3RX2A

Crystal structure of human aldose reductase complexed with sulindac sulfone
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
318
structure length
318
Chain Sequence
SHMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3rx2A00
3LZ5A 3V36A 4PUWA 3GUGA 4Q3MA 1PZ0A 3RX2A 3LQLA 2IS7A 3EB4A 2BGSA 2IPGA 4RPQA 4WEVX 1XJBA 3LUTA 4OTKA 2INZA 1IHIA 4JQAA 1ZUAX 2PF8A 4DBUA 1ZSXA 3GHUA 3R8GA 4F40A 5AZ1A 2R9RA 3ERPA 5C7HA 4JIRA 2NVDA 2PZNA 2IPWA 4H8NA 4XZNX 2I16A 2IKHA 5LIKX 2I17A 3LBOA 1A80A 4XZMX 1QWKA 1US0A 5HA7A 1PWMA 2ACSA 3H7RA 3LN3A 1Z9AA 2AGTA 4XZIA 3R6IA 4JTRA 1AZ2A 1OG6A 1RY8A 3D3FA 3WCZA 2PDJA 4PRRA 1Z8AA 2PDIA 3G5EA 1XF0A 1YE4A 3NTYA 3O0KA 4IJRA 4XO6A 1S2AA 3COTA 2BP1A 3CAQA 2QXWA 3DOPA 3LEPA 1PWLA 5DANA 3LENA 3UZZA 2PDGA 2HVOA 2ALRA 3P2VA 2HVNA 3GHSA 4GQGA 4WRHA 1S2CA 3BURA 4XVEA 1ZGDA 2IQ0A 2IKJA 3GHRA 2PD5A 4WGHA 2FVLA 4GABA 2IPJA 1AFSA 3B3DA 4JQ3A 1JEZA 3FX4A 1Z3NA 3BUVA 2FZ9A 4PUUA 2DUXA 3N2TA 2DUZA 3RX4A 4FALA 1ADSA 3F7JA 4R9OA 4I5XA 2C91A 1RY0A 4Q7BA 2PDKA 2PDPA 2FGBA 2PDUA 1K8CA 3UZWA 1EXBA 1PYFA 3N6QA 4YVVA 4YVPA 2IKIA 3KRBA 4XVDA 4JQ2A 2VDGA 1X97A 4QXIA 4GA8A 4L1XA 3H4GA 4PMJA 2ACUA 1Q13A 2PD9A 2ISFA 2WZTA 3FJNA 4JIHA 1R38A 2BGQA 3U2CA 2PDMA 3BV7A 4LB3A 1EL3A 4GQ0A 3UZXA 3V0UA 3UP8A 1Q5MA 4EXAA 3O3RA 1UR3M 4L1WA 2F2KA 2HV5A 4ICCX 4FZIA 3GHTA 1HQTA 1T41A 3LD5A 1RALA 3M4HA 1AZ1A 4WDWA 3CASA 4XZLX 1J96A 2PDBA 1VP5A 3WBYA 2R24A 4AUBA 4LBSA 1QRQA 2A79A 3WBWA 4EXBA 2FZ8A 4JTQA 4H7CA 4JIIX 4DZ5A 2HE5A 4JQ4A 4GCAA 4PR4A 1YE6A 4GIEA 4WDXA 3R8HA 3EB3A 2PDHA 1M9HA 4PRTA 4QBXA 3UGRA 4FA3A 5JH2A 5LIYX 4ZFCA 1GVEA 1HW6A 4HMNA 4QX4A 2PEVA 2PDXA 1LQAA 2PFHA 5LIXX 3V35A 4FAMA 2PDYA 3R43A 4LAUA 1C9WA 2HE8A 4LBRA 3UFYA 3DN5A 3UZYA 1PZ1A 3ONBA 2PDLA 2HEJA 4LB4A 3RX3A 4XO7A 3WBXA 2J8TA 1X96A 3CMFA 5KETA 1XGDA 3LZ3A 3S3GA 1YNQA 1AH4A 3G1RA 4IGSA 4JTAA 4QR6A 2HDJA 1Z89A 5HNUA 5AZ0A 3BCJA 5LIUX 5HNTA 1S1PA 3V0TA 1S1RA 1AH0A 3MB9A 4JQ1A 1FRBA 1ZQ5A 1SM9A 3LQGA 4LAZA 3R58A 2CLPA 3WG6A 3UYIA 3V0SA 4NKCA 2INEA 3ONCA 1T40A 4MHBA 3H7UA 2IPFA 3M64A 2NVCA 3Q65A 2IKGA 1YNPA 4YVXA 5LIWX 4XAPA 3CAVA 3R94A 1LWIA 3Q67A 2PDNA 4G5DA 3R7MA 4YS1A 3LNMA 4JTDA 2IQDA 3UG8A 4JTCA 1IEIA 2FZBA 4IJCA 4XK2A 1MRQA 1EF3A 3T42A 5JH1A 2ACQA 3UWEA 3QKZA 4WDUA 2PDFA 4XZHA 1MZRA 3MC5A 4WDTA 3VXGA 2PDQA 4HBKA 1AH3A 3EAUA 2ACRA 4DBSA 1MI3A 3C3UA 1X98A 4GACA 2P5NA 4ASTA 4DBWA 3CV6A 3M0IA 1VBJA 2DV0A 2PDWA 3CV7A 2FZDA 5M2FX 4YU1A 2F38A 1EKOA 2PDCA 2WZMA
chains in the Genus database with same CATH superfamily
1OX4B 1MQRA 4FIRA 2C0HA 1KBIA 1AODA 5BRPA 4ACZB 4U10A 5I3FA 3CT2A 2OSWA 3LQLA 3BG3A 3EB4A 4U31A 5FD0A 2Z26A 3BTNA 3AIEA 1XDLA 1W5MA 3BDKA 5A94A 3IIPA 1GVYA 4KRUA 3E49A 2HXTA 1B90A 3B03A 4R9XA 3CZ8A 5IM51 4E3VA 3D6NA 5I5RA 1JZ3A 2CLLA 4DBUA 2QLYA 3F2DA 1ZHAA 3BLOA 4AIOA 1GHSA 4UB9A 1VBRA 4JIRA 1LT8A 2AGKA 2YXOA 3ITXA 1EO5A 5HJXA 5AYYA 4AQLA 1VEMA 4LH8A 4OQVA 2I17A 3LBOA 5D9OA 4YWSA 3AMKA 2ZZ5A 1W0MA 1BKSA 1EXPA 1E4MM 5LXXA 1O6IA 5C2XA 3EXSA 4F4RA 4A3RA 1XIHA 3B9NA 1NOFA 3AXHA 4GJJA 1JNDA 1OZMA 2WBKA 3AALA 3ZJ6A 1IT7A 4N9DA 2DSVA 2XM1A 3AAMA 1ZJHA 1KRAC 1Y5VA 2E8ZA 4G7EB 6PTDA 1PXGA 4AWSA 4DO5A 2ASHA 3O0KA 3LHTA 1PTDA 2WJZA 4UTTC 3TR2A 1TJ1A 4Y8FA 1GJPA 5MF5A 1ME7A 1U5HA 4S3FA 3MUCA 4RLIA 4HU8A 4W8AA 2VO5A 1L2UA 3KP1A 2D0GA 2QJHA 3QVQA 4LRSA 3DX5A 3UZZA 5I79A 1NP0A 3HG2A 1P43A 3VO0A 4HSOA 3ZJKA 5K9CA 4REQB 2FIQA 4O4WA 3M5YA 3GR4A 1TYGA 2J7EA 2E77A 5I06A 3QQWA 2GJXA 1DE6A 4UFLA 2PMQA 1A5AA 3FAWA 4IP7A 2YL5A 1RLDA 2E3ZA 3PZOA 3VCNA 4IH3A 3BGJA 3PFRA 4EWJA 1KM1A 3ES8A 4O50A 4W5ZA 2ZOXA 3NQCA 1Z41A 1BHGA 3REQA 1GTHA 1WZKA 4JTHA 1I2NA 1CGVA 3BUVA 1BG4A 1FOBA 2FZ9A 1LBFA 1GYLA 4N0RA 1VBGA 4C5ZA 2VP8A 4FF5A 2ZVRA 1HL9A 3N2TA 1V02A 2J9YA 3RNDA 1GVSA 1ME8A 1WO2A 3O8AA 5JMUA 1A5MC 3SAZA 3ARYA 1ICSA 3WLHA 1H11A 4PN2A 2J27A 4DWSD 1QOXA 5D33A 1JCNA 2WV8A 3P60A 4ZSTA 4Q4SA 1C9DA 1MEWA 4NZ1A 3OJGA 1MDLA 1KD0A 1EC9A 4HVXA 3E0WA 2J78A 2DT0A 3QGVA 5E0CA 1CGYA 5KTLA 2OO6A 2CYGA 4LOCA 4HNOA 3O16A 2QV5A 1F6YA 2V3DA 3CL7A 5LYRA 1H1ZA 2HV5A 3SCPA 1CGXA 3M0XA 3LD5A 3T4CA 3QEZA 5G4HC 4HNVA 3GXFA 3N2XA 4XZLX 4E2BA 2XFRA 1B3VA 4IL2A 4ZOBA 1E5JA 5T26A 1Y65A 2PDBA 1VP5A 2R24A 1M7XA 4O13A 3HOJA 2ZZ6A 2Z6IA 2X1SA 3HG3A 1OX4A 5IBXA 2FQIA 1O1HA 1E1FA 1UOZA 4ACZA 1AQ0A 3GU1A 3BAYA 4ZOCA 5XIMA 1B0IA 2GWNA 5C2GA 4F0RA 1VLIA 5PTDA 1R47A 3M47A 2BS9A 2RH9A 4Q8QA 3LCIA 3OZOA 5LIYX 1S38A 2X1UA 3VGHA 3RRXA 1EP1A 3GH7A 3CB8A 4X0NA 3LHZA 1V3HA 3W6MA 1OCBA 4IFKA 3G8RA 4UFMA 3H2OA 4N6EA 4ZFMA 3MS8A 5BZAA 3TTEA 1KGXA 3P8IA 8CGTA 3H54A 3AISA 4HZ8A 2HE8A 4GYKA 1KV8A 4O11A 3BOLA 2XM2A 3FCPA 4Y6GA 1E70M 2Q02A 3VNZA 4CKQA 3EYPA 3U2EA 5BXSA 3JUGA 1LZOA 3W29A 2CITA 1E1EA 4AD3A 3PP7A 3O15A 3P5YA 4HYWA 1RCQA 2W4XA 3W71A 1UMLA 2VRJA 1J8VA 4ZOEA 4ADTA 3QFWA 3HG4A 5HQMA 3IJDA 4G7EA 3AS1A 3EWWA 3SCRA 1FKWA 4QDPA 1Z89A 1VB9A 5CPTA 1X39A 3VIGA 2VVSA 2V3EA 2YA2A 4IFRA 4C6BA 1XYBA 2FB2A 1KTBA 5C54A 1VFMA 2VMFA 4D6FA 4JNYA 1JNEA 4OBTA 3KW3A 1YNYA 3PBUA 1EC7A 1DPMA 1YW1A 3E2RA 3A13A 1IEWA 