2QCEA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to sulfate, glycerol, and chloride
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qceA00
2Y7EA 4XWUA 4FIRA 4B5NA 4BI6A 3GNNA 2FPTA 3Q94A 1I2RA 3QC3A 2YW3A 1H7WA 2AGKA 2B4GA 1J4EA 4JY8A 1Q6QA 3H55A 4UCGA 1ZENA 1A53A 3IIXA 3ZR4A 3MUXA 2I9EA 1A50A 5HWJA 1Z48A 1SW0A 2CFFA 2R94A 5TIMA 4N9BA 4O1BA 3EWZA 3DZ1A 2EGZA 4UMCA 1HUVA 4OV9A 5AHLA 4DF1A 5CZ0A 3B0VC 3F1QA 3TROA 4QNWA 3TMLA 4K37A 5CZSA 2H6RA 1EPXA 4Z1CA 4M7TA 2AAMA 1TYGA 3W23A 3O06A 2QCEA 4UTHA 1W5MA 5LNSA 3THAA 3BGJA 4MKNA 4K7YA 1P0NA 1GVFA 3MBFA 4LS2A 1JQXA 5EMUA 4HNTA 5DCEA 1PVNA 1TREA 1JCJA 4NJIA 4ZL1A 3M1ZA 5G4EA 1R2SA 1TPH1 2F7FA 3DH7A 1GVOA 4YLWA 1VHCA 1DV7A 3WJWA 4GUIA 4OV4A 3QEZA 3W7LA 1W5OA 2ZZ6A 3BLFA 3IVUA 3STGA 1H5YA 3NPVA 3R2GA 2RDUA 1GEQA 1H51A 1XBZA 1W5NA 3WK0A 4NNCA 3W75A 3W7KA 4JYDA 1OFBA 4NX5A 1G6CA 4MY1A 5U7SA 3GR7A 4O0KA 3BGGA 1XCFA 2X1UA 1O4UA 4FNSA 1ZAHA 3NQ8A 3EXTA 3QPZA 4GWEA 3TDFA 4QM1A 4AHPA 2NXGA 1AW1A 1BTMA 3MI6A 5AN7A 1VYRA 3L21A 1H60A 2DZPA 2R8WA 3HGSA 1FDJA 3PVFA 3L0KA 4EF9A 3TJLA 4AWUA 2A7NA 4JICA 4WY0B 5LKYA 3HPXA 2BX7A 3N19B 2DU2A 3QMRA 1R30A 4PFMA 4QISA 4LS1A 5HQEA 3F4WA 1EA0A 3RU6A 1ICQA 4JTUA 4FXSA 2RFGA 4I7WA 1PIIA 3LV5A 4LU0A 3STEA 4D2JA 6TIMA 4NU7A 4EOUA 1KTNA 4HNUA 4MVAA 5MHBA 3LV6A 4LWWA 1IXPA 4O53A 4WOQA 2V5BA 2ZRZA 3E02A 3GIYA 1F5ZA 2WNNA 2W6RA 2GJNA 2Z0IA 3W83A 4MFDA 4OU1A 3W1RA 1WDWA 1ICPA 2H3BA 1NSJA 5AOUA 1SFJA 1VS1A 3WJZA 4AHQA 1XBXA 2ISVA 3GXPA 1EB3A 1S5VA 4FEZA 2A85A 2Y7DA 4WJEA 3C8FA 4CCDA 4Q32A 4WUIA 2YDAA 1KM0A 3OEXA 2O7SA 3A21A 3FOKA 5K7JA 4MY8A 3TC6A 4GUGA 4AF0B 2FPVA 3G0SA 4AEOA 1K3UA 4GFSA 4OE7A 4IJBA 3S42A 1UASA 3MWAA 2ZA3A 2QUTA 1OVDA 2B0MA 3MI3A 5HMSA 1I8JA 3PB0A 3PUOA 1QOQA 3IIZA 2E5CA 1XC4A 2BLEA 5D2WA 2J6XA 3R5EA 1FDZA 1A5SA 1C9DA 4IXHA 3W85A 4JTJA 1RV8A 1EWEA 3KX6A 1TO3A 5DCBA 4K8EA 2J9YA 2V2CA 2WO5A 2Y89A 4RXGA 1JCLA 4ZQCA 4IX0A 1TB3A 4LW7A 4NZFA 4CNPA 4GNJA 1LBLA 4LVBA 1M5WA 2ZDRA 1FXPA 2ZQ0A 3P80A 1UUOA 4RK8A 2WSYA 4CLMA 4X22A 2VXNA 1KTBA 4DF2A 4IXXA 4JD4A 3AJXA 3SGUA 2ZFAA 4P2VA 2RKXA 1PL9A 3GLCA 1KA9F 5EA9A 1OG0A 2QCDB 3NQ6A 5CPNA 1B57A 2VOMA 4O12A 2QCCA 1AL7A 2Y6ZA 2ZCGA 3TUUA 1NEYA 4E2DA 3W1UA 2V30A 3L2IA 3OBKA 1K8YA 2A4AA 4W9TA 2V9DA 5CG7A 3TE9A 2OCZA 2TPSA 5CSRA 2Y7GA 3C2VA 3ELFA 4FNQA 3E96A 5H2ZA 1J5TA 1KM1A 1RPXA 2D73A 3EWXA 2WNZA 4WY0A 3B4UA 4FX8A 1QAPA 4UTLA 3SW6A 2UV8G 3P81A 1I2NA 3M43A 3PBWA 3RFAA 3TQ0A 2C16A 5EBUA 2WSQA 4NNAA 4FF7A 3ABOA 4M6QA 3PG8A 3TW7A 4HT3A 1SO6A 1GOXA 3EWBX 3QM3A 1G4EA 3O8AA 1XBVA 3CIXA 3PG9A 1SPQA 2Y61A 4JX5A 1KFKA 1VH7A 3CT7A 3N34A 4BF9A 1TIMA 3HPZA 3S1WA 4N9EA 4O52A 1F6PA 5F1VA 1YDOA 3C2RA 5H91A 1KV5A 3NPWA 1EEPA 1F2JA 1MEWA 4LRSA 2R14A 3NPXA 3G1HA 3BW3A 1LCOA 5K3VA 5LZLA 2A5HA 1XUUA 1QPQA 4AB4A 2CZ5A 5HUOA 1LRNA 4JR5A 4UTKA 3M47A 3IIOA 3LM7A 4QQ3A 3S5NA 3KOFA 3GVGA 4UTWC 4IPJA 4KWWA 1A5BA 4AF0A 3P82A 3HF3A 3PWAA 1K7FA 1M7OA 2PRHA 3G24A 1NF7A 3IGUA 2NZLA 1OK4A 3A5FA 3Q37A 4QITA 3RLVA 1ZY9A 4AHOA 3VFLA 5FF4A 1Q3NA 2EF9A 3W2NA 1FXQA 1ZAIA 4RXFA 3KFTA 3HQ1A 3DU0A 1GYNA 3QW3A 5IBXC 4CCEA 3W70A 4MJZA 1XBYA 5F1UA 1EP2A 1H63A 1VYPX 4LC6A 4MOZA 3EX3A 1OFEA 2JGQA 2ZZ5A 2VFGA 4YCPA 3THQA 2AQWA 4TR9A 3QSTA 4O4VA 4BWLA 3UWZA 2YPIA 4ICNA 1ME7A 1KFLA 1PS9A 3SFKA 3NG3A 1YDVA 5T26A 1Y0EA 5G2IA 3KXQA 3W2JA 2VFDA 4DO5A 5D30A 1LROA 3T40A 2QCDA 2VFFA 3L68A 5LNWA 3N2MA 2WJZA 3DI0A 4A3UA 1FWWA 5IM51 2E6DA 2A7RA 3MMTA 4WY0F 4JN6A 1M7PA 2DZTA 1IXQA 5K9XA 2VEKA 5E93A 3E0IA 1HFBA 2BWGA 1T99A 4Q33A 2I14A 3PY2A 3U6WA 4JIQA 4GRSA 3W6YA 5D32A 3UXDA 5D2TA 1GVRA 1KTCA 3IEBA 5BOOA 5LHFA 1D9EA 2WOQA 2E6YA 2C15A 2C1HA 4FX6M 3M5YA 1ME8A 3B8DA 1K7EA 1IXNA 5D2XA 1RR2A 4ZMGA 2NX3A 2JK2A 3TIMA 3S5OA 1JUKA 1VPXA 5AB3A 4O0ZA 5FESA 4BFAA 5EYWA 1B4EA 3LTPA 1OHLA 1FWSA 2Y88A 4IMGA 1LOQA 4PH6A 1WX0A 5G2WA 1FCUA 3FYPA 4HNNA 1G69A 1KM4A 4XQ6A 2Y85A 4BI7A 1DQXA 4MLJA 4JXCA 1JRCA 1WBHA 1IGSA 4O13A 3SI9A 2DORA 2A21A 3LDVA 5C55A 4UTTA 4FIQA 4UMBA 3CQ0A 5BW6A 3TV8A 4MYAA 1M6JA 5HINA 1TSIA 4Y96A 3SJ3A 4DBDA 2QDGA 1L6YA 4R53A 3TXVA 3N9SA 5FEWA 1SZEA 2DZWA 4JTKA 2JKPA 3CLMA 3G1YA 3YPIA 2Z6IA 4I7VA 1OK6A 2EKCA 2YZRA 4AMAA 1F76A 4MZ1A 5KZMA 4EVZA 3SECA 4A22A 3HB9A 1T0OA 1KBJA 2ZTJA 1V7YA 4K39A 2QJGA 2YYTA 1W8SA 3A22A 5AYYA 2Y63A 3NOEA 3SZ8A 3UWWA 2ISSA 5SWUA 4JYFA 3W86A 3S5YA 4UIOA 1RVGA 4DO6A 1H7XA 2A1YA 3NQDA 3F4NA 3G0UA 3EWUA 3W1PA 4UFJA 2GUUA 1WOBA 2E77A 3TMQA 3G1FA 1K03A 3DHDA 1R46A 2PE4A 2C14A 2NX1A 1G67A 3M5XA 3L65A 1XM3A 4EWND 3P5YA 3O05A 3KAOA 3NL2A 1ML1A 2BSLA 3UZ5A 3QMSA 3W1AA 4N4PA 1WXJA 5LGZA 4UTMA 5CKSA 4DPQA 3W2LA 2XN2A 3FA5A 3IV3A 1CW2A 3IRDA 3M9YA 5DN1A 3W87A 2QJIA 3W7EA 1IF2A 3E49A 3W1QA 1K8ZA 3A24A 2QJHA 3EKZA 2QCLA 3VKJA 4CCCA 1LOLA 1XL9A 2C19A 3P5ZA 4LVAA 5FEPA 1SR9A 4DBEA 3M16A 3IVSA 4UFIA 2E68A 2QKFA 3LCHA 5DBTA 2VFHA 4UNLA 5F4WA 4I9AA 3LHVA 3EWYA 1EP3A 1W5PA 3TQVA 4H4IA 1QOPA 4YWIA 5CPLA 1KLZA 4NJGA 3WFAA 3HGRA 1W54A 1KM3A 2EPHA 1QNVA 1G4SA 4O1CA 1O5KA 3W7PA 3MI2A 2E1DA 3S1UA 3G3DA 3N73A 3W2KA 