1S5VA

Crystal structure analysis of a mutant of dihydrodipicolinate synthase--residue tyr107 to phe107
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYFNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title The Crystal Structure of Three Site-directed Mutants of Escherichia coli Dihydrodipicolinate Synthase: Further Evidence for a Catalytic Triad
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 107
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1s5vA00
4UUIA 5CSRA 4O15A 3W7CA 1ALDA 4K39A 3O63A 2FPTA 2Y7GA 4XZ9A 3R8RA 3LV5A 3GYEA 1FDJA 2V9DA 4GFSA 3U6WA 1LZOA 1FY6A 4IUOA 4MFEA 2DJLA 2QJIA 2A0NA 4IX2A 4LS1A 3VKJA 3OEXA 3A22A 1KBJA 3FFSA 1RVGA 3STFA 4JS3A 4DF2A 2ZZ4A 5HULA 1XDLA 3M47A 4RZ5A 2A2IA 2AQWA 1TIMA 1NFBA 5FF3A 2JGQA 2QCEA 3C3NA 4RJEA 4WX2A 1O5XA 4JIQA 1BWLA 4Z1AA 4WUIA 2JKPA 3P5YA 1W54A 2QEZA 4LS2A 2J9ZA 1OFPA 1YXCA 2OMAA 4HPXA 2JGYA 1ZHAA 4WY0B 5EA9A 4B5NA 4NUWA 2WOQA 3DFNA 3MI6A 3NQFA 4FEZA 1KFKA 3ELFA 3C2OA 3Q94A 1FUYA 3DU0A 5D09A 4GXMA 3BG3A 3L0KA 2HS6A 3QEZA 1F6KA 4NNCA 4GUFA 3G1SA 3FJLA 1JR1A 1YPIA 1DJQA 2PRHA 2V2HA 3SIZA 4JY9A 3CQ0A 4O53A 3TK7A 5LGZA 4JX4A 2V5LA 2NUXA 3HPSA 1VHNA 1EUNA 1IGSA 1VZWA 1SU5A 3SGZA 1GVSA 3TA6A 1TSIA 1JVNA 2TYSA 1XDMA 3LRLA 3MI3A 3SJ3A 4LRSA 3W2LA 1FWSA 1KFLA 5D38A 3QQ0A 1OYBA 5DCBA 3LHYA 1L6SA 1ICPA 1GTHA 3W7NA 3EX4A 1W1ZA 3NO5A 2Q8ZA 3G1VA 4JR5A 4O4VA 4A3UA 3BW3A 4QM1A 1TJRA 1KFEA 1ZY9A 3QC3A 2A21A 3HGRA 3QFEA 5HINA 2NUWA 5C6MA 3M43A 3MP4A 3P84A 7TIMA 1F2JA 3QPYA 4CLMA 4RXGA 3LM7A 2QCDA 5G1TA 2QR6A 4WJEA 4NJGA 5EMUA 2ISVA 1R47A 3NPVA 1W5OA 3NDOA 4BI5A 2F7FA 2OZ0A 2Y7FA 3M9YA 2FPYA 4H3DA 1F5ZA 1JRBA 4NZJA 4AWSA 3IIVA 5FF0A 2YX0A 4WQ6A 3E49A 3C6CA 3RLUA 2H6RA 3NNTA 3IIPA 3L66A 1NF0A 1OYAA 1JUKA 3LHZA 3EWBX 4GUIA 3MO7A 1N7KA 4EOUA 1GG1A 1AG1O 5D2WA 4MFDA 3PVFA 3W74A 4U4MA 2VEMA 4POCA 3QM3A 2JBMA 1EP1A 3LBCA 3UXDA 1VCFA 2YR1A 2VFHA 4RZ6A 5HWMA 3CTLA 4HSNA 2E6AA 5I3GA 1PVNA 1Y0EA 4JYEA 2E09A 4O52A 3EWZA 4O13A 1DORA 1VLIA 3N2XA 3PUDA 3DAQA 5DXYA 2GPTA 1XCFA 3UNDA 4OBTA 5AN7A 2W0UA 1HG3A 3NPWA 1SO6A 1SW7A 3B05A 4AHOA 1A5SA 3STGA 3HMJG 1XM3A 2V8ZA 5F4XA 3IV3A 5KMYA 2X1TA 4UMBA 2W79A 2ZA1A 3W2JA 5SWUA 5DCDA 5EL1A 2NWRA 3LV6A 1OF6A 4KKXA 4FHAA 1F6PA 5D30A 2CLEA 3TQKA 3FOKA 1J4EA 4MY8A 4JN6A 2YSWA 4A2RA 4PTNA 4TMCA 3W7JA 4DPQA 4HNUA 3LBMA 1RQHA 4WY0A 1WX0A 1VPXA 3ABOA 2QCMA 3LI0A 2VKZG 1H7PA 2E5DA 3NL2A 1JQVA 1W5QA 4AB4A 2VEIA 1R46A 2BXVA 2X16A 5A5WA 2I9EA 5FESA 1DKWA 5DXXA 2EHHA 4PA8A 3F1QA 3BO9A 2CU0A 3KVMA 3MBFA 4O10A 1W3NA 2BX7A 3RU6A 1OFAA 5U7SA 4C1KA 1KM4A 3ATYA 4RK8A 3VE7A 3SSJA 1AK5A 1K03A 4IJBA 1K02A 4IXXA 1MEIA 1QAPA 2QF7A 3HQ1A 2YCEA 2WO5A 1YTKA 2UV8G 1XUUA 4MOZA 3TROA 3W1MA 4UTIA 1C9DA 1W56A 3TC7A 4GC4A 3C4UA 3LCLA 3HG3A 1KM0A 1LBMA 4MZ1A 5MHBA 2DZWA 3INPA 4CNPA 4ZQPA 2ZA2A 3LCFA 3HJZA 3IGUA 2ZTJA 2H90A 5AHNA 4O14A 3HF3A 5CKSA 5GVJA 3TJXA 3UWWA 4U28A 4UFIA 1MO0A 5HMSA 4FF7A 3A5VA 3SFKA 5CZSA 4BI6A 4O54A 3L5AA 3W1UA 3LRMA 3THAA 5HUPA 4JDYA 3P80A 2X1RA 1I45A 5C55A 2C16A 1P1XA 2ZZ5A 5BMWA 1B3OA 1FCVA 2GVLA 1OFDA 3PULA 3NQVA 1F73A 1MXSA 1NSJA 3FYPA 3S1UA 1FCBA 5CZTA 4LTSA 2QCFA 2CLHA 3QH2A 3L0NA 4Z08A 2J9XA 1KA9F 4OV4A 1QDSA 2FLIA 2V0TA 3WFAA 5J5RA 1T0OA 2J88A 2O7SA 2YFNA 4Y96A 3GDTA 5G2IA 3NYZA 3KRSA 4HN4A 1OX4B 1MZHA 3T44A 2NV1A 3A9IA 3LCGA 5LNWA 4N02A 4A21A 1VCGA 3W86A 5HR7A 1PIIA 5IBXC 3FKKA 3G1DA 5F4SA 4RCXA 2R94A 4TX9A 1TV5A 5I3KA 1YDOA 1G69A 1JUEA 4FXSA 4LVGA 2QCCA 1FWWA 3GDLA 2TSYA 1YDVA 1HFBA 4M6PA 4DELA 1KLZA 5G4EA 3G3MA 1TMHA 3STCA 1SUXA 2NUYA 1C8VA 3HB9A 1EX5A 4MY9A 3C61A 5LHEA 3WK1A 3BV4A 3OBKA 5K9DA 3BPWA 2CLFA 2NX1A 1TPC1 1Z41A 3CWNA 4IMGA 4Y6GA 3ABSA 3E9AA 2Q3RA 2ISSA 4HNVA 3DHFA 3O16A 5L9FA 1IXNA 1KM2A 1IXOA 3BLEA 3HBLA 3PUOA 3NVTA 3MWAA 1U5JA 1Q6RA 4R33A 3DFPA 2QAPA 3IIOA 3LXCA 5EBUA 4O28A 3TCEA 5BNKA 3PG8A 1B4EA 5KTLA 5D33A 1JCJA 4IX0A 4K36A 1VC4A 3IGSA 2HS8A 4YCPA 1A5CA 1IXPA 1O94A 3GKFA 1YYAA 3F4WA 4NJHA 4YXGA 1FQ0A 3T40A 5BOOA 3UWQA 4I9AA 4J9JA 5BW6A 1W5NA 3SECA 1RQEA 4XTDA 1VHCA 2RDTA 1I4NA 2C6QA 2Z6JA 1WXJA 2CLIA 1GVQA 2RDUA 4R34A 1SZFA 3LXAA 4MJZA 1OHLA 5I3IA 3NQDA 1OJXA 4XQ6A 4E38A 3CU2A 1R2RA 4JTKA 2YFOA 4AEOA 4Q32A 1ZAHA 2FJKA 1QR7A 1XBVA 3TNOA 1S3HA 1T99A 1LRQA 1TPH1 5TBOA 4CNOA 5CZJA 4GWEA 2RDWA 4BI7A 3GVGA 4FNTA 4ORIA 1K8YA 3MW7A 5IBXA 3B0VC 3A5FA 1VYRA 3M0ZA 4LC6A 1QPNA 1UBSA 4LRTA 1WOAA 5DELA 4W9TA 4HSOA 4M5PA 5E1QA 4DO4A 4MZYA 5CZ0A 4O0KA 1FWTA 3BGJA 4IMCA 4ZZ9A 3GNDA 2PRLA 3G0XA 4JTHA 1I2QA 3GZ3A 3N2MA 5AYXA 3TQ0A 4LV9A 1LORA 5D2XA 3L5MA 1SO5A 2QUTA 1CX9A 1TPFA 3QW4B 4XBKA 3I7SA 3W88A 4LWWA 3NQCA 2XN0A 2ISWA 1JCYA 4UIOA 4UXDA 2QCGA 2FQIA 3CPRA 3O6CA 3TSBA 3GKAA 1OX4A 2BLEA 1Z44A 3FEMA 1TRDA 3KX6A 4K6AA 4DQWA 3HPXA 1Q6OA 1Q6QA 1TQJA 4UFMA 3EXTA 2C14A 3PY2A 3S0CA 3SGUA 3WJZA 3TV8A 1AW5A 3LHTA 4MVAA 4IOTA 4O1CA 1KM1A 3MJYA 3LTPA 5CPMA 3S5YA 4EVZA 3BW2A 4EF9A 1L2UA 3TJLA 2WPBA 2QJHA 2YW3A 1WQ5A 3N14A 4I7WA 4PH6A 4CNNA 4EWND 3NL3A 1RQBA 4DXVA 2C18A 1LOSA 5LHFA 4LNYA 1YADA 4JDBA 4CCDA 3CT7A 2ZRYA 4WY0F 2E6FA 3CB8A 3NQ8A 5HNRA 