1H11A

2-deoxy-2-fluro-b-d-cellotriosyl/enzyme intermediate complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 116
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h11A00
3PHAA 2PWEA 1JYVA 3S2CA 3ARTA 5D8ZA 2J7EA 5AYIA 4FLQA 4CN4A 1J0ZA 1QNOA 1VJSA 1VB9A 4WSKA 3WENA 1JF6A 3I3EA 5F7UA 2PWGA 3VIOA 1W91A 1KGXA 2X09A 3CHEA 3MMWA 1CXHA 4OKDA 3WH9A 3MUZ1 4MAZA 1UG6A 2RGLA 3WELA 1E6XM 2WVVB 2J7BA 2CBUA 4H2CA 2VO5A 3WNLA 3E1F1 3ZQ9A 2OYMA 4EK7A 4EKJA 5I3DA 4GXPA 1J0HA 3VGFA 4CD6A 1FH8A 1U33A 3VIJA 1E71M 1UOKA 2BHYA 1PBGA 1EO5A 4MNJA 4UFLA 3DHPA 4GZEA 3MSGA 4GI8A 3ZR5A 1KXVA 4ACZA 3ARQA 4E8CA 3ZJKA 3VPLA 3HU7A 4U2YA 3WEOA 1GORA 4PSRA 4DWSC 2WB5A 5HNNA 1ZB5A 1Q6EA 1LJYA 1NOUA 2WMHA 3FW6A 4X9YA 1J10A 3WF4A 4XX6A 3T2QA 1QW8A 3VKKA 1BF2A 4AEFA 1JYWA 3PZQA 3WFZA 2DQXA 1E6SM 1JD7A 2W91A 1E5JA 1AQHA 1QBBA 1VEPA 3M46A 4HPHA 3ZJ6A 7A3HA 3BMVA 1IT0A 1AVAA 3ALGA 3VILA 4UOZA 4OOUA 2PBGA 1NP2A 2WWCA 1HJUA 2EPLX 1HJWA 1NM9A 2IXVA 5GQBA 3TOPA 2YA0A 2XSBA 2DH2A 2EJ1A 2OWXA 4HMEA 1R7OA 3CZ8A 2ZX5A 1HF6A 2CCRA 3CHDA 3W0KA 3VGBA 4HP5A 3VX0A 4QP0A 4JL1A 1Z32X 1E4MM 4UFIA 3RILA 3QOKA 2PF0A 5IHSA 2J47A 5JBDA 4D6HA 3ZIZA 1W9XA 1W9UA 4YPJA 1DWFM 3W27A 4AZHA 2BXYA 4KWUA 1E5NA 2WKLA 1ZL1A 2WCSA 3OB8A 3SUVA 2ZX7A 2HVMA 2Y4SA 5M03A 3GNRA 4CD4A 1UYQA 3AMLA 2CNCA 3AS1A 3NDZA 4LXFA 3RPMA 1XD0A 1VIWA 4P7NA 4UR9A 4P7RA 2A3EA 3WNMA 4JIEA 1PEZA 3GBDA 3GNPA 1UWSA 3UCQA 5JIWA 2D3NA 1UZ4A 5FL1A 5I24A 5A8QA 1CTNA 2X05A 4GO9A 3VM5A 1UR2A 5D8WA 2D0FA 2GDVA 3SIMA 1B90A 3T09A 1QNQA 3NCOA 2VURA 3SUUA 3OBAA 2WMIB 4PYSA 4MB4A 1RP8A 1ISWA 3WDIA 2BNJA 1CGYA 3ZSTA 4HMDA 3W25A 2NW0A 1JF5A 1WKYA 1CENA 1C92A 4P7OA 3WBEA 4LYQA 3WKZA 2DSUA 1CYGA 1E4LA 2XWDA 1D7FA 1VEOA 4D6IA 5CJ5A 3NSNA 3EMZA 3IJ8A 5E70A 2D24A 4FK9A 1J0YA 1DWJM 1M03A 3VD4A 1PX8A 3G6LA 2WMGA 1E1EA 4MB5A 4AY1A 4PMRA 2C8NA 3WD4A 2D0GA 1UR8A 4R27A 1BYAA 1KCLA 2XGBA 4UFKA 3AS3A 2YL9A 4XZWA 1K9TA 1GJUA 2EO7A 3VD5A 1HIZA 2FHBA 2QHAA 1JGIA 1JYXA 1J0KA 4JCLA 2VQUA 1ZS2A 4RE4A 2YL8A 1C8XA 2WHLA 3OZOA 3WH7A 3CZEA 2J62A 5GNYA 2CPUA 4JKMA 3L4ZA 3U7BA 3IAPA 1UQZA 3GZAA 2CHNA 2ZICA 1UKPA 2VX7A 3VNYA 3A4WA 3A4XA 3LPGA 4AD5A 2A3AA 2CXGA 4AZBA 1G01A 4IUGA 3MMUA 1VBUA 3VO0A 4MPKA 4F9DA 3L4TA 1V02A 4J28A 5HXMA 3UR8A 3ZT5A 5CLWA 1JI1A 3WH6A 3W38A 3TA9A 3WDJA 1C3FA 1EO7A 5E6ZA 4Z2LA 1ITCA 1GOMA 1X6LA 3BAKA 1GUVA 2VCCA 2V3FA 1B3XA 4J7RA 5EBAA 3ZJ7A 5ABFA 1UWRA 2XPKA 5JUVA 3SCRA 2JEPA 5D4YA 4JCMA 2WC7A 2OSWA 1RPKA 2BVDA 3N15A 2VZVA 1GVIA 2WANA 2CBVA 1H4PA 4F66A 1ISZA 3MV01 2EBNA 1CLXA 5HPCA 3OGRA 5D9PA 4QLLA 4X0NA 2E40A 2CERA 2BY3A 3AS0A 1UKSA 2XVKA 1CDGA 1F4AA 4UQAA 2VZSA 4D6GA 5A2BA 4MNMA 3AMKA 3CHCA 1HXJA 3PZNA 1X1NA 1ZBWA 1OD0A 1MYRA 1VAHA 2ZUUA 4H41A 2VZUA 3PZ9A 1GONA 3W28A 3AI0A 3W4RA 4ZENA 3K8KA 2OWWA 1V3KA 3WMBA 6TAAA 4TXEA 2UY2A 1C8QA 5D9OA 1GNXA 4UNIA 3EDDA 1UKQA 1UWQA 1OINA 1J0IA 4UFHA 2E0PA 3AIWA 3EDJA 2NT0A 3IJ9A 1GZJA 2WYSA 2WM0A 4OUEA 2VI0A 1M04A 3HMCA 3SUTA 3ZMRA 3DC0A 1DWAM 4LX4A 5FOOA 3SCPA 5A69A 3MANA 2BV9A 2WW5A 3AIBA 4HA3A 4UOQA 3BGAA 1EH9A 1JNEA 4QLJA 1DHKA 1KFWA 1HKKA 1E4IA 2BS9A 3OZPA 4BS0A 4ACZB 4UFMA 1KBKA 3PZVA 3WL0A 1UWIA 1DTUA 2WLYA 1CGWA 2A3HA 3WDHA 1XSKA 1CXLA 4ACYA 4BQ4A 3T0AA 4C7FA 2G4FA 1MQRA 1EHAA 2PWFA 2CYGA 1FFQA 4OJYA 4AD0A 1ZU8A 2EPMX 5D9NA 5DF0A 1GOQA 3CZJA 3GDBA 1PZ2A 4Q7NA 3OG2A 5KEZA 3CMJA 5A6KA 4B16A 1BHGA 1HJSA 1R85A 3L4YA 4W84A 3N18A 3RIKA 2Z1KA 2ZX8A 5C70A 2WWDA 1BGGA 3VOCA 3CUHA 3VM7A 3F5KA 1B31A 3AOFA 5FCZA 4OBSA 1G9HA 5CSYA 1KWGA 2YBTA 4YHGA 1H41A 1UD8A 3QHOA 1E15A 2FGLA 5A2AA 2XG9A 1B1YA 1XSJA 1TVPA 1WDSA 3U57A 2DT3A 3SCTA 5DT7A 5A3HA 1V0NA 1TE1A 1YQ2A 1SMAA 5I6SA 3QGVA 1JZ5A 1UA7A 4AD1A 3N17A 3PN8A 4GPNA 4BF7A 5TD4A 1MVYA 1WAWA 1TFVA 2ZIDA 4BA0A 4ZE5A 4HU0A 4AZ7A 1EOMA 4ATLA 4UQDA 1JAKA 4AXNA 2AOSA 2NSXA 1PAMA 4CUCA 2YDQA 1O6IA 2UY3A 4BQ5A 1QW9A 3BLPX 2F8QA 3VTRA 5JBEA 1HKJA 3MKKA 3WQ5A 3HJEA 1WZAA 1XCWA 2YA1A 4TVCA 1EXPA 5AC5A 3EMCA 1GHRA 2XVPA 2FHFA 3WD3A 1AQMA 4UQCA 5E0CA 2E9BA 3CZLA 3SCUA 4MTVA 1FOBA 1WCGA 4J3SA 4TTGA 4KGLA 2VZTA 3ZJ8A 2ZXQA 3WNNA 4LYRA 3DECA 1MFVA 5A6BA 1UD5A 3WY1A 4U3CA 4FLOA 3POCA 5M3WA 2WMJA 2CBIA 3DYPA 2Y2WA 2G41A 1I1WA 3ARYA 4UCFA 2XIBA 2V3GA 1KGUA 5CGTA 4QAWA 1E73M 1US3A 2W92A 4AIEA 2WBKA 4JFSA 1VBRA 1NARA 1HVXA 4ATDA 3K1DA 1GVYA 3G6MA 3ZM8A 5A8PA 1CGXA 1GPFA 3WBAA 4AEEA 2D2OA 2DGAA 1HKIA 2JFEX 4KRUA 1CIUA 3L4UA 5JIPA 3T2PA 1J0JA 2YOCA 5M17A 1MXDA 2EPKX 4PCTA 3PZTA 2V5CA 1UH3A 2O9TA 5CG0A 2FGZA 4U5KA 3W29A 1A3HA 4U3AA 4C7DA 1KXHA 5I78A 3ZOAA 3TTQA 2UWFA 3VUPA 1G5AA 3WMSA 2XTKA 3SEPA 1S46A 2V5DA 3CUGA 1HP4A 5CPSA 2BVYA 5GNXA 2CHOA 1E6PA 3PBGA 1B3ZA 2YLAA 4W89A 2BHUA 2O9PA 1BG9A 2CKSA 4CCEA 4B3LA 4W8AA 2VC9A 3WF0A 4QCFA 3F5JA 2J8FA 3OLDA 4AZIA 1ZBKA 5A1AA 1QI4A 1UD6A 1L8NA 1QPKA 4NRSA 3AIRA 4X0VA 2D3LA 3FXYA 1U30A 1UR0A 1W9DM 3T0DA 1H5VA 1EA9C 4AC1X 3L2LA 4JFTA 3ARVA 4CD5A 2C0HA 4PMUA 3WNKA 1ZJAA 1NOFA 3OLGA 1QNSA 2VT0A 4LPCA 1EDGA 1N82A 1V3LA 3NDYA 1JDAA 2JF6A 4LYPA 5ABFB 2C7FA 4GI6A 4AZ6A 1ECEA 2G3NA 5I23A 3VMPA 