3RX2A

Crystal structure of human aldose reductase complexed with sulindac sulfone
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
318
structure length
318
Chain Sequence
SHMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3rx2A00
3DOPA 5HNUA 3V0TA 2PDYA 1XF0A 4PUWA 3GHSA 4IGSA 3FX4A 4XZLX 1AZ2A 2HVOA 2FZ8A 2PDWA 4IJRA 1Q5MA 1X98A 5C7HA 1IEIA 1AH4A 3BV7A 2R9RA 5AZ0A 3UZZA 2INEA 4H8NA 3O0KA 2IQ0A 3R94A 5LIUX 4F40A 1SM9A 2BGSA 4GACA 4HBKA 3CAVA 2C91A 2PZNA 4GCAA 2PDCA 2IKGA 3EB4A 2PDUA 3R6IA 5JH2A 2PDBA 4RPQA 4JTDA 4HMNA 3FJNA 4R9OA 1S1RA 1YNQA 3VXGA 3LNMA 2I17A 4L1XA 2FZBA 1QWKA 2QXWA 3V0SA 3O3RA 3V36A 3LENA 1ZQ5A 4ASTA 1YNPA 4YVVA 4MHBA 4LBSA 1GVEA 1EL3A 4NKCA 4GQ0A 4DBUA 4DZ5A 3ONCA 3UG8A 4FAMA 1PYFA 4GABA 4YU1A 3C3UA 4LAUA 2PDIA 3N6QA 1OG6A 3WBYA 3DN5A 2HE8A 1S2AA 1Z8AA 3UYIA 1MZRA 2PDMA 2PDGA 2WZMA 4YVPA 2FZDA 4ICCX 3M4HA 2HVNA 1Q13A 2FGBA 3CV7A 3NTYA 3UZWA 1AZ1A 4XO7A 2IKHA 3S3GA 2IPWA 4XK2A 2R24A 3LEPA 1MI3A 4ZFCA 1X97A 2IQDA 4XZIA 1Z89A 2FVLA 3LN3A 4PRRA 3UGRA 4JQ1A 2VDGA 2WZTA 3H7UA 4AUBA 2DUXA 3GUGA 4JTCA 1ZGDA 2HV5A 1EF3A 1PWLA 1YE4A 4Q7BA 1K8CA 3MB9A 4LB4A 4WRHA 3H7RA 2J8TA 4WGHA 2PDQA 5M2FX 3R8HA 3BCJA 1ZSXA 1RY0A 2F38A 4XVEA 1IHIA 1ADSA 4EXBA 3RX2A 2ACRA 3R7MA 2DUZA 4JIIX 1S2CA 4XVDA 2BGQA 1R38A 1UR3M 3Q65A 4YS1A 2PDNA 4FA3A 2ACUA 3COTA 3EAUA 4DBSA 4JQ2A 4XZNX 4G5DA 2IPGA 3M64A 3ONBA 4FZIA 3CV6A 1LQAA 3GHRA 4WDTA 2PDLA 3R43A 1VP5A 4DBWA 1C9WA 4QXIA 4WDXA 3LQLA 4XZMX 3UZXA 3LBOA 1ZUAX 1PZ1A 4JTQA 4JQ4A 2CLPA 1HW6A 2PEVA 1Z9AA 1XJBA 3RX3A 3LQGA 4GIEA 3V0UA 3H4GA 4JIHA 4JQ3A 1PWMA 3BURA 4GA8A 2IKIA 4LAZA 3UP8A 2PDJA 3LZ3A 4PR4A 3WBXA 2ISFA 1X96A 1PZ0A 2P5NA 5LIYX 3GHTA 3V35A 5HNTA 1RALA 3UWEA 2NVCA 3UZYA 2BP1A 1YE6A 2I16A 2IPJA 1Z3NA 3M0IA 5LIKX 1M9HA 4PMJA 3RX4A 3G5EA 1LWIA 2INZA 3ERPA 1QRQA 2DV0A 2PDXA 4FALA 3P2VA 3LUTA 4L1WA 1FRBA 1T41A 3LD5A 4H7CA 2HDJA 1MRQA 5AZ1A 2IPFA 1EKOA 3U2CA 2PDKA 2AGTA 3Q67A 2IS7A 4XAPA 3CAQA 3WCZA 4JIRA 4QX4A 5KETA 3WG6A 5JH1A 4WEVX 5HA7A 3MC5A 3GHUA 1S1PA 4JTAA 4WDUA 5LIWX 1EXBA 3EB3A 3BUVA 4QBXA 2PDPA 2PFHA 2PD9A 2ACSA 3B3DA 2FZ9A 3CASA 1AFSA 2PF8A 1JEZA 1HQTA 2PD5A 3N2TA 4IJCA 4QR6A 3CMFA 2IKJA 1RY8A 1AH0A 2F2KA 4XO6A 1J96A 2PDFA 1VBJA 5DANA 1US0A 4PUUA 5LIXX 4OTKA 2ACQA 4LB3A 2HEJA 4LBRA 3D3FA 1AH3A 2HE5A 3R8GA 4EXAA 2PDHA 3T42A 4WDWA 4Q3MA 3LZ5A 3WBWA 1A80A 4JTRA 3R58A 4I5XA 1T40A 3KRBA 4XZHA 1XGDA 4PRTA 2ALRA 2NVDA 2A79A 3QKZA 4GQGA 3F7JA 4JQAA 3G1RA 3UFYA 4YVXA
chains in the Genus database with same CATH superfamily
1XR2A 4JTKA 9CGTA 2ZQ0A 3H2OA 3WYZA 3GW3A 3KS5A 3PUDA 4FNUA 4LV4A 3M7WA 3TR2A 1HJQA 1XH0A 2BZNA 2BXZA 3WD2A 1O4UA 3PHAA 3E5BA 3WIJA 3AIVA 2EF9A 2D22A 2GVYA 5C2GA 1JZ8A 3O0KA 1VH7A 4TUFA 3AICA 2QUTA 3HF3A 3CGTA 1TRIA 3TMLA 1TWDA 1TMLA 5MKGA 3O1NA 1JZ3A 1MFUA 1EOKA 3AIQA 2GDQA 1W5NA 1ME8A 1XSIA 1XP3A 3L5AA 1Q7QA 3TYEA 4IIHA 5D2VA 3S42A 4D6JA 4Q4OA 4O54A 3CZEA 3TTOA 3VNJA 4QDMA 1W1B1 2V5LA 1NWSA 4IJBA 4DXKA 3AMCA 1EHNA 1BYBA 1FWFC 1XLDA 4GXMA 3H55A 5CZTA 5TAOA 3V75A 4GFSA 4CNOA 3PBVA 4NX0A 2CESA 1OF8A 3B05A 5IDZA 2VEPA 4C5ZA 1P6WA 3LS9A 4UIOA 4XB3A 3A64A 1ZS2A 2ZTKA 1TCDA 3IACA 1FVPA 1S5MA 2PBGA 2WSPA 1HO1A 2EG7A 2BVDA 1WZLA 5D8ZA 1EFZA 3VIIA 4EOUA 1TSIA 4YN5A 4ZTXA 4WZHA 1TWSA 3FW6A 3C3UA 1MNSA 1QO2A 4H04A 1FWCC 1TZZA 2A21A 4BQ3A 3LXAA 1WX0A 1QOPA 3GBDA 1JI2A 1VFLA 1KRAC 4NAFB 4L4PA 2B4GA 3PZUA 3NAVA 4A22A 2J4GA 5M17A 1EO5A 2PODA 3TC7A 1RUSA 1DL3A 3PBYA 3AHYA 3GXDA 3UZWA 3PBGA 2IKHA 4IMAA 1LLOA 1SYTA 2E9BA 3FXYA 2QCFA 3BAWA 3V5FA 2IQDA 2QUMA 4UR7A 3LN3A 4S1FA 4G2DA 4KW2A 3CMJA 2DJLA 4JL2A 2DZTA 3EXTA 1YE4A 4AXKA 2O9OA 1EQPA 1W9UA 2QYGA 3RR4A 3W1QA 1UOKA 3I68A 3PB2A 3R8HA 1VLIA 1R2TA 4XVEA 4Z1BA 2G3IA 3YPIA 3VKJA 4LPCA 4MDPA 4D1JA 1JF5A 3R7MA 3VDAA 2RH9A 3FLUA 3SRHA 1WUEA 4PTXA 2GQ3A 3ES8A 3WDPP 1NQ6A 3FDKA 2CNCA 4EIVA 3V16A 3CQHA 1R9YA 3AU2A 5KMYA 4ZQMA 3E0FA 3P81A 1QW9A 2GSJA 2X0HA 2ZX7A 4M56A 3FKRA 3R13A 1HKMA 1LQ2A 3NQ8A 1LQAA 3WMLA 4HZMA 2OSWA 3WUBA 3MBFA 1Q6GA 3R43A 4IWWA 5FF3A 5XINA 3WLKX 4CD7A 1P6BA 3EXSA 1GKRA 3SCTA 5F7UA 2WJFA 3EDJA 1PKNA 5FF0A 1ZUAX 1PZ1A 3TR9A 2WVTA 2XG9A 1TPH1 3WNKA 1S5NA 3VIHA 1RD5A 1RCOB 1E6PA 1F8MA 3S5SA 3NPWA 4H19A 2WPBA 4DN1A 5HQLA 5I6SA 1H61A 3RNDA 3AO0A 3B97A 3LHWA 2IKIA 3QVQA 4JL1A 4B5WA 3BMXA 1BXBA 1Y5XA 5LYRA 5GNYA 5I3FA 2F6KA 2O7SA 3F5JA 3UZYA 3EX1A 3SECA 4GXWA 1VJIA 3H4WA 4YTUA 3WFAA 3ZWTA 2CBVA 2CLMA 3DFTA 3TC6A 1LWIA 2FTPA 4NZ3A 1A50A 1O5KA 1GPWA 4H8HA 5EU9A 3LLFA 4OE7A 4L1WA 4LRSA 3W3OA 2GVGA 2DP3A 4G7FA 5C6MA 5TF0A 3GB6A 3QHMA 3VDGA 4MNJA 4KESA 2PAJA 3VKBA 3TNBA 3E1F1 3L5LA 2W92A 4AVFA 3M0ZA 2ZUTA 4XG1A 1KFJA 3LCHA 3KP0A 1KM3A 4FXRA 2BX7A 5JBEA 5HJXA 1ZPTA 2AMGA 3OG2A 3EB3A 3P61A 4OOUA 3K13A 1KLYA 4GWEA 1HIZA 1KNWA 3IJLA 2AGKA 3W24A 4OFCA 3HTWA 4GCXA 2ZXAA 5G1MA 3H2EA 4ZBCA 1R7OA 3WD3A 4GXPA 2DZPA 3WQEA 5AYIA 1AG1O 1YX1A 5I24A 3EMZA 1VBJA 5TQLA 1VAHA 4R27A 2OWCA 3WSUA 3CQKA 3QH2A 5BXPA 1KM2A 1NF7A 2W61A 2XFYA 1UPMB 4M19A 2WC7A 3N29A 2EPLX 1AH3A 4LS2A 2ZTJA 2PDHA 2XVNA 3SI9A 4GO9A 