2QPUA

Sugar tongs mutant s378p in complex with acarbose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGPRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 'pair of sugar tongs' site on the non-catalytic domain C of barley alpha-amylase participates in substrate binding and activity
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type A isozyme
total genus 140
structure length 404
sequence length 404
chains with identical sequence B, C
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qpuA01
4GQRA 3WDIA 2BXYA 4D1JA 1US3A 4CD8A 5I79A 1WP6A 4E2OA 1ISWA 2DDXA 2YKKA 1VFFA 3WQVA 5I78A 3MO4A 1B3XA 1RH9A 1U33A 1FP8A 5A69A 1MFVA 1H0IA 5ECUA 2XN2A 3UESA 3QGVA 3BLPX 4D6FA 1WE5A 1JDAA 1EOKA 2EXOA 2OYLA 3LRLA 4OOZA 4H41A 1P6WA 2OW6A 2V3EA 4AD4A 1W3JA 1FHDA 4YN5A 1B3YA 2V38A 1BG9A 4D6HA 4D71A 4RE2A 5CQ1A 4HP5A 3ECQA 4NX0A 4N0RA 4U5IA 3T2PA 2XM2A 4IPNB 1OGBA 3M6DA 4WKHA 5GPRA 3CMJA 3OGVA 3SUTA 3WN6A 3GXFA 1NWTA 4Z2KA 2EPLX 3PTKA 1R86A 3WQ4A 2X0YA 3M46A 2E4TA 4UFIA 1B9ZA 3EDDA 1OIFA 1DWHM 1UWUA 3IK2A 1BYBA 4ML4A 3WKZA 2WVVA 4UQBA 2VTFA 1UH4A 4GO8A 3H55A 3WNKA 2WSKA 4V28A 1JL8A 1GW1A 2EAEA 1C7SA 1E71M 2ZOXA 4DUXA 3B9DA 3MSGA 1HXKA 3VNYA 4J27A 3GTNA 4U31A 5ABEA 2VCBA 3WNMA 1CXLA 1KR0A 3NIYA 1E72M 3EJTA 4AD1A 1HN1A 1E6NA 3WDJA 1LF1A 4HOWA 4N42A 1EGZA 3U5YA 1HL9A 5GNZA 2YA1A 2W67A 2XVGA 2VX4A 2ZICA 1KFWA 2OWWA 2NT1A 4ATLA 1E43A 1HKKA 1BSIA 3N1AA 4MJ4A 2WKGA 1U2YA 5EFFA 3DDGA 4KMQA 4JKLA 1CIUA 1CXKA 1BLIA 3WY4A 2WLZA 2G41A 2EPMX 1E3XA 3MUIA 3WD3A 3H54A 3QHNA 1IV8A 1EDGA 1GOOA 2CBUA 1C92A 2VO5A 2D23A 2DEPA 3DHPA 1BVZA 2E8ZA 1V6YA 4AEFA 4E8DA 4B9YA 2W5FA 3ZIZA 1JXKA 5GNXA 2V3DA 1KWKA 3AXIA 2EQDA 5I77A 2WZEA 1W1TA 1ITCA 3CHCA 4NXSA 4HPHA 3NDYA 3WIJA 5FL0A 1C91A 1TVPA 4AD5A 1BAGA 3WF3A 4JFTA 2YA2A 4QLLA 1CXIA 4UNIA 2J8FA 3PZTA 3AS0A 2ZXDA 5I6SA 4WLCA 4U3CA 4D6DA 3DX0A 4BS0A 1XSKA 3W53A 4S3JA 3WUFA 4PTVA 7CGTA 4M1RA 3ARTA 1JAKA 3LX9A 2BNJA 5IHSA 4FF5A 3ARUA 2GK1A 3SUVA 3CZEA 3VGEA 3AMKA 1JDCA 1VEOA 2CKSA 3AZSA 1UR2A 2C0HA 2E9MA 4LQ1A 1GNXA 1OWQA 1UR4A 5A6BD 2DIEA 3T09A 1ITXA 1OD8A 3AIVA 1QWNA 5JIPA 4UFHA 2OWCA 3WDHA 2BXZA 1J0IA 5E09A 2WMJA 3KL0A 1O7AA 3WD0A 4LYRA 1JD7A 2JALA 4BQ2A 5JBEA 2D24A 5LA1A 3VSTA 1UYQA 2E9LA 3NUKA 1GPFA 2NSXA 3VO0A 3WELA 4W8LA 3WNOA 2PBOA 1JI1A 2DT1A 4DWSD 2DH3A 3WY1A 2UY4A 1PBGA 1E4NA 2VNCA 3AFBA 4ACZA 3UG4A 1GOWA 3BGAA 1PIFA 3AISA 4S3KA 3O2LA 4JFVA 1XGZA 2QPSA 3CO4A 4PTXA 3CMGA 1MQPA 4WSJA 1TZ7A 2YL9A 3CBWA 2J75A 1MW2A 5BXSA 1HWWA 4URIA 4GI9A 4A4AA 4GZIA 3T0AA 2CIPA 5C8BB 1OINA 5BROA 3AIQA 3PZOA 3WD1A 2CHOA 3RM8A 1UR8A 4OBSA 4W85A 4L4PA 1HVXA 3VIGA 3VUPA 5FKYA 4CD4A 1WZAA 3MSDA 4WKFA 2GSJA 1CLXA 4TUFA 1BQCA 1XC6A 4DO4A 5I24A 2F7OA 4DM2A 2J7BA 3L4VA 3VINA 3GZAA 1KBBA 1HKMA 1PJ9A 3L4ZA 5M03A 2V5DA 4Z2HA 4UFMA 2GK1B 3BUQA 5CPTA 4D6CA 2ZWYA 3WUBA 4JL2A 1JZ2A 1JF5A 3BMWA 1GOIA 1MYRA 2X09A 1MW3A 2J62A 3CGTA 5ABFA 2Y4SA 4P8WA 5HOSA 1ZBVA 1R7AA 4DUWA 5D8ZA 4OBRA 3UEQA 3ARYA 1E6RA 1UZ4A 1OSEA 1W9UA 1TQTA 4F8XA 1L0PA 4DWSC 2VURA 4CD5A 2J7CA 3GM8A 1YHTA 2FHFA 5A8NA 4QAWA 1WCGA 2WKLA 2ZX5A 1CGXA 5CJ5A 3BC9A 4HMDA 1E6SM 2J77A 4P7QA 3WD2A 3AXHA 3F5JA 4GINA 5A95A 3HG5A 1HNYA 2WM0A 2AOSA 1B3WA 1VB9A 1EQCA 1TMQA 3PZQA 1C8QA 1UA3A 5I23A 3VMPA 3PZUA 2VX6A 4W5UA 4AIEA 1XD1A 4TTUA 2DH2A 4P7NA 3HZ3A 1QW9A 3PN8A 3ZOAA 2E0PA 4JFUA 4ATDA 1BVNP 3POHA 3WDRA 4J3UA 1K9DA 1H1NA 2WCGA 2QLYA 3S6TA 5IHRA 4ACYA 1NH6A 4U3AA 1LJYA 1KQYA 1R33A 5EBAA 4AZ7A 4Z2JA 3GH5A 1HKJA 4TVDA 1TQUA 1KXVA 3BSGA 3HG3A 3SURA 3THCA 1QI5A 1WNOA 4P7OA 2QF8A 1NP2A 2XVKA 4RL3A 1EHNA 3GH7A 3VIFA 4PMNA 1B2YA 4Z2LA 2F7RA 3N11A 4M56A 5BRQA 4B16A 2E8YA 2J8GA 1Z32X 4AYSA 1E5JA 4TVCA 4KWUA 2VX7A 5A8MA 2V3FA 3VTRA 3W0KA 3AYRA 3WDQA 3BCFA 4R5EA 2IXVA 3WNPA 2Y8VA 5A6BA 1VRXA 1SMDA 4AZIA 1MQRA 2XFFA 3ARPA 3VIHA 1RD6A 2DT0A 4XUYA 4CD7A 2BY1A 2CITA 1QI2A 2XFYA 1D3CA 4H2CA 2WMIB 1W3HA 3VDBA 3WUEA 2W66A 5CGTA 1MQQA 3MS8A 1R85A 2FYVA 1JDDA 4AZCA 2XM1A 2G3NA 3DX2A 1XH0A 3NYDA 4HMEA 3MMUA 3GXDA 3F5LA 3BVUA 1PPIA 1QI3A 3AROA 1C93A 1N82A 2YA0A 1GCYA 4UQAA 3DECA 4CCDA 2EPOA 4F79A 3S5ZA 2XSAA 1V0MA 4W86A 3K46A 4BQ4A 2WAGA 4M80A 4AZHA 4LYQA 4PUDA 1DWFM 1WKYA 4W7WA 3ZR6A 3OGRA 4JIEA 4IISA 4ZEPA 3DYPA 5GQBA 4OKDA 3CTTA 1EIBA 3D4YA 1M01A 2QV4A 2WWDA 2HISA 2VCCA 3EMQA 3BCDA 1QVBA 5FOOA 4MPKA 1CXEA 2BHYA 4M24A 4MTVA 4ZFMA 1VIWA 2GFTA 3LPOA 4AW7A 5AC4A 3EDEA 1X6NA 4J3SA 4P8UA 2A3AA 4W89A 1TQWA 2EACA 1CGTA 1J9YA 4FNQA 1VBUA 3JUGA 1NQ6A 1HX0A 4D6GA 3VSVA 3W6LA 1CGUA 1TG7A 3A4WA 3WL1A 4CGTA 3HJEA 1E6XM 2BFGA 2YBTA 4JCMA 3EMZA 1LG2A 3FW6A 1ECEA 4XV0A 1QOXA 3BAXA 1NP0A 3CV5A 2VRKA 3UR7A 5BXTA 1LG1A 1R87A 3EJUA 3CIVA 2XUCA 3FHAA 3BVVA 1GQIA 1KR1A 1B1YA 1GQJA 1DWJM 1W32A 4P8XA 1CECA 1EO7A 1B31A 4UZSA 3WDPP 2CKRA 2CNCA 3ARQA 1I1WA 2QHAA 5DT5A 4FNSA 4TOQA 2ZXQA 1FH8A 4UOZA 2ZX9A 2CYGA 1R47A 1BYCA 1QBAA 2XVPA 1W9DM 4P7LA 3SEPA 3BAIA 1G01A 3CPUA 1EDTA 2F7QA 5A6LA 2VVSA 3KL3A 3NSXA 1BTCA 3L4UA 3WH5A 3LRKA 1QX1A 3MU7A 1WZLA 3HG2A 2VR5A 4U33A 1XD0A 3CZJA 3MMWA 2ZUVA 4Q22A 4MNJA 4D6EA 1JYVA 3AZRA 