2QPUA

Sugar tongs mutant s378p in complex with acarbose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGPRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type A isozyme
publication title The 'pair of sugar tongs' site on the non-catalytic domain C of barley alpha-amylase participates in substrate binding and activity
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 140
structure length 404
sequence length 404
chains with identical sequence B, C
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qpuA01
4ACZB 1CXEA 1J01A 1CGTA 1MXDA 4PTMA 3CUIA 2VURA 1EQPA 5GNZA 5GPRA 1EHNA 3CHEA 1DP0A 3GBEA 3IAPA 2ZX9A 3PZ9A 3CZEA 1Y7VA 4WSKA 2XN0A 4JCLA 2AAAA 4BZYA 2A3EA 5JUVA 1PIGA 4H8VA 1UWUA 4IM4A 3VSUA 3N12A 4C7GA 1V6VA 2DSWA 1GOKA 2V5DA 3GZAA 2YIHA 4E8DA 4URIA 5A8PA 1WZMA 2WZHA 5AY7A 4JFUA 2BY1A 2VX6A 1HTYA 4CGTA 2GJXA 1VEPA 3WENA 3EBVA 5I6SA 1TUXA 3VIMA 4PBGA 4D6HA 5BXPA 1E6RA 1OD0A 2GJXB 4B9YA 3UETA 5JIPA 3WNKA 3BC9A 4AC1X 2W92A 4CVWA 1K9TA 1OBAA 2XFYA 3VO0A 4JIEA 5TD4A 4AXNA 1UWTA 4ZE5A 1CXHA 1G0CA 3GM8A 1UA7A 1GORA 2BNJA 5A6SA 1V03A 2J47A 5FCZA 1GHSA 1UH3A 4M82A 3ZOAA 4YN5A 1EDQA 3VX1A 4AY1A 2J8FA 1J0ZA 7TAAA 1V6YA 4UOJA 4GPNA 3TA9A 3U7BA 4MDPA 1XD0A 4UCFA 3BVWA 2ZXAA 3ARQA 3MKKA 2JE8A 2BY0A 2D0FA 4P7OA 4V2XA 2OWWA 3TTSA 1CGUA 1JDDA 2ZUTA 2WKGA 2DSKA 1JFXA 4B16A 1K9FA 2G3MA 1H1NA 2WPGA 1JG9A 4AD2A 1KWKA 1JYXA 1W9DM 4U5KA 2X8RA 1ZJAA 4H7VA 1CLVA 1MW1A 4MJ4A 4J7RA 2YA0A 4MPKA 1SR0A 2G3JA 4W7WA 3ZSTA 1KXTA 3VDCA 4AZ6A 1PBGA 1JAKA 1ISZA 3G6MA 3ZM8A 3VGGA 3EDKA 1DHKA 3ZT6A 3WQVA 2WLZA 1BLIA 1DWAM 1WDSA 5A2BA 3VOCA 4FNQA 3M46A 2O92A 2C8NA 1DWGM 2WVVA 3CGTA 1UR2A 5DEZA 3WQ8A 1O7DC 1R85A 1G01A 1TQUA 3DHUA 2WVVB 5F7UA 1HJWA 4LYPA 1KCKA 4PMQA 2CHOA 1JZ7A 3T2PA 2VRQA 1R75A 2GFTA 4M81A 3CMGA 2Y4SA 3BSGA 3S5ZA 3ARTA 3WH9A 4CN1A 3AMKA 3ZO9A 5IFPA 2WK2A 4HU8A 2DSVA 1E4LA 1BVNP 1GOMA 1E73M 2F1BA 2WVSA 4HZ6A 3QHMA 3EDEA 4D1JA 1M7XA 2WB5A 1OCQA 4GI8A 2HVMA 2ZWYA 2DT2A 2GJPA 4AZ7A 4NXKA 3CZ8A 2XWEA 2IUZA 3FHAA 3RPMA 3HG4A 3VNYA 3DYOA 1B2YA 5CLTA 4CD7A 4J3WA 4E4PA 2BXZA 3CZLA 2X2IA 4UOQA 4GIAA 4AZ5A 1BYCA 1OWQA 1BFNA 3W82A 2VC9A 4UTFA 1E6NA 5AYBA 4QDMA 2VCCA 4AZGA 3DX0A 3RJXA 4BS0A 5A6MA 3FY1A 3WD1A 4CU7A 3BMVA 4W88A 1XCXA 1TQTA 2VX5A 2YA2A 4AYGA 3WUBA 3VIOA 1UR4A 3ZJ8A 2E9BA 1LWJA 3T0AA 3CO4A 4D6FA 3T2QA 4W89A 3UERA 1TG7A 3GXNA 1XSIA 4UQ9A 3M07A 1O6IA 4OOUA 2CEQA 3AIWA 4OUEA 1BQCA 1R86A 2VX7A 1HJXA 1B3WA 3UR8A 1QNSA 1E0XA 2OSWA 1ZBWA 3GH7A 5BXTA 4ZXLA 2YL9A 2DDXA 2O9TA 1HNYA 2FH6A 1TQWA 2CNCA 3SCOA 3EMZA 5DF0A 1HWWA 4AZHA 2VQTA 1JZ2A 2WBKA 1B3ZA 3POHA 1WDRA 3OLIA 5BCAA 2ESCA 4Z2KA 3AS1A 3WD4A 3TTYA 2VR5A 5A2AA 5I0DA 3AXIA 3DDGA 2VZUA 5HDRA 1HP4A 2VZOA 4MNMA 3OB8A 4E2OA 1EOKA 4GI9A 2DIEA 1PIFA 4Z2IA 1JIBA 1V0KA 2Y24A 1M03A 4N0RA 1BYAA 1UHVA 1GOIA 3BH4A 3VSVA 1RD6A 2WHJA 3IK2A 4U2ZA 1XSJA 3MO4A 1FH7A 1ZBCA 3EJUA 1VFFA 4FNPA 3VILA 1VIWA 4AZIA 3W25A 4FF5A 4LYRA 1J0HA 2WCAA 1TMQA 4DUWA 1C91A 1C93A 2XIIA 3TONA 3D3AA 1KFWA 1K6AA 3HG5A 3GNPA 2DQXA 3ZMRA 3WUEA 3EMCA 4RE2A 3BAIA 2XPKA 3WN6A 1JNEA 3T0DA 2XWDA 1TZ7A 3AYRA 4MAVA 3LRMA 1JZ8A 3MUIA 3DC0A 4P8XA 4HZ8A 1SYTA 3D4ZA 3VGDA 2XTKA 2W67A 3ZJ6A 4P8WA 1QW8A 2V5CA 4DM2A 5LA0A 3A6OA 4U33A 4PMDA 1PS3A 5ABHA 3RM4A 4NXSA 2WCGA 3SCSA 4M24A 1E43A 2ZXDA 3AHTA 2JIEA 2UY4A 3VUPA 3UESA 2J7BA 3K8MA 4UFLA 3ZJ7A 3CBWA 3VDBA 4AZBA 4Z2HA 5I79A 3UG3A 3S6TA 1EXPA 4X0NA 3WNOA 1UH4A 3BUIA 3F5KA 2ZX8A 1LG2A 1J0YA 2YFNA 1UR1A 3W81A 2BHZA 3GXDA 4H41A 4UR9A 4PUDA 4HMCA 4MADA 1HX0A 4OKDA 3LMYA 3AICA 5CSYA 3KWXA 1W9BM 2PBOA 1E6PA 2FHFA 3N17A 4W93A 4DWSD 3RDKA 3VNZA 3BAKA 4FLQA 4GZIA 4DUVA 3M7SA 4P8VA 3OZOA 2W5FA 1WDQA 3MMWA 1AMYA 3FAXA 1H09A 3AS2A 4K68A 4DM1A 1O7AA 3MANA 3VD7A 1EIBA 3A3HA 1OGSA 3SUUA 1NOUA 1CTNA 3QGVA 1E72M 3AXHA 3ZJKA 1VFMA 1VJZA 2J7CA 4IISA 3NIYA 5FD0A 3AOFA 1CGXA 2E9LA 1XYZA 1TVNA 4AIOA 4LPCA 3A22A 4HA1A 1C90A 1KGXA 1HXJA 2ALWA 1M04A 2WCSA 3MI6A 2YDQA 3OGVA 1WAWA 4MNJA 5C71A 3PZVA 3VSTA 2W62A 2WMFA 1TA3B 1JZ4A 4D6IA 2IGTA 3BMWA 3AIBA 4MTVA 4PMXA 1A47A 3D50A 3SIMA 3PZMA 1NQ6A 1JYWA 1B1YA 4PTVA 4PMOA 5JBDA 3UEQA 1FH8A 4PSPA 2BVYA 2X2YA 3UCQA 2VJXA 1KGWA 1R34A 2YLLA 2UWFA 2OW6A 2VI0A 1E56A 1V6XA 1NWTA 3L4WA 1UG6A 1IZJA 1RP8A 1EO5A 1H0IA 1DEDA 4Z2LA 1X6LA 1DTUA 4HMEA 4NI3A 4NRSA 2JALA 1B3YA 2XG9A 1XRVA 3N9KA 2Y8VA 2F7PA 1FFQA 2BVTA 2WMKA 5D8WA 4W7VA 2VRKA 5EFDA 2WM0A 1E5JA 1LF1A 3A24A 3K4DA 2QPUA 4UOZA 4GQRA 2NSXA 3D52A 1PJ9A 3U5YA 5A6BD 2J78A 2UY3A 2BHYA 2WLYA 4TX6A 1EDTA 1W9VA 3W24A 3WY4A 4EANA 3KL0A 1ISYA 1XYFA 1NWSA 5A8MA 1MWOA 5D9OA 2TAAA 3KEHA 2OWXA 1MFVA 4A4AA 4DUXA 5FIPA 2D0GA 3FW6A 4PMNA 2CERA 4NF7A 1WZLA 1EQCA 1C92A 3EJPA 3WBAA 1G1YA 4HU0A 4JFVA 1WDPA 1QPKA 1GJUA 3WNPA 4QLKA 1E1EA 1W1YA 3MMDA 2JF7A 5HNNA 3AFBA 3K46A 4TVCA 5E6YA 5EFFA 2JEPA 1SZNA 4ZENA 4PEEA 2DGAA 2F1AA 1CGVA 3EJRA 3WY3A 2O9OA 3RM9A 3PZOA 1W91A 1WB0A 1QHOA 1BYDA 1OM0A 1ZBKA 5BYWA 1E71M 3ZIZA 5HOSA 1HVXA 1E6QM 4JFTA 2Y8KA 3L4TA 2FDMA 3A4AA 3VMOA 2DH2A 2V3GA 1V0NA 1E5NA 1CENA 1B3VA 1OT2A 2ZE0A 1ZJBA 5DT5A 1UUQA 4D6JA 2DT1A 