2QCEA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to sulfate, glycerol, and chloride
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
total genus 97
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qceA00
2CLIA 4WY0B 1TV8A 3UD6A 3ATYA 1PV8A 4IMDA 2JGQA 1LDCA 3LHTA 1OYBA 2GQAA 1K02A 1C9DA 2EHHA 3M6YA 4ZQOA 1AMKA 4EF9A 1VJIA 2DZTA 4JDBA 5D37A 4AHQA 2DZSA 3GVGA 3PUEA 3DFOA 3G0XA 3O63A 2NLIA 5HWMA 3O6YX 4HNUA 2QCNA 2EGZA 4NQ1A 4P2VA 3GK0A 3THAA 4AB4A 4UFMA 3EWZA 1A5BA 3KAOA 4IGHA 3W22A 3TMQA 1OVDA 3HPZA 4DPPA 4E0CA 2ZCGA 3SFKA 1LRQA 3W7JA 4AHOA 4BI6A 2FDSA 2NX1A 3WK0A 1A5SA 4IOTA 3FOKA 4FNTA 1JCJA 3WJSA 3P8IA 2PCQA 3TV8A 3BG3A 3EXRA 1K7FA 3JRKA 4MY9A 1JULA 1L6SA 1WOBA 3GXTA 3TX9A 1F05A 3UWVA 4HPJA 1FWRA 3KRUA 1CW2A 2YFNA 6TIMA 3NQ2A 2DU2A 3M44A 4E2BA 4K36A 2Z6JA 2DP3A 5FF4A 5TIMA 3W1MA 4MOZA 3H55A 4FB7A 2FPVA 5G4EA 3G1XA 4X9SA 4GJ1A 3ZR4A 4A3UA 4LUJA 4ZL1A 3F4NA 2VENA 3IVTA 2AAMA 1D3GA 1JUKA 2YGYA 3NR0A 4IXXA 5HJLA 3P7YA 3FKKA 4IMCA 4N9BA 3QSRA 1N7KA 3PR2A 4AF0A 4LWWA 3BARA 3I7SA 2C0AA 2YYUA 3GNNA 3OVRA 4MFDA 3I65A 1H60A 5CPNA 4O10A 1DORA 4DQWA 2YYTA 3TFXA 4NVTA 3O6CA 2VFFA 3W86A 2QCDA 5CSRA 1B9BA 3HMJG 3WJWA 1GTHA 1WDWA 3S5OA 3CHVA 5DN1A 5EMUA 1WV2A 4NT0A 4K39A 1TPDA 1P0NA 3S5YA 4E2DA 3LXBA 4UNLA 2P0OA 3LTPA 1HO1A 3UWZA 3W7MA 1FBAA 2ZZ7A 3KVKA 2CU0A 3GDRA 1G4EA 1YDNA 4O1AA 5LHFA 5MHBA 1IXOA 4C1LA 4KWVA 1VCFA 4UR7A 3F4WA 3C2RA 2QJGA 3OHIA 1PIIA 1GQNA 4PA8A 4XTDA 2I14A 1XBZA 2GQ8A 5HWJA 3S5NA 3PG8A 4UTUA 2RKXA 1OK6A 4TMBA 2A7PA 2WNNA 2TYSA 1AL7A 2JGYA 4UR8A 4W9TA 4IQLA 3MBFA 4DPQA 1DJQA 4JTFA 3PBYA 3HIJA 1FWNA 2BX7A 1TPFA 2R94A 1H7PA 1ZENA 3L5LA 3SW6A 1TPVA 2YCEA 1KFCA 1RQBA 4JD4A 1TMHA 3LV5A 1FXQA 1P0KA 4UTHA 3E12A 3SJ3A 1T99A 3W23A 1OFPA 1G6CA 5E93A 1D9EA 3MP5A 4O11A 3L0NA 5TBOA 4DO6A 4Q33A 3M5VA 1OJXA 4LVBA 1I2OA 3QC3A 3QFEA 3UPWA 1IGSA 3ZWSA 1TQJA 1I4NA 2F7FA 1QCWA 3TC7A 5EKYA 1OFOA 3W1NA 3EWUA 1R30A 5EYWA 3LV6A 5E1QA 3TH6A 1YPFA 3TAOA 3W87A 3PS7A 1K03A 3O07A 5AB3A 3N9SA 3SIZA 4O1DA 5HWNA 4QNWA 3EWXA 4R34A 5AOUA 1SSDA 1O5XA 3ELFA 2KZHA 1OFAA 1UASA 1WQ5A 2B7PA 1IXQA 2WO5A 3THQA 3Q2DA 5KZEA 3P67A 4FEZA 5FESA 3UWYA 1FWWA 4RCXA 2ZRXA 3W1PA 3B0PA 5DXYA 4OWGA 3MBDA 4NJJA 4UMCA 3EXTA 3NPXA 3USBA 2GVJA 3IGUA 1THFD 4UCGA 2NWSA 3M41A 3TJXA 3TFCA 2HTMA 4RV8A 3TDFA 3CQ0A 5D32A 4X2RA 3EEGA 2CZDA 3L0GA 2O7SA 5I3KA 4LC6A 4QNEA 1UUMA 2H6RA 2YZRA 5C5YA 3C0JA 4TIMA 4ZQNA 4JTUA 4JTGA 4J9JA 2GOUA 2ISVA 1W5MA 1XL9A 1F74A 4DXVA 4O13A 1VR6A 4QITA 3W2JA 3NPUA 1SSGA 1TV7A 2VFIA 1D3HA 3M5YA 2Q3OA 3PG9A 3G3DA 3LI0A 4LV9A 2RFGA 4DBDA 1YTKA 1JQXA 1WX0A 1XBYA 4MVAA 3W7GA 2A7NA 1QPNA 2C16A 4Z1CA 1VC4A 1XUZA 2BTMA 4POCA 1GJPA 4BI5A 5LHEA 2B7NA 3TUUA 5KINA 3R89A 4PODA 3C6CA 2EAWA 4M5PA 4JY9A 4UC5A 3W7QA 3NPWA 3TQ0A 1AW1A 1H1YA 4B5NA 1OFEA 3DXIA 4FHAA 3IGXA 4WJEA 4WQ6A 4OHQA 1M7PA 2FJKA 1X1OA 3M0ZA 3MI3A 3PC0A 4UFHA 5F1UA 1FDYA 3LHWA 3GAKA 4LV4A 4WXZA 1W56A 3C52A 3D0CA 3T55A 1TTJA 2X1RA 3DENA 3HG3A 3ZS4A 1SZNA 4M6QA 4JX6A 1I2NA 1YPIA 2E5BA 1W5PA 3EX2A 3KFTA 2J9XA 3PM6A 3R2GA 5HUPA 1ADOA 1OFDA 4O14A 1KV8A 3W72A 3OG3A 3W7KA 3MW7A 1TYGA 5I3HA 1SO6A 5CZTA 3HPXA 4QIUA 1YDVA 8TIMA 1I45A 2ZZ2A 1VYSX 4IUOA 1DBTA 5AHIA 4I7UA 3TXZA 4GFSA 3C56A 2NXGA 4AWTA 3I7QA 1R2TA 4MY1A 3W6YA 5HR6A 3HGSA 4WD0A 3G1AA 3UY7A 5C54A 3LRMA 4QISA 2RHGA 5FF0A 4EIVA 1PL9A 1GEQA 3LHYA 3CC1A 1C8VA 1KFLA 2A1YA 5DXXA 5F4WA 2FPYA 1W54A 3HQ1A 5GVJA 2Q3RA 2BZNA 1FDZA 3P74A 3EWWA 5D30A 1ALDA 3QEZA 3W7OA 1SUXA 1SQ7A 3E9AA 3JS3A 1RQEA 3IIOA 2Y85A 3GKFA 4IPIA 5CGQA 4GXMA 3CIXA 4NX5A 3DZ1A 2QUVA 2C3ZA 5TQLA 2HS6A 1F6PA 3BLEA 3LRKA 3L21A 4K7YA 5IM51 3CIWA 1SO3A 2V30A 2FIQA 1GWJA 4C1KA 3NQAA 2ZBTA 1LYXA 1YTDA 4TMCA 3EXSA 4U28A 4JR5A 3TNOA 3T7VA 4FIRA 2X1UA 5HNRA 2Y61A 1O94A 1VS1A 4JTEA 3NA8A 4JYFA 1RR2A 4LVGA 2QDHA 3W9ZA 2O7QA 3MI2A 2VEPA 4IX2A 1FX6A 1UBSA 1MEWA 2Y7DA 3UWWA 1QPRA 1S5WA 1VLIA 1EA0A 2E6YA 4JICA 1L6YA 3LERA 5K9DA 5LNVA 4GUFA 1TPEA 2VELA 3TSDA 3GAYA 4UTJA 1HFBA 4IMFA 4GUIA 3P81A 2A7RA 4FNRA 5FEZA 5CPMA 4JIPA 3B06A 4G1KA 1RVGA 2A5HA 3W2UA 3B05A 5F4SA 5D38A 3QM3A 3CT7A 3FJLA 3PSVA 3RFAA 3LHUA 1MZHA 2ZZ6A 3G1VA 3M9YA 1EPXA 3RF9A 1G7VA 4RJEA 3UZJA 1Z44A 4MJMA 4UFLA 3W1UA 3W84A 2Y63A 2DZXA 3CPRA 4FX6M 4BWLA 3TMLA 2NUXA 3C2OA 3BGGA 4RXGA 1LRNA 5CZ0A 2Z0IA 2Y7FA 1A50A 1W5NA 3EB2A 2R14A 3UQNA 4RLIA 4FNUA 1JCNA 1WAUA 4Z1AA 4O15A 4AH7A 1LOSA 2JKPA 4IX0A 4L4MA 1XBXA 2E09A 3C2VA 2OJPA 3DU0A 3L68A 1FWSA 3QW4B 1XDMA 1DQXA 3LCIA 4A22A 2Q8LA 5K3VA 3ZWTA 2C6QA 3RK8A 4JTJA 4UFKA 5C55A 1Z48A 3O1NA 4NUWA 2V82A 3W1AA 3TW7A 3R8RA 3B0VC 3FS2A 1ICQA 2GVLA 4ADUA 2GQ9A 2PURA 5A8GA 1TRIA 4PL2A 3W1QA 3NQMA 4RZ6A 4NJIA 1XUUA 2VC6A 1DL3A 2XN1A 2A6NA 1FCVA 3OA3A 1Q6QA 3IIZA 2J6XA 3LTYA 1JCMP 2E5CA 1T96A 5KTLA 3N2MA 1Q6OA 1HL2A 4JS3A 3BW3A 1TJRA 5H91A 1RPXA 3FLUA 3HGJA 1QO5A 3A21A 3SSJA 3TJLA 4OE7A 3NG3A 1R47A 3QQ1A 1Q6RA 3LCLA 3TC6A 3TKFA 1TSIA 5L9FA 3U6WA 4MYXA 1KFKA 1EP1A 3S0CA 1OX4A 3P62A 1YYAA 4NNAA 1OX5A 3NAVA 3DH7A 1JJKA 3RLVA 1TPUA 2V2HA 3GX9A 3BLFA 4CCCA 2XFWA 