1S5VA

Crystal structure analysis of a mutant of dihydrodipicolinate synthase--residue tyr107 to phe107
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYFNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
publication title The Crystal Structure of Three Site-directed Mutants of Escherichia coli Dihydrodipicolinate Synthase: Further Evidence for a Catalytic Triad
pubmed doi rcsb
source organism Escherichia coli
total genus 107
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1s5vA00
3EX4A 3OEXA 5G2HA 3UWQA 1SO6A 3QRHA 4KWWA 1UJPA 4A3UA 1OK6A 5C55A 1H50A 3H54A 1JULA 2QCLA 4QM1A 3G1FA 4J9JA 1TV7A 1RD5A 4YWIA 4WOZA 3MI6A 5TBOA 1YXYA 4NJJA 2ISVA 3BO9A 1IIGA 1UUOA 4UTJA 3BGGA 3PM6A 4IWWA 2TPSA 3QMSA 1Q6LA 4RXFA 5D2XA 2JGYA 2ATSA 1GZGA 1JCMP 3C2EA 4JTFA 3W1UA 3L0NA 2WKJA 3EB2A 4K37A 5CZJA 1HFBA 2X2GA 1SUXA 3W7IA 5FF2A 4GFSA 2RDTA 4ADTA 2E5BA 2TYSA 3GAYA 1TIMA 3P8JA 1I2PA 2WSRA 3MBFA 5AYZA 1RV8A 1H1ZA 1ICQA 4GXMA 1OVDA 5U7SA 1T96A 5FESA 5LNRA 1DJQA 1QR7A 1FWNA 5EA9A 4RLIA 1YPFA 3QPZA 2VEKA 4QNWA 1SSGA 1DL3A 3GDKA 2GPTA 1OFDA 3LI1A 3WFAA 3L5LA 2VXNA 4UMAA 3R8RA 1O60A 3QSTA 5BOOA 1THFD 2FPVA 1UASA 4FNRA 4E2DA 1W31A 4C1LA 2QCNA 4JICA 4QIUA 1TPVA 3EWUA 3UPWA 2A6LA 3IVUA 2ZRWA 1OFOA 2C1HA 5CZSA 1C9DA 5D37A 1VC4A 4CLMA 1KBJA 3C56A 1SPQA 1XDLA 2XN2A 5AC7A 3L67A 3W1MA 5LNVA 2QEZA 1K8YA 4NJKA 2DP3A 2YCEA 5BW6A 1D3GA 2JBMA 2H3BA 3HF3A 1G4EA 1ALDA 3V75A 2QCCA 2NX1A 1TTPA 3UY7A 3LBCA 1M7PA 5K4XA 5CZ0A 2PRLA 1H7OA 3CT7A 4MKNA 1KFJA 3GR8A 5IM51 1KW1A 4RK8A 1U5JA 5U4NA 2VOMA 2QF7A 4UFIA 2ZZ7A 3DFNA 4N2YA 3EWWA 1F74A 4FNQA 3CIWA 1FCUA 2J24A 4HNUA 1R2SA 5KZMA 3S1WA 2YYTA 4QQ3A 1AW2A 1ML1A 1AG1O 3PB2A 2J88A 4Z1CA 3O63A 4Z0JA 1XBYA 5LSMA 3Q2DA 4WQ6A 3W7DA 3IIXA 2PRHA 1LBMA 5F2IA 3QFEA 2V30A 1G7VA 3LHZA 4NXKA 1QDSA 1LTDA 3DKJA 4PODA 3W3OA 1Y0EA 1XUZA 4BWLA 4H6KA 2ZZ5A 4IX0A 3KFTA 4O0KA 3NO5A 4GWEA 4RCXA 3HPZA 4JTUA 1TCDA 4ONVA 2FLIA 2YGYA 3TXZA 3S9YA 2ZCGA 5E0KA 4KFNA 3DFSA 3TR2A 3DI1A 4LRSA 4EF9A 1HO1A 1VZWA 1WX0A 2CWNA 4A22A 2JK2A 4WZHA 3FJLA 3W22A 2C14A 1TTQA 2GVGA 3A5VA 2ATMA 4LT9A 1FWTA 2FB2A 1RPXA 3C52A 1TTJA 4O0ZA 5D2TA 8TIMA 1G69A 2YX0A 2DZTA 3SECA 2FQIA 4CQAA 1QCWA 1VHNA 4AEOA 2VEMA 4O16A 3GDLA 2HS8A 3PF3A 4PC8A 1H63A 3W75A 5CSRA 3IIZA 4UTUA 3NQ8A 1HTIA 2VENA 1OF6A 2FFCA 3QZEA 2QCMA 3W07A 2DZWA 2W0UA 4N9CA 1ZAIA 2FDSA 3MW7A 5C2XA 4EIVA 3D0CA 4PH6A 3L65A 3TJLA 2H8XA 3PVFA 1F05A 5DN1A 4OU1A 3UYCA 4JTKA 3W1QA 3EXRA 3M5ZA 2C18A 4L4MA 3STFA 3C2FA 3KXQA 3HGOA 4MPQA 3M6YA 3T55A 3W2NA 3C6CA 3BLEA 2I14A 3NQAA 3CWOX 1VLIA 1W3NA 1SZFA 4UTIA 4FNPA 1IXPA 1GG0A 2CFFA 5EYWA 5FF7A 5C54A 1YDOA 1TQXA 3B0UX 4QJ1A 1YYAA 2ZZ3A 3N9RA 5HJLA 1VGAA 3LX9A 4BFAA 3CWNA 2YPIA 1WQ5A 3AJXA 3JS3A 4KWVA 4ORMA 4AH7A 2V5LA 4JDYA 4TX9A 3G3DA 4LS0A 1SSDA 3LDVA 3NQEA 4AF0B 3GLCA 3PY2A 3W2KA 2G97A 2PE4A 1UUMA 3G3MA 5KMYA 2FPTA 2B7NA 1L2UA 2CLFA 2Z2UA 3UWVA 1PCWA 2ZYFA 2NXHA 1ZCOA 4PFMA 4FNTA 1RQHA 4I7VA 5DXXA 4H3DA 3TA6A 5A8GA 1Q6RA 4UTHA 2Y70A 4MLJA 2ZA1A 3W7OA 4JEQA 4HHPA 1OFEA 3VCRA 2C15A 1MSSA 2FPYA 2JKAA 4WOQA 5AHEA 3WJSA 1L9WA 3S42A 2Y85A 3NZ1A 4DELA 3TX9A 3M5XA 4JY8A 3MHUA 3NGJA 1MZHA 1OFAA 4UMBA 3TFXA 1ZENA 1ME8A 2X1TA 4MYAA 2X16A 1EUNA 1X1OA 3G0UA 1TJPA 4E38A 3LHVA 1JCNA 4UTKA 4O8RA 5G5IA 3HG4A 1GVQA 2C0AA 4UTMA 1AMKA 3A24A 2QUTA 3GXNA 1N8FA 3QW3A 1I2QA 5AYYA 5DCDA 2OJPA 3TKFA 1X7FA 2O7QA 2A0NA 4JDBA 5HWNA 1OF8A 4IMEA 1JUKA 4OGZA 3F4WA 4ZQRA 2HMCA 4XKYA 4N02A 2CLKA 3W1LA 3QC3A 1F5ZA 4A21A 5D05A 1BTMA 2WV8A 1B3OA 2AGKA 3O07A 1TPDA 4R33A 2E77A 2G5WA 3TU9A 2QCDB 3LCFA 5K7JA 3NQMA 2A7NA 2XN1A 1ZJIA 3S0CA 3GXPA 4LUIA 4MZ1A 2JKPA 2W6RA 3THAA 2ZQ0A 3CQ0A 4HPXA 1EWDA 5D2YA 3I7QA 1QFEA 1OX4A 5C6MA 2EGZA 2WSYA 4UIOA 4O1AA 1LZOA 4LV9A 4R7JA 3I7RA 4XWUA 4AHPA 1KM6A 3P74A 1KLYA 3B8DA 3HO8A 5HNRA 1XBZA 2QCHA 5D2VA 5G4EA 4O4WA 2C6QA 4DF2A 1Z44A 1YTKA 1VR6A 2AQWA 2NWRA 3W72A 5LKYA 3NPVA 1WBJA 1PE1A 1FWWA 4WY0A 3CHVA 3W74A 1TMHA 4IGHA 3VKJA 5CSSA 3Q94A 1VQTA 4ZQOA 4MUZA 5AHIA 1BEUA 4XTIA 3TW7A 1LDCA 1JUBA 1IXQA 3TW6A 2X1UA 4MY9A 1EEPA 3RF9A 3W7QA 1RQEA 1W3IA 3PULA 3T7VA 3E02A 1GG1A 2B7PA 5HUPA 1SW7A 3SFKA 3LTYA 1KA9F 4X2RA 4YCOA 3LCLA 2AAMA 3B05A 3N19B 3R12A 4JTEA 3LCHA 1GWJA 1ZHAA 1GT8A 3MYPA 2A85A 2X30A 3LM7A 3HG2A 4NNBA 3FEMA 3FJ6A 1EX5A 1KM1A 2ZRXA 1SO4A 3G1XA 4TMBA 4Y96A 1IF2A 1JCYA 3KRSA 2E5DA 2ZRUA 3W6YA 3C61A 3IIVA 4YLWA 1GPWA 2B4GA 3W7GA 3ABQA 2C13A 1TPUA 3VNDA 3UZJA 3SSJA 3TAKA 3W71A 1TRIA 1EWEA 2Z1BA 2YSWA 5KZDA 1YXDA 3EX6A 1LP6A 2NUXA 4QSHA 2A2IA 3C0JA 4HPJA 5AOUA 3W1RA 5CPLA 4CNPA 1KFBA 5HR6A 2Q3OA 3P8IA 4CCDA 2C16A 2RH9A 1ONRA 4ZMGA 2V0TA 1VCGA 2J9XA 1SR9A 4JNMA 4DPPA 3HGSA 5I3IA 2A7RA 3WJYA 4MVAA 4RV8A 3TQ0A 3UXAA 1SFLA 1B4KA 4JGDA 3SZ8A 3L66A 3DHDA 4HKPA 4GRSA 3CM4A 4MLRA 3FYPA 3LCIA 5FEWA 2TMDA 3M9YA 2VELA 3HBLA 1OFQA 3L2IA 1S5VA 2QDGA 4ICNA 3NYZA 3HPSA 1LM1A 2VFHA 3NM1A 2NX3A 2P10A 4G1KA 3IIPA 3STGA 3IVTA 4UTLA 4TU1A 1HG3A 1K8XA 3PG9A 2NXIA 1FCQA 2DU2A 4M7SA 1R2TA 3LRLA 3HIJA 3W87A 3IGXA 4IXHA 1DORA 4PL2A 1M7OA 3UQNA 1EP1A 3HGRA 5J5DA 4S2CA 3TMQA 4Q33A 