4AWEA 3AZRA 2WNWA 4O8RA 4BI5A 3L0GA 4GVGA 2A1YA 3I7SA 4CD6A 1MEWA 1QTWA 1O5RA 3MSGA 4TVDA 4PH6A 7XIMA 4A29A 3DFQA 1B4EA 1QBBA 2NUXA 1XIIA 3WH5A 1FKWA 2BODX 2LLEA 4NUWA 3JZEA 3TSBA 5AZ0A 4A4AA 5BXSA 3WNMA 1S2TA 3DI0A 1LWJA 4ZQPA 4N4QA 4JX6A 1U30A 4A21A 4M6VA 4D8LA 2QEZA 3ISIX 3AOFA 1C8QA 4AWSA 5A8OA 1W3IA 1Y0EA 4POCA 5HJLA 3UJFA 1W1PA 3NPUA 3TZNA 4HCHA 3FJNA 1T5AA 1TPUA 1R3SA 1CENA 4L1XA 3L9CA 1BWVA 1H2JA 3CL7A 1QWKA 3LI0A 4JYDA 1MMFA 1XQLA 2DT0A 3ARQA 4Y8EA 2OX1A 2OOGA 1JPKA 3F5KA 1VGAA 2ZZ5A 4JTHA 3LENA 2YL6A 1HO4A 1YNPA 2NX1A 5BOOA 2WSYA 5CSSA 4X3ZA 3AFBA 3ZWSA 1L2QA 4MWAC 2E67A 2VGFA 3AIRA 4Z2LA 2F6UA 4KWVA 4AB4A 4LVFA 3UA3A 3MDWA 4H2HA 1HXJA 1VFSA 2ZRYA 3ONCA 3CPRA 4H9UA 5HNNA 4UQEA 4QSFA 3VGDA 4JZ5A 2WHLA 3SO7A 1JRBA 4TR9A 2R82A 3HU7A 1IYXA 4QTGA 4FO4A 4H1ZA 3BK0A 3BW4A 3QV8A 5CJMA 2DPEA 1S2AA 1MXGA 3UYIA 3W1TA 4AWTA 4LX4A 3OZMA 1PIIA 4ZTYA 3WD0A 2BTMA 3B0PA 3ATZA 3BG5A 4QG9A 1UWQA 1JPDX 1ISWA 4NYUA 3LDVA 2NLIA 3FK4A 2O55A 4NI3A 4C60A 4EANA 4YNGA 3RF9A 2QS8A 4RPPA 3QMRA 4W84A 4LF2A 1KXQA 4OBRA 1XYCA 1Z89A 2GDUA 2DJXA 2QPSA 3HGOA 4BQ2A 5CPSA 1XUZA 5U4NA 2WZTA 5RUBA 3CH0A 3O16A 5LGZA 1ZGDA 2CC0A 2J7DA 1LL6A 4UOZA 1VIWA 3R0UA 3STPA 3TK7A 2Q3RA 2YCLB 1R46A 2D24A 1SGJA 3WQ8A 2QT3A 3I6EA 8CGTA 4Q6JA 1QPNA 3WK1A 1ADSA 3CEPA 2B7OA 1WDPA 3PTMA 3N34A 6REQA 2NUYA 2V63A 4UQBA 2CLEA 2E7FA 4PSRA 1LP6A 1I0BA 1V51A 3CU2A 3W22A 3GY1A 4AD5A 2CZFA 4YS1A 2CBJA 1FHUA 4QNWA 4DJEA 1HL8A 4GIAA 1LCOA 2ZZ6A 3QXBA 1LOQA 3VI2A 1TTQA 4D6GA 4RUBA 1CXHA 3PF3A 4PEEA 4RNFA 3EEZA 4PCPA 4FNTA 3ABSA 1GQJA 3C61A 2ZDSA 5HMDA 3UZ5A 1JDDA 5AHFA 1KXVA 4MY1A 4JEJA 4LS1A 4BF5A 4E3TA 4JKLA 4GZJA 2YZRA 4CCEA 2WNZA 1SUXA 4J3TA 2ZUMA 2VC9A 3M0VA 3KL0A 3G3DA 2VKZG 2FB2A 4PE8A 1HW6A 3TVAA 3ZLFA 2NZLA 2W27A 3CYJA 4B9ZA 1XJBA 3FN9A 4CU8A 4MFEA 2Y5EA 3SY1A 4XD6A 4HCLA 1JCMP 4GO8A 1VBRA 1CZ1A 1RLCL 3SIMA 2X40A 1J93A 1P0BA 4M51A 3HQ1A 3VOGA 2Z4GA 1OCNA 2W0UA 3V35A 4R33A 3R10A 3W1AA 3UWEA 4KERA 3IIVA 4GY7A 3AU6A 4FF7A 4QLJA 1G9HA 1ONRA 2IPJA 1OIFA 1XC6A 4CEXC 3REQA 4AD2A 1W2VA 3E0IA 1A4LA 4PBGA 1Q8AA 3T1GA 3BWWA 1WB0A 3RYSA 3MUCA 4KRTA 3LB0A 1Z32X 1VPXA 3BLLA 4MPKA 1HX0A 3IGUA 3N12A 3MMTA 3GFYA 1XLCA 5C71A 1A5LC 2RKXA 4U2ZA 3GIQA 2BFGA 1RK6A 3U48A 3W2MA 3WD4A 4AFYA 3EX3A 4LF1A 1SW7A 4B3ZA 3WDHA 2R8WA 1X6LA 4GYFA 5D05A 4OUEA 3TFCA 2J7GA 3QN3A 4AY7A 1QI2A 3OLDA 3P93A 2DVXA 1YLVA 3PWAA 2WNQA 3BUVA 2XGZA 4BEUA 3HG3A 3MUXA 1D8WA 3SBFA 3QPYA 2V2CA 3WEMA 2V5KA 7A3HA 1NP0A 1ZY9A 1QNRA 3CZKA 1B3ZA 3KBWA 3F03K 2A3BA 1ZBKA 3PNUA 3C0JA 4QISA 4MWAE 3O6DA 3W26A 3S2LA 1RBAA 1J5SA 1EUAA 1Q45A 3FYOA 3ZM8A 1EJWC 1WKDA 1H0IA 4ZCWA 1BKSA 3XINA 3WBEA 1BSLA 3GSMA 2ZDRA 2V38A 3R8GA 1VCFA 2JEQA 2I14A 1UG6A 3P82A 4K8GA 1K9EA 3AZTA 2HPIA 3TWBA 4MGGA 4CKQA 3HGJA 3INPA 4FB7A 3M0YA 4WIWA 3AIBA 3F4VA 4NNBA 3WZ0E 4PRTA 1EH9A 1CCWB 2VCCA 4BEQA 4JYEA 2FYMA 3DOPA 1H49A 3BXWA 3LA4A 1EA0A 3WQ6A 2OG9A 1SPQA 3QJAA 2YR1A 3L68A 4LCSA 3MDUA 1TV2A 1LDCA 3AISA 1XCXA 3ABQA 1Q2SA 3ALGA 4M24A 2W63A 4UTWA 1OFBA 2VEIA 1U5HA 3BGJA 1G1YA 1S2UA 3QV6A 3NQFA 1XPGA 4QE4A 4TMCA 2PDUA 3VPLA 4C91A 2D2JA 2NQJA 3OYZA 2BS9A 5HOSA 4B2DA 1NSJA 1PUDA 1ZHAA 4DNHA 4GVIA 4IG2A 4R9OA 1KFWA 2ZC8A 4CU6A 1V0LA 1GONA 4JN7A 5D2XA 5FJIA 5U7SA 1FQ0A 2IXUA 1A3XA 1DHKA 1RK5A 3VFCA 1Q6FA 4MYAA 1ZQ5A 4Z42C 1BPLB 3SSZA 4YVVA 2EPOA 5AKQA 1KCLA 1GYMA 1BXCA 8XIMA 2GJPA 4KCUA 3K5XA 1WOAA 3QBUA 5CPOA 3A4AA 4HOXA 3UZJA 1JAEA 1O94A 4GUGA 3UG8A 4FX7A 3IIXA 3DFYA 2ZUSA 1DQUA 4KH2A 2WLYA 4M7SA 1WV2A 3LV6A 2E5CA 1K4HA 1TTJA 5A69A 5ABFB 1UJQA 1E15A 2HTMA 2B7PA 2YFNA 1POJA 4F2BA 1TPB1 3R79A 2XU2A 4DWSB 3R11A 1TX0A 5D2YA 3T4CA 3CV7A 2X09A 3NDOA 3DHPA 1WBHA 4JY9A 5KEZA 2YJQA 7PTDA 4G7EB 1I9CB 5MHBA 3C0QA 4Q8WA 1W6TA 4HMDA 3LEPA 1WYIA 3NQBA 4A05A 1IEVA 1OF6A 2DUXA 4LVGA 1YDOA 2CZEA 4J3WA 1HL9A 5LA1A 2GWGA 3IJ7A 5I3IA 5M2FX 4IMCA 4CUCA 3BTNA 3UNDA 1DJXA 1EJSC 4B2DD 3I4EA 1AUSL 1RA5A 1TJRA 5BNKA 1SZFA 3M0LA 1GVQA 2WBGA 1S2CA 2J47A 2XGIA 1VD6A 2QIIA 1R38A 3UVAA 1UR3M 3TW6A 2QUVA 1XYBA 3BJTA 3VNLA 3GC5A 4FA3A 4RE4A 1VFTA 4J35A 1FFRA 1IGSA 2DZUA 3I7RA 2WO5A 2XHYA 4XZNX 3S5YA 4QJ3B 1WDSA 2DDXA 3F5LA 1JYWA 3BOLA 4XAYA 4FZIA 4JTJA 3I10A 3MBDA 5IHSA 4IL0A 3UERA 2BWGA 3WDJA 2WVVA 5EL1A 5REQA 4EE9A 2DZAA 1FHDA 3VUPA 4OOZA 1A5NC 1VEMA 2ZICA 1X1NA 4DO5A 2NV1A 5CPQA 3O07A 5FF4A 2PURA 1IXOA 4Z2IA 2AQOA 2PZ0A 3LBCA 4GNVA 4S3GA 4AIUA 4KETA 3STFA 2J6VA 3C2VA 2CERA 1A5AA 1BQGA 1Q66A 1W3JA 1F7BA 3O06A 4UFJA 4QCFA 1VR6A 5DLCA 5G1YA 1FHLA 3KZSA 1SO4A 1NM9A 3ECQA 3EWCA 5DELA 3AXIA 3WLMA 1JGMA 4NILA 4KMQA 4R3UA 2E6DA 5CH9A 2GVLA 1EPVA 1MFVA 1L8NA 1JPIA 4LYPA 1VYRA 3VIFA 3BMVA 2Y5JA 3VA8A 4N6FA 2D23A 3LD5A 5E6ZA 1LL4A 3UNTA 3LRKA 3D3AA 4N02A 3EWWA 4AHQA 2FHFA 1Q7ZA 1ZP3A 3UGVA 2WC4A 3TA6A 1F3XA 1GOKA 4JIRA 1UWSA 5C5YA 3VMNA 3OYXA 4YPJA 5B7ZA 3UETA 4AZHA 1JYXA 4XD4A 3NEHA 3LRMA 2GSEA 4Q4RA 3J7HA 2YKKA 1UR8A 2J88A 1ZJAA 3AXKA 1JCXA 4JTAA 2PWHA 3U7VA 3QKEA 4O1BA 4CQCA 1M53A 2CZ5A 4KEVA 4O50A 4WD0A 5ABHA 1D3HA 3VKAA 4AZ6A 1ICSA 1NU5A 1R2SA 4L9ZA 4ILSA 2OCZA 3H23A 