4PMZA 2BVTA 5E09A 3WMCA 3EBVA 5C71A 3GM8A 4P7QA 5IFTA 5IFPA 5A95A 4AD3A 2QPSA 3AHVA 3ZR6A 2J7DA 5HDRA 1MW2A 2QMJA 1H0IA 3ARSA 5HPOA 2A3CA 4TVDA 5BYWA 1V02E 3L2MA 1QVBA 5FL0A 1B30A 4GI9A 2MANA 1E4NA 5LA1A 3VIMA 1GQLA 2XWEA 1GQKA 2J7FA 3VX1A 3FHAA 1MW0A 2NT1A 1JAEA 1B3YA 4M24A 1B3VA 1WZKA 4H04A 1C93A 1C7TA 2PWHA 3II1A 1K6AA 2GDUA 3PTMA 1V0MA 3UESA 3DYOA 1V6XA 3BXWA 1PIFA 5FD0A 4AD2A 2CBJA 4XZBA 1WP6A 1E0XA 3ZO9A 4A3YA 3LPOA 2VRKA 2XIIA 2DH3A 2GVYA 4YN5A 2O9RA 3VIPA 5EFFA 1CWYA 1E9LA 2WBGA 2IXUA 3CPUA 3JUGA 1ODZA 3GYCA 3TTOA 4GZJA 3VD3A 2EEXA 4Q22A 2XSAA 3SCWA 1Q6DA 1EQPA 2Y8VA 5CZKA 1W3KA 3TTYA 9CGTA 3OGVA 2DIJA 1W2VA 3GH5A 4AW7A 2XJ7A 3M6DA 1EOKA 2DEPA 4HA4A 5DEZA 3ARXA 3WH8A 1V3MA 3UETA 1G1YA 6CGTA 1OCQA 1KR0A 3RJXA 4B9YA 1WZLA 1NOWA 2EXOA 4OOZA 1V6UA 2YL5A 4PTMA 3BAJA 1UZ1A 4PMNA 1D3CA 3W26A 3AQUA 1CZ1A 2G8ZA 1CXIA 4JL2A 1A47A 5AC4A 1Q6FA 3BAYA 3GTNA 5E0FA 2YLLA 4H8UA 3AYRA 2ESCA 2G3MA 3VD7A 4AD4A 2EQDA 2BY2A 3TONA 4M82A 5CXPA 3UG5A 1JFHA 4HOWA 2YDRA 3CZGA 1M01A 1BLIA 3UEQA 1V08A 3WEZA 4BZYA 3PZUA 1Y7VA 2GUYA 4E4PA 1XCXA 1LLOA 2JF7A 1XHGA 5D9MA 4FMVA 4J3WA 4PBGA 1E6RA 4DWSA 2ZUMA 4D1JA 1H3GA 3WH5A 3SUWA 5LYRA 3BAWA 1E1FA 4MDPA 1V0KA 1OGGA 4QLKA 5DT5A 1CXKA 4QCEA 5I77A 3DYMA 1R7AA 1KB3A 1JDCA 2VZOA 1JD9A 3AXXA 4OZOA 1BGAA 1E0WA 4JKKA 4W85A 1UH4A 3WDQA 1OD8A 3RMEA 1KXQA 4S3KA 3AISA 3GH7A 4L4PA 3QHNA 3EDFA 2J78A 1OT1A 2QMKA 3AJ7A 4BCEA 2PBOA 3K4AA 2OWCA 4UZUA 1SFSA 3IAQA 3MV11 1LG2A 3GBEA 1CECA 2W62A 3WF2A 2WVTA 4PMYA 3A4AA 1K9FA 3WUFA 3SCNA 4UQEA 2ZUSA 2WZHA 1ITXA 2X1IA 4K68A 2OSXA 2XUCA 4ZFMA 4S3JA 2OYLA 3J7HA 2W5FA 4AISA 2X0YA 4NI3A 4KH2A 2V38A 1LL7A 2Y24A 1AQ0A 1C90A 1PZ3A 2FDMA 1UUQA 1GOWA 1PJ9A 1CGTA 1J18A 1JFXA 1OB0A 1U2YA 3WNPA 1BG4A 1XH1A 5FIPA 4AWEA 8CGTA 1K9DA 2AMGA 1HL8A 2J8GA 1V3IA 3BSGA 4UTFA 4HPGA 3ECQA 3MO4A 4D72A 3UG3A 3AHTA 2XFYA 3AYSA 2WK2A 3NSXA 3SURA 4ZE4A 3W82A 4W8BA 1H1NA 3CHFA 2D1ZA 1KXTA 3M7SA 4V27A 3OGSA 6A3HA 3O9NA 5CQ1A 1B2YA 1BTCA 2YDSA 2XHYA 4WK9A 3W37A 1VFFA 1QOXA 2EPOA 4D6CA 4MJ4A 4AZGA 4HZ8A 1LL6A 5BCAA 4FF5A 3VDAA 4TTUA 3WNOA 1CPUA 1VENA 3WDPP 1EQCA 3RM4A 3VIKA 3WD1A 1VRXA 1UR1A 2WCAA 2W61A 3T0BA 2GJRA 2ZXAA 3PTQA 3AS2A 1HKMA 4PMVA 1MW3A 1GW1A 5DMYA 2OYKA 1MQPA 4GKLA 3ARWA 3CLWA 3CO4A 3WDRA 3WIJA 3PZGA 1M7XA 1MQQA 2BY0A 3U5YA 2WHMA 4H8VA 2VMFA 2VX6A 4CCDA 2D22A 2VJXA 1WDRA 2GK1A 2WHKA 3WEMA 4W7UA 2RGMA 4D6FA 1WZMA 2WKGA 4QDMA 4J3TA 2X2YA 2VRQA 4HZ6A 3ARPA 1WPCA 2W63A 4J27A 1V0LA 2ZXDA 3O6AA 2J7HA 4CU8A 1BVNP 4CU7A 5BXTA 4AIOA 3EDEA 2CIPA 1WDPA 2D20A 3MSDA 3VU2A 2CESA 1CXEA 3MMDA 3AHYA 5A8NA 4MB3A 2DIEA 5BRPA 3AIUA 4JKLA 4WKFA 1DWGM 1G94A 4OBRA 3OLEA 3AIQA 4DUVA 4J3XA 4GQRA 4DM1A 4J3UA 1K9EA 4C7GA 1UD2A 2VCAA 1M53A 3FY1A 1XH2A 1TA3A 4HA1A 4V28A 5HBFA 4ZEPA 3L4WA 1BYCA 3DHUA 1DWHM 5EMYA 1VFMA 3WUGA 3CH9A 2Y8KA 4AIUA 3ALFA 3VNZA 1TR1A 1OBAA 3SCVA 5FKYA 4MAVA 1QI0A 2OSYA 4M80A 4ZXLA 3FHQA 3VIHA 4MB1A 4D71A 3AZRA 3GNOA 4H8HA 1V03A 4MDOA 1E72M 2DSWA 2VOTA 4IISA 3WQ8A 1FP9A 4PSPA 3QR3A 5LA0A 1YHTA 3N1AA 3D5HA 1JNDA 2DSZA 3N11A 2WZIA 1B9ZA 3BH4A 4JAWA 1C8YA 2BY1A 1W9VA 4U5IA 1CEOA 2XVGA 2PWDA 2PB1A 2E8YA 4HMCA 2XVLA 1BSIA 5IDIA 3QOMA 2PI6A 3S6TA 4B3KA 4LGXA 1PPIA 1NWUA 2WAGA 1I75A 1IV8A 4UQBA 3KL5A 1OGSA 2V3DA 4PMOA 1EHNA 3FAWA 1EGZA 1H49A 1BYBA 2FHCA 2GJXA 3VDCA 5BXSA 1ZBCA 1CLVA 1JZ2A 1B3WA 2XYLA 3WL1A 2O9OA 2HISA 1XH0A 3CBWA 3AFBA 3MS8A 1XGZA 4CVWA 1TZ7A 1UA3A 1QNRA 4JFUA 2DSVA 2OLHA 3KL0A 5CPQA 2ZWZA 1HJQA 2E9MA 1KQZA 1ZJBA 2VL4A 4NRRA 1TCMA 2JIEA 2W66A 3VDBA 3K8LA 1UKTA 3K46A 3VIIA 4PN2A 1SMDA 4AZCA 3W81A 4AZ5A 4CD8A 4D6JA 3SUSA 1BFNA 4Z2KA 3PZOA 2JIWA 1J01A 2PC8A 1BAGA 4CCCA 4HU8A 1UD4A 3GXIA 3CZKA 4N0RA 1I1XA 2Y5EA 1MW1A 4DWSB 3U7VA 1VF8A 1JXKA 1GQIA 4W5UA 3POHA 4PMQA 1NH6A 4H7VA 3MUAA 3CIVA 3BSHA 1CGUA 1KQYA 3M07A 1ODUA 3QHMA 2BXZA 1HP5A 1QBAA 5E9AA 3EMQA 4F9JA 1XYFA 4DUWA 1XSIA 3L4XA 3L4VA 4EANA 4FLRA 3K8MA 1E55A 1OGBA 2WSPA 2YA2A 2QF8A 5ABGA 5A6BD 3BCFA 2X8RA 4W88A 4TOQA 5A8MA 2ZOXA 1EDTA 1XC6A 1Q6CA 3N04A 2W67A 1W2PA 2XM1A 1TVNA 1H0GA 1PIGA 4DUXA 2J7GA 1FHDA 1VFOA 1ISVA 2VQTA 3RM9A 3I3DA 3WD2A 3KZSA 2VR5A 1HJVA 1RD6A 4B9ZA 3VD9A 3D3AA 1GOOA 4GIAA 1UWTA 1E6ZA 3WN6A 3ZT6A 1TMQA 3KEHA 2VVSA 1JIBA 1E3ZA 3LPPA 1Q4NX 3O2LA 3OIHA 3WF3A 3GXDA 1E43A 5KZ6A 1WE5A 1E6NA 4LQ1A 1HNYA 2CEQA 3NJ3A 3W53A 1CBGA 2J4GA 2WCGA 2A3BA 4B15A 3BC9A 3EDKA 1KWKA 2E3ZA 4N42A 4XV0A 4KRTA 4CN1A 1JZ3A 4WKAA 1JDDA 3EYPA 3THDA 4D6DA 5IHRA 3AICA 2VCBA 3OA5A 4DM2A 1WNOA 2UY4A 4ML4A 3MUY1 2DT0A 2WXDM 5BXPA 1ESWA 2JALA 4GO8A 4WF7A 1GQJA 3GH4A 4WSJA 4PMDA 4Y7EA 2O92A 2DDXA 4IM4A 1PX4A 4GQQA 1PX3A 1LWHA 3UG4A 5I5RA 1JL8A 1UWUA 2F2HA 3AIEA 2X0HA 1W3HA 1HN1A 3I3BA 4E2OA 1VFUA 3BCDA 1G0CA 1W32A 4PTVA 4RE2A 3BMWA 1JZ4A 4P7LA 4CU6A 5JBFA 4PTWA 1JZ7A 1WB0A 1DP0A 3IANA 2WC3A 5A6MA 4M29A 4PMXA 1V6YA 2Z1SA 5A6SA 1QHOA 3W6LA 1NWRA 3SCOA 1LQ0A 1QHZA 3NIYA 2GK1B 2YBUA 1VJZA 2DT2A 4WKHA 2WMFA 2ZE0A 3AMGA 3CUFA 4W86A 3A47A 5AY7A 1ZBVA 5BWFA 4JFWA 3A6OA 3W6MA 4MJ2A 5LA2A 1QNPA 2YIHA 2B31A 1GOKA 1W9BM 