4REQA 3WG6A 2BOGX 3VGDA 3TWAA 4Z0JA 4H04A 3C56A 1UP2A 2FKPA 4GUJA 1K1DA 1EJXC 3PZQA 4HCHA 3N3TA 1OCQA 4L61A 4YCOA 2PLMA 3VOHA 1UR9A 4PULA 3IJIA 1TR1A 4EX4A 1G9HA 3ZT5A 5AVNA 4KCUA 2QYGA 1MRQA 1UUMA 3NO1A 2O0TA 2OU4A 4NJKA 2JGQA 4TX8A 3IARA 4A3HA 1UR1A 4F2BA 1EGVA 3MC5A 1E6ZA 1UZDA 4NZFA 1I2QA 3VXGA 3W7DA 3GIQA 1EO7A 3H4XA 1W5PA 2ZRZA 4R33A 5LNRA 4AZ7A 5FJUA 3FA5A 2A6LA 4CEUC 4W89A 4PE8A 1KKRA 4DN1A 5DRCA 1VCGA 4YU1A 3GK0A 3SRDA 3FKKA 1UZ1A 1F74A 4IPLA 3GUGA 4BEUA 2FHFA 3LHYA 3GC2A 3RILA 1OD8A 1J93A 4AY8A 5FSDC 4WEVX 4DY1A 4D72A 3L0KA 3EMCA 3W00A 3B8IA 4KMQA 1DEDA 2PGFA 4RV3A 3AMDA 1UQYA 1TTIA 2ZZ4A 1C91A 3N11A 2Y7FA 3QQ0A 3ZWSA 1ZSXA 3TROA 4WOQA 1KQZA 1UR4A 3UF9A 3OZPA 4ADUA 2E6FA 2IPWA 5KZ6A 2R8WA 3RU8X 1UIPA 3JZUA 4ZTYA 1TPH1 4GG9A 4FSAA 4RE0A 3SQLA 4YTTA 2FYMA 4E5TA 2GUYA 3MMWA 3VOJA 3PK7A 1K03A 4LY8A 4XD3A 4JGDA 2VEGA 2WKGA 3GS6A 3IV3A 3M0ZA 3AJ7A 4Q8VA 5CC7A 2BXVA 4K39A 2YA0A 4LJ3A 3TTYA 4D6DA 2PWEA 2YB1A 1XF0A 1YE4A 5LGZA 5JVLA 5CGQA 2SFPA 5G1TA 1S2AA 2OZTA 1LG1A 3COTA 4AB4A 3QV9A 5ABEA 2XIQA 5CEWA 3UT0A 2XVGA 1B3XA 1HKWA 3IK2A 3NOEA 4OV9A 5CSRA 1XGZA 1ZCOA 3SCOA 3NGJA 2ALRA 1QI4A 4IMEA 3RGTA 1H5YA 4ZA0A 4DNHA 3SADA 4CVUA 4PMYA 1XH0A 1XYFA 2G4JA 2CIPA 1RV8A 1LJYA 4L65A 3HGOA 3VE9A 1QNRA 3TQKA 5FF0A 2OKOA 5D8ZA 4HMCA 1A5UA 4MPKA 3P61A 1EQCA 1NFPA 3L4WA 4CD8A 1BF2A 5ABFB 4FX6M 4J3ZA 4JY8A 2QS8A 1PB0A 1R7AA 3KFTA 3P0WA 4HPGA 3KXQA 3NM1A 2OODA 2ZIDA 3CXOA 3W70A 4I90A 3G18A 2E6YA 1KNWA 1PYFA 2VGFA 3MP3A 2D2OA 5AHEA 3CUFA 5HMFA 2XINA 5E0KA 1FH7A 2VJXA 2XPKA 1PS9A 1FX6A 1XH1A 3L4XA 1BYBA 1JDDA 4OBRA 4A05A 3HJZA 4RXFA 2NUWA 3H2EA 3T07A 3PG8A 4GQ0A 3UZXA 4CCDA 1Q8AA 1TE1A 3ZR6A 5IFTA 2XYLA 1XLIA 3KBNA 4FNTA 1MXSA 1T41A 1P5BA 2VWSA 5HMDA 3WL0A 4H9XA 3BAWA 2J66A 5HQLA 2DT2A 2FZ8A 4BHYA 3MANA 1W2PA 2VZVA 2XN1A 1E71M 3QRHA 4PR4A 3MDUA 2F6XA 3IJ8A 4PRTA 2NT0A 4NXSA 1RP9A 4B16A 4CGTA 1GVOA 5HOSA 3JR2A 4IMAA 4FXSA 3WNLA 3R0UA 3PTDA 3A6OA 3MWCA 3VZXA 5KZDA 4MKSA 3LPFA 4IT1A 4JICA 1SYTA 1SR9A 2VX4A 4K8GA 1LDCA 1BF6A 5F2LA 3BMWA 3JRKA 4LV4A 3G0UA 2Q8XA 4RE3A 3PY2A 1M1BA 4Q8WA 3WK3A 2GFTA 1UMYA 2WMKA 3T0AA 4CD7A 2VQTA 4EANA 1BYDA 5LGXA 1CGTA 5BMWA 5HAOA 3CUZA 1EDQA 2EPNA 2ZYFA 2WK2A 4IUOA 3TJ4A 3RK8A 3POCA 3NPVA 1J6OA 3FYOA 4XIAA 2XIOA 5AHNA 3TZNA 2VVNA 4AIUA 4AY7A 2PU1A 3HF3A 2J7HA 4NZ5A 5AZ0A 3FGCA 5HNTA 4RE4A 4XSLA 1X8FA 4DJEA 2YB4A 3C8FA 1HKMA 3T4WA 3TYDA 3GW0A 1EDTA 1KRCC 2P50A 4ZB0A 3FN9A 2G37A 3UA3A 3NJ3A 2QIIA 1MFVA 3ONCA 1PZ2A 2QCCA 3O6AA 2O7SA 1PKNA 4M56A 1RAKA 1JCMP 5J04A 2YPIA 2I5QA 1AK5A 1K70A 4DELA 2Q01A 4MGGA 4EAYA 2QPSA 1KXVA 1QNPA 4XISA 4GVIA 1IEIA 4IJCA 1JUBA 4LUSB 4QJ3B 4ZQOA 1OFAA 3VMNA 1EF3A 2VZTA 3L0GA 4LYQA 3NURA 2J9ZA 5ABFA 1TQXA 1V0KA 3TN6A 3JVAA 4EOUA 4K6AA 1JPMA 5A8PA 4MSSA 3ITYA 1ZCCA 3CV6A 3B4UA 2VCBA 3BW3A 2Z1WA 3GTFA 3WQ8A 3ARXA 4W93A 1YTDA 2DUAA 4GX8A 4YTRA 4I3GA 1DL3A 1OBAA 4MZYA 3W1TA 1XQKA 3KOFA 3TSMA 2GOKA 1TVPA 2PDCA 3WBWA 3LZ5A 4IX2A 2I56A 2X7VA 4NJGA 1UZHA 4LC6A 3TYZA 3WMBA 3C0SA 2R1NA 2Y85A 3UJEA 3WQEA 1WX0A 3QSRA 2AOSA 3XINA 1XJBA 3DXIA 4LYPA 5D8WA 1JDEA 4JQAA 3WMSA 3GAYA 4D6CA 1ZJAA 4ECLA 1CEOA 3OHMB 4NF7A 3ZVIA 4EP8C 4J7RA 3I7QA 2XG9A 1K3UA 4H9YA 1EEXA 2E5CA 2R9RA 1BG9A 4DAIA 4LX4A 3ABQA 5CAKA 2I16A 3DBNA 4ZENA 2IXUA 1VENA 3GAKA 4QS6A 4HCDA 4I9TA 3TW7A 1ZFJA 3FS2A 4CQBA 4PTVA 7TAAA 4BF5A 3DG6A 3APGA 3W1LA 4TVCA 4ZQMA 5I3DA 1A50A 2D0FA 4LS2A 4PTNA 1A53A 2XFWA 3MKCA 1S2WA 1BGGA 3TYCA 4H2HA 2V3GA 3W72A 3P80A 5DCEA 2A3CA 1JDAA 3WUEA 5FEZA 3CIXA 2PDGA 1TPEA 3OHIA 4YL2A 1L6WA 4CCEA 2YGYA 1OIFA 3AYTA 4DJEC 2CXEA 1FH8A 2QNEA 3NZRA 4O0KA 4XVEA 4XKMA 1QFEA 2WZHA 1VFLA 3SUSA 1HJXA 1XRSA 4IQEA 1JPDX 1TVLA 3U48A 3GH5A 1JZ8A 1BEUA 3RR1A 4NZJA 3B8DA 1XCFA 1P0DA 1FVPA 1G01A 4LXFA 4AMAA 1CBGA 4D8AA 2JK2A 3OYZA 4MAVA 1OX6A 1QTWA 3SN1A 4LYRA 1IXNA 1UJQA 3DFHA 2NT1A 1EJUC 4MYXA 5JXQA 2J6VA 4GXWA 2P3EA 2W92A 1N55A 3KHJA 1RY0A 4HN4A 3SY5A 1N7KA 2PDPA 3RPMA 3HQOA 3DKLA 2CW6A 3KRSA 3WJXA 1TJPA 1LCOA 1CXHA 1DWGM 3BZGA 3T8QA 2BZNA 3PJUA 1ADDA 1CDGA 4PMRA 3DGRA 1KCKA 1PX3A 4LUSA 3KRBA 1W54A 3DIPA 4E2DA 2EJ1A 4HN8A 3PJXA 2JKAA 1PO9A 4F2UA 2EF9A 2EEXA 3K30A 2KX9A 2QDEA 3W81A 4JTLA 1FA2A 4AD4A 4C6PA 4NI3A 1M41A 3AROA 1VIWA 3UCCA 3BICA 1QNSA 5FF3A 2J88A 5A1AA 4S3GA 4JTJA 2G3JA 3FJ4A 1RK6A 2YZRA 1AZ1A 3NQ8A 3APYA 2INFA 3DHPA 3K5XA 2DT3A 3B9DA 1FWHC 1HJSA 2R91A 2B7NA 4DYEA 1TV2A 3AQUA 3ITGA 3FKRA 3MKKA 3PC0A 4NJJA 4H7VA 1LLZA 3NEHA 1CGUA 4CCCA 2HE5A 3IAPA 5HWJA 4N4QA 1G67A 3RCYA 4QJ1A 2PDHA 1HZYA 4KEMA 4NL1A 2WQPA 3UJSA 2QCNA 3SURA 2VZOA 1OF8A 4RNJA 1XIEA 4JNMA 3BSMA 2CZEA 1TA3A 2V8ZA 3R0KA 4Q8UA 3EWUA 2F61A 2L5HA 3VIPA 4RL3A 4H83A 3S2CA 4FAMA 4MJZA 1GG0A 3UWUA 3DH7A 3LGEA 2NLIA 2D3NA 2WYSA 3N6JA 5TD4A 2BOFX 4CNTA 2ATMA 2Q71A 1LLWA 1XSKA 4NUWA 3S1WA 4CEXC 3VD7A 4CLMA 3A64A 4LEFA 3VNDA 4P2VA 1D8CA 1AH4A 2F6UA 3VNIA 1GTEA 3T2QA 5AECA 4D1IA 2CEQA 3DFTA 4B5VA 4HHPA 1DWIM 5I3HA 3KP0A 3AZTA 3G3DA 3V0TA 2ZE0A 5FEPA 3O07A 3WF3A 5C70A 2QUUA 1GOOA 1XLMA 1B57A 2VCCA 3LBMA 2P0OA 1T7LA 1BLIA 1XFBA 3OTRA 3IIZA 