4M6VA 3F4NA 3DFTA 3NM3A 2RDUA 1XM3A 4QITA 2R8WA 1QWGA 5FI8A 3EWYA 5AFDA 5EMUA 5K9CA 3N9SA 1P5BA 3NL2A 3SIZA 5BNKA 3NR0A 1O94A 1DKWA 3KAOA 2Z6JA 3ANYA 3W2LA 1LRTA 1OYCA 2ZZ4A 3NQCA 3LHWA 3TQKA 5K4ZA 2E6DA 1DJNA 2QAFA 1A5SA 3KVMA 1XBVA 4AWTA 4O14A 2V2DA 3INPA 1WOAA 2QUVA 5F4XA 4K8HA 3WJXA 1W5PA 1JRCA 4JYDA 4K6AA 5CGQA 5D03A 4K38A 1KLZA 4BWLC 1S5WA 1P0KA 1J4EA 2QJHA 3LXCA 4FF7A 3SGZA 3MP5A 4FXRA 4WUIA 3PR2A 2Y7FA 3HB9A 4JX5A 1BKSA 3U8GA 3S1UA 1IXNA 5MHBA 3FKKA 4HNVA 1AW5A 3YPIA 2CZ5A 2EF9A 1SO5A 2YFOA 3TUUA 4NJIA 3S8HA 2QR6A 1XL9A 5D04C 3MUXA 2E1DA 3FYOA 2E5CA 2QKFA 1Q6QA 3Q37A 2WNQA 1H7PA 3LV6A 3C2OA 4ADUA 1P0NA 1QAPA 2YW4A 1FWRA 1FBAA 3A5FA 2GQ9A 1TPWA 1EPXA 4JTJA 5G2WA 1H61A 1M6JA 2Y88A 1FCVA 5L6UA 2WJZA 4AHOA 2ISWA 3I68A 1G7UA 5C5YA 3USBA 4Z1DA 3M43A 4JIQA 3B0PA 2C3ZA 1LORA 4LV4A 4UFJA 1B4EA 2CLMA 3ZWSA 2V81A 4K7YA 3IGSA 3P60A 5E1QA 1GTHA 4FB7A 1EP3A 4O53A 2F7FA 2ZRYA 5F2GA 1O5KA 3W1NA 1XI3A 1KV8A 3I7SA 4UFLA 5K9XA 4Y90A 4NJGA 3UY8A 5HULA 5F1VA 1EB3A 1E51A 2ZRVA 3BLIA 3PG8A 2G96A 1MO0A 1DQXA 1F2JA 4N4PA 5D32A 1AW1A 1SZNA 5L9FA 1O95A 4HIBA 1JJKA 4EOUA 3BK0A 3EX1A 4JX4A 1SU5A 2VFFA 1TO3A 3N14A 4KFOA 4KFPA 3TSBA 1QPRA 3MP4A 3P62A 1IXOA 2Q8LA 2EKCA 3DFQA 3W7PA 4L4LA 2E68A 3O06A 3ZS4A 3MI2A 3O6CA 4M5PA 1F6KA 2CLEA 1VPXA 3SY5A 2RHGA 4LVDA 3U2OA 1B9BA 3N34A 3C2RA 1FWSA 3RK8A 2ZRZA 4O52A 4NNAA 1DQWA 4CCEA 3IRDA 4JY9A 2Q3RA 3QPYA 1RQBA 2DZVA 3RNDA 1C8VA 4DO4A 1TV5A 2FJKA 2WSQA 3NL6A 5DY3A 2NLIA 2BWGA 2VEPA 4FIQA 3PBWA 2QJGA 1ME9A 1VS1A 1LRNA 2ALDA 2DZPA 1IIHA 4Y9AA 1TTIA 3NZRA 2VEIA 1ME7A 3PBUA 2G95A 5CPMA 3OG3A 4DBDA 3JR2A 3FOKA 3E49A 5I3FA 2NX9A 1RZMA 5IBXA 2QCEA 4WY0F 3B0VC 1Z42A 1UB3A 3UZ5A 4LW7A 3G8EA 4P2VA 3TC6A 3BPWA 3F03K 4U4MA 4XTDA 1VYRA 4LOCA 4CQ9A 1CW2A 6ALDA 5EL1A 5FEXA 5HWJA 1K7FA 4HT3A 4E2BA 5D30A 1FUYA 2J9ZA 2H90A 4O11A 3NL5A 4YL2A 1JUEA 3O6DA 2BTMA 1YLVA 3W7EA 4Z1BA 3S1VA 3DENA 4S1FA 4NT0A 5HMSA 3V1PA 1I2RA 3TQVA 4E0CA 1YTEA 4O15A 4UR8A 4MFEA 3L0KA 3EX3A 4MOZA 4XBSA 1VCVA 4YMZA 4TO8A 3W7RA 2P0OA 1KFEA 1VJIA 1NF7A 1UBSA 1PV8A 3M0ZA 1K7EA 2CLIA 3BV4A 3M16A 4DQWA 1VYSX 3GKFA 3KOFA 4O17A 1FXQA 3GIYA 3GYEA 5LGZA 4UXDA 4WXYA 1YADA 1ICSA 3LERA 3BW2A 4I7UA 3VE7A 3G1VA 5LNUA 3SI9A 3FLUA 4GUGA 1XC4A 3CC1A 5BMXA 1JCLA 3TFCA 2WNZA 3WJWA 3BG3A 4IMGA 4Y6GA 5LZLA 4LS2A 1OG0A 3LXAA 5KITA 4NUWA 5DCBA 3G0XA 4JYEA 1FDJA 3NQ2A 3W9ZA 1WDWA 3CPRA 4M6QA 3LXBA 2R91A 3EX2A 4O13A 3ABRA 3OVPA 3KRUA 5AB3A 1O4UA 3R13A 3VFLA 4O18A 3NG3A 4JYFA 4NX0A 2PRMA 3DFPA 2BSLA 1O5XA 1W8SA 1YDNA 3PWAA 4MFDA 1ZNNA 3IGUA 3Q58A 3E0IA 5HR7A 5CPOA 4WX2A 2CW6A 3NEVA 1X6UA 3LLFA 4O57A 3MI3A 4S2BA 1A5AA 1W5QA 3DFOA 3QYQA 2X1RA 3W85A 1WAUA 3FS2A 5G1TA 3DI0A 3BVJA 3QJAA 3QMRA 3LHTA 4FHAA 5DXYA 3CEUA 1T0OA 1N7KA 2VFEA 4KKXA 1W3TA 2RFGA 4QISA 5DLCA 2Z6IA 4QNEA 4O50A 1WXJA 2V82A 4AVFA 3AO0A 3HOJA 3WK2A 3W7JA 1OFPA 2EAWA 1H7RA 3P7YA 4JTIA 5HWMA 5KINA 4DO6A 3E12A 1OYAA 5BMWA 4MZYA 3B04A 3HPXA 3FFSA 3B4UA 2CZDA 3UD6A 3DBPA 1GVFA 4C1KA 3GNNA 3LTPA 3MHFA 5CZTA 1JRBA 4O4VA 3P81A 5LNWA 5D09A 1KBIA 1WYIA 3R5EA 4O1DA 4GUHA 3CEPA 3GB6A 3N2XA 4AB4A 3A9IA 3P61A 3UPBA 1P1XA 1W5NA 4K8EA 4B5NA 2YDAA 3DKLA 4IPIA 3TDFA 4LUJA 1HO4A 3L0GA 1VCFA 1YTDA 2RKXA 1S5TA 4EF8A 4NU7A 1OK4A 1H5YA 1QPQA 5ABTA 2V2CA 1MEWA 1MEHA 2EHHA 5F4SA 4LVGA 4CQ8A 3NVTA 3UWWA 1UCWA 1L6SA 4DO5A 3M41A 4NQ1A 2I9EA 4H4IA 1XBXA 4NXSA 2V5BA 2OX1A 3QQ0A 1GEQA 3S6DA 3O1NA 2HSAA 2E6YA 5D2WA 3HMJG 3KVJA 3NNTA 4ADSA 3EEGA 2DZUA 4IMFA 5TIMA 4A29A 1GVSA 4P61A 4FX6M 3EKZA 2H8ZA 2QUUA 1SZEA 3S5OA 1ZAHA 4RX0A 5HQEA 1OJXA 4IOTA 1QPOA 3MO7A 3W88A 2VC6A 1GYLA 5AYXA 1SFJA 3DU0A 4RZ4A 4NX5A 3OVQA 3EWBX 4Z1AA 5CKSA 2PURA 1VRDA 4TIMA 2QCFA 2WNNA 4AAJA 1IGSA 3BGJA 5FF3A 3W7HA 3SW6A 4X22A 3MWAA 3KVLA 4IPJA 3SR7A 3M5VA 1I4NA 1X1ZA 2RDWA 3A22A 4Q32A 1P4CA 3T44A 4CNOA 1PVNA 1DBTA 1KFCA 1HL2A 2ZA3A 3L68A 1R30A 4M6PA 1WBHA 2J27A 2NUYA 4MIMA 1AL7A 5TQLA 5FEPA 3LRMA 3S5ZA 4AXKA 5LNSA 3W7NA 3BARA 4CCCA 3NPXA 4IX2A 3G1HA 1KV5A 4N9BA 5AC8A 1SQ7A 2DZXA 3PUOA 4RZ6A 3UWUA 3C4UA 1OYBA 4OWGA 4O19A 2C19A 1JR1A 3G22A 2V8ZA 4UTTC 3NXFA 4FIRA 1DV7A 1H7NA 4N9DA 1TPB1 3NAVA 3NDOA 2ZTKA 1Q6OA 1KTNA 3EKLA 3QSRA 1OX5A 3A21A 4O12A 3FKRA 4D2JA 3PS7A 2H6RA 3QMTA 4PCFA 1LROA 3C2VA 3H53A 4LTSA 1VLWA 2VFDA 4PL1A 4TMCA 4PA8A 2CZEA 5AHNA 1W37A 4UTWC 5J5RA 1ZY9A 1QO5A 1FCBA 4XKYB 3CLMA 1W5OA 3FIGA 3IVSA 4N9EA 1XKYA 1FDZA 1XUUA 3ZFHA 3O16A 3DAQA 3GK0A 1FQ0A 4I7WA 4MY8A 3TSMA 4JS3A 1ZFJA 3O05A 5EY5A 1KFKA 3WK0A 1NSJA 3IIOA 4JXCA 1F7BA 2WQPA 3O8AA 1KM0A 2QJIA 3LRKA 2VKZG 4N6EA 5A5WA 2Y63A 3W2MA 4M7TA 1F73A 1QPNA 2GUUA 2NUWA 4ML9A 2GOUA 4DBEA 1LBLA 2GJNA 4DXVA 2KZHA 7TIMA 3OHIA 1K02A 1OX4B 5H2ZA 3M47A 1AL8A 4I9AA 4OT7A 3TSDA 2TSYA 4ORIA 4PTNA 5SWUA 4HSNA 3TC7A 2Y7GA 1GVOA 1EP2A 2GQAA 4LVAA 4OQVA 1SW3A 1LOQA 4FNUA 1J5TA 1GYNA 3UWZA 3W1TA 3W23A 3TH6A 1G4SA 3GDMA 3L5MA 5K3VA 4UMCA 3LV5A 2ZZ1A 3N73A 2GVJA 4Q4KA 3U6WA 3STCA 3ELFA 4MZ8A 3R2GA 4WY0B 3TK7A 1NF0A 3P67A 1A53A 3TE9A 1L6WA 5IBXC 3NQVA 1K03A 2A1YA 1T99A 3GAKA 2J9YA 1EUAA 3MHGA 3LHUA 1KM3A 4JTLA 1TPC1 4UTTA 3PC0A 4JTHA 