3RX2A

Crystal structure of human aldose reductase complexed with sulindac sulfone
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
318
structure length
318
Chain Sequence
SHMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3rx2A00
4JTDA 3UGRA 3UWEA 3R6IA 2HVNA 4DBSA 3LBOA 3ERPA 3DN5A 3RX2A 5AZ1A 3RX3A 1UR3M 3G5EA 2PDQA 4DZ5A 2PF8A 3UZWA 1PZ1A 2IKIA 3LEPA 5HNUA 5DANA 4H8NA 3R43A 2INZA 4XZMX 1Z9AA 1EXBA 4I5XA 1MI3A 4H7CA 4XVEA 3V0UA 3N6QA 4Q3MA 1HQTA 1Q5MA 3LUTA 3WBYA 3D3FA 5M2FX 2NVCA 3MB9A 2PEVA 5KETA 3V36A 3DOPA 3FX4A 2DUXA 3LN3A 3EB3A 4JIHA 2F2KA 3U2CA 2PDJA 1R38A 4WDTA 1S1PA 2J8TA 2PDBA 4LAZA 3V0SA 2BGSA 4DBWA 1RY0A 2IPFA 2HE5A 3UZZA 1IEIA 4JTQA 4AUBA 2FZBA 4JTAA 2HVOA 4L1XA 4QR6A 1SM9A 2R24A 4JQ4A 1Z3NA 2DV0A 2PDLA 3R58A 4GCAA 1XF0A 2PDMA 4JIRA 4OTKA 3WG6A 3GUGA 3UYIA 3BUVA 5AZ0A 2PDPA 1Z8AA 1FRBA 1VBJA 2ACRA 1YE6A 2I17A 4YVPA 2FZ8A 1MRQA 2IQDA 4JQ2A 1EL3A 5LIUX 4WRHA 5LIKX 2ALRA 4F40A 4YU1A 2IPGA 3ONCA 3G1RA 4LAUA 4GACA 4WDUA 3R8GA 3O3RA 3T42A 1HW6A 4FZIA 5HNTA 4JIIX 4FALA 5C7HA 4GA8A 3EAUA 2HEJA 2HV5A 4QBXA 3R8HA 2I16A 2A79A 2PDNA 2FVLA 2PDYA 1RALA 1S1RA 1XGDA 3CASA 4LBSA 5JH1A 4LB4A 1Q13A 2PDCA 4FA3A 2WZMA 3H4GA 3C3UA 4GABA 2NVDA 4XO6A 3R7MA 1PWMA 2CLPA 2PDXA 1OG6A 1IHIA 3V0TA 1AZ1A 4WDWA 2PFHA 2PDFA 3LNMA 5HA7A 3LZ5A 2ISFA 4R9OA 3UG8A 4EXBA 3LQGA 4YVVA 2HDJA 1C9WA 4XO7A 4XZIA 2FZDA 4PUUA 4JQAA 4ZFCA 2INEA 4IJRA 3COTA 5LIWX 2ACUA 5JH2A 3M0IA 4JTRA 2WZTA 2PZNA 4IJCA 4QXIA 3LZ3A 1K8CA 1X98A 3BV7A 4XAPA 1QRQA 2F38A 4PR4A 4DBUA 2BP1A 3FJNA 3BURA 1JEZA 3M4HA 2C91A 4WDXA 3GHUA 4MHBA 4PUWA 4WEVX 4LBRA 2PDKA 4XVDA 3UZXA 3P2VA 4RPQA 2ACSA 2IPJA 2PDHA 1AZ2A 4FAMA 3ONBA 1US0A 1EKOA 1S2AA 1PYFA 1ZQ5A 4XZLX 1AFSA 4PRRA 1X96A 3M64A 1X97A 3Q65A 1LWIA 2ACQA 2IKGA 2BGQA 3NTYA 1QWKA 3LENA 1PZ0A 3Q67A 3R94A 4XK2A 3GHRA 1RY8A 4GIEA 3VXGA 3N2TA 3CV7A 4HBKA 2IS7A 2PDUA 4JTCA 1T40A 4JQ1A 4XZHA 4LB3A 1AH4A 4GQGA 2PD5A 4ASTA 4GQ0A 3V35A 2FZ9A 1LQAA 2IKHA 4PRTA 1PWLA 3LD5A 3GHTA 3BCJA 1J96A 3RX4A 1AH0A 3LQLA 4WGHA 2IKJA 1YNPA 2FGBA 2VDGA 3WBXA 3B3DA 3H7RA 2P5NA 4L1WA 2DUZA 1S2CA 4G5DA 3UP8A 2PDGA 4NKCA 2QXWA 1XJBA 4YS1A 1VP5A 3UFYA 1YE4A 1EF3A 1M9HA 3H7UA 1ADSA 3QKZA 2HE8A 3O0KA 2PD9A 4XZNX 1T41A 1MZRA 1ZGDA 3CV6A 3MC5A 3S3GA 3GHSA 2PDWA 4EXAA 4IGSA 2AGTA 2IPWA 3WCZA 4HMNA 2IQ0A 3CAVA 3CAQA 4ICCX 3CMFA 1ZSXA 3KRBA 1YNQA 3F7JA 1AH3A 4Q7BA 4JQ3A 1A80A 3EB4A 3WBWA 4QX4A 5LIXX 5LIYX 2R9RA 1GVEA 1Z89A 3UZYA 4YVXA 1ZUAX 2PDIA 4PMJA
chains in the Genus database with same CATH superfamily
1E56A 4OE7A 3N9RA 3VKDA 3G24A 3OLGA 5BOFA 1UWUA 1LLWA 3RO6A 2NV2A 4Z1DA 4LC6A 4GUHA 5TQLA 2IXVA 2MANA 3VE7A 2WSRA 2GYIA 3A5VA 1A5NC 2OLAA 2ZUWA 5BU9A 1X7IA 3W4RA 1OJXA 1ONEA 1XYFA 3VGGA 2GK1A 4H9UA 3OA3A 4H9XA 3OBKA 4D6IA 1Z9AA 3S5SA 5T91A 3R4IA 4FNSA 2XIOA 2B7OA 5JXQA 4K7VA 2V6AA 1MDLA 2BXVA 9RUBA 1DIDA 3HBLA 3LTPA 4JTEA 3VGBA 4M7TA 2FVMA 2Q8XA 2V3GA 3W27A 3LCHA 5I3DA 2NV9A 1XIEA 1FCBA 5A6TC 4RV8A 4B3KA 3EPMA 4JEQA 1UUQA 1V6TA 1E4NA 2E6DA 1KV5A 3TMQA 5A6SA 3QMSA 2FHBA 4NF7A 1EBHA 2QHAA 3WFAA 1PS9A 2C14A 1UWIA 2BODX 5AVHA 1XDJA 3GKFA 3E0IA 2WKJA 1A5OC 4EACA 4N6EA 3VFLA 2YB4A 4YYCA 2ZVRA 4JTSA 4UMAA 4PTXA 3ARRA 4FF5A 5I5RA 4JIRA 4DVOA 2ZXDA 3W7QA 4RXGA 3EOEA 1JR1A 4N9DA 4MJMA 4KIRA 1EDGA 3PZ9A 1J2WA 2FZ8A 1W3HA 3NEVA 3EA3A 3D46A 1EL3A 4GBDA 4U5IA 4F40A 2NQJA 5DF0A 5MKGB 4JFWA 1A49A 4L65A 4D8ZA 4YTTA 2WC4A 1G1YA 2XWEA 1EP2A 3TJ4A 3TTEA 3UA4A 1B4EA 3LGGA 5BW6A 5DX7A 2ATSA 2VRJA 2Z1WA 4DF0A 4TMCA 1L6WA 2B0MA 3WQWA 5D03A 3N14A 2WW5A 1XXXA 2A79A 4NZFA 2DJLA 2XIBA 2O9TA 4HK5A 2NSXA 2X1UA 1P7TA 1BWKA 1NDWA 1ZAJA 2PDCA 1H49A 3VIKA 3OQEA 5CPLA 3IACA 1PTAA 3WD3A 3E5PA 2X8RA 3BO9A 3LX9A 3FW6A 3WQ4A 4CU8A 4KRUA 1ZBVA 1MW3A 1JGMA 1A3WA 3DH7A 4EXBA 1G94A 3SCUA 4HCHA 2G5WA 3ZO9A 1F6KA 1S5WA 1UA7A 4IP4A 1DXFA 1LBFA 4CNUA 4XZIA 3AXKA 1I2OA 4R88A 5AN7A 2VWTA 2LLEA 1R3SA 5C8BB 4Q4PA 1H61A 1XYBA 3LZ3A 1OSEA 1OY0A 1QI2A 4PL2A 5TBOA 1NP2A 2GSJA 4AYGA 3MSGA 2PC8A 1RBOB 1F61A 2GFTA 1GJUA 3OPSA 1NWSA 2CLMA 1MWOA 1PSCA 2WHMA 1LLOA 1EO7A 3KL3A 2C18A 1B90A 3P5YA 5C9XA 4RPQA 4O1EA 4NL1A 4NZ1A 4ZTXA 5DBTA 3W1TA 1BVWA 1IF2A 3H2OA 1BAGA 3W0KA 2WMGA 3IVSA 1C92A 1Z44A 1EZ2A 1DWJM 4XX6A 1EZWA 4G7EA 4Q4QA 1AQ0A 4MNMA 1OEPA 1EOKA 1PDYA 3S2CA 1XD0A 4GJJA 5GJPA 3FSUA 1QPNA 4CQBA 4F0SA 4W87A 3R1ZA 3INPA 3IPWA 1M7OA 1CTNA 4QLJA 3UPWA 1EJUC 3M0VA 2Z27A 1AG1O 4UTFA 2VI0A 1WKYA 3FA3A 4PB3A 3O16A 3NCOA 5C7VA 3ARPA 1FDZA 4BR1A 4F3HA 3QC3A 2EKCA 3UWZA 3KHJA 1PWLA 3DBNA 3BCJA 2YGYA 3FEMA 1ZALA 3OP2A 4DX3A 2C3ZA 2AKMA 1KXHA 3ABZA 5CC5A 2Y0FA 1KTNA 4EP8C 2ZWZA 3AO0A 2F2HA 3WBXA 3WDRA 1EIXA 4E2VA 4BJHA 5A8OA 3EWUA 4H4IA 3L23A 4G5DA 2OMAA 1ZS2A 4UTWA 5LA1A 1C7TA 3DG3A 2ZA1A 1XDMA 3CJPA 1EGVA 1VBHA 4S39A 1VP5A 1UWSA 1V08A 1GNXA 4DUXA 1F6YA 1A5UA 5HNRA 3H7UA 1A4LA 3CS2A 1BRLB 4O4VA 3O7UA 4FB7A 1F8IA 4QSFA 2YCEA 1X7FA 1OFPA 1MZRA 4XBKA 5AC4A 3S2JA 2YXXA 3HQOA 4CD4A 3NSNA 2PDWA 1JG9A 1XIIA 4IGSA 3BLLA 3AQUA 1LTDA 4DELA 3WCZA 4HMNA 1J11A 2G4JA 3GTFA 3N4FA 4DJEC 1YBQA 5LHFA 5GQBA 