5CPOA 1QMLA 3YPIA 3GIYA 3C0JA 4RLIA 1VLWA 3PS7A 1XL9A 3C2RA 3NAVA 1DQWA 5D03A 5G4WA 5EYWA 3E12A 4O19A 3SW6A 5FF2A 1G4SA 5K3VA 4MKNA 3OVRA 4N6EA 2B7QA 5HUOA 1ZFJA 1AMKA 5FF7A 5F2LA 1F76A 4KFOA 2C13A 1V7YA 3SI9A 3DHDA 1QPQA 2ZRUA 1ZAIA 5F2MA 4ONVA 1GYLA 3NL5A 5G5IA 3P8JA 3W1NA 1NF7A 4XKYB 2QJGA 3W7IA 1P0KA 3HOJA 3IIXA 1TO3A 4ZQCA 3WK2A 2G5WA 3A21A 5AHFA 2DZPA 1OFQA 3F4NA 3W7OA 3IEBA 4UFHA 1BTMA 1TV8A 1SZEA 5E93A 1GWJA 3DI0A 2HMCA 3W7EA 2IQTA 1GQNA 1KFJA 3QPZA 1QO5A 2E5CA 1JCLA 5TIMA 2AGKA 5HR6A 2R91A 2QUVA 1ICQA 1YPFA 1H51A 4K8HA 3PG9A 3M5ZA 3QJAA 4IWWA 3IVSA 1OYCA 1TQXA 1IF2A 1H5YA 1Z48A 1LP6A 3DKJA 4K8EA 3VNDA 1LM1A 4OT7A 1OF8A 3GR7A 1J2WA 3WK3A 1T8XA 3TX9A 3LXBA 5DCEA 4O11A 3LLFA 3CIXA 3NL6A 5AHEA 3VE9A 3NQ2A 4ZVJA 4HIBA 1I2NA 1W5PA 3TFCA 5C5YA 2BWGA 4N9BA 5LSMA 2FFCA 2QUUA 3TSDA 3TKFA 3NQMA 1EP3A 1WV2A 2H3DA 2GQ8A 4ZQRA 2E6YA 3GAKA 4O17A 4Q4KA 2GQ9A 4O1DA 2WNNA 2Y61A 1FCQA 3DI1A 4DF1A 2A85A 1SSGA 2ALDA 1D3GA 1PHQA 3QF0A 3RFAA 1SFLA 4TR9A 4GUHA 4NJKA 1H7WA 3THQA 3MHGA 1H7XA 3RF9A 3W76A 1GVOA 1RV8A 4MYXA 2CZ5A 5HWNA 2EF9A 3N34A 3M6YA 4M19A 3BARA 1TPVA 4O12A 4KFNA 3EXRA 4LVDA 1W3IA 1QCWA 3B4UA 4G1KA 4UTWA 3C52A 3JS3A 4JTLA 3LDVA 4FX8A 2CZEA 3B04A 1OX5A 1EIXA 2Y7DA 3S42A 4NQ1A 3FA5A 5FEZA 4P61A 3I7QA 3EX6A 1TRIA 1GVRA 1XBZA 4ORMA 1GYNA 1YXDA 2R8WA 1M7PA 1KV8A 1YLVA 4JTJA 3DFSA 4LY8A 1I2RA 4Y90A 5DY3A 1LLWA 4MIMA 3O6YX 4GBUA 1F7BA 3S8HA 4UR8A 3EKZA 3CEUA 3DH7A 4UTUA 4QJ1A 3OVPA 4TIMA 3GDMA 4RKAA 4DPPA 5I3FA 1DJNA 3Q58A 3DKLA 5DN1A 3ANYA 4UNKA 2Q8LA 4GJ1A 3GB6A 3NZRA 4GUGA 4K7VA 3TW7A 3I6RA 3W7DA 5AC8A 3G0UA 2FB3A 1H7NA 5LKYA 4UTHA 4FX6M 3I65A 3W7KA 4JX5A 2NX9A 3AJXA 3R5EA 3TAKA 4XKYA 4XWUA 3M16A 1WBHA 2QCHA 3KOFA 5AYZA 1GT8A 5F1VA 2ZA3A 3VCRA 3F03K 6ALDA 3TSMA 2B4GA 2YYTA 3GR8A 3ABQA 4K38A 4FXRA 3DFQA 3QRHA 1TTPA 1KFBA 2DZUA 1ML1A 3ATZA 1FXQA 3V1PA 1TTQA 4NJJA 3NEVA 3SZ8A 1JQXA 4FO4A 2NZLA 1SW3A 3BG9A 1FWNA 4PODA 2Z6IA 3U2OA 2NXHA 4JXCA 4N6FA 2VFDA 1N55A 3TMQA 2DJXA 3M41A 3T7VA 5HQEA 2VC6A 4MYAA 4BWLA 2NXIA 3A23A 1H63A 4JYFA 3EWYA 1LDCA 4NX0A 2WSRA 1A5AA 1D3HA 5AHMA 3HPZA 1OK6A 1FDZA 5H91A 3HG5A 2OT0A 4HNNA 3KXQA 2NLIA 2PCQA 3C56A 3IIZA 4O4WA 3TE9A 2P1FA 2PRMA 5K7JA 3W7PA 2A7NA 4YMZA 1H62A 4Q33A 1A5BA 4CQAA 3EWXA 3P62A 4CCCA 1UASA 2WNZA 1QOPA 4OHQA 3NXFA 3PAJA 3IVUA 3O8AA 4UTLA 2E68A 3BLFA 5LNRA 1H60A 3TU9A 2R14A 4UTTA 1KTBA 1HO4A 2I1OA 1GZGA 4AWUA 4NVTA 3MI2A 3CHVA 4FIRA 3D0CA 1K7XA 3LLDA 1VRDA 3NA8A 4AXKA 4LV4A 2XN2A 3DFOA 2G95A 1DVJA 3UD6A 3A24A 4M6VA 3LCHA 2C15A 3STEA 3N73A 2PE4A 2ZBTA 3OA3A 3EWUA 3W9ZA 2NWSA 1XI3A 3DBPA 3L0GA 4UC5A 4X2RA 5FEPA 1Q3NA 4LS0A 3EEGA 1VS1A 3PWAA 3W23A 1BWKA 3H53A 1X1OA 1SO4A 3PUEA 5CG7A 3T4CA 3HG4A 2Y85A 4CQ8A 2YDAA 2OCZA 1Q6LA 2VXNA 3P5ZA 1SFJA 1W8SA 1LRNA 3CC1A 3RNDA 2H3BA 3NR0A 1L6WA 1D9EA 1SPQA 3W1QA 2VEKA 2ZRZA 4X9SA 2ZRXA 2Z1BA 2ZFAA 1O60A 4LW7A 3H54A 1Q45A 4ICNA 5K9XA 3W7QA 3GAYA 3BGGA 3AO0A 3P61A 5KINA 1ME8A 3M5VA 3N19B 4Y8FA 4CCEA 5CSSA 1H1ZA 5AYYA 4LVBA 4MJMA 8TIMA 1R2TA 3PF3A 2A1YA 3EXSA 2PURA 4N9CA 3L21A 3UQNA 3EWWA 3GNNA 2J9YA 4R7JA 3CM4A 1TPB1 4WXYA 2Y88A 1DOSA 4ZQOA 1SR9A 1VR6A 2CZFA 3HG2A 3HO8A 3GXTA 3NM1A 4HHPA 2X1UA 4NXKA 3M5YA 3TR2A 2VFGA 3W2UA 1FCUA 2ZRVA 4ZL1A 3ZFHA 5D32A 3TH6A 1S5VA 3UY8A 5LGXA 2EGZA 3M44A 4OE7A 1G67A 5HWJA 1SZNA 3IVTA 2E6DA 1DV7A 5F2GA 1G4TA 5J5DA 2DZXA 3B0UX 1J5TA 4YL2A 3LRKA 4JIPA 4JTFA 3W85A 1TTIA 4LUIA 1UUOA 4JTEA 3G22A 1KM6A 2CLMA 3NQ6A 4JYDA 3FJ6A 4FNRA 2WQPA 1ME7A 1ZJIA 3G8RA 1AW2A 4ZMGA 1W3TA 1EPXA 1AW1A 4ML9A 1MSSA 4UTMA 4QNWA 4QIUA 3W87A 4E2BA 2FB2A 3VI2A 3LGEA 2V5BA 3FS2A 4PC8A 4N4PA 1TPDA 2CLLA 3O1NA 3LTSA 5DY2A 4FNSA 4JTTA 2H8ZA 5F1UA 4EF8A 3U8GA 1BEUA 3TFXA 2VENA 1TPEA 2ZZ6A 2FPVA 5CPLA 2X2GA 1KW1A 2A7RA 2OJPA 1WAUA 1DQXA 3OVQA 1BKSA 3R89A 4BFAA 3UZ5A 4A2SA 3KRUA 5DBTA 1JCNA 3UWZA 3UZJA 4O1BA 4MY1A 3LTYA 3W2MA 1U83A 3TDFA 4AVFA 3TMLA 2VEPA 3KAOA 4Z0JA 4TU1A 1CI1A 2ZQ0A 4Z0SA 2DP3A 2ATMA 1YTDA 4XBSA 3E02A 3SY5A 3NG3A 1TPUA 4FNQA 3QQ1A 1GJPA 3L67A 4O50A 3UYCA 2ZCGA 1QO2A 1WBJA 4JD4A 4HNTA 4R53A 3E0IA 3L5LA 4RZ4A 1GEQA 2W6RA 3TXVA 4O0ZA 1E51A 3LB0A 2FTPA 3O07A 1I2PA 1VYSX 1FWRA 3SR7A 3ABRA 3W3OA 3JRKA 4OGZA 2VELA 2OX1A 4N9DA 3QMRA 3EX2A 3C8FA 1VQTA 1SZGA 2Y63A 1SW0A 4QAIA 1X8FA 5C54A 4UFKA 5G2HA 4WOZA 3W1RA 3PR2A 1RD5A 3CIWA 4JTIA 5U4NA 3TW6A 4S2CA 3P82A 3B0PA 2XFWA 2A6NA 1K3UA 2GVGA 3MP3A 3W1LA 4M7SA 1XFBA 4K7YA 2V2CA 5AC7A 4QITA 1ZNNA 2V81A 2ZDRA 4JEQA 3C2FA 1JUBA 3MHFA 1PV8A 1LLZA 1WYIA 3GXNA 3W6YA 4AWTA 3NPUA 1EEPA 4UTWC 1TB3A 2EPHA 1LCOA 2RHGA 2TPSA 1HL2A 4NNBA 4BK9A 1H7OA 3EKLA 4AAJA 3W7RA 3M1ZA 1R2SA 1PE1A 1VH7A 1H7RA 3IGXA 1C29A 2E5BA 4P2VA 3R12A 1XUZA 3HIJA 3WJWA 1NAL1 2GQAA 1LYXA 4IMFA 3PBWA 1FDYA 2DZVA 4IPJA 1FXPA 3MYPA 3TQVA 1F74A 4WD0A 4XTIA 1XXXA 4FX7A 3V75A 5F4WA 6TIMA 3BVJA 2ZRWA 4QSHA 2QCLA 1DHPA 1GVFA 4TO8A 1G6CA 4ZQNA 4NXSA 3NQEA 1P0NA 4JNMA 3L9CA 4N2YA 4LC8A 1QPOA 1A53A 1K7EA 3PC0A 3QW3A 2X30A 3G8EA 5K9CA 3MP5A 2Y7EA 2V2DA 2NV2A 1AL8A 3JR2A 3KVJA 3QZEA 1OFBA 2ZZ3A 2A5HA 2DZTA 3UXAA 3P7YA 1EWDA 4HT3A 1B4KA 3TUUA 4AH7A 3W1TA 