2Z0IA 4IMCA 3LLDA 1X8FA 1LBFA 1LRQA 4UFKA 5LHFA 2XFWA 3W1XA 4AF0A 4BI6A 3DH7A 3M44A 1R47A 5HUOA 4JTSA 4RXGA 3LBMA 2CLHA 3P82A 3W76A 1N55A 3RMJA 5KSWA 5CPNA 3W1PA 4UTWA 3LCXA 4IJBA 4LRTA 3OVRA 3I65A 5DELA 5F4WA 1GOXA 3M7WA 1OFRA 4MJZA 2J6XA 1K8ZA 1I45A 4XQ6A 5G4WA 2WPBA 2HS6A 3WJZA 3W83A 4WD0A 1OFBA 2A7PA 5LHEA 3PSWA 1H62A 4X9SA 5KZEA 1FDYA 1SZGA 3NOEA 3G0SA 5EPDA 3GNDA 4NJHA 3B06A 3PBYA 3QEZA 3E9AA 3G1DA 3L5AA 5GVJA 1H60A 3JRKA 2F84A 3TIMA 3WK1A 2GQ8A 1YDVA 3UXDA 3WK3A 5K9DA 2QCGA 4A2RA 2DZSA 3NQGA 3GR7A 2W79A 2YR1A 1QNVA 2TRSA 4R34A 5AHMA 3NQFA 4FO4A 4O1BA 4OV4A 2H3DA 2E6AA 3KX6A 2B7QA 1XDMA 5DCEA 4FX7A 4M19A 2Y7EA 3C8FA 4AWUA 3ATZA 3MJYA 4JD4A 2VFIA 4PEKA 2OMAA 1LYXA 3RU6A 5E93A 2OCZA 2QCDA 3NPUA 1LOLA 5H91A 2NWSA 1EA0A 1G4TA 3HQ1A 3PSVA 3DGRA 2X1SA 5T26A 4GUJA 4ZQPA 4LY8A 1TPEA 2DORA 2ZA2A 1YXCA 1K7XA 3OIXA 4TR9A 4FNSA 1G4PA 1GJPA 1DOSA 5F1UA 5AHFA 1VYPX 1NAL1 3GDRA 4U28A 3ABOA 1AK5A 3ZR4A 1Q3NA 4W9TA 3LCWA 4CNNA 4RR4A 2Q8ZA 3TV8A 5EKYA 2E09A 3E96A 3ATYA 1I8JA 3G1AA 4DF0A 1WOBA 2ZFAA 2P1FA 3MBDA 1DHPA 3BLFA 3GX9A 1XXXA 1PCKA 3G18A 4LU0A 5I3HA 4HSOA 4YCPA 5HINA 3NQDA 1A5CA 1L6YA 3TAOA 5K2ZA 3VE9A 4IMDA 2B7OA 2JKEA 4LVFA 1LLWA 4RJEA 4GNJA 2CU0A 4Z0SA 1FXPA 4UCGA 4ZVJA 3SJ3A 1I2NA 2A4AA 2A21A 1CI1A 2ZDRA 4XZ9A 1R2RA 2FIQA 5BRBA 2R94A 1SO3A 1J2WA 4YXGA 1KFLA 4K39A 4UFMA 3NQ7A 4UUIA 2NXGA 4XUGA 3GVGA 3W7KA 3GDTA 3W73A 4K7VA 1H7XA 4OBTA 3I6RA 1W1ZA 2V9DA 1C29A 2ZBTA 3P5ZA 1LLZA 3EXSA 4HN4A 3CB8A 1KTBA 4GC4A 3NQ6A 1PS9A 1LCOA 4BF9A 1KM2A 3G1YA 1H1YA 2GVLA 2UV8G 1M5WA 4IXXA 3UWYA 1HUVA 2E6FA 2ABBA 1R46A 3O6YX 2OT0A 5DBTA 2OZ0A 1DVJA 1G6CA 1TJRA 3STEA 3QH2A 3W2UA 4K36A 1F76A 1TYGA 3KRZA 3SGUA 3MMTA 4IUOA 4WXZA 1TSIA 4NNCA 1TPFA 2Y7DA 3HG5A 1JVNA 1Q45A 3MYOA 2YFNA 3GXTA 4O28A 3S5NA 3KVKA 4POCA 3BW4A 4O10A 4WJEA 3RFAA 3VI2A 4JTTA 1VH7A 1TB3A 1KTCA 5CG7A 1V7YA 1TRDA 3W70A 2YXGA 2WO5A 3PUEA 1G67A 5F2MA 2JGQA 2WOQA 3T4CA 3M1ZA 3B03A 4NZFA 6TIMA 3LHYA 3W86A 4O54A 4JR5A 3LGEA 2DJLA 4ALDA 3LTSA 3CU2A 3W84A 3EWXA 1MXSA 3OBKA 5F2LA 1LOSA 5D02A 1QMLA 3T40A 4NZJA 3DZ1A 4ZL1A 3TXVA 4JX6A 4O1CA 2ABAA 4FEZA 3BW3A 3HGJA 2Y61A 1V5XA 3LB0A 3S1XA 2BZNA 5I3GA 4BI5A 1GTEA 3TCEA 1QO2A 2HTMA 2YW3A 1NFBA 1W54A 2I1OA 4HNNA 3W7CA 5FF0A 4XBKA 1QOPA 3GKAA 1PIIA 1WV2A 2Y6ZA 4Z08A 4FX8A 4UC5A 3HJZA 5I3KA 2V2HA 1ZALA 4GUFA 3S5YA 5I3JA 1NEYA 4DEFA 1TV8A 3W2JA 3N3MA 3W7LA 1OABA 2XN0A 1H7WA 3MP3A 4JN6A 4UFHA 1ADOA 2Y89A 3A23A 3QF0A 3K30A 1RVGA 5AHLA 1W0MA 1A5BA 1VHCA 3QM3A 1MEIA 3G24A 4GE8A 3TJXA 4ZQCA 4Y8FA 1B57A 4DPQA 3QQ1A 1FY6A 4HNTA 2BLEA 2ZZ6A 2DJXA 3M5YA 3PUDA 4LS1A 4GBUA 3QW4B 1T8XA 4RKAA 3IEBA 1RR2A 1KM4A 2GJLA 1BWKA 4X3ZA 3HG3A 4RZ5A 3BG9A 1D9EA 1H51A 3ZWTA 3THQA 4OHQA 4AHQA 3L21A 1ZAJA 1CX9A 3EXTA 4ZQNA 1TQJA 4OE7A 2PC4A 1JQVA 4ZZ9A 3H55A 4QAIA 2BXVA 4EWND 5DBUA 2CLLA 3C3NA 4IQLA 4LVBA 2YYUA 1ICPA 3G8RA 3PAJA 3G1SA 1U83A 3KHJA 3P80A 3TMLA 2O7SA 4AMAA 1BWLA 2NZLA 4MYXA 3CTLA 1K3UA 3L9CA 4AWSA 2QDHA 4JTGA 4UNLA 3TNOA 1W56A 1Z41A 4MJMA 1XFBA 2ISSA 3IV3A 1FX6A 5AN7A 1SW0A 1WA3A 4OV9A 1A50A 2OT1A 4NVTA 5EBUA 2CZFA 5D33A 4BI7A 2A6NA 2QAPA 5D38A 4ZQMA 5FEZA 3LOTA 5FF4A 1GVRA 2D73A 4R53A 1GQNA 3P5YA 4GJ1A 1JCXA 3W7MA 3NA8A 2YZRA 4N4QA 4A2SA 1QOQA 3DHFA 4BR1A 3OA3A 2ZTJA 2VFGA 1PHWA 5KTLA 3P84A 4BK9A 4LC8A 4GUIA 3LI0A 2CLOA 3CIXA 2FTPA 5DY2A 1PHQA 1D3HA 2IQTA 4LWWA 1NVMA 1EIXA 3NPWA 3PBVA 4FXSA 4DF1A 5LGXA 2PCQA 5G2IA 3RLVA 3EWZA 3FA5A 5AC6A 2EPHA 2ZZ2A 1F6PA 1OHLA 1S3HA 3UNDA 4JIPA 3W1AA 3N2MA 4N6FA 2LLEA 3T78A 2NV1A 3ABSA 3DXIA 2NV2A 3TROA 3GZ3A 3R89A 3LCGA 5G1YA 2A5HA 4EVZA 2R14A 1YPIA 2BX7A 4LC6A 2B0MA 1TREA 1TPH1 1JQXA 2Y62A 2FB3A 3NL3A 3BG5A 3PB0A 1Z48A 1XCFA 1JCJA 3F1QA 3O15A 3RLUA 1KM5A 1OX6A 4MY1A 4LNYA 1I2OA 4UR7A 1W5MA 1PL9A 4UNKA
chains in the Genus database with same CATH superfamily
2HDJA 3CPGA 2JEPA 1XG3A 2D1ZA 3A12A 1KNWA 1KRMA 2FDMA 3GO2A 4W87A 4QG6A 4PMXA 1JULA 2VDIA 3AIWA 2PLKA 4WOZA 5TBOA 4NJJA 2E67A 2EO7A 4UTJA 3NZGA 3PM6A 3QMSA 4D8AA 1Q6LA 1J12A 3L0NA 4GIAA 2WVVB 4K37A 3IARA 4ICCX 5CZJA 1CXHA 4DNMA 4HU8A 2RDTA 3USZA 4FLRA 1TIMA 1RV8A 3E2RA 1V0MA 1QR7A 1KD0A 1XGZA 2VEKA 3DGBA 1OFDA 2A3LA 2G37A 4A8LA 1DEDA 2HNEA 2YLLA 3MSRA 3P93A 3WFAA 4Z2LA 3W28A 4WDTA 2VXNA 2BS9A 1D8CA 1VFSA 4I6VA 4ECLA 1DIOA 1UWUA 1PJ9A 1ONEA 4E2DA 2QGYA 4HBKA 1GKQA 2QCNA 3VZXA 1XIDA 4QIUA 3IVUA 3WLIA 1VBGA 5CZSA 1VC4A 4GYFA 3M7SA 3FJNA 3BSMA 2PA6A 2VDGA 3TYUA 3IACA 5ABHA 4MGGA 1UH2A 3L67A 3LPGA 1J93A 3QY6A 5LNVA 3BL3A 2QEZA 4NJKA 4GQ0A 4ZA0A 2RGMA 2H3BA 4P8WA 2YL9A 3UEQA 4Q4RA 2NX1A 3ZJ8A 1TTPA 3LBCA 1HKIA 1KW1A 1NJJA 4AFYA 4RE2A 1Q8AA 2ZZ7A 5JBFA 3VNLA 3EWWA 5KZMA 1PBGA 2YYTA 4QQ3A 1AW2A 1ML1A 3A4WA 3I10A 1SJAA 3OBEA 4PSRA 3Q2DA 4WQ6A 3WQEA 3W7DA 4U2YA 2PRHA 3WLJA 4J3XA 1R9ZA 2DSVA 1LTDA 3DKJA 1WZLA 1XUZA 4FPSA 4HA4A 1AQ0A 4O0KA 1CGYA 3NO5A 3MSYA 4LRSA 4QG8A 1VZWA 3T0BA 4WZHA 3IAQA 4L1XA 1V8EA 1BQGA 1TTQA 2GSHA 2F61A 4HMNA 2ATMA 4LT9A 1FWTA 1FWBC 1O5QA 1RPXA 4CGTA 1Q6EA 1TTJA 1X7IA 2FZBA 3KZPA 2CEQA 8TIMA 4XX6A 1S3TC 3MKVA 4QE4A 4Z17A 1LJYA 2FQIA 3K8KA 4GHRA 4J3UA 