA 1EQPA 1IF2A 4EXAA 3U3HA 2VX7A 3WX7A 1SFTA 2G3JA 3H8AA 3IIZA 2I9EA 3DFSA 4RV3A 5KMYA 4LEFA 1XLIA 4JTKA 7TIMA 4IGNA 1SO5A 4DJFA 3VGDA 1FWCC 2GOKA 1V02A 1P0BA 4GUHA 3TYAA 2ZUNA 1MRQA 3T09A 1EBHA 4B5XA 4KIEA 4DO7A 3DXIA 4WXZA 3S9IA 1OFRA 4RL3A 4OT7A 3FCPA 4H2CA 4F2TA 4DLMA 4ZB2A 1XLFA 3APYA 4EACA 2QIWA 3GVGA 4JIIX 1JZ7A 3G8EA 1I1XA 2C19A 3NZGA 5EMYA 3T55A 4PEKA 2Z2AA 1MVYA 3CQJA 1V3JA 4E6MA 3ARPA 1RR2A 4MNLA 1C3FA 3AO0A 5C8BB 3R1ZA 4HOXA 5E09A 3PAOA 2FPYA 2A3EA 1ZCOA 4LAKA 5E0CA 4QXIA 3L23A 3S3GA 4KWWA 8XIMA 4Y9PA 3UG8A 2PWEA 4HCHA 3A21A 3GAYA 1R9XA 4A6GA 2IKGA 4DUWA 4QNWA 1IR1A 1K3UA 1U1HA 3WNLA 4Q8QA 4RLIA 1PPIA 3DFPA 1E4LA 3G1RA 5AYZA 2QUMA 3N29A 2PP0A 1FFQA 3BJSA 5LGXA 4OBSA 1AMYA 2J78A 3NPXA 3M4HA 4I5XA 4XZLX 1G4SA 3WENA 2A3BA 4YMZA 1XV8A 3OO2A 4LWWA 2VGGA 3STGA 3GC4A 4UTFA 4N42A 3LRLA 4GACA 2F38A 1E70M 3FNDA 3GHTA 3AHYA 4OBRA 1W3TA 3ZR4A 3C0SA 1PKMA 3AIBA 4G8TA 3AU2A 4GI9A 2WPGA 2ZRXA 4UTTA 1UBSA 3GY1A 3BAJA 4QJ1A 1U5JA 2Z26A 3STEA 1ISXA 4AZ7A 3TQKA 3KOWA 1YE6A 3TJ4A 1QI0A 1E0TA 1VLIA 1Y7VA 3MP5A 1AQMA 2A3HA 6REQA 2CYGA 1NOWA 2GGGA 1RUSA 4PMZA 3U57A 3EOLA 2P3EA 4AQLA 3RPDA 1LUCA 4RW5A 2EPNA 4UQ9A 2Z1KA 3CTTA 2OXNA 4S39A 3OB8A 1JGMA 4IX2A 1BQGA 3DHPA 4ZEPA 4O8RA 1CGXA 4DELA 2ZA3A 1IR2A 3TONA 3SCTA 4UQDA 5U7SA 3KW3A 5A8QA 1RY8A 3KM8A 4MB4A 4B90A 3QSRA 2TSYA 1H0IA 1XYZA 1YNYA 3CEUA 4QX4A 3EWCA 4QJ3B 4GLEA 3LBMA 4KW2A 2V6AA 4JKLA 3VD5A 1YQ2A 1UW9A 2ATSA 5JH1A 1BF2A 2RJGA 4F9JA 3LM7A 1DWJM 3IRSA 4QE4A 3U9IA 1GOIA 1RJPA 2FH8A 3PZ9A 3SRHA 1C9WA 4ZO7A 4GNJA 3QY6A 2Y89A 3T0CA 2NVAA 1KKRA 5IDIA 1M5WA 3B9EA 5XINA 2VT0A 1YPXA 1FXPA 4FA3A 1B3OA 3GXFA 1OF8A 3EWXA 3EGJA 4DZ5A 4L9YA 2KAUC 1EL3A 4MJZA 1XP3A 3PZUA 