2QCEA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to sulfate, glycerol, and chloride
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 97
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qceA00
4OU1A 3W1AA 3W1UA 4HKPA 4UCGA 4UTMA 3GXNA 3G1VA 5FEXA 1SW0A 3UWVA 5I3JA 1XBZA 4RJEA 1H7WA 2QCHA 5AYXA 1VGAA 1GJPA 3MBDA 2ZA1A 4QITA 1IXNA 1IXQA 1KTBA 2NX3A 2OJPA 2PE4A 3PUOA 4JTUA 3SGZA 2DU2A 3CEPA 1ZFJA 2A5HA 2C6QA 3W6YA 3MUXA 2B0MA 4N02A 4I7WA 1KM1A 2FJKA 4Z0SA 4JX6A 4Y96A 1W5NA 1IGSA 5K2ZA 3GXPA 4ZQMA 4GE8A 4O18A 1AL8A 4NX0A 3FA5A 3W75A 5LKYA 3DZ1A 3F4NA 2WOQA 8TIMA 4K7VA 3DFQA 3O06A 3CU2A 2NLIA 1F76A 4IPIA 1TPC1 1W31A 1YTKA 3MJYA 4BK9A 2Z6JA 3W7RA 4AXKA 1M6JA 1QWGA 4ICNA 3LCGA 1ZAIA 2JGYA 4HSOA 2H8XA 3G24A 4IX0A 2JK2A 5DLCA 1HO1A 1XDLA 3RLVA 2HSAA 5BOOA 4H3DA 3QPYA 3H55A 4R34A 3E49A 1FXQA 4UNKA 1NF0A 1JCYA 3KRZA 4IMEA 3W7OA 4KFPA 1H51A 2C1HA 3NZ1A 3LX9A 1X6UA 3G3DA 2QCFA 3IVUA 4M19A 3NEVA 1GT8A 3I6RA 3DBPA 1EB3A 3HF3A 1WBJA 4XKYB 3W7DA 1O5KA 4YLWA 1O60A 4BWLC 4GUGA 5G2WA 3EKLA 3BV4A 3EB2A 3A5VA 3G22A 3USBA 3IV3A 1PL9A 3NQAA 3S5ZA 5AC7A 3BG5A 1SO4A 2DZVA 3W22A 4GNJA 2VFDA 3N34A 5AFDA 1XFBA 2GPTA 3HG3A 3IVSA 3L65A 1QO5A 4AHQA 3IEBA 3TROA 2O7SA 1S5WA 2C3ZA 1P5BA 2YZRA 1ZHAA 2CW6A 3C52A 1VR6A 3NPWA 3PB0A 3R12A 1XBXA 1LP6A 3HOJA 5GVJA 1JCJA 4M6VA 4OV4A 4UIOA 1Q6OA 2WV8A 3W7PA 2QJIA 4UTTC 3VE9A 3PULA 5I3IA 2C18A 4NJGA 1AL7A 1PE1A 4O0KA 4O14A 1SZNA 2ABAA 1WV2A 2QCMA 1K7EA 4JYEA 5EY5A 1BTMA 4JTGA 3UNDA 2TRSA 4S2CA 2DZTA 1PCKA 1JCMP 1DOSA 1LLZA 3V1PA 3N73A 4N9CA 3ATYA 3N19B 4AF0B 4QNEA 1W5QA 3MP5A 1OYAA 3P8JA 5HJLA 1SR9A 3W83A 1U83A 2EPHA 2ZTJA 5K7JA 5LZLA 2ZYFA 1TTQA 3M5ZA 4JTSA 4JIPA 5CZ0A 3IIPA 2EHHA 3LRLA 3HO8A 1GTHA 4O0ZA 4JDYA 4BF9A 4RXFA 4FXRA 3MI3A 3M9YA 2Y63A 4K39A 1ZALA 2EAWA 4UTWA 2G95A 3LXBA 1FWSA 4PL2A 3EX6A 4MYXA 4UMAA 2NX9A 2J6XA 4FX7A 4JDBA 4P61A 4A2RA 1SZEA 4HT3A 5T26A 4O19A 3LXAA 5DCDA 2CLLA 4LU0A 3NQ2A 4L4MA 4AWTA 1KV5A 2ZZ7A 3LCHA 2VFIA 1AK5A 2B7PA 2QKFA 1KM5A 4MFEA 3TA6A 5FEZA 2Y70A 1VCVA 4ZQCA 3C4UA 1GOXA 5FESA 3LERA 2YW3A 2QUVA 1L6YA 2VKZG 4Z1BA 2E5DA 2A7RA 1S5TA 4IOTA 4UFKA 4A21A 1S5VA 4J9JA 2QAPA 4DO5A 2PRLA 5LNRA 3WJYA 3TJLA 3WK2A 4N4QA 2WSQA 1SU5A 2P1FA 3EKZA 3NR0A 4G1KA 5TBOA 3C61A 1FBAA 2Y7EA 3TQ0A 2YR1A 3W71A 4M6QA 4R53A 4O52A 5I3GA 5FI8A 1P1XA 2TPSA 3DHDA 1ICPA 1NF7A 5KMYA 3NOEA 4Y8FA 3G0XA 4Q33A 2WSYA 4UFHA 1M7OA 4TU1A 2E6YA 3V75A 4XBKA 2YXGA 1L9WA 3OIXA 3L66A 1MXSA 4N2YA 4NUWA 2WQPA 3LV6A 1V5XA 2CZ5A 4CNOA 1T96A 3LI1A 4UFMA 3SZ8A 3UWWA 3PUEA 1DV7A 5FEWA 3STGA 4X9SA 4RZ5A 1JRBA 1WX0A 5LHFA 3THQA 3LCWA 2ZZ2A 3TFCA 1JR1A 2XN2A 4A3UA 1ZAJA 5G5IA 1OJXA 3EXSA 1W5PA 3T4CA 4WD0A 3BG3A 4JR5A 4DF0A 3PAJA 4IMDA 5LNUA 2YX0A 3CWOX 2ZZ4A 3FYOA 3M5XA 4E0CA 5K3VA 1VCGA 4S1FA 3GDTA 4WX2A 3NPVA 5AHIA 2GJNA 2RFGA 4RCXA 1GYNA 3I7QA 2H90A 2CZDA 3NO5A 3FEMA 3DI1A 3TFXA 4N4PA 2BX7A 3O16A 4WUIA 4UMCA 4KFOA 1EP3A 1SSGA 2FDSA 1FUYA 2J9ZA 5CZSA 4NJHA 1TJRA 2E1DA 3C2RA 1TV8A 4MZ1A 5EPDA 5EL1A 3W84A 4RZ4A 2H8ZA 3PBWA 2Z0IA 4WOZA 3SW6A 4Y6GA 1GTEA 5BMXA 2R94A 4QM1A 4NXKA 1F7BA 1PVNA 1XC4A 4FNRA 2J24A 4LT9A 1UASA 2X1SA 4ZL1A 1I2OA 5U7SA 1YPIA 2OZ0A 3CQ0A 2PURA 3M47A 2QCNA 2DZSA 1KTCA 4IXHA 4HNTA 1Z41A 1TB3A 2CLKA 5LHEA 3SSJA 4O16A 4LTSA 4ZQOA 3IGUA 3NYZA 2JKAA 1R2SA 3P62A 1L2UA 1H7OA 3LCXA 2E5CA 3W76A 3TDFA 5FF4A 3NL5A 4OGZA 3TQKA 1SQ7A 3B4UA 3MWAA 3PG8A 4A2SA 2WO5A 2AQWA 1IIGA 1JQVA 2CWNA 3ABRA 5K4ZA 1OVDA 5HMSA 5IM51 3FKRA 2Q3OA 1BWLA 3BW3A 1O5XA 3G18A 1GZGA 2VELA 3IIOA 1UBSA 5HINA 3M44A 4JTJA 4K8HA 3DI0A 4CQAA 1DQWA 2CU0A 2W79A 1ME8A 2CLIA 1SW7A 1LCOA 3WK1A 4LV4A 1EUNA 4I7UA 3W7CA 1VRDA 3W1QA 4UTTA 1AG1O 3M1ZA 2G97A 5D2TA 3QRHA 3GB6A 1Q45A 3KVKA 3NQ8A 3IVTA 2UV8G 2ISSA 3W2MA 4EIVA 5AN7A 3CLMA 3O05A 3FIGA 3OHIA 1G4EA 4UFIA 3BVJA 1K7XA 4OWGA 1RR2A 4UR7A 4FEZA 5MHBA 4UTJA 1NAL1 1KFBA 3E02A 4O12A 1VC4A 2ALDA 1F5ZA 5F1UA 3W7KA 3DFSA 3MBFA 4N6FA 1D9EA 2Y62A 1Z42A 4LW7A 2CZFA 5D2XA 3NQMA 1C29A 3NVTA 1N8FA 3T40A 2FLIA 3JRKA 1VYRA 3TCEA 1R2RA 1SZGA 4LVFA 2DP3A 4HPXA 4WOQA 1WYIA 3UZ5A 1TJPA 4UTUA 2ZRXA 3IGSA 1I4NA 4FIQA 2A7NA 1W5MA 3CWNA 3MHUA 2ISVA 4NNCA 1NFBA 5A5WA 2GVJA 3BG9A 3L2IA 4FNUA 4ML9A 3RF9A 4MY9A 4JIQA 3NQ7A 3W07A 2ATSA 4HPJA 3O63A 2X16A 1A53A 4C1LA 5D02A 4O53A 3S0CA 3QQ1A 3GR7A 1OFOA 4ADUA 5CGQA 1QDSA 2DZPA 2QF7A 3NNTA 4LS0A 5FF7A 3TU9A 2CLHA 3W1TA 3W1LA 4IJBA 4HHPA 3AJXA 4QISA 3E9AA 2ATMA 1KFCA 3I7RA 5KINA 3DKJA 4DQWA 2VC6A 3QM3A 4JTFA 2JKPA 5BMWA 1EA0A 2LLEA 1GVFA 3W2JA 4AWUA 2V81A 1XUUA 3TK7A 3TSBA 2ZRZA 3BW2A 1KV8A 2ZTKA 3CM4A 3CC1A 1TTPA 4K6AA 1OFBA 5C5YA 3TSMA 1G4SA 3CIXA 3EX4A 2TMDA 3BLEA 3E0IA 1ME7A 1L6SA 1WOBA 4JTIA 4JX5A 2TYSA 3LM7A 3Q58A 1K03A 2I14A 4R7JA 1ZENA 1TQXA 1U5JA 3W1XA 1W37A 5FF3A 4ADTA 5HNRA 3W2UA 3TW6A 3SJ3A 1PHWA 1DORA 7TIMA 1TPVA 3GR8A 4HNNA 4LWWA 1XL9A 5K9CA 4LY8A 3T55A 3LLFA 3WFAA 4MJMA 1GVSA 2WSRA 1K7FA 5D37A 1JCLA 4POCA 4FX6M 3G1XA 1FDZA 3HMJG 3HG5A 5K9DA 3G1SA 4AHOA 3N2MA 3NG3A 1MEIA 3QQ0A 4QSHA 1TTIA 1G7UA 1AMKA 2Y7DA 4A29A 2R14A 2C15A 4O1AA 3HQ1A 