5AFDA 4IMEA 4RXFA 3GLCA 1TREA 3ZR4A 1H61A 4LUJA 4MLJA 1KFCA 2RKXA 4O57A 4MLRA 4UFLA 3W75A 1EB3A 3W1XA 5I3JA 4PL1A 2ZZ7A 3KVLA 5DBUA 3Q37A 2ZTKA 4WZHA 4PCFA 2G97A 1N8FA 3W7HA 1ME9A 3TIMA 3W1AA 1PL9A 2Y6ZA 2WV8A 1HO1A 3T78A 1ADOA 3TAOA 4RR4A 1VYPX 3RMJA 4BR1A 2Z0IA 5KSWA 1OFRA 1QOQA 3PB0A 4O16A 1WDWA 3P60A 1GG0A 2E77A 5D2TA 2YZRA 1GTEA 4O8RA 5K2ZA 4BWLC 1RPXA 2GVJA 3QMTA 1JULA 4NU7A 2ABBA 2WSYA 2G96A 5FEWA 1O4UA 4IMDA 5G1YA 3LI1A 4DEFA 1EP2A 2WJZA 1KM3A 5D2VA 3BW4A 3EX3A 2C3ZA 4N9EA 1Z42A 2YW4A 1YDNA 2V30A 1KM5A 1VGAA 1TJPA 1ZAJA 2BSLA 3P81A 5IM51 1ONRA 1LOQA 2QAFA 3NPXA 3DZ1A 3EB2A 2B7OA 3R13A 1UUMA 1TPWA 3W22A 4ADSA 4NT0A 4O1AA 1A50A 5AHIA 1L6YA 3UY7A 4E2DA 2B7PA 2DORA 4JGDA 2YPIA 2P0OA 3KHJA 4PEKA 1SQ7A 5KZDA 2VOMA 4UTTC 1X6UA 5FF4A 3LCWA 4IPIA 1TTJA 2VFIA 2YYUA 4KFPA 5TQLA 1DBTA 4OV9A 5LNSA 1P4CA 1LBLA 4AHQA 4TMBA 4UCGA 1M7OA 2EKCA 3O05A 1YTEA 4A29A 2FDSA 1EA0A 1QWGA 3NM3A 3DGRA 2J27A 4I7UA 4IXHA 2Y70A 5HJLA 3FIGA 4UTKA 3G18A 3L2IA 3N3MA 1K8ZA 4MPQA 5AHLA 4DF0A 4E0CA 1UJPA 1H1YA 4LVFA 1HUVA 5G2WA 3S5OA 5D05A 2GJNA 3UWUA 3NOEA 3CEPA 4Y9AA 2C19A 3I68A 2BZNA 4PFMA 4UMCA 4X22A 1W0MA 2P10A 5KZMA 2A7PA 5EKYA 3NQ7A 3N9RA 3RLVA 1M5WA 1OX6A 4OQVA 4WXZA 3S1XA 2QKFA 1VJIA 3P74A 3B03A 3EX1A 3LCXA 3LHUA 4NNAA 3R2GA 3QYQA 1SO3A 2B7NA 5EPDA 2GJLA 2TMDA 1KTCA 4GE8A 3RK8A 5BMXA 4RV8A 3M5XA 1FX6A 1ZCOA 4N4QA 4KWWA 1LTDA 2HSAA 3MUXA 4I7VA 1H50A 1B57A 2WSQA 2Z2UA 4DO6A 4YLWA 3S1WA 2X1SA 4YWIA 2XN1A 2OT1A 4FIQA 3L68A 3L65A 3LERA 2O7QA 1G7UA 3LCIA 4UNLA 1I2OA 3PSWA 3WJYA 2JKEA 3S1VA 3MHUA 1ICSA 2ABAA 3ZWTA 3HGJA 3PSVA 1VCVA 5ABTA 1O5KA 4H6KA 1K7FA 2D73A 3BLIA 3PBUA 1T96A 3W2KA 4Z1BA 4HKPA 4BF9A 3DFTA 1PHWA 3USBA 3K30A 4AF0B 3PB2A 1HTIA 3WJXA 3LOTA 1W5MA 2NXGA 2Y62A 5AOUA 3TC6A 2B0MA 3NQGA 1LRTA 2CWNA 5CGQA 3G1YA 3MMTA 1PCWA 3ZS4A 4QNEA 4IGHA 4S2BA 3NGJA 5A8GA 2GUUA 2DU2A 2AAMA 1GOXA 1LOLA 3W84A 1GPWA 3TXZA 1OABA 2VFEA 4FB7A 3B8DA 1IIHA 5BRBA 2H8XA 4ALDA 3FYOA 2GOUA 5FEXA 4FNPA 3I7RA 3C2VA 3DXIA 4NX5A 1G4EA 1I8JA 3PBYA 3BG5A 4EIVA 3S5ZA 1KBIA 4XUGA 1THFD 3HGSA 4DO5A 1KLYA 5I3HA 4H4IA 3G1HA 5FI8A 3GK0A 3OIXA 1V5XA 1RR2A 3W1PA 4WOQA 5F2IA 4DBEA 4MZ8A 5DLCA 2HTMA 1PCKA 3QSTA 1MEHA 3W83A 3IRDA 3PBVA 1RZMA 3DENA 4O18A 3M7WA 4L4LA 3T55A 5C2XA 3P67A 1QFEA 1TYGA 1W37A 1XBYA 2J6XA 5LZLA 1S5WA 1NVMA 1WA3A 1X7FA 3O06A 2PC4A 3W2NA 5K4XA 2Y89A 3GX9A 1F05A 2YGYA 3O15A 3GDKA 1ZENA 2JKAA 4JTUA 3W07A 1XKYA 3UWYA 3WJSA 3OHIA 3LX9A 1P5BA 3W7GA 1JJKA 3FLUA 4D2JA 1W31A 4Z1DA 1L9WA 1AL7A 4JX6A 2CW6A 4UR7A 4ADTA 3NQAA 4ZQMA 1IXQA 3S6DA 2J24A 2CZDA 2JK2A 2LLEA 3W71A 1MEWA 3S5NA 2RFGA 3MYOA 1IIGA 3G1XA 5E0KA 4L4MA 2F84A 4GUJA 3FKRA 4QQ3A 4JTGA 2ZZ2A 2QDHA 5D04C 3LHWA 4GRSA 3WK0A 4HPJA 5AB3A 3HGOA 1FBAA 3E96A 4RX0A 3UPBA 4PL2A 3G1FA 5KZEA 3W73A 4Z1CA 3W72A 5D37A 1EWEA 1R30A 4LT9A 3G24A 1JRCA 1CW2A 2DZSA 3UPWA 2TRSA 4LU0A 2CLKA 1LROA 3OG3A 2I14A 5KITA 4GNJA 5H2ZA 1G4PA 3QSRA 3P8IA 4OU1A 3G0SA 4CQ9A 3QMSA 4AHPA 1OVDA 4YCOA 1LBFA 2Q3OA 3W7MA 2C1HA 3O6DA 1UB3A 2E1DA 1K8XA 3BK0A 4OWGA 3KRZA 3NZ1A 1OFOA 2CFFA 4AF0A 1YXYA 2RH9A 3GDRA 4C1LA 4NZFA 3MBDA 1JCXA 2EAWA 3CWOX 3N9SA 4JTSA 3VFLA 1G7VA 1OFEA 4MUZA 5D2YA 5L6UA 1QPRA 4NJIA 4UFJA 4UTJA 3W7LA 1NEYA 4JY8A 5CPNA 2QCDB 2A6LA 4M6QA 1O95A 1X1ZA 4QISA 4ADUA 4LVAA 2VFFA 3GXPA 1PS9A 5LNUA 1M6JA 4M7TA 2CLOA 3W70A 4FNUA 3KFTA 5K4ZA 2NX3A 3Q2DA 5D02A 3PM6A 5AC6A 4JICA 4DBDA 2V82A 1QNVA 3H55A 1XBXA 4AMAA 1WOBA 3G1AA 1SSDA 2QDGA 1TV7A 2BTMA 4IQLA 2YXGA 2C0AA 1XC4A 1TCDA 3KVKA 3S9YA 4UMAA 1JCMP 1ZALA 3G3DA 1KTNA 1UCWA 2ZYFA 4X3ZA 5EY5A 4KWVA 2ATSA 3B06A 5LNVA 5T26A 2KZHA 4A22A 2QCNA 1DL3A 1KV5A 3LHVA 2A4AA 3C2EA 4S1FA 4LOCA 2WKJA 1OG0A 2ZZ1A 2WNQA 1EUAA 2FIQA 3ZWSA 3UWVA 3CLMA 1S5TA 4K37A 1OK4A 1B9BA
chains in the Genus database with same CATH superfamily
4GQGA 3FHAA 1KCZA 3U9IA 1JYXA 2ZXDA 2Y7GA 4XZ9A 3LV5A 3GYEA 1HJWA 3MSRA 1Q7ZA 2E25A 1JNEA 4MFEA 4C6OA 2A0NA 4IX2A 3LLXA 2QGYA 3FFSA 3CO4A 5HULA 3M47A 2AQWA 2Q6ZA 1NFBA 4LYKA 5C70A 2JGQA 2QCEA 3C3NA 4CNUA 4PSPA 4JIQA 1HVQA 1W1TA 4WUIA 4HPGA 4LS2A 2E28A 1UR2A 3UG4A 2OMAA 4KH2A 4PFHA 4PE8A 1DEDA 5FJJA 3OPSA 4RW3A 4WY0B 5EA9A 4B5NA 4V1YA 3MI6A 1MDLA 5IHRA 2FGLA 3GVQA 2XIJA 3K8LA 4U31A 2WB5A 5HDRA 4A05A 5D09A 4GXMA 3GTIA 2J8FA 1BXCA 1XIMA 4NNCA 5AC5A 3NSMA 4JFSA 4QS6A 1DJQA 3VNLA 3SIZA 3CQ0A 5LGZA 1RJRA 1DJGA 1W3JA 2V5LA 1VHNA 2V3GA 1IGSA 1B3XA 3SGZA 3KZSA 3SJ3A 3PJWA 1FWSA 1O1ZA 4G8TA 3QQ0A 1OYBA 3IACA 3E0LA 3QHOA 4P5UA 3W7NA 3SDOA 4O4VA 2WWDA 1E4IA 1KCLA 4QM1A 1Q7QA 1TJRA 3QC3A 1S1PA 1ZPTA 2NUWA 3HA1A 1QBBA 3NDZA 7TIMA 1GOMA 4PMQA 1WKYA 3QPYA 1GONA 3ZMRA 4CLMA 4RXGA 3GU2A 2DW7A 4B5TA 3LM7A 5G1TA 2QR6A 4NJGA 1OWQA 1P0EA 1WP6A 1R47A 3CNYA 3VKDA 1W5OA 4XD3A 4BI5A 3U0HA 2PFHA 2OZ0A 1DE5A 4B15A 3LG3A 2YBUA 2MANA 1TV4A 3M46A 3OP2A 2FZ8A 4H6EA 1RCQA 2REQA 2E9BA 2DT3A 4GIEA 4H04A 3ZM8A 8RUCA 4WQ6A 3U7BA 2WMKA 3BJFA 3GS6A 3V7PA 4CEUC 1Z32X 1GOIA 4YU1A 3VYLA 3L66A 1NF0A 1OYAA 5H1WA 2QLYA 4WDWA 2YB4A 3O3RA 3SRHA 5HQMA 1DE6A 1N7KA 3Q45A 3WLKX 4U10A 4ZXOA 1IWBA 3A64A 2VEMA 4POCA 3QM3A 4RNJA 