2RH9A 1VCFA 5EL1A 1J2WA 3EX4A 4PODA 1O60A 4JTFA 1Z42A 4JTTA 1FCQA 5HR7A 1KV8A 2ZRYA 3C6CA 4R33A 4RR4A 3KHJA 3EB2A 1I2PA 5F2IA 2CLEA 3KVMA 3NQAA 3N14A 1YYAA 2P1FA 3GDTA 4Z1DA 2WSRA 2YR1A 3OIXA 5GVJA 2V5LA 3TNOA 3WK3A 1ICSA 1RQBA 1Q6LA 1TPFA 3MJYA 2Y70A 1FX6A 1MSSA 3GDMA 2C18A 3SGZA 3PBUA 1F05A 5AHNA 5DY3A 3DFSA 4DEFA 3TFCA 5TBOA 3T78A 2Z2UA 4WD0A 4ZZ9A 3NL6A 1T8XA 1VGAA 4FX7A 4O16A 1W3IA 4JTSA 4K7VA 2ZA2A 3UQNA 4G1KA 4XZ9A 5CZTA 3VNDA 1ZFJA 2ZZ3A 4AH7A 1YADA 4JTGA 2OT1A 4NZJA 1Q6OA 3NEVA 4M5PA 1GTEA 2HS6A 1FWNA 3W73A 1A5AA 1OFAA 2QCGA 5KZEA 2HSAA 3FIGA 4IMFA 1QPOA 1OX5A 3OA3A 1PHWA 1LTDA 2CW6A 4LVFA 3GAKA 3W7QA 4JGDA 1GYLA 3HPSA 1OF8A 4NNBA 1JUBA 1QPRA 3NM3A 4IGHA 4LRTA 2ABAA 3P8IA 4R34A 2FJKA 2Z6JA 1BWLA 1TPUA 2CLFA 1TTPA 1WAUA 5I3GA 2F84A 1GVQA 2ZYFA 1ZHAA 1OFOA 5F2GA 3NDOA 4KKXA 1VLWA 3LCFA 3RLUA 4JS3A 5D05A 3TK7A 4ZQNA 1AL8A 3KVKA 1TRDA 2ZZ7A 2R91A 5I3IA 2WKJA 2ZZ2A 3W7NA 2H8ZA 1UUMA 3VE7A 5J5RA 3CTLA 3W7CA 3W7GA 3DKLA 2ATMA 4GE8A 1MZHA 3JS3A 5J5DA 2DP3A 5DBUA 2VEIA 3PBYA 3ABRA 1F7BA 2IQTA 2ZTKA 2NV1A 3QH2A 1DKWA 2E09A 1H7RA 3AO0A 1AW2A 4WXYA 3TSMA 3GAYA 2H3DA 1XI3A 2J9ZA 4MZ8A 1H50A 1ZNNA 8TIMA 5BRBA 1TPDA 1NAL1 4ZQMA 4GUJA 4E2BA 3SSJA 3GKFA 3O15A 2NWRA 3P7YA 3SY5A 1NVMA 3QW4B 4FNUA 2V2DA 1RQEA 3QF0A 1QCWA 3ANYA 1LLWA 1NF0A 3EX2A 2GPTA 2TYSA 5F4SA 4JIPA 3W1TA 3FYOA 1R2RA 4MUZA 5F4XA 3ABQA 4RX0A 3LHWA 2ZZ4A 1L2UA 4O8RA 4WZHA 4ONVA 3CM4A 1TTIA 4XKYB 4Y9AA 1OYBA 4AXKA 4O14A 5CPOA 5KINA 1HTIA 3HGJA 3IGSA 4MIMA 1X1ZA 4HPXA 3USBA 2QCNA 1VLIA 3C3NA 2OJPA 4O19A 5K2ZA 1TPB1 3TQKA 3STFA 4UC5A 4WX2A 4J9JA 4Q4KA 3W74A 3L67A 5L6UA 3LCGA 2G95A 1OYAA 5CPMA 2QEZA 2NWSA 3GXNA 3G1SA 2ABBA 4LY8A 5AFDA 3N2XA 3R12A 3QQ0A 3QYQA 4YMZA 3W7RA 3C4UA 5AHFA 3QZEA 4ZQOA 2HS8A 3N3MA 4MFEA 1TCDA 3FEMA 2H8XA 3LHYA 4KWVA 5D33A 3TCEA 1OX4B 2J9XA 1TPEA 1K8XA 3A23A 3JR2A 3TAKA 1HG3A 2Q8ZA 5FEZA 3MP4A 4NJHA 1RD5A 2BTMA 5DXYA 2E6FA 4GUFA 3B03A 1TJPA 2E5BA 3H53A 1DQWA 4K36A 4M19A 4JYEA 4HNVA 2Q3RA 3GXTA 3G3MA 2CZDA 2GVLA 3TSDA 3ZWSA 1B9BA 1JJKA 4KFPA 4O4WA 1EWDA 1WA3A 5AYZA 1LBMA 3NQMA 3M5ZA 4HSNA 2C0AA 3OHIA 3DFQA 4U28A 1EX5A 1GG0A 5FI8A 1OFDA 4K8HA 4E0CA 3T44A 1L6SA 4H3DA 3P67A 2CLOA 4UFKA 3W7MA 3W7OA 2NUYA 3KRSA 3UYCA 3BK0A 1YPIA 4DXVA 1KM6A 1TV8A 3UWVA 1FWRA 4FNRA 3LRLA 3W22A 3WJSA 2B7OA 3HIJA 4UTJA 1W31A 3ATZA 5C2XA 4PL1A 4NQ1A 3M5VA 1OABA 2YFNA 3LCWA 4AAJA 2TSYA 1QO5A 3W7JA 4YXGA 4XUGA 3P60A 1DOSA 1ZCOA 2VEMA 3NA8A 4UTWA 3OG3A 1W3TA 2HMCA 2A6NA 2DZVA 2CU0A 4O15A 1DHPA 4LVDA 1XKYA 3MBDA 4DQWA 1IXOA 1JR1A 2E6AA 4XBKA 5LSMA 3P74A 4LOCA 1DVJA 4RZ6A 5FF7A 2VKZG 2NUWA 4M7SA 3EX6A 1GT8A 1U83A 2Z1BA 5K4XA 5IBXA 4Y6GA 1SSGA 3FJ6A 3HG2A 1QWGA 2GVGA 3Q2DA 4DPPA 4XKYA 3R13A 4IPIA 1PCKA 1R47A 3OVRA 3M6YA 3O6YX 4X2RA 1CI1A 1SUXA 3NXFA 4A29A 1GTHA 4HHPA 1GVSA 4AWSA 1H62A 3OVPA 3P8JA 5I3HA 3MHGA 1TQXA 2TRSA 3C2OA 3C0JA 1O5XA 4AWTA 4X3ZA 1X7FA 3I68A 4S2CA 1W37A 3S1XA 1SU5A 3LHTA 3NZRA 4TU1A 3LX9A 3NM1A 4UXDA 2FQIA 3NVTA 4TMBA 4ZVJA 5BMXA 4WOZA 5EPDA 3TA6A 5HR6A 3ZWTA 3U8GA 1DL3A 3LHZA 3KVJA 2GJLA 3QQ1A 4FO4A 1F73A 2FDSA 5L9FA 1VR6A 4PCFA 2HTMA 4UTTC 1N55A 1QPNA 3QPYA 4ML9A 3C2FA 3CC1A 1OX6A 1YXYA 3NL3A 3LTSA 2FFCA 4LC8A 2X30A 5I3JA 2P0OA 3EX1A 2JGYA 3RNDA 1ME9A 1SO4A 4QJ1A 1THFD 3C52A 3G0XA 3EEGA 4JX6A 2LLEA 5EKYA 4GC4A 1PE1A 1WBJA 3B05A 3ZFHA 2XFWA 2FLIA 3P62A 2CZEA 4ORIA 2Q8LA 3W07A 3D0CA 2A7PA 5FF0A 1KLYA 3UWUA 4LUJA 5C5YA 4L4LA 3DKJA 3LB0A 4BK9A 5CZJA 5G1TA 3PSWA 4MLRA 3L66A 3BG9A 3BARA 3B0PA 4LTSA 1YXDA 5D37A 5AHIA 1LRQA 3QJAA 1SZNA 1G4TA 3TC7A 2QUVA 4O50A 2CLHA 3S8HA 4ADTA 3W1NA 1KM2A 5E1QA 3NQ2A 1VCVA 4C1KA 5HWNA 4N6FA 3MP3A 2ZBTA 3BVJA 2B7QA 1LOSA 1TPVA 1XDLA 1W3NA 3RF9A 1L6WA 2ALDA 5FF2A 2PRMA 5G5IA 3W1MA 1GJPA 2J27A 1O94A 4ADUA 1FY6A 5KITA 4QAIA 3I7SA 4FB7A 2NXIA 3PBVA 4IX2A 5LHEA 4Y90A 4OGZA 1VRDA 3PULA 3T4CA 4GUHA 3BW4A 5U4NA 2WV8A 4EF8A 3PB2A 4LNYA 3IIVA 1JVNA 3HG5A 1C29A 1XUZA 5G1YA 3LLFA 4O1DA 1ZAJA 1YPFA 1RQHA 4HIBA 3UPWA 3PM6A 3MYPA 3L0GA 1B4KA 3PS7A 4YL2A 3HOJA 1EUNA 5I3KA 5KZDA 2PRLA 1S3HA 3CEUA 3KVLA 4NUWA 3HG3A 3TXZA 4I7UA 5DCDA 3M0ZA 1BWKA 1MEIA 2NXHA 2QDHA 3DENA 2H90A 3R89A 1K02A 3JRKA 3QMTA 1AK5A 3LTYA 3DBPA 1VCGA 4IMEA 4FXRA 2JKEA 3CWNA 1H1ZA 3DAQA 3UPBA 2GOUA 3HO8A 3I65A 1H7PA 2JKAA 2FIQA 2PURA 3BG3A 3NQ7A 3LLDA 1TPC1 4JTEA 2GQ8A 4MPQA 2QUUA 2VC6A 1VHNA 5K9DA 1HO4A 1D3GA 2G96A 4O1AA 5AHEA 2YYUA 1DJQA 4K6AA 4GXMA 2WQPA 3TSBA 1WQ5A 4RV8A 5CGQA 4NX0A 4GBUA 1LORA 4O10A 1N7KA 6ALDA 1EUAA 4GJ1A 2EAWA 3FJLA 2NV2A 4NVTA 3F03K 4UFMA 4MYXA 2GQAA 3VE9A 2C6QA 4IQLA 4N9CA 1K7XA 1S5WA 2NX9A 2A0NA 3TFXA 3PUDA 1F74A 7TIMA 1BEUA 3LI0A 4RZ5A 2FB2A 3W84A 1G7UA 5KSWA 3DFOA 5DY2A 3GZ3A 2A2IA 1PCWA 5KMYA 2BXVA 3W7DA 4UUIA 3S5ZA 5KTLA 1Z44A 4Z0SA 1OFRA 3W9ZA 5I3FA 4NJKA 1H7NA 2QF7A 4EIVA 3B0UX 1SFLA 4JY9A 1G4PA 5FEXA 1KM5A 4M6VA 5AC6A 2GQ9A 1A5CA 2DZSA 2QAFA 2XN1A 4NJJA 1KBIA 1H7OA 4JTIA 3CEPA 3G18A 3QFEA 2QCFA 2J24A 5BMWA 1UB3A 3UY8A 3S0CA 3O63A 3DHFA 1QMLA 4CQ9A 3EXRA 3NNTA 4TIMA 3TH6A 1I2QA 1D3HA 4UR8A 3IGXA 3NQEA 2QAPA 