4EWND 2QCDA 4N9BA 4RV8A 3ABQA 5G4EA 4GC4A 1H63A 3TKFA 2AGKA 4GUJA 4UTKA 4Y9AA 4CNNA 4O1CA 1TPUA 1DL3A 2RDUA 3HG4A 3M43A 1IXPA 1TIMA 3L9CA 1G67A 1A50A 3GKAA 3TR2A 1I2NA 4FX8A 4N6EA 1N55A 1T0OA 1VHCA 5LNWA 3TX9A 3VI2A 3FJ6A 1JULA 4M7SA 4O4WA 1YLVA 6TIMA 3LHYA 5K4XA 3T78A 3K30A 1TPFA 3TC7A 3SY5A 3P5YA 1SO3A 4BI6A 5CG7A 1OFEA 4MY8A 3KX6A 1KFEA 1K8YA 1LBLA 4O1BA 5HUPA 3WJXA 2NWRA 1P0KA 3QPZA 4MJZA 1J4EA 2V9DA 2J9XA 5EA9A 3BARA 1I2RA 3NGJA 3EX2A 4MYAA 1ZAHA 2CZEA 3RFAA 1OX4B 4DF1A 4MOZA 4UTIA 1RQHA 4DPPA 3IGXA 3P74A 3Q2DA 5A8GA 2QCCA 1DJNA 1DQXA 1WBHA 4DBEA 1TPB1 5D03A 3GYEA 1SSDA 4JY9A 4CCCA 4CCEA 1WQ5A 1OG0A 5EBUA 1YTDA 3QJAA 1AW1A 3S1VA 1IF2A 5CSSA 3W23A 1WA3A 1OFQA 3I65A 1HFBA 3HIJA 3IIXA 1R2TA 3DH7A 3OEXA 4PODA 1JUKA 4GUHA 2WPBA 2E6FA 1W56A 2E09A 4UC5A 1EEPA 1B4KA 1MEWA 3S1XA 3BLIA 1E51A 3U6WA 4GUIA 5HR6A 3Q37A 1JCNA 1OX5A 5EKYA 4IQLA 1LBFA 2GVLA 5CPMA 3EWXA 5D30A 3PS7A 2PRHA 2NZLA 1OABA 2VEIA 4LS1A 2RKXA 2ZA3A 5F4SA 3TXZA 3ATZA 3TJXA 5DY3A 3DFPA 4R33A 3A9IA 3E12A 1JVNA 5LNSA 2V5BA 2ZRWA 4WY0B 3INPA 2DORA 3P7YA 1OFDA 3C2FA 4JTHA 3UPWA 1CI1A 3L68A 1Z44A 3R2GA 1TPDA 4QJ1A 2OT0A 4DF2A 4MZYA 4W9TA 3KHJA 3FYPA 2A4AA 4BI5A 1FDJA 3THAA 2NUYA 4FXSA 2A6LA 3TV8A 2FB3A 2CLEA 3U8GA 4FB7A 1K02A 4Z1AA 4WXZA 5CPOA 1LRTA 1W3TA 3OVRA 3N2XA 2EGZA 3CPRA 4I9AA 2NV2A 4OHQA 1EUAA 1O95A 5AHMA 4YWIA 3LRKA 2BZNA 1FWTA 4D2JA 3UWQA 1LOSA 1FQ0A 1YDVA 3QZEA 1VLIA 4MVAA 1LRNA 2WKJA 3QC3A 4MIMA 4NX5A 5DXXA 2EF9A 3KRUA 3S5YA 4PFMA 1SW3A 4Q4KA 4X3ZA 1G6CA 3P60A 3NM3A 1F6PA 2Y7GA 4KKXA 5D2WA 4O10A 3W7MA 3G1AA 4WY0F 3MHFA 4IXXA 4UFJA 1ICQA 5CKSA 1WOAA 1T8XA 3EX1A 4NZJA 5L9FA 1TYGA 4CQ9A 1K8ZA 1QPNA 3AO0A 4YCOA 3F4WA 4GXMA 3UY8A 5DBTA 3W7HA 3QMSA 4ORIA 5BW6A 5FF0A 3W86A 3O6YX 3VFLA 3M6YA 1H50A 3QEZA 3LTPA 3M41A 1KLZA 4E2DA 2ZQ0A 2C14A 5D09A 3BO9A 3S8HA 4UXDA 4O8RA 3G8RA 1H60A 4O11A 3I68A 4U4MA 2DJLA 3CB8A 1LBMA 2QUUA 3QW4B 4QQ3A 2V2CA 3EWUA 3B8DA 1P0NA 3HGSA 5I3FA 3C0JA 1DKWA 4PH6A 3GX9A 2A7PA 1GVRA 1Z48A 1KFKA 4MKNA 4TMCA 1L6WA 5CZJA 5EMUA 3LV5A 4P2VA 4FNQA 4FIRA 4CLMA 1LLWA 1BWKA 2GJLA 4UTLA 4GWEA 4RXGA 2B7QA 2H6RA 1T99A 1YXDA 4LNYA 2ZZ3A 3C2EA 1ZCOA 3LXCA 1OFPA 1VCFA 3VKJA 3NL2A 3SI9A 4O17A 4S2BA 3LTSA 3W85A 5H2ZA 1VS1A 4NXSA 4M5PA 3GDKA 2EKCA 1MZHA 1I45A 2YYTA 2QCEA 3H54A 2RDTA 2Y61A 1LOQA 3UWUA 3N3MA 3GZ3A 3WJSA 1QCWA 1RQEA 2NXGA 3GNNA 4ALDA 1Q6LA 5KSWA 3LCLA 3OA3A 4XBSA 3L5LA 1LORA 4FO4A 1ZY9A 4WJEA 3H53A 1GYLA 3EX3A 3G1FA 4TO8A 1WDWA 1HUVA 4MLRA 1QPOA 3P84A 1KM3A 3W1MA 2Q8ZA 1EX5A 3WJWA 1EWEA 1ONRA 1XCFA 3TUUA 4ADSA 2RDWA 5BRBA 2TSYA 2GUUA 1PHQA 1SO5A 4XUGA 4LUJA 3O15A 1OYCA 3M5YA 4ZQNA 3PC0A 4NT0A 3MI6A 4JGDA 3TE9A 2VEMA 2FFCA 4L4LA 3GAYA 3DFNA 3L0KA 3QMTA 3EWWA 3YPIA 2E5BA 2VFEA 4LVAA 4UFLA 5AOUA 1QOPA 3M7WA 5LNVA 2VEKA 1ALDA 2YW4A 3C2VA 2QJHA 4TX9A 1KFJA 3B05A 1LOLA 1A5AA 1TV5A 5G1YA 3M5VA 5F2IA 2V5LA 1ME9A 1OK4A 1TPEA 3PBUA 4N9DA 1LM1A 3FKKA 5G1TA 4FHAA 5EYWA 4AVFA 1EPXA 3B04A 3A24A 2ZFAA 2VXNA 3W88A 4CQ8A 2V82A 1UUMA 3L5MA 1MEHA 1KM0A 2YSWA 3GAKA 4KWWA 4HSNA 6ALDA 5CZTA 3W7EA 1GQNA 3QYQA 2FPYA 4XQ6A 3D0CA 1XKYA 2ZZ5A 1FXPA 2QAFA 2XN1A 2V0TA 3FLUA 4OE7A 3ZWTA 3NQCA 5K9XA 2CLFA 3LTYA 1LROA 1HG3A 2NWSA 4MFDA 3WK0A 3QSTA 4KWVA 4XKYA 1H7NA 1M7PA 3IRDA 3SGUA 1QAPA 1W5OA 5AC6A 5L6UA 3FFSA 1ZJIA 4JTTA 3R89A 3T7VA 3W7GA 4RR4A 3HPXA 1VLWA 3G0UA 2ABBA 4ZQRA 3GDMA 4WQ6A 3KRSA 4GFSA 3W9ZA 2BTMA 1YDOA 2V2HA 2IQTA 4RZ6A 3P61A 1V7YA 2Y85A 2HMCA 4IMGA 2A1YA 2V8ZA 1C8VA 3G0SA 5KZEA 3L0GA 1O94A 4MPQA 5E0KA 4LV9A 1JRCA 1F05A 2PC4A 3W7JA 3B0VC 1UCWA 1PIIA 4M7TA 3HG2A 1JUBA 3LOTA 4YL2A 1TRDA 4CCDA 4PL1A 3O6CA 2E6DA 4ORMA 3L21A 2WJZA 3NL3A 5D33A 4GUFA 1F74A 2GVGA 3LHVA 1JUEA 1TO3A 1GVQA 1UJPA 2PCQA 1VH7A 2H3DA 4YMZA 3VCRA 3W72A 1R47A 4XTDA 1G4TA 4AB4A 3TSDA 3PUDA 4AF0A 1NEYA 3UWZA 2R91A 2BXVA 1THFD 2BSLA 3NPUA 1H7XA 3HB9A 1O4UA 3L5AA 3P80A 4Z1DA 3O8AA 4Z1CA 1I8JA 3KAOA 5C54A 3TNOA 3VNDA 1PS9A 3GXTA 2A21A 2BWGA 2G96A 1G7VA 4LRTA 2C0AA 1XI3A 5E93A 3PM6A 1VJIA 2FPVA 1A5CA 4RK8A 4O15A 3LHTA 3TIMA 3I7SA 3A22A 3PWAA 4DO6A 1LTDA 3F03K 1M5WA 3HJZA 1B57A 4NNAA 1XDMA 1BEUA 1JQXA 1TRIA 2VFFA 5I3KA 4CNPA 1PCWA 2GQ9A 3P5ZA 2RH9A 2ZZ1A 1WXJA 2Y89A 2DZXA 2HS8A 3ELFA 4O57A 1LYXA 4Z08A 3C6CA 3W7IA 1AW5A 5CPLA 4PA8A 1H7RA 2FPTA 3DKLA 5J5DA 4AHPA 1TV7A 4NU7A 2F84A 5BNKA 2QDGA 1IXOA 2QEZA 2ZBTA 3QW3A 5DBUA 4JN6A 1QR7A 2WNQA 3F1QA 1SFLA 4LRSA 3O07A 4B5NA 3MP3A 4K37A 2V2DA 1GG0A 1RVGA 1RD5A 4O1DA 1DHPA 4O4VA 5DN1A 2Q8LA 1Q3NA 3RMJA 2OX1A 3L67A 4FNPA 3G1DA 2HTMA 3NL6A 4LC6A 3B0PA 5DXYA 1X7FA 3W7QA 4UUIA 5LSMA 3FS2A 3LLDA 3P67A 1JJKA 1KBJA 3OVPA 3W7NA 2W6RA 1W54A 4RLIA 1OX6A 1YXCA 1N7KA 3NA8A 4YXGA 2FQIA 2CLOA 4Z0JA 1F73A 1FWRA 3GVGA 3STEA 2VFGA 3N9RA 1QOQA 5ABTA 2B4GA 5KZMA 3O1NA 1LDCA 4JX4A 3EXTA 3TAKA 4ZQPA 1W0MA 5D32A 1B9BA 2FTPA 3GLCA 2I9EA 2NUXA 3RNDA 2NXIA 1XBVA 4GRSA 4LUIA 4PC8A 3UXAA 3W2LA 3R5EA 3LRMA 5G2IA 1YADA 5AYYA 4OQVA 2A2IA 3NDOA 5FEPA 1TSIA 2X30A 1P4CA 3MI2A 3MO7A 1LZOA 1ICSA 2JGQA 1TQJA 3M16A 3WJZA 5AC8A 1XM3A 2QR6A 3NAVA 4JTEA 4MUZA 3TMQA 