1H11A

2-deoxy-2-fluro-b-d-cellotriosyl/enzyme intermediate complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Direct Experimental Observation of the Hydrogen-Bonding Network of a Glycosidase Along its Reaction Coordinate Revealed by Atomic Resolution Analyses of Endoglucanase Cel5A
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 116
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h11A00
1FHLA 2WMFA 4OOZA 1GNXA 2XVKA 2GJXA 2X09A 1E1EA 4U33A 1QI5A 5I78A 1J10A 3CUGA 3MMWA 1WP6A 2ZUMA 3O9NA 3N12A 1HVQA 4HA1A 4J3XA 1HJVA 2CYGA 2OYMA 1JL8A 2BS9A 3LPFA 1CECA 2CITA 3FHQA 4AD1A 3BSGA 1JZ8A 4MADA 4CUCA 4MNKA 1HKIA 4ACZA 1J01A 4Q22A 4B15A 4Z2GA 1CBGA 1B0IA 1UWSA 1W1TA 4HMEA 3VNZA 1P6WA 1JZ3A 1KQZA 1WZAA 2EPKX 5AY7A 1E4IA 1B3ZA 2VZVA 3CIVA 3GBDA 4ZE5A 3GNPA 2ZOXA 1UKSA 3UR8A 3OLIA 3CHEA 5FD0A 4AMCA 2FGLA 4ZEPA 5FL0A 2WKGA 2WC7A 3VX1A 2DEPA 3BH4A 3WF2A 4QCFA 3SCUA 3TTSA 1IV8A 2GSJA 5AYIA 3WNPA 3RIKA 1E56A 2PB1A 1EDTA 4HP5A 3PZGA 4J28A 3BCFA 5EMYA 3BLPX 2XYLA 1OGSA 4TXEA 4PCTA 5CG0A 1YHTA 1KFWA 3WUFA 1XSIA 2WMIB 3NSXA 5GPRA 2WAGA 3K4AA 4LYQA 5CJ5A 4BQ2A 1EO5A 3I3DA 3WH5A 1VB9A 1HJQA 3VM5A 2ZXAA 4CU7A 1Z32X 2FH6A 2FHCA 4A4AA 3WDIA 3FN9A 1TA3A 4U31A 2YJQA 3GH4A 3OA5A 4UFKA 5E0CA 3VGGA 4Z2IA 2W61A 2WCSA 4HMCA 2ZIDA 1QNQA 5F7UA 1I1WA 1VEMA 3L4VA 3MANA 4CCCA 3VOCA 1XV8A 1W3LA 1NP2A 4D6CA 3BGAA 2GK1A 2G41A 4H04A 3MV01 4UFJA 5TD4A 3VDAA 4BS0A 1WZKA 3I3EA 1UR2A 3BAWA 1GHRA 2DSZA 1QBAA 3OLDA 3CGTA 1BFNA 4TTGA 4E8CA 2WYSA 1GQKA 3W53A 1ZBCA 2E40A 2WBKA 2BY2A 3S2CA 4S3KA 4H8VA 3F4VA 4CN1A 4EK7A 1L8NA 3A6OA 4AZGA 1OT2A 2EJ1A 1RH9A 3GM8A 3K8LA 1ITXA 1M7XA 4GZIA 2WLYA 2BVYA 4PUDA 2YA1A 1TE1A 5DFAA 3RO8A 3FY1A 3W38A 4NRRA 3KL0A 1UA7A 2NSXA 5HPOA 4YHGA 1M04A 1CXHA 3CZ8A 5E6ZA 3W25A 3BSHA 1J0KA 1OSEA 1HKKA 3K4DA 4U5IA 4DWSC 1E70M 1GZJA 1GONA 3AICA 4PMQA 1UD4A 3QHNA 1ESWA 2XFYA 2CPUA 2DQXA 1Q6CA 4IISA 3TP4A 3HN3A 4TOQA 1BG9A 4IUGA 3WH8A 3WQ8A 4ZXLA 3ARUA 1SFSA 5BWFA 1TFVA 5HOSA 1GQLA 1GOKA 1GOIA 1LF1A 3HU7A 4GO8A 1FFRA 2EPNA 4LYRA 3HMCA 3PTQA 2OWXA 1JF5A 5BRQA 3VMOA 3WIJA 4UFIA 3QHOA 2J7HA 1DWJM 1BGAA 3NDZA 2D3LA 1Q6FA 2WXDM 1CDGA 1MYRA 1W32A 3CUIA 1UH4A 2YL6A 1MW3A 3ZJ8A 1OD8A 1FP8A 1VIWA 3GXIA 4LPCA 3PBGA 2A3AA 3VUPA 4H2CA 4CN4A 5E6YA 1LWHA 2X1IA 1V02A 3K1DA 4K68A 1JFHA 4JAWA 3SCNA 1NWUA 1CIUA 2ZUVA 4M24A 1A47A 3WY1A 5KZ6A 1TMQA 4WK9A 4B9YA 3K8KA 3D3AA 1CLXA 1UA3A 3WBEA 1GQIA 4QLKA 1X6LA 4AZ5A 1WDSA 3WBAA 2JALA 3EDJA 5FCZA 3CMJA 2QMKA 1KXQA 1NWTA 5I2UA 2XHYA 3CPUA 4PMVA 1V02E 4UQEA 1Q6EA 2VO5A 1ZS2A 1EQCA 2BY0A 3AMGA 3L2MA 4PBGA 2G8ZA 3FW6A 2UY4A 3AIVA 4MNJA 1JXJA 1UHVA 1WZLA 2VZSA 1J18A 1I75A 3GXMA 5A6BD 5A6KA 2VJXA 1W3JA 2AAAA 4UR9A 4ATWA 2VL4A 3G6MA 2YL9A 3MUZ1 3A3HA 5JBDA 3FXYA 2UWFA 1FA2A 2E9BA 5LA2A 3CZJA 4CVUA 4FLQA 2RGLA 2J62A 3NCOA 5A69A 3POHA 1KQYA 2VVSA 3W6MA 4JCMA 3T2QA 2PWHA 3CH9A 1E6PA 1SYTA 5A94A 2NT0A 1J0JA 3IANA 3CZEA 4UQCA 2C7FA 3PZVA 1VJZA 4IPNB 3F5KA 2FGZA 1J11A 2W66A 4AIUA 2WW5A 2ESCA 1HF6A 3AXXA 3WD4A 2WBGA 4KGLA 4DWSB 4E4PA 3APGA 3JUGA 2Q8XA 3KE0A 4XX6A 2Y8VA 2WCAA 5AC4A 1GCYA 1V3MA 2D20A 1U2YA 4KH2A 2WZHA 1JG9A 1VFFA 1C90A 3VIKA 1UD3A 5IHRA 4ZFMA 1VEOA 2XVLA 2VOTA 1E5JA 4P8UA 1CGYA 3NIYA 1TVPA 2DSWA 1W2VA 2WMHA 1JYNA 5D8WA 5JBFA 1OIFA 2ZUNA 3SUTA 1OT1A 2CCRA 1TG7A 5E9AA 5ABEA 3T2PA 3S6TA 3SCSA 4DM1A 1U33A 4QDMA 1IT0A 1MW2A 1G5AA 2ZX8A 1H09A 8A3HA 2DH2A 2OWWA 4GQQA 3ZSTA 4GI9A 1V0MA 1HJSA 1MQQA 4GZJA 3ZM8A 4CD7A 3DHUA 3WMCA 3OIHA 6A3HA 1W2PA 1E6ZA 5FL1A 4JKLA 4CD6A 2G3JA 4PUEA 3O6AA 4ZE4A 2BFGA 1LL7A 1UH2A 4GINA 2WSPA 2VCBA 3MUY1 3TTQA 3WF0A 3ARTA 3T08A 5CXPA 2DIJA 4WIWA 1PZ2A 1FOBA 1R87A 3GDBA 3VTRA 2E3ZA 1US3A 4JFWA 3WELA 1LL6A 1UWQA 2XWDA 3WFLA 5LA1A 1LL4A 3PZOA 3AS0A 4HOWA 5A6BA 2XG9A 3GBEA 2VCAA 3PTKA 1MFVA 2D0FA 1ZJBA 2OSWA 1TZ7A 1ISVA 4ZXOA 1ZL1A 1N82A 4NI3A 3ALFA 4HTYA 3WD1A 4AD4A 4A3YA 5A6SA 4JZ5A 2DSVA 2XVNA 5A1AA 1RP8A 2D0HA 4UFHA 2XGIA 4YHEA 2W4XA 4PRWA 2CIPA 4P7RA 5E70A 3QHMA 2CEQA 1QI0A 1ZBWA 1UH3A 4JL2A 2HVMA 3WDPP 3WDHA 5CLTA 3AZRA 3WNMA 5CZKA 1W1YA 1V08A 2CETA 2BVTA 1MQPA 2J7BA 1JD9A 2CERA 4X9YA 1I1XA 5A8NA 1WZMA 4TX8A 1TR1A 2WVVA 1E55A 4KMQA 3DYOA 3VGEA 1BTCA 1UYQA 2OYKA 4E2OA 1JZ7A 4WKAA 3SUVA 2A3HA 2A3EA 3CZLA 4UOJA 2XFFA 2V3DA 5BCAA 5CSYA 3WF4A 5IFPA 3NDYA 3UR7A 3GXDA 5BXRA 1HJXA 1PIFA 1MXGA 3BMWA 1W3KA 4QCEA 2XSAA 3RJXA 1SMAA 3G6LA 4R5EA 3WQ6A 4PMOA 3WNKA 1HJWA 4W8BA 1LG1A 4U2YA 2ZUUA 4MB5A 2WC4A 1DWIM 4CCEA 1D2KA 2WMKA 4XV0A 2J8GA 5GNZA 5M3WA 3B9DA 1BYCA 3N1AA 3CHDA 5CPSA 2CKSA 2XPKA 3RM4A 3WD2A 5DO8A 1C93A 3WENA 1V03A 3BAYA 3RM9A 2PWEA 2QHAA 4KRTA 1DEDA 2D23A 1FFQA 1XGZA 4MAVA 1WE5A 1KBBA 3AS3A 2XIIA 1MQRA 3U5YA 1JDAA 1JF6A 2WVTA 3WDRA 1KCKA 1NARA 4BA0A 1E73M 1XSKA 2PC8A 1E3ZA 3N9KA 3ARXA 3LMYA 4AZBA 5D9OA 2CHOA 1GUVA 3NJ3A 4OUEA 4AZCB 2EPMX 4J3VA 1E71M 3CHFA 1C8QA 3M46A 2VZTA 5HDRA 2J7EA 1WCGA 1H49A 3RDKA 1FH7A 1VFOA 4W5UA 5A2BA 1GOOA 4D6EA 2OLHA 2XIBA 2JIWA 3B9AA 2DH3A 4DM2A 3BC9A 2QF8A 2VRJA 3N11A 3SUUA 4FLSA 4AW7A 3VD5A 6TAAA 1EGZA 2VMFA 2WHKA 1UKOA 1OIMA 3EBVA 4BF7A 3VDCA 