3WQEA 3M6DA 1ODUA 3AISA 3VMPA 1VHCA 2BFGA 1VEMA 2VURA 2Y5JA 3TQPA 3KRZA 1PCKA 5I6SA 2PTXA 3SUUA 1AODA 1JRCA 4O52A 1JYXA 1FKWA 2H9AA 4R34A 4LVGA 4A35A 2E68A 3BL3A 1M68A 4YVXA 3RLHA 1OYCA 4RDYA 1KO0A 4MYAA 3WEOA 3NZQA 4ZQNA 4RDWA 3B4YA 1F07A 2WNNA 3AYTA 2ZZ7A 1KBIA 3NYZA 3T6CA 1DPMA 4QJ3B 2QDEA 4J3VA 3QHMA 3NQ8A 1Y8BA 4LYPA 1FDJA 5DN1A 4EK7A 1FWFC 1ISZA 1HL2A 3A24A 1XUZA 3O63A 4AD1A 6CGTA 5HNUA 3B9AA 3PTKA 2X2YA 1UWQA 3AZRA 3ICJA 5KZ6A 2PBGA 2PGWA 5HINA 3A4WA 4ZB2A 4ZXOA 4YMZA 2GJXA 1EJ7L 3V0UA 5E9AA 7XIMA 1CXHA 2C15A 4L4LA 4A3UA 1SFLA 1O5KA 3UJ2A 4R7WA 2GVYA 2WPGA 2BHYA 4JKKA 4AMAA 4GIYA 5AOUA 1R38A 1GQJA 1TB3A 1Y5VA 4UQ9A 3NIYA 2H3BA 4AWUA 1S1PA 3B06A 4MB3A 4D6DA 1QR7A 2V38A 1HO1A 3FGCB 1LL6A 2YL9A 2ZICA 2Q3OA 4PMYA 1TIWA 2WMKA 2P76A 2KAUC 4Q8OA 4Z2GA 2OU4A 2FZBA 1WE5A 2V3DA 3GVRA 7ENLA 4GI9A 2WZHA 4UTTA 3SCOA 1Q45A 3N73A 1HGWA 4HK6A 3UGVA 3U5UA 2DV0A 4Q4OA 2PDLA 1DOSA 1BD0A 3B8IA 2YBTA 1WNOA 2X1RA 3NQEA 3R79A 3GUGA 4KS0A 3E38A 3APTA 3L2MA 2JKEA 1RLCL 1TYGA 4YIWA 3N6HA 4D2JA 5E5CA 4WUIA 1H09A 3MYPA 1KXQA 3P7YA 1R7OA 2X0HA 4CN6A 2IQDA 1LQ2A 3AJ7A 3IEBA 4FNPA 3VOGA 3WH5A 3REQA 4JY9A 1L6YA 1QPOA 4YU1A 1E6XM 5BCAA 4CD6A 1BXNA 2X1TA 4JD4A 1VZWA 5HJLA 3KVLA 1J6OA 4BQ2A 3QQ0A 2P3EA 1B3VA 3TXVA 4ERAA 3R2GA 4ERGA 3PZIA 3NURA 4GA8A 2QCLA 4AMCA 1MUMA 2HV5A 5IXEA 4A8IA 3R8HA 2YDAA 3BW4A 3WNPA 4B9YA 3T4WA 1G7UA 4NQ1A 1I2PA 2NUXA 2Z1SA 1RQEA 1A3XA 5EY5A 4CNPA 1XR2A 1OCBA 3EYPA 3RU8X 1JCMP 4B16A 3G0UA 1BQCA 5FOOA 5BRQA 1LOLA 3RGTA 2A4AA 3B9EA 4U31A 1XRFA 3F2CA 1NF0A 1B31A 2XFRA 2FZDA 1W3LA 3LPGA 1P1XA 1S38A 3HU7A 3GNDA 3ZYZA 4ADSA 3PNZA 4JHZA 3Q45A 1QRQA 1VEOA 1ONWA 1WYIA 1VEPA 4TX8A 2NQ5A 2WCGA 6TAAA 1XFCA 3WNKA 3M4HA 1J5SA 4AVOA 4W5ZA 5I79A 3N2BA 4WDXA 3C3NA 1QHOA 3R11A 4S2BA 4NZJA 1XYMA 1KFJA 2Q3RA 4XVDA 2J47A 1SU5A 4NHVA 3BLPX 3W38A 3T07A 4PZVA 4J27A 3C0LA 2E4TA 3QZ6A 4FI4A 3W1NA 1PKYA 1I2NA 1PYFA 2BHZA 5BXPA 2RDUA 2XM1A 4IMCA 3W29A 4O54A 1OCNA 3M64A 1LWIA 2BLEA 3ZSSA 2XPKA 2V63A 1V6UA 4TV5A 1KGUA 3VM7A 3I3DA 2BVWA 3RLVA 1LBLA 3BTNA 3R0DA 1GONA 4HMDA 3G1HA 5IOBA 1CECA 2NXHA 3W88A 3SEPA 2AAMA 4F0LA 1T40A 2HWGA 3TN5A 3S2NA 4NXKA 4N6FA 4XZHA 4S3FA 1VIZA 1E73M 2E5CA 1XIMA 4MZYA 3V35A 4ECLA 3AMLA 4P7NA 4GX9A 3TR9A 3RR4A 4KEMA 4B9ZA 1HG3A 1AH0A 3L7RA 1F3TA 3G22A 4YCOA 2OODA 2QF7A 1DP0A 4KCVA 3K30A 3SN1A 4HTYA 1QOPA 2PTZA 3W53A 3LI1A 4JN8A 5MF5A 4NKCA 4UFJA 2QXWA 4KW2A 3TNOA 3WO8A 1IWBA 3ABXA 5D04C 3BG3A 3PB0A 5CBJA 4XWUA 4CCCA 4N42A 1NTHA 2CW6A 4NJJA 3DGBA 2BWGA 4QM1A 4UR9A 1ITXA 2PBOA 3WJXA 1UZ4A 4NI8A 5GPRA 1V3JA 1DJYA 2FLIA 3GAYA 1J9YA 3TAKA 1M5WA 1HTIA 2V9DA 1EJXC 5FA5A 1P6BA 1G9HA 3CAQA 1UROA 4ICCX 4HNTA 1TA3B 4YL2A 3P82A 3F03K 3T2PA 3W76A 4RL3A 1O5RA 3EB4A 1QHPA 3POHA 1QOXA 1OZQA 4MKNA 4K36A 3W7PA 5BMXA 1BVNP 3WBWA 3APGA 3HO8A 3H4WA 1BTMA 1VCGA 1T7LA 1GVEA 5JBFA 1ELSA 3VOIA 3A64A 4YTRA 1GGOA 2AMGA 3TN6A 1MXSA 5I09A 1DXEA 5C9UA 2DZPA 4E8DA 2Z1KA 2G8ZA 4OFCA 1W9PA 3EX2A 4M1BA 4Q4RA 1I2QA 2E40A 4AIBA 1Q7ZA 1V5XA 3W1QA 4PMRA 1H5VA 4LXFA 1C8VA 4HP5A 2VOTA 3TA9A 3URAA 2HBXA 1E43A 1VF8A 4GIAA 4Z1BA 3FA5A 4D9PA 1O66A 3MA8A 3T0AA 1RQBA 3GSMA 3ZJ6A 1S2VA 1H7RA 1KFBA 5ABTA 2WNQA 4AIUA 5DCEA 3BCDA 3W1AA 3CUJA 1V03A 2O7QA 1QI5A 1QNQA 3AU6A 1HNYA 1G69A 1FHLA 3A21A 2QVHA 4ZENA 4X63A 2J77A 4FO4A 4GI4A 2WKLA 2ZZ6A 2WQPA 3VCRA 1IR1A 3NPWA 5CZSA 3OOQA 3GW3A 1HT6A 2VL4A 4JTIA 4LEQA 4A05A 1O6IA 1F3WA 1ZL1A 1OWQA 4OUIA 1XBVA 2V2HA 3WLLA 3W00A 4ZZ9A 3LXAA 2J24A 4AC7C 4GUGA 4KEZA 3FVDA 1PDZA 4O1CA 3WH8A 1WDRA 3BOLA 2FPTA 3Q94A 2EO7A 3R58A 1NWUA 4P7OA 4IM4A 2PRHA 1O7AA 4H3DA 1R3RA 1JD9A 1SO4A 2R14A 4Z2KA 4ZR8A 3QOMA 3TJIA 9XIMA 1OFOA 1SSDA 3H4XA 3PF3A 3D5HA 3JUGA 1RVGA 1V3HA 2QQ6A 3RN6A 3BGJA 4E2BA 3BAJA 1QVBA 4IT1A 4NYYA 4IXHA 3OEXA 1S5MA 2ZUUA 3NSXA 1TJ1A 4Q8QA 1UH2A 1YYAA 1LWHA 2XTKA 3L12A 3M47A 1UR0A 2CWXA 3GZ3A 3B05A 4IP5A 3EAUA 2OO0A 3NDZA 3BAWA 3W82A 1R85A 2ZA3A 5CPQA 4HHLA 4OOUA 4A22A 2BZNA 4MADA 3Q4DA 3LHWA 3QR3A 4TTUA 5JVLA 3NQ2A 1TE1A 3VDBA 3SW6A 4IJBA 2CCRA 3ALFA 3EDJA 4F2TA 4KWOA 2REQA 3QPEA 3WH7A 3N11A 1R2SA 4MPKA 2HDJA 1XL9A 3AZSA 3PAOA 1KM6A 4JQAA 3LM3A 1PAMA 2XVLA 1J0JA 1YPIA 1XQLA 3CXOA 2WZTA 3BJSA 3EX6A 1K8CA 4KT2A 4B5WA 1SMAA 2F38A 3ES7A 1QK0A 4RPPA 1F05A 1TV3A 2DQWA 3DFPA 4E0CA 8CGTA 2VYOA 5CLWA 4IPLA 3AHZA 5DT5A 3P61A 4V2XA 1TUXA 3TWBA 2A6NA 3DKJA 3L2IA 2ZX8A 3GU2A 4GNKB 1SPQA 3KVJA 2YR1A 1E6ZA 4BHYA 4XKYA 4MY8A 3GG8A 1IQ8A 3GC4A 5DBUA 3TWAA 3C2YA 3MI3A 3Q65A 3EKLA 2AQWA 2GVGA 4UOJA 4Q6XA 1PKNA 3G77A 2WQDA 4JIQA 4OV9A 1GJPA 2VELA 1E4MM 4MWAA 1HJSA 5TNVA 4CQ8A 2Y89A 3DECA 3WD4A 4EANA 2EG7A 3CUXA 3LI0A 2TRSA 2NX3A 4AH7A 2BSLA 1VHNA 1W3KA 2OXNA 4J40A 3Q37A 4DPPA 3NXLA 3P84A 2PB1A 2ISSA 4PCFA 2YSWA 3UJSA 1ITUA 3UWUA 1XINA 1I1WA 3TNBA 5K4ZA 5EMMA 1H7WA 2J75A 3CM4A 5G2IA 1B5TA 2P3ZA 4C6OA 2FGBA 1QNSA 2VDGA 4DWSB 2X41A 2P5NA 4LEFA 4MNLA 4ZOCA 3L4YA 1BPLB 4H19A 3B0VC 3S2MA 1OFAA 5I3IA 1UKQA 2VR2A 3NOEA 4S2CA 1JFHA 1HVQA 4G2DA 5EBAA 1NEYA 1Q6QA 4XUYA 4JKMA 2YW4A 4M6QA 2CIPA 2YCKX 3G0SA 2E9BA 4ZCWA 4AF0A 3LCXA 4WY0A 