1UG6A 1CB2A 2DY3A 4QCFA 2IKGA 4D8ZA 3CYVA 3CV2A 4RDVA 3AUJA 4HPJA 2EPLX 3LA4A 2Z00A 4DXXA 1Q2SA 3U57A 3W84A 3KBWA 4AVFA 1R0MA 3NQEA 5DEZA 3TYAA 3W7CA 1J5SA 3W7NA 2Y8VA 2D2GA 5E6YA 2RGMA 5REQB 1MZRA 3KEHA 4J3WA 4MY1A 1OFBA 3VIJA 4K1WA 3W1NA 5D2YA 3KVLA 1TPC1 2QPUA 3ITTA 1DJYA 2RAGA 4GBDA 4CU7A 3B0PA 1OCJA 3E38A 1D3HA 4ZE4A 4ZOAA 5DT5A 1K8YA 2WPBA 2NXGA 1Q6DA 4DO4A 1O12A 4O1FA 1ZU8A 1KC7A 2HJPA 4X61A 5FOOA 4GUIA 4OUEA 2EHHA 3VM7A 1UWSA 1V3LA 3K46A 2VOMA 2AKZA 4C60A 2BGSA 2MNRA 1OGGA 2X16A 1I1WA 1DXEA 1FXPA 1W9BM 3A9IA 4O54A 1GVQA 1QXLA 1A5BA 3GW3A 4ZQRA 3NL3A 4KCTA 4UFJA 4BJHA 3N2CA 2C79A 3SFWA 3ELFA 2O92A 3AS0A 4OE7A 1TUXA 1JCLA 1JJKA 1YQ2A 3I3BA 3PUDA 2Q6ZA 2PLKA 2IKHA 1XIJA 4K2SA 1US0A 3WD0A 4JEJA 5FF4A 2DQWA 4KFNA 5MKGB 5XINA 3WF2A 1LRQA 3QLLA 1OC7A 3IJLA 3ZM8A 4HU0A 4S3CA 1AQMA 3FHQA 4B9ZA 1IGSA 6TAAA 4MWAE 5EKYA 2VFHA 1EQPA 4OT7A 2Z29A 3TXVA 1OC6A 4WY0B 3PFMA 2BP1A 3CAQA 2VZUA 3VCCA 1PWLA 1V93A 4B4HA 2AMGA 4J3VA 4GGBA 1Z42A 3CMJA 3UNTA 3CQ0A 3ARSA 1Z44A 4BZYA 3CUXA 2PODA 2O55A 3SRHA 2OSYA 3VOIA 4LC8A 3QV6A 4D2JA 1DVJA 5CJMA 1PTAA 4RW5A 1ZGDA 4LUYA 3ZT7A 2IQ0A 3QMRA 1WDDA 1V6UA 3BLEA 1GQJA 2FVLA 4JKKA 2QCEA 2V9DA 4L9YA 5GNZA 2Z1BA 3PM6A 3A4WA 4G2DA 4DM1A 3ICJA 1R3RA 2YDSA 3BMXA 3KCOA 3RPDA 4FALA 1XINA 2QVNA 3O1NA 2TYSA 1NDWA 2VUYA 1W31A 1DIEA 1H63A 1A47A 1F61A 4GPNA 4FLQA 2FGBA 5L9FA 1WZAA 3IIVA 3T2PA 3C2RA 1C29A 4EKJA 1IYXA 3DHUA 4D1JA 3ABOA 1X97A 3RM4A 3H70A 1EOKA 4I7WA 3HQ1A 3ABZA 4M81A 1KFEA 2ISFA 5REQA 1UYQA 1I0BA 4TTUA 1NARA 3BV7A 4L6HA 4HYRA 2IW0A 1PAMA 3GXMA 3M43A 4YCPA 4LNYA 4QDWA 1UP3A 2XH0A 3LGGA 4HHMA 3FYYA 4DF2A 1CLXA 2FDMA 1P0EA 4WSJA 3VDGA 1Q6OA 4WDWA 4R53A 3U9IA 2ZZ2A 4FP1A 5LHFA 2ZX7A 1IF2A 3CAWA 1AD4A 1G4EA 4LBSA 1QT1A 2G4FA 1FWWA 2VR5A 3KZPA 4EXBA 1R9YA 1KLZA 4DZ5A 3TN5A 3IJ7A 4R5EA 3SI9A 2CKSA 3EDDA 2YDQA 4J35A 5I23A 1ZBKA 3CO4A 1S2UA 4NYUA 4PMXA 2EQDA 2OELA 4FMVA 2XGBA 1TFVA 4QISA 3WEMA 1X1OA 1R5YA 2CLMA 3TN4A 4GKTA 4ML4A 1K7XA 2PTZA 3GD6A 2DP3A 5H8PA 1AL8A 4YYFA 7TIMA 4W5UA 3S6DA 1HXJA 4B92A 3R43A 3QM3A 2Z27A 2DJLA 1E4NA 3MMDA 3P5ZA 2GQ8A 3W2LA 1XXXA 1E9ZB 3GFXA 1SO4A 3L9CA 4O1EA 1IQ8A 4EAMA 2AL2B 3T81A 5MKGA 3HPFA 4I9JA 1QCWA 2C7FA 2V69A 4YJ5A 1G5AA 4WKAA 1X96A 3CMFA 3IJQA 1PVNA 3GVGA 3POHA 4EACA 4JTGA 4Z2HA 3GTNA 2FB3A 3QZ6A 2VFEA 4JNZA 3NR0A 3FA3A 4ZO6A 4DBDA 4XQ6A 3JS3A 1M7JA 2XWEA 1O7AA 4WY0A 2J24A 1H7RA 1CW2A 2G41A 1TZ9A 1VPYA 1S1RA 1AH0A 3QY7A 4AX7A 3WQGA 1FRBA 4QEEA 2QT3A 1MYRA 4JL1A 3VX0A 1J4EA 3L0NA 4FNSA 1GKQA 1OYBA 5AC5A 1GUVA 4R88A 3N04A 3N2BA 3QZAA 4GZ7A 2B0MA 5CBJA 4ATLA 5A8NA 4QITA 2HBXA 1YBQA 1LTDA 2DW7A 4J3SA 3NZQA 2YR1A 3SIMA 1IZCA 1XYCA 1LWIA 1EIXA 1O95A 1R3VA 1ZENA 1UQZA 4U28A 4ICNA 3APTA 3CHFA 3M0LA 1SJCA 4GD0A 4IPJA 3SUWA 3UR2A 5JH1A 3N29A 4HA3A 3UZ5A 4HQVA 4DBEA 6ENLA 3ITVA 4HGXA 2OG9A 2QCMA 3TTQA 3RF9A 4U5IA 1FCVA 1X1NA 1H1NA 3SCVA 3LSBA 1EJTC 3MTWA 1CWYA 2C1GA 3AXXA 4F66A 5BRQA 3G1YA 4GISA 4NAFB 3VC5A 2Z2BA 1EEPA 1J6PA 1QPOA 1NU5A 3UR8A 1E4IA 3CUIA 3F2CA 2NZLA 1TWWA 2OWCA 4IPPA 3ATYA 1FBAA 4OWGA 1JCYA 4PTWA 1F05A 4GC4A 1SUXA 3WDRA 2DSWA 1RCOB 5EY5A 4AZ6A 3E12A 3MSRA 4H00A 4H9TA 3RM8A 4DXKA 2CLHA 4IGNA 4GCXA 1TWIA 4WKHA 1EPXA 1R9XA 3OGSA 3CO8A 3Q45A 2XN2A 4ADSA 4WJXA 1E6QM 1UC4A 2OJPA 3O6DA 1Q45A 3CS2A 5A8OA 2AQVA 2IUZA 4RPQA 3VD5A 1NSJA 1UB3A 1W1YA 1UD5A 3CNYA 5DF0A 3HFTA 2YXXA 1KA9F 4MM1A 2I9EA 3NQDA 1GPWA 7ENLA 3QW4B 3W7OA 5KEZA 3ZQ9A 3M6DA 3THQA 3PBYA 1SSDA 3K2GA 1V51A 2P3ZA 4PMDA 5FKYA 4HZ7A 5HR7A 1POJA 3KOYA 1DQUA 4KWVA 3ZWTA 4U2ZA 4MNJA 3L4ZA 1QU4A 4JFTA 3AYRA 1GOKA 4US5D 4IIDA 3TA9A 4ATWA 4PCSA 4UNLA 4W7VA 3K4DA 4C6NA 1S5TA 1EJVC 4QAWA 3H7RA 1V02E 2W5FA 4XG1A 4XSMA 1SPQA 3PPGA 1WYIA 3E5PA 1E6XM 2ZX5A 3UA4A 1TB3A 3KX6A 4D6JA 4XD5A 4JCLA 3AIVA 4GH3A 2E40A 3BLKA 1G69A 5B7ZA 2OQYA 4M8UA 3SY8A 4HA4A 4FNRA 1V3MA 3EZ4A 2PRMA 2GQ9A 2HSAA 1PHQA 4N7QA 4M19A 1YEYA 1JZ4A 2V2CA 4LALA 3MSDA 4HIBA 4IHCA 5BYWA 4GQGA 3E1F1 1S2CA 3AI0A 4AY1A 1W32A 5I0DA 3PTQA 2X40A 1DIKA 1UR0A 3GHRA 2IPJA 2WCGA 3LHVA 3BZJA 2C3ZA 3WFLA 3A5VA 1XIIA 4E8CA 2YJQA 3LY0A 3BVJA 1S5VA 2Y5SA 3H26A 3LOTA 2DUZA 4M6UA 4NYYA 1VPQA 5AC8A 3O63A 4C1LA 1Q6QA 3LCFA 2WOQA 5FJOA 2Y70A 1M3UA 5F1UA 5FSEC 3WJSA 3W2MA 5LA1A 5HK4A 1H7PA 3WLLA 5M5DA 3L23A 1UPMB 3W07A 1TJRA 2IKIA 3L2LA 4I9MA 1ODZA 2DZAA 2J7GA 3A5FA 4Q7NA 3SBFA 3WH5A 1EUNA 2GJNA 2VCAA 4BR1A 4KPLA 2WZTA 4JIHA 4MNMA 4UZSA 2G5WA 1EL3A 2OOFA 3PG9A 2E25A 3Q58A 1XPYA 4P7QA 1JQVA 2RDWA 5DBTA 1DJHA 2D3LA 1YIXA 4GFSA 4IOTA 4AZ5A 2DJXA 4DO7A 4D6EA 4UTMA 3MSYA 1XLFA 1IR1A 4H6RA 3A9BA 3IGHX 4HZMA 4JIEA 3WDPP 1VEOA 3SDOA 4HCLA 4NSBA 2CPUA 5LHEA 3MHFA 3N4FA 3ITCA 3AIQA 1JQXA 3AYSA 5D03A 3O06A 5ENLA 3DG3A 3VVGA 1GHRA 3GG1A 3CQIA 5IHRA 2NX1A 1XX1A 3TC6A 4MKNA 1OYCA 1YE6A 4RJEA 1ZP4A 1FDJA 3EEGA 1TPB1 1NIUA 2YL9A 3ISIX 1WAUA 4P7LA 3MCNA 5DX7A 2GDQA 4US5A 5AVHA 4KEUA 4FOJA 3VK5A 4CN6A 1HTIA 1EFZA 3G3MA 1YTKA 1WOAA 1GJUA 3HZ3A 1C3FA 3FLUA 1LOLA 4EPEC 3DFQA 4A4AA 9XIAA 5DRIA 4DIAA 1EYEA 4X63A 2WC4A 1XV8A 4UOJA 1XH2A 3GFZA 4MY8A 3BW4A 4CQ8A 4WKFA 