2QCEA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase bound to sulfate, glycerol, and chloride
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
256
Chain Sequence
b'MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 97
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qceA00
2F7FA 2P10A 4TMCA 1TV7A 2E6FA 4FIQA 4MY1A 3DGRA 5HUOA 1G7VA 3NZ1A 1W0MA 1PE1A 4AF0B 2H3BA 3MP4A 4P61A 5D2WA 3IIXA 1W5MA 3S1XA 3W1PA 3PBUA 1CI1A 3DFQA 3N14A 1A5SA 3P5ZA 3TK7A 4HNUA 1M6JA 3NQ6A 2AAMA 1OFQA 2C6QA 1R2TA 4GNJA 2X16A 3LB0A 3QMSA 4O4WA 4UTHA 1H50A 3CIXA 5K3VA 1L9WA 4FNTA 2CLFA 2Y7EA 3BLIA 3GK0A 3CHVA 5CKSA 3RNDA 3QJAA 3NL3A 5G1TA 2DZUA 5DBTA 5AB3A 3L0GA 4QJ1A 4UXDA 3W1RA 2CZEA 5I3IA 1UUMA 5BW6A 3GDRA 2QCLA 3GKFA 2CZFA 4FXRA 4LRTA 1ZHAA 1BWKA 3NAVA 2DZTA 2DZPA 1IIGA 3NM1A 4BWLC 1SW7A 5CPLA 3W2UA 3THQA 3BGJA 3G0UA 1G67A 1F05A 5G2WA 3B03A 4A22A 3KOFA 5DY2A 2OZ0A 3I65A 4ONVA 3NZRA 3C0JA 5ABTA 2GVGA 5AYXA 4FHAA 1F6PA 3GXPA 2NXIA 4IXHA 2QCGA 1W3NA 3H54A 4N9DA 5DBUA 4A21A 3C2VA 2V5LA 3ANYA 3S8HA 1VGAA 2A85A 4DPPA 3L67A 3O63A 1H5YA 4UFKA 2QJHA 2YW3A 1TQJA 3IIVA 4IPIA 5KMYA 3W9ZA 4JY9A 1YDVA 2EGZA 4NX5A 2YX0A 4GE8A 4DO4A 2C0AA 1LORA 3LBMA 3TH6A 2NX9A 3OVQA 3LXCA 3W1MA 1TSIA 2QCHA 3BG5A 2NZLA 2PRLA 3EXRA 1TO3A 5CZJA 3O16A 2VEIA 4O11A 4D2JA 2J88A 4O54A 3OEXA 1WBJA 4XWUA 1GG0A 1OFBA 3OG3A 2AQWA 1TPWA 1OG0A 1I2OA 2B4GA 2W79A 4Z1DA 1FDJA 5G1YA 1LOSA 5K7JA 1O5KA 3TXVA 3EX2A 2ZZ1A 2NV1A 4NXKA 1D9EA 4M6QA 1IXNA 2OCZA 2VFGA 3G3MA 1JCNA 3OIXA 1JRCA 2FB3A 2Y7FA 1OK4A 1O95A 3AJXA 1A5AA 3TE9A 4FX8A 1K7EA 3ABRA 5D30A 1YYAA 4A2SA 1TQXA 1W56A 4K36A 1HUVA 1XFBA 2QCNA 5K9DA 1TCDA 3MI3A 3DHFA 3R12A 2RHGA 2XN1A 2DZVA 1VH7A 5FEPA 4AHQA 1I4NA 1F74A 3T55A 3RLVA 1S3HA 4HSNA 5AFDA 3HG2A 1EB3A 5C54A 2ZZ4A 3B8DA 1EUAA 3TFXA 4XBKA 4O17A 2GOUA 1TTJA 2CLOA 3HB9A 3ZFHA 1W3IA 1SQ7A 3IGXA 1OHLA 3CWNA 2WV8A 1SR9A 4RX0A 1LDCA 5HR7A 4JYDA 4O14A 4AWUA 4KFNA 4RJEA 1KFEA 3TSBA 5F1VA 4RV8A 1XBXA 3A5VA 3G24A 2V2HA 1WX0A 2X1UA 3W1XA 5AOUA 2ZBTA 2NX3A 4JDBA 3KRSA 1JCXA 3FLUA 3MP3A 3TCEA 3NDOA 4ZQRA 3M5ZA 3M6YA 3Q37A 1VCGA 4QM1A 2VXNA 1G7UA 1OJXA 3TJXA 3W7KA 3PUDA 4GUHA 1ADOA 3EWZA 2O7QA 4BK9A 1A50A 1QOPA 3LV6A 1FCQA 5DCDA 2NLIA 3JR2A 3FJ6A 3CC1A 2JKPA 1VZWA 3G1FA 3I6RA 1W5NA 3UWUA 4MJMA 2Z2UA 4PL1A 5EYWA 3NPVA 4PCFA 1G6CA 2C14A 4RZ5A 3RMJA 1W1ZA 3QPYA 3GDLA 3P8IA 5EBUA 3G1YA 3P82A 3LLDA 3C4UA 1YPFA 4JD4A 5HWMA 1H7WA 4PTNA 2P1FA 5AHFA 1SZGA 1Q6LA 3VFLA 5LSMA 4TU1A 3L21A 4LNYA 5LNRA 1P1XA 2BLEA 5LKYA 3DH7A 1Z42A 4JTEA 3PBYA 2WNZA 3QQ0A 3W1TA 1QO2A 3B0PA 3MHGA 4AF0A 3USBA 1W5PA 4CNNA 2CW6A 1PCWA 5MHBA 1XC4A 2QCDA 2VFHA 3JRKA 3RLUA 1I8JA 1DORA 3QMTA 3NQFA 1GJPA 4YLWA 3NNTA 4O0KA 3L5LA 4O16A 5F4XA 2QUTA 3LTYA 4L4MA 1AG1O 5LHEA 3ABQA 3O8AA 3QSRA 1LBMA 4R33A 3GB6A 1A5CA 5K4XA 3F1QA 2QR6A 1X1OA 1TIMA 3L9CA 1WDWA 2ZZ5A 3NQ8A 4K39A 1KBIA 3CLMA 1QFEA 5D03A 1N7KA 2Q8ZA 4AWTA 2FPTA 1IXPA 2Z6JA 3MW7A 3W87A 1G4SA 2H8XA 3TV8A 2C19A 1EUNA 3L65A 2DZXA 3EX3A 1LRTA 4AHPA 2QCEA 4LRSA 4PH6A 3GXTA 3P60A 1AW5A 3TQ0A 2ISSA 4NJGA 1E51A 1JRBA 1KM2A 5HULA 2VEPA 3W1AA 2I9EA 1TTIA 2I14A 3FA5A 2C16A 4WOQA 1QR7A 4GJ1A 4WX2A 3EKLA 2O7SA 4QSHA 3P61A 3R8RA 1G4EA 1OX5A 3N9SA 4PODA 1FWWA 1D3HA 5KSWA 4IWWA 3P67A 3W7OA 3T44A 1LLZA 1TJRA 3W73A 4JTSA 3NL2A 4HSOA 4JTUA 2Y89A 2QUVA 2OJPA 5IBXC 2QDGA 3HGSA 5F2GA 4GBUA 3TQKA 1H63A 2ZZ3A 3R2GA 1DQWA 2V0TA 2X30A 2EHHA 1KFJA 2Q3RA 4AHOA 2CLIA 5D37A 3T4CA 2UV8G 3PBWA 3NG3A 4IUOA 3NQ7A 1L2UA 1L6SA 1H1ZA 3F4NA 2FB2A 3UWVA 3PWAA 1XXXA 2YR1A 5KZMA 2A7RA 4OWGA 5LNWA 1KFCA 4DO5A 4NZJA 4XTIA 3IIPA 5AHMA 1GQNA 5A5WA 1MO0A 2YDAA 4UFJA 3M47A 3SECA 3M7WA 3TU9A 1PVNA 5HQEA 2VFIA 5F2MA 3BGGA 4WY0F 3B04A 4DBDA 4ADUA 5EPDA 1K8YA 3DFNA 3IV3A 2ATMA 2EF9A 1Z48A 4DEFA 4LS1A 4UTTC 5F4WA 3KHJA 2J9YA 3I7RA 1ZNNA 1TMHA 1VR6A 3FFSA 1DQXA 4AH7A 5CG7A 3BPWA 1OYBA 3MJYA 1LP6A 4HKPA 3YPIA 3S1WA 5AC8A 1H51A 2GVJA 4MY9A 4HNNA 1KBJA 3SGUA 2HS6A 1GYNA 2J9XA 2ABBA 1T0OA 3B05A 3LRKA 4R7JA 2YSWA 1TTPA 3W2JA 4LOCA 4FNUA 2A4AA 3IVTA 5CPMA 1XKYA 1J4EA 2R91A 3W7EA 1C9DA 1NF0A 3FKRA 1DJNA 3NGJA 4LU0A 4RK8A 2Q8LA 1PIIA 1B3OA 4JTFA 3B06A 1JJKA 2P0OA 2CLEA 3LI0A 3MO7A 1JQVA 2DP3A 2HSAA 1I2NA 4X9SA 3EWWA 4BFAA 1V5XA 1F2JA 4NT0A 4OBTA 1EIXA 1VCFA 3PY2A 4O53A 3TMQA 4Y96A 1OK6A 2CU0A 3W7RA 1VRDA 2Y70A 2H6RA 3EX4A 3GR8A 3BW4A 2X1RA 4KWVA 3LTPA 3SI9A 1Q6RA 2DJXA 4Z1CA 4GRSA 3G18A 3UXAA 3G1XA 1KW1A 3L2IA 2H8ZA 2VFEA 3TSMA 3NQEA 1AL8A 3GAYA 2PRMA 1X1ZA 4LVDA 4JYEA 4DF2A 2WNNA 3PR2A 2VEMA 4NNBA 3A21A 2E5DA 2XFWA 4UMCA 3LBCA 1GZGA 1NSJA 4LVFA 4UNKA 2JKEA 1P5BA 4FNQA 5I3GA 4Z1BA 4KFOA 1AMKA 3LX9A 1QPRA 2QJGA 1NEYA 2PRHA 4NZFA 4B5NA 3QEZA 1YXDA 2G5WA 1YXCA 1ICQA 5DXXA 1EPXA 1XUZA 3RK8A 4O57A 5LNSA 3FYOA 4UIOA 5FESA 4O1DA 1LBLA 4IXXA 3NQDA 2ZRYA 2ZA3A 2QCDB 2H3DA 3QFEA 3G1SA 5CPOA 4GC4A 1O4UA 1LLWA 4HIBA 4MZYA 3W07A 1PHWA 3STFA 3P84A 2FLIA 1QCWA 3BG3A 3M41A 1WOAA 3ABOA 5CZ0A 3UYCA 3QYQA 2GVLA 3WK2A 1SO3A 2G97A 3LCGA 1EP1A 1H7PA 3DFSA 2NWSA 4NQ1A 1QDSA 3UNDA 3BVJA 4NX0A 1VYSX 4U4MA 3UY7A 1AW1A 2TYSA 3N73A 