2QPUA

Sugar tongs mutant s378p in complex with acarbose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGPRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 'pair of sugar tongs' site on the non-catalytic domain C of barley alpha-amylase participates in substrate binding and activity
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type A isozyme
total genus 140
structure length 404
sequence length 404
chains with identical sequence B, C
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qpuA01
3AIVA 4MB3A 5A6BA 1KXVA 2WCAA 3EJRA 3KLLA 3L4TA 4EK7A 3ZJ8A 4KMQA 2VR4A 1V3KA 3NDYA 4XV0A 5AC4A 2A3BA 3VU2A 2F7RA 4W7UA 5I2UA 4W93A 3RIKA 4PTWA 1TMQA 2YL9A 5D8ZA 3SUWA 1VIWA 2AOSA 4JCLA 1W1PA 4CU8A 4MB1A 1H2JA 2WMIA 3N9KA 2VT0A 2V5DA 3RM8A 1QVBA 4D6EA 1UKQA 1E4LA 3SCUA 3N04A 4TUFA 3VIOA 3MSGA 4OIFA 4D6FA 2X0YA 4YN5A 1BHGA 4NF7A 3WY2A 1PIFA 1UZ1A 1ZL1A 4PTMA 3HU7A 3VIGA 3EMZA 1O6IA 8A3HA 3RM4A 1WZAA 1C93A 2CKSA 2YBTA 3L2LA 1GZJA 4TTUA 1HJWA 1VFFA 1EXPA 1LJYA 5EB8A 1MXDA 1E4IA 2WB5A 4W84A 1O7DC 1TQSA 3LXCA 4P8VA 1JZ4A 3WY4A 3W38A 2XM1A 2WC3A 4WLCA 1KFWA 1UOKA 2CYGA 2O9TA 3WFLA 3LX9A 4UQDA 1EA9C 4NXKA 2HISA 1E6XM 3VD7A 4NXSA 1M04A 5A8PA 1CGWA 1GUVA 4BS0A 4BQ4A 2WHLA 1W2VA 2J8FA 2D3LA 2VZOA 4AZIA 2PBOA 3T08A 3N17A 2CBVA 4ATDA 3VNZA 3KWXA 2DH2A 4N0RA 3CZKA 3TTQA 4HA1A 3W24A 1V3HA 1BYCA 4CU6A 3WDIA 3AS1A 2CBJA 4IM4A 3OZPA 1TQUA 2J7GA 1NM9A 4M1RA 4W5ZA 2VUYA 4B9YA 2PI6A 2E40A 5CSYA 3ZIZA 2Y5EA 1HKMA 4AD0A 4JCMA 1QW8A 5CQ1A 1ESWA 1BAGA 1BQCA 4P7LA 4C7FA 3W27A 3WQWA 1GONA 4JKKA 2ZE0A 1B3XA 1BYBA 3WQ6A 4U2YA 1V3MA 4ATWA 1UWUA 5A8MA 3AS2A 4D6GA 5A6JA 1YHTA 1HWWA 1YQ2A 2J7FA 3GBDA 1TZ7A 2WMJA 2F61A 2J4GA 1KR0A 3W6LA 3RDKA 3AZTA 5D9NA 1PEZA 4D6CA 4AZBA 1Q6CA 4D6JA 2A3AA 4LYPA 1E0XA 5I0DA 3B9EA 3WBEA 2ESCA 1LG1A 5ECUA 4LGXA 1EHNA 4JAWA 4W8LA 3EDKA 5IFTA 2ZUVA 4NZFA 1ZJAA 2EQDA 2WMIB 4U3CA 1E4NA 3A5VA 4CUCA 1JDDA 1RPKA 2VVNA 1R7OA 3M7SA 4FNPA 3ZT7A 1AQMA 2CESA 2CKRA 2G4FA 3T2PA 2RGLA 4BCEA 1FH7A 3POHA 1PAMA 1OGGA 4M82A 4OGZA 4UZSA 2VI0A 2VURA 4U2ZA 2D0GA 2WYSA 4JFTA 3VGFA 3G6MA 1UR1A 1EO7A 4AZGA 3AISA 5A3HA 1XH2A 2VRKA 1HKIA 3ZO9A 1H09A 2XVLA 4JFWA 5E0FA 3W26A 4M56A 3BMWA 3WF4A 1R47A 3DX4A 3WMSA 4W88A 1HX0A 4A4AA 2OSXA 1V0LA 3MI6A 1JI2A 1CXEA 2GSJA 4IUGA 4UFHA 3NSMA 4PSRA 4ACZA 1UKPA 4UOJA 3L4ZA 3SEPA 4ZE4A 3WD3A 4AZ7A 3WUFA 3IANA 5JBEA 4CD8A 2DT3A 4JKLA 4WKFA 2GJPA 2XWEA 4WIWA 2VNCA 5A69A 1RD6A 1E43A 2XVKA 1OB0A 2WZEA 3BAKA 5BRPA 5EFDA 7CGTA 4DWSA 1SYTA 2C0HA 3LRMA 1C8QA 3VIHA 1DWJM 2JEQA 1JZ6A 1BPLB 4RL3A 1TE1A 3CUJA 2GDVA 3CUHA 1XSIA 4M29A 5A94A 1FFRA 2YOCA 4CN1A 2FGZA 2JIWA 1HJSA 1W1TA 2JE8A 1DWFM 3MV11 3MMUA 4QLLA 5AY7A 1FP8A 4Z2HA 3WQVA 1CLVA 1V6YA 5I24A 5JIWA 2WKGA 1ISZA 1GOQA 3SUSA 3T2QA 1OIMA 3CHFA 4CN4A 1MW1A 1W9UA 1OD8A 2VZVA 3M46A 3RM9A 1JFXA 1JZ7A 2J78A 2Y8KA 1OT1A 4RE3A 2VCCA 4M80A 3WD0A 4C7GA 5I79A 5C8BB 2Y24A 2JEPA 3CUGA 2D1ZA 4U31A 1VFMA 2IXVA 4UFJA 3T0AA 1CENA 1GHRA 1KGUA 4B15A 5I78A 4AD1A 2ZXQA 1IV8A 2CITA 3VNYA 3AHZA 3RO8A 5DT7A 3H54A 1C8YA 2E8ZA 3AXXA 3AHTA 1M03A 4JHZA 4M24A 4FLSA 1GQIA 2XGBA 2YA2A 1J0JA 2W91A 3U7VA 1NWTA 2BV9A 4UZUA 2XGIA 1QHPA 4E8DA 5A6SA 1ISXA 3ARVA 3THDA 3ZR5A 4HPGA 3A23A 5AC5A 3FHQA 2VQTA 2EPMX 1ZBWA 3NDZA 4WSKA 3SCRA 2FHCA 4PMDA 4W5UA 4QLJA 1LL7A 2IGTA 3WF1A 1JF6A 1MXGA 4R5EA 2AAAA 2XTKA 1EGZA 2J7DA 2VR5A 4V27A 4X0VA 3W81A 1WE5A 2WZIA 3ARPA 4UCFA 2DIJA 1NH6A 4MDPA 3SCOA 4BQ2A 4LYQA 3TTOA 1CXIA 4E8CA 3QOMA 1NP2A 1V3JA 3T2OA 2VZUA 2EPNA 3WH6A 2YIHA 4QCFA 3WMCA 3LPGA 5E9AA 3HZ3A 2EACA 1ZBKA 1K9FA 3II1A 3L4UA 3D52A 2XN2A 1B3WA 2E8YA 2XIBA 4GO9A 4W8BA 1R7AA 1WDRA 4B3LA 2DT2A 1NARA 2G3NA 1GHSA 1AVAA 4X0NA 1FH9A 1ZBVA 3FN9A 1GNXA 4ACYA 1E71M 1E6PA 4CD5A 1OM0A 1LQ0A 4QFUA 5BROA 2QPSA 2ZX7A 2UY5A 4F8XA 4Q22A 4NZJA 4H2CA 1SFSA 3GNOA 5AYIA 1KCKA 1JYWA 3EMCA 3CC1A 1EIBA 2VOTA 1HP5A 3D5HA 2EPLX 1M7XA 4V2XA 4EKJA 3DYMA 4CGTA 1G94A 3PZIA 5CGTA 1MWOA 1J0HA 3HMCA 4UR9A 4HZ8A 5DF0A 4AZHA 4PCTA 1UKSA 1E6SM 4CCDA 1O7AA 2Z1SA 4GZJA 2EJ1A 2ZXDA 1HNYA 1PZ3A 4J27A 5A2AA 2OYLA 5GNZA 1C8XA 3QOKA 1V6XA 3VX1A 3VD5A 4CN6A 1JDAA 2WW5A 3PZGA 1MFVA 2EXOA 3NCOA 1MQQA 4PUDA 4W87A 5CLWA 3GXMA 3VPLA 1B9ZA 3SCSA 3VIPA 3PZ9A 1X1NA 2YLLA 3EJTA 2VCAA 2YKKA 4Q7NA 1NP0A 2WC7A 2EEXA 2D0HA 3E1F1 1LWJA 3KL3A 4UFMA 5A8NA 2XN0A 2GJRA 2QPUA 4BQ5A 3VMNA 3WN6A 4WSJA 2O9OA 4OOUA 1TG7A 5A6MA 4L4OA 2ZXAA 4ATLA 1JZ8A 5DFAA 1E56A 2DT0A 2WWCA 3CPUA 1R87A 5M3WA 2VO5A 5BXRA 3GM8A 5TD4A 5F7UA 4EE9A 3ALGA 3ARQA 2FH8A 1E4MM 1UKOA 3M6DA 1GW1A 2OSYA 1V0KA 4P7OA 3UG3A 4TVCA 1B90A 3W6MA 1V03A 2W61A 3BH4A 4D72A 5HPCA 3T0DA 1ZU8A 1XD0A 5D9MA 1OCQA 1J10A 3VDCA 1X6NA 3GTNA 3M07A 3WH7A 2B31A 3GXIA 3CMJA 3PZVA 1JYNA 4PMNA 1QI5A 3WD2A 1VFOA 4HOXA 1J0YA 1KR1A 2RGMA 2OSWA 5BCAA 4MB4A 3HG4A 3CHEA 3HG5A 4UOQA 3GXDA 1B3VA 1RH9A 1KBBA 3IJ9A 2XVGA 1QHZA 3RCNA 1HVQA 2WMHA 4LQ1A 5BWFA 3N15A 2UWFA 5IHRA 3AS0A 3DHUA 3F4VA 2J7BA 4FLOA 1WPCA 2O9PA 1G5AA 4S3KA 3BSGA 1CEOA 3GDBA 3WY1A 4QP0A 5GQBA 3ZR6A 3GNPA 3PZMA 1FP9A 4F9JA 1UWIA 3VX0A 1UZ4A 2V3GA 2E9LA 4PMVA 2WBKA 