2QPUA

Sugar tongs mutant s378p in complex with acarbose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
404
structure length
404
Chain Sequence
b'HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGPRYDVGAVIPAGFVTSAHGNDYAVWEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type A isozyme
publication title The 'pair of sugar tongs' site on the non-catalytic domain C of barley alpha-amylase participates in substrate binding and activity
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 140
structure length 404
sequence length 404
chains with identical sequence B, C
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qpuA01
4GINA 1JNEA 3WDQA 4K68A 3OB8A 5A6AA 1V03A 2WMIA 5GNYA 1GOOA 2XUCA 4OOUA 1MQRA 1E55A 1BPLB 1QI5A 3WH8A 1G01A 3T2QA 2VR4A 2VX5A 4JHOA 3BLKA 2VZUA 3WH6A 2FH6A 3T0AA 4BCEA 1CYGA 2ZICA 1WDQA 1UQYA 1C92A 3T2PA 4FNUA 4PRWA 4D6JA 3AYSA 2HISA 3UESA 3SCVA 1V0KA 2ZUVA 1JNDA 4QDMA 4PYSA 4MB1A 4TOQA 3WL1A 4CUCA 1JYNA 4BA0A 3UR8A 3EJQA 1NOUA 3CMGA 3AISA 2Y8KA 1VB9A 4IUGA 1BYAA 2OYMA 1UKTA 4AIOA 4M81A 5EMYA 3ALFA 3MO4A 3TOPA 5HPOA 4IPNB 4Q22A 4M1RA 1RD6A 4W7UA 2YA2A 2OLHA 1JZ2A 5KEZA 3A6OA 4FLOA 1W9DM 2ZWZA 2DT3A 2GSJA 1JZ5A 3HG3A 5LA1A 3QOMA 1BVNP 2DIJA 4P8UA 4YN5A 4ZFMA 2WHLA 5HPCA 4W5UA 2J8GA 3BUPA 4HOWA 1WB0A 1UD4A 1UG6A 3OGVA 4UZSA 2NT0A 3VMNA 2WC4A 1US2A 5EB8A 3U5UA 1E70M 3CHCA 2J79A 1C7SA 3BMVA 1OGBA 2YDQA 3EJTA 1KFWA 2G3JA 4P8XA 1V3IA 1R75A 2EADA 4B3LA 3AS2A 4AZHA 5A6MA 3NCOA 4UNIA 1NWTA 1M53A 4V28A 4Z2KA 1FH9A 1I1WA 1U33A 3AQUA 4BQ3A 4B16A 3VOCA 2WLYA 5IHRA 5E1QA 2WMGA 1VFOA 1OIFA 4JAWA 1K6AA 4D71A 2YKKA 1B0IA 2E0PA 3S5ZA 1ISXA 4GI8A 3VD9A 2WANA 2WMHA 3VIFA 5D9MA 3OLDA 3WF0A 1SZNA 3PTKA 2A3EA 3GNOA 3ARSA 2DT0A 1HXKA 7CGTA 2DEPA 2WC3A 3QOKA 1V3JA 1JXJA 3GM8A 2NT1A 1XD0A 2OYKA 1EIBA 1KGXA 3SIMA 1QHPA 1GUVA 2BY0A 3MUY1 4E2OA 2WVVA 4DO6A 5JBDA 2ZIDA 1WP6A 3EMZA 3B9EA 4J27A 3AMLA 1BLIA 4PMOA 4J7RA 8A3HA 2ZXAA 1WZAA 3EDFA 4LXFA 2E8ZA 3D50A 1J0KA 2JFEX 4GZEA 2O9TA 4DWSC 1WO2A 2WHKA 1H0GA 3NYDA 1GOKA 1UR4A 3LXAA 3WQ8A 3WUGA 1XH1A 1UR1A 3WQVA 4ZE5A 3VGGA 3N17A 2PWHA 1GOWA 3M07A 4JHZA 1GPFA 5CG0A 3GXFA 1VENA 1WPCA 2PF0A 5FOOA 1ZB5A 2WSKA 1BYCA 3A21A 1HX0A 3AHVA 1UH3A 3BVXA 5I23A 1JDDA 1PX4A 3WF2A 1FFRA 3OA5A 3W81A 3D5HA 5IDIA 1B9ZA 4P8WA 3VSTA 2F7PA 3S2CA 2GJPA 3VUPA 2J7CA 3BVWA 2BY2A 1ODUA 4ZE4A 3MI6A 1KQYA 3HMCA 1BF2A 1JAEA 2X05A 2DDXA 2VZTA 3CMJA 4MJ2A 1XSKA 2ZXQA 2WVUA 2MANA 1W9UA 3PZQA 3WF1A 4ACYA 3PZVA 4W87A 1VJSA 1ZBKA 3OZPA 3D52A 4XUYA 2FHFA 1CXKA 3RM9A 5LA0A 3RILA 1B3WA 1UKSA 1GVYA 5M5DA 3SUTA 5JIWA 4H8HA 1HL9A 4P7QA 1ISVA 2CCRA 4V27A 1D2KA 1HJSA 2DSZA 1TMQA 4OJYA 1HP5A 3KZSA 2EPKX 2BFGA 4GI9A 2DT1A 3BUIA 1V02A 4DO5A 2Y24A 3PBGA 3ZIZA 1PAMA 1QWUA 3ARUA 2DSKA 4HOXA 1UZ1A 3OZOA 1TQUA 1WZMA 3VNYA 5M03A 3LX9A 3MUZ1 1W32A 2WWCA 5CPQA 4AD1A 3ZJ6A 4AW7A 2DPEA 4MB5A 1E4LA 2VCAA 2GK1B 4WLCA 1D3CA 3VM7A 1UD8A 1HKIA 5DF0A 1GHRA 5AYBA 1CNVA 3SCNA 3ARXA 1CTNA 3N9KA 5E0FA 1X6NA 2WW5A 2Z1SA 4UFHA 2OSWA 4A3HA 2FHBA 1J01A 2D24A 3QGVA 1JFXA 3TTOA 2J7GA 5A6BA 1TQSA 4PUEA 3WH5A 1W1PA 5C8BB 1R7AA 4CU6A 2D23A 2XWDA 2XVKA 4JFWA 2X1IA 1CGVA 2Z1KA 2GVYA 3ZJKA 1G0CA 1E1FA 4WJXA 3NJ3A 3VTRA 1LL4A 4U2YA 4JL1A 4PMDA 3W37A 3CLWA 5CGMA 2VVNA 4UOQA 1QNQA 4OIFA 1HT6A 1PX8A 1O7DC 2A3BA 3AS3A 4AD4A 3ARZA 3GNRA 2ALWA 3OGRA 3VX0A 5I78A 3W38A 3VD4A 1E4NA 2W91A 3AFBA 2J7BA 3GDBA 1OB0A 3AS0A 3VIJA 1JDAA 1FFQA 1V6UA 2F2HA 3PZGA 2ZX5A 3GH7A 1PS3A 1U2YA 1WKYA 1H3GA 1UH4A 2VC9A 3DX2A 3BSHA 1B2YA 2YOCA 2WCAA 4TX6A 3N13A 4D6IA 4PUDA 4FNTA 1R33A 1DEDA 2O9PA 4S3KA 4W93A 5CXPA 1HJWA 2XIIA 3SCSA 3TTQA 4TTGA 1OT1A 4MNMA 3PZNA 3A4AA 3RMEA 2QPSA 2YDRA 3VDHA 5BROA 1XV8A 1BTCA 2WMJA 4D1IA 4FNSA 2DT2A 2OYLA 2XM1A 2EJ1A 1UKQA 2OSXA 1CXIA 4HPHA 2OWWA 3CV5A 2YIHA 2VMFA 1XYZA 3POHA 4MPKA 5EFFA 2C0HA 3UETA 4W7VA 1ZS2A 1BYBA 3ZM8A 4D6CA 5I2UA 1XGZA 1UR8A 4U31A 3CZEA 3A3HA 3ZJ7A 2CXGA 3L4TA 1SYTA 2CKSA 2W62A 3U7VA 3IJ7A 3K1DA 2ZX8A 2BHYA 1MW0A 2BY1A 4XB3A 4GQQA 1ZBCA 4HA4A 4ATLA 3WDIA 2WKGA 1QPKA 1YQ2A 3AI0A 5ABEA 2V3DA 4CCDA 4QLKA 3BLPX 1C8YA 2BXYA 3AOFA 4AZCB 1BQCA 1V6XA 3BUQA 4ACZA 3WKZA 2DGAA 2CBIA 5BXPA 4HMDA 1VBUA 4A3YA 3WDJA 3ZSTA 1LLOA 2ZWYA 1V3KA 2F7QA 3GNPA 3WD0A 1Q6FA 3WQ5A 3E1F1 2D20A 5CPTA 4Z2GA 2YL6A 4CCEA 4F8XA 1XRVA 1NQ6A 4AD5A 3QHNA 3CC1A 4B9YA 4JFSA 2E4TA 1TVNA 5A6KA 5FIPA 3CZGA 3WMBA 2EEXA 4B3KA 1EOKA 1JDCA 4LYPA 1JG9A 3DYPA 2GUYA 2ZUWA 4MADA 1KGUA 3PZOA 1LF1A 1BG9A 3WY1A 4AEFA 1JL8A 5ABHA 3VILA 4AZ6A 4KGLA 1J0JA 3VGBA 1TQTA 5DT5A 2J75A 4QLLA 2W92A 3KWXA 3WUEA 3K4DA 1V02E 4WKAA 1B3ZA 1W9VA 2GJRA 2E3ZA 2Y2WA 3VM5A 2GK1A 3WNOA 3AMCA 4M56A 1E6SM 2JIEA 4NI3A 5FD0A 3CHFA 1HKJA 3NSMA 4UFLA 4OGZA 3CUIA 3N1AA 1WCGA 1LG2A 2WZIA 1UKOA 5HOSA 3DX1A 2XFYA 1ZL1A 4H8UA 3CPUA 4UFKA 3KL5A 1NH6A 3EYPA 4N0RA 3IAPA 2Q8XA 1GJUA 3J7HA 6A3HA 1PEZA 4MAVA 3GXDA 3NUKA 2UY3A 4W7WA 2JEQA 5AYIA 1EO5A 1PPIA 4BQ5A 4OUEA 1XSJA 4PBGA 2WNWA 3CZLA 3WUBA 5EBAA 4UTFA 1CPUA 3AMKA 4W84A 2X2HA 1ZU8A 3L2LA 2XSBA 5BRPA 3ZMRA 2YJQA 4CD6A 1UZ4A 1GJWA 1R47A 2OWCA 1EDGA 5E9AA 3A47A 2YL9A 2V5CA 