1V7AA 2J8FA 3V1HA 3LM7A 3DC0A 2BVTA 4JTKA 4GGHA 3GNRA 4IP7A 1ZNNA 4EXAA 2IPWA 2YBVA 4TIMA 5CZJA 4YXGA 5BMWA 4EPBC 4LT9A 3C5QA 3GNPA 3DHFA 1NQKA 3FJ4A 3LGDA 1V7YA 4DJFA 3VUSA 2FGLA 3MKVA 2WSYA 1CT5A 3R5EA 3U8GA 3DFHA 4PBGA 3HGSA 3C2FA 3PBUA 4I3GA 1TREA 3UWEA 1TVLA 4ONVA 4UZSA 3WF3A 1UZ1A 5IBXA 2QDGA 3ARUA 3UR8A 4YPJA 2OJPA 2PWGA 1W8GA 2PCEA 3ZM8A 3B9NA 4FOUA 4IIDA 2Z6IA 4OWGA 4DZ5A 1R5YA 4M8UA 2PF8A 1JDFA 1DIEA 3FKKA 3HA1A 1L2QA 3PR2A 3IJ8A 1F2JA 3WSUA 4U2YA 4XZMX 5C2CA 3U7BA 1XLJA 2NUWA 4L1GA 1RCOB 4ORMA 1RR2A 4R7OA 3WLQA 3EWCA 3H2CA 1Y0EA 3QH2A 2XHYA 3FYPA 4LPCA 5M5DA 4C90A 3RCYA 1WV2A 2PEVA 5AHLA 3S6TA 2VZSA 4A3HA 2QPXA 2ZFAA 4FMVA 4HOWA 3W7OA 3EB3A 4IGNA 2F2KA 1QNOA 3MP5A 1BYCA 3CYJA 1JPDX 2PDJA 4YYFA 2GVLA 3E2SA 3RO8A 2Y5SA 1U30A 3T08A 3VX1A 2WK2A 5DMNA 1TRDA 4LAZA 2FMOA 5D02A 1FX6A 1N8FA 3W37A 3ZQ9A 3CUHA 1ME9A 4KEUA 4J3SA 1TPWA 4L80A 1Q6EA 4Y6GA 3V7PA 1UOKA 2NQ9A 2VRKA 5C9RA 3TSMA 1FHDA 3GM8A 5C9WA 3PZOA 2WJZA 4MOZA 4XSLA 4I90A 3NGJA 5BOEA 1KBBA 1XYZA 3EPNA 1W2VA 2QCNA 1IGSA 3W7NA 4P61A 3VUPA 1RBAA 1QPRA 3IJ7A 3BUVA 4Y8FA 4B90A 3N2XA 1IXNA 1K8XA 3U3HA 1FKXA 4PBEA 3QSTA 4MG4A 1XC6A 1UWRA 2VCAA 4XBJA 1AW1A 3FJ6A 4WHBA 3WD1A 2IW0A 1F76A 1YADA 2OTDA 5G1MA 3URQA 1UC5A 2R6OA 1OFQA 3M46A 1R6WA 3GVWA 2Z0IA 2X1IA 6TIMA 4W9TA 4M56A 4S3DA 3WIJA 4E5TA 1QNPA 1FFRA 3MV01 1GPFA 4C6PA 3TN3A 1V3MA 2Q8LA 3KCLA 4LB4A 3LSBA 4HA4A 1JDDA 4GK8A 1RBLA 1ADOA 3I6EA 4GABA 1KNWA 1KFKA 3E0WA 4L9XA 1I6NA 4H2HA 5I3GA 4XO6A 5L9FA 1PWMA 1HL8A 1HO4A 3VX0A 3NO5A 1OVDA 1QI4A 3TSDA 4U3AA 4AW7A 3T78A 5H8UA 4Z0SA 5EMKA 2ISFA 2GZXA 4XD4A 2BBFA 3KOYA 3GNNA 3KWXA 1TVPA 3LQGA 1PCWA 3TEVA 4L7ZA 4IICA 3NWRA 1F5ZA 3UR7A 2NT1A 3SGZA 2GSHA 1E0XA 4O0QA 1POJA 3GRIA 1V3LA 4AFYA 1DV7A 4GYJA 3P14A 2PRLA 5CBBA 5GVJA 3AYVA 1SR9A 3AWNA 1K9FA 2EPKX 1J0KA 1X98A 4XAPA 1WX0A 4DBDA 2DU2A 3VIPA 1UCWA 4POCA 1CLXA 2IXUA 4AISA 1ECEA 5D05A 2Z4GA 2DGAA 4MHBA 3MT1A 1G7VA 1K4HA 2E25A 3AS3A 4HHPA 3TAOA 3ABRA 3N2OA 2UV8G 3UWWA 3SR7A 3SIMA 2E77A 4C6FA 4DO4A 1QOQA 4HJFA 3TYAA 1UR9A 4ATWA 4KWSA 2YPIA 3B04A 3MP4A 4NAEB 1ZQ5A 2DW7A 1AFSA 2R1NA 4L64A 1XIFA 2ACQA 1C29A 4FR1A 5F2GA 2A85A 4BI6A 4F48A 4B5TA 3QC0A 1OT1A 3GU1A 1S3TC 3S5NA 3CGTA 4J7RA 3AIWA 4GIEA 1K7EA 5F4SA 2BNJA 1ZU8A 3U5YA 4WR3A 3BLFA 3N34A 1PTGA 4FS9A 3B8DA 2WPBA 3VGDA 3VDCA 4AEEA 1LG1A 4W88A 4JIPA 3M7WA 3VZXA 3CLWA 3NL2A 1PV8A 4JAWA 2FZMA 3VNZA 1QW7A 4HTBA 1EGZA 4NVTA 3TVAA 2C71A 3M7SA 3NPVA 1YNPA 2EGZA 4MB5A 4O11A 3B3DA 2NSOA 3OHMB 1JRBA 4PMZA 4Q8NA 4RZBA 4MAVA 4QS6A 1SO3A 1JZ8A 1KQZA 4XIAA 4GZJA 4PL1A 1V4YA 5LNRA 2W91A 1BRLA 4E4UA 1BHGA 1E9ZB 1H1NA 2D2GA 4FNQA 4EX4A 4LAMA 2TYSA 4LUIA 4MUPA 1G0CA 1XV8A 5FIPA 1U5JA 1GVFA 3E12A 1JDCA 1S39A 2OPJA 4RE2A 3OBEA 5HWJA 4HMCA 4TVUA 5AFDA 1EWEA 2NQHA 4XG1A 2Z7GA 3LPFA 1UH4A 1AQFA 5B80A 5H91A 1RD5A 1TCMA 4GZEA 4H6KA 4HPNA 4UFIA 3CUGA 1NOWA 1K7FA 3OZPA 4C1NA 3QXBA 1O5XA 3NL3A 5ENLA 3ZZ1A 3QMRA 1YKWA 1XYCA 2HTMA 4A8NA 3PULA 2CHNA 1XLLA 5BRBA 3VYLA 2WMIA 2E8YA 5HQLA 2DPEA 3CQ0A 1WOAA 4DBSA 3PC0A 1VFSA 2XDFA 2J6XA 1UBSA 1P0EA 2AL1A 2VX4A 4DUVA 1R3YA 2PDQA 2GOKA 2DZXA 3PUEA 9XIAA 3T2OA 1O68A 2QJHA 1I9CB 4UBPC 2IKIA 1GOMA 4PUMA 2DT2A 3FNDA 3RXZA 3UU0A 3F4NA 1UWAA 1C90A 3WDQA 2H8ZA 4ZL1A 4WJ8A 3BGGA 2ABBA 2BVYA 4XVEA 2EG6A 3N6QA 4JXCA 1Q5MA 3HF3A 4JCLA 3UG3A 1FQ0A 2QPSA 1NDVA 4O16A 3LB0A 3LXBA 2DEPA 2YDRA 3ECQA 2DDXA 4ACYA 4NJKA 4PC8A 2PP1A 3V0SA 3U2ZA 3FGCA 1SW3A 2ZXBA 1QPQA 2QJJA 3PG8A 4AVNA 2Z25A 1M7PA 4CQCA 4J3XA 3GR4A 1I4NA 4LV9A 1KKOA 3OZYA 1R0MA 1R8LA 2QIIA 4L1XA 2WMHA 3T0DA 4JQ4A 2PF0A 4Z42C 4RR4A 2DSUA 2HPMA 1VCFA 2ZBTA 2VMFA 1YHTA 5A2AA 4GWEA 1E55A 2PUZA 5H8MA 1JUBA 3GDBA 4OTKA 4X0NA 3WG6A 3KP1A 3UJFA 3GG1A 4GI6A 1XH1A 5DXXA 1O1HA 2F6UA 2NWSA 1C8QA 1W1TA 5HMEA 1SZRA 1PIGA 3BPWA 4YVPA 3MO7A 5GJMA 1J0YA 3W6LA 3QTPA 1FWJC 4Q4MA 1FCVA 3NPUA 4NSBA 4Y9NA 4AD2A 4MY9A 4X2PA 4TQTA 5C54A 4IISA 2GGHA 4OOZA 4X22A 4QTGA 3G2GA 2IPGA 4PTNA 3L4TA 3BW3A 4N4QA 1HW6A 4FOKA 4OKDA 5DRCA 2XIMA 8XIAA 6ALDA 3FKRA 4I9AA 4UB9A 4MLRA 5C7HA 1RUSA 1EJTC 4H6EA 1JAKA 2Y24A 1BKSA 3CUZA 3QYQA 1S1RA 3KM8A 1A5SA 1TO3A 2G41A 3BAKA 3GTHA 2ZZ5A 4UTIA 4MUZA 1RK5A 1H50A 4JX5A 3PBYA 2WXDM 3R7MA 2X1SA 3MS8A 1OX4B 3C8NA 1V0LA 4LUJA 3VE9A 1TR1A 3PNUA 4P5UA 1VPQA 4AY1A 1XPGA 2VDHA 2YX0A 4I9MA 3C2EA 4IUOA 1S5VA 2J62A 3WZ0E 2ZKMX 3UXIA 1MRAA 3G1AA 4ZFCA 3SSZA 3FLUA 2XN1A 4GO8A 6XIMA 5GNXA 1WKDA 3I7RA 4WF7A 3CPGA 2NVAA 4XAYA 4KETA 3STGA 2V3EA 1N82A 1XCWA 2BP1A 4NT0A 3ZLGA 3ARZA 4DJDA 3CO4A 2D0HA 4S3BA 3VNDA 4FNUA 4K3ZA 5CZ0A 3NPXA 3WQVA 4JTFA 3UJEA 2ZTKA 1Q8AA 4GNVA 5D33A 1ZY9A 2Q09A 2WBKA 4LRTA 3UZXA 4ZSTA 3AIVA 3DYMA 1EIBA 4C6MA 2FGZA 3W02A 2DJXA 4FAMA 3KTXA 2A3EA 1CENA 1JFXA 1VJZA 1YX1A 4Q4SA 2Y4SA 1Q6FA 4XZLX 1V02A 4RK8A 4LF1A 3MJMA 4KPLA 5FEWA 5HPCA 1AMYA 3S1XA 1XS2A 1Q6OA 3LENA 3TLLA 1XSIA 2OB3A 3OZOA 2DSVA 3GG7A 3RNDA 3N2TA 1P43A 3SRDA 5TF0A 1DL3A 1A53A 1TX0A 3DYOA 4H9YA 4DZIA 3I68A 1GW1A 3IIVA 1LUCB 4GQGA 4C6LA 1IEVA 3OW1A 2O4QA 1H7XA 4J3WA 3C4UA 3QGAC 5FI8A 1RPKA 3I4EA 3O1NA 4H9TA 4GGBA 1ICQA 