1VEOA 2VFHA 1W1PA 3CTLA 3N2TA 5I3GA 1Y0EA 4S3CA 4JYEA 1I1XA 4ZBCA 1W1IE 5A6JA 3DAQA 5DXYA 5AC4A 4OBTA 3OA5A 5ECUA 1HG3A 1V0NA 1UZ4A 1XM3A 2V8ZA 4HU0A 3IV3A 3CAVA 5A2BA 2DT1A 2BNJA 2EPNA 4WCJA 3WCZA 1D8WA 5DCDA 1CWYA 5EL1A 1UA3A 4HJFA 4AD4A 4FHAA 1F6PA 3FOKA 4DXXA 4DIAA 3EMQA 4DAFA 4J3VA 3DG3A 3UA4A 4QEHA 3LBMA 2AL1A 2D0HA 4D6EA 2ALRA 1WX0A 3QOMA 2QCMA 1VPYA 4B9ZA 1H7PA 1JQVA 1W5QA 2VEIA 1R46A 2BXVA 3BSMA 4UQCA 5DXXA 2QQ6A 5LIWX 3ARXA 3F1QA 3BO9A 1XLDA 3KVMA 4TV6A 4B3LA 4R9XA 3FVDA 4V28A 2BX7A 7REQB 3RU6A 3AHVA 1KM4A 3ATYA 4JL1A 4C1KA 4D6JA 3KS6A 2HWGA 1RP9A 4B2DA 3FAWA 3TROA 2VGFA 4L64A 2NQ5A 1NFPA 3ITLA 4CQCA 3C4UA 1SVDA 1KM0A 1ZGDA 3RHGA 3VIIA 3EMZA 1V3JA 2WANA 4D8AA 3GQYA 3ZJ8A 4ZQPA 3N12A 2ZTJA 5AHNA 2X42A 3HF3A 1XINA 5CZSA 3BLOA 4BI6A 4O54A 3FA3A 3JZEA 4NI8A 3W1UA 3P80A 1UD5A 5C55A 2P0IA 1IR2A 1B3OA 1RY0A 2VX7A 3M7SA 3PULA 3OBEA 1FH7A 1OGGA 1DJIA 2VGBA 3FYPA 4PMZA 5AZ1A 1IE7C 4RPQA 2V5DA 4Z08A 1BRLB 1KA9F 4UQDA 5BOEA 1MFVA 2V0TA 2FZNA 2Y8KA 3WFAA 4HOZA 2J88A 3UJFA 4HB7A 2YFNA 4Y96A 3GDTA 1XG3A 4ZOAA 1P0BA 4HN4A 1JPKA 1GQJA 2Z7GA 5M03A 4J28A 2ZVRA 4A21A 4W8LA 4B5WA 4RCXA 1N2VA 4TX9A 3VC6A 1TV5A 1JZ6A 1TVNA 5I3KA 2WMJA 4FXSA 5JU6A 5HMFA 3NZQA 1XPGA 4TUFA 4DELA 4E3TA 3G3MA 1TMHA 3WLMA 4Q6XA 2ACQA 3C61A 5FA5A 3OBKA 4NL1A 5H8UA 5K9DA 5CLTA 3QHNA 1M3UA 1TPC1 1Z41A 3CWNA 2INZA 4Y6GA 3ABSA 4EXAA 2Y24A 5M17A 1JYVA 2DUZA 2BB0A 1UKSA 3NVTA 3MWAA 4H8UA 4ZO7A 2QPXA 5EBUA 1OCBA 3PG8A 9RUBA 1JCJA 3CYVA 1A80A 2HS8A 1O94A 3GXMA 3MANA 3G5EA 3T40A 2FGZA 2F9RA 1P7TA 1RQEA 4XTDA 1SR0A 1VBJA 1I4NA 1K4GA 1WXJA 1WZAA 3EOSA 4OOZA 4KQNA 1OJXA 1T8QA 4ERGA 4JTKA 4PMNA 1ZAHA 2FJKA 1JXKA 4REQA 3UF9A 1R3VA 4HA0A 1T99A 4CVWA 2CLPA 2O9OA 5CZJA 4GWEA 1XGZA 4FNTA 4ORIA 3MW7A 3PZQA 1TMQA 4XSLA 4LGXA 4M5PA 5E1QA 1ISYA 3VKAA 3W25A 1E72M 1FWTA 3SM0A 3EPMA 4MPKA 3N2MA 4H19A 3L5MA 1TPFA 2GVEA 8XIAA 1UMYA 1A4LA 3QLDA 6TAAA 3VDBA 2QCGA 2FQIA 3CPRA 1CTNA 1CDGA 3CS2A 3O6CA 3WQ6A 1KBBA 3FXGA 4JKLA 4ICCX 1OX4A 1TRDA 2ONEA 3WQPA 4G1NA 3HPXA 3WJZA 1HJVA 3TV8A 3UESA 4LAMA 1R3TA 4IOTA 2G0WA 3QKZA 1KM1A 2VURA 3S5YA 2IQDA 4U2ZA 4EF9A 2QJHA 2YW3A 3N14A 1PB0A 3NL3A 2DVXA 1E1CA 1RQBA 1NDYA 2KAUC 2C18A 3H2OA 5LHFA 3ZJ6A 1PSCA 2CCRA 4LNYA 4JDBA 2DH2A 3UVIA 3RGTA 4WY0F 2OWCA 2E6FA 3SRFA 3TWBA 3CB8A 3HMCA 1QMLA 3YPIA 3B8IA 1VLWA 3PS7A 4CD4A 2NLYA 3C2RA 3ITOA 2BVYA 5G4WA 3FVMA 5EYWA 3E12A 5FF2A 5K3VA 4MKNA 4N42A 1ZFJA 5LA0A 5FF7A 5FJPA 1F76A 4KFOA 1V7YA 1HVXA 3DHDA 5JH2A 3KW3A 1G9HA 5F2MA 1OGBA 3WL0A 5G5IA 1XR2A 2E7FA 3MKVA 3W7IA 1QTWA 2FZBA 3HOJA 1B3YA 3WK2A 3L4XA 1QK2A 2G5WA 4W7UA 3W7OA 3IEBA 4PULA 4S3JA 1SZEA 1A0DA 1R6WA 4NZ1A 3QHMA 1MWOA 3QY8A 5EU9A 3QPZA 1OZMA 1QO5A 2BP1A 3URAA 5TIMA 3AXXA 2EPKX 3AISA 5HR6A 1CBGA 2R91A 1W9UA 3MSDA 3T42A 4HYVA 1ICQA 3IJ6A 2G8ZA 1H51A 4K8HA 5DT7A 3PG9A 1FWEC 4G7FA 4J2MA 3PWIA 1TQXA 3DKJA 1LM1A 5BYWA 9XIAA 2YOCA 3TX9A 1UR8A 4I9MA 1WUFA 2EJAA 1JZ8A 3LXBA 4O11A 3LLFA 2CBJA 3CB3A 4PMDA 4M80A 2CEQA 4HIBA 1W5PA 1V3IA 4WKAA 1QBAA 2GSEA 2QUUA 1LL6A 1X6NA 3II1A 1IZKA 1WV2A 2GQ9A 2WNNA 3F2CA 4DF1A 3NZGA 1D3GA 4B3ZA 3AXHA 1SFLA 5CLWA 3MHGA 1H7XA 5CC6A 3W76A 1MXGA 4US5A 3LY0A 4MYXA 4LXFA 4GVGA 1M68A 3N34A 1NH6A 3UA3A 1L6FA 3M6YA 1TWIA 1TPVA 2I17A 5HOSA 1OC6A 3EXRA 3AIBA 3L2MA 3B4UA 4UTWA 4XB3A 1IQ8A 3OJGA 4EE9A 3RYSA 1OY0A 1TR1A 2PGFA 4PB3A 1ITCA 1RALA 4PMVA 6A3HA 4C91A 1YLVA 4JTJA 4FF5A 1TELA 3S2MA 4IIBA 1IR1A 4LY8A 1GZ1A 5DY3A 1E1FA 5F7UA 4J4KA 5CG0A 1MUWA 2FTWA 1V02A 1XLEA 2O55A 3EKZA 3CEUA 3DH7A 5FJIA 3WEMA 4UOZA 4TIMA 3GDMA 5I3FA 1DJNA 3CH0A 3PZ9A 3Q58A 5DN1A 1KXQA 3ONCA 4ZCWA 1REQA 3W53A 4GJ1A 3NZRA 3ABZA 3I6RA 5HPCA 5LKYA 1BSLA 3WD3A 2X1IA 3T8QA 2NX9A 2F61A 3KP0A 2QJNA 1WZMA 5AYZA 4H8VA 5F1VA 1RCOB 3F03K 2X2YA 3TSMA 2BDQA 5BOFA 1KR0A 4K38A 4Z2HA 3AYSA 5CGMA 2WNWA 5I07A 2ADAA 3VOJA 1KFBA 1ML1A 1UD6A 3ATZA 1FXQA 3V1PA 4NJJA 4FO4A 1CYGA 4JKMA 4C6FA 1M01A 2DT2A 4GKTA 5HXMA 2NXHA 1ONXA 3KBSA 4JXCA 5JBDA 4N6FA 2VFDA 1N55A 4A8IA 3T7VA 3D3AA 3L4YA 4CCZA 5I6SA 3UZXA 1CXEA 4GQQA 2ODOA 3CZJA 3EWYA 5CH9A 4NX0A 2FJUB 1D3HA 2J6VA 3KTXA 1OK6A 1FDZA 4Q7NA 4Q22A 4HNNA 3R79A 1VFHA 4O4WA 4L9XA 3TE9A 3NIYA 1EEXA 2A7NA 3UJRA 3P62A 1R7AA 2WNZA 1DHKA 5AYIA 3TYZA 3ARVA 4DYJA 4UTLA 2E67A 1FWBC 4UTTA 1RY8A 4NVTA 3VGDA 3CHVA 2CIPA 1XIJA 4U3AA 1VRDA 4G2DA 1V6UA 1XJBA 2VTFA 2G95A 1DVJA 2PE4A 1KKRA 4JIEA 3RR4A 3EWUA 3W9ZA 3ONBA 5AKQA 1G5AA 4UC5A 4X2RA 1Q3NA 1OBAA 4LS0A 9CGTA 1M7XA 3GFZA 3E0FA 1UZHA 1X1OA 3CQKA 1Q6LA 2VXNA 4RE3A 2QJMA 4GKLA 4AZIA 2PBOA 1W8SA 1NY1A 1R9XA 4C5ZA 4WHBA 3W1QA 2D24A 2Z1BA 2GGGA 2PWFA 2WHKA 4Q8UA 4FS9A 3W7QA 1R9YA 2YBTA 4I5RA 3BAXA 2XSBA 3AO0A 5KINA 4Y8FA 4AY8A 4CCEA 1LT8A 2GK1B 8TIMA 1R2TA 2PURA 4B3KA 3CHFA 1NQ6A 2GSJA 1O7AA 3L21A 3SCPA 3AALA 3L4VA 3TOPA 2FVKA 1GVIA 1OG6A 2PD5A 3CM4A 1ZS2A 1I60A 4JQ1A 4L4PA 3SUSA 1YDYA 1TPB1 4C90A 3CUFA 3EDFA 3WNKA 1Q63A 2VZVA 4PUMA 4ZQOA 3R1ZA 3NM1A 2ZDSA 3TCSA 2GWNA 2J13A 1OCQA 2PWEA 2VFGA 2WVSA 1FWIC 4GK8A 3WUFA 5D32A 1HP4A 2EGZA 3M44A 4LH8A 1G67A 4AY1A 3KM8A 1PPIA 1G4TA 2DZXA 1RBAA 4IL0A 4DWSB 4RZBA 4YL2A 4EPDC 