3NWRA 3W7IA 3O7UA 2J9XA 3WD1A 4F0SA 3H2NA 2QHAA 1IXOA 4R7WA 1H51A 5HMEA 2X05A 2PP0A 4YHGA 5G5IA 4KCVA 3NEVA 4UNIA 2JIEA 3DBPA 4WXYA 2PB1A 2XFFA 5HNUA 1WPCA 2Y63A 2PWUA 5HWNA 2V5KA 4FLSA 1W1VA 2VEKA 4IXHA 4JKLA 4B3ZA 2H3BA 7XIMA 4C6EA 1KFBA 4TQTA 2YCIX 2WB5A 3R58A 4L4OA 2BVDA 1NM9A 2CBJA 2BY2A 2WSYA 3D0CA 3NQAA 1YMYA 3RYSA 1T40A 3RRAA 1R3WA 3UPWA 1ODUA 5C71A 3ANUA 4WJEA 4WOZA 4I6KA 3TOYA 3STGA 1VZWA 1QI3A 3B8VA 5GVJA 2ZKMX 2GQ3A 4WY0F 2QAPA 1KLYA 3T8LA 5BOOA 4HOZA 5EMMA 5HWMA 1ZB5A 4XK2A 3AHZA 3MP4A 4D6GA 2NXHA 4RKAA 5K9XA 3FXYA 1IE7C 1D9EA 1A3WA 3E6EA 3QKZA 3RG6A 3E2QA 3D47A 1A49A 3O6YX 3QR1A 3N6HA 4LPCA 4WDTA 3BAJA 1MI3A 4A29A 4KKXA 3S5ZA 1EGMA 4DBWA 3BLPX 3WEZA 3LCXA 2WW5A 4CQDA 1KO0A 3VPLA 1XLKA 3IV8A 3SSJA 2YSWA 1VBJA 2DV0A 4CVWA 3UJ2A 4O18A 3WIJA 1QUMA 4PBEA 3V36A 1VD6A 3TAOA 1LBMA 5DO8A 3R11A 4UZUA 1UKSA 5GPRA 2GUUA 1EHNA 4ZQPA 2QUVA 4MB5A 2CLKA 1OZQA 3INPA 4NX5A 4QEHA 2GGHA 2IS7A 2ZUSA 5I02A 4RPPA 3AICA 3W85A 2Q8LA 4Q4QA 4UUIA 5FJJA 4O28A 1ZUAX 2HRWA 2QJJA 1OFPA 3OBAA 1ONRA 3QYSA 2EBNA 2E0PA 4W7WA 1C7TA 2DT1A 2DU2A 1V08A 3M9YA 4NJIA 5C7HA 4QE1A 4HPNA 4IJBA 2A7RA 3P74A 2Y62A 3L5MA 4R27A 4Z1DA 4H8NA 4XZNX 1QK2A 3M0JA 3H6OA 2R14A 2AAMA 3BLDA 5F2IA 3HN3A 5MHBA 3AWOA 2OPJA 3FJ6A 2CETA 5H2ZA 1TQJA 1FXQA 4GI4A 1CB7B 3AZSA 3SUUA 3LU2A 4JAWA 4XAGA 3OZMA 1N2VA 3R6IA 2FPTA 2BMBA 3ZLFA 3AOFA 2ZUUA 4XO6A 3GC4A 2XH2A 2NXIA 2E5DA 1DXFA 1E6RA 2VXNA 1VFHA 3W6LA 1QHPA 3KVMA 3W7QA 2X41A 4GBUA 4D8LA 4DZIA 2MUCA 4FNUA 4OJYA 1QAPA 4OVXA 2DEPA 4K8HA 1IEVA 4MJMA 1W3IA 4E6MA 3BE7A 4UOZA 3W86A 1I4NA 2H8ZA 3PUOA 3GU9A 3VAVA 2R1PA 1E6NA 1VHCA 3W9ZA 1F5ZA 1KBLA 1QI0A 3CJPA 4UTFA 1AA1B 2AL1A 3WELA 2E4TA 4QLLA 4GC3A 1LG2A 3MZ2A 2VHLA 1SMDA 2YYTA 3F4WA 3UBPC 3K1GA 2WANA 4GNJA 2G96A 2E6AA 1BGAA 3C52A 5A6TC 1N8FA 2E1WA 1MDRA 1G1YA 3AHYA 1NWRA 3OOQA 2EKCA 5LNWA 1R7OA 4DYKA 8RUCA 1B2YA 3U5YA 3D5HA 5G2HA 1V6XA 2WMHA 4ZBCA 1ZBCA 3DG7A 1NWUA 4YVVA 1V6WA 4H6QA 4LS0A 1VFOA 2VUNA 3QHMA 2C19A 2I5GA 3TNBA 4GXMA 2TRSA 4DRSA 5T9BG 2PDMA 1IXQA 2W27A 1TCDA 2FGLA 4PTMA 1WOBA 1FWGC 1U1JA 1Q5MA 4EXAA 4YTSA 3G77A 3GDLA 3BQ5A 2BY0A 2GGGA 3TK7A 4AW7A 4GLEA 2QF8A 1HKJA 2NQHA 3Q2DA 1TX2A 1OHLA 2QJMA 3TVAA 2WNQA 4GK8A 3H23A 3CASA 3WLSA 4ES4A 2C18A 4LAOA 4QTGA 3A3HA 2BVTA 2CZ5A 4V28A 1TRIA 1I2RA 4GQRA 1SVDA 4AEFA 1I9CB 2BHYA 4E4UA 4E8DA 4JX4A 2DZPA 1ZAHA 2PS2A 1XIDA 3R8HA 4GXPA 2E67A 4MVAA 4H9MA 4FA3A 2WPGA 2VT0A 3QR0A 2R6OA 2B7PA 3CT7A 4YYCA 4HMNA 1XBXA 3BJFA 1CCWB 4M1BA 2E9MA 1UWRA 2QDGA 4Q7IA 1DYSA 2JKEA 3V7PA 4B5UA 3A23A 1GWJA 4GVHA 4P8UA 1UD6A 3IWPA 1Q85A 1YTEA 2FLIA 1K7FA 3L4UA 3TV8A 2R1KA 3ONBA 2VI0A 1KFWA 1OFOA 3CV1A 3WBXA 1M7PA 4A8RA 2P88A 1GYMA 3BO9A 3TE9A 4DVOA 1TIMA 1BSLA 2YCLB 3USZA 3EBVA 2BASA 2CWXA 3RR4A 3LB0A 1XG4A 3HGSA 1WNOA 3PZMA 2G3IA 3SJ3A 1XYMA 1ZAIA 5J8LA 5BOEA 4JTIA 5A2AA 1TVNA 4Y9OA 3W0KA 3HV8A 5DCBA 3VKKA 1F3EA 3OO2A 3LQGA 4LVAA 3UYIA 1OIMA 1WUFA 8A3HA 3D3AA 3OP2A 3BJTA 4MDOA 1VIZA 4N2YA 4YPJA 3B05A 3GVVA 1R85A 4GWEA 3Q65A 3CWNA 2WHJA 3R79A 1FCUA 5JIPA 2OYMA 5D05A 5LNVA 1TPWA 2I1OA 2PWDA 1GJWA 3RUBL 1QBAA 4DI8A 5GJNA 4NU7A 1G0CA 1H3GA 4MAZA 4FOUA 2D24A 1H0IA 3WY1A 4FK9A 1M03A 2JF7A 4GQBA 1KM6A 1QR7A 2VTFA 4XIMA 1LWJA 4FIQA 5TQLA 4XZHA 5K9DA 1F4HA 3IJ9A 2OLAA 4I6VA 3PUGA 5DXXA 2D69A 3BAKA 3EAUA 2VELA 4DBSA 2YW3A 1F8MA 3I4KA 1M65A 1FWFC 1W5NA 1U5JA 1ENUA 4H3DA 4IQLA 5BWAA 1W5OA 3S9IA 4JOMA 2QGYA 3G6MA 4N9CA 5C9UA 1FHUA 3BARA 1OJXA 4HK7A 1QATA 2BNJA 1NDZA 4UTJA 2ZZ7A 5EMJA 4L4LA 5EU9A 3FSUA 5CLWA 3UVIA 1PZ0A 2Y2WA 4H4IA 4JZ5A 3AIRA 5HJLA 4MNLA 4GQQA 1UBPC 3MO7A 4Q22A 4A3YA 4OTKA 1ZJBA 5BNKA 2ZXBA 3WDQA 3DKJA 2YOCA 4FS9A 2I57A 4P5UA 3URBA 3KAOA 2OLHA 5D2VA 4Y2WA 4ZB5A 3GHUA 2WCSA 2ISWA 1RCXB 3AC0A 4WSHA 3ARUA 1PE1A 2E8YA 4C65A 1T6MA 1LM1A 3U4AA 2F2HA 3LCGA 1GVRA 3WD2A 2DH2A 5LIKX 2C71A 1GK8A 3QOKA 1KBJA 1NQKA 1W3NA 1V6TA 1W3JA 3VD9A 1FY6A 3ARVA 3E96A 3VNJA 5FF7A 3WF1A 2R1LA 5U4NA 2EJAA 4JTRA 3V1PA 1BSIA 4QFUA 4PMZA 3G5EA 3FOKA 4JIQA 2NUYA 4RUBA 1ECEA 2C1HA 3H7VA 3I68A 4GGHA 2VC5A 1EDGA 3OQEA 1JCXA 3PPCA 1GZGA 1H50A 1H5VA 3L5LA 3A12A 3CQHA 3MWAA 5FJRA 3S8HA 3TN3A 2HVOA 5F2MA 4AMCA 1CGWA 1V0MA 2KAUC 3P2VA 2YCLA 4ZXLA 1NOUA 3B04A 4WRHA 3VDCA 1F3TA 2CWNA 3WNOA 4IL0A 4U3AA 1SJBA 3OQ8A 3UCDA 3NL5A 5A69A 5KMYA 2IKJA 3UU0A 3KUMA 2OEMA 3NPUA 2W66A 4H8HA 4HKPA 4HOXA 3WK2A 2OWXA 3W75A 1LORA 2ABAA 4ZXOA 1XLHA 3CHCA 3M7WA 4IP5A 2G8ZA 3FX4A 2BWGA 3KOZA 2RJHA 4DX3A 1GOWA 4P7OA 2WAGA 1V0LA 1WAWA 3MKVA 4GINA 1XD1A 4PSRA 5AHLA 1XHGA 3VOCA 5C8BB 3TUUA 4OHQA 3UWWA 4W85A 3T1GA 5GNYA 2GOUA 4XKYA 4LVDA 4F8XA 3GZAA 1R3SA 3NOYA 5XIAA 4FOKA 3RFAA 2XTKA 1OFRA 1ISZA 4JQ2A 4GA8A 3S1GA 1Q13A 3I10A 2Y5JA 2HWGA 3BGAA 3WX7A 1MSSA 5FJIA 2O4MA 3P67A 3REQB 4X2PA 3H8AA 1FFRA 1OGSA 4W9TA 3LXAA 1HJWA 4H6KA 3TMQA 1KQYA 3M7SA 3AS3A 4URIA 3MSGA 1R30A 4ZO9A 1KM3A 9CGTA 1UA7A 1A5KC 3AMGA 1O5RA 3TCEA 3WBYA 3LHUA 1DBTA 3UR5A 4Z08A 3GDKA 4O53A 3NDYA 3IACA 4ZO8A 2NQZA 3K8MA 3LERA 5CPSA 3SFKA 3W73A 3HFYA 1JGIA 3RM9A 3ES7A 2DH3A 3M0YA 4QBXA 2WHLA 2V67A 3SJNA 3EA3A 1SJDA 