4Y7EA 1I75A 1GOMA 2G3MA 4OBRA 3U57A 1E0VA 1E72M 2W92A 3WD1A 2XFRA 3VGGA 5D4YA 4CVWA 1JI1A 4HU8A 1DHKA 2XSAA 4TTGA 3GXNA 3KL0A 3A24A 3AIQA 1JZ2A 2EABA 1JIBA 2Y8VA 5A6AA 5JUVA 4OOZA 2WMKA 2ZUUA 4J3TA 1OGSA 3VD9A 3W0KA 4FLQA 1VEOA 1H5VA 4MDOA 2PWGA 4MADA 4JHOA 4N42A 2F8QA 4B16A 2WK2A 2J7CA 9CGTA 4OZOA 1QNOA 4L4PA 3WNLA 2XN1A 5D9OA 1MW0A 2X1IA 4Z2LA 1UQZA 4MB5A 1MVYA 2G3JA 2YL8A 3AYRA 2CNCA 1KWGA 3BUIA 1NWUA 3WL0A 1HJQA 1DTUA 3L4VA 3VGEA 2CBUA 1WCGA 2VZSA 3DHPA 2WPGA 1HVXA 3AHVA 5CPSA 5HDRA 1NQ6A 2W5FA 2J25A 1KTCA 2FDMA 5CSUA 4QDMA 1KWKA 4PMUA 5E6YA 2QHAA 1DWGM 1UWSA 4DM2A 4F9DA 5HOSA 1MYRA 5CPQA 3AROA 3QR3A 4U5IA 1UKTA 3PHAA 1U30A 3WH5A 3VSVA 1KTBA 1H0IA 1UWQA 2ZIDA 2V3FA 2D22A 4V28A 4P8XA 4DUXA 3KE0A 1E5JA 1E9LA 1XHGA 1HP4A 1V0NA 4Z2KA 2FH6A 3VGHA 1F4HA 4MNJA 3NUKA 1UD8A 3VMPA 4HPHA 1JXKA 2VCBA 3BUBA 1PIGA 4TX6A 3ARTA 1DEDA 1E6QM 4AWEA 2YJQA 5A1AA 1GQJA 2QMJA 1B3YA 1W3HA 5HXMA 3LPFA 4BA0A 1J9YA 4KRTA 2D20A 2X2YA 3ALFA 2F7OA 3MV01 4D6HA 2WHMA 1Y7VA 2JF6A 2PF0A 3B9AA 4LYRA 4WJXA 3ARXA 1UH4A 3WH8A 2FE0A 4LPCA 3DX3A 3WELA 5CZKA 1PPIA 2OWWA 5A8OA 2WM0A 4U33A 1VRXA 3K4AA 3JUGA 1W2PA 4JIEA 4UFIA 1G0CA 3N12A 1TVNA 1FFQA 4MTVA 1BGGA 1GQLA 5HBFA 1OGBA 2UY4A 3VD4A 1AQHA 1OWQA 5LYRA 1J12A 2C7FA 1B1YA 3PZQA 1HKJA 3WQ5A 3W25A 3D50A 4JFVA 4WKHA 1K9TA 2YA0A 1WNOA 3NJ3A 1UD3A 1ISYA 4PTXA 1J18A 2X05A 4GQQA 1R86A 5EBAA 4B9ZA 1KBKA 4AD5A 5HNNA 2NW0A 1GOIA 1LLOA 2ZWZA 3UR8A 3D3AA 4PRWA 3PZUA 1V3IA 2W67A 1B30A 3AFBA 2VX4A 1UH2A 4BQ3A 4PMRA 4AY1A 3A47A 1WO2A 2OLHA 2O9RA 5CJ5A 4ML4A 1J0KA 1KCLA 1CZ1A 1R85A 4AC1X 4JFUA 1VB9A 3ZJ6A 4UNIA 1TUXA 1ZS2A 2VTFA 4C7DA 2D0FA 4H8HA 1UA3A 1RP9A 5E1QA 3OLIA 3NYDA 3VGDA 2J7HA 3CHDA 1QI0A 1W91A 2UY3A 1AMYA 2PC8A 4OUEA 2NT0A 5A6LA 2DGAA 1J0IA 3DC0A 4J7RA 3NSXA 3W28A 4PTVA 5M17A 3PZOA 3VD3A 3AI0A 3L4WA 2VMFA 3UR7A 1H3GA 5ABGA 1HJUA 1ZJBA 2ZUTA 2DT1A 1PX4A 1UYQA 3S5ZA 1E55A 1GORA 1UWRA 2BS9A 5GNXA 5BXPA 3LRLA 3VMOA 3VIIA 3SURA 3W29A 3ZJ7A 1HXKA 1QHOA 2ZUSA 1K9EA 2DSWA 3VIJA 3VM5A 4UQCA 3D4YA 3PTQA 1BG4A 1XGZA 2ZOXA 3BSHA 3OB8A 1KXHA 3LPOA 2FHBA 4CD4A 4DM1A 4FNSA 3BGAA 1M01A 1QI2A 4KH2A 3G6LA 5LA2A 3MSDA 1OINA 1ODUA 2Y4SA 3BC9A 1MFUA 1FA2A 3BVUA 1UR0A 2DDXA 3BVVA 1E73M 3L4YA 4NX0A 3T09A 1PS3A 4UFKA 2EPOA 3K1DA 3MKKA 3MO4A 3T0BA 4AYGA 1KGXA 3UETA 1GJWA 1TQVA 3KEHA 3MU7A 2V3EA 1C7TA 5LA1A 1JAEA 4HMCA 3AMCA 3GH5A 4MAVA 2X2IA 4KGJA 1CXFA 2IXUA 3OA5A 5D8WA 1R8LA 3VIMA 3ARZA 3QHNA 5ABFA 2CIPA 4P7RA 2XFFA 3BXWA 1OIFA 5FL1A 2Q8XA 1GOKA 1IZJA 2BVTA 4ACZB 1BSIA 2CXGA 4LXFA 4HA3A 3N11A 4ZE5A 3WF3A 1E3ZA 3WKZA 4P7QA 5EMYA 4AD3A 4UQBA 5I23A 3NSNA 3WEZA 4AZ6A 1OD0A 5EFFA 2VL4A 3ARUA 3IAPA 3WFZA 2OWXA 4DWSD 3AXIA 3HG2A 4DWSB 3WF0A 4MJ2A 3OBAA 4TOQA 2GK1B 2WCSA 1J0ZA 1DWAM 3SUTA 4NRSA 3ZQ9A 4NI3A 3WEOA 2J47A 3LMYA 1V0MA 3BLPX 1B2YA 2Y2WA 3KL5A 1HKKA 4ZENA 3EDFA 4NRRA 3FHAA 3FNDA 3THCA 1H11A 1JZ5A 2WLZA 2ZX5A 1ITCA 5GPRA 3U5YA 1HIZA 4W85A 3SCTA 1PBGA 1UR8A 2J79A 1EQPA 3HJEA 3TONA 3ARSA 4FF5A 5FIPA 3AOFA 3BAYA 4CKQA 1FOBA 3WF2A 3LRKA 4PMOA 1IT0A 2WWDA 2EPKX 3AZRA 4OKDA 4AIOA 1VEMA 1WDQA 2WVUA 4AMXA 3CBWA 1CWYA 1GOWA 4U5KA 2VVSA 5A6KA 3K8LA 4PBGA 2XPKA 4CD6A 4Z2GA 1A47A 3WL1A 4UQ9A 3AXHA 3PZNA 4MNKA 2BHZA 2CETA 4BF7A 2A3EA 4FLRA 2V3DA 1B31A 2GUYA 2X2HA 3GYCA 4GI6A 4PMZA 3WNNA 3OZOA 2J77A 2ZXBA 4AXNA 2XG9A 2DQXA 2UY2A 4YPJA 1V02E 3GXPA 3EJUA 5IXEA 1E1EA 3EBVA 3SCWA 5DEZA 5ABFB 3UG4A 2EADA 2TAAA 1G9HA 1UA7A 3ZJKA 2OYKA 4KRUA 1J11A 2E3ZA 2GJXB 1WB0A 2VX6A 3A4XA 3I3EA 1A3HA 1QOXA 1XSJA 1W9PA 3FY1A 3RJXA 1ISVA 2D24A 4RE4A 2GJXA 1PJ9A 3H55A 3B8SA 4MPKA 3AQUA 3GZAA 2BY0A 1EHAA 2NSXA 3QHMA 1SR0A 4TVDA 1CGVA 4ZFMA 3WQ8A 2E9BA 1JL8A 1Q4NX 2BY1A 2FYVA 2AMGA 1CIUA 3AYSA 4YHEA 3EYPA 2OW6A 1UD2A 4AYSA 2BXYA 4GQRA 1K9DA 1GOOA 1VBUA 3VDHA 2E9MA 2WANA 3SIMA 1TA3B 3ARRA 3AHYA 4CCCA 2EAEA 1DWIM 3K4DA 2ZUWA 1BTCA 4H41A 3CO4A 3OGSA 3WDHA 1ZB5A 2XHYA 5E70A 4HTYA 4GKLA 4XX6A 2YLAA 3LPPA 4CD7A 3K8MA 1HTYA 3MUY1 3GBEA 1UUQA 1E40A 1C3FA 1QI3A 3ARWA 1XYZA 1TR1A 3ECQA 2ZUNA 1C92A 2CERA 1W1YA 3DYOA 3N18A 1JXJA 1JNEA 3ARYA 1V6VA 4M8UA 2GDUA 1GJUA 3TP4A 1JD7A 3OLDA 4R27A 2WNWA 3A6OA 1VF8A 4AMWA 1R46A 4AD2A 3IJ8A 1X6LA 2JF7A 2F7QA 4DO6A 3OLEA 2WBGA 1CGUA 1HJXA 3WMBA 1TFVA 3ZM8A 1HJVA 1XCXA 2EBNA 2PWDA 3UCQA 2V5CA 1BF2A 1BVZA 2G3IA 2J7EA 1DWHM 1D2KA 1VBRA 3WENA 2VQUA 1E3XA 1Q6GA 2GVYA 4MNMA 2XJ7A 1N82A 3SCQA 4PMXA 1Q6EA 4BZYA 4D6DA 1EDGA 4Z2IA 4H7VA 3APGA 2X2JA 1W3KA 5I6SA 3WEMA 2ZUMA 4HZ7A 3WUBA 3WSUA 4EANA 3O9NA 1QNPA 2CEQA 5JIPA 4IPNB 5C71A 4JKMA 4XZBA 2O92A 5BXSA 4HMDA 3CGTA 2OWCA 3ZOAA 3RJYA 1UHVA 5A2BA 4IISA 4J3SA 1XYFA 2A3HA 3BAWA 1FHLA 4HZ6A 3NIYA 1VEPA 4X9YA 2YBUA 1UH3A 3VILA 1HT6A 3EJQA 1QNRA 1TVPA 2XM2A 4HMEA 1JG9A 3A3HA 1VJSA 1WAWA 3BMVA 1TCMA 1C90A 2YFNA 3OGRA 4P8UA 4XZWA 2BVDA 3QHOA 3BLBA 2MANA 1NOWA 3MUZ1 4LX4A 3O6AA 3N1AA 5LA0A 2W62A 3B9DA 4UQEA 4CVUA 3KZSA 4H04A 4AZCB 4TXEA 2ZX9A 3U7BA 3WIJA 4D6IA 3BAXA 3RILA 1WDPA 3VM7A 5ABEA 1EDQA 4UFLA 4P8WA 2CPUA 5GNYA 5M03A 2NT1A 5A95A 4FNUA 3W4RA 1UD6A 3TA9A 1DP0A 2WMFA 1EO5A 2BY3A 1QI4A 3DX1A 2HVMA 1LWHA 2F1BA 