1EIBA 4IM4A 4ACYA 3FHAA 1R86A 3GNOA 1NOUA 2Z1KA 4YPJA 1G0CA 5LA0A 1CXFA 1QHPA 4PTVA 4MJ4A 1JZ4A 2GDUA 3VIPA 2FH8A 2JF7A 2E8ZA 4C7DA 5GQBA 3N17A 1RP9A 5DT7A 2WVSA 2EQDA 2ZX7A 4DUWA 1XYFA 3SCRA 1HX0A 1UKTA 3U7BA 4P8VA 4UOZA 3AMKA 4W93A 4BZYA 3AQUA 4ATLA 4OKDA 3B8SA 4JHZA 3ZT6A 5BYWA 1M01A 4W8LA 4GQRA 5JIPA 4M81A 2EEXA 2CBIA 1WDRA 3AIEA 2ZXQA 2YA0A 4JKMA 1NM9A 1E0WA 1W1PA 1KR1A 2BY1A 2YBUA 1HJUA 2XVPA 3W24A 4PMDA 2GJXB 4J3UA 5I3DA 3I3BA 4UOQA 2YLAA 1GJWA 1OB0A 4CN6A 1GPFA 3BAIA 3EDEA 3W29A 1J0ZA 1X1NA 1GW1A 4PSPA 1O6IA 3TA9A 4W86A 1Q4NX 4M29A 3WMSA 1PPIA 4FLOA 4W84A 4JIEA 4F8XA 2W5FA 4R27A 1E6SM 1E4LA 4W8AA 4ACZB 1BGGA 3PZIA 2DT0A 1UOKA 4W88A 2D3NA 4X0VA 4OOUA 2VRKA 4L4PA 5ABFA 2VUYA 2PI6A 2VX6A 2CHNA 3GNRA 2XM2A 1BSIA 4WSKA 4D6GA 1PEZA 3T0BA 4Z2KA 2G3NA 1VBRA 2X0HA 4PCSA 1C7SA 5EFFA 1EQPA 1OD0A 1WNOA 3PZQA 2O9PA 1B3WA 1QNRA 1TCMA 3ARZA 4BQ5A 4LYPA 2Z1SA 3VIFA 1H1NA 4TTUA 3PZ9A 4CU6A 3GZAA 4MB4A 5C8BB 1CGUA 1BVZA 5D9MA 3CBWA 5M03A 1K9FA 2YDQA 4F66A 4TVDA 1KXHA 3CHCA 3PTMA 3DYMA 2BNJA 3UG3A 3EDKA 2W62A 3AISA 3WDQA 3IJ7A 5I24A 3DYPA 2Y8KA 1TA3B 2YLLA 3FNDA 1JFXA 3ZT5A 3AIWA 4PMXA 4F79A 4TVUA 5ECUA 1HP4A 2VTFA 3ZR5A 1JI2A 5CSUA 4CCDA 2VX4A 1ECEA 5IHSA 1MWOA 3WKZA 3BXWA 3WMBA 1E9LA 2YA2A 3PZTA 1V6UA 2GK1B 3AHTA 1H3GA 3UG4A 5CGTA 1Y7VA 4M1RA 1WKYA 3BAKA 4HZ8A 1BYDA 3KEHA 2GVYA 4PTWA 3W37A 1CYGA 1K9EA 2BHZA 2WM0A 3L2LA 2ZE0A 2ZXBA 1CGVA 1UR4A 1DWFM 1B3XA 5A8MA 2YL5A 2GDVA 5I79A 4Z2JA 1C8XA 1QNPA 3WQWA 1IZKA 4M8UA 3ARRA 1CENA 2WHMA 3WD0A 5C71A 1C8YA 2PBGA 2EPOA 2CBJA 4MAZA 4Q7NA 4PMUA 1UWIA 2VNCA 1PBGA 4UFMA 5A6MA 2GJPA 4WLCA 4CU8A 1ISWA 1UKPA 4P8WA 2F2HA 1VBUA 3ARQA 3WEZA 1US2A 1H4PA 4U5KA 4GI6A 3O2LA 2O9TA 2V3FA 4NZCA 3WQ4A 2X2YA 1J0YA 1VRXA 3W26A 2UY5A 2PF0A 5A3HA 3DECA 3VM7A 2G4FA 3U57A 1BYAA 5E09A 3OBAA 1UG6A 1PX8A 4D6DA 2E9MA 3VGHA 2D2OA 2E9LA 2VR4A 3AIUA 5DT5A 1B3VA 4W7VA 1B1YA 2VC9A 3AMCA 4IPLA 3ZOAA 1R7AA 5A8OA 5IXEA 5A8PA 3WUBA 1V6VA 1PJ9A 4P7NA 3HJEA 3AS1A 3OGSA 4MB1A 1X6NA 4UZUA 3IJ9A 1UR8A 2PBOA 3VIOA 5C70A 1WPCA 1UQYA 3SCWA 3WNNA 2JE8A 2WMGA 3QR3A 3AMLA 3MMDA 2TAAA 4V27A 1QNOA 3MUAA 1O7AA 1E15A 1G94A 2Y24A 3OGVA 5I5RA 1XCWA 3WNOA 1H5VA 1JGIA 1LQ0A 3PHAA 3N04A 3BCDA 3NYDA 3WQVA 4OBSA 4W89A 1AQ0A 3KL5A 1OGBA 3T0AA 1XH2A 1EDQA 2WLZA 3ECQA 4W85A 3VMNA 1KXTA 4XUYA 4HMDA 5D4YA 1UD5A 2XSBA 4E8DA 1EOKA 1MVYA 1GJUA 3II1A 2XUCA 3AIBA 4HU0A 3MSGA 1V0KA 4X0NA 4RE3A 2ZICA 5BXSA 2D22A 3A4AA 2VZUA 4MTVA 4B3LA 3LPOA 1AVAA 3D5HA 2MANA 3W81A 3ZJ7A 5EB8A 3AHVA 3EDFA 2J7CA 1VFMA 2O9RA 2DDXA 4MNLA 1BG4A 1MW1A 1MW0A 2DGAA 4EANA 4MDOA 4JFTA 5ABHA 3F5LA 3WD3A 2WK2A 3PZUA 1LJYA 3QOMA 3CUHA 3AROA 3PZMA 5EFDA 3ZJKA 4B16A 4HOZA 5BXTA 3CO4A 3SURA 1QBBA 1CXEA 4P7LA 2A3BA 4AYSA 1VAHA 2J78A 2ZUWA 1QVBA 5DMYA 5A2CA 4AZIA 3U7VA 3LPPA 3MSDA 4D1IA 2OSYA 3EMCA 1NH6A 1PX3A 4D1JA 3NSMA 1HVXA 1HXJA 1BHGA 2WZEA 2BHYA 2ZUSA 3L4WA 3MO4A 4MNMA 1U30A 1QPKA 1BLIA 1JZ6A 2GUYA 3K46A 3ZSSA 1E43A 1CXIA 4OZOA 2XFRA 3VD9A 1E40A 3ARWA 1AMYA 5BRPA 1NOFA 1XRVA 3WFZA 2J7GA 2YOCA 3BAJA 3T09A 3THDA 3SCPA 9CGTA 2AMGA 2JEQA 1KBKA 4AIOA 4TX6A 2D24A 3UG5A 1CPUA 2QLYA 3WH7A 3VMPA 1K6AA 3BMVA 1HNYA 1JDCA 1E5NA 1R8LA 5JIWA 4H41A 3WUGA 5ABGA 1XC6A 3VDHA 3N18A 1A3HA 7A3HA 4J3WA 4BCEA 4W5ZA 4UNIA 5GNXA 4KGJA 4GI8A 3A4WA 3ZR6A 3W6LA 4JFUA 1E4MM 2OWCA 3L4UA 3WH6A 2O92A 1S46A 2WZIA 1E0XA 1UD6A 1B2YA 3OLGA 4WJXA 2ZUTA 4XB3A 4Z2LA 1JNDA 1HN1A 2V38A 4AZ7A 1BF2A 1DP0A 2BV9A 1QW9A 4H8HA 4AZ6A 5AC5A 1XD1A 1UD8A 2J7FA 4MB3A 4MPKA 1HKJA 1V0NA 2WMIA 5A6LA 1FH8A 3W4RA 3M07A 3WNLA 4EKJA 4P7QA 1E4NA 1OGGA 1C92A 3OLEA 3RM8A 1WDQA 4A3HA 3CUJA 1KGWA 2QPUA 2DSUA 4EAMA 4WKHA 3MKKA 1W9PA 4ML4A 1HL9A 4AEFA 1WB0A 1VENA 3BLKA 1EO7A 4UFLA 3RCNA 4HZ6A 1ZJAA 3FAWA 2GFTA 4AZHA 2PWDA 3QGVA 4QLJA 5I0DA 4AY1A 4U3AA 2DPEA 1ZBKA 1W91A 2UY3A 3WL0A 3B9EA 1DWHM 3AXIA 1KGXA 2QPSA 2D1ZA 4AD5A 3L4XA 3SCQA 2WVVB 2F61A 4FF5A 1OM0A 2WMJA 4J3SA 4GO9A 1PX4A 1W1VA 1E6XM 2ZX9A 1FP9A 4AD2A 2F8QA 3EMQA 2EO7A 2WHLA 2PWFA 2A3CA 4B9ZA 2V3GA 2WSKA 4JFSA 1B31A 2X0YA 1UZ4A 1Q6DA 1CGTA 2VZOA 1F4HA 1V3IA 2YL8A 3AZSA 3KL3A 1W9VA 2YKKA 5A6JA 4UQAA 3IAPA 2CESA 1LWJA 2XJ7A 1TVNA 1C91A 1UZ1A 5A6AA 3AI0A 3T0DA 2ZX5A 4NRSA 4DWSD 1QHOA 1KGUA 1H41A 3QOKA 4LQ1A 4D72A 3MUIA 1BYBA 3ZJ6A 1G9HA 4RE4A 3UETA 3VIMA 1L0PA 4AC1X 3TONA 5CLWA 2DT3A 2VX5A 3WF1A 1KB3A 1J9YA 3LPGA 2VQUA 3VGBA 1DHKA 2FHFA 4ATDA 5AYBA 1VEPA 1CWYA 1PAMA 1JAKA 2JEPA 3ALGA 1W9DM 3AYRA 2J4GA 3IK2A 2QMJA 1GOMA 3AHYA 3F5JA 4UZSA 2EPLX 1JNEA 3OGRA 2WPGA 1JAEA 4MJ2A 3UCQA 2ZWYA 1ISXA 1E72M 3SCVA 3VD3A 4RL3A 4KRUA 2J7DA 3MS8A 3NSNA 5IFTA 1WDPA 2XM1A 3PN8A 4JKKA 4AWEA 4URIA 1V6YA 4J3TA 2XWEA 3ZMRA 2DSKA 2WNWA 4LX4A 2JIEA 4D6HA 2EBNA 2W63A 5CPQA 1RD6A 1JIBA 1JI1A 4S3JA 1NOWA 4GXPA 1UR0A 3VIJA 2WC3A 5DF0A 4EE9A 4AD0A 1SMDA 2J77A 1JXKA 3ARPA 3WQ5A 2Y4SA 1E6NA 2IXVA 2V5DA 2YIHA 3WF3A 1M03A 3M7SA 1DWAM 3TOPA 1V3KA 1BAGA 4AEEA 2YBTA 1BQCA 2FHBA 4DUVA 2WHJA 3UEQA 2VVNA 1KR0A 1QHZA 1V3LA 4OJYA 4QP0A 3W0KA 1JZ5A 1R7OA 4F9JA 1QI3A 1UR9A 3MMUA 1CZ1A 5GNYA 1KWGA 1GHSA 4U2ZA 1D7FA 1UQZA 3ZQ9A 