1S5VA

Crystal structure analysis of a mutant of dihydrodipicolinate synthase--residue tyr107 to phe107
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYFNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Three Site-directed Mutants of Escherichia coli Dihydrodipicolinate Synthase: Further Evidence for a Catalytic Triad
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 107
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1s5vA00
2H90A 1WQ5A 3O8AA 4IMGA 4KFPA 1TSIA 1GYLA 2ZQ0A 3PBUA 3S5OA 4MYAA 4O54A 3D0CA 3YPIA 3O16A 2NUXA 3RF9A 3O15A 1GJPA 1JR1A 3UY7A 3QSRA 2Y7GA 1QAPA 3GZ3A 4GUJA 5DLCA 4ADUA 4ZQOA 3CLMA 3G0XA 3RFAA 4BI5A 1UCWA 3W1AA 2DZUA 4MFDA 1FDZA 3MUXA 3GDTA 1VYPX 3M5VA 3H55A 2QCDA 4LT9A 1VC4A 3W7EA 5DCEA 4JTKA 1TTQA 3SGUA 4R7JA 3B8DA 3W2JA 4O13A 4JGDA 1RQBA 4E2DA 5EMUA 4O19A 1W3NA 2Y61A 2QJGA 3C52A 3C0JA 4DELA 4RCXA 1I4NA 1KM4A 3CWNA 4Z1BA 1OHLA 1PIIA 1JCNA 1AW2A 4LC8A 4CNOA 2YGYA 4ICNA 3HPXA 2NUWA 1XUUA 3UWYA 3BLFA 3G1FA 3UD6A 4QITA 4N6EA 2ATSA 3W76A 1XDMA 2WSYA 2ZFAA 4OU1A 3EX2A 5FEPA 5F4SA 3H54A 1BWLA 1NFBA 4NVTA 4EOUA 1YXDA 3GAYA 3LBCA 3BG9A 1R46A 3UQNA 4NNAA 1FWSA 5HUPA 4HKPA 3TSDA 3U6WA 1ZALA 4LWWA 5HWMA 3EWYA 1RQHA 1J2WA 1VCVA 1B4EA 3NL6A 2A7RA 2ZRWA 3DFSA 3NL5A 4DF0A 3E02A 3NPVA 2BLEA 2Q8ZA 2YW3A 1LRQA 2C1HA 2AAMA 2GPTA 4N02A 3W7HA 3HPZA 3VI2A 3TC7A 1K8YA 1DKWA 2W79A 2RDTA 2CW6A 2QCNA 1L6WA 3MWAA 3T7VA 1EWEA 4A22A 3I7RA 2JGQA 5C54A 3OHIA 3UZJA 3LHVA 3I65A 2DZTA 3S1VA 2FLIA 2FPTA 1SSDA 3TU9A 1VCGA 3M5XA 4O17A 3DBPA 1O94A 3P5ZA 3QW4B 4B5NA 3LTSA 5D02A 4Z1DA 5CPMA 3USBA 4CQ9A 3RLUA 4QAIA 1FCBA 4MZ8A 2P0OA 1IIGA 3SR7A 3JS3A 3FJ6A 1TPVA 4ZVJA 3QMRA 4WY0A 3M47A 4UC5A 5K9DA 3IV3A 3PUDA 1GVQA 4BK9A 2DU2A 2CLHA 4JTTA 3W7IA 1LROA 3FFSA 3DI0A 4BWLA 3EWWA 4LRSA 4QIUA 4FB7A 1EUAA 2ZZ6A 4DBDA 2CLMA 4N6FA 3PG8A 4A2SA 2V2HA 3W86A 5G4EA 3W7DA 3STFA 1H7XA 3PF3A 3GXPA 4UTLA 3IGSA 2LLEA 4O11A 2Z6IA 3LCFA 4LOCA 3TMLA 3UXAA 2X1SA 4RKAA 1H1YA 4O0KA 3N3MA 4NX0A 4K6AA 1F6KA 1S3HA 2GUUA 3C3NA 3UZ5A 1WXJA 4M7SA 3W75A 2ZZ2A 1TYGA 4O15A 1ML1A 1SFLA 1WBHA 3NQVA 5HUOA 2ZRUA 5AYXA 1DJQA 3EWZA 3L5AA 3LRKA 1VHCA 2A6NA 4Z1CA 3LHTA 3LCIA 5I3GA 1AL8A 3W9ZA 3MHFA 3N9RA 2FPYA 2VC6A 1EWDA 4IPJA 5U7SA 2NV1A 1EB3A 4GNJA 1QPQA 2J6XA 3R12A 4NQ1A 3A9IA 3GXNA 3NXFA 1KFJA 4DO6A 4AB4A 1TPC1 3ABSA 2I9EA 1PVNA 1IXPA 2QKFA 3WK0A 4AHQA 3U8GA 5FF0A 3S1UA 3KHJA 1QPNA 3LOTA 5DCBA 5BW6A 3C2FA 3G8EA 1A5AA 2C3ZA 1YLVA 4O1BA 5F1UA 5EKYA 3TROA 2D73A 4KWWA 1T8XA 5DELA 3TQVA 1RD5A 2CLLA 2TRSA 3M44A 1K7XA 1TB3A 1XXXA 4UMAA 1DJNA 2CU0A 5LNWA 4JTLA 4IWWA 4ZQMA 5KMYA 1ZAJA 3T55A 3HG2A 2VFHA 3BARA 4AWSA 2BX7A 1H7RA 2FTPA 3MP3A 4YL2A 1GVSA 1TPH1 1ZJIA 3NQEA 2G97A 3LLFA 3B06A 3TA6A 4ADSA 3V1PA 4JX4A 4ORMA 2HSAA 3NAVA 1B9BA 4IGHA 3NQGA 1KM6A 3MI6A 1G4EA 3K30A 4DPQA 5E0KA 3HOJA 5FESA 3NQAA 1R47A 1KBIA 3S1WA 4O18A 2FB2A 2PRMA 3P60A 5FF3A 1F76A 2GVJA 1PCKA 1TRDA 5L6UA 1TV5A 3HG4A 3O1NA 3EWXA 4O14A 2RDWA 4HPJA 3W3OA 1PCWA 1QR7A 1BEUA 4NZJA 1B4KA 4JIQA 4M7TA 4N9EA 4RX0A 2B0MA 1AG1O 3CPRA 1W3TA 2V8ZA 2QAFA 4C1LA 2ISVA 3T44A 1K02A 4HPXA 1TJPA 5AYYA 3KXQA 3LI1A 4DPPA 3TX9A 4AEOA 4UFKA 1YTDA 1RV8A 4YXGA 2R14A 2ZDRA 4QSHA 2WKJA 4QJ1A 3CHVA 4RLIA 1N8FA 3JR2A 4JTHA 2Y7FA 3PY2A 1TIMA 2ABBA 3DFQA 3L5LA 1M6JA 4N9BA 2BTMA 4YLWA 1TJRA 1TPB1 3TJLA 4LVBA 5HQEA 2QCHA 2ISSA 3GKAA 4NJKA 3M0ZA 4TMCA 3UWQA 1QPOA 4UCGA 2VXNA 3FYPA 4O8RA 5D30A 2QAPA 5EYWA 3NR0A 1N55A 3O06A 4GE8A 1VHNA 3W71A 2WO5A 3STEA 2J27A 1SFJA 3TQ0A 2FB3A 2EPHA 3G1DA 3EWBX 1G7VA 5AC8A 1A5BA 3TUUA 2JKEA 3OIXA 4RXGA 2OX1A 5D33A 1ZENA 1V7YA 2E5DA 2HMCA 1SZFA 1TREA 1Y0EA 3O6DA 3QJAA 3WJWA 4FIQA 4IX0A 5DY3A 3TV8A 3CWOX 3R89A 3GKFA 3W72A 2NUYA 5IBXA 1M7OA 1YXCA 5I3JA 4MUZA 1FCVA 4NJIA 5DBUA 6ALDA 1DL3A 3QRHA 3DGRA 1I8JA 1HO1A 4ORIA 1LYXA 5KINA 2O7QA 4H3DA 2GOUA 2HTMA 4QNWA 1W5OA 2Y63A 1O5KA 1H62A 1WOAA 5AC7A 4ONVA 4I9AA 4N2YA 1TRIA 1D3HA 5DCDA 1LDCA 4JEQA 1OYAA 4PL2A 2QUTA 5F4XA 4ZMGA 1C9DA 3EWUA 3R5EA 1ME8A 3VNDA 2QR6A 3P80A 1CX9A 3LX9A 4UTTC 1EP2A 2BXVA 4UIOA 3M16A 3PBVA 2WV8A 3UYCA 2RH9A 1YDNA 1FQ0A 2YSWA 2H8XA 4UMBA 3W2MA 4NT0A 3WJSA 2YZRA 5CSRA 1OF8A 3C2VA 5C6MA 1O60A 2P10A 1GG1A 3TAOA 2WSRA 3SY5A 2JKPA 2G95A 5A5WA 2VFDA 1SO6A 1WX0A 2Q3RA 3QMTA 3P84A 2X1RA 3VE9A 4NNBA 2OCZA 1TTPA 3W2NA 3FKRA 1UBSA 1YPIA 1AW5A 4HIBA 4MJMA 3L5MA 2C0AA 2FPVA 5H2ZA 2EKCA 1JCXA 1NF7A 3OVPA 2FFCA 3GLCA 3G18A 1JULA 2A7PA 1KM5A 2DZPA 4FX8A 4PC8A 5GVJA 4L4MA 1W56A 2A6LA 2YX0A 3NPWA 4CCDA 3MHGA 5EPDA 3N2MA 3TJXA 3TDFA 1OYBA 5D2YA 1SU5A 4BWLC 3MJYA 2VEPA 4K8HA 3W7LA 5HWNA 1OX4A 3NQFA 4EF9A 4XZ9A 3GR8A 3S5NA 4LVDA 1TPDA 1KM3A 4HT3A 5EA9A 1GVRA 2NWRA 4EVZA 4IUOA 4UR8A 5KZMA 3S0CA 1TMHA 4DBEA 3L9CA 1P0NA 3P67A 4EIVA 4N4PA 4O4VA 3OG3A 3FA5A 1LOQA 1GZGA 3ABQA 4O1CA 1HG3A 1BTMA 3IGXA 3B4UA 3W22A 3ZS4A 1I2RA 3P8IA 1EIXA 4O10A 2AGKA 2XN0A 3NM1A 3W23A 1OG0A 1LLWA 3TXVA 1XUZA 1SZGA 4UFJA 3BV4A 1FDYA 3W1PA 4FNUA 1EPXA 4JTGA 3LXCA 1EX5A 2Z6JA 2RKXA 1FWRA 1FUYA 2GJLA 3GR7A 4M6QA 2DJXA 5F2GA 5I3FA 1DV7A 3LTYA 2EF9A 2YYUA 2V81A 1PE1A 4BFAA 3NG3A 4RR4A 