2OT0A 4PC8A 4PEKA 3G1DA 4IOTA 3BO9A 4Z08A 1JCMP 1TPWA 4FNTA 4POCA 5EY5A 1WV2A 2ZRUA 4A2SA 3NQGA 4OT7A 4O28A 5HUPA 2ISWA 2TMDA 2RDTA 2VENA 1FQ0A 3O07A 2CLMA 3B06A 5C6MA 2CLLA 3BPWA 3GNDA 3DXIA 5F2LA 1OFQA 2QCHA 4QNEA 1PHQA 3UD6A 1TMHA 3W88A 2ZRXA 4CNOA 3C56A 3MHUA 1EP1A 3A5VA 4OBTA 2CWNA 4NXSA 4R7JA 3TX9A 3W72A 3PSVA 3O6DA 3WJXA 2GVJA 1SW7A 1KFJA 3HBLA 3GDLA 2E5DA 4O54A 5C54A 4LV4A 1MEHA 3NAVA 1P4CA 1NFBA 4O57A 4JX4A 1GPWA 4LVGA 2DZUA 1VZWA 3RK8A 5HJLA 3V1PA 4LT9A 3CIWA 3G8EA 3HJZA 3LXBA 3S1VA 3SIZA 1YTEA 4UFLA 5HWMA 2YFOA 1JCYA 4RLIA 1OF6A 3N9RA 3BG5A 1X8FA 5DLCA 1JQVA 3NQCA 3CU2A 3W2UA 1HL2A 4S1FA 1TV5A 1B3OA 1XXXA 1FBAA 4JNMA 1P1XA 1RZMA 2G5WA 2ZRVA 1Q6RA 3BW2A 4UNKA 5LNRA 3NYZA 5AHMA 3CHVA 3IIPA 3LCIA 3WK1A 4MJMA 3FS2A 5LNVA 4CQAA 2VFIA 2ZZ1A 2X1TA 1LM1A 1AG1O 3GDKA 1ZJIA 3O6CA 2X2GA 4UTIA 3EXSA 2BZNA 3LBCA 1MO0A 2W0UA 3GYEA 1JCNA 2CZFA 4UTUA 4OWGA 2X1SA 4FHAA 4P61A 5CSSA 5D2YA 3G22A 3G1XA 1N8FA 4ZQRA 1ZALA 1FUYA 3UNDA 1MXSA 3NGJA 1G7VA 2W79A 1SO5A 1FDYA 2X1RA 4ADSA 4O17A 4HN4A 3UWQA 1DBTA 1S5TA 2RDWA 4QSHA 3FKKA 3M44A 1TRIA 4S2BA 4ALDA 5BNKA 2X16A 4A21A 3ZS4A 4UMAA 3R8RA 1FCVA 2WNQA 3G1AA 4AVFA 1XFBA 2KZHA 3BLEA 4FNPA 2FB3A 3C61A 4MY9A 3PR2A 4NT0A 1V5XA 3LHUA 1P5BA 1YDNA 1R2TA 3LGEA 5HULA 5D2VA 2FPYA 2CLKA 3KRZA 1KFCA 4O18A 5AC7A 2B7PA 1U5JA 2OMAA 3MW7A 4JTHA 4QIUA 4Z0JA 1X6UA 3CWOX 1OJXA 4CQ8A 1YXCA 1EIXA 3GDRA 3L5AA 5D38A 2V0TA 2PC4A 4H6KA 1H61A 2CLIA 3KRUA 1VQTA 3S9YA 2VFEA 3MP5A 1ADOA 5HNRA 1ONRA 3L0NA 1C8VA 2P10A 3C2EA 4HKPA 4OQVA 1TTJA 3FKRA 3TKFA 3NL5A 3UXAA 4PL2A 3OVQA 3W1XA 1GZGA 4RJEA 1WOAA 3LRMA 4L4MA 4BWLC 3HMJG 3G8RA 2J88A 3W3OA 3FLUA 3M7WA 1L9WA 3O16A 1UJPA 2Y62A 3A9IA 4MZYA 3NO5A 1YTDA 1SSDA 3W2MA 2OX1A 3HG4A 3IVTA 4YCOA 1ALDA 1I4NA 2RHGA 3EKLA 1VC4A 3O1NA 3PC0A 4BR1A 4XTDA 3HGOA 1H1YA 3DGRA 4IMCA 4RCXA 1W5QA 5D04C 3W7IA 1OFPA 1QDSA 1JRBA 2EHHA 1SQ7A 1I45A 3NQFA 5ABTA 3SR7A 3TAOA 4IWWA 3UZJA 1GG1A 3ATYA 3LBMA 1FWTA 4IUOA 3QRHA 4LS0A 2O7QA 3VCRA 1E51A 1Q45A 3GR8A 3MO7A 1LP6A 3DFTA 3QSRA 4Z1BA 3S6DA 3LCXA 3BLIA 3GB6A 2Y7FA 3DI1A 2B7NA 1JULA 3H54A 1YLVA 3NZ1A 4OHQA 2NUXA 3G1VA 5F2MA 2G97A 4JTLA 2VEPA 1KW1A 3RMJA 1UBSA 4HSOA 4ZQPA 1HO1A 3L9CA 5D02A 3GK0A 3INPA 4WQ6A 1KFEA 1T96A 2OZ0A 3W1LA 5G2HA 3TR2A 1SZGA 2Q3OA 1AMKA 1I2OA 3NQVA 4O11A 4Y8FA 1OX4A 3MYOA 3M41A 1KFBA 3TJXA 4N6EA 4KFNA 5DELA 1TQJA 1FCBA 1BKSA 3I6RA 3NPUA 3E12A 1VJIA 1OYCA 3GKAA 5FF3A 1JUEA 3CPRA 2YGYA 3VI2A 5G4WA 1GWJA 3FFSA 3TU9A 4N4QA 2VELA 1W56A 3NR0A 1WYIA 3WK2A 4KFOA 1IIGA 1TTQA 4CNNA 2YXGA 1LDCA 2QCMA 2I1OA 3T7VA 3LXCA 2C3ZA 3BV4A 2XN0A 1TJRA 5TQLA 1O95A 4IMDA 3LI1A 1W0MA 1LLZA 5AC8A 4U4MA 4TX9A 3ABSA 3K30A 1CX9A 2YW4A 2DZXA 1JCXA 5A5WA 4JEQA 4DELA 2DJLA 2V81A 1DJNA 2JBMA 2DJXA 2YCEA 3T55A 3WJYA 3L5LA 4PA8A 3V75A 4K38A 4Z1AA 4UR7A 5LNUA 1UCWA 4E38A 3STCA 4LV9A 1F6KA 4XBSA 4LUIA 4PTNA 5D09A 4XTIA 1SZFA 2WPBA 3P61A 3P84A 5D03A 5DXXA 4X9SA 1SW3A 3W7HA 4ORMA 5K9CA 1IIHA 3CB8A 1SO3A 1LRTA 4NXKA 4JDYA 1X1OA 3W71A 3LCLA 1LYXA 3LERA 4DF0A 1P0KA 1Z41A 1LZOA 2PCQA 1PV8A 1LBFA 1TV7A 3I7QA 3U2OA 1VYSX 4JDBA 2A6LA 4UFHA 4A2RA 3UY7A 4M6PA 3EWWA 4TO8A 1XDMA 1W1ZA 3PUEA 5E0KA 3MHFA 3Q58A 5A8GA 1QFEA 3W76A 2V2HA 3GX9A 3E9AA 2QR6A 2C13A 5LGXA 2ZA1A 3DFPA 4TMCA 2V8ZA 4N2YA 1AW5A 3L5MA 3PAJA 4HPJA 1YTKA 3B04A 1DORA 2V82A 2ATSA 2ZRWA 4N02A 3UWYA 4N9DA 3DFNA 5AYXA 1QR7A 3I7RA 4WXZA 3TW6A 3LRKA 4C1LA 3LXAA 3PF3A 4BI5A 2YX0A 4DO4A 1GQNA 2FTPA 3LOTA 2NLIA 1QO2A 2YSWA 5K4ZA 4RZ4A 4RKAA
chains in the Genus database with same CATH superfamily
4FIRA 4B5XA 2FPTA 4W88A 3Q94A 2YW3A 2AGKA 2B4GA 4WGHA 4NAFB 4JY8A 2QS8A 1IEIA 1Q6QA 2PP1A 3H55A 2ZC1A 4UCGA 3EAUA 1SMDA 1K4GA 1A50A 2WHLA 1Z48A 1SW0A 2XH4A 3EWZA 1HUVA 4D1JA 2OZ8A 3B0VC 3F1QA 2ZICA 3TROA 4L9ZA 4QNWA 3CL7A 2R1PA 3TMLA 4K37A 4B9YA 3QR0A 2INEA 3O06A 5BU6A 2J4GA 4MNMA 4KGJA 1W1B1 3BGJA 2GGIA 4QQUA 3HFTA 4HNTA 2G3MA 4X0VA 1TREA 1IEVA 3BQ6A 1JCJA 1AZ1A 3M1ZA 1DXFA 2GDUA 2BP1A 4YLWA 5A95A 3W82A 1DV7A 3UCCA 2OOGA 2CCRA 3W7LA 4IZGA 1W5OA 3UJEA 2RDUA 1W5NA 4LGXA 4XO7A 1XFCA 3MT1A 5I09A 4LUSB 2BVDA 1LT7A 4AWEA 2PDUA 3CAWA 4UQ9A 2I9UA 4FNSA 1ZAHA 3NQ8A 1P0BA 1QVBA 1CGUA 5AN7A 3L21A 1XLCA 2R8WA 3CH9A 3PVFA 3FJ4A 4D6DA 3MANA 1VBUA 3C8NA 4QISA 3SUWA 3K8MA 1RP9A 4WRHA 3BAXA 3W6LA 4PSRA 1PIIA 1R87A 1NOUA 3FAXA 3N11A 6TIMA 4EOUA 4MVAA 3GIYA 1F5ZA 1J10A 2W6RA 1EOMA 2XVGA 4Q4RA 4OU1A 3U2ZA 4NILA 2CKSA 3OLDA 1E72M 5ABEA 1ICPA 3F2CA 3DFYA 1XBXA 2PTXA 4FEZA 4WJEA 4Q32A 4W86A 4LAZA 3H7RA 1X39A 4Q4SA 4E4FA 2FPVA 1K3UA 2FGLA 1CXHA 4GFSA 1PZ1A 1W1TA 3A3WA 1UASA 3QTPA 4LUTA 2ZA3A 8CGTA 1OVDA 2B0MA 3E38A 4GGBA 1XH2A 3GM8A 3PB0A 4NF7A 1XC4A 2BLEA 1FDZA 1C9DA 4IXHA 3W85A 1QU4A 2GL5A 3OP2A 1KD0A 4ZGYA 4QG8A 4KWSA 6XIMA 1UC4A 2Y89A 4RXGA 1JCLA 2EEXA 2J77A 3VNLA 1Z32X 4CNPA 1UD6A 1LBLA 4OOUA 2ZDRA 2ZQ0A 1P48A 4CLMA 2VXNA 3FNDA 3VDBA 1KTBA 4DF2A 2C8NA 3PWIA 3FN9A 1NU5A 3SGUA 1PL9A 3GLCA 1BVNP 3NXLA 1B57A 2CIPA 2OYMA 4O12A 1CLXA 2ZCGA 2MANA 3M0KA 1E4LA 3W1UA 4DJDA 1K8YA 4ZB2A 3H4WA 2OQHA 1BWVA 4P7QA 3MKVA 