3F4VA 1HJSA 3BVTA 4XZBA 2DSWA 2BY2A 4J3TA 3PTMA 2Z1SA 3VIIA 4PTMA 3W28A 2CEQA 1V6WA 2WHJA 1UWIA 3W27A 1FP9A 4NZCA 4HA3A 1AMYA 1E0VA 4C7GA 3ZO9A 3ZSSA 7TAAA 3ZMRA 1KTCA 1W1PA 1E3ZA 3B8SA 3TTSA 2WSPA 5E0FA 2VI0A 1R34A 4AEEA 1O6IA 3OZOA 3ZM8A 1UH3A 2O9RA 3FXYA 1UASA 3OA5A 3H53A 4PYSA 3D4ZA 4UQCA 5D4YA 4PMXA 3G6MA 1D2KA 4FLSA 1BG4A 1DHKA 3BUPA 2PWDA 5BYWA 4WF7A 1L8NA 3L4XA 4UQEA 4EKJA 1VAHA 3UETA 2PWEA 3SCPA 5AY7A 1F4AA 3CH9A 3N04A 3VNZA 2F18A 3WMSA 3N18A 3BAJA 1DWAM 4H7VA 4B3KA 1H11A 1H49A 2YDQA 1JFHA 1UD6A 1CXFA 3PZMA 4CVUA 1QNOA 1E5NA 2CBVA 3GXTA 2J7EA 1V02E 5CSYA 1DEDA 2EADA 3VIJA 1XH1A 5A2CA 1K9TA 4QLJA 3GXNA 1F4HA 3TTOA 3AYSA 1EOMA 2VZTA 3L2MA 2VR4A 4HPGA 1GOQA 2F61A 1BFNA 2VCAA 5A8PA 5KZ6A 1GZJA 1TE1A 1C8YA 1JD9A 4TXEA 1QWUA 5I2UA 5A6KA 2BY0A 1UD8A 4U5KA 4OJYA 2FHBA 3KLLA 6TAAA 1JG9A 2JEQA 3I3EA 1PEZA 1KB3A 1MXDA 3D51A 3G6LA 4BF7A 2WZIA 2D0HA 1PS3A 4AZGA 4AIUA 1PAMA 1UH2A 2FGZA 3DYOA 5CPSA 3VPLA 1QW8A 2PI6A 3I3BA 3LXBA 3VM7A 5CGMA 2E40A 3WBEA 3LPGA 2W4XA 2OW7A 3SIMA 1GUVA 5BRPA 2ZX6A 1JF6A 1LL4A 2EABA 3MANA 3K4AA 3LXCA 3WFZA 1W9PA 5HPCA 2QPUA 3K1DA 3OLEA 1FFRA 3FAWA 1QI0A 5FIPA 3U7BA 3K8MA 2J7DA 2JE8A 1NM9A 5HNNA 1E4MM 4W93A 1VBRA 2YFNA 4HZ8A 1MXGA 5A8OA 1E15A 2F8QA 4W84A 3PZ9A 3T2OA 2X1IA 2V5CA 3APGA 1GOKA 1JZ5A 5TD4A 1JZ6A 4NXKA 1QI4A 4X0NA 1NOWA 3VD4A 3UG5A 2YBUA 2FDMA 1FFQA 3PTQA 1CTNA 1TFVA 2WWCA 5HXMA 3CZ8A 5FCZA 2XYLA 1KGWA 3GBEA 4DO5A 3MI6A 3CUIA 1V0LA 5LA2A 1UHVA 2G3IA 3AS3A 1TA3B 5A6AA 1JZ7A 2DT3A 4B9ZA 2J4GA 4WJXA 3WH9A 5A8QA 1G0CA 3PHAA 4AD2A 4CU7A 1B0IA 1DWIM 1K9EA 2F1BA 3BMVA 1QPKA 4Q7NA 3ZJ6A 2G3MA 1E70M 3KLKA 4JKKA 1MVYA 1V6XA 4AMXA 3O9NA 3WMBA 1NWUA 1FH9A 1KGXA 2DSVA 5I0DA 2C7FA 4W5ZA 2BV9A 2CESA 1W9XA 1JIBA 1CGWA 3CUJA 1EO5A 1AQHA 2PBGA 4KRUA 2GVYA 3RMEA 1GJUA 1J0YA 1Q6CA 3PZVA 3AIEA 3VGHA 2VJXA 1JI2A 4V27A 4XX6A 4PEEA 2Z1KA 3W24A 2JF7A 3SCQA 2GDUA 2CBJA 3ZJ7A 4UFJA 1JZ8A 3OZPA 4OZOA 1VJZA 5CXPA 2XPKA 1Q6FA 1CPUA 5KEZA 3ZR5A 2DT2A 4PMQA 3W38A 1WO2A 1HKIA 2D1ZA 5LYRA 4BA0A 1FH7A 3TP4A 2XVLA 4CN4A 1OGSA 3EJPA 1ESWA 4FNUA 3A4AA 3ARXA 1KBKA 3B9EA 3FHQA 1QNSA 3W4RA 3ARZA 1JYWA 3IAPA 3CUHA 4LPCA 3MMDA 4NZJA 4IM4A 3WQWA 4JHOA 3TV8A 1V08A 4H04A 4Y7EA 1G94A 1B30A 1XHGA 4OOUA 3WNLA 4EK7A 4AZBA 1SZNA 1HP4A 3TOPA 3DC0A 1H09A 1UA7A 4BQ3A 1W9VA 4L4OA 2JIEA 2XVNA 2RGLA 3AHZA 4WIWA 2ZUSA 4GZEA 4FLQA 4MB1A 1J11A 3OG2A 2VX5A 1J0JA 4DUVA 1J0KA 3WY3A 3EDKA 4HOZA 3L4YA 3AJ7A 1NWSA 4MAZA 1CXHA 4UOJA 3WSUA 1V03A 2A3BA 2YLAA 4NF7A 3GNPA 1CGYA 3WFLA 1QHPA 3CC1A 4ZXOA 2WYSA 4AZ5A 1KXHA 4J28A 4J3XA 1LLOA 1UKQA 1V3KA 5ABGA 1ODUA 3VIOA 4FK9A 1CYGA 4CCCA 2E9BA 4GO9A 1SFSA 4BCEA 3TA9A 2ZUUA 2WMKA 2FH8A 1V3IA 2AMGA 4PMYA 2YFOA 1BHGA 2D22A 5EB8A 1UKPA 4D1IA 5ABHA 4WK9A 2D3NA 3GXIA 1W3LA 5JBDA 1M04A 2G4FA 1XSJA 4UQDA 1TUXA 4CCEA 3HG4A 4LX4A 4HZ7A 3ARWA 5BXRA 1C3FA 5AC5A 3RM9A 2VUYA 3A3HA 1H41A 5DF0A 2WCAA 5IFTA 1HJXA 3AXXA 4ZXLA 1UD4A 3EMCA 4B15A 3A5VA 4MDPA 4KGJA 1JNEA 5A6JA 2JEPA 1JZ4A 1V3HA 3GXPA 2IXUA 3LMYA 1W2VA 1M53A 2BHZA 1U30A 1MFUA 3M07A 5E9AA 4Z2GA 2WANA 2OSXA 1RP9A 2EBNA 1SYTA 2ALWA 3ARSA 3CUGA 1QBBA 2VZUA 4HZ6A 3A22A 4JFWA 1RPKA 5IXEA 3W25A 3AHYA 4W8BA 1GORA 2D0FA 1GHRA 3VIKA 3BUBA 1W91A 1E6PA 1HVQA 2EPNA 5DFAA 4JZ5A 4AY1A 3VMNA 1J0ZA 4PUEA 1S46A 2WNWA 2XWEA 3CZNA 4LYPA 4HOXA 3OB8A 1QNPA 1FA2A 4KGLA 1A47A 1CNVA 1C8XA 1HIZA 4D6JA 4U2YA 3SUWA 2PB1A 4PTWA 7A3HA 2J25A 3CUFA 2ZX8A 3ZJKA 1BGAA 1CEOA 2BVDA 2D20A 1UR1A 1I75A 1PX3A 3D3AA 4FNPA 4QCFA 2NW0A 2WCSA 1VF8A 4U2ZA 3VX1A 2XFRA 2ZX7A 1HT6A 5HBFA 1RP8A 2DSUA 2J7HA 1EA9C 1ZL1A 3BVWA 2E3ZA 2ZWZA 4MNMA 2X2JA 2Y8KA 3BSHA 5BWFA 1G5AA 1JAEA 1Y7VA 3W26A 2CCRA 4ZE4A 1MW1A 2WLYA 3CHEA 2YIHA 3IJ9A 3VD5A 6CGTA 3J7HA 5FL1A 2DSZA 2PC8A 2WPGA 1KCKA 1D7FA 1R7OA 4B3LA 4CN6A 4QDMA 1LL6A 3BAWA 3A23A 3RCNA 3AMDA 1V6VA 1LQ0A 9CGTA 4AXNA 5ABFB 1KCLA 5D8WA 1UQZA 1CZ1A 4GKLA 3UCQA 4H8VA 4UZUA 2J79A 2GJXB 2XN0A 1SMAA 5E70A 1Q6EA 2VVNA 4GPNA 4PMOA 1XYFA 1WZMA 4NSBA 5DT7A 3WH7A 1TR1A 3AI0A 4AWEA 1VFMA 2J47A 3AIRA 1AVAA 4JCLA 3GBDA 3DX1A 4GI8A 3PZNA 5CZKA 2Y5EA 1OIMA 2WMGA 3MUZ1 3RILA 2DPEA 1JXJA 2JF6A 3VDHA 2O9PA 3VVGA 4M8UA 1G1YA 1VJSA 3O6AA 4F66A 4XZWA 1ZBCA 5LA0A 3LPPA 4AISA 1GHSA 1W2PA 4CKQA 2CXGA 5A2AA 3EJSA 4W8AA 1V3LA 5CLTA 5E6YA 1WDQA 1HJVA 1H5VA 3IJ8A 1HXJA 3AS1A 1UD2A 1ISVA 3HN3A 1DP0A 3WQ6A 1UD3A 3ZT6A 1XRVA 3EJRA 2CBIA 3SCUA 1AQ0A 4M81A 4H8HA 4NZFA 5M3WA 4PSRA 1HTYA 3ZT7A 2OYKA 3MV01 4EANA 4KH2A 5HDRA 4MDOA 2ZIDA 2IGTA 4LXFA 3SCTA 1UKTA 2CERA 3AOFA 2YL8A 3U57A 1GVIA 2Y24A 3SCVA 3AICA 3B9AA 1GVYA 3WMCA 2J7FA 1MWOA 2VZSA 1TQVA 2WVTA 1V02A 2RGMA 1V0KA 1UKOA 2XHYA 1KXTA 1UZ1A 3VIPA 4D6IA 2WHKA 1B3ZA 3GH4A 4AD0A 2CPUA 3SCOA 3BAYA 8A3HA 5EFDA 3OLGA 5GNYA 3ARRA 3CZSA 3WEOA 1VEMA 4FNRA 2ESCA 2XGBA 3WY2A 2VL4A 4W7UA 1KGUA 1UUQA 3ZQ9A 2WBGA 3ZT5A 2EJ1A 4OGZA 4PMZA 2WC3A 4R27A 3SCWA 1UWSA 4DWSB 1WAWA 2VZVA 3VIMA 4QCEA 3VMOA 3QOKA 3PZIA 1UKSA 3BLKA 1VEPA 2GUYA 3AMGA 1OD0A 4H8UA 1E1EA 2X05A 3FN9A 4MADA 3T0BA 3VKKA 4OUEA 1AQMA 2BVTA 1OM0A 2O9TA 3IAQA 3WF0A 2WBKA 1J0HA 2A3HA 1HJQA 3II1A 4MAVA 2X2HA 4TVUA 