4OBTA 1OFOA 3W7JA 3TMQA 2C13A 5CKSA 3DXIA 1QO2A 3PBYA 3F4WA 4MPQA 2QDGA 2V9DA 3G1XA 1NF0A 1FDJA 4FHAA 4IMDA 5CZJA 3LHWA 4EWND 1VPXA 2PC4A 3E0IA 1XI3A 3U2OA 1NSJA 1LTDA 4K8EA 3ZFHA 3L0GA 4FIRA 4UXDA 3W6YA 5G2WA 3CQ0A 4U28A 1X6UA 5F2IA 3TC6A 3B03A 5T26A 1C8VA 3L68A 2DZSA 1ICPA 2DJLA 5D2WA 4K7VA 4PA8A 1JUEA 4Q4KA 5HJLA 3THAA 1HL2A 3W1UA 2CZ5A 2ZA3A 1TPWA 1TQXA 1XL9A 3TNOA 4K37A 1SZNA 2PRLA 1K8ZA 3CTLA 3LCHA 1NEYA 1Q6LA 3I7SA 1GWJA 3LBMA 3IGUA 5AC6A 5BOOA 5G4WA 5G2HA 2FDSA 3BVJA 4O1AA 1H5YA 2BWGA 3L21A 5TBOA 1O5XA 3TCEA 3FLUA 5IM51 1GEQA 3DKJA 3O05A 1KFKA 3AO0A 4FNQA 1RZMA 5C2XA 2H3BA 3P62A 1FWWA 3W7NA 4P61A 4W9TA 2QJIA 3Q94A 1XBYA 4MLJA 2UV8G 1KM1A 1YDVA 4XWUA 3G24A 1KW1A 4I7VA 3W7RA 1KBJA 5HMSA 1LP6A 1GOXA 4LV9A 4ZQRA 1H7OA 3WK2A 1KLZA 4JYFA 1OF6A 1LBLA 3STGA 3GIYA 5BMXA 3F03K 1N7KA 3KOFA 4JDBA 2ZZ5A 1Z41A 2GVGA 3NL3A 4XBSA 3W1LA 1RVGA 3L66A 3ATZA 3QPYA 5LHFA 1W1ZA 5MHBA 1TTIA 3I7QA 3M6YA 3LI0A 4O1DA 1I2NA 3TE9A 4UFHA 1VRDA 4QISA 3W7QA 3M5YA 4LU0A 2ZZ1A 5FEXA 3G1HA 3WJYA 2ZCGA 1GT8A 3DZ1A 2J24A 1JJKA 1S5WA 4LVGA 1T96A 4FNTA 7TIMA 5FF7A 3L67A 1SPQA 1L6YA 2ZRXA 2QEZA 3S6DA 3G1SA 3LTPA 5F4WA 3S5YA 1KA9F 1FY6A 1VH7A 5LNUA 5LHEA 2X2GA 3UWUA 3IIPA 4QQ3A 1F5ZA 4RZ6A 2C6QA 2OZ0A 3UWZA 3TSMA 1IXOA 1VJIA 1UASA 3MW7A 4AHOA 5ABTA 3W2KA 5DXXA 4L4LA 2WNNA 4NJHA 3NL2A 2YR1A 1D9EA 2B7PA 1G7UA 2HS6A 2QCLA 3PUEA 4PCFA 4DF1A 4HNVA 3M43A 4WQ6A 1AL7A 3CM4A 3S9YA 5FF4A 2ZA1A 3DHFA 3IIZA 4QNEA 2GJNA 1ZHAA 3EB2A 1CI1A 2WJZA 3TAKA 2QUUA 1VR6A 5KSWA 1MO0A 5SWUA 1JQVA 2J9ZA 8TIMA 4UFIA 3HGSA 2DP3A 4LS2A 3TFCA 4FO4A 3O07A 1DBTA 3C61A 3W7CA 3NA8A 3FEMA 1OFEA 2NV2A 4UTTA 2H8ZA 1IXNA 1QPRA 3I6RA 3HF3A 1SO3A 1H60A 2V2CA 1F6PA 3ZWSA 5D38A 1OFDA 1WAUA 2R91A 5U4NA 3FJLA 4CCEA 3KRUA 1VGAA 3QQ0A 4ZL1A 4JNMA 2W0UA 2E6DA 3IVTA 1YTEA 3RLVA 4S2BA 5K9CA 3QMSA 1VQTA 4A29A 2RDUA 4E38A 1DQWA 2NXIA 4BR1A 2FIQA 4CQ8A 4HNUA 1ICSA 3H53A 4O0ZA 3EX1A 3O6YX 5AHMA 3A24A 5E93A 3RU6A 4JTJA 5D2TA 4LV4A 4Z0SA 2A0NA 3QSTA 3GDLA 3M7WA 4NX5A 4LUIA 4JTEA 1I2PA 3MYPA 3BO9A 4E0CA 3TW7A 1TCDA 1HFBA 1HUVA 1ZNNA 3W7KA 5E1QA 3KAOA 5D2XA 3L65A 4WD0A 1T0OA 3BG5A 4ZQCA 1Q6OA 3PULA 4WUIA 4ML9A 1LZOA 3B04A 4DO4A 1XDLA 5KZDA 3KVLA 1MXSA 3G1YA 5K2ZA 3IEBA 2TYSA 3TQKA 3LCGA 4Y90A 4LS0A 4IX2A 4YMZA 1OJXA 1SO5A 1Q3NA 4WY0B 4UNLA 2J9XA 1LBMA 3W84A 2GQ8A 2ZZ3A 5G1YA 4PL1A 5J5DA 5LNVA 2ZTJA 2C14A 3MO7A 1K7EA 3N19B 3HQ1A 4GUGA 3NZRA 2Q8LA 3Q2DA 4UR7A 5FEWA 1K8XA 1A53A 3C2EA 3IRDA 5DY2A 2E6FA 3IIOA 1FXPA 3RK8A 3ATYA 2QCDB 3OEXA 4GWEA 4POCA 1W37A 2Y88A 4XBKA 2OT1A 1SUXA 5AFDA 3MBDA 1EP3A 2DORA 1TV8A 3E49A 4TX9A 4WX2A 1ICQA 3NZ1A 4O53A 3W07A 3DFPA 1H61A 5CZ0A 1MEWA 4O28A 3M5ZA 1W5QA 3QYQA 1G4SA 4MJZA 2KZHA 3FOKA 3PSVA 1KFBA 4Y96A 1W3IA 3A5VA 5F1VA 2A2IA 3LV6A 2ABAA 1UUMA 4UFLA 1CW2A 3KRZA 3NM3A 4MLRA 5AHLA 2YCEA 1OYCA 3NQ7A 1SW3A 5LSMA 4LNYA 4NJGA 2Y62A 1K7FA 4IJBA 1ADOA 4JTFA 4X3ZA 1LRNA 3A21A 2TMDA 3NQ8A 1VCFA 3L2IA 2VEKA 4PEKA 3BGJA 2ZYFA 2I1OA 1VLIA 2NXGA 4HNNA 1LLZA 1YYAA 2CLKA 1JRCA 3GNDA 1X7FA 3HB9A 1OK6A 2R94A 4LVFA 2VELA 4K36A 3HG3A 4R33A 1OX6A 2QCGA 1FBAA 1SR9A 4IOTA 2V5BA 5FF2A 1YDOA 5KZEA 3OA3A 3GK0A 5CZSA 3B0VC 2V5LA 1TO3A 2JBMA 5G1TA 5D09A 1OX5A 2QF7A 1XM3A 1P1XA 3E9AA 4IMFA 2CLOA 3WK3A 5DBTA 4ZZ9A 4RV8A 4AWUA 1J5TA 3G0SA 4WXYA 4OT7A 3Q37A 1EEPA 3IVSA 3QM3A 4Z08A 1JCYA 4CLMA 1DQXA 3G3DA 3DI1A 5K7JA 4ADTA 1TPEA 2X1UA 5HULA 4IMCA 3UXDA 4S1FA 5J5RA 4YWIA 3STCA 4MFEA 3NOEA 4CQAA 4TO8A 4OWGA 3QFEA 3DKLA 4KFNA 4AWTA 1WV2A 4OV9A 5D04C 2VOMA 1GTEA 2XN1A 3KVMA 3QW3A 4Y8FA 3RNDA 5D03A 4D2JA 1BWKA 3HBLA 2YXGA 3MP5A 2V82A 3NNTA 4H6KA 2CLIA 3PAJA 1ME9A 4N9CA 4DXVA 4N9DA 3N34A 4IXHA 3ANYA 3W1NA 4ZQPA 1MSSA 1SSGA 5AB3A 5K4XA 3GDRA 2O7SA 4UTMA 3G1VA 2AQWA 3F4NA 1S5TA 4O57A 1XBZA 4XTIA 5K9XA 1MZHA 5LKYA 5CPLA 1W0MA 1BKSA 3MP4A 4RJEA 3PR2A 1FWTA 2JGYA 3TW6A 5I3IA 5D37A 3BG3A 3GYEA 4PH6A 3EXRA 4PTNA 2GQAA 4JS3A 3DH7A 4JTUA 3CT7A 5KTLA 1NAL1 1H1ZA 1WBJA 2EAWA 2YPIA 4K39A 4WOQA 1A5CA 4JTIA 1PV8A 2Y7EA 3BK0A 1Z48A 4GC4A 3M9YA 2WOQA 4Y9AA 1IXQA 3LDVA 4H4IA 3LLDA 4MVAA 2I14A 3CC1A 1ONRA 1H51A 1JRBA 2J9YA 4WZHA 1P4CA 4GJ1A 5I3HA 3PSWA 4LRTA 4ZQNA 3E12A 3C2RA 3CEPA 3S42A 2A4AA 4CNPA 3HGJA 3ABOA 3TK7A 1GPWA 3MYOA 2ZRYA 3LXAA 1C29A 2A21A 3C2OA 1WOBA 2TSYA 2B7QA 4PFMA 3W88A 4IXXA 3B0PA 4X2RA 1FXQA 2F84A 2EGZA 4AVFA 3EXTA 2ZZ4A 1RR2A 2V0TA 3FIGA 4AMAA 1W5PA 2X1TA 4MY8A 1F7BA 2IQTA 3O6CA 1K03A 2RFGA 2CZFA 3HPSA 4IQLA 1YPFA 4Z0JA 4Y6GA 1H7NA 3W1XA 2YYTA 2CLEA 4WY0F 1OFRA 1KTBA 2QCFA 1L6SA 3PWAA 2EHHA 4GUFA 5CPOA 3UNDA 3EKLA 4O12A 1YADA 2OJPA 4RXFA 4S2CA 4XKYB 3W73A 3QEZA 1ZAHA 2R8WA 3KRSA 3KVKA 3UWVA 2PE4A 1XKYA 4K7YA 1QNVA 3IIVA 3QF0A 4LUJA 1GVOA 2C15A 3GDMA 1JUBA 3QH2A 1KFLA 1ZY9A 2E6AA 2TPSA 2QCMA 1WYIA 3RMJA 3LERA 3ZR4A 4WOZA 5AHFA 1W5MA 4O4WA 3N73A 3NPXA 3P7YA 5EY5A 5C5YA 4AHPA 4JY9A 5K4ZA 3GVGA 1T99A 2NX9A 1PS9A 3Q58A 2YFOA 1DVJA 4N4QA 3EX6A 1O95A 3W74A 1KFCA 3IVUA 3INPA 4M19A 2QCEA 2G96A 3TFXA 4EF8A 5FI8A 1G4TA 1V5XA 4FX7A 4OGZA 2XN2A 3EEGA 1MEIA 3KVJA 3PB2A 5TQLA 4BI6A 1GTHA 4HSOA 5F2LA 1DOSA 1TV7A 1UB3A 