4ZB0A 3W7HA 3CASA 2RDXA 3EDKA 1Y5VA 1CXFA 4NZ4A 4CQBA 4UFMA 3W1NA 3ZSTA 4C6OA 5FKYA 3RCYA 3R5EA 3FIGA 2H3DA 1FXPA 4FOKA 1JJKA 4GY0A 3KM8A 3PZNA 5DANA 2G41A 2Y5SA 4YMZA 2NWSA 2INFA 4JIQA 3TEVA 5H1WA 4JFVA 2Y4SA 1K3UA 3W37A 3GH5A 3ITOA 4HSHA 4RL3A 5D8WA 4K36A 5AN7A 4UTUA 3P0WA 2XN1A 4X9YA 2W6RA 1EWDA 1YNYA 5JU6A 1MW0A 1O7AA 3DXIA 1JI1A 5AECA 3LTSA 2Y63A 4UXDA 4DO6A 2ZX5A 4FXFA 2E09A 1XF0A 1EZWA 4PMUA 1UH3A 4ZE5A 1E1CA 1WPCA 3S6OA 5EMKA 1W3TA 3AIUA 1MQQA 4AHPA 3AS1A 4D6CA 4JTTA 1ZBVA 1ADDA 4LQ1A 3W85A 5BW6A 3VILA 3AMLA 4RDWA 1GYLA 4HA3A 2V3EA 2YBUA 1MW2A 3DYPA 3GVRA 4Q33A 3GS6A 1KQYA 3QTGA 2Q8LA 3W83A 5CG7A 3EMCA 4CNPA 1PDYA 3GKAA 1S38A 3NQVA 2FPVA 1A47A 1QOXA 3MCNA 3UU0A 2YZ5A 5KSWA 1RVKA 1L6SA 2Q02A 1YNQA 4J4KA 2OLSA 4F0MA 1LBMA 1JGIA 3N73A 1YTEA 1A5BA 3BICA 5JVLA 3U2EA 4I8YA 3TYZA 4IIDA 4MHBA 1V6VA 3W53A 4E5TA 4G9PA 5I2UA 4NKCA 4AVNA 3P7YA 2DZBA 3VMPA 3OEXA 3CUIA 2A4AA 3RJXA 3F2CA 4FLQA 4C6LA 3AROA 3VOHA 3N9RA 3WLSA 5LXEA 2G3JA 3LGGA 3THUA 3SSJA 1K9TA 2GUYA 1OC6A 5A6KA 1CDGA 1UWTA 1TELA 4YWSA 2Z1WA 3WX7A 2PTYA 1LLZA 2QCEA 1EJXC 3EWUA 2HJPA 1EDQA 4HHPA 1EJTC 1KFKA 5B80A 5FF2A 2QCLA 2WZMA 2Y0FA 4J3UA 4PMVA 1W1VA 2FZDA 1BRLB 3N19B 3IJ9A 2OYMA 1R5YA 3U2ZA 2R91A 1FH7A 1GOOA 4J3SA 4Y96A 1QK2A 2GLKA 3A21A 3B9EA 1AZ1A 4UCGA 3GG7A 1OABA 5DX7A 4ZOEA 3W29A 3MVTA 5CZJA 3P3BA 3MPGA 2EPKX 1B54A 3LHUA 4PUDA 3W38A 4MAVA 3CUFA 4NAEB 4CD4A 1XCWA 5I03A 3L2MA 3GUGA 5IDIA 1XFCA 4DYKA 2CKSA 5E0CA 1I2RA 3MHUA 1KW1A 3GDTA 3A4XA 5CGQA 2DQXA 2J8TA 1PS9A 4D6FA 4NX5A 2WKGA 1ZSXA 4HQVA 3ZJ8A 1SSDA 1XBVA 1IHIA 4TQTA 4S2CA 1GUVA 2V8ZA 1GOWA 2DUZA 1V7YA 3OZPA 2HXTA 3Q65A 5A6MA 2ON3A 4HGXA 3AXXA 4DBSA 4JIPA 1NDVA 2OO6A 2VFHA 2G97A 2OX4A 3ZVHB 1PTAA 1DJIA 1KM5A 4LVBA 1TA3A 2C79A 4GYJA 4S3JA 3QGKC 3BZGA 1QO5A 3W71A 1KC7A 5FEPA 2VT0A 4ML4A 3LV5A 2ZBTA 2PGFA 1KB3A 2WZHA 4AXNA 4MB1A 3JW7A 3PZOA 2BSLA 3ZOAA 4ZR8A 2NX3A 2ZX8A 3BO9A 3VGEA 4GJIA 3GXPA 2FMOA 5A6BA 1J18A 3LQGA 3MCOA 1TVPA 1GTHA 4AZ5A 7CGTA 4IFKB 3MQTA 4C7GA 5EBUA 3GE7A 3HN3A 1V4YA 4KPLA 3WJXA 3R89A 2YBTA 3PTKA 3L23A 4JHMA 1MEHA 3CUHA 4C6CA 5HNTA 1V6WA 3N6HA 2ZWZA 2R1NA 4JHZA 4WKFA 5FJTA 4LFYA 4A8RA 1YDYA 2BP1A 1T99A 3WD1A 5CBIA 4MMWA 3GXIA 4CQ8A 4JIEA 1JL8A 4HU8A 5L9FA 3M0IA 3UCQA 4JX5A 3IK4A 2DV0A 1SFLA 4V2XA 5D37A 1FRBA 1T41A 3O05A 1WQ5A 3DGRA 3AXMA 2VELA 4UTKA 3EX6A 5EPDA 3BOFA 2CETA 3BCFA 5D2TA 1OT1A 1YBQB 4Y8FA 1E4NA 3C2OA 5EY5A 3A9IA 5HA7A 1MQRA 3KDNA 1B2YA 3LM7A 1TYGA 1EJUC 4GK8A 4S3CA 5DRIA 3G22A 2HK0A 1NWUA 5CAHA 4GISA 3WL1A 2C7FA 1EXBA 2OWWA 1QXLA 3WNOA 3CHDA 4BI6A 1DJHA 3QGVA 4I90A 4NASA 2PLJA 3UWZA 3QPZA 5XIAA 2Z7GA 2GUBA 2PD9A 1J6PA 1OC5A 2GVJA 4PMZA 3ARYA 2Y61A 4HN4A 2AAMA 5HMEA 4AC7C 3TJLA 2DIKA 5FEWA 3ARVA 4IJCA 2E77A 2NSOA 2PWEA 1U22A 4ORIA 3SFKA 1E72M 4E4FA 4PMOA 1ITXA 2GGIA 4DJEC 4PB5A 1XLHA 1LWHA 1CNVA 4QM1A 3K30A 4F66A 1J0HA 4B91A 3AHVA 3EXRA 3D0CA 1L9WA 3WQPA 9RUBA 4PMYA 1JD9A 4LCQA 3WMCA 3N13A 2NVAA 1I0DA 3LZ5A 1A80A 4XKYB 1L0PA 1K02A 3ITYA 4O52A 4XZWA 3OW1A 1P43A 1Q8JA 3KP1A 4L61A 4C6PA 4JTFA 1C8XA 4OECA 3N4FA 3E3HA 4OGZA 1XKJA 4KKXA 4NQ1A 4RV8A 3TQPA 2VWSA 3NA8A 4JNYA 1EB3A 1FXQA 1J01A 2BVTA 2VR5A 3SZ8A 2HXUA 3RMJA 2O0TA 1OYAA 1SM9A 1EX5A 1W3NA 2QDDA 4GCAA 3N2MA 2PRMA 2VUYA 2EXOA 4PUNA 3FXGA 1I45A 4TV5A 2AAAA 1P0KA 1Q6QA 2ANUA 4UTLA 3RG6A 3GIYA 5A2BA 4HMNA 2V3FA 1KRCC 4D8AA 3VOJA 2I17A 4L4LA 1IE7C 4DF2A 2Z26A 5BYWA 2FZBA 1E6SM 1A3HA 1YDNA 4M29A 3PPHA 2VENA 3NVDA 4U5IA 1I6NA 2P3ZA 4QG6A 1ITCA 1EZ2A 4XD3A 5CG0A 1QMLA 3BANA 5A8NA 3N6JA 1PYMA 1GVEA 3UG3A 4ZOCA 1DE6A 3AYTA 5CPTA 2O4QA 2WWDA 4NXKA 5C9ZA 4O53A 1B5TA 1H1YA 1SZRA 3UPWA 1SJAA 1Z42A 3QPEA 3QY7A 1FWEC 1Y7VA 3IJ8A 5GQBA 3EDFA 1TPEA 3M46A 1IT0A 3CAWA 3S2NA 4LXFA 2FFCA 1F74A 1ML1A 2YCIX 3ANUA 3CT7A 4F9JA 2F6XA 3WBYA 1BQCA 2ZRUA 3BL3A 1Y65A 1TJ0A 1CWYA 4PN2A 1CXEA 4B92A 3EOUA 3W7EA 2PMQA 2X1IA 5EFFA 3H2FA 1M7XA 1V0NA 4HVXA 2QR6A 4XV0A 4FXSA 5CPNA 1ZCCA 5E93A 1XGEA 2VRKA 4IX0A 3R12A 1RSCA 3P8JA 3GDRA 4OKDA 3QR3A 4AZGA 1YXCA 3S3GA 1WO2A 3VKCA 3K8KA 2WZEA 4M6QA 4AISA 1EX1A 4B4HA 3MVIA 2VFGA 1X97A 3N04A 2E0PA 3W7QA 1JAKA 4PRRA 2EPHA 4LUTA 4DVOA 1P4CA 2E1DA 2CYGA 1WXYA 4WKHA 2QQ6A 3GAYA 3PUGA 2A6NA 5G2WA 3SB0A 3VCNA 1OK6A 1J11A 1XIEA 3URAA 1HFBA 1LUCA 3NZQA 3TUUA 1SSGA 3EPOA 1G94A 4WRHA 3ZLGA 4Q4PA 4RNIA 3B9NA 4H8UA 1PX3A 2YXOA 1EGZA 1EC8A 4WGHA 5IM51 3G8EA 4QCEA 1J8VA 4MUZA 1QPRA 1V6YA 1DXIA 4JCMA 1OBAA 3CWNA 5H6HA 1K4GA 3LERA 1JFXA 1EC9A 1HKVA 1UP2A 3UJSA 2XH0A 3EMQA 4PTMA 2CLKA 2GGGA 4JY8A 5JBDA 1OM0A 4OIFA 4LH8A 3TSMA 3POHA 4A8LA 3ID7A 4J40A 1IWAA 3RRXA 1A5MC 3TTSA 4URIA 3PBMA 2JGYA 1AL7A 1W9DM 1E9YB 1P0NA 4Q7NA 1UR9A 4US5A 1WZAA 2ZRWA 2WHMA 4UTWC 3W74A 1E5JA 1ZP4A 4JS3A 1XG4A 2WMIA 2FGLA 2QZRA 2ZUVA 4RNHA 3NOYA 4LUSA 1UIOA 2NUWA 3ME3A 3TOPA 4DYJA 1BWLA 4FLOA 3WH6A 4AYSA 4DO7A 3LLXA 3L67A 2RDUA 3A5VA 2DZWA 1XLEA 3KFTA 3FGCB 5G2IA 1QW7A 4PCNA 2OO0A 2X2GA 1DIOA 3SUSA 2DGAA 5I78A 3L4YA 1TPDA 4PGLA 4RK8A 4KFOA 1RH9A 1JYNA 1HTIA 1T96A 4ES4A 4H9XA 4UOQA 4WVXA 4G6CA 1GVYA 3RUBL 5DMMA 2XZ9A 3MP5A 2YW3A 