2VO5A 2XHYA 2QMJA 4LQ1A 4PMUA 4OKDA 3EDEA 4H04A 1V3HA 1FP9A 1TZ7A 5I6SA 2O9OA 2JIWA 3T0DA 1CXLA 3MMDA 4MNLA 2A3HA 3AICA 2XFRA 4IPLA 4AIUA 1CEOA 3AIUA 3K46A 2ZX9A 3W82A 2V3EA 2F8QA 4JCLA 1F4AA 2GJXB 4UQ9A 2O92A 3RPMA 2D3NA 1GOMA 2G8ZA 2WBGA 4M82A 1K9TA 3WEOA 1L8NA 2J74A 4AZGA 3VGDA 1W1TA 3OLGA 3IJ9A 4NXSA 1MQPA 2CERA 1HL8A 5A6SA 1CLVA 3D51A 4H2CA 3TTSA 2DH3A 2WVTA 3W29A 3KLLA 1GVIA 2ZOXA 1UA7A 1X6LA 1E0WA 4TVCA 3IK2A 2VRJA 3BUBA 1JZ8A 2IUZA 1KXTA 5AC4A 4W8AA 6CGTA 4NZCA 9CGTA 3VU2A 3WQ6A 3LXCA 4ZXLA 3MMUA 3F4VA 3OIHA 2YFOA 5GQBA 3EDDA 5BXRA 1V3MA 4AXNA 4WKFA 3W6MA 3GTNA 1UH2A 4HMCA 2VQTA 4U33A 4GPNA 2D0HA 1CXEA 3ARWA 4PMVA 1E1EA 2E9MA 3RIKA 3POCA 1KTBA 2UY5A 4PMNA 4HPGA 3WMCA 5BXSA 3HG2A 2XVGA 4C7GA 3VSUA 3DDFA 2WB5A 3MSGA 4AZCA 3DDGA 3VD7A 3SCUA 5EFDA 4PCSA 4P7NA 4PSRA 5M3WA 4X9YA 3KL3A 3ZSSA 4E8CA 1JI1A 1HTYA 1SMDA 1GNXA 2J8FA 3H53A 3WBAA 2CYGA 1NWRA 4LPCA 5JBEA 1J9YA 4Z2LA 2VX7A 2BY3A 1HP4A 3VGEA 4PTMA 2BHZA 3FN9A 2WHMA 1MQQA 3W4RA 1PX3A 3ARPA 1HKMA 3RDKA 4Q7NA 1VEPA 4GIAA 2CHOA 4UFIA 3SCWA 1DP0A 2E8YA 3DX0A 4DM2A 5IXEA 1UOKA 1JZ4A 1ITCA 2F1AA 3GBDA 4U2ZA 4CGTA 3ARTA 1V3LA 1PZ2A 4UQBA 3W25A 1JD7A 1QBAA 5AY7A 1R46A 2OSYA 3HJEA 2J25A 3BLBA 1G5AA 4B9ZA 1CXFA 3VX1A 1CGWA 1W3LA 1KXVA 2BXZA 3CUFA 2PBOA 4KGJA 2OW7A 4Y7EA 3WNLA 5I5RA 2YLAA 1C8QA 1EO7A 2W67A 3WSUA 3IGUA 3FAXA 1PIFA 1M04A 5DFAA 2DSVA 4L4OA 1NWUA 2DSWA 1QW8A 1JF6A 1E5NA 2XJ7A 2YFNA 1BSIA 1GCYA 4DUWA 1J11A 4CU8A 4QP0A 3AHXA 3WNMA 3OG2A 2CKRA 4WF7A 4P7RA 1MW2A 3MV01 5IFPA 2C7FA 3GBEA 5BYWA 3N15A 3W28A 3VDAA 5A6JA 4BS0A 5HNNA 1UWRA 1OD8A 1ISWA 1E73M 1VFFA 3K8LA 4TX8A 4HA1A 3BAYA 1UKPA 3EJPA 2VL4A 3VIKA 1KWGA 3ALGA 1VBRA 2VTFA 2X0YA 3PZMA 2W5FA 4CCCA 2QV4A 4D72A 1UUQA 1QWNA 4CD5A 2RGMA 1XSIA 4JIEA 4QCEA 3B8SA 4ACZB 4J3TA 1GQKA 2EAEA 3N12A 2ZXBA 3NDYA 5BRQA 3VKKA 2FH8A 3PTQA 1QVBA 1B1YA 1GONA 3CUHA 4GO8A 4D6EA 2CETA 2GJXA 2F7RA 1XYFA 2D0FA 4TUFA 3WDHA 1Q6EA 1VJZA 3VVGA 1HJUA 3D4YA 2WCGA 3CUJA 1OT2A 1R87A 3JUGA 1XCWA 4UFJA 3AS1A 4R5EA 8CGTA 1UASA 4LYQA 4H7VA 1EGZA 1K9FA 1QNPA 1E9LA 4OBSA 2QF8A 1HF6A 4A4AA 1J0ZA 1E0XA 1Q4NX 1W3KA 4U3AA 1EHNA 3CUGA 3BSGA 5D8WA 3T09A 1H4PA 3U57A 3SCOA 1KCKA 1FH7A 5A2CA 4WSJA 1V0LA 3VINA 1W1YA 3NIYA 3BUDA 4FLRA 2VRKA 1HJVA 2RGLA 4NZJA 3CHDA 2D2OA 4URIA 2D22A 3SCQA 1CDGA 1OBAA 3T2OA 2PWDA 4PMZA 1ZBVA 4DUVA 3CTTA 2WMKA 3EMQA 1OSEA 1BFNA 1J0IA 1ECEA 5I3DA 1E6PA 4IISA 3SEPA 1OM0A 5A8OA 2VR5A 4PTWA 1HVXA 4IM4A 1LL7A 3LPGA 1M03A 2G3IA 4DUXA 1LWHA 3BGAA 3LRKA 1E43A 1FH8A 5D9NA 2CIPA 1WDSA 3LXBA 3BVTA 3FXYA 3VPLA 2YBTA 1OCQA 3U5YA 1C3FA 1KTCA 3PHAA 1JF5A 5BXTA 5CZKA 4W8BA 4HMEA 4HOZA 1OIMA 3VGFA 2HVMA 1W9PA 3VSVA 1A3HA 4AD2A 3L4UA 1FA2A 2ZUMA 3OBAA 3BXWA 1X1NA 1UA3A 5A8QA 1XC6A 1ODZA 4Z2IA 3AYRA 1WZLA 3SUVA 2CBVA 4C7DA 3F5LA 3HZ3A 3LPFA 4FNRA 2VX6A 1KCLA 1GOIA 3DX3A 1CZ1A 4CN4A 1VEOA 2J7EA 3AIRA 1VFMA 1H49A 1V0MA 4CD8A 3PTMA 2W66A 5C71A 4RE4A 3M46A 3RJXA 4W85A 3WDPP 2XVLA 1OGSA 1PJ9A 1KBKA 3B9DA 3HG5A 3WNPA 2IXVA 3RJYA 2PBGA 1XHGA 1ISYA 4DWSB 1NP2A 3M6DA 3SCPA 2EXOA 4CN6A 2AAAA 1QHOA 2JALA 5D9OA 1OD0A 1ZBWA 1RH9A 1RP8A 5CLTA 2VVSA 4CKQA 1AVAA 4M24A 2J77A 3VDBA 4M80A 3EDKA 3HG4A 2XIBA 1B31A 4TVUA 1UR2A 2YL5A 5D9PA 3L4WA 1JIBA 1VF8A 4AMXA 4U5IA 3RO8A 1CGXA 1JGIA 2GDUA 3MS8A 3BVUA 2DH2A 4NZFA 5I77A 5A6LA 4JCMA 4PMRA 2X0HA 2F18A 2DIEA 4J3SA 4QFUA 2ZUSA 5E70A 1KWKA 4AD3A 4MB4A 2WC7A 1XCXA 2WVSA 2F7OA 4OBRA 1NOWA 3ARYA 2XSAA 5JIPA 2OW6A 3A5VA 1E3XA 1MFUA 4J3UA 3WN6A 3WY4A 1WNOA 3EJSA 3BC9A 2V3GA 1CGYA 1LWJA 4LGXA 2EQDA 4ZENA 1NM9A 3S6TA 1H1NA 4PMXA 4WSKA 2BHUA 3S5YA 5A95A 2NSXA 3LMYA 3SUSA 5DO8A 4HZ7A 3RCNA 3QHMA 5AC5A 4WIWA 3A23A 1B3YA 3ZR5A 2ESCA 2JEPA 3SUUA 2JF6A 3CO4A 5F7UA 2VCCA 3K8MA 3D4ZA 3GXIA 5D8ZA 4P8VA 3WBEA 1U30A 5CSYA 1LJYA 5HDRA 4J3VA 2EPLX 2AMGA 3GXTA 4KH2A 1UWQA 1WZKA 1ZJBA 4WKHA 1SFSA 3WUFA 1D7FA 2AOSA 1UQZA 5I24A 4JKMA 4RE2A 2VI0A 3BVVA 5A2BA 2UY2A 1E72M 1GQLA 2VCBA 3BAJA 1TG7A 2QHAA 3VGHA 3MUIA 3NDZA 4F9DA 4AISA 4EAMA 2E40A 3FAWA 3FY1A 4H8VA 3AHZA 5I0DA 3PZIA 4N42A 1VAHA 3B9AA 1LG1A 5HBFA 2VJXA 1EDQA 3TA9A 2XPKA 2CNCA 3WDRA 3A24A 1J0HA 2FE0A 3HN3A 3CZ8A 3G6LA 3DC0A 3THCA 3WD2A 1EDTA 3BAIA 2ZX7A 1K9DA 1CLXA 1R7OA 5GNZA 1EOMA 3UCQA 2PC8A 2EPOA 2X2YA 3KL0A 5FCZA 2D3LA 4TTUA 5ECUA 1HKKA 4XV0A 2QMKA 2EO7A 1HJQA 1LQ0A 2CITA 5A69A 4FF5A 3WEZA 3IJ8A 4MAZA 2D0GA 2WPGA 2B31A 1TCMA 2BNJA 4DO4A 2UWFA 2VUYA 3EJUA 4U3CA 3T08A 4NSBA 2BVYA 3TTYA 2J7FA 1UD3A 4F9JA 3GYCA 3ZQ9A 1BGAA 1UR0A 3WFLA 1G1YA 2EACA 3DX4A 1W2PA 3ZT5A 1W9BM 2J62A 3VIGA 3K8KA 1NOFA 3F5JA 2GFTA 3DYOA 3CHEA 4LX4A 3KE0A 4R27A 4AEEA 2WXDM 2PWGA 2ZUUA 4E8DA 3UEQA 4PSPA 3CBWA 1HN1A 3AMGA 4JZ5A 1JXKA 4W8LA 1PIGA 3M7SA 5LYRA 2XGIA 4AZIA 5JBFA 1ZJAA 4JL2A 1C90A 2WCSA 4AZ7A 1MXDA 1B30A 3II1A 3UG4A 5CPSA 4JFTA 5ABFB 4FNPA 1QNOA 2XTKA 3BMWA 5LA2A 2PWEA 2VZSA 4D1JA 4H41A 4QAWA 4DWSA 1ISZA 3WENA 1BHGA 3AROA 3LPOA 3UG5A 3HU7A 1UWUA 1O6IA 3AXHA 1W2VA 4DWSD 3FHQA 1CECA 1Q6CA 3APGA 1E40A 2DQXA 1KB3A 5E6ZA 1T0OA 1P6WA 1QNSA 3WY3A 4W88A 3AIVA 1MW3A 1QHZA 1H5VA 5I79A 2X2JA 2E9BA 3FW6A 3CIVA 3ARQA 3BCFA 1M01A 2WWDA 