2YFNA 5HQEA 1H7PA 3UQNA 1C9DA 2C13A 4LVDA 1OK6A 3TC6A 1H5YA 3TAOA 4O13A 3O6DA 4AWSA 3QF0A 1RPXA 5H91A 4FF7A 2J88A 5HWJA 1VYSX 1UUOA 4NJKA 3IIVA 4AH7A 1QO2A 5FF2A 2RHGA 3KXQA 5C2XA 3C3NA 4FNSA 2NV1A 4JY8A 4JYDA 4RKAA 4IMCA 4WXYA 3CT7A 3CHVA 3RU6A 3P8IA 5F4XA 5DCEA 1BKSA 3MYPA 3FJLA 5KZDA 2VFHA 3DHFA 1TPH1 1PV8A 3UD6A 4U28A 3W7LA 5I3HA 3W74A 3KFTA 2X1TA 1B4EA 4IWWA 2Z2UA 4LVBA 5D2YA 1K3UA 1EP2A 5F2LA 2E68A 5D04C 2Z6IA 3G8EA 1YYAA 2YCEA 1SFJA 4IMFA 3SFKA 1W3NA 4LOCA 3NXFA 2O7QA 2WNNA 1RQBA 2FB2A 3NM1A 5D2VA 4DBDA 1I2QA 1W1ZA 3R8RA 4WZHA 2KZHA 4TIMA 3P81A 3P82A 4IX2A 5IBXA 3TQVA 3ZFHA 3S5NA 1SUXA 3VE7A 2NXHA 1KBIA 1D3GA 1GEQA 4EF9A 4XZ9A 1TMHA 2QUTA 4JXCA 3T44A 2CLMA 2QDHA 3HPSA 4DXVA 1FCVA 1Y0EA 3G1HA 2V30A 1MO0A 5D05A 4E38A 2CFFA 5HULA 1XBYA 2A6NA 3NQDA 4UMBA 3HBLA 3GDRA 3LGEA 1F6KA 4JS3A 1OF6A 1VYPX 2Y7FA 3GDLA 1TTJA 1YTEA 3EWBX 2VEPA 1EWDA 1XXXA 2BLEA 3PR2A 2DJXA 1GG1A 3MP4A 4JTKA 1OHLA 4O54A 1I2PA 3BW4A 1K8XA 1XUZA 2GQ8A 3DFTA 3W1RA 1MSSA 3ABOA 5HWNA 4LC8A 2GQAA 2E6AA 3FOKA 3S1WA 1B3OA 4PCFA 3GIYA 3EWYA 1D3HA 4XWUA 1OFAA 1QFEA 4KFNA 3B03A 1KA9F 1VHNA 3ABSA 1IIHA 3W1NA 3ZR4A 3JS3A 1KW1A 3LI0A 1JCXA 3OBKA 3NPXA 3NQGA 2QCDB 3MW7A 3L0NA 1FCQA 4FNTA 3W1PA 1FWNA 3SECA 3NQFA 5DELA 4NNBA 2ZRVA 3SR7A 1AW2A 2H3BA 3DU0A 3PG9A 5F4WA 4NJJA 5U4NA 3U2OA 3W87A 1QMLA 2DZWA 3PVFA 4MZ8A 3QH2A 5HUOA 2J9YA 2R8WA 2G5WA 4GJ1A 3DGRA 5AHEA 4QNWA 3JR2A 2VOMA 5DY2A 5TIMA 4JYFA 3S1UA 2YDAA 5KTLA 3W73A 3Q94A 1NSJA 3CTLA 1GVOA 4H6KA 4NZFA 2DZUA 4X22A 2W0UA 3QFEA 4TMBA 3IIZA 1KM4A 3PB2A 4GBUA 3ZWSA 4BR1A 1H62A 1FY6A 1TPWA 2E77A 2YPIA 1UB3A 1ZNNA 3DAQA 3DENA 1DBTA 3B06A 5AYZA 3UY7A 5LGZA 1HTIA 2QCLA 5KITA 2GOUA 4Y90A 3ANYA 4AMAA 3HGOA 2A0NA 2I1OA 2Y6ZA 2YFOA 4MY1A 4EF8A 5C55A 2Q3RA 1NVMA 5HWMA 3NQ6A 3LDVA 3STFA 3LHZA 3BLFA 4JICA 3KVMA 5CSRA 1EIXA 2ZZ6A 2A85A 2XN0A 4DO4A 2X1UA 1OYBA 3UPBA 3PF3A 3HGRA 4IPJA 3WK3A 4ZZ9A 1RV8A 5AB3A 3A23A 3N9SA 3MHGA 1A5BA 1J2WA 3W70A 1OF8A 3TW7A 3ZS4A 1FCUA 3G3MA 5LGXA 4X2RA 2NUWA 1Q6QA 4EVZA 1CW2A 4ZVJA 1FCBA 1H61A 3B0UX 4AAJA 3GK0A 1TCDA 3LBMA 3BPWA 2AAMA 1G4PA 5F1VA 4AEOA 3PSWA 4OT7A 4K7YA 1R46A 5F2GA 2X1RA 1QNVA 1KFLA 4NVTA 1TREA 1HL2A 4DPQA 3NZRA 4QIUA 3LCIA 2ZRUA 1X1ZA 3A5FA 4NQ1A 5AHLA 1J5TA 5F2MA 4UTHA 1FDYA 2FIQA 3RLUA 3UZJA 3C8FA 1H1ZA 3NQEA 3S6DA 2YYUA 1DJQA 3OG3A 1EP1A 1R30A 3N14A 1QPQA 1X1OA 3UYCA 1FX6A 4BFAA 4I7VA 4BWLA 3GNDA 1ADOA 3S9YA 3PSVA 2NX1A 2JBMA 3S42A 5J5RA 3EXRA 1GWJA 3BGJA 1HO4A 3A21A 5AHNA 3E96A 2WNZA 4IUOA 1YPFA 1OFRA 3KVLA 2VENA 5IBXC 1X8FA 3PY2A 3QMRA 4OV9A 3CEUA 1VQTA 1YXYA 5DCBA 1GPWA 4C1KA 2C19A 4JD4A 1OX4A 1YDNA 4UTWC 3LB0A 4K8EA 4UNLA 2OMAA 2QCGA 4IGHA 3C2OA 2ZRYA 3KOFA 4N9EA 3PBYA 1LRQA 2J27A 3UXDA 2QJGA 1QPRA 3W3OA 3BGGA 3RK8A 1W3IA 2C16A 4OBTA 3TH6A 4MLJA 5E1QA 2ISWA 2P0OA 3DFOA 3EEGA 4JNMA 4UR8A 4K38A 3CIWA 3W2NA 3C56A 5G2HA 2Y88A 4PTNA 1ML1A 4YCPA 1Q6RA 4DEFA 3LHUA 5C6MA 5AHFA 2Z1BA 1KLYA 5CPNA 4PEKA 1KM6A 2B7NA 3LCFA 1KM2A 1A5SA 3EWZA 3GKFA 4HN4A 3SIZA 4Q32A 3LHWA 4XTIA 2ZA2A 1CX9A 1SO6A 4ONVA 2X2GA 4E2BA 2F7FA 5HR7A 4O50A 1WAUA 1DVJA 4DELA 3TXVA 2HS6A 4RX0A 2XFWA 1FWWA 1SPQA 3S5OA 1S3HA 4A22A 4JTLA 4O28A 1KTNA 1VPXA 2B7OA 4WY0A 4HNVA 2YGYA 3R13A 1VZWA 3OVQA 4HIBA 2ZCGA 3HPZA 1SZFA 3MMTA 3W2KA 2D73A 4BI7A 5G4WA 1W8SA 3BK0A 5D38A 1H1YA 3DXIA 3M0ZA 4H4IA 1F2JA 4JEQA 2ZDRA 3MYOA 3UWYA 5TQLA 3HGJA 2PRMA 3QSRA 3NQVA 4LS2A 4M6PA 1RZMA 4ZMGA 3PBVA 3STCA 1G69A 2OCZA 4NJIA 3G1YA 2OT1A 3KVJA 4K36A 4TR9A 4HNUA 4EOUA 3TMLA 4LVGA 4QAIA 3LBCA 2P10A 2JKEA 5SWUA
chains in the Genus database with same CATH superfamily
2OOFA 3F5KA 3DYMA 4C7GA 3G1VA 2NQZA 5FJOA 3UWVA 4E4PA 1ZCCA 1H7WA 2FH8A 2QCHA 4D8AA 1V02A 2ZA1A 1E6NA 1B1YA 1M03A 2QJNA 3RR1A 1R7OA 2G37A 2NX3A 3PUOA 3SGZA 1GW9A 3MUXA 4N02A 1Z9AA 4PB5A 1UPMB 4Z0SA 3IS4A 2PF0A 5K2ZA 4M29A 3GFYA 4O18A 2YCLB 3FA5A 1GQLA 5LKYA 3F4NA 4JPGA 1V3LA 1TPC1 4B92A 4J7RA 3C8NA 9XIAA 4BK9A 4PCNA 3W7RA 5J04A 4GBDA 4ICNA 4B9YA 1PEZA 1ZB5A 4HSOA 1Z69A 2XTKA 2CBUA 4C6DA 1TR9A 4N7QA 2HSAA 2BBFA 1WPCA 1HP5A 3PBMA 1UHVA 4M6UA 4QG6A 4UNKA 1K77A 3AHYA 1YNQA 2WKLA 4LCQA 4IMEA 1JCYA 3V18A 3W7OA 5A6KA 5HBFA 1FWDC 2WNWA 2C1GA 3M0MA 1X6UA 3B9EA 4OOZA 1SM9A 2BODX 4J40A 3KTCA 1WBJA 4XKYB 1HKKA 3WN6A 1O5KA 1ISXA 3CO8A 4GNVA 4LJ3A 4GUGA 4MWAB 3R1ZA 3IV3A 3EPNA 1ZP4A 4ZB0A 3CHFA 2VFDA 3ITGA 3L65A 4Q3MA 3UR2A 3RPMA 3S9IA 1S5WA 2C3ZA 1P5BA 1UIOA 3NPWA 2D24A 5HMDA 2XGZA 3PB0A 3R12A 2V68A 3HOJA 3M6DA 4M6VA 1Q6OA 1OCJA 3NXLA 3PULA 4YVXA 1P43A 1G94A 3EA1A 1AL7A 4O0KA 3S46A 1SZNA 2ABAA 1C9WA 1BTMA 4JTGA 5A95A 3DFHA 2TRSA 2YCJA 1SMAA 4U10A 1JCMP 1DOSA 3N73A 2J7BA 3EBVA 1U2YA 1WKYA 1UQZA 3CPUA 3NZGA 1B90A 1XIDA 5CAHA 1GYMA 2EPHA 1GGOA 4GKTA 5LZLA 2ZYFA 4B3KA 2FZ9A 1J0ZA 4KT2A 1F4HA 2FTYA 4URIA 1GTHA 3KLKA 3AHZA 4GXPA 1W1PA 4XO6A 3GZAA 3MI3A 1QI0A 2G95A 1W1IE 3LXBA 3GVWA 2NX9A 4FX7A 2UY4A 3DHUA 1QNOA 1OADA 5AZ1A 4GQGA 4Q7IA 1QNRA 3TLLA 3ZJ7A 2YCIX 3GTNA 4L4MA 3GTIA 1FHDA 1KM5A 5CC7A 4AD5A 2ZVRA 4D1JA 4LYQA 1GQKA 3PBGA 1H1NA 3C4UA 1LQAA 3URAA 2YW3A 4A6GA 2QUVA 