1H11A

2-deoxy-2-fluro-b-d-cellotriosyl/enzyme intermediate complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
total genus 116
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h11A00
2OSXA 3WN6A 4TVDA 1EQPA 1DWJM 3UG4A 1JYVA 3LPGA 3CO4A 3CIVA 2WKGA 3CUIA 4H8HA 4PMRA 4J3VA 1W3KA 1HP4A 3L4ZA 1M04A 4M56A 5CSUA 2E9LA 4UFHA 1FP8A 1LQ0A 2VVSA 3KE0A 1WZMA 2GSJA 3OIHA 5BROA 3WENA 2ZX7A 1HKIA 4AD0A 2WVUA 3CHEA 3PZVA 4CN1A 2J7CA 4HTYA 4NRRA 5D4YA 5C70A 1BPLB 2ZXQA 3RO8A 4MADA 1JFHA 4PMOA 3VKKA 4AD4A 5M5DA 1CLXA 3UETA 2DT2A 5DT7A 3IJ8A 4H8VA 4PEEA 3W38A 2AOSA 4DUXA 3PZNA 1LG1A 2WHKA 1D3CA 3RJXA 4YPJA 2VT0A 2VCBA 3POCA 5A6KA 3WF3A 1W2PA 2YBUA 2RGMA 1VBUA 1C7TA 1ZJBA 1MW3A 1TR1A 2J62A 5EBAA 4D1IA 4H2CA 3BCDA 3J7HA 2QMKA 2G41A 5ABEA 4AWEA 1HF6A 1PZ2A 3GH4A 3SURA 1WDPA 1EDQA 3VILA 1VRXA 1R85A 3QR3A 5CSYA 1C8YA 1CDGA 3K8MA 1QW9A 5IHSA 4CD5A 2HVMA 4AIUA 3SCPA 1KXQA 1UKOA 3FY1A 3GM8A 1BGAA 3WH7A 3VOCA 3WEMA 3TONA 3MMWA 1XCWA 3VD4A 2BNJA 3NJ3A 3N1AA 3KZSA 4AD5A 3QOKA 2VX5A 1J0KA 3LPPA 3N9KA 3ARWA 2BVTA 1SMDA 1ZS2A 2WLYA 3CMGA 1MW2A 3EBVA 3UR7A 4LPCA 5M03A 5EFFA 3PZTA 3SCNA 2X0YA 2CITA 5I77A 5FKYA 4UFMA 4TTUA 1NWTA 2XSAA 2MANA 3CZKA 3WF2A 2BY3A 2VRQA 3W29A 4NSBA 5D8ZA 1CEOA 1GZJA 4UFJA 1E1FA 1N82A 1RPKA 3AIRA 3THDA 2J7HA 3WH9A 1CXFA 5JIWA 3BLPX 4JFSA 2OLHA 4W7VA 4YHGA 2G3NA 5IXEA 4PCSA 4CU7A 4LGXA 1BG4A 2O9OA 2WC3A 1M03A 1X6NA 3VM5A 3WF0A 1E4MM 1JNEA 3HMCA 1CGUA 1TFVA 2J79A 1GJWA 2ZUMA 2BY1A 5JIPA 3IJ7A 1CGVA 3L4UA 2EEXA 1GQLA 3LMYA 1ISXA 1R8LA 2EBNA 1DWFM 2E0PA 1GJUA 1QHOA 4A3YA 1HJVA 1Q6FA 1UUQA 3WDIA 4D72A 4JCLA 1R7OA 1BVZA 2CCRA 3EYPA 2YL9A 4LXFA 2C0HA 3ARYA 4WF7A 2DSKA 3WFZA 2WMIA 2DGAA 3SEPA 2ZXDA 1OGBA 3A4AA 4BQ4A 2EPKX 3PTQA 1W1VA 2VVNA 2Y4SA 1GOIA 5EB8A 1MXGA 1KXVA 2W5FA 1W9BM 1EHNA 1HP5A 1Q6CA 4P7NA 4AD2A 2FHCA 2ZX9A 4ACYA 1KQZA 1UKPA 3MMUA 2Z1SA 1ISZA 3M07A 1I1XA 2A3CA 1E4LA 3VGBA 4ZEPA 1J11A 3O2LA 4JKMA 8A3HA 1FHDA 2A3BA 2PWEA 1HNYA 2XPKA 2ZUUA 1OT2A 2WMHA 2DT3A 2W66A 1CZ1A 3OLGA 1KXTA 1UZ1A 3WL0A 5ABFB 4JHOA 1KWGA 3W6LA 1WPCA 2GDUA 4XZBA 1MFUA 1JZ4A 3WKZA 5HBFA 2WHJA 1NOUA 4E8DA 1QI3A 1MW1A 2X0HA 7CGTA 1PZ3A 1ECEA 1WO2A 2WXDM 4ZXLA 4GQRA 4J7RA 4ATWA 4U2ZA 2VCAA 3AMDA 3BH4A 5CLTA 5CPSA 3SIMA 3VIIA 4GI6A 3ZO9A 4Z2HA 1LJYA 4OZOA 1E5JA 1C90A 3W24A 2CBVA 1BF2A 1QNOA 4CN6A 6TAAA 1KCLA 4W5ZA 4BZYA 1YHTA 4UOQA 3W53A 4RE2A 4V2XA 4HMDA 2D0FA 5FD0A 3A4XA 5GNYA 2V3GA 4IM4A 3VIFA 3ZSSA 5A6JA 4U5KA 1GNXA 1JYNA 3A3HA 3CTTA 3O9NA 1VEOA 4D6HA 1J10A 4D6FA 4W84A 3WUFA 2J7EA 1ZJAA 1PPIA 1VENA 3ARTA 4J3XA 2QPSA 4MAZA 4S3JA 2OWXA 3VU2A 3G6MA 3B8SA 3BAKA 2ZXBA 2FGLA 2JFEX 4GPNA 1B1YA 3AS2A 3GBEA 2FHBA 2G4FA 1E0VA 4JIEA 2WW5A 2A3EA 2W67A 5BRPA 1KWKA 4QDMA 4QCEA 3RM4A 3EMZA 1LWHA 1SFSA 3WQWA 5HDRA 2Y8VA 2EPNA 1QHPA 1E6RA 5D9MA 2VNCA 3B9EA 2DPEA 1LWJA 3MUAA 4QP0A 3CZLA 3N15A 4B16A 1SYTA 2BXYA 2BVYA 4HZ6A 1W9XA 5LA1A 3W81A 1UKQA 1CIUA 4PUEA 3WNOA 2Q8XA 4UQAA 1TCMA 1JYXA 3K8LA 1US3A 4AZ7A 3FAWA 4WJXA 3BXWA 4R5EA 2CHOA 3WELA 2UWFA 3RCNA 3PZUA 4B15A 3CPUA 1CGYA 3U7BA 4DWSD 1GW1A 1V6VA 1HIZA 1JDAA 3PZ9A 3PZGA 4GO9A 4X9YA 5DFAA 2J8GA 3S6TA 3EDFA 1VJZA 5D9PA 4UQDA 3AFBA 3WQ6A 2W63A 1ZB5A 5E0CA 1H4PA 4B9ZA 7A3HA 1TMQA 2ZICA 3OZPA 1A3HA 4J3WA 4WKHA 5A8OA 1G01A 2PWGA 2DIEA 1CWYA 1V02E 2WC4A 3QHNA 2YLAA 1E0XA 1UKSA 2VOTA 1JZ7A 1UD5A 3I3EA 5BWFA 2Y5EA 4MB4A 2YL5A 3CZGA 4C7GA 4QFUA 3U7VA 3BSGA 1XSIA 2A3HA 3AYSA 4WSKA 4RE3A 5LA0A 2NT1A 2DT0A 1EGZA 3VIPA 2J7BA 5IFTA 4D6CA 1JAKA 2V3EA 5A6SA 2VCCA 2DH2A 1H41A 2W92A 3VDAA 1EOMA 3WY1A 2YDRA 1H49A 4AYSA 2VMFA 1JXKA 4C7FA 1V0MA 4PMQA 4FLRA 1M53A 4S3KA 4FLOA 4EK7A 2WVSA 1ITCA 1UD4A 1ISWA 3AMLA 1KR0A 1NOFA 3WUBA 2V3FA 1WKYA 1UWQA 1JZ5A 4WSJA 3ARUA 1MQPA 1DWHM 4E8CA 4JFVA 4X0NA 1QVBA 4AZCB 1UR4A 5LYRA 3VD9A 1JF5A 3GXIA 3MANA 1C93A 3DHPA 4HPHA 1E73M 1IV8A 4CUCA 3ZJ6A 5AYIA 1EHAA 2ZWZA 1V02A 2VQTA 4HU8A 3BAWA 3ZOAA 2WVVB 1J0JA 4AXNA 1GOOA 2W4XA 1W1PA 1TUXA 3BAYA 1J0ZA 4KWUA 1E9LA 1Z32X 1W1YA 1BYDA 1A47A 3QGVA 3U5YA 5FL1A 4AZBA 1B9ZA 1EH9A 1U30A 2CBIA 2XUCA 1E6PA 3CUFA 2WSKA 2ZE0A 3NYDA 4Z2GA 1OT1A 2J8FA 1ITXA 4M82A 5CQ1A 3ALFA 1WZAA 3ZT6A 4D71A 2DSVA 4CU8A 2QV4A 2WKLA 1LG2A 1QBBA 2E8YA 3SCQA 1MQRA 3WD0A 4HPGA 2X05A 4W89A 4Y7EA 1W1TA 1W9PA 5HXMA 3DYOA 2YA1A 1W3LA 1TA3A 1JYWA 1UHVA 5FIPA 3MSDA 5I5RA 3M46A 3VNZA 1GVIA 5BYWA 4MDPA 4MNJA 3AROA 4GZEA 2XVNA 2PWDA 4MB3A 3TTSA 5DF0A 4EANA 5LA2A 1HKKA 4DM2A 4QAWA 1PBGA 4PSRA 4W87A 1HL9A 1FFQA 4GZIA 4D6EA 2WWCA 2G8ZA 3D5HA 3MKKA 4AZ5A 3OZOA 4J3TA 1U2YA 4L4PA 4HZ7A 5JBFA 3GBDA 2VURA 3QHOA 1HKJA 5A6BD 2D23A 1CBGA 4TXEA 1W9VA 3AIUA 5D9NA 2GVYA 3N18A 1FFRA 1FP9A 1WCGA 2YBTA 1QNSA 4D1JA 3EDJA 4AW7A 1PX3A 3F4VA 1UH3A 2VRKA 1WDQA 4YN5A 3AHTA 1BQCA 2RGLA 2GJXB 1KFWA 5ABGA 2JEQA 4U2YA 1XSJA 3GH5A 3RDKA 1J0HA 1VFFA 4HP5A 4HZ8A 2JF7A 1V6XA 3WMSA 3K1DA 3THCA 4KGJA 1VFMA 4AISA 5ECUA 1OB0A 4CD6A 1V3LA 2O9TA 3NDYA 2O9PA 5GQBA 3T2OA 1RP9A 4FLQA 3SUWA 3L4WA 1JL8A 3NSXA 1GOKA 4HOXA 1B3ZA 4Z2KA 4BCEA 2VRJA 4CN4A 1NM9A 2D1ZA 3FHAA 4AZGA 4JL1A 3AHZA 2XVKA 1KB3A 