1TB3A

Crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
332
Chain Sequence
PLVCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKRNQLNLEAKDLRALKEASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREVVAAVKGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISPDLIQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyacid oxidase 3
publication title Crystal Structure Analysis of Recombinant Rat Kidney Long Chain Hydroxy Acid Oxidase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 118
structure length 332
sequence length 349
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tb3A00
2VOMA 4OWGA 2C18A 3NL5A 2H90A 4FX8A 2GVJA 1FDJA 3UPWA 3LHTA 4FNQA 1P4CA 1AK5A 4Z0JA 1J4EA 4DEFA 1VYPX 2TYSA 4K39A 4NQ1A 3PBUA 1DKWA 1LORA 1AL7A 3W7LA 3HGJA 1HO1A 5AOUA 1VHCA 5D2XA 2G97A 1H7PA 3O8AA 2LLEA 4LS1A 1H5YA 2VFDA 2NLIA 1G69A 3NQ8A 4JGDA 4MKNA 4ORMA 1H7RA 2UV8G 4NZJA 2DZVA 2V81A 4ICNA 3GDRA 4OQVA 5F4SA 4AB4A 1C8VA 3OG3A 3IGSA 2A2IA 3HG5A 2QDHA 2WJZA 2YDAA 5K4XA 2RDUA 4JX5A 1THFD 1I45A 2QCMA 3NM1A 5HJLA 3VE7A 4R33A 2C3ZA 4CQAA 1JCJA 3M5XA 3OA3A 2ATSA 2YPIA 2BSLA 2WQPA 5D09A 1XDLA 5E0KA 1YXCA 1T0OA 1WQ5A 2P10A 3G1HA 5HWJA 1RQEA 3OBKA 1TV5A 3BLIA 3NYZA 5AHLA 1LDCA 3W7RA 4O12A 3GYEA 4NNAA 3JR2A 4EF9A 5K7JA 1W5PA 4RZ5A 2X16A 3BG3A 1OX4B 1W8SA 5CG7A 5D05A 3P62A 1A5AA 3EKLA 4O54A 1O94A 4GUFA 4O50A 5FF4A 5C2XA 1I2RA 4LW7A 3W84A 1QCWA 4ZQMA 1GVOA 5G2WA 5HNRA 1UUOA 1EWEA 4OGZA 2ZDRA 3VCRA 3R2GA 4QAIA 4JTKA 3KVJA 4WJEA 4ML9A 2YX0A 5DXXA 4QNEA 3GZ3A 5C55A 2CLLA 3EB2A 1X1ZA 3DU0A 1EIXA 1VLIA 1LRTA 3NGJA 4DPQA 3W7KA 1SPQA 1T8XA 4GXMA 4XKYB 1WBJA 2BX7A 1JCNA 4Y6GA 1Z42A 4O14A 1N55A 1W56A 4H6KA 3LRMA 3MUXA 3HIJA 2CWNA 4M6QA 2DJLA 2R94A 1JUKA 3I6RA 4WY0B 4UIOA 2QCDA 1EEPA 2RFGA 1JQVA 4O0KA 4UTHA 3TNOA 1L9WA 3PAJA 3SSJA 1GEQA 4M7TA 3S5OA 5BMWA 1PCWA 4NUWA 4Q32A 5F2GA 3IIVA 3OVPA 4UMBA 4GJ1A 3H53A 2QCFA 3MW7A 1TPC1 2TSYA 3FIGA 3NO5A 1IIGA 4UTIA 2YYTA 4NJGA 2YSWA 1R46A 3B4UA 3W1MA 3E12A 4PCFA 3L0NA 3STGA 2E6YA 3IRDA 4MY9A 4K7VA 3W6YA 3S5NA 3LCLA 4O1BA 3P8IA 5J5RA 2VELA 3TC7A 1OVDA 1OYBA 3P5YA 4UMCA 1L2UA 4MYXA 4O18A 3NQGA 4H3DA 2ZA1A 1SFLA 2G96A 3A23A 3ZR4A 5FESA 3HBLA 1IGSA 1ZAIA 1U83A 4WZHA 4YWIA 4UTJA 1FCVA 3G0XA 4LV9A 1QPNA 1TCDA 1CI1A 3P8JA 1LBLA 3MI6A 3P61A 3P74A 4MZ1A 1O60A 4BWLC 3M16A 1VYRA 2V82A 5BW6A 4JTEA 2FB2A 1FXQA 2PRMA 3GXPA 1TTPA 2ZZ4A 5LNWA 2V30A 4O28A 2VEMA 4HT3A 4JEQA 3LCHA 4OV9A 3SJ3A 3B04A 3M7WA 2TMDA 4LY8A 3MP5A 4WOZA 3FKKA 3TFCA 2QEZA 5KTLA 1WAUA 5I3HA 2V5BA 1H50A 3S42A 3R13A 3NQCA 3STEA 1G4PA 4XBKA 3SZ8A 3NQAA 4L4MA 4A3UA 3LXCA 2ATMA 4KWVA 2V9DA 2VFGA 2FPVA 1LLWA 2E5DA 2A21A 2VFIA 1FWSA 2C15A 3QPZA 1K8XA 1MO0A 3TSBA 1DJQA 3LHWA 2ISWA 1KFEA 2H8XA 4AWSA 4EOUA 4N2YA 3LM7A 5AHMA 4S2BA 3LCXA 1S5TA 3HOJA 3LI1A 1XKYA 1X7FA 2FFCA 1EUAA 1IXQA 1NFBA 3AJXA 3O1NA 1JR1A 4YL2A 1OF8A 2RDTA 5AHFA 3W2UA 4LTSA 1OJXA 3FJ6A 4MY1A 5F2MA 2ZYFA 3CWOX 1DQXA 1Q6QA 3GIYA 1SO4A 3E96A 3NQ6A 2DZUA 1TTQA 1R2RA 1YDNA 3LBCA 3EWBX 2FQIA 2FDSA 3PUOA 4O1CA 1W3NA 4IX2A 3W1LA 3DFPA 1O95A 3EX6A 3PG9A 2J6XA 4RXGA 3IVSA 5L9FA 1DORA 1LBMA 5F4WA 1R47A 1GG0A 5LKYA 2ZQ0A 3TMQA 4GBUA 1M5WA 5KINA 1G67A 1O5XA 2VFHA 1M7PA 3UWZA 3DI0A 1PCKA 4GRSA 2ZCGA 3S1VA 2C13A 2HTMA 1KFLA 4MIMA 3TJLA 5E93A 1I2NA 1B3OA 2C16A 2JBMA 3TXVA 4NX0A 4BI5A 4UTTC 3KHJA 3OVRA 3PSVA 2QDGA 2XN0A 5F2IA 4FIRA 2QJHA 3QJAA 3LCGA 4FXRA 3P84A 1WYIA 4PFMA 5CZSA 1OFDA 2PCQA 2XFWA 3M41A 2VXNA 4QIUA 1EUNA 4CQ9A 4NU7A 2CLFA 1OFOA 2GJLA 2XN1A 2AGKA 1FCQA 2V2DA 3DKLA 3Q37A 5EKYA 5HUOA 1ICSA 4JTFA 1TJRA 3G1SA 1B9BA 5MHBA 3MO7A 1P0NA 5I3FA 4HSOA 4XTIA 2O7QA 3A5VA 3HB9A 2Z1BA 4JD4A 1LCOA 4GFSA 3QW4B 1ICQA 4DO5A 1F73A 5AYYA 2V0TA 