2VEMA 4O16A 3W75A 1IT8A 1FWAC 3U48A 1RCXB 2VENA 3ITTA 2FFCA 3QZEA 4LYRA 4GO8A 1QASA 3QYSA 2DZWA 2V38A 2D23A 4YU1A 5C2XA 1V3KA 3VMPA 4EIVA 3GNXA 3D0CA 4PH6A 1A0CA 3L65A 3KTSA 3HURA 1F05A 3C0LA 5DN1A 4QBXA 4H00A 2B81A 2GUBA 1QRQA 2HBXA 1XIMA 1I9CB 5M2FX 1M9HA 3W1QA 3VKBA 1PDYA 1UROA 1XLLA 2C18A 3W2NA 3C6CA 1J0HA 3B8IA 5CLTA 4RE3A 3NQAA 3CWOX 1W3NA 4FNPA 1K4HA 1TV3A 5FF7A 4QJ1A 1E70M 5GNYA 1QJWA 2YL6A 3CH0A 3GIPA 1MUMA 4L9ZA 3TLQA 4C6CA 3PFRA 4KWVA 2V5LA 3G3DA 2UBPC 3PY2A 4F79A 3HQNA 3W2KA 2G97A 4JQAA 3R7MA 1UUMA 1RP9A 2FPTA 2Z2UA 1L2UA 1NTHA 3SN0A 1ZCOA 4PFMA 4I7VA 4ZB2A 4GO9A 2YZ5A 1RSCA 4H04A 2OELA 4D6DA 4AD3A 4MNLA 3MY9A 2R9RA 4ZENA 4WOQA 3WJSA 4B5XA 2XDFA 1CNVA 5AY7A 1QNPA 1K70A 4JY8A 4WDXA 1MZHA 1A5NC 3TFXA 1ME8A 2X1TA 3QGVA 4PMVA 3S1GA 3WLMA 2WQDA 3G0UA 1TJPA 5I5RA 4E38A 4A8NA 1C8XA 1JCNA 4F40A 3MZNA 4O8RA 3UR8A 2AKZA 5BU6A 4AY8A 1PX3A 1XWYA 1GVQA 3HG4A 2BDQA 1I2QA 4V1XA 5DCDA 4HZ7A 1X7FA 2O7QA 4DUWA 5HWNA 1OF8A 3MVIA 4IMEA 5FL1A 1W1PA 3V5CA 3W1LA 4PB4A 3QC3A 4HN8A 1F5ZA 2WV8A 5CSYA 4ROQA 1Q2RA 2XUCA 3N12A 4R33A 2V5KA 3AICA 2VQTA 3TU9A 3W38A 2Z28A 3LCFA 4TTGA 1V6YA 1RLCL 1LL7A 2XJ7A 3GXPA 4JKKA 3CQ0A 4HPXA 2FVKA 1OGBA 1PX4A 5D2YA 4QJ3B 4GQRA 2QPXA 3WBXA 1G1YA 2J75A 4M1BA 2R1KA 1W91A 3MTWA 4O1AA 2FZ9A 2NQZA 4LV9A 1PEZA 4HSHA 3SJNA 4L7ZA 3I7RA 3VKCA 1XBZA 2QCHA 4BA0A 5G4EA 2C6QA 4DF2A 1Z44A 2AQWA 3CV6A 1WDPA 5LKYA 1UWAA 1UD8A 4IJCA 1FWWA 4GI6A 1GK8A 1TMHA 3Q94A 1EF2A 1E0UA 4X60A 3UT0A 2WAGA 1LDCA 4K8GA 3GHTA 3DFHA 4DJFA 1NOUA 3WQPA 1H0GA 1SJDA 3NZPA 4ZFMA 3PN8A 1GG1A 2B7PA 1CGXA 3LTYA 4X2RA 4YCOA 4JCLA 1CT5A 4QJ4B 3WQ5A 3F4DA 2D3LA 2QGHA 1MDRA 3LCHA 5BROA 1XH0A 3M0KA 2EPMX 1O1HA 4Y9NA 3FJ6A 2C79A 2ZRUA 5AVNA 4RE4A 1TPUA 1T6MA 4M80A 3UZJA 3GG0A 4ATDA 3GVRA 4H9MA 3THDA 4PUWA 3S2NA 3QVQA 3TAKA 3W71A 1QU4A 4LBRA 1EWEA 2Z1BA 2OQYA 5CAHA 1WPCA 2CC0A 4WEVX 3ECQA 4FI4A 1X38A 2UY5A 2DT3A 3R0DA 4S3KA 1PKMA 2C16A 6XIAA 2V0TA 2J9XA 1V3IA 6A3HA 4JNMA 4XAPA 2JQXA 4DPPA 1V3LA 4WKHA 1RJPA 2P50A 2A7RA 2AOSA 4GNVA 4MVAA 1E6SM 3II1A 2O9TA 1B4KA 2O92A 2YL8A 3L66A 1M7XA 3PZGA 3FYPA 1YQ2A 2TMDA 2VELA 3L2IA 3NYZA 1Q63A 2JALA 3NM1A 3I3EA 4G1KA 1TV4A 4U10A 3IIPA 3STGA 2VGFA 3M0IA 3W27A 3IVTA 1AQHA 3PG9A 2YDRA 1XINA 4W88A 2NXIA 3PNUA 1REQB 3HIJA 1KWKA 3AS1A 1K4GA 1M7OA 2O9OA 1W32A 4Q8WA 2RGLA 1E6NA 3ZJ6A 4S2CA 1JZ7A 2RDUA 2R8WA 1QWGA 4DJEA 4A05A 3EWYA 3WBAA 1BG4A 3APTA 5HMEA 1LRTA 1QXLA 3NQCA 2E6DA 1DJNA 1UR1A 5XINA 1NP2A 4GYPA 4DVOA 1XBVA 3M0VA 2V2DA 3INPA 5F4XA 1W5PA 4JYDA 4JTRA 5CGQA 5D03A 4BWLC 1P0KA 4GKTA 2QJHA 3LXCA 4LAKA 3PR2A 5I6SA 4JX5A 3U8GA 5I07A 3OODA 4M51A 2GDUA 1SO5A 3EMQA 3BCDA 3QV6A 3S8HA 2QR6A 3PJWA 4Q8TA 3TEVA 3MUXA 4IJRA 1HT6A 2GSEA 2E1DA 3FYOA 1Q6QA 2PU0A 3Q37A 1GOKA 3AS2A 3BLLA 1QAPA 1KGXA 2GQ9A 1H61A 2VC9A 3LA4A 3SCTA 3JUGA 3BANA 3BAKA 3QOKA 2QDEA 3B9EA 3M0YA 1BSIA 4DO7A 4L61A 3LQLA 5AZ1A 3NFUA 4X0VA 1FKWA 3EDFA 3WF0A 4IFKB 4W86A 2C3ZA 4LBUA 2QV5A 1B4EA 3RXZA 4IT1A 2XH4A 4B16A 1IWAA 4QFUA 3NSMA 3ZLHA 3AZSA 3IGSA 3VPLA 3DN5A 4Q6XA 1H1NA 4CUCA 5C9RA 2VZVA 1ZRQA 4AD5A 1XIBA 1BAGA 2YBVA 1LQAA 3FEQA 1W9XA 3RCMA 5F2GA 3W1NA 4GG9A 1F3WA 4F0HA 2VD8A 4MWAD 3OYXA 1F2JA 3EPMA 5BXSA 5L9FA 2R6OA 3DFYA 1JJKA 3UGVA 1SU5A 4QS5A 4B15A 4V2XA 3VNJA 4QXIA 1HJQA 4KFPA 3LK6A 3MP4A 3TSBA 4D6HA 4WIWA 4KF1A 2Q8LA 3DFQA 3G6LA 3W7PA 2E68A 3LS9A 4LYKA 3MI2A 4M5PA 1F6KA 3KZSA 4HMEA 3N34A 3C2RA 1FWSA 2ZRZA 4NNAA 3GG7A 3IRDA 3UJFA 1P0EA 3WENA 3RNDA 4B9ZA 2I17A 4B2DD 4KWSA 1WDSA 1PKLA 1KXQA 3NL6A 5DY3A 3AXMA 2VEPA 2BWGA 4ML4A 2QJGA 4YTRA 2D0GA 1XV8A 4O1FA 4CN1A 3PTQA 4Y9AA 1BVNP 3GU9A 1H4PA 2G95A 3FOKA 1RZMA 3PHAA 4DYKA 2AL2A 3FAXA 1XQLA 1UB3A 3AYSA 3SUSA 4HU0A 4LW7A 3G8EA 3KUMA 2G8ZA 3BPWA 1CW2A 1UKQA 5EL1A 3BMVA 5FEXA 3DYOA 3VIKA 2AAAA 3APYA 3BLPX 5D30A 4Q3MA 1JUEA 2I7GA 2BTMA 4Q4OA 2Z1XA 3HV8A 3S1VA 3V1PA 2IKHA 3TQVA 4E0CA 5HATA 5KEZA 4Q8MA 3L0KA 1N82A 4MOZA 2EPOA 3W7RA 2W5FA 3OZOA 1TJ0A 4AIUA 4ZR8A 4GIEA 2DEPA 2XTKA 4C5YA 4LPCA 3GIYA 1R9YA 1ICSA 5BOEA 1GNXA 1AJ0A 3H23A 3FLUA 4GUGA 1M41A 4JPGA 3F5KA 5BMXA 1V0NA 1A5MC 2WNZA 5CPSA 3WJWA 4IMGA 4LS2A 3HPAA 2OGYA 2YL5A 1KQZA 4NUWA 5DCBA 3T2PA 1XIEA 2AL1A 2HCVA 3VNIA 2PAJA 3QFWA 2R91A 1JGIA 4PUNA 3OVPA 1O4UA 4NX0A 2PRMA 4PMYA 2A79A 3MA8A 2GJXB 3VIPA 3KTXA 2V5DA 5MKGB 1C90A 1G01A 1X6UA 3FX4A 4O57A 4WSKA 3H2OA 3DIPA 4I6KA 1A5AA 2F6XA 3MB9A 1V6TA 3NSNA 2X1RA 4AU0A 3FS2A 1PIGA 3DI0A 1S2AA 3QMRA 4PTVA 3H8AA 3LHTA 1Z89A 3CEUA 3WD1A 1M68A 4XZLX 2VFEA 5BRPA 4GFIA 2XINA 2Z6IA 3WQWA 4KCVA 3EA1A 3DEQA 2QYGA 4U33A 1W6TA 4DZ5A 3HOJA 1LG2A 3WK2A 2GFTA 1E0TA 3SCQA 2EAWA 4IIFA 1TZZA 3VD9A 3CIVA 3DBNA 3WQOA 3E12A 1OYAA 5BMWA 2DSWA 4L1WA 3FFSA 4L65A 1J0YA 1YE4A 1GVFA 5E70A 4WCJA 4HA3A 1JRBA 3P81A 5D09A 3R5EA 4O1DA 4CEXC 3GB6A 3A9IA 3P61A 2AMGA 1R86A 4JHZA 1Q2SA 3DKLA 4IPIA 4PN2A 4LUJA 4ZTYA 1QOXA 1YTDA 1DHKA 1TE1A 4P7RA 3T05A 1ITQA 1KXTA 3QR0A 3KDOA 1QPQA 1XLFA 4FXJA 1MEHA 3V5OA 1X96A 2EHHA 1KKRA 1XDJA 4B5UA 1MFUA 4LYPA 4DO5A 2I9EA 3BV7A 3CWHA 1KRBC 5GNXA 5IFPA 3O1NA 1P48A 2HSAA 3STPA 4KCTA 5D2WA 3BLDA 4W7WA 1W9DM 4B4HA 3SIMA 