5AHLA 3RLUA 3KVLA 1TTQA 3YPIA 4CQAA 1CI1A 1H63A 1F76A 1OFRA 4ADSA 4O4WA 1PS9A 3G3MA 3VI2A 2E6DA 3VCRA 1ZHAA 3NQGA 1TPB1 2X2GA 1H7OA 2JKEA 3EX4A 1OHLA 5AHEA 3L65A 5CG7A 4PCFA 2JKAA 2CLKA 3NL3A 2ZTKA 5CKSA 3P82A 2GJLA 3LGEA 2BXVA 3P84A 3B4UA 1YXYA 1QMLA 3HBLA 2YW4A 3O6DA 5AFDA 4TU1A 5FEXA 5HINA 5LNUA 1TTIA 1F2JA 1IF2A 2Y62A 1QR7A 5DLCA 3WJYA 2X30A 4JTTA 5D02A 1RD5A 3K30A 3LCXA 3IVUA 1W0MA 4LC8A 4NZFA 1GVOA 2WJZA 1EIXA 3O16A 3EX6A 3OVPA 4O53A 3FYOA 1CX9A 1TRDA 2C1HA 2NUWA 2YPIA 3MHGA 2X1TA 1TTPA 2RH9A 3HOJA 3KOFA 3F03K 1V5XA 4LW7A 1UJPA 1OX4B 5SWUA 1VRDA 3W7HA 4O1CA 1GT8A 5G2IA 3STGA 3S1XA 3G22A 2J88A 5D04C 4YCPA 4E38A 3G1YA 1K7EA 3NDOA 2BSLA 2VFGA 1XM3A 4K38A 3P60A 3C4UA 2RDWA 3W3OA 4DO5A 1H1ZA 1FY6A 4UTTC 5DELA 3NM1A 1E51A 4Y9AA 5J5DA 4KKXA 3WJXA 5G1YA 5D2VA 4X3ZA 4XQ6A 4O0ZA 4LVAA 1SW7A 3L5AA 1XC4A 2V9DA 4NXKA 3F1QA 5BMWA 4XBKA 1SZGA 3DFQA 3R13A 4MFEA 5HR7A 3PUDA 1G67A 3QMTA 4HKPA 4UNKA 1W8SA 2ZRUA 3A23A 1JRBA 2QDGA 4RZ5A 5LSMA 2VFDA 3CM4A 3M1ZA 3FIGA 3G18A 1G4SA 3UXAA 3MP3A 4AF0B 1ZAIA 2Y7GA 1PE1A 3N3MA 5I3IA 3GYEA 4CNOA 1ZALA 1NEYA 3M5ZA 3PULA 4O50A 2RDUA 3EKLA 4CNNA 3NZ1A 2FTPA 4ML9A 3G1DA 1X6UA 3T40A 1ZNNA 5DBUA 5EY5A 1QDSA 4XWUA 1F5ZA 1LBMA 3A5VA 3ZFHA 4K37A 2WPBA 4I9AA 3OVQA 4XZ9A 2TRSA 3NL6A 3W7CA 2C14A 4ZZ9A 5BW6A 2NX9A 1LROA 4H6KA 2ATSA 1S3HA 4MYAA 4LY8A 5HULA 4MLRA 2VFHA 3W83A 1XDLA 1QFEA 3RMJA 1JCLA 2OX1A 1KBJA 1QPOA 1SZEA 3KXQA 3NL2A 2AGKA 2C19A 2NV2A 5LKYA 4O19A 2E77A 3S5ZA 4Y90A 4Z08A 1K3UA 1GVRA 1FCQA 2J9YA 3LX9A 4GRSA 3BV4A 3G8EA 1K8YA 2UV8G 4H4IA 4XUGA 1BWLA 4CQ9A 4RXFA 4MUZA 5K2ZA 4LRSA 4EF8A 1KTNA 1P1XA 2ISSA 1SO4A 1SW3A 1KLZA 1BEUA 1V7YA 1JUBA 2VKZG 2WKJA 3AO0A 3C8FA 3TAKA 2ZRWA 5C2XA 2HS8A 5CPOA 3NPVA 1KM3A 3WK3A 2EPHA 2ZZ1A 4JYEA 2FLIA 3FKRA 3QMRA 1Z42A 2PRHA 5U4NA 4YLWA 5D2XA 5U7SA 3DFPA 5I3JA 3MHFA 5FI8A 2E6AA 1QO2A 4AWUA 1B57A 4FNPA 3LTSA 3H54A 1FUYA 3R12A 3N34A 4YXGA 1L6WA 5AYZA 3Q94A 3W70A 3BG5A 1W31A 1GG1A 3W1RA 3NQVA 2GUUA 1QOPA 3QQ0A 3E96A 3O06A 1VYPX 4MLJA 3MYOA 2ZA2A 3L66A 4O57A 4ZQMA 4UFIA 5DY2A 2OT1A 4NNCA 4UTWC 1OYCA 1JVNA 3G0SA 2TSYA 5IBXC 3KRSA 1KFBA 1VPXA 1NF7A 3CEUA 2ABBA 4JDYA 4MIMA 4QSHA 2V2CA 1M7OA 5EPDA 3S1WA 3A5FA 3W2NA 4Y8FA 4L4LA 4DF0A 2FPTA 3BW2A 5AHMA 1ZAHA 4HNNA 5K4XA 2G96A 2QUTA 4AXKA 4LS0A 4AHPA 3IEBA 3NGJA 2DZVA 4ICNA 3LCWA 4NX0A 5AC7A 3MWAA 3GR8A 2B4GA 1LCOA 4HNTA 3VFLA 1A5CA 1LP6A 3JR2A 1L2UA 1J4EA 3KRZA 5EL1A 3TA6A 2IQTA 4A29A 1XFBA 1MXSA 3DKLA 1H5YA 3LI1A 3G0UA 3NQ6A 3L5MA 1KA9F 3BO9A 2NZLA 3PBWA 4LT9A 4JTIA 2CLEA 2G5WA 4N6EA 4MZ8A 4IJBA 2ZA3A 3BLIA 5C6MA 3S1UA 4DBEA 3T44A 3UYCA 2QEZA 2P10A 3SI9A 4O54A 3I7RA 2W0UA 5LNWA 5KSWA 1SPQA 1TB3A 2YDAA 4K8HA 4IXHA 5EA9A 1XI3A 3E0IA 4U4MA 5G5IA 1I2RA 1ML1A 1YLVA 1KM6A 3DHFA 2I9EA 5FEWA 3NM3A 3KVMA 4AEOA 3HGOA 4LNYA 1T0OA 5CSSA 3UXDA 4D2JA 5FEPA 5LNRA 4Y6GA 1OFBA 3TE9A 1TV5A 2QCCA 2WNZA 4MKNA 3ABQA 3IIXA 2WV8A 3NL5A 4WX2A 2XN2A 5F2MA 1TCDA 3NQFA 4N9DA 2ZTJA 1GZGA 1N8FA 2OMAA 4R53A 4NJHA 3QF0A 5EBUA 1PCWA 3M16A 4OU1A 7TIMA 3UPBA 4GUHA 1EUAA 4A21A 4Z1DA 3L2IA 1R2SA 4JXCA 4O18A 3E02A 3NVTA 3GKAA 4PL1A 2YR1A 4ZQCA 4EWND 5BRBA 1JQVA 6ALDA 2ZZ4A 1QNVA 1QWGA 1VCGA 4Q4KA 4DF1A 4IPJA 1ME8A 1W3IA 1RV8A 4PH6A 3NQ8A 1LTDA 1PHWA 1EP3A 2QR6A 1ZFJA 3HG4A 1SZFA 3LOTA 1I2QA 4GUJA 3SR7A 4O12A 3HPSA 1G4TA 1SFLA 4ZQRA 5F4XA 4UTKA 1O60A 4YMZA 3GB6A 3MMTA 2PRMA 1IXPA 5K7JA 3PWAA 3G1FA 5D09A 3C61A 3V1PA 2PC4A 3GXPA 2ISWA 3STCA 1FQ0A 2DZWA 1KW1A 1WA3A 2AQWA 4I7WA 3TW6A 1AG1O 3ATZA 4JN6A 4FXRA 3PSWA 2X16A 1J2WA 1Q3NA 3A22A 2QCLA 1Q45A 2X1SA 4LVDA 3NXFA 4O0KA 1M6JA 3O8AA 5H2ZA 3N2XA 3DFSA 2E6FA 4GUGA 2YX0A 3SZ8A 4CQ8A 1GYLA 4S2CA 4H3DA 3HJZA 1VLWA 4YL2A 4FXSA 4NU7A 3LBCA 3C2EA 1KTCA 2WQPA 2D73A 3MP4A 1NFBA 1EUNA 1I2PA 2QAFA 3ABRA 1TPC1 1K7XA 4IMGA 4JTHA 4CLMA 5E0KA 2B0MA 4AAJA 2H8ZA 3MI6A 5F2IA 1NAL1 1VYRA 2P1FA 3LRLA 1H50A 2B7OA 3PB2A 1HO4A 3SECA 2ZRVA 5KITA 1BKSA 4N9EA 2A21A 3HG5A 4M7TA 5D2TA 1PHQA 1H7WA 4O1BA 4GE8A 1Q6LA 4R7JA 2VEMA 3ANYA 1ZJIA 3DI1A 5AC6A 1PVNA 4OV4A 1O4UA 5J5RA 1ICPA 3TROA 1YXDA 3QPZA 4N4PA 2GVGA 3EWYA 2Y88A 2EF9A 4QM1A 3CU2A 2G95A 3DI0A 4TR9A 4KWWA 1LM1A 4JY8A 2CFFA 4M7SA 1KFJA 4IMEA 4HSNA 4WUIA 1OF8A 5DCBA 2VOMA 1KM0A 3CLMA 3GDKA 3R5EA 5LZLA 2ZYFA 5BMXA 3MO7A 4HT3A 3NQ7A 1KV5A 4TO8A 1B4EA 1KTBA 5CPLA 5K9CA 1EWDA 3VE9A 2DJXA 5L6UA 4DELA 4NZJA 4N02A 1VZWA 4EVZA 3OIXA 1KLYA 3EWBX 4OT7A 2H3DA 2RDTA 3W1TA 5CZJA 2A0NA 2FFCA 1KBIA 5LGXA 2W6RA 4HPXA 3L67A 2DJLA 2F84A 1OYAA 4LUIA 1OF6A 1WBJA 2CWNA 2QJHA 3NYZA 3PVFA 3DFNA 4JNMA 2B7QA 1SFJA 1ZAJA 4XKYB 3MUXA 4LU0A 3MJYA 1ICSA 4MJZA 1JR1A 4UTLA 3W7LA 3TK7A 3W2LA 4O16A 3S9YA 3RNDA 5DCDA 1RQHA 3C3NA 3FYPA 2Y89A 1A5AA 2ABAA 1IIHA 3G24A 5G1TA 3W7PA 2W79A 2CLFA 4FO4A 5KZDA 4RZ4A 1OK4A 1TPH1 3PBUA 2QJIA 4A2SA 4O4VA 2CLMA 3N14A 4RKAA 2WSYA 3W7NA 3GDMA 4PFMA 4AMAA 1ZCOA 4XKYA 1H7NA 3P80A 2ZRZA 3LXCA 3GIYA 2ALDA 1YTEA 3OBKA 4HNVA 4MY8A 1K8XA 2YXGA 1LBLA 5HUOA 5G2WA 3DBPA 4P61A 1T8XA 4WXYA 3KHJA 3INPA 4JTSA 4RR4A 3VE7A 1DKWA 4FIQA 4JGDA 1O5KA 1KM5A 3WK2A 3DHDA 5FF3A 2VEKA 