2QPUA

Sugar tongs mutant s378p in complex with acarbose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGPRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-amylase type A isozyme
publication title The 'pair of sugar tongs' site on the non-catalytic domain C of barley alpha-amylase participates in substrate binding and activity
pubmed doi rcsb
source organism Hordeum vulgare
total genus 140
structure length 404
sequence length 404
chains with identical sequence B, C
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qpuA01
4AZ6A 2CESA 4HPGA 1VJSA 1BLIA 3AMCA 3AOFA 2YDRA 1UH2A 3VGHA 1DHKA 4TX6A 3TV8A 3VINA 1TFVA 1QNRA 2G3NA 2J62A 1UKOA 2WMIA 4P7OA 1ISVA 3VMOA 1JZ6A 2YLLA 2PWHA 4PCSA 2VRQA 1E6ZA 2XUCA 3VGDA 1HNYA 3BSGA 2BNJA 4H41A 3T0BA 1E73M 1QWUA 1GHRA 3VSUA 1XSIA 3PZMA 2ZOXA 4A4AA 3L4UA 4KMQA 3DX2A 3A3HA 3SCQA 2BXZA 1Z32X 2YL6A 2AMGA 5BXPA 1GQLA 2WK2A 3DHUA 1KGWA 4U2ZA 1QI5A 3TTQA 2OWCA 3GTNA 3BUIA 3GNPA 4AEEA 2WC4A 4TXEA 4CCDA 3FY1A 1CWYA 2GK1B 2W66A 4FLSA 2W91A 4GZEA 4FLOA 2QV4A 1E4IA 1UG6A 3WIJA 3F5KA 1V0MA 1GOQA 1W1TA 2BVDA 3ZJ7A 1ESWA 3NYDA 1ITXA 3IK2A 4OZOA 3KL0A 3WDRA 1XYZA 4Z2HA 4MADA 2ZUUA 1XRVA 2V3FA 3WUEA 2VRJA 4JCLA 5E70A 1R8LA 2JEPA 1P6WA 3TTSA 4D1IA 3OLDA 2BHZA 1UKQA 2OYLA 1QVBA 1OWQA 4D6FA 3GYCA 4W8BA 4AEFA 3BUPA 2FHFA 2DH2A 2XTKA 3MV11 4BA0A 1E6PA 4LX4A 3T0DA 2F1BA 5CLWA 2G41A 2X1IA 4UCFA 1OIMA 2GFTA 5ABFA 1IT0A 4DO6A 4PMYA 3ARYA 5BXRA 3GNOA 3EMQA 1HN1A 1E5NA 2CBIA 2J8GA 2CXGA 1CXKA 2GJXA 4B9ZA 3VDAA 1UA3A 3NJ3A 3OG2A 1NWRA 5ABEA 2XPKA 1OIFA 1PIFA 1PPIA 1NWTA 1WCGA 2VC9A 3U7BA 2X2YA 3CBWA 1E1EA 1B9ZA 3ARTA 4LYQA 3SCSA 3LRMA 3FN9A 3F4VA 2A3BA 5FL0A 5GPRA 3L4VA 3WBAA 2PWFA 3FNDA 3WN6A 5HNNA 1C93A 4U2YA 4J3TA 4GQQA 1DWGM 2YA2A 1AQMA 3ZJ8A 3BC9A 1EDQA 3HG2A 3CUFA 1IZJA 3EJUA 4UQBA 1PZ3A 1QI4A 3CIVA 2VVNA 3POHA 3KLLA 3N1AA 4YPJA 1BYAA 1W3HA 1E6NA 2BV9A 3QHMA 4HOWA 1CYGA 2J7DA 4YHGA 2WZHA 4P8WA 2F7PA 3CUIA 2CETA 3ZJKA 5M03A 1UWIA 4E4PA 2RGMA 1J0HA 1KTCA 4U3AA 1DWFM 1ZBWA 2YL9A 4FF5A 1QI3A 3QOKA 1VB9A 3BVWA 3U5YA 3B9EA 1V6YA 4D6DA 4PTWA 4BQ3A 4CN6A 1KR0A 3EBVA 1UH4A 1B3ZA 2GVYA 3AIVA 2A3EA 2FDMA 4IPLA 4GI8A 2VCCA 3W28A 2JF7A 1E4LA 4JIEA 5D8WA 1G94A 2O9RA 1LG2A 2UY2A 3VMNA 3PZUA 2DPEA 2G3IA 3ZJ6A 1QNOA 1TMQA 5CSUA 2YDQA 3B9DA 3VIPA 2BXYA 4UFMA 5EFFA 2CERA 1HL8A 3VDBA 1CENA 1E55A 4GXPA 3U57A 3ARVA 1KB3A 3W29A 3M6DA 4AZ5A 2VZTA 4FNUA 1VEPA 3OZPA 3GXIA 1PX4A 1R33A 2VR4A 2OYKA 3A21A 5JBEA 3A6OA 3QHNA 1WDRA 1R7OA 1RP9A 3PTMA 2YA1A 2IUZA 1BHGA 4PTXA 3G6MA 2JFEX 1UKPA 3THDA 4NSBA 1ZL1A 3FAXA 2DH3A 2D3LA 4FNQA 4ACZA 2D0FA 2J78A 1VFMA 3VOCA 3TP4A 1B3YA 3W27A 3VD7A 1H5VA 3AIBA 2VX7A 4Q22A 1E15A 1W32A 3OGRA 4AZGA 1WE5A 4AD0A 3HG4A 5CGMA 2G4FA 3EDDA 4U31A 3VSVA 1FP9A 4P7LA 5C8BB 3WNNA 1E0WA 1J12A 3ECQA 4AWEA 4BCEA 4PMQA 3T2OA 4R27A 1HIZA 1LLOA 2WCSA 3GH7A 4CD8A 2FH8A 4UQDA 2YBUA 2Y8VA 3VVGA 3AQUA 4HTYA 4WIWA 5CLTA 2WVVA 1U33A 4HMCA 1BYCA 4B9YA 3GBDA 3I3EA 1UR1A 3LXCA 1MW0A 2E0PA 2HISA 5FOOA 4N0RA 2OWXA 1XGZA 4XB3A 2YL8A 3VGEA 3BAYA 1OGSA 2XVKA 2EBNA 1FHLA 4GZJA 5HDRA 3VX0A 1E56A 1ISZA 1A47A 1V6WA 3TONA 4HU8A 3AIRA 3DX0A 1G01A 4LPCA 1H11A 2ZUNA 3BUDA 3U5UA 5IXEA 1X6LA 3K8LA 2FHCA 5I5RA 3VIMA 3UG4A 4AZCB 3AROA 2J74A 3WQ6A 2CBJA 1OD8A 1U2YA 2XVGA 1VENA 3MKKA 1PX8A 1G9HA 4HPHA 5DT5A 4QP0A 4E2OA 2XN2A 4LXFA 3ZT6A 1K9EA 3NDZA 1WDSA 1D3CA 3MUAA 4GKLA 3AISA 2ESCA 3EJPA 4NZFA 2E8ZA 1HJQA 1VAHA 4HA4A 2YA0A 3L2MA 1JG9A 1XH2A 4RL3A 4HZ7A 1V3KA 4AMWA 4ACYA 2VURA 2QHAA 4AZIA 3BVUA 5ABHA 2E40A 1MFVA 2UY3A 1B3VA 3BLBA 3WDPP 1WZLA 2VTFA 4MB4A 1E4NA 4FMVA 2V5CA 1C91A 2IGTA 1B1YA 1CEOA 4R5EA 2Z1KA 7CGTA 4WF7A 1QHPA 5DFAA 3CHEA 3D3AA 1OGGA 2DT0A 3OZOA 3O9NA 1HWWA 1HVXA 3KWXA 3U7VA 5BRQA 1NOWA 1TQWA 1LL4A 4D6IA 1KXQA 3WD1A 2DSKA 1V0NA 2WPGA 4TX8A 4B16A 2WXDM 1ISYA 4W7WA 4CKQA 2J7GA 4PEEA 3WH9A 1GUVA 4PSPA 5D4YA 4E8DA 3APGA 2YKKA 2NSXA 4HMDA 1UD6A 1V3MA 5AYBA 4EAMA 1EDTA 2J4GA 3DHPA 3WENA 2XN1A 3EJTA 4MTVA 1HL9A 2XWDA 3VM5A 2D23A 4TUFA 3RDKA 4M1RA 5E0CA 5A94A 1RH9A 1KTBA 4CVWA 2X05A 4DUVA 2PBOA 2DSVA 1QNQA 1CGWA 3DECA 2J79A 5E6ZA 1JZ7A 1CTNA 1MW3A 4CUCA 5D9NA 1DWJM 4JFTA 1ZS2A 3AI0A 2XVLA 3EDEA 1JXJA 1W3KA 1GOWA 4P8VA 4CGTA 2JEQA 2BY3A 1UR8A 4CD7A 2GDUA 3BMVA 3CH9A 1Q6GA 5A6AA 2X0YA 3N17A 2ZX6A 3BAIA 4OUEA 4F66A 2F7RA 4BZYA 1FP8A 2WYSA 3AYRA 1RPKA 4PTVA 4MB1A 4DO4A 3UR8A 1K9FA 1GHSA 3A47A 4U5IA 1K9DA 4D1JA 2WBGA 2X0HA 5A69A 2OW6A 1KXHA 1JNEA 4MPKA 3WD4A 1XD0A 4J3UA 1QW8A 1EGZA 3K4DA 2DGAA 1UR9A 4WKHA 1UKTA 1ECEA 2E9BA 2A3HA 4TTGA 3SCWA 3BSHA 4AZBA 2CKSA 4NX0A 3SCRA 2DSZA 3I3DA 5A6MA 3FAWA 1JD9A 1EO7A 2JF6A 2D22A 3EMZA 2Y5EA 1UWUA 3PTKA 4U3CA 3ZSSA 3WH6A 3RIKA 4GQRA 5BWFA 4UFLA 4PMUA 2DIJA 1CGXA 3L4YA 2CITA 1R46A 3KL3A 2WBKA 3EJQA 3TOPA 4M81A 3IJ8A 4B15A 1JAEA 3N15A 3II1A 1EO5A 4DUXA 1GNXA 2V3EA 2VQTA 4W8AA 4BQ4A 2D0HA 4UQ9A 3M07A 3LPFA 4J28A 5I24A 4MNKA 3DC0A 1NOFA 1V6UA 2DSWA 3G6LA 5E09A 4UR9A 2AAAA 1WDPA 4UFKA 1ZJAA 3A24A 2UWFA 3RJYA 5C71A 2ZX5A 1KBBA 4UQAA 3WEMA 3W26A 4HOXA 1KCKA 5A2BA 4U33A 3WSUA 4PYSA 5A6KA 1V0LA 1J10A 4B3KA 1BF2A 