4XB3A 4UOZA 3N13A 2ZWYA 1UWTA 3AHXA 2W63A 5DMYA 1CECA 4ZXOA 3EJPA 1BFNA 1V08A 1UD4A 3MUIA 1KGWA 1U33A 3VVGA 3GNRA 2YFOA 4W7VA 3RMEA 2X0HA 2PBGA 4E2OA 3UEQA 3VIFA 3WQ4A 1CBGA 4GO8A 4UTFA 1CPUA 5JBFA 3CMGA 1CXHA 1XCWA 1BVNP 4CCEA 2WAGA 1LL4A 2WVTA 1H49A 4QLKA 5FCZA 3OIHA 5BXTA 3VTRA 1G1YA 2XVPA 2WHKA 1D7FA 1RP8A 1QBAA 1V6UA 2XYLA 1E0WA 4P7NA 4FNRA 1CTNA 8CGTA 1GCYA 3CUIA 1MW3A 2FGLA 3BUDA 4DUWA 1W3JA 3CUFA 4KGLA 4JL1A 2F1AA 1OSEA 1QNSA 1TQWA 1KQYA 2W4XA 4FMVA 4CU7A 5KZ6A 1BYDA 3H53A 1H4PA 4S3JA 3GXTA 1TA3A 1H41A 1H1NA 3S6TA 2F2HA 2E0PA 2CHOA 1UQYA 5CGMA 3WNKA 4F79A 1EQCA 5FL0A 4H8VA 1R75A 1GQKA 2F7PA 4HOWA 1QPKA 4EAMA 4AZCA 5A2CA 4XUYA 4DO4A 3VDBA 6TAAA 4W86A 2VX5A 2D3NA 3HN3A 1UG6A 2G8ZA 3DX0A 1I1XA 3WUEA 1UD5A 1CGXA 3SCNA 2WCGA 3CTTA 1U2YA 3WH9A 3CHCA 4DWSC 3CV5A 1PX8A 4HP5A 1UR4A 4MAZA 4AZ5A 2WHJA 4J3VA 3IK2A 4DUVA 4FNTA 2D23A 1JNDA 3S2CA 1Q6DA 3A4AA 1CNVA 1NOFA 3PZTA 2J74A 3PN8A 1OBAA 4NZCA 3ZSSA 1MQPA 3WDJA 2G41A 5CPTA 1OT2A 2WVSA 4W7WA 1AQ0A 3WNPA 2GK1A 2DPEA 1LG2A 1XD1A 4FK9A 5AYBA 1ISWA 1K6AA 4KWUA 3SCPA 3UERA 4PCSA 1QW9A 4URIA 3BVWA 2WSPA 1UR9A 3CZLA 1R34A 2OW7A 3L4XA 3LXAA 3IAQA 4ZXLA 3TOPA 3VGBA 3BCFA 3BCDA 2DSUA 3CIVA 1CXKA 3OG2A 3MANA 3SUUA 1EOKA 1QX1A 1JFHA 5I77A 1M53A 4GI8A 2GFTA 2WLYA 1QWNA 2X8RA 4OJYA 7A3HA 3F5JA 2DIEA 1LL6A 1QNQA 1W9BM 1US2A 4H8UA 5I5RA 4QAWA 1KXTA 2DSKA 2QMKA 3WD4A 4IPLA 3IJ7A 1WKYA 3FW6A 5BYWA 1QWUA 2QF8A 4AW7A 4NSBA 4JZ5A 1ODZA 1WZLA 3PBGA 3BLKA 5DO8A 1KXQA 1CGYA 3BUPA 5DT5A 5I3DA 1H0GA 4AD4A 3WNMA 5A8QA 1CYGA 1L8NA 3GXFA 3K8KA 1BG9A 5E6ZA 1KB3A 4ZEPA 2BXZA 4J28A 3AIRA 2D2OA 3MUAA 3HG3A 4AIEA 1BYAA 5E09A 1E6ZA 3VSUA 2PB1A 1T0OA 1W32A 2YDQA 1W9DM 3DX2A 2WMGA 4MJ4A 3WDQA 4Z2JA 3BVXA 3AJ7A 2WKLA 1D3CA 4A3HA 5C70A 3VDAA 6A3HA 1EH9A 3O2LA 3TV8A 4E4PA 2VC9A 2QLYA 1HL8A 3ZSTA 2EO7A 1LF1A 1NWSA 3WDRA 3CZ8A 3J7HA 3WUGA 2QV4A 5M5DA 1JYVA 7TAAA 1B3ZA 1E6NA 5FOOA 3W53A 3VIKA 1MW2A 3AMKA 3GH4A 3MS8A 1Z32X 4JL2A 4HOZA 2ALWA 3S5YA 3BUQA 1XH1A 1PX3A 1GPFA 3VUPA 5CXPA 1G01A 4AMCA 1ECEA 1NWRA 3OLGA 1JAKA 5CG0A 5JBDA 4K68A 3AIUA 1BGAA 4PYSA 3IGUA 4GPNA 4B3KA 3VO0A 2ZX6A 4PMQA 1JDCA 3CZGA 4RE2A 5IFPA 3CZJA 1CXLA 4GZIA 2JIEA 4WF7A 1L0PA 1P6WA 2YDSA 2YDRA 2PWEA 4GXPA 3AMGA 2CBIA 2XWDA 2E4TA 3EDEA 1SMDA 1UASA 1WP6A 1HF6A 4PN2A 3F5KA 4J3WA 4UQAA 4W8AA 4F66A 4U3AA 3W82A 3KLKA 2VX7A 1SZNA 2YL6A 5D9PA 3MMDA 3A4WA 1VENA 1BLIA 3AIBA 2XSBA 5FD0A 3DDFA 2BY2A 1E70M 3WNOA 3VKKA 3UESA 2XUCA 1V3LA 5KEZA 1SMAA 2F18A 1ZBCA 1CGTA 3LXBA 3AZSA 3VINA 1CDGA 3FAXA 2A3CA 3GH7A 1XRVA 2V38A 2XFYA 4WK9A 1WZKA 5A6BD 2DSVA 5IHSA 1CLXA 2X09A 3BVTA 3CH9A 4TX8A 4MNLA 3ZMRA 2D73A 3VSTA 3CLWA 1XH0A 2WVVA 4GI9A 1F4AA 4YHGA 1XC6A 2XVNA 2W66A 4OBSA 3POCA 1R33A 3AMDA 5FKYA 2PWHA 3TTYA 3U5UA 2WXDM 4D1IA 2FHFA 1GVIA 1XV8A 2DEPA 4JFSA 3FAWA 1C91A 3EDJA 3PTMA 1NOUA 3QGVA 3WY3A 3ZT5A 1VAHA 2YA1A 4D1JA 5ABHA 1W1VA 5CLTA 3BAIA 1KQZA 2VZTA 5E0CA 3FXYA 3VOCA 1J01A 3WBAA 2ZX8A 4HA4A 1E1FA 3WDPP 2CCRA 2XIIA 1XSKA 1IZKA 3CZEA 2BHUA 2VRJA 3UG5A 3PTKA 3AMLA 5HPOA 1MQRA 2WZHA 4D71A 2J62A 3AICA 2VJXA 3K46A 3F5LA 2CHNA 1V6WA 1VJZA 1HN1A 2WSKA 1QBBA 1US3A 2BFGA 1HL9A 3L2MA 1PZ2A 4WKAA 3A21A 1B0IA 2DSZA 1WZMA 1ITXA 3CZNA 1FHDA 1S46A 2IUZA 3DYPA 1HXJA 1VFUA 4HU0A 1JYXA 4PEEA 1W9XA 4J3UA 3OGVA 1UR2A 2J8GA 5IDIA 2BVYA 3DECA 3A22A 4PUEA 3D4ZA 3MMWA 3SCVA 4AIUA 3CZSA 4AEEA 4AEFA 4GINA 2VRQA 3EDDA 3EMQA 1I1WA 1Q6FA 2WC4A 4GZEA 1EDTA 4M81A 1W9VA 3D51A 3TTSA 3I3DA 1JD9A 2BHYA 2Z1KA 1V02A 2BNJA 4FNQA 4AISA 3I3BA 3ZT6A 2OYMA 4PMYA 4J3XA 3W37A 6CGTA 3SUVA 4A3YA 2DH3A 2ZICA 2YL5A 2WVVB 2JFEX 1JGIA 1E15A 1W3LA 2C8NA 4TVUA 2PWFA 1WDSA 4QCEA 1FH8A 4GIAA 1E6RA 3BAJA 1TQTA 1C7SA 1EOMA 4W89A 3AS3A 3EJSA 1E5NA 2J75A 1JF5A 4DO5A 1GVYA 3AIWA 3AIEA 1JZ3A 5BRQA 3RPMA 2JALA 3DDGA 4PSPA
chains in the Genus database with same CATH superfamily
1AR1D 2C34A 3S3JA 4DPRA 1Z9SA 1BREA 2ZUQC 1WEJH 2NNFA 2ZVRA 5A6BA 1RQHA 4ORGA 4A39A 3V55A 4M5PA 2F5AL 2QCHA 3KLLA 1QUPA 5AW0B 2EYRB 2VLKA 4GRLA 2NCMA 3BN9C 5E5LA 4KK8D 1DSFL 4XPGH 3SDYL 4PJIE 2X6UA 1Z5LB 2ICWI 5D7IE 4KMQA 1V4YA 2AJXL 3ZJ8A 4ZOBA 1IWBA 4TULH 1GJPA 3BVNA 3W7IA 2G3XA 5AC4A 1HQRA 1VKFA 4TUJB 4F7PB 1TMLA 4DOHE 1A6VL 1JTPA 3QRFM 3HTWA 2QZRA 5K1VA 3MNZA 2E4FA 3DV4A 2AGTA 3GHEH 1GS7A 4XIAA 1TYJA 3RHWK 1AXIB 1I1CA 4W93A 5C8JB 2IV9A 1NIAA 4N0UB 1A5FH 1NVMA 3WE6A 2VMJA 4U3HA 2EIEA 2YWYA 3IBOA 4WEBH 5E1AB 1A1MA 3INUL 4M4RA 1I1YB 2F6UA 3ONBA 3R7QA 4WOQA 3RU8X 4XXWC 3UWEA 1JULA 3ZXAC 1SY6L 3MRPA 3L7EB 4PJEA 3KWWB 5K69A 2FDSA 2FLIA 4D6EA 4R26H 1KJ2L 4QTIH 4JDBA 1E4LA 1N70A 2VEPA 3LIZL 3SCUA 3VIOA 5HBBA 1H5BC 3VNKA 1INDH 4H8WH 2V69A 4D6FA 2WXGA 2UWEB 3MMEA 4HKZA 3U1PA 4OFDA 3TQKA 4L3AA 1FKWA 5I17B 2DUZA 3MLYH 2P43B 4KTDH 5IBLC 4W9JC 5IHWA 1AOHA 3RM4A 3PWJA 4Y16A 2R56L 1C93A 5HA7A 2CKSA 4JJ5B 4K2UH 2LLGA 3IVKB 5JIIA 2V5BA 1HJWA 1M2OA 1HKWA 5DC4B 2DFAA 4F37F 1YUHB 5E94B 1EXPA 3QAQA 3WBWA 1LJYA 1SUHA 4IK6A 5I71C 5G4HC 5F97E 5IESH 1E4IA 1FY6A 2PCQA 4D0CA 2FX8L 5ADPL 4W84A 4F7CA 3MLTA 2WQSA 4GAJH 1J6PA 3KPSD 4S39A 2X87A 3LXCA 3QCUL 4MXVF 2Y7EA 4J8RB 