3W2NA 3W7MA 3ARUA 1AD4A 3A3XA 2WQDA 4C6KA 1YE6A 3HPFA 5TNVA 5I09A 5I3KA 5D4YA 3TOYA 1XRVA 1M9HA 3SN1A 3LHYA 2VJXA 4DM1A 2DW6A 1LL7A 2VX4A 4Y2WA 1DBTA 5SWUA 1VCGA 2WM0A 3ALFA 3L12A 4W7UA 2PPGA 2GJNA 5EMLA 3VNKA 2X1TA 3Q67A 2ALDA 2VR2A 3DKJA 5DT5A 3NQAA 4LEFA 5CZSA 1FY6A 3ZQ9A 1PPIA 4AD0A 1FWWA 2VFDA 4OBTA 3QTPA 1Q6OA 2O56A 4DY1A 3SN0A 4UTTA 4F0HA 4RZBA 1XICA 2EPNA 3DENA 2G4FA 3MI3A 4DRSA 4ZQOA 4P8VA 4ACZB 4KRUA 4US5D 1CGUA 1MDRA 4ZO9A 4QBXA 3M5ZA 1XGZA 3ZT5A 4M8UA 2W5FA 1XLBA 1W1IE 1E3XA 1U5VA 4LW7A 3UXLA 4XBSA 1JCLA 4GKLA 3DI1A 3B3DA 1FWJC 1TRDA 9XIMA 2OMAA 1AFSA 2PF8A 4JGDA 3M5XA 3I3BA 1D7FA 3KL3A 2X8RA 1JZ2A 1DV7A 5DBTA 3IS4A 3EWDA 5A6SA 4H9VA 2Y62A 3FHAA 4HOZA 4TXEA 2HBXA 1TMQA 4IFOA 2ACQA 3ZFHA 1IXPA 2JKPA 3RU6A 2VXNA 1H1NA 3SCUA 4TVUA 1FCBA 2FIQA 3D3FA 2Q3OA 3HGSA 4RNJA 1FOBA 3TN6A 2J77A 1EF2A 3BPWA 1OFPA 4WDWA 1E6ZA 4UWMA 4QJ1A 5CZ0A 4E2VA 2X1SA 3VUSA 4ECLA 2JE8A 2NVDA 2V6AA 4B90A 4YVXA 1PKMA 3GTIA 1BFNA 4WCJA 3S0CA 2OJPA 4DWSC 3C5QA 3KBJA 4W8BA 1GHSA 1PCKA 5IFPA 3N17A 2Z0IA 2C18A 4DAFA 2BGSA 6ALDA 2Z1SA 4XWUA 4XD5A 3NPVA 4ACZA 2OLHA 2ZZ4A 1DVJA 2VL4A 4MIMA 2ZZ7A 1HVQA 3KWSA 1TPC1 3ABOA 2P50A 2Y8UA 1AQHA 5TD4A 2DVUA 4JTDA 4P7QA 4C5YA 2ZRXA 3AS0A 4NU7A 2C14A 3T8LA 1LM1A 3MYPA 3QZAA 1XIBA 2HVMA 2B7NA 3WEZA 4O28A 5AC7A 1N8IA 4KRZA 4DZHA 2O7QA 2WMHA 3H54A 4GMEA 3MUY1 1BKHA 2BY3A 2J62A 3DEQA 1GQIA 3IAQA 5JXQA 2E6YA 1IIGA 5FF7A 3GM8A 1MYRA 1DWIM 2VP8A 4IQDA 1JDCA 4E3VA 1D7KA 1O66A 1R2RA 1E9ZB 1NOFA 3ZIZA 3GD6A 3DN5A 3IANA 1Z8AA 3N1AA 5BRBA 4A3HA 1R3QA 3L65A 1O1HA 1PHQA 3L66A 5AYYA 4QROA 1KM1A 3FV9A 3E5PA 4ML9A 3IGSA 3W02A 4TX8A 4INFA 4S3DA 5AFDA 1GG1A 5D32A 4IGMA 5CBJA 1Q4NX 3QYQA 1QNOA 4WSJA 2J25A 4XK2A 3DBPA 3F1QA 2XSXA 4LBUA 5AYZA 5DF0A 4WY0A 4ZENA 3WLPA 3S1GA 4LVDA 4XZIA 2OEJA 2YX0A 1BWKA 3MYOA 2E8YA 4GC4A 1KGWA 1O95A 5LHFA 7REQB 6CGTA 3G0XA 4J28A 3H7RA 1ZENA 1NTHA 1LT8A 2QCMA 3W2KA 4S3BA 1XYZA 2X16A 4YWIA 1ZRQA 5CQ1A 2PDQA 1VEOA 3CBWA 3LGDA 3OVGA 4B16A 3UG5A 1RY0A 2DH2A 2ACRA 3TXZA 3ARZA 2TYSA 4TMBA 3EDEA 3TXVA 4JQ2A 2Z7KA 3LGEA 2CCRA 3VMOA 3MZNA 1YPIA 1JYVA 4KCVA 4C6DA 2XIOA 6PTDA 1QU4A 3SN4A 4WDTA 4J27A 3C8FA 2GVEA 1VP5A 1SR9A 4BR1A 4L4MA 3E96A 4H3DA 1H3GA 4GY1A 1M41A 3H21A 2Y8VA 2YCEA 3MSRA 2VI0A 4HCDA 4M0XA 1PX8A 3MP3A 3NQ6A 2EPMX 1GVOA 4GUHA 4IPJA 5JMUA 1N82A 2I57A 1NFPA 3EKZA 4JQ3A 2CPUA 2YCJA 3W7JA 3M7SA 2GJXA 4PFMA 5AHMA 4L4OA 3GTHA 4DYEA 3ITCA 1AJZA 3LCLA 3CO4A 2QLYA 3DZ1A 4GE8A 3W75A 3U0HA 4NXSA 3IPWA 3FNDA 1FWAC 1TJ2A 3WLLA 2XN0A 1Y8BA 4C1NB 3BAJA 1HJUA 2CHRA 3MT1A 5C54A 1TE1A 5LIKX 5CBBA 1M03A 5LA0A 5I3HA 2Z25A 4HD5A 1XIHA 3SUVA 4HPJA 5J04A 3TLLA 1W91A 2BB0A 3W00A 4MNLA 2XISA 3P2VA 5ECUA 3R25A 3W9ZA 1M3UA 1XRSA 4AEFA 3WF3A 1I75A 2XJ7A 3U2CA 2J24A 4JICA 2NQHA 3MMUA 4W86A 1IR1A 1P0EA 1UJPA 2J8FA 2F84A 1VBUA 2PGWA 3W1PA 4B15A 5JH1A 4IMEA 5E0KA 4A3UA 3ELFA 1N55A 3KVKA 3VTRA 4IOTA 1TB3A 4O19A 3FA4A 3KDOA 3NSXA 1S1PA 5CC7A 3EBVA 1CPUA 3H24A 3HQOA 3C0SA 2SFPA 4H6EA 1BG4A 4JHOA 1P48A 2XTKA 3PJXA 1OVDA 3MMWA 2YA0A 2PDPA 3P0XA 5DCDA 3RJYA 4BF7A 5FCZA 5A1AA 4LY8A 2HS6A 3T0AA 3B8UA 4AZCB 3KCJA 4TV6A 2ZC1A 5E9XA 3TYAA 1DJYA 1V3KA 1OFEA 3N2TA 4WGXA 4M3PA 3D47A 3USZA 4ATWA 5HUPA 1OCBA 3WQVA 3K8MA 1JCYA 1FWBC 3HG5A 3KS6A 4O18A 2UWFA 3N18A 3FSTA 3NQ2A 2Y7DA 2QIWA 3D5HA 1XH2A 3T8QA 3QQWA 3WK0A 4C1LA 1D9EA 3TC3A 3IGHX 3S4TA 3GAKA 4CVWA 4DJDA 4LALA 2P0OA 4D9PA 1HJVA 2FHBA 1F61A 4I9TA 2I56A 4Y6GA 1CXKA 1E9IA 2YXGA 2NT1A 5HINA 4I9AA 2FTYA 1VBGA 4NZ1A 3WDQA 1I1XA 2ASHA 1V6UA 3UFYA 3OLIA 3T2PA 3O6AA 3QR0A 4Y90A 3DHFA 2WCSA 4Y7EA 3BCDA 4WQ6A 1X98A 3VDBA 2ZE0A 4J3ZA 3VNZA 1AW2A 1RBOB 4O14A 1OFAA 3GVQA 5FSDC 1DTNA 1V7AA 1KCZA 5C55A 5H2ZA 2VZOA 1GWJA 1JVNA 4LV9A 2IKGA 3OBEA 3ORWA 1GHRA 2I5GA 1XRFA 2AOSA 4IPNB 1ZFJA 4IL2A 4RPQA 1O1ZA 5HULA 2CU0A 2WMFA 3NQ7A 3RM8A 1V79A 3W7PA 4GX9A 3LX9A 2C1HA 2VTFA 1P7TA 2QMKA 1NIUA 4IH3A 1V3LA 3JS3A 1C9DA 4IQLA 1X39A 3FOKA 1M7JA 1W5MA 3W6YA 4S3FA 4N2YA 1UIPA 4QQ3A 3B9OA 1X1ZA 2BVYA 1Z69A 3TA9A 1EL3A 4KIEA 1XYFA 3TN5A 3NL5A 3RM4A 3GDMA 5TIMA 4CN4A 3KAOA 2Z29A 5LSMA 3SM0A 3T05A 1U1UA 2ABBA 4Q4KA 4WJ8A 5EMJA 4Z1YA 4JFSA 3PTDA 5AHLA 3LPOA 4YU1A 1GPFA 2OFJA 1YQ2A 2X0SA 3OU8A 4DJDD 2PUZA 4HK5A 4ZSUA 1XSKA 3LCXA 3AQUA 1BVWA 4C6FA 1BLIA 1JFHA 4CN1A 2P53A 4F3HA 3GDKA 4S23A 2C1IA 1R7AA 1OFDA 4PMQA 5AVHA 2WM1A 2CWNA 2V9DA 1JDEA 2RDTA 4N9DA 3LTYA 2DH3A 3CNYA 3QR1A 4GI4A 3GG8A 4PYSA 3WQDA 1G69A 3QQ0A 4XKMA 2H8XA 1ZLPA 4D72A 4O10A 3M5YA 3PJTA 1MI3A 1Q6CA 3L2IA 1KTNA 2QVHA 1E6RA 4IIBA 4JQ1A 4DX3A 2VGBA 1J2WA 3NPXA 1AMYA 5EMYA 2Y6ZA 3TN3A 4IXHA 1Q7MA 3W6LA 3T6CA 1J0YA 2ESCA 4IPIA 1XLIA 7TIMA 1W5OA 4AQLA 4EXBA 1QR7A 2VEKA 5A6JA 3PZQA 1W5PA 1B4KA 1HGWA 4F79A 1AD1A 1R86A 4OT7A 5E09A 3MANA 4DB7A 3UJEA 4LUYA 2BY1A 4WSHA 4ZZ9A 4DLMA 1EA9C 2VYOA 4DJFA 3E9AA 1VFOA 4CQDA 3U4AA 1E9LA 4GZ7A 1Q6DA 1DJWA 3BLPX 3SCOA 1TUXA 4AG0A 1JF6A 3HG2A 2PGEA 2NT0A 2DUAA 3LU2A 1M7PA 4GQQA 1WZMA 3DG3A 3POCA 2I1OA 3OZOA 2XSBA 1M7OA 4WR3A 3VM7A 2NXGA 4JDBA 1UP3A 2FDMA 4CU7A 3DU0A 3T09A 3OHMB 2ISVA 2V5JA 3RR1A 