The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
72
|
sequence length |
208
|
structure length |
208
|
Chain Sequence |
STINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQPEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGTWMVDKKLVTNGEWDEIARLTREIVEQVNP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Designed Riboflavin synthase
|
| publication title |
Accurate design of megadalton-scale two-component icosahedral protein complexes.
pubmed doi rcsb |
| source organism |
Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
|
| molecule tags |
Protein binding
|
| total genus |
72
|
| structure length |
208
|
| sequence length |
208
|
| chains with identical sequence |
2, 3, 4, L, N, P, R, T, U, V, W, X, Y, Z
|
| ec nomenclature | |
| pdb deposition date | 2016-03-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| 1 | PF01081 | Aldolase | KDPG and KHG aldolase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Aldolase class I |