2ZX9A 4XUYA 1XRVA 3IK2A 1NWTA 1V3JA 2WVVA 2D23A 3N12A 4IPLA 3WUBA 1OM0A 2J74A 1RH9A 3VIGA 1HJXA 1BPLB 2XGIA 3RM8A 3AXHA 1ISYA 2E9LA 1KGWA 3LPFA 1KR1A 3AROA 5CSUA 1JXJA 2CITA 3FNDA 3GXFA 4F8XA 4WJXA 3AMDA 1H09A 2VX4A 2QPUA 1TA3B 3BLKA 1W1YA 2BFGA 1HT6A 3AZSA 2ZUWA 5AYBA 2F61A 1W3LA 4UOJA 2GSJA 2EPNA 2XVNA 1OIFA 4UQ9A 4WIWA 4UZSA 1JG9A 1P6WA 2ZUTA 3LMYA 5A8OA 1HVQA 4PUDA 1QI2A 3SCQA 3UR7A 1E0VA 3WQWA 3ARZA 3GXMA 1FA2A 3CUJA 2WPGA 4P8VA 3ZSSA 1E6QM 2QV4A 1D2KA 4TVUA 3RDKA 4EE9A 5C8BB 3AZTA 1E56A 4AYSA 5CPTA 4W93A 5CLTA 4NZCA 3VMOA 5HOSA 4HOZA 4QFUA 4ATWA 3A3HA 1NP0A 4M81A 1CXFA 2J75A 3SCSA 2WLZA 4KMQA 5CGMA 4AMCA 4RL3A 2BHZA 4E8DA 1EDQA 4W7WA 3KWXA 1MXGA 1KBBA 4U31A 8A3HA 5A6LA 1XD1A 2WHJA 1JZ8A 1OIMA 2J77A 4D1IA 1UD3A 1IZJA 3WUEA 2J7CA 4FLSA 2FH6A 4GZIA 1XYZA 3RCNA 3CTTA 1J11A 2ZXBA 4IPNB 2E8ZA 1QHPA 3AIVA 2GJXB 4TUFA 4CGTA 1E40A 3B9DA 1SR0A 1HX0A 3PZIA 1GHSA 4RE3A 5IXEA 4R5EA 1JZ6A 3U5UA 4CKQA 1F4HA 1B0IA 1V6VA 4U33A 1V6WA 1OT2A 1Q6GA 5BXRA 1C91A 3CGTA 4TX8A 4HOXA 2J25A 2Q8XA 2XFRA 3PZMA 2J79A 3UERA 1W1PA 5EFDA 3RO8A 1NQ6A 1GCYA 4L4OA 4P8WA 4WLCA 3CMGA 1RP9A 1QI3A 4DWSD 2DT1A 2D0HA 4PTXA 1NWSA 1MFUA 4M56A 4JHZA 3VGDA 5GPRA 4BQ3A 1X6NA 4W87A 4URIA 1UR4A 5I79A 5DFAA 4TX6A 2VTFA 3PTKA 3F5LA 1R8LA 3MUIA 3ARRA 4JFVA 3F4VA 3WQVA 2VUYA 1BVZA 2WC4A 3WQ4A 2ZX6A 1J12A 1US2A 4AZCB 1CGVA 4EAMA 1EIBA 2WMIA 5A6AA 4J3VA 2WSKA 1C7SA 3MU7A 3NSMA 2YKKA 1V3HA 2W4XA 4D6EA 2FH8A 1JI2A 2AAAA 3VDHA 2JE8A 2XM2A 2G3JA 4PEEA 1O7AA 2IUZA 1UQYA 3VMNA 4Z2GA 3THCA 3APGA 4NF7A 1MWOA 4Z2HA 5BRQA 4NSBA 5BROA 2VRJA 3ARUA 5A94A 2VVNA 5ABEA 1SYTA 4JZ5A 3T08A 1WO2A 1E3XA 4W7VA 1LL4A 1DEDA 2ZUVA 3VIFA 4W5ZA 4A4AA 3WQ6A 5E6YA 1FH9A 2VX5A 4PUEA 2ZWYA 4W8LA 1BQCA 4OIFA 3IJ7A 1FHLA 1DWIM 3KL3A 1R86A 5M5DA 4A3HA 5ABHA 3TP4A 5A2CA 1GOIA 1UH2A 5I2UA 3BAXA 1BYDA 1LWJA 5EB8A 1E70M 1GJWA 2QLYA 3VVGA 3WFLA 1JYNA 1UKOA 2WZEA 4GINA 3K4DA 1W1TA 3WF1A 1J9YA 4MNKA 2WMKA 1WDQA 1R87A 2XFFA 3AHZA 1IZKA 3AXIA 3RJYA 2WNWA 2DPEA 3FN9A 4UFJA 3W24A 4U2ZA 5ECUA 4P8UA 1W9PA 3CUIA 1ISXA 2E4TA 1AMYA 4PCSA 4P8XA 2TAAA 3VGHA 3VGEA 1LF1A 3B8SA 2YL6A 3BAIA 5DO8A 4Z2IA 4M1RA 4Z2JA 2VNCA 3AHXA 2CETA 3N13A 1H11A 1TUXA 2G3IA 5GNZA 1L0PA 4CD7A 5I0DA 4M8UA 7TAAA 2GFTA 2V3EA 3NYDA 4XB3A 1W1VA 3B9EA 2ZUNA 1LG1A 4PRWA 3N9KA 4JHOA 3AMCA 4V2XA 4KGJA 2WVSA 1KCKA 1TG7A 4HTYA 1XV8A 7CGTA 3FAXA 4BQ2A 1QI5A 1HL9A 3B9AA 1OWQA 2JEQA 2YJQA 5A6JA 1FH7A 1UR9A 4CVUA 2CKRA 1OSEA 4YHEA 4ZXOA 4MADA 1W3JA 3VINA 2WVUA 2GJPA 1FFRA 1H2JA 4F79A 3TTSA 3WSUA 2DSKA 2UY5A 3WD0A 4HZ7A 3HN3A 3OLIA 3T2OA 4MNLA 3KE0A 4CN6A 1VEMA 3VGGA 2VR4A 1FP8A 3NUKA 3ZT7A 1CNVA 1UHVA
chains in the Genus database with same CATH superfamily
1NY1A 1JYVA 2DIKA 2J7EA 4MIMA 4FLQA 3A24A 5BU9A 1HFBA 3EX1A 2C1HA 2FB3A 1OG0A 3A13A 1B4KA 4HNLA 4LVGA 2PWGA 3M47A 1W91A 1KGXA 3E0LA 4XD6A 3WH9A 1CXHA 4A6GA 4MAZA 2YYTA 3ZWSA 3FSUA 2RGLA 4I5UA 4ALDA 2CBUA 1R3QA 3H70A 2NLIA 2OEMA 3GNDA 1D3GA 3WZ0E 1UCWA 3KZPA 3MWCA 3VGFA 1A5SA 5CC3A 1UOKA 3FEQA 4JTKA 1LOLA 1ZP3A 4GI8A 1G7VA 2VFEA 4QNEA 3ZR5A 3ARQA 3VPLA 5I00A 4DPQA 2WB5A 4NQ1A 1EXBA 5HNNA 2D2GA 4ZFCA 3I4KA 1LJYA 1NOUA 5F4WA 3VFCA 4IMCA 1HGWA 3FW6A 3PNZA 2I5GA 3TW9A 4FHAA 3VKKA 2V5KA 1YE4A 3ITGA 1TTIA 1UASA 3IIVA 3EXSA 3PZQA 3UJSA 4M0XA 2DQXA 1E6SM 2W91A 1B54A 1E5JA 1LDCA 3R11A 3S1GA 1BXNA 4JIIX 4UOZA 3K4WA 4ZTXA 4C91A 2EPLX 1HJWA 5FAGA 4K37A 4Y8EA 3TLQA 2DH2A 2EJ1A 4UTWC 3OBKA 2YCKX 1PYFA 2CHRA 3H26A 2ZX5A 2CCRA 1EX1A 4BEQA 2ATMA 4XSLA 4HP5A 4JL1A 1E4MM 3P93A 4I7WA 4C65A 1ZRQA 2J47A 4LAZA 3F4WA 1OG6A 1W9XA 3T55A 3W27A 1DWFM 2F2KA 1E5NA 3WJZA 3GHUA 3VNIA 2NQ9A 4IMFA 2FMOA 2QIWA 3V16A 2ZX7A 1U5VA 2Y4SA 1W54A 1ZAHA 1OFEA 4XBJA 3S5NA 5CC6A 4G7EA 3NDZA 2GUUA 1VIWA 4UR9A 1OZQA 2FPYA 4OUIA 4P7RA 3AALA 4G5DA 1W3TA 2Z1WA 5MKGB 5I3KA 4UTHA 1FDZA 4Q8TA 7XIMA 4B4FA 2GVLA 4WY0B 5I24A 4JGDA 1FCVA 4JD4A 3P81A 3NQAA 4S2CA 4GYKA 5A8QA 4JX4A 4GO9A 2ISWA 3PG8A 4RDVA 5AHLA 1QNQA 1XGDA 3MSYA 3NCOA 3OVPA 1J2BA 2WMIB 4R9XA 3DG6A 2ZZ1A 3OJGA 3R10A 1RP8A 2NV2A 4K8GA 3U8GA 2BNJA 1PHQA 1JF5A 1OCJA 4P7OA 3WBEA 3WKZA 3KVJA 1CYGA 3DG7A 2ZE3A 4LCSA 3S5OA 4JDYA 4FOKA 5E70A 4LVBA 1PV8A 1XYMA 1W1ZA 1X38A 2XH4A 3BICA 3RCYA 2R91A 4AY1A 4IQDA 2X30A 5CPNA 3TH6A 4R27A 1DJYA 3R0UA 1KCLA 3DFQA 1CX9A 2OKTA 2PP0A 1YDNA 1HO4A 2NVCA 2GSHA 4JCLA 3RF9A 4AF0A 3OOQA 1N2VA 5HAOA 2YL8A 1C8XA 3PB0A 1EJ7L 4C5YA 3TZFA 3OZOA 3WH7A 3LLXA 3CEUA 2CPUA 3L4ZA 3WQOA 3NO5A 1UKPA 1UJPA 3A4WA 3A4XA 3LPGA 1IR1A 4AZBA 3DBNA 3MMUA 4L6HA 2Z6IA 4BK9A 3VO0A 2W0UA 4PRRA 4F9DA 3RITA 5HXMA 3UR8A 3ZT5A 1JRCA 2VD8A 4TX9A 1JI1A 4HB7A 3ITTA 1WOBA 3KX6A 5E6ZA 4B5XA 4Z2LA 2PTXA 4NJIA 4ADSA 3QTPA 3CQJA 1KFBA 3BAKA 2D2HA 3WCZA 1B3XA 4PUMA 1DL3A 2G50A 3ZJ7A 3F2CA 4ZO8A 3QC0A 5EMUA 3UY8A 5JU6A 4S3DA 2V2HA 1ADDA 4WJ8A 3W71A 2DFAA 4H9TA 2V30A 3KTSA 1ENUA 1NAL1 2BVDA 1W37A 1TQJA 2AL1A 1KTBA 1TE6A 1K7FA 3ZWTA 3CV6A 1VRDA 1CLXA 5HPCA 4JIRA 2NXHA 4S3BA 4QLLA 3TW7A 4X0NA 2E40A 1K6WA 4DYJA 3UBPC 5CZTA 2ZYFA 1RZMA 2VZSA 4OT7A 4C1LA 3A22A 3AMKA 3SW6A 1X1NA 2V67A 4H41A 