3HF3A 4GUJA 4AHOA 4CNOA 1JRCA 1ZHAA 4PL2A 4R7JA 3GK0A 3M47A 1E51A 5HUPA 5BMXA 1DJNA 2PC4A 2YW4A 3C4UA 1JCYA 2BZNA 2WKJA 3EWUA 3A24A 4BF9A 3WJWA 3ABSA 5C6MA 2Q8LA 3S5YA 3W70A 5K3VA 6ALDA 1W37A 5AHEA 2DZSA 3TH6A 5K9CA 4O57A 2X1UA 2YW3A 3FYOA 3PS7A 3TK7A 4O1AA 4NJJA 4A2RA 3NL6A 4G1KA 4O8RA 2CLEA 2VENA 3CWNA 1HUVA 3KRUA 1GTHA 2FIQA 1A5BA 3WK0A 3W1TA 1IXPA 1F6KA 1OK4A 4JNMA 1ZENA 3ZWSA 4DO6A 1TV7A 4ZQPA 3EWWA 1UJPA 3PBWA 2X1RA 5HULA 5I3GA 1X1OA 5AFDA 1XC4A 4OBTA 2WSYA 3UPBA 2Y7EA 5EY5A 1WOBA 1D3HA 3DFOA 3W7IA 3NQFA 3IV3A 3OHIA 1YTKA 5CZTA 4IMFA 1ME7A 2X1SA 3EX1A 1TQJA 3NPWA 5CKSA 1M6JA 3GR7A 1NEYA 5HMSA 4DBEA 2DJXA 3G24A 1W5OA 4NZFA 3NPUA 4JXCA 3S8HA 5H2ZA 3R5EA 1TPWA 1DBTA 3LRLA 1OYCA 1GVQA 3CTLA 4JYEA 4WOQA 2OJPA 2QUTA 1KLYA 1W54A 3TQVA 4UC5A 2B4GA 4KFNA 4JYFA 2H6RA 3B8DA 5D33A 4M7SA 3MWAA 4O4WA 3A21A 2Q3RA 1HG3A 3TSMA 4UR8A 1KTCA 4HSNA 1KA9F 5AN7A 3CM4A 1SO6A 3R8RA 1ZAHA 3SGUA 1PIIA 3DXIA 2ZRUA 4HPXA 3CT7A 4CCCA 2NXHA 5IBXA 2E6AA 5FEZA 1PHQA 4KFPA 3LCIA 5HWMA 3PB2A 1XUUA 2WNNA 4LWWA 3W7JA 3C6CA 3P67A 1VRDA 4FNTA 1DOSA 4MFDA 4LRTA 3P5ZA 3SGZA 3BO9A 4AH7A 1SZNA 1LRQA 4MOZA 4RZ4A 1XL9A 4OV4A 3NR0A 3WJXA 3RMJA 3C61A 1K03A 1GQNA 4W9TA 2B7OA 3IGXA 2GQ9A 4UUIA 1Z48A 3W7QA 3GDKA 4HKPA 3ATZA 3IIZA 3M5VA 1XM3A 2YXGA 3TW6A 3TQ0A 2FLIA 2JKEA 4UTMA 4K36A 3PULA 4Z0SA 1T96A 1KLZA 1EPXA 4O1DA 3H55A 3HPXA 4A21A 1TPUA 2B7NA 3SY5A 1AMKA 4UCGA 1W31A 3QC3A 1ZY9A 2Y7GA 3ATYA 2JK2A 1UUMA 2W6RA 2ISSA 3T7VA 1ZALA 3GDTA 4O53A 4LUIA 1P1XA 3NQDA 1I2PA 5CZ0A 3STFA 2WV8A 1GOXA 2QCCA 1ZFJA 3MI2A 1FWTA 2GOUA 4Q33A 3WJYA 1SFJA 3G8RA 5E1QA 3HQ1A 3SFKA 3WFAA 3NVTA 1SO5A 1XBXA 1GG1A 3EXSA 3OEXA 3UWWA 5DN1A 1H7WA 1IIHA 3ANYA 1VPXA 1D9EA 3LB0A 4NNCA 2CW6A 4AXKA 3BG5A 3CPRA 4NXSA 3W1NA 1JUEA 3G3MA 4FX7A 2CLMA 2A1YA 1IF2A 4TR9A 4CNPA 3BK0A 3W85A 2DZTA 2CLIA 3Q58A 1V5XA 2H3BA 1K8YA 4UTKA 2EKCA 4ADTA 3LHZA 3N9SA 4WX2A 3CQ0A 4JX4A 2Y85A 1PV8A 2E77A 3PBYA 2EAWA 3TXZA 3M9YA 3PUEA 4CLMA 3RF9A 1KFCA 2Y62A 4A29A 2GQAA 2ZZ3A 3MYPA 2EHHA 4NXKA 1K7EA 4O52A 3O16A 2QCHA 2ABAA 5DELA 2ZZ6A 2P1FA 3P80A 5D38A 2ZFAA 3LOTA 2NXGA 3A5FA 3F03K 3GR8A 3MP3A 1P0KA 1LLZA 1GYNA 4LU0A 3HGRA 1W0MA 3FS2A 2PURA 4N4PA 3NQ2A 5EPDA 4KWWA 4K37A 1SZEA 2AQWA 4UFKA 4DELA 3IGUA 4LV4A 3STCA 1I8JA 1NVMA 4WQ6A 1XXXA 4E2DA 2ZBTA 5DCBA 4N9BA 1ZNNA 4UFIA 2QJGA 3L0GA 3QM3A 3P60A 4IMEA 3UD6A 3TSDA 4O11A 1RZMA 4AF0B 3HGSA 2QCGA 3FEMA 3W1RA 1XBVA 5FF0A 4YLWA 3EKZA 3TIMA 3E02A 1FCBA 3W1UA 4OT7A 3S6DA 2EGZA 4FXSA 4R53A 2ZTKA 1OX5A 4ALDA 4Y9AA 3R12A 4A22A 3LTSA 3W76A 5AYZA 3L5MA 5D2WA 5AYXA 4DF0A 2CZ5A 4LUJA 3B03A 2KZHA 1LZOA 1Z41A 4JR5A 3QZEA 3DENA 3TROA 4MPQA 1SUXA 4NVTA 3W7OA 4H4IA 1WOAA 4OE7A 1KM1A 1MEHA 4EWND 3O6YX 1OFAA 4PTNA 5CPOA 5TBOA 4C1KA 1WA3A 1OF6A 3G18A 2PRLA 1F2JA 1DQWA 1VS1A 4MZYA 4QQ3A 1MZHA 1G4EA 5CGQA 3WJSA 3KFTA 1SW3A 1PE1A 3N2MA 2V8ZA 4GE8A 3QMTA 2FPYA 3CEPA 1ZJIA 3LXBA 3FJLA 1KFKA 1YLVA 3MMTA 2WNQA 4FB7A 4FIQA 3BPWA 1KM4A 3NZ1A 1FDYA 4Z1AA 3BGGA 4JY8A 1LTDA 1MEWA 1V7YA 4MJZA 1K7XA 1LYXA 5A5WA 3W7HA 1SO3A 1OABA 2BWGA 3S5ZA 2H3DA 3IEBA 1D3GA 5G2HA 1G6CA 3L0KA 5F1VA 1H7NA 4GUHA 3EX2A 1H7XA 3SW6A 2W79A 3M44A 4O17A 5LNVA 3UWQA 5LGZA 3S0CA 1FDZA 1BEUA 2QCLA 3N19B 2R14A 3C2EA 3NNTA 1FWWA 3W2MA 3W7GA 2G5WA 3WJZA 5G5IA 3W2LA 1QR7A 3RLUA 3IVTA 1T99A 3BVJA 5HINA 1K3UA 4AWTA 4CNNA 4LVFA 3MI3A 4PC8A 3L66A 5A8GA 3NG3A 1QDSA 3F4WA 5HWNA 2GPTA 3RU6A 4K6AA 1LBFA 2ZA3A 5BRBA 1MSSA 2ZRZA 3MHGA 2BLEA 3GKAA 2QCNA 2OX1A 1KM2A 4AEOA 5L6UA 3TAKA 1EWDA 1RPXA 1KTBA 1QO5A 1VR6A 2C0AA 2CZDA 1H1YA 2NX3A 3NL3A 3O15A 3F1QA 3NDOA 3BLEA 4O15A 1QWGA 1MEIA 3Q94A 3YPIA 4WY0F 3N34A 3TW7A 3UNDA 1XUZA 1QFEA 2Y89A 3G8EA 3M1ZA 1JCLA 1YXDA 5D2TA 1ME9A 2HSAA 5I3KA 