3PVFA 4PEKA 1F4HA 1H62A 4C6EA 5FI8A 3QV9A 3IJ6A 2OZ0A 3HQPA 1XDMA 3DAQA 2VR4A 2YYUA 2PEVA 5JQ9A 2RDWA 3GKFA 2DSWA 2IXVA 4QAWA 2ODOA 2OKOA 3MP4A 4QJ5B 1AODA 4J2MA 2ZUWA 3C52A 4XSMA 4C6JA 1CX9A 3RPDA 1PZ0A 2I9UA 4YTTA 4W8LA 1MO0A 3ZT7A 3GFZA 3SGUA 4JKMA 5DY2A 3E49A 3VX0A 2YDRA 3OA3A 1E4MM 4IUOA 4TX9A 4ZMGA 3O0FA 1MEIA 4PMJA 4WK9A 3W7GA 1GNXA 1KKOA 1VS1A 1NVMA 4KWUA 4AMAA 4EPDC 1LLWA 1TV7A 1CW2A 1F6KA 1REQA 3C4UA 3TQKA 1RJRA 4FXJA 1PEZA 2C3ZA 3CUJA 4GOAA 2PDKA 5GJNA 4DXVA 2VFIA 3CB3A 1XYMA 1B9BA 5HPOA 3VGFA 3KHDA 4XAPA 3LG3A 4E0CA 4PL1A 3PTQA 1DKWA 2QPXA 1AL8A 3IJQA 4LSBA 1KR1A 1B3YA 1U2YA 3GHUA 2ZRVA 2EAWA 4DXXA 4HOWA 4ZO6A 2EO7A 3WQFA 5FJJA 4DO4A 1V0MA 3NJ3A 1RCQA 3W73A 1XBYA 2W4XA 3OJGA 4EAYA 3IEBA 4BQ4A 1WXJA 3E2RA 2B7QA 3MJMA 4UB9A 1I2OA 3I4KA 4H9MA 3N9KA 3TYBA 3WQOA 2ACSA 3IK2A 3N4AA 1YPFA 4X2RA 3R2GA 3T78A 1US3A 1KRMA 3PJWA 3HMJG 2Y70A 2VUNA 1LRNA 1TIWA 5A2AA 3N2BA 1GKPA 3W1RA 3OIHA 5FSEC 1YRRA 3CYVA 4HSNA 4BKNA 4MAZA 4FR1A 1CEOA 2YFOA 1UD3A 4RCXA 4K2SA 3RLGA 3TN4A 1FWHC 3Q4DA 4QEHA 2H9AA 2ZZ3A 3R58A 2BHZA 3A4JA 3SAZA 3VOFA 2VGIA 3KUMA 1G4PA 4GI9A 2PGRA 4P2VA 3G1FA 3E2QA 4GQGA 1J0IA 4WHBA 4JXCA 3TCSA 1XV8A 4LTSA 1WA3A 3CC1A 4H7ZA 1CIUA 4DPPA 4MB4A 3AZSA 1IT8A 1UWUA 2PDWA 3KBVA 5KZ6A 3FYYA 1Q6EA 4ZO7A 4LC8A 3B0YA 4FPSA 4K7VA 1QCWA 4AIBA 4NJHA 4C7FA 1J10A 2EGZA 4HBKA 3GNNA 5AVNA 2XUCA 4K3ZA 5D02A 2ZADA 2FVMA 1BGAA 2EJ1A 1G5AA 4DF0A 4HK6A 3SADA 3BW3A 4PODA 2WSQA 2VD8A 3WFZA 4JCLA 1OFOA 3A12A 4QRNA 4UTIA 5D03A 1D2KA 1R6WA 3MU7A 5E5CA 5EGRA 1JIBA 2ZYFA 1FCUA 3FVDA 1CGTA 2ZVRA 1RLDA 5G4WA 1ISXA 4YTQA 4AIEA 3AYSA 3H2CA 3V0SA 2EG6A 2XFRA 3STEA 3KWXA 3K4DA 4WOQA 3B8WA 2BXYA 2DT1A 4UQAA 4B5TA 4DUOA 4UTHA 3T7VA 4GBUA 1JUKA 3EA3A 4DBUA 1OG0A 2DEPA 2Y89A 4UTTC 1FP8A 2X42A 4AHOA 1UR2A 3KTXA 3VINA 3M1ZA 4GG9A 5A94A 3SCSA 1V08A 2ADAA 4REQB 2OZ8A 4NAFA 2TODA 1E70M 5DMYA 1XIJA 3NWRA 1LRQA 3VK5A 3NQMA 2WANA 3NQCA 3C2RA 2W66A 3GDBA 4LU0A 1MZRA 3R0KA 4UMBA 1OHLA 4O17A 4MUPA 4CVUA 1TREA 1J79A 4LT9A 2REQB 3A13A 3FCPA 3M07A 4PUKA 1BD0A 2GQ9A 3EDDA 4JEQA 1KV8A 1E71M 3S9YA 3NTYA 4MVAA 3THCA 2GK1B 4FS9A 4RZ6A 3ARTA 3KOWA 2RUSA 4FIQA 3GQYA 1YEYA 4AF0B 5FESA 1N8WA 3CT2A 3LSBA 2QHAA 1V3IA 2BXVA 1V3JA 1W8SA 3H7UA 3EWYA 3LPGA 3WF4A 5ECVA 2ZXBA 1XRTA 5FJUA 3RITA 1KCXA 1JD7A 4U10A 1ODUA 5JIPA 2PI6A 4IQJA 3BCJA 1UZ4A 3BQ6A 4ZXOA 2Q8XA 1NWTA 3V7PA 4I8DA 2QGYA 2Z6IA 3VOCA 4U2YA 1I2QA 2QCDB 2P10A 3MCMA 2XN2A 3TONA 3WJYA 1FWIC 4O11A 1XM3A 4CCDA 3OQ8A 1QI3A 3CZGA 1E0WA 1HZYA 3H12A 1G67A 5GJPA 3S9IA 5DY3A 3ANVA 4DBEA 3UPMA 4UFHA 3S47A 3SEPA 1C9WA 4HA4A 4K8EA 1JPMA 4E4UA 1E73M 1XBZA 2V3GA 3F4CA 3LQLA 3V18A 3UZXA 4YHEA 5FEZA 3ZO9A 1RJQA 4HIBA 3QV7A 4HHLA 4R7WA 5CGMA 2CLPA 2ZRZA 3FJLA 4GIYA 2V82A 3RPTA 2C15A 1OGBA 3DYMA 3C3NA 3APYA 3N3MA 1JZ6A 1K9DA 4JNZA 3SRKA 5A6AA 1A0EA 3HBLA 3TJ4A 1MSSA 3CWOX 3W72A 5C2XA 1C8YA 5JIWA 4M6UA 3WDIA 3OO2A 1PTGA 3PULA 4PR4A 4IICA 3WBXA 3CQIA 4K7YA 4UFKA 1EP1A 1WDWA 1H41A 1EGMA 1NQKA 1VPQA 3GHTA 3AWNA 1OQFA 4B3LA 5M03A 1RALA 2HPMA 3CEUA 5K2ZA 1OEPA 4IT1A 1R30A 4YYCA 2CBUA 5BRPA 2XIQA 3TLQA 4U28A 4PC8A 4X0VA 2WW5A 3V5CA 4XIMA 4LUIA 3G5EA 4QS5A 4UZUA 4RKAA 1GZJA 8TIMA 1WE5A 1XCFA 4KIRA 1HKIA 1TV3A 4J3XA 2QCDA 1IR2A 1EWEA 4AY1A 4A8NA 1PZ3A 4A2RA 4PTNA 3HPZA 4FOUA 4JTEA 4B5VA 4PL2A 4GGBA 4HP5A 4R9XA 2Q71A 1I4NA 1A49A 1X6NA 1HNYA 3WG6A 3UR5A 1W31A 1VYSX 1F73A 3W1XA 4NRSA 2J74A 2H8ZA 4DUVA 3PK7A 4BWLA 2NLYA 4MWAB 1W1A1 3I6RA 2E28A 4NRRA 2NX9A 1SW3A 1T0OA 3WELA 3L0NA 2QVNA 1XLGA 3FYPA 1DORA 3M0MA 5D9MA 4HHMA 2VVSA 1E3ZA 4CD5A 3BLOA 4A3QA 1ELSA 3WDRA 2PD5A 1JZ5A 4QR6A 1B1YA 3NURA 1UUQA 2VZVA 4S2BA 3MJYA 3VIOA 2F2KA 1FTXA 2GUUA 2VDIA 1OWQA 1US0A 3AYRA 1LBLA 5GPRA 9XIAA 3VKKA 3SUTA 5F4XA 1QWGA 3NM3A 2VURA 2UBPC 2HE5A 2Y88A 4X22A 1XL9A 4AZBA 1Q6LA 3C2FA 1LORA 4Y9AA 2TPSA 3WBWA 3OVQA 3T55A 2ALRA 3G1DA 3ITLA 4D8ZA 2J8GA 2AQWA 3F7JA 1TIMA 1QK0A 4IP7A 5I06A 3V0TA 2PDYA 2Z1BA 3FX4A 2X1RA 3BE7A 4LGXA 4PTWA 3PWGA 1L6FA 4ATLA 3P84A 2PWFA 1H7XA 4JOMA 1DHPA 2GOUA 1R0MA 1OY0A 3WUEA 4JTGA 4S3KA 1CT5A 3CUZA 3AMGA 5HWMA 3GNXA 2D3LA 3S5OA 2WJDA 4O1CA 2PDCA 1TV5A 2OVLA 4RDZA 1V8EA 3O9NA 3R6IA 3QOMA 3AXHA 3TWAA 3D46A 1GZ1A 3TAKA 1YDVA 3DFNA 1V3HA 1XDJA 3W23A 3VXGA 3SY5A 4IMFA 2D73A 3KRUA 3W1LA 3S83A 1UP0A 1B3XA 4B9YA 1PKYA 3ZSSA 5J5DA 2PA6A 3GBEA 3QSTA 2HWGA 2QXWA 2G50A 3CK5A 3GUWA 1H11A 3HPSA 3O3RA 5XIMA 3WNNA 4ROPA 2J9XA 5K9XA 2Y7EA 3ZS4A 1TV4A 2BV9A 3W88A 3LRLA 1FBAA 2HCVA 3A47A 4UCFA 2C13A 3RLVA 4V1XA 1AQ0A 5AHIA 1PDZA 1H7OA 4LVAA 4L7ZA 3E2SA 2J75A 1HJWA 1Z7AA 4CCCA 3EX2A 4O1DA 3MI2A 3VABA 3TTEA 1KRBC 5H8PA 2XIMA 2QJIA 2MUCA 3G0UA 1EHAA 2TAAA 4J1OA 3F4WA 2HE8A 3AIWA 3DX5A 1K8YA 3GWQA 3VYLA 1ONXA 1OYCA 2J7HA 2UZ9A 3VM5A 3TH6A 1ZAJA 4QNEA 5EBAA 3IAPA 4K1WA 5HBFA 3OB8A 2PWUA 2VC6A 1U83A 3CO8A 1KD0A 2PC8A 1ZB5A 2XM2A 4R34A 4NSBA 2IPWA 4BHYA 1W37A 5DEZA 4E38A 1C7TA 1HG3A 2D1ZA 4EPEC 5I3JA 4ZFCA 2OR2A 2YCLA 3EOOA 2FVLA 4AEOA 1E5NA 1XXXA 5HR7A 4A2SA 1VLWA 2QDEA 4DJDC 1J2BA 3TYUA 3OBKA 4I5RA 1XIMA 2R1KA 1W17A 3NXFA 1FKXA 1FDZA 2X7VA 