2BS9A 4URIA 3UG5A 4UOJA 1B30A 5BXRA 2EXOA 2WZIA 4XX6A 4W7UA 4PYSA 4ZENA 3ZM8A 1GUVA 3GNOA 1V0NA 2C8NA 4EKJA 1UR0A 1B31A 3NDZA 1XD1A 1K9FA 3NCOA 1OGSA 2WCGA 2E8ZA 2GJXA 3WDJA 4W5UA 4Z2LA 1JI2A 3VGEA 3FHQA 1C3FA 3L4YA 3BMVA 5AYBA 2XHYA 4ACZA 1HVQA 4XZWA 3IK2A 2XSBA 3PZQA 1WDSA 1HXJA 1UR2A 2D20A 2JALA 1BSIA 4U31A 2JIWA 3AMGA 1V3KA 5CPTA 2EQDA 5F7UA 2D2OA 4HA4A 3OGSA 2QLYA 3UCQA 1QW8A 4C7DA 1JZ6A 5I3DA 5CLWA 3MUIA 1AMYA 3WDRA 3PBGA 4GI8A 1C7SA 1CGXA 1E6QM 4AEEA 3VPLA 1TG7A 3ZR5A 2WMIB 5CZKA 2XVPA 1UH4A 3W37A 1PX8A 4AMCA 4ATDA 5C71A 3PZIA 1B3WA 5A8NA 3HU7A 3WF4A 3GXMA 1NWUA 4W8BA 1R86A 2VX6A 1GQIA 1W91A 2FGZA 4PCTA 3ZJ8A 2WWDA 4JL2A 4Q22A 2ESCA 2ZUSA 2VQUA 3APGA 1BYBA 5CGTA 2EPOA 1U33A 5D9OA 3W28A 2WCSA 3MSGA 2V5CA 2ZX5A 4TVUA 1J01A 1B0IA 4PMDA 3VD7A 4TX6A 5EMYA 3VVGA 4GIAA 4UNIA 1CXLA 1QOXA 4H7VA 2X8RA 1GCYA 3AQUA 3RILA 2E3ZA 1VFUA 3VIKA 2PI6A 4LYQA 4F79A 2CPUA 3CUJA 5M17A 1JF6A 4TUFA 2EJ1A 3AIBA 2XVGA 4V27A 2WC7A 2OSWA 1US2A 3L4VA 1QI5A 1NOWA 1FOBA 4MNMA 4OUEA 2WNWA 4MJ2A 3CUHA 3VD3A 4BA0A 1EOKA 3MU7A 3WD4A 1D2KA 3HN3A 5DT5A 4HMEA 4U5IA 2UY3A 4CU6A 1UG6A 4KMQA 3B9AA 1HJQA 3AZTA 2ZX6A 5I78A 3IANA 3WDQA 5CPQA 3WL1A 2DSUA 3RPMA 3T0DA 4M24A 2BY0A 3AMCA 3IAPA 4J3SA 3W82A 1CXIA 2OWWA 2E4TA 1DEDA 1Y7VA 2XWDA 1JZ3A 4WK9A 3W0KA 2QMJA 4ZFMA 2O9RA 4OOZA 1NP2A 2JIEA 2Y24A 1UKTA 5BXTA 2WVTA 4D6JA 1EA9C 1CLVA 4HA1A 2XM2A 5CGMA 3EDDA 3PZMA 1HX0A 1JI1A 4MTVA 3VIHA 4DUVA 2G3MA 1PIGA 1XH1A 2VR4A 3ECQA 1OINA 5I79A 6A3HA 1UWIA 5A2CA 2VZUA 3T0AA 1AQMA 1E1EA 1GHRA 1GQKA 1QPKA 1OIMA 3JUGA 4BQ2A 4PMXA 2CBJA 1UWSA 2O92A 3AXXA 3QOMA 4A3HA 5A3HA 3GZAA 5GNXA 4AC1X 1E56A 1VF8A 1YQ2A 2CYGA 1E6NA 3OB8A 2YOCA 4KGLA 1JIBA 4PTMA 2ZUTA 4PBGA 3U57A 1KR1A 3T2QA 3VUPA 1XSKA 4UZUA 3VTRA 4D6GA 4CCEA 4PMNA 1UA7A 2BY2A 4FK9A 2X1IA 2XFYA 1UR9A 2FH6A 2AAAA 3AYRA 1IZJA 1WDRA 3MMDA 1OD0A 3A47A 1JD9A 2J7FA 4W86A 5GNZA 2DQXA 3SUUA 3VDBA 1P6WA 3GXDA 3WUGA 2TAAA 4M81A 2GK1A 1MVYA 2BVDA 1VBRA 4JFUA 2XG9A 1M7XA 2EPMX 1V6UA 1AQHA 4QCFA 4M29A 4P7RA 3ZSTA 4PSPA 2WHLA 4GINA 1GOQA 2BFGA 1J0YA 1V6YA 3M7SA 3OBAA 1OIFA 4UFLA 1NH6A 1QI0A 3SUSA 3VDHA 3WF1A 2HISA 1TVPA 1B3YA 1CXEA 1VAHA 2VO5A 1WE5A 1XGZA 3E1F1 3KWXA 3I3BA 3AJ7A 2ZUVA 2E40A 3AI0A 1DP0A 1JDCA 2WK2A 2GDVA 4V28A 2CIPA 5BXPA 1LL6A 4WKAA 3PN8A 4E2OA 1KXHA 4D6DA 1W3HA 1UZ4A 5CJ5A 4UTFA 1PEZA 3KEHA 1JFXA 3CHCA 5I2UA 3VINA 1MFVA 2J47A 1R7AA 1CENA 4BF7A 4LX4A 3WD3A 1JAEA 2W61A 4KRTA 1WZLA 4P8UA 1VJSA 3SCVA 4GQQA 5E09A 3LPOA 2FH8A 2J74A 2PC8A 4Q7NA 1HJWA 2V5DA 4MNLA 2JEPA 2YA0A 2JF6A 3WNNA 2QHAA 1XCXA 3EMCA 4WKFA 5JUVA 1JZ8A 5IFPA 1LL4A 1KGXA 3FXYA 4FLSA 1E40A 3CGTA 2VI0A 3WEZA 2DEPA 3WDPP 2VC9A 2W91A 4L4OA 4W93A 2F2HA 1QBAA 2V3DA 2J7DA 3ZIZA 2OYLA 3UG3A 1PJ9A 4K68A 3PTMA 4P7OA 2XFFA 2XYLA 8CGTA 4WIWA 3M6DA 2Z1KA 1TA3B 1WZKA 1RH9A 5A8QA 3TTYA 3VIOA 4UQCA 1TVNA 1NP0A 2IXVA 4UCFA 5E6YA 3CUGA 2J75A 4H41A 4PMYA 2E9MA 3PHAA 3WEOA 1I75A 3VX1A 4OOUA 3AIEA 1H11A 5A95A 4XV0A 3WNPA 5C8BB 4JKKA 1W3JA 5A6MA 1BG9A 3ALGA 1G0CA 4ZE5A 4GKLA 3CH9A 3EDKA 4N42A 4MB1A 1CYGA 4AD3A 4TX8A 1HKMA 1XC6A 3TTQA 3CHFA 1ZBCA 1LL7A 3KL0A 1K9EA 1BAGA 3TP4A 2WCAA 4MJ4A 4TVCA 3WQ8A 1H2JA 4UQEA 3WQ5A 1F4AA 3ARZA 1E71M 2BHUA 3W26A 1QNRA 3RM8A 4AY1A 1AQ0A 4DWSB 2VJXA 1G94A 4JAWA 1QNPA 4YHEA 1J12A 4H8UA 3L2LA 2DIJA 1EIBA 3ARPA 3B9DA 3WH6A 4J28A 4B3LA 3T09A 3MUY1 1BYAA 1CXHA 2BV9A 4TTGA 2ZX8A 3GTNA 1L8NA 1K9TA 3F5KA 1E55A 2D0HA 1WNOA 1E72M 3ARSA 3L2MA 1WP6A 4RE4A 1GVYA 3GH7A 3BAJA 4AZHA 4IUGA 3RM9A 5HOSA 4IPNB 4PRWA 3SCRA 4W8LA 3N12A 4UFKA 4MNKA 3AIQA 4B9YA 3N17A 1G1YA 4FMVA 2G3JA 4GXPA 3ZJKA 2WMJA 3OGVA 4UOZA 2YKKA 1E5NA 2CBUA 2DSZA 3UESA 5GPRA 1ZBWA 4LYRA 4DWSA 1X1NA 3G6LA 2YA2A 1H5VA 5CXPA 4CVWA 1B90A 2DH3A 1IZKA 2J78A 1UWTA 1ZBVA 3AXIA 1OCQA 4CD7A 2D0GA 1F4HA 3K4AA 3W6MA 3AS0A 4ACZB 2UY4A 3BCFA 2WAGA 2YIHA 5I23A 1QNQA 2YL6A 3I3DA 2ZUWA 2WBGA 2X2YA 3FN9A 5I6SA 2J7GA 3WD1A 1UD2A 1OGGA 4A4AA 5AY7A 3T08A 4P8VA 4NF7A 3TOPA 5IHRA 3MV01 2XGBA 1XV8A 2D24A 1EQCA 1JNDA 4MPKA 1V0LA 1FH9A 3BMWA 2UY2A 5A6AA 4NZCA 3VM7A 4AIOA 4UFIA 4GI9A 2YL8A 1D7FA 4P8WA 1E3ZA 1E70M 3U5UA 1C92A 3NUKA 3VMOA 5HNNA 1HJUA 5AC4A 1CTNA 1PIFA 4CVUA 1ESWA 1OBAA 1UQYA 3AICA 3VMPA 5DEZA 5E9AA 2CXGA 2D3NA 4M8UA 1WB0A 3ZMRA 1PAMA 1ZBKA 3AZSA 1NWRA 3N04A 3AXHA 5A8PA 1CGWA 3T0BA 2FDMA 5ABHA 5I0DA 1OWQA 3WMBA 4X0VA 4W8AA 4ZE4A 3A6OA 1J9YA 3WNLA 3WUEA 2V38A 4LQ1A 3ZQ9A 3BGAA 4F8XA 1WAWA 2OYMA 4CKQA 3SUVA 3AIVA 2VZTA 2CETA 2FHFA 1V3HA 1V6WA 3K4DA 3VNYA 4F66A 1CPUA 2CKRA 4N0RA 1G5AA 3SUTA 1HN1A 4BS0A 2UY5A 1DWAM 1UH2A 4W88A 1UWUA 3PZOA 3D3AA 3F5JA 2YJQA 2XVLA 4DM1A 3WMCA 3L4TA 4QLJA 3ZT5A 1E6XM 3FW6A 5AC5A 2F8QA 1E3XA 4GZJA 4HOWA 2WSPA 1XRVA 4B3KA 2VZSA 3VIGA 4KH2A 4F9JA 1RD6A 1GQJA 3NSNA 1V3IA 1UWRA 7TAAA 4KRUA 1H1NA 2IXUA 1DTUA 3ARXA 3SCWA 1BTCA 4XB3A 1IT0A 1CXKA 2WZHA 5A6LA 9CGTA 1JDDA 1QHZA 1V0KA 3CZ8A 3FAXA 3N11A 1UYQA 3AIWA 2ZWYA 1OM0A 3K46A 4GO8A 5CG0A 4U3CA 1UD3A 2CERA 1JGIA 1NQ6A 4OKDA 1C8QA 3VX0A 3GNPA 3UR8A 1X6LA 4RL3A 5A6BA 1E6ZA 5HPOA 3BSHA 4R27A 4EAMA 2PB1A 3BAXA 