1ITXA 2EJAA 1AA1B 4IMFA 1GVSA 2YA1A 3EB4A 7CGTA 1ZAHA 5AC4A 1OG6A 4J7RA 4RX0A 1OJXA 3F4VA 4IL2A 3K1GA 3W88A 2VC6A 3QZAA 3LGGA 1SFJA 3DU0A 4RZ4A 3DYMA 1T41A 3VIFA 3A3XA 2PURA 3WDPP 3KP0A 1T7LA 2Z25A 5FF3A 3N4AA 2OEMA 1VIZA 3N1AA 1TWSA 4QTGA 2WJEA 1S38A 3MKKA 4BHYA 3KVLA 4RDZA 1E73M 3H2NA 1I4NA 3WH5A 3A22A 3KBWA 4CNOA 4AZGA 3SQMA 4YYFA 7A3HA 3L68A 1AL7A 3ZOAA 5FEPA 7REQA 1BRLA 3KOYA 1VBHA 5TD4A 5LNSA 4P8XA 1KV5A 1C92A 3VNZA 4PB5A 1XIGA 4EPEC 3DG6A 1G9HA 2WCSA 3C4UA 3CZGA 4I5UA 4G7FA 3MV01 2Y4SA 1H3GA 1XH2A 3NXFA 1XYAA 4N9DA 3TZNA 2GDQA 4FLSA 4ZXLA 2PDKA 1LQ2A 1Q6DA 3PS7A 1KCZA 4TQTA 3H53A 4E6MA 1VLWA 4S3GA 3QHNA 2VFDA 4S3JA 2NVDA 5J5RA 5HQLA 2ZUWA 3IVSA 1HZYA 3K4WA 1VP5A 1FQ0A 3BE7A 5EY5A 3TOYA 1KFKA 3WK0A 1KRCC 5JU6A 4FOJA 2YDSA 4JTCA 1F7BA 4TVUA 3ZT5A 1EO7A 1KM0A 3AZTA 4U2ZA 2VKZG 2Y63A 4QE1A 4M7TA 2Q02A 1CYGA 1F73A 1QPNA 2NUWA 2GOUA 1EDGA 3ITGA 1W1IE 2OQLA 1NQ6A 5H2ZA 3M47A 3CBWA 4MB5A 3UR5A 2TSYA 4ORIA 1ADSA 2FZDA 3AS0A 1Q13A 5HXMA 4PMNA 1PZ3A 1GYNA 3W1TA 3W23A 5CC5A 3BOFA 1G4SA 2PF8A 4G8TA 3PWIA 5GQBA 1HL9A 4PBFA 4QDWA 2ZZ1A 3GZAA 4Q4KA 3VC5A 3ELFA 4MZ8A 3R2GA 4DJFD 3TK7A 3P67A 2Q6ZA 3TE9A 5IBXC 4WSJA 4AIOA 2V3DA 2QT3A 4JOMA 3SQLA 2Y8UA 2VVSA 3ARWA 3PC0A 4JTHA 4IMCA 1BWVA 1MW0A 1BVZA 4GY0A 4YVVA 4ATWA 1LBFA 1GJUA 1UR2A 5I24A 3VVGA 5HUOA 4FZIA 2VYOA 4RXGA 4P7QA 3W76A 3ARSA 1OT1A 4AZHA 3ARYA 5KSWA 4UTWA 3NDYA 1UP0A 1HP4A 3I65A 5F4WA 3M7WA 2P0IA 4I9MA 2OOFA 2OR2A 4D6EA 1R3RA 3OO2A 5G4WA 2XM1A 2FH6A 3OLIA 4HA1A 4GISA 1SFTA 4GJIA 4WD0A 1OFBA 3ALGA 3VGFA 3UCDA 1DP0A 5LHEA 1DWGM 3I3DA 4ZO7A 3PSWA 1CXLA 3W6MA 1FDYA 1UUQA 2HJPA 2Q09A 2ODOA 2FZMA 4IGMA 2GGJA 4URIA 1MI3A 1SM9A 3VA8A 4YN5A 3DYPA 3UXDA 9CGTA 2JFEX 5ECUA 1Q85A 4C5ZA 4DM1A 3CAQA 4ZO6A 2YR1A 5HOSA 1QNVA 1S5NA 4R34A 4NP7A 5AHMA 4O1BA 5FL0A 2ZIDA 3FN9A 3H7UA 3L2MA 5DCEA 1DPMA 4FX7A 4M19A 4C60A 1J5SA 2G3JA 2NT0A 4AX7A 5E93A 5HAOA 2PD5A 3MV11 4DJED 1EZ2A 3HV9A 2QCDA 1PZ2A 5H91A 1R5YA 1EA0A 3PSVA 3DGRA 2PP0A 1DJZA 2X1SA 1W9VA 4RUBA 3CXOA 4WSHA 4JFUA 2XIBA 4ZQPA 4F0KA 4LY8A 3S47A 1YXCA 2O9PA 1K7XA 1G4PA 1CXKA 5F1UA 1B5TA 1NAL1 3GDRA 3RPMA 1IE7C 1R3TA 4U28A 1AK5A 1Q4WA 3ZR4A 4G5DA 3I6EA 1Q3NA 3LCWA 2ALRA 4EE9A 3S3GA 1PX8A 4C6JA 4GIRA 4RR4A 2HNHA 3CTTA 3DERA 1R7AA 2ZFAA 2P1FA 3MBDA 4WK9A 3GX9A 3GHRA 1VENA 4E4UA 5E6ZA 1A5CA 1GHRA 2ZC1A 1DTNA 3SBFA 3BMWA 2HK0A 1OGSA 3TYAA 3M0LA 3BDKA 4LVFA 5AYBA 4KIEA 4GNJA 3ARUA 4Z0SA 1FXPA 3LLXA 3WLSA 5A6BA 2PDFA 2A4AA 2A21A 1CI1A 1R2RA 2R94A 1SO3A 1KFLA 3WQGA 3ARZA 1WKFA 1Y5XA 3PZVA 4EXAA 1VD6A 3GVGA 3SRKA 1QK2A 3GDTA 3W73A 1H7XA 1OQFA 1JPMA 3GD6A 1W1ZA 2V9DA 1NARA 4H6EA 4H9XA 1G5AA 5EMLA 2GLKA 1KM2A 1TWWA 3MQTA 1ZGDA 1OBAA 4GH1A 3N15A 2WXDM 3O6YX 1G6CA 4ES4A 3STEA 3QH2A 3NVDA 3W2UA 4K36A 2BOFX 5A8PA 3SGUA 2C8NA 5BWFA 4IUOA 4WXZA 4CU7A 5ECVA 1GOOA 2QJMA 4KT2A 3MYOA 3I6TA 1DQUA 3KVKA 4L6HA 2E0PA 3CQJA 4WJEA 4A8RA 3H2FA 2CKRA 1KTCA 3H26A 3OLGA 1TRDA 4MAZA 2QZRA 3B9NA 1G67A 1HNYA 3GXMA 1IT7A 2GK1B 3W86A 4Z2JA 3O7UA 1EX1A 3NZQA 2VURA 2IMRA 5KZ6A 4ALDA 3CU2A 3EWXA 1MXSA 2PD9A 5BRQA 3RM8A 2D2HA 4JIRA 1VEPA 4BY3A 1V08A 4JX6A 2WZIA 4EAYA 2VQUA 2JIWA 1V5XA 4GCXA 2OWWA 2QUMA 3UESA 4LAUA 1NFBA 5I77A 5FF0A 1QOPA 4CD7A 1PIIA 2PU1A 4DNHA 1WV2A 1S2CA 4CD8A 4UCFA 2WSPA 1NEYA 3W7LA 4QCFA 1H7WA 1OC7A 3ARRA 1NDVA 4UFHA 1SYTA 3U9IA 3KL0A 1MEIA 3G24A 3TJXA 4CN6A 3VD4A 1WZKA 2BLEA 2ZZ6A 1EGMA 1V79A 4GBUA 1U1JA 4RKAA 1A0DA 3ABXA 2I5IA 1KBLA 4QS6A 4RZ5A 2WZMA 1D9EA 2ISFA 2J7EA 4OHQA 3ERPA 1ZAJA 4MJ4A 4F3HA 5HMDA 1Z69A 3VM5A 5I23A 4OE7A 5TAOA 1JQVA 4X9YA 1UR0A 2OO6A 2BXVA 4EWND 1DXFA 2DH2A 1TVPA 4NG3A 3VCNA 4HHLA 4A3HA 3W0KA 1OM0A 4ZOAA 3UR2A 4AMAA 3TYZA 3D46A 5HQMA 1KC7A 4S3AA 1DIEA 3IV3A 4YPJA 1E5NA 1FX6A 1SW0A 1WA3A 3UU0A 1A50A 3BAXA 1JFXA 3MC5A 2I5QA 3GC5A 2OLHA 4ZQMA 1L8NA 4H2CA 3LOTA 5FF4A 1A47A 3UVAA 1I1WA 4L4PA 3OTRA 1RCOB 4LH8A 1XYBA 3NA8A 3A6OA 4NZCA 1KWGA 3B40A 1HJVA 3DHFA 4NYYA 3GNOA 2ZTJA 3SCOA 3WNNA 3P84A 4BK9A 4GUIA 5EMYA 3B9OA 1Y5VA 4O0QA 5I78A 3ISIX 3KOXA 4ZOEA 1XFCA 2CPUA 2PCQA 4XV0A 1OD8A 3WFLA 2ZZ2A 2ZOXA 2DGAA 1S3HA 4H9YA 3A4AA 3UNDA 4D6IA 3QN3A 4QGCA 3XIMA 3BAIA 4OOZA 4CD4A 4ZTXA 3TROA 3E5BA 3B3DA 4WR3A 4Q4PA 2Z2BA 3NGFA 1YPIA 1ZBVA 2BX7A 4YWSA 4PEEA 2PP1A 5HNUA 2GJRA 3AYTA 5I06A 3RX3A 3O15A 3RLUA 1R85A 4S38A 4EXQA 4MY1A 3U7BA 4MPKA 1W5MA 4KMQA 3OEXA 3WH7A 4LFYA 2BVYA 1ZBCA 1UD4A 3D3FA 1UJPA 2IKGA 1RD6A 2JF7A 3A3WA 1HKMA 4DYEA 4OJYA 3BCFA 4S3EA 4J9JA 3MI6A 4PZVA 1YXYA 4HYRA 1OADA 1LUCB 4QQUA 3BGGA 4IWWA 5D2XA 2JGYA 5C70A 1GZGA 3C2EA 3TWBA 2WKJA 1HFBA 4GOAA 4UR9A 3WQFA 1FWEC 1JF5A 5AC5A 4GFSA 1FWIC 3P8JA 1I2PA 2WSRA 2J25A 4YTQA 2QF8A 3OZYA 5DF0A 4D6CA 1VJZA 4CU8A 4RW3A 1MXGA 5EA9A 3WQCA 3UG8A 1YPFA 4G6CA 4QNWA 3FA3A 1LWHA 3VIJA 1UZHA 3LI1A 4YJ5A 4FLOA 1JG9A 3WNPA 4AUBA 6CGTA 3UP8A 3TP4A 2OX4A 3GY1A 4JICA 1GZJA 2PP3A 2ZRWA 2RJHA 3UG4A 1YNPA 3E1F1 1JD7A 5D37A 2CBVA 1E5JA 1KBJA 3ZMRA 3CHDA 1PAMA 5AC7A 8XIAA 3W1MA 2CWXA 1RH9A 4H6QA 2DP3A 5BW6A 1TE6A 3KS6A 4MB3A 3AROA 3N11A 3HF3A 5FOOA 1TR9A 1BXBA 4QLLA 3ES7A 1M7PA 2HPIA 1JD9A 5CZ0A 3CT7A 1H7OA 3GR8A 