3RM8A 2BV9A 3WD1A 3WQ4A 2XWEA 1I1XA 3SCTA 2FGZA 4W89A 2ZX6A 5CSUA 1DWJM 4Z2JA 7A3HA 3ARVA 1QI3A 4D6HA 3T0BA 3L4VA 5CQ1A 4D6GA 4WK9A 4ZEPA 3CZJA 3GH5A 1V6WA 3SURA 1KGWA 5M17A 3WL0A 3WY2A 1CENA 3WNKA 2YA1A 1L0PA 1DTUA 1EH9A 4NF7A 4MDPA 2VURA 3VIHA 1VFUA 2ZUNA 5A3HA 7TAAA 1MXGA 2A3AA 4HZ8A 1FHDA 4E4PA 1MVYA 1VRXA 1C8XA 2WSPA 1C7TA 4ML4A 4ATDA 2BVDA 1HVQA 4CU7A 4AMWA 2XN0A 4U5KA 2W61A 4LYRA 4AIEA 3AIBA 4QLJA 1B90A 3I3BA 1CIUA 3EJRA 4NXKA 1QI0A 3DHUA 1JI2A 2WMFA 1RPKA 1I75A 1UD2A 3ZT6A 4UR9A 1PBGA 4CVWA 2ZE0A 3N11A 3W0KA 1ESWA 1KR1A 3G6MA 1WAWA 1JZ3A 5D4YA 1UD5A 1HIZA 4OZOA 1DWIM 1CBGA 3WIJA 3VD5A 3CGTA 3PZTA 4XZWA 3W24A 1OINA 1Q6GA 5A1AA 2EBNA 4PTXA 2F1BA 3IAQA 3VIOA 4BZYA 1E6NA 3N18A 4M29A 4D6FA 3ECQA 3AZRA 4TVDA 4JFUA 5E6YA 2EPNA 1R8LA 2G3NA 4PCTA 3GXNA 4DM1A 1IZKA 3AHYA 2W4XA 3D3AA 4NRSA 4D6DA 3A4XA 4FMVA 4F79A 3BCDA 3WELA 5A8NA 2BS9A 3A4WA 3BAKA 1WE5A 1EXPA 1JD9A 2WM0A 3AJ7A 3TONA 4BQ4A 1BAGA 3UERA 1OGGA 3BAWA 4B15A 2FHCA 4PEEA 1JYWA 1H41A 3AXIA 1J12A 3TP4A 4GZIA 4KRUA 2VRQA 3L2MA 2FGLA 4AYSA 1H2JA 3WD3A 3I3EA 2WAGA 3AXXA 2D73A 1E0VA 2X8RA 3FHAA 1KBBA 5FL1A 3O9NA 3THDA 1AQMA 1GHSA 1JYVA 2CBUA 3QHOA 1DWGM 1KR0A 3H55A 1Z32X 1M7XA 4FK9A 3W27A 4PMYA 3VD3A 5CGTA 3SCRA 3TV8A 2PB1A 3PN8A 2J7DA 3PZ9A 3N04A 1TA3B 3AMDA 1JZ7A 4PMQA 1MFVA 4JFVA 3VO0A 1V6VA 3L4XA 1O7AA 2UY4A 2VZOA 4PTVA 3VIMA 4CVUA 1GORA 2E9LA 4CN1A 2X09A 1XH2A 4FLSA 1UWSA 3K4AA 4UQDA 5ABFA 3ZT7A 4TXEA 3CH9A 1W3JA 2IGTA 1TVPA 2XFFA 2C8NA 3MANA 2VT0A 1CWYA 1MYRA 3WF4A 2J7HA 1V0NA 2WYSA 1ITXA 4QCFA 1HWWA 2D1ZA 4AC1X 1UWIA 1TQVA 3W26A 3LRLA 4EE9A 3GZAA 2CBJA 3CZSA 2YBUA 1CXHA 3MMWA 3WD4A 5JUVA 3WMSA 1EQPA 2XN1A 2QPUA 1GOQA 3NSXA 2YL8A 4UZUA 3U7BA 4ZXOA 1E5JA 4GXPA 3W6LA 2J47A 4AMCA 5C70A 4P7OA 4KWUA 3PZUA 4AD0A 5BWFA 1V6YA 5A2AA 1QW9A 4W5ZA 1Q6DA 3L4ZA 3ZO9A 3OLEA 3MSDA 5A8PA 4M8UA 3MV11 3NSNA 4F66A 2WHJA 4X0VA 3O6AA 1TR1A 1R34A 3VIIA 3CZKA 5FL0A 5ABGA 2CESA 4V2XA 3WH9A 4HTYA 4AZ5A 4RE3A 2A3CA 1W1VA 1TUXA 1DWFM 3FNDA 5A94A 3MKKA 1QX1A 1BGGA 1E71M 2V3FA 3VDCA 4YHEA 1DWHM 1B3VA 2IXUA 5A6BD 4C7FA 1GW1A 2PWFA 1WDRA 1QOXA 1QI4A 4UFMA 3EMCA 1UHVA 3F5KA 3DHPA 4L4PA 1C91A 4YPJA 4GI6A 3MUAA 5A8MA 1F4HA 4J28A 4MJ4A 2XG9A 1XD1A 5IHSA 1GZJA 1N82A 2YDSA 4AY1A 3MU7A 1IT0A 6TAAA 5DMYA 4HA3A 3AZTA 4BQ2A 1FHLA 2WMIB 5CJ5A 1HXJA 2G4FA 3LPPA 1HNYA 1YHTA 1B3XA 3AIEA 4UCFA 1W3HA 2BVTA 1G9HA 3VNZA 3SUWA 1UWTA 1JFHA 3KEHA 1J0YA 3WH7A 1A47A 4AYGA 4UOJA 2VZVA 5BCAA 4P7LA 2DSUA 2VX4A 3AHTA 1SMAA 4J3XA 2V5DA 1E3ZA 2QLYA 5E09A 1KQZA 4UQEA 1HJXA 3GXMA 1QBBA 2CEQA 4NRRA 1TFVA 3GXPA 5E0CA 3BH4A 4EANA 4EK7A 3UR7A 1C93A 2XN2A 4J3WA 4XX6A 1CGUA 1Y7VA 2XYLA 1OWQA 3ARRA 1AQHA 1BVZA 4CD4A 1RP9A 5CLWA 3VMPA 1GQIA 4XZBA 4UQAA 4W86A 1H0IA 4MNKA 1EHAA 2O9RA 4OOZA 1AQ0A 4GKLA 5TD4A 3AIQA 1LL6A 1TQWA 1E56A 4HZ6A 1US3A 4MB3A 1E6XM 1G94A 1NWSA 1GQJA 3O2LA 2WBKA 2CHNA 2JE8A 4YHGA 3DECA 5HXMA 2XVPA 4X0NA 5DT7A 2WZHA 2OWXA 1BYDA 1EQCA 2VOTA 1NP0A 5KZ6A 1TA3A 1QNRA 2NW0A 1IV8A 4AWEA 2G41A 4Z2HA 1KXQA 4EKJA 2XM2A 4JKKA 1E6ZA 1CGTA 1E4MM 4MTVA 1SR0A 1KXHA 1R86A 1K9EA 1S46A 2EABA 1EA9C 2CPUA 2YLLA 1XH0A 3KLKA 4GZJA 3WF3A 4CD7A 4FNQA 4S3JA 5GNXA 2F61A 3WEMA 3H54A 3AZSA 3IANA 1JZ6A 3ZOAA 4UQCA 4MNJA 2FDMA 2Y4SA 4MDOA 4GQRA 3WFZA 1H11A 3BAXA 4PN2A 1JAKA 3W53A 2EPMX 1W9XA 2WK2A 3I3DA 3CZNA 3EDJA 3ZR6A 2J4GA 4GO9A 1JYXA 3UG3A 1E4IA 1NARA 4BF7A 1UYQA 4HU8A 3OGSA 3ZJ8A 4HP5A 1V08A 1UR9A 1E6QM 2GDVA 1IZJA 2WZEA 2G3MA 4KMQA 2VQUA 4FLQA 4ATWA 1FP8A 3WQWA 2Y8VA 1W91A 2XGBA 3AIWA 3QR3A 1FOBA 3DYMA 3LRMA 3L4YA 5DEZA 3EBVA 2VNCA 2WKLA 1AMYA 2XVNA 1VIWA 5FKYA 1QI2A 4JKLA 4NX0A 2WVVB 1VEMA 1UD6A 5GPRA 1WDPA 2PI6A 3WNNA 1DWAM 1J18A 2ZUTA 1E15A 2TAAA 3RM4A 1J10A 2W63A 3OLIA 2WLZA 5IFTA 1E6RA 1MWOA 3VIPA 2YA0A 4RL3A 3A22A 4AZBA 1R85A 2JF7A 1H09A 2V38A 3VMOA 1TE1A 4KRTA 1PZ3A 4UOZA 1BG4A 1MW1A 1DHKA 3GH4A 2FYVA 2ZXDA 2X2IA 4HU0A 2J78A 2Y5EA
chains in the Genus database with same CATH superfamily
1BQKA 3T77A 4NKMA 3CUZA 5DMIH 4O2CB 2ZG3A 5JNYA 4AVOA 2EYRB 3I84A 1V05A 4ES9A 2JJTC 1G01A 1BF8A 2NQHA 4JZNA 2V7NA 1BCIA 3E74A 2J73A 3WU1A 1LO0L 3FB5B 2DLEA 1WDQA 4FX8A 2CLVA 3GJEB 4OZFA 2H3BA 1VYPX 4GG6F 4E0RA 4BFNA 3WLHA 2DUXA 5FECA 3B5TA 1HILA 2HVJA 4W9FC 3IGLA 3SE8L 5KTLA 5C0CE 1W1ZA 5TDNB 1U8KA 3SCMA 4F0KA 5F7DA 4N8VA 4NO0A 4M81A 4G6KH 2BWIA 4AWSA 1S7XB 5KEZA 3IFOA 2WINA 1JZ5A 3FMGL 2R4RL 4W5UA 4LRIA 2J8GA 5DDHA 2EECA 4X7EC 4PJGF 5ABTA 1RJPA 1Q13A 2OOFA 2WC4A 1TPWA 3QRBA 4QE4A 3LZPA 5ECVA 1MF2H 5F0PB 1TSIA 4ZQCA 4YHMH 5IOPA 5IEHA 1QRND 3VVVA 4H00A 4YHPA 4W9LC 4CW1B 4PY7A 3D33A 5IB1B 4G7VL 4O50A 4Q9QL 2X4QA 2W65B 1K6AA 2YKKA 3WI9A 2OX4A 5IQLA 5IEKA 2JJSA 5L88H 5FDYA 5B1BB 3Q2DA 1P7QB 1HQRA 5JHLL 3WTUA 3I9IA 4ZX3A 3GM8A 5C08D 2PPEA 2F74B 1U3JA 4DJDD 4C59B 1EIBA 1F4WH 3MUY1 3TVMB 5C0CB 4ODSL 7TIMA 1OYBA 1V6TA 2MH4A 2QR6A 5T5FH 3VOIA 2GY7B 4RMVA 4H88L 1CZ8L 3PANA 4WWKD 4G9FA 3G5XB 4EOWH 2ZZ2A 2MCPH 5FOOA 1AR2A 3E9UA 4X50A 2EYSA 4MMWA 2JKLA 4DVRL 4YIWA 3EO0A 2BY2A 3VFMA 1R38A 3IPWA 4EI5C 2LU3A 2ZXQA 2MANA 5JVLA 1P7BA 1HCFX 2QGEA 1YE6A 3CDZA 1ASOA 2C7UB 2BC4A 1YEGH 