4Z2IA 3VGFA 3AHVA 2PWHA 1E43A 1E4NA 1EO7A 3BC9A 3K8KA 3WSUA 1J0IA 2WLZA 4EE9A 4OJYA 1ZU8A 2VX4A 4W85A 4NI3A 3BLKA 5BXSA 2WMGA 1HJXA 4OIFA 3DYPA 3CLWA 3MO4A 2NSXA 1R87A 1SMAA 3FNDA 1JG9A 4JKLA 4NRSA 1L0PA 1Q4NX 1AVAA 2C7FA 2J25A 1KBKA 1LF1A 3GYCA 2XIBA 3OA5A 2D3LA 4JFTA 1FH8A 3WNKA 3NIYA 4CCDA 5A1AA 2XIIA 2PWFA 3WIJA 2YDQA 1ISVA 3ZJ7A 2BXZA 6CGTA 2EO7A 1B2YA 1HT6A 2WB5A 4OBSA 1EDTA 3WBAA 3MS8A 2BHYA 3PTKA 3TTOA 1BYCA 5FCZA 3W25A 3AS1A 2B31A 1QI2A 2J4GA 4HU0A 4PTWA 4WLCA 2GK1B 3F5LA 3WQ4A 1DWGM 2YLLA 1BGGA 1V3JA 4ML4A 3DECA 4P7QA 2VZOA 2PBGA 3CHDA 1KBBA 3EDEA 1XH2A 1M01A 1FHLA 5I24A 4M1RA 1Q6GA 3MV11 1QI4A 3GDBA 2Y2WA 5A2AA 2CEQA 2F61A 1GOMA 1XD0A 1EDGA 3VIMA 1TZ7A 2JE8A 1E6SM 4UR9A 2QPUA 3VGHA 1Q6DA 3SCTA 3WNMA 1CGTA 3AS3A 3DYMA 2AMGA 3KL3A 1V08A 3ARVA 3RIKA 3WQVA 3VD5A 2PF0A 4W7WA 2VL4A 4PMUA 5ABFA 2IUZA 4IISA 5IDIA 1ODUA 4AD1A 2VTFA 1BVNP 3QHMA 5HPCA 1VB9A 1JXJA 1FA2A 1W9UA 1OD8A 2WZEA 2WMKA 4PTXA 2D22A 1W2VA 3GNRA 2WYSA 4J27A 4MB5A 4UQBA 1H0IA 2XWEA 1ODZA 4M80A 1W9DM 3ARQA 3CMJA 1UD6A 2CKSA 4PMZA 2GFTA 3AOFA 4LYPA 2WMFA 4FF5A 4OBRA 2ZUNA 4ATLA 5FOOA 3WBEA 3DC0A 2G3IA 1XYZA 2CESA 1KGWA 3OLDA 1I1WA 2Y8KA 3OGRA 3O6AA 1XHGA 2XTKA 5JBEA 3AMKA 1W32A 1KCKA 4PUDA 5E70A 1MYRA 5A94A 2QF8A 1C8XA 1GPFA 3IJ9A 3WH5A 1V3MA 1E4IA 5BCAA 3S2CA 1XH0A 3OLEA 5DMYA 4JCMA 2BHZA 1UR1A 3UERA 4QLKA 1C91A 3WFLA 1EXPA 1MWOA 1MXDA 1UD8A 3VGDA 3L4XA 3II1A 1JZ2A 1LLOA 1MQQA 1CNVA 4DWSC 2XGIA 4HMCA 1BFNA 5A8MA 4CD8A 3N13A 1EO5A 1ZL1A 4H04A 1GONA 4MAVA 3CBWA 4HOZA 2ZIDA 2DT1A 1JD7A 1PX4A 4TOQA 3ZR6A 2OYKA 1ISYA 3NSMA 4IPLA 1K6AA 3DHUA 3IAQA 5KZ6A 1K9DA 5EFDA 2CHNA 4XUYA 1FH7A 1GOWA 4U3AA 1J18A 1DWIM 2WHMA 3OG2A 1NWSA 1GHSA 3EMQA 3GXFA 3OLIA 3W4RA 2ZXAA 1VFOA 4HA3A 1SR0A 4JZ5A 4UZSA 3WD2A 3LPFA 4AZ6A 5DO8A 2CNCA 5TD4A 3AISA 4JFWA 5JBDA 1VIWA 2GJPA 1G9HA 1HL8A 2J77A 3WDHA 2WANA 5E0FA 5A69A 1XYFA 1HJSA 3SCUA 4ZXOA 1E15A 4DUWA 1UA3A 4BQ3A 4PTVA 5M3WA 4P7LA 4PN2A 4PMVA 3A4WA 5A2BA 3T2PA 3VGGA 1TE1A 3KL5A 2DDXA 1UOKA 3SCOA 1KGUA 2OSYA 2WPGA 3CZEA 1H3GA 1UQZA 1E0WA 1O6IA 2A3AA 3VDCA 2DSWA 3VIJA 3WH8A 2OWCA 1VEPA 2X09A 4Z2JA 1S46A 4CGTA 4J3UA 3UEQA 2XFRA 2VX7A 5FL0A 3W27A 4P8XA 1B3VA 1RP8A 1CECA 3TA9A 3CZJA 3MUZ1 2VR5A 4AZIA 3ZT7A 2YDSA 3AZRA 4JHZA 4AEFA 1UR8A 2W62A 3AHXA 4BQ5A 3SCSA 2PBOA 4QLLA 3HJEA 3RJYA 4CCCA 1Q6EA 1OSEA 1H0GA 1HVXA 4E4PA 4AIEA 1MW0A 2GJRA 1BLIA 5BRQA 1VEMA 5KEZA 4MDOA 2NW0A 3VMNA 5D8WA 1H09A 2VZVA 1DHKA 4AZCA 2VUYA 3BAIA 2ZOXA 3POHA 4D6IA 2NT0A 3VO0A 1KQYA 1BHGA 3AHYA 4UQ9A 2XM1A 4F9DA 4CD4A 2WVVA 1GORA 1O7AA 3RMEA 1B3XA 2WM0A 2WBKA 4U33A 2XJ7A 3ARRA 1NARA 1V03A 2GUYA 5E6ZA 2EPLX 2E9BA
chains in the Genus database with same CATH superfamily
4LAKA 4TVDA 1DWJM 3VC5A 3LPGA 3NO1A 3CUIA 3DFNA 3GS6A 2YGYA 2GVGA 3ZFHA 3EX6A 3UXAA 3HM7A 2ATSA 1HKIA 1MUWA 3CL6A 4CN1A 1Q2RA 3NQGA 4S2CA 4K36A 3RN6A 3OVQA 2ZXQA 4M6QA 1JFHA 4PMOA 5M5DA 2ZZ6A 2EKCA 1R9YA 3TQPA 5C5YA 4PEEA 4ZVJA 1L6SA 3PZNA 1LG1A 1AL8A 3NQMA 4YU1A 3LM7A 4OQVA 4LUSB 1RAKA 4L65A 4RE0A 4C6JA 3I7QA 1FXQA 3LBMA 1W2PA 2YBUA 4NNCA 1E0TA 2RGMA 1VBUA 2AGTA 4K6AA 1DJYA 1ELSA 2PP1A 4JIIX 3T40A 3N73A 1MW3A 2J62A 1Q4WA 3VE9A 2RAGA 4H2CA 5AHEA 3GH4A 3IEBA 3GC2A 1EDQA 5FJOA 1C8YA 1CDGA 3K8MA 3KBSA 4JY9A 5IHSA 4C6NA 4HZMA 3SJNA 3SIZA 1L6YA 3FY1A 2AAMA 4LEQA 4XIMA 4JTKA 3R0KA 2X16A 4UWMA 3TONA 2PDCA 1XCWA 2BNJA 2RDTA 3KZSA 4AD5A 1MXSA 1P1MA 3QF0A 1J0KA 5KTLA 1J2BA 3C56A 3N9KA 1MZRA 4TO8A 2BVTA 3L0NA 4B5UA 1SMDA 1ZS2A 3MYOA 1MW2A 3EBVA 3UR7A 3HFTA 3SCNA 2RUSA 4WXZA 2VWSA 3ZVHB 1GYNA 2QJJA 2EPHA 4UFMA 4QIUA 1NWTA 5LXEA 2PURA 3LBOA 3WF2A 1IEIA 1YEYA 2VRQA 2XN2A 3G1XA 1JUBA 1E1FA 7PTDA 4O1AA 3THDA 2J7HA 3W01A 3CC1A 5JIWA 4W7VA 2OLHA 2PGFA 5B7ZA 1BG4A 1S2CA 2WC3A 3FGCB 1Z9AA 1TPWA 1H61A 4TMCA 2VEMA 3B05A 1CGUA 1TFVA 4BJHA 3TAKA 3VFCA 3N4EA 3E74A 3L4UA 4HVXA 1EJXC 4DBDA 1HJVA 3LNPA 2E6FA 4E2DA 4R3UA 2C0HA 4WF7A 4RK8A 4G7FA 2QDEA 3W88A 1OGBA 3O6DA 4GVFA 2ZZ7A 2EPKX 1IEWA 2GGEA 3PTQA 1W1VA 1F3XA 4D8AA 3PY2A 5EB8A 1KXVA 3OIXA 1HP5A 2BDQA 3CPGA 4FX8A 4N4PA 2A0NA 1TV8A 3WLIA 4L9XA 5DBUA 1UKPA 3MMUA 2Z1SA 3PG8A 1QASA 1Y8BA 1I1XA 3PULA 3EOUA 1E4LA 4ZEPA 1J11A 3O2LA 4JKMA 2XIOA 2G95A 2J88A 1HNYA 5FEXA 1OX5A 1KXTA 4M6VA 5J5RA 4IP4A 2A21A 3W6LA 3BURA 3A4JA 3GE7A 4GY0A 1K8CA 3CK5A 2HE5A 4NJKA 1GPWA 4IQEA 4DF2A 3S46A 5FEWA 3M5VA 4ZXLA 4GQRA 1GTHA 4QAIA 5FSEC 4GI6A 4MIMA 1LJYA 2PEVA 4Y2WA 4GWEA 1KCLA 4G7EB 4BZYA 3NPUA 4FNUA 4E3TA 1I0DA 3W53A 1EF3A 3L9CA 1PXGA 1ICSA 1PTDA 3SQMA 2NQ5A 3L23A 3MP4A 3N2OA 2V3GA 4US6A 1GNXA 4DX3A 3A3HA 1VCVA 4IIBA 3L65A 3MBFA 5K9XA 1YBQA 3FA5A 4ORMA 3PG9A 2TMDA 2H3DA 1PPIA 4GACA 2Z1VA 4DJED 2YFOA 2MNRA 3S9ZA 4MAZA 3VU2A 4EF8A 1EL3A 5TNVA 1B1YA 3W76A 4DJEC 2G4FA 2QCEA 4HHLA 4O1EA 5DMNA 1KWKA 3NTYA 4IIFA 3ONBA 4N4QA 3EMZA 1LWHA 3EGJA 2E28A 2ZC8A 3WQWA 1QK0A 3B0UX 2PDKA 2Y8VA 4J4KA 4V15A 1QHPA 1E6RA 4B5VA 3MY9A 3B9EA 2DPEA 5HWMA 2INZA 1QPQA 2ISSA 3QJAA 5AHIA 3RYSA 3IGUA 7ODCA 1UKQA 2YCLB 4PUEA 2GGHA 2Q8XA 3F2BA 4JN8A 4UQAA 1LRNA 1QJWA 1S3TC 1US3A 3FAWA 3Q94A 