2QPUA

Sugar tongs mutant s378p in complex with acarbose
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGPRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 'pair of sugar tongs' site on the non-catalytic domain C of barley alpha-amylase participates in substrate binding and activity
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type A isozyme
total genus 140
structure length 404
sequence length 404
chains with identical sequence B, C
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qpuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qpuA01
4UQCA 1E6RA 3WF2A 1WE5A 1CGWA 1HTYA 3GNRA 1TMQA 1L8NA 2D2OA 4F79A 3EBVA 1KXHA 1EA9C 4M29A 3A22A 4E8CA 4Z2HA 3MO4A 1JZ5A 2D24A 2CBVA 3CZKA 3OLGA 1ITCA 1HJWA 4X9YA 6CGTA 1J9YA 2CETA 4TX6A 1J0JA 1E71M 4AMWA 3EJTA 5CPQA 4A4AA 4BQ3A 2CNCA 3BVVA 3K8LA 1HX0A 2QHAA 2E9LA 4B15A 4AZ7A 2EPOA 5D4YA 3AHVA 3HU7A 1BYDA 2ZXAA 4PTWA 2ZX9A 1ZJBA 1ISVA 5IHSA 1JFHA 3T0AA 5CG0A 1JZ4A 1J0YA 3W81A 1I75A 1WKYA 3AMLA 1E6XM 1VJSA 3U5YA 2VVSA 1H41A 1ZB5A 1C92A 1UD6A 3AZRA 4Z2JA 1ZBCA 2OYMA 3LXBA 1XYZA 1EGZA 3DYMA 4ATWA 1EIBA 1X1NA 4TOQA 1GQJA 1ZJAA 4J3VA 3MSDA 2BVDA 5JBFA 2F8QA 1UH3A 1J0ZA 3A5VA 1W9UA 4PMOA 2QPSA 2J7FA 3LXCA 1BLIA 5F7UA 1G01A 1ZS2A 3WY1A 1JF5A 1Q6FA 3T08A 5ABHA 2WCGA 3VDBA 4AD4A 2GDVA 3CUIA 1R33A 2WMFA 1C90A 3EJUA 2BHUA 3AHZA 3TA9A 4BCEA 4H2CA 2X2HA 2PC8A 1V6XA 4D72A 5KZ6A 1C7SA 1DEDA 1NP0A 3T09A 1UOKA 2DIEA 3BMVA 1GJUA 1HJSA 1TE1A 3VGDA 1E43A 5E0FA 3MUAA 5EFFA 3WDRA 3WKZA 4WKAA 5GQBA 2YBTA 3VO0A 1JZ8A 3W28A 2J7DA 4JHOA 3AIEA 1CGXA 2J4GA 3RDKA 1BVNP 3DX1A 2JALA 2FHCA 4D6EA 1OGGA 5I2UA 4CD8A 1LF1A 4PTVA 2W92A 3QOMA 3GBEA 2UY2A 5I0DA 3NDYA 1ECEA 4PTXA 3WELA 2GSJA 3EMQA 2ZUWA 1FFQA 5CPTA 1MXGA 2GJXB 1GORA 2QV4A 4J3UA 4M8UA 5BYWA 4U2YA 4CVWA 3L4UA 3LPPA 5A2CA 1UUQA 3AIQA 2UY4A 1JNEA 4M56A 4A3YA 4TVDA 4MB3A 5D9PA 3LPGA 4V2XA 4U33A 2HVMA 5E6ZA 2ZX8A 3SUWA 5JIPA 4YHEA 4ML4A 4V27A 2J78A 4DM2A 3N04A 1QNOA 1ZBVA 4AIOA 4HOWA 1RH9A 3CUJA 1XH2A 5CSYA 3GDBA 1MVYA 3BLPX 2X05A 2WBKA 4PYSA 4GKLA 2EJ1A 4NRSA 5AYBA 1NM9A 4XX6A 1ISWA 1XRVA 2WPGA 1CGVA 2VCAA 2XN0A 1C8QA 1RPKA 4OUEA 4P8WA 4FNRA 5FKYA 5CXPA 4BQ4A 4PCSA 1HVXA 1OWQA 4OGZA 1GOMA 3AS1A 2WKGA 3WF3A 2VCBA 2JEPA 4AYSA 2D23A 3SCPA 5LYRA 5DEZA 1GJWA 2XSBA 5CGMA 3SCUA 4D6HA 1JDCA 2EPMX 3FW6A 2G4FA 3PZIA 1W9XA 1PS3A 3LMYA 5CZKA 1E0WA 2FGZA 3WUFA 1XD0A 3PHAA 1WAWA 3CIVA 1MW3A 1KXTA 1BPLB 5I3DA 3VIIA 1V3KA 3UEQA 2O9TA 1W3JA 4JFUA 5A8OA 1WDQA 1K9EA 4MJ4A 4D6JA 4JHZA 4ZEPA 4AWEA 1LWHA 3J7HA 2J7CA 3T0DA 3WNLA 3AMGA 4KMQA 3AHTA 2XM2A 3BMWA 1E5JA 3CGTA 2WMJA 1UWIA 1W2PA 3WUEA 2ZXBA 2QMKA 3E1F1 1GQLA 4GZEA 1JAKA 2YL8A 3AXIA 2DIJA 3MMUA 1JFXA 2GJPA 4GXPA 2VQUA 2WYSA 2ZX6A 1K9DA 3ZT7A 3L2LA 3NCOA 4URIA 3ZR5A 4JZ5A 4LQ1A 3EDFA 3KLKA 1LL4A 4JIEA 2ZXQA 3WIJA 3WDHA 2DQXA 1XCXA 3ZT6A 1NOWA 2ZUTA 3VGHA 2JIWA 3VDHA 1CENA 2J8FA 5CLWA 2X2YA 1H1NA 5M5DA 3BVWA 4AW7A 1B3YA 2VI0A 1V6YA 1Q6CA 3BLBA 4KGLA 4EK7A 1I1WA 4S3KA 2J7EA 4WIWA 3UG4A 2OYKA 4AEEA 2BY0A 1R46A 2F1BA 4UFLA 1E73M 4AXNA 1CWYA 1UA3A 1GOKA 1EDQA 3ZM8A 4EE9A 3WQVA 2CHOA 4UQAA 4AIEA 3PTKA 1J0IA 2OWWA 3A4WA 2D0FA 3ZJKA 2E4TA 2PBOA 3ALFA 3IAPA 3L4TA 2VZSA 4B3KA 3EDKA 2CKSA 4NZCA 1ISYA 3UR7A 3WD3A 1TUXA 3BAJA 2EPLX 2WMHA 3IGUA 4WKFA 3VIFA 2WVTA 4GZJA 1NP2A 3VIPA 4LXFA 3T2OA 2WZIA 5A6MA 4P7OA 4ATDA 1BG9A 3K46A 4LGXA 3LRMA 2FHFA 1KQYA 4M1RA 3VDCA 3MI6A 1V02A 2DSVA 4W7UA 3VGFA 1LJYA 1TZ7A 2CCRA 4HZ8A 4UFHA 4EANA 3WQ5A 3ZJ7A 3GXPA 5A6SA 3VIOA 4U3CA 1EDGA 3RCNA 2IGTA 5GNZA 3BSGA 1DHKA 2VT0A 1W3KA 3A4XA 4BQ2A 4UOQA 3W29A 3IK2A 3VU2A 2W66A 2IUZA 2WC7A 1CZ1A 1IV8A 1QBAA 3H53A 2WB5A 5D8ZA 1O6IA 3QR3A 3B9AA 5HDRA 3KWXA 4PMRA 3BUQA 5E1QA 1IT0A 2PF0A 4UFJA 3SCSA 1BF2A 2VOTA 1R86A 1UD2A 3UCQA 3VDAA 1HKKA 4X0VA 3SCNA 2CKRA 2VZVA 2J74A 3VD3A 3W38A 2F1AA 2WC3A 5I77A 2ZX7A 2JF6A 2O9PA 4GZIA 2WLZA 1CXKA 2X1IA 1E56A 3GXNA 1QI4A 3ARSA 3WQ6A 4JFWA 2XWDA 3BVUA 1AQHA 5E09A 4NXKA 4FNSA 4A3HA 4BQ5A 1CGYA 5BXTA 1NH6A 5AY7A 3DDFA 4Z2IA 3DX0A 2OLHA 2W4XA 2W62A 5E6YA 1V08A 3ARUA 3WMBA 4AD0A 1KQZA 2YKKA 1I1XA 1JZ2A 2J7BA 4P7LA 4CCDA 4GI8A 4U5IA 4DUXA 4XZWA 4AIUA 3M6DA 3EDJA 1EQPA 3GZAA 1IZKA 5D9MA 3EJRA 1TQVA 1E1EA 4MAZA 1V3IA 2CERA 1GHRA 2EPKX 1ISZA 4HA3A 3VD9A 4B9ZA 4WLCA 3H55A 3VD5A 1JAEA 4HZ6A 3MUZ1 2Y8VA 2YDSA 3VD4A 1KR0A 3A24A 1OD8A 5ABGA 3PZOA 4CCEA 1E6SM 3VSUA 3W25A 2FE0A 2F18A 2F7OA 1KR1A 1W1VA 4PUDA 3QGVA 1GOOA 4NF7A 2FGLA 3IAQA 2BFGA 1Q4NX 1LG2A 1HVQA 3MUIA 2WZEA 2F61A 1JZ7A 1ITXA 4GQQA 4UZUA 2W91A 2EBNA 3LX9A 3PZ9A 2CITA 1CEOA 4HMEA 1SYTA 2MANA 1LQ0A 3K4AA 3NUKA 4S3JA 1TQTA 1GVIA 3MMWA 3CUFA 4PSPA 1RP8A 1DWHM 1S46A 4QCEA 4M80A 1R87A 5BXPA 4XV0A 1H3GA 2WNWA 3D3AA 1AMYA 4WSJA 4AD2A 1KGWA 5A95A 3A23A 1A47A 2XHYA 8A3HA 2YLAA 2YDQA 4UCFA 3UR8A 1J10A 4MADA 2EAEA 5IHRA 5BRQA 5BWFA 3WY3A 2ZUVA 4UOJA 3SCQA 2DSKA 1B3XA 3G6MA 4BA0A 4AMXA 2E40A 3VM5A 3BAIA 1V0LA 1WDPA 3AZSA 2QF8A 2WHKA 1V0NA 3RIKA 3THCA 3UESA 1JI2A 3VNYA 1GUVA 1UR9A 4AYGA 3BAXA 1OIMA 3WFLA 4CD6A 4HA4A 1OGBA 4H8HA 3K1DA 2UY3A 1UR8A 2VRQA 3WL1A 4UOZA 3APGA 5HPCA 3M7SA 