4EE9A 2UY5A 4YPJA 1E9LA 2YDSA 5AYBA 2WC4A 2WB5A 1EQPA 4JHZA 2PWGA 3MKKA 3NDZA 1TCMA 1HL8A 2OYMA 4K68A 5I5RA 4CN1A 1KQZA 4PN2A 5A1AA 1VFOA 1EHAA 1C90A 2W63A 1BGGA 1HJUA 3WENA 3WEZA 1M7XA 2DIJA 2G8ZA 1W1VA 2O92A 4FNTA 2XG9A 5D9PA 3MV11 1Q6GA 3D50A 1J18A 1WB0A 5IFPA 5HPOA 1ZBKA 2UWFA 3RJYA 2F1AA 1E4IA 3W81A 4E8CA 1H0GA 3BVXA 2ZUMA 1GQKA 4DM1A 3N15A 1OCQA 5C70A 5A6SA 3AIUA 4LGXA 1V3JA 3K4DA 2D3LA 4P8VA 3TTQA 3DDFA 2J74A 1E56A 2YL5A 3WBAA 1OB0A 1G9HA 1E6ZA 2WW5A 1E0WA 4GQQA 1KXQA 1HP5A 3CHDA 3K8KA 4ZENA 3I3DA 4HMCA 3VGDA 3AIBA 3ZSTA 4HU0A 3AQUA 4JFSA 2FGLA 1DTUA 1B90A 1R8LA 3TONA 3U7VA 3M7SA 2FE0A 3WF1A 3A6OA 1GOMA 1T0OA 1CLVA 4BZYA 3SUSA 3VDAA 3DHUA 2XWDA 1LL7A 1BF2A 1JFXA 5A3HA 3KZSA 3FAXA 3GNOA 4UTFA 1V3MA 2WVVB 3VILA 1R46A 1X6LA 2BS9A 4NRSA 2WK2A 4A3YA 4M82A 4WSKA 1Q6DA 1JNDA 3EYPA 2EEXA 3WQ8A 4DWSA 1C7TA 2FH6A 3NSNA 3S2CA 2YDRA 3MUY1 1WDSA 4PBGA 3KL5A 1K9FA 3D52A 3OIHA 3NJ3A 2YOCA 1IZJA 3RDKA 1A3HA 3SCNA 2V3GA 1ISXA 3GYCA 3RIKA 2D0GA 4ZE5A 3HMCA 2PF0A 3CZKA 4UCFA 1E55A 4CD6A 1EH9A 2VRJA 3VSUA 1E73M 4AD3A 4OIFA 1UR0A 3UR8A 2WMFA 4IUGA 1XH2A 3QOMA 3W29A 1ISZA 4AMWA 4RE3A 2XTKA 2YL6A 3SUUA 3KEHA 3WF2A 3ZJ8A 1FOBA 4ATWA 1PZ3A 3IANA 2PWFA 2ZE0A 3ARVA 5FD0A 2WHMA 3A21A 3AHVA 5EMYA 4PSPA 1E1FA 1V6UA 3N9KA 3FNDA 3OLIA 4JL1A 2EO7A 2OSWA 1EDQA 1UOKA 2UY2A 1PX4A 1UD5A 2ZUNA 4UR9A 2NT0A 1Q4NX 3NSMA 3POCA 3T2QA 3A47A 3CLWA 2VQUA 3LPFA 3WNNA 1MW0A 1K6AA 1NARA 2PWHA 4FLRA 1CGVA 2AAAA 3MUAA 3DX4A 4RE4A 2VC9A 4C7DA 1BYAA 2G3JA 2DQXA 3BAKA 1ZBWA 3WEMA 4QFUA 1H3GA 1QNQA 5DO8A 2X2IA 3L2LA 3RO8A 3DX3A 5JIWA 3VD3A 3OBAA 4AMCA 5CSUA 3PBGA 4Z2IA 3QHMA 3QHOA 3CZGA 2X8RA 2WVSA 2J7GA 4J7RA 3BXWA 4UFKA 3T0DA 4GZJA 3RPMA 3L4TA 4MB3A 1JYXA 3WD4A 1OBAA 3UERA 1QNRA 2WZHA 1PZ2A 2JIWA 1ZU8A 4HU8A 1H2JA 3LXAA 3AMLA 1W1YA 2WHLA 3W6MA 5D9OA 1ODZA 4FMVA 2OSYA 4BQ5A 3ALGA 1YQ2A 1UWTA 3VD7A 6A3HA 2A3CA 1NOFA 2J78A 4DO6A 4NRRA 2XSBA 4MNKA 4J3WA 3SCRA 1ISYA 1CBGA 1CDGA 3GNRA 2VZOA 2W61A 1ZB5A 3QR3A 4A3HA 3VDCA 3S5YA 4AZCB 4M29A 1NWRA 4TTGA 1TQSA 1XCXA 4HTYA 2WVUA 1H4PA 2QMKA 4UQ9A 4CU6A 4PCSA 4W87A 1GONA 4MB5A 2EPKX 3CZLA 1X1NA 3UG3A 5D9NA 2VMFA 4P7RA 4NI3A 4PMRA 3AMCA 4PMUA 3GXMA 1VFUA 3EDJA 3N17A 1OT1A 4CVWA 3N12A 4TX8A 5CLWA 2WMIA 4F9JA 4AC1X 4EAMA 5JUVA 1W9BM 2XGIA 3BLBA 1UQYA 1ZJBA 3VD9A 1JYNA 2TAAA 2WC7A 4X0VA 1WDRA 5BXPA 4QP0A 5E6ZA 5IDIA 2VOTA 1KWGA 3AIWA 5AYIA 3LRMA 4KRTA 1FHLA 3A24A 1JZ3A 2HVMA 2WMHA 3DYMA 3SCSA 1QHZA 4X9YA 2GJRA 2XN1A 3AHTA 1UG6A 2XIIA 1US2A 4AZ6A 2W91A 1R75A 4CUCA 3EDFA 1E40A 2C8NA 4FLOA 3VGFA 1DWGM 3EBVA 2WXDM 4TX6A 4WKAA 4GXPA 5M5DA 2VT0A 4JAWA 3IGUA 1PX8A 3VX0A 4F9DA 4JKMA 3KWXA 2YLLA 3ALFA 5CG0A 2D2OA 3L4WA 4PRWA 5F7UA 1WPCA 2X0HA 3VGGA 2ZUTA 1HF6A 1E0XA 2DSKA 1OT2A 3AHXA 4W7VA 3VOCA 3WF4A 5DMYA 2Y2WA 2JFEX 2X2YA 5D9MA 1ZS2A 3PZGA 1WZKA 3TTYA 2OLHA 1IT0A 5E0CA 1O7DC 1GJWA 2ZUWA 4PMDA 5CPQA 4V2XA 4PCTA 1GQLA 3AZTA 1ZJAA 3D5HA 3N13A 4UFLA 4XB3A 5C71A 1E6QM 1SR0A 3WQ5A 1LWJA 2F2HA 1E4LA 2XIBA 1BYDA 2IUZA 2CETA 1B3VA 2CHNA 4AYGA 1J12A 3VGBA 3HU7A 3T08A 3THDA 2O9OA 1WDPA 3BUDA 1TVNA 1XV8A 4AIOA 2DGAA 4PMVA 2GJXA 2VRQA 5E1QA 4C7FA 4E4PA 2A3EA 2ZXBA 4W88A 2W92A 4MB4A 3KE0A 4MNLA 3WH8A 2D73A 1OGGA 4QLKA 1CWYA 2YJQA 1EXPA 4J3VA 2W62A 3W37A 4HA4A 2XJ7A 1J01A 3E1F1 1W3KA 1XCWA 3IJ7A 1LWHA 1PIGA 1J10A 1NOUA 3BH4A 5M17A 1CENA 2F7PA 1M03A 3AS2A 3U5UA 4GI6A 2BHUA 1V0NA 2VQTA 2B31A 3BUIA 2GJPA 1BPLB 1UWQA 1IZKA 5BCAA 4D72A 3K8LA 4GIAA 3OLDA 5A6MA 5I3DA 3A4XA 1VENA 1I1XA 4MJ2A 3RJXA 3WL0A 1TA3A 2BY3A 4YHEA 2UY3A 3EJQA 1XYZA 3VU2A 3CHFA 4CU8A 3GDBA 1KTBA 2ZXAA 5JBFA 4HA1A 2BVYA 2FHCA 3OGSA 2OWXA 5A2BA 3F5KA 3VM5A 3FY1A 2QMJA 5A94A 3WH6A 4YHGA 1HJWA 4ACZB 1UR9A 3W82A 2Q8XA 3WUGA 1JGIA 4UOQA 1UWRA 2GDVA 5DEZA 2MANA 8CGTA 1XSIA 3RM4A 3NCOA 4IPLA 1QHOA
chains in the Genus database with same CATH superfamily
5I1HH 5J7CC 4AQ8A 2J6VA 3BQ5A 1Z2KA 4NOFA 3W7HA 1IC5L 2BVOA 2BXYA 5IB5A 5CHNA 2EDBA 3GHPA 3F2BA 4M9OA 4HU3A 5I79A 4AISA 1OHLA 3T0WA 1T7VA 4E2OA 1ISWA 5J5RA 1HQRA 1F3RB 4FYTA 4L1BA 1RK6A 4OZIA 1UCWA 2DDXA 4JTDA 3WQVA 4AH2B 3SE3A 2NTSP 3WLPA 4ZTXA 4PUWA 3F4CA 2WD0A 4WUKL 5I17A 1H0IA 1MCWW 1A6ZB 4TMBA 2QVMA 1Z5LB 4N2IA 1YX1A 3U0WH 2NX9A 4MWAD 1V7ML 2DJ4A 4N8UA 4YL4A 3IWVA 3LRLA 2OYLA 4BXSV 1VH7A 2CZEA 4H41A 4OOZA 4JFYA 3GNDA 4P2QB 5DUBA 2QZQA 3TPKA 1P6FA 4G8GB 5DX7A 5FFGA 1KN2L 1IT9L 4TPRH 3W9EA 4QRTB 2NWSA 3OHIA 3FS9A 4DELA 4GBDA 4HBKA 3MRRB 4AW4A 1WD8A 1BRLA 1QTYT 2IDUA 5D7IA 4APQB 3B56A 4CKVX 4TSCH 3T65B 4RE2A 2VIRA 3H1ZA 5D1ZD 4RW3A 4NX0A 5A43C 3NJMA 5IVOA 4X6EA 2XM2A 1TITA 4B4FA 1NC2D 3LOWA 1O95A 4IPNB 3M6DA 1A7PL 4LVOB 4R5VA 1KDIA 2FJFB 2Z92B 3QYMA 2ETWA 1V5JA 2ZCKL 3ILEA 4KJPC 2ITEA 4HIHA 1OC7A 1Q65A 3RURA 4CSSA 1TJGH 5HR7A 1XR8B 1LORA 1QPOA 4AMAA 3NIGF 1UOZA 3M46A 2E4TA 1S7WB 4FKHA 7TIMA 1IEWA 1MJUH 2JIXD 2HS8A 2HZGA 5LNUA 3LCHA 1ZLUK 4GMTL 3Q6GH 5ITBH 3IK2A 3PWNA 1IYXA 4JY9A 3TYDA 4TL5A 1BXVA 1BYBA 2BC4A 2G30A 3MA9H 3P11L 2VSKB 5FF6B 5D2LB 4L37B 2WVVA 5AYUH 4MY8A 5D33A 4IK6A 1M42A 4GVFA 5IOPB 4Q9RL 4J2PA 4UQBA 2CQVA 3QMRA 6REQB 4GQ9L 2VTFA 