3UF9A 4ZBCA 4G1NA 5AHEA 1UG6A 1KCXA 2NQLA 1G4SA 4CNSA 2WSPA 4BS0A 2Z7KA 3DC8A 2XSAA 3MHGA 2FB2A 1XLKA 4AQLA 3UPBA 2WJFA 3EPOA 3BAYA 1KLYA 3CT7A 1TPC1 3BSMA 4AYSA 1Q3NA 4LSBA 1TG7A 3S9ZA 2J7DA 1TFVA 4M1RA 1BFNA 3H7VA 1TPEA 2EPNA 1G4PA 1E0TA 2DH2A 1YE4A 3ARVA 3N6JA 4HGXA 1KBKA 4QQ3A 1M9HA 2PSNA 3F5LA 1LOQA 4DB7A 1EC7A 5I3HA 4CQDA 3OTRA 3CL6A 3LHYA 2DZVA 1HKMA 1Q6CA 1AW2A 4IFKB 1HJXA 1XSJA 4HMEA 5D8ZA 1CIUA 5FF0A 1YTEA 5AHMA 1GVIA 2BASA 4ILSA 3ZS4A 3HJEA 3TX9A 1W54A 7REQB 4CEXC 1DJIA 5U4NA 3T2QA 1TA3A 3L68A 5EKYA 3W25A 1ZSXA 5ABFB 1FY6A 4N9EA 2J6VA 3WMBA 4REQB 4UTKA 2OYLA 1JCNA 1KR1A 1NU5A 2VD8A 4D8LA 2J7HA 4KWWA 2QYGA 2WNZA 5A94A 1DTUA 1JJKA 1YMYA 1GPWA 3KOFA 1JPIA 3NO1A 5EBUA 5ABHA 4FXRA 4YLWA 5REQB 3CHCA 4JTHA 2YZ5A 3SCPA 4PMJA 1BYAA 1OZMA 2WCAA 1XWYA 5D4YA 3WJYA 3PJWA 1J6PA 1HFBA 3B9DA 4F0KA 1KTBA 2OLSA 3OQ8A 1OCQA 1M7XA 4CQAA 1O5QA 4AIOA 3V5OA 1S5TA 5E0KA 4LNYA 1F73A 3IGUA 3AIUA 3H2MA 4DN1A 4MVAA 4QP0A 3QY6A 2JEPA 5DANA 3AYSA 4ML4A 4UC5A 2NX1A 4I7UA 2INZA 2D2JA 1XBYA 3K4DA 1C7SA 4MB4A 1FWSA 3LRLA 3HMCA 5KSWA 5T26A 3CAKA 3O15A 1TZZA 4XAGA 2HRWA 4XV0A 4GMEA 4MAZA 3THUA 4RLIA 4DQWA 2EJAA 3MUIA 3QHNA 2NVCA 1QATA 1WKFA 3NM1A 4E2DA 5EMLA 5KETA 3WYZA 1KM2A 3SUWA 3GH4A 1KC7A 4ROPA 5FF3A 2JGYA 3K46A 3ZLFA 5HXMA 1XG3A 4U10A 1HP5A 2V69A 1R3QA 4KQNA 2Y62A 1JCYA 4KRTA 2AOSA 1KQYA 3VNYA 2CXEA 3BAIA 2HE5A 5IDIA 3A23A 3UEQA 3UCDA 2HVOA 1SR0A 1S2UA 3FN9A 1Z7AA 3AOFA 3SADA 4B5SA 3POCA 4CCZA 2CEQA 3G0XA 4I8YA 2Y7EA 2XVPA 3H8AA 2NZLA 4BF7A 2QULA 3C6CA 3LU2A 5HATA 5CCZA 4JYDA 4IQJA 1EHNA 2QLYA 3HQPA 2A3HA 3IS4A 4Z2LA 2OWWA 3OLEA 4CVWA 3BANA 3SCRA 1MRQA 4F4RA 1XCXA 4DXKA 3AS1A 4KH2A 3LPOA 2QS8A 1S5NA 2G3IA 3EB2A 3QR1A 1UUMA 3G1RA 3H24A 1XH2A 4UQCA 3WD0A 2J74A 1FP9A 2WSKA 4MYXA 2E0PA 3QHOA 8TIMA 4KFNA 4J9JA 3BDKA 2DVTA 4XD6A 1FHVA 4GFSA 4RNJA 1VRXA 2CETA 1M1BA 4JS3A 1UD6A 4BQ3A 3RILA 3PFRA 2PDYA 1W5NA 3QOKA 3PFMA 1AL7A 4AD3A 3MSDA 1E71M 1J93A 1PHQA 2J27A 1H0GA 2PAJA 3VGHA 4HHMA 3VIOA 2A7RA 4AWEA 4XD3A 1OG6A 4TOQA 2PFHA 4WOQA 2OELA 3O9NA 4Y8EA 3VCCA 1KGWA 3DENA 3I7SA 4UNIA 3QZAA 4WJEA 2Y63A 4BCEA 2VGIA 4O50A 3RG6A 5DRIA 1TV8A 4DYEA 4DUOA 1XLAA 2XIQA 5JBDA 4OGZA 5JH2A 2J7GA 4JTRA 3DI1A 3S2LA 3GXPA 4PRWA 3RJXA 3VC6A 2V5JA 4CNNA 4KFOA 2R1LA 1A47A 3LLDA 4WKFA 2CYGA 4HNUA 3ZJ7A 3A3WA 2W3ZA 3IJDA 2QJMA 4HYWA 2UY4A 2RDWA 1GVQA 1XIBA 3U9IA 5BRPA 2YL8A 4J28A 1MYRA 1JZ3A 1XGEA 3GVVA 2PA6A 1TCDA 3KLLA 2C79A 2QIWA 5I23A 4NNBA 3KVMA 3QW4B 1E3ZA 1EQCA 3USBA 3N9SA 3AFBA 4J2PA 4UNLA 3EWYA 1ECQA 4HU8A 3SRFA 1US0A 2PS2A 1EKOA 3S1GA 1TZ9A 5EFFA 5KZDA 1W3IA 2JK2A 4JZ5A 1E9IA 2WB5A 1VIWA 3RF9A 1EJRC 5CGQA 2YXGA 2BV9A 4YWIA 3QN3A 1K8ZA 1P6CA 3LHUA 4U3CA 3M43A 4N0RA 5BXTA 5DO8A 5C0QA 2PTWA 3CB8A 2PDUA 4BEQA 4MWAD 4U28A 3KBJA 1XYAA 4X61A 1WA3A 3R89A 2J66A 2NUYA 2TODA 1PYMA 1MNSA 1XLGA 3CZLA 3TUUA 4DNMA 3VNJA 2FIQA 4CQ9A 1XSKA 4PH6A 2HQAA 4B3ZA 1XLCA 3TN4A 2CHRA 5C55A 4K8EA 1RAKA 3C0JA 4OU1A 4PFHA 1RQHA 3UVIA 4JYEA 3UG5A 3OLDA 3WBAA 2F84A 4DRSA 3GR7A 2DW6A 3T8LA 1CGXA 1QO5A 3PVFA 1FWGC 2OQLA 3M0XA 5RUBA 3N19B 1LWJA 1XRTA 5AC6A 1SZEA 2GLKA 1VBRA 4MTVA 3RPTA 5A8PA 1EXPA 1WQ5A 4X60A 5HMDA 3I65A 2VFHA 3EXSA 3VOFA 2B31A 1JYWA 1IT7A 2W27A 3LYEA 5A8NA 1M65A 1ZGDA 5KMYA 4UQDA 3S3GA 2ADAA 2GVJA 1BVZA 1OFBA 2I9UA 1W1YA 3IGSA 4LCQA 1R47A 3MI2A 3CMFA 3QGKC 3PK7A 3TTYA 2I9EA 2VZVA 1VLIA 2Z26A 4Y9MA 4M3PA 4QDWA 3I10A 1KFWA 1HJQA 3WF1A 4KCUA 1PEZA 4EF8A 1MEIA 1NWTA 5CEWA 4FR6A 5CSSA 8XIMA 4Q8MA 1WXJA 4O1FA 3E0LA 4X0VA 5HUPA 4DJFD 3QW3A 4PCPA 1ISWA 2NXGA 5G2HA 2ZCGA 5D9OA 1H11A 1ZJBA 3QFEA 4U2ZA 4FP1A 1JXKA 4M80A 2QR6A 3LBOA 2XFWA 3JW7A 4PUNA 3DN5A 3U4AA 1PBGA 2CLLA 4V27A 3VIFA 3WDPP 1E4IA 4AZBA 4GYPC 3GXIA 1MNZA 4AB4A 2OYMA 4RKAA 3BG5A 2J78A 5H8PA 2DIKA 2KZHA 3N3MA 5F2IA 3VNLA 1VFHA 4D1JA 4S23A 3MMUA 3OO2A 4V28A 1TZ7A 3AALA 4GFIA 3W74A 3KL0A 2ZIDA 3WBYA 3AIEA 1DXIA 3MB9A 4XSMA 3IJ9A 1V3IA 5FL0A 4DO6A 4WSHA 1P0DA 4FX8A 5HK4A 4D71A 1XLFA 4MKVA 2WOQA 3CMJA 3LN3A 5IFPA 1P4CA 1XP3A 2D2OA 4AEOA 1UP2A 3BOFA 2HZGA 3P5ZA 2ZVIA 2P0OA 3GUWA 3VC5A 3AUOA 1WAUA 6ENLA 2Z1BA 2VVNA 3GWQA 3VD3A 2VRQA 1HF6A 5AC5A 3NQ6A 4R85A 1ITQA 2G3NA 4ZQRA 1JUKA 2GQ9A 4F0HA 1JNDA 4HJWA 4JIEA 1B4KA 5ECUA 2B7PA 1M3UA 2YFOA 3BH4A 3F2DA 1AD1A 3VM5A 1Z48A 5LSMA 3STPA 5U7SA 3UPMA 3VKCA 3L4XA 4GD0A 3FYOA 3LGEA 1FWCC 1AVAA 3GTNA 1YTDA 3PZTA 3N2CA 3DBPA 3LCGA 3CMGA 1VBGA 4GY1A 1UYQA 3QPYA 1A0CA 2ASHA 1R2TA 4JQ2A 1W2PA 4WRHA 1MZHA 5I06A 2H3DA 1WZAA 1OFDA 2WC3A 4I9TA 1XIDA 3GS6A 2EPLX 1ZBWA 2Y61A 3KBMA 3U6WA 2FTPA 1XKJA 3CK5A 5LXEA 5D30A 1HIZA 2V5DA 2HK0A 5HNTA 1E1EA 1GOKA 2VZUA 4DJEA 1I2RA 2QT3A 2WBGA 4P8WA 4DLMA 1R2RA 3O06A 3EOOA 4NXSA 3S0CA 3BICA 1GWJA 3HG4A 1Z6KA 3KS6A 4B4FA 3P0XA 1UD4A 2ZUVA 3VVGA 5CPSA 1PKMA 3N2MA 4RNHA 4GINA 3EMZA 4GNJA 1AZ1A 1GYMA 4AD5A 3VD4A 5HA7A 2NXIA 3C61A 2BY1A 1OYAA 4Q4KA 1FDYA 4H8VA 4NI3A 3K5XA 2XGIA 3OZMA 4LS2A 3PTQA 3PWGA 4HSOA 4NJIA 3MWAA 3K8LA 4QLLA 1OGBA 5K7JA 1CNVA 5G2WA 1E5JA 4Q8WA 3AMDA 3AHXA 2PZNA 4GXMA 4L5ZA 3NVTA 1ICPA 2XVGA 2OZ3A 5G1YA 4KGLA 3MO4A 