2ZUUA 5D05A 2VZUA 3PZ9A 3QFEA 3PBMA 3NL5A 4ZENA 3HMJG 3K8KA 3UWEA 1V3KA 3WG6A 1HW6A 3KAOA 2BOFX 4GH3A 1K8ZA 4UNIA 3TOYA 1UWQA 1OINA 4NZ3A 3DX5A 5I09A 1J0IA 5KSWA 2QQ6A 3PTDA 4PRTA 1GZJA 3O16A 4O8AA 5DELA 4P61A 2PPGA 5HQLA 2WYSA 4GCXA 1M04A 2ZRWA 3ZLFA 2HS8A 1DWAM 1U5HA 4LX4A 5FOOA 1F73A 4L61A 3ZLHA 1KM0A 4OBTA 3LHVA 4O4VA 3URBA 1YBQB 3DFYA 3NL6A 4X63A 2HXUA 5EL1A 2J6VA 4IL0A 3E6EA 3ZLGA 1DTUA 4HIBA 4M51A 3C2VA 1GTEA 1XSKA 4ACYA 4BQ4A 3QPZA 4C7FA 2G4FA 3SBFA 3WLHA 3BLDA 2CYGA 3E2SA 4KS0A 3BANA 2GQ9A 2V69A 5EPDA 3N4FA 3NQMA 3N19B 5A6KA 1HJSA 1R85A 4GWEA 3N6JA 5LIKX 2WWDA 3CUHA 3UGVA 3SQLA 1K02A 1TTJA 4OBSA 1PCWA 3GFYA 4YHGA 2Y7GA 1UD8A 3O6YX 5HANA 1B1YA 3BE7A 4ZQPA 3HV9A 4IZGA 5A3HA 1R2TA 1V0NA 1XDMA 4O17A 1ZSXA 4OWGA 3N17A 2YXGA 4GPNA 4O1AA 3F2BA 2Z2AA 4Y8FA 1WAWA 2P1FA 4UQDA 1JAKA 3F2DA 3QSRA 2AOSA 1PAMA 1O6IA 2F8QA 1HKJA 4L56A 1EJTC 3HJEA 3UWZA 1WZAA 1XCWA 5AC5A 3EMCA 1GHRA 3ME3A 5D38A 2XVPA 1M7JA 4UQCA 5E0CA 1G7UA 1B57A 3TYDA 3CZLA 4JTSA 1WCGA 2OLSA 3QSTA 1OFBA 4LYRA 2PDLA 1MFVA 2YW3A 2INZA 2PUZA 3S6DA 4RDYA 1R3SA 4OE7A 3P5YA 3WK2A 2G41A 2J9ZA 2PWVA 1KRCC 2V2DA 3QMTA 2XIBA 4HYVA 4GKTA 4LS0A 4DLFA 1XINA 2XN0A 5CGTA 2QYGA 1E73M 1G69A 1JCMP 4UWMA 2WBKA 5GJNA 4JFSA 1NARA 3KLKA 3NOEA 3FDGA 4Q8WA 3N73A 4DJDD 2QVHA 1GVYA 4Y90A 1BWKA 3G6MA 5MHBA 4W4QA 1BTMA 1R3WA 3IJDA 4YTRA 4Z08A 3WBAA 5I3HA 1TJRA 3A23A 3GG1A 2JFEX 1JGMA 3L4UA 3T2PA 2YOCA 5M17A 1MXDA 1CB2A 2ICSA 2EPKX 4ZODA 4IFKA 3PY2A 3BJSA 3DBPA 2DZWA 2O9TA 5K7JA 4U5KA 3OYZA 4H6RA 2QAPA 5AKQA 2UWFA 1QFEA 3NPUA 3WMSA 3R94A 2WOQA 3STEA 3MHUA 3SGGA 2E6AA 4JQ4A 2V5DA 1HP4A 3FJLA 2PDWA 3PBGA 3HPFA 2PTZA 2DY3A 5G1TA 2INFA 4TV6A 1D8CA 4NAFA 4W8AA 1VPYA 2ZADA 3UWYA 3WLMA 2J8FA 3OLDA 3WLIA 3R6IA 5FJUA 3WK1A 3B0VC 1LQAA 3VKBA 1UD6A 4HMNA 3H7VA 3WJSA 3LYEA 3DOPA 3HJZA 3SJ3A 4AC1X 1A5BA 1PL9A 3KS6A 3CO8A 3OZMA 3NQCA 3QLLA 5CSSA 1M3UA 4F0KA 2E7FA 3ZVHB 5F1VA 4AHPA 1NOFA 3OLGA 1QATA 3G1AA 3NDYA 1EP2A 4LYPA 5ABFB 4AZ6A 3ELFA 1ECEA 2YYUA 3GC5A 1YDVA 4Z1CA 3VMPA 2BVTA 3GKFA 5E09A 4IIDA 3KBWA 1JCXA 3AHVA 3OW1A 1H0IA 3ARSA 3PSVA 1QVBA 5FL0A 1B30A 3EWCA 2AL2A 1E4NA 3ZZ1A 5LA1A 2XWEA 1GQKA 4AU0A 1AW2A 3O15A 2NT1A 3KCOA 5XINA 4EPDC 3TQKA 3TC6A 1WYIA 3ZXWA 2PWHA 2XIJA 3CV2A 3V35A 4V1XA 1V0MA 3UESA 1PIFA 2DUAA 4DX3A 2CBJA 4INFA 2Z28A 4A3YA 4NIRA 4YN5A 1SFLA 3M0XA 3NPVA 3JUGA 2PTDA 5K9CA 5LNWA 3LRLA 1FUYA 4GZJA 3VD3A 2EEXA 5F1UA 1EQPA 1W3KA 3VZYA 9CGTA 3OGVA 4Z1YA 5D03A 3W7OA 3UJ2A 2ZQ0A 4AW7A 1K4HA 1S5TA 5IM51 1EOKA 4B4HA 2DEPA 4CQ8A 3TMLA 2PMQA 5AHEA 1DQXA 5DEZA 1B9BA 6XIMA 2GVJA 4XZLX 3UETA 1G1YA 2PURA 3IJ6A 2W3ZA 4I9MA 3C2FA 3UJEA 1ZJIA 4OOZA 2XSXA 4PTMA 1GYNA 3W26A 3Q2DA 4JL2A 5CBIA 2DZAA 4GVHA 1Q6FA 4FPSA 2YLLA 2XN2A 4EVZA 2RFGA 3CEPA 4DXVA 2G3MA 3CC1A 1K77A 4AD4A 2EQDA 2BY2A 4GVGA 3CZGA 1R3YA 1PCKA 3LMZA 1T8XA 4MWAD 4QG8A 5H8UA 4I5RA 5D9MA 3O07A 4FMVA 2DUZA 4F2TA 2DORA 2O7SA 3W1NA 3WH5A 2FIQA 1E1FA 3BAWA 1S2WA 1OGGA 3TC7A 1CXKA 1OCBA 3UZYA 4CEXC 2YW4A 4HPJA 3VFLA 1JD9A 3AXXA 5CPOA 1FVPA 1EJRC 5LHEA 4Q4OA 1KXQA 1TPFA 1O1ZA 3AISA 3M5VA 4L4PA 3BO9A 3EDFA 3VCCA 4PL2A 2PDXA 3M16A 4IIBA 4G56A 3K4AA 3EWXA 3FOKA 2OWCA 4DLMA 3R8GA 3MV11 1LG2A 3S83A 2W62A 2WVTA 4MSSA 4RUBA 2PP3A 1K9FA 1VJIA 3WUFA 3O6CA 5J5DA 2ZUSA 3DESA 1QO2A 2QF7A 2X1IA 1AFSA 4K68A 1KLYA 2XUCA 3CK5A 1LORA 5HK4A 4KH2A 2AGTA 4JQAA 4QE5A 4GABA 2ZRZA 2Y24A 1C90A 4FNRA 3C3NA 2FDMA 1UUQA 1GOWA 1J18A 1U2YA 1BG4A 4IP5A 4E2VA 1K9DA 2X0SA 1V3IA 1W0MA 5CPLA 4HPGA 3T7VA 3WLRA 1NTHA 3BSMA 2RKXA 3AYSA 2ZRVA 3IIOA 3M64A 3VOIA 4RV3A 3LGGA 4W8BA 1HUVA 2HROA 7REQA 4QE4A 3KBMA 1PVNA 1KTNA 3TUUA 3O9NA 4MMWA 3GDRA 4NJHA 2NLYA 1BTCA 3ITYA 5D04C 3W37A 3OA3A 3GO2A 3GTIA 4MJ4A 4AZGA 4HZ8A 1YE6A 4FF5A 4TTUA 4LANA 4DY1A 1LLWA 4JTEA 4DYKA 5PTDA 2WCAA 2R8WA 4Z0SA 4EPKA 2WJDA 3NVTA 1HKMA 3E5PA 1NVMA 4ROQA 4O19A 5DMYA 3N9SA 2ACQA 4C6JA 3QBUA 4XD3A 3M0VA 1MQQA 3CS2A 1MDLA 3CAVA 4QR6A 6XIAA 1SM9A 3U5YA 3GVGA 1EUAA 4H8VA 2VJXA 4W7UA 2PAJA 3KDOA 1RV8A 1XRSA 3KBSA 4HZ6A 3IACA 1WPCA 4US6A 1AZ1A 4DO6A 2VYOA 4KFNA 1BVWA 4J27A 3T42A 3DG3A 4KBXA 2J7HA 4CU8A 4RNJA 2VDGA 2CIPA 4XZHA 4JIHA 2CESA 1CXEA 4MB3A 1ZJHA 4JX5A 3VOHA 1JCYA 4F4RA 1DWGM 3D6NA 3ANVA 4Q33A 3UPWA 4WX2A 3LI1A 4B5TA 4J3UA 4QM1A 1K9EA 1O95A 1M53A 1QW7A 3ANYA 3DFOA 3GXTA 1CLKA 5HJXA 3FYYA 4ZEPA 1PZ1A 1PS9A 1TV4A 3NQFA 4NNBA 2Y8KA 3WLKX 4MG4A 4LF1A 3SCVA 5H2ZA 3W7DA 4H8NA 2R1PA 4B5UA 5HINA 1X1ZA 1VYSX 3BZJA 3MBDA 4MDOA 4DNHA 3KLLA 3T07A 1WAUA 4H9UA 1DIOA 2X41A 1YHTA 2DZUA 3NPXA 4XISA 2CZEA 1JNDA 2OX4A 3PM6A 2DSZA 2QUNA 3WLJA 3BH4A 4JAWA 2BY1A 4YWSA 2PWDA 2QT3A 4CNUA 3KOWA 2XVLA 1BSIA 4C1NB 3S6TA 3R79A 4LGXA 1NWUA 1GVOA 1QWKA 3E0FA 3WYZA 3TE9A 1H1YA 1JRBA 2PLMA 3GNNA 5FI8A 3LY0A 1EGVA 1F6YA 3GU9A 5BXSA 2CW6A 2J88A 3W7PA 1X7FA 4HBKA 2P50A 3G18A 1KM2A 4Q8OA 3IV3A 2NX9A 3M5YA 1DVJA 2XYLA 3WL1A 7TIMA 3C86A 3WQEA 3AFBA 4XKYA 2FYMA 1OX4B 1I4NA 3B8TA 3VC6A 5MF5A 1Q7QA 1QNRA 4JFUA 2GGGA 3UNTA 2OLHA 3W1AA 1OF8A 4QXIA 4GI4A 4NXSA 1E9YB 1TCMA 4LSBA 2W66A 3U6WA 1SGJA 3AU6A 2OXNA 3DI1A 