3B8VA 3ZOAA 4ROQA 4JTQA 1R5YA 3OBEA 4GVIA 1EJWC 2BS9A 3POHA 3QV9A 1OC6A 3SCWA 3WK2A 4EKJA 1V3MA 1EC9A 2P1FA 4G1KA 5TBOA 1W3JA 2YR1A 4HJWA 4CCZA 4PE8A 2QJMA 1ECEA 1UR4A 3ARSA 1MXGA 2UWFA 1LUCB 1EC7A 1P1XA 4QDWA 4YHEA 3G0XA 2WSYA 1B31A 4BY3A 4TU1A 4HU0A 2OG9A 2X8RA 1NOWA 3B8WA 2YXGA 4DM1A 3PZQA 4N2YA 4ACYA 2G3IA 3AIBA 1V5XA 2GL5A 3SZ8A 4UFMA 3UWWA 5DO8A 3FEQA 2BXYA 4Y2WA 1X1NA 4Y9NA 1V3KA 1QHPA 5LHFA 5AVHA 1AD1A 4RNHA 3LCWA 3TQPA 1Q7ZA 1JR1A 3OQ8A 4Q4SA 2BGSA 3OVGA 3HJEA 3BAYA 2Y0FA 3BG3A 4DWSC 4IQJA 4JR5A 2CITA 3WLJA 2DT3A 4PSRA 2YX0A 3S2CA 3FYOA 2ZZ4A 3IAQA 4HZ8A 2WYSA 1T40A 1GYNA 3NO5A 4V33A 3DI1A 4N4PA 1CB7B 4UMCA 1EP3A 2VZSA 4E5TA 2O9RA 4MDPA 1KBLA 3C2RA 4L6DA 1TV8A 5CSYA 5EPDA 3AICA 5EL1A 3SY8A 4D1IA 1FKWA 4JTRA 5KZ6A 4ZA0A 3MUZ1 3SSZA 1F7BA 3VGFA 4LT9A 2NLYA 2QF8A 7CGTA 4J3SA 3CUIA 1UASA 2NQLA 3O6AA 3M47A 1VB9A 4GMEA 2XWEA 3GG0A 5B80A 4ZQOA 4LTSA 3MPGA 4NL1A 3IGUA 4PUDA 3K5XA 2WK2A 1XIFA 4H8UA 1ZS2A 5FF4A 3I3DA 3B4UA 3TYDA 3PG8A 1H0IA 3KBSA 3CASA 2WO5A 3WF3A 4XK2A 1JQVA 5K4ZA 1C8YA 4HMNA 5JIPA 1JD9A 4XIMA 3G18A 5PTDA 2MANA 2VELA 3UXKA 2O55A 3PZ9A 2P0IA 4JTJA 3WQEA 4DZ5A 4RE0A 3DI0A 2PDPA 2CU0A 4GGBA 5D8ZA 3BMWA 3ES8A 1EUNA 4IPLA 3W7CA 3W1QA 1AG1O 2J75A 4XSMA 2VVSA 2GUYA 3F4CA 4CNUA 3KVKA 3NQ8A 2D2HA 2UV8G 3P14A 2PODA 2E40A 5AN7A 4LB3A 3BJTA 3JU2A 2QXWA 1S2AA 1HJQA 1M65A 5A8PA 3EKGA 2ALRA 2DQWA 1RR2A 1I9CB 2G3NA 4FEZA 3KTSA 1UC5A 1UMLA 1NAL1 1KFBA 4GVFA 3WBAA 2ANUA 5F1UA 3DFSA 4E8CA 1Z42A 3CMJA 3ITTA 1TVLA 3NQMA 1C29A 2O56A 3DC0A 3B40A 1DJXA 2X0HA 6PTDA 3GU2A 2OZ8A 2PB1A 3IAPA 1ZTVA 5MF5A 4UTUA 2ZRXA 3IGSA 1I4NA 4FIQA 5EU9A 1HQTA 4JKKA 3A3WA 4MY9A 4F2UA 4JIQA 3LPGA 4U3CA 5IDIA 3REQB 4Z2LA 2X16A 1A53A 1KXVA 4C1LA 5CC6A 4EAMA 4H9ZA 4X2PA 2DZPA 3NNTA 4LS0A 5FF7A 4ZENA 4X9YA 4IJBA 2QW5A 3AJXA 4QISA 3V16A 3E9AA 4A8RA 5XINA 2ZUUA 3I7RA 4GIRA 2VC6A 4JTFA 3WNOA 2JKPA 2YJQA 3PPCA 3W2JA 2DUAA 3CM4A 4K6AA 3L2LA 2PP1A 2MNRA 4GC3A 3W00A 3K8LA 4RPPA 2TMDA 3BLEA 2D3LA 4CN4A 3LM7A 4R27A 1UKQA 2I14A 1D8CA 1DJHA 1XYMA 4HQVA 4RNFA 4QSFA 1R86A 3CH9A 4ADTA 4M1BA 4PEEA 3W2UA 3TW6A 3SJ3A 1GJWA 3BJSA 7TIMA 3GR8A 4HNNA 4LWWA 3EDKA 5K9CA 3LLFA 1OCNA 1NQ6A 3CUFA 2OX4A 2E9BA 1K70A 3CAWA 1NJJA 2PC8A 4FX6M 4CU8A 3WNPA 2JEPA 3SAZA 3G1SA 2HQAA 3SEPA 3N2MA 1WDRA 2V5CA 1NOUA 2W4XA 4HGXA 3M0XA 4NZ5A 1SFSA 2Y7DA 2DZAA 3ZYZA 4A29A 4DJFC 1DE6A 2V3EA 4EWND 2Q02A 4RV8A 2PF8A 2YA2A 3TKFA 1H63A 3VX1A 3VIGA 4D6JA 3A3XA 5CXPA 3SUSA 4DUXA 4HU4A 1DL3A 3M43A 3L9CA 1Q2SA 3GKAA 5JH1A 1GUVA 1I2NA 1N55A 1NARA 1KBBA 1VHCA 1E4IA 2W91A 5LNWA 3ANVA 1QI3A 3UVIA 1QK0A 4O4WA 3LHYA 3VC6A 5K4XA 1AZ1A 1TPFA 3K30A 2YKKA 3RX3A 4CEXC 1EXPA 1OFEA 3WH6A 4MY8A 1KFEA 5HUPA 4O1BA 3WJXA 3OZPA 4MJZA 1J4EA 2XZ9A 2J9XA 3STPA 3WO8A 1ZAHA 3VX0A 3AHTA 2PZNA 1GONA 2GJXA 4DPPA 3P74A 5A8GA 2PGFA 2DV0A 1DJNA 1DQXA 3MVTA 4QCEA 3RO6A 3UA3A 1TPB1 3H2FA 3W81A 4KEZA 1SSDA 4CCCA 1CXLA 1WQ5A 2G3MA 2VTFA 3S6TA 1AW1A 5EMJA 5CSSA 4U2ZA 3PZIA 3GFZA 3IIXA 1R2TA 3CUXA 4PODA 3SUVA 2DW6A 1E1CB 2E6FA 1HKIA 3N29A 4B4HA 5A6BA 4UC5A 1EEPA 3A13A 1B4KA 3PANA 1CCWB 1MEWA 3IUHA 3M46A 5HR6A 3Q37A 1JCNA 1R7AA 1OX5A 1LBFA 5BWAA 1KKRA 3T1GA 2ESCA 3EWXA 3B8IA 3FCPA 2QVHA 1OABA 3QFWA 3D46A 3TTSA 2RKXA 2Z7KA 4ENLA 1PDYA 5DY3A 2ZWYA 3E12A 3WUBA 2V5BA 1I0BA 4LUYA 2PCEA 4IT1A 4AZ5A 1MQPA 1B3VA 2WMIA 2UZ9A 1M04A 1GVYA 5E6ZA 2XSXA 4ES4A 4MZYA 3MTWA 3KDNA 1UWSA 3EB3A 3UJRA 4PUNA 1FDJA 1XLGA 2CLEA 1K02A 3VMNA 4Z1AA 4WXZA 5CPOA 1R3TA 1EF2A 3B0YA 1LRTA 3WNNA 4QLLA 4MB1A 1UKSA 4HMDA 1KQZA 4RDWA 4YWIA 3MCOA 1CECA 4D2JA 3UWQA 3QZEA 3V1HA 1KXHA 2EF9A 1UR9A 3S5YA 4PFMA 3HA1A 3QKEA 4S39A 2VGBA 1S5MA 2HPMA 5CKSA 1T8XA 1QPNA 3OLIA 3UY8A 3IANA 5FF0A 3W86A 3O6YX 1QRQA 4HK7A 4GI8A 3BO9A 5DQPA 3ZSSA 4HA3A 2E8YA 3CB8A 3VOJA 1JNEA 4I6KA 2OOGA 5GJPA 3VNJA 1GVRA 4L9ZA 3BGAA 1UR2A 2GWNA 4J3XA 5CEWA 5CZJA 5EMUA 3LV5A 1GKQA 2J4GA 4AC1X 4FALA 1T99A 3N4FA 1Q6DA 1XKJA 4DWSB 3C2EA 3LXCA 1VCFA 2ZX6A 4O17A 1GQIA 4M5PA 2EKCA 4AZGA 2Y61A 4L7ZA 3N3MA 3CHDA 3HU7A 3MMUA 3TYCA 1QCWA 3KZSA 3QGVA 3CYVA 1E15A 2Z28A 5BROA 1MW1A 3I3EA 4WJEA 4ZOCA 3KLLA 1E6RA 4TO8A 1WDWA 1UA3A 4BQ4A 3CMFA 1I60A 1EX5A 3WJWA 1E72M 1ONRA 4L6HA 5HOSA 4J3ZA 5BRBA 3DG7A 3WLTA 3ZVHA 4HHHA 2TAAA 4PBEA 2Z27A 3SRFA 1V4YA 4EANA 3G6LA 1WDSA 3UERA 3WLMA 3QBUA 1XDJA 2VEMA 4L4LA 2ISDA 5FJTA 3L4YA 4UQCA 1Q6GA 3QMTA 3EWWA 4UQDA 1VJSA 4CD4A 5CJMA 4FLQA 2YW4A 5C9WA 2QJHA 4TX9A 4W8BA 3B05A 1LOLA 2YCLA 5G1YA 2XIJA 1G01A 4MWAE 3DDMA 3M0KA 1HJUA 1OK4A 3PBUA 3CTTA 4TTUA 1LM1A 1AVAA 1EPXA 4AZ7A 2VXNA 2FGLA 4LF1A 1V03A 3CV6A 2WMHA 3DGBA 5DMYA 1MEHA 3B9NA 1KM0A 2IKGA 4Q8OA 4Q6XA 1MUMA 1RJRA 2VO5A 3B9DA 1YKWA 3W7EA 3ONCA 4QXIA 4JHMA 1GQNA 5XIMA 2FPYA 1KRMA 4MDOA 2ZZ5A 1FXPA 2QAFA 3GTHA 3FGCB 1VPYA 4JKMA 4GIEA 3C2YA 1TWIA 3SDOA 5I07A 4AMCA 3T2PA 1GHSA 3LTYA 2RAGA 4K1WA 1ZBVA 4XKYA 3SGUA 5AC6A 5CC5A 4AZ6A 5A2AA 1JI1A 4MWAA 4JTTA 4L80A 3KL5A 1ISVA 1UZ1A 4NG3A 3GBDA 4HPNA 2WSKA 1VLWA 1R9XA 3QXBA 3OA5A 2NT1A 4GFSA 4I9MA 1YDOA 1UPPA 1V3JA 2IQTA 4R9XA 5JBEA 1Q6CA 2Y85A 4EPDC 2WJDA 4GI6A 