1JZ4A 4P8VA 3TROA 4H3DA 4GFSA 4OGYL 3W38A 3VH8G 4H1LA 1OY3B 3IRZA 3L1OH 2WC3A 1MIEL 1YXCA 5F2LA 2X5PA 5FAGA 4JANB 2OS7A 1CX9A 5C09D 1ZS8B 4IMDA 3LX9A 1TWIA 4B5UA 4ZZFA 3O9WC 3ITGA 4NAEB 2FJKA 1FDLH 2HEJA 4XN9A 1I9CB 1RBAA 5FM4A 3CFBA 4JHMA 2V8MA 4L3EE 4BKSC 3EYOA 5C0QA 4F8PA 4RIRA 2E6DA 1SXBA 1KRCC 1R5WA 4JQXC 4CNSA 3LHYA 4EIUA 5BRZD 1C5DB 1Z7JA 4UTIA 4WGVB 5AYUL 3RP1A 1MNNA 2CIIA 4JFYB 1GUVA 4BS0A 2AHIA 1UUOA 1IT7A 4EWND 4MVBD 1E28A 1MCOL 4BBWA 1DKWA 1E4KA 1NELA 3AWOA 4EX4A 3P9WB 3ABQA 3IETB 2HRWA 1A7QL 3Q1SL 1BOGA 2D3LA 4QT5B 4FDWA 5IQ7L 4N5UA 2XTJB 4JQVC 3RZCA 1FXPA 4QRUA 3GSUB 4M6PA 1AP2A 5KG9A 4IGMA 4ANVA 3H7UA 2K6YA 5TDPA 1FDJA 1HXYA 5IVZA 3FTZA 2CBVA 3KWXA 3QDGA 3KXFE 2DH2A 2FTPA 3BD5A 3QFJD 3SYAA 2Y70A 1P69B 3BKJH 1EYWA 3KCJA 3RN6A 3TTQA 2GC4C 2E9GA 4XI5D 4PLKC 1PXGA 1F56A 3UJTL 1BYCA 1NCOA 1SZGA 3WDIA 4XD5A 3AS1A 2IH3A 5L0QC 1E3FA 2J5LC 4FG6C 5TDPB 3QUML 2ASHA 5F88B 3NIGB 4A1RA 3OO2A 4J9JA 3OZPA 2PNDA 2EVGA 1RZJL 1YJDH 2PWVA 1NQKA 4ORGB 4BKLA 2PAJA 4PRPB 3BVDB 3MJ8A 4JO8A 4N4PA 4GG8A 5JIMA 2WOQA 3GKZA 1P53A 1TMHA 3NGBC 2E40A 4JGJA 4OZIA 5ANME 2A3LA 5IVNA 2O72A 1CLOH 3CDGA 4ANUA 1MCIA 1S2AA 4LLVA 1P0BA 5EMJA 4HJ0D 3G5ZA 5HVGB 3RX2A 1HHGA 3SDDD 3WFBH 4KV5F 1CLYH 3FJLA 5DO2C 2O4MA 4IP5A 2GJNA 1CR9L 3GIZL 2IANA 4GP5B 4TVSa 2V5TA 4XP4L 3DVIA 3DRQA 1YNTA 4IBZA 2HX9A 2PO6D 1IEBB 4PRAA 2IQAB 4G8EA 4KRPB 5DQ9A 2XPYA 3DO7A 3WQWA 2CBQA 1I2QA 1O5RA 5D09A 1LO0H 2DQDL 2QGYA 1T4WA 1S9YB 3KS0J 2BO0A 3LNPA 5D2TA 2IG2L 3VFTA 1RIVH 1BYBA 4Z1CA 3TO4D 1SHSA 4AM0A 3QVAA 3WSQH 1VPOH 4DEPC 3TWBA 5IBXC 4K5NA 4G9FD 4MMZA 2H9GA 3AS2A 1YEIH 3FSVA 5F9WB 5IHUH 3INPA 1TPXB 3FJTA 5FEPA 2UZ9A 2Y3NA 5C08B 5I75C 4HNNA 1O0VA 1YQ2A 2VSKB 3EHBC 5EFIA 1JS4A 2J4GA 1KR0A 2X4RB 4LV9A 3V0AC 2ON3A 3W6LA 5CEXA 4UTCA 4PRHD 5DUML 4GOAA 2DM4A 1K8DA 3R06A 3AZTA 5D9NA 2LABA 2ZP9A 3RAOA 4D6JA 1QPPA 2A3AA 5KITA 1YPZA 2ZF9A 2E46A 1NFIB 3WBEA 1W80A 5MEQA 1OF2A 1MVFA 2CGZA 4WFEE 4O00A 1E7UA 3VXGA 3VFPA 5IFTA 2NQ3A 2E5EA 4MJHA 3ARGB 2EIKB 2Z7WA 2WTRA 3QIUC 4MWFA 4NZFA 3TBBA 3UGUA 3WHE0 5K93A 1E4NA 1EP3A 2RJHA 1QNZL 3HNVH 5J89A 1R24A 2LE9A 3BPLB 4YCPA 3ARDB 2WLLB 1P6BA 5IQOA 2PE4A 5I3HA 1TZZA 3RJDA 2LAGB 3QR2A 2O9OA 2X9XA 4GOSA 3ZKND 3M7SA 1YEFH 1ITQA 4ZFQA 4CSTA 3T2PA 4BCEA 1BZ9A 3Q3GB 1FH7A 4Q8TA 4MCYA 4ZFOB 4M82A 3F12B 4OGZA 5EZLB 4CC4A 4GBXB 4U1KA 5KZDA 2WYSA 2F19H 4RSYA 4MVAA 3KX6A 2VHLA 2VDOL 3TYBA 5AYUH 2CLMA 3MCKA 4HHWA 3STFA 1IGCH 1T21B 5A3HA 1XH2A 4WNSA 3P30H 4PBFA 3DGRA 5HNTA 3RUGF 4A29A 3ESPA 3F58H 3BJ91 2Q8AH 4LK4A 2WZ5A 1ZTXE 2AABH 2CFFA 1JK9B 1J9SA 3MJGX 3QQWA 4G1NA 1G5GA 4TUUA 1OSPL 3GC3A 4JFHE 5DA0B 3QCTL 4DN4H 4U6VH 1JF1B 4HF5H 4ORIA 5D55A 2PXYB 4CNIB 1K1DA 1JI2A 2A9NH 4M7JH 4JDVB 3QZMA 3CNKA 4XN7A 3ARED 3Q6FB 4YSTA 5T5NF 3N1GC 5D2WA 1QWKA 3NSMA 3AYTA 3LV5A 3FCSA 2FX7H 3Q2LA 1UKPA 4UOJA 4OZHA 4HGKC 4HAGA 4XXDA 2G9HA 4D9LH 3MWAA 3VD0A 1NTHA 3EEGA 4US6A 5AZ1A 1EFXA 4GW4A 5C9WA 5CC6A 4FFVD 5JBEA 4CD8A 3BEWA 2DT3A 2GFBB 2I69A 1IM9A 1ZANL 4UMSA 5G5DB 2XWEA 4DF9A 2OMYA 3WTTA 1D5ZB 2DLFL 2VNCA 3WFHB 3NPWA 4GKZA 1RCQA 2WLLA 3BGMB 4PJEB 4K7PH 1CFTA 2GEQA 4AE0A 4NRYB 2WZEA 1XYCA 3ZZ1A 7CGTA 4UNVA 4JO2L 4WHTA 5CP3A 3GRWA 2BSSA 4TSAH 1NEPA 3W02A 3LRMA 1C8QA 4OFCA 3AU1A 4KI5E 3P9MA 1IB5A 2YD5A 3O8XA 4R96A 4DW2H 2YGQA 2NNRA 5XIAA 3U0TB 4AKPA 1LP9E 2HXTA 3CUJA 3CUHA 2GBVA 3RL2B 1XSIA 3VI3B 3ABXA 1T8XA 5HJXA 1AZRA 1XRTA 1EAOA 1S2EA 2YLHA 4FALA 2GJ6E 1GIGH 3ITOA 4BHUI 3AM8A 2IBGA 1DCEA 1QVOA 2JKLA 3SJVA 1AUSL 4XMTA 3MV11 1GGOA 2V2TA 3GZQA 2Z00A 1R3LB 3K30A 1KFAL 4S3EA 4IRSC 3P77A 4ERIA 2JVUA 1MF2L 4GB9A 4PHZA 5I15L 1V7NL 1FP8A 4GI4A 3FDKA 1CLVA 5D5MA 4NP7A 4HIIB 3RZWA 4B5EA 3M1OA 5JIWA 3SECA 2OX4A 3E0WA 4OM0L 2ZZ5A 1DBBH 2PYED 4PJFF 1AA1B 3FN0L 3SUSA 5C2CA 1XZ0B 4AL8C 1Y6MR 1WC7A 1MCPH 1ZHBB 3ROLB 4F9LA 4N8VG 4HK6A 1SQMA 3DMMA 3M46A 4JKPL 1BF6A 1JFXA 3TA4D 5ACZA 4LUSB 3MJ7B 4KTEH 1OF0A 3NVTA 4GK8A 3GR8A 2C9UA 1FE8H 3SO3B 3DXAA 1ZVSA 4LRNH 3UPCA 3PS6A 4XO9A 5EEZA 1YEHL 1FWCC 3FEMA 2A7NA 1RIHL 2ZOLB 1Z2KA 4GNJA 3WD0A 1F11A 3FSWA 5A5WA 4L1BA 5AG9A 1DQXA 1LP6A 3GAKA 2D1ZA 5IB4A 4M62H 3LSOB 3QJSB 3B9VA 5D7LE 4ZI8A 2Z28A 4L37A 3HOJA 1U8HB 3C12A 2MTPA 3T0AA 1PG7H 4LS1A 4C6KA 2YLKA 2DY2A 1CICC 5I1AB 2H0FA 2HFFA 4DJFC 2NXZD 3W76A 1KGUA 1A0QH 1G4RA 1K8IA 3L6FB 4L9LC 5KVFH 4AD1A 2AJYL 2ZXQA 1ZVHA 4DGIH 2G3ZA 2XG4A 5AD0A 3GZ3A 3GO1H 1JRCA 3UWVA 4IFKA 5F9OH 3RO8A 2F54E 3MSYA 5CU9A 2IFFH 2G2NA 3IEBA 4BDVA 3QTPA 1J48A 2RJGA 4PLJD 4N8CH 3KOYA 4GAGH 4GISA 3FQNB 4QNWA 4FLSA 3L5AA 4BKNA 4ERAA 3QO0A 1J0JA 4RX0A 4AW4A 1LTXA 1L9OA 1AGFA 1JPGA 2D7TH 4JDEB 5DJYB 5ETUB 3RWHA 4CMMB 4DKTA 2X7WA 5JHBA 1QHPA 3SFKA 3VNIA 4JHVA 4E8DA 3FPYA 2P5WB 4KO7A 5A6SA 1ITBB 3MRCB 2IKHA 4G6KH 1N6QL 1CGSL 4UU9B 1ADQL 1T5AA 4Q89A 1BQLH 1EJWC 4UTAL 3FRUB 1RFDL 4XVUC 4ZSOB 2DD8L 1O68A 4WAFA 5BOPA 5JR1H 3RU8L 3VYNA 3X1NA 2RCSL 5E1AA 1TJGL 1UJ3C 3HC0B 4TQHA 4YXGA 3BD4A 4GX8A 4CKVX 3MLRH 4QQ3A 3VFWB 4HKJA 1WDDA 1ZBWA 4YHOH 4F8TA 2WAHA 2FHCA 4TQEH 2VLJA 5JYLA 5K9DA 2X1RA 5BRZA 4PMDA 1FVCA 2NY3C 4L8SA 5JHMA 4P2VA 