2ZX9A 3VD4A 1H41A 2W63A 2VZOA 4BQ5A 3D50A 1UWQA 2WC3A 2Y8KA 3K1DA 5AC4A 4NRSA 3SCOA 3S6TA 3IGUA 2EAEA 1KBKA 2F1AA 2BS9A 2XGIA 1EH9A 3BXWA 3AMDA 4H04A 1ZBCA 4ATDA 1VFOA 5BXSA 4WLCA 1E6SM 2XHYA 1V3HA 4S3KA 5IHRA 1CGUA 2BFGA 1L8NA 4AIOA 4AD3A 4GI9A 1SR0A 1JFHA 4GO8A 2ZIDA 1OB0A 3W6LA 2PBGA 4PUDA 3DDFA 3WQ8A 2W67A 7A3HA 5LA0A 3CZEA 4NXKA 4M24A 1E6RA 5A8MA 2WZIA 1NWSA 6A3HA 1H09A 3OA5A 3GH5A 1US3A 1GPFA 1UD5A 3BAJA 4CU8A 1K9TA 1R75A 5CPTA 1HKIA 3CZGA 1BSIA 4JAWA 2B31A 4QAWA 1CXLA 1KQYA 2W62A 1E72M 2EPLX 3AXHA 4D6GA 4F9JA 3SUUA 5BYWA 1JXKA 4P8UA 1NARA 1C8QA 1CLXA 3WH5A 2WVVB 2GDVA 5EBAA 2W4XA 1V6XA 3F5JA 3VKKA 3VU2A 4D6HA 1CXEA 4CN1A 3ARRA 1BGGA 3VDHA 2ZICA 1TZ7A 1QHZA 1MXDA 4CD6A 1V3LA 9CGTA 2F18A 1BFNA 4PMRA 1KGUA 2F8QA 2AOSA 3A4AA 3LRKA 3EDKA 1VJZA 1VF8A 1ODZA 3GXMA 4MB3A 4WJXA 5A6SA 1EDGA 1UA7A 1W9BM 4AC1X 2HVMA 4MJ2A 1B31A 1D7FA 5GQBA 1JYXA 5JIWA 1LWJA 1PIGA 4X0VA 1TA3B 1UOKA 5A2CA 5HXMA 1F4AA 2PI6A 1OT2A 2OSXA 2D2OA 1LL7A 1JZ2A 3CZ8A 1XHGA 3ZQ9A 4DWSB 4J3WA 1VFFA 2VCAA 5CG0A 3ZM8A 1QHOA 5KEZA 1JD7A 3GXFA 4J7RA 1JYWA 3GXPA 3CZLA 4M8UA 3WUBA 4KWUA 1HJWA 1OBAA 3OGSA 4W8LA 4W5ZA 4JFUA 5CPSA 3PN8A 1C8YA 4DO5A 2VRKA 2XIBA 2YFNA 4F79A 4A3HA 1JFXA 3SCVA 2VT0A 3PZ9A 3BVXA 1HVQA 4W85A 1J0JA 3DX3A 4QDMA 4EANA 1W1VA 2WCAA 2OYMA 3EYPA 1E6QM 1GORA 3WL1A 1ISXA 1CDGA 4DM2A 3W82A 1UASA 3VIKA 1C8XA 3ZIZA 4AXNA 2QMJA 1ZU8A 5JBFA 3PZGA 4W7UA 5F7UA 3PHAA 1CXFA 4GZIA 1TQVA 1W1PA 3AXIA 1WO2A 1PS3A 4TVDA 3VTRA 4XUYA 1GQKA 1AQ0A 4IM4A 4N42A 3VD5A 5E6YA 3AIWA 4UTFA 3IAQA 3S5ZA 5HPOA 3AICA 4PRWA 4CD5A 2J8FA 1KQZA 3D52A 1E0VA 1G1YA 1C7SA 1FFRA 1OM0A 5DO8A 2EADA 2YLAA 2BVYA 3NDYA 4WSKA 1HT6A 1FOBA 3SUVA 2NT0A 1Q6CA 5CSYA 1JDDA 2EXOA 3T0AA 4FLQA 5JBDA 2DEPA 4LYPA 4W89A 2WMJA 3OLGA 3WNMA 3B8SA 3M7SA 2VCBA 4Y7EA 1UD4A 4WKFA 4CCCA 3WMSA 2PC8A 4L4OA 1X1NA 3AS0A 3O6AA 2Y2WA 3WMBA 1Q6FA 4JHZA 2EABA 3I3BA 3SURA 1W2PA 4JL2A 1AVAA 4AW7A 4UZSA 3SIMA 5FIPA 2GJRA 1BYDA 2OSYA 2CIPA 3NSMA 1XH0A 1E3XA 2GJPA 5D9OA 3WL0A 1TG7A 4JL1A 2E8YA 1HJSA 2C7FA 3BAXA 1I1XA 4E8CA 2GK1A 4OOZA 3VGBA 4PMZA 1CXIA 1DWHM 3WF0A 1B2YA 2XYLA 4PSRA 2RGLA 2Y4SA 2WANA 3A4XA 1EQPA 1JF6A 3W38A 4Z2KA 1GW1A 1V08A 1V3JA 2CCRA 1TVPA 3VSTA 1O6IA 3H53A 2XVPA 1IV8A 4FNPA 5IFPA 4DWSD 3MS8A 3WH7A 5CPQA 2VZSA 5CZKA 1MXGA 2IXVA 2DT3A 2XG9A 1KXTA 3VGGA 2XVNA 5FL1A 3QGVA 1V02E 3WY3A 3W81A 4AZHA 1XCXA 5I23A 1H0IA 1FH7A 4XZWA 2QLYA 1ODUA 4WSJA 2QMKA 4M82A 1H3GA 4OGZA 3H54A 3AIUA 2W61A 1O7AA 2EPOA 3CHFA 3NSXA 4A3YA 3AMKA 4AIUA 5CGTA 4QCEA 4FLRA 1O7DC 1UR4A 2V38A 2VOTA 3WQVA 4CCEA 1WZAA 2D24A 3AZRA 3VIFA 1FH9A 3A23A 5GNXA 3CTTA 1JDAA 3MMUA 3UEQA 4MNMA 4D71A 1MQQA 1PZ2A 2WMIB 3GXDA 1BVNP 3RO8A 2VX4A 3MSDA 4AD4A 2E9LA 3WDHA 5DMYA 3WNOA 3WF4A 1FH8A 3ARQA 4AYSA 2D3NA 2V3DA 2W5FA 3AIQA 2X2IA 4QLJA 3GXNA 2ZX8A 4RE4A 2YDSA 1C92A 4W88A 4EK7A 2VNCA 4OBRA 1GOOA 1JIBA 1KXVA 4XX6A 1VRXA 1V02A 2JE8A 4U5KA 2VX6A 3VIJA 1UQYA 3E1F1 3VNYA 1JI2A 1TCMA 3AIEA 2J7BA 3UESA 1M7XA 3FHAA 1QW9A 4W5UA 4MDOA 3AJ7A 4JFSA 3CO4A 3AS3A 3RM9A 1I1WA 2F2HA 1XSJA 2J7CA 4IISA 3ZR5A 1WDQA 4XZBA 2XSBA 2PWEA 2UY5A 5AY7A 5M17A 1B3XA 1UR0A 3N12A 3L2LA 2CHNA 2EEXA 3N11A 3WEOA 1VBUA 3RJXA 4RE3A 4OKDA 5I77A 1HKMA 4H7VA 1SMDA 2DT1A 2XFRA 1H2JA 3SCNA 5I78A 1QI0A 4UFJA 2PF0A 3UERA 4WKAA 1CGYA 2VX5A 3SCUA 5LA2A 5E0FA 1VEMA 3OBAA 3KLKA 1LWHA 2NW0A 1BQCA 2ZX7A 2ZUMA 1H4PA 3WD3A 4JKLA 3AHTA 2XM1A 5ABFB 5GNYA 2XFFA 3SUTA 1WP6A 1HJVA 1XYFA 1UZ4A 1KWGA 1Q6EA 3WKZA 4ATLA 3WBEA 2UY4A 2FHBA 2WKLA 1NP0A 1GZJA 3LXBA 3OB8A 2GJXB 1XC6A 4D6EA 1WZMA 1L0PA 2WNWA 1JYVA 4OJYA 1GOKA 2VZVA 3AZTA 1NWUA 3TTYA 1FA2A 4QLLA 3EDJA 3WDQA 2YIHA 2E4TA 3GBEA 3BCDA 4PCTA 4HA3A 1VFUA 3UCQA 4MB5A 5AC5A 1R7AA 5EFDA 3CMJA 1JGIA 5D8ZA 1C90A 2ZUTA 5A8PA 3CZKA 3WNPA 1C3FA 1H49A 5FKYA 2ZWYA 4UFIA 4PUEA 1J18A 3B9AA 1RD6A 4H8UA 1H1NA 3A4WA 5A6BD 2D20A 1M04A 3LMYA 1XV8A 4H8VA 1HJUA 1E43A 2WVTA 1W9DM 1KGXA 2JIEA 4NZJA 1LQ0A 5A8NA 1JZ3A 2VVSA 1UYQA 2X8RA 1V6VA 3ARXA 3BLKA 3HG5A 1EHNA 2WAGA 3KL5A 3ZR6A 2CNCA 3LPGA 2VL4A 3PZIA 5BRPA 1OCQA 4OBSA 1R86A 1TQSA 2XFYA 3TTOA 2O9PA 3BUBA 3BAKA 1AQHA 2YL5A 2VZUA 4TVCA 4J3VA 1TR1A 1PAMA 2JALA 2WSPA 1JI1A 3WY2A 3OLIA 2G3MA 5M5DA 2Q8XA 5BCAA 2EPNA 3MU7A 1QBBA 3WELA 4AD2A 3VM7A 4JHOA 4EKJA 1OGBA 2VR5A 3K8KA 4KGJA 1BVZA 3TA9A 4F9DA 3AHYA 1J11A 2BY1A 1CLVA 4B3LA 2O9OA 4ZE5A 5EB8A 6TAAA 1GJWA 1EQCA 2XSAA 1XH1A 1HXJA 4NXSA 4AD1A 4D6CA 4W93A 3MI6A 2A3CA 3POCA 4UOQA 3VIOA 2QPUA 3AS1A 1CNVA 1KFWA 3IANA 4W84A 1OINA 2DSUA 1XCWA 1NOUA 1UWTA 5A8QA 4H8HA 2IXUA 4NF7A 1HP4A 3CGTA 1JYNA 3BGAA 4QFUA 1QBAA 3VPLA 1EHAA 3MV01 5CXPA 1HF6A 3CZJA 3ZSTA 2VI0A 3KEHA 4ACZB 1WZKA 5A95A 3WFLA 3AMLA 2BHUA 4UNIA 4JFWA 3OIHA 3BUQA 4J3XA 2V5DA 5E1QA 3FHQA 5C70A 1KR1A 3PZNA 4ZFMA 4F8XA 1GVIA 1J0IA 4K68A 2YJQA 2CPUA 1RP8A 4J27A 1FHDA 3VUPA 1B0IA 6CGTA 1MQRA 2Y24A 3PZOA 4AYGA 1W91A 3LRLA 2J25A 3SCTA 1SMAA 1PBGA 1QI2A 4HOZA 5D9MA 1OSEA 2CHOA 1B3WA 3QOMA 1VEOA 1EXPA 4PMOA 3W4RA 4FK9A 4TTUA 1EOMA 1LL6A 1UD3A 4Z2JA 4FNSA 5TD4A 2X2JA 1QPKA 5ABGA 4KH2A 3VX1A 1C7TA 3NUKA 1JL8A 4YN5A 2WLYA 3THCA 2EPMX 2D73A 