4WX2A 3I65A 2PEVA 3USBA 1CIUA 3BXWA 4HNUA 1F6KA 1EYWA 1H4PA 4CUCA 1OFQA 1KB3A 1BXNA 1VCFA 1R2RA 3B4YA 5AKQA 4PUJA 2A3HA 1S5NA 3B9AA 9RUBA 1SFJA 3IUDA 2EPMX 1W91A 3CL8A 2ZX6A 4K37A 2GK1A 1W3LA 1XGDA 3VIHA 1XKYA 1DWJM 2ZXQA 4GJ1A 4M51A 3EKLA 1A0CA 1UBSA 4XZBA 4ZEPA 4QSHA 4B91A 3HG5A 5CJNA 5LIUX 1T5AA 1OD0A 2P10A 3VM5A 4IFKB 2DVUA 3WK1A 4MPQA 3W7HA 1XDMA 3W82A 4DHGA 4M6QA 2CLPA 1ZS2A 4GI8A 3FSTA 2Z6JA 1FWRA 1VC4A 3QC0A 1TWDA 3SGGA 2VC9A 4ERGA 3H7UA 3BOFA 3VGFA 2D0HA 4U5KA 4O1BA 1OF6A 3P14A 3SCNA 4CD6A 1ISVA 2C8NA 1YDVA 3G1SA 5U7SA 1RHCA 3CUGA 2O4QA 4AIEA 3AIBA 3UERA 1F6PA 5CC3A 2A3EA 3SCWA 2VFFA 4YS1A 3LRKA 3LV6A 1VJZA 1MXGA 4GZIA 3PR2A 1UZ4A 5JIWA 3HBLA 3EMZA 1PIIA 3QY8A 3OA5A 1H7WA 2QPXA 4MY9A 3L68A 1VJIA 2Y7EA 3ZIZA 4QS5A 4FR1A 3STPA 5CGTA 1UJPA 3U0HA 1J79A 3KOWA 3C3UA 2DVTA 1X98A 3R10A 3VINA 3CU2A 3W37A 2A6NA 1U30A 4X0VA 1QOPA 3LI1A 1NP2A 2ALDA 4BWLA 3CV7A 1WDPA 2ON3A 3KWXA 2YW4A 4JL2A 4WK9A 3R89A 3I4EA 3CLWA 1W9UA 4C90A 2Z1KA 4PUEA 5M17A 4A22A 1PV8A 4TVUA 2WZMA 1KBBA 3CBWA 6XIAA 3CTTA 1G4SA 2TAAA 2A7PA 4NIRA 4KS0A 5GNXA 3BLIA 4DWSB 2NLYA 1TMHA 1UKOA 1HJVA 1BYAA 4JYFA 2V63A 1XM3A 3VDHA 4GOAA 4ERAA 3DFOA 4DJDD 3L65A 3MDWA 3NGFA 3WNKA 3ZJ7A 3H2CA 3B8SA 3C2FA 2NV9A 3GKFA 4LVGA 2OMAA 3LGDA 3RXZA 3SSZA 1ICPA 4LCSA 3JZEA 5FEXA 3VI2A 3S1UA 2ZWZA 5AFDA 4O10A 3U7BA 1R87A 4L6OA 3OGRA 3U4FA 3KL3A 1K7EA 5D09A 3F03K 2VC7A 3RIKA 4L9ZA 1YKWA 1VYPX 2ZRUA 2ISSA 3W83A 2HROA 4MYAA 4FNPA 4DM2A 4C6QA 1CT5A 3KTXA 1GW9A 2ACSA 1D2KA 3OLGA 2B81A 5AC7A 3EOOA 3U3HA 4JEQA 1P6BA 1I2PA 2CU0A 3CZEA 4KH2A 3DYMA 4MUZA 2XVPA 1NTHA 4XZIA 2VGGA 2BVWA 3T0CA 2Z28A 1MXDA 2BY3A 2OX4A 3T78A 1IWAA 4F0KA 1VGAA 3M0KA 1E6PA 3GSMA 4RZ6A 2QXWA 2P8CA 1MW0A 1N8IA 2J74A 1BWKA 2JEQA 2YLAA 1T99A 2GVYA 3RJYA 3V5FA 4DJFD 2POZA 4M3PA 1ZL1A 1P6WA 1FWEC 1XYZA 4FLRA 3HM7A 3GHSA 4MMWA 2C16A 2OX1A 2ZTJA 3CTLA 3W25A 1X6NA 1XLJA 3KCLA 1G7VA 2ZRXA 2CHNA 1S39A 3NPXA 2P1FA 3V18A 1KWKA 4AZBA 1E56A 5C0QA 3TYBA 3SEPA 1THFD 1FP8A 4GUGA 1LL4A 2XFYA 5A8MA 4JY9A 3DHFA 3NSMA 3PPFA 2ZZ1A 4DF1A 3WUFA 3AUOA 1BWVA 4QLJA 4UQ9A 1DWAM 4UTWA 2XIMA 3LK6A 1FWCC 5EYWA 2PDUA 3UZWA 1EXBA 3VGEA 5C7VA 3S5SA 1ZAJA 4XVDA 2VDGA 2OGYA 3GG8A 1VJSA 4J5NA 2FTPA 3HO8A 4I8DA 4GZJA 2CBIA 2OXNA 1DXIA 1L6YA 3TX9A 1F3WA 2UY2A 1SQ7A 3WYZA 4CN1A 4MNKA 1XW8A 5H91A 4AZGA 3F5JA 2Z1XA 2CZVA 5KZEA 4BWLC 2OCZA 3KBJA 4MJ4A 4DZAA 1WCGA 3NZGA 4P8WA 1TO3A 1XBYA 2ZDRA 4ZQNA 3GNPA 4L7ZA 3UZJA 5CKSA 1L6GA 3UY8A 1PX4A 4JIPA 4IPIA 3UWZA 4UWMA 3MJMA 5AYIA 1HJQA 4AZCB 1NF7A 1XGEA 4DWSA 4JIIX 3PJWA 3LLXA 3GR8A 4GIEA 4J3XA 3RU6A 1JVNA 4KWWA 3LYEA 4QM1A 1A4LA 2VYOA 3WQCA 5BOFA 2ZRWA 1HW6A 3CLMA 4JX5A 1FWBC 4WZHA 4K68A 3W4RA 3Q4DA 1V6VA 1EHAA 3QZEA 3B0VC 3W7MA 2ZA1A 2WJEA 1JXKA 2POTA 1WQ5A 4S23A 4A3QA 4QAIA 4MZ1A 4LV9A 1JL8A 2VR2A 5DQPA 3S42A 2XHYA 5E9AA 1U2YA 5D30A 1PZ1A 2TMDA 1AW5A 4UTLA 4XZWA 4RDWA 5CZTA 3RX3A 1H62A 4PUKA 3S5YA 1W1TA 4QE5A 5A6SA 1JPKA 1U22A 1RR2A 1ZNNA 1IGWA 3ALFA 2D20A 3EXRA 2EG6A 2W91A 4MB4A 4FO4A 2HDJA 1PZ3A 4DJFA 1J10A 5CG7A 3WQOA 1KBKA 2DIKA 3P93A 2QUTA 4E4PA 2XISA 1ADOA 3CPRA 5HUOA 3K8LA 1B4KA 3C0QA 3DFSA 1OINA 2V5BA 3GYCA 3W1AA 4DB7A 1DKWA 5AYBA 3QJAA 4GI6A 2PTXA 5H6HA 3TNOA 4PSPA 1NWTA 1P1XA 3G6LA 3QW3A 4Q8NA 5A6AA 1B3YA 4K36A 4R7JA 1W9DM 2YCEA 4AD2A 4K7YA 2ICSA 3KHDA 4Z1YA 1UWAA 1DIOA 4UTWC 2WNNA 1P0BA 3WFAA 2I9UA 3FGCB 3SIZA 3WLMA 1O5KA 2WCAA 1DV7A 1RK5A 2FMOA 4WF7A 3VGGA 4DXVA 2V2DA 4ERIA 1XLBA 1BVNP 3GFYA 4HA1A 4MB1A 1ISXA 4E3TA 3VC6A 3W3OA 2QKFA 4PUMA 1OK6A 4O57A 4HT3A 1US2A 3MI2A 5AHFA 4ZSUA 3OPSA 1W1ZA 4KERA 2FZDA 1O68A 2ZCGA 3E5BA 2OQLA 5IFPA 4O19A 4AVNA 4PZVA 1HFBA 2Z7GA 3PB0A 1WKDA 2RGLA 3ARTA 3PNUA 3V3WA 4DJDC 4Z2IA 1GYNA 4P61A 3MV11 2C15A 3NQMA 5IHSA 1AL7A 3ITLA 4PMUA 4O14A 4DWSC 1J0ZA 4GRSA 1KM2A 4FXJA 4JTUA 1OWQA 2RDXA 2A4AA 1GQKA 1CYGA 1W2VA 2H8XA 3W7LA 1B4EA 1CXEA 1MEHA 4AZCA 2C13A 2V5LA 2JGYA 3G1HA 5M3WA 1ZZMA 2WKJA 4FXFA 2VFGA 4JDYA 4LUTA 3V5OA 1KV5A 4UQEA 1O5XA 2GVEA 2VX7A 4HJWA 2LLEA 4LUIA 4NRSA 4LUJA 1Z48A 1N8WA 4AZIA 4BCEA 4PB4A 1I45A 4Q8PA 3KM8A 4UCFA 1J18A 3THCA 1A80A 5H8MA 3TU9A 2J7FA 1ITQA 4RE2A 4PMQA 3H4WA 3LPOA 4G6CA 4HHLA 3LPPA 4FB7A 4IWWA 4GO9A 4GIAA 3PZUA 1E15A 1J0KA 1GNXA 3ENLA 3RAOA 1RY8A 3WCZA 5ECVA 4B2DD 2PDIA 3NQ2A 4MIMA 1L9WA 4MWAD 4H8VA 4GZEA 1YXCA 3UGVA 5A6KA 2VURA 4GYPA 3G1AA 3LEPA 1PKLA 4W87A 2VL4A 4D6IA 5D9NA 1TPVA 4UR9A 4DJFC 3PBGA 4PC8A 3PN8A 2P76A 5CQ1A 3M0HA 2DZWA 4NJHA 3KRZA 3KE0A 3B40A 3FW6A 1F4AA 1YDYA 5FI8A 5D2TA 1MNSA 4AF0B 5D4YA 4K7VA 1S46A 1YHTA 1GZJA 3PB2A 3IUHA 3HU7A 1L6FA 2BXZA 1AFSA 2YZ5A 2Z0IA 3MVIA 1V8EA 4JQ3A 1OC5A 2OYLA 4Z2KA 2GL5A 4ZZ9A 1QW9A 3EX4A 3SECA 3BWWA 5CPNA 3DENA 1B5TA 3KBSA 1E73M 1IIGA 3W1PA 1EBGA 1L0PA 3N34A 2OEKA 4IQDA 4S3KA 1JFHA 4AD1A 1XS2A 4JBRA 3B06A 1UIOA 2A0NA 2FDSA 3MUZ1 1EZWA 3TH6A 4EVZA 3TIMA 2FVKA 1GOMA 3H4GA 3K8KA 2ACUA 1J01A 4PMJA 4Q8TA 1DQXA 3IVTA 1UKQA 1B9ZA 1GEHA 3IVSA 4AYGA 1DWFM 3V0UA 4DF0A 1WKFA 1JUKA 3CWHA 4WIWA 4E2VA 3K1DA 1JZ7A 3T0DA 5D9MA 4TXEA 1SW0A 1KM5A 3OB8A 4LY4A 3PJTA 3A3WA 1A3HA 4ML9A 