1O94A 4M24A 2XIMA 2G4FA 1Q66A 2IMRA 1PTDA 2XPKA 2DEPA 4H83A 4W4QA 5G4HC 4UZUA 1TRDA 1QOXA 4NRRA 5FL1A 2E6DA 4ORMA 2WJZA 5SWUA 4GKLA 4MKVA 2PCQA 1UJPA 3PJXA 4L56A 4AZHA 4PB4A 3VGGA 3W72A 1HVXA 4GY1A 5JBDA 2J77A 3TSDA 3VOIA 4IIGA 4WLCA 2BSLA 3NPUA 2OWXA 3FSTA 3P80A 1JD7A 4Z1DA 2QPUA 4GNKB 1PS9A 5GJMA 2R1MA 2A21A 5E93A 4PMVA 1UR8A 3KWXA 4L1WA 1A5CA 4RK8A 5D4YA 3LHTA 5JXQA 1XH2A 3PWAA 2VI0A 1LTDA 4Z17A 4E4FA 4A8LA 1M5WA 3HJZA 2EPMX 1B57A 1QUMA 5I3KA 1PCWA 3P5ZA 4EACA 1AH4A 4TV6A 1CGYA 5IFPA 1FTXA 4Z08A 2WVSA 4MAVA 1F07A 3KCJA 3CZKA 1H7RA 2FPTA 3BTNA 1TV7A 4NU7A 3OHMB 1IXOA 3F4DA 2ZBTA 3QW3A 1F61A 4NKCA 8A3HA 3A9BA 1SFLA 3O07A 4B5NA 3MP3A 3RJXA 3IUDA 1RVGA 2AKZA 1RD5A 2C8NA 2X2YA 4ZB2A 4D6EA 2PZ0A 4HYWA 2WJFA 2PGWA 3RMJA 1CXFA 1VP5A 4IGNA 3G1DA 1TZZA 1X7FA 4NI3A 3CJPA 3W7QA 3JZUA 5CCZA 3OVPA 1YXCA 3VGBA 4YN5A 3PK7A 1F73A 2XUCA 2VFGA 3IWPA 1LUCA 4JEJA 2VX6A 4PYSA 1W0MA 1B9BA 2ZOXA 3WH7A 3CHCA 3GLCA 3I6TA 5I06A 4U31A 1HIZA 1IV8A 1JCTA 1MQQA 4GRSA 4M82A 1V08A 1U5VA 4OQVA 2A2IA 3USZA 4IL2A 1JPMA 2FGBA 1VFHA 3MO7A 3U57A 1LZOA 1WDPA 4LBSA 5A69A 4GYKA 3WJZA 5AC8A 3N6JA 1XM3A 1WXYA 2ZX5A 1BLIA 3RM9A 3S6OA 4DZAA 3W38A 1H7PA 3UQNA 1QASA 3V0TA 2C13A 4LVDA 4IISA 3TC3A 3R11A 1H5YA 1JI2A 3T42A 4O13A 3O6DA 3QVQA 4P7LA 1G1YA 4FF7A 5HWJA 4C6NA 2W66A 5HATA 3AAMA 4H6QA 4GXWA 1UUOA 2HVNA 3WKZA 4RNIA 1TKKA 3AWNA 4J1OA 5TD4A 4FNSA 4JY8A 4JYDA 4WXYA 5FJUA 3W6LA 5DCEA 2VFHA 3GY1A 4F0HA 1PV8A 3CWHA 3EYPA 3WLIA 3W7LA 1M7XA 2X1TA 3CQJA 2O9TA 4C6CA 4IWWA 1XJBA 1K3UA 1S2CA 1JPDX 1GOWA 2E68A 5D04C 2Z6IA 3G8EA 4DNMA 1HP4A 3VGDA 2HXUA 4BA0A 1WO2A 5T9BG 1LWJA 4O8AA 2FB2A 4DBDA 3PZOA 3BC9A 4I9TA 6TAAA 1D2KA 2J7GA 2FTWA 3P82A 3TQVA 1V0MA 6XIAA 3CT2A 3IJDA 2XH7A 3H4WA 4EF9A 1B0IA 4XZ9A 1H41A 3VD5A 2BGNE 4WDUA 5IHRA 5DF0A 4ZFMA 2FMOA 1Y0EA 3G1HA 2V30A 5D05A 3ITYA 4JHZA 3MJMA 1ISYA 4GYPC 1E6ZA 1CBGA 1OF6A 4AIBA 1VYPX 3KBMA 1FH9A 2Y7FA 4UNIA 2AAAA 1WB0A 3EOUA 1FWAC 4KEVA 1B30A 1GOMA 2IPJA 1SGJA 1YTEA 3EWBX 1EWDA 2A3LA 4XIAA 3PPFA 1PAMA 4UOJA 2DJXA 2BHUA 3OZYA 3MP4A 1MUCA 3P6LA 4IIFA 3P2VA 4NYUA 3W27A 1I2PA 2DH3A 2D2OA 3TN3A 1NDYA 4PR4A 1KQYA 5ABFB 2E6AA 3FOKA 1B3OA 1XD1A 1DWJM 4LGXA 1AZ2A 4XWUA 3DG6A 1QFEA 4W8AA 4KFNA 3MKCA 3UP8A 4MADA 1IIHA 1W91A 3VIKA 3W1NA 1K9FA 2OEJA 1NP2A 2X41A 2VMFA 1PTGA 4FNTA 3SECA 3RCNA 1J18A 1LQ2A 5DELA 3L2MA 4NNBA 3OJGA 4NJJA 1A3XA 3W87A 3NFUA 4MZ8A 4FAMA 3QH2A 3NJ3A 4OFCA 2CETA 4RDVA 3DGRA 1RJPA 4QNWA 3E6EA 2AMXA 3REQA 2VGIA 1UR1A 3SGGA 2YDAA 5KTLA 3W73A 3HFTA 3IACA 4GH1A 2DSVA 2DZUA 3RU8X 5I2UA 2VEGA 4TMBA 3IIZA 4BR1A 1X96A 4PBGA 2J8GA 3B06A 2WZMA 3LQLA 2CERA 3N4EA 5LGZA 2PEVA 3CL8A 2A0NA 2I1OA 2Y6ZA 4MY1A 3MCNA 4AIUA 4QE1A 3H2MA 5JQ9A 3N13A 1LL7A 4IG2B 3N2TA 4DN1A 4JICA 3KVMA 2A85A 2XN0A 5EGRA 4C60A 4Z2GA 1SYTA 3CUJA 5LIYX 4QS6A 2A3CA 1OQFA 3HGRA 4OECA 3WK3A 2BP1A 2IS7A 4ZZ9A 5AB3A 4ACZB 3MHGA 3MB9A 3QGAC 3W70A 3ZS4A 1FCUA 3WX7A 1E40A 3A6OA 2NUWA 1Q6QA 4EVZA 4B5WA 3QR1A 4ZVJA 4HTYA 1XLCA 5D9OA 2VOTA 1GVIA 4XZBA 1QNVA 5I79A 4DB7A 4Z2IA 3V0UA 3BLPX 4QIUA 3LCIA 1M53A 4MWAD 3ZVIA 3A5FA 4NQ1A 3U3HA 1M01A 2FIQA 3G6MA 3UZJA 4HCLA 1R30A 3RRAA 4LYRA 1QPQA 4ZSUA 2PDQA 1X1OA 3UYCA 3SQSA 1FX6A 3LM3A 2J78A 3S9YA 3PSVA 5J5RA 4WR3A 3EXRA 3A21A 4NAEB 1CXHA 1TV4A 4IUOA 1YPFA 2A3EA 3O0KA 4HOZA 4XSLA 3WDIA 1W3LA 1BGGA 4L9XA 1US0A 2R1PA 2RGMA 5C2GA 1GOIA 9CGTA 1IZCA 4FS9A 4NP7A 2L5HA 1YXYA 1RHCA 3OODA 4BCEA 2OMAA 4AFYA 3KOFA 4LXFA 2HJPA 3KL3A 1EXBA 1J6OA 2C91A 1LRQA 2RJHA 2QJGA 4OBTA 4MNJA 1D3CA 3DFOA 2IQ0A 4UR8A 4K38A 3L7RA 4S3FA 5G2HA 2IQDA 3AISA 3BCJA 1E1CA 3LCFA 1C3FA 3SIZA 3JUGA 4HN4A 2AOSA 4PUJA 2ZWZA 1UD2A 3RO8A 3WIJA 3WD0A 1CX9A 4L1XA 4HCDA 3U7VA 1H49A 1WAUA 5GJNA 3CUZA 2XIQA 2I5QA 3S5OA 1S3HA 1DTNA 4O28A 4A3RA 1VPXA 1V6XA 4GYFA 4OOUA 4HNVA 1PKNA 2YGYA 1A5KC 3UJEA 5D38A 1R6WA 5CAKA 1F2JA 4L61A 2YBUA 3UWYA 1S3TC 3AXKA 3NQVA 4M6PA 4PUMA 1XIMA 4ZMGA 3F2BA 3G1YA 2CXGA 4K36A 4Q8NA 4EOUA 1AQHA 4P7OA 2PDLA 4C6QA 3N6HA 3R0DA 1JDEA 1ISWA 3VIOA 4A4AA 4OU1A 1YRRA 4PMQA 3W1AA 2D69A 2Y4SA 4HKPA 3NGFA 1YPXA 4GINA 3UCQA 4UCGA 1UH4A 3GXNA 1DJWA 1XBZA 4Q8WA 5A6LA 5I00A 1JDDA 2OB3A 1IXNA 1HN1A 1IXQA 1GOQA 1KTBA 5DFAA 4JTUA 3CEPA 2A5HA 3CHEA 3W6YA 1EDTA 2QULA 2B0MA 1W5NA 3GXPA 4GHRA 1PWLA 5A8NA 3RJYA 1AL8A 3DZ1A 4BF7A 3DFQA 3O06A 5HMFA 2GDUA 2NLIA 2ZX7A 4PRRA 1W31A 1N82A 1RALA 3GW3A 2JF7A 4LSBA 1UKPA 4LAKA 3LCGA 3TN6A 4A35A 2BNJA 1NFPA 4IX0A 4UQEA 5DLCA 1DWHM 3ME3A 1YIXA 2FZDA 3HTWA 4DWSA 1OIMA 4D6FA 3AIRA 1U30A 4ZR8A 5EBAA 4F0LA 1FXQA 4KRZA 1NF0A 4BZYA 2W3ZA 4IMAA 2GSHA 3P0WA 2QCFA 3V7PA 3I6RA 3DBPA 3HF3A 4YLWA 1ODUA 2EBNA 1O60A 2VZUA 1KNWA 2P5NA 3K2GA 3BV4A 2WBKA 3MSDA 3WLOA 3A5VA 3KBWA 1YNPA 3NQAA 1S5NA 4GZIA 1N8WA 1H2JA 2WMFA 3AZSA 3AXMA 2DZVA 1NWTA 7PTDA 5AFDA 1YHTA 3M0HA 1KC7A 3ZJ8A 1QBAA 4GZEA 4AHQA 1ZHAA 2CW6A 1V6VA 3C52A 4Q8PA 3VTRA 1DQUA 4GABA 5A8QA 4CU6A 5LA0A 4OV4A 4E2OA 4UIOA 5DT7A 1A3WA 2I5GA 2E9LA 2C18A 3CV1A 4X61A 3R8GA 4LF2A 2Y5EA 3A47A 4R3UA 1JXJA 1B54A 3T0CA 1WV2A 2QCMA 5EY5A 1G5AA 4Q8VA 1VBGA 2QGYA 2DZTA 3V1PA 