1JYXA 3VIIA 1VF8A 1GVIA 3WH9A 3CZKA 1JYWA 4LXFA 3MV11 3VINA 5JUVA 2J74A 2W91A 4HA4A 1W9XA 1V6WA 3W28A 1E0VA 2CXGA 1JZ2A 3L4ZA 1V6XA 3WUEA 4JHOA 2FDMA 1ZU8A 2BHUA 2G3MA 3UESA 4M56A 4B3KA 1QI2A 3SIMA 4QAWA 4C7GA 1F4AA 4BQ3A 1PIGA 4DWSA 1MXDA 2WANA 4PMZA 3ARSA 2ZWZA 2XVGA 2VURA 5LYRA 2QV4A 6CGTA 3VPLA 3W27A 5BROA 4BQ4A 1UD2A 3AIQA 3VKKA 5JBEA 1EHNA 1NWRA 3L4TA 3VO0A 4UQBA 3TTYA 4H8UA 3AOFA 1XD0A 1LG2A 3AIRA 4CKQA 4GKLA 4PMYA 1XH0A 1ITCA 4UCFA 1V0LA 3E1F1 4DUXA 5FOOA 4PMRA 1AQHA 3N13A 3VNYA 3SUSA 2VQTA 3AYSA 3VVGA 1HKMA 2RGMA 1VJSA 3GH5A 4M80A 4WSJA 1XYZA 5IDIA 3DC0A 2V5CA 4M82A 5D9NA 4FK9A 3AZTA 1C7TA 1GOQA 3RJYA 3SEPA 1E3XA 1JYVA 3RPMA 2E0PA 2O9OA 1B9ZA 1OWQA 3VILA 1OBAA 2EXOA 5ABFB 3K8MA 1V3HA 5A8QA 2BY3A 1QOXA 2WWDA 2IXUA 4JL1A 1E6RA 5HBFA 4PN2A 4PYSA 4CD8A 4CD5A 3THCA 1B30A 4KWUA 3AHZA 4HZ7A 1OINA 1MFUA 2X8RA 3CZGA 3J7HA 4Y7EA 2BXZA 1CXLA 3VIGA 4N0RA 4GPNA 2NW0A 8CGTA 7TAAA 1B90A 3ARVA 1UWUA 4PTMA 1CXKA 4OBRA 3FAXA 3ZT7A 1GVYA 2YDSA 2GJRA 1E1FA 2XGBA 3AJ7A 4UQ9A 1GOWA 1K9TA 4NF7A 5EBAA 3AS2A 1G1YA 3CTTA 4ZENA 1JD7A 1PZ3A 3MU7A 2VX7A 4XZBA 1AQMA 2WCGA 3IJ8A 1G01A 2BXYA 5A2AA 1UUQA 3CMGA 2J47A 4RE2A 3EMZA 1LLOA 1D3CA 4UQDA 3VGDA 3ZO9A 1QW8A 4TUFA 1CGWA 5CPTA 1WO2A 2V3EA 3A47A 1ODZA 3WEOA 3EYPA 1KCLA 3ARYA 3CLWA 4MDPA 5CGMA 5D9PA 3SCTA 1OCQA 2VT0A 3GYCA 4HPGA 2YDRA 5I77A 5M17A 2IUZA 2J25A 2NT1A 3OB8A 1ISYA 2E8YA 1XHGA 1C3FA 1JDDA 5HNNA 3W82A 5HPCA 3GXFA 1WAWA 3GH7A 3WSUA 2W67A 2JF6A 2WVUA 2Y2WA 3NUKA 4OIFA 5E0FA 1NWSA 3VD7A 4HU8A 3VU2A 4P8XA 2DIEA 1EH9A 2AOSA 2DT1A 3BAXA 4PSRA 2C8NA 4D6IA 1UR1A 5FKYA 3AXHA 2BVDA 4H7VA 2G3IA 3EDDA 1J0IA 1W9UA 1W9BM 4J7RA 4N42A 2OSXA 4PEEA 2CBUA 1UWRA 2WKLA 1EXPA 1BPLB 3DHPA 2CKRA 4CVWA 4YN5A 3WN6A 1M53A 4P7OA 3VIHA 2VRQA 2CBVA 2UY2A 5I23A 1K9DA 4CD4A 5BXPA 1BVNP 4PMNA 4QFUA 1EDGA 2J75A 4W87A 1TUXA 3RMEA 4W7WA 3VD4A 5A95A 1IZJA 2E4TA 3T2OA 3U5UA 4QLLA 1ODUA 4W7UA 3VGFA 2WB5A 5DEZA 4WF7A 1CLVA 1FHDA 4GIAA 4XZWA 1HIZA 4AIEA 1NQ6A 2VR5A 4C7FA 4HPHA 2W92A 1H0IA 4D6FA 2J8FA 4AXNA 1HT6A 1DWGM 1EHAA 3POCA 5FIPA 1V3JA 3ZIZA 1R85A 4AZCA 4PTXA 3VX0A 2XTKA 1ZBVA 2VCCA 3KZSA 3UERA 4AD3A 2CNCA 2Y5EA 2C0HA 3OZOA 1KXVA 1H0GA 3CUFA 4FMVA 4L4OA 4D6JA 1J0HA 3KWXA 5I6SA 1UKQA 1XSJA 4JFVA 4U3CA 1CGXA 2J79A 1EOMA 4V28A 1YQ2A 2D0GA 3RILA 3GTNA 5M5DA 3AMDA 1CEOA 4UTFA 3VDBA 2VI0A 5HXMA 4FLRA 1ZB5A 3PZNA 3N15A 1J12A 1Q6GA 2ZX6A 3SCOA 2B31A 4AISA 1H11A 1XCXA 3IAQA 4LGXA 7CGTA 2HISA 4HOXA 5CQ1A 3SUWA 4CGTA 5D8ZA 4D71A 2DT2A 1UWTA 1FH9A 2JFEX 2X05A 1HL8A 1EA9C 1XH1A 4J27A 2OYLA 1HP5A 4HA3A 1NP0A 1QI4A 2WWCA 1E6QM 1KWKA 3WEMA 4GZEA 3M6DA 3OZPA 1VFUA 1W3HA 3WL1A 1ISZA 1GORA 3TTOA 3AHXA 4WKFA 1B3YA 1CTNA 3WDJA 1QNSA 1CNVA 1RPKA 2PWGA 2ZXDA 3AFBA 4JCLA 4V2XA 4Z2HA 4NSBA 3L4YA 4TVCA 3OG2A 1DTUA 1H2JA 1GQJA 5KEZA 3A4XA 1SR0A 4F9DA
chains in the Genus database with same CATH superfamily
3UXDA 3WLSA 2XVKA 5CSRA 1DORA 3LCGA 2PODA 3AAMA 4XZLX 1SJBA 2FGBA 3G1AA 3MMWA 4S3DA 3O9NA 4NXKA 2EPHA 1OX6A 2XN1A 1HJVA 2Y5JA 4IL0A 4O0ZA 4I5RA 4JTLA 1BQGA 6XIMA 5AHEA 1VBHA 3HGSA 2ONEA 4AD1A 2GQAA 1OZQA 1K8YA 4M6PA 4B15A 1CBGA 1B0IA 4HMEA 3VNZA 3H4XA 1KQZA 2HWGA 1DJYA 1Y5WA 2PSNA 1S38A 4O1CA 4FHAA 1E4IA 2CLLA 2VZVA 3GBDA 1W3TA 4UTLA 1ONRA 4ADSA 3UR8A 1QAPA 5DXXA 3P62A 2WKGA 4ZQNA 2HNHA 4IIHA 4PBFA 3ZVIA 3XIMA 3WF2A 2VELA 4YVPA 3S6OA 3TTSA 4DN1A 2FPYA 5AYIA 3WNPA 4E4UA 1FWNA 1E56A 2YW4A 1KM3A 5LNRA 2OT1A 3BLPX 1OGSA 1ICQA 5CG0A 1RA0A 3HZ3A 1KFWA 1PO9A 5GPRA 1ML1A 4BQ2A 1EO5A 5KITA 1X6UA 2ZVIA 1VB9A 2ZXAA 2NZLA 1QATA 2FH6A 4JS3A 1AMKA 1TKKA 1FWHC 2WCSA 4HMCA 1D9EA 2ZIDA 5F7UA 4TV5A 4GYJA 2CWNA 3OVQA 4MMWA 1W3LA 3PB2A 1OFQA 1GKQA 3A21A 3BGAA 4NNCA 4HSOA 4H04A 1A80A 3N2BA 4Z1BA 4JTDA 3I3EA 1UR2A 5I3JA 2A7RA 4JN6A 3MZ2A 2D69A 2OCZA 2ZBTA 3GIYA 5L9FA 2WYSA 4D8ZA 3ZLFA 3A5FA 3SRKA 4AZGA 3R4IA 4H6KA 1OT2A 3WBYA 1B9BA 1TV4A 4FP1A 4N9BA 4GZIA 1AW1A 3CEUA 3NVDA 2BVYA 4PUDA 4DJED 2FIQA 3W38A 2PRLA 3QGKC 4YHGA 1ME7A 4L56A 5E6ZA 4HK7A 3BSHA 1HKKA 4DWSC 3BOFA 3P82A 3NPUA 4PB4A 2XFYA 1ZAJA 2DQXA 3W1RA 3CUXA 1Q2RA 1E1CB 2PTDA 3HN3A 1BG9A 3E2SA 3MCOA 3DFSA 4IUGA 4RCXA 3FJ4A 1K8CA 1SFSA 3PUGA 1TFVA 1H7WA 5HOSA 3D3FA 4GJIA 4Q8PA 1MEIA 4QDPA 1XUUA 4LEQA 1ZHAA 3PTQA 4C6QA 1W8GA 3M0HA 3U2CA 3NDZA 4Y9AA 1KO0A 1MYRA 3CUIA 3N9SA 4NAEB 3KBNA 1KLZA 1I2NA 1TWIA 3M0IA 2A3AA 3TMQA 1RV8A 4ADUA 4KFPA 1LWHA 2X1IA 4MKVA 3BL3A 2J9ZA 4WEVX 3K1DA 4K68A 1JFHA 3O07A 4M24A 4B9YA 3K8KA 3MHFA 1UA3A 4S2BA 1VPXA 1X6LA 2VDHA 4PH6A 4Q4OA 3P80A 3AXKA 2JALA 1VYSX 5KSWA 1CLKA 3CMJA 1KXQA 4HNTA 5I2UA 3CPUA 1PHQA 1V02E 4PMVA 2A79A 1IR2A 2VO5A 1LBLA 4AEOA 2G8ZA 4O13A 4FX7A 3SDOA 1YXYA 2UY4A 3KCJA 4F2BA 1NELA 1NFPA 3Q94A 2ABBA 1WZLA 2VZSA 4O10A 4PEKA 1ZTVA 1EJWC 3GXMA 5A6KA 2GVLA 3BJTA 4YYFA 3PFMA 3SN4A 5LKYA 4Q8WA 1Q66A 2Z29A 1FA2A 3IRDA 3M7WA 3LNMA 4CVUA 3C0LA 4C1NA 1VHNA 1ECQA 1TIWA 2EJAA 2C18A 3POHA 3C4UA 1WKEA 3T2QA 2J9XA 3CH9A 1SYTA 1KFLA 3WLHA 2O7SA 1J0JA 4GXMA 3L12A 2Q09A 2F84A 1B5TA 3P5YA 1EP2A 1P0DA 4QQUA 4FAMA 1SW7A 2YCJA 4HSNA 3L23A 3TZFA 1P5BA 1VBJA 3WD4A 4KGLA 4DWSB 1H7RA 