4UTWC 3VKJA 1G67A 4NJJA 2V30A 3SW6A 3PBWA 2VEMA 3C8FA 2E6YA 1YTKA 1XCFA 4JR5A 3E96A 2B7OA 3ZWTA 2B7NA 1VYSX 3LHUA 1ZAIA 2FJKA 4UFMA 4BF9A 4AF0B 4UUIA 3EX4A 4RK8A 2E68A 4JICA 4K38A 3G1AA 5LZLA 5TIMA 2C16A 3P8JA 1TTJA 4MY9A 5G5IA 4GUHA 4QM1A 4MYXA 3TKFA 1SW0A 2Z2UA 4O50A 3UPBA 1EUNA 3AJXA 5D32A 1QFEA 4KKXA 3L0KA 3LCWA 3DENA 2C19A 3BW4A 3MHUA 4NNCA 3B0UX 2VKZG 3TR2A 4M6PA 3M1ZA 3SSJA 4YCPA 4FNPA 3HG5A 3P5YA 2OMAA 3MI3A 3UY8A 2H6RA 1B57A 5H91A 1Q6QA 3W1MA 4I7WA 4FNSA 3LV5A 3WFAA 4GXMA 3HGRA 1KM0A 3WJZA 4NU7A 1XC4A 1KLYA 1QWGA 3UPWA 1KV8A 3G22A 1IGSA 1QCWA 3W2LA 3GDKA 1JUKA 3FS2A 3DFOA 4MKNA 2B4GA 4JIPA 2QUVA 4MZYA 5I3KA 4MOZA 5D2VA 2YDAA 5LNRA 2BSLA 1LOLA 1WA3A 5LGXA 3OVQA 2RHGA 3NQMA 3W1QA 3T78A 3GXTA 2YW4A 1VYRA 4AXKA 2NX3A 4JX6A 4G1KA 3W7MA 3SJ3A 2ZA2A 4HN4A 2VFGA 3OBKA 4FF7A 2ISWA 4LVAA 2Y89A 4MIMA 3MMTA 1GYNA 3EX3A 4YCOA 1WDWA 3G8RA 3VCRA 5FEZA 3EXSA 1RPXA 2V2DA 2WNQA 4O52A 4XTDA 4IPIA 1W8SA 4XKYA 4UTIA 2WSQA 1FX6A 2ATMA 2Z0IA 1OFPA 4DQWA 3CU2A 3HGOA 4GUIA 2PCQA 3N2XA 3N14A 3MBFA 3SIZA 2Y6ZA 4JYDA 1EP1A 1EA0A 4C1KA 1JCMP 3R2GA 1HTIA 4JYEA 1QMLA 3S1XA 3TIMA 3GX9A 2X30A 2WNZA 1LRTA 1AW1A 1DHPA 1LBFA 3A5FA 3LHZA 5HINA 2VEIA 4M5PA 4BI7A 2H3DA 3SECA 3W7OA 4U4MA 3LCXA 1F2JA 4AF0A 2E5BA 5AHNA 1JCJA 2GQ9A 4XUGA 3WJXA 4GBUA 2BZNA 3DHDA 1F74A 1H50A 3BGGA 3PUOA 2DZXA 3A23A 3QQ1A 4JD4A 1LCOA 3LHYA 3FKKA 4FEZA 4AAJA 4RZ5A 4UTWA 5BNKA 3SI9A 5L9FA 4R53A 3P81A 4UTJA 4FNRA 2E1DA 2DZWA 3W7GA 1KFEA 1R2RA 4ALDA 3SZ8A 2VFEA 1D3GA 1KTNA 2QDHA 3PB0A 2G5WA 2A7NA 1P5BA 2YFNA 4DO5A 5KITA 2WPBA 1QOPA 4DEFA 3BLIA 5AHEA 1A50A 3A22A 2NZLA 1AMKA 3DAQA 4CCCA 3EKZA 2GVLA 4A21A 3SGZA 3G0UA 1F05A 3CIXA 5CPNA 5AOUA 3TH6A 3NO5A 1UJPA 3CB8A 2Q3OA 1ZCOA 3GNNA 4O16A 1PHWA 3VFLA 4LW7A 4M6VA 3HO8A 3CIWA 5DXYA 1F73A 4FXRA 3V75A 2CLFA 2A5HA 1OK4A 4IMEA 3HIJA 3L0NA 4CNNA 2NXHA 5CSSA 2ZZ7A 2CWNA 4UNKA 3GAKA 1GQNA 3BW3A 4I7UA 1AK5A 5K3VA 4Q32A 2X16A 4HSNA 3NGJA 1QDSA 2XFWA 1J4EA 2W6RA 3M41A 2ZRVA 3THQA 3PVFA 5BMWA 1RQEA 3LM7A 1Q6RA 2DZVA 4LY8A 3TXZA 1W54A 1SW7A 4X9SA 3W1TA 2NLIA 4LC6A 1OABA 4TU1A 4PODA 2VENA 4A2RA 5HNRA 3C56A 4FXSA 1H63A 1G4PA 3LCLA 3HMJG 4LS1A 1OFBA 1W31A 2QJHA 4E2BA 2ALDA 4LTSA 3I68A 2QCCA 2A1YA 2PURA 2JK2A 1R2SA 2JKAA 1JQXA 1JCLA 1A5SA 1K3UA 3QZEA 3PM6A 4HNTA 2A85A 1NVMA 1HO4A 5F2MA 1LM1A 3NQ2A 3HJZA 4J9JA 4UTKA 3MI2A 1ALDA 3BW2A 4FX6M 4JN6A 3KFTA 5HR7A 1JVNA 1O4UA 2FQIA 1SQ7A 3O63A 5CGQA 3P61A 5HR6A 4NZFA 1M5WA 2WQPA 3DFTA 3G3MA 5EBUA 1FCQA 1TQJA 4R34A 3F1QA 4TMBA 3T4CA 1DORA 4KWVA 1L2UA 4MY1A 3KX6A 3FYOA 3W83A 4HHPA 4OE7A 3LRLA 4TIMA 3WK1A 1FCUA 1PL9A 2J88A 2HS8A 3IIXA 4WXZA 2CZDA 3GB6A 3P82A 1PHQA 1LORA 3JRKA 3NVTA 5A8GA 3QC3A 3BLEA 1THFD 5EL1A 1TPUA 2E09A 1SO4A 3NQCA 2Y85A 2VFIA 2VFFA 3N9SA 2Y7DA 4P2VA 5HWJA 3P74A 1QOQA 1TPFA 3W70A 1XBXA 1M7PA 1E51A 4GRSA 4NUWA 3R13A 4Z1AA 1Z44A 1L9WA 3C6CA 5C55A 4OQVA 3SFKA 5DN1A 3OVRA 1VZWA 1S5VA 4NXSA 1H7PA 1U83A 2CZEA 5D05A 1IIHA 2C18A 5BRBA 1XBVA 1LOSA 4AH7A 2CFFA 1I45A 3LXBA 3W1RA 5AYZA 4Q33A 3ELFA 1GVFA 1KM2A 2NWSA 3UWWA 4OHQA 2F7FA 4TR9A 1ZFJA 4JDYA 3S8HA 1B3OA 1OFQA 3LB0A 1Z42A 2OT0A 4GFSA 1H7WA 1SZEA 4JXCA 3NDOA 2E5CA 5AN7A 3NPUA 4JTSA 3NEVA 4JX5A 3B05A 5CG7A 4DF2A 3PS7A 4RZ4A 3QPZA 3LRMA 1OFAA 3PC0A 3W87A 3LGEA 3VE7A 3W85A 3NQ6A 3TSBA 1VLWA 3NQDA 2PRHA 1I2OA 3S5ZA 5LGZA 3PG9A 5IBXC 1UUOA 1X8FA 1U5JA 1I2QA 4A3UA 2P1FA 5AHIA 2ZTKA 1KTCA 1XFBA 1QO5A 3C4UA 3NYZA 3W7PA 1FWNA 2ZBTA 1IF2A 2ZRZA 1G6CA 1MEHA 4X22A 4NXKA 4UMCA 3T40A 3DU0A 2NX1A 3BPWA 3ABRA 3R8RA 1Q45A 4KFOA 5G2IA 1OVDA 1ME7A 5CZTA 3W2UA 6TIMA 1OX4B 2Z1BA 3DFNA 4UTHA 1P0KA 4UTUA 3CEUA 1KV5A 1R2TA 4JY8A 1GG0A 1W5NA 4WJEA 4XQ6A 5LNSA 1VS1A 1G69A 4OV4A 1R30A 2Y70A 1X1ZA 1X1OA 1YXYA 4MZ1A 2E77A
chains in the Genus database with same CATH superfamily
3BJTA 1WQ5A 3O8AA 1TSIA 4NAFA 4QHRA 3O16A 3B0YA 4ICMA 3HTWA 3O15A 5HDRA 3I6TA 3CAQA 5BRPA 1QAPA 3GZ3A 1QT1A 2GOKA 3L4XA 3TVAA 3WF3A 2OO6A 4QX4A 4ZOBA 3GDTA 5EB8A 2X0SA 4JPGA 2QGHA 3M5VA 4JTKA 3KWXA 4NZ3A 4R7JA 3B8DA 3W2JA 4O13A 3WEMA 1TE1A 3N15A 5EMUA 3K4AA 4L6OA 3WNOA 4B3ZA 2QJGA 3C0JA 1O6IA 4NAEB 5BU6A 3TLLA 3D46A 3STPA 3I3DA 3RX4A 1FA2A 4LC8A 4CNOA 2YGYA 2D20A 3WLSA 5LYRA 1XUUA 1H1NA 3QGKC 4S3EA 2B81A 2VRKA 3WO8A 2VZOA 2G3MA 3RX2A 4CD5A 4FSAA 2WSKA 3OODA 1BWLA 3CHEA 3Q45A 1BYBA 3GAYA 3LBCA 5HUPA 1FHLA 3WUEA 3TSDA 3U57A 3EAUA 2A3HA 3E0WA 3QBUA 5HWMA 1AD4A 4W8AA 4HJWA 2BOFX 3SBFA 1VCVA 4YTRA 4G1NA 4PSPA 1ITUA 5FSEC 1LT8A 4K1GA 1VFLA 3NQBA 1E9IA 1MW3A 4AY7A 3NPVA 1IQ8A 3WENA 1DIOA 2O9TA 2GPTA 5CBIA 3ZSTA 4GQGA 3RMEA 1AVAA 2RDTA 3W6MA 4EKJA 2CW6A 3B0XA 1L6WA 3MWAA 3MUCA 3ZT6A 1EWEA 2XTKA 3LENA 4M24A 2QUNA 4LCSA 1DIEA 3LHVA 2DZTA 1X6LA 4UB9A 3S1VA 3TU9A 1IEIA 1K9FA 1BAGA 4OVXA 2XH0A 2IMRA 5A6BA 3LTSA 5D02A 1MDLA 4QAIA 2P0OA 1IIGA 1FH9A 1M9HA 4ZVJA 3RHGA 7A3HA 4WY0A 1DWAM 3M47A 1EQPA 4UQAA 1KQYA 3A3HA 3PUDA 4IP4A 4JTTA 3AYTA 3TJIA 4QE5A 3MY9A 2G8ZA 2DVXA 1GOOA 4J3UA 2WANA 3PG8A 4A2SA 1V3IA 1DWHM 3GH5A 2FDMA 2E9LA 4KRTA 3LCFA 3TMLA 5BOFA 2FGZA 4O0KA 4HA0A 4ACZB 3GXFA 4FF5A 4K6AA 5FJUA 1KO0A 1S3HA 3VOIA 