2CZFA 1TPWA 1TJPA 3OEXA 2NX3A 4BK9A 4JTLA 1H62A 4FNQA 1KM1A 2V5BA 1HUVA 1UCWA 2CW6A 3O05A 1TREA 2FB2A 3LM7A 3W76A 3W1XA 3NO5A 1ME9A 1FDJA 3G1HA 1W1ZA 1KM4A 3PBVA 1B4KA 3TQKA 3LHZA 3UZ5A 3DFTA 4DF2A 3W2KA 4JX4A 3MYPA 3S8HA 3LLDA 3HF3A 5D33A 4FF7A 1R46A 2NUYA 2JBMA 3ABSA 4GNJA 5IBXA 3BW4A 3G1SA 4JEQA 4AWSA 4N4QA 4CCEA 4JX5A 1XXXA 3BPWA 5DCEA 2H3BA 4ONVA 2HSAA 4I7VA 1DHPA 2QCFA 3TXVA 3QH2A 5K4ZA 3BG9A 3G8RA 1LLWA 1EWEA 2QCMA 4ZQPA 3STFA 3PB0A 3WJZA 5I3GA 5AHNA 3TIMA 1VH7A 4N9CA 1W5OA 4M6PA 1U83A 3LCGA 3CWNA 3O15A 3UWUA 1L9WA 3LBMA 3M43A 1DV7A 3I6RA 5AYXA 5D05A 2V5LA 3FEMA 3QSTA 2A6LA 4UMAA 1JRCA 4QJ1A 3W1LA 1LLZA 3S6DA 1H51A 1FWTA 2CZ5A 2ZRYA 1FCUA 3MHUA 4ALDA 5LGZA 4HN4A 4EOUA 5FF2A 2BWGA 3W07A 2E68A 4S1FA 2ZFAA 1TIMA 2YSWA 2GPTA 2A85A 3QJAA 3LB0A 3Q58A 3IGSA 3TSMA 4UUIA 4JYDA 3B04A 1MO0A 2H90A 3M7WA 2OZ0A 5I3FA 3CB8A 1Z41A 3L9CA 3P5YA 1H7XA 4XTIA 4LVFA 3DKJA 1S5VA 1PCKA 2V2DA 2YFOA 3GR7A 3C2FA 2QKFA 3IIPA 3W2MA 2V81A 1WOAA 4PTNA 2E5DA 1GVFA 3H53A 4NXSA 4O17A 3PUOA 4PC8A 1EEPA 2V8ZA 1GVQA 5D2WA 1B3OA 1NSJA 3EX3A 4LS2A 3STEA 5FF7A 2PE4A 4GBUA 2J24A 1DVJA 1C29A 3W7EA 3N19B 2ZQ0A 1P4CA 3EX1A 3GDTA 1GOXA 2CLLA 4R33A 4S2BA 3SGUA 4WY0A 1J5TA 2OT0A 1X7FA 1P5BA 2Y6ZA 3U8GA 2A2IA 3B03A 1GPWA 2WSQA 5AC8A 2NXIA 2CLOA 3A9IA 5HMSA 2VFEA 5BNKA 4JTKA 4NJKA 3TSBA 2TPSA 3DAQA 4K8EA 4O8RA 1K8ZA 1I8JA 1AW2A 3GXNA 4KFNA 1OX6A 1EB3A 1NF0A 1BTMA 1EP2A 1QOQA 1OABA 3S1VA 5BOOA 3E49A 4OV9A 1MEIA 1UUOA 4N6FA 2G97A 1JUEA 1JCXA 4GWEA 3WFAA 3T78A 3FA5A 4RK8A 4ZVJA 2Z6IA 3P8JA 4YCOA 2J9ZA 1DQWA 2GJNA 1TQXA 3VNDA 3RU6A 3N73A 4Z1BA 4X22A 4DO4A 5DY3A 2ZDRA 3LCHA 3LLFA 3DGRA 1YXCA 2R8WA 3HO8A 5DBTA 3AJXA 4UTWA 1G69A 1JCYA 3N9RA 4HHPA 3TR2A 1SO5A 3IVSA 4CCDA 3CEPA 3IV3A 5AHFA 1XBVA 3LHVA 2NXHA 4ADTA 1MSSA 4MPQA 3QW3A 3NZRA 2C13A 3NQCA 5G4WA 3GNDA 2YW3A 1OFQA 1A53A 2ATMA 4AVFA 2WNQA 2Z1BA 5D2YA 3TQVA 5KZMA 4WY0F 4YWIA 2EKCA 5KMYA 1RZMA 2A4AA 3UNDA 2NWRA 5F2LA 4PEKA 1W5QA 4BI7A 1GG0A 2NV1A 2Q8ZA 4MZYA 3IRDA 1BWKA 3NQEA 2E1DA 2C15A 4UFJA 4LRTA 3I68A 3GLCA 1LBFA 4LTSA 2FQIA 4FX8A 5F1VA 1R2RA 3BGJA 3M5XA 4LS1A 4IWWA 4BF9A 3V75A 2DORA 1XCFA 3P5ZA 2QUUA 4Y96A 3HB9A 1YADA 4NNBA 3FJ6A 3S42A 2QAPA 1ME7A 4K6AA 2WSRA 2JK2A 3QRHA 4MZ1A 3TU9A 1GVSA 1LOQA 1Y0EA 2TMDA 1O95A 1X8FA 1WXJA 5A5WA 1LRTA 3HG2A 1MEHA 4UMBA 1F73A 1VQTA 2PRLA 4O28A 4N2YA 1NVMA 1EX5A 4OBTA 1M5WA 4K7VA 3W73A 4OQVA 4UIOA 1FCBA 2Y70A 2VXNA 4UXDA 1TO3A 3W7DA 3W88A 3BK0A 3PF3A 2Z2UA 3GZ3A 4FNSA 3QPYA 2QCHA 3IIVA 2J27A 1VHCA 1HG3A 3SY5A 3QMSA 3NOEA 5G2HA 1AL8A 5AN7A 3W71A 3LCFA 1QAPA 2XN0A 2QCEA 1OG0A 2ZZ3A 4Z0JA 4M19A 1F6KA 4M6VA 1VGAA 3W74A 1AK5A 1G4PA 4QQ3A 3B8DA 2ZZ5A 4KFPA 4UTIA 1W37A 3KVJA 4O52A 3Q37A 2V0TA 3W75A 1H7RA 2FB3A 4WOZA 3M47A 3FFSA 4A2RA 5K9XA 4WOQA 4NJGA 3ABOA 3T4CA 4BR1A 3PAJA 2QCGA 2LLEA 1H61A 3NEVA 4UTTA 1SU5A 3HGRA 2DZUA 1KFEA 1W3TA 2DZPA 3SGZA 5ABTA 3LDVA 1ZY9A 3UWQA 2WOQA 4UTMA 4TX9A 4OGZA 3A24A 3B0UX 2QF7A 3UY8A 4ORMA 1S5TA 4Z0SA 3NQDA 1U5JA 3CWOX 1ONRA 2CZEA 1AW5A 3P61A 1SW0A 3CTLA 1WBHA 1YDOA 4ZMGA 5F2GA 3W7IA 1VCVA 1F7BA 1SR9A 4XBSA 2I1OA 1X1ZA 1KM2A 4DEFA 1HTIA 2C18A 1UB3A 3NNTA 4WZHA 4JIQA 1VHNA 1DOSA 2QCDB 4BWLC 1DJNA 3W85A 1G7UA 2BLEA 2OCZA 2H8XA 1QPQA 4LOCA 5HQEA 5LNSA 2HMCA 2VEIA 3KX6A 2CLHA 5AYYA 3U2OA 1WYIA 3GDLA 4BFAA 5T26A 1GYNA 1N55A 1IIGA 1LOLA 2Y7EA 4HIBA 2R91A 3W7RA 4KFOA 3PY2A 5CZSA 3EKZA 4FX7A 4HSOA 3WK1A 3L0KA 3BVJA 4RX0A 1FXPA 3LXAA 4CNPA 4GC4A 1LZOA 4Q32A 1W3NA 4QAIA 4ORIA 1IXNA 2ZA1A 3VKJA 1LORA 1GTEA 3QZEA 5D03A 3TCEA 3QYQA 1XKYA
chains in the Genus database with same CATH superfamily
2CLIA 5H8UA 4WY0B 3HV8A 2DUAA 4RW3A 5FJRA 1XV8A 1OYBA 3ES8A 2QF8A 2V63A 2EHHA 2PF0A 3M6YA 4OUIA 4EF9A 2DZAA 3J7HA 2D20A 3G0XA 3O6YX 4NZ1A 3I4KA 4XD5A 2Q71A 4QCFA 5GJPA 1QW7A 4AVOA 3TMQA 1UZDA 4DJEC 3ZM8A 3HPZA 4DPPA 4E0CA 4MWAD 4ILSA 2FDSA 1AQMA 3WK0A 3CASA 3GWQA 2Z4GA 4HPNA 1JI2A 4FF5A 2AOSA 3R43A 1LLOA 2ACSA 2WJDA 7TAAA 3TV8A 1TA3B 1K7FA 3GXTA 3B8TA 3EA2A 4HJWA 1FH7A 2RGLA 1NU5A 3M44A 4E2BA 3POHA 1B2YA 4KRUA 3H55A 4FB7A 4X9SA 1QWKA 4MKVA 2ZXAA 4ZL1A 3BMVA 3IVTA 1JUKA 3QLDA 2E7FA 4N9BA 2REQA 1RA5A 1Q6EA 3LZ5A 1VD6A 1FOBA 2J66A 3I65A 1DORA 3Q67A 3ARRA 3TYAA 4H7CA 3CUFA 3GNPA 1D3CA 5A6BA 2Z1VA 1EYWA 4KETA 2OOFA 3KL3A 5EMUA 1TPDA 1P0NA 4UNLA 3L4YA 4L5ZA 4D71A 1FBAA 1Q6CA 1AD1A 2J7BA 3FVDA 5LHFA 5MHBA 1IXOA 1VCFA 3F4WA 1MQPA 3HQNA 1EEXA 5H1WA 4PA8A 2WJEA 3BSHA 3GVWA 3T42A 2RKXA 3CYJA 2NT0A 4MF4A 1IR1A 2PWDA 5A95A 2JGYA 2J62A 3MBFA 3FV9A 1XW8A 3TYEA 1ZBVA 3T2PA 3QBUA 3HIJA 1TPFA 3MKKA 5CH9A 2R94A 1EQPA 1XG3A 8XIAA 5A69A 1LF1A 3HU7A 2IKJA 5M2FX 4JD4A 1HKMA 1UZHA 5LXXA 4JTQA 3LV5A 3FXGA 1Q2SA 2X05A 1P0KA 3E12A 2G3JA 3SJ3A 3VZXA 1EX1A 3WQVA 1FFRA 2GVYA 5E93A 3MP5A 3AS1A 4DO6A 3UPWA 2HPIA 1TQJA 4DN1A 3E0VA 3CAKA 1T8QA 2E25A 2BMBA 2VD8A 3LV6A 2Y24A 2ZUUA 4OVXA 3TAOA 4B3ZA 1R38A 3PS7A 5XINA 2SFPA 5HWNA 3M0IA 3ELFA 3WLOA 1OFAA 4RE3A 1WQ5A 1UKQA 2WO5A 4H00A 1KQYA 3Q2DA 1Q8JA 3P67A 1TR9A 2J8FA 1QW9A 4KCUA 1IQ8A 1XJBA 3FHQA 4PMDA 4N0RA 2P5NA 2XYLA 5C2GA 