4QLJA 4RPPA 4OZFA 3RWCA 4FHKA 1E5CA 3PPSA 4LCUB 3RY5A 4PL2A 1MXGA 1M57B 3CDZB 4RQQB 5LCVA 1C08B 2CHZA 2HT3C 4FZ8L 2DD8H 4OV6F 4R2GD 1TITA 1T1WB 3URNA 1CFTB 2BVWA 3SJ3A 4DW2L 2P3YA 2WZIA 3ARPA 1PW3A 4UCFA 1NH6A 5DJ0A 3L68A 3LV3B 5G5DA 5LUMA 4BQ2A 2WQAA 2F08A 2WZPA 3RVVD 4Z7WF 2BVQB 1RZMA 1MFAH 5MEOB 4E8CA 1PD0A 4H40A 3QOMA 1NP2A 3PPHA 3WLJA 2NZ1A 1OFBA 4PUJA 1V3JA 3CSFA 3L9YA 3VWKD 4EUPG 2Z26A 3SCMC 5HUOA 2VN3A 3ARBA 3WIFB 4ZDHA 1D7CA 5IG7B 5EWIL 4AGOA 1GZQA 1QBLH 2RFXB 1E5ZA 1OHZA 4JFOA 4N1HB 3G1XA 1ZANH 1OGPA 1D9EA 4A8RA 2VLMD 4B3VA 2PN5A 5EC2B 2C3VA 4PP1C 2PO6B 5FM5O 1MSPA 3CUZA 2MHAA 5ACMA 1ZBKA 3EOBB 1AIFB 3G6JB 3K13A 2NY0B 3EO9L 3PJSA 1FNHA 3VWJC 1AHKA 4P5TB 3LCFA 4ABUA 1EUNA 2NZ9D 4R4BA 3GWQA 4HZLA 1DQVA 4A8LA 3ERPA 4FSAA 1S3KL 1QSFD 3GGWB 1MHHB 4JO1H 2P3ZA 1TYEB 5FDWA 5EC2A 1TUFA 1BZDA 1DQTA 4BCZA 4Z1YA 1R7AA 1L0XA 1T5KA 1T04A 3G5VB 4JY8A 3RWCB 1KJVA 2OX5A 1MSSA 2YAFA 4X6CF 2X28A 5J56B 2NOYA 1OP5H 1A5BA 1GZPA 1F42A 1P2CA 4LBEB 4DPQA 1GNXA 3SB3A 2DF3A 1XCTB 5HHMD 5EPMB 1QNVA 3U46B 4XTRD 3UR2A 3RPBA 4R7LA 3WLTA 3F58L 4LGPB 1V7ML 3MXVL 2BNRE 4WUUA 3SN4A 4WO0A 5DD5L 3GRIA 2GQ8A 1YPZE 5CKGA 1OM0A 3MYOA 4OAWA 3KNBA 4OJFH 5BROA 1H60A 2A83A 4HD9A 2YB4A 3VFNB 1FVPA 2GQHA 1KD0A 4RMBA 1OFRA 4LDCA 4Q22A 1JPFB 3FO1B 3BSMA 3P5YA 4ZSTA 1NCHA 1KCKA 3I6SA 3N42B 3CC1A 1A3LL 4YXKH 1JYWA 5EU3A 3E38A 4YWGH 3EMCA 3OA3A 3GSNB 2QKIA 3RVWD 2Z0IA 3D5HA 1FCVA 3UBPC 2EPLX 4HEPG 5F3HB 3JUYA 1W72L 5AWNL 3S5LA 3UZQA 4DJMA 1Q6OA 3L23A 1L0YA 1EJVC 2EUXA 3CXDL 4KRMB 3ITTA 4UR9A 4Y6GA 4GRWH 4DYEA 1UKSA 1DUZA 4N2BA 3MKVA 1E6SM 1G7PB 3T4CA 4CCDA 2ERJC 3PGCB 1O7AA 1FHGA 5DSCA 5K1JA 1NOAA 4GZJA 4AVJA 1JMZA 1SQ2N 3ZL1A 4NUWA 4Z78A 2KQNA 3N4AA 2P3EA 3B2MA 5E4EC 2OT1A 3LMZA 4LMQI 3HZKA 4JPSA 1C8XA 4IGBD 5HR7A 1GYVA 1AGEA 3VX1A 2ZAGA 4PI0A 1Q7QA 3PZGA 4PUDA 4LL1A 4U10A 4N0UE 2HTLC 4I77L 4K7PL 3DHMA 5CLWA 4LSBA 2AV7A 3BQ6A 1B2WL 4ABQA 1ZMYA 2JNZA 2Z9TA 1XLHA 4KHXL 2FZ9A 4HHLA 3RX7A 4IQJA 2CO4A 4YX2L 4QKTA 2DY3A 4C6PA 2IANB 4Q7NA 1F1AA 2WMPB 5CJOH 5B3JE 2WC7A 1LROA 1E4XI 3BPNB 3E1F1 3MRLB 1BEYL 1ENUA 3G04B 4NO0D 3F1QA 2VH5H 4P5SA 3PB2A 2WWMD 1GGIL 4Q8PA 1J8RA 3DX6B 1BVLA 4XVJL 1ZHNA 4Z3GA 3N3TA 1W1ZA 4GSDH 3WN6A 4WSJA 4S1SL 2X4UA 3QFJB 4HJUA 5C09E 4TOYH 4Q6IA 4LUIA 1UZ8A 2F74B 4H26A 1QLRB 4MA7L 4LSUH 2OVLA 4MY1A 4OOUA 3S9DB 2NR6A 4H5SA 4ZUVA 4TVPL 1XBRA 5DFAA 3SY0B 4I9MA 3I2CH 2BP1A 3IYLW 1R87A 1MCWM 2AVGA 3TF4A 2VO5A 2O7QA 4Y1TA 2OAAA 5IBLD 4LF3A 5F9JA 1FCGA 4QDGA 3MLWL 3WN5B 4WENB 1IGCL 3M6DA 3VFMA 4BFIB 1JZJA 1NCTA 2CCWA 2VXUL 4RDYA 1PKOA 1W8OA 4FEMA 5IVZB 5DUBA 3DIVA 3BKML 4OIBA 4I1RA 3QUMH 1VDGA 3CYVA 5K59E 4Z0XA 1T4KA 2CA4A 2ZOOA 3OXRA 4MFHA 3IU3A 3C8FA 4ACTA 2OZ4A 1A14L 5J7CC 1Q0XL 4D72A 5HPCA 3T0DA 4M1GL 3RX8A 1Y18A 3VAEA 2DQFA 4EE2A 3GJEA 4OW6A 4V1DB 1OCQA 3FQRA 1RCYA 5D1QD 1KG0B 1J10A 3ZPDA 3CTLA 2HT4D 1X6NA 4GFXA 1FVDB 3GTNA 3GSRB 2KZHA 1RAMA 1ML1A 4KK9D 4PG9B 1YMYA 3CMJA 4V1XA 5I1GH 1OCJA 3SYOA 12E8L 3DCPA 2MOGA 3K6OA 3PWUB 1ZS8A 1YY8B 3T0EB 5HPMB 1VFOA 3VK5A 1S8DA 3IFLL 3FLUA 2OOGA 1E1CA 1L9NA 1E4XL 2BVUA 1DANU 3M7FB 4N85A 4GC4A 4GUFA 3SIZA 2R82A 2VDPL 4E8GA 3CSGA 1KFBA 1TLKA 4OD2A 4TO8A 1A6VH 4AYMC 2J1KA 3CHEA 4UOQA 4IQLA 1B3VA 5E9NA 1BVNT 3ZWSA 5FV1L 4JIHA 3B1TA 4KMLB 4LGSB 2I14A 1YEIL 3QEHA 3IGKA 4MA7H 3FX4A 4PYGA 3O0FA 1XHHA 1DSFH 3QG6A 4PB9H 4XPGL 2WMHA 3L17A 2FMOA 4APQB 3IV8A 4A05A 4PW3A 3R79A 3VRJB 1S7SA 5AL0A 2K9UA 5I2IA 2R1KA 3MRDA 1LO5A 2J7BA 2EKSB 3GLDA 1DOSA 4M3HA 4Y90A 3H7BB 5AZ2H 3L3OA 1MMFA 3EB4A 3RA7H 3EKCA 3FRPB 5KVGH 2V2XA 5KSWA 4ONHB 3SM0A 3VNJA 2VW6A 3RVXD 3FQYA 2WZAA 5L88L 3UG8A 1P7KB 2Y7SA 3AT8A 1KIQB 3CFKB 3ZR6A 1MO0A 1WXZA 5GRXG 5XINA 5AN7A 2KDGA 1LO3H 1I3RA 1IX2A 4DPBX 2O55A 5EH1A 4GY7A 2WQRA 4QS6A 2ZKHL 4G6JH 5L6YL 2V3GA 3KYMA 4HJEA 2FX9L 4Y7EA 2G3MA 2WXKA 3PJLA 4OBRA 1M2VB 5AG8A 5TDOB 2R59A 3SDOA 4QHLA 3WD1A 3FSUA 3GFXA 4GKTA 4OBTA 2PP3A 5D4YA 1PDZA 1FFTB 2GIYA 3N9GL 1LXMA 4MMXC 1RR2A 4FIRA 2QGEA 3HHSA 1DXIA 1G7QB 1HAUA 4XMLH 2K8MA 1KTLB 4PG9A 5ACZB 1DEEB 4IRJD 2QQLL 2X3CA 4CMHB 3T6VA 3W7OA 3C6LC 1AQ8A 3X14A 2I5YH 3TSBA 1UWEL 5IB2B 3WJWA 2SEBB 5E08H 2REQA 1JIBA 1LEKA 3EGXA 4PUMA 3HFML 4JHBA 2Z2UA 2MOVA 5E6IC 3S42A 3NJFA 3P0VH 4NQVB 3PLYA 2HMIC 3VTTA 4Z1DA 2JB6A 5IEKA 3HA0A 1HH6A 2VXQA 4LHUD 1I1AA 5DJCA 4AQZA 2E68A 4K23H 2H32B 4G82A 4J5NA 4RNIA 4N2HA 4MDOA 2Y6SC 2ZQKA 1E9QA 3PQYA 3JU2A 4MADA 4NILA 5GGUA 1POKA 3LMJH 5LBSH 4AUJA 4BK4A 4ELKB 4GQPH 1C16A 1IAIM 3QORB 2HWZL 5JHDE 2RFGA 3W7GA 2F9BT 3QC3A 3G3MA 2J7CA 4OZOA 2ZRWA 4DF0A 4EF3A 2DYPD 5LO7A 1WBXA 3VB9A 4FQPA 3QUXC 1AZ2A 3T0TA 4AXKA 4I9XA 2XN1A 2B5IB 4HWBH 2EG7A 5DCEA 1OCWH 4Z2LA 3V0TA 1KUMA 1D9KC 1W0VA 3KPSE 3QUYB 2ZSWB 4LO9A 2H9AA 3DENA 1MVYA 5JXED 2OGYA 1IGWA 4UTJA 4QNPF 1OP3K 3STEA 3GHTA 3BSZL 3BUIA 5K39B 3GHUA 3LKRA 3JZYA 1XEDA 4F2EA 3SZ8A 5JYMA 3WL0A 5HDBF 5B3NA 3K80A 4FEZA 1W54A 3MLZL 5LAPA 4E41B 4BWUA 5F2MA 3L3KB 3N1PC 5E1GA 2CBUA 4JM4L 2CPCA 2OMYB 3LKPA 4A22A 4GRWF 2VZSA 4AL8H 3L12A 3DHPA 4JPKL 3IFOA 4ODXA 3VC6A 5CC3A 2C4FU 3AHVA 5AZUA 3PWAA 5DMIH 4JTKA 