1GVYA 1A5SA 3S37X 1WS8A 4K7PH 1K2DA 4OLZH 4QG8A 5HI4C 3KZSA 1BEYL 3P02A 1TFPA 2DT1A 3N50A 4B9CA 3FUHA 3NQIA 2CWNA 2CBTA 3ARUA 4XK2A 3FB6B 2ZZ4A 1KN2L 5M03A 4A2LA 2AQOA 5KG9B 5CHNA 3JU2A 1MUWA 4WLCA 3FO0L 4KMTH 4BA8A 1UUSA 1CNVA 1XB3A 4F40A 3N25A 1BKSA 1CTNA 2OSWA 4A3HA 1GIGH 3L3DB 2J7GA 3TR2A 1OY3B 4P5MB 3RUGF 2FO1A 5JMRA 5K5YA 2DQGL 3H2OA 1RFDL 1BMWA 4K8RD 1J8KA 2B08A 4LGRB 1DBBH 5D7LA 3Q48A 3P73B 1EK3A 1YLVA 1N8WA 4LUYA 3NQ7A 4KOCA 3W38A 3FQTB 5ID1A 2ZZUT 1Q7QA 1N6VA 3OMAB 3DV6A 4R3SA 4ODWA 3TBVB 4A55A 4GH7B 3CYJA 1HH6B 2GTWB 5C09D 1HOCB 2REQB 3IFPA 3EGXB 4R8WH 5CXPA 1HJWA 4YSSA 4TTGA 4QEHA 1DSFH 3CIAA 4HUUB 3JV6B 4UT7L 2WMJA 2QGYA 3CIWA 3KEDA 3QG7L 2DT2A 2WIIA 1FLRL 3LS4H 4FXFA 2JXMB 2JGYA 4O1DA 3HZMA 3B97A 4WDIA 5GS0L 3M7OA 2OTUA 3GX9A 3CMOL 3NZQA 5TE6L 1KYFA 4GKTA 5ESAA 3F00A 4RMRA 3UVAA 3K1DA 1R19A 4H8WC 2A6IA 1XYLA 3M16A 4IMGA 3TBTA 4ATLA 4NNPH 5ABEA 4K3DL 3M0ZA 2XWXA 3BIKB 4GQ0A 2CJSA 1WUEA 1L6ZA 3C60A 3TA6A 5LGYA 5AB3A 3RQ3A 3W7OA 3CX5J 2HPMA 4RA0C 1IL1B 2QDDA 3S4SA 3HGOA 4AB4A 3LY6A 3MXVL 3NMEA 4JO4L 3KPPA 5IESL 2XVBA 4S1QL 1KGUA 5H2BA 5ABHA 3VILA 4AOFA 4KGLA 4MMZC 3CXHJ 1N10A 2CLFA 3MUUA 4NM4H 2GSIB 4AYBA 1FDZA 3CUIA 5KSUB 2D3VA 4ODVH 1JWMB 1ZL1A 2QADC 1PEZA 3H6AA 1TVBA 3EPNA 3IDMA 3VXUA 1OFRA 1YE4A 4UTFA 4MDRA 2XSBA 1H50A 3V5DB 2A6NA 2ZKXA 2VSCA 4MWAE 4TL4A 1UVQB 3MODH 1S9XA 2NOYA 2QMJA 4LQ1A 4L18A 3SR7A 3C2SA 4Z7NE 5J7CC 2PFHA 1TDQA 3IYLW 5FYJH 1TZ7A 4MNLA 2FRGP 2C4FT 3R6IA 3LKOB 3K46A 3GNMH 2BSBA 5H37A 1I3GH 3S8GB 2WBGA 4M82A 2QT3A 4UCGA 2MHAA 3WUWB 1A8JH 4FR1A 1UZ8A 3WCZA 3DI2B 4X6BB 4U1GB 5KVDE 1CLVA 1WAUA 4IIDA 1KNOB 3KLLA 2FJGB 3RX2A 4YXKH 1MFDH 3E80A 3PGCB 5HUOA 4NZCA 4B95C 5PAZA 3R8RA 4PJEE 1WYJA 2O5ZH 2C5DC 2VSKB 1CUOA 4XKMA 5KZDA 1LOSA 4HCGA 5EUKA 2HH0H 4DRSA 4GRLB 3BP7A 1UP3A 1IFRA 3HG2A 4HJFA 3FHEA 1R3WA 2CIKB 2V7HA 1CI5A 3O6MH 1EJFA 4NERA 2P4AB 4PSRA 3S83A 2ATKA 3KCWA 5JIKA 4GIOA 4JTQA 3GHBH 4GAFB 2A5HA 4O2EA 1MVFA 3O6FD 3N9RA 4MWAB 1TTJA 4O58L 3RWCA 3SOBL 3LIZL 1AQKH 2Y7QB 1T7WA 2WV3A 4Z7NB 4XXDA 5AVUB 3LCFA 1IBBA 3FT1A 1OW0A 3GBDA 4AVKA 5IM7B 3UACA 4WTQA 1F02I 4OUUA 2NXYB 4JDVB 1S5IL 2ALRA 1DOSA 2EINB 1FBIH 1PIFA 5CD3A 2ERJB 4L4OA 2NZIA 1E5NA 4Y19A 2R1XA 1J11A 4QOKD 3T65A 3WNMA 4A3QA 4PJEB 4NZTL 3GRBA 3Q6FB 2V2WA 2VENA 4KX7A 4U3HA 4HX1A 2ITFA 1E73M 2E6AA 4ADTA 1OCCB 4TNVF 1G69A 4ONOA 4ZUUB 3Q9PA 3BOLA 4FI8A 3RKPA 5FO9A 3GR4A 2FZMA 1DUYB 1C5CH 4GI4A 5JW3H 1Z3GH 3NQGA 4FYTA 3T6CA 4J3TA 4R4NC 5E08H 5B7EA 1U8CA 4PJ5D 3FFOA 3FSAA 4G8TA 4H40A 3STEA 1FVCB 2X4OA 3HE6D 2R0WL 5E6RB 4FQQB 5E8DH 4P2QE 4BFEA 3US0A 3JUGA 5JXEC 3DFTA 5IVXE 3EYFB 5T8IA 1K9FA 4FHKA 1E4KA 3SN0A 1J0ZA 2UXGA 1O5KA 2ZJSL 2QXWA 5ERWB 1DDHB 1W1YA 3V0WH 4JBSA 3FZUC 3L3JA 2PYFA 4BQ9A 3HUJE 2GGGA 5CJBA 5D32A 3N3MA 4AJ0A 2G3IA 1R5IA 5IB5B 4KNQA 1Q1JH 2CIPA 1LP9A 2EE3A 3EYUH 1E27B 1PFCA 1UURA 4YK4B 4UZGA 3KS0H 5CKSA 3G3LA 3EOEA 2VQ1A 2ZQKA 4D9PA 3S34H 3FCPA 3A4EA 3H7VA 2DQMA 2WO5A 2CBVA 4US5A 4GABA 1IIHA 1AG6A 1VEOA 5ICXB 4P2QB 4CD8A 3HGJA 5IVXB 1OG6A 2X1SA 1WC7A 4JPIB 5B3JE 5ELIA 4L3EE 1NANI 1KENL 2XYBA 2UX6A 5HYIA 2ODOA 2Q8BH 3MBEC 2Y1VA 3V5OA 1OCNA 2WXJA 1K4CA 4KW2A 2AMUA 5JMOC 2FWLB 2GAZB 5DYOB 2W27A 3E2SA 3CFMA 3NZHH 3VDBA 4M80A 3MLXH 3GTHA 1ZRUA 4ZSOE 3GWQA 3HUJB 1YA5A 3SD5A 4AMXA 1VF8A 2VGLM 3ZE1F 4PGDB 2VLRE 4PD4J 1IX2A 5DJXB 4NZFA 3RDTA 3TYEA 2R4SL 3G08A 2F18A 2FZ3B 5C54A 2JJTA 1GHFH 2I9UA 2H0FA 5E70A 4NSKA 1XGEA 1UATA 5IROD 1DBJL 2F7OA 5AYZA 4P57B 4KCTA 4FQ1L 3FBQA 4UTAH 1MFUA 1DQML 1OC7A 1O5PA 2GB2A 3G04A 3X2QB 3GTFA 4LEOB 1F4YH 4LGXA 2GW5A 4LNYA 3RCNA 4K37A 2VLJA 3ZR5A 3I4KA 2YX0A 5JR1L 2ZTKA 4Q32A 4RISH 2BNRD 4ALDA 1E3FA 4E38A 1GYUA 5F1OB 3THML 4EXAA 1CFNB 2NZ9D 4NB7A 2AMGA 3UY7A 1NDYA 2A9DA 1SFSA 2ZWNA 2YGYA 1AJ0A 7FABH 3GHUA 2H9AB 2I7GA 4L3EB 3V7MA 4IM8A 3WEXB 2ZOKB 4N9BA 3IRPX 4IQDA 3L16A 5I0DA 5F7EL 4YDKL 3DUUA 3S5OA 1CMOA 3ABMB 4HUNB 1J48A 5KSBF 3BAIA 4KKBD 2Q6ZA 4UQ3B 5CLZA 1DJWA 2V5KA 5FO7A 4A29A 5GS0C 2VLRB 1FX6A 4LLWA 2VC7A 1O6TA 3KUMA 2DDQH 3WUWG 3OWEA 4GG8A 1XIJA 5ID0B 4MVBC 3M8OH 2FATH 3B5GA 3TE9A 4KRLB 3BQUB 4OFVA 4JQ2A 1H6EA 2YEZA 5LGKA 3ZQ9A 1D5ZA 2OX1A 4ZB0A 2A7NA 1CFMA 4E4UA 3VIGA 1VF5C 3KE0A 5TK4A 5LCVA 2Z00A 4PJ9A 1M6OB 1YYMH 3V4BA 4Z3TA 1IXPA 1JXKA 4KTGA 1SSDA 2WSQA 2DY3A 4JL2A 2BMBA 1MXDA 5HYSB 3RU6A 4JFTA 2JQMA 1QNOA 1ZT7B 2GDQA 4KTDH 1V7MH 2GSMB 4HALA 1CK0H 3UG5A 4DLFA 4Q8TA 5ENWA 1NANH 4GBXD 5C0JB 2OZ3A 1E1CB 3F7PC 5I16A 5F3HA 5C3IA 4GJ1A 4WFGE 4GW5A 3U7YH 3VXNB 4OBTA 4XWUA 4DGIL 3LM7A 3W1MA 2VDNH 5CSUA 2EIZB 3UNDA 3WLWC 1A6UL 5C86A 4KXDA 3IGXA 1JK8A 3T9PA 5TGBA 1X5MA 3N4AA 1WT5A 4ZMYA 3BUYB 4XAZA 3FVMA 3IEAA 3WE1A 4C56E 3LZQA 3LS9A 4Z8FH 3FFCB 3QY7A 3BQVA 4AY8A 1WEJL 4DKTA 4PW3A 3IIXA 4CLMA 3TBSA 4EMZA 4PWGA 1WTLA 2I5GA 4ATDA 2H47C 4Y4KA 4LYRA 3S1WA 4L5FL 4N5ED 3W7EA 3NJFA 3N55A 3T1WA 3WHE1 4MDIB 3AW5A 1AGDB 2QR0B 1ESWA 3EPOA 4PRBA 1ONRA 2ESVD 3ALWA 1DWIM 3F7VB 1QBLL 4YDVA 4FEZA 1UQSA 4WD0A 4S0HA 4HFWA 2HPOA 3EOBA 2B1AH 2JKAA 4LC6A 1OAQL 2VISB 3A4XA 3MRBA 3H6JA 4MMYB 5A8NA 1KRCC 2KQMA 3DLQR 2E56A 2QCLA 4CNSA 3A4WA 