3HG4A 4HNTA 3ZOAA 1CGYA 3WL0A 2QCFA 4HNCA 4UTHA 4TUFA 3VDBA 4A2SA 4MWAA 4PB3A 3WFZA 1VCFA 2HJPA 1CT5A 3B8VA 1M53A 4LT9A 3T2PA 3CQ0A 1MI3A 1QWGA 2IPWA 2GK1A 1IEXA 1PJ9A 2AL1A 2ZRVA 1VKFA 3ARUA 3O8AA 3WF2A 1EEXA 4EF9A 5CPNA 3MZ2A 3FVDA 3TAOA 1FWRA 2E5CA 2RAGA 3SUVA 4LSBA 4PA8A 2R1LA 3WQ4A 3MVIA 3SIMA 1R9ZA 4KPLA 1V77A 4KFNA 3N12A 4JFSA 3TZNA 3IVUA 1NARA 1LG2A 5EYWA 4WEVX 1VLWA 3ARQA 4YTTA 4FP1A 3QHOA 3LXBA 3N3MA 2NV1A 2ZZ7A 3BICA 3UVAA 2BY0A 2XISA 5A2BA 5HINA 4QLLA 3GW0A 1XKJA 2G97A 2YA1A 1PB0A 3A3HA 4OQVA 3ES7A 4A8RA 4U31A 1Y5WA 2J27A 1JNDA 1UH2A 3O15A 1EUNA 1TREA 4JN6A 3BVJA 1CXKA 2RGLA 2OGJA 4EE9A 1Z6KA 1FHLA 2AL2B 3CHFA 2OKOA 2VNCA 1I4NA 3E74A 3PZOA 3BAXA 3HA1A 3AI0A 1JI1A 3R0DA 5HQEA 3B40A 1RLCL 3M07A 3GNDA 5LIKX 2ISWA 2R82A 3NEHA 2QCCA 4WDUA 4ROPA 1O66A 2CKSA 2PBGA 5AC5A 5HMEA 3Q58A 1KM5A 3LHTA 1LLZA 4F8XA 3GTNA 4E2OA 3AMCA 3S1UA 4L4PA 3O06A 1PZ2A 2XVKA 1Z48A 4H6KA 1XQLA 2A7RA 2ZTKA 2W6RA 1LDCA 1E1FA 2HBXA 5I24A 3QFEA 3VOJA 2WANA 1NJJA 3T42A 1O94A 3PZIA 5C9WA 1F9CA 1QPRA 1QPOA 2OSYA 3N19B 1JAEA 4TXEA 1SZFA 4CCDA 1LM1A 3SCNA 4LX4A 1E71M 1SO4A 4TO8A 4C7DA 1F3EA 2OGYA 5DANA 4MPQA 4O1CA 2P50A 4D6EA 5A94A 2PRLA 1KWKA 3NQFA 3KCLA 3BZGA 1JCTA 1GG0A 1PX3A 1XKYA 4H04A 3G8RA 5JVLA 2PS2A 4DXVA 1E0UA 1BWKA 3H2AA 3YPIA 3S42A 5IHRA 1ONRA 3VIHA 4LVDA 1XBZA 3NNTA 1M68A 3HGJA 4AZGA 2PAJA 2W91A 2PRMA 1O7AA 4YTUA 9CGTA 1DJWA 1K4GA 2WVSA 1WP6A 4CQ8A 4YYCA 4UTLA 5M5DA 3V0TA 4AIBA 1FDYA 3EWZA 4Q8MA 5G1MA 3BJFA 2F2HA 1AJZA 1DP0A 1ONWA 4DO5A 1CYGA 1T99A 4FXSA 1YE4A 3UT0A 5REQB 2UV8G 4MJ2A 4DM1A 2GJNA 1V6XA 4PE8A 8XIAA 2BODX 5DFAA 1TPVA 1S5TA 4JIHA 2ZUTA 4IMCA 4E3TA 3HMCA 3NDOA 1WXJA 2AMGA 4JTTA 4J7RA 1KTNA 4O12A 4OJYA 5CBBA 