1XQLA 1XX1A 3NO5A 5B80A 4HSHA 1A5AA 3U7BA 4CQ9A 4DWSD 2OQYA 4X9YA 5I3KA 1VJZA 1XR2A 4FI4A 4UQDA 1WAUA 5E0CA 4S23A 4B9ZA 1U5VA 2REQB 3OZPA 3LXAA 4J3WA 4CQCA 4QM1A 1O94A 1E9IA 4L1XA 1CWYA 1VBGA 3WMLA 3QHNA 1XM3A 4MY8A 3A21A 1V79A 4PCFA 1JZ7A 2Y5EA 5KINA 3ISIX 4M5PA 5J5DA 4HPNA 4C7GA 4QFUA 4KFNA 3U7VA 2PTXA 4DYEA 4WSKA 1XDMA 2NT1A 5DLCA 4INFA 2GZXA 3BUVA 2J24A 4D6CA 1JAKA 5U7SA 4A29A 3OVGA 2VCCA 2DH2A 1PTGA 3CIXA 4AYSA 5EKYA 1NF0A 3HB9A 3IWPA 1V0MA 3GNNA 4FOKA 4FLRA 1M53A 3DAQA 4B5TA 4QG9A 1NOFA 4KEVA 2ZDRA 1JZ5A 5ABTA 5C7HA 4OBTA 1DWHM 3OYZA 1BRLA 1O95A 4JFVA 4Q4KA 5TAOA 4X0NA 2PE4A 4OFCA 3UBPC 4AZCB 4GNJA 2O56A 3MJMA 3R0UA 3GD6A 4IJRA 1R2RA 1EHAA 2ZWZA 4GUGA 1A3WA 2ISVA 2WVVB 1J0JA 2P0IA 1E9LA 3M0VA 1Z32X 4XAZA 2A79A 2HROA 1TMLA 3LX9A 2I17A 1KW1A 2ISDA 2XUCA 1E6PA 2CLLA 1GT8A 2IKHA 3WBWA 1DKWA 3NYDA 2VEKA 1CT5A 2J8FA 2GQAA 5CQ1A 5D02A 2HXTA 3ZT6A 4XK2A 4PTNA 4ALDA 3IJIA 1H63A 5DCEA 3TFCA 3P6LA 2VR2A 3CUZA 1LG2A 3EA2A 3WD0A 4HPGA 2V9DA 4FO4A 4ADTA 3M47A 4B5NA 1PWLA 2YA1A 4JTUA 3H54A 4PUJA 3KBVA 4GIEA 1GVIA 1SZGA 1K77A 3BSMA 2DZWA 4GZEA 1O5QA 2PWDA 4JX5A 4MB3A 1PBGA 5D37A 1O12A 4P61A 1XFBA 2GVJA 4LCSA 3IK4A 3FDGA 4AWUA 3TYAA 1KBJA 3OZOA 1KM2A 1Q6QA 1U2YA 4GA8A 5JBFA 1BTMA 2PDIA 1K8XA 3QHOA 3UY7A 1CBGA 3A5FA 2PTWA 3AIUA 5D9NA 2ANUA 2GVYA 1WCGA 1M7OA 4E3VA 3H7VA 2YBTA 4OHQA 3GKAA 2A5HA 4DXVA 3F4VA 2VRKA 2G4JA 4D8LA 2ALDA 3NWRA 2RGLA 5I3FA 1KFWA 5ABGA 1GVRA 3G1AA 4FA3A 1IIHA 1KM4A 4UMBA 3ERPA 4N02A 2GQ8A 3LU2A 4HZ8A 4XG1A 2JF7A 3WMSA 4KGJA 3N4AA 5CPNA 3SFWA 3H2EA 2ADAA 4AISA 4JQ3A 2PDFA 2O9TA 3ITCA 3S42A 2RDWA 5GQBA 5FESA 3B8VA 3SUWA 5J8LA 1W37A 3QW4B 1EKOA 4ERAA 1GOKA 5HMEA 3ANVA 4BCEA 3FHAA 3FK4A 3PB0A 4IXHA 1ML1A 1TWZA 4GFSA 4XX6A 4DZHA 4IX2A 3GNOA 3NPVA 2C8NA 4A21A 3PP7A 3N29A 3NDZA 1XD1A 4IJCA 1XBVA 2WCGA 2X0SA 3ITVA 1H7OA 2E8ZA 2GJXA 4KEZA 4W5UA 2HS6A 1UBSA 2VXNA 5AYBA 2XHYA 1ZALA 3UXKA 4ACZA 4HB7A 2Z29A 1MEIA 3W7HA 3PZQA 1AJ0A 1XIBA 3KHDA 4HPXA 5CPTA 2EQDA 1JDFA 1TPEA 3OGSA 5HK4A 5I3JA 1IEXA 1OY0A 1JZ6A 3U2ZA 4CNNA 1DXFA 3LV5A 4FR1A 3GUWA 3MUIA 5CBIA 1MZHA 4AHPA 3WDRA 3PBGA 4ZCWA 1VFHA 1C7SA 5IDZA 1I6NA 2HRWA 4MVAA 1TG7A 3ZR5A 5JQ9A 3VNLA 5CZKA 1UH4A 1OF8A 4E0CA 3WJSA 4AMCA 3KVMA 5CBBA 3PZIA 3WF4A 1NWUA 2VX6A 5LHEA 1R5YA 3BLLA 3N3MA 3ONCA 3QQWA 3O1NA 4IQJA 4Q22A 3UPBA 5DMLA 3SB0A 1KCXA 3APGA 1BYBA 5D9OA 2Z2UA 4UMAA 1XLEA 1OCBA 3G0UA 3TZFA 3WQOA 4HHPA 1B0IA 1AMKA 4PMDA 1JQVA 3S83A 1KRMA 2QJHA 3RO6A 4Y96A 2PI6A 4F79A 4MG4A 1O1HA 1JF6A 3TXVA 2ACQA 1WKFA 2OOFA 1UP2A 1WV2A 2OT0A 3BWWA 1LTDA 2WSQA 4YCPA 1QI5A 1FDZA 4S38A 3ORWA 2WNWA 1W3IA 3CUHA 1YXCA 4Z08A 1UZHA 4BA0A 3WD4A 2P0OA 4U5IA 3VOFA 4KMQA 1NQKA 3G1FA 3IACA 1IWPA 3LGEA 1Q66A 1TCDA 1SJBA 3WDQA 3LCWA 1JR1A 2DIKA 2XGZA 2FJUB 1OADA 4LB4A 3VOIA 3M43A 3T0DA 2BVWA 3IAPA 3TNBA 3HV8A 4J3SA 2H8ZA 3B0YA 4JYDA 3QYQA 2XWDA 2QMJA 4ZFMA 1F5ZA 1G4EA 3NR0A 1A5SA 3GC5A 1ZAHA 4KETA 1G4SA 2Y24A 4GVIA 3W7DA 2QCCA 3VNDA 3VUSA 1P43A 3BLOA 1CLVA 5CGMA 3RK8A 3ATYA 4OV4A 3QYSA 3R12A 3UU0A 5M2FX 2VR4A 4C65A 4O11A 1UWIA 4FS9A 1VHCA 1AQMA 1QPKA 4AFYA 3THAA 3JUGA 4PMXA 1KTNA 3QOMA 4A3HA 3F4CA 4LF1A 4LFYA 2KAUC 4ZR8A 1FVPA 4O54A 6REQA 1E56A 1VF8A 2CYGA 1GG1A 3OB8A 2YOCA 4PTMA 2HSAA 3A64A 4GKTA 1ZCCA 1KR1A 3PUOA 2E7FA 3T2QA 4YTSA 3VUPA 3E0LA 3V0UA 3L68A 2NUWA 3P8JA 2Y7DA 3IIZA 2P8CA 4BI6A 3S2LA 2Q09A 2VEGA 2FH6A 3AYRA 3IJ6A 4PL2A 1IZJA 1WDRA 1OD0A 2J7FA 4W86A 4AX6A 2QULA 3NO3A 3GXDA 2TAAA 1YNQA 4RJEA 2RKXA 2GK1A 1MVYA 4FXRA 3T0TA 4NZ3A 3BANA 2UBPC 4M29A 4P7RA 1UOZA 1J0YA 1VHNA 2V5BA 1V6YA 1XGDA 4NZ4A 4KCTA 5LGXA 4WRHA 3OBAA 2NWRA 1T40A 1NH6A 1TELA 4C6LA 5DRIA 5EA9A 3BQ6A 1VAHA 2VO5A 2QJNA 1TE6A 3EWXA 1XGZA 1AH3A 3E1F1 4LC8A 3W84A 3KWXA 3E3HA 3AJ7A 2ZUVA 1JDCA 2WK2A 3EWZA 3CL7A 1BRLB 3PB2A 3PN8A 2V5JA 4IPPA 4YWSA 1UZ4A 3T4CA 1L6FA 4K7VA 3MO7A 3VINA 2J47A 3CPRA 1IT7A 4H01A 3W7RA 1LT7A 3FKKA 1W56A 2ZTJA 5E5CA 1TIMA 3TVAA 4KRTA 1WZLA 8XIMA 4P8UA 4GQQA 5E09A 2FH8A 3GC4A 1HJWA 2V5DA 3V5CA 1JCTA 4JEQA 9XIMA 4RDWA 2DVTA 5JMUA 2QCDB 1DHPA 4MNLA 4UTKA 1MRQA 3MDUA 4NNBA 3IVUA 1EJTC 3GO2A 4FLSA 4AYGA 2G97A 4J2MA 1RK6A 4W93A 2V3DA 1T8QA 3MHUA 4C6IA 1I4NA 3PTMA 2CU0A 2XFFA 5I07A 5AC6A 3A23A 3E2RA 4Z1AA 2X1UA 3VIOA 2PSNA 1TVNA 5FJJA 2IXVA 2WNZA 3MWCA 1LLZA 1QFEA 2VOMA 1VBHA 1AZ2A 1W0MA 4K8EA 4QGCA 1BKHA 4DJDD 3CUGA 3T44A 4MKNA 4H41A 5F4XA 3PHAA 1EJRC 4Y9PA 5A95A 4JTHA 3WNPA 5C8BB 1KA9F 4XO6A 1KKOA 4AAJA 4JKKA 3TROA 3ALGA 3KW3A 2BSLA 1K3UA 3CH9A 4N42A 4AD3A 1XC6A 4LSBA 5CZSA 1Q63A 2WCAA 4MJ4A 5DY3A 5CH9A 1FQ0A 1TWWA 4WY0F 3WQ8A 4UQEA 1JJKA 3DN5A 3DXIA 3B4UA 1E71M 4GC3A 3K13A 1X97A 1S1RA 3CNYA 1AQ0A 1J5SA 4WDXA 5AB3A 4JAWA 1J12A 3I10A 4L4LA 4B3LA 3MUY1 4ES4A 4LOCA 1JUKA 1EB3A 3GTNA 5AC7A 3OZMA 1E55A 1JUEA 4Q4PA 3HGSA 3E0WA 1E72M 1WP6A 1ZENA 4RE4A 1GVYA 1Z69A 4FIRA 3G1SA 4M19A 4IUGA 8RUCA 4TV5A 1ZJIA 4C6EA 3GDRA 3FA4A 2OZTA 2HV5A 4IPNB 4PRWA 4US5A 4UFKA 4MNKA 4OWGA 4DJFD 3N17A 4GXPA 3S2MA 3ZJKA 4UOZA 2YKKA 2QDHA 1XBXA 2A7RA 4Q32A 2CBUA 2DSZA 1ZZMA 3RRXA 2TSYA 2RDXA 3KXQA 1KV5A 4AY8A 