5ABEA 1FFQA 4JTFA 3W85A 3FSTA 4LUIA 1C92A 3NSNA 3G22A 3FJ6A 1EGMA 4S3DA 3KBVA 2HVOA 4H1ZA 4G56A 2DIEA 4CGTA 1AW1A 4HNLA 5C7HA 2VMFA 4JHZA 4QNWA 4E2BA 2FB2A 2OSWA 3VI2A 3FDKA 3H2FA 4Q8OA 1CT5A 4N4PA 1NIUA 3AU2A 1W8GA 3O1NA 3LTSA 4L1XA 2GGEA 4FNSA 3O6AA 3PJUA 1TPEA 4R9OA 4UR9A 3VNZA 1A0CA 2A7RA 2OJPA 1AQ0A 3PTDA 1BKSA 4BFAA 3UWZA 1AZ2A 3LS9A 1Q66A 1MNZA 2VEPA 4Z0JA 4TU1A 4YN5A 3WH6A 3AS3A 5BXTA 1EF3A 1UIPA 2UY3A 4I5XA 1A5NC 3SY5A 4AZ6A 4Q4OA 3QQ1A 3OGRA 3KOYA 1QO2A 3TYCA 1WBJA 5GJNA 4HNTA 4RZ4A 5HJYA 2W6RA 1G0CA 4PRWA 1YE4A 3QR1A 3RJXA 3W3OA 3W6LA 3ABRA 2VELA 5BXPA 3VINA 1QU4A 1WDSA 1P43A 3ZQ9A 3C8FA 3JVAA 2E8YA 1FWGC 1VFLA 2QPUA 4P8UA 4J3TA 2INEA 4LEQA 3XIMA 3K13A 2XM1A 3PR2A 3CIWA 1RSCA 2BOGX 4Q4RA 2GVGA 3MP3A 4IGMA 3TYUA 2WKLA 1MNSA 1V79A 3S2LA 5CJNA 4ZOCA 3TTEA 1HXJA 2PDIA 4XVEA 2XH2A 3SB0A 3AZRA 1MVYA 1DYSA 3U2ZA 1S3TC 3EKLA 4AAJA 2E9MA 1IZJA 1QJWA 4QE4A 1R2SA 1PE1A 1H7RA 3THDA 2BOEX 4AEEA 5DMYA 4IMFA 4WD0A 4GVIA 2CXGA 2WZHA 5F4WA 3WBXA 2QCLA 1UOZA 1GVFA 4D72A 3NQEA 3CZ8A 2IUZA 1QPOA 1A53A 1K7EA 4ZB5A 2X30A 2D22A 3G8EA 5FIPA 4DI8A 3GTHA 1DWHM 3AMCA 1LT7A 2NV2A 4XK2A 2PLKA 3JR2A 3KVJA 3QZEA 1WDDA 2FHCA 3FNDA 2ZZ3A 3CZKA 4FLRA 3RM9A 3K5XA 4PEEA 3HTWA 4GI4A 1EXBA 3IANA 2ESCA 4G5DA 4IMEA 4RXFA 4HU8A 1UWQA 1BTCA 1MXDA 1KFCA 1MRAA 4D6GA 3W75A 5DBUA 4M1RA 3RMEA 4J35A 3KTSA 4NG3A 1PO9A 1G1YA 3E0WA 3WDIA 4PCFA 1ME9A 2Y6ZA 1IEIA 1E6PA 2WBGA 2J66A 1VYPX 5EMJA 2Z0IA 4LUSA 5HK4A 1OFRA 1UA7A 1PIGA 4ATDA 2JE8A 3PB0A 1WDWA 3WMBA 2OEJA 3DHPA 2GVJA 4GA8A 3QMTA 1JULA 4FSAA 2G96A 2FZMA 4IMDA 1K77A 4KWUA 4DEFA 1EP2A 2WJZA 4HPNA 5D2VA 1Z42A 1YDNA 2V30A 1KM5A 2O9RA 1EJWC 2BSLA 3HFYA 3GNRA 3H12A 2ZC1A 3NPXA 2P3EA 3HM7A 5C9WA 1GOQA 1LG1A 4NT0A 1J0HA 3WD2A 1E3ZA 2GWGA 2P0OA 2VI0A 3FGCA 2VOMA 1QI4A 2PDHA 3WF4A 5ABGA 3URNA 3MY9A 5JQ9A 1FHUA 1P4CA 3VKCA 5HQLA 4UCGA 3LEPA 3CZLA 1EA0A 1RPKA 2J27A 4HJWA 2Y70A 4F0SA 1XLAA 3FIGA 3PJTA 1IZCA 4MPQA 6XIMA 3W4RA 1UJPA 2WK2A 1H1YA 4LVFA 1XLGA 3WIJA 1GNXA 2TAAA 3S5OA 4FLOA 3CAKA 5D05A 3L4UA 1BKHA 1MW3A 2GJNA 1ZUAX 4AZCB 2YLAA 4Y9AA 3I68A 4UMCA 4X22A 4E4FA 2IPGA 4QDPA 2YCJA 2W27A 4C1NB 3RDKA 1M5WA 1E4MM 3BMWA 1EGZA 1VP5A 4DZIA 2QKFA 1GW1A 4PBGA 3QYQA 2B7NA 5IXEA 2TMDA 2JFEX 4ZOEA 3KBJA 4GE8A 1OC5A 2I16A 2C7FA 4KEVA 3UCQA 3A4JA 1IT8A 1LTDA 2ISDA 3MUXA 3G6MA 4I7VA 2WVVA 3GW0A 4NYYA 2P3ZA 4R88A 2JF7A 3LERA 1QNQA 4AIBA 3R43A 1I2OA 1P6WA 3MHUA 4IICA 2AGTA 4HA3A 3BWWA 3RPTA 3HGJA 6ENLA 5B7YA 4RNFA 3T0BA 2D73A 1ENUA 4KEZA 1TUXA 3RR1A 3W2KA 4PTWA 4HKPA 1E55A 2WZTA 3DFTA 2XVPA 1F3XA 3K30A 1HTIA 1W5MA 1UZ1A 2NXGA 1JPIA 5EGRA 4QG8A 3UVAA 2XINA 1R38A 5CGQA 3G1YA 1GKRA 3MMTA 2YA0A 3EKGA 5MKGB 3BL3A 4B5VA 3LBOA 4S2BA 1JYNA 5A8GA 2V6AA 4MTVA 1ISWA 4DUVA 3RIKA 1NTHA 4H2HA 2Q09A 2VUNA 2OQLA 4Q8PA 3H7UA 4FB7A 2E0PA 4C7DA 1IIHA 5E6ZA 2EG7A 4ALDA 2H9AA 4MUPA 2NSOA 2J8TA 3I7RA 1VBRA 3MS8A 3DXIA 2ZUVA 1S2VA 1G4EA 1XYLA 1I8JA 4GI9A 3PTKA 4LYQA 5HNTA 4XUGA 5D9NA 1W9VA 2GUBA 4HZ8A 5I3HA 1M7JA 4H4IA 3THCA 2XVGA 2YIHA 4ML4A 3OIXA 1IHIA 3AYVA 2YDRA 2DFAA 4WOQA 1BXNA 1CIUA 3OGVA 3I4EA 4ILSA 2HTMA 3QSTA 1MEHA 5EBAA 1MW1A 3EAUA 3A3XA 2PDLA 1QI5A 1F61A 3DENA 4O18A 1EZ2A 3WFZA 5C2XA 1AH0A 2D20A 2J6XA 4LJ3A 3N1AA 3TOYA 1X7FA 5EB8A 5CBIA 3D6NA 3O15A 3GDKA 2JKAA 4JTUA 3W07A 3EPOA 4V33A 2J7HA 2CW6A 1ISVA 2XZ7A 3WSUA 3TTOA 1YMYA 3ALGA 4JQ2A 3WUBA 2PWHA 4ACZB 4QQ3A 3T05A 4Z42C 4JTGA 3MPGA 2QDHA 3VOHA 4PR4A 4C6PA 2XSXA 1O5QA 1K9DA 3GU9A 1NJJA 3UPBA 2OWXA 4DN1A 2V3DA 3G24A 1L6GA 2C91A 5B7ZA 3RX3A 2UY5A 1JFXA 2TRSA 4ZSTA 3L2LA 5I5RA 2HZGA 2CLKA 1H4PA 2OEKA 4PCTA 4RE2A 3OG3A 4GFIA 3QSRA 3P8IA 3SUVA 4F0RA 5A2CA 3W7MA 3O6DA 3ENLA 3ZVHA 3EOEA 3BK0A 4OWGA 1X38A 3NZ1A 1OFOA 2CFFA 3QKEA 4NZFA 1E6RA 3N9SA 4P7QA 1XLLA 5JMUA 4KCVA 1QPRA 1C91A 2J7GA 1UQYA 4NJIA 4UFJA 1GOKA 1ZJAA 1E0TA 2PMQA 2QCDB 2A6LA 4BEUA 4R5EA 1PS9A 5LNUA 3B8WA 1RAKA 2ZX8A 1CCWB 1UP2A 3ITCA 4M7TA 3W70A 2CLOA 2BY0A 4W8BA 5K4ZA 2NX3A 2XFRA 5AC6A 3P3BA 4JICA 4DBDA 2V82A 1QNVA 2P53A 4Y2WA 1RLDA 1U5VA 2QDGA 4C65A 1OCJA 2OKOA 1Z7AA 3EB4A 2C0AA 1UWRA 3S9YA 3DERA 1VEMA 1NM9A 3PPGA 1FVPA 1NDVA 1RH9A 3OW1A 3NOYA 1WNOA 2KZHA 3BANA 1DL3A 4E4UA 5HJXA 2A4AA 3C2EA 4S1FA 3ZLFA 1OG0A 3MT1A 1TA3B 4PMUA 2OYMA 2X0HA 2UZ9A 5CSRA 3SAZA 3APTA 3M6DA 4ZE4A 3GXIA 3O63A 4D6CA 2O0TA 4ICMA 3A12A 3WZ0E 4D1JA 1FDJA 4GFSA 1LZOA 1FY6A 4IUOA 3TVAA 4N7QA 4L65A 3MVIA 3ZSTA 3STFA 4JS3A 3AROA 1VBHA 3WQFA 3R94A 1AA1B 2HNHA 5FF3A 2WVUA 4WX2A 1O5XA 1BWLA 1W54A 2QEZA 2CWXA 3GTXA 3EA3A 2AL2B 1EC9A 1CLKA 2WOQA 3BC9A 1KQYA 3WBEA 8XIMA 3ELFA 5ECVA 2PTWA 1FUYA 3DU0A 4DI9A 2O92A 4X0NA 1S1RA 2G3IA 2HS6A 2UY4A 4BKNA 1F6KA 3G1SA 1ZLPA 1J0ZA 1JR1A 1YPIA 2PRHA 1RCXB 4WIWA 3TK7A 4O53A 2R6OA 3WD0A 4LAOA 1WKEA 2OYKA 3BOFA 4B9YA 1VZWA 3VKKA 1GVSA 3TA6A 4KCWA 1RJPA 2D2GA 1XDMA 2MNRA 5E9XA 3W2LA 1J11A 1KFLA 3VIHA 3N29A 2EBNA 5D38A 5BU6A 2E1WA 4IG2A 3S2CA 1GGOA 1GTHA 4AZGA 3EX4A 1W1ZA 4JR5A 1BYCA 5JBFA 4A3UA 2W67A 3UR5A 1AJZA 1JI2A 4YHGA 2PF0A 1KGUA 3WX7A 2A21A 3HGRA 4IM4A 4PB4A 3BURA 4GQ0A 3H26A 3H4XA 4W88A 1U1JA 3WLQA 3P84A 3QV9A 1F2JA 2Y5EA 