3TR9A 4L6HA 1XRTA 2CLMA 3AIUA 1HKVA 3C61A 3I6EA 4F48A 3AAMA 3MT1A 1UIOA 2PD9A 1ZLPA 1RA0A 3GBDA 4P7QA 1NOUA 3MDUA 1DXEA 2E9MA 4P2VA 2W9MA 3P84A 3ISIX 5A69A 3DCPA 1UZHA 3GM8A 3DOPA 4D6IA 4QQUA 4HN4A 1EP1A 3M0ZA 3HPZA 4HIBA 2VHLA 3EX3A 3I3EA 3VUPA 3GSMA 5CXPA 5J04A 2H9AB 3KHDA 2A7NA 3UZ5A 1X98A 3VIJA 2WKGA 1F6YA 3WQCA 3TV8A 4O0QA 4AG0A 2F9RA 8A3HA 3TN5A 1A5NC 3W6MA 2POTA 4YIWA 4Z1BA 2JKEA 2ZDSA 3AXXA 2WWCA 3GWQA 3PM6A 5BRQA 4EKJA 5CCZA 4GYJA 3GDTA 5H91A 4XQ6A 3IGXA 3G2GA 3KBNA 3D5HA 5KZ6A 2XUCA 3LCHA 1G01A 3P2VA 4C6QA 2OO0A 5LSMA 3UWEA 2ZE0A 4BZYA 4A29A 5H1WA 1V51A 2J8GA 4X3ZA 4RZ5A 4NP7A 1B2YA 2A5HA 2PDKA 1ME9A 1H11A 1VYPX 5LA0A 3LQGA 4AZIA 4GUJA 3ZJ7A 2GGJA 4GPNA 1JL8A 2J62A 1W56A 1DQUA 4XK2A 3NQVA 3WZ0E 3MI2A 4S3EA 3I4EA 4P8XA 4C60A 1SUXA 1FDZA 1DV7A 4B4FA 4DYJA 3GR7A 3WELA 1Q6EA 2J77A 2P8CA 1WO2A 4DWSB 3UQNA 3PB2A 1M9HA 1W9XA 2E9BA 2INFA 4H9XA 5JIWA 4FOJA 1OCQA 3PBVA 3S47A 4GG9A 4Z2LA 1HKMA 1LL4A 1CPUA 1FFRA 1QPKA 2CETA 1KRAC 1TJ0A 3C0QA 4OE7A 1IQ8A 2NUYA 4D6CA 3ITXA 4XKYA 1Y0EA 2C8NA 1JQVA 3ITVA 2XH4A 1VFLA 4KEUA 3MS8A 3W0KA 2OT0A 4QR6A 3WD1A 2C13A 5KINA 3VAVA 3UCCA 2OOGA 1M6JA 1WKFA 1K4HA 3AXKA 3WD0A 2HK1A 2X1TA 2PRHA 3APGA 4MTVA 1P5BA 3NSMA 1PWLA 4GXWA 3CL8A 2GDUA 4XAGA 1FWTA 2J8FA 3P0WA 2FB3A 1NDZA 1XJBA 4WOQA 5L6UA 4TU1A 1YDOA 3E0FA 2QKFA 1UD8A 1K7XA 1XPGA 1A3XA 5I09A 2FZ8A 3LSBA 3EKLA 1E43A 4XAPA 3U2ZA 4AZ6A 3H24A 4QLKA 4MDOA 1E0XA 3HQOA 4X0VA 3VKCA 4L9XA 4L1GA 4W5ZA 5HUOA 1AUSL 1NSJA 3WY1A 1KXVA 2WJZA 3GK0A 3AJXA 3MW7A 4PSRA 3M47A 4EVZA 3A4JA 5HXMA 3VX1A 1W1YA 2DT2A 4C6BA 1JF5A 2QNEA 3GZAA 1NEYA 3NQDA 4FLRA 2DVTA 3T78A 1XLMA 2ACUA 4XD5A 1OFPA 3AOFA 4DZHA 3LI0A 3BUVA 1SMAA 1W2PA 1HTIA 1HG3A 2GFTA 