2WMJA 3W07A 4DZAA 2Z2UA 1SO5A 5M5DA 3IGXA 4XVDA 4DJED 3CPGA 3PZVA 4HJWA 5FIPA 4GFIA 4U3CA 1FDJA 4W93A 3PBWA 5I0DA 4TU1A 1XLJA 1SZEA 3T81A 2UY2A 3M0KA 2P3EA 1Z44A 4PMDA 5LNWA 5M1TA 2VX6A 3P67A 4Z2JA 2DSUA 1LF1A 4C6NA 5F4SA 3TNOA 2C6QA 1ONEA 2Z1KA 5A2CA 1MRAA 1QI0A 1K6AA 3NNTA 4N0RA 1UWIA 2A85A 4XZMX 4KEMA 1J0JA 4EXQA 4JTQA 3T07A 4GGHA 2PSNA 1XD0A 3PWIA 3OTRA 6A3HA 2Z27A 4EACA 3RX3A 2ZCGA 4MJ2A 4PCTA 3NIYA 3LCFA 2HMCA 2XFWA 1WAUA 1ICPA 3LHVA 5F2LA 1OB0A 1PZ2A 3LZ3A 2W91A 3OBAA 1W1TA 3W0KA 1X96A 4FP1A 2XH2A 2AQVA 3IIZA 3UR2A 3A3WA 2QPUA 2J66A 1MZHA 1FUYA 5I5RA 1HJXA 4P7OA 1OK4A 4D1IA 4M1BA 4OBSA 3MUZ1 1V6TA 2V68A 3IJDA 3A5FA 3VIGA 3ABRA 5LNRA 4RX0A 2XGBA 3APGA 1UUOA 2P8BA 1T6MA 3NG3A 2NSXA 1TVNA 2X7WA 3T40A 3CMGA 4L6DA 3UYCA 3WF2A 3BOXA 5FJRA 3O6YX 3BSMA 4B5UA 4DHGA 3V1HA 4UR9A 4Z0SA 2VEFA 2IPFA 3BG9A 3SCVA 3DFHA 5HDRA 3UESA 1SFSA 1ZJIA 2D20A 1Q63A 2GZXA 1Q85A 3WCZA 2Q09A 4IIGA 4FNQA 4EPKA 2P0IA 2PWGA 1E1FA 3IUDA 3QHNA 1BAGA 3OVRA 3P62A 3C86A 4HZ8A 2YB1A 4D6HA 4A3RA 1LYXA 5ABGA 2E1WA 1TWIA 5K4ZA 4MKSA 2A3AA 1I1WA 2Z6JA 1YYAA 2FH8A 3UXDA 3DCPA 1K70A 2AL2B 1TR1A 2X2YA 1BYDA 4J5NA 4XUGA 2QAFA 3SCQA 2PP1A 2C0AA 1TG7A 1A0CA 2D2GA 4HJFA 3H70A 3G1HA 3C2EA 2E40A 4I5UA 4DJFC 1EYEA 4U5KA 5IOBA 3CV1A 3UCCA 3LK6A 3ZR4A 2WMKA 3L4TA 2VQUA 3WLOA 3GNOA 1PJ9A 5HQEA 2VOTA 1JCJA 1KFBA 3P60A 3PZIA 3N3TA 3S2CA 5EYWA 1K8ZA 3RIKA 2HNHA 3K1DA 3BZJA 1XGDA 3QRHA 2D2OA 2DFAA 1OFQA 4OU1A 3T2OA 4NP7A 4FLRA 4KT2A 1ITUA 1R3VA 4FF5A 3FAXA 4N9BA 2I7GA 4FX8A 1U1HA 2P76A 5AC8A 3BV7A 4JKKA 5F1UA 5DQPA 5DT7A 1UR1A 2E9MA 4HK7A 1K7FA 4GACA 4Z1AA 2OB3A 1E55A 1WP6A 4JYFA 1A5SA 3EB4A 1N7KA 3EPMA 1FWNA 1UROA 4E8DA 4XIAA 3NGFA 1H50A 1NELA 2XVLA 2Z1VA 2ZX6A 3K1GA 3MS8A 5H8MA 3BDKA 5A6LA 4BQ5A 1JG9A 1S5WA 5MKGB 1UD8A 5LKYA 1OADA 3CS2A 4LY4A 3NL3A 3GXTA 1IXQA 3IUIA 4L65A 1P5BA 3DG6A 3SFWA 3NXLA 4YCPA 4Z2GA 1MQPA 2F2HA 2JGQA 4H83A 2ZXDA 4NNAA 1ME9A 3UA4A 2XIIA 4IUGA 1TR9A 4NZCA 3SCNA 4JDYA 4LUJA 1AJ0A 1XC4A 4DUWA 4AZIA 1BVNP 1MUMA 5ABFA 4PTDA 1OZMA 3ARPA 1VFHA 3E0WA 2UY3A 1X7FA 4XTIA 1MDLA 3G1XA 2TRSA 2YA1A 4HZ7A 4DWSA 1UASA 4QE1A 2YW4A 4NYYA 1NDWA 4S3EA 1EP3A 3VAVA 1VPYA 3PANA 3QQ1A 5DFAA 1RZMA 3BV4A 4ZE4A 4G7EA 1D3GA 4YVPA 2DY3A 2A3EA 4Y9OA 2FPTA 1TTPA 2FGBA 1UB3A 2WLZA 1DP0A 1J4EA 4UQDA 4XQ6A 3WKZA 3VD4A 1PCWA 2JALA 1ISZA 2WVUA 1VFMA 4MPQA 2R24A 3C0LA 1OGSA 2Y8KA 4O12A 4DI9A 3WENA 1PAMA 4IGHA 1KCKA 1OZQA 3IARA 2D2HA 1UCWA 3UXIA 1QNVA 4F0SA 3NSMA 1NP2A 3L4ZA 4D2JA 1RQEA 4MY8A 1NY1A 4JTSA 1K8CA 3GH7A 3GNRA 2GDVA 1VBHA 3Q37A 3CJPA 3TROA 2F38A 1G6CA 2YIHA 3SY8A 5A8MA 1OT2A 1GJPA 3ITGA 2VX5A 2WXDM 3WEOA 5I07A 4U3AA 1H63A 1JXJA 3G1SA 1H09A 3EPNA 4CQAA 4XX6A 3S1XA 3COTA 1TWZA 4Q8VA 3THDA 3VE7A 3W7LA 1JPHA 1VZWA 4G5DA 4UNLA 2VOMA 4JTIA 1GKQA 2PB1A 3B04A 3BQ5A 3EA2A 3GTNA 1K77A 4K39A 4A3YA 2A7RA 3QMSA 4QXIA 2YGYA 1SQ7A 1XI3A 1RCXB 4PFHA 1IV8A 2G5WA 4AYGA 3LBOA 4DM2A 1FCQA 2NWRA 5CSUA 4DWSD 3B03A 4XBKA 4GVHA 3GG1A 3JU2A 2ZA2A 2ZZ1A 1KFEA 4JPGA 5HJYA 1GK8A 2OQHA 3ZJ6A 1R3RA 1DQWA 4MF4A 3RAOA 3DESA 3STCA 1UKSA 3H4GA 3RGTA 2C1GA 1PWMA 1UZHA 3M47A 4ZODA 4C7DA 1E40A 4EX4A 1NDYA 4LNCA 4A35A 4WSKA 3CHVA 2YLLA 3G6MA 2P5NA 4ADTA 3MSDA 4I7UA 4O4VA 3M0XA 4GIRA 3ZT6A 3VDCA 4GUFA 1R87A 2VWTA 4BY3A 3S46A 2BASA 2FHCA 3PAOA 4ZOAA 4Z2HA 3NL6A 2QW5A 3CL8A 3ITXA 1TX2A 2XSAA 1C92A 4HPNA 4MFDA 2AL1A 1XLMA 1SMDA 2INZA 3GH4A 4ADSA 3KRZA 3S2MA 3NVTA 4LYKA 5AOUA 2V0TA 4YXGA 1K9FA 4FALA 4NNCA 4F2TA 5BU6A 1E56A 1JULA 2HDJA 1MRQA 2FLIA 1QOQA 3QW4B 4X9SA 4KCTA 3T4WA 3OLEA 1H7WA 1GOQA 3RLHA 3HURA 3GDLA 4W7VA 3NDYA 4QX4A 3KVJA 3HV8A 2JEPA 3TCEA 3N2OA 2V69A 4O57A 3OQEA 5ABEA 1RBLA 3G1YA 2VCAA 2QV5A 2A0NA 1AW1A 1MVYA 1E0TA 4BZYA 1LOLA 2CZVA 5LIWX 2WWCA 3GVVA 1B3VA 5T9BG 4R85A 2IW0A 4ZB2A 2ZKMX 2ZFAA 1BGGA 3M6DA 4H2CA 3H8AA 2NQLA 3BLEA 1UD5A 2ZUNA 1A5UA 2A2IA 1TZ9A 4FMVA 1J12A 3GG0A 1V6XA 4IZGA 2YB4A 4YTRA 8RUCA 1V77A 3PSWA 3W2JA 3AYVA 3RCMA 3SRFA 4PCFA 2QF7A 2NV2A 3KHJA 1P1MA 4LB3A 1G4EA 2HEJA 1XLAA 1W9BM 5E0FA 4LBRA 5E70A 1VRXA 3U5UA 1PIGA 4RXFA 3HV9A 2XPKA 2Z2AA 4U33A 3SJNA 3QY8A 5T9CE 3O7UA 1CXIA 4ZB5A 3QFWA 2O9PA 2XVKA 2ICSA 2WVSA 1XS2A 3NZRA 3R4IA 4JTRA 1XISA 3TZFA 2FFIA 4GX8A 2QJJA 3MUIA 1R9XA 3GZ3A 5HXMA 4W88A 1ISVA 1G01A 2WJZA 2OOFA 1GVRA 3URQA 2XH4A 3DDMA 3NSNA 2EEXA 5HNUA 3VZZA 2POTA 1KFLA 1OD0A 4IGNA 1I8JA 5EMMA 5AC4A 4IJRA 2ISDA 2ATSA 1EUNA 2P1FA 3OOQA 4Q8TA 1Q3NA 2D3NA 1X7IA 4F40A 4AU0A 1M5WA 3QYSA 1U5JA 4R53A 3NGJA 3NUKA 4NL1A 2G95A 4L64A 2E8ZA 4RW5A 2HQAA 5I7GA 4ZGYA 5CLWA 1PSCA 2DIJA 4AY8A 3I6TA 4PBFA 5EMUA 5HMFA 2A3LA 3DKLA 4WXZA 4D6EA 2PDBA 3VNDA 2OGYA 3GTFA 4RLIA 6TIMA 2FZNA 1PIFA 1Y5WA 1PHWA 2F8QA 5J8LA 1EJRC 1S1RA 4QIUA 5LXXA 3H2NA 4P7RA 4LYQA 3VGBA 4GINA 4UBPC 3ABZA 2GFTA 3EWXA 1HUVA 1QBAA 4ZO8A 1AJ2A 3P8IA 3RRAA 4UMAA 2YL8A 4DELA 4Z17A 1K1DA 3N11A 3BAIA 3ATYA 1XINA 3CZ8A 4HNNA 1W54A 3QLLA 4BWLC 4W5ZA 1ZJBA 5GJMA 3CHFA 2DZXA 4H6KA 5HATA 2YLAA 4WUIA 3ANYA 1V3MA 1A53A 1E0UA 1CXLA 4H7VA 5C70A 4LAUA 4CGTA 1BRLA 1PO9A 2A7NA 2G3NA 2VHLA 4ADUA 3VCCA 3MZ2A 4U31A 4DWDA 