1UH4A 4Z7UF 4CVZA 1I45A 1QT1A 3BSZL 3EX4A 1YEGH 4LSPL 2HRPH 5LGHL 4W9FC 3KYMA 4GO8A 4KDWA 4N0YH 4A2GA 4DQWA 4CVXA 5BOJA 3H55A 5IVXA 1F13A 3MLPA 3MBWA 4UQIM 4UUJA 2OQHA 1UJ3B 3MQTA 2KLSA 3ILQD 4TNVK 4G11A 3IDIB 4V28A 1EPXA 1YBQB 4K94L 1M05B 1GW1A 3O2VH 1ZNNA 3QGAC 3TCEA 3KYNA 1JNHA 1I7TB 5JMOC 4DWDA 2PD9A 4CQBA 1Q8JA 3E9TA 2CUHA 5CLYA 4ZJ9A 1KFLA 4Z7VE 1WEJH 3B9DA 3K2IA 3QEGL 5AFAA 4JTGA 1U8NA 2Y25A 5KSUA 4N1EA 2WNKA 1F58H 1P6CA 1QNVA 3O6FD 3OXSA 3QUKB 4QRQB 2VISB 4LCWA 5G5IA 1XAKA 5KSWA 2G9HB 2CZ5A 5GSRA 3IAGC 1CXLA 3T8LA 1UWEH 3CLEL 4C6CA 5IM51 3GMOA 5LDUA 1E72M 4PBEA 5ICXA 3VFUB 1S1PA 1YKWA 1HN1A 3MRBA 2J5LC 4S3GA 4PD4K 2H45A 4K9JA 1HI6B 3RB7A 3WDJA 4HOWA 4KZDL 4JTSA 3H12A 1QA9B 4CRPA 4N42A 5EPMA 4PGDA 4LUIA 2W67A 3KRSA 3VABA 2J1KA 4ZFGL 2NXZC 4JFZH 2VX4A 3MUXA 3BZFB 2B2XH 3P4LA 5DT1L 4BHUI 2V9DA 2F53E 2OWWA 1TJ1A 1ED3A 3G5EA 1KNWA 1NSNH 5FV2A 2I5YH 5CJ8A 4KOBA 3QHZL 1XP3A 3ZYIA 3BGMA 1S5NA 4X4XA 3N1AA 2DW6A 2WKGA 4EDWL 3VD0A 4NRXA 4NOBA 3K6OA 4KMQA 3DFNA 1E51A 3UNDA 3U36B 3HFMH 1DVYA 4JQAA 1RURL 3I74A 3ZIYA 3ITXA 3V4UL 3N85L 2OOFA 5DQDH 3OKOA 1LP9F 2R9HD 4LL4A 2OJPA 2YR3A 1ZGLB 1Y18A 5GZNC 4OTXL 4XVTL 1Y0EA 2BDQA 5EU3B 3DKJA 2B1AH 3IFLL 4TSAL 1F6KA 3MBEB 3SGDH 1FWIC 3SADA 1EDGA 5AW8B 1XMEB 1NOLA 4MNGE 5JZ7C 1C92A 1GWJA 2QQQA 1S2VA 2WYZA 5L9DH 1I9IH 3TVMD 3RAOA 4REQB 1Q9OB 1IKOP 3DPBA 2X0SA 5DEFB 4JREC 4LAMA 3BYTA 2YCLA 1SJVA 2YQBA 2PXYB 1FRGH 4KKNA 3WSQH 4X50A 5AHFA 4OUUB 4NKIH 4XZNX 5J6GB 1PGRB 4OFCA 4L1DA 3RRAA 5I77A 2WTPA 4AM0B 1ITCA 1W1TA 4LASH 4QRAA 5I6PA 2PLMA 2R1KA 3CHCA 3PF3A 1JWMA 1A0QH 1RH8A 2EPHA 1ZVNA 2AZUA 2CO1A 4FYRA 4NN5C 5F71A 1CD1A 4QSFA 5T1MB 4YDKL 4EN3D 1YAIA 1BAGA 1JWSA 1XX9C 4TQEH 4UM9D 1NBZB 1P0EA 1AE6L 2NNAB 3TQPA 4JFED 2VJ8A 4LLMB 4NGHH 5EDXA 1KCXA 4I18C 2YA2A 4V11A 5TDOA 3TIEA 4LBRA 3ZY7A 4QLLA 4V1DE 3ZKXC 1MIEH 3BMXA 5EF2A 2PUZA 5ALBL 3QNZB 3LGEA 4DIXA 1Q9KB 2PP0A 5EZJA 5KJ4A 2A2IA 2FWUA 3K91A 2ZXDA 5TGBB 1M41A 5I6SA 5D1XD 4W9DC 1HFBA 3NVQA 3GLEA 3C6SB 3FB7A 3ZDWA 2DQDH 1A7QL 4ZMVA 2GUBA 4R7OA 1XSKA 3N50A 3W53A 3UJSA 5C09E 4OJAA 3BPNC 3VW3L 1NEYA 4L4LA 1AHWA 4DKEL 5KJ7E 4W4OC 3N73A 1JAKA 3LX9A 3US0A 4KCTA 4LSVL 4RMTA 2BNJA 4OY9A 4PGBB 4UTIA 1D6VL 3QO0A 4HEPA 4JHAH 1OCOB 5F21B 2DYPA 5I1HL 3CZEA 3AMKA 1ZE3H 2K6YA 4G3YH 4KVPA 1PG7H 3CMOH 4OGYH 3ULUE 1UR2A 4LQ1A 4KRZA 3N6JA 2KI6A 3KLQA 1QLEB 3CN2A 2K8MA 3KBWA 3KVMA 3MKVA 4BFIA 2DZVA 5EN3A 3PB2A 5D8JL 1OWQA 5E5CA 1QEWA 5DCCA 1KC5L 5DEFA 2C1OB 4GQZA 3ZVHB 1QWNA 4A22A 2VR9A 4EI5D 2EXYC 4M3HA 2OWCA 5HI5C 1MHHA 3ECUA 4WUKH 2X6BA 5F7NC 4QRNA 1XWYA 3EFDH 5E09A 4K3EH 3KL0A 3H8NA 4FO4A 3S5NA 1MRFL 4OAWB 2FJKA 1BVLB 5I71B 4OI8A 2ZZ5A 1JD7A 4IRSD 1VHCA 1A9EB 4BQ2A 4XP9H 3CE1A 4A6GA 4TUJA 4GQPH 3HAEB 1UYQA 4FQXC 2E9LA 3V7PA 1R5VB 3TYAA 3U36A 3EFFB 3C2FA 3BOVA 5FW6A 4P23A 4K8RL 1I3GH 4LAOA 4GKOA 4ZOAA 2NDFA 2WUCL 4P2RD 3VUAA 2FDSA 4X99B 3WLHA 2JGYA 3EZJB 4H7ZA 5LAXA 3VRIA 4UTWC 3LERA 2DT1A 5B7FA 1F11A 4KHTH 3WN5B 1RUML 5ESAB 5IROD 1ZANL 2UY4A 1PBGA 4BK8A 2VNCA 3G3LA 2TMDA 1KKOA 4AWSA 3MYZA 1C5DB 1ZIAA 4Z18A 3CJJA 2PCXA 2GBTA 2UZXA 3TSMA 4LRIC 3AISA 2NY7L 2AMUA 3FGCA 1KB5A 1MIMH 2ENSA 4MBRA 2DUZA 2VEIA 3QKEA 2HSAA 4U4BA 1EUNA 4GMTH 3TOYA 1BBJA 2XRAH 3V0SA 4IFOA 2EYRA 2Q8ZA 4KWSA 4B5UA 5F7HA 1XGZA 3E6HA 1AK5A 5HAOA 3VOHA 3A67L 3R19A 4TUKH 4DGVL 4IQJA 1WSST 4WO0A 3QFJD 3N14A 1PVNA 1J8RA 2CRZA 4WSJA 3ZTEA 2DVXA 2YL9A 4QO1B 2YAEA 5J11B 4IKLA 3IACA 4IH3A 1MCRA 2IWEA 1S7VB 3G5VB 3H9SE 3KYNB 3EOTH 5C92A 1GYUA 3L9YA 3UTPD 3QXDB 4FQPA 4URIA 1F4WL 3UWWA 2VKWA 2R39A 1L3WA 2WXLA 1NMBH 2VLRA 1O9WA 1E4XH 3NN8A 4W9EC 1G67A 3MRQA 3AIQA 4NO3A 2P8BA 4MQ7A 5IMLA 4WU7B 2OSLB 1YNTA 4PH8A 4DKFL 3RM8A 1II4E 3BHBB 5SWSB 2DJLA 3GG8A 4W85A 7REQA 5DSCA 5FEWA 3OAUH 5C6TH 1BV8A 1Q8AA 5FDYA 4OBTA 3VUPA 4M1CD 1ITBB 5ESAA 1WZAA 1VYSX 1S7XB 2ZCLL 1DO5A 4TUFA 1YC8A 1CLXA 3IJIA 4XO7A 4MG4A 4JAMA 2ADIA 3BKJL 1LBFA 4ODHL 3AC0A 4DM2A 2ZOLA 5L2KD 3SDDD 3B37A 2J7BA 3TMLA 4N3UA 1HKMA 5D2YA 4DJFD 2H6PA 5JA8B 1EFXB 2FX7H 1T0PB 3VTAA 4UFMA 2PP8A 2DQIH 4ZS7L 4ETYA 4KZDH 1EPVA 2GK1B 1LO4H 4DJFC 2O5YH 2YD9A 4AEHL 1KEML 1N70A 5AZ1A 2R27A 2Y6SC 4D6CA 1VZIA 2ZWYA 3NQAA 1JZ2A 4HEPG 3A3XA 1YXCA 4X5WA 4G80B 4OLVL 1JNLH 1G4MA 1ZVSA 3CGTA 2C3XA 2Y4SA 5LG1A 4Y19B 3R0UA 5EY5A 1ONEA 2HPMA 4HNVA 3QHZH 5HOSA 3PAYA 2G2RA 3NM3A 1R7AA 1ADQA 1L6GA 2CLLA 2EDEA 4EDWH 1UWAA 3DCPA 3LTSA 1L9QA 3HFFA 4JY4A 5D8ZA 3OKDA 1MDTA 4NUJB 4OBRA 3NEHA 1IL1A 4IRJA 3AABA 3KPNA 1S9WA 2E9GA 5ANME 1I3RA 1PCKA 2LAGB 1BQKA 5CU9A 3O2WH 4DWSC 2H8ZA 2EYSA 3NRFA 3GM8A 3LPWA 5F1IA 3W2DL 1HJCA 2DLTA 4XWOD 3KZ8A 4MCNA 1M65A 3L3KA 1FZOA 3BRDA 1OG0A 2AQSA 1GG1A 3SDAD 3KPRE 1A6ZA 4BFJA 4DQOH 4K8RC 2MOGA 4K7PH 4KKLD 4U1HB 1P5VA 1NJJA 3SJ3A 1SUHA 4DAIA 3VE0A 4PGBA 4JQVA 3ZHKA 4JTIA 5HTSA 3QVAA 5JQIB 2PW1A 4CQAA 2XY1A 1KY7A 3FO9B 4AK1A 4HMDA 3HBZA 3ES6A 5KBLA 2QQLL 1A0DA 2E6DA 2YGYA 3WD2A 1VKXA 3AXHA 3FU9A 3B8UA 5AVHA 4E5TA 2G2NA 5CIPA 3LIUA 2L0DA 1KCBA 3BGFC 1PWMA 1QLRA 4X2PA 3B40A 2BVOB 4HUNB 5KYYA 4J3BA 3Q06A 1HILA 4IMLA 2OTUB 2PN5A 5DEGB 5EOQH 4Q9CA 