4AC7C 1SMDA 1ZLPA 4D6JA 1BFNA 1K8XA 1TREA 5HQEA 4Z2KA 3PZOA 2JIWA 2OELA 1BAGA 3I6TA 1XIJA 4XWUA 3CZKA 1I1XA 4HK7A 1AMKA 1JXKA 3H22A 3POHA 1NH6A 2C16A 3UGRA 1CGUA 1B3OA 1WUFA 1ODUA 1YXCA 3VOFA 1QTWA 2BXZA 3H4XA 4LBUA 1S38A 2PWUA 2HE8A 1S5NA 3KRUA 5E9AA 1XYFA 4UTTA 1A5KC 5AHNA 3MUXA 4FXRA 5TBOA 3T6CA 4MUPA 4J5NA 2WSPA 3CH0A 2YA2A 3MI3A 4HKPA 5ABGA 4MKVA 2CLKA 5A6BD 5B80A 4QDWA 4J2MA 3RCMA 2ZOXA 1XC6A 2BXVA 2E5DA 2XM1A 1NQKA 3FYPA 3RM9A 1W8GA 3WD2A 2P3ZA 2YXOA 4WRHA 1GOOA 5LSMA 2OTDA 1UWTA 1Y0EA 2A7RA 3ZT6A 1PDYA 1MEHA 3BMXA 3LPPA 4TO8A 4CEUC 3OIHA 3TKFA 5AZ1A 1BRLA 3LTSA 2CEQA 3W53A 3N6QA 2R9RA 1XLHA 3E2VA 2WCGA 2A3BA 2J6XA 3G0XA 3VOGA 3QW4B 1KKRA 4KRTA 1F07A 1JDDA 3HOJA 1RY0A 1XBVA 2D73A 5EMJA 3THDA 3K2GA 5IHRA 1WNOA 4ML4A 5C2XA 1RQHA 2WXDM 3FJ6A 5BXPA 1OABA 4L1GA 3V18A 5XIAA 2JALA 4GO8A 4WF7A 2W9MA 3GH4A 4JYEA 4Y7EA 2O92A 4L1WA 1YNYA 2DDXA 4IM4A 4GQQA 1LTDA 2SFPA 2V81A 3HIJA 3AIEA 4E2OA 4BF9A 2F38A 1I2PA 1W5NA 4RE2A 3W2KA 1Q8JA 1KM4A 1K03A 2NQZA 3ID7A 3RO6A 4PTWA 2QJMA 1DP0A 1ZY9A 1E0TA 4Q8NA 2EG6A 5A6SA 1V6YA 2Z1SA 4GOAA 4FNSA 1PUDA 1LQ0A 1HTIA 1SO5A 3IRDA 4H9YA 1YRRA 2ZE0A 3CUFA 4AY8A 4BI6A 4UXDA 5AY7A 4YVPA 5FF3A 4JIPA 1ZBVA 3WQDA 4JFWA 4IF2A 3W6MA 4MJ2A 5LA2A 2B31A 3RNDA 3OYXA 3TNOA 1XRVA 1NWTA 3UXIA 2WVVA 3N2BA 4WEVX 4IPLA 1RH9A 1BPLB 2XGIA 3RM8A 5JH1A 2PA6A 1ISYA 4EF9A 1SW7A 3UCDA 2A7NA 3P84A 3AROA 1E9ZB 1TIMA 1R3VA 4WJXA 1TA3B 3BLKA 1W1YA 1HT6A 3N4AA 3AZSA 1PWLA 2ZUWA 5G2IA 3W2LA 4UOJA 1JDEA 2EPNA 4JEQA 1JG9A 2OQHA 1P6WA 3VNDA 1QRQA 4NNCA 3TJ4A 3CWNA 2ZZ7A 3LMYA 4ORMA 5A8OA 3SCQA 2NUYA 4IX0A 1PDZA 4ADUA 4C6MA 3E12A 2Y1HA 1D2KA 3RUBL 3QY8A 3SN0A 2PDKA 1GVQA 4EE9A 5REQB 3NURA 1E56A 4UTWA 5CPTA 2OCZA 3VMOA 2WQDA 1I8JA 4ATWA 1VIZA 3A3HA 2VP8A 3MI2A 2OZ0A 4KWSA 3PAJA 3ZVHA 3SCSA 1P1XA 3VUSA 4JX6A 3KWXA 3DKJA 4U31A 3EZ4A 1X8CA 4JQ2A 1JZ8A 4XD5A 4R33A 3E9AA 4FLSA 3W1UA 1OYBA 4GZIA 1XYZA 2GQAA 2PDCA 3RCNA 4PTNA 4IP4A 1QHPA 1E40A 3O3RA 3UXDA 1XDLA 4O15A 5AHIA 5IXEA 1K4GA 2NQHA 4RV8A 4G2DA 1RK6A 4U33A 1VP5A 4DJFC 5LNVA 5K9XA 5BXRA 3KRZA 4TX8A 4HNUA 1XKJA 3EOUA 4HOXA 4H19A 2XFRA 1Q85A 3JZEA 5EFDA 4WLCA 3CMGA 3CWOX 1EC8A 1QI3A 4DWSD 3LCXA 4NYUA 4PTXA 4E6MA 3WK3A 4GJIA 9XIMA 1MFUA 2R94A 3A5FA 3VGDA 3S2JA 2PF8A 4JTGA 4TX6A 3PTKA 3R1ZA 1EB3A 1UC4A 2POZA 3MUIA 3F4VA 1BVZA 1BWLA 3O05A 1CGVA 4O8RA 4QQ3A 2Z1XA 2WSKA 1KNWA 3R13A 8RUCA 4QS6A 4NAEB 2QDEA 2E28A 2XM2A 2HE5A 4PEEA 1O7AA 4KEUA 3GHSA 4S3FA 3THCA 4NF7A 5FACA 4K1GA 4Z2HA 1J8VA 3TSMA 2PGFA 4K7YA 4NSBA 3L12A 2CXEA 2VVNA 3UW6A 1WO2A 1HZYA 2WZTA 4ZQCA 1LL4A 2ZUVA 4H9MA 2IQTA 1LCOA 3VIFA 2FGBA 4PBEA 3LEPA 4W5ZA 5E6YA 2ZWYA 1BQCA 2NUWA 4YVXA 1REQA 2QW5A 3B8IA 3IJ7A 1FHLA 1LLZA 1DWIM 3GDKA 4XBKA 1KM3A 5A2CA 4DJDA 1JCJA 1UH2A 1PXGA 1TIWA 3IV8A 5I2UA 5I3IA 3MC5A 3FLUA 3KWSA 4OVXA 2BOEX 3DZ1A 3IVUA 4A8NA 3GC4A 3WF1A 2Z7KA 1DIEA 2J27A 2WMKA 3HFTA 4R34A 4OV9A 3H2MA 3TN3A 4B5SA 5FF0A 3W24A 3GTFA 1YXYA 3CUIA 2Z2UA 4OECA 4PCSA 3CQIA 2TAAA 4J2PA 3HG4A 1XYCA 2GQ3A 4Z2IA 1A3XA 2CETA 1H11A 1TUXA 1L0PA 2OT1A 1KLZA 4CD7A 2PLCA 2V3EA 3R12A 3NYDA 4JR5A 2R24A 2E77A 3W7GA 3P62A 1DOSA 4JHOA 4V2XA 1JPDX 1TG7A 3OHMB 7CGTA 1K7XA 3UG8A 2P0OA 3URQA 4BQ2A 1AL8A 1JUEA 1CB7B 2Q71A 2JEQA 3B9AA 4LUJA 1MI3A 2B7QA 2UZ9A 3TW6A 2ODOA 5A8GA 4ZXOA 9XIAA 4MADA 1W3JA 1ITQA 4WZHA 2GJPA 3LA4A 1FFRA 2EHHA 4E0CA 4F79A 1UB3A 3WSUA 4YS1A 2DSKA 3WD0A 3A3WA 3OLIA 4MNLA 2B0MA 3HQOA 3NUKA 3B0PA 3E74A 4QRNA 3PHAA 3CB8A 3S2CA 3W72A 2DVTA 3IVSA 5AYIA 4KESA 1J0ZA 3TFXA 5F4SA 1KTCA 4RJEA 1TPUA 3A9BA 2X7VA 3R5EA 4AWTA 2FLIA 2R1NA 3RLVA 3I3EA 3VIOA 3CHEA 2X09A 3MMWA 4OKDA 4IJRA 4ZA0A 1A5UA 4GFSA 5FF4A 4UMBA 3SN1A 2J7BA 4ZGYA 2VO5A 4F0RA 1YLVA 2G96A 5I3DA 3H12A 1J0HA 1KFEA 1FH8A 3PWAA 4NILA 1U33A 3VIJA 3S47A 4IXXA 2BHYA 1PBGA 2YB1A 4MNJA 3LCFA 4K38A 3DHPA 3LRMA 4BJHA 5LNUA 3MSGA 3DUGA 4Y2WA 4FXFA 4ACZA 1DE6A 3HU7A 4U2YA 2DJLA 4PSRA 4S2BA 1KCXA 1MO0A 1ZB5A 1Q6EA 4O52A 2OFJA 1VQTA 5CJMA 1R3RA 4HNTA 3P0WA 4HTBA 3SZ8A 3OBEA 4KCWA 4M7SA 2GOKA 1DJWA 5J5RA 3I65A 2EKGA 4Z1AA 4L9ZA 1B5TA 3IK4A 1GGOA 1VEPA 3M46A 1EJUC 3BLEA 4RPQA 3BMVA 1P7TB 3VILA 2PBGA 1HJUA 4QJ3B 2FKPA 2IXVA 5GQBA 2JGQA 2PGEA 2YA0A 4PB4A 3FS2A 3SSJA 1ZCOA 4DWDA 4X2RA 1R3TA 1W5MA 1XFBA 2DZVA 4QG6A 5H8PA 3WQCA 1S2AA 3IS4A 3WO8A 3VGBA 1ZAIA 5AHMA 3VX0A 1RA0A 1EFZA 5AOUA 3A3XA 4AUBA 2FTWA 5IHSA 4MWAA 2PTYA 4LALA 3PR2A 1Z9AA 3UNDA 2PDGA 4Y96A 4IUOA 2BXYA 4WDUA 4KWUA 2HNEA 5C55A 1ZL1A 3S2MA 2WCSA 2J9XA 3N6HA 3SUVA 3VYLA 4AH7A 4PCPA 4YVVA 5M03A 3GNRA 4CD4A 3HFYA 2CNCA 1ONEA 4P7NA 8TIMA 4G6CA 5H1WA 3BW4A 1XS2A 4RKAA 1ZPTA 2Z29A 1DJNA 3GNPA 1UWSA 4GGHA 3UCQA 3Q4DA 5JIWA 1YX1A 3C0SA 2P0IA 5FL1A 1X6UA 3MB9A 5AVHA 2X05A 3QKZA 5D8WA 4B5WA 1AH4A 3LENA 4ZO9A 3T09A 3OBAA 1FQ0A 1ISWA 4O0KA 3WDIA 4YYFA 3ZSTA 4HMDA 3OQEA 2NX3A 1C92A 1YIXA 2WSQA 2V5BA 1E4LA 4NJGA 3W7LA 4D8ZA 1VEOA 1XIMA 5CJ5A 3NSNA 2CU0A 3EMZA 3WJWA 2HS6A 1XLDA 4IL2A 5J04A 3VD4A 3G6LA 1S5WA 2DUXA 4MUZA 3SI9A 2XISA 2VC5A 3G1RA 2ISSA 2C8NA 4D8LA 5D2VA 4O11A 2OZTA 4UFKA 5FJPA 2WJZA 5AN7A 4KKXA 