5IM51 3GTXA 3N3TA 4RK8A 7REQB 1BRLB 1AZ1A 3H70A 3WUFA 2J8FA 1OZQA 1XRTA 3QGAC 3LG3A 3CIWA 1FCUA 1R2SA 5JUVA 4MMWA 3S1WA 1B1YA 2Z1SA 4IIGA 4D8ZA 4KCWA 1AG1O 4Z1CA 4L80A 3K8LA 2CXGA 2YBTA 1XBYA 1ZQ5A 3BTNA 4JBRA 3IIXA 3EOEA 3O3RA 3DX5A 5FJUA 1LBMA 4Q4SA 2V30A 1U1HA 3LHZA 2E28A 1Y0EA 3LY0A 3KFTA 1QATA 1E72M 4GWEA 2PDJA 1HN1A 4ONVA 4EACA 2FLIA 1O68A 2YGYA 3BSGA 1BYBA 1O1ZA 3DFSA 3TR2A 3DI1A 1HO1A 1WX0A 2O0TA 2CKSA 5DT5A 3FJLA 4GZIA 5CPQA 1HX0A 2PC8A 4GK8A 4R3UA 3W22A 2C14A 1CXIA 3A5VA 3L23A 1UD3A 3EOOA 1Z32X 3B8SA 1G69A 3PPCA 2WMHA 2DZTA 3G2GA 1J0IA 4CQAA 1VHNA 1BF2A 3GDLA 4UTUA 2G41A 3NQ8A 3QV9A 2X7WA 2A3AA 4P8VA 3V3WA 3WF4A 2QCMA 1V3HA 4Q7NA 1EJ7L 3W07A 4MAVA 1IEVA 4N9CA 1ZAIA 1Z6KA 2E3ZA 3TN5A 2V6AA 1GEHA 1W9BM 1PSCA 1A0EA 3BOXA 1RA5A 1Y65A 3DDMA 1RVKA 4WLCA 4KEMA 4OU1A 2OWXA 3EDDA 4S3FA 4AX6A 5TNVA 4XO7A 4AZIA 2ZKMX 3HGOA 1Q6FA 3P14A 4J3ZA 2XSXA 3WEZA 2CHNA 4KRUA 1VLIA 3HZ3A 4DWSD 4UTIA 1IXPA 4US6A 1GG0A 1DJGA 4QROA 2CFFA 3DHUA 3SRHA 1HVQA 1YYAA 3S83A 3T0DA 2ZZ3A 1OCJA 5HJLA 4BFAA 2YPIA 1VBJA 4LF2A 1GKRA 4JEJA 4ORMA 2XFRA 4LYQA 2FVLA 2PE4A 2E9LA 5KMYA 3BQ5A 4NIRA 1PCWA 2W67A 1QHPA 1RQHA 5AVHA 1CTNA 5DXXA 2Q01A 3S9ZA 1Q6RA 2NLYA 2W92A 4UTHA 1TG7A 3LQGA 3GSMA 2VEFA 2F6UA 1MSSA 2EXOA 2JKAA 3NUKA 5AHEA 3S42A 4C6EA 1LWJA 4DELA 3T08A 3WUBA 3VIGA 3M5XA 3VDCA 3CZJA 1DIDA 3MHUA 3NGJA 5TF0A 4AG0A 4R88A 1OFAA 3MPGA 3WD4A 4MYAA 1EBGA 2Q71A 1WP6A 4KS0A 1X1OA 1UR9A 4IP7A 1NWTA 3UWEA 6XIMA 5JXQA 2DIKA 1KR1A 3CPUA 3HPFA 5G5IA 3M0MA 1AMKA 5FJPA 5A8MA 3S4TA 5ABFA 2J79A 4UQCA 5AYYA 3TKFA 1W3LA 1AH3A 1JUKA 4ASTA 4OGZA 4XKYA 2GWGA 4FS9A 3QV7A 4Q8VA 5A6JA 2CLKA 3WMBA 1TX2A 1BTMA 2AGKA 3BSHA 4ICMA 2QCDB 4S23A 3L7RA 2W3ZA 2PODA 4B4FA 3S0CA 2JKPA 2DVXA 2ZQ0A 4MWAC 1LF1A 3WH8A 1MNSA 1EWDA 3WLKX 1IZKA 3WH9A 4Y8EA 2G0WA 3D3AA 3SM0A 1DWJM 2VX5A 2PFHA 4CD6A 1UKSA 3SURA 1VFHA 2GZXA 2HXTA 2HZGA 3BLKA 1LZOA 2PGFA 2BMBA 3V5FA 5C7HA 2VNCA 4AHPA 3P74A 3VGDA 5D2VA 2EG7A 3FGCB 3BCJA 2WSKA 1YTKA 3W72A 2IQDA 5G1MA 3NPVA 1OD0A 1XSJA 5A6BD 2DW7A 3N18A 4F66A 3CHVA 1K6WA 4IGHA 4A35A 2WC7A 4MUZA 4M8UA 5AHIA 1DWHM 5FA5A 3Q67A 4XTIA 1A5LC 1JUBA 3CUGA 2Y2WA 2ACSA 1OC5A 2DT0A 3W7QA 4QEHA 4HNLA 4LCQA 4UOZA 3V35A 3PULA 1W3IA 3WNKA 3T7VA 3E02A 5HUPA 1SW7A 1KA9F 2AAMA 5EBAA 5EU9A 3MCNA 3N19B 4K68A 2X30A 3LM7A 4NNBA 2PDUA 5HBFA 3FEMA 3G1XA 4Y96A 2ZRXA 1SO4A 1N8WA 1IF2A 4R85A 3CV1A 3W6YA 3IIVA 4YLWA 1A3WA 2FVMA 3ABQA 2VP8A 1F61A 3CQIA 3R1ZA 1TUXA 3NWRA 2ON3A 3GXDA 4LGXA 1E1FA 1LP6A 4QSHA 4JNYA 4AZBA 4AY7A 3ARPA 5AOUA 3W1RA 4C7DA 3PZMA 3PK7A 3L4UA 1WDRA 1ONRA 3M0JA 4HA0A 4RV8A 1SFLA 1B2YA 4JGDA 4PULA 2PDXA 3SZ8A 3DHDA 2W66A 4GRSA 4H41A 5ABEA 3Q65A 2QMJA 3BQ6A 4W5UA 4CNUA 1E1EA 4ZB0A 2J7HA 3AJ7A 3HPSA 2VFHA 2YDQA 2P10A 5FJTA 4UQDA 5M1TA 4QSFA 4CQCA 3VGEA 1VFTA 4TU1A 1HG3A 1K8XA 3N4FA 4J2MA 4FOUA 5H6HA 1PO9A 3LRLA 4E8GA 1RBAA 3IGXA 3E2VA 4IXHA 1DORA 4JTAA 4PL2A 5MF5A 4Q8QA 3ARQA 1W2PA 3RM4A 3VZYA 1RY8A 3F4NA 3NM3A 4MNMA 4QITA 4NI8A 5AFDA 5EMUA 1UWRA 3N9SA 3MCOA 1DXIA 3RDKA 3ANYA 2VUNA 3CV7A 3TN4A 5K4ZA 1GQIA 1A5SA 3KVMA 4O14A 1EXPA 1JRCA 4K6AA 2XFYA 4K38A 4HOZA 3CHCA 3SGZA 2FJUB 3VIHA 4AZ6A 3HB9A 4K1GA 5MHBA 4V27A 1AW5A 3YPIA 2YFOA 3TUUA 1EJSC 2REQA 4YYCA 4NL1A 1J01A 1AJ2A 3SCUA 2J77A 3K13A 3TR9A 4GX9A 2E5CA 2QKFA 4PRWA 3UXKA 2CYGA 1KCLA 1GYMA 2XZ7A 2YW4A 2HV5A 1ECEA 3MMWA 2RUSA 1EPXA 5G2WA 4DUVA 1E4NA 1BGGA 2D0HA 2ACUA 1U5HA 3WLQA 4CD5A 2ISWA 2ZUVA 7XIMA 3M43A 1MUCA 4Y7EA 3B0PA 2ZE3A 2P3ZA 4GBDA 1MVYA 1BF6A 2XGBA 3B8UA 1XIIA 3ZWSA 3ZZ1A 1UQZA 3UZXA 4AD1A 1D7KA 4X2PA 1EP3A 1V02E 1W9PA 2P8BA 3SUWA 3DECA 2IKIA 2ZRYA 1E6QM 3L4WA 3BZJA 1KV8A 4UFLA 5D8WA 3UY8A 1EB3A 2ZRVA 3UXLA 3PG8A 4N4PA 2VT0A 4RDWA 1XG4A 2I16A 2GVEA 1O95A 2POZA 4W84A 3VINA 4EOUA 1M3UA 2VFFA 1RPKA 1I0DA 1EXBA 3N14A 3JVAA 4KPLA 1QPRA 3U57A 3P62A 4H1ZA 4HZ6A 3ZLGA 3ZS4A 3V0SA 2OZTA 3KW3A 5FAGA 1NELA 1X6LA 4IISA 4LVDA 2VR5A 3N2CA 3V36A 2GYIA 3GU2A 3RK8A 3RIKA 3BGAA 4CCEA 2EG8A 5CBBA 4JY9A 4J28A 3QPYA 2DZVA 1C8VA 1JDDA 4I9TA 2FJKA 2WSQA 1XLHA 3VX0A 2WBKA 1EO5A 5PTDA 1EYEA 1OCNA 3E2QA 2AKMA 3UG3A 3PBWA 2HVMA 2XYLA 1ZSXA 1TTIA 4L9XA 2WHKA 1ME7A 3PBUA 1P1MA 5CPMA 3OG3A 3VM7A 3JR2A 2R1PA 1QI2A 4BEQA 2NX9A 2ZX8A 5B80A 3TYDA 3G6MA 3LMYA 4WY0F 3B0VC 1CCWB 3GTIA 1RHCA 1MXDA 4N42A 4IPNB 1VPQA 3TC6A 4U4MA 5DX7A 2X0YA 3IUIA 1EH9A 2AGTA 1K7FA 4R27A 4HT3A 1NOFA 3C3UA 5A8NA 5DANA 2BP1A 4PUDA 2Y5JA 3N6QA 2X0HA 1YMYA 1UWTA 4PTMA 3DENA 3GHUA 3NYDA 5HMSA 1I2RA 4GQQA 1PTGA 4O15A 4MFEA 4FA3A 2IPWA 4TO8A 3HTWA 1GW9A 1KFEA 1XKJA 3ITYA 2ZX7A 3T07A 3F2BA 1NF7A 2E40A 3RG6A 2GJPA 1K7EA 3BV4A 3MSDA 1SJBA 4O17A 4CNTA 3GYEA 1HL8A 3WQ6A 4EAMA 1JPKA 4L1GA 1KRAC 3GR4A 5I3DA 1Q5MA 1JCLA 1WB0A 2WMIA 2ZVIA 1JZ3A 5LZLA 3ZYZA 1OG0A 1EC7A 1CLKA 2OLAA 3LXAA 5KITA 1TZ9A 4ZSUA 3G0XA 4JYEA 4GNKB 3SRFA 4XD6A 3NQ2A 3CPRA 3ARVA 1YHTA 3LXBA 1QPKA 3V16A 3ABRA 3KRUA 3ORWA 1PXGA 3R13A 3VAVA 3VMOA 3NOYA 2OKOA 3P3BA 3DFPA 4B5SA 4KEUA 4H8VA 2VZUA 3V0UA 1W8SA 2WKLA 5D8ZA 1L8PA 2PWUA 1UR3M 1X39A 3E0IA 5HR7A 3WL1A 3RRAA 3NSXA 4UOQA 1SFSA 3NEVA 1YE6A 2HQAA 3LLFA 4XKMA 