1ZBWA 3ZVIA 3EX1A 1H5VA 1XYLA 5CXPA 3V1HA 4CVWA 2Z27A 2DH3A 1IZKA 1VPYA 4UBPC 4DVOA 1UWTA 1WXZA 1ZBVA 3SJ3A 4CD7A 4GUFA 5CZ0A 3QY7A 5HQLA 1F3WA 1RR2A 1F4HA 3K4AA 1KV8A 3OJGA 4ACZB 3M0KA 3R7MA 2DVUA 2UY4A 5I03A 4NAFA 2QJIA 4XZNX 3DFHA 4QBXA 3FN9A 1B3OA 5AY7A 3T08A 4P8VA 3PBVA 2X40A 2FPYA 3EKZA 1W1B1 1YRRA 2D24A 1UC4A 1EQCA 3NPXA 4C1LA 3DFOA 4MPKA 1D8CA 3PPCA 3ANYA 4C6KA 2QUUA 2RJGA 1XLCA 2ZQ0A 3F7JA 4AIOA 2F84A 1BD0A 3E6EA 1E70M 5HATA 2OVLA 2XZ9A 2IQ0A 3NUKA 3VMOA 2WJFA 1HJUA 5AC4A 5AHNA 1ESWA 4Q3MA 2Z2BA 3KS6A 2CWNA 2Y7GA 5E9AA 1EIXA 2YBVA 1JCLA 2WPBA 3B8DA 1M7JA 4KS0A 3AXHA 1REQA 3QLDA 3M41A 1IE7C 1OWQA 3DERA 3WMBA 3GR4A 4ZE4A 3TR2A 3WNLA 3NNTA 1OF6A 3H2MA 3WUEA 2OGJA 2W9MA 5CZTA 4IICA 4I9JA 3AIVA 2VZTA 2CETA 2FVLA 3UJSA 3O06A 1G5AA 4DBUA 4W88A 3RF9A 1QMLA 3QV8A 2EF9A 3SZ8A 3V4BA 3F5JA 3G2GA 1GVEA 2V2HA 4GFIA 3ITTA 3L4TA 4AG0A 1OFBA 1TPFA 4N2YA 4QLJA 2OLAA 3LN3A 3ZT5A 4AUBA 3H24A 1K7EA 1CI1A 3FOKA 2P8BA 4S3CA 4FX7A 4DF1A 4GZJA 1XRVA 4UTHA 1OX6A 3H4XA 3W7QA 3LBCA 1RD6A 2GUBA 1UCWA 1GQJA 3NSNA 1X39A 1UWRA 3T1GA 2IXUA 1DTUA 3ARXA 3SCWA 1KKRA 4EWJA 1BTCA 3RHGA 4ZGYA 2WZHA 3GU2A 3QW3A 1FHUA 3MCMA 3RITA 1V0KA 3CZ8A 3FAXA 1UYQA 1OM0A 1EPXA 3K46A 4GO8A 4JTCA 1SZEA 2F6KA 4KEUA 1Z6KA 1NFPA 5AZ1A 3S47A 2GWNA 5E0KA 3BOXA 1P5BA 4FXSA 3CV2A 4ZO8A 3UR8A 3WBYA 4RL3A 1F73A 5A6BA 3LZ5A 5LXXA 3KVJA 3BSHA 4WDTA 2PWUA 5HMSA 3GHSA 3HPSA 1A0EA 3I7SA 3CUXA 4LW7A 4H7CA 4OJYA 1ZU8A 4QQ3A 3BJSA 4K2SA 3OPSA 3GXTA 4B5XA 1RV8A 4OIFA 3KX6A 3WLPA 2TRSA 1KLYA 2CXEA 2TODA 1R87A 1PUDA 1SMAA 3GIYA 3HTWA 5HWJA 4WGHA 1JG9A 2QQ6A 2PGRA 4POCA 2V6AA 3T55A 4JICA 1H1ZA 3SQLA 1KBKA 1XIHA 3USBA 4ROPA 2D3LA 4JFTA 3WQEA 1L2UA 3WNKA 4CCDA 3LA4A 2PGWA 1V51A 5TIMA 2EO7A 4X3ZA 4R53A 2BTMA 1F74A 2A4AA 1IXQA 1H7NA 1NDWA 4A8LA 3PTKA 1XF0A 3TTOA 3WQCA 3F4DA 3UYCA 3NVDA 2B31A 1TX2A 2GK1B 1K8ZA 5GJNA 3WQ4A 2X7WA 1DWGM 3B03A 4WHBA 3S1UA 1FHVA 3JVAA 3EDEA 1XH2A 1M01A 5I24A 4MYXA 3N2TA 2Y2WA 2CEQA 1VLWA 1EDGA 1XUZA 1TZ7A 1DL3A 1F8MA 4EWND 4UR9A 2QPUA 3FA3A 3W72A 4LJ3A 3RIKA 1I60A 2VL4A 3R1ZA 5ABFA 3PAOA 1ZAIA 2W27A 4AD1A 1BVNP 3QHMA 4XBSA 4U10A 1R9ZA 2OJPA 4MWAE 4BFAA 1J79A 4ORIA 1OD8A 2QVHA 1XLHA 1YPFA 3MVIA 4UTTA 4J27A 1FWDC 2XWEA 2OODA 2FMNA 1UJQA 1EF2A 1XLDA 4M80A 4MUZA 3BARA 3M1ZA 2CKSA 3AOFA 2PCEA 1WKDA 4Q7BA 3O07A 1VRDA 5AYZA 1KGWA 1O5RA 3OGRA 5L6UA 4FXJA 3P8IA 3O6AA 2QNEA 3P62A 1W32A 5E70A 4MHBA 4GYKA 4DF0A 2HBVA 3QC0A 2YCIX 1DTNA 1XH0A 2ZBTA 5DMYA 2EGZA 3P2VA 4JEJA 5DY2A 3UERA 1B57A 1C91A 2AQWA 4YVPA 1UD8A 3PFMA 1PDYA 3OTRA 1CNVA 1QPNA 3SSZA 4GGHA 2FZBA 1BFNA 1UMYA 4CD8A 2C1HA 1EO5A 2PZNA 4FAMA 3Q67A 2A7NA 4NJHA 1B5TA 4HOZA 2RDUA 2X7VA 4TOQA 3IIVA 1NDVA 4PBFA 2OYKA 3TEVA 3U0HA 1TUFA 3DHUA 4ZMGA 4U3AA 1NAL1 2GJLA 3OG2A 3GX9A 3HA1A 2J27A 3TZNA 2Z6IA 3GXFA 3W4RA 4CQ8A 5G1YA 3KRSA 1SR0A 5K4XA 3WLQA 1SR9A 4AZ6A 5DO8A 2R1KA 4R33A 5JBDA 4PRRA 4UCGA 1G9HA 1ECQA 1HL8A 1G6CA 2WANA 1TVLA 5A69A 5CAKA 1XYFA 1HJSA 5LKYA 5M3WA 4P7LA 3VK5A 5A2BA 3TTEA 1TE1A 3O8AA 1XICA 1IT8A 3IGXA 3B4YA 2VDHA 3PWAA 4W4QA 3U48A 2WPGA 4A05A 4H3DA 1M9HA 4CNTA 1B4KA 1H3GA 3D3FA 1N55A 2DZTA 3RNDA 2INFA 1VBJA 4WVXA 2OWCA 4QDPA 3N6HA 3W22A 3W27A 1PZ1A 1KM0A 2WSYA 4S3AA 3VKCA 4P8XA 3TA9A 3FDKA 3CZJA 4PC8A 2D2HA 1JCJA 3TR9A 3MHFA 1NJJA 3ME3A 4QG8A 4I5RA 1JGMA 3C2YA 1UR8A 2W62A 4NILA 4MZYA 1OZMA 1UWAA 3T8QA 2Z2AA 3EPOA 2PBOA 2BWGA 3RJYA 1QPOA 1TPVA 1OSEA 3W02A 4E4PA 1HVXA 3S6OA 5MF5A 3M0HA 1VEMA 4QG6A 4NAFB 1R47A 2VZVA 2E6DA 3QMSA 2ZOXA 2NWSA 4ZTXA 1KQYA 4DO4A 3T9PA 3GG7A 2ABBA 4UQ9A 1T0OA 1GKRA 1GORA 4AY7A 1Q45A 1ZNNA 2WBKA 3GYEA 1PCKA 2G37A 2XJ7A 1V03A 4KFOA 4H7ZA 3PAJA 3VNIA 2O4MA 4QJ5B 5AYYA 2WKGA 3N9SA 3KOXA 3QGAC 3QZ6A 4H8HA 4J3VA 3B40A 1DYSA 1HP4A 5E1QA 3L4ZA 5H6HA 2GGGA 4I5UA 2VVSA 3MUCA 3OIHA 1VYRA 1REQB 3GAKA 5BROA 2ZX7A 3WENA 1RBAA 2SFPA 4ICCX 1UUMA 3CHEA 4GNKB 3W7NA 5LNRA 1BPLB 4HK5A 4WOQA 2QZRA 2DT2A 2H9AA 5DT7A 4UTMA 4H8VA 3HPZA 2XU2A 3RMJA 1ZGDA 4K7YA 3RJXA 4GYPA 3S2JA 3POCA 2Q6ZA 5A6KA 4FF7A 3UCCA 3WF3A 1YTEA 1SZFA 1O60A 4HNTA 3AXMA 1R3RA 2VELA 2FB2A 3BCDA 2FGBA 3J7HA 2QMKA 5FF0A 3WQFA 4AWEA 3TYUA 3R58A 4B3ZA 4WGXA 1WDPA 1VRXA 2NVAA 5JH1A 1QW9A 1W8GA 2DORA 2HVMA 4AIUA 3UXIA 3SCPA 4E2BA 1BGAA 4IZGA 2P3EA 2OOGA 2QT3A 1LT8A 3MMWA 5EMMA 3VNMA 4NY2A 1AG1O 5K9DA 1Z3NA 5IOBA 1W5QA 3UZ5A 3ARWA 3VZXA 4IUOA 4LPCA 3W7GA 5AFDA 5DXYA 4TTUA 2XSAA 2AL2A 3MBDA 3CZKA 4F3HA 3CAVA 3VABA 3G77A 3VCRA 4NSBA 1GVFA 1CEOA 1GZJA 1SO5A 4UFJA 1RPKA 2OQHA 3PBWA 4V1XA 3W7PA 4JTDA 1P0DA 2OG9A 4JFSA 4QJ1A 3WLMA 2G3NA 4PCSA 3CQKA 2O9OA 1M03A 3G3MA 3C2VA 1GW9A 1A53A 4XD6A 4J1OA 3CV1A 1GJWA 2ZUMA 2BY1A 5JIPA 4DBWA 4RDVA 3LHUA 4XWUA 3LMYA 3KAOA 1R8LA 2EBNA 2E0PA 3S1GA 1HTIA 1Y5VA 4L56A 3LTSA 3R8RA 4GIRA 1Q6FA 1UUQA 1XINA 3WDIA 4D72A 1RCXB 3EYPA 2XH0A 1XLAA 4LXFA 2R24A 1BWLA 3ARYA 2DSKA 1C9DA 4HD5A 3SEPA 4HNLA 1VLIA 4BQ4A 3OVRA 4HBKA 4GJJA 5JXQA 4F2BA 3F2DA 3FYPA 2VVNA 1GOIA 1MXGA 4B5WA 1W9BM 2PDUA 4ACYA 1KQZA 3PNUA 5FJPA 2FFIA 2A3CA 4FNPA 3XINA 4FOUA 3RRAA 8A3HA 3SAZA 1FHDA 5C9ZA 3PBUA 2FZ9A 2ZUUA 