2NUYA 3O05A 4POCA 2QCDB 5AB3A 1FWNA 3G1AA 1TSIA 3W7MA 2H8ZA 2NUWA 1ONRA 3V75A 3WK1A 3TJXA 3UQNA 4MZ8A 5DCEA 3TMLA 1TO3A 4DBDA 3GDLA 3TU9A 1H61A 1ZCOA 1UBSA 2QJIA 1VJIA 3TX9A 2IQTA 1LRNA 1JUBA 4UNKA 1R2SA 2E09A 3B0VC 1TRIA 2CFFA 4FNRA 5C54A 4RCXA 3C2VA 4IXXA 2PRHA 4N6EA 2X30A 1CX9A 4P2VA 1W3IA 3DKJA 5BNKA 4RX0A 4CQ8A 3I7RA 3LTPA 5TIMA 4DPPA 1SQ7A 4E38A 2NV2A 3AO0A 1C9DA 1GVSA 3GDMA 1A50A 3GX9A 5DY2A 4LNYA 3HG2A 4YXGA 5EA9A 3LXAA 5D30A 4IMCA 2O7SA 5AHIA 4LC6A 1K7FA 1YDVA 5SWUA 3GKFA 4QNWA 1SZFA 1U5JA 2EF9A 3PBVA 3A9IA 4P61A 5LGXA 4NT0A 3FKRA 2J9ZA 4JTJA 4X2RA 3EWZA 3SIZA 1ICPA 2JGQA 1WXJA 5LNUA 1EB3A 3N3MA 1PS9A 5EL1A 3LDVA 3W71A 4MYAA 3CIWA 4TX9A 4LC8A 4E0CA 2C19A 4XZ9A 4TO8A 1SSGA 1NF7A 3QMRA 4FX6M 2NXIA 1AW2A 2G95A 1KM0A 4EF8A 5F2LA 4O4VA 4LVDA 1SW7A 3QMSA 4FNSA 3L65A 1QPQA 4IX0A 4O0ZA 4KFOA 5KMYA 3HPZA 3C52A 4LS0A 3QSTA 3LTYA 2V2CA 3H54A 4ZQOA 1H51A 3GB6A 3TCEA 3M5YA 3W1XA 2EPHA 3O07A 3JS3A 3HO8A 4MUZA 1BWKA 1RD5A 4K8EA 4QSHA 3VNDA 1KBIA 2A6NA 5KZDA 4S1FA 2Y7FA 5F4XA 4LRSA 3B06A 3S1UA 3ABOA 5D37A 1W3TA 1N8FA 4J9JA 5G1YA 4PA8A 5CSRA 1GYLA 2A7NA 3KX6A 1NSJA 5H91A 2I9EA 2P0OA 3G0SA 1JVNA 1OFPA 5FEXA 3EWYA 2A7RA 4KKXA 2ZZ2A 2GJNA 2QR6A 3E49A 2HS6A 1EP3A 1IXNA 4RV8A 1VH7A 4BFAA 4ZQCA 4X22A 3G0UA 4UFHA 5F1UA 5D04C 1EP1A 1PL9A 1TPH1 5BOOA 2NUXA 3UY8A 3PWAA 5AC8A 2I1OA 4RJEA 4WUIA 4N9CA 3W7PA 1F05A 2CLOA 3K30A 1TYGA 3TFXA 1DHPA 2WO5A 1GWJA 3NM3A 4ADSA 3GLCA 2DZWA 5CSSA 3NOEA 3THQA 3CEUA 3E9AA 1ZAJA 1KTNA 2FB3A 5CPMA 1WV2A 1LOQA 3LLDA 1OX4A 3M5ZA 2J9YA 1X6UA 3N9RA 4UNLA 1G4TA 1C29A 1FUYA 1SW0A 4WXZA 4AAJA 4BK9A 3CC1A 3T44A 5DCDA 2R91A 2BXVA 4BWLA 2RHGA 4NJKA 2B0MA 1WDWA 3LHUA 3QPYA 4QISA 1KV8A 3NQVA 4EVZA 4UFMA 2ZRWA 4TMCA 1H62A 4ORIA 4XBSA 3O6DA 4O10A 3NQ7A 1HO4A 3CIXA 3EEGA 1XI3A 5DXYA 5EMUA 3L21A 3QSRA 2A6LA 1DVJA 1BKSA 5DBUA 2TPSA 3MYOA 3Q2DA 4IMGA 3RFAA 2A5HA 4K38A 3MP4A 3IIPA 1W5MA 4N9EA 7TIMA 5HR6A 4XKYA 3HJZA 4JX6A 3ABRA 2ZZ7A 3QF0A 2GQ8A 1KW1A 3MHUA 2JKPA 4PL1A 2OT1A 3QH2A 1BWLA 4WD0A 4N4QA 1S5WA 3W87A 3TQKA 5FF3A 4UTUA 4WY0A 2J24A 3GXNA 1F76A 3L2IA 5CPNA 1Q6LA 3G1XA 4BI7A 4IUOA 2C1HA 4IOTA 5LNRA 3LCFA 3HG4A 2DZPA 4HNUA 1L6WA 3MBFA 4YCOA 2VEPA 1F5ZA 1AW5A 1P5BA 3NA8A 4M6PA 4LVAA 1QNVA 4I7VA 2FPTA 3BW3A 1Q45A 3W1PA 4MJMA 5LHFA 3FOKA 3TKFA 3NEVA 4DF1A 2QUVA 5HR7A 3W88A 2BTMA 1X8FA 2Y6ZA 1QO2A 2X2GA 4IXHA 3KVLA 4LVBA 4PEKA 3ZFHA 2OT0A 4ADUA 2Z6JA 2B7QA 2XN2A 3WK3A 3BLFA 3CLMA 3VI2A 4Y8FA 3UXAA 3LGEA 1TB3A 3OVQA 1RQHA 2V5LA 5K9XA 3TA6A 3FYPA 3TC6A 2FTPA 1FBAA 2Z0IA 4RLIA 1I4NA 4UFJA 3T40A 4BR1A 5FF2A 1J2WA 4FO4A 1TPEA 1TPB1 3HG3A 1O4UA 1FY6A 4JYDA 4OHQA 5G2IA 4N6FA 4UTTA 1QOQA 1WBHA 3NPVA 2ABBA 4IQLA 4OU1A 2DP3A 1J5TA 3G1DA 4UXDA 3PY2A 3EX3A 3U2OA 2CU0A 3KVMA 4Z1DA 3UWUA 4AWUA 3LLFA 3ZWTA 4QM1A 1YTEA 1JCMP 2WSQA 5EYWA 3PF3A 1KFBA 1GZGA 3NQMA 4GUGA 3NAVA 4M5PA 3UZJA 2VEIA 5LHEA 3LHYA 2CLKA 4JICA 1JULA 3USBA 4FEZA 3RNDA 4Y96A 3LV6A 2ZRVA 3C2OA 1TREA 2V2HA 3GAKA 4MLRA 4UTWA 3LV5A 3KAOA 3PC0A 4PH6A 1I2QA 1AL8A 1SU5A 4CCEA 1FWRA 4Y90A 2ZTJA 3S1WA 2Y70A 3PG8A 3E0IA 1JJKA 3W9ZA 3GVGA 1N7KA 4HN4A 1XBZA 1DV7A 2NWSA 1W1ZA 3SI9A 1B57A 3M0ZA 5T26A 3KOFA 4DXVA 3C56A 3B0UX 3VFLA 3PVFA 2QKFA 1QPRA 4HNNA 2F84A 1OK6A 1H1ZA 2ALDA 4IPJA 3I68A 1PVNA 3O6CA 2I14A 4RR4A 3P82A 1QOPA 4U28A 1LM1A 2X1TA 1VYSX 2YGYA 3NPXA 3VE9A 5D32A 4X9SA 3EWXA 1O5KA 2ZRYA 3EXTA 3W72A 1B4KA 1W5QA 3GNDA 1VCFA 3G1VA 3R89A 4TIMA 5KZEA 5GVJA 3QQ0A 1HL2A 1I2OA 4CCDA 1YDOA 3ZS4A 3LERA 4E2BA 4XWUA 4I7UA 4ZZ9A 4ZQRA 4AHPA 1GJPA 1HFBA 2NX9A 3UWYA 1TQXA 2VFEA 3BW2A 3V1PA 2DU2A 3IVUA 1Z44A 3LRKA 2YZRA 4HNTA 1H63A 1QAPA 3EXRA 3W2NA 3G1YA 3L5LA 2Y61A 4RK8A 3QW3A 4HPJA 5TQLA 2DORA 3FLUA 3P81A 3W1QA 1XDMA 1KM5A 