2A7NA 3SQLA 2GGGA 3F5KA 4I9JA 5FEXA 5KINA 1E1FA 1W37A 3ZWSA 3NZ1A 1MQPA 2NX9A 3WEZA 2VD9A 5D09A 1REQB 1KRBC 1QASA 4C7FA 4W7VA 1SFJA 3MWCA 2YDSA 3L5AA 2RJHA 1E5NA 3MP3A 3W72A 1M41A 4PULA 3WUEA 3IJQA 4NAEA 3SIZA 1CXEA 4GKLA 2YCLB 2VQUA 4XZWA 3WENA 2Z00A 1UD8A 4RDZA 4LF2A 4HN8A 4YWSA 3WLMA 3W7HA 2I14A 3ORWA 4KESA 3QGVA 2VNCA 4UOZA 3LDVA 3BSGA 4N02A 2E1WA 3STEA 4ZGYA 4FXSA 4LVAA 3PUGA 3VIGA 2VTFA 4HHHA 3EOLA 3MCMA 4AC1X 3DESA 4HVXA 1R3VA 4NAFB 3UJRA 3B0YA 5AYYA 4IPNB 3ZT7A 3IANA 4MNJA 5FAGA 1OF6A 3TLQA 2V2DA 2C0HA 2XZ7A 1LG2A 3WNOA 3LD5A 1KM0A 1KFCA 5CZTA 2VC7A 1AW5A 2OT1A 3LQLA 1NDYA 1W32A 3GX9A 4BI7A 4Q8UA 1JCJA 7TAAA 2FVKA 5G5IA 3U4FA 4QE1A 4LOCA 3CPRA 1Q4WA 1YPXA 4IPIA 3CZKA 4UQBA 1OK4A 1M53A 1ZBCA 3V16A 4H8UA 3XISA 4FLSA 3AHYA 2GDQA 4K8GA 3DIPA 1BGGA 4AAJA 1Y7VA 1G01A 3MUY1 1SSGA 2PDGA 3WL0A 4ZOEA 2Y8VA 4X2RA 1W5PA 4E38A 5CG7A 4HA1A 5B7YA 2ESCA 4TTGA 2PTDA 3SAZA 5AC8A 3W1PA 4TX6A 2D2HA 1O12A 3E0FA 3TFCA 1PX3A 3QV9A 1Q85A 1TIMA 2FHFA 4AZ6A 3I4KA 3CZJA 3TU9A 3FFSA 1VENA 1UBPC 4C6QA 5EGRA 3SRKA 4KKXA 3S4TA 2JEQA 1VH7A 3F7JA 2XINA 3B8UA 1BYBA 2AL2B 3ZVHB 4O17A 5KZEA 3R25A 2X16A 1W8SA 1XIHA 4DPQA 3O6AA 2E6AA 3E5BA 3SFWA 2PGRA 1YDVA 4AHQA 2FJUB 4GH1A 3UGRA 2EHHA 1I8JA 2YYUA 3VOHA 5F2LA 4DWSC 2J7EA 5C71A 3ITXA 4TVCA 4UIOA 1YW1A 1DE5A 3E3HA 4NRRA 2HXTA 1RK6A 4V15A 1NFBA 2WWDA 3L5LA 5ECVA 2F9RA 1RP9A 3NVDA 1MEWA 2A3BA 3TIMA 3W87A 3NO3A 3SSJA 3N13A 3C52A 1WXYA 3B0XA 3LS9A 4OV4A 5DCBA 4HQVA 3EA2A 4D1IA 4GOAA 3GVGA 3TTOA 1PHWA 1EB3A 1PB0A 3W3OA 4O10A 1K1DA 3PSVA 3AIQA 1M7JA 4GYFA 3W70A 4FLOA 2A6LA 1ZAIA 4W8LA 3TC3A 5FSEC 3AMGA 2Y85A 4H6RA 5FF4A 2CWNA 3WFZA 4DI9A 3EXTA 2QJIA 5FEPA 4ZSUA 1TV7A 1FCQA 3HPFA 5M3WA 1EQPA 4JFVA 4WDTA 3VZZA 2XWDA 4Q7IA 2DORA 3CIWA 3W7JA 3U2EA 4FK9A 1ZP3A 3VOJA 2B7QA 4IXXA 4TX9A 1W1B1 4Z1YA 3EA1A 4M7SA 3WQ6A 4FLRA 4PE8A 4PMQA 4E8GA 3MMWA 1ADDA 3PJUA 5I0DA 3T8QA 4JR5A 4MF4A 4JICA 2D0FA 1UIOA 4GQQA 2Z2AA 1XW8A 4K37A 2ZUMA 4XZ9A 3WLTA 1D2KA 3ITOA 4XD5A 1E51A 4KWVA 3B0PA 5I3KA 3S6DA 1WBJA 2H9AB 4QJ1A 4P8XA 1CEOA 5LIKX 1SZFA 5JUVA 3ITVA 2RH9A 3F5JA 1HKJA 3BMXA 3FK4A 3OA5A 3NSMA 3H54A 2O4MA 5FJRA 4PTVA 4YNGA 1T8QA 4UQAA 3QLLA 4A3YA 3MMTA 1GG1A 4MGGA 1FH9A 2XU2A 3P80A 2HEJA 1JYVA 1EHAA 3ABQA 1VFFA 2YIHA 1T96A 1YPFA 2QCFA 4Q7NA 3TROA 5I03A 1GW9A 1W0MA 4F79A 3PTMA 1TTQA 2J8GA 3SUSA 5DMMA 5J5RA 3LBCA 1PZ2A 2GJXB 3C3UA 4IHCA 3VNKA 3L4WA 1FCUA 1OX4A 2PDFA 3QY8A 4KWUA 3PBGA 2EKGA 3CIVA 2CITA 2PWVA 5HMFA 2UBPC 2G97A 2Y1HA 1X1NA 4B4HA 3XIMA 2OT0A 2V0TA 1A5CA 1EBGA 4AZHA 1H41A 2ACUA 1XQKA 1DE6A 2WVSA 2Q02A 2DT1A 4QITA 3I7QA 1L6GA 4HNVA 1GVYA 1GEHA 3KBVA 1IXOA 2VEFA 5BXRA 1JI2A 3HGOA 1ONRA 1JEZA 3GNOA 1US2A 4EIVA 3P60A 3VGFA 1DJGA 3PANA 3WK2A 4I8DA 4WEVX 1V77A 4QJ5B 3HGRA 3VA8A 4R9XA 5CBIA 4DJDD 1CYGA 4MFDA 2DUAA 2WJDA 1TWZA 3TV8A 2IPJA 4GXPA 4PUKA 2VJXA 2QMKA 3WQGA 2ZUTA 2CBJA 3GBEA 2E7FA 2QGHA 2VM8A 1IE7C 1JZ4A 1DWIM 1NJJA 1RLDA 3W24A 3E6EA 1KCKA 3GIQA 3F4DA 2IQTA 1B30A 1FWAC 4LS0A 1QWKA 5HWNA 3OIHA 3WUFA 2XGZA 2YLLA 2D23A 5E0CA 4JKLA 3WLIA 1UUOA 3WX7A 4ZA0A 1FXQA 3JZUA 1JXJA 1H7PA 1GZ1A 1D7KA 2Q8ZA 1I0DA 4NX5A 3CZEA 4CU6A 1OT2A 2D69A 2CESA 1FXPA 5IHSA 2C19A 3W2JA 3SJ3A 4LB3A 3LNPA 3ENLA 1D3GA 2FZNA 3BG9A 3R10A 1N8WA 3QQ1A 2QW5A 3BJFA 2G3MA 4UMBA 2BGNE 3AC0A 4K1WA 2V68A 3BMVA 3LCWA 3WQDA 5JQ9A 3MV11 1K3UA 1JNEA 1JF6A 1VR6A 3I3BA 2GGJA 1KFLA 5CPNA 4ZOBA 4G56A 3GFYA 4OIFA 5IHRA 1DWHM 1NY1A 1WBHA 4CLMA 1B3XA 2E3ZA 1VFUA 1SJAA 3NXFA 3A9IA 1GHSA 4DUWA 3V4BA 3LPPA 3MYOA 3WLNA 4Q22A 2RDXA 1ADSA 3GXNA 3QRHA 2HROA 4Q8PA 2PWFA 2ZE0A 3G6LA 3K2GA 4LY8A 2GWNA 5C5YA 4W86A 4IFKA 1KRMA 4UCGA 3WEMA 4WZHA 4J1OA 3ITGA 7REQA 4GRSA 3S47A 2TMDA 4K8HA 3DFOA 2VCCA 2ZC1A 1D3CA 1SW0A 4HPGA 5ABFA 4O53A 4REQA 1W1PA 3SUVA 3OYXA 1J12A 1VS1A 3RMJA 5KZMA 2VR4A 2FFCA 1DVJA 4O1DA 2VFDA 3TA6A 1VAHA 1DWGM 5REQA 1UZHA 2BMBA 1KLZA 3L2LA 3HIJA 4A2SA 3OIXA 2X40A 4RZ4A 1OC7A 1GOXA 4N9CA 3SN0A 3ELFA 2WHJA 3TW7A 5E0FA 4NASA 3KTCA 3C2RA 4E3VA 3B0UX 5HULA 3W6YA 3S9IA 2PWDA 3QJAA 7PTDA 2JBMA 3EOSA 2GGIA 1B0IA 4HNLA 3LA4A 3DEQA 4IIFA 3S9YA 3DYPA 1ICSA 4JNMA 4D6EA 4UUIA 1T0OA 4H8NA 4J2MA 2R1KA 3SGUA 4U33A 1UOZA 2ZA2A 1FH7A 4HD5A 1LDCA 3FXGA 3BLEA 1XLEA 2I1OA 3EDFA 2PZ0A 4BK9A 2H90A 3OYZA 4K68A 1HJWA 4Q3MA 1ZFJA 3QEZA 2CXGA 3BC9A 3RCMA 2QCCA 1U1JA 3GNXA 3UETA 1TPB1 3ANYA 3ZT5A 2QCDB 1KV8A 4JPGA 3H6OA 4EPDC 2PLMA 3PM6A 3U2CA 4UTLA 4QCEA 3RM8A 2W62A 1DTNA 1WUFA 4IIHA 3EEZA 1RV8A 4ML9A 4OQVA 3JR2A 1K4GA 1W9VA 2PP3A 3DG7A 2QUMA 1TPDA 3G1FA 1XLIA 1SUXA 3UZZA 5K9DA 4ZVJA 3DCPA 1MFUA 3RAOA 4QR6A 4R5EA 5A8QA 3LRKA 1W1VA 1W9BM 2OEKA 1OIMA 2F6XA 3CV1A 1IGWA 5I00A 1S46A 4O0KA 2PDMA 3W6MA 3H23A 1UZDA 2B81A 2VFEA 2HSAA 1FWEC 1Z8AA 5A6BA 4L6HA 1FWBC 3HPXA 4YTQA 4W4QA 1SJBA 1E6SM 4HPJA 4ALDA 2D3LA 1EA9C 4JBRA 1B54A 1FWWA 4HSNA 2A3CA 1YDOA 4PBFA 1J0ZA 4OBTA 4BQ5A 1PUDA 1E3XA 1L8NA 1OADA 3H2AA 2VGFA 1E0VA 4FZIA 1V6YA 4QS5A 1XG4A 2DH3A 2Z1VA 4KEVA 2CU0A 3UR2A 1UMYA 2FYMA 2EAWA 2ZX7A 2E9MA 4M6PA 4IGHA 4UMCA 3T05A 4ZMGA 2VCBA 4MFEA 4H7ZA 1EA0A 2L5HA 4HZ8A 2V8ZA 