1C91A 1OBAA 4D8AA 3UEQA 1KCXA 1ZZMA 3BOFA 4HYRA 2ZUTA 3TQPA 2P8BA 4XAPA 1WBHA 2ZRUA 3CUHA 1W6TA 5AYXA 3EWZA 2R6OA 4XAZA 4TQTA 1XF0A 3WLKX 1UD4A 1A3XA 2IS7A 1HQTA 3VIMA 3CZEA 3LHTA 3LCIA 1XIBA 1EWDA 1EYEA 5U7SA 1EB3A 1KBKA 4EACA 1W9VA 3NXFA 2J4GA 4C7GA 4F4RA 4AUBA 1QRQA 1PVNA 2NSXA 3PZTA 1QPNA 3LOTA 1H0IA 2D2GA 1OIMA 3FJ4A 3C2FA 1A5AA 2OQYA 1YLVA 4J4KA 3MB9A 3TROA 4UOZA 4C6EA 4EXQA 3SCQA 1I75A 1K7XA 2PU0A 1XXXA 4UMAA 1S38A 2P5NA 4E5TA 2OELA 1MWOA 1JI2A 4B2DD 4S23A 1ZAJA 3VGDA 1XLCA 2Y8KA 4YL2A 4G7EB 1JD9A 3LLFA 4Q4QA 1R9ZA 2IKGA 3T4WA 1PJ9A 3NQGA 5CPTA 3GTNA 4FALA 2P3EA 2NV9A 4XZHA 2EQDA 1JXJA 3T81A 3NQAA 4MG4A 1R47A 1EC7A 5HNTA 1KBIA 4Q4OA 4TOQA 4F48A 2ZOXA 2GDQA 1MXDA 5FF3A 1F76A 2GVJA 1HJXA 1NOWA 2YLLA 1JDAA 3H2OA 4HPJA 4ZEPA 4B5WA 4JIQA 4M7TA 4CKQA 2OLSA 2QUMA 1AG1O 3JUGA 2IPWA 2R1NA 3F5KA 4QDMA 1OT2A 2DQXA 2V5CA 2ISVA 5CXPA 4ZBCA 1S1PA 5AYYA 4DPPA 3IJ8A 4UFKA 1YTDA 2ZDRA 3H7UA 5EMLA 4H6EA 4QSHA 4KWUA 4JTRA 4EXBA 1GKPA 1KXVA 3CHVA 4GG9A 4RLIA 4BA0A 4E4FA 2Y7FA 1TIMA 2XWEA 3DFQA 4HOZA 2BTMA 1TPB1 3TJLA 1MZRA 4MKVA 4O0QA 4HP5A 4NJKA 1C92A 4DBUA 1CB2A 4UCGA 4AIBA 1GQIA 3MT1A 5EYWA 4QRNA 3NR0A 4PYSA 2WO5A 2EPHA 3EWBX 1HKIA 2OX1A 3TN6A 4CEXC 1R7AA 2HVNA 5H1WA 3WJWA 1Y0EA 3QJAA 3W4RA 4FIQA 3ARQA 1AZ1A 1LL6A 3W72A 1UH4A 5LA2A 5IBXA 2E9BA 1V7AA 3LEPA 1E71M 1QW8A 1A4LA 1DL3A 2OR2A 5JBEA 3NEHA 1I8JA 2FZ8A 2HBVA 3GVWA 3T2OA 1B3YA 3CTTA 4OKDA 2X42A 5KINA 2ZX7A 1CENA 1ADDA 2GUBA 1H62A 1WOAA 4ONVA 4I9AA 3C0QA 3QV8A 1KWGA 1NDWA 4JEQA 1OYAA 5F4XA 1VFTA 5B7ZA 3EWUA 3RRXA 1ME8A 2XVKA 1ISXA 2QR6A 3P80A 3LX9A 2VEGA 4UIOA 3BL3A 3BGAA 2WV8A 4IPPA 2RH9A 4NT0A 3F2DA 2YZRA 2ZKMX 1O60A 2FHCA 5IOBA 1NY1A 1IR1A 3UCCA 4JCLA 3WLJA 1K6WA 2JKPA 3L4WA 1SO6A 3QMTA 5LA1A 2X1RA 3VE9A 3TTEA 2QQ6A 3AROA 4YU1A 2WMHA 1TTPA 2W92A 8CGTA 1MDRA 3OLGA 1HJSA 4HIBA 2PDKA 2C0AA 1XDJA 4MAVA 1JCXA 2FFCA 3GLCA 4YN5A 1KM5A 2DZPA 3ZJ8A 3H6OA 1TJ0A 4CCDA 2XSBA 1OYBA 4UZUA 5CCZA 3BMVA 3AXXA 1MUMA 3H2NA 4K8HA 2F6KA 3W7LA 5HWNA 1FP8A 1OX4A 2PEVA 3W24A 3U5UA 2XIBA 1G5AA 3WFLA 4J1OA 3PNZA 3RCYA 2NWRA 3QR3A 4EVZA 4EPKA 4DBEA 2OZ8A 4N4PA 1GHRA 3OG3A 3TN3A 2VMFA 2G3JA 2Z2AA 1Q7MA 1XYCA 1GZGA 3ABQA 2EPKX 5M17A 1EL3A 3EMCA 1TUFA 4WJXA 3BE7A 2PS2A 4Y2WA 3IS4A 2ALRA 3ZSSA 3APGA 4Q4MA 3ZS4A 3CUJA 5BRQA 1I2RA 1Q6CA 4R7WA 3TYUA 1R3WA 4O10A 2HROA 4V33A 3NM1A 1SJAA 5IFPA 1EF3A 2JQXA 4UFJA 3BV4A 3WMBA 5DRIA 4W5ZA 4FNUA 4MWAA 1EPXA 1A5NC 2OZTA 4M81A 2PDJA 3GR7A 1DV7A 2EF9A 2YYUA 4G56A 2WZMA 3WQ6A 1UWAA 4FLQA 2V81A 3UT0A 3TMQA 1NWSA 1UZHA 3PBYA 5FA5A 4YVXA 2QDGA 2V9DA 4B5VA 5CZJA 1XI3A 4F0MA 3OQEA 2V3EA 4GXPA 5CAKA 3M7SA 1F6YA 2HE5A 5I00A 4UXDA 3W6YA 1ZLPA 4HZ8A 4UTFA 4WHBA 4G6CA 4U28A 1XGDA 1H4PA 1UC4A 2V5KA 2RGMA 4PRTA 4MDOA 4HCLA 2ZX9A 3PZNA 1C8VA 4D6DA 4AEEA 1QK2A 2XH7A 2DJLA 1P0BA 4UQBA 3WQ4A 1JUEA 3UJRA 4Q4KA 4C6IA 4YVVA 2Y1HA 3W1UA 1TQXA 3RDKA 3BQ5A 4K37A 1SZNA 4QBXA 1FHDA 1EBHA 3VIJA 3CMFA 1RK5A 1UH3A 1DWGM 5BXSA 1RY0A 3TA9A 4O1AA 1BGAA 1JXKA 3ZLHA 1XIJA 3KS6A 1QATA 3TTYA 1W1B1 4AD5A 3O05A 1KFKA 4FNQA 1RZMA 4C65A 2WK2A 3SADA 4XSLA 3QOKA 3W7NA 3SN4A 1UKTA 2QJIA 1W9XA 1AQHA 3EOSA 2PWHA 5M03A 4OOUA 1O12A 3IAPA 1KW1A 4O8AA 4GQQA 4YJ5A 3BUVA 3I4KA 5JVLA 1GOXA 4LV9A 1E0UA 3WK2A 3U2ZA 3EDEA 1LBLA 3QN3A 1N7KA 4JIRA 1Z41A 2GVGA 3NL3A 4GCXA 5B80A 1RVGA 3APYA 1UR3M 3V3WA 1R8LA 3CHFA 3QPYA 4DVOA 5LHFA 1PX8A 4Q4PA 2UZ9A 2P0IA 3KOZA 4QJ5B 3EA2A 3W7QA 2A3LA 4HGXA 2ZZ1A 4CVWA 1EQCA 3DZ1A 1S5WA 3I6EA 3L67A 1ZCCA 2WHMA 1ECQA 3LTPA 4CD4A 3S5YA 3VFCA 2UY4A 1VH7A 3W82A 1ZTVA 1PXGA 4QQ3A 2C6QA 3NZPA 1GVYA 3RU8X 1IXOA 1FOBA 3HM7A 5A2AA 2PBOA 1XV8A 5ABTA 5DXXA 2HVOA 3M6DA 3PFMA 2BASA 1D9EA 2B7PA 5HAOA 1XQKA 2HS6A 3VDBA 2HCVA 2XUCA 4WQ6A 1Q8AA 1PIGA 3BCJA 3AMCA 4E4PA 1CI1A 2QUUA 4IGSA 4IZGA 3HGSA 4LS2A 1IYXA 4FO4A 3O07A 3C61A 4QP0A 3W7CA 1IE7C 3NA8A 4IF2A 2NV2A 2H8ZA 1NTHA 3LNPA 3I6RA 3HF3A 1WXZA 4HPHA 1H60A 1VENA 1F6PA 3OTRA 5D38A 4Z2KA 4B90A 4GNKB 1TWZA 1WAUA 2P76A 4CCEA 4ZL1A 4Z2LA 4DWSB 2J7BA 2W0UA 2ANUA 3IVTA 5A8NA 3QMSA 4WRHA 3CB3A 4YWSA 3ID7A 2RDUA 4E38A 2FIQA 4V28A 1KWKA 3TOPA 4GIEA 3O6YX 5AHMA 3A24A 4GD0A 3BANA 4JHOA 4HK5A 2PDXA 3QSTA 4JTEA 1UR8A 2VGGA 3BO9A 1PB0A 3MYPA 4PMYA 1VP5A 3TW7A 1HFBA 4JN8A 1IWAA 1ZNNA 4I5RA 2VZUA 5E1QA 4DYKA 4F0HA 5D2XA 3QV6A 3BLOA 4S39A 6TAAA 4EAYA 4DO4A 2BVTA 1M04A 1EJRC 3IEBA 1OB0A 4LS0A 1SO5A 4WY0B 4HA4A 3OLEA 4AZHA 2EJ1A 5G1YA 4PL1A 3OB8A 3PN8A 1K7EA 2CZVA 3N19B 1U1JA 4PTXA 3NZRA 5FEWA 3VK5A 3IRDA 2R1PA 5DY2A 4X0NA 3IIOA 1XRTA 2J7GA 3ATYA 1S5NA 2FJUB 4POCA 1Y7VA 1W37A 4X0VA 1EP3A 2DFAA 2QXWA 3E49A 4TX9A 4WX2A 1UZDA 4GOAA 3NZ1A 3KCLA 3K1DA 2ZX6A 4AEFA 3AHYA 2TODA 5CZ0A 1MEWA 3QYQA 1G4SA 4J27A 1EHNA 3PWIA 4MJZA 1W3IA 5F1VA 1EFZA 3VKCA 2ABAA 2QIWA 3ARUA 1I9CB 3PTDA 4UFLA 1CW2A 1J01A 2FZNA 4L7ZA 4ZTYA 5ABGA 1JGIA 1A47A 1OYCA 3QY7A 3THUA 5LSMA 4DLMA 2Y62A 3CV7A 3WQEA 5I06A 1ADOA 1LRNA 4MNKA 2C79A 1XYMA 2J7DA 1BWVA 2ZYFA 1ZQ5A 3B8WA 2NQ5A 1C8XA 1XICA 4HNNA 1G9HA 1CIUA 2WHKA 3WQPA 1X7FA 2R94A 1C9WA 3M0XA 1PYMA 4U2ZA 4K36A 1EO7A 2V5BA 4EANA 1YBQA 5KZEA 1CLVA 1CWYA 