3TOPA 4OWGA 4NJJA 5C71A 2GVJA 4UCGA 3WBYA 1CGUA 2GUYA 2HTMA 1DHKA 5D9OA 2CZDA 1WZLA 1YBQA 4J3WA 2O7SA 3RPTA 1WNOA 1UUMA 1RVKA 2H6RA 5CJMA 4HA3A 4Q4RA 5IHRA 3CGTA 1RUSA 1BF6A 2GOUA 4TOQA 1W5MA 4F79A 1XL9A 1F74A 2VURA 5JBEA 2PF8A 2VC9A 3ENLA 4G7EB 1F3TA 3ARWA 1JGMA 3PG9A 3LI0A 4S39A 3E0LA 5HPOA 1AQFA 1DQUA 3N4AA 4LNCA 2YBUA 1SJDA 3CUJA 3RM9A 4Z1CA 4P7QA 3SUSA 1VC4A 1IT7A 3AS0A 3UG4A 3R89A 4PODA 3C6CA 2EAWA 2VEGA 1I0DA 4JIIX 4E8GA 5I24A 1OFEA 3UG5A 1M7PA 2FJKA 1TIWA 1UROA 1LWHA 4WXZA 3ZJ8A 3KBMA 4EXBA 2X1RA 1KRBC 2OLAA 1SZNA 2YA2A 2YB1A 5FJUA 1W5PA 3EX2A 1XIHA 3M6DA 1MRAA 4GI9A 1I60A 4HD5A 1QJWA 3QKZA 1KV8A 1EXPA 1TYGA 3L4UA 1XINA 2V6AA 3HPXA 1BVNP 3AMLA 2ZZ2A 1VYSX 3AIRA 2VHLA 2VX4A 3ITOA 3GZAA 3EMZA 1DBTA 2Z7KA 3CJPA 4C90A 3TP4A 3VFCA 3TXZA 4S3JA 3VGHA 4S3AA 1CZ1A 1E3ZA 3VNZA 3BZJA 1ZU8A 3W6YA 3N9KA 3HGSA 1GOWA 4CNUA 3N2OA 3LRMA 4QISA 2RHGA 5TNVA 5FF0A 5HQMA 2A1YA 3VC6A 2DFAA 4EPEC 1W54A 1Z89A 3PK7A 2Q3RA 3SO7A 3EA1A 1JPIA 1DWAM 2PGRA 3EWWA 2VDGA 1HP4A 3AFBA 1Z8AA 3ZLHA 4YYFA 2INZA 3DYPA 1RQEA 3IGHX 4LPCA 3SCRA 4FP1A 1W8GA 2XGBA 2QUVA 2FGZA 2XM1A 2J78A 1JD7A 3LRKA 5IM51 1XGZA 4C5YA 2OPJA 3VOJA 4C1KA 1YTDA 2CBJA 1LL7A 1CXFA 3A3WA 2DT2A 1LL6A 2X1UA 4JFWA 3RAOA 4DJDD 3C8NA 4Y9OA 3W9ZA 3MI2A 5MKGA 4HPGA 1UBSA 2Y7DA 1S5WA 4C7GA 4KCTA 1E6NA 4MM1A 1CCWB 5LA0A 1F6YA 5LNVA 1NY1A 1UP3A 2WLYA 1JDFA 2CERA 2PWFA 4FNRA 3L4WA 2OO6A 4FPSA 5CPMA 4LAMA 4ICCX 4L1GA 3H4WA 2DV0A 3MWCA 3W2UA 3WL0A 4AD4A 1N8IA 1XIDA 1YKWA 2ZZ6A 3M9YA 3RF9A 4JCLA 4CU7A 3IACA 1Z44A 4MJMA 4NAFA 3AAMA 1EJRC 3FSUA 3WBWA 4AY8A 1XX1A 1VIZA 3FA4A 2H9AB 3UWEA 4JZ5A 2G8ZA 4I3GA 3U7BA 1UW9A 3SCNA 3OZOA 4HCDA 1A50A 3UQNA 3EB2A 3IJ6A 2OG9A 1JCNA 4Z1AA 5CCZA 1E6SM 4L4MA 2XSBA 1WP6A 1XBXA 2O9PA 4DYEA 2E09A 3C2VA 1FWSA 1ADSA 1OC7A 4ZCWA 2QJJA 4DO7A 4A22A 5K3VA 2WVUA 3F4DA 3M0HA 4JTJA 4UFKA 1DIOA 3GO2A 3O1NA 2V82A 2VQTA 4XAPA 2GVLA 2PURA 5A8GA 1HKIA 1BYBA 4NJIA 4RDZA 2YBVA 2RUSA 1Q6QA 3IIZA 1JCMP 2E5CA 1T96A 3U5UA 3KBJA 3BW3A 2WVTA 5H91A 1RPXA 2G3FA 2YZ5A 5JIWA 2ADAA 3HGJA 7ENLA 3A21A 3TJLA 3QQ1A 3PBMA 1ITQA 3D5HA 3TC6A 3RG6A 1C8XA 5ABEA 3U6WA 1XSKA 1XF0A 1KFKA 1A80A 1VPQA 1QOXA 4W7WA 3UZYA 5A8MA 1YYAA 3KTSA 1OX5A 3NAVA 3DH7A 3IJDA 4B5XA 3DESA 4MAVA 2AL2B 3GC5A 1TPUA 1XPGA 3TVAA 5C8BB 5C9ZA 3LPPA 4XZHA 4CQAA 3CHEA 1YIXA 4TVDA 2CYGA 1GOQA 2YLLA 1F76A 5FJIA 1OFRA 4ADSA 2E6DA 3VCRA 1ZHAA 2BG5A 4PMUA 3R94A 3P82A 3RDKA 3P84A 1ZRQA 3B4UA 1QMLA 4J3UA 3PJTA 4S3FA 5AFDA 3VNMA 3IJLA 5HINA 5LNUA 1TTIA 2OEKA 1QR7A 4GK8A 3SCWA 5D02A 2W27A 2Y1HA 4IUGA 5GNZA 1CXEA 1J0KA 3SCVA 1K9EA 1WXYA 3GUGA 5C9WA 3O16A 1OSEA 3OVGA 3FYOA 1CX9A 2C1HA 2NUWA 3LS9A 4GVFA 5LA1A 3OZPA 4ZOAA 1QNRA 1JYNA 2X1TA 4TV6A 2JF6A 3F5KA 1ONEA 1V5XA 1OX4B 4ZGYA 1LG2A 5FA5A 2HROA 4PSRA 2D1ZA 3STGA 3G22A 3H8AA 4G7EA 4YCPA 3QLLA 3EGJA 3AOFA 2F6UA 2YOCA 2W62A 3K4AA 3CLWA 1UD8A 2VFGA 2AQVA 2ZUTA 4GCAA 3BTNA 5M5DA 3U48A 5I09A 1RJQA 1WKYA 4XQ6A 4O0ZA 1SW7A 5BMWA 3F1QA 2YCJA 4XBKA 1Q6GA 1XLHA 5CLTA 1US0A 1GQJA 1RH9A 5HR7A 1WAWA 3PUDA 3CPGA 1G67A 2OQLA 1R3SA 3N3TA 4AIUA 2RJHA 5LSMA 1UWIA 2VFDA 5CPTA 4IZGA 3M1ZA 2WK2A 3FIGA 3UXAA 5BOFA 1E3XA 1ZAIA 1KRMA 3CL7A 3UZXA 4CNOA 3PULA 3EKLA 4W86A 3NZ1A 4ML9A 1X6UA 4G7FA 3T40A 2OFJA 1ZNNA 2JE8A 1J10A 1S39A 4Q8MA 1TFVA 1OG6A 3ZFHA 2ZUSA 4OBSA 2WPBA 1D8CA 1RAKA 4I9AA 1A4LA 2VJXA 3RRXA 2C14A 1LUCA 3ARTA 5HJYA 3SN0A 1S3HA 4LY8A 3W83A 5I03A 3V0UA 4V1YA 1JCLA 2OX1A 5AYBA 1CIUA 2E1WA 3NL2A 1M41A 2C19A 2NV2A 4G6CA 4XZLX 2YCLB 2ZWZA 4ECLA 4Z08A 1Q5MA 3ITVA 3B8SA 1K8YA 2UV8G 4XUGA 4IPLA 1WO2A 4LRSA 3QV9A 2I5GA 3N29A 3LZ3A 3V5CA 3NDZA 3S3GA 5CPOA 1AJ2A 2IPFA 4TTGA 3NWRA 2XIOA 4JYEA 1TX0A 3DGBA 3FKRA 1Z42A 1WZAA 4FR1A 1TMQA 4WIWA 2XM2A 3MHFA 4EP8C 2E6AA 3ONBA 4AWUA 3LTSA 2GDQA 1EBGA 3N34A 3LN3A 4C6EA 4H9MA 1L6WA 5AYZA 2WBKA 1CLVA 1S46A 3NQVA 3TR9A 3QQ0A 1YHTA 3WEZA 2F8QA 3O06A 4AXNA 4MLJA 2ZA2A 1DIDA 4HN8A 3CUGA 3AIUA 2INFA 3ARYA 3H2OA 1QVBA 4FI4A 4GYPC 1C9WA 3WQDA 2QT3A 3MVTA 3CEUA 4PB5A 1B30A 2BFGA 2ABBA 2WMJA 4MNJA 4MIMA 3FDGA 4QAWA 3BLOA 1SZRA 3A5FA 3PTMA 1TJ0A 1ZAHA 1P0DA 2QUTA 1XLJA 1WKEA 1IE7C 4A3YA 3GIPA 3BLDA 4NX0A 4C6KA 1B0IA 2B4GA 4HNTA 3VFLA 1L2UA 3H2EA 5A6SA 1W17A 2IQTA 4FK9A 1Y8BA 3B8UA 3G0UA 2BVTA 3CPUA 4S3EA 3PZUA 4JTIA 1VFHA 2W9MA 4MZ8A 5CZKA 1JDEA 2ZA3A 3VAVA 1KXQA 4B5UA 4DBEA 1DXEA 2PGFA 4D6JA 3I7RA 5LNWA 5KSWA 1IWAA 4K8HA 4IXHA 4U4MA 2Z25A 1I2RA 3DHFA 1KM6A 4B92A 1PO9A 4P8UA 5FL0A 3HGOA 3O7UA 3KOYA 4F48A 4EAYA 5FEPA 4C7DA 3EDDA 4Q8TA 2QCCA 3ANVA 4A3QA 3IIXA 4IP7A 2XDFA 4WX2A 1XLAA 2XN2A 5F2MA 1TCDA 4GI4A 4FSAA 4MWAE 5KETA 1C8YA 4N9DA 4GH1A 3FXYA 3UG3A 3QF0A 1DWGM 2GSEA 4OU1A 4D6EA 3UPBA 1XYMA 4GUHA 2PP1A 4LYKA 2HNEA 4TX6A 1BWVA 1CGXA 3WH8A 2BOGX 2BV9A 3NVTA 3GD6A 3GKAA 3N17A 4CVWA 1HGWA 1QWGA 3VGBA 2GVEA 1NWUA 1K4GA 2FMNA 3NQ8A 1B3YA 1PHWA 1E6PA 5B7ZA 1ZFJA 2HRWA 4HB7A 1BFNA 5EMKA 1I2QA 4L9YA 2WCGA 1SFLA 3H7UA 1O60A 4YMZA 3MMTA 4HJFA 3VO0A 1ZUAX 2PRMA 5K7JA 4H8HA 4D1JA 3UCDA 4QG9A 3GXPA 2ISWA 3OBAA 3BURA 2DZWA 1KW1A 2W3ZA 1XD0A 1L2QA 1AG1O 3THUA 3ATZA 4ERGA 