7XIMA 1VJZA 4MWAE 2D73A 3W01A 2DVUA 3KZPA 3B9NA 4FX8A 4UTLA 3IPWA 2DT2A 1VF8A 4XG1A 1QNOA 3KCOA 3PBWA 2VGBA 1PXGA 4YTUA 4FF7A 3ABOA 3TW7A 1HP5A 3PG8A 1NWRA 4HT3A 5JIWA 1NP0A 4GKTA 3H4GA 1GOXA 3EWBX 3QM3A 1G4EA 3O8AA 1XBVA 1UIPA 3CIXA 5E0FA 3SCQA 4IUGA 1BG9A 1P6BA 1B3ZA 3K1GA 1F6PA 3ZIZA 5F1VA 1YDOA 4ZO8A 1VFMA 3RJXA 5H91A 1PEZA 2GVYA 4DUVA 4LRSA 3G1HA 3NPXA 1CENA 1N82A 1QPQA 3I10A 1SGJA 1JD9A 5GQBA 2CZ5A 1UROA 1LRNA 2EKGA 3DERA 4BJHA 1UBPC 4V1XA 3LM7A 2NVAA 4PCSA 1A5BA 1RH9A 1XSJA 3A5FA 2ZUUA 2EF9A 2D3NA 3W2NA 2X0HA 4XAFA 3BZJA 1F4AA 1ZAIA 3PZMA 1E6PA 3URQA 1XBYA 2VD9A 3VCCA 5GJMA 5F1UA 4NZ1A 4E2OA 2ZZ5A 2HNHA 2VFGA 4IG2B 3RUBL 3LK6A 1EJSC 4CQBA 1V3HA 3QSTA 4O4VA 3TVAA 3KBMA 1HJVA 4I6KA 3V0UA 4C65A 2WJFA 5I24A 1JXKA 4GJJA 2GJXB 5MKGA 1KXVA 1PS9A 3SFKA 1YDVA 5BXSA 7ODCA 2ODOA 2VFDA 4CEUC 4F0MA 4NYYA 1MNSA 5HA7A 3QY6A 3N2MA 3MCOA 2P53A 3DI0A 4KRUA 2PWFA 3MV11 1N8WA 1FHUA 4EPBC 3GXDA 2CYGA 3KS6A 3H2MA 3IJ7A 3VD5A 3AI0A 5E93A 3V16A 2VZOA 4F0KA 1XLBA 1TWDA 1ELSA 4GRSA 3UXDA 5D2TA 5REQB 3VVGA 5BOOA 1D9EA 4IFKB 1AA1B 3KTCA 5FACA 3QBUA 4Y9MA 1ME8A 3E6EA 1V08A 1RR2A 4ZMGA 1ZJHA 1JUKA 4O0ZA 5FESA 3RM9A 4Q8OA 3WLIA 1ONEA 3IANA 3ITXA 3QY7A 1B4EA 3LTPA 1FWSA 4HB7A 4IMGA 1HQTA 1G69A 2NV9A 3SAZA 4BI7A 4W8AA 1JRCA 3CQIA 2DT1A 4O13A 3SI9A 4IQDA 4E4UA 4FIQA 1MUCA 4US5A 1S2CA 3CQ0A 2QPSA 4PUDA 3I3DA 1UA3A 4RL3A 4C6OA 1RCXB 1JYWA 1HKJA 3AZSA 4GPNA 2PDJA 4H8UA 3OHMB 1EF2A 3N9SA 3N18A 3KDNA 2GDQA 4L4OA 1OK6A 1RA0A 1OGBA 4EVZA 1ITCA 3GXFA 1TV3A 3PBGA 1T0OA 4Q7IA 1BF2A 2YYTA 1JZ6A 1W8SA 1DWAM 4W8BA 3WDRA 2Y63A 2PDLA 2HJPA 3FCPA 3UWWA 2ISSA 5SWUA 3W86A 3S5YA 1H7XA 2A1YA 3S5SA 3NQDA 2OO0A 3ZR6A 8XIAA 4H7CA 3W1PA 4UFJA 4R9XA 2WVSA 2L5HA 1UG6A 1R46A 2C14A 4MWAC 2XM1A 4EWND 1W2VA 3KAOA 1ADSA 4ROQA 2WSPA 3UZ5A 1JXJA 3QMSA 3W1AA 2YCKX 4N4PA 1BQCA 2YCLB 5JBEA 4ICCX 2WCGA 1KGXA 2QIIA 1CW2A 3IRDA 5DN1A 3GTHA 5JXQA 4LB3A 3W7EA 1IF2A 1XIEA 4CD4A 1EOKA 2HV5A 3A24A 4PR4A 4AIOA 3MQTA 1XL9A 4ZO6A 5FEPA 3H12A 3M16A 4HA1A 3Q4DA 1TZ7A 3GTIA 4E4PA 4GY0A 4UNLA 4XIMA 3LHVA 3EWYA 1EP3A 4YYFA 3ES7A 4NJGA 1G9HA 4LF2A 5DX7A 1F6YA 1MW0A 3W7PA 1C92A 1E9IA 3S1UA 2XSBA 5GNXA 1Q66A 1X1NA 5EL1A 1J2WA 2NQZA 5DMNA 1E0XA 3N4EA 4ZBCA 4AD3A 4IJRA 2D20A 4JTTA 4HJFA 2XZ7A 1PWLA 3C6CA 2DIJA 8RUCA 4RR4A 1C7SA 3UJRA 3N14A 1YYAA 1FRBA 1EDQA 5A6AA 2P1FA 4R7WA 4Z1DA 5C9RA 1ICSA 2O92A 4XISA 1F4HA 1FX6A 3ZJKA 5BCAA 1GGOA 3DIPA 1EJTC 5LIUX 2O9TA 1AD1A 2OEJA 3L7RA 3DFSA 4DEFA 2QXWA 5TBOA 1O66A 2Z2UA 3AROA 3NL6A 1VGAA 1KBLA 2UBPC 3CB3A 1ZZMA 3N9KA 3SCNA 4AYSA 5CZTA 3WL1A 2X09A 2XZ9A 2ZZ3A 7REQB 1YADA 4JTGA 1LQ0A 2PWEA 1Q6OA 3NEVA 3V4BA 2P5NA 4D71A 4XAGA 4PTXA 3K4WA 4ZO9A 1J0YA 4A05A 1QPOA 1OX5A 3T81A 5JQ9A 4QLKA 1LTDA 3LPPA 4KEUA 4KPLA 3GAKA 4FALA 1OF8A 1JUBA 4IGHA 2ZUMA 1LJYA 3P8IA 1PDZA 2FJKA 2Z6JA 1XWYA 4OTKA 3B9DA 4DJEC 2I5GA 1TPUA 4CKQA 9XIMA 1WAUA 1PAMA 2F84A 1GVQA 1EIBA 1X96A 5AVHA 3E2VA 1OFOA 2HROA 3IJLA 1XF0A 2WVUA 4Q4MA 3GG0A 1VLWA 3HQNA 4URIA 3LCFA 3DESA 4JS3A 1AL8A 2C79A 2R91A 3UCQA 4I5RA 3HA1A 4L4PA 4RDZA 4GE8A 2DP3A 3PPGA 5DBUA 1ISVA 2ZTKA 2CEQA 1PX3A 2NV1A 1DKWA 4I9JA 4WXYA 1XI3A 2ICSA 3PZIA 8TIMA 1Z89A 2FMNA 4GQQA 3R8HA 3AUOA 3B40A 3O15A 2CPUA 3RO8A 3E3HA 1TV4A 4FNUA 2V2DA 1RBOB 2Z1KA 1NDVA 1EXBA 3KTXA 5AC5A 3BSMA 3GBEA 1NF0A 4B92A 2QUMA 4IIBA 5F4SA 4HU4A 1E4NA 4G8TA 1P0EA 1CLVA 3WN6A 4W89A 4RX0A 3PWGA 4B5TA 1OINA 1YE6A 5F7UA 4DAFA 5KINA 4L9XA 3KOXA 3SRDA 3USBA 1KBKA 1VLIA 3MV01 2Z28A 4A6GA 4REQA 4O19A 1Z69A 5CPSA 4GVHA 3TQKA 3S2CA 1EJXC 3W74A 4GYKA 1OYAA 4PUNA 2JEQA 3GXNA 1DQUA 3QQ0A 3QYQA 3CZLA 5A6KA 3EPNA 3BJSA 3QZEA 4ZQOA 2V69A 1QNPA 5XIAA 1PKNA 3LHYA 1PX4A 5D33A 2H9AB 3WY1A 3JR2A 3TAKA 1X8CA 2WWDA 6REQB 2EG6A 4NJHA 3UR7A 4A8RA 1PZ2A 5DXYA 3B03A 1TJPA 1BYBA 4JAWA 4A3RA 3GU1A 3N3TA 3PTQA 3UR5A 1QK2A 4HNVA 3GXTA 2GVLA 2GQ3A 3TSDA 3ZWSA 1JJKA 4M56A 4O4WA 3RX4A 1EWDA 3QR3A 1LBMA 3S83A 2D1ZA 3DFQA 3PTKA 2ZWZA 5FI8A 3U7VA 4K8HA 3THDA 1L6SA 5EB8A 2CLOA 1PX8A 4UFKA 3W7MA 2GGEA 5E0CA 3KRSA 3CK5A 3UYCA 4JNYA 1YPIA 1EQPA 3UWVA 3LRLA 2GWGA 4IIDA 3W22A 2B7OA 3OGVA 4UTJA 1MUMA 1R86A 1V6YA 1F3EA 3VX1A 3VMPA 4PL1A 4NQ1A 1CT5A 2ANUA 1OABA 2YFNA 3AFBA 4YXGA 1QRQA 3FX4A 3TTQA 4XUGA 1ZCOA 2VEMA 5I5RA 1W9DM 4WDUA 4BEUA 2JEPA 3OG3A 1YBQB 1XX1A 2VC5A 2A6NA 2DZVA 4MHBA 4TTUA 3Q45A 1SM9A 1DHPA 1EDGA 2FTWA 2J13A 3CLWA 3F2BA 4FZIA 3NURA 2E6AA 2NW0A 3KBWA 2WANA 2ZE0A 1R8LA 3HQOA 5FF7A 1QW8A 2VKZG 2NUWA 1GT8A 1U83A 3MTWA 3VIFA 3FJ6A 4LXFA 1QWGA 1Q2SA 1EEXA 1CCWB 4DPPA 3TTYA 1R47A 3OLIA 1GVIA 3EMCA 4EPDC 4JIHA 1GZJA 4QLLA 4X2RA 1KRMA 2PTZA 4UQBA 2J7CA 4AWSA 3CPUA 1H62A 2VO5A 1TQXA 2TRSA 4HGXA 4MB4A 2R82A 4S2CA 3IACA 1W37A 3EMZA 4TUFA 4HCHA 3NZRA 3LX9A 3ZLGA 2D2HA 3EBVA 3NVTA 2OSXA 6TAAA 4KEMA 4WOZA 5EPDA 1FTXA 1UD8A 2PTDA 1XIIA 2BFGA 3LHZA 3BAIA 2BVYA 1F73A 3L4XA 2Z4GA 5L9FA 1QOXA 4S3FA 3MSGA 4A4AA 4UTTC 1QPNA 1PB0A 3QPYA 4CGTA 2Z7GA 3QQWA 3C2FA 3NL3A 2CETA 3SUUA 3M6DA 4DRSA 1ME9A 3TYUA 3IJ6A 4B2DD 1EPVA 4QJ1A 2J8FA 3C52A 1ZJAA 2FYMA 4I8YA 5IDZA 4YIWA 2Y24A 