1Q2RA 1YLVA 3W7RA 3AXKA 3SUTA 3F2BA 1O4UA 4JFSA 1HN1A 3TJIA 1JPHA 1M5WA 4IIFA 4BI6A 1Q6LA 5IDZA 1DJXA 1OVDA 3V1HA 1A5CA 2A3LA 2XVNA 3M16A 3SQMA 4GMEA 2EPHA 2VENA 2XGIA 3A24A 3ZOAA 4M82A 1M7OA 3GTIA 5BMXA 1FWDC 5HXMA 3W7JA 1DTNA 5CPQA 2QMKA 2VGBA 2XWDA 3OEXA 2W79A 1PIGA 1TELA 1MFUA 1RXOB 1W37A 1W9XA 2OSXA 8XIAA 4OBSA 4BQ5A 3U2OA 4DZHA 1C9WA 2XSAA 4M24A 3N25A 1QHOA 5LNSA 4HK6A 4X3ZA 3B9EA 1IXPA 1TG7A 1QI2A 1YPIA 2VC6A 4OZOA 3GDTA 3UFYA 3ZZ1A 2QR6A 1YDNA 3DN5A 4OOZA 2HZGA 4B2DA 1JYWA 2BODX 2ZTKA 1FWJC 1KM4A 3AWNA 4MWAA 2J8TA 3IANA 4O15A 2H9AA 4CD5A 3GNRA 1XIBA 1AQHA 4GYPC 4NRRA 3NPWA 4A2RA 4XTIA 4Y7EA 3U2ZA 1IIHA 2V30A 3C6CA 4Z1BA 3PZVA 2BX7A 5CZ0A 1TA3B 3WENA 5E9XA 2YBVA 4W86A 3RLUA 4XWUA 3T08A 4BQ4A 2QIWA 4EPKA 4NNCA 1JGMA 3LTPA 4FEZA 1MWOA 2W63A 2IPFA 4F3HA 3JW7A 2FHBA 2ZICA 1XPGA 2X7WA 3S2JA 2V6AA 3L4TA 4ZCWA 3IIOA 2A5HA 4AF0A 1HKIA 2V3FA 1X7IA 5LZLA 1P1MA 3GY1A 3PZNA 4RXGA 4ORIA 3IAQA 2OFJA 3VMPA 2IQDA 3C5QA 4YWIA 5FL1A 3H2MA 2FZBA 1FKXA 1GQNA 3CQJA 4UTHA 4KETA 4MG4A 2WO5A 5TAOA 2DSKA 4LRTA 2JALA 1UWQA 3LXBA 3PTMA 5I3IA 3WDJA 1TSIA 5BU6A 2BOEX 3W24A 4P8VA 1CENA 2H6RA 3PUEA 3QLDA 2BBFA 2V0TA 2CLIA 3SRKA 4Q8OA 2B31A 3QMSA 1KFJA 3DC0A 1X38A 4GJIA 1OM0A 3RCMA 2CC0A 1K8ZA 2A1YA 4GNKB 1TUFA 5HANA 5M2FX 2J62A 4UFKA 1K4HA 2ABBA 4A2SA 1SM9A 2Q3RA 4NI8A 3LCHA 2IXVA 3DEQA 1CXIA 4AZHA 2UWFA 3ZT6A 3OYXA 3N14A 3KS5A 4ILSA 3S0CA 2AQOA 2PWHA 4JYDA 4ZODA 1K6WA 2PA6A 1GVIA 3HQNA 1IV8A 3I7SA 3LXCA 2RDTA 2VD8A 5CZSA 1OYAA 2YKKA 1SU5A 1ZY9A 3DI1A 3EOSA 4JDBA 3R8RA 2Z1VA 5AZ1A 1PEZA 3DFYA 1TJ2A 2DGAA 3VOGA 3T2OA 5BWFA 1FCQA 3VMOA 4IIBA 2Y0FA 1EJWC 3EMQA 4HMEA 5G4EA 5HA7A 3HB9A 3QKEA 3M07A 1TV4A 3K4AA 1MVYA 2I5IA 5CC5A 4G8TA 1AZ2A 4O12A 1Z8AA 4MWAC 2NQLA 5CXPA 1E1CB 3NTYA 2QMJA 5M1TA 3WLIA 1JYVA 4IJRA 3THAA 1TREA 4AEOA 2PTYA 3QOMA 2CFFA 6XIMA 3DOPA 4QGCA 2PPGA 4XBKA 3E9AA 4LW7A 1EWEA 3WK0A 4POCA 5AY7A 2VNCA 3OG3A 3WDIA 2GSEA 3M41A 1ONXA 2Z4GA 2EXOA 1EC8A 4RV8A 4TV5A 3BURA 3RMEA 4LBUA 2B7OA 1XRVA 1PHWA 4NT0A 4V15A 3O9NA 4EK7A 2ADAA 1GOXA 1PBGA 1XSJA 5B80A 3QF0A 1UOKA 4AC1X 2FPYA 1XUZA 1PDYA 2CZDA 3H12A 2H90A 4A8NA 1YYAA 2X2GA 2G50A 3PWIA 3TWBA 2FTYA 4OFCA 3N1AA 3VIIA 4GHRA 3RN6A 1C8VA 3M5VA 4AWUA 1ADSA 2VDIA 1UR8A 3ANYA 4O1DA 3EDEA 2VZSA 4IIEA 3OW1A 1OFEA 2VD9A 3SCUA 3DYOA 3S5NA 3PTKA 3F5LA 1K8CA 1M68A 5SWUA 4F2TA 5C2CA 1R3TA 3W27A 3WQ4A 3NZPA 3ALGA 4O8AA 4YVPA 4S3AA 1R9ZA 4KWSA 4RR4A 1A4MA 4X9YA 3CIWA 2XZ7A 3AYVA 4GKLA 3PVFA 2Y8UA 2IQTA 1X7FA 3WMLA 2G3NA 3WLTA 1R38A 5E6ZA 1NOWA 3LPGA 3UPBA 3E0FA 4A21A 5FEWA 3ZLGA 3KOXA 2QVHA 3A47A 4C6JA 2F2KA 2HISA 1OADA 5FJTA 1DE5A 3FHAA 2BXYA 2WNWA 3DC8A 1C90A 3WKZA 4PODA 3OBEA 1OEPA 3SN4A 1Q6GA 3LSCA 4O0QA 4XD4A 3UPMA 3BG5A 1XC4A 1KCLA 2A85A 1WDWA 3H53A 1VKFA 2ZFAA 4ACYA 3HGRA 1NWSA 4NQ1A 4PB5A 4L4PA 4UTIA 1KFLA 4E0CA 1UKPA 1XICA 1PIFA 3EOEA 4AD5A 1E0UA 3ECQA 3FEQA 1NQ6A 4B5TA 4GO8A 3L21A 3PS7A 4W84A 4Q6JA 4XB3A 2XVLA 1LL7A 1GVEA 3A4AA 3TSDA 1M04A 2VEMA 2G3MA 3OVGA 3ZLHA 3NFUA 3STEA 4DAFA 3N12A 4NX0A 1TMQA 2PFHA 4BI7A 4DUWA 1HJUA 3CPUA 1TE6A 2DSUA 1QPRA 3W7EA 1RPKA 5M03A 3DHDA 3C8NA 3LRMA 1KXTA 5HUPA 2VM8A 3MYPA 3WH6A 2NWSA 3NUKA 2CKRA 1R8LA 1JYNA 1UD3A 2O9TA 3VDBA 3CQKA 1Q6RA 4ZB2A 1B54A 3MU7A 3OVPA 2G97A 5KETA 3LZ3A 2QCHA 4K8EA 5TIMA 1SZNA 2QW5A 5CJ5A 3NM3A 3QHOA 3QQ1A 1E1CA 4QQUA 1UD8A 1D8WA 3VZYA 3BLLA 4Z2JA 3B0YA 4U4MA 4PUDA 3RDKA 1SSGA 3C3NA 5D32A 1Q6EA 3EWDA 1AVAA 1GQIA 4BQ2A 4UOQA 3WDHA 2QDDA 3A21A 2QJNA 3UXIA 1I75A 1OK4A 1YPFA 2NVCA 1L2QA 3AJXA 4JR5A 2RJGA 5H1WA 3MUIA 5LIWX 1T8QA 3CAVA 4XAPA 4LVBA 5HNNA 4V1XA 1UCWA 3TJLA 4G5DA 3GVRA 1E51A 2QF7A 3IJ6A 3TCSA 4AG0A 3GVWA 1TRDA 3LNMA 1QVBA 4KIEA 3TQ0A 3LDVA 4NHVA 2DZBA 2D2JA 3I6RA 2XDFA 4C6IA 4UXDA 1B1YA 1BTMA 5CSYA 4EPDC 4S39A 3TLQA 2PDQA 3G1FA 1KKOA 3LM3A 4AU0A 2R94A 4GACA 2WKLA 2P5NA 4RW3A 3GG0A 4MZ8A 1GZ1A 4WSKA 1KR0A 3GNOA 4MFEA 1YBQB 3TW9A 2Y7GA 4O8RA 4K3ZA 1OQFA 3MHGA 3WQ5A 1DIDA 4AXKA 4CQ9A 1ITXA 2WJDA 2QQ6A 3VKBA 5CAHA 1BWLA 4Y9MA 5B7YA 2BV9A 1D7KA 3AO0A 4H9ZA 4PTDA 3UR7A 4KWOA 1AG1O 4F48A 3LUTA 3THUA 3PWAA 5I6SA 2WC7A 3G24A 3A4JA 3MJYA 3EX3A 2YA1A 3E2SA 1Y0EA 3GRIA 1EPVA 1JF6A 1UW9A 1TZZA 2AMXA 4I7UA 2NVDA 1S3HA 2FFCA 1J12A 3HMJG 4LYKA 3L4YA 4C7FA 1Q63A 1QJWA 2EKGA 3LMZA 3O6CA 4MKVA 4RNIA 2OQHA 3AHTA 1JRCA 2FH8A 1QWKA 3NL6A 3VIKA 4C1KA 3PZGA 4WHBA 2WVVB 1CECA 3KS6A 1DWHM 1J0YA 3E0IA 4QJ4B 3E2VA 3VNKA 5E5CA 3SY1A 3VIFA 1R2SA 2PSNA 3ID7A 1KW1A 3URAA 2WSKA 1KCXA 3UXLA 1HP4A 4UTUA 4PEKA 3F4NA 1P0NA 1IT0A 1OX5A 3QN3A 4U2YA 3WLRA 1O5QA 4N02A 4JCMA 5AHIA 4MF4A 1JG9A 4O4VA 3WH8A 4HSHA 1CI1A 3W74A 2JEPA 4UCGA 2X42A 3SQSA 3UETA 4Q4OA 1IWPA 4IP4A 1Z32X 1PPIA 1RA5A 5IOBA 4W7UA 4R7OA 5C5YA 1PTGA 1G7UA 2HBVA 2ZVIA 3GQYA 1XCWA 3ZS4A 2A3BA 2PGEA 4L9XA 2PD5A 1HX0A 1Q8JA 4WGHA 3MVTA 3QFEA 4JXCA 4JKMA 3NZ1A 4NAEB 5DMNA 1GT8A 2X0HA 3B0XA 1YDOA 3S1VA 1B3ZA 1PKMA 4N42A 2OTDA 4XAYA 4PYSA 5CSSA 4BEQA 1Z3NA 2X09A 1DHKA 4S1FA 2BTMA 1FWSA 3ZSSA 1EOMA 1XBVA 4XBJA 4DYJA 5IBXC 1QASA 1LF1A 1IEQA 3M5ZA 1TMLA 3MBDA 4G1NA 2HVMA 1MMFA 2C91A 