4AEEA 3GVWA 3W6MA 1W9PA 1WDQA 2V67A 2EJAA 3N9SA 1KTCA 2CZDA 3QF0A 5I23A 3DGBA 4ATDA 4NAEA 4Q8NA 4PUEA 3GXNA 3S9ZA 2FDSA 5CJNA 1JCNA 3NOEA 3UWUA 3II1A 4LNYA 3RMEA 3PY2A 2WKJA 1I2NA 4QFUA 4LJ3A 3B8TA 3CZLA 4I6VA 1EF3A 4X2PA 2PRHA 2Y2WA 4Q7BA 3OA5A 4X63A 3EOLA 4JNMA 1HN1A 3V5OA 2XWDA 4GZIA 3U57A 3MKKA 4GUJA 3EX4A 1EGVA 1E6XM 4MZYA 2WAGA 2DSKA 4MNKA 3NO3A 1BG9A 4QEEA 4ZL1A 4HZ6A 3BAKA 1EEPA 1VQTA 4GVFA 4CNNA 1J0ZA 1CTNA 5I77A 2QJGA 5CZKA 4BI7A 3DECA 3ZVHA 5A8GA 1VYPX 4KGLA 3EAUA 1VC4A 1ZTVA 6REQB 1ITQA 2BGNE 5D2WA 3MTWA 3I7QA 2G8ZA 1V02A 3GHRA 3W7OA 3RU8X 3CLMA 3CL6A 3C6CA 1QVBA 2FJKA 3SJ3A 1XHGA 2ZWYA 2E68A 3LYEA 2GSHA 4L6HA 4MSSA 4K6AA 4IFKA 4QG8A 4TTUA 3DFOA 4KEUA 3MKVA 5A6BD 4MZ1A 1ZU8A 4ZQCA 3UWYA 2XFFA 1M1BA 1K8XA 2VQTA 5CPLA 3HJEA 3UCDA 1NAL1 5C9RA 1F8IA 4FNPA 3BURA 3WLIA 4P8XA 3DC0A 2FGZA 3NR0A 3SCPA 3NZ1A 4H6RA 2JFEX 3MKCA 4WXYA 4HN8A 1W56A 2XIJA 3FAWA 3FEMA 3AUOA 1W1YA 1TE6A 2VEMA 4LEQA 3OGSA 1R3YA 5AHEA 4TIMA 1VRDA 4QSHA 1FH8A 3M44A 3DG7A 2G0WA 2EKGA 2GWNA 4PB4A 4MG4A 4QHRA 4AX7A 1OSEA 3ERPA 3QC0A 4UFIA 4QP0A 1E1EA 2J7CA 1ZBCA 2WK2A 2PDXA 3MW7A 5PTDA 4ERIA 3I3DA 1YBQA 2VC5A 2E5DA 1UZ1A 3LXCA 3TFXA 1EKOA 3E2VA 4LANA 3REQB 5IXEA 1SJCA 3SUWA 3W7IA 1OGGA 2IS7A 3QGAC 4AD4A 1GCYA 2X05A 3LMZA 2J78A 4XAZA 1OX4B 3TU9A 1YTKA 1OD8A 3LHZA 3BARA 5GNXA 4W89A 4EKJA 1HJSA 2BDQA 1DJNA 3VCRA 4UR8A 4JN6A 2CLFA 4DPQA 1VEPA 5D09A 2RAGA 3VNYA 2VGGA 3GYCA 4RE2A 3S5ZA 3SQSA 1XPYA 3WQ4A 5BWAA 3KOZA 1FH9A 3S1UA 3PG9A 4IQEA 1AQMA 4EWND 1V0KA 1WXZA 2DW7A 3QM3A 3B4YA 3B8DA 3TMQA 1ICQA 1EJ7L 4K8HA 3OZYA 3P5ZA 4ZVJA 2C19A 1UC4A 4Z1DA 1IWBA 1QPQA 5BMXA 1IEQA 4K38A 2DQWA 5BXRA 4GNKB 4XKYA 1DQXA 3UXKA 3VIMA 2XIBA 1S39A 1KXHA 4OZOA 3QHOA 3AJ7A 1QPKA 4G8TA 5CAKA 4EF9A 4EXAA 2CLOA 3SR7A 4Q8UA 3T42A 4ERGA 2VDHA 5CSYA 1KM6A 1J5TA 2JF6A 1HVXA 2ONEA 3OIXA 4RE3A 2JBMA 4MYXA 1TVLA 1EXPA 3G3MA 1B31A 1UOZA 2DORA 2PTXA 3H4XA 3F2DA 4O15A 1A3WA 4IISA 3QZ6A 1DE5A 1MW1A 3CM4A 3HZ3A 3W7CA 3BSHA 3IJIA 4HU0A 3CPUA 3HA1A 4EK7A 2C16A 3VKDA 3GHSA 4IGSA 5G4EA 1QJWA 4XZLX 4P61A 4DNMA 4J9JA 4NY2A 4JTUA 2DT2A 4Q8MA 1IEIA 3FFSA 4LAKA 1OX4A 2AMXA 1CYGA 4LOCA 4YTSA 5CLTA 2OLAA 3GC4A 4GI6A 2DU2A 4Y9NA 2R6OA 4RDYA 1UH2A 4MDOA 1TZ7A 2OZTA 7TAAA 2Y7GA 1OINA 3C56A 4FNRA 4CNSA 3KOYA 2BY2A 5F2IA 3BVJA 5J5RA 3JRKA 3HMCA 1UPPA 3MUAA 3LPPA 4W87A 3HB9A 2NQZA 5E1QA 4GH3A 3PP7A 1S2VA 4UTMA 4F48A 1IEXA 3PB0A 1KBLA 1GTEA 1YTDA 1OCQA 4NJJA 4Z0JA 3IVUA 3QFEA 1EQCA 3CAKA 1Q6RA 2J9YA 2F7FA 2RHGA 4HA1A 1UA7A 4X61A 3FEQA 4IG2B 2OODA 1X8FA 5FJOA 3TQ0A 1OC7A 1TPWA 4LBSA 4Z08A 3ITVA 5GVJA 2QCCA 3UVIA 1AW5A 2Y7FA 2QDHA 2Z00A 1G7UA 1IEWA 1WAWA 4UMCA 4DZ5A 3T44A 1DJZA 3LCGA 3LBMA 5FJPA 4PZVA 3M43A 4UNIA 4FAMA 2OQYA 2GOKA 1P0DA 1T7LA 3KLLA 4PMNA 3WLTA 5AB3A 1B9ZA 2HROA 4QJ4B 2Z1XA 3AHXA 4HU4A 4N6EA 5DBUA 2PDMA 4E2BA 5D9NA 3GNPA 5CCZA 1XX1A 4JFWA 5LNSA 5CJ5A 1GQNA 5HWNA 1F3EA 2X41A 4ICCX 3M4HA 1KV5A 2HVNA 2ZA3A 4QAIA 1N8FA 3LOTA 2FB3A 3KEHA 3AHZA 2JKAA 1OIMA 4E8GA 1QPOA 1SW0A 4IXXA 1ZAIA 3PG8A 3UF9A 3KXQA 2Y85A 3DFPA 1TPVA 3DH7A 2VDGA 2CITA 4AUBA 1NDZA 3DYOA 3MMDA 4JTCA 1J0KA 1KGXA 5K4XA 4P5UA 1KM4A 4LB4A 1W8GA 1GYNA 2FMNA 4XISA 4AX6A 1DTUA 4I9MA 2HK1A 3MI6A 5BCAA 4HNTA 2ZX9A 4R7OA 3RILA 4UFLA 1SFJA 2OYKA 3RX2A 1FFQA 3M41A 1UKPA 3WO8A 2D69A 2I9EA 3AMKA 3VD9A 3KBMA 4IMGA 2Z28A 3Q45A 4C90A 1ZNNA 2RJHA 2QJMA 4O0KA 4LWWA 3VC6A 5DXYA 1OX6A 4KEZA 1X8CA 4WF7A 3JUGA 3M64A 3UW6A 1G0CA 3CV6A 4GYKA 5GNZA 2J27A 2ZXQA 3W28A 5DXXA 2E9LA 4N7QA 3XISA 4MLRA 5HNRA 3SGGA 2PDLA 3ZZ1A 3FGCA 1TJPA 1SO6A 1VB9A 4WDXA 3WH7A 1OCJA 4MY9A 3M5VA 1DWAM 3U5YA 2WVVB 3QMTA 5REQB 1G7VA 4HNCA 1JCTA 1H1ZA 1S3HA 2YA2A 4P8UA 3NDZA 2IUZA 4IP4A 1DWJM 5DMLA 1VJZA 4I7WA 3HFTA 4JIHA 1E6QM 4B3KA 4I3GA 4UTFA 3R0DA 3BAXA 2PDJA 4P7LA 5CEWA 1XLLA 5LIYX 2W62A 4AW7A 3B40A 2G37A 4D6DA 3ICJA 3UWVA 4KWSA 1DEDA 3W4RA 1R8LA 5AC6A 1KFCA 2WOQA 1E51A 1R9ZA 4IIFA 3DUGA 3KX6A 4OWGA 1GOXA 2JQXA 2PF0A 3GU9A 1GZGA 3TP4A 2YBVA 3VNIA 5A8PA 2E5BA 3SDOA 4IMDA 1ENUA 3SUUA 5DCBA 4K1GA 5DN1A 4FSAA 3LSCA 4FNSA 4K68A 3THQA 4JFUA 2J79A 4AMCA 5KZEA 4NI8A 5EKYA 1GVSA 2BHYA 3UEQA 3U6WA 2Q8ZA 3KE0A 3LCWA 1V93A 3M9YA 5BMWA 3OGVA 5FAGA 2R94A 3WLNA 4NJIA 4BF9A 2VD9A 6ENLA 2H6RA 3DERA 1KLZA 1P1XA 7ENLA 4QE5A 4DBDA 4UTJA 4H9YA 4BCEA 4S39A 1QI4A 1GGOA 1SZGA 3B8SA 4AIOA 2FZ9A 3SURA 1TKKA 1IT7A 1VKFA 4WLCA 4KWOA 2ZA1A 4IPPA 1XSJA 3WJSA 4C6QA 1DWHM 1OYBA 2EG8A 1AH0A 1GW9A 3TTQA 3S2JA 4E2DA 1FWDC 2BY0A 1NF0A 3N15A 2B81A 1GJUA 3UBPC 2J7BA 1YIXA 2G4JA 3TQVA 5IFTA 5JUVA 2QAPA 2VMFA 1PXGA 4CEUC 4UQCA 1R3TA 5L6UA 3P5YA 3FJ6A 1MXDA 2OPJA 4WOZA 1J9YA 3STGA 4XSLA 4M82A 1UHVA 3IRDA 4NF7A 4NHVA 2WQPA 2YDSA 2VRQA 2L5HA 3R8RA 1PX4A 3VZXA 1WCGA 3P80A 8XIAA 3ARWA 5TBOA 2CLIA 5IRPA 4YIWA 2CKRA 4PMRA 5HMSA 2B31A 4YHGA 1B90A 1AZ2A 1UBSA 4MM1A 1C8VA 1FDYA 3AS2A 5LZLA 1W9XA 2V5DA 5C7HA 5LHEA 1ODZA 3VE9A 1DJGA 3HG4A 4GH1A 1GVFA 3XIMA 4P8WA 3B8VA 3RPMA 3VGHA 5LNUA 2INEA 4HNUA 2E6AA 3PPCA 1JRCA 3RLUA 5LIUX 5C0QA 3EYPA 3WLRA 2VX7A 2Z24A 4XUYA 1XFBA 1E1CB 4G56A 4JN8A 3U9IA 1TQXA 