3PFRA 3UG3A 5GNZA 2CPUA 3BSGA 1L8PA 5EMUA 2ISVA 2PSNA 4YTUA 3UU0A 3NPVA 2F7FA 1FHLA 2FPYA 3M0XA 4H3DA 3SURA 3TC3A 3BCDA 1F5ZA 4E2OA 3IIVA 1ZP3A 5FF0A 1CENA 1Q6FA 5AECA 3FK4A 3RLUA 4E8CA 2PDGA 1IGWA 3RO8A 1AUSL 4HN8A 2H6RA 3R11A 4MJ2A 4QG9A 1JUKA 2ZXQA 3DC0A 3LHZA 3LPFA 3DCPA 3FEQA 1JFHA 5CPSA 1EJ7L 1GG1A 4EOUA 4AX6A 3MCNA 3KOWA 1EP1A 3LBCA 1VFMA 4RZ6A 2ZX9A 1PVNA 4IH3A 4X9YA 3VVGA 4W85A 3FSUA 3N2XA 2PC8A 1XCFA 4J3ZA 4ECLA 2YBVA 1A5SA 1BQGA 7TAAA 1Y5WA 1YKWA 4C6QA 3N04A 2ZA1A 3WLHA 5SWUA 4QE1A 5FOOA 3F4DA 1UWUA 4KKXA 2F6UA 2CLEA 3AHZA 5D30A 4IP7A 4JN6A 4OBRA 1VBGA 2WLZA 4QDMA 3BAWA 4DPQA 3CL8A 4XISA 3NFUA 4WY0A 1W9XA 1UOKA 4PMJA 3VXGA 2E5DA 4DM1A 2WHLA 2X16A 2I9EA 5FESA 2VD8A 1HJXA 4HTBA 5ENLA 4DO7A 4KETA 4Z2IA 4U33A 1GKPA 1L8NA 3CIVA 3N3TA 4CNSA 1QAPA 4CQDA 1YTKA 1RHCA 1XUUA 1FKWA 2RJHA 4UZSA 2VZOA 2RUSA 3TC7A 1LBMA 3GM8A 1PZ2A 4B16A 3LN3A 2ZA2A 3QY6A 2Q02A 4O14A 4UFIA 1MO0A 5HMSA 2WBKA 4LF2A 2Y8VA 4CKQA 3L5AA 3AJ7A 3W00A 3THAA 2BXYA 2E8ZA 5JXQA 1EF2A 3CHDA 3WF3A 4ZSUA 3ARWA 4CU7A 2A3BA 4MWAE 3URQA 1HZYA 4DWSD 1GQIA 1F73A 1FCBA 3LK6A 5CZTA 2CLHA 1B2YA 4EACA 4ERAA 3L0NA 4BQ5A 1UUQA 2VR4A 2ZX7A 1FKXA 4AZ7A 3M0JA 1QDSA 5FACA 1XKJA 2DSKA 2W61A 1T0OA 4M1BA 2O7SA 3SUTA 3WN6A 3AXIA 2QVNA 1GJUA 3N2CA 3NTYA 3NYZA 3I3DA 1MZHA 1UD3A 3LGDA 3A9IA 3LCGA 5LNWA 4N02A 3SEPA 4I9TA 3BCFA 3VGFA 1VCGA 3W86A 5HR7A 1HX0A 3PZUA 4HSHA 5IBXC 3G1DA 4DVOA 2PDXA 3IK2A 5D9OA 1JUEA 3GUGA 2QCCA 3KCJA 2YL6A 1BXBA 1E3XA 3LSBA 1KLZA 3WY1A 4GI8A 1SYTA 3ZIZA 2PA6A 4M29A 5LHEA 1AQMA 5CQ1A 2OSYA 1BG9A 2EO7A 4QCEA 3IAQA 2CLFA 2NX1A 1E56A 1CXKA 3E9AA 2Q3RA 3RRXA 2OLAA 3O16A 3BLEA 1U5JA 1Q6RA 2HVMA 2J47A 3EOOA 1Q8JA 3DFPA 3UXIA 3TCEA 5BNKA 1NELA 4JTQA 1XGEA 1EBGA 3GG1A 4PBFA 3LYEA 3FJNA 3H21A 1A5CA 1XSJA 5H8PA 4Z2GA 2AMGA 2OODA 5XIMA 5A94A 3F4WA 4NJHA 4YXGA 4IFKA 3UWQA 1AH3A 4F79A 3SECA 3WH5A 3VPLA 3GFXA 4S38A 4NRSA 7REQA 4DRSA 2Z6JA 6CGTA 2CLIA 2PDWA 4K68A 3NQDA 4DNHA 1O6IA 1R2RA 3MB9A 3AYRA 4L61A 3C5QA 4Q32A 5ABHA 4LCQA 4JNYA 4ZENA 1S3HA 3C8NA 5TBOA 4CNOA 3R6IA 1PWLA 4WGXA 4BI7A 1OSEA 1E4NA 2ZUUA 3UJSA 5KZ6A 3U48A 1QPNA 4LRTA 1A49A 5DELA 3DYOA 4W9TA 4DO4A 4PCNA 4O0KA 3WQ8A 1I2QA 5AYXA 3A4AA 2XZ9A 3TQ0A 4JQ4A 5D2XA 4YPJA 1CX9A 1UH4A 3W88A 4YVPA 3WFLA 1VBUA 2IMRA 1BRLA 3VD9A 1VJZA 4UIOA 5LIUX 2JF6A 2YA2A 2XVNA 3CUXA 1E9LA 3GKAA 2BLEA 4CQBA 1Z44A 3FEMA 1Q6QA 1ZP4A 5I2UA 3EXTA 3PY2A 5E6YA 2PUZA 5T91A 2Z1KA 3W6MA 4XG1A 2DQXA 1R3WA 3MJYA 5CPMA 1Y5XA 3BW2A 3TJLA 4CNNA 4EWND 3FW6A 4M82A 3VIOA 4QX4A 3EA2A 3VIGA 2PWUA 3I4KA 4WR3A 3R10A 4YYFA 1EJTC 1M53A 3T1GA 3BE7A 4CN1A 5E0CA 2ZRYA 2OOFA 4JIHA 2HVNA 3NQ8A 5EMYA 3WDPP 3GIYA 1UWAA 2J7FA 1BFNA 4RLIA 3NAVA 2R82A 4GH3A 3SIMA 1ELSA 4YTTA 4O19A 1DIKA 3VUPA 1HGYA 2YCIX 5HUOA 5I77A 3NJ3A 2RJGA 5F2LA 4YJ5A 2C13A 3SI9A 1QPQA 1XIIA 1ZAIA 4ONVA 3M07A 1AODA 2XGIA 3W1NA 3DBNA 3WH9A 4XKYB 3H8AA 2QJGA 2R1KA 2FHFA 3ITXA 2VC9A 4ZQCA 3SN0A 1V6TA 1MQRA 3A21A 5AHFA 4W5UA 1M03A 2DZPA 3WENA 1OFQA 1XYFA 4D1IA 3RPDA 1KFJA 2E5CA 2AGKA 5IRPA 3LM3A 4Q4MA 3OHMB 2QUVA 1M41A 2EXOA 3M5ZA 4HVXA 3M0LA 4RDZA 3PTMA 2NQHA 1UR3M 1H5YA 1I0BA 3VNDA 4ROPA 1CXLA 1OF8A 3WK3A 3PZVA 1BF2A 4ACYA 3PJXA 4HD5A 7CGTA 3N13A 1U1HA 1WDRA 3Q4DA 3NL6A 1HIZA 3NQ2A 4KS0A 4ZVJA 3VE9A 2PDCA 3IJ8A 5C5YA 5LSMA 4DJFD 5DRCA 3GRIA 3TN5A 3VAVA 1A3XA 4O17A 1RUSA 4IGNA 5HBFA 2WMIA 3VGHA 3B4YA 3FX4A 5FAJA 2ALDA 3VFCA 3QF0A 3RFAA 5A6BD 4TR9A 3THQA 2PGRA 1UQZA 4YHEA 1GVOA 1RV8A 2CZ5A 2EF9A 3ITYA 2PBGA 1QNSA 4HMNA 2WZMA 1DJZA 3C2YA 2HEJA 3SCOA 1PTAA 3JS3A 4FX8A 4GYFA 6PTDA 1OX5A 2PCEA 2WJDA 4P61A 2VRKA 5IDZA 1GVRA 2VCAA 2ZE0A 4EXBA 1IEWA 2YLLA 1YXDA 3SCRA 1NARA 2NT0A 2OO0A 4EKJA 2DUAA 5DF0A 1I2RA 1S2CA 4QLKA 2NVDA 4MIMA 1EO5A 1JD9A 4GBUA 3S8HA 4UTUA 4QJ1A 3OVPA 3EPNA 3CXOA 4DPPA 2OWWA 4GISA 3WNOA 4K7VA 2WAGA 3M0YA 1T41A 5AC8A 1H7NA 3OBAA 4IZGA 2VX5A 5D4YA 4JX5A 3U3HA 2FH8A 3CV7A 4HTYA 4XWUA 3M16A 4IIDA 3AHYA 5I79A 3IJLA 4DLFA 5DRIA 3KBMA 2ZA3A 3P2VA 4PCPA 3V0SA 4DZ5A 4YVVA 2IPJA 2VP8A 6ALDA 1TVLA 3GR8A 2Z27A 2I5IA 2WC4A 3W02A 4HZ6A 1TTQA 4J7RA 1JQXA 4WJXA 4V2XA 1SW3A 5A95A 2QV4A 1FWJC 3RX2A 1JDDA 4YTRA 3TMQA 1ECEA 2I5QA 5HQEA 4MYAA 4BWLA 1QI0A 2VRJA 4JNZA 2BGSA 1AQFA 4KW2A 4JYFA 5KEZA 4CD8A 2WSRA 1OEPA 2YZ5A 4IMAA 1HNYA 3HPZA 4US6A 3HG5A 2OT0A 2XFYA 2PF8A 3V3WA 2NLIA 3IIZA 3L4WA 2PDNA 5RUBA 2WMGA 1H62A 3KCOA 4Q33A 3VCCA 3QYSA 1A5BA 4CQAA 4CCCA 3M0HA 3PAJA 2PLJA 4G7EB 1H09A 5LNRA 3BMVA 4WKHA 1KTBA 4JQ3A 1GZGA 1L2QA 3D0CA 4S3GA 5FCZA 1LUCB 1J0IA 2Y2WA 3LLDA 3MV01 2XN2A 3DFOA 3LCHA 1YIXA 3CMJA 3N73A 3IJ7A 3OA3A 2J75A 1WZLA 1BSIA 1XI3A 3HQPA 3EDDA 3VIPA 3W23A 1SO4A 5CG7A 3T81A 2Y85A 2C1IA 2X8RA 2OCZA 4PUWA 3P5ZA 1SFJA 2E3ZA 1V3MA 1LRNA 3R0UA 4GXPA 3G77A 3NR0A 3P14A 1SPQA 2VEKA 2ZRZA 3L4TA 1V93A 2ZRXA 1NOWA 1O60A 3H54A 3E74A 3T2QA 3BGGA 2QHAA 1ME8A 3N19B 2GJRA 1H1ZA 5AYYA 1CLVA 3POCA 4P7NA 2QW5A 2A1YA 2YXXA 3EXSA 1ODUA 3ZR5A 3DC8A 1F9CA 5CBBA 5A6LA 2VZUA 4LAKA 3GH5A 3QV7A 2ISFA 2E9LA 1JPMA 1SR9A 2W3ZA 4JIRA 1KXVA 4HHPA 4GABA 1B30A 3M5YA 4WVXA 4JHMA 4WDTA 2GJPA 3TH6A 2Y5JA 1D7FA 3DOPA 1KRAC 