3PPGA 5G1TA 1E1FA 2QF7A 4PUJA 4IGNA 3ZVHA 4IMFA 5DBTA 3H2MA 3GVRA 3MC5A 2WNWA 4ERIA 2I5GA 4GZJA 1J5TA 4TTUA 4WXYA 2AL2B 1JI1A 1HP4A 3VO0A 4Z08A 1JCYA 1DQXA 3E2VA 4ADTA 4MSSA 1HXJA 3F2CA 2PP0A 2EO7A 4C6QA 1W9BM 4H83A 3STCA 1JF5A 3NOEA 4OWGA 3BOLA 4US6A 3H2CA 4RL3A 2PZNA 3DKLA 4KFNA 4D6FA 2GSEA 3H12A 3KVMA 4Y8FA 1V03A 4D2JA 3MP5A 1EEXA 2V82A 1U33A 4IIEA 2CLIA 1ME9A 3M0IA 2I16A 2NQZA 1XGEA 5I78A 5AB3A 3GDRA 5XINA 4Q7IA 4ZSTA 2AQWA 3F4NA 2OEJA 4A3QA 4XTIA 2OLHA 3P0WA 3AICA 2ODOA 4AZIA 3RG6A 1V6XA 3EA1A 1C8YA 4DJDA 4PTNA 2GQAA 4JS3A 1FWBC 5KTLA 1NAL1 3ARZA 1WBJA 2INFA 4QFUA 1A5CA 1Z48A 4GC4A 3M9YA 1IXQA 1ZPTA 2BY3A 4H9YA 1UIOA 3LDVA 1XSIA 3WKZA 4I9JA 2J9YA 4X60A 5I3HA 5IRPA 3PSWA 3RRAA 2VR2A 4ZQNA 3S42A 1YHTA 3ABOA 3VKDA 1Y5WA 2ZRYA 1C29A 1WOBA 3P2VA 3L4ZA 3OPSA 4H9VA 3AXKA 4X2RA 2F84A 4AVFA 1XSKA 1MXGA 3SCNA 2RGLA 3WD3A 1AQ0A 3O6CA 1K03A 1ITXA 2ACUA 3RN6A 3HPSA 4AD2A 3OHMB 3UJEA 3H70A 3T42A 2C8NA 1KTBA 2P8CA 1TCMA 3MWCA 3QZAA 2QV5A 3TC3A 3VC5A 4LEFA 3GU2A 1XYBA 1QVBA 3W73A 1K8CA 2R8WA 3U3HA 3RM8A 5EFFA 2E40A 2OWXA 3AFBA 4OIFA 1Q6DA 1P6WA 2PE4A 1QNVA 3PBMA 4I5XA 6PTDA 2OYMA 1KFLA 3DC0A 4ZO6A 3LERA 3NXLA 3N2OA 3R11A 1WE5A 2YA1A 3N73A 3NPXA 3P7YA 2VQUA 1EHAA 1JZ4A 1NARA 4JY9A 1V4YA 3RO6A 3E2SA 3OU8A 4N4QA 1DVJA 4UCFA 4ICCX 5CBJA 1KFCA 5B7YA 3INPA 4EF8A 4RDZA 3U4FA 1UPMB 1V5XA 1MEIA 3PB2A 4KEVA 3V0SA 4BI6A 1AH0A 1K9DA 1TV7A 4UTWC 1BTCA 2BMBA 3N6QA 1LUCB 4FI4A 4ZO9A 2VEMA 4HA1A 1JL8A 2DSZA 2XIMA 1YTKA 3ZJKA 2IQ0A 2YCLA 2WKLA 2Y5EA 4UFMA 3CAKA 1RHCA 3EX4A 2E68A 3G77A 3TYBA 1CXFA 5LZLA 4D71A 4GY0A 3SJNA 4GI6A 3S2JA 7XIMA 5G5IA 1J11A 4MYXA 5JUVA 2BG5A 4YTTA 5D32A 4A3HA 1HKVA 3TR9A 1E0XA 5I5RA 3PJWA 3SRDA 3V7PA 2GJRA 3TR2A 4M6PA 5ENLA 4CD6A 1GOWA 2OMAA 4AX6A 2H6RA 1C3FA 1HKMA 2YBTA 3LV5A 4GXMA 3VIKA 1QBBA 2I9UA 3GW3A 2GDUA 1KLYA 1W91A 3UPWA 4DYEA 1UG6A 1EH9A 4JFSA 3DFOA 3UR5A 3WNPA 2BVYA 3B9DA 1XLHA 2YDAA 5D2VA 2VWSA 1RVKA 2BSLA 5LNRA 1WA3A 4XK2A 2RHGA 3NQMA 3RLGA 2PTDA 2YW4A 1NJJA 4BS0A 3OZYA 2G4FA 2D0HA 2YCJA 4JX6A 2QMJA 1VFFA 4L4OA 1J0JA 2HBXA 2YCKX 5CC3A 4HN4A 2F2HA 3OBKA 3EKGA 2Y89A 3QKEA 1GYNA 2FGBA 4D9PA 4KGJA 3VXGA 3BAYA 5FEZA 2WVSA 1UWIA 4PGLA 4JQ2A 4O52A 2OWWA 2WC7A 4IIBA 4IPIA 3S47A 4XKYA 4UTIA 2YB4A 1E4IA 4DQWA 4GUIA 2EPLX 4CGTA 3A9BA 2YA0A 3N2XA 1NIUA 1XS2A 1XCWA 1W8GA 3N4AA 1W2PA 1E6NA 5A6AA 4IQDA 3E2QA 1HTIA 2VJXA 3TIMA 1Z3NA 3GX9A 2X30A 1EGVA 5HINA 1DHPA 3LHZA 3MANA 4BI7A 1GKQA 1M03A 2VX5A 3AZRA 3K1GA 3LCXA 3UCQA 4UOQA 1YQ2A 3WJXA 5I3DA 2BZNA 2V63A 3A23A 4HCDA 3QQ1A 2XVGA 3E0VA 2WCSA 2WZHA 4RZ5A 5AVHA 1HJUA 4R53A 1AJ0A 1XWYA 1XP3A 2VC9A 4FNRA 1EJSC 3W7GA 4LX4A 1JYVA 2POZA 2G41A 2VRJA 1US2A 2VRQA 4DAFA 1CGUA 2HK0A 3VZYA 3QR0A 1UA3A 5FIPA 3ITXA 3UYIA 1D3GA 1XH1A 2QDHA 5FJPA 4R9OA 3V5CA 2G5WA 2A7NA 1J0KA 4DO5A 1TWDA 1QOPA 2WPBA 3REQB 4DEFA 2VL4A 1A50A 1JZ8A 1RP9A 4M82A 1TJ1A 4CCCA 2CBJA 2GVLA 4GINA 3SGZA 3G0UA 1TZ7A 2HZGA 4JTQA 1ZCOA 3GNNA 2Z2BA 1PHWA 3BICA 3GC4A 3KL0A 4M6VA 3V75A 1PDZA 2CLFA 1K4GA 1TZ9A 5EGRA 3HQOA 3WF4A 3L0NA 4J28A 5CSSA 2ZZ7A 4UNKA 3BW3A 4I7UA 1YKWA 3JU2A 2X16A 3R58A 1QDSA 1J4EA 3M41A 5CC6A 2WZEA 1RQEA 3V0UA 2DT3A 3LM7A 5AZ0A 3PZQA 3S9ZA 5JH2A 1W54A 3PJTA 3R0UA 2NLIA 2GZXA 1OABA 1D3CA 3WBWA 1FWDC 3N13A 4QROA 1ONWA 3S4TA 3LCLA 3WL1A 4UBPC 4LTSA 4FXJA 2JK2A 3OOQA 5DMMA 3MPGA 3WG6A 4JTCA 3T07A 4E3VA 1ZGDA 2P50A 3CHDA 3O9NA 1BYAA 4RE0A 4C6JA 3HPFA 3PM6A 4F0KA 1ISWA 3VNIA 4XV0A 4W85A 2A85A 3N18A 3KP1A 3VNKA 4TTGA 4XKMA 4J9JA 3BW2A 4FX6M 2FQIA 4X63A 3RJYA 5HR6A 4GJIA 2FFIA 3TOYA 2JE8A 1FWEC 3GU9A 3T4CA 1V3MA 1L2UA 3KX6A 4NKCA 4EE9A 2NW0A 6XIAA 1GUVA 2FMOA 3FYOA 3W83A 2W66A 4QEHA 2BDQA 1E6SM 3IIXA 4ZO7A 4DIAA 3GG7A 1UJQA 1ESWA 1PHQA 4PMQA 5JIWA 3NTYA 3JRKA 5A95A 1EJWC 2VTFA 4K68A 1SO4A 2J62A 3NQCA 2Y85A 3H7VA 3BOXA 4D6IA 2VFFA 4P2VA 2WKGA 1UR2A 4DN1A 2J6VA 3P74A 1TPFA 1E51A 4GRSA 1VBHA 4PULA 3LS9A 4XZNX 1JPIA 2EG8A 2VX4A 1ODZA 4OQVA 5DN1A 2VC5A 3OVRA 3OW1A 4C6FA 1U83A 4HMCA 4HHLA 2HXUA 5EFDA 1PEZA 4IJCA 1I45A 1UR1A 5AYZA 4Q33A 1NWUA 4IFRA 1JDDA 3WD1A 2F7FA 1ZFJA 1ZUAX 1JDFA 1B3OA 2PSNA 1G1YA 1MI3A 3IJ6A 4XIMA 1QNRA 1Z42A 3CH9A 1H7WA 1SZEA 3N2BA 3NDOA 2IPJA 1W1A1 3K4DA 4JTSA 5C9WA 5CG7A 1A3HA 4JX5A 2BOEX 3QPZA 3R0DA 2BS9A 3VE7A 3NQDA 1I2OA 3TZNA 4H9TA 4LYKA 3GVVA 1X8FA 5AHIA 1XFBA 3C4UA 1W3JA 3NYZA 1RH9A 5HPCA 4DWDA 4MWAE 1EOKA 1UPPA 3AHZA 1IF2A 2OO0A 4UMCA 4FLRA 5AYIA 3ABRA 3NZQA 1PDYA 1Q45A 4B5SA 1JIBA 4C6CA 1Q6EA 5CZTA 1LWHA 2O9OA 6TIMA 1JDEA 2Z1BA 3DFNA 2XG9A 1Q65A 4U5KA 4AFYA 4JY8A 4WJEA 2WC4A 2Y70A 5EMKA 1TMLA 1AW2A 2H90A 4IMGA 3PBUA 2ZQ0A 2HDJA 4M1BA 2NUXA 3RF9A 1GJPA 2EG6A 3G0XA 4BI5A 3W1AA 3ARSA 1RLDA 3MUXA 5LIUX 1VYPX 3IUHA 3H55A 2JFEX 2YXXA 4LT9A 1VC4A 1Q6GA 2OSXA 3SGUA 1E56A 4JGDA 3LGGA 2CKRA 1AJZA 1W3NA 2WVVA 3T0CA 1V3KA 3VIPA 3C52A 4MNJA 2VD8A 4NG3A 4KMQA 1PIIA 2DSVA 1LT7A 4XZBA 4GACA 4KT2A 3QY6A 3GIQA 4PUDA 1XDMA 1Q85A 4KCVA 1T5AA 4A8IA 4OU1A 4WGXA 3CYVA 5FEPA 5F4SA 3H54A 1TVPA 5JBDA 3QKZA 3CHCA 3LQLA 4EOUA 1R46A 4NNAA 1SJCA 1PTDA 3U6WA 2X2YA 1ZALA 3EOUA 3WQ8A 5FKYA 2QJMA 4LWWA 5I77A 1H5VA 