2OLHA 3PZVA 3AS2A 1W1YA 3L4WA 3GDBA 2VUYA 4V27A 4URIA 1Q6DA 4IPNB 1W3JA 2J77A 2VJXA 1AMYA 3UG3A 2WW5A 5I79A 1WAWA 3CC1A 2EPKX 2ZXQA 7TAAA 5ECUA 2MANA 3ZO9A 5CJ5A 4D72A 2WZEA 1G5AA 4BS0A 1XD1A 3HJEA 1LF1A 3VGFA 2EO7A 1UHVA 3VNZA 3BVVA 2WMKA 5LA1A 1E6XM 2ZUVA 4ML4A 3OLEA 4GINA 3FW6A 1MYRA 2WM0A 4HMEA 2DT2A 5LYRA 5A3HA 3WF1A 1ZBVA 4JKKA 3MSGA 4YHEA 1JNDA 3ARPA 1NP2A 4PMXA 3D4YA 3KE0A 4S3JA 3VO0A 1US2A 2CBVA 3IJ9A 2CKRA 1UWSA 3W24A 1KWKA 2JIWA 3K8MA 3QHOA 3BMWA 2NT1A 4UZUA 3DX4A 4J3SA 3AYSA 4QCFA 3UR7A 3WQ4A 5HPCA 2J7HA 3GXTA 2VMFA 1GVYA 1MFUA 3WQWA 1V0KA 3IAPA 5HOSA 3EDFA 3BAWA 2PWGA 1KCLA 2CBUA 8A3HA 5D9PA 3W37A 1DP0A 1UKSA 3DX1A 3ARUA 4GI6A 5FD0A 1YQ2A 3WF3A 4DUWA 3CPUA 5A2AA 3HN3A 4AY1A 2WHLA 2C0HA 4LYRA 4BQ2A 2GUYA 3CZSA 2WMGA 3VIHA 4FNTA 3BH4A 5IFTA 1IZKA 2VQUA 1YHTA 3VD3A 3DYPA 1CGVA 4UQEA 1E40A 4EE9A 3W25A 2J47A 3NIYA 2J75A 2EACA 4ZE4A 4CU7A 1QWNA 1UWRA 1GONA 2WB5A 1R47A 3A5VA 1V3IA 3K4AA 2YFOA 3AZSA 3CUHA 5KZ6A 2FH6A 3VIGA 4L4PA 4JKMA 4LGXA 2OW7A 1SZNA 1GOIA 4P7QA 3L4TA 1J0ZA 3VIIA 2WMFA 1CGTA 4NI3A 3IJ7A 2PB1A 1NQ6A 1ZBKA 3M46A 2DIEA 3W6MA 2C8NA 4P8XA 3S2CA 4GO9A 3WH8A 4Z2GA 1Y7VA 1MW1A 4M29A 2WHMA 3AHVA 1G0CA 4HP5A 1M53A 4AZ7A 1K6AA 4KRUA 1HP5A 1TQTA 3ZT7A 1UUQA 4C7DA 5A1AA 3AFBA 3WDJA 4JZ5A 1ZJBA 1CXHA 1E70M 2J7EA 1QNSA 1PX3A 3NCOA 4M80A 1UD2A 2WKGA 2A3AA 4PN2A 3KZSA 4ZEPA 4XV0A 3T2QA 3WY1A 2D0GA 3O2LA 4ATWA 3N18A 1V03A 1J9YA 2TAAA 3EJSA 3AMGA 2ZXBA 1DEDA 3WUFA 2WHJA 2FE0A 4CN4A 3MUY1 1EA9C 5DT7A 5I3DA 4PTMA 2WLZA 3AXXA 2FGZA 1QNPA 1OT1A 4TVUA 1XSKA 3NSNA 2F7OA 3CUJA 3PZQA 1QX1A 3WFZA 3N9KA 1NH6A 1LJYA 4TOQA 1JZ5A 5IDIA 4X0NA 1HJXA 3ARWA 1GJUA 4UOZA 3S5YA 4MAVA 4ZENA 1E9LA 1B30A 4W86A 2WCGA 2WHKA 1UQZA 2XM2A 3AHZA 1TVNA 3VDCA 1JF5A 5GNZA 1MVYA 3ZMRA 1HX0A 3UG5A 3A22A 1JZ4A 1GQJA 4V2XA 4HA1A 1H0GA 5A6JA 1MW2A 1PJ9A 1W3LA 2ZUWA 5JIPA 4OIFA 4MDPA 3LPPA 2FGLA 3J7HA 3WQ5A 2EQDA 3WY4A 4MNJA 3SUSA 3LX9A 3RPMA 5I0DA 4PBGA 1TUXA 2BY0A 2OWWA 4FNRA 5BXTA 1HKKA 4KGLA 2XIIA 4HZ8A 3WUGA 4DM1A 1MQPA 1U30A 1JAKA 2BHYA 1QOXA 1TA3A 1SFSA 2BY2A 3LPOA 4MJ4A 3PZTA 3EMCA 4IUGA 4HU0A 2X09A 2XJ7A 3AHXA 4DWSA 3CMGA 1X6NA 4ZXLA 4WK9A 2WSKA 1ZB5A 4P7NA 3CLWA 1J01A 3WNLA 1DWIM 1EOKA 3ALFA 1UR2A 3ARZA 1E0XA 1BAGA 3HU7A 1WB0A 3RM4A 5IHSA 4GPNA 3CZNA 2DQXA 3UETA 5AYIA 4LQ1A 2FYVA 1E1FA 3MO4A 1WNOA 4PMVA 2ZUSA 1CIUA 4DWSC 5EMYA 2YBTA 1UD8A 2CEQA 1E4MM 1T0OA 2ZXAA 1M01A 3W0KA 4AISA 2BVTA 1WKYA 3MUZ1 4UQCA 3VILA 2ALWA 4X9YA 5A6LA 3HZ3A 5DF0A 4UFHA 1BGAA 4AD5A 4V28A 3BCFA 1VIWA 4AMXA 3T09A 3CHDA 4KRTA 2XN0A 5M3WA 1BPLB 2WWCA 3HMCA 2G3JA 2WMHA 4NRRA 2V3GA 2XWEA 2G8ZA 3MUIA 3L4ZA 3DYMA 3GH4A 1A3HA 1BTCA 1ISWA 3RMEA 3BVTA 3N13A 1R85A 3SCPA 3SUWA 3ZT5A 4HZ6A 2XGBA 1ITCA 1BG9A 2E3ZA 3WD0A 3WDIA 4UOJA 3QR3A 3CV5A 1M03A 3BLPX 2VO5A 4Z2LA 1UZ1A 1FFQA 1R34A 2D1ZA 2PWDA 2ZWZA 4JCMA 2YOCA 4CD4A 1DTUA 1E5JA 1W2VA 1CECA 2O92A 4W87A 1E3ZA 3WD2A 1MWOA 5CQ1A 1Q4NX 1JZ8A 3DYOA 3F5LA 2ZXDA 1S46A 2WVUA 4MNLA 3W53A 3GNRA 1GCYA 2O9TA 4NZCA 5BROA 3CUGA 1UH3A 1BG4A 2WC7A 3RCNA 4D6JA 2CYGA 3SEPA 3ALGA 1JDCA 3WMCA 3T2PA 1R87A 3K46A 2X2HA 4C7GA 1CBGA 3ARSA 2Z1SA 1HTYA 2GSJA 2EJ1A 3EJRA 1WPCA 4Z2IA 3RM8A 1TQUA 3D5HA 1B90A 1HKJA 3PTQA 1CZ1A 3ZOAA 4JFVA 4CVUA 4Q7NA 4PMDA 4OOUA 5DEZA 3VD9A 2WVSA 3D4ZA 4GIAA 3MMWA 1TE1A 2J7FA 5A8OA 2WWDA 1PEZA 1GQIA 4H2CA 3WNKA 1OD0A 3FXYA 1D2KA 4AMCA 3WF2A 3WEZA 4ZXOA 1GOMA 5JUVA 3L4XA 1W9UA 5FCZA 3LXAA 8CGTA 3GZAA 5I2UA 4M56A 5I6SA 5HBFA 4BF7A 1E71M 1W9PA 3T08A 1VBRA 1HXKA 2ZE0A 1CPUA 4RE2A 2F7QA 4P7RA 1W9VA 2QPSA 5E9AA 1W9XA 3VMPA 3CHCA 1BYBA 3D51A 3OGVA 4PMNA 4AIEA 3RILA 1LG1A 4AZCA 1J0KA 1DWAM 3PBGA 1N82A 4QLKA 3N04A 4C7FA 2QF8A 3JUGA 2E9MA 1F4HA 1SYTA 3MANA 3HG3A 3H55A 2F61A 1EIBA 1J0YA 2W92A 2OSWA 4CU6A 5A6BA 3GM8A 2DDXA 1NM9A 4W7VA 1I75A 3DDGA 4MAZA 3MMDA
chains in the Genus database with same CATH superfamily
4EUPA 2F6UA 3DIFA 3LG3A 1UH2A 1HCFX 1A9BB 5DJZA 3VINA 3IFOA 2RH0A 4GW1B 3S8HA 4OZIE 2F54D 2O4QA 5JQ9A 3VGDA 1ZAHA 2GDQA 1EUNA 3DKHA 3A3HA 3UBXA 3CVIH 1X9RA 2JB5H 3OZLA 1QBLL 3IEBA 5JIHA 5EY5A 3TTQA 1SYSA 3REVB 5K5YA 2WC4A 4GS7C 4GMTL 4PQXA 5DD5H 3H2WA 1MFBH 4ZJ9A 4BQ6A 1M1BA 1AIZA 5DDHB 5HD8D 3F5KA 1Z3RA 2OXGA 1XF0A 4Q8TA 4XAWH 3TK7A 2BVDA 2Z6FA 4PJAF 1ITXA 4LBEB 4YN3A 3IK2A 4HHWA 1TPB1 1OCNA 2VRJA 4DFIA 4EMZA 2OELA 1ZV2A 1QVBA 4J3OH 3UYCA 1A6WL 2F1BA 1T20A 3U9UB 4JFFA 4AV4A 1AP2B 2Q8AL 2D7TL 3KBJA 4AH7A 4N0CD 4B9ZA 1SXNA 1DDHB 2Z1PA 3SQSA 3ZYJA 3BQVA 1GW6A 4HKZA 1PIFA 1B4JL 1Q90A 5TTRA 4PPTA 4Y2DD 3TESA 4F7TA 3UTSB 3UYRL 2JK5A 4CKVX 5IWLA 4ZPTB 3KXFE 5EU6E 2VAAB 1Q0EA 2Z64C 2HUEA 2IH3B 4JHMA 5HATA 5DY3A 4L9ZA 5D2YA 4HGMA 4AYFA 3GHEL 5I9QC 1P4UA 4C55A 3N91A 3TN0C 2HSAA 3P3RA 1Z7JA 3I9GH 3CPLA 3WLHA 4RGNB 4GQBA 1RZKC 3KAAA 3D30A 5D8WA 1OY3B 2V2HA 1HGYA 2GLKA 4I88A 3TZVB 3SDXA 1HHKB 3Q8CA 3UJJL 3L5WA 4MWAB 2NLIA 2BVEA 5I75B 2WLMA 4FFYH 3GXIA 4UT9L 5J5DA 1S3HA 2YA1A 4PJDB 3RJOA 4Y5YC 4YDJA 3EX4A 3VXPB 1VFMA 5CZRA 3H21A 3W27A 1JN6A 3AIBA 4M1DL 4ZOAA 3H42H 2YC1A 4DGYH 1U8IA 3HG4A 2EDBA 4QHLB 3A3XA 5JQ6H 1KIPA 3U2CA 2QS8A 2G5BA 1U8HA 