1YXYA 2Y63A 5IBXC 1JRBA 1OFRA 3BARA 5K9DA 3DI1A 4JTUA 3W83A 3DFTA 1F6PA 4ZQNA 3NL2A 1A53A 1RR2A 3FFSA 3W7EA 3W75A 1TMHA 4PODA 1UB3A 1AG1O 1OX6A 2Y88A 1VCGA 1B4EA 2QAPA 4LVGA 3S1XA 3L67A 4RKAA 1Q6RA 3W2JA 5K4ZA 2A0NA 2D73A 5I3JA 3W07A 5DBTA 5AC6A 3PUDA 4HIBA 4Z08A 5KZMA 5U4NA 3EX4A 1L6YA 4U4MA 1IXOA 6TIMA 2JGYA 2FJKA 4YMZA 3LX9A 4FHAA 1GT8A 3W7DA 1G7VA 4S2CA 3UXDA 3O63A 4ZMGA 3DFSA 1QPOA 4O13A 4AVFA 1GPWA 3MJYA 1VHNA 2Q8ZA 1F7BA 1S5VA 5CPLA 2E6DA 2YYUA 1SZGA 3I7SA 5LSMA 3INPA 8TIMA 5HQEA 3CHVA 4JTSA 1XCFA 5FEWA 2PE4A 5DLCA 1VLWA 1HTIA 1LOSA 2E5CA 3W7NA 1OFQA 1WX0A 5FF7A 4AHQA 2OMAA 1EA0A 1R2TA 2ISVA 1M7OA 3O06A 5KITA 2TRSA 2OZ0A 4MY8A 2AAMA 3F4NA 2J27A 1SSDA 1UCWA 1YADA 3W73A 3HMJG 3S9YA 1FCUA 4XUGA 5D03A 4JS3A 3QYQA 1VCVA 4DO4A 3A22A 2NZLA 3ABQA 3DGRA 3PB0A 3W7CA 2RKXA 1AW1A 4ONVA 3BV4A 3OIXA 1PHWA 4X3ZA 1LROA 4JTIA 3DHDA 4HHPA 1BTMA 2VKZG 5D2YA 4JN6A 3W1AA 4WXYA 2HS8A 1JCXA 2YFOA 2JKAA 4FF7A 3DFQA 1TPFA 3GAYA 2VFFA 4QJ1A 2F7FA 1S3HA 1ADOA 1W5NA 4RXFA 3FA5A 3UYCA 3W3OA 2Q3OA 3T55A 3THAA 3T78A 3P7YA 2ZA2A 1TV8A 5G4EA 2HMCA 4JIQA 1XFBA 4UTLA 3M43A 1TIMA 2GVLA 1OG0A 5C5YA 1K8ZA 3JRKA 3CB8A 4JTLA 3VKJA 1KM3A 4Z1CA 3RLVA 3TDFA 1A5CA 2J88A 2QUUA 3NQEA 1K02A 1Y0EA 3TR2A 1LOLA 4AMAA 1G7UA 3LHVA 2CZEA 1DL3A 4LS2A 3G3DA 3I65A 2ZZ1A 2QF7A 3C8FA 5DY3A 3DAQA 4HNVA 3LCWA 4IMDA 4JIPA 4N02A 2QAFA 1F74A 1YYAA 1FQ0A 1XBYA 2CZFA 2WPBA 3W74A 2R8WA 1R30A 3D0CA 4GUIA 3IIOA 4NJHA 3GXTA 3TAOA 3KVKA 2A4AA 3BG9A 3DZ1A 1YTDA 1NAL1 4UTWC 4FNPA 1TRDA 1RVGA 3TUUA 2B7PA 2J9XA 4JY9A 5FEPA 2E6FA 4JTGA 1TTJA 1TJPA 4GC4A 4O16A 1UASA 2W0UA 4B5NA 3BGJA 2ZRXA 2Z2UA 5IM51 3L9CA 1ME8A 3MHFA 1A5SA 4DQWA 2QCEA 2A7PA 1MXSA 4NNBA 2GVGA 4RZ6A 3CU2A 1VGAA 4K7YA 1ALDA 3KRSA 4QITA 2NWRA 3DFNA 4GWEA 3PSWA 3G1FA 4JTHA 1TPVA 5AC7A 3QFEA 1SR9A 3U6WA 4UMAA 3HPSA 3MBDA 3BW4A 3NXFA 5EBUA 4D2JA 3UZ5A 5I3IA 3W86A 5G1TA 3M6YA 3L5AA 1LP6A 2DZXA 1G4SA 4M19A 4JDBA 3C3NA 2Y7DA 1GVFA 4JTTA 1KFJA 3PR2A 4DF2A 4LT9A 2YCEA 3U8GA 5LNSA 4XTDA 3PM6A 1TPDA 1OYAA 5KSWA 2VC6A 1OHLA 5FI8A 3LI0A 3KRZA 1FXPA 3G22A 1YPFA 3W2KA 2YR1A 4K8HA 3I7QA 1CW2A 2OCZA 4GNJA 4MLJA 4R34A 3WK2A 5K2ZA 3B0PA 4JDYA 4IPIA 3SR7A 2E68A 1EP2A 1KV5A 4BI6A 3HGOA 1KBJA 5LZLA 4FNUA 3DH7A 3N14A 3C2RA 1FX6A 3T4CA 5CZJA 1GVRA 2NV1A 4NJIA 3N73A 1VC4A 4YCPA 3TE9A 1H60A 1Q3NA 3GNNA 5D2VA 2CLHA 4Z1BA 5U7SA 3RK8A 3B05A 4XQ6A 3DBPA 4O19A 3SECA 4EIVA 3TV8A 2NX1A 4I7WA 4IJBA 2VEKA 1GTEA 1OFBA 3IIXA 4NX5A 3UY7A 3QEZA 2A85A 3C0JA 3ELFA 5ABTA 1OFEA 1ML1A 4IWWA 4LOCA 1NF0A 4A2SA 2E5BA 1KM6A 1QMLA 1JQXA 4AF0A 1YPIA 2C6QA 2WSRA 2WOQA 4C1LA 2RH9A 3N2XA 4ZL1A 2RDWA 3NZRA 4TU1A 3LBMA 1RV8A 4ZVJA 1TTIA 2Z6IA 1RQBA 2ZZ5A 4UFLA 5J5DA 4MVAA 1VZWA 1VQTA 2C14A 4IGHA 4TMBA 1Q6OA 3DHFA 3KXQA 2GUUA 3C2FA 2WNZA 5D02A 4I9AA 2E1DA 4Q4KA 3QRHA 2YFNA 4MFEA 3W23A 1H7OA 4M6VA 4L4LA 3L68A 3UWVA 1EX5A 5G4WA 1L6SA 4N9DA 5AHNA 4UR7A 3W22A 3QQ1A
chains in the Genus database with same CATH superfamily
3WN6A 1EQPA 3MUZ1 1J11A 4LAOA 2H90A 3JVAA 1FDJA 2IKIA 4HNLA 1AK5A 4AIOA 3TYEA 3PPGA 3SEPA 3LENA 3MSDA 2TYSA 4CD4A 1LORA 1AL7A 3MMDA 3HGJA 4G6CA 1U5HA 5AVNA 7XIMA 4QEEA 5AOUA 5BWFA 4KGLA 5D2XA 4DAIA 3KE0A 3O8AA 1DIDA 4P7NA 1TA3A 1KCKA 1H5YA 1XLLA 1G69A 4IG2B 4ORMA 5BU6A 1MRAA 4DJDC 3DC8A 4ICNA 5F4SA 4OQVA 4O1EA 4LJ3A 4QXIA 2A2IA 3BGAA 2EPKX 3BOXA 2YDAA 2RDUA 1H0GA 1GOMA 5EMMA 3AROA 4WDUA 4C7GA 4TVDA 5TAOA 1PUDA 3TC3A 2PTDA 1U33A 3PZTA 1JCJA 3SY8A 3S6OA 2WQPA 3VD4A 1G9HA 5E0KA 2O55A 1YXCA 1T0OA 1WQ5A 3F5KA 3SQSA 3GVRA 4AY8A 3G1HA 4CQDA 3OBKA 3NYZA 5A8QA 3W7RA 4CEUC 1VAHA 5BROA 4XZWA 4NNAA 5K7JA 1W5PA 1X39A 1M03A 1JEZA 1BVZA 1W8SA 1FKXA 1JG9A 3MC5A 4TQTA 3AI0A 3EKLA 4GUFA 5FF4A 1W1PA 2ACUA 5B80A 