2DT3A 3OLGA 1CZ1A 4O12A 5ABFB 3OOQA 3UA4A 1OC7A 4JHOA 1WPCA 4J3ZA 2GVEA 3W00A 2YCEA 3E96A 4ZOEA 3LI0A 2P1FA 5DX7A 2WHJA 1NOUA 3MC5A 5K9CA 1JPIA 3DDMA 2BOGX 5BW6A 1YW1A 2YPIA 1OFRA 3JU2A 5BU6A 4ATWA 2VCAA 3AMDA 5CPSA 3GVWA 1EBGA 4CN6A 5G2WA 4UOQA 4RE2A 2FLIA 2D0FA 5FD0A 4LEFA 5CC3A 3IV3A 5GNYA 4XTIA 2Y1HA 3VIFA 4JTIA 4U5KA 5A6JA 3CL8A 4E6MA 4O17A 4I9TA 3WK0A 2GQ3A 4JY8A 3DG6A 2J7EA 1VENA 3ARTA 1HO1A 2VC7A 4J3XA 2OKTA 2OWXA 3DI1A 1R9XA 3B8SA 3G6MA 3BAKA 5F2LA 3KBNA 3IGHX 4A2SA 3AS2A 4FOJA 2FHBA 4JIEA 4MWAB 2GJNA 5BRPA 3RM4A 2CFFA 1US0A 2VP8A 3N2MA 2PTZA 4V1YA 1L8PA 1PV8A 1RPXA 1QT1A 1XKYA 2BXYA 1TJ1A 1HG3A 3W81A 1CIUA 4RZ4A 1WQ5A 4M7TA 3RR4A 1JYXA 4WEVX 4WCJA 1A49A 3PJWA 2OXNA 4JDBA 4ZQRA 4R5EA 3UZXA 2PLJA 2GWGA 5CPLA 3PZUA 4XZ9A 3CPUA 1CGYA 4BK9A 1OX4B 4PGLA 1HIZA 1JDAA 1KFBA 4GO9A 4YWIA 4XSMA 4C6OA 3WQ6A 1JRBA 1LOSA 2W63A 1RZMA 4BEQA 1TMQA 2ZTKA 2C79A 5FEZA 1G01A 3LHTA 4J5NA 4B4HA 2DIEA 3QZEA 1V02E 4DPPA 1E0XA 2KZHA 3NAVA 2VEPA 3I3EA 5BWFA 1TX0A 2VD9A 3BGJA 4O52A 4MB4A 4HNUA 4IP5A 4PB3A 1MDRA 4JTAA 4TV6A 3AYSA 4RE3A 4EX4A 1DPMA 1SZNA 2DT0A 1EGZA 2J7BA 2NX1A 3IUHA 3GUGA 2PZ0A 3AYVA 9RUBA 1EOMA 2YDRA 1ZY9A 4XZMX 4F2TA 3UG8A 4S3KA 1G7VA 5M1TA 1V6TA 3GTXA 4WJEA 5F2GA 1ITCA 1UD4A 1MEWA 3AMLA 1KR0A 3WUBA 3PM6A 4WSJA 3ARUA 3S4TA 4E8CA 3HGJA 4MGGA 1A5UA 1QVBA 2CW6A 1KRBC 1C8VA 3VD9A 3GXIA 3U9IA 5AN7A 5CSRA 1E73M 1IV8A 2ZVIA 3IRDA 2C91A 4NNAA 4XAGA 3ZJ6A 3EWYA 1V02A 4WDWA 1UP0A 3COTA 3BAWA 4AXNA 1F8IA 1GOOA 1YIXA 1TUXA 1J0ZA 4KWUA 3P14A 2V8ZA 1H50A 4GQ0A 1AJ2A 1A47A 1V4YA 4IIGA 1GKQA 3QGVA 5FL1A 4JNYA 4LT9A 1B9ZA 1EH9A 3FJNA 1IWBA 5FJUA 3W2UA 5I3GA 1XPYA 1FY6A 4Z2GA 3JZEA 1OT1A 4AH7A 3LCHA 3ALFA 4GRSA 1IF2A 4D71A 3LXBA 4EPEC 4XAFA 3NQ6A 1W5MA 3EZ4A 4HIBA 4W89A 3BZJA 5HXMA 5FAJA 4QITA 3TJXA 1GVOA 3MSDA 3VNZA 3AUJA 1FWWA 3PNZA 1Q6OA 2H9AB 4N7QA 3GSMA 4YTRA 4PE8A 2NXHA 3LD5A 1K02A 4PSRA 2FB3A 3UVAA 3DFPA 1AA1B 1PYMA 1GGOA 2J66A 4RZBA 4R85A 2P3ZA 1G67A 1G4TA 2G8ZA 1POJA 5XIMA 4AZ5A 5RUBA 3SN0A 4AIBA 1FXPA 4L4PA 4O8AA 4HZ7A 3GBDA 2NQJA 3IV8A 1TMHA 5KZMA 3UWYA 5I00A 3L7RA 1HQTA 4L61A 4OGZA 1FFRA 4ZO7A 1FP9A 4Q8PA 1WA3A 1QNSA 4D1JA 4HCHA 3TYEA 2O7SA 1SW0A 4YN5A 5LNVA 3HV9A 2JEQA 4U2YA 4LANA 5BMWA 4NIRA 3GH5A 1VFFA 4HP5A 5CAHA 3THCA 1F2JA 2GSHA 1Z8AA 2W6RA 4NJJA 3CYJA 1OB0A 4CD6A 1V3LA 2VGFA 2CLHA 2CLPA 4FALA 2O9PA 3T2OA 4FX6M 5B7YA 2Y88A 3NSXA 1B3ZA 4QISA 4Z2KA 4KCVA 1EP1A 1EWEA 3SY8A 3QM3A 3RPDA 1T6MA 3EKGA 2AL2B 2BS9A 4MLRA 4UOJA 1B30A 2C18A 5BXRA 4ZENA 1Q8JA 3QXBA 2JK2A 4EKJA 1OGSA 2V81A 3STEA 3QSRA 1DE5A 1PSCA 3FV9A 3VGEA 1C3FA 1TB3A 4YCOA 1YNPA 4MJZA 1XLBA 1F3TA 2XSBA 3CAWA 3O7UA 1WDSA 1C9WA 3NGJA 1BSIA 2HPIA 3L67A 1H60A 4RNHA 2RFGA 1X8CA 2QEZA 3ATZA 2NVCA 3N2BA 3W7JA 4NQ1A 4C6FA 4GXWA 1AMYA 4KKXA 1CGXA 3DKJA 4AEEA 2ZRYA 3VPLA 4HPJA 1LOQA 4KCWA 1LZOA 4ZB5A 5T91A 4O14A 3TMQA 4K38A 3WLKX 2Q02A 2CLOA 5D30A 4Q8UA 2NQ9A 3NZRA 3GXMA 4W8BA 1R86A 3K2GA 4LAOA 1M3UA 2FGZA 1DJNA 3R11A 4DRSA 4PCTA 2WWDA 4GJ1A 3CV7A 3UWWA 1LBMA 2ZUSA 4IX0A 5CGTA 1TO3A 1U33A 1HZYA 1OFPA 2V5CA 2WJEA 2VENA 3S5NA 4XZIA 4GIAA 1K4HA 1BWVA 1XPGA 1CXLA 1ZRQA 4MPQA 3P61A 1H7WA 2X8RA 2FKPA 1A5LC 3AQUA 5TF0A 3FJLA 4IMAA 3KRZA 3GG0A 3AIBA 2XVGA 2OSWA 5IBXC 1NOWA 1FOBA 4MNMA 1FBAA 3UZJA 1YYAA 5HNTA 1EOKA 3KVLA 3GDLA 3CWOX 3GW0A 2E1WA 3AZTA 1DIKA 3V18A 4CCZA 4YLWA 5CPQA 4EF9A 1W5PA 4RXFA 3RPMA 4MF4A 3NQ8A 5LZLA 1EEXA 2C0AA 4L1GA 3W82A 1CXIA 2G3FA 1AW1A 1DEDA 1JZ3A 2ISFA 5LNUA 3TSBA 1EX1A 1UROA 3BOFA 3HPFA 1NP2A 4F48A 1UKTA 2NZLA 2I9UA 4AB4A 4GHRA 1M6JA 4F0RA 3D47A 4YTTA 2XM2A 4YTUA 1GZGA 2QS8A 4KQNA 1JI1A 3E5PA 3E2QA 1FWBC 3VIHA 2G3MA 3ECQA 1OINA 2V5KA 3V3WA 2PDBA 1IR1A 2VZUA 3T0AA 2GGIA 3BV7A 1GHRA 2ACUA 1RJQA 4IMEA 1JDEA 1UWSA 4PUUA 1P6BA 3W7IA 3PBYA 3DX5A 5G4WA 3TOYA 1VIZA 3GZAA 3MSRA 2PDXA 5AECA 3R94A 2PU1A 3PTDA 1YQ2A 2E6YA 1P0NA 1BKSA 2ZUTA 2BBFA 3HGOA 4JQ4A 4C6MA 3N4FA 5C2CA 3WLNA 2AKZA 5HJYA 2NV9A 4DB7A 4D6GA 3P84A 1UA7A 4YS1A 3RXZA 2I56A 2XFYA 3V1PA 2OU4A 2AAAA 2VHLA 3MMDA 5K7JA 3OZYA 3UWQA 1ZTVA 1W5NA 4QNEA 3SUUA 3OQEA 3VDBA 1T99A 1ZFJA 4UTWC 4HJFA 4M81A 2YXGA 4IIEA 1A5OC 1EGMA 1M7XA 2V0TA 1V6UA 3TC7A 2BG5A 3TC6A 3QQ0A 1ZUAX 4GINA 1GOQA 1XP3A 2BFGA 3IIXA 1WXJA 2E25A 1DQUA 5G1MA 1B3YA 1CXEA 1WE5A 4LAMA 2UZ9A 2VFIA 2E40A 4W9TA 3AI0A 1DP0A 4PTDA 4V28A 5EMKA 4S3GA 5BXPA 1LYXA 3KEHA 4IGMA 4Q8TA 5I2UA 1LM1A 4HT3A 4GVGA 4IL0A 4BF7A 1JAEA 2OPJA 4Z42C 2D69A 2ZRVA 5GJPA 5G4HC 1VJSA 1KTCA 3HZ3A 2GYIA 5HJXA 1J6PA 2PC8A 3M0IA 1DE6A 5KZDA 1MDLA 4Q7NA 3M0MA 3LCFA 4WY0B 5FJRA 5HAOA 3U2CA 3S8HA 2OGYA 1HUVA 5JUVA 3NGFA 3C8FA 4NX5A 4H9VA 4IIDA 3UZWA 3DZ1A 3WEZA 3WDPP 1A5MC 5FJTA 3PVFA 4JQ1A 3DHFA 2J7DA 2ONEA 4J2PA 1PJ9A 4K68A 1TRIA 2XYLA 4TIMA 3WG6A 8CGTA 5HMFA 3TXZA 3LYEA 3URNA 1SUXA 4IHCA 1NP0A 4UCFA 1H1YA 1NY1A 3N14A 2BOEX 3LLDA 1VPQA 3TW9A 4DI9A 1P4CA 4PMYA 4NYYA 3WEOA 4A8IA 3LNMA 3VX1A 3DI0A 3ZS4A 4LU0A 1H11A 2HZGA 4XV0A 3OW1A 4Z0JA 2CZDA 4O53A 5A6MA 1BG9A 1XI3A 4DEFA 3HGRA 1HKMA 1TQXA 3ITGA 1BAGA 4NJGA 2I7GA 4AXKA 4WXYA 1PZ0A 1H2JA 4BKNA 