1DWJM 2ZUSA 3BGAA 2F7QA 1K9DA 4AMCA 5ECUA 2VRJA 4F9DA 4GO9A 2XUCA 3O9NA 1EH9A 4B3KA 4UFIA 3DYPA 2YOCA 5D4YA 1BF2A 3MSGA 4MB5A 3AMDA 5FL0A 3PZNA 1HJVA 1H11A 5CJ5A 1HL8A 4W87A 5AC5A 4GXPA 3N11A 3L4VA 3VM7A 3AYSA 2E8ZA 1V3KA 2QLYA 1QNRA 3WD2A 5AC4A 3GNOA 3WQ4A 5BRPA 3NSNA 1E40A 2Y5EA 4F9JA 1AVAA 4HPGA 2BVDA 2CBUA 3CZKA 3HN3A 1E55A 3AROA 4JKKA 2C7FA 1UOKA 2HISA 1CXIA 3CLWA 3QHNA 3A21A 5A3HA 3AHXA 3VKKA 4IUGA 2O9PA 1UD2A 2ZUNA 1WO2A 1MYRA 4JFSA 1HKKA 3ARRA 1ISVA 1CIUA 1BGGA 2RGLA 2CHNA 4OGZA 3GH4A 3AQUA 1JXJA 1G94A 4FNRA 4ZE4A 3AMLA 2ZXBA 4M56A 1Q6CA 4M8UA 4DWSC 1KXQA 2G8ZA 4AEFA 2CKSA 4TTUA 1XGZA 3IJ8A 4WKFA 3BLPX 1F4HA 1JGIA 3II1A 4AEEA 4IPLA 2NT0A 5A69A 1KCLA 4JAWA 2ZX6A 1HL9A 2XVPA 1VEMA 5GNYA 1MW0A 2DT0A 2OYLA 2A3HA 2E40A 3BUDA 2VTFA 1UKSA 5C70A 2XVKA 2BY3A 5A6KA 1CYGA 4F66A 2CXGA 2Z1KA 3S2CA 3WDRA 4B15A 1QW9A 3QOMA 2VCBA 3HMCA 1Q6DA 5IFTA 3G6LA 5ABGA 3W38A 1BYBA 3D5HA 3TTQA 2ZUWA 1AQ0A 2EADA 1E9LA 1VFUA 1QBAA 5DO8A 4JFWA 1V0LA 5HXMA 1B31A 1W32A 4RE3A 2DH3A 1JD9A 5M3WA 2YDRA 1HIZA 1UKTA 3BUBA 2PWGA 1J10A 1QWNA 4TOQA 1V6UA 3K4AA 2F7RA 1CXLA 4AW7A 4NZJA 3BUPA 4N42A 1HXKA 2WHKA 4GO8A 5I24A 2XN1A 3PHAA 3W53A 2CCRA 1SMAA 5IHRA 3W28A 4ZFMA 3VVGA 1PAMA 2FGLA 1L8NA 1QBBA 1CGYA 2AOSA 1I75A 1ESWA 5CPQA 3DX1A 3POCA 2DPEA 3T0BA 3ECQA 1H3GA 1ZBVA 4AISA 1HJSA 3DX4A 1XH1A 3WH8A 2VVNA 3CHFA 4PMUA 5I77A 3LPGA 2ZIDA 3TP4A 4W86A 2OYKA 1GONA 4MB4A 1JZ3A 1J0IA 1KXHA 2FYVA 4Y7EA 3GH5A 4TTGA 2XGIA 3F5LA 4BCEA 2E0PA 1J0JA 4CCDA 1HJQA 3BVVA 3WDJA 1UD5A 1H49A 2VZTA 2D3LA 3PTMA 4P7QA 1EDGA 5D9PA 3VIPA 4PCSA 1GQLA 2J79A 3A47A 1AQHA 2J75A 2YJQA 2J7HA 3FNDA 1UKPA 3AIUA 1R8LA 2YL6A 3WMBA 2EXOA 3ARYA 5E0FA 2EJ1A 4KGLA 2BHUA 2Z1SA 1VRXA 2X05A 1FOBA 2J7DA 4D72A 3VU2A 1TCMA 3I3EA 3AHYA 4JL1A 3SCPA 3THCA 1GVYA 2YA1A 4XUYA 1WNOA 3ARPA 1U33A 1LJYA 1BGAA 3WSUA 1ZU8A 3CUHA 1CPUA 1ISWA 2EQDA 5FOOA 3HG2A 3MUY1 1P6WA 4E8CA 4FNTA 4GI6A 3ZSSA 3AZTA 4RE4A 3DX2A 3DYMA 4P7LA 3NYDA 1GQIA 1W2PA 3B9EA 3VD5A 3ZR6A 1V0MA 4QLJA 2WC7A 4ACYA 3VMNA 1XSKA 4AD3A 3ZT7A 2WHLA 2DIJA 2EEXA 3WNMA 1CNVA 2J7EA 3CUGA 4XZWA 4WSJA 3B9AA 2WHMA 1C8YA 4XX6A 1XHGA 1RPKA 4DWSA 3OGRA 4UQEA 4Q22A 3ARVA 3EDJA 1QNQA 1QOXA 1R46A 2VCAA 3I3DA 1C8QA 1TQVA 4DWSB 1M01A 1CXKA 3OLEA 3ZQ9A 1V02E 1OIFA 4MJ2A 2MANA 4WJXA 3WF2A 5M03A 2YBTA 3WD0A 2V3DA 3AJ7A 1MQRA 3KL3A 2GDUA 3SCTA 1NWUA 4NX0A 4P7NA 4J3SA 3WQ6A 1JI2A 1GOWA 4D6EA 5A6JA 3PZGA 1VFOA 1PX3A 2YL5A 1QNOA 1UD3A 4WIWA 4W8BA 1GHRA 3N15A 3AZRA 2VR4A 2WW5A 5D9NA 3F5JA 3EYPA 4MB3A 4FK9A 1HKIA 3RJYA 2VVSA 2GVYA 1OIMA 3D51A 3PZUA 2GJRA 2WNWA 2OYMA 4Z2GA 1ITCA 3AIRA 5CG0A 3EJQA 3GNRA 2D20A 1OGBA 1FHLA 1UQZA 4H2CA 8CGTA 4PN2A 5EB8A 2D24A 1Q4NX 3HZ3A 4UZSA 1BHGA 1E70M 1UWRA 2BXYA 4U31A 1V3MA 1HKMA 3SEPA 1EHAA 1CZ1A 1MXGA 4QCFA 1B9ZA 1UQYA 4S3JA 1E4IA 2ZUVA 1HN1A 3AISA 2GK1A 1EO7A 1IZKA 2WMIA 1TR1A 4LYQA 3WMCA 1VBUA 2EPKX 1JL8A 2GK1B 3PTKA 1OB0A 4U5IA 4CD4A 3W6LA 4OBRA 4XV0A 1HKJA 3RCNA 3WF1A 1HVQA 1KGUA 4FMVA 3WH5A 4CCEA 2W61A 2VZSA 4CD5A 4GKLA 4Q7NA 3PTQA 4UNIA 1C7SA 4GQQA 3O2LA 9CGTA 2WAGA 2XHYA 3WEMA 4MB1A 4D71A 4H8UA 3NDZA 1QVBA 1TE1A 4WKAA 1DWFM 4HOXA 3MU7A 2VNCA 3NSMA 1US3A 3WF4A 2XFFA 5CQ1A 3OLGA 1D2KA 5A6BA 1XH2A 4UZUA 2WZIA 1RH9A 2PWEA 1US2A 1HF6A 4EK7A 4DO4A 1W3HA 1QI2A 1LLOA 1XV8A 2FHCA 3MV11 3VGBA 3GBDA 3WF0A 3VDAA 4PSRA 2VOTA 1UA3A 5LYRA 5I2UA 1VEOA 3GXTA 4GZJA 1FA2A 5IHSA 2JEQA 2QMJA 2WBGA 1LG1A 4IPNB 4ZXOA 2VX4A 5A6AA 2XN2A 2D73A 1VBRA 1E0VA 3BAXA 1ZB5A 3VMPA 4ZEPA 3WY1A 1V3JA 1YHTA 5I5RA 4JCMA 5LA2A 1LL4A 1KQYA 3SCNA 4AMWA 1PX4A 4QAWA 3CMJA 3CZJA 3MSDA 3QR3A 2X09A 1UD6A 4KRUA 3ARZA 4AZCA 3BVUA 3WDIA 3TTOA 1EA9C 1JYNA 4BA0A 5D9MA 4BQ4A 1B0IA 5BRQA 1S46A 3CTTA 2F18A 4UQBA 2WZEA 3VIGA 4V27A 2D0HA 3CIVA 1UD4A 2BY2A 4QFUA 3U5UA 4NZFA 4Z2JA 1BPLB 4W84A 3IANA 2WWCA 2UY2A 3GXIA 4CN6A 3ZT5A 4LXFA 4UFKA 2WKLA 4AIEA 1HP5A 4A3HA 3CV5A 3WEZA 3ALGA 5KZ6A 3L4XA 1GJWA 3VX0A 4NZCA 2ZXQA 3N18A 3AHVA 4A3YA 1V6WA 1CGWA 3LPFA 3BUQA 5CXPA 4PCTA 1QI5A 4AD5A 5DFAA 2CPUA 3T08A 1R7AA 4RL3A 3MMUA 3TOPA 5CGTA 3W6MA 1E1FA 1WPCA 1GQJA 3AMGA 2QMKA 3GXPA 3HJEA 3IAQA 2XVNA 3MS8A 3NDYA 3OGSA 1E6XM 2J25A 3GTNA 3APGA 3VD4A 3L2LA 6CGTA 1JAEA 2PWDA 1KXVA 1SFSA 4H04A 1V3HA 2JIWA 1GZJA 2WVUA 2CBJA 2XJ7A 1VJSA 1H5VA 5A94A 3VTRA 4LQ1A 3GYCA 5HPOA 1C8XA 2FE0A 3BSHA 4CVUA 4YHGA 1D7FA 1W3KA 3HG3A 1GPFA 1Q6GA 4W85A 2J77A 3WFZA 2G4FA 2CBVA 3FXYA 4PTWA 1U30A 3KL5A 2W63A 4X9YA 2XM1A 3BLKA 2DEPA 1UWSA 3SCVA 7A3HA 3AS3A 2EACA 1ODUA 2XVGA 3VD9A 3SCRA 4GINA 4OBSA 5ABEA 1JYVA 1G9HA 1WZKA 3SCQA 3UR7A 2XFRA 3CZSA 1UH2A 2WYSA 3VIJA 3EJSA 3SCWA 5E0CA 4TX8A 4OZOA 5AYIA 4ACZA 3LRLA 5BWFA 4S3KA 4YHEA 5KEZA 3W27A 1LQ0A 4FNUA 2CESA 1QI4A 4HOZA 4M1RA 4PMVA 1TQSA 4UFMA 3VGHA 3WDHA 4CN4A 4OIFA 3AZSA 4DO6A 1WE5A 5ABFA 3L2MA 4PMRA 1LWHA 1H2JA 1OINA 2YLAA 3CHDA 2E4TA 4PUEA 4H8HA 5ABFB 1W3JA 2XGBA 3N04A 2X0YA 2A3BA 4TVDA 4UQCA 3BAYA 1B30A 2VO5A 1T0OA 2FGZA 7CGTA 1BVZA 2QV4A 5BROA 4BQ3A 5A8QA 2PI6A 2OSXA 2EPLX 4DO5A 1KB3A 2ZUUA 1MW3A 3ZR5A 2C0HA 4EKJA 2F61A 2UY5A 2DT3A 4U2YA 1W1PA 3RO8A 2V3EA 5I3DA 2BS9A 3WFLA 