3ANUA 3OVQA 3NA8A 4C6DA 3TDFA 1W1IE 1Q6RA 3FIGA 1N55A 5A8GA 2CLPA 2PDXA 1IHIA 2JKPA 2QCMA 3UERA 3VDHA 2I5IA 3GC5A 1GHRA 2TAAA 4PUEA 1QO2A 3AWOA 5F1UA 1QBAA 4QCFA 5LNUA 4I5RA 1P0KA 3WNMA 1QHZA 4H8HA 5G4HC 4O18A 1MEHA 1SVDA 4OUEA 2FH8A 3G8EA 1THFD 3QV6A 1JZ6A 1AD4A 3EWBX 2EPHA 4QXIA 4Y7EA 3PS7A 1GKPA 4U4MA 4M29A 3UG4A 2HK1A 4Y9PA 3MUXA 3TSBA 1G5AA 4S3CA 4H2CA 3UWYA 4DXXA 3HFTA 2J7CA 2Y7GA 4XZBA 2VEIA 3HV8A 5DMLA 3LG3A 1TTJA 2QUNA 3LY0A 3R0UA 3PN8A 1D8CA 1AJ2A 3E0VA 2D1ZA 2Z1XA 4YN5A 1J18A 3TFXA 4QROA 9CGTA 4YHEA 3UXKA 2XIIA 3H70A 1EPXA 2BDQA 2E8ZA 5ABEA 1X96A 4LAKA 2H8XA 4AX7A 3U0HA 3L4UA 5IDZA 1GOQA 2ZRUA 5KITA 5D2WA 3Q67A 3K8KA 4W7WA 2JIEA 1EEPA 5JMUA 3XINA 4H00A 2OO6A 1BWLA 2OVLA 4HCDA 1XCFA 1R30A 4HBKA 3ARQA 1KB3A 3T40A 1RH9A 4PTMA 4JHMA 3GDMA 3FY1A 1XRSA 5H1WA 2O56A 1PIIA 1NOFA 2AAAA 4ASTA 5CGTA 3VKKA 1B9BA 2DT0A 3BK0A 1X39A 4Y2WA 1TWWA 1O1ZA 1LQAA 1SW7A 3SURA 6REQA 4H9VA 3UQNA 3TOYA 2OX4A 3PJXA 1GOWA 2QCGA 1KRAC 1V6WA 4AY7A 4C5YA 4WGHA 4IL0A 3ITYA 3CIXA 1ZTVA 1NF7A 2IKJA 1JDAA 3ARWA 4IMDA 3P74A 1CGYA 5IM51 1WPCA 3FVMA 3ANVA 3H7RA 1Y5XA 2REQB 4GCXA 1I75A 2V82A 2CLKA 3EWWA 3G1SA 5AB3A 4DI8A 1DEDA 2R1MA 7TIMA 1RZMA 3NQVA 2VDIA 4YS1A 1R7AA 2WZIA 1HUVA 1EJWC 1RHCA 4EPEC 3UNDA 1VLWA 2WZEA 4MDPA 5AY7A 3QKZA 3LV6A 3M07A 1JUEA 4IX0A 4BFAA 2PD9A 2HXUA 2GSEA 4XZNX 3THDA 4FXJA 2VC6A 4ZB5A 4JFUA 3H2EA 1FWDC 1CDGA 3IK2A 4CKQA 2CPUA 4EAYA 4PYSA 1JIBA 2CBUA 4AZCB 1KGXA 4LY4A 4E2OA 4JTTA 3MW7A 1BF2A 1WUEA 4MIMA 1E9YB 2XUCA 4JOMA 3WELA 2YYTA 4DZAA 3CQIA 3T7VA 5BXSA 2GDVA 4GC3A 4IMAA 3UY8A 1MXDA 1QFEA 4AWSA 2HCVA 1A5LC 4EAMA 5LIXX 2OGJA 1FBAA 1Z69A 5AYXA 4K1GA 1M04A 4WKAA 5FESA 1Z89A 1GUVA 1ZUAX 3T55A 2RJGA 2PDIA 3SCQA 4JTDA 2C1GA 5T9BG 3WN6A 3R6IA 3VIHA 4PSPA 4ZO8A 1TX2A 1YNYA 1LL7A 5DEZA 2OCZA 5AZ1A 3W01A 1FUYA 1LCOA 3CWOX 3M5YA 4DM2A 3NQAA 1TWDA 1QW8A 3TK7A 3DFSA 3ITLA 1LT7A 1NDZA 3QM3A 3UZWA 3KBNA 1PZ1A 4PB4A 3TZFA 3TQ0A 1YRRA 3GB6A 4Z2HA 3VZYA 4ZE5A 3R43A 1R3TA 4QHRA 1A5MC 1CGTA 3DDMA 1XYLA 5DY3A 5K9XA 2Z29A 2Y7FA 4LANA 2V81A 1NFGA 1XISA 4I7WA 2NT0A 4FX6M 3EWXA 1DHKA 4JNZA 3RYSA 4CVUA 5F2MA 1TUFA 4P2VA 4PB5A 1IWAA 3IVUA 1X1ZA 1NM9A 4LQ1A 2QAPA 4Z17A 3SJNA 3F4WA 2J8TA 3V1PA 4AZ7A 4GBUA 3VI2A 2BGSA 2O55A 1YDYA 4JTGA 3VD7A 2NLYA 4WY0B 1TV2A 2XH7A 2CLIA 5BNKA 3AHTA 2J9ZA 1J8VA 1GTEA 1R9YA 5AECA 1OD0A 5PTDA 3RR1A 1Z3NA 1FA2A 3MDUA 3S5OA 3AHVA 4ORIA 3NDYA 3P62A 5FJPA 4LC8A 3AI0A 2WCSA 3TC6A 3NQFA 3A4JA 1RXOB 3GDLA 3O2LA 4HA0A 1KA9F 1GOOA 1TQXA 1WOBA 5KTLA 1E0WA 1UW9A 3SRHA 2P50A 3RJYA 3WD2A 3T9PA 2VR5A 3CC1A 2XM2A 1D7FA 2DP3A 3ITTA 5FJTA 4FIRA 4A8LA 5LNVA 3O6DA 3DUGA 1JPHA 1KM4A 2X30A 2X0YA 4DYJA 1OFEA 3WF2A 2ZRWA 2XZ9A 4FALA 2CBVA 2J7FA 5A6LA 3MQTA 3LMZA 4WXZA 1XUUA 2C0AA 4ZXLA 1US3A 2DQXA 4QGCA 2I16A 3UZ5A 2X0SA 1RALA 1HKKA 4DJED 2WVVB 8RUCA 3CASA 2OKTA 1H7NA 2F7FA 1P6WA 3LLXA 1L6FA 1GZGA 1EF2A 1E1CB 3H4GA 4FF7A 4YCPA 3B03A 1JD7A 5I24A 4WDWA 2R82A 4X9SA 1K6AA 2IUZA 1F4AA 1LRNA 4M51A 3M5XA 1J79A 5A6JA 1SFTA 3M0ZA 1ISXA 1MQRA 2QV5A 3MJYA 4BKNA 3A13A 1Z41A 5B7ZA 3W86A 4N4PA 1UKTA 5CQ1A 4PMXA 5F4XA 4AX6A 2BY3A 3CQKA 3BV7A 4LUTB 1UKOA 1ZB5A 2QPUA 1ALDA 5FJJA 3BURA 1PKLA 2VENA 4IIEA 2RAGA 4K38A 3IAPA 1REQA 1EWDA 3FDGA 3PUOA 2WO5A 1KRCC 3ZT6A 4HK7A 1V8EA 2QVNA 1U22A 4KF1A 1FOBA 1VB9A 2ACSA 2W61A 4JGDA 2PDHA 4NNCA 1SZGA 3L0NA 2YCLA 3K4AA 3IUDA 5JIPA 4QDMA 1UKSA 3AROA 4FHAA 4RZ6A 4K2SA 3NTYA 4QNEA 3H53A 1XC4A 3EDEA 5I3FA 4P7LA 5BOOA 2CFFA 2R1PA 3FXYA 3HGJA 2EEXA 3UW6A 4JX4A 2NV1A 3OG2A 3L66A 3L5MA 3KWSA 3G1XA 3EZ4A 2ISWA 4NAFA 1GQNA 2VXNA 1EO5A 3VNMA 3FYYA 1MXGA 1GCYA 3E2VA 1VJIA 3GYCA 4DF2A 4HOZA 3N15A 4HSHA 4ERIA 1O4UA 2IKHA 3RRAA 3T81A 3WFLA 2XJ7A 4KCTA 3RX4A 2ZX9A 4DLFA 4G7FA 2A2IA 4C1KA 3TJXA 1E6PA 4MY1A 3NZGA 1Q63A 3TW6A 4WVXA 3THCA 4QISA 3UXLA 1S2CA 4RJEA 2DVXA 3CTTA 1TPVA 3HURA 4UTMA 4IQEA 1JULA 1UASA 3VKAA 3K4WA 2DSZA 4BWLC 1FHUA 4CCEA 3MPGA 4IMGA 3BVJA 1UQYA 5CPMA 4UTHA 1JI1A 2ANUA 2R8WA 1IXPA 2PRMA 4RE4A 5D9MA 3NQMA 2PWUA 5CKSA 3HN3A 1MFVA 3EXRA 3N3TA 3OVGA 4ICNA 1HXJA 3O07A 1SFSA 3TYEA 2YA0A 4Y9OA 2JGQA 1B3OA 4NZ5A 1HZYA 5DT7A 2ODOA 1QNVA 1B2YA 1UQZA 2AGTA 2IQ0A 5HNNA 1CXFA 1EDTA 4BZYA 1QUMA 5TAOA 3VD9A 4PODA 2AL2A 4LS1A 4KGJA 5DLCA 3ZVHA 4J3UA 2VFGA 3MUZ1 2J25A 2EQDA 1EEXA 2XH0A 3ABOA 2OZ0A 2EXOA 2IMRA 1VGAA 3CT2A 1R87A 5EMUA 1QJWA 1BWVA 5E70A 3GXMA 2XIJA 4GIRA 2GJLA 2X2GA 4M6VA 1N7KA 3II1A 1QTWA 3LHZA 5D2YA 5MKGA 2YB1A 3JU2A 2VEKA 2PU0A 3BLIA 4O15A 1TRIA 3CTLA 5D8WA 8A3HA 3WK1A 4HNCA 1XHGA 2XH2A 4M82A 2W92A 4O28A 1UR3M 4KERA 1GOIA 3EMCA 3NR0A 1J0HA 2O0TA 3G5EA 1U1UA 1L2UA 2QV4A 4NNAA 5AYBA 3WH9A 5J04A 1K70A 4IX2A 3W1RA 4PA8A 2YFNA 3LK6A 2Z2BA 2ZDSA 2E28A 3QQWA 1TSIA 3ZWTA 3WLSA 4OBRA 3J7HA 3RIKA 1B3YA 3AJXA 2RGMA 3AXXA 1AJZA 5CG0A 2DSKA 1BSLA 1LF1A 5BZAA 3PPFA 3D3FA 4UOQA 1AQMA 3OVPA 1YXDA 4ADTA 1Y65A 1WB0A 3PWAA 3A3HA 4H83A 1UR4A 4GVHA 2QMJA 2RUSA 2PCQA 3SCSA 4XAFA 4FIQA 1TWIA 2E67A 2GQ3A 5FACA 3RCNA 5FEZA 3B40A 2G95A 1Z32X 1F3XA 3GXFA 4YJ5A 2YDQA 3B97A 1Q6GA 4JTAA 1JCXA 1LJYA 3DXIA 3N4EA 4FNTA 3DHDA 