2DUAA 4E5TA 2Q8LA 1BTCA 5FF0A 2DT0A 3UG4A 2Y5EA 4HNCA 3DKJA 3LB0A 1B31A 4BK9A 5G1TA 4QHRA 4AZ5A 3BARA 3B0PA 4A3QA 1NFPA 5AHIA 1LRQA 3GIQA 3GC2A 3EB3A 1G4TA 1QBBA 1UIOA 2CLHA 2CZVA 3W1NA 1KM2A 1OIMA 1VCVA 4C1KA 4CU7A 4PTWA 1XDLA 1W3NA 4JCLA 4EK7A 3D47A 3VINA 5FF2A 5G5IA 3QV6A 2CC0A 3TLQA 1D2KA 1FY6A 4QAIA 3I7SA 4FB7A 3WNMA 2NXIA 3G2GA 4Y90A 1XC6A 1VRDA 3T4CA 1TZZA 3BW4A 4EF8A 3IIVA 1JVNA 3IS4A 1V3LA 5G1YA 1C8YA 3F5JA 3MCMA 4NASA 3ZR5A 3T9PA 4H83A 2J7FA 1YPFA 1RQHA 3PM6A 2Y5SA 1F3XA 4GG9A 4Z2GA 1B4KA 1V8EA 3PS7A 4YU1A 5I3KA 1YHTA 2PRLA 4ZTXA 1L6GA 4XUYA 1WB0A 3GC4A 3HG3A 3TXZA 3V36A 3UNTA 2NXHA 4I9MA 3P2VA 3KRBA 4B5UA 3FK4A 3BL3A 1VCGA 3KLKA 4FXRA 3LNMA 3MCNA 3HFYA 3OW1A 4JTEA 4GVGA 3SADA 4L1GA 1VHNA 2VEGA 1BG4A 2WQPA 3TSBA 3A4JA 2VHLA 4RV8A 5CGQA 4GBUA 2E1WA 3UXIA 6ALDA 3C0LA 5DQPA 3R1ZA 3RPMA 3TN6A 4ZFCA 3AMKA 4B15A 4E3VA 2C6QA 4N9CA 1E1FA 4AXNA 1W3HA 1BEUA 3AUJA 1T7LA 3LI0A 2I56A 4IF2A 2A3BA 3ZT7A 3S5ZA 4GYFA 4O1EA 5KTLA 1Z44A 3VGDA 3W9ZA 3M0YA 3B0UX 4FPSA 1TJ2A 4JTAA 4M6VA 3UETA 2GGHA 2WLZA 3WF2A 4H9ZA 4NJJA 3TP4A 3GNRA 4E6MA 1WZLA 1L2QA 4GH1A 2VZSA 1HKWA 3FW6A 2YJQA 4PC8A 4Z08A 2WCSA 2PUZA 2ZRUA 1WE5A 3WQWA 1AQFA 4O28A 5HUPA 4RUBA 2I17A 4IGSA 4IHCA 2CLLA 3BPWA 3GNDA 2G0WA 1OFQA 2NQ9A 4QNEA 4LX4A 1H41A 1FWDC 3UD6A 3PPCA 4CNOA 2J7HA 2JE8A 3MHUA 5FCZA 2CXEA 3A5VA 4OBTA 2RJHA 2AOSA 3EWDA 1SW7A 4O54A 3ITCA 3VIMA 3RR1A 5C0QA 5C54A 4R9OA 4D6FA 1MEHA 3NAVA 1NFBA 3U7BA 3RK8A 3PJXA 3EOUA 1RLDA 3E5BA 4PCPA 7PTDA 1PPIA 3ONCA 1XCWA 1X8FA 3NQCA 3TYCA 3RCNA 4S1FA 3ARVA 1RZMA 4AZIA 2V3DA 3EDKA 4Q8TA 2F6UA 5LNRA 3NYZA 3B0YA 3DYPA 4GYPA 3CQJA 1Q85A 1IWBA 1W8GA 4B5VA 5LNVA 2VFIA 5AZ1A 5A8NA 1AG1O 1ZJIA 4RPPA 4AZCB 1XH0A 4AY8A 4DJDC 4EAMA 2YKKA 5BXTA 2MUCA 2J7EA 2XG9A 1MO0A 3GYEA 3PZOA 1DHKA 5FJOA 4HMEA 5D2YA 3G22A 3ARYA 2VYOA 3W00A 3TYAA 3NFUA 1ZALA 3CUJA 4NAEB 1TA3B 5IFPA 2W79A 4DUXA 1OZQA 9CGTA 5EU9A 4O17A 4ADSA 3CZ8A 4HN4A 1W3JA 3UWQA 1DBTA 2INZA 2WMGA 4JNZA 3AU2A 3M44A 4ALDA 3CUIA 3R8RA 1FCVA 2IPJA 3QXBA 4U3CA 2FB3A 3C61A 3AMGA 3M0JA 4Y2WA 1P5BA 3LGEA 5D2VA 5FJUA 2R24A 2CLKA 2VCCA 4O18A 2DW6A 1GJUA 4DM1A 2WXDM 3S6TA 3VOFA 4O8AA 3W29A 1U5JA 4AUBA 3WDIA 2OMAA 1X6UA 1MZRA 1OJXA 4WR3A 2GSEA 4HN8A 3KRUA 1X38A 1VQTA 1FFRA 1PJ9A 1ZRQA 5FKYA 4EX4A 4W93A 4I8DA 1QW9A 2XWDA 4M6UA 3L0NA 2P10A 3C2EA 4OQVA 4U10A 1TTJA 3PTDA 3TN4A 2O9RA 3NGFA 4PCTA 3UXAA 2DFAA 1XG3A 3OVQA 3W1XA 1QNSA 1GZGA 4RJEA 3LRMA 4L4MA 1CGTA 4GHRA 4JBRA 1US0A 3HTWA 1GOKA 5HBFA 2J88A 3W3OA 4GZ7A 3M7WA 3PUGA 3UW6A 4J3TA 3O16A 4RZBA 3U3HA 4XKMA 1QWKA 8A3HA 4C6NA 4EXBA 1E4MM 3RM4A 2PP3A 2RHGA 3EKLA 1VC4A 3WH6A 4J4KA 3HGOA 1UD2A 4F79A 3DGRA 4IMCA 1W5QA 3AQUA 3AS2A 4AZBA 1JRBA 1SQ7A 4XK2A 5ABTA 3NIYA 1VEPA 2FVKA 3L4YA 1FWTA 1OWQA 1FOBA 1E51A 3GRIA 3MO7A 4FLQA 4GZJA 1H4PA 3E1F1 4Z1BA 1UJQA 4F40A 1TWWA 4QG6A 3SQLA 1HNYA 3H54A 3KBSA 1B0IA 3FVDA 4OHQA 3CNYA 4MTVA 2PS2A 3CO4A 3R0DA 1R3SA 1A5NC 3RMJA 1KW1A 1UBSA 1BSLA 3L9CA 3R4IA 4P7RA 3EB4A 3KOZA 4WQ6A 4M82A 4B4HA 2OZ0A 3UG5A 3TR2A 2Q3OA 2QPXA 1ZSXA 2UY2A 1M53A 3MS8A 3BAWA 4MJ4A 1JFXA 3VABA 1GQKA 3EDFA 2YGYA 2VZVA 4DHGA 3TU9A 1I9CB 1W56A 1WYIA 3M07A 3WK2A 4KFOA 4DYJA 1TTQA 4CNNA 3LXCA 4C7GA 2C3ZA 2XN0A 1TJRA 4D9PA 1J6PA 5A2AA 5AYIA 2I16A 1BQGA 3DGBA 3LI1A 1H0IA 1IZKA 4KW2A 1LLZA 3ALGA 5AC8A 2J62A 3K30A 1CX9A 1JCXA 4Y9PA 4DELA 3V5OA 4D72A 2VDHA 1DJNA 2JBMA 2OODA 3T55A 2V5JA 3M0LA 3V75A 4U5IA 4MKVA 1JDAA 2QGHA 4E38A 4LEQA 2EPOA 4PTNA 5D09A 1L6FA 3AC0A 3BAJA 4X9SA 4ORMA 2Z26A 5JH1A 1UWRA 4NXKA 1X1OA 4C6IA 1WUEA 5LYRA 1LYXA 3LERA 2FHBA 4DF0A 2JIWA 2EPKX 2DH3A 1CYGA 1LBFA 3I4KA 3I7QA 3V1HA 4JDBA 4P7NA 3SGGA 4FA3A 2PDCA 3EWWA 2UZ9A 5E0KA 1Q6DA 1L0PA 1QHOA 4HHMA 5DT7A 5BZAA 3E9AA 4D6IA 3WLOA 5GPRA 4PCNA 2C13A 2PDBA 3DFPA 3VDGA 2V8ZA 3SO7A 4N2YA 1AW5A 3N25A 5H8UA 3PAJA 5M03A 4XZHA 2ZRWA 1KFWA 2YIHA 4W84A 1OG6A 3I7RA 4PMJA 3LXAA 4BI5A 3ZJ7A 5KEZA 4HHHA 3MDWA 1GNXA 2YSWA 4RZ4A 5FJTA 2J8GA 4MB3A 3UG8A 2OELA 1UH3A 3K8KA 1ZLPA 2QF8A 3MZ2A 4LH8A 3E74A 2PLMA 3S2LA 2E4TA 4H04A 1ZENA 3IIXA 2DUXA 1UKQA 2JALA 3MUXA 3W25A 3ZT5A 2CFFA 2R94A 2GK1A 4LF1A 3SDOA 4Z1YA 1F8MA 2POTA 3L4UA 4Z2LA 3THCA 2Y8VA 7ENLA 3DZ1A 4YS1A 2BG5A 5AHLA 5LXEA 1UOZA 5CZ0A 3S2NA 2WYSA 3CAVA 3V5CA 5A8OA 3XIMA 3OODA 2IKGA 1EPXA 4Z1CA 2AAMA 2PEVA 1TYGA 5B7ZA 2QCEA 4UTHA 4QDPA 2BOFX 4P5UA 3A4WA 4K7YA 2YLAA 4D8AA 1P0NA 3MBFA 5EMUA 1R3WA 1FH7A 4IM4A 4TVDA 5G4EA 1MW1A 1VEOA 3B8IA 3DH7A 1GVOA 1UKOA 3UP8A 4XSMA 2C1GA 3C0QA 3WJWA 3RCYA 2FGBA 2Z24A 4KESA 1HF6A 2HK0A 3NPVA 3PFRA 2B31A 1JI1A 5CLWA 3WK0A 4EPEC 1QNRA 3DHUA 4NX5A 1G6CA 4MY1A 4UTFA 5U7SA 3GR7A 4O0KA 3BGGA 1XCFA 1O4UA 2X0YA 3FGCA 3ZZ1A 3TDFA 1VIZA 1TFVA 1H60A 2INFA 5HOSA 2DZPA 3HGSA 1DTNA 2VDIA 4F48A 4D1IA 2DPEA 4EF9A 3TJLA 4AWUA 1NP2A 1J2BA 4WY0B 1S2TA 3HPXA 1V0MA 4XSLA 1XICA 3QMRA 1R30A 1IWAA 1NOWA 4UOQA 5IRPA 4LS1A 5HQEA 1QI5A 3ARZA 3F4WA 1EA0A 4JTUA 1CECA 5AC4A 3WF3A 3LV5A 4LU0A 5CXPA 3STEA 2E9MA 4G7FA 4HNUA 1XSKA 1REQA 4PTMA 3LV6A 3N4FA 2ZRZA 3E02A 3UERA 4DNHA 5DANA 2GJNA 2Z0IA 4M8UA 3W1RA 