5IY5B 5D4JA 2Y8VA 4MZ8A 1P0DA 2QL1A 2X70B 3N9GH 3L5HA 1NIAA 3F03K 3NSCA 3CFJB 3GDRA 3DFOA 4G1EB 4U1KA 4U7SA 3BAYA 3RCYA 3UXDA 1KC5H 1J4EA 2NCMA 4KRNA 4XVJL 1ISZA 5ICYA 1FBIH 3T04D 1XLCA 2OVLA 4QRNA 1A0DA 3VCNA 4N2FA 1E6JL 5LBGA 4L9LA 4B5NA 4NHUB 2X1QA 3ARED 4H44C 3N5AA 2CZDA 2LV4A 4NKOB 4ACYA 5HGHA 5SX5K 4DKAA 4IMEA 4K3DL 5CEZD 2Z27A 3M0IA 4IL2A 4REQB 3BKJH 1UM4H 1DLHA 1FL5B 3K6IA 1CC3A 2BZNA 2OCCB 2C9RA 2Z1KA 1A65A 4WOQA 4NZRL 5CR1A 1RBOB 2CBTA 1OARL 4BF5A 4J39A 1AHWB 3K6SB 4UB9A 4CKQA 4Z5RA 1FQ0A 4R7DA 2VN6A 1QUPA 2ZKHL 5I19H 4JFZL 4HVXA 1CF8L 1FCBA 5LGJA 3L13A 1RBLA 3OX8A 4LF3B 1ZLWH 4LPUA 2FL5B 2B1AH 2YPLB 1AW2A 1YY8A 1R3HB 1DBTA 2A1WL 2VLKB 2DUZA 2IWEA 1K4GA 1IEWA 5KBDA 1HHHB 1FUNA 3T8QA 4PJCA 1RSFA 1ZVSA 4JE4B 1CE1L 1WIOA 3EHBB 2HRLA 2VDPL 1AUSL 5DHXB 2ADGB 3TXZA 4L8SC 3OAZK 4BZYA 2Q6ZA 1NCAH 4Z8FL 5BOZG 3FCTB 1J8HA 3RWCA 4HUVA 5EUOE 6TIMA 5FGCB 1OFAA 1DVFB 1NFPA 4IEFA 4S1FA 1W5OA 1GTEA 3RDJA 4GQZA 4PWIA 5AAPA 1CK0H 2FZ3B 1KB5A 3TVMA 3K4DA 4PLKC 1SM3L 3PABB 1UUMA 2M26A 1CGSL 3APTA 4M9OA 4EI6B 5BXFB 4ZFFB 5J11C 3HMWH 3SCRA 1XBYA 2W65B 1AD1A 4MZ1A 4RX4A 4TU1A 8FABA 2QZ5A 4H4NA 2W79A 1HHJB 1SO6A 2DF3A 3BOVA 2XWTA 4HUXB 1NBCA 3TOPA 4AWJC 5F0MB 4B15A 1EO5A 1GNXA 4W8AA 3V0UA 3X1EA 3V7MA 4N2DA 3MA8A 2VFFA 1KC7A 2NQ9A 4PJFB 1FZJB 4GOAA 3ASWA 3A24A 1KBBA 1A5KC 3JVAA 1MCOL 4Q0XL 2RTTA 4GUIA 1YYCA 4HLZG 1DVTA 4NRSA 3S6TA 2Y70A 3MGOA 3QSKB 3AW5A 4KTGA 4Z77A 2B2XH 2X44D 2XGIA 1I1CA 1YPZE 3TIEB 3CDZB 4JFFE 1HHIA 4ATDA 3THML 1LUCA 4LB8A 3DX8A 1T5WB 4XBKA 2GPTA 5FFOA 4GI9A 3G5WA 5F7WC 5GRJH 3V75A 4ORGB 2VENA 2AKRB 1XF2A 2WXLA 1MFCH 1SO3A 1E6RA 1NMCB 1KYAA 1N0XL 3QNYA 3VWKB 3I7RA 4OFYA 1ZHBB 1EERB 1F11B 3W1MA 4QAWA 1YNKL 4FXGB 1E72M 5BYWA 3VU2A 3KNBB 4D6HA 35C8L 2MFNA 4CN1A 3D33A 2C3GA 2BWQA 3VDHA 2NUYA 4Z18A 4PB9H 4LLVB 1F58L 3DVGA 2ITEA 4WI2A 4X98A 4AC1X 4LSSH 3RG1C 4PBWD 4PS3A 2IBZY 3JTTA 4P2OD 1LL7A 2FIQA 4UMAA 1BWMA 5DFTA 4ODUB 5HYIA 5HHXH 4PJ5E 2N1TE 3CZLA 3QDMD 4Y88A 4H8PA 3ZQXA 3E6FB 4LLQA 3OG3A 3VA2C 3GR7A 3GVVA 3IVKB 4ZTXA 5KBNC 4QIRA 3G5ZB 4E9SA 3BVXA 4IP5A 3LGDA 4JPVH 2WLIA 1KTDA 1VLWA 5FHBL 3EYPA 5HWMA 2IANB 1B4KA 4PZVA 1FNGA 2X6BA 4S3DA 4YXLL 2Z8RA 2DJ4A 1ENUA 4WY7H 1QTYT 3MW7A 3BPWA 3K4ZA 2VB5A 3UZZA 3S5ZA 2BGNE 3CUPA 3IK4A 4PRWA 5FAGA 1KQZA 4BZ2L 1PQZA 3HTLX 1AQFA 4F27A 3VNLA 3PGFH 3MBWA 1ZENA 4ZNCD 4Y16C 4NPYB 4B90A 3ZHLA 3HB3C 2UV8G 4E9LA 1X1NA 4N0YL 4HV8A 4G6JH 2RALA 4WD0A 2Y2YA 3UJTH 4KXAA 2V9RA 1PG7W 3AYTA 1BXAA 4X7TB 5J6HA 4OOZA 4EN3B 4U1MA 2WANA 1DIEA 3S9YA 1ZD6A 4MJ6A 4BKNA 3UWWA 1R3YA 1LLZA 5C09E 1UM5L 4V2BA 3JTSA 3N2TA 3FSOA 5FV2A 2I27N 5JW4N 3U4EB 3DVNB 2XG9A 2AL1A 3FSVA 2V2TA 1V02E 4RXFA 4NQEE 4QRPA 3WFHB 4MD4B 1MRCH 3IDXH 4M82A 4Y5VB 2LU4A 4OZHA 1VZHA 4AVJA 2DM4A 1OFRA 2CO4A 3MODH 3AZRA 1IAII 4W4NA 1CD0A 5IBUG 4YXKL 4JDVB 5DJ8B 1JDAA 1YJDL 1TZAA 4BEUA 3FFDB 2R1XA 3PWPA 3MMUA 4JQ2A 1Q9OA 5AW4B 2W95A 4XC3H 1UMLA 2CRZA 2E9LA 1XBXA 2GK0A 2CM6A 4ZFCA 2ZX8A 5GGTH 3WLWC 4RNRA 1EGJA 2FJGA 4MBOA 3V52H 4XCFH 4ODHL 4DCQA 3SSZA 2BC4B 2WGNB 3RWJB 2KC0A 3VACA 2GSGA 3L3OA 2ZA2A 1CI5A 4HYWA 4ZUSB 3B83A 4PAZA 4BFJA 4BHYA 5DUJA 4H7VA 5D5MB 4HPXA 1G6RA 3IEAA 3HM7A 1BD0A 5KN5A 4HK6A 2Q3XA 2Z92B 3TPUB 3KLKA 1A22B 1UWFA 3WJYA 4NQDD 1DLFL 2IALA 3PU7A 3EH4B 3CQJA 4JKLA 1XEUA 5TPWH 3CX2A 3SUTA 4N28A 1VS1A 2Y22A 3P30L 1BV8A 1OQXA 3OBEA 3MV9B 4R4FL 2VZVA 1J5OH 4RPPA 1T4KB 2DUAA 4RISL 2VUKA 4YHOH 2Y5TB 4I9TA 5SV4A 3BCDA 3LBMA 2PGWA 3FO2B 3AWEA 2ZP8A 4NERA 3KRSA 2VSKB 1E9YB 3BWUC 3O8XD 4LEOB 3QI9C 4N3UA 3LMYA 1I4NA 4NPJA 5LHDA 1SXBA 4JHAL 5HQLA 1S7TB 5KSAC 1M42A 1RVGA 3UBHA 4OBSA 4ABVA 2XFYA 3U6WA 2KQNA 3BUBA 1AQHA 3IGXA 3ZDXB 2YK1H 2P8BA 4HSCX 3OLIA 3DK2A 4K15A 2FSEB 2X4SA 4GP4B 2OMUB 5T1KB 2QJIA 3SE9H 3TBVB 1OGBA 4YCOA 3DHJA 1YE4A 5EU4A 3CC5B 5FWQA 3W9EA 3MUGB 3Q43A 1XIIA 4XKYB 1SJEA 3ESVF 5I18L 1CDUA 4WO4C 1JCNA 1FWGC 3LS5L 4W93A 3S9IA 5FEBA 3FSAA 2OMBA 4OGAC 1A5FL 4OCRH 1OINA 1XCWA 2IXUA 3DO4A 1NCJA 4NSKA 1LEIA 2FX9L 4BUGA 1OK0A 1R0MA 5T3XH 4ACZB 4HUUA 4OCSH 3WFLA 4XWGL 3FOMA 3V5FA 4AGMA 4KRZA 1GVIA 5E1IA 1RP8A 5IMKA 4LUTA 1BZ7A 3I7SA 3F2BA 1X9UA 1YUHA 1T2XA 2E6QA 1NCUA 3O05A 5BMFL 1NCDH 3W4RA 5FYLE 4FK9A 1E6OL 1F90H 3B6SB 5ABGA 1A25A 1HWGB 2Y1AA 5C9XA 5DJDA 3THCA 1M65A 3R89A 1F2QA 2I9TA 1NDTA 3C08H 4YHPB 2G95A 3W22A 5EZLB 1M2OA 3NCCB 5GJSH 3AWOA 3KPNB 1MWAB 5I79A 1BVLA 2NUTA 3QZWG 2CGRH 4ROQA 3GLAA 1UHVA 3VRIA 1JXDA 4BM7A 2Q7NA 3O2DA 1FSKC 4ZW8A 5CBAB 2XWBA 5IM7B 2GAZB 4KY2A 2YGQA 3S35H 2WZPD 3SDCA 1ND0B 1QTWA 5E00B 3VXUA 4B4HA 1P7TA 2J7HA 1ES0A 2H2SD 4NKIL 3B2PA 5KVDE 2YPVL 5KBKA 1IHIA 1UC6A 4UTWA 5J1AA 5LNVA 8A3HA 4ICCX 1QD0A 4GMSL 1QABA 2BIMA 3KW8A 4IRSA 4H88H 4DUWA 2KZBA 5G1MA 4LAJH 1S5HA 4BQ2A 3CZSA 2E6JA 4B7LA 1CDIA 4CSSA 2JFCA 1IZKA 5TE6H 4NHCH 1G43A 4BKSC 5F9JA 2WXQA 3B9KC 3NIDE 1WT5C 2YBGA 15C8H 4G1NA 1MI5A 4GC4A 4LSVH 5DMLA 5AVZB 1EHLL 3AWNA 3VIGA 2L7JA 3PF2A 4O13A 2WMFA 5IUSA 2J8UB 4R96A 1YEJH 2FJHB 1UJ3B 1G7JB 1Q2RA 3S2CA 4NOBA 3M17A 1MW1A 3MNWA 1FTXA 4P46A 5E8OB 3W39B 5JHMA 5K9KB 4TUJA 4E68A 4TX9A 2QDWA 4XRCA 4WW2B 