4AYGA 3IVTA 3OO2A 5J5DA 3LRKA 4JIPA 1UUOA 2CLMA 2IPWA 3NQ6A 4JYDA 4FNRA 3LNPA 3U2CA 1VJSA 4ZMGA 1W3TA 5C71A 2IS7A 1EPXA 4LBUA 4AC1X 1HKKA 4OVXA 2YDQA 1US3A 4QLLA 3TONA 3LGEA 3FS2A 4PC8A 2HROA 3IJIA 4BQ4A 4A8RA 2CLLA 4EF8A 2VENA 1Q65A 2ZZ6A 4OZOA 3VGEA 4F0MA 3TYDA 2PODA 5CPLA 2X2GA 2OKTA 1WAUA 1DQXA 4NI3A 3OVQA 2YCLB 4UNIA 1Z69A 3MUIA 3R89A 2D2OA 3UZ5A 4A2SA 1ONWA 1MMFA 4O1BA 2QV5A 3LTYA 4MY1A 3W2MA 1D8CA 4LQ1A 2QNEA 5J8LA 3TMLA 3KAOA 2YXOA 3W24A 3VDCA 3C0LA 1CI1A 3RAOA 4AD5A 3V0UA 2ZUSA 1FH8A 2J7BA 1RA0A 4JFUA 1YTDA 1LWJA 3E02A 5I24A 3QTGA 4NF7A 3MCMA 4FNQA 2XH0A 1GJPA 4O50A 4W8AA 4S3EA 3WQGA 4JD4A 5JIWA 4GINA 5CAHA 3E6EA 4HK7A 5IFTA 3TXVA 5A1AA 1NOUA 1Q6DA 4MWAA 3N4FA 3SCUA 3F2BA 2FTPA 4TTGA 2DUXA 1XIGA 1K9FA 1VYSX 1FWRA 1RVKA 4HCHA 4ATLA 3G1RA 1JDFA 2OX1A 2WMFA 2XVLA 1V02E 4C6JA 1VQTA 2SFPA 5LYRA 3WBAA 1SW0A 2V38A 1X8FA 5C54A 5G2HA 3TTQA 3UP8A 2ZIDA 4WOZA 2NQJA 1XYZA 2FVLA 3GHTA 4JTIA 4S2CA 3ES8A 1K3UA 1H0GA 4UQBA 2V2CA 4C6CA 5AC7A 5BWAA 4PN2A 1R3YA 1ZNNA 3GG7A 4W93A 1REQB 1X96A 4K3ZA 5BZAA 4M6UA 1LLZA 3GXNA 2DQWA 4JCLA 3VNYA 1E40A 7PTDA 3NPUA 1EEPA 4AYSA 4UTWC 1UR1A 3OVGA 4HQVA 2WJEA 1HN1A 2V5CA 2TPSA 4NNBA 2YKKA 3AXMA 1H7OA 1WUEA 1CNVA 4XAYA 2DIKA 3M1ZA 3OLIA 1VH7A 1VRXA 3AAMA 2ZUWA 4JQAA 1C29A 2E5BA 1NP0A 3VNJA 3TLLA 1NAL1 5PTDA 1DP0A 3QBUA 3KEHA 3PBWA 2DZVA 4I8DA 1FXPA 2W63A 1KC7A 1IEXA 3V75A 4J3WA 1TV3A 1SJDA 4AG0A 3BVJA 4QSHA 1DHPA 2OLSA 4DWSA 3N6QA 4J3XA 4D9PA 3TYAA 4NXSA 4OFCA 4QHRA 2VL4A 1P0NA 4UOQA 3VMNA 3KP1A 4LC8A 1A5KC 3SY8A 1F07A 4KPLA 3IV8A 3K46A 1J0YA 4NASA 2DZTA 2W62A 1B4KA 3LGGA 4D8LA 5C7VA 3WQ5A 1D7KA 3OZOA 1UR9A 4R85A 3E1F1 3ZR4A 3NCOA 1H61A 1RXOB 4HZ7A 2RKXA 4O57A 4MLRA 3KCLA 2A3CA 1EB3A 3EBVA 5EMMA 2PDYA 3W1XA 2ZZ7A 3KVLA 1Z8AA 1W91A 2ZTKA 4L5ZA 4WZHA 2G97A 3ID7A 1N8FA 3RX4A 1V0KA 3W7HA 2WV8A 3VM5A 1HO1A 4U3CA 3T78A 3FA4A 3R0KA 1ADOA 3F4VA 4OBSA 4XSMA 4RR4A 3RMJA 1UZDA 5KSWA 3A3WA 1HL9A 4Q8QA 1QOQA 5A6AA 1VIWA 4O16A 3P60A 4NZ5A 2EPMX 3QFWA 2YZRA 5K2ZA 2VNCA 1R8LA 5FEWA 1JF5A 1O4UA 3J7HA 1RBLA 1UD4A 4XZBA 1OADA 1KM3A 2JEQA 2C3ZA 4CU8A 4DJED 5HANA 1G01A 1XIEA 4HA4A 1F4AA 1KQZA 1OIFA 1JCTA 4O1AA 3LQGA 1A50A 2GYIA 5AHIA 1L6YA 2DORA 2YPIA 3KHJA 4W84A 1ZBWA 5KZDA 4UTTC 5FF4A 4J5NA 4IPIA 4KFPA 4Q3MA 3TNBA 2O4MA 3HURA 5DMLA 3ZT6A 2ICSA 1LBLA 3VD4A 4LF1A 3O05A 4A29A 2FDSA 3CK5A 1QWGA 4M81A 1Q2RA 3WH8A 1B9ZA 4UTKA 4HOWA 3N3MA 4P7RA 3UGVA 4MADA 1KB3A 1LF1A 4DF0A 3THUA 2XU2A 1JL8A 5G2WA 2FDMA 1UD2A 2PWGA 1ISZA 1JZ7A 5I00A 3HJEA 1W0MA 3QPEA 3F5JA 4MF4A 1QI3A 3AU6A 3UCDA 4MDOA 3U5YA 3B03A 2PZNA 4XAPA 3GO2A 2VR2A 3R2GA 1AD4A 1SO3A 1OB0A 5EPDA 3WDJA 3UBPC 3RK8A 4XO7A 4RV8A 2XIIA 3TN3A 4C6DA 4N4QA 4OTKA 3UR2A 2DIJA 4JN7A 4KWWA 1AFSA 1H50A 1B57A 2Z2UA 1FWHC 4F48A 1TFVA 1EOMA 3L68A 3L65A 2O7QA 3BV7A 3HFTA 1RP8A 4B90A 1B3ZA 1B5TA 2HXTA 4MAZA 2JKEA 3UXKA 3ZLHA 1ICSA 2HV5A 2ABAA 2Z29A 2BHUA 3SQSA 1VCVA 5ABTA 1DWGM 1BYDA 4ZFMA 3WO8A 2RDXA 1JGIA 3RCNA 1B90A 3DECA 3PBUA 3CQIA 5I06A 1ZJHA 1PHWA 4Z17A 1VFTA 2G3JA 4H01A 1RK6A 3WJXA 4NIRA 2QVHA 3BOLA 4QROA 4ZB0A 4MB1A 5CXPA 4I90A 4L7ZA 3VK5A 4PUNA 1TE1A 1PCWA 3AIRA 1W3KA 3TP4A 4IGHA 4CU6A 1GQLA 2GUUA 2DU2A 2WJFA 1LOLA 1H1NA 1PYMA 1J96A 4Q4SA 2VFEA 1HJSA 1B3VA 5BRBA 1J10A 1V8EA 2VCCA 4PMXA 3ORWA 1VD6A 4AXNA 2BGQA 3PBYA 1PDZA 4EIVA 4DBWA 4M0XA 3HGSA 4DJDD 4DO5A 4GCXA 3T4WA 5EMKA 3T0AA 3OZYA 3G1HA 3GK0A 3N6JA 5M3WA 2FYMA 4QG6A 1QNOA 1DJXA 7XIMA 4KRUA 3GC2A 3N25A 2J7CA 4DBEA 2VGIA 4MZ8A 4QS5A 2IW0A 3MMWA 3M7WA 4L4LA 5I02A 1QFEA 2HJPA 1TYGA 5FL0A 3E5PA 3WDRA 1S5WA 2HPIA 3LNMA 2HISA 1X1NA 4ASTA 3ZYZA 4DZHA 2PC4A 4V15A 4M3PA 2R1PA 2Y89A 3GX9A 3F2DA 4AZCA 3CHCA 4E6MA 3W37A 1XKYA 3UWYA 3WJSA 4DJFA 4PRTA 3VCNA 2J7DA 1EQPA 1ZZMA 2Z1XA 3W7GA 1W31A 1GOWA 4F0HA 1AL7A 2NVAA 1I9CB 2JIEA 4ZQMA 3S6DA 1EJUC 4HHLA 3W71A 4Z2KA 4NKCA 1YBQA 2GVYA 4MKSA 1K8CA 1DWIM 2ZZ2A 3AFBA 4PYSA 3CHEA 4IJCA 3LHWA 4GRSA 5CZKA 7ODCA 4MB5A 5E0FA 5AB3A 1XLBA 4RX0A 4GYPA 5KZEA 3W72A 4LT9A 1FH9A 1EJXC 2ZE3A 1JRCA 4IFOA 5CSYA 3UPWA 4MGGA 1QW8A 3GE7A 1XRTA 2WLYA 2XYLA 3ZT7A 3S6OA 4OU1A 1XX1A 3QMSA 1UKOA 4H9ZA 1LBFA 2CESA 2C1HA 1YEYA 3REQB 1UB3A 2E1DA 3DFYA 2JIWA 2R9RA 3BSHA 4CUCA 3CWOX 4JTSA 1E5NA 1XLIA 3ZLGA 4MUZA 4F40A 3LD5A 4TX6A 1PJ9A 1V77A 4MKVA 1O66A 5MKGA 4GG9A 2VFFA 3M0VA 1C9WA 4FNUA 3KFTA 4P7LA 3PM6A 3AIQA 1E5JA 2VOTA 3KLKA 4B2DD 4A35A 5LIYX 1XBXA 1OD0A 4JTCA 1WOBA 1ONEA 3O0FA 2IXVA 1SSDA 1TV7A 2BTMA 1UROA 1XC4A 4UMAA 1P6BA 1XIFA 1ZALA 3WNMA 1EKOA 2XIOA 2RAGA 2ZYFA 3B06A 5LNVA 3MO4A 1US2A 5T26A 5G4HC 2QCNA 1KV5A 4EXQA 4RE0A 4IL2A 1PWMA 1KXHA 2ZZ1A 2WNQA 1EUAA 2XGBA 2BVWA 4Q8WA 3ZWSA 3UWVA 3W38A 4HPHA 3CLMA 1UBPC 3PZGA 4UUIA 4O15A 2GLKA 2EG8A 3W7CA 4MB4A 1ALDA 4OECA 1MQQA 4K39A 2PDMA 4QR6A 1A5OC 2FPTA 5IOBA 1GVEA 4GI6A 3OU8A 4F0KA 4MB3A 2V9DA 4LCSA 1QT1A 4LS1A 3VKJA 3OEXA 3QGVA 2Q01A 3TZNA 3A22A 3WNNA 1RVGA 3AS1A 2ZZ4A 1E9YB 4C6BA 4Y7EA 1S5MA 3BGAA 4RJEA 2ZVIA 3UW6A 4Z1AA 4WDXA 2JKPA 3P5YA 4UB9A 4RL3A 1OFPA 3V5OA 1ZHAA 4I5UA 2J74A 1UKQA 3DFNA 4ACZA 4FEZA 3C2OA 3Q94A 1I75A 3VNIA 3B8SA 4IIHA 4ZFCA 3C86A 3QEZA 3FJLA 