1XIDA 2W0UA 2N7AA 1R9XA 1IBGH 3MFFA 1DQLL 1UC6A 3IDYB 1JERA 2ESVB 4I3SH 5LN4A 2VN7A 2PGFA 2FD6L 3ZE1E 4KKPA 3BLIA 1YMME 4C6MA 3QPYA 5I23A 4L5FE 4XAKD 5KVEL 4WHCA 5B3JF 2E4FA 2GIYA 4XVJH 3UAJC 3CV7A 1S7TA 1XD1A 2ZKYA 2PTVA 2Y3AA 3EGSB 4F9LC 1SGJA 4N1HB 3NA8A 4TTUA 5FB8A 3WQOA 1G7MA 1MCPH 3N43F 1QW9A 4M6OH 5F7LB 4K3JH 2P49B 1OG6A 3PN8A 2B4CL 3PR2A 1PDZA 3CL6A 3WO4C 3HNTH 3VXNB 3GS6A 3SGDI 5E0QA 5AVQB 5BQ7B 3KYKL 1ONQA 4LBEB 1FO0L 2X70A 2PUQT 1M1XA 3DLQR 1PG7X 3HUJE 4PRHD 5HI5D 1UEMA 2DKMA 3WDRA 3OKKA 4HNUA 4S2CA 3S6TA 2DQJH 4PG9A 2P8MA 2BP8A 4ZXBD 1P7TA 1L6WA 1YDOA 2D2HA 1NAKH 5J13C 4LY8A 2IOMA 4U3AA 2ICWB 4YXKH 4N9DA 5TTRA 2C79A 4A7UA 3W7KA 5HY9B 5EBAA 2FZ3A 4QTHA 1HSAA 4LCRA 1K4CA 2VQ1A 1HL4A 1QLEL 5TDPB 2PABA 3KD4A 2XPZA 3Q8AA 1J6PA 2QKFA 5D8JH 4Z2JA 4TMPA 3USZA 3NQBA 1KXVA 3AQDA 3HG3A 4ZXBA 1FYTE 3ZKMD 1QI5A 4FA6A 1U41A 1P6BA 4AQZA 2Y7QB 2MCPH 1DSFH 3IFPB 1DTNA 2ODIA 1HK6A 4MJ6B 4KESA 4PP1D 2JKAA 5D02A 3T2NL 1TCRA 1JRBA 1BMGA 4FF7A 3B7SA 3GH7A 4DP0X 1UBSA 3LNPA 5LCVL 4HHLA 3TLQA 4TKWA 1B2YA 5MP6H 1YPXA 4GIYA 4L64A 1AC6A 4LUJA 3SR7A 5EU6A 4F58H 1AKJA 4MKVA 4Q8PA 1S7UA 3WHXB 3GIYA 3M41A 3D0LA 4DBSA 1A6TA 4I5XA 3PL6B 3B9OA 3FQWA 2VXUL 5KBDA 1KBGL 2FCBA 2Z9TA 3FCGA 1JMXA 1E5JA 1IEHA 3H42H 1SPDA 1IXPA 3T71A 2VX7A 4K37A 2XXFA 1KV7A 1Q9LA 5GJTL 2BSLA 2NZ1A 4LWWA 3HHMA 5KVEE 3TA3B 2Y7DA 4K38A 1RUMH 3EJCA 1A8JH 3WDQA 3ABLB 5ENWB 4IFRA 4X6BA 4HWBA 4WFED 1XMWA 3TJHC 3WI9A 3USBA 2IXVA 1LO0H 2VXVL 2CHRA 5J5EA 1T8QA 3C2RA 4EQ3A 5IVNA 1M9WA 3HPJB 4UM8A 4PVBA 4C56E 5JHBA 4UNVA 1O1ZA 1MCHA 1RZJL 1RBAA 1MIML 2QVTA 3MCMA 1MQRA 5J06A 1LQAA 3GSRB 5DUPH 3L54A 3QULA 5E8OA 1KBJA 5DD1H 4AIZB 2DT0A 3CK0H 1C16B 5B1CA 4XUYA 2BY1A 4CD7A 5AC7A 5B3NA 5I1AB 2RUSA 3GWQA 2GY7B 4CVZB 4MWAE 2WIIA 5EULV 5EZPA 4Z23A 1QI2A 5AECA 3SBQA 4L48A 4RNRA 3VDBA 2WMIB 3IRDA 1BQSA 1JBJA 3QH2A 5TJWK 1NCTA 3IVKB 3J27A 5E5LA 2BLEA 4GW1A 1DJZA 4FRWA 5MERA 1R85A 1XJBA 2JJTA 4RW5A 2NZLA 3U0HA 2NSOA 3RX2A 5CP3A 3W01A 3INUH 5D70L 4XPFL 4FP1A 3REQA 4L0ZA 1R3HA 2CZFA 4YHOL 3LB6D 5AB2A 2WM1A 5TBOA 3KW3A 3D39A 3DX2A 2PP9A 1F3EA 1XH0A 2W38A 4P3WA 3CUZA 4NN7C 4HMEA 2O4QA 3VA6A 4K5LA 4P0DA 5C2BL 5T33L 3C8KA 5K4ZA 3CZFB 5C0AD 4U6VH 2QUNA 5AVZB 5EBLB 3QUMB 1GGBH 3OR7B 5AOJA 1LUCA 5ERWB 2ZZUT 3BVUA 1QU4A 1PPIA 1QI3A 3ZZQA 3BOFA 3PPFA 3CHSA 1ES0A 3RZCD 1USZA 3MRNB 1GCYA 2BGNE 4CCDA 2EE9A 2AHIA 1X7QA 2FR4B 5FW7A 3LKPA 4AYMC 3W1LA 4F79A 4X61A 5I03A 1I1FB 1UADC 2CRIA 4J23A 5BV7C 3DBXA 4IHCA 4BQ4A 4AZUA 3CHPA 2SEBA 2NQ3A 3NZRA 1M6OB 1FH2A 1YY9D 1DDHA 4M80A 4NAFA 5FEBA 5D1QB 4LYQA 4WFFD 4PUDA 4KPHL 2ALRA 3MRLA 3P77B 1G7HA 2IVFC 4QHNB 4GYJA 3NRQA 5HVGB 4PRHB 3U3HA 4NEHB 5L88L 1NGXA 3CIAA 3DV6A 3FQ1A 4M03A 1I1AC 3ZR6A 5H35A 1S9XA 2NUWA 5D6DC 1W54A 3RLGA 3URBA 3AQZA 2R1WB 3D4YA 4ZDHB 3EAUA 4PRIA 2HJPA 2NPLX 3PGDA 3ZTJG 3CCHA 4JGNA 2VCCA 5GIRB 5IRPA 2Z65C 3JSSA 2IV9A 2JELH 3FULA 3UXAA 5FOOA 4GAGL 1OGPA 4GYBA 2D2JA 3Q37A 1RZIA 4QXVA 4AG4L 5FYKH 4AV4A 4YWIA 4MTVA 3X1EA 4CJ0A 4B3ZA 1MRCH 3DIVA 1N10A 4PV9A 2GFTA 2VDRB 2H32A 3B0YA 1ML1A 1SY6H 1PF3A 3UAAA 3HBGA 4I13B 2X4RA 4ERSL 1OFQA 1T1YB 1Y5WA 4KJWD 4JFHE 4MNQA 4IMGA 3HFYA 1U5JA 2EG7A 4Y2DB 4CMMB 4HH8A 3EDEA 3R0NA 1MEXH 1NGWA 4JRYA 4J3SA 4X7EC 5CZJA 1TQWA 4S3BA 1CGTA 1F1GA 1I3UA 4QOKD 3S8FB 3TQ0A 3IDYC 3EYQD 4FNQA 3JUGA 3LVEA 3VACA 4WTZG 4AF0B 4KRLB 2X4PA 2XXMB 4HUVA 3UA3A 4D6GA 1Q7MA 3FO0L 3T9WA 1CGUA 2YX0A 2FD6H 3Q4DA 5TE7H 1AJ7H 2RA1A 3MRDA 3X1BA 5CFHA 5KYWA 2I16A 3EOLA 5EMUA 4UTTA 1MHCB 1I8AA 5CEXA 1NCOA 2BFGA 4JCMA 4EN3A 4JE4B 1OAXH 1ECEA 3FOKA 3BAXA 3PWAA 5E0KA 1LK2A 3CV5A 5CILL 4HHAB 5E23A 4G7EA 1TB3A 5D1ZI 1LG1A 4ZR8A 4KNSA 4Z1PA 5KAQG 4RDYA 1OX6A 4K5MA 4HPYH 1H50A 1ZVYA 3QUXD 2ARJA 2BS8A 2XNAA 5D1XA 3RWGA 2RJHA 1KJ2H 4G6ML 3A6BL 1W32A 2GZXA 3ID7A 1VGAA 2CKBL 4QCIA 4MJHA 5D4JA 1EO7A 1ADDA 3ZYJA 1D5ZB 4QF1A 1B31A 1RA0A 2AF2A 2GQ9A 5E93A 4IPIA 5F96H 2ZCKH 5F93C 3UJIL 3HEIB 4FJ6A 4QRUB 3ARBB 5MHSE 1G6CA 4JHOA 2RALA 5FUOH 2CNCA 4HLJA 2YZ8A 2H3NA 2BSDA 5E2VL 4PJBB 3MLVH 1I1WA 3IRZA 2D31A 2ZXQA 4YGAB 1YRRA 5I1KH 3UPRB 3RZCC 3GNNA 1YE4A 1PYWA 3GSMA 3IVSA 3SFWA 2P10A 3HZKB 2P53A 4ORGB 1YEEL 4UOZA 3SDDB 5DS2A 5L2KB 3LJ3A 4HZMA 2HFTA 2VDRH 5GSVB 1FO0B 4NNAA 5C09A 3I75A 3UXFA 2YRLA 4V2CB 5D03A 2XVPA 3H4XA 3DURB 3ME0B 4MZIA 2FIKA 3BAEH 5KSVB 1E90A 4GAJL 1FO0A 2O5NA 1B5TA 1D7KA 4U1GB 1GJPA 2EP6A 3CQPA 3H9HA 3KPMA 2JJWA 3PG8A 4NJ9H 1Q5MA 3OPUA 3F7KA 4U6XA 3P80A 4UXDA 4NLAA 3T0TA 1EGJL 3V9CA 2NV9A 2MOVA 3GSOB 1A5CA 3L4UA 1F3WA 3BZGA 3FA5A 3LRKA 3FLUA 1QX1A 4K94H 1WZLA 3AGWA 3VG0H 2WO3B 4U33A 3F1QA 1WFUA 3CZJA 2CFFA 3D0CA 3OJDA 4QHLB 3I7SA 3RXZA 2DEXX 2ZUVA 4ZUUB 4D6EA 4B5VA 4FQ2H 4GP8B 3G5WA 4BH7B 4W9ZA 1SJHA 2MEJB 5GHWL 1JYVA 1CLCA 1DVQA 3F4VA 4P2OD 4O9HL 1E9QA 4DH2A 2I9LA 4UV4L 1MVUA 4UC5A 4ZFOL 4Z77A 2P24A 2V5LA 5G1MA 3RG6A 4NRYB 4MZ8A 5FSDC 1FN4B 4KMTH 1ZLPA 4J3TA 1JVLA 4B60A 2BMKB 2R0ZH 3JV6B 3PDGA 3C8HA 1K72A 2Z1SA 3SFKA 5DJAA 3VIIA 3W28A 4RRPG 1OM3L 5I16B 1REIA 1HE7A 1W16A 1G43A 1I7ZA 5CSBA 4YNYB 4ZNCD 5C0DB 5KSVA 4HTBA 4AVNA 3QUML 4HJ1A 2IH1A 