4MZ8A 4AD4A 3RITA 6PTDA 1MDRA 2POTA 2OYKA 1EP3A 2PDPA 4AVFA 4US6A 5FSDC 3KRUA 3MUAA 3KAOA 1HVXA 4C1NB 3P8IA 1F8MA 2ALRA 2DFAA 3PWIA 2WMIB 4GZIA 3VU2A 2O7SA 1FWHC 1XPYA 3MHFA 4EPKA 5BWAA 2QEZA 3C8FA 3MKKA 3FOKA 5I3JA 3FHQA 1FFQA 5HANA 1LQ0A 4QSHA 1UPMB 4ES4A 2ZZ1A 4QBXA 2V5CA 2ON3A 4B2DA 4M6UA 2PDNA 3LRMA 5BYWA 3HOJA 1W9UA 4GY0A 4LBSA 1QXLA 3TW9A 1Q13A 4K7YA 4PCTA 2J9YA 4PFMA 3SCTA 2PE4A 4ZO9A 3LCIA 3U7VA 4BQ4A 3LZ5A 2ZRXA 1EPVA 1CZ1A 3BW2A 3R8RA 2Z2UA 1EP1A 2WSQA 4OJYA 1GZJA 3BQ5A 1AK5A 1UIPA 1LOSA 2WMJA 3EDKA 4ICMA 3FHAA 1L9WA 3CU2A 1RJPA 5J5DA 3QBUA 4Z1AA 4GXWA 5C9ZA 1M6JA 4D6GA 1ZZMA 3VDGA 2VFFA 3QYSA 1VQTA 1DJHA 1H7OA 4AG0A 4EWND 1EFZA 3KCJA 1BGAA 2WVUA 3BV4A 3G1DA 3B8SA 1RJRA 2C91A 3W1XA 2VQTA 2C1HA 1OB0A 4PTWA 2UWFA 2PDKA 2FMNA 3G1VA 3P2VA 3APYA 5JU6A 3WLPA 1AZ2A 3ZFHA 2Q01A 4MKSA 1SO6A 2Z24A 3TYZA 1EX5A 3W7EA 4RW5A 3VDAA 5CSYA 2D22A 4AEFA 3W75A 3QR0A 1X97A 3MMDA 4QDPA 4UFHA 1XLHA 3WK3A 5A6KA 2G37A 4IG2B 2WHKA 2D3NA 3F1QA 5D37A 3CZ8A 1WKEA 3MDWA 4XK2A 5CZKA 4DEFA 4Z1CA 3H21A 4LUYA 3PTDA 3VXGA 1QT1A 2OG9A 4HYRA 3W84A 3IK4A 4AHPA 3TQVA 1W56A 1JDEA 2OX1A 4F0RA 3MY9A 1LROA 2W67A 3TYCA 3TTQA 1BLIA 1LZOA 3W07A 3EWZA 1DQUA 1P0NA 3WKZA 1RCXB 1Z42A 3W81A 3E1F1 5FAJA 4C7DA 1J96A 2Z28A 1W5QA 5I02A 2YZRA 2RKXA 1V93A 3GXDA 3AAMA 1D8WA 3I3EA 1TTIA 3SBFA 1NIUA 1QI3A 2XN2A 3P93A 3KBSA 4DAFA 4B3LA 3TCSA 4HCLA 2ISVA 3NZPA 3RM9A 2ZQ0A 3TC7A 1FH8A 3P8JA 2A7PA 1DJQA 4MJ2A 5AYIA 1AL8A 5JBEA 1BXBA 1IEWA 2Z6JA 4PMDA 4GKTA 3W2UA 1NVMA 2GUYA 1RA5A 4RX0A 4NYUA 1TMLA 4AY8A 1WP6A 1V79A 3FAXA 4WLCA 1Q4NX 4C60A 4MSSA 4D6CA 4L56A 1YLVA 4OVXA 1F6PA 3FEQA 4GUJA 3MC5A 3UR5A 2A1YA 3AIRA 3P67A 3MHUA 1U1HA 3GE7A 3FJLA 4N2YA 4GI8A 4QRNA 4ACZB 4W5UA 4HIBA 5FL1A 1FWIC 3C0QA 3A4AA 1XM3A 4Q7BA 1CWYA 4K39A 5A95A 1RP8A 1A80A 4DWDA 2ICSA 4RNIA 1GQIA 3NQ7A 3NQBA 3IV3A 3SO7A 4W8BA 1DWFM 3FSTA 1MW0A 2ZXAA 1BG4A 1QU4A 1GK8A 3OGVA 4J35A 3OGRA 3PZQA 4LYQA 3USZA 3G3DA 4A2RA 3GC2A 4NUWA 2J79A 1XI3A 1WDPA 1AMKA 4GUIA 2JQXA 2PWEA 2Q71A 2JE8A 1XLMA 5HPOA 1P48A 3LEPA 3NNTA 3E74A 4ZB0A 3BWWA 3CWNA 1GT8A 4PSRA 3OGSA 1G4EA 3CNYA 1P5BA 3CHVA 3EGJA 4WKHA 2OLHA 1MI3A 3D47A 3EBVA 4JTJA 1KR0A 1OFRA 2WM0A 4I6KA 3LUTA 4RZ5A 5M2FX 1LT8A 2QCDA 3Q2DA 3LTYA 4CD8A 2ZC8A 3PUDA 3GDRA 3CH0A 1K77A 2WLZA 3DOPA 1HJVA 2D0GA 3MTWA 1IXQA 1YQ2A 3AXMA 1C3FA 1I1XA 3I6TA 2QF8A 1L0PA 4L6DA 3E9AA 1RY0A 4HPHA 5I78A 4PMNA 2IPFA 2GJPA 4INFA 2XISA 4LNCA 2PODA 3WH6A 1JVNA 4AUBA 4WIWA 1EJVC 1BF6A 1DJWA 1U5VA 4HT3A 1SM9A 2G3JA 3A12A 4HZ6A 1OYBA 4JL2A 4BI5A 2GUUA 1CI1A 2D20A 4GCAA 4O57A 2W79A 1IWPA 3KBWA 1HKWA 1WDQA 1KCLA 3LTSA 3WQCA 4L6OA 3GG0A 5I77A 1T99A 4TO8A 1VBJA 3WQOA 4H41A 2WMFA 3R12A 2YA2A 3LBMA 1VFOA 3IRDA 5BROA 4JDBA 4XUGA 1UC4A 1JPKA 2ATMA 3VABA 1QPKA 2TSYA 2BG5A 3EDDA 1U5HA 4F2UA 5A6BD 5F7UA 1K9TA 1OG0A 1KWKA 1ZJAA 1IYXA 1X6LA 3W2NA 3ONCA 4P7RA 3BCFA 3IIZA 4QG9A 3TH6A 3AXHA 5BWFA 2X42A 3O3RA 3VAVA 4GX8A 1PO9A 2QJGA 3W2MA 1DIOA 1VFMA 4UTWC 3G18A 2G96A 3EX3A 3VMNA 5IRPA 4LFYA 3SQSA 3MZNA 5DCDA 3W85A 2VGBA 2QJNA 4Y9AA 1ZPTA 4N7QA 2FVLA 4BF9A 2V5KA 1M01A 1L8PA 1J5TA 4A21A 3UESA 1WZKA 2V67A 1HX0A 2WZMA 1IIHA 1X8FA 4PEEA 3A5FA 2NVDA 1YTKA 2OKOA 3HM7A 4PUJA 3IUHA 7ODCA 2OEJA 5SWUA 2OQHA 3M0JA 3LMYA 1C8YA 3D0CA 1TTPA 1YDNA 2QCHA 4OZOA 1IEXA 2VO5A 2GVEA 4NY2A 4EWJA 4PUUA 2V30A 4GYPA 4US5A 4JY8A 5DQPA 3PZVA 5LIWX 3PBMA 1C93A 3M0IA 4TV6A 4GISA 2E5DA 1EX1A 3M5ZA 5CJMA 2QUUA 1JZ5A 4LU0A 1HJUA 4ZOAA 3ALGA 3VKBA 1OGGA 3BZJA 4J3TA 1IZKA 3H55A 4PUWA 1BG9A 1GEQA 5DFAA 1HKIA 1QWGA 1RA0A 2HNEA 2WHLA 5LZLA 5HDRA 4D72A 2G0WA 4IOTA 1NQ6A 4IUGA 3EX1A 3MCNA 5T8GA 1T5AA 1UP0A 2OSYA 1CXIA 3AMCA 2W6RA 3WJZA 3M16A 2FH6A 4GQBA 2ZZ2A 3KXQA 2IKGA 2ZYFA 2BOGX 2YJQA 4P7QA 1VBUA 3GAKA 3GHRA 1QNRA 1RCQA 4Q33A 3M41A 1MUWA 4WJXA 3CAWA 3CV7A 5FF2A 3RU6A 1Q66A 5XINA 4R7JA 1ZCOA 3WLJA 4F0MA 4NILA 4JQ1A 3M5VA 1EH9A 4XKMA 3L65A 3HG2A 4HU4A 4I5UA 4GQ0A 1TQJA 3K1GA 1GVRA 2MNRA 3PZUA 4UTJA 3STCA 4B92A 2ZRZA 3CLMA 3LSCA 1UHVA 3W2LA 3UA3A 4BEUA 3DX5A 1W5OA 3QFWA 4UTTC 1VJSA 2OQYA 1S2WA 5HWMA 1LL4A 4F9JA 4EXQA 3ZR6A 3ZJKA 4CGTA 3VPLA 4UXDA 2X09A 1TELA 2PGFA 4FPSA 3UZJA 2CLOA 3ZOAA 3W7RA 5D2TA 1S3HA 5CSRA 4ENLA 4MWAE 3MZ2A 1EF3A 4LCSA 3TTSA 1PTDA 3E49A 1EJSC 3SM0A 2AQOA 3A4XA 1GJWA 1B57A 3GDKA 1MO0A 3D3AA 3LHVA 3T44A 2QUTA 3NAVA 4F66A 3CV6A 4JL1A 3PHAA 4R27A 2BS9A 5EMJA 4DZHA 4O1AA 1VPYA 4AZCA 3DHUA 5CPOA 3GU9A 3IARA 4XTIA 2DZBA 3PZGA 3O6YX 3PZMA 2ZXQA 3QV7A 3M0HA 4IGMA 4NX0A 3W7KA 3KOZA 5LHEA 4JQ3A 2E1DA 3W71A 2E6YA 2C1IA 3VGEA 1FVPA 4C6JA 4LVFA 4UR8A 4IQDA 2BY2A 4W85A 1F4HA 3TYUA 2FB3A 3BXWA 4S1FA 2Y8KA 3VCNA 1TPH1 1ZP4A 1NP0A 4EVZA 4ZQOA 4C1LA 3ERPA 5HQEA 3ZSTA 1NWRA 4W89A 3RX2A 1PZ3A 2OSXA 3HQ1A 2WWCA 3KOWA 4DYKA 3P6LA 5G4WA 1OINA 1VRDA 4R53A 1ME7A 5M1TA 3CO8A 2NW0A 4PMUA 4LUSB 4DY1A 3UVAA 4GH3A 2OWCA 1N8IA 4C6NA 2ALDA 3OHIA 5T9CE 3WNNA 4LRSA 2FQIA 3GR8A 3OU8A 3OB8A 4LYKA 2DZUA 5FF7A 1X38A 1ODZA 1WZLA 4XB3A 1K6WA 2O9RA 3RPMA 4L9ZA 2E5BA 2VFIA 4H7CA 1UJQA 3RHGA 4XTDA 3FDKA 1TJ0A 3CUFA 5FCZA 2VP8A 3B9OA 3M44A 