2VEMA 5DMYA 2W0UA 3L9CA 3RHGA 5HA7A 3ZVHB 1E6XM 1EC7A 2BZNA 1F6PA 4GMEA 3S5NA 4MZ1A 2R14A 3KOZA 3WLKX 4KQNA 2FFIA 1ZJIA 4IG2B 1VHCA 2F84A 3ATZA 4PCFA 1KNWA 4R27A 5HJYA 1A47A 1Q6OA 1PEZA 4HJFA 4N2YA 2WMGA 4Y2WA 3OBKA 4IMGA 4XX6A 2Z6IA 1FHUA 1T41A 2ISFA 3ZIZA 4O11A 1DJHA 4HVXA 4W8BA 1IWBA 2B4GA 2NQ9A 1DQWA 1TV3A 2RDXA 3QKZA 4HHLA 1IZJA 3L5LA 2KX9A 2DSKA 1PS9A 3W74A 1IIHA 3S1VA 1T96A 4IMAA 1XS2A 4F0LA 2BVDA 1W1VA 5DY3A 3QBUA 3OVPA 3GXIA 3MCOA 3VKKA 7ENLA 3OLDA 2BWGA 3DU0A 3C8NA 3BQ5A 1VGAA 3OP2A 3CBWA 1ADSA 2A85A 4LCRA 4DYEA 2IUZA 4PMYA 3LMYA 4ZXLA 1H7RA 4FXFA 1W1A1 3CAVA 3VNIA 2Y63A 4H9UA 4AZCB 4IFKA 1OX6A 2VX5A 3WBAA 1QOQA 4DBWA 4KEZA 5CG7A 3RO6A 1I2QA 4WJEA 3VMNA 3W1NA 3LHVA 4C6DA 1GWJA 3E2SA 4BEUA 4HYWA 3CZKA 3EA1A 4CD8A 4A21A 3RO8A 5K3VA 2PD5A 2R1MA 1MEHA 5DCBA 2WSRA 4FAMA 4FS9A 5IBXA 2WBGA 3H4WA 4IGHA 3E9AA 3WK1A 3UG3A 3TLQA 2CZVA 4WR3A 3WKZA 2WCAA 3L4VA 1ECQA 3BW2A 1ITQA 5DX7A 4LC6A 3VI2A 1QW7A 1KWGA 3VIPA 5CH9A 3KDOA 2VFHA 3G1XA 1A0CA 1TV8A 2X1RA 1L6GA 1JIBA 3OBAA 2WLZA 5CZSA 3LNMA 3N17A 2ZTJA 5D9MA 2WC3A 3M0IA 1F3TA 4LAUA 2GPTA 4N4QA 4X9SA 1LWHA 1OFEA 2ZVIA 1PHQA 3M1ZA 4HK7A 3CLWA 5C9RA 3DFYA 5EU9A 3NFUA 3IAPA 5LNSA 3CQIA 4B3LA 2V5DA 2XIJA 4BQ3A 4KFOA 4MB5A 3RX3A 1A5MC 5FD0A 3GKAA 4WK9A 3ITGA 2P88A 3THQA 4JBRA 2QF8A 3NXFA 1JAKA 3ZT7A 4TX8A 4E4UA 1NQ6A 3G77A 1W17A 2FYMA 1BRLB 1CTNA 2EJ1A 4ZQOA 1KBLA 2ZC8A 1OK6A 1CZ1A 1UUMA 5CBJA 3UR5A 2BHZA 3W7KA 1J0ZA 2ZZ1A 1BEUA 3SFWA 3WBEA 4FF7A 3N34A 1MFVA 5I7GA 2QJHA 3A24A 1CEOA 2JEPA 2D2OA 1Y5VA 2VVSA 1OM0A 4B5SA 2J7CA 4Q8OA 4R88A 3PZQA 3FSUA 4ZQMA 3BLOA 3P5ZA 4YVPA 4ZB0A 4V15A 1WKYA 1HKIA 2D24A 4MB3A 4UFIA 1LOSA 5EL1A 3NZRA 3L21A 3E96A 1MEWA 3W4RA 4AXKA 4TQTA 