3N2XA 4XZWA 1D3HA 2A5HA 2EO7A 3VD5A 2QHAA 1XYBA 4MLRA 4RE4A 2QVNA 4XO7A 2I56A 1MZRA 2H3BA 2J62A 3CZEA 1XLMA 3TXZA 4QBXA 2CHNA 3JS3A 3HF3A 4AD5A 2A3AA 2I7GA 1VBUA 1M5WA 5FJTA 1D8WA 4MPKA 4LAKA 4J28A 4QROA 3CV1A 3IRSA 5CGQA 5CLWA 1QPOA 2QCCA 3W38A 3WJXA 3TA9A 5CCZA 3BQ6A 1ITCA 3MVIA 4V33A 4FX7A 4CNTA 5AYXA 3VZZA 4LY4A 4Y9PA 5EBAA 3EOOA 5CEWA 3C8FA 2G97A 1EC9A 2CZFA 5IDZA 3CAKA 2TSYA 3LI0A 5D4YA 1XIBA 2WC7A 2OSWA 1RPKA 2OEJA 2VZVA 2YCLB 5KMYA 2WANA 3EAUA 1P0DA 1H4PA 4F66A 3MV01 2EBNA 3OGRA 5D9PA 2X42A 1TPEA 3HA1A 2CERA 4IH3A 3W84A 1DJGA 2YR1A 1UKSA 3W7HA 4QE1A 1IXPA 4HK6A 4UQAA 2Y85A 5A2BA 3JVAA 1S2TA 4MNMA 4WUIA 3W88A 4IIEA 4JHMA 3T4WA 4ERGA 3PZNA 3LUTA 2AQVA 1TTQA 3QV6A 3R0DA 1VLIA 3BV7A 3FV9A 3W4RA 4WCJA 4GQ0A 4DJEC 1FWTA 2OWWA 5GVJA 3WMBA 3R0KA 1NFGA 1C8QA 1GNXA 3W1RA 3MSRA 3B03A 3MQTA 2E0PA 3QYQA 3IJ9A 4YCPA 4FAMA 2B7PA 1B4EA 3HMCA 4GFIA 1IXOA 5EMMA 7ENLA 3SCPA 4LUIA 4A21A 3MANA 4AWSA 3EPMA 2A7PA 1EF2A 1GYLA 3AIBA 5DANA 4KQNA 1JNEA 1UUMA 3GX9A 1FWFC 4Q3MA 5KITA 3HQ1A 3OZPA 3EOLA 4BS0A 1KW1A 4UFMA 1KBKA 5EA9A 1TWIA 4ROPA 2WLYA 1Y5WA 1CT5A 3WDHA 2ZVRA 4HU3A 4ZTYA 1ELSA 3KBVA 1LUCA 5TQLA 2PDBA 1OC6A 2CC0A 2FJKA 1EHAA 3ATYA 1S3TC 2PWFA 1FFQA 4AD0A 3QV7A 1ZU8A 1XLAA 5D9NA 5DF0A 1VD6A 1GOQA 2NUXA 1JR1A 5DY2A 4PUJA 5KEZA 4LNCA 1BHGA 4W84A 3LHZA 3N18A 2ZX8A 5C70A 1SO3A 3VOCA 3VM7A 3F5KA 3AOFA 5FCZA 1A3WA 1G9HA 2ALRA 1W17A 5CSYA 2Q3RA 2XIOA 2YBTA 1KWGA 1H41A 1F8MA 2TPSA 3LXCA 3VAVA 1Y5XA 1XSJA 1N8WA 3H2AA 2OKOA 3WBXA 1FCQA 3U57A 5JQ9A 5DT7A 1TE1A 3CAWA 3EB2A 2HZGA 5T26A 5I6SA 1YPFA 3H2OA 1UA7A 5T91A 4AD1A 3S0CA 2FDSA 2CLMA 1G67A 5DXYA 1FWIC 2A79A 2VGBA 2NX1A 3B8DA 3N29A 4TMBA 2F6KA 2REQB 3VABA 4BQ5A 3BLPX 4OTKA 3VTRA 2J9YA 5DCDA 3QY6A 2YA1A 3Q58A 4WHBA 3IJLA 4G7EB 3CQ0A 1WXZA 1TV2A 3H2CA 4LFYA 1GG0A 2AMXA 5DN1A 4ZMGA 5C9UA 3ONCA 1TPWA 4EIVA 1VGAA 5AZ0A 1WDWA 2GPTA 2YPIA 4GG9A 2ZXQA 4I6VA 5AHFA 3DECA 5A6BA 2RDXA 1UD5A 2Z1VA 1BXCA 4MWAE 3LK6A 4UTIA 4GLEA 3POCA 1ZFJA 2Y2WA 4XBSA 2Z27A 1I1WA 3ARYA 4JPGA 3UJRA 1AQFA 4I7VA 2ZTJA 4AIEA 3W2NA 1TWWA 1FWBC 3GB6A 3FIGA 3OEXA 4I8DA 2RH9A 3VE7A 1J6PA 4ATDA 3PVFA 2XH2A 1TJ0A 4JQ1A 4GH1A 1DXEA 1CGXA 3BLIA 3XINA 3C2RA 2D2OA 3CIXA 1V6TA 1F3WA 4L6OA 1CIUA 1LBMA 5JIPA 2OR2A 1FY6A 4JTTA 3QRHA 3W29A 4UTUA 5I78A 3TTQA 3G3MA 1Q63A 1XG4A 1G5AA 3QLDA 1AJ2A 4N2YA 1XLEA 3INPA 3W7KA 1A5OC 2CHOA 4L1XA 4AF0B 1E6PA 1T40A 5FF2A 4DAFA 2YLAA 4W89A 3KXQA 2BHUA 2JGYA 1LT8A 2BWGA 1EGMA 2CKSA 1R9ZA 1Z44A 3FFSA 5KZEA 3N3TA 1VPXA 4Q8VA 5LXXA 3EOSA 4AZIA 3UA4A 1AG1O 1QI4A 1Q2RA 1L8NA 1QPKA 2VEKA 4NRSA 4BKNA 4MM1A 1YNPA 3CLMA 4JYFA 3V1PA 1EA9C 1SZEA 4K1WA 3T1GA 3GHRA 1IGSA 3L2LA 4JFTA 5L6UA 4MVAA 2ACRA 4PMUA 4WQ6A 2IMRA 3DFSA 1GKQA 2QGHA 4DEFA 2BSLA 3IGXA 4GMEA 4L4MA 3I6RA 4F40A 5AC8A 4PUUA 1T7LA 2QCLA 5I23A 1O1HA 1E0UA 1YYAA 1W3IA 5A95A 4EXQA 2QPSA 4ADTA 1XFCA 2J7DA 2QMJA 3DN5A 3AWNA 3M4HA 1GK8A 3LLDA 2X40A 2A3CA 5BYWA 1ZGDA 3CV7A 1U22A 3G1DA 1P6BA 4S1FA 3RYSA 5JH2A 2ZC1A 3VX1A 2J7FA 1ADOA 2NVAA 3UVIA 2WNNA 1GZ1A 1OADA 4YL2A 1C7TA 3L23A 5EKYA 1L9WA 3AO0A 3KCJA 1AJZA 4MFEA 2NQ5A 3VOJA 3ZO9A 3WQFA 3W07A 5FSEC 3VIPA 3EOEA 2WBGA 3AXKA 2IXUA 1NSJA 2E6FA 3GY1A 4UIOA 2YCJA 5LKYA 1TUFA 3RLHA 3LU2A 3T40A 2DZBA 3GYCA 4Q22A 2KAUC 1Q6DA 3GC2A 1TTPA 3IIPA 3DIPA 3GH5A 3OVQA 1EC7A 2XJ7A 5K4ZA 3UD6A 1RXOB 3P8JA 3S6OA 4JS3A 4NZ4A 3LTYA 4LEQA 3V36A 2BMBA 5G2WA 3WH8A 3M0YA 3KS5A 4CNNA 1OCQA 1KR0A 3ABQA 2ANUA 2EXOA 4GE8A 1FWAC 3OIXA 1D3CA 3BV4A 4ZB5A 1TCDA 3HURA 2G8ZA 3BAYA 5E0FA 2ESCA 1QJWA 3VD7A 3CL6A 2GL5A 2QZRA 4O0ZA 4M82A 4N9EA 3TN4A 4HOWA 3K30A 3URAA 1M01A 1V08A 4BZYA 2W6RA 1Y7VA 4JXCA 4E4PA 1JVNA 1IYXA 2RDTA 1PSCA 4I9JA 4BI7A 3V0UA 1OFDA 2OZ3A 1YTDA 4J3WA 3ITOA 4KCVA 3VC5A 1E6RA 1OX5A 2NV1A 1DV7A 1A80A 4DWSA 3W1TA 5LYRA 1EWEA 1XRFA 1QWGA 3FKRA 1V0KA 2EKCA 4QLKA 4QCEA 1EYEA 5I77A 4ONVA 1KB3A 3CAQA 2VZOA 2FZ8A 1BGAA 2ASHA 1JEZA 3LBOA 4ICNA 1H60A 3ZYZA 3U2ZA 4ZO7A 3QHNA 1XLJA 2IPJA 2J78A 1OT1A 1GOXA 2JQXA 2HCVA 4Y9OA 1ZAJA 1Z48A 3REQA 2AKZA 5HNUA 2E1WA 3GBEA 3UWUA 3M5ZA 1CECA 4FXSA 1LM1A 2E25A 3A4AA 3C52A 1P6CA 4HJWA 4LBRA 4NZFA 3S5ZA 1T5AA 1TWSA 1LROA 2W5FA 1CI1A 1VHNA 1US0A 1PZ3A 3UYCA 2F6XA 2BLEA 3KBJA 4M7TA 4AWEA 1H50A 3L2IA 2J8GA 3BSGA 5CAHA 5CSRA 2XFYA 2ABAA 3NSXA 3S42A 2HPMA 3XISA 1QK2A 1NELA 3N34A 2QJIA 2D1ZA 3AU2A 3M7SA 3FVDA 5HMEA 1OFOA 4A29A 1TZZA 3KOFA 4GUJA 1ME9A 4G9PA 2XHYA 1QOXA 5H91A 3RMJA 3STCA 3B04A 2Y8UA 3PUGA 2KX9A 3WNOA 1EQCA 3HV8A 4ZOBA 1UC5A 3VIKA 2AKMA 3SY1A 4IFKB 1UR1A 3T0BA 2ZXAA 3AS2A 4PMVA 1BEUA 3I4EA 2QV5A 3L0GA 1EJXC 4GKLA 1YDYA 3P6LA 1SZGA 3E38A 1T41A 1LWIA 3CO4A 3PZGA 1EJWC 1M7XA 1XLGA 3CJPA 2WHMA 2MNRA 2GK1A 2HTMA 3WEMA 4NAFB 1LRTA 3B8WA 1WZMA 2WKGA 4QDMA 3PWGA 2X2YA 1OFQA 3Q65A 1W31A 1EX5A 2IQ0A 3ARPA 3BG3A 2W63A 4XUGA 1L8PA 4HHMA 2I9EA 3OP2A 5FEXA 1BVNP 1S5MA 5BXTA 2XU2A 2RDWA 1AJ0A 2J13A 1TWDA 1UROA 3VU2A 3DI0A 3H23A 3AHYA 5BOEA 5JVLA 3STPA 2DIEA 5LIXX 4WKFA 1A0DA 4OBRA 3OHIA 3AIQA 4J3XA 4C7GA 1UD2A 3FY1A 3KCLA 1KRMA 4ZO6A 2AAMA 3QW3A 5HBFA 3L4WA 3HG5A 1BYCA 4CCZA 