4AD3A 1PZ3A 1Q6DA 1HJQA 2WVUA 1K9FA 4TX8A 3AOFA 1MQQA 2B31A 3WNKA 1VFMA 5DFAA 3VVGA 1HXKA 2V5CA 3PTQA 5HBFA 2G3MA 3MS8A 5HNNA 4HPGA 2X2IA 1LLOA 3WMCA 3BVTA 4ACZB 7TAAA 3HZ3A 2WMKA 3A3HA 4DM1A 2WWCA 1UD3A 1FP8A 3WSUA 1CXHA 4JFTA 1E4NA 3OLDA 2V3FA 1MYRA 4WKHA 2BY1A 1E1FA 3VX0A 4ZFMA 2VNCA 3BAKA 5A8MA 2X0HA 2XVKA 3MV11 1P6WA 4W7VA 4ZE4A 2YIHA 2YJQA 1BAGA 1UQZA 4D1JA 1TA3A 2JEQA 3MKKA 4FLRA 1JDDA 1EHNA 4AC1X 3A4AA 2CEQA 1LL7A 2G41A 3N18A 1XSKA 4XZBA 3ZO9A 1H11A 3BUPA 2PWHA 5BRPA 2WANA 3O6AA 1W3LA 1W3HA 2V3DA 3W53A 2BXYA 1E9LA 3EJPA 5M03A 4GQRA 1CIUA 2GK1A 4RL3A 1G94A 3PZTA 4PRWA 3AJ7A 4MNMA 1JXKA 4GI9A 2VX4A 1E4IA 3UG3A 1VIWA 2Z1SA 2E3ZA 2VX7A 2VC9A 3VIMA 1PEZA 5JUVA 5JBDA 3NYDA 1KTBA 3WF1A 2F7QA 3VSVA 2OW7A 2X2JA 3CC1A 2BHZA 3AXHA 2D22A 3W37A 4J7RA 3AYSA 1B30A 4H8UA 3CLWA 4QLLA 3VSTA 1J0KA 4RE3A 1H4PA 1WCGA 3FNDA 1VFFA 3U7VA 4HZ7A 3HN3A 2PWEA 4R5EA 3SUTA 2XG9A 3RPMA 1TFVA 3WD1A 1EXPA 5FIPA 3OBAA 1QI2A 1E70M 3CMGA 1V3MA 3NSMA 3BCFA 1OSEA 2CESA 1V6VA 3AS0A 2BHYA 3WF4A 4CVUA 3VGBA 3KE0A 4D1IA 5A3HA 2NW0A 4DO5A 1PJ9A 3CHCA 4W84A 5BXSA 5KEZA 1US2A 4NRRA 3LXAA 3L4VA 4DWSB 1VEOA 2WVVB 3WENA 2OYLA 4IM4A 2WMIB 3GXFA 3W24A 3GBDA 3VMNA 2JF7A 3SCWA 3ARQA 4UQEA 4AEFA 3EJQA 1QBBA 1W9DM 3WDJA 1E55A 3A21A 2A3HA 1UKTA 1UH2A 1TQUA 1V6WA 2VO5A 3L4YA 2ZUSA 2DH2A 3AROA 3U5UA 5JIWA 1CXFA 5A2BA 4KRTA 5I79A 1XC6A 2CHNA 1SR0A 4IPNB 2WMGA 3VIGA 4DUVA 4CU6A 3WMSA 1GCYA 4FLQA 3GNOA 3TTYA 1E6PA 1UKSA 2ZOXA 1X6NA 3CMJA 3F5LA 4H8VA 3HG2A 2VL4A 3RILA 4TUFA 4PMVA 3VIKA 3TTSA 1E5NA 3SUVA 4CD4A 3THDA 1KBKA 1QHPA 5IDIA 2AAAA 3AIUA 1KXQA 3B9EA 3W27A 1H09A 3AISA 1FA2A 1O7AA 5ABFB 1F4HA 1M7XA 4L4PA 5FCZA 2WWDA 4GI6A 1CGUA 4X0NA 1D2KA 1E6ZA 4PEEA 1WZKA 1VB9A 3ZQ9A 3N15A 1W9BM 1W1YA 2YDRA 5LA0A 1QW8A 3DYPA 2XJ7A 4D6DA 4H04A 1UWRA 3OGSA 4PMQA 4QP0A 1QWNA 1NWSA 1WB0A 1CECA 1HKMA 1BGAA 3LPFA 1KXVA 2FDMA 5HPOA 2V3GA 4YHGA 2D0GA 2VRKA 1E6QM 3OZOA 3FAWA 3BSHA 2XFYA 3I3DA 1XH0A 3MANA 4CUCA 1GW1A 4JKLA 2D1ZA 1RP9A 3CHDA 2VZUA 1E6NA 4UR9A 1F4AA 3LPOA 2G3IA 1WPCA 1TA3B 3RJXA 1VAHA 2J77A 3AIRA 2DGAA 4PMZA 3SCVA 1TQSA 1C8YA 2YA0A 2XGIA 1GOWA 2A3BA 1R47A 4E8DA 4YN5A 1UD8A 1QI3A 2YL5A 3FXYA 1V0KA 4TXEA 1CXEA 2OWXA 3POCA 2DT1A 5FOOA 5BROA 2AMGA 5A8NA 3TTOA 2UY5A 1B9ZA 4JCMA 4UQBA 3DX4A 1UD4A 1GQIA 1OM0A 2J7GA 4V28A 3LRLA 4PMNA 1G5AA 3ZJ8A 1QI5A 4PBGA 1K9TA 2VJXA 5GNYA 2CYGA 4GO9A 1VEMA 1C3FA 4W5ZA 1XD1A 1XHGA 3F5KA 4MNKA 1MQPA 2BY3A 1QPKA 2BNJA 2G3JA 2ESCA 4C7FA 3MU7A 5ABFA 2WCSA 2DEPA 3GTNA 1QNSA 1MFUA 2EQDA 4P7RA 4PMYA 1M03A 3L4WA 4KWUA 1E72M 5EB8A 3L4ZA 1UWUA 1JGIA 2JFEX 1OD0A 1R8LA 5CJ5A 1CDGA 3QHNA 3WY2A 2XVGA 4E4PA 3WDPP 2A3EA 4FNTA 3AQUA 4Z2KA 1JI1A 5CGTA 3AMKA 2DT2A 3VX1A 2ZWZA 3MMDA 3WEZA 3SEPA 1CBGA 3CZEA 2YFNA 6A3HA 1UD5A 1W9VA 2QMJA 3B8SA 4FMVA 2FYVA 3IJ8A 4W93A 4Z2LA 2ZUNA 4GPNA 3F5JA 2PWFA 3WD4A 4OOZA 3AI0A 4HPHA 3I3EA 4IPLA 4NSBA 1KCKA 2WLYA 1DP0A 3WH5A 2XUCA 3WEMA 1B3ZA 1EOMA 1QHZA 1OT1A 1Y7VA 3RM9A 4H41A 2Y24A 4BZYA 2NT1A 3GH4A 4JFSA 1XSJA 4R27A 4WF7A 2X0YA 1E3XA 2WVSA 4HA1A 1FH8A 2OSYA 3CTTA 3HMCA 3WL0A 1AVAA 2CBUA 2O9OA 4UFIA 3S5YA 3EDEA 3DX3A 2J62A 3ARXA 1EO7A 2VZTA 5IFPA 3OLEA 1EQCA 1HL9A 1G0CA 3CHFA 1KB3A 3DX2A 2HISA 1M53A 1JG9A 4ACYA 3BH4A 4OOUA 5EFDA 1LWJA 2D3NA 4LX4A 3SUUA 5IXEA 3QHMA 5EBAA 1JYWA 1BTCA 4LYPA 3TONA 4CN1A 1UHVA 2JE8A 4UQDA 3WEOA 5CLTA 1US3A 3W26A 3CZGA 3EMCA 3WDIA 3KL3A 2A3CA 3QHOA 2WZHA 4MNLA 5FL0A 1FHDA 2YA2A 3GXTA 4W8LA 2WHLA 5D9NA 3GH7A 1UA7A 1CLXA 1GPFA 3UETA 1E3ZA 1UR4A 3BXWA 1JIBA 1GOQA 4JL2A 4GIAA 1TCMA 3ZOAA 4DO6A 1V03A 5HXMA 5JBEA 4P8XA 2WHMA 1V3LA 1WZMA 1WP6A 3TOPA 3W82A 4F9JA 1KFWA 1XV8A 3WFZA 1KWGA 1DWAM 2WAGA 2D73A 2NT0A 3N1AA 3HG4A 1VJZA 2ZICA 1G1YA 4Y7EA 3GXIA 4ZXLA 4U2ZA 2EACA 2QPUA 3AICA 4JKKA 3G6LA 3WUBA 2YOCA 3CO4A 1KGUA 2BV9A 3ZT5A 2WM0A 3RO8A 2GK1B 4W85A 1TQWA 1HP5A 3SCRA 4NI3A 3ZIZA 1B31A 1D7FA 1K6AA 2DDXA 3AIBA 2E8ZA 4AZBA 1NWRA 3WH8A 3WH9A 1TG7A 4HMDA 3BUIA 2Y2WA 3LRKA 3RMEA 3HG3A 4D6CA 1NARA 4AZCA 1KBBA 5E70A 2BS9A 4TTUA 3EYPA 5DMYA 3D5HA 4DWSD 1V02E 4AY1A 5A8QA 4J3XA 3WBAA 2XYLA 4PMXA 3ECQA 1UQYA 1MW0A 2WSPA 5A94A 1GZJA 1PX3A 1J0HA 3WN6A 2CBIA 1CNVA 1RD6A 2F2HA 3BAYA 2ZE0A 4H7VA 2D0HA 4N42A 3U7BA 3MV01 1U30A 1FOBA 1BYBA 3AHXA 3RJYA 3WBEA 2E8YA 3U57A 2CBJA 1D3CA 1PX8A 1VFOA 3PZGA 1MW2A 2OW6A 3ARRA 1BVZA 2OSXA 2O92A 2XIIA 1GHSA 1MWOA 3MSGA 2YFOA 4CN4A 5ABEA 1HL8A 4HU8A 1J18A 1DWIM 2CXGA 5FD0A 1ZBKA 2W5FA 3CZ8A 3ARPA 3II1A 2WMIA 1GVYA 1WDRA 1B3VA 3DDGA 1B1YA 1Q6GA 3S6TA 1XYFA 3WY4A 2CIPA 2XN1A 2EXOA 2J79A 4Z2GA 2FH8A 2VX6A 4PSRA 5DF0A 5I78A 4BS0A 3FAXA 1ZBWA 4RE2A 1EH9A 1MW1A 5BCAA 3TV8A 1GNXA 4MTVA 1WZAA 5D8WA 3GXDA 3PBGA 1DWGM 1UYQA 2YLLA 5DT7A 3FN9A 1LL6A 2TAAA 3VNZA 4GO8A 2PBGA 1DTUA 1SFSA 1M01A 3EDDA 3B9DA 1G9HA 3D4ZA 4AZGA 1HNYA 4OBRA 4W7WA 4AD1A 4QFUA 4AZIA 3GXMA 1J12A 1JYXA 4W8BA 1QHOA 1X6LA 2ZIDA 1M04A 1MFVA 3A6OA 3W6MA 8CGTA 1UKOA 4PTMA 3ARVA 2W67A 4UQ9A 5AYIA 3N13A 1HJUA 3VPLA 1NWUA 1VRXA 3W4RA 5LA2A 1H0GA 4B16A 4YPJA 3T0BA 2A3AA 4GINA 2IXUA 1UR1A 3WDQA 4IISA 2VR5A 1E0VA 2FHBA 3CZNA 2E9MA 1PAMA 2XN2A 3JUGA 2XVNA 