3BMXA 2C79A 1J12A 3WLQA 3AU6A 2X1SA 1X6NA 4GJJA 2FDMA 3NXFA 4QEEA 3O8AA 1IZJA 4NIRA 3EWCA 3WLPA 1XIMA 2E6FA 2YX0A 1GYLA 3MUAA 4J3ZA 3WNPA 3PHAA 3KOWA 4JQ1A 4EE9A 4FXSA 1UZ1A 4M51A 4Q8OA 3LBCA 1KTCA 2X7WA 1YEYA 3AIBA 2Q02A 3MY9A 1EUNA 1I2PA 1JDAA 1CECA 2QAFA 3ABRA 3ARUA 4J3TA 1K7XA 2J47A 3LGGA 4HMCA 4AD0A 1OM0A 3ZLFA 3NTYA 3H6OA 3WFZA 2IPJA 6CGTA 1GNXA 2DT3A 5F2IA 3M0VA 5EBAA 3LRLA 1XCWA 1HO4A 4B5VA 4EXQA 2XH7A 4AU0A 4DI9A 4O1BA 4GE8A 4Q3MA 1ZJIA 1PKLA 4OV4A 1KCKA 4BKNA 4N4PA 4CD5A 2PBOA 3TZFA 3T0TA 3CU2A 5CSUA 2VX7A 4ZB0A 3CWHA 2CFFA 3JZEA 1UKPA 4QXIA 3DFYA 1OF8A 4KS0A 3KWXA 3GDKA 3R8HA 3CLMA 3R5EA 4IG2B 1V3KA 5LZLA 1NJJA 3OYXA 1BSLA 3MO7A 3T0DA 4BQ2A 2I56A 2TODA 2VZOA 3UCQA 4R9XA 4GX9A 4J4KA 3VE9A 3BCDA 4N02A 3EWBX 4I9TA 3NQBA 4OT7A 5AYIA 2Z1WA 3BOLA 1SM9A 3E2VA 2F84A 3AQUA 4U10A 4F40A 1MQRA 2PLCA 4XKYB 1SFJA 2WVVA 4MJZA 4AEEA 1EZWA 1W1TA 2PDHA 4M80A 4XSLA 3R11A 1RQHA 3AYTA 2O56A 3FYPA 1PTGA 3SCSA 2Y89A 1A5AA 3RHGA 2ABAA 3BQ5A 2GDVA 1BGAA 3K4DA 5A6AA 3DECA 2NLYA 5KZDA 3DC0A 3PN8A 3C3UA 3VKAA 2E40A 4GVHA 1VBRA 1PDYA 3RPDA 3OW1A 4M24A 1EO7A 3GDMA 5I77A 3P80A 3E2RA 3JVAA 4GJIA 1YTEA 2QHAA 4H04A 2QMKA 4XIAA 1LBLA 4B3LA 3M0KA 3T8LA 4P61A 4WXYA 3INPA 4JFUA 2VVSA 3BQ6A 3VE7A 3BAYA 1DKWA 2VGFA 3ANUA 4BY3A 1LUCB 2ZUNA 4Q4OA 5FF3A 2VEKA 1TPWA 3CXOA 2C91A 3AWOA 1OGGA 2VCCA 4JTLA 5EMLA 4GNKB 5BXSA 2IKHA 4IHCA 2ZVRA 4GQRA 2CW6A 4WCJA 2VC7A 4KF1A 3W76A 3SCOA 3W1XA 5DT7A 2IXUA 3N12A 1KGXA 2ZADA 2CHNA 2R6OA 4B2DA 3DFTA 4DF2A 3S2NA 3MYPA 2QS8A 4B15A 3VNJA 5D33A 2OZTA 3WELA 3CZKA 4F4RA 3G1SA 4AWSA 3RXZA 2DSVA 2OGYA 4LFYA 1E4IA 4LH8A 4GIAA 5DCEA 1DHPA 3ALGA 4BQ3A 4ROQA 3N04A 3WDIA 2PPGA 3H70A 3BGAA 3APTA 1EWEA 4KWUA 5JQ9A 2O4QA 1KWKA 3STFA 1ISYA 1VH7A 2EPNA 1XQLA 5LYRA 3NVDA 3UWUA 3OHMB 3LBMA 1RXOB 3WQOA 5AYXA 4QE5A 2R1LA 1MXGA 2WSKA 4DUWA 1UR4A 3E74A 3R79A 3W1LA 5HNNA 1A5LC 1XRFA 3MU7A 1LLZA 2XVKA 1BXNA 2P3EA 4ALDA 2ZRYA 1VFUA 1Q13A 4E8CA 1PX8A 3EDKA 2ZFAA 2YSWA 1HJQA 3QJAA 4K2SA 3UYIA 2MUCA 2V68A 3GRIA 4J40A 4W5UA 3CB8A 3NJ3A 5LIKX 4TVCA 3RPMA 3F4CA 4LVFA 4ERIA 2DVXA 2CNCA 4HTYA 3W2MA 2V81A 1SVDA 4WRHA 3GQYA 1GVFA 3H53A 4DWSC 1EEPA 2V8ZA 1V03A 1SFSA 1QK0A 1XIEA 3COTA 1UJQA 3STEA 3CZGA 1U22A 5C9UA 2J24A 3B9AA 1TCMA 3MMUA 4FS9A 2ZQ0A 1P4CA 2RGMA 2AAAA 2PDLA 4R5EA 2G4FA 1R7AA 1PYFA 1J5TA 2GWGA 3DHPA 2BHUA 1F4AA 3L4TA 3SAZA 3VDAA 5AC8A 5HMSA 2CLOA 3A9IA 2WXDM 1Y7VA 2ZX8A 1QNOA 3TSBA 3ZZ1A 4O8RA 3GXNA 1OX6A 1EB3A 1UR3M 1NF0A 1SJAA 2V5KA 1FHLA 5REQB 2I17A 1BVWA 3E49A 1S5NA 3VCNA 4N6FA 1XLDA 4GWEA 3WFAA 1KKOA 4ZVJA 3RU6A 2XPKA 1U5HA 4X22A 4YHEA 4JHZA 5DY3A 3VIIA 2HISA 3LCHA 3GHSA 1PZ2A 5DBTA 3UGVA 4BQ4A 2GJXB 3AJXA 4UTWA 3CQKA 1PAMA 4HHPA 4AZHA 3GM8A 1SO5A 3CEPA 1E4LA 1GOKA 4MNKA 3L4ZA 2NXHA 2PWEA 1H09A 1OIMA 1LT8A 1DWIM 1S1PA 3GNDA 1OFQA 1QHPA 1KXVA 2CC0A 4RE0A 4R7OA 1GZJA 5KZMA 4V28A 1OZMA 5KMYA 2A4AA 2NWRA 1W5QA 4BI7A 1GG0A 4J2PA 1NQ6A 1G94A 4DZ5A 4XD3A 2YL9A 3OOQA 4Q4PA 5GJMA 5AECA 3H12A 2C15A 4UFJA 1BQCA 3ZR6A 5BWFA 2FQIA 2YDRA 3CAVA 3CUZA 3BGJA 1PWLA 3M5XA 3C0QA 2DORA 3N6HA 4XKMA 4H83A 2ZICA 4OOUA 4JQ2A 4ZO6A 2QAPA 3MUZ1 4PCNA 4C91A 3CO8A 3TU9A 2TMDA 5ECUA 1LRTA 2DSKA 2PRLA 4O28A 2D0HA 2D0FA 1NVMA 3EEZA 4KMQA 1M5WA 4QDPA 3CZLA 2Y70A 1R3WA 4OFCA 1SR0A 1QI5A 1NDYA 3EBVA 4I8DA 1OB0A 2PDUA 2XTKA 2J27A 3KBNA 2BY0A 2FVMA 1Q7QA 3QMSA 2HDJA 4WR3A 5DMLA 4IPPA 1GK8A 2C1IA 3D6NA 4V33A 1VBUA 4QP0A 1Q7ZA 4EPKA 4XD4A 4AWEA 1MWOA 4W4QA 3IUDA 3W24A 3SQLA 3T9PA 2PLJA 3GC2A 3GXMA 1W3KA 1Y5VA 4O52A 3Q37A 3GTFA 2ISDA 1MQQA 5FJTA 1GGOA 4P7OA 2VRKA 4WOQA 4LEQA 3ABOA 3P2VA 4S3DA 4C6IA 3T4CA 4BR1A 2XH2A 2X7VA 4UTTA 4I5XA 4F66A 1JI1A 1R6WA 3CV2A 3LDVA 2WOQA 3C0SA 4GNVA 4OGZA 3QR3A 3OO2A 2CZEA 4DJDC 1SW0A 1UD3A 4AY7A 4E2OA 5F2GA 2IW0A 1BLIA 2ZX9A 1SR9A 3G5EA 2WZIA 1X1ZA 4AIOA 1UB3A 4WZHA 4PUUA 4Q7IA 1DP0A 2HVNA 3MZNA 3GW3A 1QTWA 1QPQA 5BXTA 5LNSA 3NOYA 3AICA 2CLHA 3QZ6A 2F2HA 3EWDA 1GJWA 1HKVA 1LOLA 2R91A 3W7RA 2D2JA 4QGCA 5CZSA 1PUDA 2FZ8A 4HMNA 2WWCA 3BVJA 4TVUA 1FXPA 5LIUX 2Y5SA 2QLYA 2VWTA 1W3NA 5XIAA 3CMJA 4PUKA 4FOUA 4DXXA 2PZNA 3QYQA 1N2VA 3VM7A 5AKQA 4IMDA 1LDCA 1UKOA 1C9DA 2X42A 4C6FA 3GSMA 1E1EA 1VJIA 3RLGA 3AXIA 3AMCA 4NQ1A 2FZDA 1LG1A 3EPMA 2Y2WA 3ITLA 3E0FA 4LBUA 3THAA 2VNCA 3GFZA 3EWZA 1A5BA 2HQAA 4IGHA 4W8BA 1M03A 1HL9A 1K4HA 3SFKA 4HZMA 4YN5A 2NX1A 4KEMA 3SCQA 2POZA 3FOKA 1U5VA 2PEVA 4I9JA 3P8IA 2PCQA 4Z2KA 3A3HA 3EXRA 3JRKA 4MY9A 1JULA 1WOBA 1DIKA 3LMYA 1B90A 2CWXA 3UWVA 1H3GA 3TN4A 2CPUA 1FWRA 4AX7A 4UQ9A 2R1NA 2IKIA 4ROPA 1CW2A 2IS7A 2WC3A 1RBOB 2YFNA 2W61A 4QLKA 4DVOA 5FF4A 5TIMA 1KKRA 5G4EA 1TE6A 4KESA 4EAMA 3ZR4A 5FKYA 2QV4A 2AAMA 4IXXA 3WD0A 3R0UA 4IMCA 2R1MA 3I4EA 2GYIA 3QSRA 5CSYA 3QPEA 1S2CA 4AF0A 4E5TA 3I7SA 2VZVA 2YYUA 3GNNA 4MFDA 5CPNA 1H60A 4O10A 4XZWA 1PJ9A 3MDWA 2CETA 1IGWA 4RPQA 1XISA 2G4JA 2QCDA 2XIIA 1R8LA 2DH2A 4IL0A 2XSXA 1V77A 1R3YA 3HMJG 3WJWA 2A3HA 4LUTA 1XLIA 9CGTA 1WV2A 4K39A 3CV6A 4J3SA 4E2DA 2P0OA 1HO1A 2ODOA 5T91A 1BRLA 3W7MA 3RU8X 2Q6ZA 1GONA 2WHMA 4WDTA 4UR7A 1TV2A 1H5VA 2ZX5A 1GQNA 