5DT7A 3WLLA 3PWGA 3MKKA 3EEZA 2EPMX 3LGDA 1JZ3A 3M0YA 3R1ZA 4DF0A 2BLEA 2IPGA 2Q8ZA 4OBSA 2FZDA 3TTSA 2C1HA 2AAMA 4G5DA 3XINA 2PDGA 4KH2A 3PFRA 4GABA 1NQKA 4GVIA 3T7VA 4A22A 3I7RA 5C54A 3CBWA 2WJEA 2FPTA 4DZAA 2X1IA 5KEZA 3R8GA 3HMCA 3VGGA 2Y2WA 2J47A 4J3XA 5A6TC 4AWEA 2OYLA 3OJGA 3A4JA 3VGFA 3SUUA 4CQ9A 3RLUA 3VC6A 1FCBA 2PODA 4BCEA 2MUCA 1TPVA 2EPOA 3WYZA 3RPMA 4D1JA 4UC5A 4L9YA 3FX4A 3GR4A 4FOJA 4K1WA 2PLKA 4QJ3B 2DU2A 2CLHA 4NZCA 1LROA 5HANA 3DI0A 1IT8A 1SMAA 2G50A 4WK9A 1HX0A 4BWLA 3EWWA 1EUAA 2ZZ6A 3SRFA 4N6FA 5G4EA 2JIWA 2R1MA 1H7XA 4NZ1A 1M7XA 2Q8XA 4AZBA 3WCZA 3IGSA 4HB7A 4FOUA 2Z6IA 4Q8TA 3W28A 4P8VA 4RKAA 1H1YA 5CC7A 4XISA 2VOTA 1VIZA 4YS1A 1VKFA 1OG6A 4UQ9A 4RZBA 2CHOA 4M7SA 3DG6A 3WMLA 3W75A 1BXBA 3MO4A 4DRSA 1TYGA 1SFLA 3UXIA 3NQVA 1AD1A 3LPOA 3WN6A 1WDRA 1F9CA 1X97A 3LMYA 3LRKA 1VHCA 4URIA 1TJ2A 3B9NA 3MHFA 4IG2B 1EZWA 2VC6A 2HK1A 4IPJA 4UNIA 1U30A 2NV1A 4NQ1A 5BCAA 3A9IA 4ZXOA 2PDPA 4DNMA 3M0MA 1H11A 1TPC1 4JQ4A 2I9EA 1K9TA 4ZB5A 4AHQA 3URAA 5FF0A 3S1UA 3KHJA 3CQHA 5BW6A 2YDSA 1ZSXA 2QV4A 5F1UA 2J7HA 3TQVA 1RD5A 3EDJA 1PPIA 2TRSA 4AVNA 2VGFA 4QDPA 4TUFA 2CXEA 4HMEA 3EWCA 3NWRA 1B3ZA 1XCXA 5E70A 5LNWA 4XZWA 2EKGA 3GTFA 5KMYA 3T55A 2OQHA 4G2DA 3HG2A 2VFHA 1RD6A 4AWSA 2FTPA 2XPKA 3MP3A 4Q8MA 1GVSA 5CJNA 4GBDA 4ADSA 2C1GA 2QT3A 4JX4A 3I3BA 3UESA 4IFKB 2HSAA 3NAVA 5T9BG 4HQVA 3WNLA 1G4EA 3K30A 1UQZA 2XVNA 5E0KA 4GY7A 3ITVA 4RDYA 4O18A 2FB2A 4KS0A 3H2EA 1TRDA 1UYQA 3SY1A 5L6UA 1AZ2A 1TV5A 1KGUA 1SGJA 4GLEA 4O14A 4YTQA 4PB4A 1PCWA 1V6YA 5FL1A 1W1TA 1QR7A 1X7IA 4NZJA 3IJQA 1E1EA 2O92A 4PE8A 4RX0A 3G5EA 3P0XA 1BVZA 2V8ZA 3FXYA 1CGXA 2QAFA 4CUCA 5EMYA 3C3UA 1HP5A 1R3SA 1TJPA 3UR8A 5H8PA 4LUTA 3LI1A 2NVDA 3WLTA 1S2TA 5D9NA 4YXGA 2OOFA 3D47A 4A35A 3CIVA 3II1A 2WKJA 1AQFA 1OC5A 4Z42C 3KTSA 4O1EA 4JTHA 2DUAA 1J18A 3RYSA 4EK7A 1M6JA 1TJRA 2D0FA 4LVBA 1TIWA 5EMMA 5HQEA 2WPGA 3U7VA 2ISSA 1YW1A 4TMCA 3UWQA 2DW6A 4O8RA 5D30A 5FD0A 4GYPC 1N55A 1V3HA 1VHNA 1WKFA 3W71A 1GJWA 3WFZA 2WAGA 4C90A 3TQ0A 1SFJA 3GY1A 1GVEA 3WD4A 4WGHA 4GH3A 3TUUA 2FMNA 4RXGA 3VKBA 4IMAA 2XGIA 2QF8A 5TNVA 2ZUWA 4S38A 3TV8A 3AOFA 3R89A 5BXPA 5AC4A 3DX5A 4EAMA 2NUYA 4WR3A 3HQNA 5I3JA 4K2SA 4MUZA 1V0KA 1FCVA 4NJIA 4B91A 1UP2A 5DBUA 6ALDA 1RA0A 2QJJA 1R3RA 1LG1A 4CN1A 4MWAD 3VUPA 4MJ4A 2HJPA 4H3DA 2GOUA 5HPOA 1SZRA 4V1YA 4GZIA 4N2YA 1S2CA 1QASA 1TRIA 2WM1A 1UKQA 4YYCA 1E0WA 1UW9A 3GSMA 1GPFA 2MNRA 1C9DA 2DEPA 4ERGA 3OBAA 1QHZA 2CNCA 2DPEA 3GG0A 4M3PA 3QTGA 4GO9A 4H7ZA 3QOMA 3FAWA 3CZKA 5CC5A 3PBVA 2IUZA 3UF9A 5D4YA 2KX9A 4NAEA 1RCOB 3AYVA 1OF8A 5A94A 3NO3A 1UD5A 3DYOA 1EJTC 5C6MA 3V18A 4HVXA 4DYJA 4Z17A 1GG1A 2OEMA 2WSRA 3G6MA 3GM8A 1UOZA 2Q3RA 3P84A 4DJFC 4LFYA 4FP1A 3ZMRA 1W32A 2HQAA 1YNYA 2OCZA 3W2NA 1X98A 1E55A 1UZ1A 4UOJA 4A4AA 1XH0A 4H8VA 2EKCA 4AZGA 1OGGA 1NM9A 5DMYA 2A7PA 3NDYA 1CB7B 2AL1A 4FX8A 5GVJA 4PC8A 4L4MA 3GW0A 4R88A 2HE8A 2Z4GA 3DG7A 2F6UA 2V68A 3AMLA 3N2MA 3TJXA 2RJGA 1SU5A 4BWLC 4NL1A 2XSAA 4ERAA 4PMZA 4HTBA 4WKFA 2OSYA 5E0FA 4DUOA 4LYPA 4LVDA 1KM3A 2WM0A 4HT3A 3W02A 4LYQA 3U2EA 3QYSA 4UR8A 4DZIA 1POJA 1TMHA 3P67A 4EIVA 3ZIZA 3FA5A 1LOQA 1YDYA 4AZ7A 1ZJHA 1R6WA 4Q22A 3M07A 1XX1A 3KP0A 3UZXA 3AS0A 3AZTA 1TV4A 2Z29A 3MS8A 2AGKA 1BG4A 1LLWA 1NU5A 1XUZA 4JFUA 3W1PA 4L1GA 2Z6JA 3MSYA 1FUYA 2GJLA 2G3IA 5F2GA 5I3FA 3CV2A 3OLIA 4ML4A 2PDFA 1PE1A 3OYZA 1HKJA 3NG3A 4BFAA 4OBTA 3PUGA 3W7JA 2C13A 3UA4A 4PB5A 2ZUVA 3I3EA 3IK2A 3G1XA 1NF0A 4FHAA 5ABFB 1E0VA 1TMQA 3LHWA 4EWND 1VPXA 2BBFA 3W29A 2NQLA 2VI0A 2GVYA 3U2OA 1NSJA 3POHA 4H9MA 3HN3A 3SN0A 1LLOA 1TVNA 1J0YA 2ZE0A 2W62A 4J5NA 3WLMA 3BSHA 2VC7A 1X6UA 1PZ1A 2CERA 4LNCA 3B03A 5LIKX 1GOIA 1VAHA 5T26A 3L68A 1FWJC 2VEFA 5C9UA 2YL9A 4CN4A 2XZ7A 3WLIA 4K7VA 4QG9A 3L2LA 3W0KA 1HL2A 3U9IA 2ZA3A 3ARTA 3TNOA 3F2BA 4JN7A 1K8ZA 3CTLA 5ABFA 1JZ6A 1WNOA 1Q6LA 3I7SA 1GWJA 3IGUA 5BOOA 1KRMA 3SCOA 1O5XA 3UJ2A 2YDRA 1M1BA 3GTXA 5IM51 1DHKA 1NDZA 1XHGA 4ZENA 3P62A 1E9LA 1HGWA 4P61A 1I1WA 1QHOA 5DO8A 3Q94A 1XBYA 2WMFA 4G8TA 1KM1A 4H9UA 4XWUA 2DVUA 1SJBA 2IKIA 2E25A 3W7RA 4JL1A 1GCYA 4XUYA 4JYFA 4JQ1A 3F03K 4XBSA 5MKGB 7CGTA 2PTYA 3M4HA 5MHBA 3T8QA 1TTIA 2YA2A 4F0RA 1I2NA 3TE9A 2PFHA 1VRDA 1JEZA 3A4WA 3LK6A 3H8AA 3SCWA 3G1HA 1RSCA 2ZCGA 3WF0A 1B0IA 1GT8A 3EDKA 3ERPA 1T96A 3HQPA 4TX6A 5FF7A 4ACZA 2QEZA 1MW1A 1CBGA 4MTVA 3W53A 4DO7A 3HZ3A 1KA9F 1FY6A 5LNUA 3AALA 4ASTA 3CGTA 1F5ZA 4RZ6A 1H0GA 2AL2A 2NLYA 1HJVA 4BZYA 4Q6XA 2Q02A 1DXFA 3W2KA 2YR1A 3PP7A 1KNWA 2GGIA 2QCLA 3PUEA 5JMUA 8RUCA 5FF4A 1L8NA 4H6RA 4JAWA 1RA5A 3WBYA 3IIZA 3NJ3A 4QNEA 2GJNA 1ZHAA 1IEXA 2WJZA 2DT1A 1JQVA 1HW6A 2J9ZA 1B90A 3T0BA 2E0PA 2UY2A 5D9MA 1IXNA 3IJIA 1SO3A 1XKJA 2QW5A 2V2CA 3ZWSA 2D3NA 2YBVA 1M68A 5BWFA 2QJNA 5U4NA 4LBSA 3JVAA 3KRUA 4HK6A 4KF1A 2WSPA 5TD4A 2KAUC 3LYEA 1YTEA 3CYJA 2ZICA 1VQTA 2QNEA 1KQZA 5JU6A 2X41A 2NXIA 2Z1XA 4BR1A 1PTGA 2VX6A 4O0ZA 2ZX8A 5JXQA 3EX1A 2DGAA 4FLSA 3RU6A 4JTJA 2WMIB 4DWSD 3GDLA 3M7WA 1IR2A 4GK8A 4LUIA 4E0CA 2PLCA 5IDZA 1HUVA 1KR1A 3DECA 1WDQA 3KAOA 1XISA 3L65A 4LANA 1E15A 4ML9A 2JF6A 5KZDA 5A6BD 3KVLA 4GYPA 