1E4MM 1J11A 3HJEA 4B3LA 1QVBA 3IJ7A 4Q7NA 1ISXA 1H5VA 2V38A 1VF8A 2D20A 3DYOA 1E0XA 1W32A 2J8GA 5HOSA 2D3LA 5ECUA 4W89A 3VOCA 2EABA 1FFRA 3K4DA 3BCDA 5A6KA 3VUPA 4TTGA 4J28A 1PBGA 4L4OA 1CGTA 4QAWA 1UKQA 2Y5EA 1QW9A 2OWCA 4JCLA 3NIYA 2VZOA 3EJSA 2VURA 3SCTA 1ODZA 3PZQA 3BC9A 4M24A 1UR0A 5AC4A 3CZSA 3NSXA 1HF6A 3ARWA 2J25A 1J01A 5DT5A 2ZUUA 1XSIA 2XFRA 1BFNA 3SCOA 1UASA 5IFTA 1W2VA 4FK9A 1ZU8A 3ZJ6A 3OZPA 4LPCA 1HWWA 2JIEA 3DHUA 1KGXA 4ATLA 3SIMA 1XCWA 2DT0A 1HJVA 1WO2A 4OJYA 5M17A 2C0HA 1CLVA 2YA1A 4J3WA 2YL9A 3TP4A 3CH9A 3F4VA 3WD2A 2GUYA 1OCQA 3OLIA 4HOXA 5TD4A 1DWFM 2VVNA 1KTCA 1R34A 4QLJA 2QLYA 2Q8XA 1UWTA 5A6JA 4W5UA 1PZ2A 4NX0A 2VR4A 4WSKA 1C8XA 3RM4A 5E9AA 2V3EA 2WSKA 2C8NA 3WUGA 1DWJM 4D6GA 3S5ZA 1U33A 1B90A 4D6FA 1WNOA 3D51A 3POHA 4DO4A 1VEPA 3BLKA 4NZJA 3VMPA 4M81A 4HMCA 2W61A 3OG2A 4J3TA 3UERA 5A6AA 3D50A 1NQ6A 1UWSA 3AS3A 1MQRA 1OGSA 3AXXA 1V3HA 4U31A 1A3HA 4E2OA 3KEHA 1H49A 3DC0A 1HP4A 3GNPA 4QDMA 1QI0A 3DHPA 3WQ4A 3OB8A 1CYGA 5A1AA 3BVXA 3NSNA 4B9YA 1QNRA 3ARTA 4W8AA 3T2PA 4D6IA 4JAWA 4P8VA 4AZ6A 2PB1A 4ZENA 4FNPA 1JD9A 3OGVA 4FLSA 9CGTA 2J47A 3AIVA 1E4LA 3W6LA 1SMAA 2X8RA 5GPRA 3VIHA 2G3NA 1FP9A 1JD7A 1JF6A 4HU0A 4IUGA 5CQ1A 1ESWA 3KL5A 2DT3A 2XVLA 3AHYA 4P7QA 1R85A 1IZJA 4Q22A 3VILA 5FL1A 1VENA 3NDZA 3AYRA 1Z32X 4UFMA 1UR2A 2UWFA 3AS2A 1ODUA 3OGRA 4KH2A 1EHAA 4J3SA 4C7GA 2XSAA 3PN8A 3FHAA 2J7HA 1NWTA 1CPUA 4MPKA 3BUDA 3M46A 2Y4SA 1PIFA 3QOKA 2WK2A 1QNPA 3RM8A 4UNIA 3CUHA 2DSWA 2RGMA 3ARYA 3GH5A 2NSXA 3NJ3A 2YL6A 4P7NA 2CPUA 2OSWA 4K68A 5A6BD 3T2QA 4LYRA 1FH9A 4F66A 1OT2A 2V5DA 3PZMA 2W63A 1R7OA 2BVTA 1B2YA 2DSUA 1HKJA 1CTNA 4U5KA 1JL8A 4DUWA 1R75A 1HXJA 3O9NA 4JFVA 1B0IA 3D52A 1SZNA 3ARZA 3GYCA 1YQ2A 1PX4A 4AZHA 2BVYA 3L2MA 1UG6A 2ZUMA 5I23A 2XPKA 4CD5A 4MNJA 4M82A 3N9KA 4XB3A 4JKMA 1VFUA 1OINA 2VUYA 3M07A 4W87A 4FLOA 3PZNA 3ZSSA 3VGGA 3WNNA 1KWKA 5E0CA 4F8XA 1XH1A 2WC4A 5D9OA 4OIFA 3AIWA 1CXLA 1L0PA 2DH3A 1GONA 4QCFA 4MB5A 2RGLA 4W88A 2F7RA 5EMYA 4MJ2A 2WVVA 1UZ4A 1O7DC 1HN1A 2EO7A 4MB4A 3VD7A 2EADA 5C8BB 2YBUA 4AMCA 1C7TA 1UWQA 4EAMA 4KGJA 3UG5A 4FF5A 3N12A 3I3BA 1QX1A 3TTQA 3ALGA 1QNQA 1UH4A 3KL0A 1GOIA 4HP5A 4N0RA 2WXDM 4PCTA 2Y8KA 1EO5A 3KLLA 5DO8A 2XIBA 1W91A 2VCCA 3DECA 5A2AA 1PPIA 3VIJA 5A69A 1JYNA 2GJRA 5CPSA 1R7AA 1BSIA 4W86A 4MAVA 2VTFA 3BGAA 2EPNA 1UZ1A 5C71A 4AZ5A 3VTRA 1WDSA 3MUY1 4MB1A 5GNXA 1EOKA 3AZTA 1TVPA 4ACZA 1FHLA 4U3AA 3W0KA 1ZL1A 1E15A 3WQWA 4PMDA 3CPUA 1BQCA 4F9DA 2DSZA 1W9PA 2PWGA 1Q6EA 1TVNA 4ZE5A 4AD5A 3A47A 4UTFA 3VINA 3N11A 5A6BA 4RE4A 1JZ3A 2IXVA 4OBSA 4TVCA 4CD7A 1AQMA 3PZUA 3BUBA 2XGBA 3PTMA 1NOUA 1CXIA 3VMOA 2AOSA 2F7PA 1JNDA 1AQ0A 3K8MA 3ZSTA 1SMDA 3PZVA 5I5RA 7A3HA 1C93A 3BAWA 4CN6A 3VM7A 1OBAA 3ZMRA 4UFKA 2ZWYA 3CBWA 5M3WA 4MDOA 5I24A 2VQTA 1LG1A 7CGTA 3VKKA 2WKLA 4P8UA 3WNPA 1VBRA 5C70A 4OZOA 4FNUA 1JXJA 2VRJA 3FHQA 3VGEA 2XVPA 3WNMA 4WJXA 5I6SA 2EEXA 3CHEA 1BGGA 3OIHA 2WCAA 1BYCA 4FNQA 3K8KA 1UKPA 1HKIA 4PMUA 1NOFA 1QWUA 4D71A 5LA1A 1KCLA 4J27A 1HJXA 3AMCA 3IJ9A 2WBGA 3CZJA 5AC5A 3IANA 1OIFA 4BF7A 4PN2A 4KRUA 3L4XA 1H2JA 4C7DA 4TVUA 4AISA 2XWEA 3OA5A 3D4YA 1U2YA 1V6UA 4DWSC 3EMZA 4JL1A 5CSUA 2XTKA 1N82A 2VX5A 1MXDA 2WW5A 4MDPA 1W1TA 2GJXA 3WH6A 1C91A 2Z1KA 3AMDA 2ALWA 4CGTA 2E0PA 4QLKA 3WF0A 1V3JA 1V0MA 1XGZA 2XFFA 3GM8A 4HOZA 1HIZA 3SUSA 2GVYA 3H54A 2X09A 1HT6A 1EDTA 2C7FA 4NZFA 2BXZA 2ZX5A 4DWSA 1YHTA 5BXRA 3AFBA 3WD0A 3WNOA 2G8ZA 3ZR6A 3S2CA 1PIGA 2XM1A 1FH7A 3HG5A 3SURA 3CZLA 4PUEA 4LYQA 4ZXOA 6TAAA 1BHGA 1JDAA 2FH6A 2PI6A 4UZSA 4NXSA 1GQKA 4EKJA 1TR1A 2BY2A 2DPEA 4CCCA 4CU7A 1OB0A 2PWDA 3O2LA 3N17A 4CU8A 2J75A 4WK9A 2GFTA 2GDUA 1T0OA 3WQ8A 1B3WA 3CV5A 5A8PA 4OKDA 1QOXA 1VBUA 4HTYA 4AZCB 4XUYA 1JYVA 1BYAA 4CKQA 2O9RA 1JZ6A 3KZSA 2WHJA 1H0IA 1WZLA 1E40A 3FY1A 2E9BA 2ZXDA 1W1PA 5A6LA 1BG4A 3CUGA 3WH7A 2VMFA
chains in the Genus database with same CATH superfamily
1IAIL 1S5NA 4P5KA 1XBVA 1E6RA 1UT2A 5EPDA 2HT2C 4HWUA 1N0XL 2NWRA 5E8PB 3HC2A 1H0DA 1WE5A 1L8PA 4ICCX 1Z5HA 4HIJB 3L5AA 4GCAA 1L8NA 3UR5A 4ZSOE 3M9YA 2D2OA 3SDYL 2NWSA 1MFCH 2YD4A 2DKUA 3ME0B 1B3JA 4IRJC 5HY9A 3ULVC 5I15H 1ZENA 1NGXB 5KZEA 5EC1A 2HJKB 2V6AA 3NZ8A 1UJ3B 2UZPA 1AJ0A 3L3IA 5GJTH 5MENA 1R3SA 4ZDHB 3GZOA 4AYMC 2BFVH 1SJBA 3GMOB 5EMJA 3VA2C 3WBXA 3F7QA 5JHLA 2PW1A 3MO4A 3SSGA 3W71A 3LKNA 2Z0BA 2W9MA 2NTFA 4X5XB 3C56A 3W7PA 1F3RB 4H0GA 1ITCA 4HXAH 3C09B 5FLVA 4IOFD 2IMNA 3V0IA 2V5RA 4XH2B 5DT1H 2V82A 3OIXA 1V8HA 1ADQA 1B4RA 3NSCA 5G5IA 8TIMA 1IKOP 1XKJA 4L1DA 3CVHH 2CETA 3TF4A 4EN3C 3NA8A 1HCFX 2EECA 2OMZB 1J0JA 1SOSA 4JFHE 1MRCH 5D4HA 1KFCA 3LSOA 1YEGH 5ICUA 5L6YH 4AMWA 3EJTA 5IR1A 2Y5JA 3G2GA 4S3FA 5F7KC 4G56A 4LBRA 4B5UA 4A4AA 3U0HA 1I1AB 2E9LA 3WLWC 5D4YA 4HN8A 1AR2A 2H32A 1UG9A 4YXLL 3NA9H 1J5SA 1MFDH 4JO2H 1BYDA 1ZQ5A 3AHVA 3HU7A 3FU6A 5GS1A 2ZX9A 2EUVA 4HJEA 2IS7A 4NL1A 5KYXA 1EBGA 1HXYB 1T99A 3GVRA 2WP3T 3KW8A 3PWPA 1S2TA 4PRTA 5IHSA 1U8MA 1UM4H 5FJRA 3O3BB 2PTZA 2D7PA 1QATA 4JFZH 4EE2A 3LZLA 1DBJL 1MVFA 3BV7A 3ISRA 4IBYA 4Q7BA 3KCPB 2FFCA 2VVSA 3BV4A 3S9DB 5AYTA 5HGHB 1DJYA 2GYSA 4J5NA 1FI8C 