2GQ8A 5HWJA 3S5NA 4Q7BA 4BF5A 3PG8A 4ZR8A 5DMMA 1DXIA 4H2HA 1E0VA 4TMBA 2XVNA 2A7PA 4D1IA 4RE4A 1QI3A 3IJIA 4JTFA 1VFLA 1YE6A 1CGWA 1SMAA 1H7PA 3SW6A 1MVYA 1P48A 1ELSA 5FACA 2BODX 5A94A 1RQBA 4J3VA 1TMHA 3ORWA 4UTHA 2I7GA 3W23A 1W1B1 2J4GA 1D9EA 3KL5A 4IPNB 3L0NA 3VXGA 3M5VA 4JTRA 4U5IA 3OZMA 3ZWSA 2F7FA 1OFOA 3W1NA 1R30A 5EYWA 5E1QA 3TH6A 1YPFA 2B81A 3W87A 2PDKA 3EB4A 1K03A 3N9SA 3SIZA 4O1DA 2WQDA 4FA3A 3VNKA 4CNSA 2QIIA 2EBNA 4HA0A 2KZHA 4QDWA 3THQA 5FESA 3UWYA 1PKNA 2WMIA 2ZRXA 3D3AA 3T0BA 2DSWA 1H4PA 2EG7A 1E1CB 2XHYA 3NURA 4M1RA 2X0HA 2Y8VA 3MBDA 4UMCA 3EXTA 3NPXA 3IGUA 2NWSA 4PBEA 3TFCA 4RV8A 3U3HA 3TDFA 2PU1A 4X2RA 3EEGA 3KP0A 3OLDA 1JL8A 2G41A 3WUFA 2OLHA 2QXWA 2FGBA 4OBRA 2I57A 3WNOA 3KDOA 5BXPA 4ZQNA 3QR1A 2VX5A 4J9JA 1J18A 4IG2A 4CQBA 4O13A 5HQLA 3W2JA 3ABXA 3NPUA 1SSGA 2VFIA 3NUKA 2VEFA 3UJFA 2PDCA 5IOBA 3M5YA 3G3DA 5EFFA 4S38A 2ACQA 1CWYA 4DBDA 3W82A 1MYRA 1YTKA 1JQXA 2PZ0A 4H8VA 4PCTA 2BGNE 1E40A 1XR2A 2VTFA 2VCBA 4OIFA 4DAIA 1XUZA 2BTMA 1ISVA 5LHEA 1SGJA 4JY9A 4MSSA 3TQ0A 3WLSA 4YTRA 3PAOA 1AZ1A 4HYVA 4WDUA 1PSCA 3WENA 1OBAA 4LUTB 3SRFA 3WLRA 1X1OA 1Z6KA 2L5HA 4NYYA 4UFHA 3GAKA 4LV4A 3WD1A 1EO5A 2BXZA 2PGWA 4LYPA 3DENA 3ZS4A 1QPKA 5BU9A 4M6QA 1I2NA 4ATLA 2QYGA 3R2GA 5HUPA 3DUGA 1PPIA 2CXGA 1OFDA 3R8GA 2J7GA 3MW7A 5CZTA 2QVNA 7PTDA 2RJGA 2WMFA 5CAKA 2CBIA 4I7UA 4GFSA 1NWTA 3C56A 3U7VA 3I7QA 4UNIA 1QASA 3D47A 2CLPA 5HR6A 2ACUA 2FZBA 5LIWX 5C54A 4EIVA 1PL9A 3A4AA 3IJ7A 3CC1A 4XAZA 5DXXA 1FVPA 3AIWA 2ESCA 3GXIA 1CXHA 4C60A 2NQZA 1GPFA 3FNDA 3UXIA 3WEOA 1Z69A 4JIEA 1IR2A 2GSJA 1SUXA 2PD9A 2XJ7A 4AMCA 4IPIA 5CGQA 5EMJA 1WDSA 4H9XA 4PTXA 4ZENA 4J35A 1CB2A 5TQLA 4PGLA 3KWSA 2BB0A 3H4GA 3DG6A 2H9AA 5CC6A 1HXJA 4Y8EA 1P1MA 1GWJA 3HA1A 4H01A 4AEFA 1LYXA 1KBBA 1U1UA 2XH0A 4W89A 1A5OC 3SQMA 3EXSA 3SRHA 4RDWA 1V51A 1UD2A 3T7VA 5I02A 4FIRA 5CGMA 2IMRA 4H9VA 2EPMX 1TZ9A 1VEOA 2WMKA 3HQPA 2NQ9A 4JTEA 3GS6A 1HZYA 3NSMA 4LVGA 4M82A 1QHOA 2VEPA 1MEWA 1QPRA 3QOKA 1VLIA 4MJ2A 1EA0A 1P6BA 3AHVA 4XZBA 3BC9A 2Z27A 3OLEA 1HKJA 3ECQA 3IJ8A 3ZMRA 4GUFA 1TPEA 4GUIA 2CZVA 2A7RA 4R3UA 3CV7A 1M3UA 3E2SA 4G8TA 4ZFMA 1FP9A 2PDBA 3BJTA 1NFGA 3B06A 4G1KA 3WFLA 5AC4A 2A5HA 1J6PA 3FJLA 4GQQA 4IP5A 4HHLA 4AZIA 1W3HA 1MZHA 1DTNA 1MFVA 1MW0A 3KRBA 4RJEA 1GOOA 5JH1A 3AYVA 3RR1A 3P0XA 4QHRA 4BWLA 3LPOA 2ANUA 4L1WA 4RXGA 1E15A 1Q7MA 5FOOA 1K9FA 1REQB 1P6CA 2Y7FA 4XVEA 3M7SA 4LXFA 5H6HA 1CBGA 1LOSA 2PFHA 3WBAA 4IX0A 3W53A 5HNUA 3RX4A 2OJPA 3DU0A 3L68A 1P0BA 3NXLA 3ZVHB 1I9CB 3O2LA 1Q85A 1X8CA 1R3TA 1Z7AA 3ERPA 4DWSD 3QV6A 3W1AA 3TW7A 4JTAA 4JFTA 1E9LA 4RZ6A 2XN1A 2A6NA 2EG8A 4PMNA 4RW5A 3R25A 3TZNA 1W2VA 4QX4A 2J6XA 3GY1A 2WZMA 3OPSA 4N42A 5KTLA 2CKSA 1R86A 3MSDA 3N2MA 3H2NA 4JS3A 2Q01A 3TN3A 1JYWA 3FLUA 3V35A 1HT6A 1R47A 4DIAA 1RA0A 3LCLA 4S23A 2PTZA 2OVLA 9RUBA 5L9FA 4JKMA 2WANA 1JFXA 4ATWA 4QROA 4UQBA 1JJKA 1RCQA 3KZPA 3RLVA 1S3TC 3GX9A 4HHMA 4CCCA 2PSNA 3YPIA 4N7QA 3F5LA 4H9TA 4UOZA 3HFYA 1H63A 4CN6A 3QGAC 4O4WA 3B8IA 1NP0A 4ZBCA 2JKEA 5AHEA 3L65A 2JKAA 3NL3A 2W4XA 3NCOA 2OXNA 2ZTKA 5CKSA 2GJLA 4E3VA 2BXVA 1QI2A 3S2MA 4ACYA 3HBLA 4H7VA 2YW4A 4NI3A 4Z2LA 2VGGA 1RALA 3FW6A 1X38A 1IF2A 3B4YA 5E0FA 1E0UA 1DIEA 3WJYA 4D6FA 3ARVA 5E0CA 1P6WA 1ZBWA 1MDRA 1XSJA 3S1GA 1W0MA 1ECEA 4YVVA 3OVPA 3AS2A 4A6GA 2JEQA 2P76A 3VOFA 3MHGA 3T2QA 1BG4A 3S2JA 4JL2A 1O5QA 2PTWA 1B9ZA 3KOFA 3W7HA 2ZOXA 3S1XA 4HCHA 5D04C 3F4VA 4C6PA 3VOHA 4S3BA 3MMWA 4Y9NA 3G6MA 3LSCA 4JTCA 4PMXA 1XM3A 4K38A 5CXPA 3C4UA 2XFFA 2RDWA 4DO5A 1H1ZA 3NM1A 4Y9AA 4KKXA 1FKWA 1XIJA 1R3RA 1XLKA 3L5AA 4Q8VA 1XC4A 2V9DA 4H6EA 1SZGA 2MNRA 2IPWA 3R13A 2QQ6A 4MFEA 1MXDA 3QMTA 4ZOEA 1OY0A 4INFA 3CM4A 2Q09A 4Z17A 3WIJA 1G4SA 3MP3A 3VKDA 1PE1A 1V7AA 5A6JA 2PLMA 3GYEA 5JVLA 3M5ZA 1QNQA 4O50A 1FP8A 1NOWA 4NSBA 1MUCA 4MPKA 5DBUA 5EY5A 3AXKA 2D2OA 2WC4A 1F5ZA 3UG8A 3M0LA 3M0JA 3OVQA 2RAGA 4HP5A 1EF3A 2TRSA 1TR1A 2CCRA 2DVTA 3R0DA 2GOKA 1D7KA 4D9PA 1LROA 2ATSA 1IT0A 4MYAA 4MLRA 1Q6FA 2FMOA 1IV8A 3SRKA 2D24A 4J27A 4B9YA 4IH3A 2QGYA 1KBJA 1WXZA 3RIKA 1SZEA 2P3ZA 3QQWA 4YPJA 1ZB5A 1EPVA 3KCOA 2E77A 5C70A 1K3UA 1BQGA 2J9YA 1XIFA 1X97A 3LX9A 3AXHA 1RSCA 4PUMA 4U2YA 1BWLA 3PNUA 4RXFA 4MUZA 3W6MA 4MKSA 1JGIA 2OODA 1E0WA 1JUBA 4E3TA 2WKJA 3AO0A 2QVHA 4FXJA 2P8CA 2HS8A 2VO5A 1U2YA 2FLIA 1J9YA 4YLWA 1J01A 4D6HA 1XDJA 3L12A 3A4WA 5I3JA 1FH9A 4IQJA 4NZ5A 4ZO8A 1QO2A 5AZ0A 4PMQA 1FUYA 4CKQA 4IM4A 1UPMB 3L2LA 3CQIA 1W31A 3T4WA 1QOPA 2ZXQA 4CGTA 3E96A 1EGZA 1O12A 3MYOA 4A8LA 4O57A 2PWUA 4UTWC 4HOXA 1KFBA 3FJNA 3G2GA 2BVYA 3VDBA 2PP0A 2YCKX 1TA3A 4JDYA 3TNBA 4RNFA 1GZ1A 4QSHA 3AUJA 3S1WA 4Y8FA 3SFWA 1TUFA 2HWGA 5AHMA 5K4XA 2G96A 4ZSUA 1JEZA 1XLLA 2OELA 4AHPA 1H49A 2OSXA 2XGZA 3W28A 2Z24A 4ICNA 3LCWA 1MZRA 4F8XA 4CD8A 3GR8A 1LCOA 1LP6A 2E9MA 5DEZA 3KRZA 1JZ6A 3MSRA 3MV11 4A29A 1XFBA 1MXSA 3DKLA 3CQJA 3BAIA 1TWIA 4DBSA 3NQ6A 3BO9A 3F2DA 2CLEA 2G5WA 1BXBA 2XSAA 1JZ5A 3THCA 4P7RA 4IMAA 3XIMA 3BLIA 3UYCA 5C2CA 2DZBA 4O54A 1E70M 1S5MA 1UH2A 3VD9A 3FGCB 2ACRA 4PCPA 1MDLA 3KVMA 1KFWA 2ZUVA 2OSWA 3AMGA 