4QRNA 1UWSA 1ZLPA 3TTQA 2VURA 5HNRA 4D6IA 4KCVA 1UUOA 1JPMA 3GHSA 3UEQA 3WFZA 3LBOA 4OGZA 2ZDRA 3VCRA 4QAIA 5H8PA 2F8QA 2QJMA 3EDEA 9XIMA 1XDJA 2AAAA 3VAVA 1ISWA 4XKYB 1WBJA 3TLLA 4YU1A 4Y6GA 1Z42A 4IL2A 4O14A 3GUGA 5LYRA 1UD2A 1W56A 4H6KA 3VOGA 3LRMA 3MSGA 4AD0A 4ZCWA 3I6RA 4WY0B 4UIOA 2QCDA 2RFGA 3HA1A 2BODX 2VDHA 4Q8NA 1JQVA 4O0KA 3XISA 2DVUA 1V6UA 3WFLA 1EA9C 1UKOA 3SSJA 2EJAA 5JU6A 3IIVA 2DIKA 1V0KA 4UMBA 1E6NA 3MW7A 4GISA 4XD3A 3TJ4A 2GDQA 3BCJA 2YYTA 4NJGA 4Y9MA 2OEKA 4KF1A 3STGA 3IRDA 1E40A 1G94A 3E1F1 3RAOA 4AZBA 4W84A 1W2VA 2VGIA 2QW5A 4FR1A 4B92A 4UMCA 1L2UA 4O18A 2G96A 5FESA 1MQRA 3G0XA 1QPNA 3SDOA 3DN5A 2YA2A 3MI6A 3P61A 1JD9A 2W66A 3UW6A 3TQPA 1E4IA 3C0QA 4BWLC 1BD0A 3M16A 4PBGA 1VYRA 2I57A 4PULA 4JTEA 1I0DA 2PRMA 3CMFA 1NJJA 3CV7A 4Q4OA 1W3JA 2VEMA 4H2HA 3GXMA 4IPLA 4IFKA 3MDWA 5KTLA 3VGGA 1W8GA 1KNWA 2HQAA 1F6YA 4G2DA 4L4MA 4A3UA 2ATMA 2V9DA 2BVDA 1QNQA 1LLWA 2A21A 2C15A 4LXFA 3E2VA 1DJQA 3DGBA 3CHDA 3LHWA 4AWSA 1TKKA 4S2BA 4E8GA 2WPGA 3LCXA 4H7VA 1S5TA 2X42A 3AAMA 3QYSA 2WZTA 3LI1A 1XKYA 3MV11 1IXQA 3AJXA 5GNYA 4YL2A 1G1YA 3URNA 2RDTA 4AD3A 2VNCA 3MUY1 3P3BA 3I4KA 3GIYA 1UHVA 3E96A 2PFHA 1XYLA 2VC9A 1R2RA 1YDNA 2G50A 4OZOA 3ZYZA 4IX2A 3W1LA 2BOGX 3PG9A 4U10A 1KC7A 3RLHA 1KRBC 1DORA 1KD0A 6TAAA 5BCAA 4IM4A 4S3BA 4HZ7A 4R27A 4KEZA 2VYOA 1XLFA 3DI0A 4AEEA 1PCKA 1VFMA 2PA6A 1U22A 1KFLA 3TJLA 3KS6A 5DRCA 2XIOA 4WLCA 2QMJA 4OFCA 4JQAA 3FDKA 4E4FA 4UTTC 5I77A 2BP1A 1R85A 4C60A 4FIRA 2QJHA 1GOWA 4FXRA 3P84A 1Z6KA 1EOKA 2VCCA 2VXNA 2WC3A 4IIDA 1EUNA 3EWDA 4AD5A 3Q37A 3C5QA 1YHTA 5AVHA 3CL6A 5FOOA 1ICSA 1TJRA 1FKWA 3AYSA 1B9BA 3G1SA 3GXFA 3H7VA 1REQB 4HSOA 6PTDA 2W9MA 4AZ6A 2Z1BA 5JIPA 4JD4A 1KKOA 2ZC1A 4L64A 1LCOA 3QW4B 1ICQA 2V0TA 3HF3A 3AUOA 4K3ZA 4AHOA 1JRCA 1E6XM 3AZRA 3GK0A 4MAVA 1E51A 1CEOA 5BMXA 1L2QA 2EBNA 3LQGA 4GY7A 2IUZA 3A24A 3UR5A 3OGSA 3DECA 3ABSA 5K3VA 2SFPA 1W37A 5AHEA 3TH6A 3AS0A 4GGBA 2YW3A 4O1AA 4A2RA 3IJ9A 1BRLA 4G1KA 4O8RA 2PDBA 4CNTA 3QR0A 3AMDA 2FIQA 3W1TA 1F6KA 2GVYA 2XISA 3I3EA 2WHKA 1V02E 1UJPA 3CPUA 4P8WA 1X1OA 1EYEA 2DQXA 3WSUA 2V3GA 2Y7EA 3B0XA 1D3HA 3DFOA 3TA9A 3IV3A 1YTKA 3GNOA 2HVMA 5JIWA 1TQJA 2EKGA 1M6JA 1NEYA 4LEFA 2OEMA 4J4KA 4NZFA 4AX6A 3R5EA 5T9CE 3CTLA 2WLZA 1EDTA 1TV4A 1R8LA 1KLYA 4I90A 4QG9A 3TQVA 2B4GA 1JF6A 3NSMA 2XGBA 2F2KA 1RA0A 1WXYA 1HG3A 4DWSB 4U33A 4HSNA 1Z89A 1KA9F 3GIPA 3SGGA 2EPMX 5CGTA 3WQOA 4FP1A 3FGCB 4FXJA 3SGUA 1A5KC 1TX2A 4HPXA 1K4GA 2YIHA 3CT7A 4CCCA 1R7AA 5IBXA 2E6AA 3LCIA 4D1JA 5DMNA 3MA8A 2TODA 1VRDA 1J79A 2VC7A 3RUBL 4FNTA 2VRKA 2W91A 4EK7A 4J1OA 1SZNA 4MOZA 1E15A 4OV4A 4LB4A 3RMJA 5LA1A 1JD7A 5CH9A 1YBQB 3A4XA 3GG0A 1E0WA 1GQJA 1XLKA 3C3UA 3WQ4A 3VD3A 3TQ0A 4W4QA 4UR9A 2JIWA 4K36A 2OWWA 3VOCA 2WSPA 4DAFA 4BY3A 1RLDA 2EPNA 4WCJA 4UCGA 1W31A 3QC3A 1BWVA 4MNJA 1NWSA 4OKDA 1UUMA 2PLKA 3JW7A 3LMYA 4LF1A 4O53A 3B8VA 2R1NA 1I2PA 5CZ0A 3NCOA 2P3ZA 4AC1X 1GOXA 2QCCA 1ZFJA 1FWEC 3GG8A 3GZAA 1ZRQA 3HQ1A 3SFKA 2C7FA 1XBXA 3ZLHA 3ANYA 3LB0A 1TZ7A 4NNCA 4XBJA 4DLMA 4DXKA 5HNUA 4HBKA 2WVTA 1DP0A 4H9UA 4DB7A 3W1NA 3OW1A 3IJIA 3QZAA 2YB4A 4FX7A 4PUWA 4RPPA 3A9BA 2CLMA 1SJCA 3BK0A 3W85A 1W32A 4LAMA 4PMNA 3MSYA 1FP9A 4KIRA 4ADTA 1V93A 3F5LA 2A3CA 3AHYA 3CQ0A 2Y85A 2W4XA 1NELA 3PBYA 3TXZA 2XSBA 3M9YA 4ICCX 4CLMA 1PSCA 2GGEA 3RF9A 5AC5A 1KFCA 5A69A 4TOQA 2Y62A 4A29A 1RAKA 1DPMA 2ZZ3A 4NXKA 3HV9A 2BG5A 1J6OA 2QCHA 3O16A 2W67A 2PDGA 2ZZ6A 2P1FA 2CLPA 3LOTA 1KWGA 5E5CA 3TYCA 2PWDA 3F03K 3GR8A 2C71A 1H09A 3DBNA 1GYNA 2VR2A 3NZGA 3HGRA 1EX1A 3NQ2A 4ES4A 4KWWA 5C7HA 2QLYA 3IGUA 3QTGA 3LN3A 5DCBA 4HU0A 4N9BA 3RX2A 1Q7QA 4Z2IA 1Q13A 4JQ3A 3BJFA 3P60A 4IMEA 3TSDA 8XIMA 1YNQA 4MMWA 2QCGA 3HGSA 3FXYA 3W1RA 3BXWA 