3NA4A 2QJGA 2OYMA 2CJTA 5KVEE 3BURA 3NG5A 3VG9B 3C60C 3LKQB 4IDJL 5IEKA 4F0MA 1EIBA 2CLVB 5I0YA 2WBJC 1XICA 1UYWH 2DEWX 3KVDD 3NIFF 4A6YB 1X1NA 4IHCA 1ZJAA 3L9YA 1JTTA 4YTQA 2WBJD 3RO6A 4XX1E 2O7QA 3FSTA 4F7PA 1B0RB 3MSDA 2VEPA 4WR3A 4AG4H 1JR1A 1MJJB 3NRFA 2IQAB 5FHBH 1IR2A 1J0ZA 4KDWA 4IKJA 5D1XD 1W9UA 4C6KA 2VC2L 4B90A 1CB4A 2QPSA 5KS9E 4ELMB 4CC4A 1R5VA 3QLDA 3WY1A 3PGFH 1I1FA 3V18A 3EO0B 1WH0A 1JF5A 1Q6FA 3GFXA 3HQ1A 5ABHA 2MQ0A 1NAMB 1A50A 2CMRH 1PDYA 3VE0B 3FU8A 3OR7A 4KEMA 1XGTB 4AIZB 5K1NA 4AD4A 2FVMA 3SW6A 3S3SA 3H4XA 3RNKB 4HYVA 2WMFA 1C90A 3EJUA 2OO0A 3KLHC 2OTDA 3TA9A 1DDTA 4IOSD 2X3AA 4ZQPA 3CPLB 4JR5A 5JW5A 4MDJA 4LKXB 1WEJH 1OGAB 3IT8D 5J0BA 1PTAA 4XNBA 2PC8A 2PR4L 5GHWH 3QV9A 4JRLA 1CU4H 4NZ8A 4HSHA 4AF0A 2HXUA 2NXYC 2R1WA 4HDIA 1DVFC 5BUGA 3R8GA 1C7SA 1DEDA 2Y5TA 3HC0A 3JYBA 1CQYA 4FQ1L 4YSEA 1H7WA 3LH2H 2X0SA 1ZT7B 3VIGA 3M5YA 2DIEA 3IBOA 1GJUA 1MH5A 1P7KB 2PETA 4PRIA 1NC4B 5E0FA 2J9ZA 5LUMA 2CHXA 2BFVL 3L1OL 4P4RA 2QF7A 4WUUE 1LGVA 5HDBF 3BQ6A 2B14A 1PB0A 3V5CA 1LUCA 5I1IL 3WKZA 1LEGA 3FCSB 4OD2A 1G7JA 2FBJH 5GQBA 1VFSA 4LPXA 2UZYB 1VGKA 2J7DA 3SDYH 2YOAA 2VEFA 4Z7WE 3JUZA 3AIEA 5EA9A 4P48A 2QPXA 4GQ9H 4PD4K 2X6BA 1WQ5A 4XXCA 4LF2A 3RDKA 1BVNP 3DOHA 1N0XH 1RK7A 1U8NA 3P3YA 4K07A 1AZZC 3FO9B 1AKJA 4RA3A 1JGLL 2MEJB 1RUML 3FSWA 4JN1L 3GHSA 4AY0A 1M3IA 5F7EL 2FGWL 1CDJA 3SGDI 5HSFA 4K8GA 1U8PA 4FDWA 3HNVL 4PYHA 4ZNEA 2XH7A 1EZSA 3TS8A 5BOZG 2UY2A 1NIEA 3QOMA 4NNXB 1ECEA 2VN3A 2GSJA 1D5RA 5DBTA 2WAQA 3PC0A 4MUPA 4IOSA 3OXRA 1CR9L 2XQBL 5FESA 1IKNC 3DV4B 1SJXA 3N1MC 3TL5A 5CD5D 3QYMA 1U8HA 1KF9B 1WWBX 2I9TB 1GJIA 3P0VL 1FWIC 4LUIA 1KRAC 2RR3A 3AU2A 5A6IA 1T3FB 4M8UA 1QEWA 2BH0A 1HHGA 1B6UA 1FCQA 4ZMLA 3X3GH 2PDMA 2P24A 4P2VA 3RJQB 1CE1L 5E6RB 2R8WA 1WBXB 3L4UA 5LGJA 3IIPA 1F7BA 2F74B 3D2UD 3UTOA 3P5YA 4GRSA 5FYKL 2MCPH 5BRZA 2QQNH 5F7DB 2QZRA 4PS8A 2TRSA 2JKIS 4JPKH 1DSFH 2ZADA 2XG4B 5CNHA 4BSVB 1V05A 3LPGA 4GQBA 4L29A 5DZOA 3VXME 2HT3D 2VM9A 3L21A 4NAEB 2NY3C 4M1GH 1NSJA 4BYHA 4PP1C 7FABL 2WJ5A 2NNRA 3WFDH 4S0HA 4RMSA 1EYWA 3KVLA 5DD3H 4QJ1A 4ADUA 3RQ3A 5IOKA 1TWZA 1IGFH 3NEXA 3LYRA 1QWHA 4BHYA 5EN2B 3N04A 2DM4A 1QNOA 1ZBVA 4BQ6A 4HOWA 1MHHA 4E42B 3SPJA 4FQCH 5DLCA 3W3BA 1XH2A 1ULVA 2XNAB 2WLLB 3HAEG 3H9SB 1MVYA 1V54B 2AQWA 3BLPX 4XNMB 3V0GA 2AJYH 3GIQA 3SKOA 2NLYA 3CFJA 5B3NA 4X63A 3QCVL 3D6NA 4PYSA 5M95B 4NO2A 1Y8BA 2CW6A 1XYBA 5E9NA 4CILA 2AKZA 2R4SH 4Z78B 2ZE3A 4R7OA 4M43L 1ISWA 4GUIA 4J1UA 3MTXA 2AV7A 1G6RH 3C5ZA 2QYGA 1KENL 3NOIA 1OC5A 1MF2H 4DGVH 5HYJB 4NASA 1XKYA 2P5WA 2VGFA 1R3JB 1TMLA 1K7EA 5LHFA 2ZTJA 3VE7A 4XMPH 1QBLL 5IEHB 4P3DA 1Y6NR 4G71B 4OD3H 2Y06H 1BPVA 1HVXA 2O5YH 4UTWA 3AS1A 4X6FA 3ICJA 5CZ0A 1BJ1H 3WF3A 3G1FA 2JEPA 2W07A 2D23A 3SCPA 1AMKA 3BOXA 3VI3B 4H2AA 3D3FA 4KUZH 1L0QA 2C1PB 1EGJL 3FQ2A 4BEUA 2C19A 1MIEH 1Q7QA 4UZGA 1NELA 1NDZA 2VISB 3APCA 2OMAA 5AENA 1U8CA 1YNLH 1XD0A 1WAAF 1BIIA 2AHIA 3IN0A 1WAWA 4Y8FA 2ALDA 1T2XA 3CIVA 1SVZA 5G55A 4FXKB 1MW3A 1TV2A 1BPLB 4MFDA 5E1GA 4NPKA 4MD5A 1ENUA 4MQXC 3G5WA 3ZDXB 3SY0B 4ANKA 2PRHA 2HWZL 3K80A 4QLRA 1W3JA 2IAMA 4Z3EA 2F0CA 3IWPA 3LBMA 3IMRA 4GMTH 4TSAL 5A2KH 4UYPA 4FN0A 4P57B 1KJVA 4JHZA 1QOPA 3QM3A 1GKRA 3LZ5A 1LWHA 3J7HA 3HZVA 4AWEA 1DSWA 4XZNX 1XDJA 3RHGA 4GWEA 3UWZA 2J7CA 3VXGA 5TF0A 3CX2A 3ULAB 4F37F 4FYRA 4UILH 4LPVA 4K1GA 2BBFA 3T0DA 4K7PY 1LO0L 3PXLA 3TZVA 4K3JH 1MAMH 1P4LB 4PWHA 5F72S 4B0MB 3TK7A 3TYZA 2QGYA 5C2XA 3BMWA 1E5JA 1YAZA 3CGTA 2WMJA 3BD3A 1W2PA 1UWFA 1NMAL 4NHCH 2Z1PA 1TKWB 2BWIA 2DQCH 4X4ZA 3URBA 3VFPB 1R3HA 2HN7B 3HUJF 5GRJL 1K6QH 5C0CD 5I28A 5DJYA 5CD3A 2H8ZA 3OEXA 1HOCB 3E1F1 1M9SA 2A6JA 3OPZL 5EBLA 5EIQA 4OUIA 3HC3L 1PJWA 3FZUD 3CQHA 2YL8A 3CFBA 1XZWA 4ABUA 2CIIB 5JPNA 2WJZA 2ENPA 1XX9C 3KRBA 1F0LA 2GJPA 3QYQA 4AVFA 2VKXA 2VM3A 4JKPH 2ZX6A 3G04B 1MCBA 2ZC8A 1FG9C 4BKNA 4OIIH 1CQKA 2X4PA 1K4CB 3OJDA 3P11H 3O8XA 1K9DA 3X14B 2HCVA 1FWFC 2JGYA 3O6LH 1WFMA 1SJMA 4FERA 2JH2A 1T5AA 4OGYH 5D2NE 2OZ4A 3S35X 1RK1A 4G9FB 5JXEC 3GFYA 4YQXH 3QW3A 3KLKA 2NY3B 2VJ0A 3QC6X 1EBPA 2ADJA 2QGBA 3E8VA 3O3AB 4C6QA 1R24B 4YVXA 1IBZA 3RNQA 1OFPA 1VHPA 3GHBL 5ISZA 2PYFA 2FO4A 2ZKHL 4IBZA 3RFRA 4AH2B 5ID0A 1HO4A 2ZRZA 4M9PA 5ALCH 1HAWA 3WDHA 1DXIA 3GS0A 2DQXA 1XCXA 1ONWA 1N8WA 4OZ4A 4UM9B 3VGHA 1T1YA 4I9XA 1QHQA 1KM3A 3VDHA 1T0NA 4N2KA 2J8FA 1TVLA 2R51A 1V7NH 5CLWA 5E5LA 5M5DA 1CBJA 2E76C 3REVA 3NT0A 4GMSH 1AE6L 4AW7A 1B3YA 4TM9A 3NQVA 1GC1L 1QNZH 1YEKH 2A74A 2HTKC 3OC8A 5CINH 5FO7B 3RUGF 3NQ8A 3GY1A 5AHLA 4B9PA 3F05A 1AXTH 2G5UA 4WUUD 2HTKD 1S78D 2KZBA 1FTXA 3VXMA 1SEBA 3S35L 3WFBL 3CH8A 6TIMA 4B7LA 3MLSH 3L3HA 3BW9A 3VFRA 4LB8A 1FAKT 4BWUA 4F7CA 2Q7NA 1R46A 2OEJA 4W7VA 1OO2A 1OSYA 2I07B 5CBAB 5I6KA 5L7XL 2CAKA 1E73M 4AXNA 1B0GB 5F4SA 5JW3L 2IMRA 4WHTA 2AEQL 4PRHE 3UF9A 2YLHA 2WD0A 2J6EH 3QXVA 3WFHA 1J5OL 5CKGA 2CGRH 1C8VA 4EO5A 3V36A 3BOLA 3KPOB 3ZM8A 4EE9A 4P4RB 4ODXB 3EA1A 2YAQA 3W5MA 1GY1A 1JZGA 3O9WD 4PCPA 3DGCR 3FH7A 4OVUA 3ZVVA 5DRXB 2DP3A 3CWNA 4YWGL 4IJTA 3EKGA 3TLQA 6ALDA 5MEND 4DVBB 1KCSL 1XDLA 3ABQA 4U1KA 2R1PA 4AF0B 5BMFH 2CZFA 