1OSZA 1WV2A 4QSHA 4DYEA 3HZYA 3PGFH 4F8QA 1XR9A 3RPBA 2FZ8A 3CBKB 2Q3RA 5AHNA 2HK1A 1FI8C 4JFZL 4EPSA 2XISA 3RZCA 3ME3A 2B2XL 3HTLX 5DT1H 3KPOA 2ABBA 2BP0A 5DUPL 3B8SA 3II2A 1NDTA 5DD1L 3ZTJH 3DIPA 3GRIA 3DARA 1QTSA 5BS0D 5I66B 1DQWA 2VSMB 1BCIA 5BW6A 4A39A 5IEKB 5DELA 3ZLHA 4AEEA 5DD3H 3Q6FA 2ZKHL 3OZOA 3NPUA 1NEPA 1UASA 3C08H 5E7FA 4PJ5D 2WTRB 1GL4B 2QKIC 3CUPA 3D4ZA 4H00A 4MZRA 3ISYA 1MJJB 4WTZA 1IAIM 2OZTA 1QNZL 1FFPA 5ABZA 1K8IB 2PWDA 3GHBL 1AI1H 3LZNA 4O58H 4KDTA 3WFDL 3WIFB 4NN7B 4R3SB 4WF7A 5AC8A 2Z34A 1AR1C 4IRSB 2VLJB 2R4SL 3UETA 5AY7A 4HHAA 1PO9A 3MKCA 3W86A 1BJ1H 4JDZB 1F4AA 5LNVA 4OV5A 3N04A 2ZYHA 3FTVA 1XO8A 3N41B 3VNZA 4ZFFB 3GTFA 5ILTL 3AQYA 2OGJA 3PUUA 4AVHA 4BFOA 4HJJH 4R4BB 4M5SA 4E42A 4OZFH 2NXGA 4N9BA 2IADA 1OPGL 1UATA 3NCCB 2DIBA 3PNWB 4H7VA 1H11A 3GZPA 2YDQA 3JQOB 3NQ2A 1PQZA 3U7WH 3OA3A 4LASL 3HPZA 1Z9AA 1XIMA 4FEZA 5I3GA 1AXSA 4ES8A 2BIOA 2DW7A 3SGEH 3MU3A 2CBVA 2J7EA 4R26L 5BO1L 1DBML 1LEIB 4P5TC 3QGKC 3O0LA 4KFPA 2A6DB 1HOEA 2DB8A 2ZNXA 4JRLA 1PCWA 1XH1A 1K9TA 5A2CA 3GPSA 1U22A 3VWKB 2DWDA 3SE3C 2CBOA 3UTTA 1MQKL 1YNLL 1QUMA 1TNNA 2HTKC 2XICA 4OKVA 4PV9B 5HHVH 1A5LC 5I5MA 5INCB 1JGDA 3DSNB 5FA3A 3M0IA 6PTDA 1A4CA 1EAOA 2OCJA 2VR4A 4JZJC 1XINA 1KIPA 2FLIA 4ZQCA 3W7IA 2J1ZA 5HQMA 1FWEC 5D2XA 2HLEB 3NO3A 3L3DB 2CU0A 4Q8WA 2CU9A 1GZJA 3QC5X 2J72A 5KZ6A 4XBGB 3DSFH 1TE1A 3CCHB 3W88A 3P8IA 5DLCA 1JD9A 3Q2LA 2B39A 4RGND 3KDPB 1NCCH 5K59F 5EEUA 3T8QA 3H56A 3EX3A 1SLWA 2BIMA 2WXOA 4Q8BA 1UR3M 1UD8A 2HNHA 4NO5B 2I7GA 2DM4A 4NB7A 4LH8A 4O19A 4BF5A 4PLNC 4HJ0D 2JEQA 5K1NA 3FDGA 5JQ6H 1B2WH 1D9KA 1B0WA 1KB3A 3OMZA 3QJFB 1PG7L 4F93B 3T81A 3NYKA 1QFUL 2P8LA 1FJ1A 4AJ0A 3HLKA 5LNWA 3DVFA 4OLYL 4AZGA 1KF9B 4IYKA 4HQQL 3DYOA 4XBPB 3IVKA 1NDGB 1ACXA 1XRTA 3NZHH 5JPMB 1R3WA 4XN8A 1T83C 1RU9H 8FABB 5I5IA 2PTZA 4NG3A 5CPSA 2YARA 3TLRA 3LKPB 4Y2OB 2P26A 4XP5L 2ZP9A 4WHTB 3R8QA 2ZBTA 5CGMA 3GUGA 4H7CA 4JNMA 4EOUA 4OCRH 3TVMB 5JR1L 1ETJA 3EB3A 4HV8A 4OZFB 3P74A 3TN0B 2E67A 3T07A 4U1NB 2Y5TA 3BP6B 3O41A 5G4EA 2BIQA 1BQLL 4HA3A 5BRPA 4JQ3A 4MDRA 2R83A 2XKUA 4M7LH 4RA0C 3SCMD 3CZFA 4CJ1A 3G8RA 4M4RB 2EABA 3N1GC 5E6IA 4IG2B 2GCYA 4B27A 3WG6A 4X9SA 1P1ZA 3B5TA 5DSCB 4R0LC 1AD4A 5HPCA 2QPUA 3S6CA 3OLEA 3DO4A 4YK4B 3BE1H 4OT7A 5FIPA 3N2CA 4BBWA 3BD4A 1PCXA 2VDLB 5GRXG 4P2RA 2HWZH 1NM9A 5GXBB 5ICZB 4D94A 1DBTA 4NY2A 2A2QT 4WTWA 2BIIA 2A3TA 2V7NB 5KN5A 3UZVB 5G1YA 4NZRH 3OTTA 1MFEH 4W93A 1VBRA 3LS5H 3CEUA 3QYQA 2ITDA 5HHOE 4LRNL 1KO0A 4WQOA 1NANI 4YHKH 2ZRWA 2A73B 4JQXC 3H22A 3MDUA 4DBEA 3T2OA 3ZDXE 2WBJC 2X1IA 3QJOA 2RCSL 5C0CB 2XINA 2KPNA 3LCFA 4B5XA 1JZ5A 3L67A 3H6AA 5H94A 1GA2A 4B50A 1QI4A 4OF0A 3NQDA 5B3JE 3CD4A 5C97A 5DGQA 2AQ1A 2QVIA 1NC4A 4F2EA 1N0LA 4JHVA 1ZCRA 3VOGA 3UG5A 2IGFL 2YBUA 2EUZA 4GISA 3VFCA 5AB1A 1KLGB 4RGNB 4GG9A 2FDMA 4PB4A 3RCMA 3B2XA 1Q94A 5MHSD 2VH5L 4JDTH 4UINH 3QIBA 5ICYA 2CLIA 3QFJA 4M1DH 2XYLA 2X12A 3CWOX 1OGAD 3PP4H 1XQ4A 1H0DA 3VXOA 3FT1A 1KGWA 5CCKH 5IIEB 1R0MA 1A1NB 3TYGL 1E2WA 3D85B 2WNGA 1J9TA 4H20L 1WIOA 4L23A 3TCLA 4JRWA 2NXHA 3LDVA 2G3IA 4GIRA 1V7NL 2R0LH 3VG0L 3MWCA 1EAPA 1A64A 1FCGA 3C9NA 2CIKB 2FO8A 4EAEA 4J4PC 1T89C 1QD0A 2VITB 1YY8B 3VWKD 2VM8A 3U2ZA 1ZGLP 4B9ZA 4Y8AA 1JV2B 2VRAA 2ZOOA 3MZNA 5AHMA 3FT4B 1HTIA 2I07A 4UV4H 4YYFA 5CAKA 4I9XA 3DX8B 3DRQB 5A8QA 4PJFE 1YDYA 3BXNB 1G0CA 1R6WA 4PRDA 1QATA 2Y69B 3ZJ6A 2CD0A 3O81A 3P3SA 4KTEH 1M9HA 1FHUA 3TYCA 2G3MA 4TYUA 4FZIA 4ZW6A 4U1SB 3V4PA 5ADPL 1LWRA 2VLKB 1MFDH 2BNRE 3GDKA 1VPXA 2E6AA 2OPJA 4OCLC 2PPDA 4HS3B 4RMVA 1DKWA 4HNCA 3MLXH 5HVWA 1FFPB 1NANH 4OSUH 4RA3A 2WZPA 3KGTA 3ESVF 3ZX1A 2ZC1A 1KGXA 5DK2A 2Y1AA 5TQ0L 2VQ1B 4J8QA 2YQ2A 4W5ZA 5AW3B 2BV9A 4KKBC 5GGSB 5BNXD 4ZFOB 1W9XA 1JIBA 2VLJD 1HAWA 3DGDA 3MKGA 1PZSA 2AL1A 2BOGX 4DN4L 2UWEB 3I2CL 4YBQD 1YJDL 4MD0A 3DFSA 1YNQA 1KRCC 5DVKA 3UTQA 2UUDK 4GBXA 2E9JA 3QNXB 4NI6A 1W72H 3EH5B 4X2UA 1KJ2B 2VFEA 3AIEA 4HEME 1ONQB 4V27A 4XX6A 2PP7A 4NQDE 3S98A 5KYUB 1BEXA 2BMBA 5GVJA 2GDUA 2HKHH 5AL0A 4LIQE 1JZ8A 4UFJA 4W9TA 4KCUA 1G7MB 4ZX4A 5F1UA 2ZZ1A 4LEOA 4X0VA 3VKBA 1A2YA 1J8HB 2DMHA 2UX7A 4H1LG 1POJA 2AZAA 1X5XA 3GIPA 3LV3A 3L3KB 5KEZA 2F8XC 2EEDA 1IWPA 2DT2A 1YEWA 3ENLA 3SQBA 1KM4A 1E9OA 2F58L 3W38A 2WQVA 1WO2A 3FYIB 1RHCA 1K8ZA 3KOFA 5K4XA 3U7WL 4QIUA 2AV7B 4KI5F 3THQA 4U49A 4AJYV 3WD5L 4JFDB 2J5LB 2K6WA 1EZSA 1EX0A 1ZV2A 5PCYA 1HZYA 1RJZB 4JPVH 4ABVA 3R5EA 3EX6A 4DJDD 2WSRA 5EOTB 3FQYA 4FNUA 4U3XA 2AXGA 3RWJB 1KBKA 3B9EA 5M2FX 3V6OE 3GYEA 4V33A 1KFCA 3LTPA 3S4TA 4HFWA 3URQA 4A7GF 3OX8B 1X8CA 3GI8H 4K3JL 1N5YL 3MMDA 3RIFK 4NZJA 1HHKA 1UJPA 4LU5L 3EOAB 4HK6A 3LIZL 2VUNA 4MLSA 3BJSA 1V08A 3KPTA 1Z66A 2COQA 3OQ8A 4LK4A 3V0AC 1NCCL 4UIOA 1XHGA 4R85A 1MRDH 2CJSA 1OARH 3WNLA 5KVGH 4GW5A 1DV7A 1SZNA 4NNXA 3DXIA 3G24A 3C60B 2HUHA 3CXOA 4GWEA 2XPYA 1UXWB 4WEMB 1GKPA 1NAKL 2GK2A 2IOIA 2X9WA 3BZEB 1QSFE 4HVBA 4BQ3A 1INDL 1DQVA 4L4OA 5K9CA 2XVNA 2VDPH 3CT2A 5CPMA 3MRQB 2I60H 3LRSA 1G7VA 1SSDA 4M3KB 4OD2B 2MCMA 2OT0A 1L6FA 2XPGB 3OG2A 5JW3H 1NC4B 2W0FB 4GSDH 1EUTA 4YDNA 1J0KA 2YEQA 4DUVA 4PYGA 3UJFA 