2WMJA 3G1YA 2TYSA 3TQKA 3LCGA 1NOUA 1BHGA 2W4XA 1XLJA 2GQ8A 3SCRA 3B4YA 2W61A 1OT1A 3MO7A 3WLHA 2DDXA 1TUXA 1HL9A 3HQ1A 3THCA 1A53A 3L2MA 3UVIA 2OXNA 1FXPA 1TA3B 3C2YA 3OEXA 1PTAA 4QDWA 1SUXA 5AFDA 4C6MA 7TAAA 2DORA 2J8TA 2V6AA 3AU2A 1B5TA 1ICQA 5E5CA 4O53A 4L6HA 2DVTA 1JF6A 1H61A 4GVFA 2PAJA 2DIKA 4QXIA 1W5QA 1VBGA 3FOKA 3PNUA 4WVXA 3PSVA 1F3EA 2A2IA 2ZXAA 3IV8A 1GHSA 3SEPA 3AAMA 1XLDA 3KRZA 5AHLA 4LNYA 1K70A 4IJBA 1S3TC 4DAIA 2TMDA 3OGRA 1WZMA 3GUWA 2QPSA 2VEKA 4PEKA 2DUXA 2RAGA 3BGJA 4FPSA 3SM0A 1LQ2A 1LLZA 3V5FA 1YYAA 1UZ4A 1E6XM 1JRCA 2BOGX 1CZ1A 2ZUUA 3HB9A 1EJXC 1IEQA 3HG3A 1VFUA 2QCGA 1FBAA 3QGVA 3ITYA 3FV9A 4KETA 1YDOA 2XVLA 2PDQA 1QJWA 1E3ZA 4Q4SA 1YE4A 2V5LA 1E6PA 5HJYA 1TO3A 3LPFA 1P1XA 2CLOA 3QZ6A 4AWUA 3RILA 3B8TA 4JTAA 1H2JA 3G0SA 3EDDA 2YL5A 3L4VA 3FGCB 4CLMA 1Q7QA 3G3DA 1P1MA 3DI1A 1E73M 4S3DA 4W93A 1O7AA 2VO5A 1R85A 5HULA 4IMCA 3UXDA 3SCUA 3DEQA 3MV11 2R82A 4S1FA 5J5RA 3E5BA 7ODCA 5LIWX 3HURA 4XD6A 3B40A 1L6FA 4MGGA 5LIXX 3WSUA 2VOMA 3KBNA 1GTEA 2XN1A 3BCFA 3RNDA 4YVPA 3HBLA 2GJXA 3QV9A 4W84A 3GQYA 1R9YA 1S2UA 4CCZA 1UROA 4N9CA 1V08A 3ANVA 3W1NA 2DIJA 3AIBA 2Y24A 3PANA 3RGTA 4UTMA 4KWOA 3N04A 3VA8A 1W17A 3P14A 4O57A 4AC7C 5FAGA 5CPLA 2CBVA 4NASA 1W0MA 4I8DA 3RM9A 1BKSA 5FSDC 3SQMA 3ECQA 3UZWA 1FWTA 2XFRA 3GYEA 3ZR6A 5C9RA 2ZUSA 3DH7A 4JTUA 1H1ZA 2PTXA 3M0KA 2EAWA 4D6EA 2I17A 3UJSA 4WOQA 4K39A 3L4TA 1PV8A 2Y7EA 3BK0A 2QVNA 1J12A 1Q6FA 3T2PA 2J7CA 4P8XA 3LLDA 5IXEA 3CC1A 1H51A 4WZHA 1ONRA 1JRBA 1QNPA 2W5FA 4GJ1A 4W89A 5A6LA 1W3HA 1XYAA 3E12A 3WD2A 3IUDA 3O7UA 4H6QA 2A4AA 4CNPA 3BAWA 1GPWA 1Q2SA 3MYOA 4DJEA 2A21A 1HJQA 4MUPA 2J8GA 2B7QA 2TSYA 3W88A 4IXXA 4ZSUA 1OCJA 4LY4A 1XLFA 3EXTA 2ZZ4A 1K9EA 1RR2A 1NFPA 3FIGA 2X1TA 1Q8JA 1V77A 2B31A 4GXWA 3CNYA 4IQLA 4AZ5A 3VD3A 1H3GA 4Z0JA 1W2VA 3T0AA 3BJFA 1PAMA 3W1XA 4Y8EA 3AIUA 1L6SA 2V5JA 2AQVA 3UNDA 3MV01 1F61A 1YADA 2YIHA 4RXFA 4S2CA 4OUIA 4CEUC 2Q01A 1O5RA 4ATDA 5HQMA 3B9OA 3UWVA 1DJGA 4K7YA 3IIVA 4HNLA 4MB4A 1GQLA 2C15A 3GDMA 1JUBA 4GMEA 2XIQA 1M7JA 3NCOA 4BEUA 2E6AA 2TPSA 1WYIA 4HA3A 3V4BA 2QIIA 1R86A 4WOZA 5AHFA 1W5MA 5D8ZA 2D0GA 3ZVHB 4MAZA 5C5YA 1JAEA 4J40A 1T99A 2NX9A 2VDGA 2FTWA 3Q58A 1UA7A 3SCSA 3TFXA 3GS6A 5FI8A 1DTNA 4FX7A 3QPEA 1QI2A 1F8IA 2D1ZA 3GFZA 1UB3A 4LXFA 4NJJA 2IXUA 3W37A 1WB0A 3WBAA 3F5LA 3C0SA 3L12A 1HT6A 1ZAIA 1YNPA 4QG6A 4JICA 2GGJA 3G1AA 5TIMA 2C16A 4WDXA 3R25A 2O55A 3O0FA 4BJHA 3VDGA 3DHUA 4QM1A 3R94A 3VZXA 2GDVA 1EUNA 5M5DA 1GQKA 1US0A 3MMUA 3HV9A 3MHUA 4GHRA 4AMCA 1WDPA 3PJUA 4YCPA 5GNZA 3HG5A 3P5YA 1WXYA 3MI3A 5H91A 1GZ1A 3KS5A 3W1MA 5FJIA 3NDZA 4B9YA 4NU7A 1XC4A 4Q3MA 1P6BA 3QVQA 1RBAA 4ZOCA 4FK9A 3URQA 3NSMA 3W2LA 1JUKA 1WZKA 4NY2A 2V38A 2B4GA 3FDKA 1KXQA 4MZYA 1JPKA 4IISA 2VNCA 4MOZA 5LGXA 3OVQA 4CQDA 4U31A 1R3TA 1AA1B 4BY3A 4BF5A 1JGMA 4AXKA 2NX3A 2OOGA 2ZUNA 3H24A 3AZSA 3GO2A 1GEHA 2ZA2A 2YKKA 3QXBA 1BXCA 4FF7A 4MIMA 3MMTA 3EYPA 3VCRA 5CSUA 1RJRA 4JIHA 3VVGA 4ATWA 1OIFA 2WSQA 3OIHA 1FX6A 2ZXQA 1JDCA 3HGOA 3THDA 1Q2RA 4A6GA 4FLOA 2G3NA 4HYVA 3CJPA 4C1KA 1EX1A 3GH4A 1DE5A 3CWHA 4JYEA 2ZDSA 3ZLGA 2WNZA 1MFUA 1HVXA 1V93A 1NP0A 3R79A 1SM9A 2H3DA 3W7OA 3PZ9A 3TONA 2I56A 2PLMA 4X9YA 4HHMA 1JZ2A 4YIWA 2GQ9A 4XUGA 3S2NA 9XIMA 3IWPA 3F4VA 4PMUA 1CT5A 3PUOA 4KQNA 3N17A 2VZTA 3MZNA 1MNSA 3SI9A 5L9FA 1E9ZB 3CQIA 4UTJA 4MMWA 1R2RA 2CPUA 3PZUA 5XIAA 2YBUA 1DWIM 1QK0A 3KL3A 3SZ8A 1XIGA 4YPJA 1XLIA 3NVDA 1IWBA 4E6MA 3D3FA 1LL7A 4YHGA 2YFNA 1BRLB 4JBRA 3SFWA 3U5YA 3G2GA 1QNOA 1H09A 3DCPA 3UU0A 3DIPA 4A21A 1UBPC 1F07A 1TWSA 4BEQA 4JTDA 1ZU8A 2X05A 4D6GA 1BKHA 1UJPA 1E3XA 4QCEA 3GTHA 3A13A 4Y9MA 2Q3OA 1EBGA 1VD6A 3VFLA 3BSMA 2OPJA 5DXYA 5HOSA 2XH2A 3ITGA 2GGGA 4IP7A 4IMEA 2GJXB 2XIIA 4CNNA 2CWNA 3GAKA 5K3VA 4R27A 4S3CA 1IT7A 3HFTA 2W6RA 2ZRVA 4EP8C 3PVFA 3FEQA 3TXZA 4X9SA 2JALA 4AISA 4QG8A 3UVAA 4TU1A 2NQHA 3BLDA 2ASHA 2VENA 2D22A 1M41A 3BDKA 3L23A 3SN1A 3C56A 5HNRA 4J2PA 4F0LA 3QV7A 3CV1A 1OFBA 2J79A 4AW7A 1FWCC 2WWCA 4E2BA 3DESA 2VZSA 3VNJA 5A2CA 1R2SA 3VYLA 1E70M 1A5SA 3UXKA 1S2AA 1UWTA 4HNTA 4DJED 3BZGA 1REQA 1OD0A 5F2MA 2OX4A 4UTKA 3AUJA 1C90A 1ALDA 5MF5A 5F7UA 1O4UA 2ZWZA 1KB3A 4QQUA 3RJXA 4NRRA 1ZB5A 1E43A 3F1QA 4TMBA 2V5DA 2IQDA 3BLKA 4MY1A 3PZMA 1TFVA 5LXEA 4LAUA 5T8GA 3VGHA 3VKAA 4WXZA 1X39A 2CZDA 3VNYA 3P82A 4M80A 1LORA 4L9ZA 3BC9A 2DSWA 4LUYA 3SUVA 1IGWA 1QU4A 1TPUA 1W3LA 3MCNA 1J6OA 2PMQA 1UOKA 3RX3A 3W70A 2G4JA 1M7PA 2PUZA 4F40A 2A3BA 1RUSA 1PX4A 2GK1A 2BGQA 2VM8A 5H8MA 3UXLA 3TLQA 4Z1AA 2O4QA 1TV3A 5C55A 4RNIA 5A2BA 3CT2A 1VZWA 4M1RA 5HNUA 1R5YA 1XBVA 2CFFA 3W1RA 3UWWA 2XINA 3WX7A 1UR9A 4OHQA 4Q8PA 1TA3A 4JDYA 4FZIA 1OFQA 4C91A 4HU4A 3BAXA 3LB0A 5AN7A 2VCBA 4CD7A 2VR4A 3NEVA 4A3YA 3G6LA 2RDXA 3FCPA 3LRMA 2CLPA 1VBJA 1OFAA 3LGEA 4NYUA 3NQ6A 3TSBA 5HK4A 4ATLA 1O66A 3BCDA 5IBXC 1UUOA 4A3UA 3FVMA 2P1FA 3KBJA 3LM3A 3CUIA 1A5UA 2WCAA 3W7PA 3O3RA 2ZBTA 3VM5A 3AWOA 2OB3A 1UWUA 2BVDA 2ZRZA 4X22A 3B8UA 5D9PA 3SB0A 4Y9NA 3T40A 2PDHA 2NX1A 3BPWA 2WW5A 1OC6A 4KFOA 5G2IA 1OVDA 4PUMA 2BHYA 2IKJA 1OX4B 4UTHA 4DBWA 3GG8A 2E7FA 2OODA 3WQOA 