3APGA 2VKZG 1WYIA 3KE0A 5AHFA 1V3MA 4KH2A 1JG9A 1VFFA 3W7IA 1UD3A 4PFHA 2QCCA 3M1ZA 5IHRA 2VGBA 3P5ZA 1E5JA 1GYMA 1V51A 3NIYA 5AZ1A 2ALDA 1R47A 2F6UA 5CC6A 5E9AA 3T2PA 4NZ1A 1U33A 4QDMA 1IT0A 3O8AA 2ZX8A 8A3HA 4GQQA 1TJ2A 1MQQA 3THAA 2HCVA 1ITQA 4DZIA 4CD7A 4ERIA 4ZOEA 3C56A 4JQ3A 1W2PA 2GOKA 4Q8TA 5JH1A 5AC6A 1FWJC 2QJHA 4JKLA 5I07A 2WSQA 1XWYA 2CLKA 4EF9A 3EKZA 2ZZ4A 1TV7A 2QCEA 4MHBA 4JTGA 2BFGA 3P8JA 1UH2A 2VCBA 3BOLA 1GWJA 3MUY1 3IJLA 3T08A 4UXDA 1PZ2A 3TYAA 1K8XA 3GB6A 3GDBA 1C9WA 4HU3A 3SB0A 3OJGA 3DFHA 3GDMA 4IGHA 4JFWA 2FTPA 3HIJA 1UWQA 2XWDA 2AQOA 5LA1A 2C79A 2ZZ2A 3OZMA 4MJMA 5A6BA 2XG9A 2VCAA 4Q4KA 4NJKA 3E2QA 1NEYA 5E9XA 1NDZA 3BV4A 3CK5A 1ZJBA 3KDNA 2OSWA 1N82A 5I3IA 3UFYA 3ALFA 4HTYA 3WD1A 5A1AA 3FSTA 1WUFA 2D0HA 3WLOA 5K3VA 3COTA 5J04A 1P1XA 2R24A 3QMSA 4UNLA 2W4XA 4AC7C 4PRWA 3VOGA 5E70A 2HMCA 3EWUA 3S6DA 3WNMA 3AZRA 1FQ0A 5CZKA 4AG0A 1W1YA 4WXYA 1V08A 4HYRA 1ELSA 2VFHA 3Q45A 5A8NA 4CQ9A 1P1MA 1WZMA 4MUZA 3R13A 4A21A 3DYOA 1VLWA 5RUBA 1JZ7A 2NUWA 3SUVA 2OPJA 4C6CA 4NKCA 1UMLA 4EP8C 3RO6A 3MKCA 3QC0A 5CSYA 3WF4A 2PCEA 5DRCA 5IFPA 2X16A 3UR7A 3R11A 1PIFA 1MXGA 1XINA 1KCXA 3QLDA 2ISDA 4C91A 1I2RA 4LAMA 2E6DA 3TSDA 3WNKA 4MPQA 1HJWA 4W8BA 5DY3A 2Q6ZA 5LNVA 2WC4A 2J8GA 3HOJA 2CLPA 4K39A 2XPKA 4XIAA 3LUTA 1XS2A 2X2GA 3RM4A 5DO8A 3ABOA 1FRBA 5IOBA 2P5NA 3BAYA 3PB0A 1POKA 2VOMA 3RM9A 3NO1A 4WHBA 3PBMA 2PWEA 3QFEA 4XO7A 4KRTA 4DJFC 1XGZA 2C14A 4LT9A 4LB4A 3F4WA 3UYIA 4XTIA 1YDVA 4KCWA 3PPFA 5EMLA 3IRSA 4BA0A 1XLAA 3JZEA 3W07A 1E3ZA 3WFAA 4G9PA 4L9ZA 4AZBA 5C9XA 5B7ZA 1EA0A 2CHOA 1GUVA 1SSGA 4LAZA 4OUEA 3KS5A 4JQ4A 1FH7A 3LV5A 3GRIA 1Z41A 2YW3A 4D6EA 3T4WA 3RYSA 2VC5A 3UA3A 4WY0A 2PU1A 1XX1A 3BC9A 2UZ9A 3U4AA 1GJPA 2PS2A 5TNVA 3I6TA 3QZAA 4LS0A 3AUJA 3TLLA 3KTSA 4IPPA 3VD5A 1SZFA 7PTDA 4QITA 5AZ0A 1IT8A 2IKIA 1OY0A 1R86A 3EOSA 3KZPA 3N29A 1X39A 1NOUA 4XWUA 4YPJA 3LBOA 4REQA 2ADAA 4PTVA 3WLMA 2GDUA 4H01A 4C7DA 4FPSA 3TWAA 2PD5A 2WVSA 4JOMA 5CKSA 3WJYA 2QQ6A 3LSBA 2WM1A 1XYFA 1TJ0A 1DXIA 3PWIA 4QRNA 3L0NA 1WXZA 3AMKA 2E5BA 4F0KA 4W93A 2G0WA 4OKDA 4JHZA 3ZT6A 3LDVA 4GQRA 3RRAA 4M81A 4EPBC 5H6HA 1U5JA 3OIXA 2QV5A 1JEZA 3QYQA 2YA0A 4JKMA 5CAHA 3EXTA 3UXAA 1KR1A 2BY1A 4AUBA 2YBUA 1HJUA 4G1NA 5I3DA 2YLAA 3W71A 3QTGA 4M1BA 4O19A 2D73A 4CN6A 3VAVA 4E2DA 4MLJA 3EWZA 3W29A 1GW1A 3RLVA 3ZFHA 1O6IA 3TA9A 4W86A 1JULA 3O6DA 3B0UX 1H63A 3SGGA 4W84A 3WLQA 4GBDA 4JIEA 1E6SM 2W0UA 4ACZB 3PZIA 1BKSA 1UOKA 5C2XA 2INEA 2D3NA 4X0VA 4OOUA 3LV6A 2PI6A 2VX6A 2XM2A 1GTHA 1K1DA 2QDGA 1PEZA 4H7CA 3T0BA 5LNSA 1PHWA 4Z2KA 2G3NA 4XVDA 4CNOA 5REQB 5FI8A 3S47A 1B3WA 4LY8A 1NDYA 4PTDA 1XBYA 4TTUA 4MF4A 4MB4A 4JEJA 1E9YB 1K9FA 4JIRA 3W84A 1HGYA 1YIXA 5AYXA 3OVGA 1KXHA 3GVGA 4IQDA 2QJIA 1Z7AA 3MYOA 2Y8UA 4MYXA 2W62A 1VS1A 3S2MA 3WDQA 4RNFA 3VA8A 2CZDA 2Y8KA 2YLLA 3BWWA 4PULA 2B7NA 4PMXA 3NQMA 2ZDRA 3ZR5A 5CSUA 1OCJA 4TIMA 5T9BG 4BEUA 4IIBA 3STPA 3URBA 3WKZA 1V6UA 2GK1B 1NVMA 1H3GA 1Y7VA 3EA1A 4GK8A 4M1RA 5EYWA 5CBBA 2OZTA 4S2CA 2C0AA 1CYGA 3W37A 3H7UA 3ABXA 2WM0A 1RD5A 3LHZA 3L21A 1Q85A 2GDVA 2VEIA 2HZGA 4JQAA 5C9RA 1QNPA 1OFDA 4DJEC 2OZ3A 4LFYA 3W74A 1XFBA 4QDWA 5G4EA 2BDQA 3WBWA 5C71A 2IPWA 1N7KA 4MAZA 1NDWA 1PS9A 4PMUA 1UWIA 1YTDA 1PTDA 1EB3A 2QKFA 2CU0A 3N2CA 1H1ZA 4UFMA 3RLGA 3MT1A 4CU8A 3FOKA 3KS6A 3ZVHB 4HCDA 1P48A 1TPUA 4N6FA 3S5NA 4DBUA 2FVMA 2Z26A 4LF2A 3GU1A 1H4PA 3AYTA 3R94A 2BXVA 1D3HA 4GI6A 2QCNA 4K1WA 2V3FA 1S3TC 1O68A 3WQ4A 5A5WA 1VRXA 2UY5A 2PF0A 4Y2WA 3WLTA 4DO5A 5DN1A 1X1ZA 3QMTA 3P2VA 3NO3A 1E9ZB 1JDEA 1L9WA 1TPDA 1UG6A 1UCWA 3GKAA 2D2OA 2VR4A 5KZMA 1TV3A 1HKVA 3H2AA 3AIUA 3HGRA 1B3VA 4I7UA 3THUA 3RLUA 3M64A 5A8PA 3WJZA 3W1AA 1DKWA 1M65A 1UJQA 1VJIA 2HVOA 3CEPA 1S2UA 3UCCA 3NOEA 4LRSA 4GFSA 3AC0A 4UTWA 5HR6A 2JE8A 4HVXA 2J24A 1GKPA 2QJNA 2PRMA 1KC7A 3W70A 2NVAA 1ZAIA 3LN3A 3CUZA 4NT0A 5AN7A 1EP1A 3GHTA 4MWAD 2A6LA 4NQ1A 4QSHA 4Z0JA 3CB8A 3OW1A 4O11A 5CPNA 4OTKA 1Q6LA 3QPEA 3CWHA 1AQ0A 3LA4A 1XH2A 2WLZA 3VMNA 4GHRA 1JGMA 1UD5A 2XSBA 1IQ8A 1EOKA 1RLCL 1AK5A 4CLMA 1GJUA 3II1A 2XUCA 4HU0A 2A4AA 4Q8QA 2ZICA 5BXSA 3TN3A 1SW3A 1AVAA 2I16A 1FWSA 3W76A 4RW3A 3AHVA 3PM6A 1DHPA 2XU2A 4L7ZA 1JCMP 4JDBA 1VFMA 2DDXA 4MNLA 2IKJA 5EMJA 5LHEA 1TPEA 4KEVA 4F3HA 3SI9A 1I4NA 3M5XA 1LJYA 3CUHA 4NL1A 3C8NA 1XG4A 1O12A 4DXXA 3G1VA 4HOZA 5BXTA 1AW2A 2ALRA 2A3BA 4AYSA 1VAHA 2H8ZA 3TU9A 3V5CA 3U7VA 1UBSA 4TR9A 1TJRA 3EMCA 5CC3A 1LUCA 1HVXA 4QG6A 1BHGA 3QRHA 4E6MA 3MO4A 3VK5A 1BLIA 3T40A 1S1PA 2YCIX 1XLGA 1QASA 5HQLA 3ARWA 1AMYA 1H7OA 4ECLA 5BRPA 3H22A 1DJNA 3FLUA 2J9YA 1SO5A 4KFNA 2OTDA 1FCBA 4WUIA 7TIMA 3SCPA 1QMLA 3BDKA 3UG5A 4GY7A 1CPUA 4NI8A 1I2OA 1SFLA 1XGEA 3GTXA 4LC8A 5D33A 3OTRA 3BMVA 1E5NA 3VDHA 1Q2SA 1PDZA 3MCNA 1A3HA 4IJRA 1J93A 3TQPA 1EBHA 4NJJA 4KGJA 3OPSA 4IXXA 2DZSA 3OODA 4UMAA 4JFUA 2OWCA 3TV8A 3RCMA 3WH6A 4F0LA 3O0FA 2X0SA 4K3ZA 1K4HA 4WJXA 3AALA 2ODOA 4AZ7A 3LU2A 4O28A 3LERA 2W79A 4QTGA 1DJGA 1UD8A 4GC4A 5GJPA 4MPKA 1V0NA 3KBMA 2EHHA 5A6LA 5C54A 4IPJA 3WNLA 2NSOA 1DBTA 1EX5A 3RM8A 1VBGA 1BXCA 4IQLA 1TPWA 3CUJA 1UP2A 1KGWA 3LHTA 