1JPGB 4JEGB 2Z92B 4NQCB 3UROR 4MNGB 5BPPA 2MHAB 3ALFA 5DA4A 1KRMA 2N7BA 1KIQB 2HA1A 1RY8A 2XFXA 2BSRA 2GQHA 3C2SA 3LKPA 5I71C 4Q6XA 3ERXA 4Y2DD 3IARA 4PRPD 1FKXA 1NFBA 1TUXA 3MWAA 4Q9QL 4HHAA 1I2NA 4K38A 3OVUB 4Y19E 3ATDA 5FYKU 4MVBD 2EVFA 3DVNA 2Q76A 3ZQWA 1YYCA 3VIFA 3D1MC 1DQML 5FECA 3OJVC 5DCCA 3VXPA 5HP5A 4R83A 3W2KA 5TF1H 5AAWA 3VIPA 5FC9A 3BZEB 4L3CB 1DQKA 4NYLA 5B1CA 4QLWA 1JSYA 2OAAA 1IEQA 2YC1A 2P8PB 3APMA 1ONQA 4ZYKA 2FRGP 2ROYA 4FQHA 3ZDXF 1UPMB 4K9EC 5HYIA 2XU2A 4P7OA 3MLXL 2FJHB 2FT8A 3CDFA 3OKYA 5HHPB 1KC5H 4FA7B 1BG9A 3CE1A 2DQTL 1W8SA 4LAMA 4HWEH 1FP5A 2BHFA 2UV3A 1N64L 4IUOA 1OCZB 1ET8A 3NPUA 3W22A 4UINH 5JW4R 3ZDYE 1F58H 3UWUA 4Y1TA 1WAAA 3SE4A 1DE5A 3M5XA 3V79C 4Q8OA 1GVSA 1JZIA 1Z3GH 2G50A 3L9RA 4XWUA 3E6FA 2IG2H 1TZ7A 1HEZA 2A73A 2YGNA 4PJIA 4UFHA 4EANA 5LDSA 2Y36H 3GPEA 4Z7OF 1HWGB 1YEIH 5IMOB 2MIZA 1O75A 4URKA 1OGAD 5KG9B 1FWGC 3FT0A 2QKIA 2OFQA 4X7SL 1XL9A 5CC5A 3BKJH 3EOBA 2ZOOA 3BQVA 5CSZB 1A7NL 1TJHL 3UDWC 2CHRA 3EH4B 1TV4A 5BWAA 2Z3FA 2OV0A 1ZEAH 3HI5L 1IEWA 1SFDA 4WGHA 4UAHA 5TDOA 2Z34A 4DYEA 4DVOA 5B39G 1OP5K 5FJUA 2PLTA 3H9SA 3ZJAA 4PEKA 1QU4A 2Z4GA 3FO2B 1GOGA 4UOQA 3FB7B 3IK2A 4UTBH 3JZUA 5IUCA 3DETD 1AJZA 1EP2A 5A5WA 1W8OA 4JJ5B 3BRGC 2DS4A 3VOJA 4A7UA 1BXUA 3VI2A 3VWKB 4EJ1C 1EJRC 4C6DA 1O6IA 4PY7A 1COBA 2KZWA 3M17A 3HPAA 3PF3A 3QBTB 4DIAA 3OZ9L 1A49A 3SCSA 4X9FA 2CUHA 2VOTA 4JFDB 3RAJH 3N1QC 4M8VA 2OCZA 4NLAA 3ILEA 2Q10A 4XBJA 4I5BB 4A35A 3EKCA 4PGDA 5ENWA 4KK8C 3SCNA 1OPGL 3BDYH 4MJ5B 2J74A 3TYDA 2XPGB 4D8LA 4JTQA 1Q1PA 1MJ8L 1PO9A 5TE6L 4GVGA 5E6ID 4A6GA 4WI0A 2F1AA 5GZOC 3AGVA 2JKEA 2W65B 2ZX7A 4R7VA 2JF6A 3DV6A 2CD0A 3PDOB 4PJXE 1YX1A 3DGBA 2GAZB 2RBLA 3NSFA 4F80A 4OECA 1U22A 1CXKA 3ARBB 4RDQF 1RY0A 2X1IA 1OTUD 2E67A 2Q8LA 3ZLFA 1HKLL 1HO1A 4JFWA 2XWDA 2BXVA 1SBSL 2GJLA 4Y9EA 1R1CA 4B2DA 5T5FL 1MVUA 2WXGA 4L6HA 1E8WA 4P2OC 4P8QA 4HKBA 1GVOA 2C4FT 2IH3A 1F2QA 1JRHI 3FPYA 2VN4A 3NIFE 4QHUB 4XNQB 3EYOA 5I76A 4GSQA 3LD5A 4KFMA 5ICZB 1XF1A 2OL3H 3PWJB 4LGRB 2OO6A 4HCLA 2E7BA 2X4SA 1CF8H 2OCCB 3M0KA 2BK8A 1UZ8B 2G2RA 3WTYA 1NH6A 4DZ8B 1XR8B 5BXTA 3KPQB 4Z2IA 2BIIA 3IFLH 4LLQB 4O02H 1NQBA 4M7LT 3D0AA 2X12A 4ETQB 4GSDH 3B03A 2J55A 5GIRB 3WMBA 1X5LA 3TFKC 1HUVA 3T7VA 2QLVB 1BWMA 4AD0A 3GC5A 4KQ3L 4B91A 1KQZA 2YKKA 3C6LA 1KFAL 1Q9KA 2QCDA 5CLYA 1GPOL 1P1VA 4NQEA 3RWIA 1ACZA 4O5LL 4G7QB 4P7LA 4CCDA 4GI8A 2F6AA 2F58H 4JLRA 4HUXB 3VI4E 5IEKB 1NUDA 4YBQD 5FUCC 2QQKL 1HW6A 4L6DA 3O11B 2BOBB 1VLXA 1EQPA 1FVDB 2K78A 4FAMA 3CUPB 4ONVA 1TJXA 3AREB 1TTFA 4NUQA 2CA4A 3QK0A 3K2GA 4A7QA 4LYPA 2H3KA 4ZFOA 5IQNA 2JXMA 1KCXA 5EU4A 4PC8A 1AZCA 4B5XA 2Z26A 5HHOB 2EPKX 2F68X 1S9VB 3KRSA 2V7NB 1E5AA 3ZYZA 4BCZA 2J6VA 1W0VB 3DX7A 5D30A 1I9JL 2OZTA 3H55A 5CZJA 4UDTB 1O9ZA 1S7QB 2BNRA 4QXTB 5D93B 3S97C 4ZNCD 2BP3A 3MUZ1 5AYXA 4V1DA 2NV1A 3G3LA 2G2RB 4AX7A 5SX5K 4FLHA 3QHZH 4L5FL 5AKRA 3IGSA 2X88A 1NF7A 3BJ91 3EOSA 3D18B 3GSUB 2F8XC 3CXDH 3W25A 3VVWA 2FE0A 2IQTA 4U1GB 5F7LB 1AZVA 4JN2B 2D7QA 1GOOA 4KW2A 4PRID 2XPYA 2HG5A 4NF7A 3IAQA 2BFGA 4IRJB 5GSVA 4FXSA 3IU4H 1I9RL 3DFYA 5CJQH 5A16A 4PFEA 1O68A 2HKHH 3MUGB 5JQ6H 5DHVA 1JZ7A 3E12A 5FYLH 4BD4A 1KLUA 3I6EA 4UMCA 3UXLA 4XNUH 3MANA 3L48A 1YECH 4KROD 1CX9A 2W91A 2KPWA 1OAXL 1JPKA 3OOQA 3QMRA 4KWSA 1IGTB 1MUMA 1B0RA 2O5XH 2EBNA 4JFPB 3CHOA 4MS8D 3O3BA 4R4BA 3VI3E 1JUBA 2OJEB 3FN3A 4XB8A 3RI5K 3PZ9A 4GRMA 4JM2F 4IU2A 1NDYA 1U42A 1WBYA 1TJGL 4JTHA 4XI5C 4NQVB 4G7EA 2VIRA 3P3SA 1RVGA 1JHLL 3K4AA 3NUKA 1M2OA 1RUPL 1BQUA 4LNRA 5KWYC 4L9LB 3VCNA 2VAAA 1XIJA 5D1ZA 1GVIA 1RUQH 1ZHNB 3CAFA 3D5OF 5HJBA 3ALXA 5FEBA 4PSPA 1A1NA 2C7UB 4KIRA 1RP8A 5GGRY 1GYWA 3WIHA 1JULA 4QCEA 1N8IA 4XMLH 5D71L 2APTA 1B4EA 2W94A 4ES4A 2A6IA 2TSBA 4Y9MA 3UWWA 2IQAA 4XV0A 5K9JL 1NAML 3WO4C 1XGPA 4XK2A 3D18A 2WO5A 4DZAA 2DMGA 4JRWA 4XHQA 1KYAA 5IVXA 1Z8AA 4JO3L 1AMYA 3TO2B 4AD2A 1KGWA 6PTDA 1OB1A 1PFCA 2QADC 1VPYA 5TQLA 2UZIL 3RRXA 3RYSA 1XZ0A 3NMEA 4Z7OE 1LROA 2XH0A 2YLAA 4KDTC 4QDGA 3UR8A 3F5WB 1FWHC 3ARBC 3VDGA 4LPYA 2Z1VA 2DTSA 5AYUH 3ARBD 3MRHA 3IGLA 4C6FA 5FO8B 3PG2A 1J9SA 4M3HA 3HG1D 2PDQA 2GK0B 5PTDA 3BPCA 1RJLB 3D39E 1EYEA 1YW1A 2VDKH 3JT0A 3SCQA 4BI5A 2WTRB 1KPVB 5I6NA 4L3EA 2CRYA 2OBGA 4WZHA 3EWWA 4YHNB 2NUPA 1I3UA 4WSGA 2QQQA 2V17H 4AMXA 4BA0A 4BQ9A 2FQFA 1USQA 2NY7L 3EO1B 5GRUH 3T1FB 3O45A 3O3UN 1G0YR 1EAOA 3N6YA 3VM5A 4DP4X 3KTXA 5DRWA 1WDPA 3M6YA 4ODWB 5D4IA 2WHKA 5IT2H 3UESA 3KS0J 1G7JB 2X0UA 3MJ8B 1GUVA 3BPNB 5CLXA 5I16A 1UR9A 2QCDB 3P02A 5CAHA 4AYGA 3HMXA 4Y1AE 3LTYA 2K70A 2P52A 3VYPA 4OLYH 3E7JA 5G4OA 3ZMEA 4QJ5B 1OGBA 4NYUA 1KUMA 6ENLA 2I17A 3P5ZA 4K3EL 3P3RA 1ANUA 3VG9C 2O5NA 3P2BA 3LGGA 5AYUL 2I5YH 3F7JA 1PTZA 4FXKC 2VRQA 5K2ZA 2NY4C 2BIOA 3V0WH 1PZSA 3OG6B 1Q8JA 3L23A 5HPCA 5DK2B 2FUQA 2W0LA 2WYZA 3MX0A 4I77L 4LSRL 2H8XA 3I2CH 2WVUA 1K9FA 2CDEA 4UUIA 2PUZA 1N10A 2IGLA 4JO5A 4LLUA 3C60D 3VRLE 1VFMA 3CSBA 1D9KC 5B38B 1T04A 3W0WA 2R23A 2XKNA 3KLQA 5K9JH 2VDRB 3OQ8A 3GMMA 3U9PL 1CYWA 3QQ0A 4K3ZA 5LA0A 2WXPA 4GXMA 1ZVHA 4I13B 4BWLA 2G3MA 1BM3L 3MS8A 3VI4B 3ZXWA 1O7VA 2FVKA 4ACZB 4KJQC 5HHOE 