4N9CA 3TJ4A 2Z29A 3MP5A 2IKIA 1OYAA 3URNA 4HA4A 1H11A 4DZIA 3GHTA 3WELA 1XW8A 2ZTJA 5K7JA 5DX7A 3QHNA 3WQDA 3BAIA 4Q8UA 3U5UA 3SM0A 4FF5A 1XIJA 3M5ZA 4JIPA 3GG1A 2OKTA 3HO8A 4V1XA 3Q45A 2OFJA 3HPAA 4FXRA 4D6GA 3KUMA 4DJDC 4FXJA 5GNXA 5AY7A 5CBJA 2ZC8A 3LSBA 4K39A 1ZALA 1C8XA 2Z00A 3FGCA 4GJIA 1OT1A 3EX6A 4MYXA 5BU6A 4C5YA 3ECQA 4DHGA 1FWJC 2ZKMX 1VEMA 2CLLA 2F8QA 3PHAA 4F0SA 1V8EA 4OKDA 4ZE4A 4PULA 4Q6JA 1HKWA 1BG4A 2DVXA 1KCLA 1X6NA 4J3VA 3QY6A 2PWVA 1UD5A 1WXZA 3C0SA 1O1HA 2MUCA 2VD9A 4DAFA 5C8BB 4ZCWA 4J3WA 3AUOA 2A7RA 2PSNA 3AHVA 1MFVA 3E3HA 1XWYA 4A21A 1E6SM 3L4UA 4J9JA 3SN1A 1W2VA 4GYJA 4DO5A 3OYXA 2QMKA 3F5LA 1POKA 2PRLA 5LNRA 3GHRA 3WJYA 3TJLA 4N4QA 1BRLB 4H01A 3EKZA 4UBPC 3E0WA 4PFHA 4XAFA 3CZEA 3W71A 3MZ2A 4M6QA 4YTRA 2PDXA 4R53A 4O52A 3BH4A 4GIAA 5I3GA 3VNKA 2TPSA 3DHDA 3E2QA 1O1ZA 3GVRA 4UFHA 4HHMA 3ZR5A 5I0DA 1A0CA 1V6UA 1J10A 1MYRA 1XFCA 3VABA 5EFFA 2NVAA 3UG5A 1KXQA 1CEOA 3LV6A 2CZ5A 3KS5A 3LI1A 2GVEA 1DV7A 4GO9A 4KIRA 3VOFA 3O0FA 4Q4RA 1JRBA 2DT2A 3M0LA 1XV8A 3JZEA 2Q71A 1EDQA 3L4XA 3ITLA 3TFCA 2XN2A 2BMBA 4GFIA 1ZAJA 1Z89A 3EXSA 4AX7A 4UQAA 3RUBL 1EQPA 3T4CA 4WD0A 3DIPA 1NFGA 3PN8A 3RXZA 4Y7EA 2Z2AA 5FJJA 5LNUA 3M5XA 3H2AA 3N17A 1F6YA 4WX2A 4I90A 2E25A 4HZ6A 3XIMA 3GFXA 2H90A 5EMKA 1UWIA 3EEZA 1SSGA 1VBRA 1AJ2A 4NJHA 2E1DA 4MZ1A 3W84A 1ONEA 4IIBA 3VUPA 1YW1A 4F2TA 4WOZA 3UNTA 3T0AA 1XLLA 4LBUA 3DOPA 4QM1A 3ZO9A 4NXKA 3KDOA 4B3LA 1PVNA 1NTHA 4UB9A 3WYZA 1VFLA 1U33A 2X0SA 3BXWA 2WW5A 2PP3A 1MFUA 2WHMA 1YPIA 3UETA 2OZ0A 3CQ0A 1L6GA 2PURA 3OTRA 3AS0A 4C6FA 4D9PA 4IXHA 4HNTA 1Z41A 8RUCA 2CLKA 5LHEA 1MDLA 2PA6A 3SSJA 5A2CA 2CHNA 3UZWA 5CPQA 2ZICA 1XRVA 2QZRA 1L2UA 5DANA 1H7OA 1LL6A 2E5CA 3TDFA 4OGZA 3TQKA 1SQ7A 1Q6EA 4B5SA 3ZT5A 3MSRA 3AFBA 2AQWA 4X63A 3WD4A 4DO7A 2CWNA 4WHBA 1OVDA 5IM51 3FKRA 2Q3OA 4PSPA 1RCXB 1PXGA 3WQ5A 1GZGA 3DCPA 3MO4A 4IGMA 2EEXA 3WNLA 3VKBA 4QLJA 4DIAA 4LPCA 1V7AA 3QN3A 4RUBA 4LV4A 1VRDA 2VP8A 4UTTA 3M1ZA 2G97A 2INFA 3GB6A 1DWGM 1Q45A 3WBXA 4B5VA 3GSMA 1Q63A 1XLDA 3KHDA 1HJVA 3IJIA 4GCAA 4EIVA 4KW2A 3FIGA 1O6IA 4UFIA 2XSAA 3B8UA 4H8HA 1TE1A 1V6WA 1D9EA 2V5JA 1XS2A 4LW7A 4PTWA 5D2XA 1EJ7L 6A3HA 1ZJAA 3ALFA 3SN0A 3AYSA 4LVFA 4WOQA 1J6PA 3UZ5A 4CD8A 4C6BA 3MHUA 2ISVA 4KWSA 4NNCA 1NFBA 5A5WA 4FNUA 4ML9A 3RF9A 3T81A 3B97A 3UZXA 2PWGA 1NDZA 1XC6A 2Z7GA 4O53A 4QE5A 2Z4GA 3R8HA 1PZ0A 2BFGA 1QDSA 1F3WA 2CLHA 4KGJA 1K4HA 1IT0A 5DRCA 2EG6A 3BE7A 3WF0A 1EC8A 1KCKA 4DQWA 1EA0A 1R9ZA 3ICJA 1EBHA 4AWUA 1VFOA 3BOLA 2F61A 2ZRZA 3BW2A 2ZTKA 1PO9A 3S47A 1XQLA 2C71A 3V3WA 3SCOA 3PAOA 3CLWA 2WC4A 1G4SA 4DLFA 3UYIA 1FKXA 3RIKA 1ME7A 4KCTA 1ECQA 1XG3A 3MZNA 3TYUA 4JX5A 3AXIA 1WDDA 2VC5A 3CXOA 1ZENA 1Z3NA 2D20A 2DGAA 1W37A 3CAQA 4JQ2A 1LF1A 3QV7A 1PHWA 2POZA 5I7GA 4DAIA 4LY8A 3T55A 5AYIA 2WSRA 3B8TA 4JFWA 2GQ3A 2OGYA 2HPIA 4PTMA 5I5RA 1XLHA 1BGAA 1MRAA 3G1XA 2OLHA 4GOAA 5ABFA 5K9DA 1VBHA 4DXXA 1TTIA 4YTTA 2YL6A 1XYAA 1G7UA 4NF7A 2UY3A 3TOPA 3T07A 4O1AA 4ICMA 3GTXA 2W5FA 2P76A 1A47A 2CYGA 1J01A 2DQXA 3NVDA 4GUJA 1B2YA 1E9IA 4NYYA 3GU9A 3HG4A 2ODOA 4D6CA 1G67A 3B0XA 2WVVB 4TOQA 2J47A 1T0OA 3IGHX 3FJ6A 1R3WA 1XF0A 4L1GA 1JULA 1QHOA 3ZXWA 4A3YA 4M1RA 4QJ4B 4ZXOA 3T78A 3TW9A 4K8GA 2ONEA 1O5QA 2CKSA 1DJYA 4BI6A 3GQYA 4TUFA 1LBLA 4PUEA 4X0NA 1IR2A 1HW6A 1P0KA 3U4FA 1F8IA 2VYOA 2V9DA 3DERA 4IH3A 5JUVA 5EA9A 1I2RA 3HV9A 3EX2A 3RFAA 1OX4B 1WZMA 1XYBA 2ZXDA 4UTIA 1KWKA 3Q2DA 5JH2A 3FHAA 1O66A 2CLPA 1V6YA 1WAWA 3AC0A 4IG2A 3I4KA 4CCEA 1OG0A 3N15A 4XBJA 5ECVA 3WZ0E 5HXMA 4FOKA 1RK6A 2PDGA 4OTKA 1JPKA 1OFQA 4IJRA 1ESWA 4MWAC 4ACZA 3AIQA 2WPBA 2GUBA 4W8LA 1XPYA 4KWUA 1M1BA 2YL8A 3BLIA 3U6WA 1XP3A 4NIRA 1XX1A 4BEQA 4DBSA 2GOKA 4PZVA 4CN6A 5D30A 3VFCA 3FN9A 3GHUA 3RYSA 2NZLA 4EXBA 1OD8A 1JDCA 4ECLA 1US2A 4X60A 1E9ZB 3TJXA 3DFPA 4R33A 3GC2A 3Q67A 3A9IA 4NZ4A 5E09A 3ITXA 3VA8A 2V3GA 2FDMA 1VF8A 2EKGA 5TNVA 4ZSTA 4OUEA 3R2GA 4LNCA 4ZTXA 3WD2A 2OT0A 1U1JA 4DF2A 4HZMA 3KHJA 3FYPA 3GW0A 2A4AA 3VNIA 4JNZA 3QC0A 3TYBA 3THAA 4UZSA 3SCUA 2A6LA 2FB3A 4FB7A 5JU6A 4F48A 4WSHA 2DSKA 1LT8A 3WDRA 4NAEA 2DIKA 1KCZA 2HE8A 3QYSA 1HNYA 4P7QA 2QMJA 3N2XA 2VR5A 3OOQA 1UR0A 1XRTA 3K46A 3LMZA 1YDVA 4AZCB 2GDVA 4Y9MA 2WKJA 3BL3A 1HGYA 5C9ZA 3KRUA 1G6CA 3NM3A 1F6PA 4UQBA 4FSAA 4WY0F 4IXXA 4LUSB 4UFJA 2YIHA 3EX1A 1TYGA 1UKOA 4B5TA 3AO0A 3H23A 2RJGA 4L9YA 3OW1A 2VT0A 4ORIA 1EEXA 3BLKA 3H2NA 2F2HA 3M6YA 3OYZA 3QEZA 3LTPA 1M7JA 3QLLA 1KLZA 4IFKB 1AFSA 3S8HA 2EG7A 4O8RA 3LZ3A 3VDBA 2Z1SA 3I68A 1RBOB 4IP4A 2PU1A 3BLOA 4QQ3A 2V2CA 1P0NA 3FSUA 3HGSA 1J11A 2A7PA 1KFKA 4P2VA 1J0YA 4CLMA 1LLWA 1ONXA 2GJLA 4GWEA 4RXGA 3H12A 3LQGA 2BVDA 3A4AA 4W5ZA 3WH5A 1Z8AA 2OQLA 3VCCA 1OFPA 1SJDA 4UCFA 3NL2A 1EL3A 3LTSA 1IEVA 5EMLA 1BXBA 1VS1A 4NXSA 1Y65A 3GDKA 3WUEA 2QCEA 1J0IA 2RDTA 2R24A 1CWYA 2R6OA 3UWUA 4Q7BA 1UD6A 1UWUA 1RQEA 2NXGA 3WQ4A 1TV3A 1HZYA 3LCLA 3GXMA 3L5LA 3U2ZA 1GYLA 1LJYA 2ZC1A 1JDAA 1HUVA 1ODZA 3G2GA 4MLRA 1MMFA 4EAYA 2AQOA 1LWHA 3TUUA 2RDWA 2XIBA 4JCMA 1OYCA 4R5EA 3SO7A 6CGTA 3M4HA 2BDQA 4KQNA 2ZXAA 3TE9A 4QQUA 3GAYA 9XIMA 