4R2GB 5EWIH 4R7NB 2AQOA 4PUMA 1VCBC 1ONXA 3Q6GH 1M7PA 4O2CB 2E7BA 1BA9A 3KJ6L 3SE4A 2C14A 4CQ9A 3CFCL 5EO9A 1OFEA 4DYKA 5IJKC 2P5EB 3HCVB 4MYXA 2YSSB 1I7RB 5K3VA 2VLLA 3Q3GA 3PZQA 5JMRA 3UCDA 5FJRA 3G1DA 1O5QA 5IDIA 2Y6SD 3C60D 5BQ7B 4UOZA 2OXHA 5AALA 4W86A 3BZEA 3ARDB 5BRZB 4HWBH 1UQZA 1L2QA 1MVYA 3W0WA 4YUEH 2IF7A 4L8DA 4DOHE 2R1WA 2BLEA 4JEJA 1T1ZA 2X88A 2JKAA 3UGVA 5F9WB 2VXQL 3B4NA 3IIOA 5DO2D 3KHOA 3O4OC 1RV8A 4FNRA 5B1BB 1MQPA 2MNRA 1U30A 4KCTA 2YKLL 3RL1A 2WWMC 4QOKB 4YDKL 2H2PC 2NLJB 2XSKA 3DV6B 3PWVB 4QHMB 1H6EA 1FF5A 5JO5B 5LXXA 5CZXC 3UG8A 3VNKA 2VH5L 4URKA 4X8CA 3H0TB 1NVMA 1D5XA 4N6FA 2FYVA 2CZNA 1PZCA 1BVKB 1QTPA 3F58H 4K3EL 4WDIB 3FT3A 4AISA 1WKYA 1JNHA 3DC8A 3E3QE 3PJWA 3W7GA 4FQLL 1YYML 2EC9U 3WKNA 3HPJA 2V2CA 2G8ZA 1O5KA 1X5ZA 1FVPA 2NQLA 4CRPA 4G6AD 3CVHB 5FK9B 1EFZA 1FFQA 1G69A 1FGNH 2QHRH 4PRHE 1TTFA 5LGKA 3H2QA 4GAJL 5AZ0A 2Q10A 2ALRA 3GNRA 4UINL 1WAAE 1BG4A 2WC7A 3EPNA 3HUJE 1W5NA 2COQA 4JR9H 2NZLA 2ZZ2A 2BNQB 4RDVA 5T3ZL 2IC2A 5EPMA 1CBGA 2A9ML 2QADC 4FP1A 2HLFC 3EJRA 4IIBA 1MJ8H 1BWKA 1M68A 1XRFA 1TE1A 5A8OA 4GX9A 4WVXA 4J4PA 3L5XH 3WS6C 3W7NA 5I6OA 1S5MA 3FPYA 1W9PA 1A14H 3RUGA 3KPPA 2W07B 3KBVA 1YC7A 1O5DT 1XKYA 1ME7A 3D51A 4ACTA 3LRGA 4LAMA 4AZCA 3CDCA 4M0XA 2FEDC 1A6PA 3IPFA 1N82A 2ZCKH 5LBSL 7PTDA 1SYTA 4FAMA 3SKJH 5B7FA 4JQIA 5HWJA 2VLJA 3G1YA 4HBCH 1EBPA 4G9DA 3FYOA 1S2EA 2FLRT 3LHWA 1BP3B 4E9WA 1N0LA 1WWBX 1GVQA 1OD7A 4GT0A 1QNRA 2WMIA 2OU4A 2GBUA 1XGPB 4IJTA 1IC7L 3JW7A 1N64H 1DN0B 2QTVA 4IK7A 1V10A 2OQJA 2BNJA 4NQVB 4MNQE 3GIYA 1WBYA 4O14A 3W5NA 3OB0H 4HJJL 3L4UA 1W1IE 5BRBA 1BZ9B 4RGOL 2PDUA 4EEEA 2ZXCA 4X9BA 3L7EA 3I9IA 4L18A 4MNHA 1YYLH 4DKEL 1EXHA 3NQAA 3GTNA 1G7LA 3HZMB 3T6WA 4WUUD 4CCZA 5IQ7H 4TXEA 4AL8L 1EYEA 3DFTA 4N2EA 2X5PA 4GRWF 1JGLL 1IAOB 1KIUB 4FLOA 4GRWB 1F3DH 2R8WA 1MRFH 2DZUA 2W8CA 1DQTA 3VXUE 4C56B 1FIGH 1A6AB 3SECA 5FM5M 4ZG1A 1U41A 3BG9A 3RLVA 3FUHA 3E5PA 1F00I 4NO2A 3UYIA 4L3CA 2DH2A 1G1OA 2E7CA 1AXSA 4ELDA 4X0KA 1UEMA 3CYVA 1EJRC 4YAQB 2VLRD 1TTGA 2CO6B 2XA8H 3N44F 2CLVA 2QSCH 3OG2A 2QSQA 4I9WD 2VC9A 1GW0A 2BVQB 1RURL 2NUXA 1FG2A 3T77B 5GPRA 5FUZL 1WXZA 3FNDA 1BPVA 2XXMB 5CEZL 4GQQA 4JXCA 3D2UD 1U1UA 5D1ZA 5I6NA 1ZZMA 4O0ZA 4JTSA 4IMDA 2P7TB 4O02L 3ULUE 4HG4J 4LOUC 3BWSA 1TZ9A 1F4XL 2CETA 4HFWA 2Q1EA 1UWIA 4IGBC 3BOLA 3FMGL 5E2TL 1JUFA 1VB9A 5IHHA 3LH2H 3IRCA 1HSBA 3QNZB 5DYOA 1DQMH 5CFHA 1WV7T 3US9A 3U3HA 4I9XA 1K6WA 4L3EB 3QA3A 1EC9A 4NENB 2B7QA 5FW7A 1TELA 3RE0A 3CLEH 5C0FA 2JQXA 3WGVB 3OZYA 2DM2A 1QNOA 1AXIB 3VIPA 4PGJA 3ILPA 4J3OD 5EFFA 1J6OA 4D3CL 1ZTVA 4G42A 3IDUA 1IAKA 3TJEL 4Y8AA 5TF1H 1MRQA 1R33A 3MJ7B 4PCKA 3UTQA 4B3ZA 3IDYC 4AKQA 4UDUA 3UXIA 5C0IB 1AFSA 5E8NB 2ZAGA 4CNTA 4AZGA 1OD9A 2XWJB 1S8DA 1EANA 4MQXD 3ECQA 4R27A 2GJZA 3QUMB 5HWNA 4HTYA 1UBSA 4JTFA 3VFOA 4BCXA 4OVXA 2RB8A 4JCWA 3UTSD 1OGAA 3MV8E 1SXZA 4XBEH 1K4HA 1KKOA 2VQ4A 5L6UA 3VX0A 1E56A 3P4OB 1P6FA 4KAQL 3HI1B 1CU4L 2GEQA 1WD9A 1UZHA 3AIRA 3DX0A 5J7CC 1XCQA 3U5UA 1GYWA 2OMYB 3GSRA 3LZ3A 3C09C 4U1NB 3U6XA 3B7YA 2UWEE 5I1LB 5IFJB 3BP6A 4UTTA 3FT1A 4JY5L 3BP5B 4M7ZC 5D2NC 4AH2B 2DYPB 4YX2L 5F7AA 3X14A 1A7OL 1O1HA 1TSHA 2WQUA 1J9TA 4JZJB 1F5WA 1RH8A 3V8OA 4RGND 2E40A 4C6EA 2WBJA 1QP1A 4P5MA 2CRIA 5HJ3A 4MB4A 4FMVA 4KTYA 3T4YB 5F7NC 3TZVD 4MJIB 4UT6A 5AVXB 3MX0B 5CC5A 1NIBA 1OGGA 4RDYA 1CLYL 2JQZA 1ASOA 4X42A 2K7QA 4TNEA 1NGWB 3OR7A 3FCSA 1FRBA 4KV5F 2ARWA 1Z9PA 3GSUB 4ERGA 5GRZA 2HKFH 2VEPA 4MQTB 2HPTA 4RW5A 4U1HB 5HPMA 4V15A 3HBQA 3ATBA 4OCLC 4ODSL 4WRHA 1NAL1 3WAJA 2PBOA 4C90A 1QNQA 2QNEA 3G77A 1NIEA 3UP6A 3HHSA 5D6DA 3OJGA 1ZIBA 3S1XA 3RUGE 2YSWA 2NZ9C 3OR6A 1ZS2A 2ZF9A 5FF6A 3EDEA 3ITOA 1P7BA 6FABL 2J20A 4MMYA 1YDYA 2IGFH 2PSNA 2KMWA 1E2VA 3BN9C 2AQWA 3UZEA 4IWWA 3EW3B 4N6RB 1LO0H 1TREA 4RMWA 4P06A 2IAMB 5DVPA 2OW6A 4FX8A 4CNIB 2PTVA 1QW8A 1L6PA 5JH1A 2WNNA 3W76A 3Q8EA 4GOSA 4PV9A 1JPTH 4A67A 2G0LA 4HKXB 4ZUVA 1GT8A 1FO0B 5SWSE 3UL4A 2QGDA 1WGOA 2GY5A 5ESAB 2IPWA 1AIFB 2D22A 2Y5EA 3V6ZB 3TXVA 7ODCA 4LUIA 1WFUA 4OGXH 4QPEA 4B5TA 5EBGA 1GZHC 4Y96A 1BZ8A 4XHJC 3ATDA 4M81A 3LIUA 5KW9H 4L7ZA 3F7KA 1A1MB 3ALXA 3II1A 2GTQA 3DFQA 3O16A 3TYFB 2CU9A 1VLIA 4ALAL 1S7SA 2PMQA 4R5XA 3DC0A 4C1NA 4GFXA 1FO0H 2BSLA 5HA7A 3RI5K 5FJIA 1BF5A 2K0RA 2UUDH 3KYAA 1EP1A 4V1YA 3LJ3A 4NKMA 4I90A 1V0LA 4Z7VF 2FK9A 4N1EA 3AC0A 1TJXA 5GGSB 1IBGH 2H41A 3CAKA 1JHKH 3DU0A 2ZOLB 3NABL 1E5ZA 1H0DB 5AVYB 3ZE2E 1UIPA 4WVRA 2OQYA 1EPFA 1NFIA 2FWOA 2YPLD 4AIOA 2A9DA 1QXLA 3TT1H 1CT8B 1PJWA 1JFHA 1VGEL 3U4BL 4E9TA 1OB0A 3TFKC 3SFWA 1ORQA 2YBRA 1N5YL 3KHQA 2VLKD 5F21B 1IEBB 3V5DB 2V9QA 3G7TA 2UXVA 3CS2A 2YQ3A 3EHBD 4A7TA 1YX1A 3IGSA 4PEKA 1Z5YD 3URQA 1KYOK 1IGYB 4PFHA 4JAWA 2P10A 4XMTA 4HWZB 1FHNA 3PJUA 4TPRH 4KFPA 3S1UA 1V7NL 2ZYHA 1C8QA 1XBRA 2W4XA 1BXBA 4Q6IC 5JORA 2I07B 3WBDA 1DVFD 1M7IA 3RFZB 4AC4A 2CMRL 2JWYA 3LKQB 4I4WB 1QHZA 4NILA 3DGGB 4GQGA 1S1RA 1FE8H 3QNFA 3U25A 3DUSB 3OVQA 2P42B 1E9OA 1U93A 2FX8H 1R19A 1IC0A 2XU2A 1IEVA 3DUUB 4NQCE 4X4XB 3P11L 4CW1B 3N3MA 4PRDB 4BFGA 3NL5A 3EOEA 5CJ8A 3PJNA 1OO2A 7REQA 1RMFL 3N25A 4JFUA 