4WF7A 4PMZA 2J8GA 1WKYA 1R87A 1PPIA 2X0HA 3MV01 1V3LA 3PN8A 3CH9A 4C7DA 3AI0A 3VGFA 2VL4A 5CZKA 1GCYA 2YFOA 1W1TA 4HTYA 1BG4A 5CLWA 1E3ZA 3QOKA 2ZUMA 3NJ3A 4WLCA 3CZNA 4PTXA 1E4MM 5M5DA 1JXKA 3WEOA 2WANA 2WC3A 5E70A 1UKQA 4TVUA 2B31A 3A4XA 2OW7A 3T09A 3VDHA 1UWIA 4HP5A 2PC8A 2AMGA 3CC1A 1GNXA 1F4AA 3BXWA 4J3UA 3RMEA 2D3NA 4L4OA 2E9MA 1JI1A 2FHBA 4UQAA 3ARWA 4KRTA 2F2HA 1W2VA 3ARXA 2W66A 4QLLA 2J7FA 3WBEA 1UR9A 4UFHA 3BAJA 2ZX7A 2O9RA 5I78A 1GOOA 1NARA 4EE9A 1W9XA 2YBUA 5A8OA 2GSJA 3WUFA 3AIEA 2WSKA 3QHOA 1CLXA 3EDDA 4ATLA 1PX8A 3LXBA 3PZTA 4F79A 4HZ7A 1CEOA 2EO7A 3L4YA 2J7GA 3MUZ1 3O6AA 3VIIA 1EOMA 2VMFA 5A1AA 3AHZA 4JZ5A 2WMGA 4CUCA 4MAZA 2JF6A 2VZVA 4OOZA 1KWGA 3N1AA 1UWQA 2V3FA 3H55A 3L4ZA 4PRWA 5HBFA 5EBAA 1BTCA 3UG5A 1V02A 1R33A 4R5EA 1KTBA 3SURA 5FL1A 2E8YA 4LGXA 2X1IA 4KGJA 4HMDA 1MW2A 1L0PA 1ZS2A 1LL6A 3TV8A 4PMYA 1WP6A 3PZQA 3DX3A 3AXXA 1X6NA 1M53A 5DT7A 1V3IA 3VM5A 6TAAA 2CKRA 1H0GA 1CECA 4KMQA 5C8BB 4U3CA 1VAHA 3GDBA 2GUYA 3W4RA 4J28A 1J0KA 3DHPA 5EMYA 1MVYA 1ODZA 2Q8XA 1W3LA 3NSXA 3SCUA 1NP2A 2DSUA 3K8KA 3M6DA 1C3FA 1EGZA 3OBAA 2D2OA 5E9AA 1Q6FA 4UQDA 1OSEA 4UFJA 3LPPA 3FAWA 2WMHA 5E09A 5BXRA 3F4VA 4J3VA 3ARSA 3A5VA 3IGUA 2OLHA 3AIQA 1R47A 1J9YA 3SUWA 1PZ2A 4PYSA 2WMJA 3W37A 1PZ3A 1U2YA 2YKKA 4OJYA 1UR0A 3IJ9A 4FLSA 1BAGA 1J11A 3FHQA 4ML4A 4HOWA 3KE0A 1JDCA 2DSZA 1JF5A 2Y2WA 3RIKA 1HJUA 2CETA 3THDA 3H53A 1W9UA 1YQ2A 2JFEX 1XD1A 3KZSA 4AD1A 4J27A 1QHZA 2YL8A 5D8ZA 3VINA 3ARUA 4EAMA 2VUYA 4QP0A 3RM8A 1QWUA 4R27A 3VIFA 3IJ7A 2CBIA 1B3XA 3WH6A 3A4WA 1QI0A 1FFRA 1UZ4A 3VPLA 1UR8A 5IXEA 3GXFA 2ZOXA 1UASA 3U7VA 1KBBA 1LL7A 5A95A 3WNNA 1K9EA 1Z32X 5IDIA 3WNLA 1JDAA 3K1DA 2ZX5A 2ZWZA 4W5UA 3J7HA 1NM9A 1GQKA 1C7TA 2E3ZA 2XYLA 2BV9A 3AIVA 3AMCA 2X2JA 4FNSA 4MNLA 3B8SA 4M29A 1I1XA 2EABA 3E1F1 3LRKA 1VF8A 4JHZA 5JIWA 2QHAA 1E4NA 3I3BA 1QHPA 2A3AA 3B9DA 5A2CA 3L4UA 3OG2A 2PWHA 4JHOA 1N82A 2G3NA 4FLRA 1J12A 3KLLA 4JKLA 3EJTA 2EPMX 2XSBA 1RP9A 1Q6EA 2IXUA 1TVPA 3EMQA 4BQ5A 3OA5A 2BFGA 3K8LA 2PF0A 5E6ZA 5GQBA 4HA4A 1QNPA 3HU7A 4AWEA 5JBEA 2PWFA 3LPOA 3T2OA 2G41A 4HPHA 2WMIB 3WDQA 1X1NA 1NOWA 1W9PA 3CUJA 3SUTA 1G5AA 3WKZA 2D23A 5HPCA 2EPOA 3U57A 3DECA 4D6DA 1XH0A 2YDSA 1JD7A 2WXDM 3EDFA 3WL0A 2GDVA 4AD4A 4X0VA 4YPJA 1E15A 2J62A 1FP8A 2CIPA 1WZAA 4CD8A 4L4PA 2J4GA 4XB3A 3OIHA 5CPSA 4B3LA 1BG9A 4CU6A 3WQ5A 4W5ZA 4XZBA 2XVLA 5M17A 5A8NA 3CHCA 2J74A 3GXMA 1HT6A 2WVTA 1SMDA 3BVTA 5CGMA 3ALFA 3FN9A 1JZ6A 4C7FA 2G3IA 2XM2A 2CITA 3WIJA 1MQQA 1W1VA 3VIHA 3S5YA 4GZEA 1JNDA 2QF8A 3H54A 1ZL1A 4D6CA 3WL1A 1AQMA 1MFUA 1ITXA 6A3HA 2F7OA 3BLBA 4W8LA 2WSPA 1TA3A 2ZICA 2QPSA 1QX1A 2W4XA 4MDOA 3WELA 1DWHM 3CZGA 1WCGA 5LA1A 1NOFA 4B9ZA 1JF6A 1JFHA 4CD6A 3BVXA 2X2HA 4V28A 3JUGA 5CSUA 1QI3A 1XCWA 2CYGA 8A3HA 1A3HA 1FH9A 1FP9A 3VGEA 1J18A 3OLDA 3WMSA 3AS0A 4U3AA 4D6GA 1KR1A 5JBFA 1PEZA 4AZCB 1BSIA 3WD3A 2NW0A 3CPUA 3WUGA 4BF7A 1UYQA 5BXSA 1GUVA 3UG4A 1CWYA 2PBGA 5A6LA 1CXFA 1UKOA 3DDFA 1I1WA 4BQ2A 4AMXA 1NP0A 4CCCA 4P8UA 4QCEA 3NCOA 3RILA 3WDPP 4KH2A 4ATDA 2EBNA 4W7UA 1MQPA 4JKMA 5CPTA 3BCFA 1ECEA 1GOQA 1NWRA 3MUAA 3OZPA 2WWDA 3A23A 3LXCA 1CBGA 1OD8A 1UZ1A 2VT0A 4J3XA 4TUFA 4FLOA 4P7RA 1E0WA 1JZ5A 4LX4A 2XSAA 4NRRA 5GNXA 4JL2A 4AD0A 5DMYA 4J3TA 4F8XA 2A3CA 3PZIA 2NT1A 1GW1A 1OT1A 3CUFA 1KQZA 1E3XA 2EPNA 4NSBA 4HA3A 1IV8A 1NH6A 2XIBA 4MNKA 4AIUA 4W8AA 1VB9A 4M80A 1KR0A 4AYSA 3KLKA 4WK9A 1ISXA 1R7OA 2OWCA 4CU8A 4TXEA 2FH8A 1TFVA 3W0KA 4KWUA 1B90A 3WH7A 2PB1A 1KBKA 5E1QA 3D4YA 1KTCA 1CDGA 2OSYA 3WY2A 3LXAA 3BAWA 1FHDA 3LX9A 4CKQA 3W29A 1DWIM 5FKYA 4ATWA 5I23A 2WC4A 3WQWA 1E6ZA 2F8QA 3WF3A 2D1ZA 1E6SM 3W26A 3SUSA 4D1IA 1VENA 1XC6A 1H4PA 2W91A 1UD8A 2EAEA 3VD3A 1IT0A 3PBGA 3SUVA 3N13A 3NUKA 3VIKA 1D3CA 1OGGA 2RGMA 4WKHA 2IXVA 2V38A 2VQUA 1GVIA 3BCDA 2D22A 1V08A 1H41A
chains in the Genus database with same CATH superfamily
2UV8G 3V0TA 5JIIA 2HRLA 2W60B 4H6RA 4JREB 2CIIB 2J24A 3C6LC 3T65A 4LDEB 2DSWA 3O9WD 4JG1L 4OI7A 3QIBD 4BFIB 1HTYA 5I0YA 3EBVA 5DXYA 5T3XD 1DLFL 2BX5A 4PBGA 2AZUA 2PTXA 3RX7A 1UP2A 1F3RB 4OD3L 5DEGA 1SJBA 1NMAL 3RAJL 1UH3A 4YN5A 2GL5A 4P2RB 4YBHA 3D8MA 4GPNA 3BWZA 5L9DH 2BVUA 1WT5A 3CFUA 3IMWA 3E9AA 1J1OL 1DLFH 3LV6A 4U5KA 4G56A 3W71A 4HUWB 1NDTA 1G9ML 4RDYA 4LWWA 1X5LA 4PUNA 3GMNB 5J12B 5IB2B 2DJLA 2OFQA 3ZT6A 4LP4A 3P4MA 3M5VA 1K6QH 1A6UH 3X1BA 1WYJA 2AANA 5A2BA 1VCVA 1H8LA 3WD5H 4X4YA 1RK7A 2EDFA 1X9UA 3OA3A 5DD3L 1F6LL 1K8IB 3ZDYE 4WDWA 3GPSA 5B4MC 4UMBA 4JFZL 2YX0A 5D7JD 1TWSA 3CMGA 3KLHD 2EDLA 4GABA 5CP3H 3HZMA 4A04A 3TIDA 2NLYA 3WK0A 3E6FA 4NXKA 3TNNA 4DIAA 4AGPA 2HJFA 2X6AA 3HG4A 4HG4K 1J6OA 2JBMA 5DMMA 3RFAA 1OHZA 3P9LA 5DA4A 5F2MA 3UNDA 3TC3A 3GNMH 5TH2B 3K4ZA 3MBWA 1G6RA 4D6FA 4PVNA 5T1LD 1HI6A 1EJVC 1TFPA 3W75A 5D71H 4D8OA 4ZT1A 2NPLX 3F7KA 3DETC 5CF3A 5M95B 2FT7A 2YL9A 1TELA 2FH6A 2C5DC 3QC5X 4A2GA 5DHXB 2F8VA 3BFOA 3OLIA 3QORC 4XVJL 4LSUL 3PBYA 5HJBA 5E5MB 4AMKL 4MNMA 2VR6A 2VAAA 4NENB 3B9KB 1BYAA 4G1KA 5H94B 4Z7QE 1RD6A 1OF0A 3W7EA 1LNUA 1NWPA 4HWNA 1H6FA 1VFFA 4B27A 1ZLUH 2LLLA 4P0DA 4XMXA 2JJUA 3VAVA 2HLAA 3L67A 5JZ7D 4A3RA 