2ZAHA 1PIIA 1FO0B 4HETA 1Q90A 4DTGL 2CKBA 1B3OA 4LRTA 5FLUA 2FBJL 2J25A 5M94B 4QDMA 1KWKA 3TC9A 2Q01A 1VLIA 4S0HA 3QQDA 1XIGA 5KZMA 4S1QH 4QXUL 4FFYL 4WSHA 2Y36L 4FLHA 1A1NB 2VABA 3N43B 3UDWA 1BPVA 3ICJA 5D7LB 4KTDL 3I6KA 3PXJA 5CPQA 4GNKB 5C55A 5FACA 1UKTA 4HA0A 3G1AA 4QRUB 3M7OA 1VZHA 3P77B 4JDZA 3S2AA 1H0IA 4G6CA 2WOYA 3CCHB 4L4TA 1LEIA 3RE0A 2ZIDA 2WHVA 5IQ9A 5IHZB 3DK0A 1JDEA 4Q8QA 2E1WA 4BJHA 5XIMA 3DX9B 4LSPH 1MUWA 3HUJB 3KPSB 3LGGA 4ODHL 1U91B 3ARFB 3D1MC 2XFXB 3ZX1A 2Q10A 1XHGA 1HP4A 3Q9QA 1IKNA 3DX8B 2C13A 4Z2KA 3QEUB 2X7LA 5F0LB 3VGHA 4FFZH 3BSZH 4DJDD 3B2DC 4JKNA 4HPHA 2VCBA 4NKMB 3BUBA 2A73A 3VOFA 1ED3B 1PIGA 5IBUG 3FT2B 2VC7A 1NCWL 2Z7GA 2AI0L 4NC1E 4WI4A 2VC2H 1I45A 3GSNA 4OUIA 3AVEA 4HNOA 4O0QA 3KM8A 4AWEA 3JVGA 4PD4K 3IXAA 5IJCC 2FFCA 3T1WA 4QXGH 2V37A 1RFDH 5DJZA 3GK8H 1E30A 4WW2A 5HXMA 1YC8A 2YCIX 2DS4A 2G5BA 2FJUB 3JTBA 3IGHX 3LQAH 4KRTA 1NFDE 4TRPL 2R1YA 1ZGLP 4QTGA 2GFBA 4DNHA 3T8LA 2F7OA 4YDKH 3MRKB 4DPPA 2F5AH 5J5RA 2Y7LA 1RV6X 1MJ8L 2G5UA 2Z91B 2VDQL 4K8RH 2IDFA 2ZD0A 4TNGA 2WSRA 2WHMA 3UGRA 5CBIA 4I0PD 3BQUC 3ILQD 3QR0A 4LLUA 3U46A 2JF6A 3NZQA 4HUNB 3B9AA 3GMOA 3HUJE 3UAAA 1IEQA 1LL1A 3V7PA 3IVKA 15C8H 3KHQA 2HJKA 3DX3A 4ONFL 2UXVA 1AO7A 2FJHA 2IFFL 3CHSA 3G9VA 4QRPA 4TSCL 1SJMA 3B7TA 4IKKA 3PJUA 4I89A 2X4RA 4LLUB 1VRXA 1AR1C 1XEUA 1WCBA 3K4AA 3PABA 4X7SL 5JOPD 4DWSA 5I00A 5DQDH 5D6DA 2QQLH 2MJWA 1TVHA 3OAUL 3VI4A 4RXFA 2WQUA 5TQ2H 3CQQA 4NJHA 1NC2B 1ZPUA 1FG2A 5FGCB 3C8KB 3SKMA 4APXB 2BVEA 4UQ3B 4XBPA 1YQVL 4PRIA 1GQLA 5EC1A 5HBFA 3VD4A 1N2VA 3W2KA 4L56A 1OAZH 2X70A 3RIFF 4ZVJA 1XZWA 3IVSA 1J12A 3R8HA 4PGCB 1KN4L 1B1YA 4Y2DC 3DRQB 4PRAB 4XZ4A 1HAWA 4CSZA 3FT3B 1OD7A 1FSKC 2JQAA 3QZBA 2C4XA 3TIDA 4LNVA 4ZFFB 5M7QA 4QR7A 1OFPA 1WBHA 4WKHA 4K3JL 4F33B 3DI0A 4UNTA 3EJJX 3P0YL 4Q0XL 3F7KA 3QO1A 1MFEL 1OCBA 3EB3A 4NKCA 5A2LH 1ISYA 1QWGA 3NZSA 4ZZKA 3KPMA 1NL0L 2WBXA 3RITA 2Z31B 5DXXA 1RCOB 1R86A 3FONB 5C2XA 4RQQA 2A0NA 4AD5A 2ZUXA 1LLOA 1DBKH 1GAFH 4XNXL 3WIHL 4WX2A 1OF2B 5K1NA 3V0WH 1I9JH 3H4WA 3TYDA 2X44D 1K7FA 2VX4A 3DFQA 4BQ3A 3QH2A 3ULUF 1CBVH 3H26A 2G60L 5EA0H 1WO2A 4E38A 5HWMA 4CA4A 5AB2A 2C9QA 4ZMAT 4WTZA 3O3BA 4NM4L 5CJ5A 4DWDA 4RFOL 1A7RH 4AT6A 3CFIC 3G9AB 2H0PA 2V2HA 3ZKQD 4H20H 1D5IL 5INCB 1CU4L 1I9EA 4WTWA 4Y5YB 3TKFA 3OEXA 1CZ1A 5HHOA 5EYWA 2HTKC 1J87A 2WN3A 1R85A 1KFEA 3ZTCC 4TSAL 1A3WA 2YEZA 4HIXL 2LOEA 4MD0B 1R2TA 4GUGA 4AC1X 3SADA 5F96L 4LP4A 1E8XA 3D05A 3DFOA 4MG4A 5B8CC 3AABA 2FATL 2WXHA 3QUZA 1T2XA 4FQ1H 3SKNA 4M6VA 4YL4A 4P9HL 4UAOB 2J8UE 1P4UA 2L4OA 2IWKA 4LAQL 1RP9A 2V5SA 4DZBB 3KCOA 4KEVA 1QPQA 3NYDA 4E5TA 3MRGA 5CFHA 3GINA 2VM8A 2BP5M 3N29A 3OKEB 4N3UA 1QI0A 1AMYA 2UY3A 2WB7A 4GIYA 4OUEA 5F44A 1DZBA 3MRLA 1DVYA 4QSHA 3NSXA 4J7RA 3ATDA 4QRTB 4H6KA 5CN3A 5M17A 1IC4L 4L5FH 1W15A 5F72S 3VVWA 2AGJH 3GNNA 4ZMQA 4HSNA 1OF6A 5FGBA 3L7RA 4H88H 4NQSA 2VMFA 1CF1A 3T8QA 2LVEA 4O02L 3S6CA 1H61A 1H3GA 5ABDE 1YY9C 4WY7L 3UFIA 4DGYH 4F2MA 5KJ7E 4KAQL 1OB1B 2BCMA 4G8FB 3E6EA 4DAIA 5L8KB 5GS1A 4ADIA 4YBLB 1UYQA 3LH2L 4L8BB 1PFCA 2Z64C 3UTQA 3LEVL 4XB7A 2J9XA 2ZVIA 2OXHA 2PW1A 3ZIMA 4H9VA 4TPRH 4Z7OB 3SQOH 4JY4B 4KS0A 4ZFZB 3FYPA 4PJ7A 4DN3L 4WCYH 3H70A 3RPKA 1LNUB 3N2BA 5BXPA 1TVBA 3SE9L 4LALA 4C6LA 3VIIA 2LU3A 3ZJ7A 1QHOA 2ZUSA 3LEVH 5AECA 4ATTA 1UZDA 4WTZG 2PDQA 4LCSA 3FO0L 4AK1A 1V77A 4OQTA 2B8OT 3BSHA 4GSDL 4K3HA 4A6YH 4WFGE 1T83C 5U7SA 1KXHA 4GVIA 3LPOA 4YJZL 2FHBA 4CD4A 4FQIH 5JMUA 4Z0BL 1K2DA 2DJUA 4U1HA 3GI8H 4LOUD 4X0KA 3HI6H 4WW1A 1IC4H 4L5FL 5T3XE 6FABL 5FEZA 3MR9A 4HHMA 3QORC 1RK7A 3AREB 3WBDA 1ODUA 1OINA 4XO8A 4GCXA 1W6WA 3TEUA 1FA2A 3BVUA 1ZSDA 2PPGA 2QLVB 4Q6XA 2APXA 4KVNL 4NGHL 3L4YA 2F54B 4XWGH 4ANXA 3BFOA 2BP0B 4I77H 4YSSA 1C5DA 4ZFOL 5IWLA 4L18A 2SEBA 3D39D 3EGJA 2FATH 1I1YA 4FQ1L 3RTLA 4NN7B 3MKKA 5KBMA 3MO4A 4R9XA 4AYGA 4UTAA 1KGXA 1DVTA 1NGYB 4H9TA 4LHJB 4XZIA 4JG1L 4YCOA 4PGZA 3OAYK 1MHEB 4ZTPL 1A25A 4HZAA 1XYLA 2NSOA 3NN8A 1TRDA 4H25B 3PJXA 1TQVA 1KJVB 1RBLA 2IBZX 3GKAA 2P5WE 3LZ3A 2I07A 4KPHH 3WKYA 1AZVA 5CR8A 4HAFA 1JZHA 4HMCA 3RWFA 4Z7OE 1XGDA 3VD2A 4MAVA 1NGZA 4B91A 3QWNA 5EU6E 5GJSL 5LQBH 3ZN6A 4Q9CA 1I8JA 5AW1B 4FFWC 3KP0A 43CAB 3MCG1 1FV1A 4AYEC 4DZHA 2H0JA 4P9MH 1QZ1A 2EYRA 2JSFA 3GRGA 2Y1AA 2NDFA 4JTTA 3L5IA 3ARZA 3W7JA 3DXIA 5HYSA 3HMXA 4XMZA 1JPSH 3D09A 5LXGL 4P7RA 5I6OA 2XFFA 3IBEA 2WJ5A 4WK0B 3TBTB 4NZRL 35C8L 1ITUA 3U3HA 5D7JB 5JDSA 2Q8XA 5E1IA 4IMCA 4F0HA 4OFKA 2J6WA 3BIAX 4H2HA 4F58L 3I68A 3TA6A 4G8IA 3EWDA 5HQLA 2MPAH 5C3TA 4X6DF 4D7BA 4HNTA 4J3OC 2I60L 1GK8A 2NQDA 4OJFL 1J9RA 3P0YH 4PJHA 3P3BA 4JDVA 3P93A 3RZCD 4XNDA 2VDHA 4Q6JA 1Q94B 5HHVL 4YHML 1B54A 1KEGH 2ACRA 3M0HA 3PGFH 4L8DA 3JBG7 4YFLI 2AXGA 5I23A 1NGPH 5JPNB 2WN2A 2WIMA 5MI0B 3UPRB 3OOQA 3UWUA 1HDMB 1S9VB 3IAPA 5ID0A 2VELA 3WFZA 4DN1A 4O10A 5EBMA 2J71A 5JQ9A 3ABLB 1RAKA 3OAZK 2V9QA 1QFWM 1MFBH 4LCUA 1EZVY 4MJ2A 4I6VA 3OBAA 3K5RA 6TIMA 3WK3A 4R2GB 4FYQA 2WCSA 1XAUA 4X5PA 4FZIA 4KDWA 1DWAM 5KANI 5GJSH 5LQBL 4NRSA 1FA4A 2WO2B 4HS3B 2V2DA 1WV7T 1U3HD 3X1FA 1ZUAX 2J47A 3LMYA 3BRGC 3DPDA 3O0RL 