3PWPD 2LTQB 3PNZA 3RDJA 2IG2L 3RL1A 3MLUL 3GMPB 1NCCL 3GPSA 5GSVA 2QCDA 2OCCB 2MUCA 1SEBA 2FGLA 3NJGA 4C56B 4ZW6A 1W1A1 3O4LD 1ZE3H 3ELFA 3ILDA 4D7PA 3L4XA 1D6EA 4UTTA 3OGCA 4PHXA 2QUUA 3S8HA 1UZ6E 5HWNA 2E7HA 1NFDF 2D2GA 2DF3A 3Q6GL 3DOSB 3TUUA 3S88L 1JP5A 1SHMA 3W26A 4L64A 1XF3A 5JUEL 4L37A 2XZQH 3QR1A 4R26H 4HULB 3WQDA 1E5JA 4GXPA 4UDUA 3P2VA 4M1CC 1EZVX 1KLFA 1OCJA 2Y25A 1QTSA 3WLJA 1A0QL 4A63A 1CFVL 1BG1A 1B3JA 4ZO9A 1ZY9A 3IMRA 4V2BA 4U1JB 2R1LA 4UYPA 5E8EA 2PZ0A 4HIXL 4C6EA 1OLLA 1ORQB 1DWFM 3EO1B 4IMAA 1B3VA 4D0BA 1RCOB 1RJLA 4ANUA 3KPTA 3QJFA 2QV2A 5DD0H 4QLRA 4I5BB 1BZEA 2GKIA 1BA9A 1XQLA 3G6DH 4Y2DB 1KY6A 4MMZA 1XLLA 1Y6KR 4PP1D 4XBPB 1R5WB 2FSDA 4FN0A 2INFA 5BRZE 4IJCA 3SY1A 2YD3A 1FN4A 3LPPA 32C2B 3ML9A 1W0VB 1UEMA 4AYGA 4LUSB 4R7DA 1HZKA 1NIAA 2DYRB 2X12A 2KT6A 2FQGA 3G9AB 1RAMA 1MCJA 3FQWB 1H6FA 4EANA 4EK7A 4QXTA 1XCQB 2P5ED 2UV8G 4R7NA 2HTLD 2PDBA 1C9DA 4MNKA 2CM6A 4HCRH 3AIQA 3G1AA 2MCMA 1MCQA 2I9EA 1KFGA 5TQLA 3E3QE 4IBSA 3SE3A 4QHRA 2XVPA 4AGQA 3HBPA 2ZWLT 3X1EA 4MZ3A 1J5HA 1OP3H 1UJQA 5JZ7D 1H6UA 4JTFA 2G41A 4ZZKA 5HY9B 4JFPA 4XNDA 4FCHA 4A8LA 2Z31B 1JCMP 2J2ZA 4MNHA 2RKXA 3UL4A 3B8TA 5BRZB 3HGSA 1WQ5A 1YNPA 3ZOAA 3TGXA 4UUJB 1EC7A 5DQJB 2F53A 2QJNA 1IEQA 1CD1B 1BLNB 4CADA 1E6QM 1MSSA 1U1JA 3VFTB 3T6ZA 4XE5B 3H42L 4G7QB 2O6CA 1Q6QA 4XBEH 5G4MA 3BT2H 4DNLA 3DBXB 2UXVA 3LEYH 3KPRD 2IPWA 2MSPA 1R2TA 4NX0A 1SUJA 2H6RA 3VD2A 5GRXG 3VRLF 5FJOA 4XO8A 1SLUA 5HYSG 1F74A 4GUIA 4Q4SA 5G2WA 3V7AG 1A02N 3EXSA 2GBVA 2AEQH 1R85A 1EAOA 2CLKA 4OQVA 1WHPA 4I89A 1NOLA 4ZFZA 5HHPA 1QNVA 1BG4A 2ON3A 3UXFA 4HXBH 2ZXDA 4AG0A 4HU0A 4ZS7H 3ES8A 3QQ9D 3VFNA 2WMIA 3ZKMC 4OOUA 2H3NA 1SHXA 2VDIA 5IFHL 1FAIH 5DJ8B 2B0SH 3QIBC 2VR4A 1D3HA 1YECL 3UPBA 5B39B 4EZLA 3MSYA 1CYGA 2WKOF 3AYVA 3FUIA 5AKRA 2ODHA 3B2VL 3W1XA 4NQED 3QFJD 3CN0A 4ODXA 1TZIB 2YKLH 1JNDA 3MCLL 3O1NA 5CIPA 2YS4A 3WL1A 1JCNA 5H35B 4KEZA 3L9CA 4DP6X 2EIMB 5EBLA 1RIUL 3CMGA 2NNCA 1RZQA 4WY0A 4GQGA 3NEXA 1FFOA 1THCA 4L23A 2V5SA 3ALFA 1MO0A 2AEPL 4Z0BH 1OAYH 4P4RB 1F73A 3RAJL 3CAKA 5CILH 3VFUA 1T40A 3VE9A 1RJRA 3IIVA 1LE9B 4LAMA 2I24N 4Y4FD 5JXEA 2VMDA 4AF0B 1BVOA 3BG9A 3NAAL 3HBZA 2LFGA 4FQLH 5DD5H 5A6IA 4UZSA 1G43A 5ACMA 5J6HB 2P7TA 4AQ1C 3Q8EA 1YADA 4LCCA 3U5UA 2XTJD 2GK0B 1TPH1 2YDQA 3DIVA 3CU2A 4O11A 2HFGH 2R0KL 4FFWD 2DQ6A 2BINA 2NMSA 3T6WA 4F5CA 3TFXA 1RJYB 3RIAK 2JKNA 5L2JB 4Z2KA 1FH9A 1PDZA 3FA4A 3TYAA 4M7LH 5SX5K 2WMHA 3LS5H 5HHXL 5BVJB 2YZ8A 2FQIA 2XN9A 3L3OB 5HYQA 3VXTA 2CLZA 35C8L 4NJHA 4N2AA 1B4TA 4QHUB 1SOQA 1OM3H 5DY2A 5ESVB 4ZD3H 3VW3H 3BZEA 1M7OA 3O2VH 4QJ4B 1YXYA 4BK5A 3GMLA 3ESVF 1N59B 2O9TA 2WHKA 1LNUB 5BV7H 1TJ0A 1E9IA 3F58H 1PYWA 4AMKL 1UCBL 3KNBA 4TSAH 5KYWA 4OV5B 1EUAA 1P2CA 2X4RB 2Z93A 4M8VA 1I1RA 1N4XL 1EFXA 3MBEA 5AOLA 5DN1A 4QJ5B 4DGWC 1AO7E 4P9MH 1EEXA 3RUBL 1RZIB 1JHTB 1VFAB 1DQKA 5DC9B 4XNQB 3SY0A 3ZDXF 1N3NA 5BUPA 3ARGC 4AGLA 3BARA 4UMAA 2HJKB 3S3SA 4N22A 4X7TB 3QWRA 4KK5C 3NH7L 4LRIC 4V27A 4JTDA 1HP5A 3LKRA 4TU1A 4BH8A 2OMTA 4DO5A 5DS1A 3DHDA 4OZGA 4GLEA 3VQMA 3CN4A 2X6CA 3B2PA 4ZUTA 1W32A 3DFYA 1E4LA 1F3XA 2KLTA 2HFEB 2NLJB 2VDKH 2Z4QA 1UB5A 3IMVA 3CVHB 4QXVA 4F57H 5A6BA 4BE5A 2IPTH 1ZT1B 3UJJH 4DN1A 5FYKL 4G5AA 3H2AA 1DQUA 1EWDA 2G60L 2JJSC 2X1IA 1OEZW 4JL1A 2XKUA 4QHNA 4UM8A 4NNCA 2EAWA 2EDQA 1GA2A 1FNGA 2V82A 3BDBA 3VQLA 3E02A 3IDGB 5LSMA 5CEXB 4F3HA 4C90A 1AO7B 5DWUH 4V33A 2EIJB 3AFBA 2F0CA 3AS0A 1GKPA 2QKSA 4LKXA 3SDAC 1OGAD 1UWAA 3B5HA 5JTWA 5T3ZE 1IILE 3SCSA 3ARDD 2FPYA 4WU5A 3EEZA 2DZXA 4D3CL 4JVPA 2ZNWA 2H1PH 2NNFA 1UKQA 4XPGH 3CV5A 2ED9A 5D2LF 3TPUB 4O14A 1AY1L 2C0HA 3BPNB 4HKZB 4ZSTA 5A2FA 4UQIM 6PAZA 1BJ8A 4R4FH 1TVDA 1EJ8A 2OX5B 5KVEL 5BOOA 3V4UL 4PG2C 4HKXA 4OAWA 2PP9A 4EWJA 2IPJA 3JXAA 3VXSA 1CLOH 1XC4A 2Y1YA 1LLWA 4NNYA 1BZ8A 4FQXB 1AH3A 5J5RA 2R0ZL 2Y23A 3EJYC 5DCCA 1F3WA 3VFCA 3ZVHB 2P53A 4OCSH 3MTRA 2FJSA 2PCPA 5FHBH 1G7PB 4AUBA 1Q6FA 2WXRA 4J3OC 2JTYA 2KPWA 3TYUA 5EBMA 4B9YA 2CE6A 3B4NA 1NA8A 3VH8A 3G6JF 5A6KA 5F88A 5EO0A 4Z7VE 4PVBA 3T0XA 5IWLA 2IKGA 4Y1AE 2BOEX 4M7SA 1FG2B 4YXLH 1A6TA 1RPQA 1NEZB 3MA7A 5DEFA 4E9SA 2GTZA 5KYYA 5I1EH 2DTML 1IGTA 5CR1A 3U0HA 4M7TA 4IW4C 3M0VA 4UIKH 3MC5A 4GT7A 4FP8H 5CZVH 3UTSE 3LKQA 2VW6A 3EFOB 1ZIBA 1GYAA 1YNKH 1JVOA 3ABGA 1J1OH 3FSUA 1DVFD 2NUPA 4MAVA 5B39G 2ZP9A 2PRHA 4LL1A 4WUUE 1EO5A 2UYLB 4JR9L 4AH2B 4LPXA 3NTYA 1ZU8A 5IBLD 3HQNA 1I4FB 4XTRC 2PP0A 3KVMA 2Q09A 1U6AH 1EEYA 4YTQA 3USZA 3A47A 5IP4A 5K9QG 1IFGA 1W3IA 3EDEA 4AIBA 4DKDC 1BBJA 3GSQB 1YHPA 3NP3A 4EN2A 4O5LL 1CXLA 1Z9AA 4X9FA 3TLLA 3TT3L 3QXTA 3GG0A 4GYKA 4Z7VB 3W82A 3UWVA 1PNDA 2D3NA 5FA5A 4Y1AB 1ZLWH 5HHOD 3KOYA 3WEOA 3F4WA 1CFSB 3OLGA 4LVOB 1ZFJA 3W9DB 4H2CA 4MJIA 4HBQA 4S11A 2Z1XA 4A21A 1F3DJ 1S5VA 3ARBD 3KYKL 2CALA 5ISZD 5LCVL 3MRDA 3LV5A 1E9PB 2V69A 4P46B 3UTSB 4K8RH 4IQJA 4U33A 2EDOA 1EVUA 3KGTA 3MROB 1G4TA 4G7FA 2VWEE 5IF0B 4YHNB 3LIZA 2DMHA 3VOHA 4WUUB 5GHWL 3BPLB 1ZLDA 4AZCA 1DQWA 4X5XA 5G1MA 3P4NA 1HFUA 1BZ7B 3B9NA 1GNXA 4KEVA 5I0YA 2VX7A 4B5TA 4DZ8A 2AJVH 2BHZA 3NT0A 2PGFA 4HJ0C 5JDSB 4D0CB 3RDKA 4JHUA 4YPGB 4K3JL 1QPQA 