4WKHA 3B8IA 4WGXA 5CC5A 3RFAA 4MFDA 1L6SA 4ML4A 4AEFA 3MYPA 3UA4A 5CG7A 1VENA 1FWGC 3ZYZA 2MUCA 4DAIA 4HZ6A 1ICPA 4QEHA 1ZJAA 2UBPC 5FJJA 1O5QA 3GFZA 2GFTA 1TO3A 3QGVA 5I0DA 1VH7A 2AQWA 2XFWA 5HAOA 2R94A 1KFCA 4RDWA 2UY3A 3B9EA 2R1KA 1XJBA 2ZE3A 2D1ZA 5C0QA 1KM4A 2WVVB 3SCQA 5BMXA 4FF5A 3WYZA 3BQ5A 5H91A 1PX4A 3N73A 1E6XM 1YEYA 2ABAA 1FP9A 2F8QA 1KFBA 2WHLA 4O8AA 2V3GA 1VRDA 1VD6A 2X0YA 4OU1A 3M5YA 1Q7MA 2ACSA 1YYAA 1V3IA 1XLMA 2VD8A 4YCOA 2I14A 1C91A 3QYSA 4TU1A 1NY1A 4NIRA 3KVKA 1XICA 1AL7A 3L7RA 4NRSA 3QOKA 1H41A 1R9XA 3UETA 3TYCA 4K8GA 4JTTA 2XH0A 1I0BA 3WLIA 2R6OA 2NXHA 1J9YA 2FHFA 2H9AB 4N4PA 5HWJA 1JAKA 1T6MA 4A6GA 3TVAA 5C7HA 2HV5A 4ALDA 2AGKA 3VKJA 1JNEA 3OGRA 3ME3A 1JAEA 4R34A 1S5VA 3MWAA 1I2QA 3FGCA 3S9IA 5FEPA 4KW2A 4KETA 4KWSA 3MS8A 3RU6A 3NSNA 3EKGA 3PN8A 1WXYA 4JKKA 4FXJA 2O55A 5AC7A 4LX4A 3REQB 4D6HA 2ASHA 2EBNA 3VNJA 1RD6A 4XD5A 1X98A 4S3JA 4EE9A 3F2BA 1SMDA 2PGEA 1N55A 2JGQA 3ARPA 3U6WA 4WJEA 3OZYA 1DWAM 3TOPA 1YE6A 3RHGA 1V3KA 4FOKA 4AEEA 2FHBA 3LTYA 3UJ2A 3GE7A 3UEQA 5CAKA 4LUTA 1V3LA 4OJYA 1JZ5A 3EX2A 3G0UA 5EMUA 2XN2A 5GNYA 1D7KA 1GHSA 3V16A 2HJPA 4QE4A 3OVRA 4OBTA 3VIIA 3R0UA 2HNEA 3VINA 3PJWA 3QW4B 4KPLA 2P88A 3QV9A 2IKHA 2J74A 3KRBA 2Z4GA 3W28A 1W9XA 4IOTA 1UUMA 3L4ZA 1SM9A 2E77A 3FJNA 1TE6A 5BWAA 4I8YA 2QUUA 2GWNA 4B3KA 2QUVA 1YADA 3B8WA 2Z1VA 1PIGA 4M6QA 2WANA 2ZWZA 3U8GA 4JNZA 1DIOA 2E1DA 1R3SA 5LNUA 2EG8A 4AF0B 3OEXA 1NWRA 5ENLA 1F3TA 2GJNA 3L4TA 3VO0A 4UQBA 3AOFA 2H3BA 2QGHA 1VYPX 5EMMA 4CKQA 4ZGYA 2SFPA 2DZWA 1OADA 4PMYA 1V0LA 3E1F1 5FOOA 1AQHA 2VQTA 4YXGA 1MUCA 3LX9A 4M80A 4WSJA 1A5AA 5H1WA 3DC0A 4PUKA 2QVNA 4JQ2A 3LRMA 2QJMA 1JYVA 5HINA 3M5ZA 4RE0A 1QXLA 2VGIA 2EXOA 5ABFB 1Z42A 1V3HA 1E6RA 5I7GA 5FEXA 5HBFA 4CQBA 4GE8A 3AHZA 1SVDA 2TODA 4F2TA 3SY8A 2X8RA 4HTBA 5D37A 3U2OA 3HA1A 1OFRA 2NW0A 1B90A 1T8QA 3KRUA 1CXKA 4OBRA 1MI3A 3GZ3A 4O57A 3ZT7A 1GVYA 4GRSA 2YDSA 5U7SA 1E1FA 1W0MA 5CH9A 1G1YA 3TR2A 4LBUA 2V67A 1JD7A 5FJOA 3WMLA 3EA2A 3MU7A 2VX7A 3VFLA 3EA3A 1AZ1A 3P0XA 3LM3A 3HURA 3CMGA 2J47A 1SR9A 2PLKA 4X2PA 4RE2A 3GTHA 3VGDA 1VPQA 1FDJA 1OCBA 3N2OA 3CT7A 3NDOA 2OELA 3KFTA 3UCDA 1R0MA 3CLWA 5CGMA 4GA8A 2VM8A 1UZHA 3NWRA 1IGSA 4HGXA 4HKPA 1LRNA 3UXKA 2NT1A 1F07A 2ZVRA 3ZR4A 1ISYA 3ERPA 2ACRA 1XHGA 1C3FA 1P7TB 3CM4A 3BOXA 5HNNA 2VENA 2BLEA 2WVUA 3NUKA 4OIFA 3VU2A 4P8XA 3K1GA 4DJDA 3FVMA 3C3UA 3BAXA 1AFSA 3G1SA 4D6IA 1J4EA 2VGGA 3AXHA 3LZ3A 1RSCA 2G3IA 1REQB 3EDDA 1W1IE 3HPAA 1H62A 5F1UA 1T8XA 4N42A 1TQXA 3PY2A 3OA3A 2YCLA 1OJXA 1BPLB 1J2BA 2V6AA 3WQDA 4YN5A 3FEQA 3WN6A 2PGWA 1ZALA 4P7OA 1S3HA 3KRSA 1E9IA 4AX6A 2UV8G 1A5MC 1K9DA 3VABA 1A50A 2OQLA 4DHGA 4WSHA 1BVNP 4Q7IA 4PMNA 5HMEA 4IMCA 3RMEA 4W7WA 5A95A 4GQBA 4LVDA 3T2OA 1D3GA 3M41A 4DF2A 3R5EA 1KFKA 3GDLA 4WF7A 2NLYA 4DNHA 4GIAA 4AIEA 1NQ6A 4HPHA 3GW0A 4XAGA 4MWAC 4AXNA 4Y9MA 1HT6A 3GNDA 1XG3A 4ZODA 1DWGM 3TYEA 3VDGA 3POCA 2DZAA 2G95A 4FX6M 2PCQA 4AZCA 2XGZA 3K4WA 2XTKA 2VCCA 4QG8A 3A24A 2Y5EA 5A8GA 4UNKA 1H0GA 4L4OA 3TQVA 2VFFA 1XSJA 4Y6GA 4GNVA 3U0HA 2DY3A 1EOMA 1I9CB 1YQ2A 3ITCA 3KHJA 3V3WA 1ZUAX 4GFIA 1UJPA 2PU0A 5M5DA 4EX4A 1DQWA 3W7EA 4FLRA 1SJAA 1Q6GA 4MY8A 2ZX6A 2B31A 2CHRA 3IAQA 4LGXA 1WBJA 7CGTA 4D8LA 2HISA 1A49A 4FSAA 5AB3A 3GC2A 4HOXA 5CQ1A 3LMZA 2DT2A 2FFIA 2GPTA 1FH9A 1BEUA 1HL8A 3P3BA 1Q5MA 3W1QA 1HP5A 4CEXC 2WWCA 3WEMA 3NTYA 3WL1A 2R1LA 4WKFA 3N2MA 1B3YA 3WDJA 1QNSA 1RPKA 4ICCX 1S2VA 3B04A 3AFBA 3N19B 3T7VA 4NX5A 2DUXA 3OG2A 3DFTA 1S2CA 3A4XA 4F9DA 1Z89A 4LS1A 4OOZA 4I6VA 1GNXA 4ICMA 1DIKA 1JPHA 3RU8X 1QTWA 4DBEA 4U33A 4PCNA 2NQLA 3ISIX 1J10A 3BW2A 1SJCA 4O17A 3GK0A 1V93A 1ZSXA 2CYGA 1V5XA 4CQAA 1DE6A 3O6YX 1X7FA 3USZA 1L6GA 4B92A 1IE7C 1LDCA 4P5UA 4M7SA 4MADA 3KTXA 2P3EA 2X42A 1J01A 2V63A 2B7PA 1A5KC 4BWLC 2F7FA 2PDMA 1UWSA 3W2LA 1W1TA 4FXSA 4UTJA 4LUYA 1WAUA 4A05A 2EPKX 3T78A 3CQKA 2VDIA 3CO8A 4CCZA 3KCOA 5G2HA 3QZ6A 4HHHA 4ZE5A 3H24A 4MWAB 4XAFA 3APYA 1UKSA 3OLIA 1YDNA 3M16A 4EPKA 4QCFA 4RZBA 3H23A 1U1UA 2CLIA 4Q8NA 1IV8A 2GSJA 2PF8A 1EDTA 3B05A 2OGYA 4J28A 3BCFA 3LBMA 3H7RA 3K30A 2XYLA 4LCRA 1SO4A 1YHTA 3WUFA 1DJHA 1E51A 3HG4A 2WMIB 2WAGA 4QM1A 4PFMA 3I3DA 3B3DA 4MKNA 2OGJA 3LD5A 4A4AA 3WDIA 1ICSA 1TA3A 4HCLA 1B57A 2ZRUA 2Z2BA 4U31A 4HT3A 3N2XA 3OA5A 4L1WA 4Z2IA 4ZR8A 1VC4A 3RN6A 3L4VA 3IJQA 1OX4A 1XV8A 1NP2A 3S83A 2G41A 3WK3A 1CB7B 5TD4A 3VDAA 4BY3A 4BS0A 1MNZA 1WZKA 4RJEA 2P1FA 3BAWA 1GHRA 1QBAA 1SZGA 3B8UA 3W2JA 2VP8A 1ZBCA 2PDCA 3MUCA 3S2CA 1ZPTA 3QY8A 3WLRA 2EJ1A 4UTMA 3GM8A 5GVJA 3K8LA 2I5IA 2YCKX 1EF2A 2YB4A 3QKEA 3W86A 2YA1A 4DUOA 1TE1A 5DFAA 1O4UA 4JX6A 3V18A 5D2TA 5EKYA 5L6UA 4G7EB 5D05A 1UC4A 4LV9A 1OSEA 5C9UA 4X2RA 1Y8BA 1YRRA 1SFJA 1GONA 4E2BA 3AICA 1KBIA 4G6CA 1P4CA 1ESWA 2NLIA 2CPUA 1YNYA 4O54A 1Q6CA 5EY5A 3D46A 2P76A 4ZXLA 2PC4A 2YBVA 2NVCA 5LNWA 3MA8A 1GQLA 1LF1A 3HU7A 1FFRA 2EPNA 4AH7A 3HMCA 2RH9A 2X1TA 2WV8A 1JF5A 5BRQA 3WIJA 3LCHA 2ICSA 3KP1A 1BGAA 4AMAA 1JRCA 1KTCA 1SU5A 1A5BA 4GISA 3NYZA 1Q6FA 5HMFA 3H8AA 2WZMA 2I5GA 4RK8A 4XZNX 3H2MA 4GIYA 1MW3A 1OD8A 4NNAA 3DERA 3GXIA 4LPCA 4H2CA 2PDPA 