3I4EA 3KTSA 3W26A 1KM5A 1YLVA 4DJEA 2DP3A 5HJLA 3UXDA 3EPNA 2VJXA 1G94A 1M41A 1D3GA 1PKLA 1QNPA 3WO8A 4NT0A 2DIJA 4AWSA 1EIBA 1OEPA 2QUTA 3B9DA 3WH6A 4J28A 4JIQA 3T09A 1BYAA 1CXHA 2BV9A 5BOFA 1OFOA 2BMBA 2PP0A 5MKGA 1ADOA 2OX4A 4FB7A 3UWZA 2YCKX 1BXNA 3BJFA 4UR7A 3DBPA 4LRTA 5H8UA 5FA5A 2QKFA 3RM9A 1T96A 4RPPA 3KHJA 1N2VA 3W1UA 1A3XA 4ZTYA 3L5MA 4JYEA 3KCJA 3REQA 2C1IA 2DZPA 1UR3M 1XL9A 1E5NA 3EXSA 4QE5A 3F03K 2D2GA 4LYRA 4DWSA 1X1NA 1S38A 1V77A 3W23A 3W2MA 1L6GA 4DQWA 2VEIA 1OCQA 2ZADA 4TMBA 3HURA 2X1TA 3AS0A 3OBKA 1YDVA 3BCFA 1VFTA 3IARA 1R3VA 3AUOA 2YL6A 3I3DA 1AH4A 1Z44A 2WBGA 2B81A 1ONXA 1UD2A 4O18A 1AD4A 3MV01 2XGBA 3NQ7A 2NX3A 2LLEA 4IQDA 3MP5A 1OK6A 3V36A 3ITXA 1TJ2A 3GIPA 2ZYFA 2QIIA 4UFIA 1O5KA 3N2XA 3MUXA 1E3ZA 3A5VA 1C92A 4ZA0A 1CTNA 3BLIA 1UQYA 3AICA 4O0ZA 3VMPA 4Q4OA 3LTYA 2ZZ5A 3CQIA 1GQNA 2D3NA 4L1WA 4YVXA 4CEXC 2OO6A 3ZMRA 1S3HA 1XISA 3ES8A 3SN1A 4IPJA 4Y9MA 4YJ5A 3U2OA 1Z41A 1TJPA 3N04A 1CGWA 2FDMA 2OKOA 4W8AA 1FWEC 1J9YA 1FCBA 3ID7A 4LQ1A 5C9RA 4F8XA 1WAWA 2OYMA 3MVTA 3SUVA 1V6WA 3K4DA 4DHGA 2CZFA 1QDSA 3T05A 2UY5A 3NOYA 1TSIA 2OZ3A 1UH2A 4NZJA 2VFDA 3EPMA 2OZ0A 4M1BA 1PCWA 2ABAA 3O0FA 5REQB 1RK5A 2YJQA 5HUPA 2XVLA 3WMCA 2NQHA 4R9OA 3LB0A 1POKA 1E6XM 1DJGA 3FW6A 4XSLA 3SI9A 4QJ4B 3B97A 1FKXA 1JPHA 1O4UA 2ZRWA 3SW6A 1D7KA 2VZSA 3RPTA 4F9JA 4X2PA 3KCOA 5AZ0A 1Q3NA 4L80A 5F1VA 7TAAA 4KRUA 1UP3A 4XB3A 3GIQA 2BASA 5FF7A 3KLKA 9CGTA 1QATA 1XBYA 4L6OA 1QHZA 3MSYA 1YXDA 4ROQA 2ZWYA 3QLLA 2YFNA 4GK8A 1RY0A 3AAMA 1C8QA 4Q4QA 4O4VA 1EC8A 2VDGA 3UT0A 1E6ZA 5HPOA 4DO6A 3W7KA 4R27A 1I2PA 2PB1A 1RSCA 2EAWA 4MWAD 2DUAA 6TIMA 3D6NA 3BC9A 1J0IA 4XTDA 3VE7A 2FZDA 4W85A 2B7NA 2B0MA 4NI3A 4QS5A 2QIWA 4MWAC 5BXSA 4NAEA 4HYWA 6ENLA 3WK3A 3DYPA 4EPBC 4HCDA 3CLWA 5LSMA 3DUGA 2NSXA 3RX4A 1W5OA 3RLHA 1IEVA 4AWTA 5I02A 2RJHA 1BXCA 3PF3A 4NRSA 1L0PA 2D2JA 2C7FA 3B0PA 3GYCA 3OA5A 1ONEA 2PWFA 5I7GA 2QDGA 3PUGA 3ZJ7A 5H8MA 1NFGA 3C3UA 1HT6A 2WB5A 4OBSA 1EDTA 3WBAA 3MS8A 1LUCB 3R0DA 4LYKA 2NX9A 1BYCA 3BICA 5FCZA 4OE7A 3QGKC 4EVZA 5BZAA 3BV4A 2WO5A 3MA8A 3AS1A 1QI2A 3R43A 2V68A 1U1HA 3F5LA 3FJ4A 1BGGA 4ML4A 3CHDA 1KBBA 5LIWX 1FHLA 3LXCA 5FF3A 1A5KC 3KOFA 4JXCA 4QQUA 1E51A 3MYPA 4IMFA 3EKLA 1XD0A 2PLMA 3KVKA 2JE8A 3BTNA 1E6SM 1EJUC 2YXOA 4J35A 3QKZA 3KFTA 1CGTA 3AS3A 4JQ2A 3N34A 1V08A 3CH0A 3QR0A 3WQVA 3NL6A 1R3TA 4W7WA 4HCLA 5FAGA 4DAIA 4RLIA 2VTFA 3GG1A 3TX9A 3DGRA 1VB9A 4XAPA 1JXJA 3W70A 2IMRA 2F7FA 1S1PA 1WX0A 3JS3A 3TQVA 4FNSA 3VKDA 3P5ZA 4WDUA 1VFSA 3H55A 4MUPA 3GU9A 5U4NA 1X1ZA 4ZQOA 3ARQA 3CMJA 2GFTA 2ZZ4A 4RX0A 5KITA 2FIQA 2XINA 2PTYA 1CCWB 2BZNA 1F07A 1XYZA 1XC4A 1I1WA 2QCHA 1XHGA 1XIFA 1YTKA 5EBUA 4PUDA 3S5OA 3UR5A 1C8XA 1GPFA 2MUCA 3WH5A 1V3MA 3OVPA 5BCAA 3S2CA 5EMJA 1UR1A 5I09A 3QVQA 3WFLA 1MWOA 1MXDA 3TW7A 4TX9A 4LUTA 3VGDA 4H9TA 3II1A 1BQGA 3VZZA 1GYLA 2XZ7A 4AF0A 4DWSC 1EYEA 3NG3A 2XGIA 5FF4A 2IKIA 5A8MA 3N13A 1ZL1A 4H04A 1GONA 2ZIDA 3O16A 4RV8A 1JD7A 2JGQA 4UTJA 3ZR6A 3NSMA 1UJPA 5KZ6A 1EJSC 4XUYA 2YSWA 1J18A 1QW7A 3PWGA 3XIMA 2ACSA 1W31A 1EJVC 2ZA3A 4OUIA 4UXDA 1DXIA 5BWAA 3IJDA 2DJXA 3SN4A 4O1CA 3FS2A 3VKBA 1WUEA 4JZ5A 4L9YA 2ZA1A 1XIEA 4E38A 5TD4A 1JPDX 4PODA 2IQDA 2X2GA 2HWGA 4FNRA 4XKYA 3TA6A 3WJYA 5MKGB 3SCUA 4PTVA 3N3TA 3CT2A 4PN2A 4PMVA 4I7VA 3T2PA 4PFHA 3F4NA 1UOKA 3SCOA 5CBJA 4B5SA 4LUJA 4G1KA 2J9YA 2W3ZA 3EEZA 4LS1A 1UQZA 1E0WA 1YMYA 2B7PA 3ABOA 4NVTA 3ES7A 4KW2A 4X22A 3WH8A 3MI2A 4XO7A 1S46A 4CGTA 5I3HA 3REQB 2VX7A 5FL0A 4BI5A 1R30A 1QR7A 3V16A 1RP8A 1CECA 2JBMA 3GVGA 4X63A 2PA6A 4HYRA 2O55A 4AZIA 3RU8X 3T7VA 1DJHA 4IOTA 3NYZA 3AHXA 4BQ5A 1PKYA 3UWEA 3AU2A 4GIYA 1H0GA 4AIEA 1MW0A 4JTQA 3E0FA 4JDYA 4O16A 2NW0A 3IVSA 4Y8EA 1DV7A 1ZSXA 4KWSA 4D6IA 1I2NA 5T9CE 1OVDA 2NXIA 1EWDA 3HQ1A 2XM1A 4LNCA 4CD4A 4U33A 2PCQA 2VFEA 3LUTA 1B4EA 1NARA 4WZHA 2E9BA 2VFGA 2DZAA 1EC7A 3SO7A 1JYVA 3RX3A 1S2TA 5LGZA 1EPVA 1XYAA 1SPQA 2XIMA 1VCGA 1M04A 4GX9A 3HG3A 4M56A 4E8GA 5CSUA 2E9LA 1OABA 1FP8A 4I7WA 3KE0A 1TJ0A 2GSJA 1OYCA 3G18A 3GDKA 1GK8A 1A4MA 3P0XA 1IGSA 3CEPA 2WVUA 3PZVA 4LBSA 4HTYA 3HFYA 5C70A 1VR6A 2HK0A 4GOAA 3RO8A 4MADA 3BK0A 3VKKA 7XIMA 4E4FA 3IJ8A 3W38A 2AOSA 4IMDA 2E5DA 4AHOA 1D3CA 1OG6A 2VT0A 2OEJA 2VCBA 4H6EA 3PUEA 2VC6A 4N9EA 2R8WA 2VGGA 2Z24A 3UQNA 3UZYA 4J9JA 2O7QA 1AODA 4UNKA 3UW6A 4K3ZA 4I8DA 1XLGA 5D05A 1EC9A 4NZ1A 5EBAA 2VWTA 3W1NA 6ALDA 2PGEA 3SURA 4K1GA 3QFWA 3CV6A 5CSYA 2FJKA 1UUOA 1N8WA 3L66A 4PULA 2ZDSA 1UKOA 3GM8A 4LWWA 1U83A 4NJIA 3WEMA 4EP8C 3H7UA 2OQLA 2Y85A 3QV6A 1HO4A 2F9RA 5DQPA 5CJNA 2HQAA 4LY4A 3NJ3A 3N1AA 3QOKA 2VX5A 4Y9OA 1XRSA 5ENLA 2NV1A 4GX8A 2GOUA 4LUSA 3CMGA 4ZQCA 5EFFA 3PZTA 1VD6A 2X0YA 4YMZA 3SADA 4IL2A 4KWOA 3CTLA 3EWBX 1L2QA 3L5LA 2GQ9A 5LIUX 3UD6A 4H6KA 5D8ZA 4GI4A 1N82A 3AIRA 4H9XA 2GVLA 1YPXA 3WH9A 1G4PA 3BLPX 2V67A 1W8SA 2GLKA 4LGXA 3EAUA 1VGAA 4FZIA 3WF0A 3VM5A 4OV9A 1JNEA 1OCNA 2QGYA 1EYWA 5I06A 6XIAA 3IJ7A 3A9IA 1GQLA 1ISXA 1GJUA 1QHOA 2IPFA 1UIOA 1R7OA 2OX1A 3ZVHA 2CCRA 1VKFA 1E1CA 2QAFA 1ONRA 2YCJA 2YL9A 5EMUA 1DXEA 4X60A 5AHFA 2DGAA 3NDOA 