1VEPA 5AVHA 4TLSA 3ATFA 3DJSA 1NMAH 5J1TC 1C9SA 2AQPA 3E6FB 2J25A 3FA5A 1CXFA 3ECBA 1JPHA 3WNLA 3ARFB 1NCIA 2PCFA 4JNMA 3IGUA 3C0JA 1J5OL 3BWZA 5HGBA 2HS6A 1XF5B 4MCYA 4B9FA 4XP9H 5AZ2L 4Q56A 1FZKB 4HXAL 1AR1D 3N15A 3B9KC 4NCC1 4TSCH 3IDJB 3ATZA 3CAFA 4MA3A 3ABXA 2NDGA 3DV4B 3T78A 4XVJL 4ZRGA 3ALGA 4JZJA 4YMZA 4L4TA 3S1UA 3MUXA 5J5DA 2BHFA 2JBMA 4K5PA 1O1HA 2XG5B 2HEJA 2QFRA 2MIZA 3T2NH 2YLKA 4PJIF 1MDRA 3N12A 3KXFE 1D6VH 3DGCR 1PAZA 2HG0A 3HVNA 3FN0H 4L8CA 7PTDA 2OBGA 2K3HA 3VCLA 5HI3D 1INDH 4GIPD 3V6OE 1DZBA 4RW3A 3GHTA 1J7VR 4ZZ9A 1BVLA 4UFJA 4N90D 2DQHH 5KVGH 3V16A 1RJZA 5J13C 3HLAA 4H7VA 1RV8A 3FRUB 5A43C 4WO4D 3T09A 4QYOA 3TYGL 2CLLA 1QEXA 3GMMB 5A2CA 3OZLA 3FU6A 4I7VA 5EBGA 4P2YA 1QRKA 4FX7A 3UPRA 5IGXL 1S7VA 1QMUA 5AAPA 4OKVA 1RAKA 1IM3A 4KK9D 4B7LA 3BP5B 4OB5H 4QXGL 3MBXH 1GVOA 1OW0C 3VD1A 2PTTB 2BP8B 2WO4A 4H8WL 2J8OA 4IHBA 2B3RA 5DR5L 1VCAA 1TEFA 1OZUA 5EBWB 1ZV5A 1KFEA 4RNRA 3URNA 3QPYA 1OCQA 1FWAC 5AW1B 3DX7A 4GXWA 3PWNB 3QARA 2C9QA 3NURA 1QU4A 4AD2A 3W7CA 3L4UA 2K9UA 2Y06L 2QPDB 3KXFB 3BXWA 3EGJA 4FZEH 1M05A 3MV7E 5CBBA 3DX5A 1PDYA 3SUVA 2I56A 3HMJG 1CTMA 5DD1L 1AZ2A 4QQ3A 1HH9A 4TLTA 3QFDA 2JK5B 3Q13A 1JN6A 2W66A 2BOBA 4W85A 2Y7FA 3PNUA 3HG5A 3LBOA 4JQ3A 4P3DA 1NP2A 2Z7KA 3V5HB 3GLZA 1V51A 2PR4L 1K7XA 2R0LL 2HRWA 4LV4A 4I77L 3DC8A 3ZQXA 4R2GD 1AQ8A 4XVOA 2ZCKL 3RWGA 5J11B 1BJ1H 1EHKB 1S7RA 3RTQB 4ADSA 4HGMA 4MJ6B 4YHZL 3T1FB 1DQXA 2DLHA 1Y5XA 2VITB 1LD9B 5KS9E 5DZOA 4O2FA 3WMPA 1BSLA 4XN2A 3QIBA 3CN1A 2JKIS 4NRXB 2WC7A 3NVDA 4GA8A 3BW3A 4OM1L 3SADA 1KCUH 1UM6H 2ZYIA 5A3IC 2ALAA 1CGYA 2ACUA 1NBYB 1ECZA 3MRRA 3PABB 1KC7A 3AB0C 1AXSA 1J8RA 3MV7B 4PU2A 4DGYL 2X6UA 4HKJB 4IEFA 1IFHH 1Z9SB 4B5SA 5D8ZA 1U30A 3A4JA 3EBHA 1MJUH 4KH2A 1UWQA 1ZJBA 2DJ4A 2BW5A 4AENA 3IMSA 1XG3A 1E72M 1GQLA 4LLAA 2ARJB 3CXHK 2A9ML 3KBHE 5EOTB 1VAHA 4ODTH 3ZYZA 3HTWA 4QXIA 2OZ0A 3ZZQA 5JOFB 1BIHA 1M3UA 1TPDA 1D3GA 4HBCL 5T3XE 3FUEA 2HLFC 3TWCL 4D9RD 4O8AA 2EPOA 4DOHE 1FUNA 1VPOH 1AHWC 4M6PA 4B60A 1OTSC 3PG8A 4MAZA 2WPGA 1LILA 2BNJA 1RLDA 5FS5A 3CH1B 3OKDA 4DLMA 1UD3A 3G5YB 4WI8A 1M2VA 4FFVD 2POTA 4ZUSB 4LH8A 2ZT9C 3LN5B 3WS3B 4K3GA 1NOFA 4Y90A 3P2BA 1HXMA 3RDTC 1JR1A 3DA0A 2D03H 3C5SB 3U46A 5F9JB 1HN1A 4O16A 1FWTA 1L9RA 2H6PB 3HR5A 5JBFA 2O5YL 4PJXE 4BZ2A 4FNPA 3FTVA 3VKBA 4J2QA 5E6ID 5C3TA 2GABA 4HA0A 3IFNL 4J6RL 2DLIA 3WENA 1OM9A 1G9ML 5G4HC 5I3IA 3ZE2F 3OQEA 2CGYA 4NPKA 3ZHKA 3AIVA 1D5IL 1U22A 1FRGL 1SEQL 3HQ1A 5IJVB 1OX4A 3BN9C 2ZPKH 4RDQG 3HLKA 2OXNA 1G7HA 1WBXA 2C1OA 5LGHL 5D70H 4QE1A 3N1MC 3MRCB 3B3IB 3N42F 3SW6A 4D6HA 1IC5L 4DOHB 1BOGA 3QUZD 4PRHE 2K6ZA 2ZCZA 3ARGA 1VFBA 2DZUA 3VK5A 5E2UL 3QIUD 1QLFB 3EWWA 2Q76A 4P2RD 3WY2A 3QZWB 3O3AA 3FTUA 4UNTA 7PCYA 4NZUH 1W6TA 1C5BH 1H7PA 5E9DD 7TAAA 5J06A 1MXGA 4OY9A 3W0WA 3AT0A 4CQCA 4ML4A 3S37L 1EFQA 4Y16B 4HYRA 1Q9WB 4XCYB 3BXNB 5G2HA 3ZHLA 2A6DA 2Q01A 2CPCA 3VXRA 4ESKA 2CXEA 4JFYA 3KGSA 4PV9B 4NNAA 4PJXB 4PBWD 2G2NA 1WD9A 4J2XA 1SFHA 4S1RH 3G5ZA 2YQ3A 4LCYB 1ZT4B 4LTSA 3FB8A 1CF8H 5C8JB 1SGJA 5GJPA 1YN6B 4CQ8A 2KBGA 4PJ9C 5GJTH 3ZTEA 3CL6A 5CNHA 4KPHL 1MFBL 2NW2B 5IMMB 4UTKA 4YTSA 1U8HB 4QSFA 1XZ0A 2KL6A 4PRHB 1WWAX 3EAKA 1M7PA 3SDAA 5AL0A 5AHMA 3N1GC 1GC1L 3HJ0A 5D55A 3O9WC 3N19B 5FESA 5DS2A 1AZBA 3M17A 3UC0L 2E7MA 4HBKA 4Q4EA 3DO7B 3D09A 2PB1A 3BW9A 4BFAA 4HT1L 2J7DA 2PLMA 4PV8B 1F4XH 4IGBA 4NHCH 1JFQL 4AWJC 5KSAD 4PREA 3PF3A 3KLHC 5FFLA 4MHHI 4UNLA 2X09A 1WT5C 2A9NL 3L5IA 1KBJA 3E5PA 1V7AA 1W3JA 3STPA 3IJSA 2GWGA 3BKML 3LDBC 4R96B 1CWYA 2D1ZA 3GZAA 2R1WB 1R3QA 1CXHA 4FHBD 5CSBA 1EQPA 4PG2A 3U7BA 1TRDA 1A6ZB 4PTUB 4Y4KC 2J47A 4S3EA 1KV8A 1Z5HA 5FC9A 2A2QT 1IVLA 4FZ8L 4K94H 1T0NB 3O6AA 2OO0A 1K77A 3VIIA 5FL0A 5CAKA 5CFAA 4HTYA 4IOIA 3VE0B 4PL1A 5I2IA 2VDOH 4KZEH 3ZTJG 1E71M 2V3FA 4IFKA 4DJFD 4YHEA 2AJZB 2BZDA 4EI6A 3HVDA 3V5KA 1HJCA 3C8KB 1WICA 2FBOJ 4U6VH 5CBEA 4DP1X 4YPJA 2F58H 3KWWA 2EH7L 1ZJIA 1NCDL 5AW5B 2DP3A 1KTLA 1W54A 4PWKA 1QR7A 3KBWA 1V7YA 1DXEA 3GZ3A 1DVZA 5E09A 4JFEE 4QTHA 3DSNA 4PC8A 1YJDH 2ZKYA 1AD1A 3FT3A 3GFXA 4JE4B 1T21A 1HKVA 4WOZA 2QVFB 2ZWSA 3VGAB 1TG8A 4H9VA 4UTTC 5CMAB 2QGDA 3Q8FA 3R1GL 5CJQL 4Z1PA 5DMKB 4AE0A 4PD4K 1EHAA 4AEOA 1GYWA 1YMHA 3GUGA 4JO3H 3B0UX 4RMUA 1XRTA 4NO3A 1TLMA 4PR5A 5D04C 5E2VH 4Y1TA 5BPPA 5CP3H 3BKJH 3IDUA 1C08B 3BP4A 3JUYA 1EX5A 1H8LA 1BYDA 1Y0EA 2Y85A 1WX0A 5D7JB 2OMXA 4MA7L 1E6ZA 1NGYA 3FU9A 3GC3A 1YXCA 1EA9C 4IMCA 3P3RA 4GNKB 4S3JA 3MSPA 3AZSA 3QN3A 1MCNA 3WFZA 3K2IA 2AABL 5LG6A 2PLJA 4OE7A 4BUHA 4D8OA 1UP0A 3KJ6L 4POZD 2E46A 4MXWH 3NCJH 4KZ0A 5HDOA 2KDYA 4G9DA 4WNJA 1XF2A 4JFEB 3ZKXB 1EV2E 2AEIT 1AC6A 4MRBA 4JO2L 1ZLUH 1FE8L 3N4EA 2RBLA 2H6OA 3I9GL 1FL3A 3H85A 3ULAB 1HEJC 3ZL2A 4ZFCA 4L1BA 3HI1B 1DWAM 3D3VA 1KFAH 4L4VA 3LTYA 4P4KD 2L4OA 1E6RA 3W9ZA 2YA0A 4TNWF 1C12B 2WLLA 4PJ7F 2CD0A 4PBXA 1KZQA 3EWCA 3LNHA 2XKNB 1OAKH 1MW1A 4A6YA 2YAEA 4C6DA 2MPAH 5JDJA 2WLIB 3RFZC 5I8OL 1JRHI 4UIMA 1WUFA 3B4YA 3EA2A 1N0XL 1BPLB 4AWUA 2XFXB 4RWYL 4FQCL 1QLEB 4ELMF 4JHOA 1AQFA 3B9KA 1GH7A 3U0PB 4BGDA 3MJYA 3SE3C 3EZJB 1ZD6A 1MWAH 3QZWG 5FDWA 2ED8A 2GTQA 4XP6L 2YCKX 