6ENLA 2TSYA 4KWOA 2P10A 1V02A 1XF0A 4EAYA 4JAWA 1NWUA 2PDGA 1CIUA 2VFIA 2DJXA 1TMQA 1OQFA 3D3AA 1CLXA 1RQHA 2ZRYA 1IGWA 3WBEA 2AGTA 2PDXA 4C6LA 4Z42C 4B5TA 1WDSA 4LB3A 3NZPA 3TC7A 4GZ7A 5FCZA 2QMKA 1WV2A 2GQ8A 2E7FA 3H54A 4O16A 1ZLPA 2Y7FA 2CZFA 1ZS2A 1EQCA 2BY0A 3AMGA 3R25A 1DQUA 2BG5A 3AIVA 3T44A 1NFGA 1JXJA 3RX3A 1UHVA 1J18A 1I75A 1Z6KA 1XFCA 1GVEA 4L64A 1VLIA 1EUAA 2UWFA 4UTWC 5LA2A 3CZJA 5A69A 1KQYA 2VVSA 3TW7A 4CQDA 3IS4A 3ABSA 2VR2A 1EJSC 1EC9A 2Z6IA 3IANA 3STFA 4UQCA 1KRBC 2HBVA 4IPNB 1R3WA 1HTIA 4HZMA 1HF6A 4ERAA 4NJIA 1U1JA 3E3HA 5JQ9A 3AXXA 3L0GA 3OBEA 2WBGA 3CHVA 3WQPA 4E4PA 1QWKA 3JUGA 1QPRA 1GCYA 1U2YA 4Q8UA 2WZHA 4ZVJA 3DG3A 2BWGA 1ZJHA 3C52A 4ZFMA 1VEOA 1TVPA 1W2VA 1K02A 2PZ0A 1T99A 1Z69A 2CLEA 3C5QA 1ALDA 3MVTA 1JYNA 3BK0A 5D8WA 1OIFA 3EEGA 1OT1A 1TG7A 5ABEA 3ENLA 1LTDA 5AOUA 3WQOA 4KEZA 4RV3A 3IGXA 1UUOA 4GI9A 7REQA 3R10A 4LALA 1O95A 4AU0A 1QFEA 2NWRA 3W00A 4A8IA 1PXGA 4ZE4A 1GEQA 2QDHA 1E0TA 3WF0A 3ARTA 1X96A 3MO7A 3QXBA 5CXPA 2DIJA 2CLHA 2P0OA 1R87A 3KOYA 1F6KA 3TW6A 4YWIA 3F4CA 1S5MA 1IEXA 1Q8JA 2PRHA 2HTMA 3P14A 3I65A 4H9ZA 4ZSUA 1MDLA 3AS0A 1FXQA 4HOWA 2JQXA 2ANUA 1MFVA 4US5A 4O1AA 4NI3A 4AD4A 5A6SA 3NVTA 1QK0A 4Q4PA 5F2LA 4FI4A 1R2SA 2OKOA 4P7RA 4IFRA 3S2LA 3SECA 1QI0A 2C3ZA 1A4LA 1TV5A 5C2GA 1VGAA 4JL2A 3WDPP 3WDHA 1OYCA 3HBLA 3ES8A 4PMJA 2DJLA 4AY7A 3IIZA 1JD9A 1U22A 4US6A 2HDJA 1TR1A 4IX0A 1T40A 4QISA 2NQ5A 3QMRA 1W5PA 1XPYA 1UZDA 3MY9A 4L61A 5FF7A 5HUOA 1BRLB 5HNUA 2OYKA 4E2OA 3TJXA 4QEEA 2YPIA 1XBVA 2PUZA 4DXKA 5K9CA 3G8EA 2V3DA 2JK2A 4HSHA 3MKVA 5BCAA 5HJXA 5BU9A 3TE9A 1WA3A 1RR2A 3R6IA 1HJXA 4L4LA 4OGZA 3EKLA 1A5LC 2XSAA 4JDYA 3RJXA 2NV1A 1MUWA 4F0SA 1PKLA 1DWIM 1D2KA 2G37A 4UTKA 1H1YA 2WMKA 4XV0A 5GNZA 1BYCA 3N1AA 1FWEC 5BZAA 4ORIA 2ZFAA 3CAKA 3TNOA 3GFXA 3T05A 1RVKA 5DANA 5F4XA 3GVVA 3MJMA 1C93A 1V03A 2Y61A 1OC6A 2QHAA 1ADSA 1DEDA 3FK4A 2D23A 1FFQA 4Z1YA 1IT7A 5CZTA 3S2JA 3HPZA 1JF6A 3WDRA 3A13A 4Q4SA 4MG4A 2BGSA 3RR4A 1IXNA 1S2TA 1XQKA 2PC8A 4GH1A 1AJ0A 1TB3A 5I03A 4GUGA 4ZO9A 3MW7A 2EPMX 1R9YA 3M46A 1H49A 3QN3A 1DVJA 4WR3A 4JTIA 4W5UA 2D2JA 3FX4A 5EBUA 2EG6A 5D30A 1GOOA 4TMBA 2OJPA 1AG1O 2JIWA 1O60A 3B9AA 4R3UA 4NYUA 4AW7A 2RFGA 3GXNA 3CIWA 4GX9A 1OCNA 4F0RA 1MNSA 4V1XA 1UKOA 3EBVA 3VDCA 4IM4A 1C8VA 1IEWA 3LCFA 3KHDA 2DUAA 5LIXX 4IX2A 3FSUA 3NGJA 3DH7A 4ZTYA 4MJ4A 2E8ZA 4KS0A 4XZIA 2BX7A 2POZA 3N17A 5I3KA 3E6EA 2EQDA 4HNCA 2TMDA 3HPFA 5HQMA 1HX0A 4NJHA 3EX3A 3U7BA 3NQEA 2E6YA 5AC8A 5FJTA 3UNTA 3W72A 1VPYA 2NWSA 4HD5A 3AQUA 1IEVA 5F2GA 1C9DA 2JGYA 4MVAA 5BYWA 1M01A 5BMWA 1TSIA 2EEXA 2CBIA 1TX0A 2ZXQA 2FZBA 3S1XA 4A3UA 4C6FA 1NM9A 1E0WA 3FXGA 1W1PA 4FNSA 5HWMA 2GJXB 4J3UA 3I3BA 3TSBA 2QJJA 2Q02A 3BAIA 3LY0A 2F2KA 1J0ZA 4ZB2A 3LM7A 3NZQA 2RJGA 3A9BA 1NF0A 1R2RA 1W37A 4FX8A 2FVLA 3DIPA 3VZZA 5T8GA 2W5FA 3CH0A 3UVIA 2X1RA 2Y1HA 2D2GA 3PAJA 3M6YA 5CZ0A 2VUYA 1LRTA 5TBOA 3TJ4A 2Z1XA 4I5XA 1MO0A 4Z1DA 2FZ9A 3PS7A 2X0HA 4IFOA 4PCSA 1C7SA 2PTXA 4LCSA 4K37A 1KNWA 2O9PA 3ARZA 3VIFA 2OU4A 4PB3A 3DGBA 1YXDA 1CGUA 1KM0A 3T9PA 5M03A 4Q7BA 1XQLA 4TVDA 1LLZA 3DYMA 3CV1A 1L8PA 2WOQA 2PDBA 4F48A 3BJFA 5T91A 3HGOA 1H7XA 3IJ7A 3ITOA 4EPEC 4XO6A 4LU0A 4S23A 2P53A 1XL9A 3TQ0A 4F79A 5B7YA 5ECUA 1HP4A 2VTFA 1JI2A 2PEVA 1XLDA 1R3VA 4DY1A 5IHSA 1Q8AA 3UG4A 5CGTA 4IMGA 4B91A 2OLSA 4PODA 4LS2A 3BAKA 3W1LA 1AW5A 1BYDA 3KEHA 2ZE0A 1CGVA 3HB9A 1DWFM 1B3XA 4RXFA 4ZO8A 1UIOA 1GEHA 3UWEA 4Z2JA 1C8XA 1UIPA 2IPFA 2V5KA 2ON3A 3UPMA 4I9AA 4M8UA 2CZ5A 3ARRA 1CX9A 2WHMA 3VYLA 1C8YA 3PWAA 3LHVA 1DL3A 4S38A 1T41A 4S1FA 1FWCC 4IG2B 2AAMA 5IM51 3LZ5A 1PIIA 4HYVA 5F2IA 3QQ1A 4Y8FA 2VNCA 3GR8A 3LCXA 3L67A 4E4FA 1PBGA 1TCDA 2GJPA 4WLCA 5DXYA 4GX8A 9XIMA 2XISA 1XUZA 1SSDA 1LWIA 1VBUA 1GW9A 3SFKA 4M6UA 1HW6A 3G1YA 1JUBA 3WEZA 2DZVA 4QJ4B 4PTNA 2O7QA 2R14A 4QJ5B 4PUNA 4U5KA 3O2LA 2O9TA 2R8WA 4R88A 2V82A 3W26A 4B2DD 3DECA 3VM7A 3KM8A 3C2FA 3MBDA 3UXLA 4JHMA 2E9MA 3MMTA 1KM5A 2E9LA 3CQIA 4FEZA 1PZ1A 5HK4A 4MOZA 4W7VA 5DT5A 2PDHA 3XISA 3AMCA 3ZOAA 4FNTA 1Y65A 9XIAA 3U9IA 3G24A 4R53A 1XLCA 2EKGA 3E2VA 5I02A 3OGSA 3B8TA 3BLFA 5CC7A 5AYYA 1EKOA 3VIOA 1VIZA 1R5YA 1WPCA 1UQYA 4CQCA 1M9HA 2OR2A 3DN5A 2Z0IA 2DU2A 3QY6A 5ECVA 1E15A 1FHUA 2VXNA 3MTWA 3FDGA 3S0CA 1EJXC 1H5VA 1VR6A 1LQ0A 3GYEA 2YB1A 4KT2A 4W89A 3KL5A 1OGBA 3ECQA 2Y0FA 3S9ZA 4XUYA 4XD6A 4YTSA 3P7YA 3EPMA 1XGDA 5K2ZA 3LI0A 1VFHA 1FDYA 3ANYA 4MTVA 4B3LA 4N4QA 5DCDA 3W7HA 1F3XA 2FQIA 3ZLGA 3G0SA 2O9RA 4RX0A 1BG4A 5DLCA 1MW0A 2DGAA 5XIAA 4IGSA 4EANA 4E3TA 1EX1A 3F5LA 3WD3A 1YW1A 8XIAA 2WK2A 3PVFA 3QOMA 2VDGA 4N9CA 2WSYA 3T4CA 4Y9OA 5EFDA 1ZCOA 1W5MA 4HN4A 1KKRA 4MLRA 4H9YA 3W1UA 4P7LA 1EF3A 1DJZA 2J78A 2ZUWA 5G4HC 3DFNA 1QDSA 5DMYA 1FWWA 3UR5A 3MSDA 3OOQA 3BTNA 3A9IA 3ABRA 4D1JA 4ES4A 1HXJA 2OO6A 3CLMA 4I9TA 5HMSA 4DNMA 1YX1A 3NL2A 2XINA 1U30A 1ZENA 1QPKA 4BF5A 1JZ6A 4FR1A 1E43A 3MI3A 1CXIA 2DZPA 1E40A 1FWTA 2QAFA 1RJPA 1RJRA 2GVEA 5TF0A 3UJEA 1YMYA 2X40A 4AIOA 3CWNA 4GVGA 4F0HA 2GUUA 1U1HA 2OB3A 3GDKA 3VMPA 4RLIA 3LCLA 4H41A 3WUGA 4GBUA 7A3HA 1XM3A 1R3QA 1OFEA 4UNIA 5GNXA 1XIIA 