3VU2A 3UG3A 2XSBA 2TODA 2HNHA 5I03A 5EMKA 2W61A 1LQ2A 2E9LA 2UY4A 3CMGA 4FLOA 3G8EA 3R2GA 2X0YA 3TSBA 3BANA 1E9IA 1YX1A 2ZA2A 2WC3A 3FA4A 2CLOA 5CLTA 3IS4A 2XSXA 2BLEA 1UUOA 4HHHA 2PD9A 2XZ9A 1E0XA 2GPTA 2WMGA 3UP8A 1Q4NX 1S5WA 1W17A 2ZX8A 3YPIA 3W22A 1JZ2A 4C7GA 3XISA 1E6SM 4Y90A 3GHTA 5BW6A 4CCZA 1ELSA 4S2BA 4CNSA 3M4HA 3RJXA 3QH2A 2NQ5A 2BDQA 4M1RA 2J7CA 1XSIA 3CC1A 1C92A 5K3VA 2ZC1A 4L64A 2GGEA 4TUFA 3WJZA 3WQWA 2GUBA 4IXXA 4AXNA 4FI4A 3ZO9A 1H7XA 3O0FA 4XUYA 4JPGA 4WDXA 1VAHA 2GDVA 6TIMA 3H22A 3W38A 1OT1A 3FFSA 3W28A 1ZBWA 3PZIA 4XAZA 6A3HA 5JQ9A 4DJED 1ESWA 5JH2A 1HKVA 1BVWA 4XBSA 3NSXA 2PP3A 1LT7A 3M0MA 2YYUA 3FVDA 3N3MA 4Q4PA 3E0LA 1GOIA 3M0VA 1FHVA 2HK1A 3P84A 1TTPA 4EPBC 1ZPTA 3UXKA 1CXKA 4N9EA 4M29A 1QPNA 3NQGA 1R86A 5T9CE 3CL6A 2VX6A 2PWVA 2BFGA 1FDZA 2WVVA 3KL0A 4CNNA 4HYVA 4Y96A 3MBFA 1TPUA 2VKZG 4OUIA 1MNZA 3AHVA 4PCTA 3Q94A 2PGRA 1TJ0A 2ISDA 4EXQA 2QEZA 1QDSA 1XQLA 4NZCA 2WMIB 3S3GA 4GY0A 4UQAA 4QRNA 8XIMA 4N4PA 1UWTA 2GSHA 1NELA 1QOQA 2JKPA 3II1A 2J8FA 3BCJA 2GWGA 1S1PA 3B9OA 2PC8A 3LM7A 1L6SA 6CGTA 1CLVA 4XD6A 4IMFA 1K77A 1ZQ5A 4V1YA 4INFA 5G4WA 1KFCA 3BGGA 1V4YA 1VRXA 3ME3A 4LAZA 5F4WA 4YIWA 1Q66A 5GJMA 4W4QA 3GC5A 1JZ5A 2FPVA 4NKCA 4TTGA 4ZE5A 1MZHA 4UQDA 4WJ8A 3V75A 3W2UA 1GEQA 4K38A 1DJQA 3OZYA 4NASA 3DERA 3MY9A 4NAEA 3RO6A 4NNAA 1JF5A 2ZDSA 3STFA 4HNNA 3PANA 5DFAA 3VILA 3NXLA 3O05A 1W1IE 4FX7A 4X22A 3L66A 4BQ3A 3CZGA 3QMTA 5LNUA 1ME9A 4Z42C 3VYLA 2NX3A 2W0UA 1TKKA 1BD0A 2RFGA 2PDFA 4TX9A 1J5TA 1RPXA 2GSJA 2CERA 3B8UA 4M6PA 2WBGA 1RZMA 2DQXA 1XP3A 3UWYA 3HV9A 5CC6A 3N2MA 3GXIA 5C9RA 1NDYA 4MFDA 1OFDA 3URQA 1WXJA 1V3KA 3ABXA 3MMTA 4BF7A 1QWGA 2UBPC 3TFCA 3N4EA 1Q3NA 3C2OA 4PMNA 2XJ7A 1O66A 1W5QA 1XDJA 4DWDA 2PE4A 1W8GA 3BCDA 1EWDA 4K1GA 2OR2A 5TF0A 4QLKA 2KZHA 2GGIA 4PUWA 4Q3MA 3KBMA 4Y9AA 4IG2B 4DUVA 5DELA 4KGJA 3RX2A 3PSWA 3FEMA 3S9YA 2VEFA 4DNMA 1EX1A 3NAVA 3EX6A 1VRDA 1XC6A 1U1UA 3BPWA 1NDVA 1ZJIA 1J0IA 1QW7A 2X1TA 1H09A 2J77A 2PLJA 3DECA 5A8GA 1W3HA 3TQVA 4KT2A 3AS2A 3FIGA 2RDUA 4F40A 5JBEA 2Y4SA 2GZXA 3VA8A 3TC7A 1VFFA 4S38A 4XAFA 1FQ0A 3BQ6A 5L6UA 5I24A 2HMCA 5DY3A 1ALDA 2PZNA 4B3KA 4P7NA 3G1DA 1JYXA 5EMLA 4J40A 4UMCA 5EL1A 4DLFA 1NY1A 1XI3A 3V16A 4HNLA 1D3CA 4CNPA 5DLCA 3PAOA 3GIYA 3IGSA 4H7ZA 3TQPA 4F9DA 1RVKA 1PWMA 4RDZA 4Q8MA 2HPIA 1X8CA 2EPKX 1E43A 1WV2A 4LEQA 1CX9A 4LCRA 5A5WA 4C91A 5ECUA 4AIBA 1GORA 2CZFA 4LVFA 3L2IA 2WMJA 5DMMA 4BF9A 2HNEA 1K6AA 4NP7A 1U1HA 1FWAC 4OKDA 3M5XA 3TKFA 4D6HA 2ZX9A 3TXZA 4AHOA 2WMIA 5K4XA 1XWYA 2J8GA 5BXPA 5F4XA 5FESA 3P3BA 1I1XA 3MT1A 5CPLA 1HG3A 1K9FA 1P48A 5KSWA 1A5NC 1AJ2A 3MW7A 5ABHA 3GXPA 3B3DA 3HPAA 3OIHA 3N2OA 4UR8A 2WLYA 3S4TA 1SFLA 3H55A 2X0SA 4PUUA 3W02A 2NQJA 3EPNA 4AFYA 5BROA 1EZ2A 4GVFA 4HA0A 4R9OA 3EEZA 4GH1A 1RJPA 3SCQA 2R82A 3P0XA 4LQ1A 1QPQA 1MW3A 4QQ3A 1E0TA 1Y5XA 1CZ1A 2CNCA 4DEFA 1Q6FA 1WKYA 5I7GA 1VCVA 3KVJA 4L80A 1H7OA 1PSCA 1SFSA 2BGQA 3U2CA 1SZRA 3VCRA 4NZ4A 3NNTA 1XRFA 1SR0A 4TMCA 2CBVA 3E74A 3RLGA 1AW1A 2VDHA 1F2JA 4FZIA 2YL6A 1DJZA 2BSLA 2Y7DA 2E1DA 3H2FA 1K4GA 5KITA 2ODOA 5EBUA 2QULA 3MZNA 3IVUA 4AC7C 1FWNA 2NUXA 1KFKA 4LU0A 1J9YA 1UC5A 3NQVA 4ZGYA 2A79A 3W26A 5EPDA 3HQPA 4IG2A 3U5UA 4GCAA 2WXDM 2PRLA 4TV6A 1WZLA 1TWSA 1PL9A 2PC4A 1RD5A 3KRUA 2VEPA 1D7FA 1H41A 3VFCA 4PUNA 3DFPA 3KDNA 3PF3A 1AUSL 3ATZA 1I2OA 2ONEA 5LIXX 4N6FA 3TLLA 2QZRA 4YHEA 5CBIA 4KESA 3FY1A 2CESA 1UP0A 1OT2A 3NQFA 3ZXWA 3UZYA 3PPHA 2J25A 2C6QA 1A0EA 4UC5A 2EG8A 1V79A 1SMAA 2D23A 1KRMA 4S3DA 3VGBA 1V5XA 5BRBA 4ZL1A 1WDSA 2ZUVA 3BMVA 1G4TA 3VDAA 1VS1A 1RA0A 2QJIA 5I78A 1H60A 5E0FA 1Y5WA 5IXEA 1YNQA 1QW8A 1DHPA 1LOSA 1RH9A 2ISVA 3H24A 3G1RA 2RKXA 4YXGA 4JTAA 5TNVA 4QR6A 3W76A 1PJ9A 3FDKA 1VQTA 3STCA 1GONA 4ONVA 2FFIA 1J2WA 3DDMA 3EX1A 4A6GA 3MB9A 4Y8EA 3GNXA 1KGUA 1WBHA 4MOZA 4AHPA 3OLIA 3CB3A 4FXRA 3TTSA 4IFOA 1Z7AA 3V0SA 1G94A 1ML1A 2INEA 3OVQA 4KBXA 1JUEA 5EB8A 3WQDA 5A2CA 4GUHA 4F0MA 1Z69A 3NXFA 1VEPA 1K02A 3WNPA 3ZMRA 3HA1A 5F2GA 1AJ0A 2BY1A 4JTCA 1AQFA 4KCWA 1TV7A 3NCOA 3BV4A 1XLCA 1FUYA 3EWBX 1NH6A 3UWEA 3E02A 1ISYA 2WSRA 3KCJA 4J3TA 1IT8A 3LV5A 2G95A 4HTBA 4H6EA 1WB0A 5I00A 4IGHA 4HPHA 2GGJA 3RLVA 3AXIA 3S1XA 3TMLA 8TIMA 3I6EA 3B8WA 3UY7A 4LTSA 4JD4A 1WUEA 2PURA 1GCYA 4Q4KA 3G0SA 1F3XA 2FTWA 2ZWYA 4G1KA 3M0IA 5HATA 3CPGA 5FA5A 5AYXA 1F8IA 4Z2LA 3PZ9A 1YRRA 3KWSA 2NSOA 4B9YA 4QSFA 3IGXA 5D38A 4KF1A 3R0DA 1OCNA 2O7QA 2E09A 1JDFA 3S46A 4E2OA 3I3EA 3O2LA 2BVYA 4QNWA 4LFYA 2J79A 2RHGA 3QHNA 3FNDA 1KWGA 1BAGA 4IIGA 3BCFA 4UFHA 4Q4MA 3G2GA 1C8XA 2VR4A 2ZBTA 1JFXA 1B31A 3EXTA 2Q09A 3F5KA 4JTFA 1EJSC 1V3IA 4JFVA 1LWHA 1TTJA 2E68A 4HP5A 3R8GA 4RZBA 1XKJA 2PBOA 2XIBA 3EA2A 1JIBA 3BL3A 4GNVA 1V0NA 4NY2A 3RO8A 1LL6A 3UQNA 3T0BA 1R46A 1QO2A 5HDRA 2ZUTA 1V7AA 1EJRC 3NYZA 3KDOA 2WVTA 3CH0A 3NG3A 3J7HA 4JTTA 3GXTA 2NX9A 1P7TB 2E9BA 4H9VA 3BSHA 3T0TA 1EP2A 1SZFA 5FCZA 1RSCA 3P62A 4YMZA 3TR9A 1OG6A 4J4KA 2PF0A 3VNYA 3QBUA 1V6YA 3P8JA 4GE8A 2WLZA 1F76A 3IPWA 4H41A 1MQPA 1C93A 2YIHA 3FYPA 4ICMA 1WXYA 4DQWA 4FF7A 3SO7A 3PULA 1SZGA 3GDMA 4H01A 4X2RA 