3ULVD 4HQQH 3DK2A 3UIZA 4O5LH 12E8H 3RX7A 5F70A 4PJ5A 2IDTA 1RU9L 4L0YA 4MAZA 1NWSA 3QUXA 5LBSL 3TVMC 4F48A 1DSFL 4TQTA 4ICCX 4XP5H 2FSDA 3NFUA 3WSUA 3Q8EA 1QA9A 4OCRL 5JR1H 2RH9A 3CHRA 4LHQB 2EDMA 3BQUD 3SGZA 1K1DA 1MMFA 1KXHA 2DZTA 2PO6A 3PBWA 3QDMA 1Z0MA 1QSFB 4YSOA 1A4BA 2CDGA 5TE6L 5FR3A 1ZT1A 2AS5M 3F7JA 5FFOA 5B8CB 4JNXA 5ABGA 1A4JB 1FGVH 4ZTEA 3B2VL 5A2FA 3O8XD 4NJAH 4EPEC 2IJ0C 5U4NA 3JTTB 5J6HB 1IWAA 4UT6H 1DQDL 3ATYA 4Y5XB 2WMPA 1XDTT 1MFAH 5GRUL 1BAFH 5I2IA 3AYTA 1BX2A 1KT2A 4CCCA 1BRLB 2RDXA 2VW6A 2G5WA 1K8YA 2VDML 3QXDA 3PSWA 4GO9A 1LDPL 1TENA 3VI4A 1ZMYA 1SFSA 2CKNA 4MLRA 3O6LL 3TA9A 3W07A 7XIMA 2DVUA 3GK0A 2WWKO 3LNGA 3LKNB 4LCCC 4LSUH 4XVSH 1EEPA 1XF3B 2CR6A 1O5XA 1O5RA 3ZZLA 4AVFA 1VBGA 4MYAA 3O2DH 3MBXH 1OSPL 2BVQB 4K9EL 2Z0IA 2HPOA 1GW6A 1FIGH 1HFUA 2FEJA 3E6HB 4S1SL 1TPB1 2Z6JA 5DVMA 4GY7A 3FUKA 2ITDB 2YFOA 4X4KA 3DRTB 4QAIA 4C1NB 2OZ4H 1BHGA 3SDCC 1BJ1J 4FLHA 3VCCA 5GS1B 2P52A 2UV3A 3S5LG 4WTQA 3CLFH 2EVFA 5A40E 4OAWA 1BIIA 1FNEB 3FH7A 1UZDA 4WK9A 1LL1A 4LP5A 4YPGB 4P46C 2AKRB 3C8DA 3MBEC 4DN3L 1RJRA 2DU2A 3KOZA 3SQSA 5JBDA 4F92B 2Q3OA 2NNRA 2OL3L 3T3MF 4GYKA 3V4VH 4PCNA 3QJVB 1XXDC 4P2CG 1XAUA 1S78C 1XSJA 1UXWA 3DGBA 2NY3B 1W3NA 3UADA 1E5AA 4CCEA 4NUGH 2VDLL 3HG4A 3KM2A 4JREB 4LX4A 4HZ7A 2Z92A 4XXDB 1EGVA 1G9NL 4HQVA 3PQYE 5DFVD 5IFJA 2BZCA 3GC3A 4IJ3C 5D70H 5C7XL 5HPMA 4J2MA 4L8CA 1ASPA 2E7DA 1HHKB 5FI8A 1X6UA 1W31A 4AE1A 3CPGA 2KL6A 1I8IA 1LVEA 2DQGL 3TCTA 1H41A 4F0KA 5DF0A 3DHDA 4MCYB 1X5IA 2WXRA 4R7LA 4GS7B 2VDNH 1A5SA 5F3FA 3ISWA 2NY5L 3ZXWA 1T0MB 3S3SA 1UD4A 3NJIA 4C6QA 3A5VA 2OX5B 1H6TA 1UWFA 5T5FH 4KGJA 4DP2X 2J8OA 4N87A 1JNEA 1INQB 3NCWA 5A6JA 5E5RB 3W39B 4PBFA 1H8SA 2ED9A 2RR3A 4C6LA 4RSVA 1HDMA 1PY4A 4MDIA 5EO9A 1U30A 4FALA 2CK0L 1SQ2N 4UT6A 1MFUA 3M07A 2XN9B 4KJPD 3NK3A 4ZNEA 5BVJA 1T2JA 1RP9A 1YQVH 3H2WA 3ALPA 3DMMA 5F97E 1XLJA 1U8PB 5C0AB 4K71B 1FDYA 1SYTA 2NNAA 4OIAA 4X9FA 4WOQA 3WK2A 3PNWA 1HZHH 4N1CA 1RPKA 5KS9F 3P3BA 1RK0B 3NACL 1GZPB 2KZBA 3LN9A 4ONGH 4JY5H 3ZHNA 2PRMA 4I0KA 4FXGA 1OV8A 4E0CA 1C1EH 5B21A 3WIHH 3QLDA 2ICWJ 4FFWD 1GHRA 4FQCL 2ON3A 4QWWD 2HUEA 4L56A 2RIKA 5FYLH 3V4PL 1QYGH 7PAZA 1XTMA 3RY4A 1KJ2A 2WLIA 4JZ5A 4R27A 4WEBL 2AI0H 1VPQA 3KHDA 2O6EA 3QEUB 2XWEA 3SKMB 5C2GA 1QMLA 4YTUA 1BOGA 1FORL 4HOXA 1GVOA 1QNPA 3RWHA 3I02B 4N86A 4XR8C 3LN5B 4XZMX 3SCMA 1CNVA 4NQEB 1C8XA 4PJIF 1HIZA 2QW5A 1P4LB 4PAZA 1NBZA 3GR8A 3NIDE 4FF9A 1DQQA 3D25A 4ONFL 2IPUG 3EH1A 5GZOC 1F6PA 5BOEA 1FWFC 2YMTA 1QO5A 3FYPA 1ZOXA 3B05A 5J1AA 4P4KA 4L4VB 3ITYA 1TTCA 3MV7D 4IIDA 2VDOB 1BGAA 1CX9A 1J1XL 3DTDA 1CVRA 4P23C 1XUZA 2VLKA 4Z3EA 3O3UN 2X2UA 1R3RA 5J6GA 5E2TH 1HZKA 1KMGA 1PX3A 2ZD0A 3Q5YA 4X9BA 5TNVA 3X3GH 4HFUH 2A1WH 5SV3A 4CSTA 3BO9A 3MP4A 4KHXL 3PL6D 1YYLL 4M5TA 5EA0L 3PWVB 6PAZA 3TEZA 4G1EA 1GH7A 1YHPA 2MNWA 1O0VA 1WA2X 4FAMA 4Z1YA 2ZWSA 3ONBA 5DMIL 1X8FA 1FVDB 2BXVA 2XZCL 3F2LA 5BRZB 2DQTL 5IMMB 1KFGA 2VUKA 2CR0A 4NPKA 4J4PA 3RVUD 3L3GA 3UG3A 4ZUVA 4F7EA 3D47A 3SGGA 5L9FA 2NXYB 4BH7A 1EA9C 3QUYA 4PUBL 3GMOB 5IBUB 3VFGH 1D5BA 4HPYL 2WJEA 5GSRB 3RLHA 4MNMA 3ATDA 2BVUA 2QSQA 2X2JA 4IRZA 3ZK0A 4X63A 2DYRB 1Z1WA 5JXQA 2CKBH 1EZ2A 1MRDL 1A4KB 2YPLD 4JO5A 1DQML 1U3YA 2GGIA 1A5MC 1L9NA 2CCRA 1SM3L 5AENA 2X6VA 4XMXA 4MZ1A 5K3VA 5FUCE 3BGMB 1VF5C 1VSCA 2NY5C 4DP4X 4RBPK 3CHEA 2YIHA 2YMXH 2JCWA 3PDDA 4LCYB 2I60L 1ZPUA 2ZAIA 4DVRH 1E9IA 2NVCA 1XF4A 3W7DA 3I75B 4K2SA 4U6HB 5T1LD 2QGHA 3B0UX 2H2PC 3IMVA 2PC8A 3B0XA 1D7FA 3L6FA 3F7RA 1RR2A 4N2DA 4ZUWB 2WXJA 1RUKL 3BAWA 3TT3L 2X4UB 4QDMA 3NJLA 4Y8DC 1VP5A 3JV0A 2QXWA 3RF9A 3O6DA 4KXDA 4WQ6A 1V6VA 5D96B 3FOMB 1K4HA 1LQ0A 4ZUUA 1IIHA 1A21A 2BGQA 4GACA 3EGXA 2AJUH 1KCLA 5HYJE 3EIFA 5ISZB 1BVNT 3HR5B 5LKYA 5D8WA 4Z8FL 1CZ1A 4GKLA 3UCQA 4H8VA 3K1GA 5HSFA 3PHOB 4HZLA 1NGPL 2XQBL 5HGBB 3ZKND 1ZZMA 2X1SA 3UMTA 2H2SC 1HUVA 5DEGA 1OHZA 1BVWA 4OQ1A 1A2YB 2C9XA 2HFFB 5EWIL 1BMZA 3C5ZA 4NKDB 2GCYB 5JXAH 1CD8A 4HIHB 1S3TC 4D9RE 1UWGL 3JZUA 3SY0B 5D7LE 5AYZA 2Q2LA 4PTTB 3SDXF 5GSVA 3V0VB 3WO4B 5I8OL 4NSBA 2ESVD 1E67A 3QR2A 4PRAA 3W57A 5LBSA 2YBRA 4JM0A 3T8XB 2O55A 2LU3A 4BYHA 4O15A 1J5OL 3RU8L 4KK5C 2R69H 4H26B 5IOPA 4K9EH 3W9EB 1A50A 2Y5EA 1JF1A 3QFDA 4WUIA 4PM1A 5IQOA 3G0UA 2X4PB 3RX4A 5CBAB 2Z31D 3IARA 4GAYB 3TN5A 4JM2F 4X98A 4IJRA 2V0TA 2APVA 3RILA 3CH0A 1FJ1B 1Y6KR 4PW4A 4ONVA 5FECB 1KOAA 2BSTB 4FX8A 5BMWA 3KEDA 5FAAA 2RJMA 4M8UA 5EC1A 2ED7A 5DCDA 3LG3A 3WS3A 1X5JA 3RBGA 2VD9A 1FAKT 3VDGA 3ELAT 3NDOA 1T4KA 4YDJA 4NUGL 1GHSA 4OZIB 3MHZA 4XPBH 4OD1H 1GOFA 1LT8A 4TU1A 3ZMEA 4N6RA 4NO0A 2VIRB 2PDGA 5DD6A 2VM4A 4KX8A 3RIFF 4W8AA 1V3LA 5E6YA 3VTMA 1AMXA 2HJFA 4KAQH 4C6KA 3C5ZC 4U7KA 3IJ8A 1ICSA 1P5UB 3WLTA 1O4UA 2FJHB 4RMUA 3P30L 4Z7AA 3DSNA 1ET5A 1UB3A 1HEJC 3PANA 1THCA 1ZSXA 1UOVA 3PAZA 2I9EA 3FVDA 1PNCA 1WAPA 2O26U 1TRDA 2IAAC 2A6DA 5EO1A 5GJNA 4Z95H 1AQ0A 4M81A 4H8HA 3VFOA 5C0BD 3ZT7A 2OYKA 3HIZA 5ICYB 1J05B 3O4LA 2MQ3A 4FTDA 1NBCA 3HW7A 1M7JA 1ZRUA 1KN4L 3R12A 1SFDA 1FE8H 3V7AG 1E8XA 1KLUA 3B34A 4AUUA 4MDOA 1DBMH 2D7NA 4QGTA 3CC5B 4BV1A 2CJUL 2OQJB 1UB5A 3OD3A 4NRZB 