1IM9A 4CDHA 3B2DC 1C8YA 3VKAA 3EX6A 1FGVH 5C92A 5FX3A 2UXGA 4EXAA 4XN1A 1U4EA 5CKSA 1X1ZA 1ZU8A 1F6PA 2N01B 5F7UA 5E4AA 2C4FU 3CFBB 2DBLL 3B8WA 1BMWA 5BMXA 4YYCA 2KPNA 3KHDA 3LS9A 1ANUA 3QHFL 3N6QA 3FB7A 2EC8A 1E0VA 3PAUA 4Z3EA 1FFRA 1TQCC 2QPDB 1FCQA 4OM1L 5D93C 2PCFB 4QXUH 1KBGL 2PYEB 1GTHA 4INFA 2F6KA 1I8UA 3VWKD 1JDDA 1JNNH 5J1TC 3BAEL 3KPTA 2PDKA 1CLZL 5F1NB 2UZYB 3QRFM 4PBEA 4W68A 4UTAH 1U8KB 3LKPA 5KS9E 4A2RA 2OMNA 2Z2BA 2GJPA 3ZHNA 4JDTH 5D72L 4LAUA 4FXKA 4MAYA 3V0WL 4B50A 2BIOA 4FMKA 3GG7A 1MQKH 2CGYA 3U4KA 3CM4A 3RL2A 3SY6A 2Y25A 3VSTA 5DHDA 2YXVA 2VZSA 3DXAE 1H3VA 1J8VA 5BNXD 4WI5A 1DPMA 3QZPA 4FG6C 4WHCA 2RJHA 4MA1C 3H3BC 1RIUH 4H8WC 2HCVA 3UDWA 4J5VA 5F96L 4AIUA 5DUPH 3TNNA 2BGQA 4PJIF 3R8BB 4PJIB 2XTJC 5L2KA 5GNXA 3CTTA 2IAND 5I3KA 1Z5LB 3UEQA 5JOFA 2ITCA 3RO8A 1JPIA 5IEHB 2OX1A 2JLPA 4YSCA 3LZOA 3LZFH 4R4ND 2QCHA 4GS7B 3UXFA 4M48L 1DVJA 4PGZA 3GVWA 1P7HL 4D0DA 2K9FB 1GW9A 4C4KO 1VRXA 4KWWA 1A4KA 4UIKH 1TCMA 1QW9A 4Z0SA 3VKBA 5AB0A 5JHLA 2R1YB 1C9SA 2N3JA 3ZR5A 4KQNA 5CAHA 3OQRA 4G9FE 1N6VA 2EEXA 3ARGC 3A5FA 2O0TA 5B8CB 2VSCA 1YNQA 3PUGA 1A9EA 3JTBA 3Q6FB 5H8PA 3CWHA 5B7EA 4XBGB 1M6OA 5CIPA 3BKYH 3T0CA 4Z7UB 4OD3L 5TE7L 5A3IC 2PCEA 5KETA 3WQDA 3M0XA 4EN3D 1WDWA 3RU6A 3EO1B 1G1CA 1M5WA 1L5GA 4WU7B 5J5RA 4B95C 2AGTA 4GP5B 4GW4A 3B0YA 4IKIA 4QO1A 1AH4A 2J1XA 5REQB 3SDYL 2EEAA 2EH7H 3BH8B 1JCTA 3IJSA 4HA3A 1FFOB 2DFAA 1AS7A 1M7DB 3CQ0A 5FSDC 5FESA 3TNMA 2XV3A 3CZKA 2DJUA 4CNUA 2EKSB 2AK1H 4M6VA 2NLYA 4N85A 3PBMA 3TN0B 2YW3A 4XCNB 1HJUA 4L5FL 1SEBB 3H2OA 3PV6B 3MRCB 4K9EL 1JGVH 1PUDA 1MY5A 2P4AB 5I1IH 2VL4A 2D2JA 4J3VA 1I0DA 4RZ4A 1K4CB 5I66B 4P05A 2EPNA 1BVOA 5L4JA 2V2WA 4AV0A 4UTKA 2O72A 2Z8VC 1RZIB 4F9DA 3L3JB 4IMCA 3ULSA 1JGMA 2C7UA 3VXRE 1RZKH 1HXJA 4Y5YB 3QEHA 4C6QA 4DBDA 3U8GA 1WUZA 2E68A 4NNPL 1EV2E 2BVOA 1SHXA 1A4AA 4NZ8A 4Y5XC 5HYSA 1NOUA 1HP4A 3URNA 3W7DA 2VR7A 3CGTA 4RW3A 3VPLA 3GSOB 3D9AH 2W3ZA 1T1YA 1GTFA 2ODOA 4WNJA 5A95A 5JOPE 5KYYA 2BHUA 3LEYH 4D9RD 5MI0C 4LNRB 3IETB 2QF7A 2WXFA 5BWAA 6CGTA 4J3OF 4PWFA 1JP5A 4XXWA 4S1RH 4P5KB 1QSEE 3SRKA 4LESA 1QUNA 4TTUA 1YZZA 4PY8J 3QUXC 4FP8L 4ANVA 3MV9D 4H0HB 5GJPA 1ZLSH 4TQIA 3JWNE 1OHQA 5G55A 5E4IA 3ENEA 4FI7A 2ZOKB 3HS0C 5HI3C 3H4GA 3ATZA 3MGTA 4N2MA 4JRXA 2VJXA 4F37K 4AK1A 1RJYB 2GGGA 3C2FA 2VDGA 5C0AB 2PR4L 4C8XA 2EO7A 2ED9A 5CILH 1GY1A 2GSIB 3QP3A 5DZVA 1F8IA 2N4IA 1MHHB 3BG5A 4GW5B 3WN5C 4EZLA 3LKSB 4NZ4A 2CKRA 2POTA 4L6DA 3CAVA 2NXIA 1L6ZA 3QUZC 3O3AA 1DBBL 4MD0B 5T3XD 3E02A 4PJBB 1K4DB 1XLDA 3WQWA 5DANA 1OHLA 3SZ6A 1CZ8L 2N56A 3LM7A 3HGOA 3NJHA 1DP0A 4ZX5A 3ARUA 1YQ2A 1T6VN 4MDJA 2WHLA 3EJYC 5F2GA 3L5LA 2G2PA 3IN0A 4HKJB 2DV6A 4UQEA 4WEEA 1MFDL 4OZ4B 1CTOA 4OI7A 4QG8A 2FZMA 3M16A 4JAMA 1PDKB 1R47A 2WB5A 4XP4H 1XB8A 4P9MH 3CUHA 4LP8A 3FSZA 3L4TA 4KWVA 2FT8A 2V4LA 4L8SB 2C8NA 3X3FL 2X2UA 1QWKA 3AHVA 4PJDF 2WIIA 4UAOC 3MCLL 5A1AA 3FXIC 1J5IA 4I0PC 5GZOC 2R2EA 3MSPA 3VQ2C 4G56A 2ZXGA 3N18A 2ZXBA 1E1CB 3ES8A 3RZCA 1AO7B 5J11B 1G5GA 4C6MA 3P2BA 1P5BA 3GZPA 1LRTA 3N9KA 3HC3H 3R8QA 4DPQA 4MJJA 2DZAA 1QW7A 1KYFA 5A5WA 4OFVA 1NCWL 3QIWB 4V2XA 1L7IL 2ZUWA 2DMKA 2KL6A 2HRPH 1P0KA 4P4RA 2G9KA 5KINA 3SUSA 3RPMA 3UR2A 5E51A 3VI3A 4NNXA 4UB0L 4H5SB 3WFEH 5I1AA 4HN8A 1PIIA 3D07A 4PTUB 2V5RA 3S5NA 3N1GC 3VYLA 3GMLA 4DWSA 2QQNL 3MRIB 2VKXA 1LNUA 3VG9C 2ORBH 1J48A 3M88A 4H83A 2DWSA 5GVJA 4DHLA 1LBFA 3ROLB 2BFVH 3D39B 5XIMA 2GOKA 4UQCA 1F97A 4UFHA 4LCWB 1HGWA 3BCFA 1H7NA 3KR3H 4K7PH 2XN0A 3B3IB 1MFEH 4NKQB 3VG0L 1W56A 3NFNB 3HMCA 4OLZL 2ISVA 2V3GA 4Q4RA 1PSKL 3RO6A 3K71A 1HQRA 4XPGH 4XWUA 5FECB 1M3JA 4BI6A 4R2GD 3BVTA 2J6EH 2XXFA 1WX0A 1V51A 3ZRFC 2OPJA 5CBEB 2X1SA 4AG0A 1TNMA 4LNVA 4I3SL 2BW4A 2FBJH 4S3CA 1F3DJ 2P5ED 4G6ML 3IDJB 1EJFA 3MI3A 2PLJA 1T1WA 2O92A 4U1JA 5D1XA 4AYDC 3DX5A 1S3KH 1YE6A 4LHJB 1RK0A 3NCYS 3XISA 3G6JB 5D7JC 3ARDD 1WFOA 5BRZD 1LROA 3BICA 4LEXH 1NAML 3VRLF 5JHDB 4UQIM 4P2QD 2FO4A 1NUDA 1WPCA 2Y36H 3N4AA 2ENQA 1Q9KA 3MUJA 1EIXA 4JFVA 1KN2H 3MMWA 1R5WA 1UUNA 3PWJA 1OCZB 5E1AB 3SDOA 1PEZA 1GQIA 5DJ2A 3RWHA 4QOKD 2ITDB 3L4XA 2Z26A 1W9UA 3T3PE 1RUAL 4JJ5B 1ZKAA 5JR1H 3AZUA 4NZUH 1H8NA 1ITUA 4BJHA 1HXKA 1K1DA 4PMNA 5HGBA 4JGNA 3BARA 4O51A 4KZEH 1EIBA 4OD2A 4K3HA 5CNHA 3NIGB 2O30A 4Y16B 4ZBCA 1GKRA 3DDGA 3KMDA 4P3DB 3U2OA 4PJFF 4OBTA 1BLIA 3QXVA 2YHGA 3BZ4A 1OZTG 2G3NA 3CN3A 4X5RA 4PJXB 3JT2A 1ETZA 5BZXA 1DV7A 2XUCA 2VXVH 4GRLD 3NDOA 3T0BA 3C2AL 3L23A 4AC7C 5C0BD 3V0FA 1EEYB 2YWZA 2P8LB 2V2XB 3DX2A 4M4RB 4QE1A 4HIHB 4ZB0A 4B3VA 3FQUB 2BCKB 4PJ7A 3CZFB 2QCMA 1G7PB 1IC5L 3CBKB 1I3GL 1EJ7L 5B38B 2F38A 3WIJA 2OPCA 4OZOA 3KL0A 5I03A 1WDAA 4LKCA 1XYZA 2BNQD 1GYLA 2ZUUA 3WCYA 1RJPA 3GSNB 2YRLA 1R8LA 4C6DA 4XMUA 4N5EC 3KYOA 1MCEA 4DWDA 1M6UA 1MCCA 5H2ZA 1ONEA 2XN9B 4Q2ZB 3KX6A 3LOWA 2XSXA 5HHNA 1P4IL 4LRNL 4UCFA 1OIMA 1FZOB 1T1XB 3TOYA 2UX6A 3HZKB 4XMLH 4YE4H 1NEZG 8RUCA 5D05A 1GYNA 4QMEA 1HINH 1FG9C 2WUCL 1X44A 5H2BA 3GSNH 2H9GB 2CHXA 1RXLA 4FI4A 5I3JA 3ARTA 2WAQA 3SDXE 3QJZA 2A3BA 4E0CA 3SGZA 3KCWA 5K39A 3T0XA 1QMUA 1Q66A 2AJ3A 4US6A 3IJHB 2F5AL 3BKCH 3S4SA 