2DUXA 3JZEA 2VZTA 4N9BA 3V75A 2PDBA 3T09A 3V18A 5CAKA 4C5ZA 2A21A 1VC4A 2WANA 1BTCA 4OT7A 3NQGA 1SMDA 3JS3A 1E72M 2CC0A 4E8CA 2RHGA 1ZCCA 1G6CA 3WQPA 1X6UA 3UXAA 1J0IA 1VCVA 3IGHX 2R24A 4JNYA 3WK0A 2W5FA 4U5KA 3VMOA 2CZDA 2HPIA 3L21A 3TR2A 3AUJA 4XQ6A 4B5VA 1AQHA 3AMKA 3MVTA 1N2VA 5K9CA 1J4EA 1XLDA 4W8AA 4J4KA 2Y6ZA 3AS0A 4IZGA 1UD5A 3NYDA 1HL9A 2B4GA 1ITCA 4I6VA 3SCVA 2XGBA 4HNNA 2WJEA 3URNA 4RV3A 2A3LA 4S38A 1V0MA 3FV9A 2BXYA 1DHPA 4O8AA 4GG9A 1I0BA 1E4LA 3EKGA 3S42A 4DO5A 3CHEA 1LRQA 3NJ3A 3ARXA 1V0KA 2FPYA 1TVNA 5CPTA 1JPMA 3QF0A 1VFLA 4LAUA 4GACA 4WDUA 3R8GA 4D6HA 4P8VA 4V33A 2J4GA 5K2ZA 4L61A 1KKRA 2W63A 1XRVA 2G3FA 4KMQA 3W7LA 4WCJA 4RW3A 3CPUA 4CD5A 2XN0A 2ZDRA 3WUBA 3WL1A 2WVVA 3KFTA 4F2BA 3CWHA 2VOMA 1TMHA 1E1CA 7A3HA 4FA3A 3SECA 2DZTA 3RLGA 4OHQA 1TJPA 1KWGA 3CB3A 1H1ZA 3DFNA 3NZRA 1QI0A 2O9PA 3N18A 1LBMA 2GQ8A 2W66A 3GVQA 3LNMA 1B9ZA 3W7IA 2GGEA 5A6MA 1R86A 2G50A 4DXVA 3FCPA 5LA2A 4DWSA 2AQVA 2P0IA 1NARA 2QUVA 2OFJA 3BLDA 4YVVA 4P8UA 1M03A 1QDSA 4RXFA 3W28A 4ZQMA 3B8VA 3M0KA 2XYLA 4O12A 2ZUNA 3YPIA 1A5KC 4PCNA 2P1FA 4BY3A 3H2FA 1A5AA 4JTLA 1CB2A 3E2RA 4LUTA 4UZUA 3WDHA 1JZ7A 5FKYA 3WF4A 1WZMA 3OG3A 4WQ6A 4ZEPA 3SQMA 3IV8A 3E96A 4IIGA 4MM1A 4IFOA 3GTIA 5I7GA 3VINA 5EB8A 3GBDA 1E9LA 3RM4A 1OK6A 5XIMA 5TIMA 1JQVA 2X7WA 1XICA 3PPHA 2BX7A 2V3FA 1A5BA 5D38A 3KW3A 4C65A 1XH0A 2OR2A 3MANA 2A5HA 4CNTA 1S2AA 4EOUA 5HQMA 5BU6A 4LVDA 2J7BA 3CEUA 5CH9A 1E40A 4PRRA 3PPGA 3L4ZA 4WX2A 3PBVA 1XIGA 2BGQA 3WY1A 2ZX5A 2QDHA 1A4MA 3N9KA 1PZ0A 1RJQA 1BEUA 3DFYA 2VX6A 4L4MA 2OZTA 4HNOA 5M03A 2ABAA 3GKAA 2IS7A 1EYWA 3ATYA 4C6CA 4GVIA 2YLAA 3ES8A 1OHLA 3LXCA 1TV5A 1CB7B 2R94A 2OOGA 1GYNA 4RNFA 3GW0A 3C56A 2FZ9A 4JCMA 4Q8TA 1FTXA 3GHTA 2YKKA 3RUBL 1KD0A 1J2BA 5EPDA 3AICA 3B8WA 1LYXA 1CXKA 1H1YA 1SJDA 3L67A 1OQFA 3T1GA 4D6FA 2YA1A 5AHNA 2PLCA 3W83A 1P1MA 5I07A 4LWWA 3KZPA 4PMVA 2SFPA 1YXYA 3BE7A 3QSRA 3KX6A 4AD0A 2EF9A 3H22A 2RFGA 2W0UA 5CC3A 3SY5A 3W22A 1PVNA 2GPTA 3M0YA 4RCXA 1W3JA 1R9ZA 3PSWA 3OVRA 1GYLA 3GH7A 3MI6A 4EKJA 2GUBA 1WCGA 3W7GA 2NLIA 4GUFA 1GTHA 1VKFA 1W17A 1K9DA 3O6CA 4HB7A 3URBA 4DNHA 1EGMA 4QJ4B 2UY3A 3TONA 3GHSA 3SN4A 1K9EA 3N25A 2NWRA 1AUSL 2JFEX 1E70M 2B7NA 4Z08A 2UY5A 2GL5A 3WLOA 4MJ4A 3S5YA 1UP3A 4O13A 3W1UA 4QX4A 4UR7A 3W23A 4X3ZA 3DI0A 3UZYA 3GY1A 2J88A 2DSWA 5H2ZA 5D32A 3TXZA 2JKAA 4AZIA 4KRZA 2HVNA 1JGIA 2FTWA 2Y2WA 5DXYA 2Q6ZA 1XGZA 2PGEA 3CHFA 3VFCA 4X9YA 3MU7A 3M1ZA 2PP0A 5E9XA 2PI6A 2I5QA 2PMQA 2EPMX 2CLEA 3UWQA 1VYPX 3IVTA 5LNSA 3WF0A 3G8RA 3ZR4A 6XIAA 3DG6A 6A3HA 3WLRA 1V6VA 5LA0A 2BOFX 2GK1B 4MPQA 1IT8A 4HKPA 2I56A 3CUIA 1LLZA 4PTDA 4L4PA 3TQKA 1ML1A 1EUNA 3A22A 1WDSA 1A0DA 4W84A 3CBWA 3SB0A 5AVNA 2JIWA 3UBPC 1TMQA 3KOXA 2P10A 1WXZA 3BGAA 1DIKA 1Q7QA 3SY1A 3WMLA 4F9DA 1IZJA 3O8AA 4TVDA 4RE0A 4UTUA 3QVQA 3DZ1A 3HB9A 3W9ZA 1WDWA 3MSYA 4OECA 4S3KA 4QE5A 2E9LA 5FJUA 1IEIA 1ENUA 4AU0A 4QE4A 4MWAC 2HJPA 3SCWA 2P88A 4IMFA 1PE1A 2PLJA 4JN7A 4WSJA 5E6ZA 3LCFA 1XF0A 2V5BA 2WAGA 1JZ2A 4Z2IA 1UR1A 1AA1B 3MBDA 5AZ0A 1TPFA 5HUOA 1V6XA 3IIOA 2I17A 4UQEA 3ME3A 4Z2JA 3VNIA 4QLKA 2VUNA 3TKFA 3F2BA 3NGFA 4E3TA 1GKRA 4K6AA 1GKQA 3PBWA 1PX8A 3U48A 1SO5A 1MUCA 1DYSA 4JIIX 3UCQA 1HN1A 4JFTA 3PY2A 1KBLA 1DORA 3DHPA 2ZADA 4S3JA 4M5PA 2QGYA 3K8MA 1ZHAA 1CGWA 1CPUA 2YBUA 2Y7DA 3KE0A 4MDOA 3W73A 4G8TA 3TYBA 1XFBA 4B2DD 3UY7A 3DAQA 1P7TB 4V1YA 2WYSA 3E2QA 4TR9A 1BKHA 2ZRYA 2R91A 2X05A 5DY2A 3OLIA 3DFTA 3BARA 3LERA 3UG8A 1PXGA 3F4CA 2DIEA 4MB1A 4LBUA 1SZNA 3SI9A 5CC7A 3L9CA 1SJCA 1JCLA 3ATZA 4S3GA 4D8AA 4QEEA 2A0NA 4MLJA 3ZR5A 5K4XA 2AKZA 2VKZG 3TYDA 4S3EA 1H63A 1OD8A 1XX1A 4GHRA 1W31A 3FS2A 5EYWA 5D9NA 4DJFC 1BXCA 3N12A 4C7GA 2HISA 2INEA 4LX4A 1W5MA 3GIPA 2X7VA 5G4EA 4W93A 5CGMA 4L9YA 4UNKA 3VTRA 1E0UA 1VYSX 3VOCA 4DBUA 4NIRA 1UD3A 1F9CA 3FJNA 4IIBA 2PWHA 2VX7A 4LTSA 1O60A 3B8TA 1IEQA 1TKKA 1XBXA 2GJRA 2ONEA 5IBXC 4ZFMA 1ZENA 2GOUA 4AZGA 2JF7A 5CJNA 7CGTA 5C6MA 3KDOA 4LAOA 3GIYA 3Q58A 2OSWA 3ONBA 3QZEA 2BVDA 3C2OA 1VD6A 1DQWA 3U57A 1HGYA 2FDSA 4IG2A 4XAZA 5G1TA 1E15A 4G7EB 3ISIX 5EL1A 4QNWA 3WQFA 3GFZA 4ADUA 4H1ZA 1RY8A 4GY7A 3RPDA 4Q8VA 4H9MA 3ARSA 3OODA 3WQ8A 1ZJIA 3P3BA 1GVOA 2JF6A 3MUCA 3BAXA 2FHCA 4B5NA 1S2TA 2YL6A 1OGSA 5CAHA 1BQGA 2WNWA 3WLHA 1JCTA 5K3VA 1IT0A 4AIEA 1Q7MA 3GLCA 1OC6A 1W3NA 2C8NA 2E6FA 4QQUA 4KFPA 3W7MA 3GXTA 1K03A 3LV5A 4QAIA 1LRTA 4J5NA 1WDDA 2QAFA 4L1WA 4HU0A 1MSSA 5AKQA 4B5UA 4PN2A 1MW2A 1DJXA 3VO0A 3KUMA 2J13A 2YCIX 1V02E 4AXKA 5LYRA 2QKFA 3UFYA 3NQDA 2C7FA 2CNCA 4PMOA 1W1A1 3SFKA 4PUDA 2O9OA 5AC7A 5M17A 1ZAHA 3WDJA 3ZVIA 3WMSA 2RGLA 3DFQA 1DBTA 4IMEA 5HJYA 2FFIA 3PZNA 3H26A 1XLBA 3PP7A 3W26A 2BTMA 4FXFA 1MQQA 1ZLPA 2P8BA 1PJ9A 2C16A 4IPPA 3QKEA 2J9XA 4GJIA 2FPVA 4NP7A 3QPZA 4ACZA 2WV8A 1W9XA 1YNQA 1YBQB 3HTWA 2HBVA 3NL5A 2F61A 3FA4A 4PEKA 1W1ZA 4HN4A 4O8RA 3WJWA 5A2CA 1O94A 1QW9A 4IF2A 4YTUA 2XFFA 3CQJA 2OGYA 2ZZ4A 4URIA 4JDYA 1UB3A 3A6OA 5EFDA 2O92A 4DIAA 3PJTA 5A2BA 1U33A 4I7VA 3NDOA 2VWSA 2HMCA 2Y5EA 3DKLA 1U83A 4Y96A 3DGRA 1OBAA 1XBZA 4NRSA 3H12A 1POKA 4TU1A 1ME8A 3RX3A <