1IXNA 3A12A 3AUOA 1Q6LA 1F3EA 2IKJA 6PTDA 4XAGA 4LVDA 3NQ7A 1OYCA 3P80A 2WNQA 1OBAA 1KO0A 4LUTA 3APYA 2WZMA 1O5RA 4MAVA 1PKMA 1VFHA 3P7YA 5LIYX 3QMRA 3WBYA 4MY1A 3VIHA 2AL2B 3PBUA 3RU8X 3GNOA 4H8HA 1MRQA 3T0CA 3JZUA 1GT8A 2DSWA 4NZ5A 3U4FA 5IBXC 1XDJA 1FP9A 4LH8A 4ZCWA 2UV8G 5LA0A 3D5HA 3QXBA 4M3PA 4OQVA 4J40A 4E4FA 1CEOA 2PB1A 1TV3A 3F4CA 3OODA 5IDIA 4GUFA 3BUVA 4UQBA 3KL5A 1OGSA 3NQ8A 4REQA 4GNKB 3CB3A 3MCOA 1BYBA 5EMKA 2GJXA 3VDCA 4HU4A 3LCIA 5CZSA 5C7HA 1JZ2A 3C0QA 2X1TA 5G4EA 1MSSA 4O53A 4AX6A 2O9OA 5FA5A 4UNKA 5G4WA 3CBWA 4KEMA 3LV6A 3EX3A 5AB3A 1XGZA 4CVWA 1TZ7A 3QZEA 4ENLA 4HPXA 2HWGA 3T8LA 1EPXA 1Z69A 1UA3A 2PDYA 2DSVA 4O1EA 1ALDA 4N6EA 4W9TA 4S3GA 3F03K 3T44A 4E3TA 2J66A 4Q4MA 3QY7A 2E9MA 2VGIA 4E38A 1FCUA 4NRRA 3L68A 5KZDA 5FESA 3VDBA 2ADAA 3U48A 3K46A 4HSOA 3VIIA 4PN2A 3LM7A 2Y70A 4AZCA 3W81A 3SUSA 2GDQA 3WFAA 4Q6XA 4HU8A 3LX9A 3W1MA 4N0RA 3IWPA 4HN8A 3U7VA 1VF8A 4KF1A 4BR1A 4H7VA 4XAPA 4PCFA 3AUJA 3CIVA 2VHLA 3MT1A 2JKEA 4S3CA 3B97A 1P0BA 3LLFA 2JBMA 4JTJA 1F2JA 5FF7A 3QJAA 1HGYA 5KETA 1P4CA 4DUWA 1XSIA 3L4XA 3E0WA 1RD5A 3N2CA 1EYWA 2F6UA 3K8MA 2C14A 1OGBA 4TR9A 3UT0A 2A1YA 1O66A 4BFAA 3LN3A 1Q6CA 3NEHA 3VXGA 2W67A 1W2PA 3HBLA 4XAYA 3U2OA 3W02A 3GNXA 3DFHA 2J7GA 4WR3A 1TMLA 1VFOA 1F61A 2IKHA 2VQTA 2R82A 5T9CE 4N9DA 1PWMA 5RUBA 4EAYA 4XAFA 1YW1A 1NF0A 1RD6A 3VD9A 4GIAA 4KCUA 4RK8A 3BPWA 1ZZMA 2HJPA 4C6DA 1A0EA 1RCQA 3HGJA 1M9HA 1UUOA 1Q4NX 1VFLA 3O2LA 4N4QA 3WF3A 5I3JA 3GXDA 3GSMA 1TPDA 2OU4A 5KZ6A 1WE5A 4LQ1A 5LNSA 3CWHA 1CBGA 2J4GA 4A3QA 4FS9A 3BC9A 3EDKA 3EXRA 1KWKA 2OOGA 3W7MA 1XF0A 5GJPA 3GU2A 4HNCA 1JZ3A 4DF0A 1T6MA 3GXNA 2VCBA 4IWWA 7REQB 4XD4A 2UY4A 1TV8A 2V9DA 2REQA 1V7YA 1ESWA 1O94A 1IEXA 5FJRA 4WVXA 5C2GA 2H9AA 4PMDA 1KRBC 1C9WA 4O1CA 3F4NA 4PFMA 1LWHA 2TMDA 5I5RA 1K8YA 1UWUA 2PDHA 3LCWA 1HN1A 1VFUA 3BCDA 1W32A 4L6DA 3AYTA 3PP7A 4CU6A 2QGYA 3L67A 3IANA 1WKEA 4GCAA 1EJVC 1FDYA 2V82A 4WGXA 4K6AA 4DI8A 1KV8A 3W6LA 5D33A 3SCOA 3NIYA 4V15A 4BHYA 4O50A 2DT2A 4UUIA 1SO4A 1Z41A 1SJAA 3S1WA 3A47A 3EWZA 4MYAA 3OO2A 3A6OA 4DAIA 1QNPA 2YIHA 1GOKA 2IW0A 3EX4A 4FF7A 1VYPX 3N12A 4NU7A 3PG9A 4JICA 3GDMA 1A5LC 3VIGA 1GW9A 1HJXA 4EF8A 3EKLA 2G37A 2E9LA 2P8CA 3HQNA 2B7OA 1H09A 1MNZA 1PKYA 2VX4A 2QPUA 1SFTA 5AYBA 3DHDA 1W3LA 3TIMA 3B05A 1LZOA 1QI2A 4ZQRA 1OY0A 4S3AA 4IG2A 2BX7A 1FA2A 2EGZA 4RR4A 4AB4A 1Q8AA 3S1XA 3WBWA 3D3FA 2WPGA 2GLKA 4P8VA 3ZSSA 1E6QM 3JRKA 3W76A 3LZ3A 3L0KA 1FWWA 3VNJA 1GZGA 4ZQOA 2Y5JA 5CLTA 4US5A 4I90A 2OOFA 4Z1DA 3MVTA 2WV8A 3SRFA 1XX1A 2J75A 2WLZA 4KMQA 4K3ZA 4RL3A 1JUKA 1EPVA 1EDQA 4W7WA 8A3HA 5FJIA 2ISVA 1V93A 2X1SA 2J77A 1EKOA 4OFCA 1MXSA 3NFUA 3WUEA 2CZ5A 4CQBA 2FH6A 3EA3A 1TJ2A 3CTTA 4XIAA 1J11A 4IPNB 1K70A 1SR0A 3PZIA 5B7ZA 3V1HA 2XINA 4NASA 3TYUA 3W7IA 4CKQA 1B0IA 3VE9A 1V6WA 1OT2A 1C91A 4XKYB 3CGTA 3FCPA 3PZMA 2WJFA 2PEVA 3PPCA 4RPPA 3RO8A 1NQ6A 3NZPA 2DT1A 3QV8A 4TMCA 1NWSA 2X16A 4M56A 5GPRA 2GJNA 3GAYA 4IIHA 5I79A 4GY1A 2VTFA 5EBUA 1R8LA 3S5SA 5DCBA 2DVUA 1M68A 2ZX6A 4NY2A 3SSZA 4Q6JA 4EAMA 4NZJA 1EIBA 3IGUA 4IHCA 5BRBA 4J3VA 1Z89A 3N9RA 4JN8A 3RRAA 3MU7A 1V3HA 2RJHA 1JI2A 2AAAA 3VDHA 1JPHA 4RNFA 2IUZA 2I9UA 2Y62A 3VMNA 4LRSA 1V77A 2VRJA 5A94A 5ABEA 4MOZA 1J96A 3B06A 1DEDA 2XFWA 4A4AA 1DXIA 4I6KA 1FH9A 4HQVA 2GQ8A 5M5DA 1RQEA 2FZBA 2QNEA 5DCEA 1GOIA 3ONBA 5CJNA 3BAXA 4XO6A 1TV5A 5F2LA 1YPXA 1JYNA 3SAZA 4GINA 5BMXA 1J9YA 1Z7AA 3SRDA 5I03A 1WDQA 2VD9A 3UA3A 1BRLB 4D9PA 2CLHA 4UFJA 1YPIA 1H5YA 2V68A 1XCFA 1P0KA 1ISXA 1AW5A 5ABTA 4LAOA 4N9CA 3VGHA 3VGEA 2RHGA 2YL6A 3LGEA 5DO8A 4M1RA 3M0HA 4Z2JA 2VNCA 1RLDA 4IPPA 4N4PA 1W56A 3O1NA 4IIGA 5GNZA 2QR6A 3LM3A 5I0DA 7TAAA 4K8HA 4XB3A 1LYXA 3O0FA 2XH7A 1J4EA 4E8GA 3EWDA 1ICQA 3H2FA 3B9EA 1LG1A 3N9KA 5ENLA 4H3DA 4KGJA 2ONEA 1KCKA 5HJLA 5JXQA 1H7RA 5I06A 4HTYA 5F2GA 1QI5A 3G3DA 3MDUA 2YJQA 3CXOA 2CKRA 4E3VA 3EX2A 2YZ5A 4M6QA 4H7ZA 3LCHA 1H2JA 4HSHA 2WSYA 2A4AA 8XIAA 3T2OA 3UR5A 1VEMA 2FZMA 3VGGA 2VR4A 3M9YA 1VFTA 1JDFA 4ZQMA 3OVRA 3U3HA 4D8AA 1FXQA 2PWEA 3R43A 1AW1A 1KKOA 3DFNA 3ARTA 5AC7A 2BGSA 1QNOA 1VJSA 4HYWA 1VB9A 1XL9A 1JF6A 5C7VA 1N8IA 3S1VA 1UG6A 1MDRA 3WELA 4JTHA 3V5CA 2WVVB 4H2CA 4O1FA 4LV9A 3QPYA 4EKJA 4GXPA 3YPIA 1A4LA 4CD6A 4QG9A 3HPAA 2WQPA 4PULA 2QPXA 1EO5A 1M6JA 3W9ZA 1Q6OA 3EA2A 1X7IA 4NYYA 1T8QA 1F76A 2DU2A 1VFSA 4E8CA 3ZJKA 4FOJA 4ZSUA 3GW0A 4M6VA 1MMFA 1XKYA 1GORA 3VNLA 3KOYA 4FEZA 1UW9A 1A53A 2P3EA 3P5ZA 4X9YA 4GYPA 3T2QA 4KWWA 4IQLA 1BF2A 4AEFA 1JYWA 4ERAA 4HZMA 1JD7A 2HBVA 1AQHA 3C56A 2OQLA 3LB0A 3Q94A 6REQA 7A3HA 2CLEA 1IT0A 2QEZA 1AVAA 3GVQA 3ALGA 3TOPA 4JTQA 4CQAA 1ONRA 3GIQA 3IJIA 1RCOB 3WLSA 4XZ9A 1M65A 3N4EA 4HMEA 1R7OA 1AD4A 3U4AA 1HF6A 1ZHAA 2OT0A 3CHDA 2CLLA 3MI6A 2GWGA 3FJNA 4D2JA 1XC4A 1IZCA 3KVKA 2C3ZA 5DRCA 1TELA 4B91A 4N7QA 5IRPA 2DP3A 2PF0A 5JBDA 4D6HA 1W9UA 5D30A 3PS7A 4M6UA 1PE1A 3TWBA 3CUZA 1XLLA 4Z0JA 1BSLA 1SO6A 3OB8A 3UFYA 4GNVA 1QK0A 1F6PA 1OX6A 3S46A 1UP0A 4X61A 1Y65A 1RLCL 2ZCGA 3AMLA 3AS1A 2H90A 4X9SA 1JPKA 3VNKA 2A3EA 3WNMA 2D69A 4JIEA 3GBDA 2D3NA 1UZ4A 2H6RA 