4YLWA 3EKZA 3M0YA 3TIMA 3LMZA 1JYVA 1FCBA 4OT7A 1F3XA 1US3A 2EGZA 4FXSA 2ZTKA 1ZJBA 1WKFA 2PF0A 4ALDA 4DZHA 1CLXA 2JEPA 5A8MA 4P7LA 4H01A 3B8IA 2V3EA 3BJTA 2FFIA 1V79A 4QS6A 1HKMA 3B03A 2KZHA 4HA3A 4LUTB 4Z2LA 3QZEA 3PN8A 2VMFA 2I17A 2G0WA 1FFQA 3NQBA 1IEXA 1SUXA 4KESA 4OE7A 1XFCA 1MEHA 3CBWA 1UWIA 1EC8A 5TBOA 3R7MA 4IMAA 3G18A 2PRLA 1F2JA 2FZMA 1DQWA 1DJZA 3GO2A 4QQ3A 2DSUA 2PF8A 4NZ1A 2V8ZA 2FPYA 3WF0A 3CEPA 2JF7A 4GYFA 2OR2A 4KT2A 2DQWA 1KFKA 4C6FA 1UA7A 2WNQA 4FB7A 3BPWA 2WWDA 1MEWA 1HF6A 1P43A 1LYXA 5A5WA 3W7HA 1OABA 3S5ZA 2H3DA 3IEBA 4ZTYA 1D3GA 5G2HA 4TV6A 1QXLA 1GW1A 3V1HA 4NASA 4ATLA 3HV8A 1UPPA 5F1VA 1H7NA 4JIHA 5HAOA 3EX2A 1H7XA 3M44A 4O17A 3UWQA 5LGZA 2NQZA 3K46A 1FDZA 1UOKA 4Q8UA 3W7GA 3SUSA 3QHMA 1E9ZB 1AD4A 1T99A 3GXDA 3G5EA 2CKSA 5HINA 2Y5SA 1K3UA 2Y0FA 3FK4A 4GYKA 4KCUA 1NP0A 3ARXA 1GONA 3TWBA 1XGDA 3GUWA 3L66A 4OUIA 4PFHA 3F4WA 5HWNA 3K1DA 4OBRA 2VDIA 4HCLA 2GPTA 4YVPA 1ZZMA 4QG8A 1TIWA 1CXFA 2OO0A 3T4WA 2ZRZA 2QQ6A 2ZADA 2NQLA 2OX1A 4QLKA 3VA8A 1KTBA 1WP6A 2CZDA 4M1RA 2F38A 3NL3A 1A47A 3OBAA 3DFYA 3Q94A 2PWUA 4G1NA 3Q4DA 3UNDA 3CZLA 5HQMA 1QFEA 2Y89A 1XYFA 2DFAA 3G8EA 3GNPA 1YXDA 3D3FA 3ARVA 2HSAA 4AYGA 4JTQA 3TN5A 4DYEA 1XRVA 1JL8A 1YDYA 2ZUVA 3NVDA 1TSIA 2H8ZA 4H83A 4JEJA 3V75A 3WK1A 5DCEA 1JXJA 2RJGA 4J3UA 1UC5A 3UFYA 4KCWA 1HP4A 2QJIA 1VJIA 3QR3A 5DT7A 1LRNA 4ILSA 1HQTA 4H9MA 2CFFA 1XYCA 2D2HA 5C54A 1C92A 3C2VA 3RIKA 1VRXA 1Y65A 4RE3A 4CQ8A 5IFPA 4IZGA 3T0BA 4M80A 1EJWC 4DUVA 2NV2A 5FJPA 3THCA 1A50A 3GX9A 2J7BA 3AICA 5EMYA 1DWHM 3ONCA 2GUYA 2O7SA 3N13A 1MUMA 4Y9NA 1F3EA 5SWUA 3WEOA 1XIFA 1TR1A 3WBWA 2EF9A 4NT0A 3S83A 2ACQA 4GHRA 3SIZA 5C9RA 1AODA 3MMWA 1YKWA 4PTXA 4DM2A 3W71A 4ZR8A 5DRIA 3WQDA 3AWOA 2C19A 2W27A 4PRRA 4TO8A 4ERIA 1SSGA 1NF7A 2NXIA 3QV9A 5F2LA 4S3GA 2PGWA 4H1ZA 2CKRA 4BKNA 2IXVA 3LTYA 2VX6A 4WK9A 4ZQOA 1H51A 4IPNB 3GB6A 2WBGA 1EL3A 4C7FA 1MVYA 2EPHA 4H19A 1ZU8A 1H3GA 1BWKA 4NRSA 1HVXA 2INFA 2XFFA 5CG0A 3U2EA 4S1FA 3ABOA 1NWUA 1N8FA 1XPYA 5G1YA 5CSRA 2WNWA 2A7NA 4IG2A 2I9EA 1K77A 4PUJA 2TAAA 1BYDA 5MF5A 1NOFA 2GJNA 1XLEA 4C6BA 3AIRA 3H2NA 1EP3A 3W53A 1IXNA 4RV8A 4ZQCA 5A95A 4UFHA 3PFMA 5F1UA 5BOOA 3FDGA 1W9XA 5BYWA 1MI3A 4RJEA 4N9CA 1ELSA 3W7PA 1DHPA 2DVXA 5DO8A 1GWJA 1FWCC 3NM3A 2VQUA 2DZWA 5CSSA 4XO7A 3CEUA 2FB3A 4I5UA 5CPMA 3ALGA 3W0KA 1PPIA 4ZEPA 1SW0A 3KWXA 1KCLA 3CC1A 3VGHA 3G1RA 1QJWA 3CQIA 4GVGA 1OG6A 3AIBA 4MADA 2B0MA 1WDWA 1B3XA 1AH4A 2J8FA 3QPYA 3A47A 4EVZA 4J3VA 1P6WA 4JHMA 3O6DA 1HO4A 1CWYA 3EEGA 2PLJA 3THDA 1UKSA 5EMUA 1UPMB 3QOKA 1BKSA 3KTSA 4B91A 2TPSA 9RUBA 3T8QA 1KXTA 5JVLA 1JIBA 4YYFA 4XKYA 3RRXA 4UQBA 1KW1A 1UKQA 2OT1A 1BWLA 2NQHA 3WUEA 4EAYA 1A49A 5IRPA 3W87A 3TQKA 3HJEA 3KOWA 4J2PA 4WEVX 4WY0A 3BDKA 2ZUNA 4XSMA 2CESA 4BI7A 4A8IA 2IPWA 4IOTA 5LNRA 3HG4A 2DZPA 1L6WA 3MBFA 4RNJA 3UR8A 4YCOA 2Z00A 2DT0A 3NA8A 4M6PA 5CEWA 1QNVA 2QDEA 4I7VA 3BW3A 2WMIB 3GR4A 3ES7A 4RW5A 4IQJA 3FOKA 2PDXA 2Y6ZA 2FVKA 1EBGA 4PEKA 3WK3A 1D7FA 1GQKA 3BLFA 1D7KA 1YW1A 4Y8FA 2J7CA 3EGJA 3H6OA 3OVQA 1QHPA 2V5LA 2FTPA 1FBAA 3GC5A 1UG6A 5IXEA 2POTA 3IACA 3T40A 2DV0A 4YTUA 4FO4A 4JYDA 4BHYA 3BQ6A 3WLOA 1ZSXA 1IT7A 4FLRA 3BAXA 3MUCA 2DP3A 4IP5A 3ZOAA 4Z1DA 3FVDA 1J5SA 3BAIA 1YTEA 3WEZA 1JCMP 2WSQA 5EYWA 6ENLA 4TVUA 1GZGA 1XIMA 2VI0A 1LT7A 4M5PA 3UETA 1C3FA 3LHYA 2CLKA 2A79A 1SMAA 3WH6A 1LQAA 2CBIA 3RCMA 3RX4A 1TREA 3GAKA 4MLRA 4UTWA 1DJWA 3PC0A 4PH6A 1FWRA 5FIPA 3UNTA 3HM7A 4I9TA 2ZTJA 2V69A 2Y70A 3E0IA 2OQLA 2PDQA 3PWIA 1EJTC 4E2VA 3C56A 3MMUA 2W63A 3E5PA 1QPRA 3WLIA 2F84A 1OK6A 4D6EA 1H1ZA 3O0KA 3GD6A 4D6DA 4WDWA 2X40A 2I14A 2ACRA 1WDPA 3PTQA 3P82A 4RR4A 1E70M 1SGJA 1CLVA 2PC8A 4DUXA 3WH9A 4MB3A 3GW0A 4J40A 1C8QA 3UZZA 1NM9A 