4UFHA 5KITA 1WOBA 3ZR4A 1JVNA 4FEZA 1FBAA 3BLEA 3MI6A 3P80A 4IOTA 5J5RA 5CSSA 1L6YA 2B7QA 4XUGA 2PCQA 4K7VA 1N55A 4UCGA 3W7MA 3DENA 3C2EA 4W9TA 2J27A 3ATZA 3DZ1A 2NWRA 2C1HA 1V7YA 3G1DA 3IGUA 1IXQA 3KXQA 4JEQA 1SO4A 4UTLA 4ZQCA 3LHYA 4UR8A 1RR2A 2ZZ6A 3O6YX 2E5BA 1R30A 4NNAA 5KINA 2VEKA 4MY8A 3CWOX 3LDVA 3PF3A 4O8RA 4O12A 4ZVJA 4LUIA 4M5PA 2WOQA 4LVGA 3PB2A 3NVTA 1MSSA 1R47A 1GVRA 3UZJA 3PSWA 4ADTA 1ICPA 1A53A 3GZ3A 4CCEA 4O0ZA 2FQIA 1HO4A 1T96A 3BV4A 5DXYA 4HPXA 1O60A 4X22A 5CSRA 3NYZA 3W83A 1Q6QA 4O4VA 1SPQA 4I9AA 3WJWA 4UTUA 2A7NA 3I68A 2J9ZA 3WJZA 1QO5A 1R2RA 4MYAA 1FCUA 3HG5A 1KM4A 3CEUA 3LHUA 1HL2A 4WY0A 1PHQA 3UWQA 4O13A 2OT0A 3GIYA 1SZNA 5C2XA 5G2HA 4LY8A 5D2VA 2B7NA 5CZTA 3FOKA 3W7DA 1IGSA 3C2FA 1F76A 4NU7A 5EMUA 4JX5A 1G4PA 3GNNA 3VCRA 1OF8A 1TPB1 1B9BA 4K8EA 3HBLA 5AHNA 3P8JA 3LERA 1VCVA 4S1FA 4KWWA 1JR1A 1WXJA 2HTMA 1SFJA 3P74A 1WAUA 4TR9A 1JULA 1FWNA 1P0NA 5HJLA 3NQAA 2R8WA 1LZOA 1TV5A 1LRNA 2YFNA 3PSVA 3NQMA 4RZ4A 1KFBA 1YPIA 5FF3A 1GT8A 3L5MA 4JTHA 2V2CA 1GVFA 3C6CA 2QAFA 3GX9A 2EPHA 2DU2A 4JICA 3O15A 1JUEA 1X6UA 4YMZA 3EXTA 1SW0A 3QM3A 3D0CA 5G4EA 4MLJA 2BXVA 4Z1AA 3CEPA 1LOQA 3DHDA 3W74A 1G69A 3HGJA 2J24A 2DZSA 2Y88A 4UTWA 3GLCA 4MIMA 3MHUA 1HG3A 4TMBA 3PG9A 4Y9AA 2W6RA 4POCA 1M5WA 3EX6A 5C55A 3FIGA 1TTQA 3LHVA 2HMCA 2YZRA 1S5VA 3BLFA 4G1KA 4M6PA 5FEZA 1F5ZA 4ML9A 4IMEA 4NXSA 1UBSA 1XBZA 4A2RA 4AB4A 3Q2DA 4H4IA 1Z44A 3GR7A 3UPWA 2CFFA 4LUJA 1OFOA 1W37A 1UCWA 2V9DA 4O10A 1VHCA 5I3JA 5K9CA 1EWDA 2Y62A 5K4ZA 1K03A 2B7PA 2GQ9A 1OVDA 1GVSA 3W1QA 3LTSA 3LI1A 4CQAA 3EKZA 4Y6GA 1EP2A 3HPXA 3DI1A 4Q32A 4FNSA 2ISVA 6TIMA 4ICNA 4QAIA 3HIJA 4JDYA 1SSDA 3V1PA 3DI0A 2CLMA 4LS2A 4MZ1A 3PBVA 2DJLA 4M6VA 1BEUA 2JBMA 4CNOA 1JCJA 2VC6A 1F73A 2WJZA 4AXKA 5D04C 3C8FA 4CCCA 3W71A 1HTIA 4HT3A 5F1UA 3O6DA 3L0KA 5K9XA 3W7LA 1ZFJA 4TIMA 1QPOA 1F6KA 1K8XA 3DBPA 3HOJA 1KTCA 4WXYA 5E1QA 1VS1A 2KZHA 4GUFA 5LHFA 5HWNA 4MVAA 3EB2A 4Z08A 2VOMA 4CCDA 3U2OA 3C52A 1Q45A 2RKXA 3EWUA 3LCHA 5D2TA 4IGHA 1J2WA 4RKAA 1TPH1 4UR7A 1S5TA 4OHQA 3U8GA 4H3DA 2X2GA 5DLCA 1THFD 4ZQOA 3TR2A 1LTDA 4FX7A 4AAJA 3FEMA 3R13A 1QMLA 4XBSA 1H62A 1KM5A 5C6MA 4FNRA 5FF0A 5LGXA 3TJLA 3RU6A 4PEKA 1KM6A 2ZTJA 4Y90A 4BI7A 3PB0A 1K3UA 4UNLA 3MBDA 3STCA 3KVMA 1FDZA 1KLYA 1KV8A 5AC7A 5TIMA 4OQVA 1FXPA 3S42A 3MUXA 3EWXA 2WSRA 1XUUA 2ATSA 1GPWA 5KZEA 1FXQA 4MKNA 3M5XA 5LNUA 1JCYA 3E9AA 2F84A 4IMCA 3S1UA 2RH9A 3GYEA 3W88A 3BW2A 2H90A 3W2LA 1K7XA 3WFAA 1QPNA 4QISA 3G1HA 3H53A 2GPTA 4QQ3A 1ML1A 3A23A 1OFEA 4JX6A 4LWWA 5AC6A 4N6EA 2V2DA 1RQHA 4MJZA 3M5VA 1W5OA 3G22A 3Q58A 1DBTA 1FQ0A 4IX2A 3TXZA 3LCFA 4PC8A 1DV7A 3I7SA 3QRHA 3UZ5A 3M44A 3NQCA 1QAPA 1D3GA 3N9RA 1GTHA 3C56A 3LHWA 3GNDA 4QNWA 4WXZA 4NVTA 4AWSA 3G0SA 3IIOA 3T40A 3WJYA 4FX6M 3G8EA 4OE7A 4Q33A 3PM6A 1TPUA 3DAQA 3L5AA 1W8SA 3SW6A 3THAA 2NXHA 1OFRA 2NV2A 4GUIA 2FDSA 3A5FA 3W2MA 3NPXA 3M43A 1KM1A 1DVJA 1WBHA 5AHEA 4OU1A 5H91A 2VFFA 1H60A 4TO8A 4UTIA 3HQ1A 1TPFA 4OV4A 3TA6A 2WSQA 2E1DA 4YL2A 4WQ6A 2XN0A 1JUKA 5AN7A 2OX1A 3GDMA 1R2SA 4WY0B 4E2BA 1O5XA 5EY5A 3UQNA 1M7OA 2ALDA 2HS8A 3EX1A 3HJZA 5FEWA 3ATYA 1ZAIA 2GQAA 4R53A 1A5BA 3HPZA 1R46A 4WUIA 3JS3A 5HNRA 4N9CA 2X1TA 1SFLA 1SUXA 2Y7DA 4E38A 1YLVA 3W1NA 4M19A 5AHIA 3E02A 2LLEA 4O1BA 3BK0A 2ZFAA 4YCPA 3N2XA 1LM1A 3A22A 5H2ZA 3W86A 3W75A 1ZJIA 2Y7GA 3R89A 3W7JA 4BWLA 3QH2A 1VYPX 2I1OA 3QW3A 4E2DA 3CT7A 1LYXA 1AK5A 3I7QA 3TC6A 5KTLA 1RQBA 1XDMA 3QPZA 3VE9A 4DELA 1GYLA 4J9JA 1UJPA 3WK3A 3TAKA 1XBYA 5FEXA 1T8XA 1FCBA 3G8RA 3NQVA 1GVQA 4XTDA 4GUGA 1I45A 2C3ZA 1VLIA 4AMAA 4BF9A 2E6DA 5EA9A 4ZZ9A 1OF6A 3DFTA 3QSTA 4KFPA 5AYZA 4FIRA 3TNOA 3LXAA 4JX4A 1VHNA 3PVFA 2FPYA 3S5OA 3MHFA 4FF7A 3T7VA 5E93A 4IMGA 1VJIA 4LVBA 4CLMA 1EA0A 2Y63A 4MOZA 3N2MA 3PUEA 1NVMA 1XCFA 5TBOA 4MLRA 5F2IA 1W31A 1QOQA 4ZQNA 1TPEA 1RD5A 2B0MA 3P81A 1FY6A 1ME9A 4K8HA 1TREA 1WYIA 4NNCA 1AW2A 3EWYA 4UTKA 1SU5A 3OBKA 3QC3A 3GVGA 3ZWTA 3NEVA 1FWSA 2ZTKA 4E0CA 3TFCA 5CGQA 3S5YA 4FNPA 4IJBA 4ZQPA 4Z0SA 2ZRZA 2RDWA 5D38A 1W54A 4UTMA 2ISWA 4N02A 2BWGA 3MYOA 3LRLA 4JTJA 4NJKA 2Z0IA 1Y0EA 2ZQ0A 2A5HA 3IIZA 3IVUA 2VENA 3LCIA 3W7PA 3DFPA 3MI2A 3CB8A 3KRUA 3SY5A 4HNVA 4H6KA 8TIMA 2JK2A 2OT1A 2YYUA 3BARA 4IQLA 4LC8A 3HMJG 2GUUA 4UFLA 5D09A 1DKWA 3DKLA 2A6NA 1IF2A 4MUZA 1TPVA 2A6LA 3M5YA 2FTPA 3MWAA 4QNEA 1WA3A 3W2NA 1JUBA 1MEHA 3KFTA 5L6UA 1LRQA 1ALDA 3NL6A 1FX6A 1OFPA 3BW3A 2CZDA 2QDHA 3TKFA 4IMDA 1K02A 1ME7A 4JTKA 3N34A 3NXFA 5J5DA 5G4WA 3FKKA 1Q3NA 1SW3A 4ALDA 4O28A 3FS2A 2IQTA 1EP3A 4DQWA 4IMFA 4WD0A 3VNDA 3M16A 4HHPA 1GG1A 2WPBA 1KTNA 3NR0A 4JY8A 3A9IA 3W6YA 4ZL1A 4N2YA 5U7SA 2G95A 1BKSA 5HWJA 2ZA2A 4JTLA 4GXMA 1OFDA 3L68A 2GQ8A 4MFDA 4WZHA 3W7CA 1F7BA 5SWUA 3STEA 5DCBA 1OFAA 2E5CA 4RCXA 1KA9F 4PFMA 4N4PA 5BMXA 5D05A 4R34A 3KVJA 3EXSA 3QZEA 3AO0A 4DXVA 5D2YA 2C18A 1T99A 2YFOA 4FXSA 4C1LA 1TRDA 3UWWA 1L6WA 3FJLA 1NF7A 3RFAA 3TDFA 3TAOA 2Z6IA 3GKAA 3UXDA 5L9FA 1TRIA 1HFBA 3LM7A 3W23A 2TPSA 3S5ZA 3G3DA 4X3ZA 3LGEA 1WV2A 1FWTA 4RLIA 3C2OA 3OVRA 1W5QA 3S0CA 1OX4B 4Y8FA 3P5YA 4EVZA 3NPUA 1YTEA 