1RJYB 3Q3GA 3KL5A 1E5BA 4OFPA 4JKWA 5L7XH 2VDRB 1HKKA 1LOQA 3M5VA 4ROPA 3BEVA 4HSQA 4XISA 4DXVA 4R7NB 5INDA 1R9YA 3FH7A 4ONFH 4ZENA 4NRRA 1BM3L 1MJUH 1QXLA 3P7YA 1SN5A 2YGPA 1KIPA 1SMOA 1JWMB 4WFGD 1Z41A 3CFDA 3SOBH 1JZ5A 2DLGA 2WLZA 2A6KB 1T4KB 2ZX5A 2ARJA 2OO6A 3CV7A 5GPRA 4N8VB 3GW3A 3OIXA 4Q4IA 1LDSA 5E8OB 1CE6B 2EIZA 4MA8L 4X5XA 1HIZA 3CIWA 1YYLH 1NIDA 2WINA 1OZUA 1ZTXH 2Z65C 5E5CA 5CP7B 4PC8A 3G18A 1I9RH 2KS0A 2YMTA 2YXFA 3FFCA 3HJEA 3ARSA 4PJGB 2B59B 3Q94A 3UC2A 3WCYA 1JCLA 2R39A 4DESA 3TFCA 3IU4H 4S38A 3FQXB 5DRZB 4MQTB 1LE9B 1FOBA 4IRZA 4TUKL 3LRKA 1R0MA 1AGCA 3O7UA 2WWDA 4L0YA 1IEAB 4JRFA 4YL9A 3UJSA 5BOOA 1B3IA 4AXWB 4XG1A 5IHZA 4AIOA 2Z3FA 5IQ9B 3P6LA 1GQNA 2J73A 3MLRL 4NKOA 1HYSC 3G08B 4ZMLA 3WZ0E 1KGCE 4PJ8C 5IVXE 1A8JH 2FVLA 4JX6A 1HESA 2VJ0A 5DRIA 3CBWA 1CWYA 4QY8A 1RMFH 2OLAA 2ZOLA 3RGBA 1ZV9A 4H7ZA 2C18A 4OU1A 2XPKA 5LXXA 4QHMB 4CVXB 2OT0A 1R5IA 5E8PB 5CGBA 4DP0X 2WLIB 3IDJB 3FU0A 2EVJA 3NEHA 4EI5C 4KFZC 5IIEB 4CD6A 4WI7A 4CQBA 3W75A 1A47A 2NY2D 2W94A 2GSIA 4HLZH 4KNTA 4KCTA 4RJEA 1J1PL 1Z69A 1PDKA 5AVTB 4MNKA 3PZNA 3EYQD 3TE9A 2CETA 2VXSH 4BF7A 1JGDB 2A3EA 3TN5A 1BXAA 2VDNB 3MVSA 2WUBL 4Q52A 4HG4K 4XBKA 1VFLA 3QV9A 3E8VA 3ENEA 4OZHF 3EWWA 2PYEB 3MLYL 4GI6A 3U9PL 4B4HA 4GG8B 3MV8B 1XB8A 2AJYH 2LVCA 3ROOA 4DGIL 1FAIH 1NEUA 1I7UB 4Y7OC 3VRIB 4BUQA 1N8FA 2FZMA 4NC2B 3WS6C 3IRDA 1CI5A 2WZMA 5HP5A 5GJMA 5D7HA 4DAGL 3BZEA 1OOWA 3SCWA 3AB0B 3B3IA 4EAEA 5DXYA 5DEZA 3EYUL 1LOLA 4DXKA 5ABFB 3FQTA 3GMRB 2TAAA 4GUCA 3UG4A 5FJOA 5LIKX 3DFHA 1GR7A 2IVFC 5GGRB 2ZUQB 3HFTA 1F2JA 3GVRA 4CC0A 8XIMA 1YMHA 4GQ0A 4HCHA 2YSSA 5KJRL 2VX6A 1WB0A 1HWHB 1IQ8A 4IRJA 3ZHKA 3A4XA 1BZ7B 3I3EA 1XWYA 1OCZB 4C6NA 4OM1H 4X4KA 3T8MA 3BP7A 2DIAA 4O02B 4Z7NB 4GABA 5EDXA 3U6RA 1BVKA 1TG8A 1JPFA 3ZDZB 1J5HA 4LU0A 2QL1A 1TVLA 5EBMB 4RE4A 5DR5L 4KDTA 1BQHA 1JRBA 2KBGA 1YG9A 3M0YA 3C2EA 4PJ8A 1J4EA 1EHAA 1W3IA 2NSXA 1CGVA 3H3PH 1BFVL 3QZLA 3OZ9H 1VBHA 1HCVA 1DDTA 2BY1A 4WHCA 1SBBA 1ZHKA 2Q3XA 4FCHA 4O4YL 3TX4A 3W56A 4I7VA 5LWYL 2WW8A 5DJ8B 4G8AC 3AYSA 1BF5A 4EXBA 4TQPA 1VYPX 1A7NL 3EYPA 2UYLA 4ZRGA 4I18C 4UWQB 3SQLA 1RULL 2QCMA 3VXUD 3GPSA 3LZOA 1XLLA 4ODHH 3FDWA 2EH8H 2K3TA 3EGSA 3MRHB 2V5MA 4YNGA 1Q8MA 3VFVA 5AOUA 1CN4A 5DMMA 4NN5C 4X7DC 2OO0A 4G8GB 4ONOA 2E9MA 2F7IA 2WANA 2VDKH 4NM8H 3ARRA 3SIMA 3AHYA 3AG1B 4D0CB 3WD5L 2BM3A 1FLRH 4MJIA 4MX7B 5B22A 5CBEA 1SQ7A 1BTCA 3EWXA 1MLCB 2C9RA 3DSNB 4EUPH 2J12B 4HISA 1N6VA 1F0LA 3KOFA 4IPPA 5AOIA 4CQ9A 1FFNA 4JG9A 3D08A 5D03A 2Z35B 4NQEA 1SFJA 4FMFA 7PAZA 3TO4A 4G9FE 3L95B 1B4EA 2Y22A 1FHVA 2JI3A 2RDUA 1HTYA 4NYLA 2YSSB 1PKNA 3CXHJ 2K45A 4JVPA 4LU5L 4ESKA 3KDOA 3RYSA 3FNKA 3QPKA 1UUQA 2PCPA 5E6SB 3I02B 4U05A 3GVGA 1F4WL 4PJDB 4KXBA 2C19A 1P5VB 5ES4B 5GZND 4HB7A 2NQ5A 1LRTA 4K9JA 3ULVF 3T6XA 4HPOH 2HJPA 2G5BB 4FI6A 4Q97A 1UXSB 3RFZB 4S2SA 4ZUSA 2D4DA 2ATAA 1QFWL 1SJXA 4HUVB 3ECQA 5C0BD 2AXJA 3NJGA 1A7BA 1MAMH 1S8DB 1RVGA 1CDCA 1RY8A 1X5YA 5DURD 3B9KB 3STPA 3WLHA 1YEDA 5FC9A 3BLLA 3WK1A 1V6VA 1TLMA 3W22A 4DNLA 3EGDB 4BZ2L 3U36A 1ZAGA 2VDMB 3E9TA 3NQDA 1RLBA 1XGQB 4I5XA 3J8F7 3LHPL 1N5YH 4AWUA 4BQ9A 5CEXB 4JFXA 3OAWA 3A6OA 3CN2A 1LILA 4QTFA 1AK5A 1O94A 3NK4A 1LWIA 1UJ3B 5GRJH 4PUUA 2UV3A 2G2PA 2O4EA 3U4EB 3OXRB 3CFJB 1JRHL 2DVTA 4I9TA 3IJ8A 3CBJB 3CU2A 1MFDH 2X40A 3DU0A 4XE0A 4JN8A 5AEAA 3Q65A 3VFUA 2PRMA 3QCVH 1YEFL 4XOAA 3SOBL 5I16B 2XWTA 2DUAA 4KQ3L 1O95A 2FNWA 2QCDA 1TFVA 3TR2A 3URAA 1M6JA 5H37H 1MJJA 1L6PA 1U8LB 2EBNA 3PPGA 1AG0A 4LUSA 3KFTA 1C9WA 3WKPA 5DMLA 2BWQA 1BF2A 2NNXA 2XKSA 4KRPD 4PFEA 4DETA 4A63A 1K8YA 3GDLA 4RMRA 1IILE 2A4EA 4AJYV 2A5HA 5LHFA 1ZLVK 2FQEA 1D2KA 2XN9E 3M1CA 4PR4A 3K2UH 4G8GE 3T4YA 1F61A 4RZ5A 3RKPA 4DP5X 5MEND 5AYXA 5GJPA 3JV4B 3FBKA 1KV5A 3LSOA 1YHPA 4ZOAA 3UMNA 3O2WL 1D7KA 2GTQA 2HROA 3HI5L 1T5WB 1ETZB 5BVPL 1E3XA 1RZKH 1WA2X 4D0DB 1BIHA 1U58A 2VDIA 1BVLB 3BZGA 4MAYB 3WMLA 2XJ7A 2OCCB 3HZVB 4YBLC 1EX1A 1N82A 2QELA 4W6YB 5AZ0A 2I17A 3SCQA 4AMAA 4PMXA 2HH0H 3W83A 4C6BA 3QUKB 2YYTA 4BZYA 1EDGA 2OJ1A 1DJWA 2AKRA 4ICNA 3QIBA 1KYFA 5GIRA 3RY4A 3TZVC 1O7SA 3APGA 2X2JA 3ZFHA 1NBZA 4JPWH 5I6SA 3AWFA 3QEQE 3WEMA 1NGXA 4KBPA 3WUBA 3WSUA 3ZE2B 3CK0H 1WAAF 3TXAA 1J5TA 1VFHA 5EZPA 1X1OA 4TUKH 5JIPA 2CWXA 3KBVA 2BNQA 4L6DA 1FXQA 4JKMA 5BXSA 2O92A 1YTEA 1Z89A 1SY6A 3RWGB 1BQUA 3TVAA 1QQDB 1UHVA 5F71A 4J3SA 4C6EA 3NZ8B 2ATSA 2FJGA 2OL3L 5ECGA 2V81A 1FHLA 2ZWNA 1UYWH 4G5ZH 4OLXH 1IKFH 2FQDA 5AZEL 5B38B 2BSRB 1K5NB 3GXUB 5FJUA 4P2QE 4ODUB 2OM5A 4DEWA 5IB1A 3FJ4A 5FKAA 4HZ6A 3E02A 1VEPA 1TEYA 4X9YA 5K3VA 3OPSA 3QV8A 2EIMB 2XIQA 5SWUA 4RIRB 3GZOA 4LFHD 2EEBA 5CSBA 4BZ1L 5AW3B 5TE4L 3F7PC 3EJQA 4Y4HA 3IMBA 3W1UA 4JLRA 3DURB 1EJ6A 3A3HA 1WXYA 4U1IB 3QT2A 2VAJA 3BW9B 4H7CA 1H3XA 2CO2A 4KWWA 4Z1BA 1SOXA 2WIIA 1N6UA 4WJ5A 2BVDA 1N0XH 1UXSA 1G9EA 1FWGC 1AQDA 3QEGH 2V6HA 3MUZ1 2MANA 3QHOA 2J88L 1BLNB 3O6AA 5FKPB 3W7NA 1Z0MA 2OQLA 5F8RC 3QEQB 1NBYB 3SE3A 3TXVA 1ONRA 4OZFH 1T99A 1BD2D 4QRRE 3HE6B 5EUKA 2ILLA 4TSBH 2NUYA 1LK2B 3VWJA 4H04A 4TXEA 2ZX9A 4HH9B 3U7BA 1RUKH 3ULUL 2CJ3A 3L3OB 4K3EL 4PL1A 1IARB 