3VE9A 5D32A 3SN1A 1O5KA 2ZRYA 3EXTA 3W72A 1VFOA 3R89A 3T9PA 2WCGA 3KBMA 1YDOA 3IWPA 4XWUA 4ZQRA 1XIGA 4HZ8A 1GJPA 4XZNX 3UWYA 5FAJA 3S9ZA 1XHGA 1Z44A 5I23A 1H63A 2VO5A 2D0FA 3G1YA 3W25A 1K1DA 4RK8A 1M01A 3BSMA 3P81A 3W1QA 4GZIA 3S9IA 1XLDA 1REQA 5IBXC 4AQLA 3BARA 3DI1A 1W1VA 3CO4A 4PCNA 3DFTA 2OSYA 3NL2A 1E0XA 3W75A 2ICSA 4AEFA 4KS0A 2ONEA 5A6AA 4XG1A 1AG1O 3L4YA 1VCGA 2QAPA 4LVGA 1TMLA 4UQEA 3S1XA 1BQCA 2WC7A 5K4ZA 3K2GA 1H5VA 2D73A 3Q45A 4S3FA 5I3JA 3W07A 2YA1A 1VP5A 4F0RA 3V0UA 3EX4A 3AYTA 4YMZA 4FHAA 2D0GA 5IHSA 2J4GA 2OX4A 3O63A 1RBLA 3DFSA 3RMEA 3TYBA 2P76A 3WNOA 3H8AA 4XZMX 2ZX7A 4AVFA 4MTVA 1F7BA 3K1GA 1S5VA 3ZIZA 2WZIA 3WLSA 3I7SA 4GG9A 8TIMA 4M24A 4GCXA 1SJBA 4JTSA 2Q8XA 1XCFA 1TJ1A 5DLCA 1HTIA 1EKOA 5LA0A 3FX4A 3V5FA 4Q22A 3W7NA 1OFQA 2X0YA 4H9YA 5LIYX 4PMJA 5EBAA 4ZFMA 2OEJA 3EB4A 1JAKA 3DC0A 2TRSA 4MY8A 4KW2A 5M5DA 2AAMA 2J27A 1SSDA 2P5NA 2Q71A 2WW5A 4RNFA 4PTMA 2A3HA 3SCOA 1ONWA 3HMJG 4XUGA 5D03A 1OCNA 3AQUA 3I3DA 4FXFA 4GH1A 3DGRA 1KKRA 5FJUA 3PB0A 3W7CA 4ZBCA 1F61A 1HJQA 3VGEA 3BJSA 1PHWA 1LROA 3QTPA 4QS5A 3WLKX 2L5HA 4JN6A 3VX1A 4WXYA 1JCXA 3GAYA 2VFFA 3OB8A 1OCQA 5EMJA 5BRQA 3W3OA 1R87A 4DWSA 3AMLA 3P7YA 3PP7A 2HMCA 2P50A 1XFBA 1QUMA 3FGCA 2EPLX 3LSCA 5C5YA 4JTLA 4ASTA 3RLVA 3R94A 1A5CA 2QUUA 5C2GA 1K02A 1Y0EA 3TR2A 3HPFA 2XIIA 1QBAA 4AMAA 2DSWA 4PTVA 3LHVA 2CZEA 1HP5A 3SRFA 1ISYA 1UR1A 4F0MA 4A8NA 3VZXA 5E9AA 2R9RA 2ZXQA 1F74A 4XSLA 1XBYA 1X96A 1YBQA 3MUIA 4TX6A 1VBJA 1HXJA 1ODZA 4HK7A 1UIOA 2O4QA 3VIGA 2I5QA 3GXTA 3LGDA 4HOWA 2A4AA 4IIEA 1NAL1 1TRDA 2J77A 3QY7A 2J9XA 2OWXA 4JY9A 2FH8A 1VJZA 2D1ZA 3ZJ6A 4UWMA 1TTJA 1Z69A 4GC4A 4OECA 2ZRXA 3TJIA 1UA3A 3PZUA 2Z2UA 3TYUA 3L9CA 3MHFA 4WJ8A 1Q66A 2IXUA 1AJZA 1MXSA 4GPNA 1JYNA 3GVVA 2NSXA 3KRSA 3VDCA 3ENLA 2QGYA 2DSVA 1XG4A 3TN4A 3CYVA 3QFEA 1SR9A 1W3KA 2PTYA 2Z4GA 2UZ9A 4D2JA 1MWOA 3VINA 3LPPA 3W86A 3PTKA 1P1MA 1AMYA 2EJ1A 2A3EA 4GQ0A 3MANA 4M19A 3C3NA 4M8UA 3PR2A 4XD5A 1XIDA 3M46A 4QQUA 3U8GA 1FWGC 4PGLA 3T1GA 3QHOA 4MWAD 2VC6A 4F3HA 2DVTA 1OHLA 5HBFA 3AC0A 1FXPA 3DERA 1YPFA 3W2KA 5JUVA 1CW2A 1V4YA 4GNJA 2F6KA 4GYPC 3UA4A 2PBOA 3ZO9A 3O7UA 1EP2A 4BI6A 5CBIA 5LZLA 3O3RA 3B0YA 2J47A 3N14A 3N15A 2EG8A 1X98A 1FX6A 3T4CA 1XSKA 1GVRA 3TE9A 3I4EA 2DT1A 4P5UA 2CLHA 5I7GA 3RILA 3KBWA 2XWEA 4WHBA 4XQ6A 3DBPA 3SECA 4EIVA 3TV8A 2OOFA 8XIAA 1W9DM 2XVPA 4BEUA 4L56A 4NX5A 1OFBA 5CAKA 4AVNA 2HCVA 2GWGA 1OC6A 3S2JA 2XVLA 1KM6A 1JQXA 3HTWA 4DX3A 4CQCA 3N2XA 2OZ8A 3ZLFA 4V15A 3NZRA 1RV8A 1RQBA 4R9XA 4XISA 1VQTA 5JH1A 5B7ZA 1MW3A 3W82A 4IQEA 1Q8JA 5D02A 4I9AA 2E1DA 2BOEX 4LUTA 4EPDC 2YFNA 4Q8PA 3W23A 1H7OA 3AIUA 4L4LA 3UWVA 1EX5A 3CUZA 4UR7A 3OHMB 3CIVA 2ZUTA 1W3LA 1OIMA 3NL5A 2ZX8A 1LL4A 2BGSA 4FX8A 2FHCA 5CC7A 3LHTA 4FNQA 4NG3A 5IHRA 1FWIC 5GJMA 5I78A 3N29A 2WQDA 4PMUA 1EJRC 5I06A 2CCRA 5EB8A 4MB4A 4K39A 3ITOA 3W7LA 2WVUA 3VK5A 1LUCB 3SRDA 4J7RA 2J7DA 3FJ4A 4C6CA 2HNHA 2G97A 4IJRA 3UG3A 1J0HA 1PJ9A 4LS1A 2EO7A 3DG3A 3NQ8A 4NI8A 4NZJA 3WQFA 4D8AA 4ERGA 2D2OA 2GUBA 2D22A 2QMKA 5I02A 4F48A 4JX5A 3ZQ9A 3QGVA 1I45A 3UXIA 3SRKA 1Q63A 2C3ZA 3OU8A 4N0RA 3M5XA 2YPIA 4Q4QA 5D09A 2HPMA 4D6GA 1HJUA 4A3HA 1FHVA 2P10A 5HWJA 3M64A 1TV5A 3BLIA 5AHLA 3GBEA 1O68A 1W2PA 4M29A 4ACYA 2PGRA 4EF9A 5C2CA 4ZB5A 4JKLA 2X16A 4HU4A 1OX4B 1S1RA 2KAUC 5D05A 1GKPA 3P62A 2D2GA 5C2XA 3T0DA 3CTTA 3SCWA 4ZQMA 1GVOA 1OM0A 2FMOA 1EWEA 1WZMA 4US6A 4C90A 2JEQA 4JTKA 1DXEA 4WJEA 4QNEA 2D3LA 3GZ3A 3EB2A 3GYCA 1QWKA 2JIEA 1EIXA 2ZE3A 1LRTA 4DPQA 2J75A 2ZOXA 4MWAB 4E3VA 2REQB 2Y8VA 2J79A 3E5BA 3OTRA 3UERA 3MDUA 4X0NA 2WZEA 3HIJA 3CZEA 3WDQA 4M6QA 3UJRA 4L80A 3QPEA 4ZO6A 3PHAA 1JUKA 4HA1A 1VFFA 1FWJC 3TYAA 4KEMA 3EMZA 1PWMA 1B3YA 1YNPA 1L9WA 4QG6A 