2PN5A 3ZL4H 4JY8A 2B0SL 4ZTPH 3KLLA 5CBJA 3R12A 4E4PA 4MASA 1B5TA 4D9LH 2QR6A 4XPHH 1PCSA 4Q4MA 3B9EA 5HHQA 4Y2OA 3VFPB 3QMTA 4M61B 2DZEA 4UQ3A 3IGAB 2WNGA 4AVOA 3N9GL 2CR3A 1E4LA 1QRNA 5HDOA 2J4WH 4UIOA 5I1HH 1OZMA 4IZGA 1FH2A 5AC6A 1RLDA 3BK0A 4ONFH 2VJ8A 1HL8A 1KC5L 4Q33A 5CJXA 3VDBA 1UZ8A 3Q7JA 3ARVA 4TL4A 5GGQH 2VWTA 3BQ6A 3TEXA 1AGBA 2C91A 3NQ8A 2RQ8A 4YR6A 2OTPA 2FYYA 1U3ZA 2X4PB 4HUMB 3UNTA 3UVIA 4XBJA 1KRCC 3KFTA 2VC2B 5DZNA 2CW6A 2A6DA 2BWDA 5E6IC 3QI9B 1MJUL 2ADIB 1S2AA 3EDDA 2G3FA 2NZ1A 2BSRA 2C1OA 5CKGA 1FDZA 2Z93B 3RWGA 3SGJC 3BKJL 2A73A 5KSAB 2NY2C 1DQIA 3S6CA 4YDMA 4K8RD 3VH8B 1RVKA 3L48A 3WTTA 5DTFB 1E8YA 5MP6H 2VC2H 3GBDA 4HD5A 1CIDA 6ALDA 4XPBH 2WN2A 5SWQA 3UZWA 4NFCA 2XVKA 5HDRA 1M05B 3STPA 2QLVB 4AIZB 4WO4B 3C87A 4YPGA 3T81A 4M00A 2NYYD 4QE5A 3PDOB 1ZRUA 4GKLA 3GUFA 3ITCA 1K7EA 3CMOL 2PRMA 2PRHA 4F2EA 1U6AH 4AMWA 4Q7IA 4YNYA 5ABHA 4H26B 2C79A 2EIZA 3S8GB 3UYOD 5D7IA 4LU5H 3O6FC 1JGUH 1SYVA 2IGTA 4PRNA 3BIBX 2OJEB 1UZGA 4PJCE 5DFAA 1AE6H 1H5BA 1A7RH 3FQRB 4WV1A 4M9PA 4UR7A 4D0BB 1NOWA 2D31B 4BUHA 1OAZH 1J8HE 3CCHB 1RJLB 2B7OA 1OCCB 2Q71A 2VDKL 1H7OA 3DHPA 2C34A 3U0WH 3VM5A 1BX2A 1WBZB 4DUVA 5DFWH 5D5MF 1OAXH 4P5SA 2VKWA 2E75C 4QHKI 4E41A 4TOYH 3FYPA 3WLPA 2ZXWB 5EMJA 4X6FB 2R56L 3Q37A 1EB3A 3L3IA 1FSKB 4JFTA 3FSUA 1FWXA 2YUZA 4CBPA 3P9MB 3MCOA 1O12A 4M6NL 5FFGA 3AYRA 4O9HH 2R69H 1UWAA 1J5TA 2PXYA 4G8AC 1CYWA 1QA9B 5BOEA 4DN3L 1M4KA 1TE6A 1TV7A 1XD0A 2EDOA 1EGZA 5AHMA 5JQHC 3L95A 1ECEA 3WLQA 1F2JA 4AZBA 3O2VH 2HKHH 4XN5A 2FCBA 1DUZA 3VCLB 4OFIA 1N9PA 3TFBA 1MFCL 3B9KB 1Q1JL 3MLVL 5JA9A 3ZDXF 4HXAH 5IW6B 2AEPL 3EJQA 4FF7A 3SE8H 1CLOH 1TJRA 5HR7A 1JZIA 4LKXB 3C52A 1ED3B 3G08B 1BEYH 4MJID 3FFCB 4UT7H 3XINA 1TZGL 2AV1B 4RFOH 4MJ5B 1NOFA 4J40A 3LY0A 4UQAA 1UWEL 3WIAA 4PRPB 4PB9L 1H41A 4LCRA 3C0SA 3ZYZA 4JQXC 1A5SA 2X42A 1D7DA 3A9BA 5DS8A 1LT8A 4MX7B 3V36A 1NQKA 3DKJA 4XB7A 1A50A 5T5FA 3HNSL 3G1SA 2V8ZA 3TC3A 1G84A 1OFDA 1V5JA 3PUDA 4Z0XB 3EBHA 1LQSR 1KLGA 3CZEA 4NXKA 1E51A 4IKNA 1A5OC 2J9ZA 2WXJA 1I7ZA 1FCCA 3GT6A 4KZ0A 3I50H 4CU8A 4I18C 3EWUA 3GD1C 5EC2B 1R75A 1P69B 5CPTA 5CJNA 3SY0B 3EOTL 1T0MA 5GIRB 5DELA 3CQQA 1OW0C 2KZKA 4LZKA 3TU6A 2WVVB 3GS6A 3ES6A 3KWTA 4JFPA 5I16A 1AMXA 1V6XA 4L65A 2IAMD 3O4OB 1A4JB 3SO3C 3FV9A 3R13A 2NDGA 2QPEB 4M5ZH 2VISB 1KLZA 2GTZA 3SM0A 2FWUA 1EX1A 2ZYRA 1PIGA 1SJHA 3BZFB 3EOAB 2Q7AA 5B7MA 1Q5MA 2D2OA 5B39G 1FL3A 2J27A 3V10A 4QYAA 4AGPA 1EPXA 4LL9A 1WEJH 1C12B 3KM1A 3LHPL 3IDNA 3GRWL 2XDHA 1WISA 4OUOA 3MV7B 3PN8A 1QVOB 3NMEA 3HI5H 2GGHA 4G6JL 2Y7FA 3LIZH 2ATAA 3VI4B 4W85A 4XH2A 4GFIA 4XVDA 4N90E 1ID2A 4XN2A 5DMIL 4DP4X 2NNAA 1QFHA 4XCYA 4DF1A 1TQVA 4K7FA 4CAGA 3VTRA 4FQJL 2JI3A 3HTWA 3L6FA 2GC7C 3L2IA 4QXVA 5AVTB 2KZ1B 1G7QA 2EYSB 2Q09A 3TIDA 4DVBA 4WFHD 1D9KA 1G1YA 1P0EA 4JANB 2B3IA 4FJYA 4J8RB 2J8UF 5IEKA 5IF0A 3SUVA 1OSZB 3BO9A 1YEHL 2O6FA 4OB5L 3A6CH 5KSWA 5IV2B 3DJRA 1KLUB 1F1DA 5IMMA 1RAKA 4H00A 2QADB 1AXTL 1ZK9A 4QRPE 1HZHH 1VPQA 4WW2F 3EFOA 4OCYL 1MJJA 4OZHE 1N59A 1AVAA 3FQYA 2I7SA 2LLNA 4OFQA 3CXHK 1XH0A 4JL1A 1RXOB 1ACYL 4FN0A 2OMAA 2PPEA 1YY9C 1HYRC 3EOOA 2Y1VA 3PWPE 3QV7A 4PY7A 1RZFH 5CP7A 3ZZSA 1FNEA 2KLTA 2QVNA 3F6IA 1WGVA 4H9MA 1P9MA 3V52L 2A21A 3FU7A 1TENA 1TV4A 4XCFL 4JQ3A 5TDOA 2V5BA 5I0YA 4NJJA 1Z3GL 2JKEA 2QMKA 3IRZA 4KZDL 4A2FA 2WXGA 2V63A 2EPOA 5F1SA 5HI4C 1UR4A 2FX7H 2ATPA 1W5PA 4C83B 3MCKB 3VFVA 1ADQL 5GZNC 4NN5C 2W80C 3OHMB 1YPXA 2EE6A 3PTDA 4PBFA 1PZ2A 2IH9A 3GXDA 1WC7B 4F0SA 1QOKA 1BGXL 4DF2A 3LEVL 4AYSA 1KULA 2V3DA 4C6OA 1ZV9A 4HK7A 1OTUD 3WSQH 4BFRA 4DI9A 1GC1C 1JZGA 4CVXA 3VFRB 4RFEA 4WFED 3UZVA 1OAQH 5F70A 4OBRA 3S88H 3INUH 3D25B 4RDWA 2PYED 2XG4B 3JWNG 4W5UA 3AS3A 1T7VA 3FO0L 2DI8A 1H62A 3RLHA 2WZ5A 3PFRA 2XSBA 3IXAA 1F6AB 4S1QH 1FH5L 3VFSB 4BBWA 4MSWB 1NCBH 1HKMA 5I78A 2Y88A 2ADJA 1QI0A 1Z48A 4NOFA 2VX5A 1TETH 2YK1L 5LA2A 3GTFA 1AY1L 2PO6A 2BIQA 3G9VA 4A29A 4OJDH 4XNMA 4F0HA 1GIGH 2ZUMA 4FZ8H 3AHTA 3B0VC 5D04C 5C07A 4Y7MA 1UZ4A 3BCJA 2BOBA 4KUZH 2FHBA 2IH1A 1E27A 1OF8A 1EGVA 3KPRA 2CAKA 1FA2A 1I3RB 4M7LT 4I1RA 4YVPA 2I5YH 4OCRL 4JDEA 5DCCA 2FB4L 4KXDA 3L54A 1THCA 1CD9B 1JNJA 4R0LC 1GS7A 1MCHA 3A4WA 2B0MA 3M8OH 2OMXB 1P43A 3QB7C 4ANWA 3GDTA 2X8RA 4LO9A 2G4JA 3OKEA 4QF1A 3UJFA 3TURA 3AO0A 3ZDYE 1IAMA 3EJJX 1VZGA 1G9EA 2WOQA 4O57A 3VM7A 2Q86A 1FVEB 4MWFB 4IJRA 3RBGA 1NBZB 1MRDH 4ODWB 3QFEA 1OC7A 4DN1A 2FJSA 3IDYB 1WH0A 1Z9LA 1O68A 3BT2L 2DV0A 3A13A 4IJ3B 3W83A 1R6VA 1UGNA 2DZSA 5AL0A 1N8ZB 3QJFB 1NAKH 4LMQE 5JHBA 3R7RA 3U82B 1XLJA 4HKBB 4L1WA 1DJXA 3RAJL 3A4DA 5F7KC 1NSNH 4U1IB 2XBDA 3DTXA 1ZLEA 4UNIA 1FUYA 3S37H 2QT3A 1WZ1L 3M6YA 5D9SA 1TLKA 2PTTA 2YJQA 1NCTA 2WQRA 2N7SA 1ONQA 4B5WA 1MQRA 2D7MA 2O5ZH 1MWAL 1QI2A 5D9MA 3L3HB 4KU1A 1YDNA 3FDKA 3CIXA 1KPVA 2ZSVA 2HJKA 4HK0A 4UNLA 3M1ZA 5LNDA 1IILE 2OLHA 4H88L 2QKIA 3C09B 3SBPA 1W72B 3TX9A 1I85A 2JJSA 5G2WA 4Z7AA 2ZJSL 4MFEA 3G18A 3TN0D 2BLFA 3CC1A 4ZW3A 2ZXQA 3PQYB 4M7ZB 5D2NB 5CJ5A 15C8L 3SB0A 6REQB 3W9DA 2NXYB 4X8JB 5EU3B 4X4YA 1N5AB 1BZQK 1CL7I 2VMCA 2E6FA 2X4OA 1MI5E 1W72H 3K80A 4NUMA 2CLRA 1UWSA 