3DU0A 1GWJA 3IGSA 4O52A 5G2IA 2ZRXA 4QIUA 5CZSA 1C8VA 4M7SA 5FF7A 1YDNA 5BMWA 1ZY9A 1B4EA 3K30A 4MYXA 1VQTA 2CZ5A 3WK1A 5EKYA 3W85A 3MYPA 1MXSA 4LTSA 1OYAA 2Z1BA 1RPXA 1RVGA 2QF7A 1RV8A 1YTKA 3MBFA 4X2RA 5AYYA 3WK0A 3C3NA 2WO5A 2QCFA 2NX1A 4NUWA 2WKJA 3RF9A 1ZAHA 1GOXA 6ALDA 2ZZ7A 3R5EA 3F03K 1FWRA 1X7FA 5KZDA 3OHIA 1BWLA 1GEQA 3HF3A 4BI5A 4S2BA 1TJPA 1XL9A 2JGYA 2ZRWA 3W70A 2ZRVA 1SZEA 2ZA1A 2OMAA 4ORMA 2NUXA 3OA3A 3FYPA 1S5WA 4O1AA 2QKFA 4K7YA 3GDKA 2TSYA 5DELA 3TX9A 4BI6A 2V5BA 4AVFA 1GTEA 3L0NA 4CQ8A 2NXGA 1UB3A 3ZWSA 1MEWA 5LNVA 1YTDA 4EF9A 1VC4A 2FFCA 3QQ1A 1JCMP 3VI2A 3EWBX 1DJQA 2Q3OA 1WQ5A 1I2RA 1MZHA 2J6XA 3NQ2A 5F2LA 1OYCA 1OABA 2WNQA 3S5NA 1VYRA 3IVSA 4OGZA 3KVLA 4A3UA 4IX0A 1ZAJA 3W2KA 3O07A 1HO1A 3MP5A 3LCLA 4N9EA 1ZENA 4JTTA 1ONRA 2C13A 1G4TA 1KTBA 2BZNA 4P2VA 4FO4A 1XDLA 1TB3A 3G1AA 3DXIA 2FIQA 5TQLA 5IBXA 1IXOA 2JKAA 3L66A 2WSYA 3VKJA 1YDOA 4A29A 2TMDA 4LVAA 4UFMA 4O18A 1ZCOA 2BX7A 3SJ3A 5U4NA 3O6CA 3LV5A 2CWNA 5FF4A 3E0IA 4PA8A 4Z0JA 1X8FA 1TV8A 2B7OA 4DPQA 2D73A 5K2ZA 2R94A 5HINA 2A7PA 3KRZA 3SGZA 2PE4A 5G5IA 5HR6A 1YXYA 5GVJA 1PCKA 2VFDA 5DN1A 3INPA 2YYTA 2R14A 1I2QA 3SSJA 3EEGA 3UPBA 1Z41A 3W1LA 2X1SA 3KVKA 3DFOA 4CNPA 3IRDA 4AEOA 5D02A 5I3KA 4RZ6A 2A1YA 3E49A 1K8ZA 1XM3A 2E77A 2Y85A 3C2RA 1UASA 4L4LA 3HO8A 4UTTA 3W7IA 3DKJA 1KM0A 5BOOA 1KLZA 5LZLA 4EOUA 3W84A 4ZMGA 1B57A 2A2IA 5CPNA 2ZCGA 2BTMA 4UMBA 4XKYB 5DY3A 1P0KA 3UD6A 1K7FA 3KAOA 3PULA 1XBVA 3W7HA 2ZRUA 2YGYA 3HG4A 3CU2A 4HPJA 1P4CA 1KM3A 5D32A 4NJIA 4O1CA 4DO6A 2QAPA 1QPQA 3PC0A 3M1ZA 4KKXA 2FPVA 5E0KA 3TQVA 4HN4A 1CW2A 2E6AA 5HMSA 1UUOA 3E12A 3TROA 3C61A 5A8GA 4S2CA 2YCEA 3NA8A 1B4KA 3LHZA 3UWYA 1PL9A 4EIVA 2GJNA 3UY8A 2G96A 4DF0A 1TPC1 4LV4A 1FUYA 3CQ0A 4FB7A 2E6YA 3P7YA 4UUIA 2RFGA 4C1KA 2VELA 3WJSA 1H7OA 3HGRA 3TMLA 1H7XA 5D2XA 1SZFA 4JNMA 4N9BA 2CLHA 3TC7A 2XN2A 4RXGA 3O06A 3LLFA 4I7UA 3LOTA 1RZMA 1DHPA 3W72A 2ABAA 2ZDRA 7TIMA 2QEZA 3STGA 3U6WA 4HNTA 3UWZA 3H55A 3B0VC 2AGKA 3NM3A 3HPSA 4YXGA 4YCOA 2V8ZA 3PAJA 3GAKA 3NQGA 4DBEA 2V30A 2YPIA 2DORA 5D33A 1YADA 3KX6A 4LS0A 2Y6ZA 1TYGA 5F4SA 1EEPA 3ABSA 4JTIA 4TX9A 2NUWA 1OX4A 3SFKA 1OX6A 1U5JA 4N4QA 4PL2A 4GWEA 2TRSA 1M7PA 3CIWA 3GDTA 1XI3A 4RXFA 3W22A 4UTWC 4JTGA 1CX9A 2YW4A 3B4UA 4BR1A 3A24A 2NUYA 4JN6A 2YXGA 5I3HA 3G0XA 1LBFA 2QJIA 3O05A 1LOLA 3W7NA 3PUOA 3CTLA 3GXNA 2DZWA 4MFEA 3NO5A 4LT9A 4K38A 4WOZA 4K6AA 4JXCA 2C15A 4ZQMA 2WQPA 1H7RA 3NL5A 3LHTA 4UC5A 5DCEA 4MZ8A 1FCVA 1ZALA 4YWIA 1QNVA 3WJXA 1H1YA 1IIHA 3W7QA 3NOEA 2E09A 1LROA 1J5TA 5EL1A 2QCMA 5T26A 2PURA 1NFBA 3LCWA 3LXBA 4NJJA 4N6FA 4K37A 1I2PA 1EX5A 2CLLA 3PG8A 4ADSA 1H7NA 4O50A 2GJLA 4EWND 1DL3A 4JYFA 5HUPA 2VKZG 2EAWA 3P62A 4JIQA 4UTJA 3W7GA 1TPDA 4ORIA 4LC6A 3MMTA 5AHLA 2RDTA 1AL7A 3HG3A 1ME8A 3TUUA 2W0UA 4EF8A 5FF2A 4JS3A 3SR7A 4XQ6A 1H61A 3G1VA 4LW7A 2FJKA 1MEIA 1NAL1 3T78A 1EWEA 2ZZ2A 4NJHA 4O19A 1N8FA 2QCCA 3BO9A 4XZ9A 1LCOA 1Q6OA 3W76A 3VE7A 1KV5A 1JQXA 4GUJA 3N19B 4OV9A 3TW6A 1ICSA 1SSGA 4UMAA 3TW7A 5I3FA 5IM51 3S6DA 3LCXA 4Q4KA 1DOSA 4I7WA 3ZS4A 4IPJA 3E96A 1JCLA 1GVOA 3S9YA 2RDUA 1PS9A 4O15A 4U28A 2CLKA 3F4WA 4I7VA 2E68A 2QUUA 1C29A 4LV9A 1SO6A 2EKCA 3Q94A 2V82A 1U83A 1VLWA 3QW4B 3BG9A 3TIMA 1QWGA 4JGDA 3CPRA 4WJEA 4GFSA 1O94A 4RR4A 2Y61A 2A0NA 4QITA 4JR5A 3CM4A 3B0UX 4JIPA 3V75A 4CQ9A 1W3TA 2BSLA 3N3MA 1VPXA 3IEBA 3M0ZA 3S1VA 4XKYA 3O1NA 4MPQA 5LGZA 2V81A 3SIZA 4M7TA 3W1UA 1SO5A 4UFIA 2PC4A 4DF1A 1RQEA 1FDYA 3QMRA 5FI8A 3OVPA 3W3OA 2JGQA 5C5YA 3NPWA 3M9YA 5BNKA 1KFKA 3QF0A 2A21A 2ZYFA 3SZ8A 3TSDA 3LRMA 3HGOA 1BTMA 4OT7A 1KFLA 1PV8A 3ELFA 5BRBA 3PS7A
chains in the Genus database with same CATH superfamily
1TV7A 5HUOA 3DGRA 2HZGA 1U5HA 5D2WA 2QJJA 2XISA 3IIXA 3OG2A 4DAIA 3BE7A 1IT7A 1QHZA 3S1XA 3W1PA 3PBUA 3P5ZA 1M6JA 1KBBA 1OFQA 1UOKA 2X42A 1BD0A 3RJYA 4GNJA 2X16A 3CQKA 3MQTA 5K3VA 5JIWA 5FJIA 1JPDX 4UOQA 1XGDA 3NL3A 5G1TA 4QTGA 1Z32X 5AB3A 4UXDA 1A0EA 4LCRA 5I3IA 2ZVIA 3GKFA 3V4BA 2CZFA 4FXRA 2VR4A 2O56A 4BWLC 1J0YA 1S39A 1G67A 1JCTA 1NDVA 4A22A 3WLRA 4QJ5B 5DY2A 5ABTA 5AYXA 1FH9A 3CV7A 2GDQA 1LL6A 4EWJA 4N9DA 2QCGA 3FVMA 1BTCA 2V5LA 1GVYA 3ANYA 3TN5A 2A85A 1WKYA 4DPPA 2YW3A 4V2XA 2PSNA 1O68A 3IIVA 1US0A 1AA1B 1GEHA 3IJ7A 2EGZA 4NX5A 1VFHA 2C0AA 3LBMA 3B8SA 3OVQA 3BG5A 2NZLA 1EDQA 3WLJA 4O54A 1O12A 5FCZA 1GG0A 2AQOA 1OG0A 1PEZA 4AD0A 4Z1DA 1QW7A 2YL5A 5K7JA 4MNLA 1I0BA 4XAGA 5I5RA 4CD4A 3GYCA 3SRDA 5E09A 3EX2A 2BS9A 1E6SM 3FVDA 1TZZA 1AUSL 1H0GA 3G3MA 3GFXA 1JCNA 3WNOA 2Y7FA 1A5AA 2YL6A 2RGMA 4XZWA 1QRQA 1W56A 4LX4A 4K36A 5BWAA 1PZ2A 3MI3A 2XN1A 1I4NA 3T55A 3UG4A 3WF3A 4ENLA 1US2A 3IGHX 4P7NA 1V02E 1EB3A 3V7PA 3RDKA 3IRSA 5C54A 3I6TA 2OKTA 3B8DA 3L4XA 4WEVX 1Z8AA 2PBGA 4D9PA 2GOUA 4PBEA 3FDGA 2CPUA 3HB9A 2J7CA 1W3IA 1SQ7A 4JHOA 3B8UA 4RX0A 4JYDA 1UKSA 2E9MA 1KFEA 5F1VA 2QQ6A 1UD3A 1M1BA 1WX0A 4PBGA 5AOUA 2E0PA 1I9CB 2NX3A 3R11A 3MP3A 4ZQRA 3TYAA 1UD8A 3PUGA 3L7RA 2PDJA 2VXNA 4MJ4A 3TJXA 3OQ8A 5CPSA 1ZBVA 1Z6KA 4JTCA 1A50A 3DUGA 4EPDC 4Q8QA 1OWQA 1V6VA 1Q2SA 4LPCA 1KGXA 3PHAA 4W7VA 3T0CA 3FJ6A 2BASA 