3ZZ1A 1PKQA 1E5YA 3HZ3A 4DIXA 2YUXA 3BTNA 4FFYA 1UD3A 1XCTB 1JZEA 3MGOB 3VXOA 3CN1A 1ED3A 4HWZA 4RNRA 3E3HA 1JF1A 3NJVA 5EZIL 3IJYB 1P5UB 3RWEA 3PJNA 3UCCA 3KHQA 2WZAA 3MRFB 4PJAE 4QHNA 1C1EH 2XG4A 3IGAA 2W9LA 3QDHA 2VNCA 1I3GL 3SD2A 2W38A 1GKQA 3PM6A 3E9UA 4GQGA 3T44A 4NAEA 1AS7A 4XCEB 3MV11 1P6WA 4DBSA 4XD3A 3VXPB 2F7FA 4RGNE 5CP3A 3TJHC 1SVCP 1IT9L 1RZ8A 1LO5A 3BD5A 3NSDA 4J8QA 1OW0A 1G7LB 4NUGL 4XNAA 3RIFF 2IANA 5I0VA 4GVIA 5MHBA 2HS6A 1CTMA 5JQ6L 3HAEH 4HZMA 5C54A 4LSUL 3AU0A 3URNA 3MNZA 2UVFA 1FWEC 1M65A 1M05A 4PCKA 4Y2DB 1SZFA 4XBMA 5I8KL 1QEXA 4OE7A 5BZZA 5J9PA 3MP4A 5EU3B 3Q45A 5FJTA 1JDDA 2VDKL 3E6HA 3FQUA 4NQCD 3T1GA 1ME8A 3W2LA 4N0FB 2RTTA 3CN0A 4KHXL 3LSBA 4QNWA 4UI2A 1EP3A 4FZEH 3AAMA 1CVSC 5FEZA 1IC1A 4NO3B 4H26A 4R2GD 1B0WA 1TELA 3ZO9A 1H11A 2HSAA 1MEHA 2QR6A 3H9HA 4XZBA 2PWHA 3IIZA 1DVTA 5T26A 3JR2A 4X61A 3DFPA 2HDJA 2J9XA 1FWDC 4YJ5A 3FXIC 4RNRB 3B5TA 3BQUD 5DQJB 2K3HA 4Z7IA 2MSPA 3MGAA 5HPMB 1OFBA 4R7JA 5M03A 1FAIH 4GQRA 1CIUA 2GK1A 3K7UA 5ITFA 4RWYH 1ZP3A 4LHUD 1CFQB 3PZTA 1JMXA 1RZGA 4R6UA 3ZHFA 3H2FA 5CUSL 4MFEA 4XMLL 1I1CA 3PJUA 5SWSE 3PNUA 2VX4A 1MJ7L 1L6XA 3GB7A 3PWNA 3FB6A 1A4LA 1FA4A 1E4IA 2YCKX 2QQKH 3T3PE 3FT4A 5JQIB 2VX7A 3WO4B 4BFBD 3TW9A 1IB5A 1MHCA 3VIMA 1PEZA 4XO4A 5JBDA 4TUKL 3SN6N 2VDRL 1CC3A 3QEGH 1RPQA 4CNIA 3T0WA 3WF1A 2XG5B 1RBOB 3UGRA 4PUWA 4LESA 1QR1A 3VSVA 2OW7A 3FTZA 2X2JA 3R06B 1N3NB 1Q72L 3G77A 5LCVA 3SE4C 1HHHA 1IAOB 1JCKA 1S9YA 3QR0A 4Q8TA 5JORB 5CAKA 1BQKA 2BHZA 3QZBA 5I18L 2OOGA 1F4WH 3CFCH 3W9DA 1QK0A 3AYSA 4J7RA 1HQ4A 1YECL 2CH8A 4FX7A 3NAAL 4P61A 1U5HA 4H8UA 2VGIA 1F2XK 3D7PA 1JWMA 1Z5LA 4RMUA 3CLWA 3IDGB 4AOFA 4QLLA 2DM3A 1J0KA 4GUCA 3D39B 4KO5A 2DYSB 5KVDE 3FNDA 3IU4L 3L66A 3U7VA 4ZMZA 3PS7A 4NO5B 1CB7B 4D7BA 3V0VB 4N2YA 5FSDC 3PV6B 4QHKJ 3QIBB 4X5QA 5HGDB 3GLDA 4L4VB 5T5FH 3V6BR 1QFEA 1AD0B 1MPAL 3U46B 1V77A 2XG9A 3SUTA 3RPMA 4JVPA 3WH6A 3N0PB 3WD1A 4GBXB 1KYDA 3QDJE 4LB3A 2FLRT 1RALA 3CU2A 4L4TD 5ITFB 1JN6B 1ROWA 2PP8A 3CMGA 1E70M 4LANA 2OLDA 3FKUS 2EXSA 1QVOB 1XIWB 5HHNA 2ADAA 3W1LA 3MUUA 3GJFH 2QCEA 3BCFA 1OSEA 1SNRA 5F70A 5GGSA 2H1XA 3G9AB 4NUPA 1U8IB 4DQAA 4JDYA 1A3WA 5I5MA 2BHYA 2XXFA 4CVUA 5I1AB 1U83A 2C9SA 1YN6A 1TO5A 2Y23A 4WW2C 5DGRA 3NM3A 3TW7A 1M1BA 4WX2A 4M0XA 2BNUB 3RWFA 2NZ9C 3RAJL 1OXYA 1X1OA 2ED7A 1L9SA 3K1KC 2DYPD 4R7NA 4WTZG 1EJTC 3M44A 4XZUA 2ZC1A 3OBKA 4BI6A 4PRHD 3WXWL 3V5KB 1J5HA 5C5YA 4MLSA 1PEWA 4XZ4A 1I1AA 1NCJA 3L4VA 4P5SA 1VEOA 4HGKC 4IBLT 1HJBC 1YEJL 4OZ4B 4EI6B 3U7WH 3WENA 3MP3A 4NDMA 3UU0A 3GXFA 1ZP4A 4AQEB 2BDNH 4L3FA 4XAPA 1VPQA 1GSKA 2C7UA 3BPNC 4FB7A 2EIEA 2KBGA 1SMOA 2NY0C 2VDOB 4HJIA 3QCTH 3HBLA 5LNVA 4UQEA 1TPDA 4PJCE 3EJQA 4H8QA 1ZVNA 1WFJA 3OR6B 3B9NA 1M42A 5DJCB 1A6TA 3SQLA 4K4KA 1WS7A 3MNDA 1ADOA 4AUUA 1E55A 5F0LB 2PLJA 2F5BH 1U8LB 1VCAA 3QJTB 4GUPA 1UA6H 1CJYA 4X7SH 3FYOA 1UH2A 2NY4B 4PJ9A 3US0A 4WNSA 3FYIB 2VO5A 1UXWB 1LK3H 3ELAT 1L0YA 2GTWB 3VXUE 2DH2A 3QORB 4WHCA 4FS0A 3GZ3A 4PP2B 1SO3A 2PODA 4YWSA 3HB3C 3APFA 3U5UA 5JIWA 3BWZA 4AMKL 5A2BA 2P8MA 4KRTA 3S8GB 4NZ1A 3TBVB 3TYGH 3TNBA 4NP7A 4XBSA 1UROA 5AVXB 5L4FA 4HUUA 4XWOD 3CDZA 4DUVA 3MLZH 3WMSA 5I1JH 1CB2A 1GCYA 4A38A 5LXGH 2YARA 1KYUA 1ZXKA 3WLSA 3IWUA 3SO3C 2IJ0C 1AG0A 2MHAA 2XI9A 3W02A 3L3KB 2C1OA 2R0LL 4UNVA 3VQ1C 4NZUH 15C8L 3PF2A 5DDHB 1UKSA 4A2RA 2ZOXA 5J6HB 1X6NA 4IF2A 4LP4A 4B0MM 4MMYA 3L3OC 5E2VH 2YMOA 1CD1A 4G8IA 3WHE0 4G72B 4H8VA 3HG2A 4MY9A 5I3GA 2FEDD 1E5NA 5K59E 1TPH1 1KBKA 2Y5TB 2AAAA 4WVRA 5LAXA 1KXQA 5IESH 3IRDA 5D72H 1S7VA 5HANA 3B9EA 4QOKA 3FB8A 1CS6A 3IXTA 4FADA 3VZZA 4QYOB 3VFTB 1A7QH 2ODHA 4XP9H 2AQ3A 1HCYA 1WVZA 2E1WA 4OV5A 1OOAA 4DLFA 2VDIA 4PJEE 1O7AA 2WXFA 2GYIA 2FEJA 5FR3A 3IBEA 3G8EA 2I9LB 2WNKA 3ESOA 4TUUA 3GKWH 4GJIA 4PRAA 2I25N 1JZHA 3QNYA 4GI6A 5IB1A 3KCOA 4OCSH 3W3OA 4IGNA 4RVBA 4G8AC 4R3SB 2XPGA 3SHSA 2DN7A 2MPAL 2A2QT 1K85A 3S5OA 1J5OH 4HUVB 4JDVA 4WWKD 2D7TH 1VB9A 1MQ8A 1TDQA 1UW9A 4I5RA 4GIEA 3F65A 5BOOA 2FAUA 2NX3A 1W1YA 3DMMC 2OR7A 3QUZD 5F71A 3SRKA 4H04A 3S35H 3U2IA 2Z0UA 2DVUA 1ME7A 4CAGA 4EVNA 4GX8A 3WHXA 3ATAA 4O12A 2BOEX 5JPNC 2DZSA 4RMVA 4B9CA 1Z0NA 3HBGA 1GC1H 3PNRB 4OTXH 5KVEL 3RLVA 4W4QA 1CECA 1FXPA 4XXDB 5SWZE 4HWEL 4NNYB 4UF7C 5A2FA 4L3EB 1KXVA 2FDMA 5HPOA 2V3GA 1KD0A 1S78C 1KC7A 1KN4L 3EO9L 2N7AA 5D2LE 5BV7H 2O61B 3N85L 5BS0E 3GS7A 2BNQB 2A3HA 4IIDA 2Z91A 3DGGB 5KSBB 3WIIL 3H3PH 2OR8A 4JM4H 4TVPH 2REQA 3DFHA 5IY5B 4WQ6A 1T20A 3P2DA 3KYNB 3G6AA 5DEGB 4ORMA 1C5CL 2D31A 2D1ZA 2EE0A 4IGBB 1N7MH 4X9HA 3ZKMC 2IDUA 3RURA 1ID5I 1YRKA 1BECA 3HN5A 3PPFA 4IGMA 4Q9QH 2W0PA 2ZT9C 3EEGA 3GS6A 2EKSB 4X4KA 1A5FH 4M6MH 3O0LA 2PPGA 2VZUA 1RXLA 3W73A 4P5TD 4LVBA 1YPIA 3H42H 3WYZA 4A22A 4NZ3A 3KLSA 1GH7A 1OE2A 4MXQC 1FNSH 4AMAA 3LPOA 4LSQH 4PJ7A 2B0SH 2G3IA 4ZQNA 2R6OA 1EGVA 4R9OA 1KCSH 3QWRA 3UEZA 3T42A 3SCVA 3O6KH 4A2SA 1NC4D 1Z1WA 5MEOB 4TVPD 4YWGH 4BXVA 1T7WA 4MWFA 3CXOA 3CSYA 3NJKA 4KERA 3FQXB 4ICXA 4JFYB 1MRDL 2IWFA 2PMZA 4XAWL 2EDKA 1GOWA 4MVBC 5GRJH 4K2UL 1H8OA 5HDLA 2DQCL 2J6EL 1DXEA 4NIRA 4HVXA 1VZWA 1MWAH 1QI3A 5DFTA 2V8MA 1H8SA 