3W24A 1KCVL 5ANMB 3K8MA 5JXAL 4GQ0A 4UZUA 5ICZA 1KDJA 3DX4A 4GKNA 5TFSH 2RH9A 2CWNA 3K74B 3NN8B 3TLRA 1JRBA 2EYRB 4ONVA 4BH7B 1EBGA 2R29H 1GZGA 5F0LB 2CBUA 3OG6B 4BWLC 4E4FA 3MRRA 5DC9B 3Q2DA 5FM4A 4FTVB 3B97A 2O5XH 3PAVA 3NQBA 1ASPA 1J9RA 1LD9B 1UR3M 5DT1H 4PV8A 3TLQA 2HZGA 4KO5A 1PY4A 1W1B1 3B2MA 2OEMA 3SYAA 4R9HA 4N2HA 4PUKA 2QBWA 4W9EC 1UWRA 3H7UA 1OAKL 3AZSA 3O9WC 1LQAA 1I8LC 4WUIA 1FWFC 5IFAH 4WGVB 4P7QA 2H4EA 1JMXA 3WLLA 1TVBA 4PHZA 2OMWB 5M2FX 3W0WE 3WK3A 4LLMA 2OMVA 4EUPG 3KDPB 2YAMA 5IB3B 3WJWA 5KBPA 5LDSA 1EC8A 1XGTB 2J7EA 1RJZB 3EB4A 4OTKA 3KOFA 4EAYA 5HHOB 5DQJA 3WY1A 2P43B 5DHYA 1J9YA 4RMTA 3QAZC 1RZPA 5DT7A 5I8KL 5I3DA 3QS2A 4Y8FA 3UBXG 5C0AD 1P5VA 3P73B 3LNPA 2X41A 3MLSH 5EBMB 3SDAA 2WCGA 1KZYA 1EKOA 2ABAA 1JF5A 3GHRA 1WF5A 1PZSA 4E9YA 3W57A 4C6KA 2Y7EA 1WWAX 4LSBA 5DEGB 1TYRA 4LASL 3M9YA 3S3GA 4R4BB 4KQ4L 3LQZB 3Q5YA 4JPSA 4N0FA 2ZRVA 1BKSA 4I6KA 5HANA 4MA7L 3QQ3A 4ZA0A 1QOXA 2IXQB 5F6HI 5ID0A 3HFML 1MJ7H 4YJ5A 4Y9PA 2REQB 3BGMA 4XAYA 3T3MB 1UR2A 3QQ4A 2Z1XA 1CD1B 1GYAA 2A6NA 3VZXA 1GGIH 3CVHL 1NDGA 4PMVA 3BDBA 1UD8A 2CEQA 2HT4C 3QCVH 3D46A 3KVDD 5GRWA 4PRAA 4MWAD 2DWTA 1BFVH 5LUMA 5F0PB 1MJ8L 3NPUA 1J1XL 3G6AA 2YCKX 3MJYA 4Q6IB 2NQHA 3L5AA 2J1ZA 1UPMB 3RMEA 3L5XL 4HZ6A 2NY1C 2YZ1A 3MYZA 4FL4C 3VRJB 4X7DC 3BYYA 1A14L 1S78D 2HPIA 4KK9C 1AO7D 4CD4A 1E4KC 3IRSA 3G6DH 1JZHA 3BRGC 1O6SA 4X99A 1OAYL 1JWMB 4G1MB 1MWOA 5LBVA 1JZ8A 1FN4B 3SKJL 1OC5A 5DJCA 3NCXA 4Q7BA 4H6EA 3GNMH 1UH3A 3RCNA 3SEPA 1LK2A 3QIWD 4Y89A 2CIIB 4KKAC 5AB3A 2VLJE 3ARSA 2C13A 5AUMB 3RVTC 1CZ1A 3E3QC 1U95A 1LTXA 1Z66A 4QRSA 2QVIA 4ZSUA 4KJPC 2ALAA 1RZJC 2WLLB 5C9KA 2G5RA 4IMFA 1JQXA 2WZ6A 1MH5A 5C0DA 4DIXA 2ZZ7A 5HBFA 4LSTL 2BERA 4LALA 4RE2A 5HK4A 5AB1A 1KJ2B 3NEVA 4ORZC 1TQCB 4RZCA 5D93B 3BMXA 4JICA 4AZ8A 5E0QA 3S35X 4NYLA 4A2DA 2OSWA 1CS6A 4D8OA 2FTPA 2GUBA 4LCWD 3ZTNL 3B05A 1KM5A 2C3VA 2YDRA 4MYWB 2RFGA 2E7LC 3G04B 3C0JA 3TV8A 3AWGA 2R6OA 2PPCA 1ET7A 2WB1A 2PWHA 3AY4A 4PCSA 1TTPA 4ELMA 4N8VA 1TIUA 4P2VA 3V95A 1B0WA 1KJ2H 2XA8L 1VESA 1BEXA 4R34A 2OXNA 2BXZA 2YL6A 4TTDC 2PTXA 4JPGA 5BXPA 2GI0A 1IARB 1SJCA 3DG6A 1FWSA 2OX4A 4XIAA 4AEEA 3EX3A 1IT9L 2AF2A 3GMQB 2W66A 2EEFA 2FQIA 4GZEA 5DLLA 3EA1A 4K8RL 2VDML 4DAFA 5EF1A 4DK3A 4E0RA 4YMZA 5JHDD 5CCHE 4I7WA 4MA1B 2XC8A 2XZAH 1IKNC 3VOFA 3DPDA 4O1FA 1Q9WA 5LGXA 1JS4A 5AVRB 3GYCA 3H8AA 3I6EA 2HFEA 2WJEA 3NFUA 3AVEA 2XTJB 4Q6JA 5ERWA 2G41A 2ED7A 2ZADA 3L3GA 3W00A 3U46B 4IIQC 2EE0A 1D8CA 1JVLA 2FPYA 3ITLA 5BW6A 3EAUA 1PMYA 4BA8A 4YXHH 4G59C 5KZCB 1TZ8A 4L56A 2R0LL 1G7MA 2VLME 2J2ZA 4H8WH 4U0RC 4L4TB 5L2JA 3FGCA 2HFFA 3DMMA 5TF1L 4EXBA 1UADC 2VDRB 4W9TA 4WY0A 1A6ZB 3ZFHA 4TULH 5JMUA 5FL0A 3QTGA 1ZDQA 3MBXL 3ZJ8A 4WEUD 2XTSA 3V4VB 4HLZH 3N1AA 3WCZA 2EINB 3CHSA 3UZQA 3TU9A 5M03A 4ZAKA 4P48A 1J0HA 1ET8A 1KTCA 3ARGB 4QRTB 3FS2A 4ZOEA 2KAUC 2VDRH 4IM8A 4Y4HC 3QIBC 4QLWA 3OKDA 3PL6C 3AGWA 1SBSH 1SLVA 4NUJA 4GH7B 1HI6A 3TT3H 3PCYA 5BVJB 3V4VH 5F9OL 2YD2A 3KS5A 2FLIA 1ZTXE 2WNKA 4N8UA 1A7NH 4EJ1C 4HNNA 2N1KA 3NA9L 1NBYB 1CENA 3JBG7 1SY6L 1E55A 3N85H 4HNOA 2VZTA 3HLAB 1FJ1B 1VEPA 4X7EC 3QUML 3QUHA 1OGAE 2XV2A 3A21A 3RWEA 4JFYB 1BBJB 1FHGA 5E94A 2HLAB 2BX5A 3VKDA 4C47A 4FA8A 1MCKA 1CFTB 1RU9H 2OLDA 4NP4H 3LNGA 1WA2X 4TQPA 5ICXA 3VD7A 1E15A 4KQ3H 3ULUC 1I45A 4MGXA 3QW3A 3VSVA 2XN9D 1FP9A 4NZDA 3VYOA 1NCHA 4PMQA 1PZ5A 4PLJC 1RVFL 3II2A 2FH8A 1R9ZA 2YBUA 4MTMA 4DJDC 4MIMA 4IMGA 4TUOB 3C2EA 4YHNB 5DZJA 4Q9QL 3LXCA 4OFPA 1MW0A 1R30A 3WLWD 4L64A 3GEFA 2IO5A 2YL8A 1DQUA 2SFPA 4ZXBB 1XFPA 3KOWA 1HH9B 2ZT9C 5HNTA 2D69A 1CB7B 1X6LA 2JV6A 3AROA 1E7VA 3D87B 2A6KA 3IFPB 4Y5XB 1GGBL 3FU8A 2R83A 2J88H 4NO5A 1LWIA 2FT6A 4Q4PA 1WBHA 1FYTA 2QHAA 5TAOA 2VUNA 3SY1A 3KPQB 1NFDA 3BQ5A 5MI0B 5E8DH 2HQAA 4WX2A 2OI9C 3IMSA 2PGEA 4Z78A 1LOSA 1U5VA 2AQPA 3M0JA 1PTGA 3W2DH 1G6CA 4NFBA 1XF3B 3D3AA 1IC1A 2R7EB 5EO0B 4LCUB 1OEZW 4YWGH 1IAIH 3QUXB 1M41A 5BRQA 3GU9A 3GAKA 4XZUA 2F74A 4ZPVB 1OFBA 3WL9A 2FSDA 1GUVA 1GTNA 2YKKA 1JPTL 2JI1A 2CE6A 1L7TL 1E9PB 3HS0B 1EDTA 1ZA6A 2I57A 1UXSA 3RIAF 3VXSB 1UVQB 3A6BH 5LLIC 1ZEAH 4KY1H 1SZEA 4JFHD 5T33H 4JTUA 4Z7UF 4A3QA 5KW9L 5IBUB 4XOEA 4KCWA 1TDQA 2OGJA 5D96C 5C6TH 4PP2B 1GOWA 3WN5B 4NZ1A 2IS7A 1FO0L 3LHYA 3W23A 2VXUH 2ZX6A 3D7PA 4Q6KA 3QUZB 2QJNA 3H3PL 1FP8A 4RMSA 3T1FA 4MB1A 4XOAA 1K9FA 4FQHA 4L29A 1NC2A 1NDVA 3GBNL 1JHKL 3CFUA 1R3LA 1WKFA 1HHGB 4LHUA 1ZHLB 2CDGB 3TN3A 5I9QB 5JPNA 5FPIA 2B1HH 5I3HA 3Q44A 5HI5C 2NX5B 3TT1L 4JFXB 4UMSA 4JIHA 1FV1B 1EO7A 2JF6A 4DF9A 4U3CA 3ATFA 4WFFD 3U36A 4K1WA 4F7PA 5EBWA 3QG7H 5LCVH 4IS6B 2XIQA 2G96A 3LHAA 4O1EA 1E90A 4MKMA 1UXWA 3NZHL 3OYXA 1CD8A 3NZ1A 4UM9A 3PWLA 4YDIH 3SQBA 4MS8C 3RJYA 4UAOB 3HC0B 4I0PB 4B3KA 2W63A 3D50A 2Y8KA 4IBVA 2BS9A 3WTWA 4QXIA 1E67A 2CR6A 4J1UB 4WWPA 3BXWA 1CLKA 4PREA 3DBPA 1L9PA 5BXSA 4FQXC 1SXCA 3UAJD 2INZA 3V6OA 2G75B 5GS1A 2XHYA 1E5CA 3TNBA 4U1LA 4H7CA 3VVWA 4GO8A 4G83A 1ZTMA 3EO9L 5L7XH 4PUDA 3DDFA 3ULVE 2GITA 2W67A 7A3HA 3UGEA 2CKBL 1B0GB 2OP4H 1S9XA 3PHQB 1YMMB 3GH5A 2EVFA 1K9TA 3UPCA 2KLRA 1TV8A 4AEIL 1KENL 4WCJA 4F7EA 1SJDA 2GQAA