1ONWA 4ZXLA 4W85A 3AHTA 2FJUB 4V28A 1L6YA 2XVPA 1LTDA 1NH6A 4GYPA 1TUFA 2EQDA 3LLDA 1YPXA 1CI1A 1XBXA 2PLMA 1MNZA 3VC5A 4JD4A 1XIGA 5D38A 2XDFA 3L4WA 3S5NA 2R14A 4HSOA 5ENLA 3N2CA 4XZBA 2W9MA 1T8XA 3MA8A 5C2CA 1KQZA 2VEGA 4H01A 4CN6A 4DI8A 1Q4WA 2R1PA 4GD0A 2YSWA 3UPBA 4DEFA 5T8GA 4TTGA 1L2UA 1X1OA 5K7JA 5I79A 5FEXA 3E0VA 1B0IA 1XLFA 1PYFA 2E3ZA 3LMYA 1ZL1A 2YDAA 1GQKA 1CGXA 3TYCA 2PDIA 4RJEA 1ZCOA 1OG6A 3B9AA 1BTCA 5IBXA 1XIDA 4WKAA 1W2PA 3URBA 1THFD 1LBFA 6XIAA 1NWRA 4US6A 2C0HA 3O2LA 2QV4A 4HNLA 5HK4A 3IRSA 1MUCA 3G1AA 5E9AA 3MV11 3GC2A 4N4PA 4TOQA 3CUXA 1QT1A 1LG1A 1M01A 4A8IA 7REQA 2GQAA 3VGGA 2OQLA 4PMXA 2FZMA 1PVNA 3PR2A 1RPXA 1WKFA 3WNPA 3EOEA 1EYWA 2VFEA 1PWLA 3KL5A 1G4TA 3HM7A 2BOEX 1XDLA 2A5HA 2WBKA 1O68A 4G1KA 4UNKA 5FACA 3ARRA 4IPLA 4XAFA 3BSGA 3VD3A 4JAWA 3ZJKA 1XQKA 2GJLA 5T26A 3F2BA 1UZDA 4OV9A 3MWAA 1XW8A 5A3HA 5D9OA 3BLIA 4F2UA 4PRWA 2ACUA 3UY8A 4E2OA 5H91A 2PP0A 1OJXA 3CTLA 3MO4A 3KTSA 3ZMRA 3GIPA 3LNPA 1GORA 1YXDA 5D9PA 2R1LA 4O16A 2BBFA 1FA2A 2OXNA 2JKEA 3BH4A 1M65A 4RZ5A 1NFBA 3TKFA 4IHCA 3RCNA 3AI0A 1QI5A 3DFSA 3ITTA 3ENLA 4GBDA 1EBHA 3PZGA 3GU2A 1TA3B 2BHUA 3DBNA 1BSIA 2H90A 3RK8A 2WHKA 4JQ4A 5BRQA 2W79A 1JZ7A 1Z9AA 3B0UX 3VVGA 2F9RA 4ERAA 1LOSA 3N4EA 2ZIDA 3KLKA 3E12A 2XINA 1VHNA 2O92A 4GUIA 4C1NA 3AMDA 2ISFA 8A3HA 1VFFA 1KTBA 1F3WA 1UD6A 3BJFA 3EKGA 5A6TC 1V03A 1W3KA 4QS6A 2I16A 4HPGA 1T8QA 1WZKA 3OHIA 4OVXA 3NO1A 3TJIA 4E4PA 1F76A 4GJ1A 3PUOA 1XYAA 3R1ZA 2PWDA 2V2DA 3G24A 5HANA 4ROQA 2AKMA 4ZQNA 2YOCA 1XG3A 1JNEA 1N2VA 1WOBA 5BOFA 4ICNA 2XVGA 2NV9A 1F4AA 1CLVA 4R88A 2FVKA 3SQLA 4FLSA 5EFDA 2GJRA 4JTLA 1G4SA 3LTPA 1EP2A 2MNRA 3E38A 1F6YA 1EC7A 5FD0A 4P7NA 1O6IA 4QDWA 4WEVX 3K46A 4ONVA 3ZVIA 4LAMA 5G4HC 4Q32A 4HKPA 1AMKA 3RFAA 3KOFA 2VNCA 3BGAA 2P8CA 4AZCA 5LNVA 1RXOB 2RJGA 4KF1A 1U1JA 5D04C 1JR1A 3U2OA 4C6IA 4E8CA 2E25A 3WBAA 1VF8A 1XLKA 1S2WA 5F1VA 4BK9A 2QJNA 4U4MA 4PSPA 3HQNA 3PFMA 4ICMA 1MW3A 1A0DA 1H4PA 4FIRA 4QQUA 1JEZA 3T0DA 1MUWA 1HQTA 4KWWA 3T0CA 5K3VA 2OEKA 1KA9F 1Z48A 1TJ1A 3CMFA 3W1UA 4W7WA 1RY8A 3H26A 1PV8A 4ZSTA 4RDVA 2WSRA 2ISSA 3NQGA 4F4RA 3CWHA 4RE0A 3F4NA 3N14A 1AK5A 5KTLA 1DWFM 1E43A 2XYLA 4KS0A 1NEYA 4NG3A 2WNNA 3VZYA 1WDRA 2KX9A 1RVGA 1XH1A 1Q65A 4Y9MA 3I65A 3WL0A 3VNMA 3S1WA 4Q6XA 1HKJA 5CC5A 7ODCA 3PC0A 5KINA 5I3GA 3OGRA 4GJJA 4KFNA 1UWRA 3LXBA 1NARA 3SCWA 3KRBA 3THAA 3W2LA 3S6TA 3CIXA 3K4WA 4F8XA 2ABAA 4PUWA 4DLFA 1TCMA 4Q8QA 3WQ5A 3OPSA 4F0KA 3A3HA 4AZ7A 2RGLA 3PBUA 1ZAHA 1AH4A 5AY7A 2DSZA 1QHOA 1F5ZA 3U3HA 1R3WA 3CTTA 3UZZA 3R94A 2F61A 1H51A 4CQ9A 3T9PA 4CNTA 1XYLA 4EPBC 3CAVA 1FP9A 1CB7B 1R47A 3UJRA 2Q6ZA 5E6YA 5JH2A 4M81A 4ENLA 2WC3A 3NZGA 1PKLA 4IP5A 3GO2A 3TDFA 1UQYA 1SMAA 3W76A 2GGJA 1MXSA 3WJWA 5I00A 3S1VA 2OU4A 3SIZA 1LG2A 5MF5A 3OODA 3W86A 1X6UA 1GQLA 2TMDA 3TTYA 1C3FA 1E0XA 4C65A 1QFEA 4G1NA 3NEVA 5F4WA 3QLDA 5LGXA 4YCOA 1O5XA 1UR4A 3GRIA 4AD3A 2A3CA 1IGWA 3W25A 4OJYA 2OKTA 1U33A 4GQ0A 4CLMA 4C6BA 4Q4QA 1W9VA 3MSYA 4QDPA 2Q01A 4X60A 2J6XA 4NZJA 2BNJA 1CB2A 2CWXA 3TSDA 5A5WA 1EDGA 5KZMA 4Q8PA 1W1ZA 2ISWA 2WV8A 3VIJA 1TTIA 3TX9A 3KRSA 1B57A 4FHAA 4K37A 3JR2A 4V33A 3BAYA 2G96A 5C8BB 2RFGA 3I3EA 2QMJA 5CKSA 1HF6A 2JF7A 4D71A 3QY6A 4GHRA 2PBOA 3M0HA 1B30A 1HP4A 1H7RA 4BFAA 1PB0A 2V30A 3QSRA 3MO7A 1M6JA 4IX2A 1DIKA 1E4LA 1ADOA 4XO7A 1BHGA 2VZUA 3O15A 5JBFA 1JQVA 4BS0A 3AUJA 2ZE3A 4DAIA 3G77A 4Q4SA 3B4UA 4W8AA 3L0KA 3VOIA 2JK2A 3AWOA 1HGYA 1UWAA 4J7RA 3VIPA 4V15A 1MWOA 2BVWA 3CIWA 1VFUA 3WN6A 3ARXA 2JIWA 1XD1A 4LUTB 2HS8A 3BMWA 1WBJA 4H9ZA 1BVZA 4NVTA 5I3DA 1EIXA 1LUCB 5CC3A 2J9ZA 1PBGA 4ZA0A 1JNDA 2WZIA 2DSVA 1SR0A 5A95A 1WDDA 3Q58A 2BOFX 4O13A 3QOKA 4O0ZA 1IF2A 3QW3A 3H22A 3WH9A 4HMCA 4UOJA 4DJFD 3GXMA 4HPXA 5CSRA 3AJXA 3CQ0A 2WCAA 1KR0A 5F2GA 4KGJA 5D30A 3RDKA 1M04A 3OG3A 2PTZA 4HU3A 5DCEA 2B0MA 1QATA 2BMBA 1AA1B 2OSXA 4A6GA 2VZSA 4MB3A 3GU1A 2MANA 3W7KA 3SGZA 2WMIB 3EKLA 2I5IA 1FX6A 4LUSB 3FDGA 5HUOA 2WCGA 3EEGA 3URNA 1LRTA 1L6GA 2WB5A 3ZR6A 3HFYA 2UY4A 2O9TA 4MJ4A 4GRSA 4O1EA 3AC0A 5H8UA 3OVPA 3W82A 3KTCA 4LAZA 3V1PA 2GQ8A 1BXNA 1RAKA 2ZVIA 3WFLA 4L9YA 3U4FA 4S38A 2PU0A 2W67A 1V02E 4MNMA 1JUEA 1GEQA 2QUNA 4YLWA 5AYXA 5HR6A 2EKCA 2WJEA 2PWVA 5D33A 4DF1A 1Z3NA 3IUHA 1KXTA 2XWEA 5CPMA 3RX4A 2G3MA 3G2GA 4L80A 2PCEA 2PU1A 3EZ4A 4QITA 5IHRA 2X0YA 4R5EA 4PCSA 1W0MA 4AAJA 5HPCA 3QC3A 1KBIA 3UR7A 1UD4A 4GI8A 3M6YA 2WSKA 1Q2RA 4I9JA 2PP3A 3WF0A 3JZUA 3DHUA 4DUXA 4MTVA 5BXTA 4WJXA 2WHJA 3P14A 1QAPA 3WF1A 3TE9A 2QJHA 4JR5A 2GPTA 4PULA 2QULA 3CHCA 4LCRA 4X0NA 4PUMA 3ABXA 1ALDA 4Y9PA 3IV8A 2QCGA 2X30A 3HPAA 1UKQA 2EBNA 1UBPC 3LPFA 1SZNA 4WDUA 3CB8A 2D0HA 3WUGA 1SU5A 4QLKA 6TAAA 2PFHA 2DVTA 3G0SA 1ZALA 3RN6A 1EEXA 2DT3A 4NIRA 3PFRA 4JBRA 3NM1A 3T0TA 1EBGA 3S8HA 1YXYA 1YADA 4B5XA 3RXZA 1J96A 1YMYA 2PDFA 4H8VA 5LIXX 3GX9A 1JUBA 2NW0A 4HA0A 2V5BA 3RO8A 3E0LA 3PAJA 1EDTA 4MJMA 1K7XA 3V3WA 4O1FA 1KBKA 4RV3A 2KZHA 5C7VA 4AH7A 2NQ9A 1B3WA 4Q3MA 2J13A 1FWRA 2FH6A 1T40A 2V5CA 3KVLA 2OELA 3EGJA 1K03A 3VIKA 3NO5A 2WKLA 2C71A 3O63A 1O5QA 2VVNA 3T0BA 4HTBA 3DIPA <