3ZYJA 2YL5A 3CS2A 4GG6B 2DT1A 2P88A 1GKEA 2DQGH 2QFPA 2ZG3A 3CFUA 2FIKA 5BROA 3A67L 5GRYA 3WS6C 5A8NA 1TJ1A 2B4GA 4OOZA 2IOIA 2NXHA 3LV6A 4ESKA 4S3DA 2PC4A 2YGYA 4YLQT 3FVDA 4IRJA 1GMEA 4LVGA 3HE7A 4ZVJA 5GJPA 2BIMA 3QDMA 1EFQA 1P2CA 4NN5B 2OMYB 1ZIBA 1YXDA 5DA0B 3RBGA 3TBBA 2J7GA 4QDPA 1G5AA 2O30A 4P99A 5D4QA 2WYHA 4CQBA 2IOMA 3FT2B 2WBJB 3JWDL 4NLHA 1MHCB 5AAMA 3NCYP 3N44B 1RK1B 3VC6A 3WLBB 1TZGH 1URZA 4GO9A 2CLFA 2AGJL 3EGXA 1VJIA 1F5ZA 2HS8A 4G3YL 3W7EA 3ARDD 2PFHA 3T6VA 2GEEA 2FX8H 3TA3A 4Y2NA 3ZHLA 3C6LB 2R1YA 2PTXA 1GIGL 3BIKB 1GGCL 4GH1A 4IP4A 1QPKA 5DQPA 1MIEL 4ZFOL 3O6LL 2ESCA 2NNXA 3APTA 3H2CA 4ERIA 1IC4L 1F8IA 3VXNB 4KUZL 1GZ1A 3GTNA 1QNSA 2X0WA 4P7RA 3TSBA 4H20L 5L6UA 3NPZB 5FO8A 2NY4D 4K7PH 5EBWA 4BE6A 4U7MA 1YYAA 4RAUB 1XG4A 5D32A 4KWUA 4NN6B 4R5VA 3TFBA 5FF3A 4YC2C 3V9CA 4HGMA 2INFA 3M5VA 1S2AA 1XLGA 3GKFA 4LSTL 3MCOA 4NKCA 2Y06L 3AUJA 1OD0A 3TO2A 1R8LA 1QBLH 1QQDB 3IS4A 3QHNA 4L64A 3L5JA 4QO1B 1EZUA 4QF1B 4XAKD 3GTTA 5C0AB 3WY2A 3NQ6A 3DWTA 3KW7A 2QKFA 3MBEC 2UX7A 1VFLA 4E4PA 4Z7VA 4QWWC 2DW6A 4FNTA 3AQUA 3MLVL 4OTKA 1HZHH 1JI1A 4JHAH 3KPOA 3AMKA 4H19A 1J9RA 2ZONA 4K3JL 5D1ZC 4CQAA 1GGBL 2MQCA 3OGCA 1DYSA 2FZMA 5I02A 3ITGA 5FA4A 3VWJC 1EIXA 4OLUL 4EIUA 2A9AA 2BODX 4GA8A 2EE3A 3PGCB 2A79A 2N4IA 4HKZA 2Q86A 4S2SA 4FQCL 5E4IA 4B9KC 3TA3B 4PJGA 1FNGB 3TH4T 2ZXGA 3P6LA 2V4LA 3UL4A 4HBQA 3NFUA 1QRNA 3T6WA 4XNDA 4QTHB 4LCIH 1S39A 1IGFL 3QQ4B 2DQUL 2A0NA 4Z2LA 4O0KA 5CZTA 3F5JA 5DD3L 1X9UA 1MHPL 1OCJA 4OM1L 3AI0A 4P2RD 3PWLB 3EKLA 2B1AL 4M8QA 5BZDB 3FSAA 1RLCL 4ZAKD 4ABVA 4AQ1A 2EDWA 4ACTA 2AAVA 3AXLA 3SGJC 2EKSA 3DX9B 4X4XB 1OW0C 4ZAKC 4Z7AA 2FTYA 2QEZA 1IKFL 4S1DD 3N73A 4IPLA 3VI3A 3HGRA 4W4OC 3BXNA 5CEZL 4Z1BA 2FO4B 2IPTL 3TC3A 4G6KL 2C3WA 3HE6D 1GW0A 3IMUA 2PDGA 4JY9A 2R29L 5AKQA 3S2LA 3SB0A 3TLLA 2GC4C 2K0RA 1I0BA 2A7RA 4PWGA 3WH5A 4PYGA 4E9TA 2G96A 1CE1H 2IVFC 3C60A 1K8IB 1SN0A 3WEMA 4HT3A 4JN7A 1EJ6A 2V67A 4KO6A 5F3HB 2ZCZA 3MUJA 4PB4A 1VZIA 1KDJA 1FWSA 4I7UA 1NDTA 1BFOA 2Y24A 3HNTH 3ZDXE 4HW6A 5AD0A 1Q3NA 2O5YL 1AGDA 1FYHB 4FCAA 3RA7H 4O15A 3V8CA 1WFOA 4A7GF 2JCWA 1LK2A 4FI7A 4PRNB 3THUA 4UTAL 2J8OA 1W80A 3B0VC 3BESR 2GQ3A 2WVSA 2FQIA 5L9DL 3C8DA 3CTTA 4Y4KA 3HR5A 3G1SA 5K39B 3HOJA 4ACPA 4M6OH 4DJDA 1LDPL 1KKOA 4I3RL 4QTHA 4UFIA 4JGMA 3LK6A 1UM6H 4LVNC 4DELA 3DX3A 4M43H 5DJAA 3OKDA 4P2OB 1OAZL 1F3DJ 4F9PA 1GJPA 3KM1A 4Y9FA 3N41F 3DOSB 1HHIB 2XWCA 4L4TA 5IFPA 2O6CA 1IGCH 1OCWH 4R8WL 3GVWA 3R79A 2VDPH 4YIQB 1DVJA 1UIOA 3UTZA 3CC5A 3DX2A 2C3GA 1M53A 4HFWB 4ACYA 5C8JB 4OOUA 5D7LA 5CM1A 2VJ8A 4PULA 4F57L 4L23A 4WNJA 2WO4A 1DYZA 3O6MH 4AQ8A 1D5IH 5FXCH 5HHVL 2UX6A 3Q6GL 4D0CB 5FEWA 1M2VA 4ONGL 5B1JC 5HULA 1TRIA 5FYJE 4UQDA 3GU2A 4I2XA 1LILA 4FXGC 3N2BA 3NPXA 4N9GB 4XB7A 1FZOA 2X7WA 1DSFL 3WEOA 4HKBB 1QT1A 3WLMA 1US3A 1U8KA 3CUZA 4UTJA 2DZXA 1YMMB 2QQNL 2UY6A 3O41B 3RE0A 3CZGA 4EIGB 1ZLPA 4QXGL 1VCBC 3W2JA 4KCWA 4OFIA 1OAKH 2A3CA 1EBAA 4ZO9A 4LC6A 4MNLA 5T9BG 4GW1B 2BOCA 2K7QA 3LKOB 4XPAH 4FFVD 2YA2A 3L7EA 1UACH 4UV4L 3I4EA 4FFYL 3RI5F 5EN2A 5DHEA 5FHBL 1IO4C 1UA7A 2ZVIA 1RZGB 2J2ZB 1E3ZA 2Y7NA 5E24E 5FFOA 1BXCA 3BXWA 1TTUA 3DEQA 2Z6JA 3B4NA 1Z9AA 3V4PH 5XINA 5IWLC 1I3VA 4IXXA 1PMYA 1WWAX 2ZUXA 5HXMA 1SPQA 5FF4A 2EPHA 5JBEA 1RUMH 4BFOA 1NMCC 4OU1A 1WZMA 2HJLB 5F88B 1A6VH 1A6ZB 1EK3A 3W82A 3KLAA 2EDYA 5EV7A 5AN7A 4HIPA 4FGMA 4HUMB 3PBUA 1GYNA 3AB0C 5ESVA 2OT1A 3N2CA 1F1AA 4JFXB 4TLSA 1EANA 5ID0B 1DQVA 3U0WL 1PUDA 5GJNA 3KYNA 3WE1A 2I9LA 1OABA 4GI4A 4HQQH 3FO2A 1R9XA 1VP5A 2WZPA 5I1IH 2VMCA 1VJZA 3SY1A 5IIEB 3DPBB 5E8NB 2B2XL 2OZ4H 3NA9L 2HVOA 3V1HA 1EZVY 2QSQA 3SRHA 3UO1L 3WCZA 3GXIA 4C58B 4MA1C 5ADPL 1WUEA 5E94B 3GD6A 2F8VA 4DVRL 4N4QA 3GNNA 4KKXA 4UT9L 1N70A 4JKKA 5D70L 2GGJA 3CCHB 1ZA3A 3QJVB 4MNGE 4EN3D 5LBVA 2OMVB 2YOCA 3SKNA 1IVTA 1NFIB 3CO4A 3CVHL 4LVHB 2E68A 2VM8A 3V7PA 2ZF8A 5HHOA 1RXOB 1HP5A 4EVNB 3ZIZA 3PQYB 4UT9H 1B31A 3KVMA 1UR3M 4EACA 2NNAA 1F4YL 1EJ8A 4DKEH 3AIBA 3JZYA 3Q8BA 1T2QH 4ZX6A 4AZBA 4K1WA 3UTQA 2OZ4L 3QI9B 2O0TA 5GJTL 3BUIA 4AIXA 4D6CA 1FJ1B 1HL2A 25C8H 2QCGA 4LCVA 2ZAHA 1WT5C 5IHUL 2F74A 2BS9A 1ZWIA 3IJIA 5DMYA 1N59B 5JLZA 2BP1A 4U7KA 4I0PC 2EC9U 4NFCA 3D5HA 4X99B 2XOTA 4L3CA 4NYLB 2JB5H 1A6TB 3NACL 1V02E 4JBRA 3MLPA 4XKYA 3WK2A 5AQ0A 1WDAA 3HZKA 1S5VA 1MLCB 3WLRA 4GSXA 3ZZQA 5AHNA 3MWCA 1EV2E 1EJOL 3WBAA 2HB0A 3T0ED 3UAEA 1EEXA 4XMVA 2XYLA 4HPXA 4TTDD 1OF2B 3QA3A 2WZ6A 4DT2A 5M94B 1VS1A 4AQEA 1UZ8A 1JUKA 1UQYA 5FWQA 3QRGH 2N3JA 1MW0A 4NC1E 2WSPA 3WMLA 3KVQA 1GZJA 1SUXA 4C59B 2HLAA 4CVZA 3KYAA 1SQ2N 1TKWA 2XZAH 3U30B 2EYTA 2P45B 1E6JH 3QIWC 4HJTA 3WE6B 2VO8A 5MKGB 3QIWD 2V7HA 5L2KA 1YG9A 2D0HA 3Q1SH 5HHME 4NQ1A 5F7BA 2X6AA 3MV01 3B8WA 4XR8C 1KXVC 3NZQA 4ZB2A 3FQWB 3N42F 3RJYA 2WYTA 3U57A 5AL8A 2HRLA 1KPUA 3MRQB 1AZNA 4GC4A 2C9QA 2MOGA 3DBSA 2COQA 3CVDA 5IROC 2ITDA 1AO7B 3NEVA 1ZXQA 3ARRA 1YEGL 4U0QB 3ONCA 4DP0X 2QR0B 4RAUA 3US1A 1YKWA 5D2LA 2EIJB 3N44F 5HDQL 4GP5B 2GEQA 3E02A 3VFLA 2J8HA 2OULB 1KPVA 3ZRCC 1GHSA 3LERA 2YFOA 3QMSA 5ABEA 1HL8A 2HVBA 1EHLH 1J18A 1AMXA 1X7QA 4YHNA 1QAPA 4GBUA 