4ZOEA 5AVXB 1ZLVH 3ZE0E 3HE7B 4TOQA 4NQXB 5EN3A 5I71B 5C0AA 1KPVA 3Q06A 1QA9B 3NJLA 4O51A 2NQJA 3CQ0A 4HEMA 4JEJA 5EMYA 1U9KA 5HPOA 3SCMD 3MGAA 3O4OB 1WIUA 1F6AA 3QM3A 5HHVH 2ZWZA 2X0SA 1EVTC 5FYLL 3MA9L 2VXSL 5FCUL 4OM0H 5HPCA 2F8IA 2XJKA 1O5QA 2DIBA 4X5LA 2YPKB 4XPHL 4KHTL 3OGVA 5BOFA 3PHOB 2JCCE 4HIJB 4QHMB 3ULVC 4IG2A 4CQBA 3QFGA 2CKBB 1IKOP 2VXTL 5DHDA 4PULA 4B16A 1PVHA 3BDYH 2WLYA 4L4MA 1DE4B 4L9XA 2R69A 2H0JA 1YTDA 4PP2A 3GNOA 3MNWB 2DT0A 1HXKA 3QOKA 3WIHA 4HWZA 2H8XA 4IGSA 3CC5B 3HFYA 4KZDH 4PLKD 1KELL 2ZOUA 3ZE0B 1YN7A 1EZLA 2ZKHL 1G9MC 3TWBA 1CLZH 3WD5H 3DBPA 4LARL 2DUZA 3RVVC 1XDJA 4LXFA 3G8EA 2FO4A 3F7JA 5CLYA 1NIUA 3OG4B 3RR4A 2BZCA 1TWWA 4JR5A 1UR1A 1NUDA 2ZXGA 4GIRA 3RWEA 4JANA 3V5FA 1MPAL 4XPBH 1XGUB 3Q0HA 3A6CL 5TFSH 1PX4A 3W81A 4FIQA 2JCCB 3AUVA 4ZE4A 1G0DA 3CMJA 3QWOA 4F7MB 5I0ZA 1U58A 3RGVD 1ZBKA 1JRHH 4UMSA 1DQTA 1CXKA 1Z3RA 2XV0A 2X9YA 3WSQH 3D0AA 2I25N 4RX4D 4QHKJ 4KRPD 4OJYA 3H26A 3ETBF 4G3YL 4LCCC 4Q7DA 3EA1A 1UZ1A 5L4FA 3LX9A 3MUZ1 3P4MB 2CLRB 3OHXC 1EERB 2BCKB 1D3CA 1W37A 1GHRA 1TJGL 3N9KA 1RURL 3QGVA 1G87A 4LNRA 4AL8H 4PCNA 3ZWTA 2DM3A 4TXVB 3PV6B 2ENYA 4HIPA 1FV1B 2I17A 4MNGA 2RIKA 3RKDD 4WJXA 4HYVA 3JTBA 1HSBA 1GC1C 3I75A 5CGMA 3KCLA 2F15A 1YDOA 3D06A 2XXMB 4NN7C 3N5AA 2W9DL 4KVNH 4J5VA 4BK5C 2HX7A 4YJ5A 5C6PB 3GMQA 3CBJB 4OFYA 3SDCB 3MLSL 4FNTA 1GTFA 2NDFA 2DKUA 4KKZA 4KWWA 1AHWA 1WFNA 1NCAH 2NNAA 4H9MA 1OZTG 4D1IA 1NPJA 2GITB 2BBFA 3I2CH 1S9VA 4GSDH 2CDGA 1YG9A 3AUJA 4UTBA 3T4CA 1JS4A 3POHA 5I03A 1O9WA 1JPFA 5F1NA 4AGNA 4FOUA 1P48A 1TWIA 2COQA 4M1GH 4HIHB 2W62A 3IJ7A 4EDXA 2FD6H 1TV3A 2HNEA 1R3HA 2EVFA 2BIQA 3WBYA 3B0VC 4AUJA 1QTPA 4QLKA 4U6YB 1QFWL 4DP9X 2C1IA 2BP0B 3C60D 1O75A 2FZ9A 3GNPA 2NX1A 5CPTA 5TNVA 5E23A 5IQOA 3V52L 4X7DC 5AW8B 5JPNB 5BVPH 1EOKA 3CHXA 4APQD 2NQ9A 2ZUWA 4PIBA 4JY4B 3FCTB 4D9QD 5FA4B 2HLEB 3MREB 2BDNH 1MUJA 1KJ2H 2P8LA 4GBUA 4PCFA 2WQAA 5I1DB 3KTXA 1F76A 1BD2D 4XN9A 5DHMC 4BY3A 2P45B 3WNOA 1MHHA 1YEEH 4G6AC 1ZWIB 4XX1E 1KJ3H 5D7IA 1XF1A 4ENEC 1LG2A 5HOSA 5EU6A 2IQ9L 3PBYA 3CLEL 2X10A 4H26A 4ZSOB 3SKMB 2DFAA 3K81A 4IK7A 5C0FA 3VXUD 4F7EA 3L2LA 5L6UA 3GE7A 1N5YL 3DVFA 1ESOA 1QO3B 2QQNL 4AZ8B 3IJEA 2IH3A 3ZVIA 1GJWA 2D7OA 4L3AA 3K4ZA 4Y88A 4DWDA 4RGMB 2G3ZA 4OLUH 4AVFA 3MYZA 5F1SA 1FP9A 2WYZA 2A3HA 4YDMA 4HHAA 1G6RH 3H8NA 2FGWL 4BZ1H 5CC6A 3IIZA 3B8YA 2XXFA 2VFDA 4LKCB 4L6OA 4FXJA 3D05A 1GTNA 1RK0A 2V33A 2WVTA 4YVNA 4YNYA 4TVCA 5F2MA 4BUQA 3O9WA 4LPUA 3GI9H 4W8AA 1WBZB 4TQPA 3WQ6A 2VC2L 2LT9A 3GTNA 1MMFA 2DV0A 1EJTC 1Z9PA 5C07E 5IWLC 4BZ2L 1CXEA 5E6UB 1PU0A 3MV8D 4MBRA 1W3TA 2H32H 2UY5A 3EH4B 4I4WA 2MNWA 2GUUA 3VSUA 1KFBA 4QYAA 1MIEH 4XCNB 1CD8A 5LAPA 2WTOA 4UT9H 4E8CA 2JTDA 1HTYA 3VFRA 5GRWA 4ISVB 3WBAA 4GRWF 3I7RA 2LVEA 1S7WA 5C2BH 3ARPA 3U3HA 2W9MA 2WBJB 3BWSA 2CHOA 2EEDA 2H6UA 1QBML 5TE7H 1OAXL 3IDNB 2PLTA 4QY8A 1OB1B 3SPHA 4LAJH 1QOKA 1ZPUA 2PODA 5DJAB 3W1UA 4XAKE 5AW9B 3HNTH 1T6MA 1M04A 3OO2A 1TVHA 4HHPA 3N6QA 3CVCA 4ZB5A 2EDJA 3PBVA 3DG7A 1MAML 2DAVA 4Z7UA 1OTTC 3GBEA 2OJEB 5J1AA 5DTFA 5C07B 3C9NB 1WWCA 2BNQA 1OD8A 4F0HA 5CC3A 4N24A 3U1PA 4LEXH 1KWGA 1LP6A 4QR6A 3DERA 2YD1A 3QRFM 2E7FA 1KB5H 4Z7QF 1JGVH 4W9CC 3D08A 3IWPA 4KKLD 3NA9H 3NFSL 2EXSA 4Y9PA 2CQVA 2MPVA 3WQEA 3L5WB 4G6CA 4WTZA 1B1YA 1ZJHA 1NFPA 2XH4A 4UTMA 2DLFL 2HCVA 4WFHE 2J7LA 3WDHA 4NJGA 3IEBA 5F6HJ 4KAQL 1UASA 2RHGA 3U2CA 2Y6SC 3NGJA 3E9TA 1X8CA 3R94A 4UAOC 3UGUA 1O5XA 2A77H 2EXWC 4L8DB 3QPXH 2FECL 5F1IB 1HJVA 2V9RA 2Y6TE 1J6OA 1UROA 1U8OB 3DURA 4URIA 4GAJL 1OBAA 1KFKA 1ZBVA 4CNIB 3QZAA 3B3BA 4AEHH 4RMQA 2PDFA 2VO8A 3C5ZB 1XCTA 4QXUH 1BFOB 5IVOA 1LO0H 1ZSHA 1E43A 5DRZA 1PKLA 5D9NA 3DEQA 3GTXA 3U5YA 4M19A 4D7BA 4KRNA 2APFA 1CDIA 2JB6B 3OBAA 5AOKA 3TZVC 3SE8H 5CN2A 2HRHA 4EXPX 4XCEA 5F7NC 1A9BA 5E4EC 4LU5L 4JKPL 4YXGA 4A2HA 1U1HA 3QW9A 5AW4B 1H8SA 4US5D 4K39A 4L3CA 4ZAKB 3GIZL 3P77A 1DZ0A 4JZJC 4XTDA 4D0DB 2V67A 3BURA 1G0YR 3HO8A 3M46A 4PRNA 1NDGA 3FMGH 3EWZA 3CK0L 3IDYB 4DWSB 5MHSD 2IW0A 5FF3A 2Q7YA 1FYTE 1Z9MA 4RQQA 1UP2A 2EDRA 3KBPA 1Q72H 4A2EA 3V4PB 3HG4A 5GRVL 2ZADA 4U5IA 2XICA 2Z0IA 3BVUA 3FO9B 3IXTB 3LCHA 1SJEB 3RFZA 1F6LL 3FO1A 5CP7B 1MJJA 3MA8A 1NEUA 4Q9QH 4DF1A 1PNCA 3R06B 1IC4L 2VKZG 3FPXA 4QCIA 1E8ZA 5LAXA 3CD4A 4DKAA 3MHGA 1J8HA 5JHLH 2OZTA 2L7EA 3R13A 4DETA 1FL6A 2NSXA 4M48H 4M7LT 3S1GA 4HS8L 5BWAA 4P04A 4BBWA 2BS71 4ODSH 2VLJD 2ILLA 1ECYA 3CQPA 5DJ6B 1BVWA 3GBNH 4UTCA 1LJYA 2Z28A 2YCLB 2NY6C 5AL8A 3B03A 1LOQA 3WJYA 4MJJA 1TG7A 3VGHA 1DBAL 1XLJA 4GOSA 3ZYJA 1TJXA 4ZNEA 4NUGH 4LASL 1FYTB 2W60B 4YBLC 4DFHA 3LTSA 1S8DA 2HN7A 4ODBD 4B9GA 4DTGL 2ZX7A 1XLIA 2C3VB 2A73A 1OVDA 2D3LA 2APBA 2BERA 3L3HA 5FV2A 1LK2B 1KM3A 5F7LB 1GJIA 1ZIAA 5C2GA 2ROXA 3PDOB 3RAOA 3QKZA 3THQA 1Z48A 1BEYH 3KM2A 5ITBL 3CFNA 2WTRA 4WKZB 1J5DA 2I07A 5AVZB 3CQFA 3TX9A 1DL3A 3VQ1C 1KN2H 4XX1G 4DCQB 1JCKA 1QG3A 4U3SB 4NPYB 4GQ9H 3VXPB 1B57A 5AYQA 3LYRA 3VXME 3BL3A 1B9KA 5CPSA 2LFEA 3PGFL 4JFFE 3LGDA 4QAWA 4A6YL 1XR2A 1Z6KA 2FZNA 3AROA 1HEHC 3H9SE 4C1KA 1KM6A 3R5EA 2AK4E 2IWEA 4RETB 3AY2A 3QHFL 4M7ZB 4EN3A 1SLXA 1EEQA 1QHZA 3QEQA 5I79A 