4BI5A 4JPQA 1KEGL 3C86A 3WIJA 3D0AA 5JW4N 5I8OL 4IXXA 4D6IA 3VTAA 3B0UX 3CJJA 1MQKH 3RILA 5CD5D 1RY0A 4BK9A 3HE6A 3ARBD 4AQ1B 4G5DA 3FHEA 5D1QB 4OD1L 3MNWB 5ABEA 4E3VA 5HD8C 4WDIA 4RSVA 3HI1B 2CPUA 1RU9L 4S1DD 4L5ZA 1ICTA 35C8H 2PLCA 5J6GA 5M03A 4BK5C 5IR1A 1MDAA 1B6UA 1NDGB 1WWBX 1YZZA 4G8GD 4MAYC 5EZJB 3UTTE 3MX0A 3ZU8A 4B41A 2WMFA 2R2HB 2HVMA 2GHWB 2QSCH 1QATA 4KKCD 2BDNH 5TE6H 3QJVB 2ZWYA 1UWTA 1QUMA 3AHXA 5ICZA 3D30A 3BDYL 5DMYA 1CL7I 1FZJB 3BP5A 4C8XA 4DP9X 5IG7A 1CECA 1ODAA 4BQ8A 4ZXOA 4NNYA 1BFNA 4U7KA 4BWLA 2VYRE 3HC3L 3EO9H 3QJHB 1HSBB 5FA3B 1U33A 2BLFA 4WTXA 5FUZL 3ZKMC 2XY2A 1SO5A 4XPAL 4F24A 3TQPA 3KLAA 1F73A 4DBUA 3BLOA 1UJQA 1HXMA 3ILPB 2CXEA 3ZL4L 4W7VA 1ECYA 2VWEE 2Z0UA 4NQCB 4EZKA 4WI5A 1JNLL 3UEQA 4LNRA 3WTVA 1IM3D 2XBTA 1MHCA 5E2JA 4XVTH 5IJKA 1IGJA 5FJPA 1J8KA 2H3XC 5TGBA 3ZKXB 3WQ4A 2FTWA 1YE4A 1XR2A 3GTFA 1K8ZA 3ECBA 4JRXB 5JDJA 1HOCA 3NIFE 3WQDA 3KLDA 4OFYA 2B1AH 1X9RA 2XWXA 2YXWA 1MIMH 1TOXA 1Z9SB 1KZYA 4FXGC 4XBEL 1VLWA 5GS1B 3EYVB 4H8WL 3STZA 3S4SG 3CSTA 3QIUB 1L9QA 2P5WD 3HMWL 4KROB 1XDTT 3TA3B 5LGYA 1B4RA 3LHVA 3M5ZA 3OIHA 5FCZA 5JXQA 5TTRA 2FWLB 1J86A 4UM9D 3VTRA 1NBZB 3HQPA 1KBGH 1YNTB 3BKMH 5CINH 1SN0A 2EDKA 4Z0BH 1KLZA 1M7PA 1RP8A 5DQJB 5FJRA 3RTQD 4BFKA 1WKDA 3C6LB 3OMIB 4IMKA 5CFAA 8CGTA 4QRAA 3KYNB 3CFEA 4IU2A 4WW2F 2Q7YB 3V6ZA 4HGWB 5PCYA 1NF7A 2PGWA 1JHKL 5DD1H 4TL5A 4DUWA 1F18A 1GAFL 4XNXH 4Z95H 5E9DD 2COVD 4Q2ZA 1IBYA 3WFDL 4BF9A 4K9EH 4IGBB 4K4KA 1BAFH 4OLEA 2NY4D 3P73A 4GG6F 4N6RA 4XD6A 2F1AA 1MVUA 3QXDA 1OM3H 4QTHB 4JFZL 1OSEA 5T1KB 4YMPA 1OPGH 1TQXA 1MCKA 1D3HA 1QNSA 4JQIA 1UM4H 1FX6A 1QFEA 4U6TA 3ZDXB 5AAMA 3NQVA 1IGFL 3LBMA 3H2NA 3OSVA 5DWUH 3KMDA 2C1OA 3GB7B 1IR2A 3H4GA 3RF9A 4AYID 3T3ME 1WS7A 5JXAL 1WA1X 1FRGL 2V6AA 4LCYB 4UB9A 3E7JA 4LPWA 2LFEA 4MA1B 4PVBA 1H7PA 4F2UA 3KBEA 3OZLA 3FL7A 4MVBC 2GTZB 3D69B 5AKTA 4LVOC 4KK8C 4C56A 1CDUA 5C2BH 2PDXA 4XC1L 1TIWA 2C3WA 2DYSB 3K5SA 1JPHA 5BOZG 5CGMA 4S3FA 2DB8A 3VFCA 4F79A 2Y0SA 1EQCA 5FL0A 2YN3A 5HDWA 3FPXA 1TPUA 3MCOA 4P5MA 1OG0A 2POZA 1UXLA 3NQCA 5EY5A 5I0XA 1DFBL 4NQVA 3C60C 5FB8A 4NB7A 4X7SH 2XQYK 1G9MH 3UC0L 4YDLC 2FYMA 4XUYA 1A02N 3ULVD 2YAQA 4X4MA 4I5UA 3VDBA 1XQ4A 4QXTB 4RZBA 3D0VB 3QI9C 6TAAA 4J3OG 5D37A 3F7QA 5HMFA 2D3NA 4MA3A 5LNVA 3Q13A 2CAKA 3BFQG 4OUUB 1EXUB 1FNSH 4QITA 4M8RA 5T1DH 3V5HB 1RUAL 1EV2E 4YUEL 3WUEA 3HJZA 5GS2D 2PTXA 3TYZA 4LOFA 4PS4L 1TTQA 4OT7A 3QY7A 4UMBA 4YDKL 1EO8H 5CMAB 4G7VH 4R4FH 5EC1B 2FB4H 1U2YA 3CFDB 2ZFAA 4OCYL 3GM0A 4DWSC 4B5NA 1PX8A 2XTJC 4FFTA 4YWGL 1JGLH 4I5BB 3H2AA 4ZSUA 1YMMD 5D72L 3IK2A 4DUVA 4QXGL 1WUEA 4KZEL 4TX9A 2IPUG 3A4AA 1CNVA 3SE8L 2JCCA 1NL0H 2MOQA 1CD0A 2NY1C 5ENWB 2J74A 3R6IA 5EUOA 5F1IA 5SWZB 1U3ZA 4XBGA 4RR4A 4DI8A 3H4FA 2BIIA 4HUUA 3QUZC 1QLEL 1TKWB 1P1ZB 1PB0A 3KBMA 5I0YA 5IVXF 1TU2B 4NC0B 4PWIA 4NL1A 4XPHL 1CDIA 3SBRA 2XUWA 4OI9A 5DUPH 1WQ5A 2C3ZA 1K6AA 2QCNA 3VOGA 4XNZB 4KWUA 4LUTB 4LKXB 4Y5VB 3MBWA 3B8VA 4GKZB 4G8GA 4Y0GA 3DOSA 2HKAA 5IMLB 2HRPL 1AD4A 3EPOA 2XG5A 4JFDE 1CDBA 5EU9A 3BRDA 5LGHL 5CCZA 4E9QA 1T1YA 4URIA 2C9AA 3BVWA 1VSCA 3VXSA 2I9LA 3CVBA 3CZLA 3PBWA 2DI9A 1KEMH 1Q9OB 2KI6A 3DBXB 1S3TC 3OAUH 1FVEA 2JIXB 3N19B 4BI7A 1O9WA 2H26B 5D2NC 1KXVC 3L0KA 1K70A 4GYFA 4XCNB 3TOPA 4ZXLA 2QVNA 3L1FA 3RFAA 3BCFA 2ZOTA 4UIMA 3TCLB 2DSUA 3PQYD 4PJ9B 2DQEL 3O4LB 3CIVA 4GRSA 3RVUC 2JLLA 3MANA 3GI9H 1A5CA 4OSUH 2PDKA 3ZVHB 5MEOA 1EOKA 5C54A 2CALA 2F5BL 3EH5B 5EWIH 5I8CB 4PJEE 1JFHA 4WR3A 5I77A 1BBJA 4GI8A 3HLKA 1YCSA 2GFTA 4GH7B 5L9DL 4WWOA 2Y7QA 2DTSA 5KZEA 1KKOA 2F0CA 1XGEA 4ZL1A 1AH0A 4X8CA 1TWDA 3VGAB 2WKJA 4Y2OB 4XUGA 2BRRL 5DELA 4O50A 1LEIB 1QSFB 3U6RB 4ZX6A 3NCYP 5IJVB 2BOGX 2X8RA 4KI1A 3EFFB 7A3HA 3F5JA 4MDJB 2VQ1B 5FR3A 4AE1A 1LL6A 3I6KB 1W9BM 4AIBA 5D4IA 4PLKD 1NJJA 1TCDA 5I76A 4IX2A 4A66A 3WD4A 4IPLA 3IUHA 3GMRA 4HJFA 1F4YL 5D2NB 3SO7A 1A1OA 3B5GA 2X1OA 3FW6A 3HQOA 3S3CB 4JREB 3HRZA 3SKOA 1QWUA 2AK1L 5U4NA 2F54A 5EF1A 3V16A 4NSBA 1PFOA 1U8NA 3WHE1 2GC7C 3BUYB 1BAFL 3Q8CA 5BQDA 4IOSD 4LVNC 5DO8A 2D9CA 1CGYA 2IH1B 3B9KC 3QG7L 4PJ5A 5DT5A 5I3DA 2JQZA 3M17B 1GYNA 3WLPA 3MI3A 2WZ0A 5B1BB 5FSDC 3JT2A 2BNRB 4KEMA 3EOAA 3PHOA 2OMUB 4C56B 4AVNA 3HV8A 3S2LA 4K15A 4NCC1 4XP9H 1F8IA 1NFIA 1CYGA 4XNQB 4J3OD 3K8KA 3HNVL 4XRCA 4F8QA 4HKBA 1U9KA 4Y8EA 3W87A 3QUYA 1UP0A 2BVOB 4XODA 3C5QA 4NYUA 2IV8A 4S1QL 2C1OB 2D2OA 3GB7A 3AIRA 5DY2A 1BD2E 1RZGA 1GY1A 2D03H 3OC5A 5LBSA 1KENL 1OTSD 3OJDA 3JZEA 3VSUA 4JTFA 5TNVA 1T0OA 3QZWA 1UP2A 1XB3A 2O4QA 3KR3L 4RW3A 3OMZA 3IMSA 2DEXX 2YDQA 3STCA 5KYXB 2X4OB 1D7BA 3FS9A 4M5TA 3Q48A 4DVBB 5DY3A 1ZLSL 2BP8B 3MFFA 3V4PL 3F6JA 1BYPA 2ZF8A 4RMWA 2DLIA 4AL8L 3E96A 3R43A 4CNTA 4FX6M 4FKHA 3O81A 4HBQA 3PM6A 1KT2B 5HHME 1MELA 1AR2A 4Z78B 4E0CA 4DLMA 3LH9A 1R3IH 1KPVB 4N2NA 2Q8ZA 1CD8A 1CVSC 5F7DB 1WC7B 2D7NA 3ROLA 2G95A 5C9KA 3DNKA 5KVGL 1LYQA 1O6SB 3PAJA 1GW9A 2VFFA 3CDGB 1ZV2A 5T8IA 2Y1ZA 3VSQA 3W2DH 4I13B 5K59F 1CFVH 1I8LA 3CVHB 5DZVA 4Z3EA 5JW4R 1EP1A 3G1SA 2QVHA 2GBTA 1B3ZA 1AO7E 4X5XB 4JZOB 3KM1A 4NJKA 3WFBL 4PRID 5F7MC 3AUOA 1M2VA 4JFPA 4KJQD