4LY4A 4IPLA 2V2HA 5FKYA 1AH4A 3GVRA 4J2PA 4JX4A 3ES7A 3GHUA 1SU5A 1EYEA 3H2EA 4IP4A 4LALA 4WGHA 4XZLX 2TYSA 3LRLA 3MI3A 3SCQA 4LRSA 3DESA 2J77A 3F5KA 5DCBA 1KD0A 2RGMA 1ICPA 3I3EA 1TR9A 3NO5A 2PI6A 1P1MA 4KEUA 2QPSA 3BW3A 1KFEA 1ZY9A 2KX9A 3CPGA 4EPBC 5C6MA 1XYAA 1A0EA 3M43A 3MP4A 2J7EA 1Z3NA 1FWFC 5CGTA 3SQLA 3DDMA 2WC7A 4F0LA 2QCDA 8A3HA 4L4OA 4KWOA 4WJEA 1QRQA 1K6WA 3VZXA 2DSVA 4S39A 3WMSA 2XFFA 3WQCA 2Y7FA 3M9YA 2ZWYA 5CPQA 1HKJA 1WE5A 3ITGA 4NZJA 1B0IA 2FFIA 2YX0A 2Y5SA 2CKRA 3QXBA 4A3YA 3DUGA 2CC0A 3NNTA 3EWBX 4GUIA 3MO7A 4LUYA 5D2WA 3BAJA 1HJQA 4U4MA 2JBMA 4W7WA 1UWTA 1VCFA 2YR1A 3PAOA 1DJWA 1TA3A 3SCVA 1CZ1A 5HWMA 2GFTA 2XISA 1PZ1A 4JTRA 1XH0A 2E6AA 2Z25A 1TKKA 3B8UA 1R9ZA 3IJ9A 3V4BA 3SRDA 3H2CA 1W9PA 3WBYA 2E09A 3P0XA 1DORA 1VLIA 1B54A 1XISA 1KBKA 2W0UA 4ZE5A 1C7SA 5BU9A 3NPWA 1SO6A 1ZBCA 5REQB 1SW7A 1VFOA 1XCXA 2HBXA 2FZ9A 3HMJG 4AX7A 4UWMA 1UPPA 3C0SA 5BXRA 4UMBA 2W79A 1GEHA 3W2JA 1PX4A 1JF6A 2VM8A 2VDIA 4NAFA 3AWOA 4QCFA 1J4EA 2YSWA 3W7JA 3MKKA 2PP0A 3B97A 1FOBA 1VPXA 4RDYA 3AZSA 2VX6A 3NL2A 4FA3A 4XIMA 4AD1A 1E4LA 1NWRA 4K8GA 3EOLA 1QW7A 2V3FA 4AZ5A 1DKWA 2EHHA 3EWCA 3MBFA 4HMCA 1NDWA 2XH4A 4B92A 4JOMA 1EIBA 1JNDA 1W3NA 2D2HA 1K6AA 1Y7VA 3KTCA 2HNEA 2PD9A 4RK8A 4AUBA 3T09A 1AK5A 2CETA 3CZGA 1K03A 4IJBA 4IXXA 4LB3A 1MEIA 3HQ1A 1R86A 2QF7A 3M0MA 2YCEA 1F4HA 2UV8G 4MOZA 1CGYA 4UTIA 4YTSA 1ZB5A 1C9DA 4GC4A 3LCLA 3HG3A 1HT6A 3INPA 1PTGA 4DUXA 3O7UA 4AY7A 1MUMA 3LCFA 3HJZA 3VGGA 3ZVHB 3BZGA 5GVJA 2VGGA 3UWWA 4U28A 3URBA 4K1GA 2EJ1A 2PGEA 3WEZA 3GC5A 1MW2A 2GSHA 5HUPA 1TIWA 3QGAC 2BODX 2C16A 2ZZ5A 1KGXA 1TUFA 2GVLA 2BASA 4PMOA 3GTNA 2MUCA 4DNMA 1MXSA 3S1UA 3GUWA 3EMCA 3VIKA 5M2FX 4H8NA 1S2AA 2J9XA 4OV4A 2FLIA 4IIFA 5J5RA 5G2IA 2OSXA 1DWAM 2WVTA 1XH1A 2DVUA 2FTYA 3OZMA 2PZ0A 3I6EA 5CC5A 3FKKA 2R94A 1TWWA 3PPFA 4LVGA 2X40A 5CPTA 3P93A 2YDSA 1RK5A 4LBRA 2TSYA 5GQBA 3CUGA 1SJCA 1SUXA 3APGA 2NUYA 1EX5A 4H7ZA 1R87A 5DFAA 1E0VA 4LPCA 4JFVA 5JUVA 3BPWA 1Q5MA 4H9YA 1QI2A 4IMGA 3SJNA 4US5D 3BZJA 4A8LA 4D6FA 1E15A 1UG6A 3DHFA 5L9FA 1IXOA 3PUOA 1JGMA 2Y1HA 4R33A 3V16A 2CITA 3IIOA 3LXCA 4O28A 1GYMA 3WG6A 5KTLA 5D33A 1WXYA 3IPWA 5H6HA 3PWGA 2QUMA 1XG4A 1PEZA 1VC4A 1EGVA 3IGSA 1CXHA 1IXPA 1FWDC 1GJWA 4L1GA 3GKFA 4LAZA 1H0IA 1YYAA 2BHZA 4GPNA 3ARRA 2GGHA 4J9JA 5BW6A 1QHOA 4WF7A 1JDAA 4E8GA 2GGIA 1CXFA 3AS0A 2C6QA 4CVUA 4YNGA 1R3QA 4AC7C 1GVQA 1CPUA 3WLOA 2AKMA 3LXAA 1OHLA 5I3IA 4DJEA 4E38A 3B9OA 4QJ3B 2YFOA 4AEOA 2VRQA 1QR7A 3IARA 1UMLA 3RCYA 1TE6A 1TJ1A 5JVLA 3VA8A 2XJ7A 2CBVA 4DYKA 3MUAA 2V67A 2PDKA 4IG2B 3KWXA 3H2NA 2F6KA 2R1NA 2RDWA 3HU7A 2Q8XA 5IBXA 3B0VC 1HW6A 3M0ZA 4HNOA 1UBSA 1WOAA 1HKMA 1ODZA 4MZYA 5CZ0A 3BGJA 4ZZ9A 4JTHA 2ON3A 5A3HA 4B4FA 4TQTA 1LORA 2QUTA 4H9UA 3I7SA 4PTMA 2VX4A 4LWWA 4JBRA 5A8MA 3VABA 3CAQA 3LPPA 4NZCA 5GJPA 1IV8A 1RA5A 5ABFA 1XIHA 2VEGA 4PMRA 5C0QA 2ACSA 1XLJA 3TSBA 3DYPA 4A6GA 4DQWA 1Q6OA 2OFJA 4OKDA 4UFMA 2C14A 3S0CA 3MKCA 3DN5A 2V3EA 4FLSA 4KRTA 4S3FA 3SGUA 1AW5A 3LHTA 2WW5A 2XGZA 3LUTA 2DV0A 1JEZA 1L2UA 5A6KA 4I7WA 3UG5A 3XINA 2VR5A 1LOSA 4GIAA 1T5AA 3MSYA 1UR0A 4UOJA 4JZ5A 2WMHA 4FOUA 1YQ2A 4HNCA 4Y9PA 4MSSA 5HNRA 4S3BA 3C0JA 1XL9A 3Q67A 1ITXA 2G41A 3OOQA 5D03A 2DVTA 3ITTA 1DWFM 3ICJA 3OVRA 3FN9A 2B7QA 2V63A 1S46A 1TJ2A 3GH7A 2PEVA 4YS1A 3GNOA 3WNPA 2P8BA 2PDFA 3WYZA 4ERIA 3AWNA 1NF7A 4F3HA 2PTDA 4GVFA 3RM8A 1P0KA 1TX0A 4KCTA 3IIXA 2PDBA 1TO3A 3QLLA 4DBSA 1P6CA 4IPNB 4ZB2A 5CSUA 4LUTB 1J93A 3KHDA 3F4NA 4UFHA 1BTMA 2DH3A 1TV8A 4KBXA 3H4WA 5E93A 3CMFA 1GWJA 2RGLA 2W5FA 3O2LA 2NQLA 3DI0A 1GQNA 5FL1A 3LQLA 3PZMA 4TVUA 3VMPA 5CC7A 1FWAC 3RCMA 1FP9A 2XM2A 1DPMA 1YPFA 5LXXA 2HXUA 4IWWA 1S2TA 4FK9A 3WDQA 4AU0A 1W2VA 4OJYA 1Z48A 4K8EA 2BY2A 1TCMA 3AS2A 1RBOB 5T8GA 1J2WA 2FHBA 1F6YA 3AOFA 1T8XA 1S38A 4DJDA 1XC6A 5DCEA 2AKZA 1Q85A 3CIXA 5AHEA 1I2NA 2VD9A 2UBPC 3TSDA 4M24A 3TKFA 4EWJA 3K1GA 1EP3A 1Q6CA 2H3DA 4GGHA 4GZEA 1EJSC 2E6YA 4PUUA 5JIPA 1F3EA 4O1DA 1UC5A 2Y61A 3DI1A 3HV9A 5C8BB 3WQWA 2A85A 3SY1A 1SSGA 4PUKA 3K1DA 3V5CA 1O1HA 3V5FA 1H7WA 4F2BA 3TEVA 1E9IA 4LANA 3KBNA 5HWNA 4OUIA 4M19A 3U57A 4GY0A 1H2JA 4U2YA 2J4GA 4LVDA 1W3IA 1H41A 1QCWA 1DIEA 3W26A 3AYTA 3WLPA 4G1KA 1UYQA 3FAXA 1UKTA 1QNPA 1NWTA 3LPOA 2Y7DA 1EIXA 4QRNA 4AD0A 4C7FA 3I7QA 4H6QA 1QXLA 2WPGA 1JG9A 1M7PA 1KV8A 5CAKA 1VFFA 2DW6A 3CQJA 1W9BM 5AY7A 1MUCA 3LU2A 3JUGA 1LLWA 1ZJBA 3RJYA 1FTXA 3O6YX 1M65A 3DIPA 3ARTA 4I3GA 4RKAA 1UW9A 3GC4A 4V1XA 4AWEA 4ROQA 1H3GA 1A4MA 1XSIA 2PLMA 4UNKA 1E0UA 2Q8LA 3TTSA 3TW7A 4GUGA 3P6LA 4AZHA 2QIIA 3W7DA 3CQHA 3G0UA 2FB3A 3T2PA 3RXZA 2XIMA 1OT2A 3WUGA 4BJHA 4FX6M 4Q8TA 3IWPA 3I65A 3W7KA 4ZODA 1MZRA 3AJXA 1JPHA 3TAKA 4XKYA 1CLXA 3KOFA 4HA1A 1PKLA 1PX8A 1PZ3A 5TNVA 3VCRA 2OTDA 2I57A 3B0XA 4IIGA 3NWRA 2B4GA 2YYTA 2Z7KA 4FXRA 3GVVA 2ZC8A 4WDUA 1TTPA 3VX0A 3S2JA 2UWFA 4IFKB 2GGJA 1MYRA 1SJAA 1XFCA 4V27A 2NZLA 2O9PA 3BG9A 1VEPA 1FWNA 4PODA 4DUOA 2Z6IA 4NSBA 3NXLA 4GD0A 3U2OA 1PZ0A 2OPJA 1X39A 3ARYA 3KOZA 2VC6A 4PUJA 2NXIA 4GNKB 4GX9A 1LQ2A 4DB7A 2QJJA 4EAYA 2VO5A 5CJ5A 1R3SA 3V1HA 1A5AA 5AHMA 5KETA 1QHZA 1XLFA