5ESQA 1EHLL 1MCPH 3HJZA 3SCTA 4W89A 2X1RA 4FD0A 3T3PF 2Q02A 1DVYA 4HYTB 5GJSH 4OZ4A 2AK1L 3KWUA 5I75C 2NQ5A 3QUMB 5FKPA 4ZEPA 1FLTX 4EI5D 1E28B 2W0FA 5C9JA 3X13B 3D39A 4MDPA 3NJVA 3QH3B 1A7BA 3VFLA 5XINA 3QG7H 5TF1L 5FKAB 1FLRH 1GT8A 2K0RA 4QDWA 5HI4D 4AIEA 2LGNA 3EJRA 5GS0H 3QQ3A 5TE6H 3OHXA 1UWEL 1IGML 1TZHA 4GP5B 1XBZA 2OTWA 4OU3A 5BMFL 2RFXB 3VXMB 3PZTA 3BKYL 4WGVB 4XZWA 2CR0A 3EFDH 4AT6A 4JFFB 3P30L 3IAQA 4YO0B 5HNUA 4M5TA 3PWUB 1QTYT 3H9SB 4YDIH 4PCPA 3GDRA 4QDGA 2AK4B 2UUDH 1D9KB 2W4XA 3QPQC 2Z7GA 1IWBA 3P9MA 2R69L 2PCQA 2QZQA 1FORL 5D4JA 4N3UA 5AALA 1QAPA 3BGFC 1OGTA 4JG0L 5JHDA 3WIHL 1LP9F 3WS6A 5IESH 2N3JA 2VMCA 4FXGA 4S1QH 4LEFA 2WMPB 4GZIA 1Q94B 4J35A 2GIXA 3D85A 5E1AA 4L8SB 3R58A 2VDML 3U0TB 4JJOA 4KO5A 4M6OH 4XZHA 4M5YL 4Y5XA 4K0OA 2H8PB 1XR9A 1JZ7A 4JM0A 4CN1A 1GG1A 4WFFD 3M0HA 1UZHA 3VG0L 4MFHA 5DFWH 4G7EA 1KJVA 1IGFL 4MD0B 5DJDB 2BVOB 1AYOA 3LRLA 2IWFA 3WMSA 2XN1A 1S78C 4V2CB 1M7JA 1I0BA 2VGGA 3QRLA 3T05A 4AMCA 3L7EA 2GFBA 1VD6A 1OANA 2NVCA 1MDTA 4Y5VB 4JN7A 5A2AA 3RL2B 1XIBA 1USQA 4RIRA 3QCTL 1I2QA 1FXQA 5I17B 4Y9MA 1HE8A 3WH9A 5FYJU 2YBVA 4QF1A 2OR9H 2AI0L 4PJFF 2C9UA 3WO3B 4IXHA 2L7QA 1S2UA 4ZO7A 3BZJA 2PRLA 4IIEA 1GW1A 5GGRB 3II2A 3EMCA 3TBCA 3PG9A 4KDVA 1IBDA 5F4SA 5HVFB 2P44B 1RULL 2DORA 3WN5B 5L0QC 3QWNA 1ZGLA 4EWND 3GYEA 4YVXA 3L3KA 1GZJA 2ZA2A 2XOTA 1KCWA 3MP4A 1OP9A 3DGDA 1Y5WA 1YHTA 4ZPTB 3FQ1A 3DESA 4EUPB 1J0YA 4LDOB 3ME3A 3OSVA 4UIOA 3IMTA 4P5RA 2QADD 2DSUA 3FK4A 1OPOA 4WXYA 1Y1UA 1EQWA 4NHUA 3KPLA 4MIMA 3BX7C 1KYUA 4O58H 3SOBH 4RNHA 1C93A 4IGBC 5EOQL 4N2FA 5KUKA 4QNWA 1OWQA 1F58H 3WKML 4CD4A 1RP9A 1GQIA 3X1FA 2HWZH 4OOZA 1TKWA 3MUGB 5AKSA 1CGSL 3VABA 5D4IA 4QRPE 1U8IA 3FQNA 2EDBA 4K7PY 1TQWA 4JOMA 4HZ6A 3LNPA 3P82A 4UTBL 5HD8C 3M1BB 2X7LA 1S5IH 2XPYA 2RJMA 3BGJA 2VAAA 2VOTA 4HMNA 2DUAA 3TAOA 1BZ9A 3W2KA 4B5VA 4HJGB 3QXBA 2HT4D 2VDPB 2Y5SA 3MO7A 1F45A 4NZTH 3GHEL 5DMNA 3ZLGA 2AL2A 1EZUA 1G7VA 2JIXD 5JORB 1JPGB 2UZ9A 4IBVA 3GMNB 2BVQA 4BWUA 2CK2A 3TN5A 2CNZA 2WK2A 3P60A 4NYLA 2ZD0A 2D31A 2F53D 4HK6A 2QKIB 4YC2C 4GX9A 4KO7A 4BGLA 2G3MA 1H15A 2Y8VA 1GVEA 2OXGA 2WGNB 4AXWA 1D7KA 2X89A 1A3RL 4JM2A 1AMXA 2R0WH 3QDGD 3GVRA 3RPDA 2FSEA 4YDZA 2VXNA 3ULUC 2NXZB 4QRPB 4LLDA 2TAAA 1T2QL 5GGTL 5TAOA 2ZJSH 1AKJA 5KAQG 3A22A 2YPVH 1OYAA 3VI4A 4WU7A 4QTIH 4TUKH 4N1CA 4Q6JA 3JWDL 3BFQG 2FYVA 4XO4A 4GINA 5A6AA 4YBHA 3GSUA 4ZMVA 3BW4A 3K2KA 4LS2A 3NJHA 3P81A 1S5WA 5I66B 1RUML 5MENE 3PJXA 4UANA 1KRMA 4F0MA 5E94A 1FZJB 5DRWB 1VADA 4DKFL 1JGDA 3QA3B 4D8LA 1S7UB 4EP8C 2AS5M 2PP3A 4F91B 3SCVA 3L17A 1Q0XL 5E8OA 3B7TA 3TXAA 2ADIB 2W5PA 3QO0B 2X44D 2J6VA 1LJMA 3L6FB 3DIPA 1KT2B 1GY2A 2YPLD 4IK6A 4F7TA 4JKNA 4AIOA 2IKHA 3N1QC 1FWHC 3ZIYA 3QJSB 4KKXA 4M1RA 1MHCA 1HO1A 5D05A 4R4ND 3REVA 2P3EA 1XM3A 5I6XC 1UUMA 1B54A 2DT3A 1A1OB 4LCWD 1FSKC 4C6NA 3FXIC 4BFIA 3LXUX 3KRSA 2XRAH 1ITQA 4KXZI 3MRGA 1TO3A 2WQPA 5F72S 4V11A 3HI6H 4MJ5B 1FNFA 4W9GC 2ZCGA 3FZUD 4PGLA 1M53A 3PHQB 2QUNA 4C60A 3VOCA 4ANVA 3W85A 4HTBA 2I9LA 2R4SH 5MENB 3VFVB 1FWIC 1HI6A 2NV2A 1I8MA 1T7VA 1SZNA 2DEPA 4L9LC 2ORBH 2HZGA 2XN9D 3I6EA 1AGBB 4G6MH 5IOBA 1T5WA 4N6FA 2X6MA 3SIMA 2BY0A 2HLAA 3LKPA 1F42A 4KH9A 4UDTB 3REWA 3AMLA 5I76A 2E8ZA 3TZVA 2QZRA 2IPUK 3PUCA 3GG7A 4NAFB 1SSGA 4KROB 3QJUB 4IJBA 3CVDA 3RNQB 4O0QA 1V5JA 4JHZA 4ZDHA 4MQXD 1B4KA 2JF1A 2PF0A 1TMHA 2V0AA 3KH4A 4QKTA 2X1OA 1R4XA 4C65A 3VSTA 1CO1A 1GVSA 4HIIA 3O3UN 3B2DC 4XO5A 3MBED 2WJ5A 5EEYA 3LU2A 1CDUA 2F9BT 4QRQA 1FL5B 2CUMA 4AHQA 4WJ5B 2X4SB 3UWQA 1ZTXE 3STZA 3ET9F 3PTDA 4MJHA 2QTEA 4DGUA 1VKXB 2D2CC 4DEPC 1YEKL 1L9MA 5DVPA 3BUIA 2YXVA 4HNOA 1DSWA 1W2KT 2FYYA 3BGMA 2G37A 5AYBA 1XUUA 5D71L 1J01A 3KS5A 2ETWA 1CDYA 5FW7A 3TOYA 4HHWA 5HP5A 4X4MA 2RAGA 1MDLA 2V5JA 4S38A 5IHUL 4WNQA 1NLBH 4WGWB 2OK0H 3WZ0E 2VDRH 1NY1A 4TRPH 5HVHB 3H9HA 1PX8A 1O7DC 2CDFB 1SFJA 5MEPB 2DTSA 3DJZA 3VX0A 5I78A 4KXZH 4NO2A 3PNRB 1V55B 4N2LA 3GVWA 4N0UE 3I02A 2J7BA 4O8RA 1HWHB 5K9OA 1BXNA 2GQ8A 4GXFA 3TO4A 1IVTA 2ZX5A 4OZFH 5L6YH 1O9ZA 4TX6A 2BJMH 3SDYH 3UGRA 2O9PA 4S3KA 3TO2A 5TE4L 1A0CA 5B8CB 3EOLA 5GS0D 2YDRA 5HQEA 3IWUA 1WEJH 4XBSA 5D1XC 4JN2B 4N85A 3CUPB 1OKEA 1W6LA 1XHHA 1NL0L 5IB3B 4L5FH 2AERT 3FKUS 5C0EB 4ORGA 3TYBA 2A99A 1UR8A 3TH2T 3MJ8A 3L4TA 3MOBH 5F89B 4Q97A 1UA6H 1QBLH 3F4CA 2J13A 2NY2B 3PXJA 4ZUVA 3X12A 1NEZG 1COBA 4E41D 2ZWKA 4APXB 3LH2L 1V6XA 1JV5B 4KNSA 3E96A 2XZ7A 3R43A 2TSAA 2XWJA 1ONQB 3QF0A 2E27L 3OL2A 1VBUA 2Y7GA 1OAQH 1U3YA 1IKFL 3FQYA 4PTTA 1CG9B 3MMTA 3IGAB 5AWNL 2CZ5A 5D6CB 5E6SB 5J8OA 4LC8A 4N0UB 1Q1PA 4LU0A 1TVNA 4BSWA 5FCSH 3MRPB 2X1XR 1ELSA 4M62L 3IVKB 3MLUH 5K59E 3OXSB 1MFAH 1TIWA 4ZXBB 3WLWD 4MZIA 2EKGA 2E1DA 3KWXA 3WUEA 2LHAA 5KETA 4WY0F 3BLDA 1UEYA 2GK1A 1II4E 2ED7A 2JIEA 3PIQA 5SWSA 2VGBA 1LOLA 3SQRA 2WZAA 2PRMA 2WXLA 2H45A 3EYPA 4H83A 3W76A 2DM2A 2OL3A 1ZMYA 1NAKH 1PLGH 1Q85A 5HGAA 3RX4A 1M71B 3K71A 3QCVL 2ZXCA 3C2AH 5JUEH 5KS9B 1PBYA 5FLUA 4GRWH 2VH5L 5FLVA 2DQTH 1NWOA 1BTMA 3ULVL 3BWAA 4MA8H 4TYUA 1CFVH 2PC4A 5T9BG 2ICWJ 1N5AB 1MCOL 5HHQA 2RB8A 2ISWA 4JTUA 4MTMA 1RIHL 3OQRA 2J88L 1B4RA 3WLSA 2YD8A