2VL5B 4PP1D 4HXAL 1ZBKA 5AKTA 4PUJA 5FD0A 2NSOA 4F57H 5T3ZD 1V7ML 5B8CB 3IDYC 5IW3A 2HVNA 1Q9OA 3W2UA 1V79A 3II1A 5J57B 5C2GA 1WV7T 1GVYA 2VDPL 1U1HA 1GT8A 4QR7A 4YHML 1OCWL 1VBHA 2R0KH 1GS8A 3KWWA 2XRAH 5D7LE 3ZDYB 3MLYL 4A2GA 4AV0A 3FB7A 5E99H 2FIKB 4FYTA 4U6YA 1LLZA 1XYFA 2F6UA 2XN1A 1LDCA 5FX3A 4WOQA 3KJ6L 2FH8A 4Z2GA 4U1MA 3MGTB 1KFJA 4ZQKA 5I78A 3F4DA 1IQWH 5G4HC 4L5FE 4C83B 2VEGA 4ZTYA 4QKXB 4AVKA 1KBLA 1GTEA 4RE2A 3E96A 1XL4A 1DQLL 3TN0B 4G9PA 3NFSH 5FUZH 4BZ1L 1R0AL 5C7XH 2QIIA 5IBXC 3TV8A 1OP9A 1BM7A 2X1QA 2ITCA 3TWCH 2UWEB 4CKVX 1GNXA 4JUSA 3CT2A 3KHJA 3ZK0A 4LCQA 2EE6A 4LCCA 3RA7L 2NX5A 3F4NA 5D8WA 4DF2A 4A6YL 3KGSA 2J72A 5CJMA 2XIQA 1NAL1 1UYQA 2DVXA 4Y4HC 2YLLA 1QFWM 5DT7A 1CI3M 1LL6A 3VXQA 2TAAA 1VADA 3VNZA 3QDMD 4GO8A 3IVTA 1EMTH 3BD4A 2YMTA 4WGVB 3UJJH 4G7EB 2EXTA 4TQEL 1M01A 5DMKA 3WNIA 4AC7C 1H15B 4DYJA 5KTLA 3M0ZA 3D4ZA 1HNYA 4H83A 1U92B 5DD1L 1P0NA 5FHAH 4R4ND 1W3IA 3NPWA 4LDEB 1D3HA 3ILDA 4AD1A 3IJYA 2MTAA 3NVQA 3ESVF 4HCRH 4KKLD 4Z7UF 4AZIA 3IS0X 3QEHB 2LAAA 3TT1L 3DIDA 5XIMA 1SO6A 4ECLA 2HTLC 3MNVB 4IIQB 3NN8B 1X6LA 4YDJB 1M04A 5E8OA 1R6VA 4LP8A 2J5LC 1AGCA 3C8HA 1Q9LA 1KY7A 2VMEA 3FBKA 1UKOA 1AO7D 4I90A 1MHPH 1BQLL 5GS0H 3Q6FA 1X1ZA 4Z08A 4E2VA 2A83B 1VRXA 5HWMA 4OF5A 3W2DH 4K8RD 4X7EC 4YPJA 1P6CA 3T0BA 4K71B 1TMCB 3ELQA 3GSRA 3ZHKA 1B4LA 4KK9D 4OF7A 2REQB 1UR1A 1BKSA 5CEZE 1H5BB 3WZ0E 1M2VB 1E0VA 2AZUA 5HTSA 4JFED 3E6HB 4EZLA 4JDTH 4M1DH 3MRRB 3S3DB 1E4MM 3BLLA 3HJEA 1V4YA 2X42A 3P3TA 3DJ9A 1HZHL 2QV2A 1ISXA 4UIOA 1JPTL 5D2NA 2BM3A 5FK9A 1VF8A 1IF2A 2D20A 2V38A 1E0XA 5C0FB 2PF6A 5CC7A 2G75A 5HOSA 3QWRD 4LCSA 1ET5A 1YEYA 3U4AA 3AVEA 3P4LA 4YZFF 1J6OA 4N9BA 1FFRA 3QXDA 1P1XA 1JHTB 4Z7VE 5C09D 4N0YH 5EN3A 3M86A 5JXAH 1CFNB 3TESA 1UCTA 1I8MA 3VUPA 4RSVA 4K7PL 5FO7A 4J28A 1JRBA 2I57A 5DXXA 1AO7A 3WJYA 4L4OA 3KDMA 2I24N 4QAWA 5JO5B 1MFEH 3V6ZB 1UKQA 2WN2A 4ZFZB 1IC4H 3RF9A 2G37A 5AZ1A 2OMNA 2UZXB 5B39B 2YZ1A 5I6PA 3S8HA 1BFSA 4JCLA 1KTLB 4XGZA 1ZAHA 3PQYD 2OWCA 2AMXA 3COTA 4XZLX 2KDYA 2FEEI 4S2BA 4GBXC 2P8LA 5GGVH 3EOAB 4NEHB 5CJXA 3QSRA 4NY2A 1N3NA 2WTOA 3K0YA 4N9OB 4OZIA 5TK2A 3GMMB 5GS2D 1EEYA 2YPVL 2YS4A 2VGGA 4GGBA 1JUFB 1MLBA 5F2GA 3I7SA 3QMTA 1A9EA 4PJHA 4JDBA 1QLRB 5FCUH 4LIQL 3L65A 2HUEA 2QJJA 3WIHH 3JV4B 5C0BD 2J25A 1J01A 4OGXH 5DT5A 2D8KA 2K1MA 3WKML 3S2JA 4RBPK 4AXWB 1QLEL 3HOGA 1O1HA 1RBAA 4OZGE 4GUGA 3QJSB 5I0XA 3ROOA 3RX3A 3MV8D 1DV7A 1QSFE 4YHLH 1SLWA 2F9BT 3DV6B 4PH8A 2E6QA 1X7IA 2C1IA 1HWWA 2A0LD 2JIEA 3GLCA 1EJSC 4FX6M 4ADTA 5I09A 4BJHA 5TH2A 1CLYL 2DQGL 3DHUA 1KGXA 3P4MA 4NWUL 4ZTOH 1PVNA 2BSSA 3W74A 1XI3A 1DQJB 2BVPB 1EAQA 4YLCA 1A5AA 2OOFA 4JIIX 3W87A 1E5BA 2QJDA 3B7YA 1NCHA 5F8QC 3E0IA 1YRRA 5M17A 3QHFL 4ZMVA 2C0HA 3RDTB 3SQSA 5I75C 2PPEA 5KS9B 3H70A 3SPVB 2YA1A 3PNZA 3TP4A 5CZSA 4RCAA 3WD2A 2X44D 3M88A 3FS9A 4URTB 4Y8DC 4PJBA 1OCQA 3K5RA 1DWFM 4IIQC 4AT6B 1CICD 3F03K 2VVNA 1R34A 3TCTA 2EH7L 1OB1B 1CICC 3EZ8A 4KPHH 5EFIB 2Y7OA 4DESA 1UWTA 3SKNB 2Q8XA 3NVTA 4AVHA 5G2IA 5BOJA 4RDBA 1NJ9A 1IVLA 4PW3A 3VKAA 5FM4A 4LSQL 2VDLL 3KCPA 2DV0A 3H42L 1Z3NA 1PFOA 4ZFFB 3MRHB 3WTVA 2PZ0A 1CL7I 4KTEL 4N2DA 5B80A 4M6ML 2KMWA 4GE8A 3MBFA 1YJDL 4X9IA 1IBHA 2PURA 3HRZA 3VA8A 2BX7A 4L8BA 3QULA 1ZRUA 1DJXA 2CJSA 4MJ6A 3OVGA 2OJZL 2PTYA 5B7MA 1N7ML 2GKIA 2HLFC 4TQTA 1XCQB 2HJFB 3K6SA 3NIDB 3RJOA 3COOA 3H3PL 2XC8A 4JM4L 2W61A 1BIIB 3UNDA 1CLCA 5A6AA 1RURH 3RGHA 1OFOA 3D50A 1NQ6A 3AS3A 2ADFH 3SCMC 1OGSA 2HFEA 1MQRA 3AXXA 2KERA 2BW5A 3C0SA 4ZMOA 1FO0B 4Y5VA 3SCMD 4XMXA 5BV7L 3MJGX 4LRIA 4WQOA 7ENLA 1FWJC 3V0UA 4C6LA 4DPPA 1PTDA 1HP4A 4U1LB 1TE6A 3OKEB 4ODVH 3LTSA 1OFRA 3N43F 5DJ2A 5ANME 5FAJA 4X6BA 5SX4H 1EC9A 2I7OA 4IU2B 1DO6A 5LIXX 1GS7A 2ZA2A 8PAZA 1ZT1A 1HXMA 4MD4B 5JW5B 4MQ7A 2IDSA 4B9YA 5ICYB 1QNRA 4GKZA 2JKWA 2X4QB 3LTVA 1REQA 1GEQA 3RX7A 5I6LA 3MROA 1KA9F 1GYVA 3PHOB 2HCZX 3MX0B 1E5UI 1SF5A 1YEDB 1E51A 2OQLA 1BVKA 1D5XA 5KOVC 1JD9A 3ZL1A 2OCJA 1OM3H 2OI9B 3P9LA 4MS8C 4MY8A 2PP9A 1ETA1 3AIVA 1E3FA 1E4LA 4ANWA 1OYAA 4YDLC 4H8WH 3U3HA 4DZ5A 1Y65A 4QIUA 4PIBA 5EU7C 3IK4A 5IVXB 5KVGE 3OWEA 4CLMA 1AHWA 1J7VR 1JD7A 1JF6A 5T33L 4CC4C 3HUJE 4LTSA 2QT6A 1VIZA 3MJ9L 4MXWH 5I8EB 2Z7UA 1XIDA 5FGCE 4L8CA 3BKML 3SE8H 3MGTA 3UVIA 4P7QA 3SYQA 4MA3B 3RAOA 2NQ3A 4LO9A 1JGMA 4Q22A 4FI4A 2P8LB 1SDYA 3G0SA 2H6PB 3FUMA 4JG5A 4PRPE 4WW1A 1OSZB 5IESL 4JGNA 1RZFL 4HS3B 4N6RB 3NDZA 1T40A 2H32H 3LENA 3BSMA 5F4XA 1BQ5A 5HHOD 5IB4B 1E27B 2YPLB 5LBSL 4YMPA 3NBNA 4UFMA 3F7VA 1X96A 1QRQA 4XP1L 4FEIA 1U8MB 3LB0A 4TNVK 4NN5C 5SV3A 4AI7A 1VD6A 2WO3B 3SDCA 1QSVA 2P80A 1U8OA 3Q1EA 1LE9B 4HYWA 1QNVA 1YCSA 3BW9B 3VFRB 3GTHA 1RZJH 2R0WL 1Q2RA 2FL5A 3NXLA 4HS6A 2GJJA 4KWOA 1NBYB 3UXFA 3MAWA 2DWDA 4DPRA 4X6DA 3VCCA 3TJIA 4UM9A 3OC5A 3RL2A 5LGJB 1F6YA 3FU5A 4GQZA 1CPUA 2ADYA 4KU1A 3E0VA 4PB9L 5H2BB 2YKLH 1ZJIA 1KCWA 3KLHD 1PIFA 4NM8H 4OZFB 5T1KB 4A68A 2KC0A 5K9OA 1QJWA 1QNPA 1HSBA 1AW5A 3MJWA 3SGUA 4QE4A 1K8XA 3H9HB 3O2DL 4JO1L 3HAEA 2RGMA 3X1GA 5E93A 2YL6A 4P2QD 3PHQA 4YE0A 4V2CB 4ZFOB 1OV8A 2NY6C 3HHMA 2R8SH 3EOEA 1M7PA 2Z7WA 4YO0B 4AT6A 3GC4A