3WNOA 3T2QA 3MI3A 1FHLA 4S2BA 5GJMA 1HJXA 4XK2A 3DFOA 2QHAA 1WAUA 2HK1A 5G1TA 1NDYA 4A3QA 3KBVA 4JHMA 4FHAA 2PWFA 4KWUA 1N7KA 4KKXA 1W3TA 2P5NA 1P43A 4QISA 4AZCA 4QNEA 4O50A 2BXYA 2PDYA 1TA3A 1WXJA 2X41A 2ZXBA 4HTYA 4C6OA 1JXJA 1QI3A 4AVFA 2PDCA 1XLIA 1EGVA 1DIKA 1GZ1A 4DJDA 3P7YA 5HWMA 4PMJA 3AHTA 1Q66A 3QY8A 4H83A 4INFA 1EC9A 3B04A 3VU2A 3WD3A 3B4UA 2CZDA 4WKFA 1JEZA 3DBPA 1REQA 5DEZA 2BXZA 4O4VA 5LNWA 4GACA 3GWQA 3N2XA 1UMLA 2YBUA 3UPBA 4DAIA 1W5NA 4FK9A 4K8EA 3IK2A 4JFSA 4AZ7A 1J11A 2PTXA 4B5NA 2PLJA 4HHHA 3BLOA 2X0SA 3SRDA 1VCFA 3CO8A 2RKXA 1S5TA 1FHUA 1OK4A 1SMAA 2C1GA 1H5YA 2V2CA 1MEWA 3FSTA 3ZSSA 4EXBA 2PGWA 4KGLA 1JL8A 3N6HA 3VOJA 1CXEA 4NQ1A 4H4IA 1XBXA 1V3MA 4TX8A 2PDHA 2OX1A 1SR0A 3S6DA 1J10A 4QE5A 1JFHA 3R58A 1RLDA 2WVUA 3HA1A 4NILA 4DJEC 2ASHA 5EMKA 1VEMA 4N7QA 2DZUA 3OIHA 2Z27A 3EKZA 1R3WA 2H8ZA 1SZEA 1NY1A 1V6XA 3L4ZA 4KCUA 3VNKA 3OGVA 4IOTA 2VO5A 2V3FA 1GYLA 4NX5A 2R24A 3EWBX 4Z1AA 4WGXA 4E8DA 1VRDA 2QCFA 2WNNA 2J7BA 2WBGA 3BGJA 2OO0A 3W7HA 4AD4A 4X22A 2A3BA 1CENA 1IZJA 3MWAA 3M5VA 3MU7A 1X1ZA 2RDWA 1GW1A 4XAZA 3T44A 3M0HA 8RUCA 3A47A 2WHMA 1HL2A 2XH7A 3B8TA 2W61A 2ZXDA 1R30A 2J27A 5BXTA 4GABA 5TQLA 4REQA 1PKNA 2W4XA 3LRMA 2VDHA 2OWCA 4AXKA 3W7NA 4OIFA 2DZXA 1LQ0A 4RZ6A 2OSYA 5IHRA 3UWUA 2C19A 1JR1A 5HJXA 1DV7A 1AD4A 1IYXA 2BY1A 1UP3A 4QHRA 4KRTA 2PTWA 4ATLA 3DG3A 3UZWA 4IIBA 2ZTKA 5IHSA 4M6UA 4EPDC 3R25A 3A21A 6PTDA 4D2JA 2PDWA 2NT1A 1EFZA 2PB1A 4PCFA 2FHCA 3WF3A 4RPQA 2IQ0A 4Y2WA 2XVNA 4XAGA 2FZ8A 4MDPA 3QKZA 4PL1A 1J9YA 1E4LA 1W37A 1WDQA 1ZY9A 1QO5A 1FCBA 4XKYB 3CLMA 1W5OA 3ITXA 3TCSA 1XKYA 5EFFA 3DAQA 3AQUA 2ZICA 4R9OA 3LYEA 4I7WA 4JTDA 4JS3A 1E9LA 3AOFA 2O9RA 1NSJA 2WCGA 2XSAA 4B3LA 3PZUA 4JXCA 3IJ8A 2QUNA 1JI1A 2QJIA 3T81A 3WO8A 5A5WA 4LJ3A 3SCWA 4PCSA 3AIVA 4DBEA 2KZHA 2DIJA 4DRSA 1S2TA 1AL8A 4I9AA 4OT7A 4OFCA 4PTNA 3QLLA 5SWUA 4JAWA 4RZBA 5CZKA 1W3KA 2NSXA 3GRIA 3PZTA 3GG1A 3QKEA 4UMCA 3LV5A 1FOBA 2GVJA 4TOQA 3VC6A 1FVPA 3UJSA 5HPCA 5DQPA 1DE6A 1IGWA 1BG9A 2I56A 3PBGA 4Y9OA 3NQVA 1K03A 1OWQA 1T99A 3B9AA 3RR1A 4LXFA 2J9YA 1EUAA 2YCKX 3MHGA 2NVCA 5LIYX 2GQ3A 1VBUA 1CDGA 3GVWA 3CUIA 3MANA 4AVOA 2BHZA 1UD6A 1X8FA 2ZUNA 3RMEA 4PRTA 3VOGA 5LHFA 2XFWA 3W1XA 3DH7A 3LBMA 2CLHA 3P82A 5E6YA 3RMJA 4Z1YA 1H09A 1O6IA 3LCXA 3GM8A 4PE8A 2WB5A 1RXOB 3LMZA 2Y8KA 2ACRA 1OFRA 2IW0A 1K8ZA 1UQYA 2GJXA 4CVWA 3VK5A 4XQ6A 3ITVA 5MKGA 3OJGA 1W1YA 3WMCA 4WF7A 4GGBA 4PCNA 2DPEA 3HFYA 1H62A 4X9SA 1ZJAA 2ZUUA 5CJMA 5EPDA 3QEZA 3PBYA 4QCEA 2QQ6A 3CL8A 2EPNA 1NIUA 1LT8A 2JEQA 2WM0A 2F84A 3TIMA 3SCRA 2GQ8A 4I5RA 3WK3A 5FJOA 1PTDA 2FHBA 3D6NA 3WX7A 4GJJA 3NQGA 1V6VA 2W79A 3W82A 4F0MA 2VMFA 1UZ1A 2H3DA 1AQFA 1EJXC 1F3XA 3BJTA 2G3FA 4AWUA 4P5UA 3ATZA 2VFIA 4JNZA 2OMAA 4IM4A 4FOKA 4UQAA 1Z9AA 8XIMA 2XZ9A 4W7UA 3NPUA 2IS7A 4XAYA 3GHSA 4GI4A 1JF6A 5T26A 4DX3A 1AD1A 3L4YA 1UPPA 1LT7A 4DWDA 3LM3A 5C2GA 4TR9A 1DOSA 1VRXA 5AHFA 1VYPX 3ABOA 4P7NA 5LIUX 4W9TA 3DESA 1MFVA 1P0BA 3UZYA 3TV8A 1JDCA 3E96A 1I6NA 1P6BA 3WLPA 3G1AA 2OYLA 1E6PA 1DHPA 3OPSA 1F9CA 4XO6A 4ZO8A 4YCPA 5HINA 4C1NB 4JKMA 3WD2A 1UMYA 3TAOA 2MUCA 2PTZA 4H8NA 2REQB 3EPNA 2B7OA 2JKEA 2CU0A 4UCGA 2J7FA 3UA3A 3OHMB 4GC3A 1OIMA 3AHXA 3SJ3A 3WDHA 4FR1A 1ZJBA 2ZDRA 1YKWA 3H12A 1X1NA 3OQEA 2KX9A 1QW8A 1E15A 4YXGA 4XD4A 3G5EA 1J0JA 4ZBCA 2HISA 3REQB 1U1UA 2NXGA 3W7KA 3I6RA 2O4QA 4KGJA 4HPNA 1E9ZB 5H8MA 3SB0A 3SN1A 2Z2AA 4HN4A 3CB8A 4GC4A 5JIWA 3NQ6A 1PS9A 4BF9A 3T9PA 4NY2A 3G1YA 1VPYA 2ABBA 1HJUA 1IEWA 2DUXA 1PB0A 1UW9A 1TYGA 3FSUA 5DMLA 3RPDA 1I75A 1TSIA 4JL1A 1TPFA 1IEXA 1JVNA 2IKJA 1KR0A 1IR2A 4O28A 3CAVA 3WLTA 4OZOA 3XISA 1QNSA 4HZMA 3VI2A 1US2A 5CG7A 3W70A 3ZJ7A 4F8XA 3PUEA 1R3VA 2WOQA 2DFAA 3NQBA 4NZFA 4LF1A 3GW3A 4JR5A 4F4RA 2DJLA 4A8IA 3OBKA 5F2LA 3T40A 2WLZA 4H9ZA 5CC3A 4UQBA 2V69A 1UKPA 3F5JA 3VGHA 1ZCCA 5EGRA 3S1XA 1QNRA 3ONBA 1GTEA 3CUHA 1SMDA 2Z1VA 3K46A 4K2SA 4GYKA 3ZSTA 4HNNA 1NFPA 2Y6ZA 4FX8A 4UC5A 3RHGA 4L64A 4GUFA 2C1IA 5I3JA 1E6XM 1JZ8A 2ANUA 3W2JA 3VNMA 3THUA 2XN0A 1BYAA 4PUEA 3MP3A 4DZIA 2VRQA 5C9UA 3QF0A 5J04A 5AHLA 1W0MA 1MUWA 3QM3A 4GE8A 4ZQCA 4Y8FA 1FY6A 4HNTA 3SUTA 2NQHA 2DJXA 4ZODA 2XIIA 3QW4B 2WHJA 4AISA 1VJSA 4DXKA 2VX6A 4X3ZA 4NRSA 2QDDA 1MQPA 3E6EA 4J2PA 1Z8AA 1H51A 1E1CB 4G9PA 3THQA 4AHQA 3L21A 1RALA 3GIQA 4I5XA 2J62A 1TQJA 5JBDA 4GMEA 2OPJA 1S46A 2X8RA 1RAKA 5T91A 3C3NA 1A5OC 3R10A 4LVBA 2WMIB 1ICPA 3T1GA 3PAJA 4U3CA 1U83A 3P80A 2O7SA 5BU9A 5LA0A 3EWDA 2AQOA 3RCNA 1VKFA 4LSBA 4MYXA 4AWSA 1EBHA 2WZTA 4Q4MA 1QHZA 1T8QA 1XFBA 3WDQA 5AN7A 3MWCA 4BQ5A 1O66A 3RX2A 4NVTA 2XFFA 2CZFA 3BMXA 3MDWA 5D38A 1Q7QA 1GVRA 1VBRA 2D73A 2FGBA 3AHZA 3EKGA 3P5YA 4GY7A 1FWJC 3AI0A 1HQTA 2NSOA 1JCXA 2DUZA 3TN6A 5JH1A 3QV8A 2YZRA 3MJMA 4N4QA 4A2SA 5M17A 1QOQA 4BR1A 1E0WA 3W01A 3N17A 2V68A 4PCTA 3OLDA 3AIBA 5DY2A 4DWSC 3ZR5A 1EIXA 3PBVA 3CHFA 2P88A 2MNRA 4FXSA 4DF1A 5LGXA 2G3NA 5G2IA 3RLVA 3EWZA 3KHDA 3IJDA 4DJDD 1E4MM 3CZLA 1OHLA 3OOQA 4AZCB 1TA3B 2VJXA 3W1AA 1PYMA 2LLEA 3T78A 3EMCA 2D3NA 3DXIA 3AU2A 3LCGA 1FFQA 4B91A 4YTUA 4EVZA 1ONXA 1W17A 2R14A 1XCXA 3VKAA 4GY1A 2UWFA 4LC6A 