1BHGA 1VZWA 3G1FA 3I6RA 2ZVRA 4YTQA 2WZHA 2C14A 3V3WA 4RZ5A 1DXFA 2EPNA 1DJHA 4H01A 1O7AA 4GI8A 3VKAA 1YPFA 5HWMA 1H7WA 5ABHA 2YDSA 5LSMA 4TU1A 1P1XA 3RILA 1W9DM 1R7AA 3PBYA 2WNZA 1UWAA 3B0PA 3MHGA 3PZQA 3FSTA 4EP8C 3E2QA 2QCDA 3AXXA 3JRKA 1SFTA 2ALRA 4KEUA 1BVNP 3RX4A 4WF7A 1GJPA 3U5YA 3QOKA 3E0WA 4I5RA 1R9YA 4LALA 4H2CA 3T07A 1CGTA 3SN1A 2HNEA 4MWAA 5JXQA 2O0TA 5D9OA 2QUTA 2QIIA 1AG1O 4BHYA 3ABQA 3O8AA 3KTXA 4J3VA 1EJXC 1TV2A 3GB6A 1UZDA 1A5CA 5K4XA 3F1QA 5JH2A 2QR6A 1WDWA 4K39A 1KBIA 3CLMA 3CMGA 2VX4A 3POHA 4WRHA 3T8QA 4AWTA 5DANA 1TMQA 1NM9A 2VZTA 1ITCA 6REQB 1KGUA 4MNJA 3TV8A 2C19A 3AIQA 3QYSA 3UBPC 1EUNA 4L61A 1XCWA 4JIRA 2XM1A 2Y2WA 2QXWA 2O9OA 4MNKA 1KM2A 4NZ4A 2BDQA 2Z26A 4ZA0A 3W1AA 3G5EA 2I14A 2NQ5A 4M81A 3VIFA 3L2MA 4WX2A 4HA0A 3R8RA 4Y9PA 3LPGA 1G4EA 1DXEA 3N9SA 4D6EA 3K4DA 3QQWA 2XYLA 1FWWA 1B30A 3AS3A 1EC8A 2INEA 1W1TA 1CXHA 4WVXA 5HMEA 3HGSA 3TQKA 3K4AA 3EDKA 3PPHA 2V0TA 2X30A 5DRIA 1KFJA 2Q3RA 3UJSA 2CLIA 3BUVA 2Q01A 3WLIA 1V3HA 1WKEA 2UV8G 3NG3A 4IUOA 1L2UA 2UZ9A 3MB9A 3RM4A 1R85A 1CB2A 4PBFA 1CT5A 1BXNA 4M29A 4QDMA 2DQXA 5A5WA 1GQNA 2WAGA 4ZSUA 2VFIA 2PGFA 3WDPP 1O5RA 3DC0A 4H7ZA 2HXUA 4C6IA 1CGXA 5EPDA 4D6IA 3WIJA 2POTA 4FXJA 2OYKA 2WCGA 1U1HA 3IV3A 4E6MA 2D3LA 1PKLA 1S2UA 5EBAA 3VNIA 2BVWA 4GGHA 4L9XA 4KGJA 1E0XA 2OLSA 2NVAA 5CAKA 3BH4A 5CG7A 3BPWA 2BODX 3LPPA 3QBUA 5LIWX 1MWOA 3K8MA 3RRAA 4PUMA 3WUBA 2PTXA 2Y8KA 1WNOA 3SGUA 2HS6A 2ABBA 4D8AA 1ISYA 1XX1A 1J4EA 1C8YA 3W7EA 2R1LA 3K4WA 3UGRA 3GG8A 1NF0A 1PTAA 3NGJA 4LU0A 3UXIA 1NIUA 1B3OA 3CUJA 1JJKA 3PZVA 2CLEA 2PDFA 4DN1A 2DP3A 5CC6A 1I2NA 4BFAA 1V5XA 4NT0A 4OBTA 2VVNA 3GQYA 1VCFA 1POJA 2A3EA 3MKVA 3CH0A 5H8UA 2X1RA 4KWVA 4KIRA 3SI9A 1Q6RA 3POCA 2PDBA 4DZHA 1U1UA 3UXAA 5B80A 3L2IA 2IPWA 4AC7C 3RX3A 4M82A 1MRAA 1PWMA 3NQEA 3GAYA 4LVDA 3TYZA 4JYEA 3CL8A 2VEMA 2WC4A 5DFAA 4NNBA 3A21A 2DT3A 2E5DA 4LBSA 3S46A 5FOOA 3LBCA 3OBEA 3W81A 3KZPA 4KCTA 1GZGA 3KOZA 4UNKA 4S3KA 2JKEA 3THUA 1SJDA 1Z3NA 2QJGA 1VFFA 2BY2A 4B5NA 4BKNA 3QEZA 1YXDA 3CASA 1EPXA 4DB7A 1ELSA 1WDRA 1KQYA 3OPSA 3SRKA 1RPKA 1GKPA 3FYOA 4N7QA 4C91A 3NQDA 2DSVA 4XZHA 2ZRYA 4AISA 2QCDB 2H3DA 3G1SA 2VRQA 2WBKA 1RCXB 4HIBA 3PJXA 1PHWA 3URQA 2RDXA 3ABOA 2Z1SA 3LZ5A 4Z17A 4DUXA 4B3ZA 1MXGA 1H7PA 1E73M 4NQ1A 1E0UA 3BVJA 2TYSA 1QUMA 3OOQA 3MI6A 3P80A 5CSSA 1XGZA 2D69A 5C71A 4K7VA 3T9PA 1SMAA 4AD2A 2NWRA 2C1HA 2E3ZA 1V7YA 3G1DA 3M0LA 4H83A 3IGUA 4OECA 2QJNA 1K9FA 4ZOAA 4ZQCA 4CQBA 3CUZA 5I78A 2ZZ6A 3O6YX 1R30A 1JAKA 2ZE3A 1GOOA 2WWCA 3CWOX 3LDVA 4EACA 5FSEC 4JQ1A 1P0DA 4P7OA 4LUIA 3S2LA 2EBNA 1EOKA 1MSSA 1XYBA 3UZJA 4ADTA 4GG9A 4UOJA 1NTHA 2FQIA 2RUSA 2HDJA 1T96A 3GHRA 2CEQA 4FR1A 1OM0A 3BCJA 3NYZA 3W83A 1JYWA 1W9UA 1KCKA 4MAVA 2J9ZA 3HG5A 1ONWA 3GG0A 1KM4A 3CEUA 2DGAA 2WVUA 4DJED 1CLVA 2OT0A 4O13A 1OC5A 1V77A 4W5UA 3VGHA 5D2VA 4GVHA 2VVSA 2VP8A 3BOFA 4H9XA 1VBRA 3UW6A 4IMAA 3QOMA 1EJUC 2EO7A 1OIFA 5DO8A 4BS0A 1JZ4A 4L6DA 3HBLA 3MSGA 2XGIA 4US5D 4KWWA 2HTMA 3P74A 3PPGA 4UQEA 3M6DA 1RALA 1FWNA 1RH9A 1RJPA 3LD5A 3NQAA 2W4XA 1LZOA 4TXEA 2YFNA 3PFRA 2Y5JA 1YPIA 3CV1A 3KBVA 4UQAA 1Y8BA 3C6CA 4AVOA 3GX9A 1JIBA 2EPHA 2YKKA 3IJ9A 4JICA 5JVLA 1SW0A 3CZGA 3LEPA 4HMNA 3D0CA 2BXVA 3CEPA 3H8AA 1HL8A 3DHDA 2XDFA 2FHBA 3HGJA 4UTWA 4LUTA 2VTFA 4ZEPA 1HG3A 5TNVA 4Y9AA 1G1YA 2YA0A 2W6RA 1M5WA 3TN6A 2XIIA 1HJQA 3EX6A 2VDHA 4OUIA 3URBA 1TE6A 1RD6A 4IFKA 4AIEA 4NXSA 3VNYA 4AIUA 1XH2A 3UPWA 4AZCA 1ZBWA 3NZPA 2VDGA 5K9CA 1OVDA 2YCLB 4GFIA 3TTYA 4RE3A 2D0FA 1EJWC 4AX6A 6TIMA 2ISVA 4ICNA 1GOQA 1EJRC 1UKPA 3H2NA 4FOUA 4JDYA 5A94A 1SSDA 3DECA 4JFUA 1DTNA 1FWEC 1U22A 2J7DA 3A4WA 4J35A 2HISA 2XVLA 2WJZA 5D04C 1GONA 3OLEA 1HTIA 4HT3A 1ZFJA 1QPOA 1K8XA 3DBPA 1KTCA 5E1QA 1XQKA 4GUFA 5LHFA 4H9UA 4Z08A 3DG6A 4FLQA 5GJMA 1Q45A 3M07A 3LCHA 1H1NA 3U8GA 2X2GA 4Q4MA 5CSYA 3RO8A 4ZQOA 1XIDA 4FX7A 3ZLFA 1XINA 1QMLA 4IH3A 1KM5A 4UQCA 5C6MA 2C1GA 4FNRA 2PI6A 3TJLA 3RU6A 5IDZA 4Y90A 1H11A 3NEHA 4PMQA 1XLDA 4QXIA 2VD9A 2V63A 4OQVA 5TIMA 3MUXA 3CQIA 1VJZA 5TAOA 2WSRA 1I75A 1GPWA 2ESCA 3RM8A 1PKNA 1JCYA 3W29A 4R85A 2CBIA 1YE6A 4IMCA 2NQJA 1B2YA 2H90A 1K7XA 3UCDA 1QPNA 4QISA 3MSDA 3G1HA 1PX8A 1T6MA 8XIAA 1M7JA 3A23A 4N42A 4A8RA 1CWYA 2AL2B 3AMGA 2V2DA 1BVZA 2DQWA 5I09A 3G22A 4B92A 2HBXA 2P76A 5BOEA 1JPMA 2YA1A 1QAPA 4WXZA 3C56A 3ENLA 3LHWA 4NVTA 2GFTA 3IIOA 3WJYA 3G8EA 4Q33A 3PM6A 3UEQA 4BJHA 3NUKA 1W8SA 1X39A 3SW6A 3THAA 2ACRA 1WE5A 2FZ8A 3ZOAA 2MUCA 2FDSA 3E3HA 7A3HA 3FV9A 4HN8A 1XFCA 4LAOA 2VFFA 1H60A 3NSMA 3TA6A 4EPEC 1QHOA 2G4FA 3L4VA 3GVQA 4M24A 3BLLA 1JUKA 2VMFA 1W91A 5E6ZA 2WMGA 3MO4A 4ZOCA 3OLDA 2XVGA 5FEWA 1DP0A 5BROA 4Z42C 2GQAA 1DJWA 1SMDA 3HPZA 4N9CA 1BWVA 2KAUC 2X1TA 3APTA 4E38A 1YLVA 1XLGA 3A12A 3E02A 3WD1A 4Q6JA 3GW3A 3BK0A 4HHLA 4YCPA 3N2XA 1LM1A 5H2ZA 2VL4A 3TN3A 2WMHA 4IGMA 1YBQB 3QH2A 3HQPA 3WBAA 1KNWA 2I9UA 2ISFA 1WAWA 3BLOA 1VBUA 1ZBCA 4KT2A 1XDMA 7XIMA 3WCZA 1XBYA 4FLSA 1FCBA 4YWSA 1GVQA 1ISZA 3QY6A 4GUGA 2C3ZA 1XYFA 4UCFA 3WDJA 3BJTA 4AMAA 4BF9A 1IGWA 2HROA 5BRQA 3FK4A 5EA9A 3QSTA 3T0DA 3TNOA 4JX4A 3PVFA 