5EUOE 3O8XC 4MNGB 3VFNA 5EOCJ 2HX8A 2VR3A 1G6VK 2ABAA 3QXTA 3HE7D 1AGCB 1T4KA 1HUVA 4L9LB 2IBBA 3BAIA 2GUOA 1MCQA 1XCQB 2CZDA 1ZLVH 4B5XA 4JDTL 4Y5XA 1DQVA 1BWVA 1A7RL 1LEKA 1OZQA 4GQGA 4KJWD 1JWSB 3GR7A 3G5WA 3I50L 4NXSA 4GIYA 2YSTA 4M24A 2YGVA 1CL7I 5AVHA 4P07A 2P5NA 5A3ID 4UFLA 2BZ7A 3CBWA 4U1GC 1JPSL 4FQXB 5CZJA 1EJRC 1EXPA 1PY9A 5EWIL 1OF8A 2BHZA 4NHVA 4JDTH 3T2NL 1COBA 4DXVA 5B38G 5DX7A 3OZOA 1S7QA 3AITA 4OLZH 4QDPA 3LKSA 1O6SB 2W59A 3DOSA 4DN1A 3RIFK 1VJZA 1BREA 5FD0A 1CGXA 5L88H 1JSYA 1VGAA 1KGXA 1A66A 5EWIH 2EF9A 1T7XA 4FC3E 5J1TC 5IUSA 1AFSA 3X2QB 4D6IA 3AIBA 3CUZA 3PZMA 2ITEA 3ONCA 1T22A 4FXRA 4GW4B 2JCWA 2H3KA 4OCXH 4M6OL 1TLMA 2YKLH 4P61A 2NW3B 1FNSL 5KZCB 1SJXA 1T1ZB 3GK0A 4M61B 4PRID 1G87A 4G1EB 5AHFA 3HPFA 1ZENA 3S5LA 4UT6H 4GNKB 1WXYA 4Y4HA 4UOZA 3BESR 4PJCF 1PDYA 4H6KA 3U5YA 2P3ZA 5HI5D 3EEGA 3AWGA 2BHYA 5I03A 3I7QA 3QRGH 5GGRB 1XYFA 4WTWA 1FNSH 4Q52A 5SWQB 1KZYA 5AYQA 2ODOA 4Y4KB 3Q2NA 4KHTL 4NVTA 3UTTE 3Q05A 4U1LA 2WWMD 3IBOA 3GSXB 3RRAA 1EEYA 4OLXL 5IW3A 2JEPA 1ADSA 1JV5B 5J3HC 3CWGA 5ACMA 4LF2A 3BG9A 3GEFA 3D85B 4Y89A 5EEVA 5EZIL 1P2CB 3ZIZA 5D93C 3CFKA 5ABZA 1CLOL 1ZTXE 1GMIA 3U83A 3EO1A 2OOFA 4BYHA 4ZB0A 4FFVC 4HNUA 1CQYA 5IBUG 3BHBB 2ZUSA 1TZZA 4OLXH 5I17B 3P2BA 4KUZH 5AALA 3H22A 3FT4A 2YOCA 3NPSC 4ZPTA 1RCQA 1BF2A 2V5LA 1AOHA 2CLRA 1IKNA 4KCTA 3PJLA 3SIKA 3W1MA 4TYUA 1F3EA 5SWZB 1JUKA 2JIXA 1FYTE 5AC4A 3BQUA 3M41A 5DRNA 4JZNB 2IFFL 3CN0A 3GB7A 4AY8A 5BW7A 1FO0A 1NFDF 3HN3A 4KC3B 4HK5A 5EU4B 3GJFK 5CBJA 1UZDA 4GBXA 3VKKA 1IWPA 2FWLB 1WO2A 1QJWA 1M6OB 1ISVA 4N2IA 3HMXH 4N1EA 3MYOA 4ABWA 1EV2E 4M8UA 2OQJA 4TUOA 4GISA 4WO4C 4P2OC 5F7AA 4B5WA 4XMZA 1TWDA 4OCLC 2A3LA 5D02A 5INCB 3O0RH 5F96H 3U0PB 5I3IA 4Z23A 5E08L 2HVKA 5C0BB 4GAYA 3RVXD 5C70A 2NQLA 4GW5B 3RX8A 3RU8X 5FO7B 4H9UA 3GK8L 3W39A 1ZT4A 3G6LA 2FTAA 3DX5A 2EADA 1OX5A 5IW6A 2YPLD 3PPSA 2XN9D 4JIRA 4RE3A 1MJUL 2W81C 2VZ3A 6ALDA 5CJ8A 1TYJA 1FNEA 3HLAB 3EGDA 4X2RA 2F15A 2X6UA 3QUYC 3IFPA 3W53A 5IHRA 2EIDA 3UFYA 1HC1A 5FWRA 2D31B 1KKOA 2P5PA 1ESWA 2DAVA 1N18A 2DPEA 4PLKD 3EO0A 1XH1A 3TH6A 4PJ8C 5G5IA 5ALBL 5EUOA 3PF3A 4XTDA 2ROXA 2I9TB 4PVLA 1ACCA 1R3IL 4LLMA 2VZTA 2K7PA 3AREC 5D7SL 2A6KA 2OL3A 2XFWA 2EDNA 3ARYA 2VXUH 3ETTA 2C1PB 3QYMA 4GQ0A 1RUSA 3I84A 1SU5A 1Y65A 3F4NA 3QN3A 1KGIA 3LTVA 5C2BH 5IJKC 1YXDA 3L5WB 4XUYA 5ALBH 4G8FB 5IJVB 1NGYA 5F1KC 2IEPA 2W94A 4OUIA 3IU3B 3RKPA 3ZSSA 1RBLA 4ZFZA 5CC3A 4AKOA 5D7SH 4L6HA 1GVOA 1L9MA 3JUYA 4LLYB 1T80A 3UZVB 3ZE1E 5B1AB 3HEIB 1WFNA 3UGXA 3QLLA 3PF2A 5IV2B 4Q6IC 3W3BA 1WD9A 2DBLL 5C55A 2G50A 3FCBA 4MWAE 2GDUA 4NX0A 3N2TA 3OVUB 4XAGA 3B3IB 2SEBB 3O3AA 1CYWA 3EYPA 3FB8A 3FRPG 3HBPA 4JQVA 4PJHE 1KV8A 1UJ3C 2WNWA 4ELME 4Z2GA 5CG0A 4AGLA 1FHLA 4AX3A 4TRPL 4Y16C 1WFTA 4ZUWA 1KYOJ 3BANA 2RA1A 2NXZC 4IRJB 3G3MA 4PUUA 5BS0E 3SEPA 1YPZF 5KVFL 1DVJA 4WSGA 3AU6A 3DFTA 4OFDA 3D39E 4O18A 1IZKA 4GH1A 4AQ1B 3NJGA 3SOBL 4LSTL 4XV0A 4L8DB 5HHVL 1QG3A 2HT4C 5E4EC 3GSUB 1FH5H 1QPNA 4CD5A 2WIMA 4TRPH 4D71A 2X87A 3BPLB 4BDVB 1KN4L 1UJPA 3UTTA 1XH2A 2L7QA 4OV5B 5I0VA 5TQ0H 4XWGL 1TVBA 4OZ4A 5TFSL 4KY2A 3GSOB 4NAFB 1I0DA 1NDYA 4IHOA 3GS6A 3ISRA 3UXAA 1DE4A 4LSTH 2X70A 1GEHA 1EX5A 5A6AA 1TTFA 1VA9A 2D73A 2ISDA 4GFTB 4H88L 5CP7A 3RYSA 3VMPA 3GMOA 3H2AA 1IKOP 4GUCA 1OK6A 1KN4H 4JPVH 5JW4M 4M48L 3BVUA 4KKQA 5D1QB 4UM9B 4BQ4A 1RZFL 7REQA 1Z9LA 5C5YA 3SY8A 1EXUA 4UQBA 2WZEA 2V5TA 3I6GB 4PCPA 3LGEA 4H8WH 3M45A 5SV3A 1FYTA 2WKLA 1HP5A 4M5YH 5JOPE 2ATAA 1GJWA 1JRCA 3LEYL 4EQ3A 4FNLH 3FVMA 1VHCA 1P0NA 2LAGB 2WZPD 2EVIA 3AMGA 4NT6B 3L3GA 4XBKA 1RZFH 3OGSA 5AW7B 4LSVH 5ETUA 1JAEA 4G9DB 3H1ZA 2CBJA 4XNUL 3ULVF 4JN1L 3TZFA 3CDFA 2XTJD 1W3KA 1FBIL 4PRNB 3JVFC 5EUKB 1FFNA 3MZ2A 4PJDB 5IB1B 3VG9C 3TJXA 4OBSA 1K4DB 4ES4A 1DDHA 4XAFA 3CZSA 2V2TB 1QLFB 4PGCB 4UTMA 1SDAB 4QOKD 4TNVF 2YR1A 4YHEA 3S8HA 4XNUH 4JN1H 1QI4A 5CSZB 4EN3B 3EOAA 3NCWA 1AH3A 3QEQB 2DP3A 5FA4A 3EX6A 3E8VA 1FBIH 1GIGL 3QV9A 2OLSA 2E4TA 1P4LA 3B0UX 2PRLA 3C2AL 3ROLA 3NACL 2X0YA 3L0KA 4XZLX 5HD8C 4XT1C 5F9AC 2BFVH 2Y72A 1NCIA 1W72A 4Z17A 2OXNA 3ZR5A 3W22A 3JVAA 1U8JA 5AZ1A 3HQPA 2QGCA 3RO8A 1AR1B 1M1BA 1INDL 5H8MA 3C2AH 2WNXA 5DDHA 1QNZL 3NACH 1D9KA 4EAEA 1FC2D 1QWKA 1GKPA 3IN0A 1YEJH 5JNYA 3EKZA 4PTXA 5CS7A 3MRMB 1TJIL 3SYOA 5E70A 2AZAA 3SYAA 4TVUA 1Q1JL 4DKFH 5K9OB 2YN5A 4XH2B 3O4LD 3CC1A 2PPCA 4J3UA 2D3NA 5D2NB 4X0KA 3FCSA 5B22A 2VLRE 4D2JA 4LLVA 3H2NA 4LHQB 3LENA 4MMZC 4UFHA 1UCWA 4GVFA 4E9QA 4WFFE 1M57B 3B03A 3FBKA 2GSJA 5I26A 3CL7A 4K94C 5HYJB 5D7LB 4GUJA 2FJGB 1Q1JH 3VIIA 3SY0A 1YE6A 4MAZA 3ML8A 2JF6A 3HRZC 4J2MA 1PSKL 3M0KA 1U8MB 5IBLD 3H55A 4JHVA 1IVLA 3BRGC 4D9RD 3FQNB 4XN2A 3EB4A 2HTLD 4LGXA 4ZS6D 4MWAA 1TUPA 1L0PA 3UMNA 2N56A 3PZQA 3FK4A 4LLWB 3ULVC 3UBXG 1XDJA 1EZWA 3IKCB 2Z8VC 4HIQA 3TQVA 2HTMA 5K93A 1HWHB 3U9IA 4PJHA 5EMYA 3GDRA 2NX3A 4ELMA 1W3LA 4JFDD 3BP5B 3C5ZC 1NF7A 2BTMA 3MV8D 2D2OA 2FO4B 3CJJA 1MIML 4KNTA 3K6FA 1S5NA 3MV9E 3IARA 5BS0A 1Y6NR 1MVFA 3PC0A 3NVDA 3NCYS 2Y06L 3D39A 1A3RL 1FFOA 1UR0A 4WEEA 1ZT7A 4FRWA 2GTWB 1FLRL 3CVBA 4HOWA 2XYCA 1WC7B 5GSVA 