2B0MA 3NXLA 3TWAA 3UETA 4C6QA 1TPH1 3NL3A 1HJSA 1JCJA 3F1QA 3WMLA 4BF5A 1UC5A 4YS1A 2Y5SA 1E6ZA 1I2OA 2V63A 1PTAA 5DMMA 3EX4A 3PP7A 5G2HA 3UWQA 1SO6A 3F2CA 5FJRA 3QRHA 2PUZA 4KWWA 2VR4A 1WDDA 3LBOA 1H50A 3WLLA 3PNZA 4QM1A 3G1FA 5AKQA 1RD5A 2VOTA 3TTSA 4Q22A 3M6DA 1FH7A 2IXVA 4NI3A 3BO9A 1IIGA 1UUOA 4ZO9A 2TPSA 3LU2A 1V6UA 2ZX6A 4RXFA 1JCMP 4JTFA 5FKYA 1TWDA 3EB2A 3LSCA 3XINA 1RK5A 2X2GA 4F0RA 1C7SA 1SUXA 3E3HA 3W7IA 4NZ1A 3L4VA 5CG0A 3UYIA 3W81A 2FYMA 1WKEA 2E5BA 2TYSA 5GJNA 4XZMX 1Z7AA 3WL0A 1ICQA 3V0TA 5U7SA 1T96A 5LNRA 3S6TA 1FWNA 1TMQA 3CMGA 4PTXA 2C7FA 4H2HA 1EJRC 1SSGA 3GDKA 2GPTA 1JZ4A 4S39A 3RPTA 1C91A 3BXWA 1HGYA 4UMAA 1XLJA 2PWVA 3N2BA 1VFOA 3QSTA 4M3PA 1THFD 1MW2A 1UASA 1R0MA 2IPJA 2OODA 4AQLA 1TPVA 3EWUA 3UPWA 2A6LA 2DV0A 1OFOA 3FAWA 4F2BA 2C1HA 1BKHA 1C9DA 4GZEA 1A4LA 2GGGA 2XN2A 3B4YA 1GQLA 3ANUA 1JYWA 1ITUA 1CWYA 4HD5A 1D3GA 2JBMA 1UWQA 1G4EA 3U5UA 2H9AB 3FVDA 2XH2A 1ALDA 2VTFA 2QCCA 4AD0A 1XIFA 4EP8C 3UY7A 5K4XA 2PRLA 3AHYA 1W1B1 4REQB 1U5JA 3RJYA 3H4WA 2GDVA 2VOMA 3M46A 2QF7A 4UFIA 3ID7A 3DFNA 4US5D 4N2YA 3R8GA 4L9YA 4I3GA 1F74A 1ZBWA 2J24A 4HNUA 4UQ9A 3RLGA 3H7RA 2WMFA 4C6IA 2J88A 4E8CA 3O63A 2WPGA 5LSMA 3MUAA 4UBPC 1SZRA 3IJ7A 2GK1A 1PPIA 1F6YA 1G7VA 5C2CA 3CL6A 4HK5A 2BHUA 4NXKA 1QDSA 4E2VA 4PODA 3W3OA 3S2CA 4ACZA 2J7GA 4H6KA 3VIIA 4C90A 3HPZA 4JTUA 3S9YA 3TXZA 1OY0A 4W4QA 4KFNA 4EF9A 4A22A 1PIFA 2JK2A 3UCCA 1WZMA 2BVDA 1VIWA 1RUSA 5D2TA 1ELSA 3EOSA 5EMMA 4TX6A 3SECA 2O4MA 4WRHA 4AEOA 4D8LA 2HS8A 5CSRA 1H63A 1IZCA 1HTIA 4HNOA 1KB3A 4K1WA 3VDGA 4CQDA 3ICJA 4IF2A 4I9JA 1UD2A 3UR7A 2FDSA 3CAKA 1DYSA 3MW7A 4F0SA 1PZ0A 3IJLA 1EHAA 3TJLA 3BAJA 2H8XA 3TJ4A 3WUGA 2PBGA 1R3YA 3BOLA 3LNPA 2RJGA 3EB3A 3P0WA 3EXRA 3M5ZA 4CN4A 4L4MA 3AHVA 1WKDA 3C2FA 3KXQA 5E5CA 4MPQA 3WELA 4M1RA 2I14A 2Y24A 5LYRA 1QWKA 1O12A 1SZFA 5C54A 1CBGA 1YDOA 3B0UX 4O1EA 4TV6A 3N9RA 1VGAA 2XIJA 1C93A 4O8AA 3LX9A 2UY3A 1WQ5A 2VWTA 3AJXA 5CGMA 3KTCA 2ZC8A 3AYRA 3CMFA 1H41A 4LS0A 3LEPA 1SSDA 3NQEA 3GLCA 4EANA 3W4RA 3G3MA 2B7NA 2CLFA 4Y9PA 2NXHA 4FNTA 1UA7A 1D8WA 4HU4A 5B7ZA 2OSXA 3UG5A 2Y70A 3W7OA 4JEQA 2C15A 1B30A 3KCJA 1L9WA 1XRSA 1CECA 2Y85A 4J27A 3NZ1A 3H2MA 1V6WA 5REQA 5FSDC 2INZA 4UMBA 4YHGA 4MDOA 2X16A 4ERIA 2AQVA 3AMKA 4ZEPA 3QC0A 3PTKA 3LHVA 5A2CA 4UTKA 3A24A 2JE8A 5FACA 1FA2A 1MNZA 1N8FA 3GXNA 1SJCA 5FIPA 2X05A 5H8UA 1QNOA 1A3XA 1XYCA 4JQ4A 4A21A 5D05A 5J8LA 3S2LA 4IIHA 1B3OA 1G94A 2HPMA 3O07A 3QQWA 4W8AA 2G5WA 1W1TA 4JN7A 5K7JA 1OSEA 1MRAA 2F2HA 3BZGA 2XN1A 4R9XA 4N0RA 4LUIA 1E55A 3THAA 3WKZA 1JCTA 3PTDA 1XLMA 2P76A 1E56A 1K9FA 3EPOA 4MADA 2DVTA 2EGZA 2V3EA 1EJUC 4QG9A 4UIOA 1U33A 3W25A 1LUCA 3PFMA 4XWUA 2TODA 1KLYA 3B8DA 3HO8A 3MCMA 5HNRA 2J6VA 1ZPTA 3NO3A 1JZ5A 3WCZA 1VR6A 3AIQA 2NWRA 3GUGA 4E3VA 4IMAA 2EPKX 2YXXA 4DY1A 1WBJA 1PE1A 3T8QA 3TNBA 3SUUA 3W74A 1LL4A 3IUHA 4XG1A 1VQTA 4HPGA 3RCYA 3RR4A 3TW6A 2PCEA 3JZEA 2PLCA 1EEPA 1FWFC 4AZ5A 3RF9A 4IICA 1U2YA 3APGA 3SFKA 4HP5A 3G1RA 3LCLA 3B05A 3WUEA 1TFVA 2QJNA 1F07A 3R12A 3OZMA 4ZXOA 1JNEA 5HMFA 1VFUA 3MYPA 4AYSA 1KM1A 1JCYA 3KRSA 3T4WA 3WDIA 1R3SA 3FXYA 1GPWA 2B4GA 1XS2A 3R94A 3VNDA 5AYIA 3SSJA 1X6NA 5KZDA 1B3ZA 1QTWA 1LWIA 3BICA 4BQ3A 4OBSA 2A2IA 3C0JA 4HPJA 4CNPA 2VM8A 4Z2KA 3U3HA 4MWAA 2VD9A 4H01A 4HMDA 4ZMGA 4B3KA 4WKAA 2R1MA 4DYJA 3C8NA 4H7VA 3HGSA 1P6CA 5I3IA 3WJYA 3UXAA 3UJEA 1FHDA 1XSKA 1DWIM 4HKPA 3CM4A 4MLRA 3ZM8A 4IQEA 5FEWA 3VD7A 3M9YA 1S5VA 2QDGA 4ICNA 1J6PA 2NX3A 5T9CE 4NZ3A 4BQ4A 2ZUMA 3KRBA 1RK6A 3OA5A 4UTLA 3MUIA 3LD5A 3K4AA 1FCQA 4XVEA 2GWNA 3RJXA 2VL4A 3UQNA 4LNCA 3TMQA 2QPSA 3AUOA 3DFTA 1GJWA 1H49A 1P5BA 3NL2A 3SIZA 3WBWA 3NR0A 1O94A 1E3ZA 3ZXWA 3KAOA 3CK5A 2Z6JA 3IRSA 3W2LA 2ZZ4A 3QTGA 4LQ1A 4QRNA 2XH0A 4H19A 3E0LA 3MMUA 3SFWA 3WH6A 4RNJA 3IPWA 4C6PA 3WJXA 3ITCA 1ECQA 4W89A 1W9UA 1ODZA 4D9PA 2F2KA 3MP5A 3A3HA 4FXRA 4G7EA 4WUIA 1BKSA 3CS2A 2X7VA 3S1UA 1IXNA 1WUEA 5CEWA 4HNVA 1ZZMA 4F0LA 1FFRA 3GH4A 4HK7A 1BVWA 1RP8A 4J1OA 1XL9A 2A3CA 5D04C 2D2GA 3N13A 2WNQA 4GGHA 4H7ZA 5DRIA 5B7YA 4C6FA 3LV6A 1P0NA 1FWRA 1FBAA 1TPWA 2BB0A 1FRBA 2YXOA 5JVLA 2Y88A 4IFRA 1FCVA 2XISA 3A4JA 2WJZA 2Y0FA 3I68A 1G7UA 4W7VA 2DQWA 3M07A 3CQKA 1GPFA 1NQKA 3V7PA 2CLMA 2PDLA 5AECA 2V81A 4K7YA 1GHSA 1P7TA 1HKWA 3P60A 1Q6GA 5E1QA 1YBQA 3WF2A 2XIQA 3KBMA 1O5KA 4OBRA 4NJGA 3GUWA 4DZAA 2G96A 5D32A 3GE7A 4HIBA 4C7GA 1SGJA 3EX1A 4JX4A 4NAEA 1UHVA 1JYVA 4HNCA 4ACYA 3PTMA 3WG6A 3TTOA 2Z00A 1QI0A 4OKDA 5A8QA 4L4LA 1DWAM 1DJHA 3O6CA 3IS4A 2CLEA 2RHGA 3U2OA 4GINA 5C7VA 1B9BA 1V93A 2E9MA 4O52A 1DQWA 5EFDA 2Q3RA 1P0DA 1RQBA 2I5GA 2OKTA 1GGOA 3KM8A 3AIRA 1JDFA 1TV5A 2V3GA 2C0HA 1NP0A 2YKKA 1XLBA 4A3YA 4X63A 2ADAA 1LRNA 2DZPA 4HJFA 1IIHA 2WJFA 3IJIA 3TJIA 3VUSA 2VEIA 2I9UA 4LAMA 3E49A 5I3FA 3VIMA 4LX4A 1E6RA 2MANA 1Z42A 3UZ5A 4KEZA 4P2VA 3AZRA 1V02A 3U2EA 1OC6A 2PDGA 5LIWX 1VYRA 1J2BA 3URBA 1EYWA 4GVIA 4D6JA 3AS3A 1UR8A 5HWJA 4E2BA 4PBEA 2KAUC 4P7LA 1FUYA 1WXZA 2H90A 3HM7A 3NL5A 3JW7A 4CKQA 4IPPA 2C91A 2CNCA 4HOWA 2ZDSA 5BWAA 1YLVA 4Z1BA 3IAPA 4NT0A 4PYSA 3FGCA 1V51A 3B9DA 5C71A 3AMGA 3QHOA 2PDBA 4UR8A 3KOZA