3L0KA 2A3BA 2YLLA 2E5BA 1XPGA 5AOUA 1QOPA 2PDIA 4KETA 5LNVA 2WMGA 4TX6A 3C2VA 4DVOA 1ZZMA 1G0CA 2Z1VA 5CPSA 2QVNA 4WDTA 5LYRA 1ME9A 4MF4A 1OSEA 2YDSA 3UZZA 1E3ZA 2CPUA 4FHAA 1JZ3A 2B31A 1FWHC 2ZFAA 3R25A 3W88A 1BXNA 4CQ8A 1UUMA 4Y9OA 4F0MA 3PZUA 4KWWA 4HSNA 2JALA 2G50A 3E0VA 4C6IA 3L12A 3OLDA 4ZXLA 1A4LA 1XKYA 7TAAA 2V0TA 4AVNA 3KRBA 2VWTA 4OE7A 3ZWTA 2OYLA 2VDGA 3K13A 2XVGA 4AD2A 3WK0A 1DWIM 5M17A 4REQB 3R89A 3W7GA 2QV4A 2YA0A 2HK0A 3RX4A 3AIEA 3G0UA 4GCXA 1BF6A 3W9ZA 2BY2A 4RZ6A 2V6AA 2V8ZA 2WJEA 1C8VA 4KCWA 1EFZA 1H0GA 2BV9A 3APTA 3GD6A 3UR8A 3W7JA 3PFMA 2XSBA 2W27A 1EX1A 3JVAA 4YL2A 3EOSA 4CCDA 1A5MC 5HJYA 1QPKA 3BSGA 4GUFA 5D33A 3LHVA 1GVQA 1VH7A 1L6FA 3EGJA 3VCRA 3WCZA 4DUWA 4AB4A 3UWZA 1PJ9A 1THFD 2R9RA 5M03A 1H7XA 2DT0A 3WEZA 3PJWA 5C54A 3VNDA 4QAWA 2DW7A 1QNPA 3GXTA 4H7ZA 3VNYA 1XI3A 1J79A 2FPVA 4XVEA 1I1WA 4O15A 1V0KA 2Z1WA 3TIMA 2VUNA 3BQ6A 5A8OA 4GYPA 1BTCA 1QW8A 1HJSA 3E2SA 7ODCA 4BKNA 5H1WA 4W87A 2GQ9A 2XZ7A 4F40A 1GQJA 2Y89A 4O57A 3UG8A 3W7IA 1KRCC 2Y2WA 5CPLA 3SQMA 4OBSA 5DEZA 1VRXA 3DKLA 2OEKA 4AHPA 1P0DA 2QDGA 3T8LA 3WBWA 2WZHA 5ABGA 4LFYA 5DBUA 3WMSA 2WNQA 3F1QA 2GWGA 4UTFA 3RPDA 3S2LA 3EA2A 1QBBA 4K37A 1QI4A 4PTVA 4O1DA 2D2JA 3AMGA 2I56A 3CH0A 4O4VA 2Q8LA 3T2OA 3TZNA 1Q3NA 4CUCA 2OX1A 3WMLA 1LL4A 1AODA 1O12A 1BRLA 3B0PA 4UUIA 3ARYA 2DIEA 3VDCA 3W7NA 1OX6A 2FQIA 4YTUA 1BG9A 1FWRA 3GVGA 1XLBA 1SFTA 2G4JA 3BUVA 4Z2KA 3N9RA 2XFFA 5KZMA 3O1NA 3MANA 1U1UA 4JX4A 5CSUA 2J7FA 3EXTA 3GUWA 2VRQA 3AUJA 1AH0A 2Q8XA 2I9EA 3RNDA 4MAZA 2F2KA 4H1ZA 1T41A 3D5HA 3K1DA 4LUIA 3W2LA 1TWZA 5I24A 5G2IA 5AYYA 2GK1B 4MKSA 3BCFA 3NDOA 5FEPA 3UJSA 1P4CA 3FAXA 2NVCA 3LYEA 4IUGA 2PDUA 1GNXA 1POJA 2QR6A 1J9YA 4CVWA 4MUZA 2YFNA 3L23A 4V28A 1WZLA 2Z2BA 4S3EA 1C9DA 4J2PA 3VNZA 4CQDA 3AALA 3AMKA 2PWDA 1OK6A 4KRUA 3E5BA 4NY2A 4GI4A 2WVTA 4AWSA 3WLQA 3FAWA 4KCUA 4P8VA 5FL0A 1UD4A 4XZWA 4LCSA 2GGGA 3OZOA 5I03A 3KXQA 5C2XA 1OB0A 2OWCA 2NQ5A 3QV8A 1GK8A 3OLEA 1GJUA 3VK5A 5F4XA 3FJLA 3RM8A 3DHFA 1JZ6A 4YTSA 1P0BA 3PNUA 3BMXA 4AVOA 3W74A 5HMEA 5I02A 3RR4A 1B4EA 1RY0A 3VC5A 4LVBA 4ZOEA 1OY0A 1F8MA 1XQKA 3NDZA 1YYAA 2AL1A 4NHVA 2YCEA 3EDFA 5FKYA 1UOKA 2VUYA 1SFJA 3WSUA 3GS6A 2OO6A 3SFKA 4LOCA 3AI0A 5CGMA 3NXFA 2WNNA 1O68A 3GU1A 1RQBA 2WZIA 5D2VA 1I2QA 2JIWA 1W1ZA 3R8RA 4WZHA 3QHOA 1XHGA 2KZHA 3UBPC 3GYCA 4TIMA 3P81A 4IX2A 2PPGA 5AKQA 2NXHA 5GNZA 1D3GA 1GEQA 1T7LA 1TMHA 2QUTA 3T44A 1JF5A 4QCFA 4HNOA 2WZEA 3SCQA 5HULA 1M3UA 4XB3A 1PKMA 3GDRA 4S3AA 4B16A 1KD0A 2VVNA 3VNLA 3BLLA 4US5A 3GDLA 5E9XA 1ISZA 4BF5A 1SR0A 3KOZA 3LGDA 1VBJA 3LGGA 3NUKA 2BLEA 3IJQA 1GG1A 3NSXA 1IWAA 2P50A 4JTKA 1OHLA 1H4PA 4S3GA 1XH1A 2ICSA 1XUZA 5HPOA 3BICA 2GQ8A 3W1RA 3ABOA 1MXDA 4PCFA 3GIYA 1D3HA 1AQMA 1GOKA 1UH2A 3B03A 3S2NA 5F7UA 1J93A 4WVXA 5HDRA 2YDQA 4DXKA 5C7VA 2QCDB 1AD4A 3BCDA 4J5NA 3NQFA 2ZRVA 3CNYA 4JTAA 1OEPA 3DU0A 3PG9A 5F4WA 5U4NA 3THCA 3U2OA 3UR5A 1T5AA 1QMLA 3ID7A 1BPLB 2DZWA 5J8LA 3AYVA 2G5WA 5LIKX 1VFMA 1CIUA 2WCAA 3JR2A 3S3GA 2EQDA 2VOMA 5TIMA 1TUXA 3EOEA 3PP7A 1MNZA 1X6LA 5FJRA 3W01A 1RBAA 4Q4OA 2XGIA 3CTLA 1GVOA 1UW9A 4NZFA 2W0UA 4LYPA 3QKZA 5AZ0A 5BOFA 3AWOA 3WNMA 2BGQA 4QRNA 1H62A 2J25A 3CL6A 3DENA 4KERA 5IXEA 1DIEA 3UY7A 1YMYA 1GVEA 4JZ5A 5KITA 1WUEA 2XVNA 4XZMX 4AYSA 3ANYA 4AMAA 8XIAA 3HGOA 5TF0A 1K8CA 2ZUMA 2J6VA 2XWDA 2FGZA 2Q3RA 1XCWA 3NQ6A 4ZO8A 3STFA 3BLFA 1TV2A 3N2BA 2ZZ6A 4YVPA 5C9RA 1LT7A 4E6MA 1HL8A 2X1UA 4G8TA 1V6TA 3PTMA 3UPBA 2PDMA 2G0WA 4DYJA 5HAOA 2YBTA 3A23A 3NO3A 1E9YB 1J2WA 3ANUA 3A3HA 1A0DA 4GK8A 4PUUA 3WBYA 4P8UA 5AC5A 2J7CA 4GH3A 2FZMA 5LGXA 2CBIA 4X2RA 3F2CA 4QX4A 4XVDA 4L64A 1H61A 3GK0A 4HK6A 4PGLA 2D23A 2PDBA 2AAMA 3MY9A 5F1VA 4AEOA 3VM5A 1ZLPA 4GY0A 4OT7A 1R46A 5F2GA 4C6OA 2VC7A 4NVTA 1TREA 2A3HA 4DZHA 2YXOA 4DPQA 3HPFA 1JYVA 5F2MA 1RUSA 3RLUA 3E5PA 3LUTA 2WVVA 2YYUA 1EP1A 5T91A 2BY3A 3ZQ9A 4NZCA 4M56A 1QW7A 5BYWA 4I7VA 3GNDA 1ADOA 4AY8A 1GWJA 5AHNA 3E96A 5HPCA 7XIMA 3LPPA 1VAHA 4RE2A 1V0NA 1TWSA 5IBXC 3PY2A 1Q85A 4OV9A 4RW5A 3CEUA 3UG3A 1BQCA 4OUIA 5DCBA 1GPWA 2C19A 3IV8A 2WVUA 2BVYA 1OX4A 1YDNA 1UZDA 3LB0A 4BEUA 4K8EA 2QCGA 2ZXBA 1UYQA 4MJ2A 5A3HA 2J27A 3W37A 3VKCA 5AVNA 3W3OA 1SMDA 2C16A 3TH6A 3ITOA 2ISWA 3EEGA 4EWJA 1TX0A 3CIWA 4HYRA 5ABEA 2Y88A 3TOYA 3PUGA 4MHBA 4PTNA 1VFSA 1Q6RA 1KGXA 2Z1BA 1KLYA 5CPNA 2FHCA 1KM2A 3UWEA 1LG2A 4E2BA 4C6LA 3S9ZA 3UESA 3K4WA 1TWWA 4YJ5A 3Q65A 2VQUA 4DJDA 4WRHA 2PWEA 1IEWA 1KTNA 3TWBA 1UKTA 2B7OA 1XH0A 3WUGA 3LY0A 2YB4A 3AYRA 4HIBA 2ZCGA 3HPZA 3H7RA 1ITUA 3RDKA 3W2KA 1BHGA 2CC0A 5IOBA 1W8SA 1IWPA 4S3BA 3MMWA 4H4IA 3A4WA 1IT8A 1DIKA 2YZ5A 4A05A 5TQLA 3HGJA 1OGGA 2QLYA 2OCZA 4NJIA 2BOEX 1DWFM 1X8CA 4TR9A 1S2VA 3EMZA 1E56A 3MUCA 4LVGA 1PTAA 1KBKA 2PMQA 4AZCA 5C9XA 2GGEA 3BQ5A 6REQB 4FPSA 4TVCA 2GYIA 4UTMA 4R7WA 2PGRA 5FEXA 1S38A 3VIIA 4LAZA 1VGAA 3WQ8A 4LUSA 1RCOB 2WANA 4MSSA 2PE4A 2OKOA 2DU2A 2C6QA 3GR4A 1CLKA 4C7DA 2FJKA 1NP0A 1IE7C 3T9PA 4ZQMA 2PBOA 1D7KA 4IFKA 4NX0A 4DUVA 2X1IA 1J2BA 3BZGA 3WDHA 3N4AA 3IK4A 4IP5A 4K7VA 2XIOA 5ABHA 1F76A 4IPIA 1YTKA 3BV7A 