4GI8A 3HMJG 3MP5A 1E4MM 5KZDA 3L4UA 5I3GA 2O92A 4JGDA 1QK2A 2WZIA 1B2YA 1JNDA 1XC4A 3GIPA 4NP7A 2YCLB 4C5YA 2H6RA 1THFD 3TEVA 4H8HA 3AJXA 3T07A 4AZ6A 3EGJA 1UOZA 5G1YA 1XBXA 4KRZA 4MWAE 3O06A 2L5HA 1EZ2A 4EKJA 4P7QA 1E4NA 2C6QA 2OX4A 4B5NA 1C92A 1KV8A 3W83A 2DSUA 4EAMA 2G50A 3MKKA 2VHLA 1AD4A 3KUMA 3A3WA 1B4KA 1WB0A 1CB2A 4BHYA 3BLKA 3C3NA 3RCNA 3JR2A 1ADDA 1EC7A 3CMFA 2VFEA 1GVOA 4LVAA 1HGWA 4GOAA 1KTNA 3FKRA 4U3AA 1ENUA 3AXIA 5AVNA 3W2MA 1GYLA 4J1OA 4LH8A 3L4XA 5DBTA 1WOAA 2F61A 5FF0A 5HUPA 1OM0A 4TQTA 3Q2DA 4GO9A 1W1VA 2POTA 3KWSA 3W2UA 2ZX9A 2YX0A 3EMQA 2EO7A 2PWFA 2A3CA 4H6EA 4JFSA 4E3VA 1UZ4A 1CGTA 2PTYA 1F4HA 2YL8A 3AZSA 3SJ3A 1RQBA 4DELA 1BWKA 2YKKA 3IAPA 3KDOA 4RZ6A 6PTDA 4WJ8A 2A85A 5HR7A 4DZHA 4GUJA 1K8ZA 1UZ1A 1IWAA 3T0DA 1OZMA 3M0XA 4LNYA 3PJTA 5MKGB 5FJIA 4D72A 3K5XA 3ZJ6A 2PP0A 3VIMA 4L6HA 3W85A 1TR9A 3U4FA 1NTHA 4IJCA 2DT3A 2VX5A 3WF1A 3QKZA 4ATDA 1DJIA 3E12A 4O52A 1PAMA 2JEPA 3GR4A 3QC3A 3IVSA 4NAEA 3AYRA 3PBYA 5XIMA 1RHCA 1GOMA 2EPLX 3W88A 1K3UA 3M0ZA 3GG0A 4MJ2A 3UCQA 2OX1A 4HNNA 2J7DA 1YTKA 2QCGA 1V6YA 1VFSA 1TMHA 5DRIA 2DSKA 2WNWA 3HV9A 4Z1CA 1EUNA 4Y8EA 3B9NA 3UZXA 4O4VA 1EYWA 1RALA 1JI1A 1NOWA 3QR0A 4GXPA 1UR0A 2WC3A 1BWVA 4Q4QA 4AVOA 1JXKA 2Y4SA 1E6NA 2O56A 3WF3A 1ZRQA 2YBTA 1BQCA 1G4SA 1TWSA 4QP0A 3W0KA 1R7OA 2FYMA 3W1PA 4F9JA 1QI3A 2FKPA 4LVGA 1AJ2A 1D7FA 1UQZA 3W7QA 1VF8A 1GVIA 3SQMA 4O0KA 1JYWA 4NAFB 4RZ4A 1F76A 1NIUA 1TZ9A 1IR1A 1J5TA 4IFKB 3N4FA 1YPXA 1Q13A 1GK8A 1E0VA 2CXGA 3V4BA 1JZ2A 1V6XA 5EPDA 3W75A 2PDQA 2BHUA 2WQDA 3UESA 3H7VA 4XSMA 1X38A 1QI2A 1F4AA 2Y63A 4BQ3A 4DWSA 1MXDA 4E0CA 4PMZA 1F61A 3ARSA 3EWDA 2VURA 5LYRA 3M0MA 4L4MA 3N6QA 3VPLA 3E0FA 1XBZA 3OBKA 5BROA 3W6YA 4JTFA 4JEQA 3VKKA 3VC5A 3JRKA 4NYYA 2OEMA 1NFBA 2QUNA 2WSRA 5CJNA 2WJZA 3TTYA 5B80A 1XD0A 1XH0A 1ITCA 1EJRC 1RQEA 4GMEA 3GIQA 4UCFA 4PMRA 3VNYA 3VVGA 2RGMA 3KOFA 4ADTA 2I5QA 1LP6A 3CL8A 1Q3NA 4MM1A 1XYZA 2YYTA 1F8IA 2F6XA 5D9NA 3AZTA 1C7TA 1F2JA 2QCDB 3CIXA 3BLEA 4RPPA 3VILA 2ZYFA 1TWDA 2IXUA 4Y9PA 2PLJA 2WNQA 1B4EA 1K70A 4HK5A 1B30A 2NV9A 4KWUA 4L6OA 1OG6A 1YXCA 4Z08A 1JCNA 3CZGA 4N0RA 4AB4A 3LXBA 1S2WA 7TAAA 4HNOA 3QZEA 4KF1A 4QNWA 3GXPA 1PL9A 2PWUA 2YFOA 4UQ9A 1VHCA 4ENLA 1K9TA 4FNPA 3AS2A 5H2ZA 4BI5A 4GVFA 3DFQA 2BTMA 4XZBA 4AXKA 5LIWX 3FJ6A 1ADOA 1RCXB 1PTAA 2C71A 3DI1A 3PK7A 1LORA 4IQEA 4Y9NA 1CGWA 2QGYA 1XYBA 1LOQA 1WO2A 2V3EA 3A47A 4MZYA 3WEOA 1KCLA 4UTIA 4KEMA 1K7EA 5D9PA 3B9OA 4GQGA 3TAKA 1QNVA 2VT0A 4HPGA 5E5CA 2A5HA 2IUZA 2J25A 2Q3OA 3OB8A 1AJZA 1DV7A 5KTLA 3L68A 4UTTA 1JDDA 3WG6A 5HPCA 3N14A 3FYPA 4PL2A 1WAWA 3H2EA 4YVXA 3GH7A 2QDEA 4ZQRA 3VD7A 5FAJA 3SSZA 4HU8A 1R3YA 3NXFA 4H6RA 3MUXA 2VYOA 1H60A 1UR1A 3SW6A 4NG3A 3VKAA 4JICA 1H7NA 1TPB1 3B8DA 3E2RA 3IUHA 2PDYA 3IPWA 1UWRA 1GG1A 5FACA 2E5DA 1K7XA 1M53A 3W1NA 1W17A 1UB3A 4UB9A 1IXQA 2VRQA 2CBVA 1GVSA 1TRDA 4DLMA 5GJNA 4JIIX 5IBXC 2PAJA 5CZSA 2J75A 3ONCA 4L1GA 4LVBA 1T5AA 4ZOAA 3JS3A 1ZP3A 3V1HA 3U5UA 4NUWA 3W7DA 1ODUA 1F6YA 3ITVA 3GXTA 3VGFA 3CAVA 4LF1A 4XZWA 3MHUA 1HIZA 2VR5A 4C7FA 2W92A 3KRZA 3BG9A 2J8FA 3NPXA 3ZWTA 1EHAA 2R1MA 1A5OC 4IMFA 3UYCA 4H3DA 1XRSA 4BF9A 2YZRA 4PTXA 3GLCA 3VX0A 2QS8A 3RXZA 2FJKA 1KRCC 3IIXA 4FMVA 7REQB 4D6JA 3KWXA 1SZNA 4JTUA 4TV6A 4JFVA 1XYLA 4U3CA 2J79A 3E5BA 4GQ0A 4V28A 3TC3A 3RILA 3VDBA 2VI0A 5HXMA 3PZNA 3N15A 7ENLA 4GACA 4EOUA 3BANA 3SCOA 1XCXA 3LHWA 4IMAA 3TN4A 1CI1A 3NGFA 5D8ZA 3MPGA 4D71A 2BSLA 5D03A 1EA9C 1XH1A 1K03A 3G3DA 4MIMA 3DHFA 1PKNA 2PLMA 3I7QA 5CPMA 4O14A 1G67A 1KWKA 4GZEA 3LLDA 3M6DA 2GQ3A 3HV8A 3B0PA 3FDKA 4HNLA 1CNVA 2QUTA 3CT2A 2BVWA 4JCLA 2Y70A 5LGXA 3L4YA 3KTCA 3TKFA 4TVCA 3LHYA 3VCCA 1H2JA 1SR0A 3QPYA 4XISA 2WMFA 3EX6A 4GYFA 4E5TA 4N9DA 1E1EA 4K7VA 3I6EA 1TJ1A 2ZUMA 3N12A 1HVQA 3TZNA 1O5RA 3TJLA 5EU9A 3V0TA 4Q8MA 1F5ZA 1L2UA 1JL8A 3LPFA 5LSMA 3ICJA 4IGNA 1PE1A 3QJAA 2CITA 2GLKA 3FA3A 2DVUA 1Y0EA 4QS6A 1SO3A 3BSGA 3M0VA 2WKJA 3RR1A 4DJFA 4A2RA 4ACZA 4Q22A 4Z2GA 3D0CA 2Z28A 3HTWA 3MC5A 4GJJA 1GKRA 1JZ3A 4A8RA 1WZAA 3A64A 2ZRVA 3WLLA 5AY7A 2IKGA 4O8RA 3W1MA 4YIWA 3CIVA 3CYVA 3L66A 5REQA 3KP0A 2ZCGA 2ZOXA 3EPOA 4WZHA 4PUMA 5FD0A 4NJGA 3PPCA 5FL0A 3TW9A 3V7PA 3VCNA 2DEPA 1QPOA 3BH4A 4ORMA 5LHFA 5F1VA 1V79A 3SCUA 2Z00A 3R8HA 2ZZ5A 3CU2A 1IIGA 1KFJA 3PZGA 3WLNA 5EMYA 5AHMA 2CFFA 1QWGA 4IPIA 4PCTA 5HANA 1PKYA 1TMLA 2NV2A 2FMNA 3NSXA 6XIAA 1F3EA 3GR7A 3K4AA 1YPFA 4LYQA 1XYAA 5CJ5A 1K6WA 3WH5A 1XDJA 5D2YA 3OQEA 1HJQA 3VM5A 4CU7A 4YCPA 2V2DA 3UWYA 2YJQA 5E0CA 3VGGA 1YKWA 2W61A 1M41A 4IWWA 1VEMA 4GD0A 4J5NA 1PYMA 2GK1A 1P0EA 3GAKA 3MV01 1MDRA 2AL2B 5AKQA 4UMCA 3OLDA 2HVNA 1ZZMA 3CGTA 4FOUA 1BFNA 5CZJA 3RUBL 4BK9A 3RAOA 4DLFA 3GG7A 3PC0A 2AQVA 2WBKA 4H8VA 3F4VA 2YXGA 1TWZA 4EK7A 1QO5A 3C2YA 1DPMA 4HA0A 1ME9A 1M7XA 1JPMA 3PPHA 4OFCA 2WLYA 1NQKA 1LOLA 4HB7A 4LV4A 4NRRA 1XRTA 1G6CA 5HPOA 1M04A 4J35A 1CXHA 3ZVHA 3CZ8A 4BFAA 3MSRA 5DCEA 5EA9A 3W25A 5I3FA 2Q01A 2G97A 3VC6A 3K4DA 4XZMX 3WZ0E 1GZJA 4CEUC 5E1QA 1XLHA 1UD4A 3QVQA 3QHNA 3KOWA 4RDVA 4IISA 4TOQA 3BG5A 3WQ8A 1GTEA 2C1HA 4A8LA 4QG9A 5BWFA 4ROQA 2PD9A 1GOKA 1GOIA 