3SJVE 3OHIA 4LIQE 2MCMA 4Y8AA 5CIPH 5D8JL 2JFEX 4DGWC 1PZ5A 3W7DA 1NSNL 4X6DB 2WZMA 4M7JL 2CR0A 1V05A 1N2RA 3X1NA 3LHVA 3IJ7A 3V3WA 2E9IA 5DRXB 2REQB 3TURA 2OCFD 2QJHA 1A3RH 2CZNA 4XE5B 3WNNA 3K1DA 5DVMA 1FLRH 2FX7H 5IKCB 4HZMA 4WEUD 3ZHFA 1MEIA 1NSNH 3S6DA 3TN6A 1G9NC 2VDKB 3BDKA 4EF8A 3PGDB 5K1NA 5TE7H 1AG0A 3W1PA 3ITGA 4K38A 4MY1A 3KXQA 2JV6A 5E6ZA 1RPQA 1DPMA 3AAMA 2GTZB 2QULA 2WQVA 5KYYA 1J8HD 3KW8A 3TN0C 1ZCCA 4AF0A 1JVKA 3CDZB 1YO4A 4U1HA 1CLYL 4AQAB 2ODIA 1XO8A 1EJUC 1GGIH 3EDFA 3DX9A 2R23A 1REQA 1T66D 1J1PH 1WZAA 2GSIA 4OV6F 4FYRA 4JQ4A 1KENH 4AQLA 4GUPB 4X8GA 5AB2A 5AYXA 2J8UF 1V7NL 2MPAL 3PBUA 3C3NA 4JPIA 1ZDQA 3MJYA 5B8CB 4NGHL 4V1XA 3IXTA 4P59H 2ALAA 5J1AA 4RMSA 1WCBA 2WNKA 4P49A 4EZLA 4WDIA 3RLUA 3H9SE 4MSSA 3RU6A 1E65A 1GGCL 2IQAA 4M1CC 2RDUA 3N1GC 4P5TC 4JFHD 3TYZA 2IMMA 3GSWA 4Y1AB 4BK5A 3NJLA 2I85A 3O7UA 2UY7B 1BSIA 5HINA 3WUGA 2APSA 4MIMA 2OLDA 2R2HB 1GUVA 3CK5A 4NGHH 5C0QA 1GW0A 3LN4B 4R2GC 3TJIA 3AM8A 3X1EA 1KB5B 3VXTA 3VXPB 1TPXC 4AQ8C 3GMRB 3RR1A 4E5TA 2VDGA 3MJ9H 4LTSA 1DCLA 5IQ7L 3TESA 3A23A 4FLOA 3U7YL 1LT7A 2BG5A 1DQQB 2QADD 1YDPA 3CUFA 1KQZA 5BQ7B 1MCDA 5B7EA 4NO5A 1YECL 2BK8A 1SFLA 5B7ZA 2GAZA 2FYYA 4YSEA 1UWXH 4AYSA 2OWCA 4GRLA 4RA0C 5E1QA 3MLUH 1OP5H 4HQQL 3WY2A 1IM3B 3MX0A 5FKYA 3HZKB 3QV8A 2DY2A 4PJIF 1I4NA 2V5SA 3MUGA 2EAEA 4J4PC 3IDXL 4XCNB 3PBGA 3BIKA 2CLPA 3JXAA 1OFEA 1F76A 1PLBA 2HE5A 1X5HA 2VLRA 1Y1UA 1EQPA 3EWWA 5JW4N 4CGUB 2I69A 1S8DA 2Z0BA 3S37H 4JCLA 4HQQH 4EBQL 3GIYA 5K1VA 4C5YA 3VSUA 5DJDB 1NBYA 1RLBA 3DH7A 1IAOB 5GZOD 1D5BB 3FO2A 3BLOA 4H1LG 2Z91A 1OD0A 2QTEA 5D37A 1NOLA 1AIZA 5DT1L 3WFCL 4BEUA 2XG4A 2FB4L 2CO4A 4AT6B 4ANVA 2XIOA 4WGHA 1MAJA 1X9QA 5DJ6A 2P24A 1QTYT 1G1CA 3B2UD 4LCCB 3PJWA 3UBXA 3WFDL 1I8IA 2CRYA 4EBQH 3PGFL 1KC5L 2BY0A 3QI9A 4UDUB 5K59E 3EXTA 1P5UC 3UZYA 1JDDA 4N5UA 2L4OA 2GSGB 2HCVA 1OGTA 2EDYA 4RCXA 3BYTA 5DO2D 1RLCL 2WPGA 4Y5VA 3RPDA 1CYXA 1YXCA 1E9YB 2X7LB 3W2UA 3CHVA 1CLVA 3WFCH 1NFAA 2AV7A 2FB4H 3TGXA 2ZQ0A 4PWKA 3R06A 4ETQA 4AZ6A 3MV9A 2C9PA 3R19A 1IGCL 5A16B 1YY8B 4OLWH 4LOVA 2YD0A 3EO9L 3ARDA 1X8FA 5GIRA 4AEHL 3PGFH 3N3EA 1JULA 1U42A 1JVOA 3QFDB 4NO2A 1JPGA 3SRKA 1KCSH 3SJVA 3FJ6A 4IDLA 3TBVA 1W0WB 3ZE2B 4M81A 2XY1A 3AMKA 5T1MA 4FA6A 5EDXA 2VZ1A 2WK2A 4HU8A 3L65A 1DYSA 1BEYH 3O6FB 1AK5A 1KTLA 1JPKA 2Z7KA 1NBCA 2A79A 3VXSE 2HVMA 1G7IA 1HCYA 2CBPA 4JX6A 1FL5A 4J3WA 4IBWA 1OWQA 3D12B 1BFNA 1AD9B 3DENA 3ESNA 2DQGL 4GAAA 2H32H 4LPXA 3SCMD 3ATZA 4BBWA 4FF9A 3ZJ8A 4L3ED 5DK0A 1O1ZA 3TJHD 5I30H 3V18A 1G84A 1SEBB 4KTDH 3I6SA 2VX7A 1B3WA 3UR8A 1QNSA 1SBBA 1YDVA 3W1TA 1ZDSA 2K78A 4I2XE 2X2GA 3GH7A 3H8NA 2AGTA 3V0AC 2FMOA 4XMTA 4IQJA 5F7YC 2NXYD 5EEWA 3DUSA 3C8KA 3VFRB 4XKYB 5A2AA 3WQEA 3RI5K 1F3DH 3O6KH 4HIIA 1ID5I 2IXQA 1V0KA 4WW2A 2Y24A 3N73A 4KIRA 2K3HA 4M6UA 4UANA 4MAYC 3F00A 4HJTA 3IK2A 4IXXA 3QAZB 1X5JA 1FH7A 1S2WA 4G72B 4AZIA 3S83A 2GI7A 3I74A 1J0HA 4GW1B 1R0AH 4XN5A 4OD2A 3P4NB 2OKTA 1UJTA 2UZYA 5C0EA 3U0TA 4KQ0A 3F12A 3REQB 4LZKA 3H9SA 3JTTA 3VI3E 3I4EA 3HNSL 1KTKE 5IJBC 1TU2B 4RE2A 1LLWA 1DQLL 1JNEA 2TYSA 1E5CA 3T0DA 1CW2A 2XZ9A 3W1UA 4MCZB 3HUJF 3MAWA 2V2XB 3P30L 3PUCA 1XDLA 2GVJA 5F8QC 2Y22A 3P3TA 5BWAA 2ZXDA 4L37B 4M5ZL 5ABTA 2J7BA 1O9WA 1TJHL 3L7FB 3TNOA 5DWPA 4E0CA 1RY0A 4XQ6A 3L3HA 1XLAA 5T1KA 1A9BB 4IMAA 3RX9A 3IS4A 3P30H 4P4KB 5DRWA 3MMWA 3FAXA 1UWGL 1I1YA 4DM1A 4TUUA 5HDBF 4QY8B 5CD5D 4BH8A 4K39A 2J57A 1BM3H 4DKAA 3B37A 1Z9OA 3CQKA 2VDML 3VQMA 4JY4B 2Y85A 2YDQA 1ZAHA 4AYFA 5C71A 1GGYA 4F7CB 5T1DL 2WMFA 2C71A 5PAZA 1VBHA 1XUUA 3G08B 2Y7MA 4I9WE 2KKQA 1B1YA 3W2DL 3T8VA 4O02B 5EN3A 3ZZLA 3UG8A 2VKWA 3MRNA 1UWGH 2XDHA 2A77H 1KGWA 1SY6L 1PWMA 3S2MA 4AVNA 5IM7A 3G6DL 3AWEA 5LGYA 1DTUA 1EXHA 1B0WA 2VDMH 2J6WA 3HA0A 2WMKA 2AKRA 4FA3A 2WM0A 3KYKL 1KKRA 1IEIA 5CMAA 3W2DH 4MYXA 5H37G 1GYWA 2C7UA 4P23A 3SE9H 2B1HL 4YXHH 2DQUH 5DS2A 3BDBA 2A3TA 3FEQA 2TAAA 1Y18A 2IV8A 2DQCH 3EB3A 2CERA 1OCBA 3ZDXF 1G1YA 2EXYD 3DO7B 1E0TA 1WDPA 3KLAB 5E5UB 3BOFA 5F3HB 1PLGL 1UOVA 1RLWA 3KYKH 4Z7UE 5EL1A 3MU3A 4NQ1A 2GSEA 3BIAX 2A7NA 2W9LA 4DAFA 1W91A 4XOCA 5GRJH 4EVZA 5PCYA 1WB0A 3SDXE 1Z9SA 2B1HH 3MGOB 3DG7A 1E71M 4ORIA 4LVOC 1QHQA 3TO2B 3KYOB 3AAZB 2OCZA 4FIRA 3FQRA 4PS3A 1CENA 3RQ3A 1UUQA 2QGBA 4D6JA 3VNLA 1I1AD 2A4CA 1A1NB 1A6WL 2Y1ZA 3TO4B 1K72A 4A63A 5JO5A 4Z1PA 5DD1H 5D4YA 5C6MA 1K2DA 2DM4A 2X44D 5CJ5A 2R6OA 1FNGA 5IROD 5HANA 1SLWA 3PAUA 5BRPA 3QK0A 2VEGA 4WUKL 2ZSVB 2OXGB 3APNA 1DORA 4RZ6A 2A0LC 4LS2A 3VXSA 4JHAL 2Z2AA 1YMME 5I3KA 3IDIA 1MYRA 4KAQL 5EBWB 3W0WD 2UX7A 1BGGA 3QW3A 3LBOA 3EF4A 1XLLA 2XV6B 3L0GA 3AMLA 3NGBB 5DHDA 3D0VA 4Z0SA 1EJTC 4IFRA 1F4HA 4R90H 1E9PA 4WUKH 4DP1X 2GC4C 3OKDA 4HD5A 1H1YA 1VYPX 5A6TC 2XUWA 5HUPA 2OYLA 4BFJA 5LHEA 4APQD 3APMA 4U0RC 3U25A 2KDGA 1FVEA 2HZHA 2CR3A 3FO0L 5F71A 2DIAA 5IFTA 1JGUL 5E6RB 4I2XA 5DJ8A 4FXKB 2FWOB 1ZCRA 4PRRA 4WOZA 1P7QB 4JFWA 2F1EA 2XGZA 1O7SA 2HJKB 3QJFA 2GEEA 1RK0A 1ZANH 2EE2A 4U1JB 4L0ZA 4I0KA 5KYXB 4O1AA 3T1FA 5L9FA 4GFSA 3BUPA 1W3IA 4JRYB 3MCYA 1AZCA 4DFIA 2A1WL 5I1EL 4QGYA 5AKRA 1P6CA 3QUHA 2H4EA 1ONWA 