4LNYA 4B90A 4D2JA 1Q6DA 1OFBA 3TE9A 3URAA 4AW7A 2E0PA 1HIZA 4MKNA 4U2ZA 1M9HA 3NL5A 4F0SA 4HCLA 3O3RA 1N8FA 4A3HA 4R53A 3M4HA 3T07A 3TEVA 1UR8A 5EBUA 1PCWA 5AVNA 3LMZA 5EGRA 4KT2A 1EUAA 2VZUA 3ZT5A 3SY8A 4A21A 1R2SA 1W91A 3CB3A 4QRNA 4JXCA 5I0DA 6ALDA 3T2OA 4EPBC 1QNVA 4DBWA 4DF1A 4IPJA 1RV8A 1UZ4A 1X7IA 2DIJA 1VBJA 5PTDA 3WMLA 4E8DA 1EP3A 4C5ZA 5C7HA 4GUJA 3AUOA 4ZQRA 5F4XA 3HPSA 3URNA 4UTKA 1JXJA 1ZQ5A 3GB6A 2PDWA 2IUZA 1IXPA 1JZ3A 3G1FA 3K8LA 4RPPA 3C61A 2X0SA 4XISA 1EJWC 3STCA 1FQ0A 1PZ1A 1KCXA 5CLWA 2CBVA 4FXRA 3PSWA 2X16A 3ZOAA 1J2WA 1PYMA 3A22A 6XIAA 2QCLA 4HNLA 6ENLA 4QFUA 4O0KA 1M6JA 3VX1A 3DFSA 4PMVA 4PB4A 4WSKA 4S2CA 1BXCA 4H3DA 3HJZA 1VLWA 1HNYA 3WY1A 3VMPA 5J8LA 2PDGA 1IWBA 2WB5A 4EACA 4B3KA 4GPNA 1XYLA 3WH6A 3T0AA 4QJ4B 3S4TA 1KBKA 2PDIA 3MV01 1NAL1 1VB9A 3NSXA 5CEWA 1IHIA 2B7OA 4FLOA 2OWCA 2ZRVA 3SECA 5KITA 1BKSA 1WDDA 3VYLA 2CIPA 3A4XA 7XIMA 5D2TA 3CNYA 3LY0A 3OLIA 2E67A 4PUWA 3AALA 2YXOA 4R7JA 2VC5A 1RP8A 1BF2A 3M0MA 1FWHC 3TLQA 1IZCA 2WHLA 3PJUA 5J5RA 3TROA 3VKCA 3PPCA 3EWYA 4PTWA 2Y88A 3M64A 4W87A 4AZ7A 1ZL1A 1M7XA 5CC5A 4KWWA 5I00A 3BICA 3TN6A 4M7SA 3OLGA 3E6EA 5DCBA 3TLLA 3SSZA 1UKTA 2VOMA 3KW3A 4GKTA 3BWWA 2ICSA 4KGJA 3OQEA 1Q8AA 3NQ7A 4HT3A 3N25A 4TO8A 1DXFA 1UWSA 4FAMA 5K9CA 2DJXA 5A8NA 2OTDA 3LPFA 3R6IA 3BZGA 3TTEA 3W1TA 2A0NA 2FFCA 1KBIA 2W6RA 3FAXA 2DGAA 4HPXA 4DJFC 1QHZA 2WWDA 1OYAA 4Z1YA 3WCZA 4AISA 1OF6A 3GH7A 2CBUA 2CWNA 1P7TB 1HJUA 3DYOA 4LU0A 3TYUA 4XO6A 4TQTA 4ZO7A 4CD7A 1RY0A 1BRLB 4UTLA 3WMCA 3W7LA 3TK7A 3S9YA 1CGVA 3POCA 4R27A 4AYSA 2CHRA 1A5MC 3WQGA 2CITA 2PDNA 1MFUA 4GO8A 4GA8A 3VOCA 3W7PA 3E5BA 2W79A 2CLFA 4FO4A 1XLGA 4A2SA 3UT0A 2ZDSA 2CLMA 2PDMA 4QQUA 3N2CA 1ZCOA 4XKYA 1A0DA 4J1OA 2BBFA 1XS2A 3GIYA 4AD2A 3UPMA 3OBKA 4HNVA 1VEPA 4YYCA 3GU2A 1RBAA 3U9IA 1CGTA 1T8XA 1EZ2A 1XLMA 2PDFA 1UQYA 4JGDA 2V67A 1FFQA 4LBRA 3WK2A 3F2BA 2PCEA 3DHDA 4AY1A 3V5FA 4FALA 2ZUWA 1H62A 4FNQA 3AISA 1HUVA 3O05A 3W38A 4DY1A 1TREA 4M3PA 4MMWA 2FB2A 4XO7A 3NO5A 3LSBA 4I5UA 2BS9A 3PBVA 2R82A 1B4KA 3UZ5A 4G56A 3NSNA 2E9BA 3V3WA 1C91A 1S2VA 3S8HA 5MF5A 4FF7A 1L6GA 2JBMA 3ABSA 4N4QA 4CCEA 4PBFA 4DUOA 4GO9A 1J79A 4D8ZA 4I7VA 4UOJA 3QH2A 1LLWA 4DUXA 4WSJA 1XIIA 4CEUC 4YHGA 2QCMA 4ZQPA 2J7HA 3WJZA 3PB0A 3TN5A 4F0LA 5C9RA 3CUHA 2RDXA 2OLSA 1T7LA 2ZUMA 1ZP4A 2IXVA 3M43A 4CN4A 4X63A 1DV7A 1MW3A 2WYSA 2B31A 4AX6A 5D05A 2V5LA 3FEMA 2A6LA 2W67A 4QJ1A 4DZIA 1NM9A 3S47A 3S6DA 2G3IA 2HV5A 1FWTA 1FCUA 2FGLA 4JBRA 2Z26A 4EOUA 1EC8A 4HTBA 3L4VA 3LLXA 2PD5A 2R24A 3RO8A 5CG0A 4ZTYA 3LB0A 4H6QA 3Q58A 4UUIA 4JYDA 3B04A 2WZEA 3IJ9A 1PX3A 1A4MA 3OG2A 3RCNA 4DBUA 2JIWA 2F2KA 2QDEA 4K68A 4D6DA 1XRVA 4V27A 4DM1A 4C6NA 1PCKA 4GINA 4YU1A 1YNYA 3C2FA 3TYZA 2DY3A 2QKFA 1V93A 3BAWA 5XIMA 1ODZA 1H0GA 3PUOA 4PC8A 3GG0A 4PUNA 1NSJA 1V0MA 1UP0A 3VUSA 1DJYA 4GBUA 4NKCA 3W7EA 4GYFA 3EX1A 1ZS2A 3GDTA 5GNYA 2CLLA 4S2BA 4YTTA 1HJSA 2HJPA 4WY0A 3U0HA 1L8PA 4C6BA 2OT0A 2JQXA 1X7FA 4L4PA 5RUBA 3B03A 4QEHA 1HN1A 1DJXA 4Q6JA 2J7FA 2WSQA 3MUY1 5BNKA 2D22A 4W93A 4CVUA 2YCLA 1O1ZA 2TPSA 3VIJA 3UA4A 1I8JA 1AW2A 3UETA 3LNPA 1NDWA 2E3ZA 1BTMA 1EP2A 1QOQA 2FYMA 4RNJA 1ECQA 1OABA 1GKRA 1X96A 2IKGA 1MW2A 4Q4QA 3IS4A 4XD6A 4YVXA 4OV9A 1MEIA 1JZ4A 1UD4A 1JUEA 4GCXA 4RK8A 3RN6A 4PE8A 4YCOA 2O4MA 1TQXA 3VNDA 3N4EA 3REQB 2OZ8A 4Z1BA 2ZC8A 1UG6A 4DO4A 5BWAA 3HO8A 1KBLA 3XINA 1G69A 1YRRA 4M6UA 4CCDA 1A3HA 1XBVA 3ARSA 3FEQA 4WEVX 1CNVA 2VUNA 1MSSA 2ZX7A 1F4HA 4LYQA 4FXFA 4K1WA 3NZRA 2C13A 3VZZA 3WQ8A 3CTTA 5G4WA 3NGFA 1V4YA 2IPGA 1TJ2A 1VBHA 2WNQA 2Z1BA 5D2YA 3TQVA 4WY0F 1XIGA 2EKCA 4MNLA 3UNDA 3BAKA 5F2LA 5FSEC 2GFTA 4MZYA 1J0IA 3EYPA 3QXBA 3IRDA 3BLKA 3WQ4A 3N6JA 3QHNA 2VI0A 4LS1A 4RDVA 3V75A 2QUUA 4ZB2A 3AI0A 4NNBA 4K6AA 1GJUA 3QY8A 2I5IA 2FH6A 4UR9A 4WDWA 1LOQA 1O95A 4C6QA 1WXJA 3HG2A 4UMBA 1F73A 3AS3A 4N2YA 2GK1B 3G1RA 4OBTA 4K7VA 4J3XA 4OQVA 4B91A 5HMFA 3W0KA 4DLFA 1QATA 4JKLA 2XZ7A 1TO3A 4HZ8A 3W7DA 3URQA 4U3CA 2Z2UA 3GZ3A 3QPYA 1F3XA 2QCHA 3DYMA 3IIVA 3WQWA 2VCAA 4H19A 4GIRA 1HG3A 3SY5A 3UVIA 3IV8A 3ZJ6A 3NOEA 2G50A 1JF6A 3SB0A 3TYDA 5CAHA 3M0YA 4MTVA 1JPMA 3LCFA 3VDHA 3MC5A 3E5PA 3MMDA 4ZE5A 4Z0JA 4M19A 3B0XA 3WBEA 1TV4A 4W88A 5DF0A 3MSGA 3DX5A 3U4FA 4HU4A 1VGAA 3HJEA 2GLKA 1AK5A 1E6XM 1G4PA 2AKMA 1IEIA 1Q4WA 2BP1A 2ZZ5A 2PC8A 4KFPA 3KVJA 3UA3A 4GI6A 2YA1A 2V0TA 3W75A 1KWGA 1H7RA 2FB3A 4WOZA 4PMYA 4DNMA 3EAUA 1G01A 4F0MA 3B40A 5K9XA 4NJGA 4C1NA 3WNNA 4E4FA 1US2A 3CZJA 3AMKA 3BLLA 2VYOA 3B97A 2D0GA 7REQB 4J28A 4H41A 4B5TA 3IWPA 2DZPA 5M1TA 3SGZA 4DM2A 3L2MA 2EPLX 2NQ5A 3SURA 3K8KA 4M56A 3B0UX 3WH7A 2Y0FA 3IRSA 4GC3A 4ORMA 3T08A 3UY8A 1O66A 3NQDA 5AVHA 1AW5A 3CTLA 1YDOA 2MANA 4ZMGA 2QJMA 4NYUA 3PZVA 3QGVA 3LK6A 2NT1A 4AZCA 2I1OA 2BGQA 1HTIA 2C18A 3VNIA 4JIQA 1VHNA 1FWDC 4RZBA 1DJNA 2DEPA 1S2UA 4ZTXA 3PUGA 3W29A 2VEIA 4X9YA 4DWDA 4KIEA 5AYYA 1AQ0A 4BFAA 4L56A 1GYNA 4HIBA 4ZSTA 1JAEA 4KFOA 3UXLA 4HK7A 3PY2A 5KZ6A 3JUGA 4HSOA 1W6TA 3VD4A 5E6YA 1LZOA 1V3HA 4Q32A 3C0LA 4QSFA 3PZQA 2X41A 1IXNA 1V0LA 3VKJA 1LORA 1FRBA 2FKPA 2J8GA 5D03A 1RHCA 