4GO8A 4LYRA 1F6PA 3WCZA 1FKXA 4C90A 2OWXA 2WNNA 1EGVA 4UFIA 3QHOA 1QPNA 2D3LA 3N6HA 4H83A 2WXDM 2Y7DA 4JBRA 1G4EA 1CDGA 1W32A 4ZO7A 3GWQA 2PMQA 3UY7A 2V68A 3ZJ8A 2Z25A 1FP8A 1VIWA 3R1ZA 3PBGA 4CN4A 4CNPA 1S1RA 1POJA 2PWVA 5FESA 3IV8A 2ZUVA 1A47A 3WY1A 2P3ZA 2HS8A 4XKYB 3G1FA 4WK9A 1EWDA 4H7ZA 5G2WA 3OP2A 1OFOA 1XIJA 4QAIA 3C0QA 1VP5A 4HPJA 3B4YA 3FEMA 4UWMA 2YZ5A 3WBAA 2VWTA 4X3ZA 3E0VA 1QOQA 4ROPA 4INFA 3WJXA 1NWTA 2XHYA 5E93A 1DYSA 1JCYA 1BD0A 3L2MA 1VCVA 4PBGA 1KFEA 4FOJA 4JPGA 1VCGA 1B3OA 3M0KA 1LM1A 1OHLA 2E09A 1A4MA 1PB0A 5HQEA 5A6BD 4BKNA 2AAAA 4UR9A 4ATWA 2YL9A 2B4GA 4GG9A 3MUZ1 4Z17A 1BWLA 2Z24A 2NQ9A 3A3HA 5JBDA 3FXYA 3E5PA 2DUZA 1MRAA 3KOZA 4DJEA 4NHVA 3ONBA 1XIEA 4GYPC 2E9BA 2BODX 4FLQA 2J62A 3NCOA 4KWWA 4H2HA 3W1XA 1AH4A 1S5TA 2PWHA 1E6PA 5A94A 3EB4A 1L6FA 3PJUA 3FYOA 3B0YA 3T8QA 3CZEA 2XN0A 3C0SA 3EOLA 1VJZA 3F5KA 1KM6A 4I8DA 3LGEA 2FGZA 1J11A 4AIUA 3TSMA 1FXPA 2ESCA 2Q8ZA 2V69A 1TVLA 2GOUA 3R8RA 4JNYA 3IACA 2Y8VA 1AQFA 2WCAA 4LUSB 5AC4A 5H8PA 1QT1A 1SZEA 2VFDA 1C90A 4AWUA 3HGJA 3IEBA 2XVLA 4MFEA 1R30A 3ITYA 4P8UA 1CGYA 4AHOA 4K1GA 2HXTA 2GDQA 4MSSA 3BLOA 3BZGA 3DKJA 3LCWA 3CV2A 1TTQA 4C6OA 1XDLA 2CCRA 2GGHA 4NASA 3SCSA 2PDFA 4PL1A 3K2GA 3M44A 1MW2A 3BZJA 1EBGA 1G5AA 1LCOA 1H09A 4WQ6A 2DH2A 4PB5A 2R1PA 4HN8A 2OWWA 5D2WA 1QR7A 2V8ZA 5FAGA 1HJSA 1TRIA 4I90A 3DHUA 4WOZA 3WLPA 3WK0A 5FL1A 3ELFA 3INPA 1GVRA 3BW4A 4CD6A 1EIXA 2TPSA 2ISWA 3CQJA 1LL7A 2WSPA 3TTQA 3SN0A 4ZQMA 4HNUA 2W6RA 3VTRA 6REQB 2VC7A 3C2EA 3IGSA 1US3A 3WELA 2NVDA 2NUXA 1LL6A 1PWMA 3GQYA 3WFLA 4OT7A 2P8BA 2OKTA 4UR8A 4F4RA 3PTKA 3GTFA 2FZMA 4NZ4A 3TN5A 2D0FA 4ZOCA 2V2CA 4GKTA 2OZ8A 1TZ7A 4ZXOA 1ZL1A 3DHDA 4BI6A 1A0DA 2C91A 4JZ5A 4IT1A 4YMZA 1RK6A 3Q58A 4UFHA 2F9RA 1W31A 3QHMA 4I7VA 4DF1A 1WOBA 3VXGA 1GGOA 4KEUA 1ZBWA 3Q4DA 1UH3A 2Z7KA 3F03K 5CLTA 2OQYA 2CETA 3M0LA 2BVTA 3UT0A 1MQPA 4XAZA 1I1XA 1OVDA 4TX8A 1KKOA 2XH2A 2WVVA 3LTSA 2ZDSA 1PVNA 1E55A 1YBQB 2NX1A 4I5UA 1EJ7L 4BI7A 1FWIC 4JYEA 1YE4A 4PUJA 1UYQA 4WKAA 2GQ9A 1PUDA 1M7OA 2I9EA 1XLJA 4IHCA 3GXDA 2EKCA 1R6WA 3BMWA 3GHRA 4QCEA 3W7OA 1NSJA 4LSBA 3WQ6A 4PMOA 3R7MA 5I06A 1WQ5A 1LG1A 4U2YA 3B0XA 1WKDA 4CCEA 4IICA 3G1RA 3PSVA 3B9DA 3KLKA 2H9AA 4DO4A 3HPXA 3PULA 3G22A 4ILSA 4N02A 3EWXA 4C5ZA 4MZ8A 3WD2A 4L5ZA 4DBWA 2LLEA 1HO4A 3S5YA 4C65A 2HBXA 3I4EA 4POCA 4C1LA 1WE5A 1R38A 1KBBA 4RUBA 3AS3A 5CEWA 2XIIA 1JDAA 1LOSA 2NXGA 1G69A 2WVTA 5BW6A 1NARA 1I6NA 3MDWA 4RKAA 2OO0A 1XSKA 3REQA 2XIMA 4XG1A 2AKZA 4LVFA 5D9OA 2QCLA 3R0DA 4XTDA 4J3VA 1C8QA 2VZTA 5HDRA 2J7EA 1WCGA 2Y88A 5IRPA 5LZLA 1QJWA 5A2BA 1IEQA 1Q63A 4GI4A 4GC3A 3SR7A 2OLHA 1LT8A 2XIBA 2ZTJA 2DH3A 3DFOA 1MZHA 1J96A 4J2PA 3BMXA 5H8MA 2VRJA 4KIEA 3N11A 1EFZA 3SUUA 3C2RA 3LEPA 4FLSA 1EGZA 2D2HA 4MJZA 2VMFA 3L2IA 2WHKA 3CL7A 3NO5A 3R89A 3W1TA 4HQVA 1OIMA 1VYRA 3R79A 3FHAA 4B5UA 4GWEA 1X97A 4C6KA 3UVAA 3GC4A 2Z1KA 4GYKA 1A53A 1G0CA 4M3PA 2V9DA 3FS2A 2FDSA 1AL8A 5DY2A 2JF7A 1RJQA 2REQB 4KCUA 3TROA 1RP9A 5DT7A 2ZX7A 4DUWA 1L6YA 2DQWA 3SCRA 3DUGA 1UKTA 4KCTA 4O12A 4UOZA 3G5EA 1OF6A 3PBVA 3NEVA 2G5WA 3JVAA 4QE5A 2E67A 2XIJA 4AF0A 1WDRA 3AIEA 2PDIA 1PCWA 1XKJA 2H8XA 3DGRA 3HFYA 2PDUA 9RUBA 1FWDC 3W24A 3NZ1A 1F74A 2VGFA 5JU6A 3S4TA 4B4HA 1XP3A 2TRSA 3OHIA 4PSPA 1H61A 3IGUA 4M29A 1XYMA 3WMSA 3GS6A 4P61A 1PPIA 2X1UA 4OV9A 1E4LA 4W8AA 3SY5A 1YDYA 3WQGA 1BGGA 3EWBX 2DT0A 2DZBA 3KVLA 3M5VA 5ABFA 2VRKA 2PLCA 3BG3A 1JR1A 2CHNA 3GG1A 3URAA 4D6GA 2J27A 3BICA 4YJ5A 1Q7ZA 1UPPA 4XQ6A 5LXEA 5DCBA 5C9ZA 1VBRA 3ORWA 3NEHA 1OD0A 3PZQA 1WNOA 4Q4MA 2PFHA 3EX4A 1QNRA 2EF9A 1TCMA 4UIOA 4AY8A 3PZ9A 4CU6A 4ZA0A 3QM3A 2ZZ6A 4GY0A 5EL1A 1VFLA 1TQJA 3CHCA 3PTMA 3W7LA 4JY8A 3TA6A 3EDKA 3H2FA 3UGRA 2FPVA 3PP7A 2CW6A 5I24A 4DB7A 3KX6A 2BBFA 5TIMA 3O1NA 1JFXA 3I6RA 3IIVA 3H6OA 4RNIA 2BOEX 2X7WA 4TVUA 3V75A 1TTIA 2YA2A 5D04C 3F2DA 3TX9A 2CLOA 3LLFA 4H9XA 5HJYA 2GVYA 5AYZA 2BHZA 3L2LA 2Y62A 2ZXBA 3M0YA 1MZRA 5A8MA 4HBKA 2YL5A 3GW3A 1P7TA 1IZKA 3SN1A 3S1GA 4DPPA 1T96A 3APTA 4M7TA 3WD0A 3LLXA 2OFJA 2BMBA 3LQLA 2CBJA 4RR4A 1F73A 4HU4A 2P0IA 2OQHA 4RV8A 2BOGX 1KM1A 5D02A 2PPGA 4JX5A 2E28A 3C0JA 1ISWA 1REQA 4JIPA 3GUWA 1OFAA 4YTRA 4R7JA 2F2HA 1K77A 3C61A 3UY8A 1GQNA 3UGVA 3ARQA 1AODA 2ZA3A 3G3MA 2ZADA 1RCQA 2HK0A 3RPTA 2X2YA 1HO1A 3LGDA 5HNTA 4YLWA 4IP4A 3B4UA 3W7JA 3VZYA 1S5WA 5E09A 4GCAA 3OBAA 1TTJA 3RNDA 4FXFA 1FX6A 3VGHA 5MHBA 3W73A 3CAWA 3KLLA 1LBFA 3NL3A 4UTTC 2QCMA 2VC9A 4GVIA 1I45A 2B7QA 1R7AA 2GGGA 3ITTA 5IXEA 4O50A 4MB1A 1X6NA 3IJ9A 4Z0SA 1UR8A 2PBOA 3L65A 1JQVA 1OFBA 3LNPA 3WNNA 3TLQA 4N2YA 2WMGA 4I9MA 3H53A 4C6NA 3QR3A 4D8AA 4V27A 1QNOA 5G4WA 1O7AA 3P84A 8RUCA 2HPMA 3V0SA 3SSJA 2Y24A 1KV5A 5I5RA 3MQTA 3NYDA 2P50A 3H26A 3A12A 3T0AA 1EDQA 4NZFA 3LGGA 3UQNA 1FHVA 4W85A 1KXTA 4FR6A 3W02A 5D4YA 1O5XA 3IVUA 1MVYA 4BJHA 3VI2A 3BSMA 3OYXA 3AIBA 1FKWA 5BOEA 3MSGA 1V0KA 4X0NA 4WDUA 4RE3A 3A4AA 3NPVA 5HATA 3NAVA 4L9YA 3P74A 1A3XA 2MANA 3W81A 5EB8A 2XH7A 3NL5A 4DF0A 4ASTA 2I1OA 3ABQA 5LIKX 4B3ZA 1UW9A 4MDOA 4JFTA 2Y5SA 2HPIA 5C7VA 4OHQA 3P6LA 5FF4A 3AROA 7XIMA 4LC6A 3PZMA 3VOIA