1F3WA 1RLDA 1AUSL 3G6JF 4JLRA 1BZ7B 1Z9MA 1JGUH 1JNLL 4JGUA 1EVUA 4U3XA 3TP4A 4MTMA 1X8CA 2PGFA 3GUFA 3VI3A 3F5LA 1J0JA 4U1SB 3R94A 4HH8A 1EDGA 5D9PA 5E5LA 5I1EH 3BICA 1UM4L 2OMVA 3FNDA 4P9HC 5I8OL 5AC8A 2WSQA 4HJGA 3VXQA 1ALDA 5J5RA 2EDWA 4C6DA 1Q3NA 2D69A 5AWNL 5JW5A 3SFWA 3PAOA 3FU7B 3LYEA 5DS8A 1NQBA 4Y1SA 4U7KA 4U3HA 4N85A 4FHKA 1HHHA 4JRLA 3B9EA 1FE8H 2TRSA 3QWOA 5I8OH 2YCJA 1HWGB 4AENB 3F3HA 4UT7L 1QFHA 4FG0A 3OGRA 4J4KA 4S39A 4DWSB 3HAEA 1ZSDB 3EZ4A 4CNUA 1Q94A 5M03A 3EOYG 3QXWA 3VXRE 2I32A 5AAMC 5E6ID 1GOWA 1OX4B 3QIUA 5A6JA 1AXSB 1P6FA 3H56A 3SGUA 2VR4A 2L8AA 4LW7A 1UXSB 4R3UA 3U48A 4RIRB 4U0QB 2GVYA 1OIMA 3D51A 1NGWA 5HI3D 2FZ3A 4UT7H 1VHNA 1YNKH 5CBAB 5F72S 3L68A 1BHGA 2VIRA 1UWRA 4LPVA 1V3MA 5I16B 1A0CA 1B9ZA 2Z7GA 5EN2A 1EO7A 2J5LC 1M7DB 2ATKA 4DJEC 3W7NA 4CD4A 3Q6FB 4QDWA 5H37A 3I6EA 2XPZA 1HKJA 2YEVB 5KS9F 4J1OA 3GHBH 2B16A 2LGNA 1POJA 4UNIA 1QTPA 4IMLB 2IQDA 5IBXC 3U6WA 4FFZH 2XBTA 2R59A 2V7NB 1S9XB 1KIPB 2HZGA 4Z7UA 3NO1A 1LYQA 4LAJH 4GMEA 2YGNA 1QSED 5LYRA 5I2UA 4GC4A 1VEOA 4NS0A 5IHSA 3CIAA 1ZHNA 2JEQA 1LG1A 3SDXA 3ROOB 1L2UA 2PODA 2Z92B 4G43A 1UPMB 3F03K 3ETBF 1KLGA 3TA3A 2V9QA 2L7UA 3WLLA 3RTQA 3TU9A 3QR3A 1T1WB 2Z31B 3QIWA 1TRDA 2J9ZA 5DN1A 2AXFA 1JUFA 4ZMOA 1RIHL 3NO3A 2OODA 4Y2OA 3QUZD 1UD4A 4PU2A 4BSJA 1OGAE 1BPLB 1KLZA 1Q9WB 3SDCB 4XP4L 3HN8A 3L4XA 3GHTA 2FATH 4UNLA 3U4BH 1FCCA 4AK2A 2J55A 4TQEH 2CZFA 1S7RA 1R7AA 4NC0B 3U1SL 1EHLL 1YMMA 1UB3A 3IAQA 3QS2A 1ZP4A 4W6XB 1RIHH 1YEIH 4Z7VE 1KXVA 1SFSA 4OQTL 3IJHA 1GSKA 1VJSA 4O2CB 1RHFA 3GYCA 2FE0A 5L0QB 3DSNA 3BH8B 4AQOA 2FJUB 4J39A 1U30A 3GLEA 2N7SA 1S9YA 1ODUA 4GINA 3X11A 3IEAA 3U1SH 3RLHA 1YN6B 3DVIA 4TX8A 5DBUA 4OQTH 2QUMA 2HTKD 5IQMA 4CCZA 5TJWK 2BWGA 2RFXA 1KG0B 1WE5A 4A8NA 5CCGE 3OOQA 2B59B 1H2JA 1X7QA 5I73B 2CBMA 1WS8A 3KOXA 3ELAT 1NDGA 4U1KA 4DJDC 2QCHA 3SPIA 2F68X 4G83A 1U3NA 3UW6A 5L9DL 1KFAH 2CLZB 3PQYB 4JVPA 4M4PA 2EO1A 1PHWA 4HG4J 1I85C 2HJLB 1R17A 3O6LL 3VRIA 5J4MA 4GHRA 2R29H 2A9DA 3N42F 2IBGA 4R4ND 3KHOA 1K6QL 4MNHB 4P46C 2Z7UA 1A6UL 1V3LA 4O0ZA 4IGMA 1W6WA 1LE9B 2VL4A 2WQUA 4HTYA 4Q89A 1CDCA 3WD5L 3SQMA 1BJ8A 5EBUA 2EUZA 3CWOX 5HBBA 4MRBA 3EHBD 2ESVB 1QRNE 3C9NB 5FYLH 3O6LH 1OOWA 5IWLA 4R7OA 2OGYA 2PC8A 2A9ML 1KSRA 3OPZL 4LNVA 1HCZA 2E9MA 4LB8A 3ITVA 4EPSA 4KRTA 1W2VA 2QZQA 2G9HB 4W4OA 5DHYA 4CNIA 1P1XA 2YCLB 1MRDL 1TJ1A 3PWNB 4DZAA 4HUVA 5IVZA 2OZ3A 2J44A 4OUOA 4IDJL 1UR3M 4WGVB 4JR5A 4DEUA 2Y1VA 4HH9B 3VH8G 1ME9A 3QCVH 3GNML 2A9MH 3K0WA 1JF1B 2SODB 3OPZH 1XVSA 5ALCH 1E2ZA 2C1OB 1P5VB 1K4CA 4W9EC 2BSSA 3RDTD 2FBJH 4AXWA 3TMLA 5D71L 1J5OH 4KGJA 3V5KB 3N2CA 4WNQA 1MRDH 4TR9A 2B5IC 3VXRA 4PMYA 3COTA 4MXQD 1ZSHA 3A0OA 1E5AA 4LOFA 4IDJH 3R8RA 1FHUA 3FFSA 4HUXB 2VGIA 1EBGA 1ITUA 4DZIA 1U3HB 3V0SA 1VZWA 2H6PA 4J28A 4F48A 3GMQB 2CRZA 2RIKA 3RAOA 2DQMA 5F88A 3UY8A 4UQDA 1B4LA 1YMHB 1MIEL 3RY4A 4TUKH 4WI0A 3QMTA 1PZ2A 5TDOA 5IVNA 3IJ9A 5A5WA 1HH6B 2B15A 3ZYIA 3CB3A 1N8WA 1O94A 1ICTA 2EG6A 2Q6ZA 4KK5D 2OZ8A 4IS6A 1TVLA 5DFVD 5I6XB 2LHAA 2CETA 2BNRD 3CUPA 3T9WA 3DTUB 3NSDA 1YQ2A 3NCJL 3E02A 4LDCA 1QHZA 4LP8A 4EAMA 2DEWX 2VUYA 4QP0A 1Q0EA 1MIEH 2HV5A 3NM1A 2RTTA 1Z2KA 4US5A 4HCRA 2OMAA 3IE4A 3QWRA 3MP4A 3BUTA 4BI6A 1JDAA 1M1XA 1SHSA 5I1DA 3UZ5A 4DP8X 5ICZA 2NYYD 2VW4A 4X5QA 4KI5F 1L7IH 4JVWA 3NCJH 1WXJA 1H0DB 3VJ6A 4O12A 2K0RA 3S5SA 3OG2A 2WHVA 4XTRC 4D7BA 4KJQC 1XJBA 5C7XH 2J72A 1RY7B 2EUXA 3EMQA 4DGYH 4BQ5A 4OLZL 2BIQA 1HEZB 3VWKD 1QNPA 1ORQB 1S1RA 3CFBA 1OGAA 4HPHA 3QRFM 4UDTB 4LY4A 5AW3B 1W9PA 1H7OA 5L88L 1T6BX 5D2LB 1CG9B 2VEIA 3WKZA 5CEZD 3UYCA 4ZQKA 4IGSA 3DECA 2XX0A 5KBDA 4N2EA 2JI1A 4LHUA 2PPDA 3LXUX 1P0SE 2J4GA 3AFLA 2PCXA 3VXOB 1KBPA 5B3JE 2XV3A 1IBGH 4GT7A 1C5CH 3IFLH 4Z7VA 4OCXL 3CAWA 3P02A 3IDNA 4NQTA 2YKLL 3CDYA 1ZLWK 3S5YA 5I8KL 1ZY9A 4EIVA 3RWDB 4AHOA 3OKOA 1ITXA 4HSHA 4QG9A 4M8QA 4UT6L 4E36A 1JFHA 4GXVH 3NSFA 5CSUA 1QI3A 1FP9A 5EEUA 4PW3A 3D0LA 4EUPH 3QRGL 1JWUB 3APTA 1D7DA 3SSGA 5KSBF 1NIBA 1J96A 1HCFX 5I8KH 4BQ2A 2HVJB 3THQA 1IRAY 4PWEA 4I7VA 4RRPG 2FPTA 1TZAA 1WKFA 4AC2A 5LGXA 2Z4QB 1OD8A 2VT0A 4TUFA 3R8HA 4NNCA 3KS5A 1BOGA 4JL2A 4AAJA 1WBJA 2BS71 5KYWB 1KLYA 5JLZB 4NUPA 3GSVA 2EPNA 4KKCC 3NOIA 2OEMA 3WTUA 1N8ZB 1Q2RA 4MMXA 3LLFA 4KO7A 1BFTA 4M80A 1TETL 5C0CB 3CU7A 3MO7A 1RMFH 4YLBA 3G1RA 2COVD 1Q45A 4KUZL 4NU7A 3QXAA 3ITTA 1DWIM 5I2IA 3DGRA 5FK9A 4KI5C 2F8OA 4JFXB 2AVGA 1QRNA 5A40E 3DFNA 2BMKA 4OR1A 4UQIM 3IGLA 4LVEA 1D3CA 3HB3B 4KQ3H 4YZFF 4MS8D 4X4XA 1R24B 4AITA 4BKTC 1TETH 3B6SB 4ADTA 2JKIS 3FUJA 3TEWA 3VRJA 2R1XB 1S7TA 4HGXA 2XWTB 5JUVA 5DVKA 3HMXL 1K8ZA 4B2DA 4G8AC 2YIHA 2W0FB 1WIPA 2CALA 3U9WA 1N10A 5BZWA 2GJXB 2WXIA 5TK4A 1OANA 4LGSB 3NPXA 2YC1A 3O0RL 2BCMA 4G7RB 3L0NA 5F96L 1TMLA 3B9OA 4ZE5A 3PHQA 3VFCA 2JVUA 1GHSA 3N41F 4FOKA 4M4RB 4HYTB 2Q6WB 2J8FA 4UOJA 2HRPH 1JVNA 4ZFFB 3MKKA 2JE8A 1NCUA 1UTDA 4P7OA 4V2XA 3QJTB 5DJZA 4YAQA 2WKGA 1RURH 5TIMA 1MZRA 3GFXA 1M7JA 1SQ2N 3MNWA 3EYVB 1I7RA 3U30B 4DCQB 1OVDA 4MPKA 1LTDA 4IQDA 1XIMA 1E9QB 2OJPA 5C8JA 1LL1A 1FWBC 4Y5XC 3Q37A 2YK1H 5HJXA 3ULUE 3LDBC 5DTFB 3ARGD 3REVB 1PD0A 