4G9PA 4H9TA 3UG3A 1OD0A 3T7VA 3UXKA 5B7YA 2V69A 4LUTB 1EA0A 3FXYA 3H2MA 3N2MA 3GXDA 4AYGA 1ZP4A 4ZQNA 5A6TC 2FHCA 3QR3A 4AQLA 2INZA 4IFKB 2EPMX 1OCNA 3SEPA 1R3RA 1FY6A 4YTUA 5D9PA 4GGBA 1QWKA 1AW2A 4GABA 4AZCB 1R3VA 4AZBA 3OBKA 3S6OA 2FGBA 4DZIA 3F4DA 3KOXA 1WZKA 2AKMA 5CGQA 3S5YA 4Z0SA 2PDHA 1MUMA 3W4RA 4ZOEA 4GXWA 5D38A 1QTWA 2XJ7A 3VDHA 1GW1A 5TD4A 1A5OC 4LYRA 2E67A 2XH0A 1GGOA 4IM4A 2ISWA 2BWGA 4JL1A 3IVUA 3N4EA 4QG8A 3ARPA 3LCIA 3W7PA 1W3HA 3BSHA 3KRUA 1C8XA 1UUQA 4XVEA 3SY5A 8TIMA 2JK2A 2OT1A 2V3GA 3WUFA 5PTDA 4DZAA 3HMJG 2GUUA 5GJNA 3ZT5A 4GO8A 1VKFA 1TPVA 2BHZA 2FTPA 1WZMA 3MWAA 1TIWA 1ZB5A 4DO7A 3LG3A 3EOSA 5C9UA 4JTKA 3NXFA 4O8AA 5G4WA 3OHMB 2BY3A 4QJ4B 3C0QA 1SW3A 1N2VA 4C6QA 4DUWA 5BXTA 3H70A 5A6KA 3FS2A 1A4MA 4PCNA 1XF0A 4HHPA 4IPPA 1HP5A 3QGAC 3NR0A 1NOUA 3S83A 1KC7A 3A9IA 1I60A 2VGFA 4QDPA 1AFSA 3RUBL 4ZL1A 3B9EA 5JU6A 1MI3A 2OQYA 1OFDA 4JFSA 4MFDA 3SRFA 3P2VA 4RCXA 3VX1A 3DFYA 4MAZA 5D05A 4L4OA 4R34A 3KVJA 2VURA 3RM9A 5DT7A 4GQGA 1T99A 1TRDA 1CXIA 1L6WA 1HX0A 5TF0A 4LEQA 3F5LA 3TDFA 2Z6IA 1C91A 1NU5A 5CPTA 2Y8VA 2TPSA 4X3ZA 2D2GA 4KGLA 4FS9A 1TVLA 1UQZA 5BZAA 2ZUMA 5KZ6A 4OKDA 3E2RA 3GE7A 1OX4B 5ABEA 4Y8FA 3S2NA 2OSXA 1GWJA 2DPEA 2ZRXA 4M7SA 4AU0A 4F0HA 1ZY9A 2VDIA 3IWPA 2EJ1A 1RCQA 3TW9A 4MYXA 3ITTA 2XFFA 1R87A 1MXSA 4PUJA 3JZUA 1YPXA 3HJEA 3E2SA 5BXPA 1J01A 1XRVA 4M1BA 4TTGA 1RV8A 4U5IA 2GSEA 1GPFA 1RK6A 3WBEA 3T2QA 2PP0A 2QCFA 3CHEA 3BWWA 1M9HA 1C90A 3B8WA 2WKJA 4PB3A 1GOXA 2ZZ7A 3R58A 5KZDA 2Y8UA 2WVSA 2O4MA 1XDJA 2W3ZA 3HF3A 1FP9A 1XL9A 2ZRWA 3W70A 1SZEA 4KRTA 4MGGA 2J7FA 2NUXA 1E55A 3KZSA 2QKFA 3GG1A 4CQ8A 1UB3A 2VWTA 1FKXA 3N6QA 3ZWSA 2XH4A 2ON3A 4NZ1A 4EF9A 1RSCA 3EOLA 2FFCA 4WDWA 5M03A 1WQ5A 3ZMRA 3U7BA 3NQ2A 5F2LA 1OYCA 4JQ4A 3RPMA 2PWVA 2Q6ZA 3S5NA 4YYFA 3K1GA 3IVSA 1GYMA 3MP5A 2FTWA 3KP1A 2FVMA 3THCA 4JTTA 5M2FX 1G4TA 1KTBA 1W17A 4U10A 4FO4A 2YJQA 3R8HA 3GTXA 5IBXA 1IXOA 3ITYA 2XPKA 1QNSA 3MUZ1 3PBMA 2WSYA 4PUDA 3BQ5A 4WKHA 5H8MA 2OSWA 3M0XA 4TX6A 3ZSSA 1AZ2A 3NDYA 4PA8A 1QNPA 1QNQA 3CYVA 4H7CA 4FOJA 4H9YA 5HINA 2QPSA 1JYXA 5G5IA 5HR6A 1YXYA 2WK2A 3F4CA 2ZDSA 3M0IA 1OCBA 2R1KA 1B9ZA 1DJXA 1FOBA 3C3UA 5M3WA 3EEGA 1Z41A 3R4IA 2X1SA 1JZ7A 3DFOA 1PBGA 3E5PA 1TR1A 4TOQA 5D02A 2A1YA 4HVXA 4LCSA 3RAOA 1UASA 3SSZA 4L4LA 2CHOA 4HYVA 2WZMA 1Q6EA 4RUBA 1DTUA 3DKJA 1KM0A 5BOOA 4GVGA 5A8NA 1W9XA 4J27A 4EOUA 4P8WA 3OA5A 2A2IA 3R1ZA 2ZCGA 3EB4A 3F2DA 2X09A 4LCQA 3UD6A 4GXPA 3W7HA 1CTNA 2OO0A 3KTCA 1X1NA 1QNRA 1VENA 1W2PA 5D32A 2XUCA 3HU7A 3R0KA 5E0KA 4Y8EA 2XHYA 1UUOA 5A8GA 1LQ2A 1RXOB 2V3DA 2YCEA 3MDUA 3NDZA 4S2CA 2D2OA 1GZJA 4I9MA 5A6BA 3CUFA 5C7VA 3S9ZA 3BC9A 2G96A 2FH6A 2J8GA 4FB7A 1UWTA 4S23A 1ONEA 2RFGA 4C1KA 3WJSA 1H7OA 3VTRA 5AECA 2PFHA 2OLHA 1UWRA 2Z2BA 2XN2A 5A6LA 2CHNA 3LOTA 1RZMA 1DHPA 3QKEA 4YHGA 4AWEA 3U6WA 3B0VC 3GVRA 3HPSA 4DWSC 2X0HA 3GAKA 3NQGA 2YCIX 4DBEA 4B5UA 1EZ2A 1W1IE 2YPIA 3AIVA 4QFUA 4AYSA 1YADA 4PMYA 3ZLHA 4ERIA 3SFKA 1EC9A 4OBRA 4GWEA 2G8ZA 3CZLA 1CZ1A 3GU9A 3MCMA 3CPGA 2ZIDA 3B4UA 1MZRA 1BPLB 3HTWA 3WLHA 5I3HA 3G0XA 4HHMA 1K9EA 3O05A 2QLYA 1KO0A 3CTLA 1BXCA 4MFEA 3FW6A 4K38A 2J75A 4K6AA 4DJDC 2JQXA 3NL5A 1F4AA 4MZ8A 1ZALA 5GJPA 5CC3A 4HYRA 3H7VA 5REQA 2PWFA 3PNZA 5CCZA 3KWSA 2Z1XA 1B3WA 1LROA 1A80A 1CPUA 5EL1A 2ACUA 1Y5WA 2P0IA 2J7EA 3GXIA 2G3NA 4K37A 4DJFA 5J8LA 2ZUWA 4ADSA 1GUVA 4F9DA 4JYFA 5FD0A 4JIQA 4RZBA 4UTJA 4ORIA 5LIKX 2Z2AA 3L4TA 1ME8A 4DNHA 3W6MA 3AMCA 4HK7A 2O55A 3PWIA 4W93A 2AKZA 2BFGA 1OQFA 3T78A 3QHOA 3KL0A 5C70A 4KCVA 4NJHA 5M17A 2QCCA 4XZ9A 1LCOA 1Q6OA 3BCFA 1SM9A 4OVXA 2GGIA 4IP4A 2VCAA 1SSGA 2EKGA 4Q4KA 1NP2A 4O1FA 4I7WA 1Z69A 4IPJA 3RCMA 2GVEA 1GVOA 1QBAA 3KW3A 3VGDA 3UJRA 4G7EA 3QV9A 3PPFA 3PJTA 4U2YA 3SCRA 3SDOA 3N2TA 3K5XA 5HMFA 3DEQA 5JBDA 4Q7NA 1XIIA 1R5YA 1JFXA 1SO6A 4OBSA 4G56A 3TIMA 1QWGA 3CGTA 3PZMA 3WEOA 2E9LA 1XLIA 4RR4A 2Y61A 2A0NA 3CNYA 2OWWA 4JR5A 3F2BA 1SR0A 3V75A 4CQ9A 1W3TA 4YJ5A 4EXAA 4CGTA 1QI3A 3M0ZA 3S1VA 3T4WA 2F38A 4MPQA 3N1AA 1NWTA 5LGZA 3M0YA 3SIZA 4M7TA 3W1UA 1UKOA 4UFIA 4Q4PA 3CO4A 2C71A 1C93A 4XZBA 4E8GA 2WMJA 2DH2A 3PFMA 3WQDA 1XIFA 5LYRA 2P88A 3LRMA 4G6CA 4H6RA 3VZZA 2F7FA 4TMCA 2OPJA 2E6FA 4MY1A 1E9ZB 1G7VA 5IDIA 3QHNA 3NZ1A 1W0MA 3MP4A 3GFZA 3J7HA 4PUNA 2WM1A 3AHXA 3B8VA 1CI1A 3DFQA 3N14A 3TK7A 1EJVC 4XZLX 2Z7KA 5A8PA 3H2FA 3WLOA 3QMSA 3HQNA 4Q7IA 4UTHA 1H50A 4H2HA 4PSPA 1L9WA 1PJ9A 8XIMA 3GK0A 3RU8X 3CHVA 5CKSA 3SCUA 2J7BA 3L0GA 5EMMA 5BW6A 3ZJ7A 2QCLA 3S5SA 4GZIA 3OBAA 3AIUA 1BLIA 3NAVA 1E9YB 4AVNA 3NM1A 5ECUA 1A47A 3W2UA 4M1RA 3BGJA 5G2WA 1J6OA 1B0IA 3C0JA 1R9XA 4ICCX 1F6PA 4GI9A 4IXHA 1W3NA 4IL0A 1ECEA 4C5YA 4J3WA 4QJ3B 3U48A 3CZJA 4H8VA 5BXSA 2CESA 3EWCA 1HT6A 4KESA 3W9ZA 1DJYA 4Y7EA 1YDVA 3NO1A 3WUGA 1DWJM 3EPOA 4WDXA 2WZEA 3EXRA 5CZJA 3O16A 4D2JA 4HMEA 1UPPA 1IWPA 4XWUA 3N25A 4INFA 1HZYA 1TPWA 3S3GA 4HNCA 2R1PA 4TV6A 1UD5A 5G1YA 2E8ZA 1DPMA 3BMVA 3T42A 3WQOA 3Q65A 4FR6A 4L1GA 3TXVA 3QY7A 2ZZ1A 4M6QA 4J28A 1K9TA 1QK0A 1IXNA 2JFEX 1E6QM 1XW8A 2VFGA 2ZX6A 1JRCA 4KIEA 5REQB 1H4PA 1QATA 5LIXX 5D30A 4A2SA 