3P82A 3N13A 3S2NA 1JPIA 5D2WA 1OGBA 3T7VA 5I3GA 1QBBA 5E70A 1VPXA 3Q37A 2X2YA 1DJWA 4JTKA 3TAKA 4KRTA 3GTHA 3GB6A 2HS6A 1JI2A 1QHZA 3LCLA 4DPQA 1OSEA 4HTYA 2J13A 2WVSA 4ROQA 3VNMA 5HMSA 1QNVA 5A95A 2XU2A 3CUJA 3WLNA 3G0XA 4PBFA 4EF8A 4EF9A 3C2YA 4QP0A 1Q65A 2DFAA 1KCZA 5J5DA 2A7NA 4O52A 3B0UX 3RX4A 1BTCA 5K2ZA 3L2MA 4QDMA 4WGXA 4F79A 4MB3A 4KFPA 2PDKA 1DP0A 4Z0SA 5ABTA 3T40A 4JN7A 4HNTA 1JAEA 2WVUA 1REQB 3N6QA 4KEVA 1WZMA 5DMLA 3MI3A 1XLLA 3IRSA 1VHNA 1HF6A 1XFCA 4LT9A 2HQAA 3VZZA 4GIYA 4UNKA 4GY1A 4NZ3A 3W1XA 4RK8A 4I5UA 1UR2A 1HGWA 5H8UA 3HMCA 1K9TA 4UTKA 1DJIA 2I7GA 2WM1A 3VNLA 2B7QA 1GKRA 1RUSA 2H3DA 3MA8A 1RALA 3AXMA 5TBOA 3H2AA 4BI5A 2OT1A 3VD4A 2YDRA 3TZFA 2PLCA 1OB0A 2YLLA 1HGYA 1W56A 4XKYB 1CPUA 4AUBA 3SCTA 3K13A 1XG3A 1FWTA 2BGNE 3SGZA 3TTOA 1QNQA 4W8LA 1IEXA 5E09A 1A5SA 4JQ4A 3NQ6A 3WH7A 3GX9A 4BKNA 5A6JA 3CZKA 1M9HA 3W23A 3FAXA 3GNNA 1JAKA 4RNHA 4C6MA 4IX0A 3NO3A 2V5DA 1XISA 4UQCA 3TONA 4HJFA 4A35A 4IPNB 1S3TC 1W3TA 2P8BA 3R25A 3U7VA 3PWGA 4N9BA 4HB7A 4B5WA 2VFDA 2PDXA 4L4MA 1LQAA 2A2IA 1J0JA 4O1CA 2F9RA 2Z7KA 5CSUA 2FGZA 2V38A 1RQBA 1SO3A 4FNQA 1YXDA 1R3QA 1NFGA 4X9SA 3CWOX 1VYRA 2W67A 3EX2A 2J47A 5FIPA 2WZIA 1RVGA 3BSGA 3C61A 3A22A 4DI9A 2PDLA 4I9AA 1QMLA 1PUDA 2HEJA 1P7TA 3VIMA 3CHDA 4L1GA 3HURA 5A2BA 1MO0A 3GG7A 1UD2A 4PTXA 4JS3A 3BG9A 4NILA 2DORA 3IEBA 3RMJA 3R12A 2OYKA 4FHAA 1RLCL 4KGLA 4F9JA 4WQ6A 2O9OA 1RQEA 3WJYA 3KZSA 4C6DA 3NDZA 3WBEA 1XBZA 3WUGA 1DQWA 1T8XA 4QG8A 2GJPA 1I8JA 2YBTA 4AWTA 1I60A 4FPSA 1VYSX 3GZ3A 4MHBA 1AJZA 2Y24A 4JX6A 4AISA 4IUGA 4D9PA 1DOSA 4LCQA 1RD6A 1KTCA 1B9BA 3R7MA 1W8SA 4RCXA 6ALDA 2GK1B 4JTDA 2XIJA 1HL8A 2W3ZA 3QPYA 3VKAA 3TP4A 1WBJA 4M7SA 2G3FA 2OKTA 1E40A 3FJLA 3I6TA 5AB3A 2X1IA 3NDOA 2EPOA 1SO6A 3F4CA 2JQXA 3WF4A 3C0LA 3QPZA 4QE4A 2BHZA 4XV0A 4HBKA 4H8UA 1XD0A 2D22A 3AU2A 3DCPA 4ZO7A 4PCFA 2DZUA 1REQA 3UVAA 1LRTA 2ZUWA 2QJGA 2P0IA 3N9RA 4QIUA 3EWXA 4M7TA 4H1ZA 3BC9A 5HNRA 3U8GA 3PBWA 4MLJA 1V7YA 2ZA3A 4U3CA 2PAJA 4ALDA 3EDKA 3ARWA 3WUBA 3MO4A 1W1A1 3V4BA 4KIRA 5AHMA 5I77A 2PTDA 1EUAA 2Z25A 2F38A 4I5RA 4J2PA 2F7FA 1MW1A 1NVMA 1C7SA 1HO4A 1S5MA 1FWIC 2B4GA 3FVMA 5EBAA 4QCEA 1LUCB 2ATSA 2D73A 1RBAA 5C6MA 1XUUA 5AC4A 3F4DA 4XX6A 4PEEA 3EOLA 4PFHA 3A4XA 1BPLB 2Y8KA 4YNGA 3L4VA 4IMGA 3R4IA 2DDXA 1I0DA 3UESA 5HPOA 4AHQA 4YTUA 4Y9PA 3ARRA 1E3XA 3LTSA 1JCJA 3WJWA 1GKPA 3LG3A 2DW6A 2X8RA 3WLQA 4US6A 4E4FA 1MRAA 3DYPA 1QPKA 2VRQA 5FAJA 4PFMA 1FP9A 4NVTA 4XZMX 1P4CA 3QSTA 1HIZA 2FZNA 4C1NB 2PWFA 1SJAA 2AGTA 4XUGA 4G7FA 4QG9A 3SZ8A 4WVXA 3WF0A 3GR7A 4AVOA 3EOUA 2QDHA 3PHAA 2XGZA 3QC3A 1FDYA 2FVMA 4B5SA 5DT7A 2OB3A 2OZ3A 3UWVA 3T55A 2FZMA 1D3GA 4JHOA 2GLKA 4B5XA 3UG4A 1ICQA 2EG7A 3BJSA 1TR9A 1DJGA 2AAAA 4LF1A 4C6CA 3MUXA 3VD3A 4TR9A 1CXFA 3N17A 3WBAA 2DIJA 4LS1A 1O94A 4J2MA 5BCAA 1F7BA 2GJRA 3L7RA 4H2CA 4KQNA 3AIUA 1V03A 1UKTA 1LQ0A 3N9SA 1K9EA 3QTPA 3R5EA 3HGJA 5F4SA 4GY7A 3W1MA 2PU0A 4CU8A 3ABSA 1GVFA 4LF2A 4IQJA 2JE8A 2WM0A 2XIIA 3GDBA 3R13A 2J7BA 1YADA 3F7JA 4GIRA 4JN8A 4UQBA 1QNOA 4DO6A 1F07A 3HJEA 4H19A 3QGAC 4GFIA 5EMUA 4L5ZA 5K7JA 4Q7BA 1HP5A 2JIWA 1Z6KA 2NSXA 5G1MA 5DCDA 2AKMA 3SCSA 1LLOA 1LROA 4J27A 3SGUA 3KL5A 2YBUA 3WZ0E 3LLDA 1W1B1 3VOFA 5HBFA 4TU1A 1OG0A 4AD0A 1HKKA 3DI0A 2WSPA 4QJ5B 1O60A 4RZ5A 5J5RA 1JZ6A 2DSZA 3FJNA 3S6OA 3EWZA 2OWWA 1FHDA 4IISA 2NWRA 1FCBA 1UR3M 4ZR8A 2YL8A 3QGKC 1BVZA 4HU4A 1HQTA 2P53A 3HPXA 5F7UA 1MUMA 3S2LA 2V81A 3CAKA 3EDJA 3AU6A 4MLRA 3CIVA 1K9DA 3LMYA 2AL2A 3SN0A 1ONEA 3NQBA 3F1QA 1GG1A 4JTQA 1XIMA 3M6YA 3M44A 1EP3A 5CZKA 1LUCA 2V68A 5A6LA 3BLFA 1EBHA 4CD4A 5D2XA 2PCEA 1SFTA 4GUFA 3PBVA 2YDAA 4ZFCA 5HULA 4B15A 1ECQA 2Q8ZA 1HVXA 3EWCA 2CBUA 2HTMA 2WSQA 1UASA 2PDYA 5LKYA 1TZ7A 4LAUA 4ORMA 3CM4A 1JULA 1H0GA 3ZFHA 3OIXA 1LRNA 3IIXA 3SM0A 4S3EA 3SR7A 3MUY1 4PGLA 4LB4A 4Q4RA 4A8IA 4JYEA 1KGWA 3T6CA 5T91A 3BH4A 4C1NA 4WUIA 3WQPA 4MDPA 4O17A 4EWND 1CNVA 2WZEA 3V5CA 1J0HA 1AMYA 3EKZA 3HIJA 1LYXA 1P0KA 4YTQA 3W53A 1IWBA 4CQCA 5C9WA 1V3JA 2ZQ0A 2D2HA 1O1ZA 1BXCA 3P6LA 4WCJA 2Y1HA 1UD4A 2YXGA 1KTNA 1EH9A 1CTNA 4NAFA 1I6NA 1AW2A 1GOQA 2F6KA 3W1QA 1G6CA 1WDRA 4YVXA 4GVGA 3LNPA 5G2WA 1PKYA 4R34A 5JUVA 4C6LA 1RJQA 2UV8G 3MQTA 4C7DA 3E3HA 5HR6A 4FX8A 5ABGA 3WQ6A 3UG8A 4JTSA 2J4GA 2WNZA 3T42A 4C5YA 5HPCA 3UEQA 1PCWA 1WA3A 1WDQA 3MMUA 4PH6A 3N4AA 4B90A 2Y5EA 4PL2A 1A5OC 3ARQA 3CHVA 2ANUA 3L5AA 4I8YA 3QYQA 1MQQA 2ACRA 2QCLA 1BXBA 3OU8A 2Y88A 3ZR4A 5DBUA 4ZQCA 2YCJA 2DIEA 3MHUA 1RJRA 4OOUA 2E28A 1GPFA 2FJKA 2FH6A 4H9UA 4QG6A 1M53A 5CCZA 3TA6A 4BA0A 1H1YA 3URNA 2TSYA 4V27A 2Y6ZA 5I3JA 3MCMA 3RHGA 2PRHA 3WH9A 1PCKA 4GI9A 3CK5A 3GXDA 3GXNA 3ZSTA 1XIGA 4WD0A 1E9LA 4PL1A 4W88A 2E5BA 3EWYA 2IPGA 2QCGA 3AIWA 2VOTA 2INZA 5E93A 1IHIA 4Z2GA 2PF8A 4C6FA 5IDIA 2WMFA 2ZUMA 2OO0A 4NXKA 4S3BA 4ROPA 4CQAA 3WNNA 3CUHA 4JN6A 3TC3A 1U83A 2ZXAA 4UIOA 5CZJA 5DY2A 4PCPA 5D02A 3VTRA 1SW3A 3LBCA 5HJYA 2WQDA 4BS0A 3TJXA 2WHMA 3RLHA 4F0LA 3HPSA 5FJPA 3NIYA 4KRZA 3OA3A 4Y9NA 4O1AA 3DFNA 2UY5A 4DUXA 1BYCA 4Z1AA 3OGVA 3ZJ8A 3G1VA 3TW6A 1VLWA 4B3LA 5KINA 4AYSA 1Z9AA