5H91A 3GXNA 4Z1BA 4H9UA 3EWCA 2Y4SA 2PF8A 3O6CA 1EHNA 3CYVA 1Q6CA 3HG4A 4ZQPA 4NZFA 5CCZA 4H1ZA 3OO2A 1GEHA 2PWEA 4HU4A 3UPMA 2XPKA 3Q4DA 1OT2A 2WMHA 1K6WA 2W66A 3NOEA 3M44A 1YBQB 1UZ1A 3WL0A 3DHDA 1KWGA 1EUNA 4XZBA 1U5JA 4GUHA 1FWTA 1QI3A 2X0HA 4PB5A 1ONWA 1PZ3A 2XH7A 3IVTA 1WO2A 3C52A 4J7RA 3C0JA 3KDOA 5CLTA 2VYOA 4C5YA 1C90A 5DXXA 5HINA 4LY8A 1YHTA 4GQGA 4HMDA 5D09A 4Q4SA 2FPVA 2DU2A 4IM4A 4YTQA 3BGGA 4A2RA 3WK1A 3ZSSA 1D9EA 2EG6A 4MJMA 3W7MA 5PTDA 3O9NA 4D6HA 4D6FA 2XFWA 4W84A 3ZR4A 3S2NA 4XD4A 4S3JA 3V35A 4HK6A 4IFRA 1JCNA 2DV0A 1YNYA 2ZXBA 3GB6A 1OHLA 2JFEX 4JTFA 4LUTB 5CEWA 3MCOA 3H23A 1BXBA 3GBEA 1E0VA 2QJMA 2WW5A 2R1LA 3U2EA 2W67A 5CG7A 3ITYA 3VI2A 5HDRA 2EPNA 2YXXA 3GTIA 4G7EA 2VNCA 4PRTA 1LWJA 3MUAA 4HN8A 3N15A 3C0LA 1P1XA 2BVYA 4HZ6A 3M5XA 5LA1A 3HBLA 3EOSA 3WNOA 5CPMA 3TYZA 1ICPA 4K8HA 3UXLA 1TCMA 4CEUC 2FDSA 4WJXA 4HMNA 4AHQA 1FCVA 3RCNA 2R91A 3O6YX 3ABXA 4QS6A 1GW1A 1V6VA 3PZ9A 1I9CB 3PZGA 3WLOA 5DFAA 2J8GA 3EDFA 2CLIA 3AFBA 4UIOA 3MB9A 1IXPA 1U1JA 2L5HA 1RD5A 1A3HA 4TQTA 1F6KA 4WKHA 1KRAC 3YPIA 4KWVA 3QH2A 5A8OA 1ZJHA 5AVNA 3GNDA 2FZMA 4BHYA 2WC4A 2AGKA 3OQ8A 4DZ5A 1WOAA 1UD5A 3LSCA 1TV3A 2PDWA 1AUSL 3BSGA 2A3HA 4O1BA 3W1PA 3G3DA 1VQTA 3H2OA 3WLRA 3RGTA 3G0XA 1H41A 1ALDA 2W92A 3MT1A 3WY1A 4J40A 4H2HA 2Q71A 4A3UA 2PP3A 4AVNA 1JEZA 4C7FA 4PMQA 4EPKA 1LRTA 3WYZA 2YR1A 3DENA 1WKYA 1YKWA 1MQPA 4DY1A 3H70A 3V7PA 3AXKA 1RCQA 2ZZ3A 3TYDA 4C6PA 5C9WA 1UR4A 3MANA 1L6WA 3DHPA 2VGIA 1XLLA 3LS9A 2VQTA 4HU8A 3ZOAA 3B9OA 1W1PA 2Q3OA 4IMGA 1XBZA 4ICMA 1WYIA 1MNSA 1BYDA 1EX5A 5H8PA 1AK5A 3U5YA 4DJDC 4RW5A 4GE8A 1U30A 2CBIA 3APYA 2Q8ZA 3CUFA 3NZPA 2WSKA 5FJIA 3I68A 1QOQA 2ZE0A 2A6NA 1ITXA 4M82A 4EPDC 3ABQA 1GWJA 3UFYA 3E12A 1OQFA 2DSVA 4CU8A 2DZSA 2QV4A 3SRKA 3I65A 4NG3A 2YB1A 4E4UA 2E8YA 3SCQA 1MQRA 4Y7EA 1W9PA 3BG5A 1FWCC 5D03A 4QEEA 2DZXA 1N8FA 4IGHA 1W3LA 2Z7GA 1UHVA 4LTSA 3M46A 4QRNA 5BYWA 4MNJA 2FMOA 1XG4A 3MZNA 3WBXA 4F0HA 2XVNA 1DJQA 1XLFA 5LA2A 1OC5A 4DM2A 4QAWA 3LG3A 1KO0A 5FSDC 1IEQA 1WDDA 3P60A 4AMAA 4DZAA 2WWCA 5GJMA 4LH8A 5G1TA 3MKKA 3UJ2A 2W0UA 4G2DA 2VURA 4ZOBA 1HKJA 5KSWA 2D23A 2OMAA 1XS2A 3M9YA 3USZA 1W9VA 2Y8UA 3UNTA 4MLJA 1OJXA 1LRQA 4RNJA 2E5CA 3BVJA 3LENA 4DJFC 4AW7A 5F1UA 3U3HA 3H26A 4DNHA 4KEMA 1FDJA 1NTHA 5GVJA 3ZXWA 2GJXB 4BY3A 2HBXA 4LUIA 3UJRA 3RDKA 3VFLA 1J0HA 4JTEA 4NX0A 2Y6ZA 2V63A 2PDLA 4O13A 1V6XA 3M0YA 3K1DA 2I9EA 1VFMA 2CLKA 1Q5MA 3LHWA 4CNPA 5ECUA 3UZZA 3NDYA 3Q65A 1S39A 1IHIA 1N7KA 4FLQA 3L4WA 1DQXA 4A22A 1JL8A 2I16A 1RLCL 3N19B 1B54A 3UGVA 1XYBA 2VRJA 4D8ZA 1MSSA 3QC3A 1NM9A 2WQDA 2C3ZA 3QZAA 4AZGA 5CPOA 1VJIA 1TTIA 2PAJA 5SWUA 4I9AA 1GZ1A 2EXOA 2WZIA 2QAPA 2IPJA 4IWWA 4K37A 1GUVA 3MW7A 3QY8A 1UR0A 1B31A 4Y9AA 1G7UA 3NCOA 4QSFA 3G1RA 2VKZG 3QR1A 3WDJA 3K4WA 1JI2A 3L4YA 3BMVA 2ISWA 3EX4A 4YL2A 4XZWA 2HEJA 3IK2A 3LI1A 1UR2A 2CLMA 3BW4A 5DMMA 1LBLA 4F40A 3L2IA 3DKLA 5F4SA 3KBWA 3EWUA 2JIWA 5F7UA 4HA4A 3UCQA 1QW8A 2BGSA 3AU6A 3LCLA 5CLWA 3ITOA 1E1CB 3TV8A 4GI8A 4MFDA 4XZHA 2PWVA 4O0KA 5ECVA 2XVPA 3UWVA 1PX8A 4ATDA 5A5WA 1W1ZA 1DBTA 1B3WA 1TRDA 3HG2A 2A3LA 1GQIA 2BODX 1W91A 3ABRA 3ZJ8A 5C6MA 4XQ6A 1KFKA 3NZQA 2ESCA 4A3QA 1WBHA 1KBLA 2DFAA 3M6YA 2EPOA 3MSGA 2ZX5A 4H8NA 3G0SA 3VD7A 4GY1A 3VVGA 3TLLA 4BR1A 5HA7A 4UNIA 4HSNA 3OODA 1QOXA 4I5XA 4R9XA 1GCYA 2J9XA 2E3ZA 4RNIA 1IQ8A 4JTJA 4LYQA 4Q8WA 4JNZA 3CUJA 3M5YA 4TUFA 3AWOA 4V27A 3JR2A 2A1YA 1MNZA 3L4VA 2C19A 2H3BA 3TJIA 3QPYA 5C55A 3GFXA 3VD3A 3TDFA 1D2KA 3HN3A 3LQGA 4HMEA 5DT5A 1UG6A 4CNSA 1HJQA 4C60A 1QUMA 1FKWA 2ZX6A 1TWSA 1XW8A 1WOBA 4XKMA 2NUYA 2QF7A 3R25A 1VC4A 4M24A 2BY0A 3AMCA 5A8GA 2NLIA 1D8WA 3A22A 1KFLA 1Q13A 2OWWA 2YZRA 5LNSA 3WQPA 2X42A 4BF9A 2Z26A 2IKJA 6REQB 1XIIA 3MDWA 4WK9A 3W2JA 5K3VA 3CT7A 5LNWA 4XVDA 1EXBA 1XYCA 2NXGA 3QPEA 1JVNA 4D6JA 3GW3A 3AC0A 4HA1A 1OG0A 3RLGA 3PZMA 1KCZA 1RVKA 1ZPTA 2ZC1A 4LV4A 1DJIA 4MTVA 4DUVA 1PIGA 1XH1A 1M7PA 1PE1A 4M7SA 5I79A 3T4WA 1Q7QA 3C0SA 3LHVA 4UTUA 1XRTA 3AALA 1I2QA 1XG3A 3W1TA 1GQKA 2E67A 1OIMA 4HJWA 1E9YB 4H4IA 4BQ2A 2CBJA 2Y62A 1SW7A 2O92A 5F4WA 1WBJA 2WV8A 3P82A 4ZB0A 5A3HA 2EJAA 2E6AA 3DFQA 3S5YA 1F9CA 4AC1X 4A35A 3E0IA 3UA3A 3ZZ1A 1XUUA 1GOXA 4JYFA 2GL5A 4QE1A 4KGLA 5IRPA 2XIJA 3U57A 4Y6GA 3ZWTA 4DYJA 2E1DA 3E38A 3VTRA 3A24A 3OBEA 4UB9A 8TIMA 4PMNA 2CWXA 2BY2A 2HE8A 4JIPA 4FK9A 4G1NA 4LCRA 2X1IA 2Q01A 1UR9A 6PTDA 1Q7ZA 4CLMA 4WSHA 1JD9A 5GNZA 3FFSA 4JGDA 2E77A 1EFZA 1P6WA 5JU6A 3WUGA 1O66A 3PUDA 3RCMA 1NDYA 1VYSX 3V0TA 4M0XA 2EPMX 1AQHA 4QCFA 3ZSTA 3TFXA 3CXOA 1SJDA 4Q6XA 4JHMA 2PDJA 2RH9A 3EB4A 1XIDA 3Q2DA 3PSVA 1Z7AA 3UWUA 1YXYA 3EX3A 3IRSA 2DW7A 4HHMA 5HQMA 2R9RA 1TWDA 2GDVA 1EUAA 4OU1A 3ZLGA 1LL6A 4DYKA 1KXHA 1IZCA 3TE9A 4D6DA 3CLMA 1W3NA 3CB8A 5CJ5A 1PEZA 4DXXA 1JFXA 1R7AA 1CENA 4LX4A 3NA8A 3WD3A 3V75A 5HULA 3GAYA 3MTWA 5HWNA 1R3YA 3LPOA 2J74A 4QTGA 1PO9A 4RDYA 3WLJA 3GG8A 3QQ1A 2WNQA 2ZA2A 2JEPA 2YA0A 2JF6A 3WNNA 5G2HA 1EP3A 3EMCA 3EWDA 1KGXA 4C6CA 5FACA 2VI0A 2VC9A 4PEKA 3BG3A 2GOKA 2Y63A 2F2HA 3ZIZA 3UG3A 5LHFA 3E9AA 4P7OA 1X7IA 4WIWA 3M6D