5RUBA 4JIIX 5BXRA 2GDUA 2PTDA 1VBGA 1E1FA 1WUFA 4YNGA 2REQA 1XFBA 2QCNA 4CNUA 2NQZA 1TCDA 4NI3A 2FHFA 3I4KA 3CYJA 3R12A 2RHGA 3VGEA 1XG4A 4CD5A 3L23A 3UG8A 1S3HA 4V1XA 1WZAA 1ZGDA 2J8TA 4Q4SA 2W67A 1TZ7A 4O17A 1TTJA 3VABA 4CVWA 2B31A 3C0SA 1OHLA 3CWNA 2OKOA 2WV8A 2NVCA 3ZVHB 4GK8A 4O14A 4AWUA 4KFNA 3W02A 2BXYA 4G8TA 4S3DA 4GI6A 1N8WA 4DI9A 3G24A 2V2HA 2X1UA 4XISA 2ZBTA 3CPUA 3KRSA 1JCXA 2L5HA 1ZCCA 2FKPA 3TCEA 1PZ3A 1TCMA 4DM1A 7PTDA 1FWJC 3ZT7A 3EMCA 1EQCA 3EZ4A 2BHUA 1D8CA 1VCGA 2F2HA 1G7UA 4RL3A 3KLKA 2DIJA 1EEXA 4RNHA 4DYJA 4CNTA 2OQLA 4G7EB 4GYJA 3M7SA 1O6IA 1XRFA 1XWYA 2NLIA 2DT0A 3D5HA 4HOWA 5IHSA 3AIWA 4KWOA 1XH1A 1G6CA 1W1ZA 1AODA 5AZ0A 1TWZA 3P8IA 5EBUA 3G1YA 1BKHA 4F79A 3EOUA 3C4UA 4JD4A 3WMCA 2ZC1A 1SZGA 1Q6LA 2D0HA 5LNRA 1GHRA 5LKYA 3CV6A 2Z24A 3D6NA 1Z42A 1E43A 4JTEA 1FA2A 5EFDA 4Z2HA 3W1TA 1QO2A 1JZ3A 1UR9A 4EANA 4AF0A 3USBA 1W5PA 4JIHA 1PCWA 5HANA 5MHBA 3CV2A 4AIBA 4E3TA 4LUSA 3NSNA 1J5SA 4O0KA 2IPGA 3L5LA 3NIYA 3R79A 3TYDA 5C9ZA 1SJBA 2PCEA 4O16A 4L6HA 4AD1A 2A3BA 3VO0A 3LTYA 3KCJA 3VD9A 3CAKA 1LBMA 1GW9A 1SJAA 4HBKA 4R33A 1IQ8A 2Z29A 4GNKB 2VNCA 4A05A 3PZGA 5FA5A 4MMWA 1PKYA 3NQ8A 3F7JA 3M4HA 1EOMA 2G4JA 3E0VA 7ODCA 3UR7A 1CENA 4FLRA 3ZO9A 3FJNA 2Q8ZA 4CD6A 1KXVA 2FPTA 2C0HA 4R3UA 1UH2A 2Z6JA 2QNEA 3EYPA 1G4SA 2H8XA 2WJDA 1UZ4A 4XAYA 3L65A 1NY1A 1W8GA 2BG5A 4PH6A 1GJWA 4QR6A 3P60A 3SAZA 4LANA 4ZE5A 4NJGA 4W87A 5LA2A 3C8NA 2PWUA 1EH9A 1R3YA 1NWUA 1S38A 3OZPA 1HKJA 3KL5A 2C16A 4WOQA 1UD2A 3SUSA 4QSHA 2J79A 3P61A 1V3JA 1AH0A 4W88A 1OX5A 1K70A 4B2DD 1E71M 2PDGA 1D3HA 4XAPA 4IWWA 1KGWA 1XIHA 1UMLA 1LL7A 1ZL1A 1LLZA 4NRRA 3W73A 1WZLA 2QUVA 3WELA 2HPIA 2DSZA 5F2GA 1VB9A 1H63A 1BG9A 2JE8A 4ROQA 3H6OA 1R3QA 1MNSA 3CAVA 2EG7A 5D37A 1FH7A 3NQ7A 1L6SA 1H1ZA 5BCAA 4GLEA 4F40A 3UWVA 4X60A 4Z2JA 1XXXA 5HXMA 2A7RA 5LNWA 4AC1X 2NQLA 4NZJA 4XTIA 3VNJA 4S3EA 5BU9A 3AU6A 4HTYA 4AD3A 3PZUA 3B9OA 4IF2A 3TU9A 3MTWA 4D1JA 1XIBA 2WHMA 4QAWA 5F2MA 1XICA 2Z27A 4U3AA 4DBDA 4GZJA 1Q4WA 4FP1A 2QPXA 3APGA 3DFNA 3GU2A 1EBGA 1Z48A 4LS1A 4BF5A 3GH4A 4UTTC 1IR1A 5F4WA 1UWUA 4IFRA 4E4UA 1ZNNA 4CN6A 4Y9OA 5HJYA 4AH7A 3CUXA 1OYBA 4Y2WA 3UZXA 1LP6A 3S6TA 5AC8A 3BXWA 2GVJA 1VBHA 1JYNA 4HNNA 1KBJA 4LB4A 3EPMA 1B5TA 1XH0A 1GYNA 3NWRA 4RNJA 1PWLA 4R7JA 3LRKA 2YSWA 2A4AA 3IVTA 3WQVA 5CBBA 5I00A 3G6LA 2BGSA 2ZKMX 2G3MA 2XU2A 4V15A 2P0OA 2ZXQA 3BAWA 1JQVA 4M0XA 2HSAA 4XZMX 3WNLA 4UWMA 3NFUA 1W32A 4K1GA 4ZBCA 3ZSTA 2OOGA 3ABXA 4Y96A 1VRDA 3NSXA 3EX4A 3H26A 1AQFA 2O9RA 3UWEA 2DJXA 4Z1CA 4GRSA 4KQNA 3QV7A 4OJYA 1TZ9A 3DYOA 1JZ2A 2H8ZA 2VFEA 5E9AA 3HA1A 3CHFA 2DEPA 3ERPA 1LWIA 4L56A 2XFWA 4UMCA 3QGVA 1HKWA 2QMKA 1L0PA 1P5BA 4Z1BA 2PLCA 1AMKA 5MKGA 1IE7C 1M41A 1QPRA 1NEYA 3WL1A 4NZFA 2G5WA 1YXCA 4GQBA 1NOWA 1WDQA 4UIOA 3PTQA 4O1DA 4IXXA 4IUGA 2OEJA 1UYQA 3AYSA 3CUIA 1LLWA 3W07A 3P84A 3WH5A 2VD8A 1WOAA 3QYQA 3U2ZA 4MDPA 4RPPA 4IQEA 4LEFA 1KRCC 1E4IA 4F0MA 4TQTA 1EP1A 5BYWA 1Q85A 2NWSA 3UNDA 3CQHA 4UFHA 5KITA 1WOBA 4IJCA 1NWSA 3BLEA 4IOTA 5J5RA 2B7QA 4HPGA 4XUGA 3N12A 1V51A 2YXOA 1LUCA 2WHKA 3DENA 3R0UA 3LBOA 1LWJA 1IXQA 4OTKA 4L7ZA 1TA3A 3VOCA 3OZYA 4JEQA 4UTLA 2QGYA 5LA0A 2DDXA 4YVVA 4ZXLA 3BMWA 1MQPA 1CIUA 5KINA 2WYSA 5EMLA 2H9AA 4MB3A 1X96A 3GD6A 3WH9A 3PF3A 1CCWB 4O8RA 4MSSA 4ZVJA 3GH7A 1L6FA 1GKRA 3V18A 3PB2A 3NVTA 3RITA 4NP7A 1K8CA 1S2TA 3GU1A 3PSWA 4CU6A 1A53A 2F9RA 4H8HA 4IQDA 1QI2A 2VJXA 4HPXA 1R38A 1VFMA 3ZR5A 4C6KA 3AIEA 1HJWA 4UOZA 1PIFA 3UA4A 1XS2A 4I9AA 4S3FA 3WJWA 4PB4A 4I3GA 3I68A 3CT2A 3WJZA 1QO5A 1MNZA 8RUCA 4HA3A 3JW7A 3LHUA 4WY0A 1TE1A 3GIYA 1E40A 3AWOA 5CZTA 2IW0A 3P93A 3DX5A 3MZ2A 4GACA 3USZA 1F76A 4NU7A 5EMUA 5ABFA 3SRHA 3NXLA 3GNNA 5AYBA 1V3KA 3DHUA 2PDWA 3UZYA 5AHNA 3EDDA 4YN5A 3VKCA 1JR1A 2PD5A 3DG3A 4HA1A 1SFJA 4JKKA 3ZT6A 3IK4A 2QYGA 3WFLA 1JULA 1E6NA 1P0NA 3N2BA 3CH9A 1TV5A 4E8CA 3UP8A 1FH8A 2Y24A 4IP5A 1WO2A 5FF3A 3L5MA 1GVFA 1REQA 1X6UA 4YMZA 2XZ7A 3EXTA 2ZX7A 4XD3A 3QM3A 4XG1A 4MLJA 4Z1AA 4J7RA 2YLLA 1QNOA 1TELA 1QI0A 5CJ5A 3UERA 2C7FA 3GLCA 4WDTA 2NLYA 4X61A 4TMBA 3PG9A 1DWFM 1A5KC 3GSMA 3FIGA 5AVNA 5JQ9A 1NELA 2HMCA 2YZRA 1S5VA 4G1KA 4M6PA 1VFLA 2XWEA 1F5ZA 2RJHA 4IMEA 4A2RA 4AB4A 2IKIA 4H4IA 1Z44A 6ENLA 4DUOA 1W37A 3FNDA 1D2KA 2V9DA 3UJEA 1VHCA 5I3JA 4U5KA 1JF6A 1Q8JA 2GQ9A 3HFYA 5AC4A 3HZ3A 3W1QA 2PTZA 4XAFA 3LU2A 3LTSA 1G0CA 4YPJA 1RJRA 1W6TA 3DI1A 4QAIA 1NH6A 1EF2A 2BY1A 3V1PA 4LS2A 4MZ1A 3PBVA 1M7XA 4JFTA 4JHMA 1V8EA 3AOFA 1BEUA 2JBMA 4CNOA 1UW9A 1V4YA 4AXKA 3C8FA 4CCCA 1BYBA 5F1UA 1GZ1A 3L0KA 2VX6A 5K9XA 1JGMA 3W7LA 1HJSA 1F6KA 4DJEC 3HOJA 2R82A 4DJDD 4XZNX 4XO6A 4MVAA 2WVTA 3N6JA 5DX7A 4CEUC 1RLCL 1L8PA 1OADA 2RKXA 4IGHA 3NQBA 4RKAA 3T08A 5IFTA 4OHQA 3TA9A 5DLCA 9XIMA 2E9BA 3TR2A 3WQFA 4PTWA 3K13A 4LYKA 3FEMA 3I3EA 3MDWA 5LGXA 4UZUA 4PEKA 1XYZA 3WKZA 4R9XA 1Z89A 4K8GA 3MCOA 4Y9MA 1FDZA 3R94A 1KLYA 1KV8A 3AIBA 4QRNA 3HN3A 5XIMA 2XGZA 3IAQA 5CEWA 1FXPA 1UP2A 3S47A 4W5ZA 3RX2A 2XZ9A 1PPIA 2OZTA 3FDKA 5LNUA 2V68A 2D24A 3E9AA 3E2VA 1A3WA 3W88A 1A3XA 2YOCA 2PP1A 3ALGA 2OEMA 5JMUA 2IUZA 3GUGA 