4XO6A 1B3XA 2E5DA 2VZTA 1KV5A 1P4CA 1EA0A 3ABZA 4GH1A 2A1YA 2PWHA 2VRQA 4QLJA 1RVGA 3WK2A 2VM8A 3H22A 4QG8A 4Z0JA 2PLKA 4BWLC 3IAQA 2CFFA 1GOQA 2F61A 3SQMA 1RHCA 3VDCA 5MKGA 1V6TA 1NVMA 3RMJA 3WD4A 3R79A 2IPJA 3LI1A 3TQVA 2HPIA 2PDGA 3UJ2A 1WDSA 2CLEA 3LA4A 1S5MA 1FOBA 1IT0A 2ZZ4A 3SDOA 3BAYA 4F9DA 2ZX9A 1UROA 4ML9A 4GOAA 1K6WA 5FEPA 1QI5A 4KIRA 4JTFA 3HGOA 2CHOA 3EB4A 3O0FA 1W3LA 2D2GA 3ZWSA 1UQYA 2VP8A 4M81A 4PRWA 4MM1A 5C0QA 3M41A 2PWGA 4JKMA 3SN4A 4HCLA 3SEPA 4U3CA 5A95A 2V3GA 1ISYA 2JGYA 1CGWA 2PDYA 3TYDA 1D3HA 1EO5A 1VFUA 1MW1A 2YGYA 2XWEA 2QJMA 1TQJA 3A23A 3B8SA 4LVAA 1UWAA 3WLLA 1U1UA 1LBLA 1A5KC 1SJBA 2KZHA 1Y5XA 4L7ZA 2ZX8A 4LRTA 2BMBA 3P81A 3UXIA 5C7HA 2QS8A 1VBRA 5FESA 4JQ3A 4NIRA 1E6RA 2GSJA 3WNOA 4I5RA 3OG2A 1HL8A 4Q4PA 4I6KA 5CPSA 1X1NA 4Y9OA 3ES8A 1YDVA 2V81A 4S3DA 4MLJA 5M3WA 4G7FA 3MMTA 3QHNA 4Z2IA 2CZFA 5I02A 4C6LA 4DI8A 3WNMA 1TB3A 1UASA 1J0IA 4A3RA 3TLLA 1GKPA 4MDPA 2VURA 5B80A 5JUVA 2QYGA 3R11A 1H0GA 3L67A 3T81A 1RBOB 5BROA 4HU0A 2W3ZA 3FXYA 1GTHA 4DWSC 2FZDA 2W66A 1KFBA 4GI8A 4WX2A 5D38A 3ARSA 2PB1A 3TDFA 3RCYA 2C15A 5CKSA 2DW7A 3I3BA 4UNLA 2CLIA 4AWSA 5C7VA 4UNKA 2DZSA 1UA3A 1GEQA 4NX0A 1LOLA 2PGRA 4L65A 5FCZA 3S6DA 3AS3A 4RXFA 3SUUA 1J4EA 1C90A 2Q02A 4L6OA 4IF2A 1JZ8A 4WQ6A 4C5YA 1Q6GA 3BO9A 1XLGA 5JXQA 2EG6A 1O5RA 2GJXB 3VD9A 2WKLA 4UCGA 1VFMA 2HNHA 3B8WA 4I3GA 1KFEA 4DXKA 2VGBA 2ZXDA 2D0FA 1S5NA 5IXEA 2NV9A 4N0RA 1SR9A 3ABRA 3IUHA 3CMFA 4I5UA 2GQAA 2XSBA 3UY8A 1C9DA 4UZSA 5A2CA 3B8UA 2Z29A 4MFDA 4GA8A 4PMOA 1DTUA 1V02E 2X42A 2O55A 3MZNA 4A2RA 4RW3A 4O4VA 1E5NA 2DZPA 5FJJA 2DSZA 2D20A 4FB7A 1JPKA 3CWOX 4UTWA 2O9TA 3G1FA 1UWUA 4FNQA 4K8HA 1OCJA 3CUHA 1U33A 4JCMA 2ZC1A 1R3QA 3FGCA