1WDWA 2AMXA 1Q5MA 2C7FA 1YNQA 1NELA 5AOUA 1SFJA 3GXPA 4C6QA 4AZ7A 1MRAA 3C8FA 3VIIA 4CCDA 4WUIA 2YDAA 3MWCA 1VB9A 3OEXA 2O7SA 4H19A 3A21A 3VKAA 3R7MA 2ACUA 3IRSA 3GC5A 4IJBA 3ARRA 3S42A 1V02A 3SUTA 2QUTA 2VTFA 2XGIA 4FF5A 3MI3A 2PCEA 3BJTA 3R0UA 3T0TA 1I8JA 4PGLA 4PMOA 2E5CA 2NQHA 3VCNA 1SYTA 1A5SA 1EYWA 4ERIA 1RV8A 1EWEA 4G5DA 4JPGA 3QV8A 3N6HA 2PZNA 2WO5A 1KXHA 4IX0A 2EPMX 2PWHA 4NZFA 1NWSA 3B8SA 1UUOA 2A3AA 1SJAA 4DWSD 2V63A 3CUXA 2CITA 4LBRA 4JD4A 2ZFAA 4A8IA 4AISA 3TLLA 3ZSTA 4D6EA 2QCDB 3NQ6A 5CPNA 4LUSA 3IARA 1AL7A 1NEYA 2OFJA 3L2IA 4GCAA 5CG7A 3TE9A 2TPSA 4PMZA 5D8ZA 3C2VA 1OD0A 2RDXA 3S46A 3ELFA 3S6OA 5C70A 4RE4A 1UR8A 3E96A 1J5TA 3OYZA 2YB1A 4E2VA 1RPXA 1XRSA 1YRRA 2WNZA 1ITXA 3SW6A 1VKFA 2HVMA 3M43A 3TQ0A 5EBUA 2CNCA 4A3HA 4NNAA 4P8VA 4M6QA 3MVIA 4HZ8A 1XG4A 1UWAA 2E0PA 2PGFA 1DTUA 1SPQA 2Y61A 1VH7A 1E5NA 1TIMA 3CL8A 3HPZA 3S1WA 1WUFA 3D6NA 2ZUNA 3C2RA 4ZCWA 1KV5A 1UH2A 1JYNA 1F2JA 1MEWA 3MB9A 3A47A 3BW3A 3PJWA 2YDQA 5K3VA 4L9YA 5LZLA 2A5HA 1W91A 1QI2A 1UKSA 4DUWA 1YMYA 4M81A 1LWHA 3S5NA 4KWWA 3FAWA 1M7OA 3AU6A 1NF7A 2NZLA 3WNPA 3A4AA 3T8LA 4G2DA 1DE6A 2XFRA 4AHOA 4DXXA 4RW3A 4F2TA 1FKWA 4D6HA 4KIRA 3VGGA 2ZUVA 3KFTA 3QYSA 1DJYA 3W70A 1KKOA 4MJZA 5JUVA 1MWOA 1BPLB 1G0CA 1OGGA 2G8ZA 3CAKA 1TUFA 1A3XA 3R25A 1VYPX 3SEPA 4CEXC 2JGQA 3WD4A 2WZTA 3ZO9A 2ESCA 3THQA 2AQWA 4PUUA 3DHPA 4IISA 3UWZA 4KEZA 3UR8A 3URAA 3SCVA 4ICNA 2VT0A 3QOKA 4OKDA 2XIJA 1EDTA 4ZOAA 5T26A 1Y0EA 3KXQA 3W2JA 1JZ3A 4DO5A 1E6NA 3T40A 2OSWA 3ZVIA 1E1CB 1E6XM 3UPMA 3L68A 3L2LA 3O2LA 4A3UA 5IM51 2OU4A 1BXCA 5E9AA 2A7RA 4WY0F 4NKCA 4HVXA 2XH2A 2Z2AA 4JN6A 3WEZA 2AKMA 2GOKA 4DWSC 1T99A 2I14A 4V1YA 3D5HA 4JIQA 5T8GA 2YL6A 3RR4A 1GVRA 1EKOA 1ISZA 1PTDA 2EJAA 1UPMB 4US6A 3WH8A 1IXNA 4CNSA 2R9RA 3CZEA 2NX3A 1XCXA 3TIMA 1MFUA 4CVUA 1SJCA 5EYWA 3BDKA 1OHLA 3QPEA 4FMVA 2BXYA 2E9BA 1LOQA 2PI6A 3HQPA 5G2WA 5A6BD 4GI9A 3AALA 1VFOA 1BYCA 3PZGA 4ZENA 3U0HA 3VD3A 2Y85A 1DQXA 3BMVA 3GHSA 1NM9A 5BRPA 1OCBA 1GW9A 1G5AA 2DORA 1WDDA 1I1XA 3VKDA 4U31A 5BW6A 1JGMA 3UYIA 2PWVA 3V0TA 4CU8A 3SJ3A 4DBDA 2AQOA 4CQDA 1R3QA 3TXVA 1LUCB 5FEWA 2PGRA 3TW9A 1SZEA 2DZWA 1SR0A 1UD3A 4GJIA 1XYCA 4CD7A 2JKPA 3G1YA 3I6TA 1VBGA 4L1XA 1QHPA 4I7VA 4LYRA 2EKCA 2YZRA 4HD5A 2J47A 2C91A 1KXTA 5KZMA 3WFZA 2QMJA 5D9PA 2J74A 3HB9A 2FHCA 3FY1A 4IG2A 4BZYA 2QJGA 5M5DA 5AYYA 3CUHA 1JFHA 3SZ8A 3DEQA 2GJXA 3MA8A 3S2JA 2OVLA 1RVGA 4DO6A 4JTQA 3W53A 1IT0A 3QY8A 3UWEA 4INFA 1SJBA 4S23A 3G1FA 5HATA 2W61A 3DHDA 2NX1A 1Z6KA 3M5XA 3L65A 2BOGX 3P5YA 3UZZA 3NL2A 5EBAA 1PTAA 2VVNA 4EXQA 4H8NA 1Q13A 2EPLX 4UTMA 5CKSA 4DPQA 3OIHA 2SFPA 3W28A 1LL4A 4LAUA 2WHKA 3W87A 5REQA 3KM8A 4IFRA 4IFKA 4EAYA 4QRNA 4RV3A 2D2GA 2QJHA 3NJ3A 5LIXX 1FHLA 1JZ4A 4H9VA 2YL8A 4CCCA 3P5ZA 4LVAA 1PZ0A 3IVSA 4WF7A 5DBTA 3CYVA 1EGMA 4I9AA 1QW7A 2BHZA 4HYWA 3U2CA 1PDYA 3CZGA 3TQVA 2XFYA 4JKMA 1V6TA 2QDDA 5CPLA 5TD4A 3HGRA 3CMGA 1UPPA 2EPHA 1G4SA 3WLQA 3WLKX 3MI2A 5FJIA 4Q6XA 4FSAA 3QTGA 3EX4A 4OOZA 2F9RA 1Z42A 1KV8A 2ZRYA 1JPIA 4R33A 4GNVA 3EB2A 4E8CA 1I2PA 2VRKA 4F66A 3F4CA 2HISA 4PMDA 3GFZA 4IGNA 3KVMA 3MUIA 3ARWA 2OLAA 2YR1A 3WK3A 2V5KA 1RQBA 4AIEA 4CQCA 3GDMA 1O6IA 5A2BA 2VGIA 1X6NA 3SGZA 1F05A 4BF7A 3VIPA 1EJVC 3GG8A 5IXEA 1A3WA 3QFWA 1T8XA 3UEQA 4FX7A 3W6MA 1W3IA 4JTSA 3UQNA 3VNDA 1ZFJA 4GZIA 4S3KA 1JD7A 1BLIA 4AH7A 3ITTA 3MMWA 4S3JA 2FZ9A 3MY9A 4M5PA 3REQB 1GTEA 4PMNA 3QR1A 4M29A 1FWNA 3A9BA 3W73A 4ES4A 1D3CA 2HSAA 1FP8A 4IMFA 3OA3A 3XISA 1PHWA 1BGGA 5EMYA 3W7QA 4JTRA 2YCLA 4FLOA 1EBHA 3HPSA 1U30A 4HZ6A 1TMQA 1QPRA 3NM3A 2R1KA 2CESA 2ABAA 2PB1A 3SCRA 5I3GA 2PDNA 2ZYFA 3T09A 1XLMA 4ML4A 3CO8A 4KKXA 1T6MA 3GNXA 3TK7A 4GYPC 1V6WA 1V0LA 1TRDA 2ZZ7A 2IPGA 2WKJA 3K5XA 2PDIA 3CQKA 4Q6JA 3QLLA 3WLMA 1M7JA 4YYCA 1XRTA 2ATMA 5J5DA 3VD9A 1FWAC 2VEIA 3M7SA 1POKA 3T0BA 4DJFC 1SVDA 1T40A 2V68A 4B4FA 1H7RA 3WLJA 1AW2A 3N6JA 3GAYA 4KEVA 1BKHA 4MZ8A 1H50A 4PUWA 3A4XA 5BRBA 3VDCA 4E2BA 1XW8A 3SSJA 4PMRA 3GVWA 4MAZA 3B97A 4DZAA 3SY5A 1DYSA 3VOCA 3QW4B 1WCGA 1CNVA 1RK5A 4F9JA 4GYJA 3UZYA 3PFMA 2D22A 3EX2A 2GPTA 2YL5A 3PN8A 2YBUA 4JIPA 4L1WA 1R2RA 1MYRA 4CUCA 3WKZA 4F2UA 5CJMA 1L2UA 3W27A 1RALA 3UXLA 3K8LA 2R1MA 4XKYB 1OYBA 1HTIA 5EMMA 4HNOA 3LZ5A 1VFHA 3C3NA 3M0XA 3UA3A 5HMEA 1R0MA 4JFWA 3WQCA 4LEFA 4QXIA 4IIHA 3EA2A 4UC5A 4WX2A 4J9JA 3L67A 7REQA 5CPMA 5DO8A 2NWSA 3G1SA 4LY8A 2ABBA 5AFDA 4GFIA 3N2XA 4DNMA 3R12A 1LG1A 3W7RA 1J8VA 2HS8A 1PBGA 4MFEA 1TCDA 3FEMA 2H8XA 1KCZA 5H1WA 2XIMA 4KWVA 3BGAA 4WSJA 2BMBA 2BODX 1B3YA 1E5JA 3B8VA 1RD5A 4HCDA 3RITA 2E6FA 1V6VA 1FA2A 2E5BA 4K36A 3VIJA 1FWBC 4JYEA 1Z9AA 1TCMA 3KHDA 3UZWA 3CV2A 4G9PA 4HTYA 3AYSA 3NQMA 4HSNA 3QOMA 3BWWA 3CMJA 1QNQA 4U28A 1OFDA 1Z3NA 4HOWA 1ZP4A 1U1UA 3P67A 1XS2A 2FVLA 1CGWA 3BK0A 1KM6A 4FNRA 3LNPA 3OYXA 3HIJA 1W31A 4E8GA 3FDGA 5C2XA 3DC8A 3TOPA 4PYSA 4DYEA 3M5VA 3BJFA 4AAJA 3WF4A 1ENUA 2WWCA 3E2QA 1BVWA 3KE0A 3P60A 3ME3A 2PPGA 3NA8A 3LGDA 4UTWA 2GYIA 4AW7A 1W3TA 4JZ5A 5C2GA 1AH0A 2XSXA 4O15A 1WDPA 4LVDA 4C6BA 2ZXBA 3GTXA 3ZVHA 4DQWA 1V0NA 4XBKA 5LSMA 