5FB8B 1Q13A 3OMIB 4QTGA 3UPRA 4FA7B 1RVFH 3T4YA 4LYPA 3RGHA 1KNWA 4EVNB 2G96A 2Z7ZA 4L9YA 3ZDYF 3CZFB 2H2SD 2QNEA 3JZEA 1A7BA 3EGXB 2DMKA 4JDYA 3GLAA 4LY8A 3V0JA 1E73M 4DPRA 2BMBA 4YFLF 1P9MA 2NUWA 2WB5A 4XVUC 2ZWYA 2VXUL 3V5DA 3ILPB 3FHAA 3DYOA 3VNYA 2VJ8A 5C2BL 4XPGH 3O11B 4NG3A 4KEVA 3M1BA 3LCGA 3N43B 2IOIA 4U6YB 2W0KA 1MPAH 2VCCA 2CDEB 1W0YT 2YA2A 2IANE 4U1NA 2V8MA 5EMMA 3BG3A 1GZHA 4G82A 1RK5A 4NNYA 4JG5A 5KSAC 3FOKA 2B7OA 2C3VA 4FA8A 2NLJA 4YK4B 4MJID 4NHUB 3EMZA 2EPHA 3NBNA 2GY5A 1IBFA 1D2OA 1FWXA 3RPKA 5B38A 5LJYH 3WQCA 5C6WH 1S5HA 5ECGA 1T7LA 3IJDA 2APWA 4XD6A 3RX4A 5GS0C 3DG3A 4Y4HC 3URBA 3ATAA 1E9OB 4Z7QF 4GRWH 2DZWA 2R1WA 2OMYA 5F93C 4FF5A 4HC1H 1GKOA 3HC2A 4Q7IA 2DVXA 4BI7A 4W9CC 4E42A 4B0MB 4XI5C 1QD0A 2DDQH 3SGJA 3PGCB 1T7YA 3EMCA 5MEOB 2DM3A 3N1PC 3DBXA 4FX8A 3TYCA 4LSDA 3OQEA 1FH5L 1W6LA 1UC4A 1UEYA 3S3DB 3WJSA 3CU2A 3KTCA 2DLIA 4BCZA 4DJFD 3UYPA 3PNUA 1KYDA 1TTBA 1PKNA 3NQ2A 4RRPA 1MSSA 1DANT 5LBGA 3UG3A 3RX2A 5TQ0L 4JS7A 3FL7A 3TVMB 3BISA 3AQDA 4GKZA 1CT5A 4HHPA 3IJYA 4J8RB 1V27A 2CO7A 3SGZA 5CZ0A 3EEZA 3VWJB 1JDFA 3HPLB 1IKNC 4IU2B 8PAZA 2CBTA 4FI6A 4F4RA 3BQUC 1IGYB 3B1UA 3W7KA 4JPVL 4K5MA 5MEPA 2FRGP 1E8XA 1MI5D 2NY7H 5BW7C 2PAJA 1AP2B 3K5SA 3MI6A 2QGEA 3D1MC 3QQDA 3QZWG 4X7TB 4ES9A 4C6LA 4H8WL 3QPQD 4WHCA 3IWUA 4K94H 3VCLA 4M5YL 5I1AA 1R34A 1DUYA 2YLLA 1LQBC 2OW6A 2VI0A 5JTWA 4FNLL 1U4FA 2PDGA 5T33H 4MZ8A 6FABH 2XG9A 1XLIA 4R88A 4LSVL 3E3QE 3P0GB 3QJOA 3QULA 2PO6B 4IYKA 3IFOA 2Q02A 4Z0XA 2VC2L 3VI4F 1UVQA 1Q5MA 3AYVA 4GKNB 1EDTA 3W24A 3DHDA 5EULV 1NWSA 1HQRA 2OWXA 3CH1A 3WBAA 5BV7H 4FXGA 4QLKA 3T55A 4S3EA 4WEBL 3NZ8A 3FQWA 1MCHA 5HNNA 3AFBA 2CZ5A 4LRIC 3ELQA 4ZENA 1PCSA 9XIAA 2O9OA 2GQAA 3HNVH 2VC2H 3CAKA 2BS8A 4JN8A 2UV3A 4M7ZC 2BIIA 1W0VB 4YSAA 4OWGA 4R0LA 3VFWB 4KWVA 3H9HA 5HHOE 4ADSA 4JZOA 1TZOA 4N0UB 3GTIA 2BNQE 3LHAA 2DWEB 1Q8JA 2BFVL 2PLCA 4HNTA 1GAFH 5GZNC 4K7PY 4WEBH 1WFUA 3LSOB 4I7ZC 4NCC2 2ZC8A 4ZMYA 4C6NA 3VFTB 1QEWA 4ZUVB 4KVPA 3ZJAA 3MBED 3OG4B 4DZ8A 4QIUA 3KPLA 4NJHA 2QLYA 3ES6A 2FIRT 3ALXA 1U0QA 4HKZB 3S98A 3H70A 3HCVB 5EOQH 3G1DA 2ZQKA 2UYLB 1G9NH 1YEJL 4HHAA 4JKKA 3AUOA 1TQJA 3EJZC 3KJ6H 1ZK9A 1XIIA 4UQ2B 5A3HA 4IUGA 1MCCA 2UXTA 4DKFL 2FLRT 5I1LB 1XGDA 3GH4A 2WMPB 2EG7A 1JXJA 1TZ8A 1ONQA 3SO5A 4D2NA 2ATPA 2J21A 2PDYA 1FWAC 2E59A 2IANA 2FVNA 1CF1A 5F89A 4QRRB 3FCTB 5AAWA 3EX3A 5FFOA 1FHNA 3WQFA 1ZLPA 1MHCB 4JJ5B 3VXUB 3PPHA 1FUNA 1IC0A 2FX8H 1PG7X 4TF4A 5B39G 4JQVC 1ZHAA 5FYJD 2ADYA 5ESVB 2WBJB 3GUTB 1E9LA 2IOMA 2CUHA 1B31A 4OFKA 4KROD 3KNBB 4QRUB 5GGTL 1AQ8A 3YPIA 3L1FA 1CXLA 4NOBA 4NZJA 3G5YB 3ZFHA 3ZVHA 3BZ4B 3MZTA 1MG3C 3PHAA 2Z34A 1TO3A 4Q33A 4MDJB 3DUUA 1C16B 1EJSC 5B7FA 5AVWB 5INDB 1LEGA 2NY0B 3DX4A 1NL0H 2VVNA 2DYPA 3BD5A 1KM6A 3OB0H 4P2QD 5EF2A 3GH5A 4TTGA 5GGTH 1L9RA 4Y88A 3OP2A 1XWYA 3OAYH 3BZEB 1XKYA 3OX8B 2QAPA 3A47A 3IV3A 1AQHA 4DI8A 2X4NB 3FRPA 1A4KB 3U2JA 2WXQA 4PV9B 1MCNA 4UAOB 1KBGH 1UXWA 2ZZ5A 3LYRA 4D72A 3D34A 4LVFA 1IQWH 3Q5YA 4E5XB 4NO3B 1SOSA 5MENB 4KK6D 5CAKA 1HTIA 3V4PA 1IQDA 3HQNA 1FVCB 3GSQA 4HT1L 1NCCH 1XZ0B 2CHZA 3UX9B 4XUGA 2IBZY 3ZTCC 3IMSA 1F1GA 1GZPA 2WC7A 2FX7L 4ACYA 3PXLA 5IF0A 3EFOB 1E6JH 1JWMA 5C08B 3OC5A 2XY2A 5F97E 3KBEA 3ZE1F 1A6ZA 4HUUA 3FYYA 5TE7L 3FKUS 5BZDA 3VOIA 4Q6YA 4QYOA 4HT1H 2JKWA 1G7PA 2FUQA 3FZUD 4X8JB 5DURB 1TYGA 3PZGA 1YRKA 2OMXA 4B5TA 2DV0A 3GTHA 5JPNB 3QZAA 5FACA 1GGIL 3HVDA 1ITCA 4MX7B 3US0A 1J1PL 2O56A 5EKYA 4I5XA 4HCLA 2VLKB 4ELMF 4PBWD 4KO6A 1YC7A 5FSDC 3QYQA 2J1WA 1KENL 3WE6B 1QACA 1UCBH 4D9QE 1QEXA 4JDEB 3MHZA 1XQLA 2X4SB 3ITCA 2OMTB 3NP3A 5EMUA 2NY2B 1NIEA 1X3DA 1TJPA 3G9AB 2BC4A 2VDMB 4P59L 2BOFX 4IIGA 4XE0A 4WRHA 2B4CC 2DQFA 3CSGA 4KOCA 3Q2VA 4NQCE 1XMEB 2VLJB 2WOQA 4IU3A 1QVBA 1BFOB 1F3TA 3U82B 3GRWA 4JOMA 3P93A 4UZUA 2WZIA 3WEXB 4CDHA 3P0VH 3U46A 3MV11 4NI8A 1I8MB 4RAVB 2ETWA 4CC4A 1T20B 2XA8H 1VFBB 1ORSA 5IDZA 1BWKA 3K71B 3BAXA 4X5RA 1ZB5A 5HHOA 2DLFL 1ZAIA 3MJ9L 1D9KC 2P80A 2BNQA 5TDPB 1W5QA 5H6HA 1U8IA 5C07E 4MMYB 3TTOA 3NSCA 3T77A 5FGCE 1KPUA 3D7PA 3FB6A 5BMFL 3KCWA 1E3FA 3NNTA 3OD3A 2WLHA 1XX1A 5AHLA 2JKRM 2NZ9C 4PRIE 3I9AA 2IH3A 1CD8A 5DFTA 4I0PB 3WLPA 4AUBA 5E8EB 2DQDL 2DLFH 4G7FA 3WEZA 1INQA 3MLUL 3MRHA 2A38A 2OKMA 4FS9A 4WJG3 3QIBA 4MYAA 2HVBA 4E38A 4E2VA 4MD4A 4HSAC 4LUYA 3W6MA 3VFUB 5LCVH 2EGZA 1BSLA 5EPMB 1E6XM 1IEXA 3MA7A 5BMFH 4IRSA 3KW7A 3UPMA 6CGTA 4GY1A 3OKMB 1UBSA 4XAWL 1A9EA 1QDSA 1NKRA 2HMCA 5GHWH 1HZLA 2ZT9C 2ZG3A 2DQDH 2G4FA 5I6NA 1DEEA 4ANWA 4H0IA 3S37L 3BLKA 1IAKA 2X40A 2PDJA 4DN4L 4C6KA 2VQ1B 2P28B 4NRXB 4HZAA 3D07A 4YNYA 5IR1B 4M02A 5CJNA 5AOZA 3JZ7A 3NURA 4XAWH 1ZP3A 4Y9PA 5CR1A 1EFXD 3VGHA 4S11A 2YD3A 3UA3A 2B7QA 1O5PA 2JB6B 4Z7AA 4MM1A 1IC4H 7ENLA 3TIEB 3BAYA 4GY0A 3TFKD 4DN4H 4K8RL 2ENQA 1FKXA 2J1KA 1UP3A 5BROA 4BQ3A 2RJHA 3T5WA 3BMXA 1IL1A 2CD0A 4M6VA 4FYSA 3ZRSA 3QTPA 4HIHB 2ZUUA 5F2GA 1XBXA 1E7VA 3QDGD 3CFEB 5LNEA 1PE1A 4LF3B 2V0TA 3N2XA 4FXFA 3C61A 3SO3B 4OLWL 4J9JA 3DXAD 5CLWA 5IHZA 3U7WH 4YN3A 1XKJA 4JW3A 4P57A 4JIIX 4K8RH 2ZUMA 1KCSL 4AM0A 4TPRL 2WANA 4DF1A 4WWKB 5GS1A 2OW7A 