3GH5A 1LUCB 2BVDA 3LY0A 1M68A 2JF7A 2V67A 2X40A 1ML1A 4DY1A 4JX6A 4WK9A 5AC6A 4N6EA 1X97A 4MJZA 2ACSA 1W5OA 4IPLA 1FQ0A 1WKDA 3TXZA 4B5WA 3LCFA 3URAA 2H9AB 4A4AA 1D3GA 4QNWA 4IISA 4AWSA 3LN3A 1IZKA 4GJJA 1OCQA 3AYVA 1W3LA 1OT2A 2IPJA 2VGGA 3DAQA 3L5AA 1Z9AA 2NXHA 1GORA 5HOSA 3IJIA 4GUIA 3W2MA 5GNZA 3F5JA 3M43A 4GY7A 5AHEA 5H91A 2WVVA 4CU8A 4I90A 4HMCA 2DSUA 3HQ1A 4TO8A 4IFOA 1IT8A 1TPFA 2INFA 4OV4A 2VYOA 2E1DA 2ANUA 3PBGA 5AN7A 2OX1A 1P6BA 1A0CA 2J77A 3VGGA 4WY0B 2D22A 4E2BA 2IKJA 2ALDA 5I3DA 4IZGA 2GZXA 4R53A 4AFYA 4PFHA 1R46A 2VRJA 3V1HA 3LZ3A 1FWGC 1MDRA 5ABFB 5HNRA 2XVPA 3LMZA 1SFLA 1MYRA 3BAKA 5A2BA 4Q8TA 1OINA 3IJ6A 2P5NA 1MW2A 1VRXA 4O1BA 3ES7A 3MUIA 3W86A 2JEPA 1UWQA 4PMJA 3R89A 3W7JA 4M8UA 1T7LA 1CXLA 3UCQA 4BWLA 1IWAA 1VBJA 4E2DA 1JZ8A 4WR3A 2OGYA 3B0YA 1AK5A 3TC6A 4G1NA 3QPZA 3R6IA 4JQ3A 4DBUA 3O6AA 4D6CA 3MWCA 3FY1A 1GYLA 1UJPA 4JCMA 5T9BG 1TR9A 1T8XA 1K6AA 1REQB 2R1NA 3UCCA 1OGSA 1I45A 1VLIA 3KLLA 3ARRA 3WLSA 1J0KA 4AY8A 4RE2A 3DFTA 1HF6A 2EJAA 4IMGA 5I7GA 1P0BA 3ARSA 2V5JA 1ADSA 4H00A 1XCFA 3ZM8A 1N8IA 5F2IA 2PLJA 3MY9A 3H23A 1TPEA 1KWGA 1RD5A 2B0MA 2MANA 1ME9A 4UTKA 2MNRA 1SU5A 3QC3A 3FYYA 4GA8A 4GIAA 3ZWTA 2X8RA 3NEVA 1FWSA 2ZTKA 3TFCA 3RN6A 3WNMA 1NOFA 2HQAA 4U2ZA 1IV8A 3AROA 2V38A 4C6LA 1W54A 2X0SA 3R25A 1HJXA 4PMOA 4F0SA 3MYOA 3W01A 2WWDA 4NJKA 2Z0IA 2ZQ0A 1A4LA 1EA9C 3IIZA 1C7SA 2WHLA 3MI2A 2PDNA 4WJXA 3HM7A 5I79A 1X98A 2CBJA 4E2VA 4HNVA 4IQLA 2PC8A 1A0DA 3QLDA 1LWHA 2V5CA 3DKLA 3EA2A 1UWIA 2HE8A 3UXLA 1Y65A 2PMQA 2R24A 3W2NA 4QNEA 4XAZA 1FX6A 3AS1A 3BW3A 2QDHA 4CD8A 1K02A 2PGWA 3MUAA 2B81A 2X1IA 3FKKA 4O28A 3ZIZA 1YIXA 1JEZA 1EGVA 1EP3A 4IMFA 2VR2A 4WD0A 2IQDA 3M16A 2OWXA 2ZX5A 2WPBA 3LMYA 1TX2A 5HAOA 3ONCA 1CDGA 1J0HA 2CKRA 4N2YA 5HWJA 4MWAE 1IEIA 3MC5A 4J3UA 3L68A 4WZHA 4PYSA 5DCBA 3STEA 4URIA 3WLPA 1ZQ5A 2X0YA 2G0WA 4PFMA 1XG3A 3UA3A 3EMQA 3MKKA 1XIMA 3G1RA 1NFPA 5HBFA 4Q4OA 5IFPA 3QHMA 4FXSA 3TZNA 3UWWA 2VZOA 1U33A 1NF7A 1FP8A 3C2YA 1TUXA 4MM1A 3SN4A 3UXDA 1EGMA 3S5ZA 1FWTA 3OVRA 4G7FA 1T40A 4MADA 2V5DA 4EPKA 2DT2A 4YTSA 1F9CA 4S3CA 2RJGA 2FTYA 2PPGA 2WXDM 1MVYA 1YDNA 2PD9A 1B4EA 1P48A 3K30A 3HMCA 4ZFMA 2WVVB 4GHRA 3WK1A 3W85A 3MYPA 1BXBA 1OYAA 2OOFA 2Z1BA 5GNYA 1QT1A 4W7UA 1RPXA 1X6NA 4Y9NA 2E8YA 3VPLA 2ODOA 2CC0A 3MBFA 2XG9A 3WK0A 3UVIA 1E5NA 5FAJA 4ECLA 3M0HA 3VIMA 3V5OA 2NVDA 2WANA 6ALDA 1FWRA 3W25A 1X7FA 3OHIA 2JALA 4S2BA 2J74A 3CZKA 2OEKA 2PWHA 1V3LA 4XD6A 3OA3A 1Q5MA 3D47A 5DELA 4JQ2A 4E8DA 1BRLA 3WL0A 3TWBA 3LM3A 2ZADA 4AVFA 3MU7A 2Z1WA 1CXKA 5I23A 4HNLA 5LNVA 1M53A 3DGBA 1CECA 1V6WA 4ZODA 3QQ1A 3OZMA 3SB0A 2Z7GA 1F3WA 1I2RA 2J6XA 4KBXA 3KBSA 3RCNA 1R3SA 4U31A 3TN4A 4A3RA 2NQHA 2Z28A 3KVLA 2C1IA 4IX0A 1ZAJA 3O07A 3LCLA 4FALA 2Y0FA 1ONRA 2BZNA 3DXIA 1YNQA 2JKAA 4F3HA 1DJZA 3WD4A 4F0RA 3VKJA 4H7VA 1YDOA 2TMDA 7CGTA 4J3SA 3XIMA 3BSMA 4CQCA 4ROPA 1KWKA 3VGBA 1ZCOA 2BX7A 2IMRA 3SJ3A 3MMWA 2CWNA 3E0IA 1M01A 2YCKX 1R7OA 4DPQA 3N17A 2GWGA 2R94A 3FSUA 2OG9A 4NYYA 1VFTA 3MVTA 3AMLA 5GVJA 1HL9A 4HJWA 3QTPA 4M80A 3INPA 2YYTA 1IHIA 3SSJA 4IGNA 3UPBA 1ODUA 2EPLX 3IK2A 5I3KA 2FMNA 3SUTA 1BG4A 1XM3A 4C6MA 1C8QA 3CMFA 4B91A 5E0CA 3HO8A 3W7IA 1W3JA 2HXTA 3EAUA 4ZMGA 3PTMA 4UMBA 1GJUA 4XKYB 1ZJAA 1K7FA 4OIFA 2QDDA 3KAOA 3PULA 3KRBA 1OSEA 1UD4A 1XBVA 2YGYA 2ZUSA 3HG4A 4Z2GA 2I57A 4JN8A 4W85A 4CVUA 4HPJA 1P4CA 2WZTA 1KM3A 4NJIA 3AMKA 3LK6A 4KKXA 3W27A 2CLPA 2CBVA 4K3ZA 1Q65A 2E6AA 1LG1A 2PTYA 1XJBA 3I4EA 5HATA 2VC5A 3NA8A 5HDRA 3UWYA 2G3JA 4Q7BA 3QVQA 1JPHA 4REQA 4LV4A 4FPSA 3CQ0A 5CQ1A 4JBRA 4ZTYA 5D2XA 4JNMA 4Q8WA 3TC7A 3UETA 1PZ0A 3OGVA 1EKOA 3W72A 2ZDRA 5HPCA 4GVFA 5FJRA 2D2JA 3S9IA 3STGA 4HNTA 3T0AA 3A3WA 3H55A 1P1MA 2AGKA 3NM3A 4LYPA 4YXGA 3VOJA 4ZTXA 3CB3A 4IJRA 3GNPA 4DHGA 2DW7A 1QW8A 1E70M 4NZCA 2V30A 4LJ3A 3W26A 2PDXA 3KX6A 4LS0A 2Y6ZA 3K2GA 1EEPA 4JTIA 5KETA 3EEZA 4E5TA 2ZUUA 1BQGA 2WC3A 3QXBA 4PL2A 1UR8A 2QDEA 2TRSA 2VQUA 2HVNA 3CIWA 3GDTA 3SY8A 4EKJA 4JTGA 2VZVA 4LGXA 4BR1A 2FZBA 1UR2A 3GY1A 2YXGA 4JHZA 4CUCA 3O7UA 3TC3A 3SCVA 4R7WA 4TUFA 3PUOA 2VR5A 3NO5A 4LT9A 4LAMA 3UYIA 3GG7A 1EJTC 1E4NA 1J79A 4GO9A 4UTFA 3G77A 2WQPA 1H7RA 3WD2A 4YWIA 1FCVA 3DDMA 4A3HA 2OYMA 1PSCA 2OX4A 4F2UA 2WPGA 1JDEA 1IIHA 3W7QA 3NOEA 3UT0A 1J5TA 1IEXA 2PF8A 3REQA 2AL1A 1DWIM 1FFQA 3OLIA 3LCWA 4NJJA 1MW1A 1F3TA 4H9MA 1MFUA 4DLMA 4O50A 3RO6A 4EWND 2XWDA 2F2KA 5HUPA 1KR1A 3P62A 4E3VA 1RBOB 5AKQA 3W7GA 1L2QA 4K2SA 1TPDA 3MMTA 4XBJA 5AHLA 2D0GA 3T2PA 3T2OA 3TUUA 2W0UA 3ECQA 5A95A 2R9RA 4KWSA 4XQ6A 1RY8A 4LW7A 2FJKA 3BAJA 2W27A 2WCSA 4GY0A 2C8NA 2ZZ2A 4O19A 2P50A 1H0IA 3BO9A 2W91A 3W76A 3L4ZA 1AJZA 1M04A 4B5TA 1BAGA 1JQXA 4J4KA 4GUJA 5FACA 3VUSA 1DOSA 1UC5A 5G1MA 2Y4SA 4M56A 3ZS4A 1CBGA 2WMFA 4XX6A 3E96A 4A8NA 3L4UA 2CBUA 2QS8A 4O15A 4U28A 2CLKA 3F4WA 1CB7B 4WGHA 5CXPA 4LQ1A 3TTOA 1VAHA 3AWNA 2QUUA 3WENA 3G6MA 8A3HA 4XIAA 1C29A 3VGFA 2EKCA 3WLNA 2VOTA 5T8GA 4PRTA 3TYCA 1U83A 1VLWA 2XINA 3BG9A 2VX7A 2YB1A 3CPRA 4WJEA 4GFSA 1O94A 5HNNA 1GQIA 3OLGA 3UPMA 1W2VA 3HFTA 2A3AA 4JIPA 1S2VA 5M5DA 2VQTA 1JXKA 2YDQA 