4GO9A 2PODA 3P74A 1O1ZA 1S5MA 3U9IA 3GWQA 5CC6A 3UZXA 3EX6A 4IP7A 3NZGA 4Y6GA 2GVGA 2GSJA 3NYDA 3Q2DA 1PCKA 4KERA 3SB0A 5KZ6A 3KBJA 3M6YA 1CI1A 1SUXA 2GSHA 3NXFA 4UB9A 4HA4A 1GVSA 4DI9A 3P8JA 1W3LA 3C2OA 5FJRA 2HXUA 1RCOB 5FL1A 2F38A 1XV8A 3GH4A 3K4AA 1R38A 1WKFA 1SU5A 2QQ6A 3IJ9A 3UVAA 1GPFA 3NM1A 3UR2A 5FAJA 4UXDA 2FQIA 4TMBA 4ZVJA 2H9AA 3TA6A 5HR6A 5LIKX 1JDEA 1XHGA 3WBWA 2DT3A 6REQA 3QQ1A 1V02E 4MNJA 1E70M 3MC5A 1Y7VA 1LQ2A 5DFAA 1YNPA 4WIWA 2HTMA 1GKPA 2G3JA 2CLPA 3L4VA 2ALRA 4F8XA 4XAYA 1E9LA 4HMNA 2FDMA 3LTSA 1O1HA 4FAMA 4LC8A 1YW1A 2P0OA 1ADDA 2JGYA 3B3DA 2IPWA 5BRQA 1THFD 3G0XA 3EEGA 3RN6A 1CWYA 4GC4A 5CEWA 3P62A 2MNRA 3D0CA 5HNTA 2XISA 3UWUA 4LUJA 5C71A 4IQEA 1CXLA 3TZFA 2OZTA 4MLRA 1Q6FA 4LTSA 1ZL1A 5D37A 1OD8A 1IR2A 1S2WA 1Q2RA 4O50A 5ABGA 5BWAA 4QS5A 2NQLA 4ADTA 1XLAA 4C6EA 1YBQA 1HJSA 2OKTA 4J3SA 1QI3A 3NQ2A 4MDPA 1D8WA 5HWNA 2V67A 4MGGA 5CCZA 3MP3A 1BF6A 1TPVA 3A3HA 4LCQA 1GJPA 3GTNA 1AH4A 1U22A 4AMCA 5AY7A 2ZUWA 4ADUA 2PGWA 5IHRA 3LQGA 5LA2A 3F2DA 4JIRA 2PGEA 4U2YA 4OGZA 3PULA 5U4NA 2RJGA 2REQB 4LNYA 2DW7A 3LLFA 1AJ2A 1BYAA 3UPWA 4MADA 2CHOA 3L0GA 3NOYA 1GKRA 3HOJA 5KZDA 1REQB 4LAMA 3KVLA 5DCDA 3M0ZA 1MEIA 3WMLA 2QDHA 2BGSA 4J3ZA 2HE8A 2I5QA 3JRKA 4M51A 3GHUA 1R3VA 3BCDA 4IMEA 4Q8QA 4GI4A 1Z7AA 2JKEA 4KH2A 4JIEA 2GOUA 3I65A 1H7PA 2JKAA 1FHDA 2Z00A 1UMYA 1XSIA 5M2FX 2QUUA 2VC6A 1CB7B 3SUSA 3BLDA 5K9DA 1D3GA 2R1LA 1A5UA 2DIKA 5AHEA 5CPTA 1DJQA 4WDWA 1YNYA 3IJ8A 1WQ5A 3N12A 4H7VA 2OXNA 1EUAA 1O68A 3ID7A 1UWUA 4NVTA 1LWJA 1OC5A 5E6YA 2GQAA 4DB7A 3SURA 2QVHA 4RDVA 1S5WA 2NX9A 2A0NA 3ITGA 3M64A 1E9ZB 7TIMA 3WQEA 5AKQA 3VZZA 4RZ5A 1G7UA 4QP0A 3DFOA 1ZCCA 2D2JA 4H41A 3AYRA 3AIEA 4DI8A 3S1GA 2OZ3A 2VGFA 3NSXA 4CCZA 2EJ1A 1KM5A 4ZOBA 5FEXA 4LYPA 5AC6A 4KF1A 3NVDA 2GQ9A 3IV8A 2F6KA 2VD8A 2QAFA 3LZ3A 2XN1A 1KBIA 4FXFA 1K6WA 5D9MA 4OBSA 4UQDA 3AS0A 2J24A 4K1WA 1GKQA 1NIUA 4IIEA 1UB3A 1IEWA 3ITYA 1V4YA 2OWXA 3O63A 1H1NA 4Z17A 1LWIA 7A3HA 2QNEA 4TIMA 4CQ9A 3TH6A 1VJSA 1D3HA 3ITOA 3MUZ1 2QAPA 2OT0A 4FR6A 3LD5A 3G1DA 4FNTA 1WV2A 5CC5A 1QK0A 5A2CA 2TMDA 2OWCA 2ONEA 4H9TA 3O07A 1MDLA 3V5FA 2NT1A 4FOJA 1E55A 7CGTA 2QCHA 4Y9NA 1PHQA 3UGVA 3SCTA 1BRLB 4C6MA 3P14A 5A69A 2BOEX 4NXSA 3TX9A 1FWCC 4H01A 1KFJA 2E5DA 3CUGA 1RY0A 2G41A 1P4CA 4W5UA 4O57A 3AAMA 3FYYA 3SJNA 5HJLA 4K3ZA 1DE5A 1QI0A 3CIWA 3G8EA 2VDGA 3HJZA 2ZE3A 4N0RA 5HWMA 2YFOA 1OF6A 3BG5A 1HGYA 2YZ5A 3W24A 3W2UA 4LYQA 1TV5A 1XXXA 1FBAA 1DIKA 2G5WA 4YVVA 1JYXA 2ZRVA 4QR6A 5A6LA 1Q6RA 1E6SM 3H2AA 1GQIA 5AHMA 3GE7A 2BS9A 1VFTA 1LLOA 3LCIA 4MJMA 3FS2A 3MMUA 1W1A1 3BMWA 4HOZA 3GG1A 4GD0A 1YPXA 4P7LA 1YEYA 4GX9A 3EXSA 1KCXA 2BZNA 2GWNA 4H9UA 5KETA 3LBCA 2QV5A 3VPLA 2P8BA 2QPUA 3RM8A 3T08A 3FA3A 1TG7A 3BXWA 5HMFA 3WD0A 3G1XA 3WLPA 3T0CA 1P6WA 3V35A 3GFXA 1SO5A 1FDYA 4XAPA 3BV7A 4LY4A 1JL8A 2Q8XA 2RDWA 1OT2A 3AIQA 3UCDA 3AZRA 2XVLA 4S2BA 1S1PA 3H24A 2WM0A 2X16A 1F3WA 4TV5A 5CSYA 3SQSA 3S3GA 3WLNA 4C7DA 3KS5A 4ENLA 4FNPA 1C90A 3WMBA 2W91A 1OEPA 3GR4A 1R2TA 5HULA 2J66A 3EDEA 4DWSB 2FPYA 4RDYA 5LA0A 1AQMA 1ZQ5A 1EXPA 1S46A 1UW9A 1GW1A 4QIUA 4JTHA 4Z0JA 4A3YA 3CWOX 4I90A 1AMYA 3BH4A 4WSHA 2FJUB 2V0TA 4YN5A 2PC4A 4H6KA 2CLIA 3DYOA 1ADOA 1W1VA 4LQ1A 2UWFA 4MB5A 1ONRA 4WSKA 4J3WA 3FKRA 4IPPA 2ZXAA 4A8NA 4WJ8A 1XGZA 3NL5A 3TYDA 1UWSA 2HNEA 3BQ5A 4I5UA 4V28A 4OFCA 3RLHA 4WGXA 3T0DA 3G8RA 4AIUA 1L9WA 2Q02A 2VCAA 3GY1A 2YXOA 4MZYA 4B3ZA 1YTDA 1NQKA 4LJ3A 2OX1A 5A6MA 1S2UA 3HG4A 3O1NA 1MQQA 4ZTYA 3PC0A 4BR1A 1GONA 4XTDA 2WMJA 4AZCA 3W7IA 1UYQA 2BB0A 3ALFA 4UQCA 1QDSA 4MWAD 2EHHA 5BYWA 3TAOA 3VIHA 1AH3A 2W63A 3VKCA 4IH3A 4LS0A 3VCRA 1BFNA 1TUXA 1AZ2A 2QJJA 1Q4WA 1EQCA 1RA5A 5D9OA 5I03A 4LANA 1AQ0A 3WBAA 3CV6A 1KCKA 2Y7FA 4NAEA 1TA3A 2DY3A 3P0XA 1XR2A 4W4QA 1YLVA 4G56A 1KRBC 3QN3A 1XLEA 3QHMA 3VGBA 5HPOA 4E8DA 3VNYA 3CAQA 2JFEX 1HJXA 3LLXA 4HSOA 5I02A 2PDKA 2XYLA 3WNKA 5D02A 1HKKA 3GK0A 3INPA 4KRZA 4WKAA 4X0NA 5G2HA 2DH2A 5AECA 5ABFB 4O11A 1OX4A 3OQEA 2W27A 4N6EA 1TQJA 2XGBA 1BKSA 3NPUA 1W1PA 2J25A 1VJIA 4F2BA 1RSCA 3B9OA 1OYCA 3GKAA 4PSPA 3K2GA 1JUEA 3CMFA 2EG7A 4B5SA 1RBAA 1LL7A 3FFSA 4X63A 3AICA 1SZRA 1J9YA 2F6XA 1LDCA 4MSSA 3T7VA 2FZNA 3BV4A 1HKIA 1MFVA 5HNNA 4HJWA 1LL6A 4IMDA 3EGJA 4EE9A 1GEHA 3RG6A 4U4MA 4TX9A 4GXWA 5TAOA 3A6OA 5HXMA 4DZHA 2DZXA 4Y7EA 2EBNA 4YHEA 4H6EA 2A79A 3WQDA 3WJYA 2DJXA 1ZBWA 3WH5A 3L5LA 4PA8A 5C9WA 4Z1AA 4J7RA 1J12A 3STCA 4CN4A 4LUIA 3VM7A 1GJWA 1SZFA 3U5UA 1XLDA 1NQ6A 3W7HA 3HM7A 2BVTA 3DFHA 2VI0A 4IL0A 3IUIA 2E8ZA 1Q4NX 4H6QA 3PTMA 3BICA 3E0FA 1XQKA 3LGGA 1WDQA 2V5CA 4D8LA 5BXPA 3AZTA 3VNKA 2XDFA 3UU0A 1TV7A 2PDMA 3VD4A 2RUSA 1EO5A 1WKEA 2A6LA 4MDOA 2XJ7A 3VNMA 4A2RA 3UY7A 2KAUC 4M6PA 3O6AA 1AODA 1EBGA 3PUEA 3W26A 5EMKA 3USZA 5A8GA 3GX9A 3VAVA 3Q65A 4DJED 2CWXA 5LGXA 1V7AA 2ZA1A 1TE1A 4TMCA 4QFUA 4HPJA 1JZ8A 2V82A 2ATSA 4D6GA 3UWYA 3T2PA 3DFNA 3VXGA 1H0GA 2IKHA 3LRKA 4MB1A 4LAOA 1JNDA 2FMOA 3UXKA 5H8MA 1S39A 2NLIA 4KRTA 2Y7EA 3DX5A 3KBVA 4B5NA 4BI6A 2OWWA 4MWAA 1GZ1A 4A35A 3QC3A 4F3HA 1B3XA 4AC1X 4EPKA 3VGEA 1A53A 1V93A 