4ZSOA 5DJXB 3SCTA 1OTTC 4M02A 1UKTA 4IGBD 5GS0D 2CERA 1QFPA 4OZGB 3AOFA 4Z7WF 4JPIB 3U57A 4YXLH 3SHSA 4AQAA 2EVIA 1GVYA 1WBJA 3HB3D 3MV9E 1FCVA 1ND0A 2OMAA 1L7IH 5BOPA 1XKJA 1NDMB 2DTSA 2ATMA 3QUMA 1LUCB 4E2BA 2VZSA 4PREB 1PIIA 4LT9A 1TQVA 1PTZA 1NDWA 1ETZA 1NMAH 4PVNA 1H8LA 4R8WL 4KXZI 4WIQA 4FCHA 3RNQB 1V0KA 2EC9T 5DDHA 2F53A 2PRLA 1NDVA 3VIPA 3AB0B 1BZQK 5HI4C 1KEGH 2WHKA 1ID2A 4L3CB 1U3HC 3WNJA 3GH4A 4G1NA 5HK4A 3QWNA 4WJEA 4AD0A 3N1PC 3BURA 2DOCA 5TQ2H 3HI1B 3BARA 2X1QA 5D1ZA 1IC7H 1ZSDB 3MP5A 5BXFA 5MERB 1R2SA 4HUXA 1AZRA 3RA7L 4J3OG 3CZSA 1H7WA 4IG2A 4JQ2A 3VOIA 1VEMA 4FNRA 3NIGB 4BKLA 2XGBA 2QT3A 3CVDA 4LF2A 4US5A 2GJLA 1W0VB 2L3BA 1K7XA 3KWWB 2NY1B 1A9VA 1W1ZA 3MI3A 4G5AA 4WCYL 2WBGA 2W88A 3BEWA 5F7BA 1UMYA 3LLFA 3M7OA 3BP6A 3O41B 3NTYA 2AJZB 4OB5H 3E38A 1ZDQA 2YBRB 3LH2L 5I8EA 2QYGA 4S1QH 3LCIA 4PMZA 4HV8B 5C2CA 4FFVD 1RZ7L 5BRBA 1SN5A 4X42A 1H7NA 5ANMA 2QEJA 3C8KB 3EA1A 1WAWA 5DHYA 2VZVA 3VIMA 3F7YA 3HPJA 3VMOA 3GO2A 4JUTA 5E1AB 1M3UA 3PZIA 2E27H 5LZLA 2AXGB 2MNUA 3RWJA 1MRQA 4RDVA 1RLWA 1UKSA 4I90A 4H0IA 2H26B 3IDMB 3H4FA 3QEQB 4JFQB 4H8UA 2FZBA 4X22A 2X05A 4XMLH 1CK0H 1RV8A 3FIGA 5IDZA 5IQ7H 1IIKA 1T4WA 2WOYA 4KQ3H 4KQ4L 4HKXB 1YXYA 5D5MB 3KW7A 4PS4H 1KGCD 3MJ6A 1OM0A 3NK4A 1P4CA 3IAQA 5E08H 5GJSH 2Z4GA 2CBQA 3O3DA 2WBKA 2B5IC 3KHOA 4YOKA 2X4UA 5TDNB 1J0HA 3WAJA 3GBML 1OF8A 3QIBD 1YEYA 3W84A 5E8OB 3BI9X 3GTTA 5C86A 1EJ6A 3SN0A 1BZ9B 4MAVA 3E3HA 4CILA 3BDXA 2O93L 3ZRSA 2AK1L 4F8PA 3LDBC 2UY5A 1UA6H 2VM3A 1DL3A 2YDSA 2MFNA 4ADUA 3GSXA 2EUXA 1X5ZA 4NM8H 5F8QC 4MMZB 2JK2A 2WB5A 2RCSH 3ROOB 1ZK9A 2JKRM 4LCQA 3NDZA 3MKKA 1WQVT 3W9DB 3QDME 3N25A 3QRFM 5DC2A 1A6UL 1QMUA 1C5BL 4CEUC 5D96C 4CNNA 3HUJF 4DXVA 4PN2A 5LXXA 3Q65A 1R3JB 1BGGA 2V5JA 3U9IA 4XZUB 1MJ7L 2E77A 2W9LA 3ITGA 4Y7MA 3ATEA 2AJUL 5E2UL 2JKNA 2Q7NA 1JHKL 3VI4F 3EJZD 4NQSA 1MRAA 1PKNA 1FLRH 4QCIB 4NUQA 2X0UA 4Z8FH 4G82A 2FEDC 2G8ZA 2E56A 2YW4A 1W1VA 3TYGH 1M7UA 1TJIH 1M7OA 4FNTA 2O92A 2ZZ3A 1CD1B 4H20H 1CBVL 3HLAB 2D9QB 1D7BA 5FK9A 1M1XB 1GKEA 3BQUA 4JM2B 2Z27A 3NSYA 4YTTA 1JPTL 1Q6GA 4GRLB 3SKJL 2IPTH 1HEHC 3D50A 2GUOA 3V4PB 1WKFA 3HMWL 3SQLA 5IFPA 4N2KA 2GY5A 3GDRA 2JI2A 4YFEA 4HB7A 4XNYL 2ACUA 4E9QA 2XX0A 1E4IA 2J21A 4NM4L 4EN3B 1F2JA 4IBVA 1MREH 1LDCA 1IBHA 1MHCA 2XG4B 3P7YA 4IXHA 3MOAL 4JTLA 1E0TA 1I9EA 1AZUA 4EACA 4KTEL 5TDPA 1CFQB 1U92A 1Z3RA 2ZJSH 3ARFB 2DMCA 3N15A 3TU9A 1ANUA 4NZ3A 2Z4QA 4MJJA 1SXBA 5C70A 5KS9E 4LS0A 2CIKA 1JPHA 1V3JA 3K4DA 2CXEA 1T21B 4EBQL 1IXNA 2BOFX 4UT9L 3GFZA 3MLXL 3M0JA 4P8VA 3UP8A 1T03H 2OB3A 3TTQA 1NGWB 3DDFA 2OJZL 3GFYA 4OLZH 4US6A 4F0LA 1BXUA 4E9LA 2INFA 3IPBA 3MC5A 5L6YH 3R4IA 3MW7A 1E6ZA 4ZMLA 5BXTA 4P3DA 4P05A 4TR9A 5LNEA 1BD0A 2PXYC 1ACZA 4GQQA 1KXQA 3P0YH 4V1XA 4J3OF 2HFGL 5DUML 5E9XA 2CGRL 3UO1H 3QBUA 3UZEC 3K8KA 4A2EA 4Z1CA 4A6YA 3BUYB 4FTVD 1Z3GL 5AAWA 3MV8E 4HMCA 5FO9A 1UQSB 4MA8H 3SDXB 1US0A 4PJIA 3RY5A 3DXAD 4AGOA 1OFBA 3AIBA 1QO3B 2EYTB 2A6NA 4HU0A 3AQUA 3VXUB 4JFSA 4W70A 2FGLA 3BO8A 3GLZA 5F2LA 5DYOA 4FI6A 4JN2B 5DA4A 2HVNA 2AJ3B 4PJXA 4R7DA 5E95B 1X1ZA 3TONA 4BD4A 5C7HA 3FBQA 1ENUA 1PTAA 3APTA 2IAND 2RH0A 4A7GA 3CB3A 3GX9A 2A6KB 3IXTA 2CO3A 1KYFA 3WF1A 4GKSA 4WK2B 4AENB 1SYVA 1T0OA 4RE0A 4BZYA 4JMNA 3SQMA 3SUSA 1SDDA 3DHUA 1XIGA 4ZQNA 1LL7A 5LIYX 3IKCB 1BF2A 5FO7A 1JFXA 4GG6E 1XLFA 3S6OA 1XL6A 4AVJA 3TEUA 1YEJL 3T6QC 2QJMA 1UZ8B 4AE0A 3AO0A 3VILA 1R46A 2BS9A 5IJVA 5LGXA 2V5KA 3WBDA 4M82A 4P5SA 2XC8A 4G71B 4F40A 4P2YA 2GUUA 4WSKA 3QUHA 3EYPA 2OK0H 4US5D 3H4WA 2FH6A 1E4KA 3UL4A 3VE0B 1FQ9C 3MUY1 5FFLA 4H9VA 5JIIA 4O02L 1WDSA 3AXLB 1M7DB 1NBVL 4ELKB 5IJDC 1JULA 2XWXA 5I30L 3OIHA 2J24A 1BQ5A 2YOCA 2F9BT 3F6JA 2ZOLB 5I6MA 3QAZC 3FU5A 5JOEA 1Q0EA 2B16A 2BW5A 3O45B 2CBTA 4EP8C 3F7LA 2J44A 4KKRA 2VLMD 3RIKA 4C58B 5DMGC 2ZVIA 5IHBA 2PF0A 1TKKA 1EDYA 2MOQA 2VSDA 32C2A 4MS6A 1CU4H 4OLUH 4WI5A 3S0PA 3TIDA 3AAZB 4ANXA 1XLKA 3EOSA 3FT9A 3VCLB 1E55A 5IJKA 1SOKA 5IF0A 1B3IA 2BP1A 1FDLL 3B8IA 4FOUA 2NYYC 4RGOL 3OZKA 4IHOA 5IGXL 3MRIB 2XH0A 3DI1A 4H01A 1NAL1 1KLFB 1T5XA 3QFGA 3QJTB 4QR6A 7ODCA 4AMWA 1ONWA 2GSGA 3UYOD 3CAQA 3NQ8A 3KEHA 8PAZA 3DGGA 3G5YB 1RCXB 3QARA 3NRPA 4UWMA 1IAIL 2NY1C 2ZF8A 4H44C 3PP3H 4HIPA 3CWGA 4PBVC 1P48A 1C5CH 1LCOA 3RVWC 1A3WA 3CBRA 2JJVA 2VDPL 4MXVF 3V1HA 4E9WA 3IUIA 2UXTA 3O0RL 3ITTA 5TAOA 4F9LA 2J88L 2HH0L 3EYSH 2CNZA 4I2XA 4YSUA 5EIIG 1E1FA 5EUKB 3U7AA 1TXKA 1HKWA 2EF9A 5HQEA 3TAKA 4U1LA 3DJTA 3VH8G 1MCJA 2VUOA 1QWGA 4PE8A 1UOKA 2UY2A 4KBPA 1P1XA 1WHPA 3QCUL 3TCXA 1A0CA 3CK5A 2WMPB 4EIVA 3LSOB 3OPZL 1FGNH 3MV7A 2FAUA 3GJFK 4APQD 3KVLA 4XC1L 4I85A 1G9MC 1YDPA 3UX9B 3OJGA 1YYCA 5ETUB 3TBVA 5C9KA 2VQUA 2GKIA 1RLCL 2OFJA 4PS3A 1GGIH 2K1MA 3KBJA 3ULVH 1DANT 2XWZA 2J6XA 5IMKB 4AHPA 4Y4HA 4XZHA 4P2QD 3L9EA 1CGVA 2B8OT 1KM5A 1KKRA 1QFWI 1JGLH 1N59A 3DX4A 4U6YB 3PSVA 1X96A 3C5QA 3QUGA 5KVMC 3TZVB 1MFAL 3W1AA 2WWMD 4JS7A 5HI4D 4N2EA 4MFHA 5E08L 2G3JA 3SYCA 2Q5BA 2P1YA 2YSSB 1AH4A 4L29A 1X5FA 3BAKA 2N3JA 4OZHE 4I48A 1SLXA 2QUVA 1W15A 3O6LH 4W9JC 5GZND 1GTFA 1QNQA 3EOOA 4GGBA 3CXDL 5FACA 2DQHL 2X2IA