1X6LA 1UH3A 3UD6A 1PV8A 1B3ZA 2JGQA 3LHTA 2OO0A 2GQAA 2E4TA 4GD0A 5JBFA 4AYGA 1CT5A 3RILA 5EU9A 5D37A 5FJPA 2DZSA 3PUEA 4YS1A 2NLIA 5HWMA 2FFIA 2EGZA 1LT7A 4AZBA 2X1IA 1B1YA 4UFMA 3KAOA 3KEHA 4YJ5A 3PWIA 3W22A 2VDIA 1OVDA 4JIRA 2ZCGA 1YX1A 2PDJA 2VP8A 3S46A 1RCXB 2EG6A 4BJHA 4L61A 1DJHA 3WKZA 3GHUA 2JALA 2R1KA 3BG3A 1DE6A 2KX9A 1L6SA 3FJ4A 4L6OA 4DXKA 4CN1A 3TX9A 1EH9A 1F05A 4HPJA 2ZIDA 1I1WA 3KRUA 1KGUA 3S6TA 3NQ2A 3W81A 2Z6JA 4P5UA 3U5YA 1REQA 3CL8A 4KERA 2HVMA 3DIPA 3G1XA 3PWGA 1UA7A 4NZ4A 4A3UA 3F4NA 1RBLA 3PZGA 1DJZA 4PEEA 4XX6A 3TOYA 3VC5A 2YGYA 4NILA 5HJLA 3P7YA 3FKKA 3HQOA 1DJIA 1N7KA 3PR2A 2EO7A 4IGSA 5DFAA 2DH3A 5IDZA 5M3WA 2D3NA 3OVRA 3MCOA 5HMEA 2YDSA 1W1A1 3H2MA 4QR6A 2DPEA 3ZQ9A 4DQWA 3TFXA 4NVTA 1FTXA 4YIWA 3GXFA 3PFMA 3QY6A 5CJ5A 3SEPA 3MA8A 2E28A 2QPSA 3VABA 1WDWA 3S5OA 3CHVA 4CD6A 5DN1A 4H7ZA 4GACA 1NFPA 3EDEA 4NT0A 3LXBA 4PRWA 3UWZA 4DYKA 2HNHA 1TE1A 3KVKA 4JFVA 3AYSA 4MB4A 2CU0A 3GDRA 3RM8A 4R88A 1G4EA 4B5WA 4P8VA 4KWVA 4ICMA 3C2RA 2O92A 5IDIA 3B3DA 1KRAC 4IFRA 1PIIA 4F0HA 2I14A 1R5YA 3MO4A 2UZ9A 4V15A 1GVIA 2TYSA 1AL7A 2A3EA 3WQEA 4W9TA 2NQLA 4UR8A 1W1PA 4OKDA 4MB1A 1FWNA 2BX7A 4HVXA 1JZ8A 3PZNA 3OBEA 1CENA 3TJ4A 4EK7A 3QHMA 3WF2A 1GW9A 5LXEA 1ITCA 3CZ8A 3P6LA 4GOAA 2O9TA 1PTDA 3SUWA 4PB3A 1FXQA 3CZEA 5ABFB 3NZGA 1T99A 4O8AA 4Z2GA 1OFPA 3H22A 3OP2A 4JIHA 4Q33A 1A5KC 1OJXA 9XIMA 1I2OA 3QC3A 1IGSA 1QCWA 3TC7A 3EWUA 3IJQA 1OT1A 4GQ0A 5AB3A 2P53A 4LCSA 4QNWA 4R34A 1O5XA 1OT2A 1UASA 2B7PA 2NSOA 1IXQA 4RNIA 4S3KA 4U31A 1FWWA 1UA3A 2GL5A 1XWYA 4R85A 5DXYA 4GYKA 1ZTVA 3RJYA 2Z00A 3USBA 1THFD 4IQEA 2W91A 4XSMA 1K6AA 4DJFD 4KW2A 1XLBA 3L0GA 4IQDA 5I3KA 1IWPA 3LGDA 2YZRA 2ZE0A 2Z29A 3C0JA 4PTDA 3VK5A 3NZPA 2V69A 4QG8A 2VM8A 4DXVA 1VR6A 1TV7A 2PODA 3WD4A 1UUQA 4Q8UA 2Q3OA 2XVLA 1QK2A 4LV9A 2RFGA 2WM0A 3W7GA 2A7NA 1NDZA 2C16A 1GKQA 5BZAA 1GJPA 1IEQA 2B7NA 2OWXA 2HXUA 4UC5A 1UWAA 3HFTA 2PLKA 3T6CA 1ZPTA 3NPWA 3ZXWA 1AW1A 1E55A 1H1YA 3SCPA 2KAUC 1UC5A 3RM4A 4B5NA 4A3RA 3IGXA 5AZ1A 4WQ6A 4OHQA 3UU0A 3M07A 3M0ZA 3MI3A 3PC0A 3IAPA 5BRPA 3TCSA 5F1UA 1FDYA 3AHXA 1D2KA 1G1YA 2HBXA 3C52A 3HPAA 3T55A 1TTJA 3HG3A 1TZZA 2QIWA 2UY2A 4JX6A 4ZXLA 3WQ6A 2E5BA 3KFTA 2WJFA 2J9XA 3PM6A 1CPUA 1GORA 4O14A 1FWBC 4GY0A 3OG3A 3W7KA 1S2TA 5I3HA 2PB1A 1SO6A 1AD4A 4ZO9A 3BOXA 1I0BA 2EPKX 1YDVA 3KM8A 5AHIA 4UB9A 4CQDA 4F2BA 4WGXA 3ITYA 3SIMA 1R2TA 4MY1A 3IPWA 3UY7A 1LQ2A 1GEQA 4TTUA 4IISA 1C8VA 1KFLA 1ZCCA 1EBHA 7A3HA 5DT5A 3LNMA 1Q66A 1I6NA 1FDZA 2QPXA 3CHCA 4DUVA 5D30A 1CYGA 1SQ7A 3B9OA 3E9AA 5GQBA 3IIOA 5CPQA 4GXMA 3DZ1A 1XKJA 5DQPA 1GHSA 3GVQA 3DG3A 1PKMA 2C3ZA 4HYWA 1SFTA 3H21A 1F6PA 1UD5A 3TQPA 1YBQB 3WSUA 4K7YA 1GOMA 3APYA 2FIQA 2ZBTA 1TKKA 1UIPA 2PTYA 4TMCA 3LU2A 4U28A 1XFCA 3TNOA 5E5CA 5HNRA 2Y61A 1WZKA 4W8LA 3GW0A 1KCLA 1AH3A 3NA8A 1UWTA 4JYFA 1E6ZA 4BF7A 1VFSA 2O7QA 4IX2A 1FX6A 3WLHA 2BVDA 3QTGA 1HP5A 1EF2A 2OYKA 1L6YA 2VMFA 3LERA 4CD4A 4Q8WA 3D3FA 4KGLA 5K9DA 3TSDA 3GAYA 2G3MA 2ZXBA 1HFBA 4Y2WA 4IMFA 4IGNA 3P81A 1VAHA 1V6TA 3GTIA 4JIPA 1TJ1A 3MCMA 2BNJA 1IEVA 5D38A 3QM3A 4AD1A 3CT7A 3PTQA 3RFAA 3LHUA 4FLRA 1VFOA 2DUZA 1NTHA 1TVPA 3G1VA 3LBOA 1EPXA 1ZZMA 3KHDA 3UZJA 2POTA 1TELA 3W84A 3N4FA 1WKDA 4ERAA 3CPRA 4FLQA 4FX6M 4TV5A 2NUXA 1FHVA 3C2OA 4REQB 3UJRA 2WHJA 4C65A 4WF7A 1LRNA 2Z0IA 1W5NA 2R14A 3VIMA 2HVOA 1OADA 5A8PA 1WAUA 4O15A 3ZSTA 4AH7A 2JKPA 1US3A 1IT8A 3KUMA 1C3FA 3H26A 1XYZA 5GPRA 2Q8LA 4NAEB 2I16A 3W6LA 2C6QA 3ZWTA 4M1BA 1Z48A 5C55A 1RJRA 3HURA 3FS2A 1ICQA 3LQLA 3SCUA 3V4BA 4U33A 1TRIA 4PL2A 3W1QA 3WDJA 2VC6A 1XH2A 3OA3A 4S3GA 5FL1A 1BSIA 3R4IA 4IIEA 2XIMA 1QO5A 3SSJA 4OE7A 3NG3A 3BAXA 4CEXC 1V3MA 4MYXA 3WLIA 1LJYA 1E1CA 3DBNA 1EP1A 1OX4A 3U2EA 3H2CA 4NNAA 3OU8A 2V2HA 2P8BA 3BLFA 3MUCA 2XFWA 2W66A 3WQFA 1UOZA 4ES4A 3KVLA 1TTQA 1EL3A 1L8NA 2AGTA 5FIPA 1F07A 1CI1A 1E71M 4H9UA 4F0RA 3VI2A 3PZ9A 1KGWA 1B3XA 1RCOB 3NQGA 4QG6A 1TPB1 3EX4A 1JPKA 1OHLA 1PZ0A 3K13A 5CG7A 2CLKA 3RX3A 4LQ1A 1J0JA 1EHAA 1CDGA 3LGEA 4DNHA 1D7FA 4PFHA 4AQLA 3UZWA 2ON3A 1E73M 4HMEA 3HZ3A 1F2JA 4Q6XA 5I79A 2X30A 5A2CA 2FVLA 4ENLA 3GH4A 3K30A 3UP8A 4C6JA 3IANA 5CC7A 3IVUA 4LC8A 2GJXA 3DN5A 3IARA 3H24A 4O53A 1D8WA 4PMOA 1A0EA 1TRDA 4HK6A 3WMBA 1TTPA 3VIGA 3USZA 3F03K 4W5ZA 1UJPA 4AIEA 4LB3A 4D6IA 5SWUA 1VRDA 4O1CA 1GT8A 2Q8XA 1QBBA 3AMDA 3I3EA 5REQA 2J88A 4HQVA 4E38A 2A3AA 1K7EA 2F38A 4FR6A 5I3DA 3P60A 3ZIZA 5E09A 3W3OA 5DELA 1EC7A 1IEXA 4RUBA 3LG3A 5G1YA 3VIKA 2WW5A 4X3ZA 3BDKA 1J6OA 3UZZA 4GFIA 4NXKA 5BROA 3RCMA 2F9RA 3DFQA 1W9UA 4HKPA 1W8SA 3P14A 2ZRUA 5BXRA 5ABHA 1AQHA 1JZ7A 3G18A 1KQZA 4AF0B 5FSDC 5GNXA 3N3MA 2YDQA 1DWJM 5LIXX 1JNEA 1W9VA 5I3IA 1J0ZA 3WZ0E 2XH4A 1NEYA 1HL8A 4UQAA 1WUFA 4CNNA 2FTPA 3WLNA 3G1DA 3K5XA 3GE7A 4W7UA 1KNWA 3BSMA 1R87A 3W7CA 1ZGDA 4H6KA 4JQ3A 3BOFA 2JEPA 5HULA 3UNTA 2VFHA 4IT1A 1XDLA 3G6LA 1QFEA 4E6MA 3RMJA 4JQ4A 1JFHA 3V18A 3WDQA 1QPOA 2V3FA 3KXQA 1QW8A 2AGKA 4L65A 3S5ZA 3SY1A 2Z1SA 3WLMA 4GRSA 1DWFM 3BV4A 3G8EA 2FHFA 1JPHA 2EJAA 1KR1A 4EF8A 1KTNA 1P1XA 1XG4A 2ISSA 3BJFA 1SO4A 1SW3A 1GQKA