3WQOA 4OUIA 4BHYA 2I9EA 2FH6A 3AIVA 5TIMA 3G77A 4N9BA 4O1BA 3TNBA 2EGZA 3LM3A 2CBIA 4OV9A 4E3TA 3R43A 1BXBA 3JZUA 4C91A 2JF7A 4M7TA 3N2TA 4ZB5A 3O0KA 1HJQA 4AYGA 5BROA 3Q67A 1R9YA 4KCVA 4LFYA 4EKJA 5LNSA 3THAA 2F2KA 2ZX8A 4KBXA 2PDPA 3KOYA 4TOQA 3F4DA 1JQXA 5DCEA 2YOCA 3UVIA 2ZKMX 2WSKA 4NJIA 4ZL1A 3L12A 1R2SA 2EQDA 4Q22A 1IZJA 1KWKA 1V6UA 4NL1A 3ZXWA 1VHCA 3QEZA 3E0WA 4Y9OA 5LIYX 3E5PA 4GIEA 3IVUA 3STGA 1TWIA 3TN5A 3R2GA 2DIEA 1GEQA 1BYDA 1H51A 1XBZA 3WFLA 4B90A 4NNCA 4JYDA 1OFBA 1UA7A 1E15A 3I6EA 1E0UA 3IK4A 3EXTA 4GWEA 4PUJA 4AHPA 2NXGA 1BTMA 1AW1A 3MI6A 4FS9A 1DP0A 4HZMA 4QROA 3L0KA 4Z2HA 1XLHA 3AYVA 4GVFA 3LYEA 4JICA 4MG4A 3N19B 4PFMA 1K70A 3VZXA 4XB3A 4XX6A 2GLKA 4QE1A 3RU6A 3KP1A 3VFCA 3SCOA 1CB2A 2RFGA 1P7TB 4FI4A 4I7WA 1JNEA 3U4FA 1UD4A 4H2HA 4NU7A 2PF8A 1B5TA 1W32A 1HXJA 4LWWA 1IXPA 4WOQA 3PZNA 4TVCA 5EMJA 3R79A 3CQHA 3LSBA 2XIOA 2E7FA 2XH0A 4V33A 1X6LA 2A3EA 3W83A 3L4TA 2ZX7A 3WQPA 4AHQA 4FR1A 1EB3A 2Y7DA 2XWEA 1J79A 1KM0A 3CV7A 3FOKA 2AKZA 5K7JA 4MY8A 3TC6A 3ZMRA 7TAAA 4AF0B 1DWIM 3DG7A 4AEOA 4OE7A 4CD8A 4GC3A 3MWAA 1HKVA 4Q7NA 2VL4A 2XU2A 2RGLA 3H7UA 1JZ7A 1QOQA 3IIZA 3WL0A 1HJWA 3U57A 4XBJA 5DCBA 3ZM8A 2J9YA 2V2CA 1TR9A 4ZQCA 1K4HA 4X9YA 3E2RA 1M5WA 4HOXA 3CHEA 1FXPA 4RK8A 3T0AA 2WSYA 3ZVHB 2Y2WA 3MPGA 3W4RA 1CIUA 2PD9A 2RKXA 2VVSA 3VUPA 1KA9F 2WBGA 1IT8A 1U5VA 3TTSA 1OG0A 2Y6ZA 1RXOB 1HKMA 2VM8A 2ON3A 4J28A 3TUUA 2C0HA 4HU3A 2OOFA 1US3A 1UC5A 4C60A 4K2SA 4W9TA 2OCZA 1WDSA 3VU2A 5H2ZA 1W9PA 2VURA 3EWXA 4WY0A 3B4UA 1QAPA 1FWFC 2UV8G 2Z1SA 3U5YA 3P81A 3SM0A 2C1IA 3RFAA 2P8CA 5C2CA 1TIWA 1IEQA 4PZVA 1EC7A 3IGHX 1SO6A 1IV8A 2OLHA 1TX2A 3PG9A 4JX5A 2XH7A 1KFKA 3TA9A 4AC7C 4BF9A 4N9EA 4O52A 2OEKA 2VP8A 4H9XA 1GVYA 1M04A 3QC0A 3SCUA 4ZSTA 3BC9A 3NPWA 2WAGA 1EEPA 3KLLA 4ZA0A 1QUMA 1Q63A 3F4VA 1KXQA 2R14A 1L8NA 1XUUA 1MW3A 4AB4A 2DEPA 5HUOA 3FHAA 4JR5A 1EC8A 4UTWC 3T07A 4IPJA 1Q65A 1CGYA 1K7FA 2PRHA 4OECA 3G24A 1EF3A 4I6VA 4PBFA 4GNKB 3PJUA 1ZY9A 2IPFA 1FXQA 1OCQA 5D8WA 3U2EA 1UZ1A 2Z1VA 3DU0A 1GYNA 4PRTA 1FWEC 3ICJA 3JZEA 3QW3A 4CCEA 1ISYA 4MAVA 1EP2A 1XLLA 3EX3A 5E9XA 1KB3A 1QASA 3WF1A 3H2OA 3CS2A 3GNPA 3II1A 3MU7A 3VTRA 1ECQA 2O0TA 2YPIA 4YTSA 3LA4A 2OSYA 5I00A 1Z8AA 4YTTA 1L8PA 4GMEA 4IT1A 4XZLX 1KO0A 1BAGA 5D30A 1V0KA 4CD5A 2GFTA 2ZVIA 5FSEC 2QCDA 2VFFA 2VCBA 3WZ0E 5LNWA 1P6CA 1MRQA 3NO1A 2WJZA 1WP6A 1R6WA 2E3ZA 3QLDA 1Y8BA 3F5KA 2P50A 5I07A 1ZBVA 4RE3A 2BDQA 1M7PA 5K9XA 1V3JA 2VEKA 3CHCA 1ODZA 3P6LA 1HFBA 1ZBCA 3WIJA 1VAHA 2E40A 4Q33A 2P88A 3PY2A 3B0XA 1KWGA 3W6YA 4C6DA 5D32A 3APGA 3SY8A 3IEBA 5LHFA 3GH5A 2ZX5A 4C5ZA 2C15A 1O12A 1JGIA 4L7ZA 1CDGA 3BMXA 4Q3MA 3B8DA 4Z42C 1HJUA 1K7EA 4Q4QA 1J11A 2WBKA 4QX4A 3VIGA 5D2XA 5CAKA 4JOMA 4QCFA 1VPXA 5AB3A 1XIHA 4BFAA 5HAOA 1NOFA 4NSBA 1PKLA 2QIWA 3UBPC 1EJWC 4XD4A 2Y88A 1DJWA 5PTDA 5JIPA 4GOAA 1EJRC 5DMYA 4PH6A 1XH1A 1WX0A 1FCUA 3H2NA 3VC6A 4HNNA 2OYLA 2J79A 4F0RA 2HVOA 4JXCA 4XZNX 1WBHA 1XISA 2HCVA 1JPDX 2A21A 5C55A 4UTTA 5GJNA 4A8LA 3TV8A 2C71A 4MYAA 4GGHA 4IFOA 1TSIA 1QBAA 1FH9A 4NZCA 5DRCA 2QDGA 4R53A 2IQDA 1VIWA 4JTKA 3CLMA 4KCTA 3GUWA 1F76A 3AISA 3VIKA 1OQFA 1V03A 4MZ1A 1V77A 4TV6A 3SECA 3IJQA 4A22A 2EG8A 3UJFA 1KBJA 2ZTJA 4K39A 1ZJBA 1R9XA 3A22A 2ACRA 2RGMA 2TODA 5HNUA 4JYFA 4RW5A 2JF6A 2GDVA 3G0UA 3WNLA 3G6LA 2EO7A 1E1CA 2GUUA 1WOBA 2E77A 1XLJA 2PE4A 4PFHA 1B9ZA 1G67A 1V3MA 1XM3A 1I6NA 2OEMA 2Q09A 1ML1A 2YL9A 1WXJA 5LGZA 2VWTA 4WHBA 2PU0A 4ZSUA 3W2LA 4D6CA 4ZXLA 2XN2A 3IV3A 3I4EA 4NZ5A 1UH4A 2HBVA 2QJIA 3PBMA 2CERA 1K8ZA 1HGWA 1M41A 3OBAA 3TEVA 2BGQA 1O5RA 1XPYA 4XV0A 2C19A 3WUEA 3LPGA 2WHJA 3SRKA 2E68A 2QKFA 3LCHA 4LCSA 3A12A 4WJXA 1W5PA 4WVXA 4H4IA 1PUDA 2JIEA 1X97A 1KLZA 1W54A 1KM3A 3CASA 4DJDD 3KDOA 3WCZA 3SN4A 4Q8NA 1O5KA 2HWGA 2ZDSA 2RH9A 2CBVA 5M3WA 2FGZA 3QGKC 1E0TA 3SN1A 1ZP3A 4PRRA 4PODA 1O60A 4JTFA 2QZRA 1N8IA 1M65A 1UR4A 3KHJA 1LUCA 5F2IA 2CLEA 1FWIC 1F61A 2PWDA 2F61A 3E2SA 3NQAA 3GS6A 1OBAA 3GDTA 2HBXA 3O0FA 2WSRA 5GVJA 2V5LA 1Q6LA 1TPFA 2XIBA 2Y70A 4JQ3A 1MSSA 2OYKA 2C18A 2G37A 3QZ6A 3PBUA 5AHNA 5DY3A 4C6FA 4UNIA 3GO2A 1K9FA 2PTWA 3URBA 2D0FA 3ANUA 2FFIA 1E40A 2NSXA 4K7VA 2FZBA 3VM5A 4B2DA 4G1KA 2DGAA 4TTGA 4MKSA 2DZBA 2OT1A 4NZJA 2HS6A 1T8QA 2QVNA 4AX7A 1A5AA 5KZEA 3BSGA 2G4JA 5GJPA 1V6XA 3RO6A 4MNLA 3TQPA 3STPA 1GYLA 4DY1A 4PULA 1KKRA 4LRTA 2VC7A 4PE8A 1RAKA 5JH2A 1W9BM 3HPAA 2CLFA 2VX7A 1BGAA 1RVKA 1ZHAA 1GOWA 1OB0A 4ZOCA 5F2GA 2IXVA 4KCUA 1UQYA 2GUYA 1XDJA 1V79A 1UUMA 4PRWA 3AMLA 5J5RA 3TR9A 4XZIA 4X61A 1XLIA 3W7GA 1MZHA 3JS3A 3MUY1 1ZTVA 2WMIB 5J8LA 3ABRA 2G50A 2ZUSA 2ZUTA 2Z2BA 1FKXA 2E09A 2XFFA 1CXKA 2QGYA 3TSMA 1EGZA 3M0VA 5E5CA 2J9ZA 1ZNNA 1Q7MA 3MZNA 3SCWA 4ZQMA 4DBWA 2PBOA 4GUJA 4JL1A 3VOJA 1A0CA 1RBLA 3SCPA 2NWRA 2AQVA 2W67A 1A49A 1C7TA 1NVMA 5I06A 1K1DA 3QF0A 3CZJA 1ZBKA 2VQUA 3ANYA 1IT7A 3G5EA 4OBRA 1GOQA 3W1TA 2PWGA 4MUZA 5F4XA 4L6HA 3LHWA 3AS1A 2ZZ4A 1CXIA 1UOKA 4O8RA 2OG9A 4ONVA 1U1HA 3CM4A 3CUFA 1I75A 4XD5A 4Y9AA 4AXKA 4O14A 2OPJA 1OC6A 3HGJA 3VK5A 3VKBA 4HPXA 3WF0A 4YTQA 4LBUA 4PEEA 5K2ZA