3K8KA 5HA7A 1EF3A 5JUVA 1VD6A 3OZOA 4GYPC 1SO5A 3EWDA 3FGCA 1EQPA 4JKLA 1RQEA 3QMRA 2FDMA 5FI8A 3OVPA 3W3OA 3WYZA 4B4FA 4HP5A 4DXXA 3M9YA 5BNKA 2XIJA 1RAKA 2ZYFA 2NT0A 4A3QA 3SN0A 4OT7A 1UMYA 3S2CA 5D8WA 3CHCA 2P10A 2BXZA 4WIWA 1DIKA 2AQVA 3W53A 1YMYA 2H3BA 1IWBA 4KRUA 1W5MA 2PWGA 3H24A 3CMJA 4HNUA 3NQ6A 2EPOA 2AAMA 4OZOA 1LLOA 4M6UA 4MWAB 1R2TA 2WNWA 2FGLA 4C90A 4O4WA 4REQB 1J2BA 3CIXA 4FNTA 2PUZA 5F7UA 3RNDA 4CD7A 2DZUA 3IAPA 5DBTA 1PXGA 3PTKA 4QJ1A 1UUMA 1BYCA 2YL8A 1ZHAA 1BWKA 2DZTA 2PDYA 4GMEA 2A79A 2DZPA 3FN9A 5CPLA 3G0UA 2PS2A 3B03A 5C8BB 5CBJA 1YX1A 2OZ0A 3I65A 4ONVA 1E6ZA 2J7HA 2GVGA 3RYSA 4FHAA 4DRSA 4ACYA 3GXPA 4A21A 3S8HA 1P6CA 1VGAA 4B9YA 1B3YA 4B16A 1DWAM 1H5YA 4UFKA 5XINA 3MPGA 4GQRA 3KL3A 2FMOA 4H6EA 4IPIA 3ZQ9A 3RGTA 4JY9A 3W6LA 1HIZA 4DO4A 3SCQA 3TH6A 3LXCA 1EHNA 3E0LA 1TSIA 2QCHA 2PRLA 2W61A 2HCVA 2VEIA 2HV5A 4O11A 2J88A 4AZ7A 1WBJA 1OFBA 1I2OA 1B90A 1J0JA 2W79A 2Y5EA 1LOSA 3WQ8A 2E7FA 1FWIC 3VKKA 1RY0A 3RHGA 2NV1A 3U3HA 1D9EA 2DSWA 2OZ8A 1CXFA 1CXEA 2OCZA 3SCOA 3GTNA 3OIXA 2FB3A 1O95A 1K7EA 1YYAA 3M46A 5MF5A 1TQXA 3ITGA 1OT1A 1XPGA 1UH3A 2HE5A 2HNHA 3REQB 5IXEA 5CH9A 1A5LC 4KWUA 4Z2LA 2WSKA 1QJWA 3WG6A 1I1WA 3KCOA 5FEPA 4B90A 1OGGA 1F74A 1XP3A 3MZNA 3ISIX 2C91A 4L5ZA 4HSNA 4IG2A 1IEWA 3HG2A 5AFDA 4LH8A 1T41A 4V28A 3WDQA 4E4PA 2ZZ4A 3NGFA 1ENUA 1EUAA 4NKCA 3TFXA 3E38A 4XBKA 4XSLA 4W4QA 1VEOA 4NILA 2CLOA 4E4FA 4CQDA 3IGXA 1SR9A 1FHLA 1MUCA 2WZIA 4PUKA 4E2OA 3WF2A 3MT1A 4A8IA 4H6QA 4XO7A 1KR0A 2AOSA 4RJEA 1VEMA 3ITCA 3TSBA 3DG7A 1Y7VA 1C92A 3BL3A 1XBXA 3A5VA 2OR2A 5HK4A 4JDBA 4DNMA 3BANA 3NDOA 5A6SA 3M5ZA 4LF2A 3EMZA 1UR0A 4HB7A 4UBPC 3Q37A 3V0UA 3VUPA 4QM1A 1OJXA 1QU4A 4QE4A 2PDQA 2I16A 1JZ6A 3O3RA 1ADOA 5EMKA 3EWZA 1MXDA 1QOPA 1KB3A 3S1GA 3SUVA 5DCDA 2WM0A 1Y5XA 7TAAA 1KKOA 3CC1A 1JXJA 2WMKA 5EU9A 5D9MA 3EB3A 3GFYA 3UWUA 4PL1A 5EYWA 2VX5A 3NPVA 4PCFA 1XLBA 1XYCA 2PDMA 4PGLA 2DW6A 3RMJA 1TG7A 3O0FA 3P82A 1XYAA 2Q71A 3H2EA 1U2YA 1R8LA 4PTNA 2P1FA 5AHFA 4XB3A 3LA4A 3L21A 2CXEA 2BLEA 4LXFA 1JDAA 3BOXA 3PZTA 4CNNA 2CW6A 1LQAA 1CGWA 1VIZA 1UD6A 1I8JA 1DORA 1KD0A 3QMTA 3DHPA 3NQFA 3N9KA 4YLWA 4HK5A 3B40A 1V93A 2YZ5A 4P5UA 1QOXA 1E1EA 2ZXDA 2E40A 3SQSA 4X63A 1EC7A 2ISDA 3U4FA 1BYDA 3CL7A 3QSRA 1N82A 4HNOA 4QCEA 1TIMA 4V33A 5EMYA 2ZZ5A 1ADDA 5EFFA 3GBEA 3KDNA 2WJFA 1QFEA 4FI4A 3KE0A 5D03A 1J93A 1IXPA 3GNXA 4KCWA 2DZXA 3SQMA 3EOEA 3HPAA 2PDKA 3IS4A 2QCEA 4LRSA 1OEPA 3GXTA 3FAXA 1AW5A 2Q02A 3TQ0A 1XLKA 1E51A 4UB9A 1JRBA 4HPHA 3RXZA 2AMGA 2VEPA 2DT1A 3WZ0E 4HTBA 1PO9A 1TTIA 3ZR6A 5C9XA 1Y5VA 3FA5A 3MANA 5ENLA 1QR7A 3K46A 3NCOA 3VMNA 2O7SA 4PMZA 4KEMA 2VI0A 1XSKA 2EEXA 4EXBA 3AI0A 2G41A 4YU1A 3P67A 4HCHA 1NDWA 3T44A 4DI8A 1TJRA 4WSJA 1QHPA 3KUMA 4L80A 3NL2A 4JTUA 1PYMA 1OB0A 3APYA 1VJSA 2QDGA 3BAXA 2GJPA 2X05A 5T91A 4DBSA 3R2GA 1DQWA 1FWCC 1Q6FA 2PA6A 3T09A 4AHOA 3WD3A 4QG6A 5LXEA 5A2CA 1ZJBA 3T4CA 1ECQA 4B3LA 4MKVA 4CN4A 1R0MA 3GRIA 2V3EA 2WLZA 2GDVA 3PWAA 1K1DA 3AALA 1I6NA 5KZMA 1JGIA 5C2GA 4DO5A 3WN6A 5AHMA 9RUBA 1MO0A 3QLLA 3FHQA 2YLAA 5GQBA 1HNYA 4QG9A 3VIJA 1ITUA 1D7FA 1DWGM 3M47A 1XCXA 3M7WA 1PVNA 1ISWA 2D20A 4IT1A 3H7RA 1V3MA 3DCPA 3BGGA 4WY0F 2J6VA 3B04A 2WB5A 1AH4A 1NDYA 2PEVA 2PDUA 3TTSA 3PNUA 1K8YA 3OYXA 3ZYZA 2UY2A 4Q3MA 2EF9A 2VC7A 1FHUA 4DEFA 3KHJA 5DQPA 1TMHA 1VR6A 1A5MC 4PMVA 3CZ8A 3S1WA 2UBPC 4IG2B 2GWNA 1T0OA 3AZTA 4C65A 3B05A 3WF4A 3W2JA 1JPIA 3EPNA 4FNUA 2BOFX 4UQBA 1HKKA 5CPMA 1XKYA 3JUGA 3A4AA 4NYUA 3WLMA 1DJNA 4RK8A 4JTFA 3B06A 4B4HA 1XD0A 3B3DA 2E1WA 5CLWA 3FA4A 3DIPA 3T05A 4QX4A 4S3JA 1O66A 4X9SA 1ZP3A 2OZ3A 1F2JA 3NVDA 1EIXA 3H4GA 1XGEA 5I02A 3PY2A 1UP3A 1LF1A 3IACA 1YHTA 3GDBA 4AIOA 1OK6A 2BMBA 3DYPA 3I6EA 2Y70A 1ZJHA 3UR2A 3VDBA 2Z00A 4JTDA 1ITQA 1W1B1 3G18A 3G1XA 3GZAA 1MFVA 3BDKA 5A6MA 4DYKA 2BY0A 4AZHA 1D7KA 1HP4A 3WMLA 2PRMA 1BF2A 4DF2A 2VEGA 4OFCA 4EAMA 2A3CA 3PR2A 3WX7A 4ZR8A 3UR8A 3AMDA 3PTDA 1NSJA 3EA3A 4FNQA 2NV9A 4R5EA 5I3GA 2XIBA 4KFOA 3OW1A 2W63A 3LX9A 4PSRA 4KW2A 4MDOA 3IUDA 2PRHA 2CNCA 1ICQA 5DXXA 2YBVA 3OVGA 1XUZA 3RK8A 5LNSA 4KEVA 5FESA 2XSXA 3OYZA 3A64A 1WXZA 1LBLA 4ZO7A 2TAAA 2ZA3A 3DBNA 4AD5A 3DFHA 3WUEA 3W0KA 4JTQA 4MZYA 2BVYA 3STFA 1PDZA 3H2OA 3BG3A 1QK2A 3WNNA 2HBVA 3WK2A 4C6FA 2G97A 6REQA 3DFSA 4NX0A 3UY7A 3GVVA 4U4MA 3ZR4A 1BSIA 2NW0A 1N55A 2QUNA 3W7MA 4A3YA 3ORWA 3WH8A 1B31A 3C2EA 4W9TA 1OY0A 2J27A 3ATZA 4C1NA 1L8NA 4Q22A 3RMEA 1E5JA 1SO4A 3GC4A 3U4AA 2YCJA 3LHYA 1RR2A 4PCSA 2E5BA 4HQVA 3ARWA 4NNAA 1F3EA 2V5KA 2OQHA 1QI5A 1RP8A 2WOQA 3U0HA 1XLEA 4LVGA 1O1ZA 1GVRA 3L4YA 3ZXWA 3MKCA 4V1YA 3WLTA 3GZ3A 9XIAA 4C7GA 1FVPA 1PTGA 4CNSA 3QV6A 1XIEA 5DXYA 2YXXA 1B3XA 1MMFA 2Y1HA 4X22A 5CSRA 4TVDA 3O2LA 4EAYA 4UTUA 2A7NA 1TKKA 4HU8A 3SM0A 1YKWA 1EIBA 4MYAA 1O1HA 3VKDA 1HL2A 3KBNA 4F9JA 4YTTA 5G2HA 1FRBA 2B7NA 3VX0A 1UP0A 4ZB5A 3FOKA 3W7DA 1IGSA 4JX5A 3OB8A 3NZGA 5FJOA 4I6VA 1G4PA 4EX4A 2I56A 2WCAA 1TPB1 3URNA 4K8EA 3P8JA 3LERA 3EA1A 1VCVA 5E9XA 4S1FA 1Q63A 3STPA 3UVAA 4TTUA 3QR1A 1TVNA 2EG6A 1H2JA 1K6WA 4I9TA 4TR9A 3PP7A 4NZ3A 2ONEA 1TJ2A 4HJFA 4DWSA <