1KC7A 4U10A 4KW2A 1UR2A 1O4UA 2D0FA 2NWSA 3SIMA 1B90A 5FJJA 1ONXA 2PDJA 3K5XA 2PZ0A 4N02A 1OJXA 1IHIA 4C5ZA 2GVEA 2VFGA 2VGGA 2I17A 1I2OA 4C6NA 1VHCA 2VC6A 3NG3A 3NM1A 2PU0A 3W25A 2NW0A 3XIMA 1EBGA 3EKZA 1GEQA 4LYQA 5DBTA 2DSUA 1YNQA 3T81A 1OQFA 3CU2A 1D7FA 4D6IA 4PBFA 4GIRA 3IJ8A 3FA5A 5D37A 2D24A 4FK9A 4ORIA 3BGGA 3KVLA 2CWXA 1DWJM 1PX8A 3QC3A 1Q3NA 3R2GA 4X60A 4K36A 4B5VA 3WD4A 3DKLA 1REQB 2D0GA 2HMCA 4UR8A 1UR8A 1BYAA 3OVGA 4LUSA 1VKFA 4O1DA 2Z6JA 2XGBA 1J2WA 2YL9A 3NDOA 4FR1A 4R53A 1K9TA 1GJUA 3NPWA 1JGIA 1JYXA 3E0IA 1J0KA 3CNYA 1XLCA 1ZS2A 2G4JA 2HV5A 4GQBA 2WHLA 4I9TA 5GNYA 1IEQA 2DZPA 4JKMA 5IOBA 1SFJA 4OV4A 3THAA 2V63A 3IAPA 1UQZA 1FXPA 3GZAA 3PUDA 4HHPA 3FYOA 4PB5A 2HXTA 1F74A 2W79A 2ZICA 3KVMA 1UIPA 5E0KA 3BVJA 1F9CA 4GUGA 2OLAA 4WSHA 2CXGA 4TU1A 3NQDA 1HKVA 1ML1A 4HHLA 5DXXA 3LHWA 4LOCA 4A2SA 1WBJA 2QJHA 1QCWA 1IEWA 1D7KA 5K2ZA 3NA8A 4O0QA 4HVXA 1GTHA 5B7YA 3UXKA 3GR4A 1AK5A 3LRKA 3TCSA 1GOMA 1OF6A 4PFHA 1SSGA 1X6LA 1GUVA 5TIMA 4GNJA 3QZ6A 1C9DA 2FPVA 1DJZA 4IQEA 1NEYA 2XPKA 5JUVA 3SCRA 2JEPA 3EPOA 4WDWA 1EEPA 4JCMA 3WJYA 3VCNA 2VC7A 4MF4A 4EPEC 3C0JA 2TRSA 1ISZA 3FKKA 1WV2A 1K3UA 2BY3A 3AS0A 3VDGA 1CDGA 1F4AA 4C6IA 1WXYA 2QAFA 4D6GA 3RK8A 1IEIA 3CHCA 1K8CA 1ZBWA 1VAHA 1MYRA 3KHJA 3TYEA 1WQ5A 1AL7A 1GONA 2HK0A 3W28A 1SZNA 3EEGA 1SJCA 4TXEA 2UY2A 5D9OA 1UKQA 3RLUA 3AIWA 3FA4A 3EDJA 4DO4A 1IWBA 1OK4A 1FKWA 3RX3A 2FZ9A 2WM0A 4OUEA 1YADA 3SUTA 3S1UA 5A69A 1GG1A 2BV9A 1NF7A 2WW5A 4HA3A 4UOQA 1EH9A 4QLJA 4YTUA 1KFWA 1HKKA 2VFIA 3RLGA 5C9RA 2BS9A 4YU1A 3T78A 1UZHA 4ACZB 4B92A 1KRAC 3PZVA 1F3TA 1UWIA 4DPPA 4C6KA 1RBAA 1CGWA 4AVOA 3QEZA 3D0CA 1CXLA 3T0AA 2PLKA 3ERPA 3MCMA 1TX2A 4TQTA 1ZUAX 3NNTA 2A2IA 4OJYA 3USZA 4GIYA 5EGRA 4FNPA 3CZJA 1DPMA 3GDBA 1PZ2A 1OK6A 2HPIA 3ICJA 4Q7NA 3OG2A 4QSHA 4A8RA 3CMJA 3L4YA 3RIKA 4FOUA 1B31A 2ATSA 1ZCCA 4PGLA 4GK8A 5K3VA 3PULA 3MKCA 1FWEC 1E15A 3S9YA 3TLLA 2FGLA 5A2AA 2PSNA 1TVPA 1X96A 2C18A 3QYSA 2Y7EA 4IICA 1WDSA 4PC8A 1H7NA 3UZJA 1YQ2A 1SMAA 1IF2A 2ZVIA 4BI5A 4JYDA 3KTCA 3RX2A 1JZ5A 4IGHA 1NDYA 1IE7C 4BWLA 3EWWA 2FJUB 2P10A 3OZYA 4QGCA 1MVYA 2C1IA 4MWAB 2ZIDA 5CZJA 4BA0A 4ZE5A 3BGJA 2P8BA 5BWAA 4AZ7A 1W3NA 3I6EA 2C6QA 3COTA 3T05A 4AXNA 4CUCA 3W6YA 3VKAA 2JK2A 2Y63A 3N2OA 1QW9A 4C1KA 4ZR8A 3MJYA 4RNIA 4KWOA 4UTLA 4TVCA 3HGOA 3MO7A 4NNAA 3WD3A 3C2EA 1YTEA 2E9BA 1QDSA 4I5XA 4MTVA 1FOBA 2YCIX 3G0UA 2VZTA 4N6FA 3TJLA 3ZJ8A 4C6BA 3HM7A 3WNNA 1THFD 4H6QA 3S2LA 3WY1A 4ICMA 3M5XA 3DC8A 4FLOA 3O8AA 3N14A 5G4HC 1CCWB 3P3BA 4DB7A 1W1A1 4CQ9A 1MNSA 2E68A 3C3UA 3LERA 4UCFA 1DE5A 1Q7ZA 2GUBA 4YTQA 3WK0A 4WXYA 4QAWA 1US3A 2W92A 5HULA 1KV5A 3NO3A 2QULA 4J35A 5HWMA 1OC5A 3RR4A 1GPFA 3GDTA 3LHTA 3C8NA 1TZ9A 1POJA 4Y9NA 2FTYA 3CM4A 4Q7BA 3W2UA 5F4XA 3PZTA 4PA8A 2Y89A 1M7PA 2QDGA 1UH3A 1YEYA 2FGZA 2HRWA 4C7DA 2Z00A 5BW6A 2QXWA 2VFDA 1J5SA 1E51A 3NQEA 2XTKA 1QUMA 4LC8A 3DH7A 3R4IA 5I7GA 3SJNA 1TPH1 5CPSA 2BVYA 5GNXA 3HGSA 1B3ZA 2PC4A 3UJFA 4MGGA 3TQPA 2R1KA 2QS8A 1SPQA 4YXGA 1BKSA 4B3LA 3W75A 3F5JA 1DIKA 3SN4A 1ZBKA 3BOXA 3G2GA 3AC0A 3MBFA 3HQPA 3LG3A 2F9RA 3P60A 2D3LA 4XIMA 3FXYA 1U30A 1W9DM 3GK0A 1H5VA 4ASTA 3ARVA 4GHRA 4JTIA 1XIHA 2VT0A 3MA8A 4GYFA 1TO3A 1QU4A 4X2PA 2JF6A 1PYMA 2C7FA 1XUZA 1OFAA 3TCEA 2G3NA 4R88A 1GVFA 2GGJA 4PMZA 3A21A 4CQCA 5C9XA 4HGXA 3EBVA 4P7QA 1Z3NA 4JN7A 5HDRA 1NDZA 4UCGA 1UBPC 5IBXA 1S2VA 3L2MA 2YCEA 2Q8ZA 3QM3A 5AC6A 3HTWA 2MANA 1UR3M 2XZ7A 2DW7A 1NFPA 2ISDA 1VR6A 1MW0A 1WBHA 3M0IA 2YX0A 4P2VA 1BKHA 3MY9A 4LS2A 5AVNA 2HQAA 1V79A 1GVRA 1WZKA 2PGWA 1A4MA 3BARA 5DBUA 2GDUA 1JULA 3PTMA 4GXWA 3NR0A 1A0CA 1JCNA 4M5PA 5FD0A 4AD2A 4XZBA 1ADSA 1J93A 5LXEA 4GX9A 1N55A 1T0OA 3LPOA 3MYOA 4JTRA 2XIIA 1SR9A 2GVYA 2Y61A 4NX5A 5EFFA 5C6MA 4GRSA 5BZAA 1W5OA 3CPUA 3G1VA 5HA7A 1ODZA 1SZRA 4MLJA 1TJPA 1EA0A 3DEQA 2ALDA 2HVNA 1UPMB 3IPWA 3TTYA 1W2VA 3M43A 3H53A 3TFCA 4NT0A 4KWVA 1XBZA 5TAOA 2IPGA 3IIXA 4KFOA 1H7WA 2ZZ4A 4HA4A 1ICSA 6CGTA 4L7ZA 4AAJA 1TRIA 2DZSA 3THUA 4B9YA 4EPBC 1V5XA 1OZMA 1V6UA 1XGEA 2YL5A 1G4PA 3C2YA 4C6LA 3BAJA 1UZ1A 4PMNA 1QAPA 3N2MA 3AQUA 1RALA 4YJ5A 1LUCB 1CZ1A 1XBYA 3W23A 5AC4A 3CYVA 4KIRA 1DKWA 4H8UA 3GVRA 1Q65A 4ZB2A 4A3UA 3TONA 5CXPA 4AHQA 3UG5A 4DVOA 1RCXB 1JCLA 2YDRA 5HUOA 1BLIA 4A35A 2GUYA 3HO8A 4YTTA 2QUMA 1SJBA 2JF7A 1XHGA 5KINA 3ITVA 1I2NA 1GQNA 5I07A 4D1JA 1IR2A 1H3GA 4DJDC 3TXVA 4MDPA 2Q8LA 5XIMA 1R7AA 4XK2A 1I2RA 3PB2A 2PRHA 4OZOA 3M6YA 4IP7A 3SFWA 1LBLA 4JKKA 4W85A 1UH4A 1OD8A 3LBCA 3RMEA 1LP6A 3UZXA 1TQXA 1XPGA 4S3KA 4FALA 4O1BA 3PAOA 1XPYA 3W1XA 3BQ5A 1GKRA 2V0TA 3TA6A 1KCZA 3AJ7A 4BCEA 2GWNA 2PBOA 4UZUA 1SFSA 5G5IA 3IAQA 1GYMA 4ZOEA 1JQXA 1XQLA 1R9XA 2FZNA 5D32A 4H9XA 1H7XA 1J79A 3CL7A 4PMYA 1AH0A 2QKFA 3DFPA 1RQBA 5A5WA 5G1MA 1W1B1 4Z42C 2WZHA 2NZLA 1ITXA 4ZFMA 4O4WA 2OYLA 2XIQA 4GIEA 4NI3A 2V38A 4QX4A 1LL7A 1S5VA 1ZQ5A 2DQWA 1AQ0A 1HKWA 4R9OA 1CGTA 1OB0A 3BOLA 5FIPA 8CGTA 2AMGA 3TV8A 4MKSA 4UTFA 3E2QA 5K4XA 3ECQA 3MO4A 1ZALA 3SURA 4ZE4A 1VCVA 3DERA 3KBNA 3W82A 1LRNA 3U0HA 4Y6GA 4Q7IA 4NP7A 1KXTA 3QF0A 4A8IA 1I0DA 2W27A