4WEVX 2Z6JA 3RILA 1M6JA 3G5EA 2XYLA 1EIBA 1ZAIA 2JGYA 2H8XA 5LIXX 2BVTA 2JK2A 1HO1A 1XDLA 4BHYA 1HJWA 2W61A 3RLVA 4H3DA 3QPYA 2HISA 3QZ6A 3IRSA 4ASTA 4R34A 3E49A 3KRZA 3PJUA 1H51A 2C1HA 4KF1A 3GG8A 3QY8A 3IVUA 4M19A 1PUDA 3AMCA 1EB3A 1CPUA 1LLOA 1PWMA 3K4DA 2PTXA 3K4AA 4GPNA 1S1RA 2OSXA 5G2WA 2ACSA 2X7VA 4PTDA 3USBA 2JFEX 3AHXA 3BG5A 4I9JA 1ZSXA 3N34A 2YA1A 1XFBA 2GPTA 3IVSA 1E4LA 1W9BM 3IEBA 4RZBA 1OCQA 2J79A 3KM8A 3WENA 2WHLA 1JFHA 1XBXA 1VJZA 1GEHA 1TZ9A 1JCJA 4A3QA 5E0FA 3POCA 2WV8A 3W7PA 2QJIA 4UTTC 2HROA 3EOLA 2CESA 5I3IA 3GH4A 2ZX8A 3FXGA 1R9YA 4NJGA 5CLTA 1F4AA 1CLVA 4JYEA 1BVNP 4KWOA 3UNDA 5I6SA 1VEOA 1IYXA 3ALGA 4S2CA 1GPFA 1LLZA 4C91A 2OWWA 5E70A 3ATYA 1KO0A 3N19B 3GXIA 4K3ZA 4AF0B 4HN8A 4QNEA 3H4GA 1W5QA 4CN1A 4GZ7A 5BU9A 5CGTA 1E0TA 1SR9A 4YYFA 4V1YA 3LG3A 3LPOA 1LG1A 4FLSA 1TTQA 3BWWA 1CXEA 4US5D 3TTEA 3LRLA 2EHHA 4JFUA 4DJED 4C6EA 3TTQA 1XCXA 2W67A 2EAWA 4UTWA 2DSZA 3BURA 3F2DA 3NQBA 3FDGA 2J6XA 4QJ5B 3PZTA 2CNCA 4P61A 4A2RA 1SZEA 5T26A 4LEFA 4O19A 3LXAA 5DCDA 4TVDA 1EKOA 2VURA 1KV5A 3SJNA 3LCHA 1AK5A 2B7PA 1RP9A 4V15A 3BOFA 2D3NA 3TA6A 5FEZA 3NSNA 4REQA 2NQ9A 5FESA 3LERA 4HD5A 1IWBA 2VKZG 2NT0A 4Z1BA 2E5DA 1S5TA 2I57A 4IOTA 4UFKA 3CZ8A 1GZ1A 4GQRA 2QT3A 3CAVA 3M0VA 1EHAA 3T05A 4P7NA 1OGBA 3QHMA 1A80A 4M0XA 1IHIA 2WSQA 1QVBA 1SU5A 2B81A 3NR0A 3C61A 4C6MA 2Y7EA 3W28A 2JEQA 3C0LA 1YNYA 2WLYA 5FI8A 2Q6ZA 5A8MA 1ICPA 1E0VA 3NOEA 2OSWA 4Q33A 1NH6A 4UQ9A 3CK5A 3NZPA 2E6YA 3K8MA 1CGVA 4GVGA 4LAMA 1A5NC 2CKRA 2XH4A 4IPNB 1RH9A 4B4FA 3OIXA 4FLOA 4HOWA 3PWGA 3T08A 3PUEA 3OLGA 2BY0A 3LSCA 5FEWA 3VDAA 3MUAA 4X9SA 1E0XA 4ML4A 5FJIA 2HRWA 1LWIA 1WX0A 5H6HA 3WLHA 2DPEA 3KWSA 4A3UA 1DPMA 1OJXA 4FR6A 2Z24A 5BXSA 3RGTA 1W5PA 3TVAA 6XIMA 4DF0A 3UW6A 4AIEA 4H7VA 2J74A 5MKGB 4IMDA 3BAWA 3QQWA 3CWOX 5K3VA 5HK4A 1G9HA 1S2WA 1VCGA 3GDTA 3OB8A 5AHIA 2GJNA 2RFGA 4NILA 2QGHA 2NQJA 4I8YA 4LEQA 1W6TA 3CUHA 1AUSL 2CZDA 1P1MA 3FEMA 3EAUA 1W32A 4DNHA 3O16A 4WUIA 4KFOA 4GACA 4WSKA 3B4YA 2FHFA 1E1EA 3QR0A 4Q8TA 1EGMA 2UY5A 2H8ZA 3SW6A 2Z0IA 1ZPTA 3RRXA 4EXAA 1OT2A 1GTEA 1MQRA 5BMXA 2R94A 2V3DA 4LAUA 2FVMA 3VO0A 2J24A 3ARPA 4DM2A 3N2CA 4GJJA 1E4MM 3VZYA 3WBEA 1I2OA 1XSIA 4S23A 1S1PA 3F5JA 2PBGA 4KMQA 4RDYA 3SCSA 1KTCA 1T8QA 4I3GA 2I17A 1R2SA 3P62A 3QOKA 3HQPA 2IUZA 2GK1A 3SCRA 4W7UA 2ACQA 3MWAA 3W24A 4A2SA 2OYMA 3QY7A 4PCPA 4G2DA 2ZIDA 2VGGA 3ABRA 5HMSA 4DUOA 1BWLA 3E38A 2CZVA 4HMEA 3J7HA 3IIOA 4RE3A 1UBSA 4IQEA 2F6XA 3M44A 4K8HA 4CVUA 4G5DA 4CQAA 2BG5A 1DQWA 2FZBA 5M2FX 1ME8A 1XG4A 2CLIA 7REQB 1SW7A 1LCOA 3S2MA 4FLRA 3WK1A 4WGXA 4JCLA 2BXZA 5FACA 4MG4A 2VNCA 5ECUA 1FWGC 3IVTA 1JL8A 4I5RA 3BSHA 3CZJA 3CLMA 4G56A 4DJDD 3BVJA 4UR7A 4Z42C 3PZNA 3L4VA 2HBXA 3GRIA 3C5QA 1VC4A 2ALDA 1F5ZA 4M80A 5H8UA 1BQGA 3AS2A 3W7KA 3MBFA 4N6FA 2Y62A 5LIWX 2CCRA 2AKMA 3NVTA 1N8FA 2FLIA 1FHLA 1UP2A 3JRKA 1ADDA 3TCEA 1R2RA 4GO8A 1SZGA 1BYDA 1CXIA 3GIQA 1TJPA 2R1NA 5CC3A 1E9LA 2H9AB 1XGEA 2A3AA 4U33A 1E0WA 1W5MA 3CWNA 1P48A 1V51A 2HV5A 3UEQA 2GVJA 2FMNA 4UR9A 3NQ7A 3L4ZA 3W07A 3ABZA 4HPJA 5HNNA 1V02E 3OQEA 5D02A 1XLAA 4C5ZA 3MMDA 3S0CA 3QQ1A 3GR7A 2VZOA 4ADUA 2QF7A 3ITCA 3W1TA 1CB2A 2WCGA 3W1LA 4UOZA 4HNCA 3MCMA 1VIZA 1KFCA 4PBFA 5A2BA 4OIFA 3QM3A 5BMWA 2LLEA 1GVFA 3EDDA 2V81A 4B91A 3TSBA 3HQOA 2OVLA 4J35A 2WZTA 3WQCA 4B15A 1J0JA 2WC3A 3CC1A 1TTPA 1OFBA 1Q7QA 3CIXA 3EX4A 3E0IA 1L6SA 1L8PA 4J3UA 1K03A 4R7JA 1TQXA 1XD0A 4W84A 1KGUA 1U5JA 3W1XA 5FF3A 4XV0A 4PN2A 1CT5A 1TPVA 4ERAA 1GVSA 1MZRA 4BQ5A 1K9TA 1K7FA 5D37A 3ARRA 2HBVA 1Y7VA 4U2YA 4POCA 3VIJA 3HG5A 1PSCA 1BFNA 3BANA 3MV01 3QQ0A 3VDHA 3DUGA 4Q4MA 1AMKA 1A3HA 2ZE3A 4E2VA 2C15A 3ENLA 4IICA 3SRKA 3HQ1A 2QCDA 1US3A 1HX0A 4MNLA 3ABQA 2C1IA 4D71A 3UVAA 4GC4A 3VIMA 4QR6A 1QXLA 3P93A 4CNNA 3H70A 2D0GA 3I10A 1DE5A 1TIMA 1EHNA 4WJXA 1A50A 4PTXA 4N6EA 5C9UA 3VXGA 1DTUA 4W85A 5C2CA 1DWAM 2O92A 4QJ3B 3RHGA 1FFRA 2BOFX 4PMJA 4NASA 1HF6A 3RM4A 3T8QA 1BYAA 1K1DA 3R10A 1RBLA 1SO3A 1ZBWA 3AQUA 2P8CA 1EJVC 1BF2A 1K8YA 4MPKA 3UF9A 1L0PA 3GDBA 4AISA 3UXIA 1NM9A 4R7OA 3VKDA 3NGJA 4MYAA 2CZEA 4MOZA 2FZNA 1BKHA 1UWQA 2QCCA 3MT1A 1AQFA 2E8ZA 3N12A 3GYEA 1YDYA 3ZJKA 3H26A 4OVXA 1E6QM 1Q7MA 4JY9A 2E1WA 3EPOA 2YLAA 3H7VA 3GTFA 1RPKA 4GI9A 3W23A 1WA3A 3CIVA 3UCCA 3I65A 1HFBA 2HWGA 3HIJA 3OEXA 1E71M 3VVGA 2HZGA 3DN5A 4WGHA 3OZMA 5DT5A 3GO2A 5HQLA 1PPIA 3G77A 1E51A 1IGWA 2PD5A 4LYKA 2ZUWA 4C90A 1PZ3A 4IQLA 1QWKA 5CPMA 1WZAA 4AC7C 1AJZA 4XD4A 1WE5A 3PS7A 4AX6A 4J4KA 4W88A 2VEIA 3WD1A 4LS1A 1ZP3A 4HA0A 5REQB 1ZGDA 3TXZA 3ATZA 3HURA 1A49A 4Q22A 4QDPA 1HGWA 1JVNA 5LNSA 1AQ0A 3W6MA 2ZRWA 2SFPA 4FP1A 2WB5A 2DORA 3P7YA 3EMQA 3HMCA 2PDNA 3L68A 2UY2A 3BAKA 1TPDA 3SCTA 3FK4A 4QJ1A 2EG8A 1JDFA 3F4VA 4OBRA 4Z2JA 1IEIA 5GQBA 4BI5A 1CXKA 2TODA 1RXOB 3TV8A 1X97A 2E67A 4HNLA 5B7YA 2OPJA 4S3JA 3KOXA 1Z6KA 4ZODA 1W3TA 3GNOA 3OVRA 4HHLA 1PDZA 4I9AA 4OHQA 1QK2A 1EUAA 3NYDA 4J28A 2BZNA 1FWTA 4YWSA 2OU4A 4TV5A 3R94A 1LRNA 3QC3A 3VIHA 2ZUSA 3MKVA 3HFYA 1SJCA 4EP8C 1XYFA 4YTQA 4Q4KA 2PWUA 2ZX9A 1XLJA 3N18A 4H9XA 4O10A 3W7MA 3SCNA