4BQ4A 5H6HA 1BXNA 2E67A 2OLAA 4RE4A 1GG0A 1W5NA 4REQA 3KBWA 1VEPA 4OV4A 4H1ZA 1X1ZA 3GVQA 1YXYA 1UHVA 1IZJA 1GYLA 1ZBKA 4L1WA 4O54A 4XD3A 1GVIA 1YEYA 2WC3A 1LL4A 2DT2A 3QSRA 3UY7A 3BTNA 4GUJA 5DLCA 4ADUA 3CLMA 3MUAA 4GQBA 2DZUA 4MFDA 1FDZA 4MNMA 3WF2A 4D72A 2BFGA 1CYGA 2QCDA 1U2YA 2Y5JA 3W7EA 5DCEA 4C6OA 4W7UA 1ZP4A 5FAJA 3UG3A 1RQBA 1Y8BA 4A3RA 1V79A 4O19A 3LU2A 1EGZA 4AYGA 4UZSA 5E0CA 4RCXA 1KM4A 4Q8QA 4Z1BA 1IV8A 3EOOA 3TYZA 2BODX 1OHLA 4DZ5A 3HPXA 1A3WA 3UWYA 3W6LA 2ZVIA 3UD6A 1OCNA 4MJ2A 2WSYA 5C0QA 1NFBA 4NVTA 3VX1A 3WDQA 2XIJA 3BG9A 4CNUA 4DUWA 5AZ1A 4HKPA 4MF4A 4PRRA 1OCQA 3EWYA 1F3XA 3CZJA 1J2WA 3QQWA 3NL6A 3VCCA 3K46A 3UETA 3NL5A 3S83A 4A8NA 4JFVA 4AZCA 3E02A 4GVGA 2PGRA 2ADAA 4GA8A 1ODUA 2HVMA 1K8YA 2W79A 1LUCA 2QCNA 1FH8A 4Z2IA 1J0ZA 2JGQA 3OHIA 4Q7BA 3AYRA 1SSDA 1VCGA 4AD3A 3M5XA 3LZ3A 2W3ZA 4O17A 4B5NA 4Z1DA 2PP3A 4I8YA 2PWVA 4LF1A 1FFQA 1OWQA 2F6XA 3SR7A 1DEDA 3IJDA 3W00A 3GFXA 3QMRA 3QLLA 1PUDA 1IZCA 3N4EA 4BQ2A 1YPXA 3FSUA 1GVQA 4BK9A 2VT0A 3FFSA 3VKKA 4CU8A 2YDQA 2D24A 4NYYA 4AY1A 4LRSA 3OZOA 4QIUA 1WAWA 3VCNA 3W27A 4DY1A 4IGMA 2CLMA 2V2HA 2ICSA 3RR1A 2FGLA 4GGBA 4NI3A 3STFA 3SRHA 1SYTA 3PF3A 3GXPA 4UTLA 1DP0A 2J78A 4N0RA 1B3VA 4GQRA 3QFWA 5C9XA 3UXAA 3C86A 2GGEA 1HL8A 2I5QA 3OBEA 3NZGA 3C3NA 2GUUA 3UZ5A 4RW3A 2HV5A 3VDAA 1TV2A 3MCMA 3AXIA 4L65A 5EU9A 4O15A 1ML1A 3MVIA 1TZZA 1DJQA 4MM1A 4CD8A 1JNEA 1CGWA 1Z69A 3L5AA 2FVKA 2CHNA 1N8WA 1QI0A 2REQB 1AL8A 2XGZA 3N9RA 2FPYA 2CHRA 2DY3A 1CGYA 4GC3A 1DJZA 3B8IA 4GNJA 2XU2A 3R12A 5BROA 3H4XA 5DANA 1KFJA 4L5ZA 4DO6A 1V51A 4I6KA 3R10A 1IXPA 2QKFA 2NVCA 2IXVA 4J35A 4QCFA 3A4XA 2C3ZA 4QLKA 5EKYA 2J75A 4KWWA 4J3TA 1UWRA 3UW6A 3M44A 4XD4A 4B9ZA 2P88A 2CU0A 1XIDA 1TVLA 1QHPA 2Q6ZA 4ZQMA 2TAAA 3V35A 2ZC1A 3BARA 4PN2A 2BX7A 1H7RA 4PTVA 4LSBA 1K6AA 3WUBA 1ZJIA 3NQEA 3ZT7A 3B06A 3TA6A 3V1PA 3WD0A 1KXTA 4V2XA 3MJMA 2ESCA 1KM6A 4NF7A 3GD6A 4O1FA 3SAZA 4PCSA 2MANA 4DPQA 3WQ5A 4MDPA 3HOJA 2CETA 5FESA 4R9XA 1NQ6A 4UQCA 4L56A 3MDUA 3H2AA 5FOOA 2J7FA 3CQKA 2VCCA 3HG4A 3O1NA 3EWXA 3QGAC 3TN5A 2RDWA 3LZ5A 4IH3A 3HA1A 4XB3A 4CQBA 4IIGA 1BEUA 5REQA 3TWBA 1KBBA 2FHFA 2B0MA 2DV0A 5LIYX 1GOKA 2XJ7A 1CXHA 2WMKA 3T2QA 3F7JA 3T44A 1ZBWA 3HFYA 1WZLA 1XG3A 4AEOA 2R14A 1A4MA 1N8FA 1RCXB 5GNYA 2ABBA 4H04A 3CV6A 4C6NA 3M46A 4N9BA 4YLWA 1OZMA 4QE4A 5CPQA 2VUYA 4H8HA 3GKAA 4YYFA 3M0ZA 3W26A 4Q7NA 3FYPA 2EPNA 5FJJA 4IL2A 4GE8A 1XSJA 1P0DA 4B5UA 4XO7A 4AYSA 2NQJA 3AS1A 2FYMA 5JBFA 3MVTA 4F9JA 1A5BA 2JKEA 1HJWA 2XVPA 1O68A 1V7YA 5CJMA 2UY3A 2E5DA 1E6QM 2HMCA 1SZFA 3SGGA 1TREA 3O6DA 3QR1A 5DY3A 2VQTA 2HPMA 2E1WA 3WNKA 4NSBA 1XRSA 3GKFA 5E6YA 1YXCA 2Z25A 3SQLA 1BF6A 2FZ9A 2CBIA 1HO1A 4ORIA 1KRBC 4DWSA 1UD3A 1UWSA 2F9RA 3APTA 2O7QA 4UR9A 2HTMA 4PMDA 4QNWA 4KCTA 3FNDA 5AC7A 4PL2A 1UKSA 4W86A 1P6CA 1W1VA 4UTTC 1EP2A 2V67A 3NGFA 4JHZA 5D9OA 2GJPA 1NELA 3UYCA 1DYSA 4Z2GA 1FQ0A 3WJSA 3UGVA 3IGHX 3C2VA 2ZX5A 4IUGA 1XPGA 3ARXA 3KW3A 3ZLFA 3SY5A 2G95A 3ITLA 4QAWA 1FWIC 2ISFA 3ZO9A 1PX3A 1CEOA 2V69A 2ZC8A 3VIFA 4NNBA 4W4QA 2XH4A 1VIWA 4AU0A 2C0HA 3FKRA 3KDOA 1UBSA 1YPIA 1AW5A 4MJMA 4A05A 1YE6A 2EG7A 3L5MA 1NF7A 4PMVA 3M0VA 5HMFA 4MB1A 4NHVA 1W56A 3VAVA 1EC9A 1M53A 3KOXA 4RNFA 5REQB 1JFHA 4RW5A 5EPDA 3VD9A 2Z1SA 2VEPA 4KRZA 3MDWA 3UCDA 4EF9A 3GR8A 1TPDA 1ZJAA 3OGVA 5EA9A 3B3DA 2XM1A 3AMGA 3WQDA 4IUOA 5C7HA 1VJSA 1B1YA 1ONXA 3D5HA 4L9XA 1A5MC 2RUSA 9CGTA 1LQAA 3POCA 1HG3A 1DE6A 3B4UA 3AMKA 2V3GA 3TCSA 2WWDA 3AISA 4HD5A 1XIHA 2I57A 1GKRA 4ZTXA 2XN0A 3A64A 1RBOB 3W23A 3D3AA 2D23A 4B4HA 1SZGA 1DXEA 2P53A 3KWSA 4LCRA 2DT0A 3H26A 4EPBC 1CXLA 5DRCA 2RKXA 1FWRA 3T8LA 3VPLA 2J77A 1HIZA 1FHUA 4PBGA 2PWFA 3AIRA 4ZA0A 4RR4A 3R0KA 4ZR8A 5C70A 5CKSA 1N8IA 3F4WA 4MPQA 2CITA 3MTWA 1QW9A 1YRRA 4LUSB 4K8EA 3L0GA 1XFCA 4FIRA 3H23A 1RK6A 5G2WA 4GH1A 3CQ0A 1QBAA 1XLMA 2FVLA 3RM4A 4HNCA 5A8QA 2YXOA 4AVOA 2DZSA 4IIDA 4AIUA 1LQ0A 1E0TA 4UQDA 4FA3A 1TPWA 4I9TA 1XL9A 3FY1A 4QLJA 3LCHA 3O2LA 5G2HA 3CK5A 2XYLA 3BVJA 1L8PA 2GVEA 4IJRA 3TCEA 2CXGA 3VABA 3CL7A 1XD0A 4P8UA 1Q63A 2H3BA 3G1RA 4IIFA 3VGEA 1FWWA 1A0CA 1V8EA 2BP1A 2BNJA 4JQAA 1AQMA 3FJNA 4XVEA 4MLJA 3GXMA 3MMWA 2O9PA 3G24A 4YTUA 3DDMA 5FACA 1W1YA 3Q65A 1LP6A 4HN8A 4ZQRA 3RITA 2JEPA 4YTSA 5HATA 1KLZA 3GIYA 5BMXA 4JDBA 3VNMA 4PCTA 1D8CA 2VYOA 3W1LA 1GONA 3L66A 3HPAA 1JPHA 3ATZA 1R3YA 3M6YA 3LI0A 4M56A 2J74A 2IPFA 2VGIA 2PU1A 3O6AA 2J8FA 1JJKA 4WJ8A 4LVGA 3E2RA 4FNTA 1SPQA 1VPQA 5D8WA 1Z9AA 3G1SA 4M6UA 1TX2A 2PPGA 3UWUA 3V36A 1R38A 3IIPA 4NP7A 1J9YA 1GORA 1Y65A 2OQLA 1XLGA 4RPQA 3I10A 3GHTA 4L4LA 4NJHA 1NP2A 3NL2A 3T6CA 4NILA 5M3WA 3QHOA 4PCFA 4DF1A 4HNVA 1MNZA 1JYWA 1XYFA 4W87A 4E4UA 3CUFA 2WVVB 1FWFC 4DZHA 2FZMA 3EB2A 3HJEA 3TAKA 5GJNA 5SWUA 2OYKA 8TIMA 2CEQA 4UFIA 1ISYA 2DP3A 1OFEA 4UTTA 3IRSA 3LY0A 3P93A 5LA0A 3BWWA 4PUUA 4XIAA 1V0LA 5HJXA 4IG2A 1JPDX 3H7RA 2REQA 3GG1A 1CXKA 1OFDA 3EMZA 2RJHA 2WMGA 3FJLA 3UNTA 1EPVA 4JNMA 3WLRA 1FWAC 3RLVA 2O0TA 5K9CA 3IPWA 4A29A 4CQ8A 4AZCB 4KEZA 1F4HA 3CO8A 4HU0A 5E93A 1OINA 5D2TA 4XZIA 4I9MA 1UIPA 1XC6A 2A0NA 4Z0SA 4KEUA 2X0HA 3VOHA 1ISVA