4Z3GA 3KPQB 5C2CA 2DM2A 4BKLB 1BEYL 4LV4A 2F6KA 4R97C 1BYPA 5C0JA 2CO3A 1BF8A 1YNTA 2RHGA 1YTKA 1ZV5A 3TBWB 4MSWA 1UP0A 4MFDA 3WLRA 2YPLE 4HIJB 3MRIA 1NDMA 3QPEA 3WLOA 1EPFA 1VBJA 4TPRH 3LXBA 5I66A 3PZTA 1F41A 4C6OA 2CXKA 1JRHH 3DI0A 3RWGA 2VITA 3L5LA 2VZVA 1GK8A 3MROB 1X5FA 5I30L 3UG5A 1KTBA 1V77A 4HWEH 1Z5LA 4XPBH 5IW1A 4KTDL 1NCWH 4UMAA 1R5IA 1Z42A 3L5HA 2R7EA 2KX9A 2ZDSA 3HHSB 4UR8A 2BSTA 3BV7A 2PDIA 4M7TA 2OZTA 1C3FA 4PJ7B 4GVHA 5FXCH 2QKIB 5EO0A 3O6KL 5HJYA 3UGRA 4AVOA 1PKQE 3WQPA 3MP3A 2N3JA 4BK5C 3HHRB 2YKKA 4YDIH 3WLSA 4JFEE 1BAGA 1I45A 1R0AL 5RUBA 4NKIH 3LRHA 3RNKB 4XVEA 4YEFA 1JF5A 1E2WA 5AB3A 3AM8C 4NQCA 5D2WA 4LCRA 4E9SA 2E7BA 2DTMH 2YL8A 3TQ0A 3G3LA 2EC9T 4Z76A 3F83A 4R4FH 4REQA 4IMKA 4J2XA 4C8XA 1ZA3B 4AXKA 3U7VA 1ICSA 2X5PA 1OPGH 2AQVA 3CEPA 2E7MA 2VN7A 1H8OA 1C7TA 3CC5B 3MJ8A 1XR8A 1O68A 4MNLA 2X4RB 2EXTA 2YAFA 2ZYSA 4O1BA 5EU6D 2BGNE 4HLJA 2RH9A 3RGVD 1NGZA 4GRLC 3QB7C 3GT6A 3QNXA 3WN5C 2UXVA 1AXTH 4MCYA 2AQSA 5C07A 1S38A 2O30A 2BFGA 2PN5A 5I3FA 4IRZL 3MFFA 2GTQA 3SOTA 4WHYH 2NV2A 1AKJA 4O57A 4APXB 1AC6A 2RDXA 3SECA 2Y1AA 5HJGA 1BM3L 3C60D 4PRIA 2Z0UA 2BP0B 5CSGA 3CYJA 3PWPE 2G97A 3URQA 2VFIA 3SFKA 2FJSA 4F7MA 4L56A 3UQNA 4OJDH 4ATTA 1GYCA 4W5ZA 4ZTEA 4X80H 4XXCA 4IRZH 4XIAA 2A77L 4WW2F 2GJ6D 4FE9A 5CGMA 3DFSA 4JFOB 3ALFA 1L7TL 1MQQA 5EU5A 3FA3A 4UU9B 1JN6A 3F84A 4D6CA 1UZ8A 4A22A 4WJ5B 1YYLL 2YZ1A 5AW5B 2ZADA 4LL4A 1JK9B 4PB9H 3BSZH 5K4ZA 4B9ZA 4I9JA 3GLCA 2X2HA 4ZUUB 4RLIA 3LBMA 3UP6A 4A1RA 3WMSA 4XO3A 4B3EA 3SE9L 1FFTB 4YXHL 3PDOB 4Y5VC 2DQUL 4I3SH 1L7TH 1SJVA 3MJMA 3H3KA 1CXFA 2CUIA 3KXFB 3LQLA 1GR7A 2DQCL 5GS2H 1ADQH 1YYLH 3VE7A 1XH3B 3ARDC 1CBGA 2VISB 1JE6A 4H1LA 4NNPH 1O5QA 3H4FA 1J9SA 5GRJL 2NT1A 1G4PA 3QO1B 1HE7A 1M7UA 4HA3A 1TIUA 3VXGA 1XR2A 2XIBA 3FDKA 4MNKA 4HLZH 1O60A 3QFJD 3KLKA 5D09A 1JNJA 1M7OA 1EUNA 4UWMA 4KWUA 4AGQA 4F15C 3FTZA 2WYIA 3X1GA 5DVLA 4L4JA 1DZ0A 1VSCA 1KTCA 4PRPB 2W07B 4P2CG 1BYNA 4IZGA 4R33A 5DD1L 3TC6A 3GHEL 1E6SM 4GRMA 2EVFA 5HHMB 4WI8A 4QR7A 1GTNA 3N13A 4F9LC 1KRMA 3UROR 5I71B 5CZXD 4IF2A 3KOZA 2X89D 3QWQB 1S78C 2ZOLB 3PZ9A 2V2WA 3B1TA 1EHXA 1KDIA 2YPLA 3E2HC 2AQ2A 2NV1A 3TE9A 3GHEH 3A13A 4BF5A 2HQAA 3SQBB 3MNDA 2WO2B 3SKUD 4R90L 1FL6B 5ACZB 1CD0A 3GVWA 2ZE3A 1VPXA 2O5XH 1TZIB 5TD4A 5KMYA 5A6SA 1A5FL 1KGJA 1KCRH 4BFKA 3W7LA 4WW2C 3LSCA 1T0MA 2IPKB 3MRLA 3ARQA 2BVPB 4WY7H 3FO1A 4BY3A 5A2KH 1MQKH 5G5DA 5D1XD 1YEWA 2BODX 5K59F 3OHXA 1EGJH 1ZANL 2KUTA 1IU1A 2C3HA 4CSTA 1YSOA 4BFNA 4AIZB 1M71B 1PKQA 3S1UA 1A5FH 3EBGA 2UXFA 1UJQA 2BGQA 1T6VN 4JFEA 3M46A 2FPYA 2O92A 1KV3A 5HJ3B 5C0DB 4A3QA 4FFYL 3C5QA 3RVVD 2H6UA 2VDHA 2Y4SA 1D5ZA 1WV7T 2QDGA 3HG1B 1XQ4A 2YXFA 1T2JA 2WVSA 4GP5B 1OCQA 3HJZA 4X9SA 2JKJA 4TSAH 3FOLB 4NP9A 1B2YA 3G1AA 3CFCL 2O61A 5EZLB 2AQNA 4FFYH 1B4KA 3PP3H 5IB3A 1XIWB 1PD6A 2VC9A 3DROA 4YDJA 3SRHA 3V6ZA 4D8LA 3QC3A 5LGHL 3KX6A 1OP3H 3IS1X 3LH9A 3B2XA 1I4FB 3TN3A 1FE8L 1HZYA 2RUSA 4F9PA 1ZAGA 3FT3A 1DBBH 3KLSA 2WJ5A 4OOUA 3G6AB 1BQCA 3BURA 4R7NA 3MV8E 3M17B 5DZLA 3CFCH 3BVNB 3CPLA 2V9DA 4OUUB 3N1FC 2VGFA 5BRZD 1RJYA 2DDXA 3IDYB 5ESAA 3FXGA 1HNYA 5I74C 4ZAKB 2VMJA 5LGHH 1AJ7L 5FECB 3PWPA 3KBFA 4DOHB 3HFYA 4N2MA 3WLJA 3IRZA 3ILQD 2P5WD 5HDRA 1HP4A 5KZMA 1LXMA 3PIQA 4AC7C 2YRPA 4IPPA 4N0RA 3PS7A 4HYWA 5B1JA 2ALRA 3MRCA 1DVXA 1YNKL 1AQKH 4DW2H 2B7NA 1IEBB 4NQED 5DC4B 1AJ7H 1XSOA 2ZXWB 1NFPA 4XMPL 1QLEH 4S0HA 4QNEA 2YQGA 4A7QA 5KAQG 2CK2A 1TZ7A 4H8QA 3VI3F 1IBHA 3MRBB 4JDVA 3CMOH 2XTKA 4FQ2H 4U33A 3GHBL 3R4IA 1LP9B 3SCSA 1HSBA 3F2LA 5D1ZA 4FFZL 3L95B 2ZF8A 4Z0JA 4MLIA 2DFAA 4EUPB 2WOBA 4XMPH 1KM5A 1BBJA 1MLBB 3JQOB 3WNOA 3C52A 1ZGLB 2OKOA 2NX9A 1X5MA 4GO6B 5J13B 3FOMB 3VOJA 2PCPB 1CE1H 1MN4A 4HMCA 1JHLL 2NUYA 4D0DB 2D03L 3MRQB 4DUVA 3OMAB 2OMBA 3AS2A 3BFWA 2D7QA 3VD7A 1EIBA 3DX6B 3HRPA 4C58B 1Z8AA 5ESQB 5F9DC 2PPGA 1B5TA 1CLCA 5AB9A 2NY5C 2PCEA 3U4EA 4J2QA 2IPWA 4B90A 5HQLA 4GYFA 1JHLH 1LK2B 1KW1A 5BPPA 5AVSB 4YXLH 2XZ7A 1KZQA 2D03H 1NFIB 4ENED 5JBDA 1FWDC 2X2YA 2FATL 3U4BL 1RQHA 4PG2A 2UWFA 1ND0A 2VFGA 1TTRA 1UG6A 4TQEL 4TV5A 4PE8A 4MUPA 2BCKB 1CDJA 3UWWA 1ZNNA 5I0WA 2YHGA 1YEIL 3NPVA 2EDOA 2VR2A 3H23A 3A3YB 1WQ5A 2IIJA 5F1NB 3Q8EA 2X30A 1A4AA 1T5KA 1GXEA 4PMNA 2YRBA 1FC1A 3BVDB 4MDIA 1DN0A 4G71B 3KS0H 4YHLH 2YGOA 3MMDA 2JQZA 4WHBA 2OPCA 3X1FA 2DW7A 4B96A 3T7VA 5I09A 4L8BB 1LUCB 3PZOA 1S9VA 4GH7B 1DVFB 4Z7UF 3W9DA 4TKWA 3WBWA 1NCAH 2UUDK 2X1TA 1FIGH 4ZXBB 4JYEA 3PDDA 4ZO8A 4Y4FD 3W1LA 5FW7A 3SDXF 2BOBB 5DHVA 1KFAL 4IG2B 4RBPK 2V3GA 4R7DA 3IJSB 3WLMA 1AH1A 2P8PA 4F27A 4TMBA 1FWRA 2GYIA 5AOMA 4UTIA 4JFFB 4D8PB 2CUMA 4OSUL 2XWBA 2FZ8A 3H6AA 3I75A 2R29L 4XBPB 3WLWC 3QDAA 3FUIA 1H11A 1BX2A 2AXGB 4FALA 4P5RA 4HJSA 2Y7NA 7PTDA 2Y5EA 4K55A 4YHYB 1RIVL 2C7FA 3OJDB 3UD6A 5ITFA 1N3NA 1KYUA 3KRZA 4CVZB 5FYLL 1DQML 1GPOH 4OSUH 3TZVB 3QKZA 3GVVA 4L4TE 2HMID 3V5CA 3T3PB 1SJMA 3II1A 4LLAA 3WTSA 2HRWA 4MMWA 1WOBA 1HL9A 2DT0A 1TEFA 1RIVH 3QIUC 1KD0A 3MV8A 3QOMA 1DQMH 3QG6B 5EEXA 4XCYA 1DYZA 4WI5A 3QCVL 4QUOA 5ALCL 5FHAL 2HXUA 2AJUL 2FBJL 5HYSB 3ZWTA 1J5OL 4OF0A 3HC0B 4LCWB 3PWVB 2IADA