3APGA 4NUWA 3LZ3A 1HJXA 4AD1A 1CZ1A 8RUCA 1IEWA 2ZX9A 4AIBA 1TPC1 2EEXA 2TSYA 3FIGA 1IIGA 4L4PA 4ROQA 1EXPA 4E5TA 1Q5MA 3SAZA 3U7BA 5BWAA 3VDHA 4TTUA 3S5NA 4O1BA 4REQB 1UH3A 3K8LA 3R6IA 1Q8AA 3F4DA 4EE9A 3TC7A 4H6QA 3BZGA 4TV5A 4H9ZA 3NQGA 4H3DA 1UW9A 3HBLA 1IGSA 1ZAIA 1U83A 3AS2A 2VX7A 4YWIA 1ONXA 1L8PA 3P8JA 5IDZA 1US0A 2Y8KA 4MZ1A 2HXTA 2XINA 1DQUA 3RCNA 2V82A 4QEHA 2FB2A 4AYSA 5HANA 1FXQA 3GXPA 4GZJA 3EOUA 1TTPA 3VYLA 5LNWA 2VEGA 4F9DA 4OV9A 3SJ3A 3B04A 3M7WA 4LY8A 3MP5A 2QV5A 3UZYA 4OOUA 2QEZA 2PWGA 2CPUA 4XBKA 5HXMA 1QI2A 3WO8A 1UR2A 1GYMA 4KWVA 2ON3A 3QPZA 5I79A 3L4VA 3TSBA 3H23A 2NT0A 2ISWA 1BVNP 1KFEA 1M65A 2H8XA 4EOUA 4N2YA 3LM7A 5AHMA 3RLGA 2PDNA 3BLKA 4I3GA 3NGFA 2E8YA 1AZ2A 2E1WA 5I03A 3AJ7A 1VFLA 3CWHA 1OEPA 1OF8A 1OJXA 4H9TA 2ZYFA 5F2MA 1Q6QA 1SO4A 1S5MA 3NQ6A 1M41A 2DZUA 4PUMA 1JF5A 3ALFA 1I9CB 1TMQA 1TTQA 2BGNE 2FDMA 1OB0A 3LBCA 3EWBX 2Q6ZA 4XKMA 3D46A 3DFPA 1O95A 3IANA 3EX6A 2J6XA 1KQYA 3BWWA 4LBSA 2AL1A 1RP9A 5F4WA 1R47A 5LKYA 2ZQ0A 3TMQA 1UZDA 1IZKA 3NYDA 4GBUA 1UR9A 1M5WA 2VFHA 5RUBA 3TR9A 3QV6A 1OY0A 1DJGA 4S3DA 4NRRA 4HPGA 4LY4A 3S1VA 3SUVA 4ZTXA 4D6HA 1B3OA 6REQB 3CZGA 2XN0A 5F2IA 4GY1A 1PEZA 3LCGA 4WGHA 4WSKA 4PFMA 5CZSA 3WBXA 3AALA 3VKBA 4QJ4B 2PCQA 2AGKA 1FCQA 2V2DA 3DKLA 3N2TA 5KETA 5HUOA 1UWQA 2FGLA 4LQ1A 1KCXA 3MO7A 1R3TA 1P0NA 5AY7A 2O7QA 1M04A 2FMNA 3A5VA 4KQNA 2QNEA 4GFSA 3BQ5A 2PP1A 5AYYA 2AKMA 2QZRA 3GHUA 2H9AB 4YNGA 1ZHAA 4PL2A 1NFPA 4PCPA 2FVLA 1CDGA 5HUPA 4GOAA 1V3LA 2PC4A 1GZJA 2OXNA 1P6CA 3EWUA 3CZKA 2ZXDA 3UXLA 3VC5A 3W70A 1JDAA 1QRQA 4GKLA 6ALDA 1E9LA 2DZSA 1XCWA 5ECUA 5K9CA 4AY1A 3PS7A 4G7EB 1B31A 3NL6A 3II1A 2GJRA 1S2CA 2WMJA 2CLEA 1HVQA 2VENA 3CWNA 3KZSA 2HE5A 1V51A 5XIMA 1GTHA 1A5BA 1OK4A 1W1IE 3ZWSA 1Q6GA 2WMIA 4GZEA 4ZQPA 1RHCA 4H6EA 1E6SM 4I6VA 5HULA 5AFDA 4RDWA 1XC4A 1Z9AA 1WOBA 1PB0A 2VD8A 3OHIA 1K9DA 3NPWA 4MF4A 3GR7A 4L6HA 5CKSA 3STPA 5HMSA 4DBEA 2DJXA 4R7WA 1FWBC 5JQ9A 3NPUA 5D8WA 1PZ3A 1DBTA 2JE8A 4RDYA 3QOMA 3T42A 3QFWA 4WGXA 4CU6A 3T05A 2QUTA 1W54A 4UC5A 4QJ5B 1F9CA 1F4HA 4JYFA 2Y5EA 2D2JA 3B8DA 4PUEA 3SIMA 2JF6A 2CERA 3A21A 2Q3RA 1PAMA 5A2BA 5A8PA 2Z26A 2WSKA 5T8GA 2J8GA 2PPGA 1PIIA 3B3DA 2D20A 1BYCA 1PHQA 4KFPA 3WLMA 1QASA 1JPKA 4AXNA 3PB2A 4J3TA 1PWLA 3P67A 2YDRA 4PE8A 1DOSA 3P5ZA 4AH7A 4RZ4A 3WYZA 2V38A 1XL9A 4GK8A 1GQNA 4HA0A 4ZSTA 2E9BA 4CN1A 3W7QA 2VUYA 4DWDA 1QHOA 1WB0A 2JKEA 3ZT6A 3AHVA 4KEUA 1KLZA 3P14A 4O1DA 3ARYA 1TPUA 1JDDA 2B7NA 1AMKA 3SY5A 4QHRA 1JZ7A 5CC6A 2Y7GA 2W6RA 3C0SA 3ANVA 1CB7B 1BF2A 2RJHA 1UQZA 4UOJA 4LUIA 1UIPA 1QI4A 3STFA 1FWTA 4Q33A 5EGRA 3WJYA 2F9RA 2PDFA 3G8RA 3ITVA 4US5A 1SMDA 5E1QA 2OSXA 5LXEA 4KWUA 3SQMA 3WQ5A 3EBVA 4FOKA 3OEXA 3UWWA 1H7WA 4FK9A 1D9EA 3AU6A 3DCPA 1JXKA 2CW6A 4XIMA 4AXKA 2XVKA 4KBXA 3FA4A 4CD7A 2DUAA 4ACZB 2VL4A 2HVOA 2XVNA 1IF2A 4U3CA 2WMKA 4TR9A 1S2UA 4BQ2A 4R85A 2ISDA 3DX5A 3H4WA 3WH8A 2CLIA 1AH0A 1V5XA 2EKCA 3LHZA 2XTKA 3BICA 2FHFA 2YBTA 2PDYA 1UR3M 3NTYA 5CSYA 1EOMA 1JI2A 3L2MA 3U4FA 4HU3A 1K7EA 4PMRA 3V5CA 3O0FA 5M3WA 2ABAA 5DELA 1R86A 4IL0A 1CGYA 5E6ZA 1CNVA 3JZUA 2D24A 1P0KA 4DZIA 4PRWA 3VVGA 2ZXBA 3GVQA 4N4PA 3AZTA 5EPDA 4K37A 2GQ3A 2AQWA 2P8CA 3WF1A 4DELA 4WQ6A 3BMXA 2ZBTA 3N1AA 1ZNNA 2FYMA 3ERPA 4C65A 3L0GA 3VUSA 1XLJA 3E0FA 4JN8A 4P8UA 5A6KA 4CNSA 4S38A 2VR4A 4AF0B 3FEMA 4ZXLA 1OADA 5J8LA 2RAGA 6XIMA 3E02A 1V0MA 2OWCA 4R53A 1OX5A 4FI4A 3T09A 1W9VA 2OQYA 4A22A 4RL3A 3S1GA 2Y24A 3L5MA 5AYXA 5ABGA 4HCDA 4RV3A 1LZOA 3DENA 3TROA 2ZUSA 3OGRA 4LAUA 2Z29A 1IT0A 3MS8A 1TV3A 1ZB5A 3VILA 2DIEA 1VS1A 1QW7A 1MZHA 4HPNA 3WJSA 3WG6A 1SW3A 5JBDA 3N2MA 3I10A 3QMTA 4P7RA 5JMUA 5D9PA 4XAGA 3TTOA 3D47A 3FJLA 3KZPA 4L5ZA 4F2UA 1KM4A 3NZ1A 4Z1AA 3R8GA 1UBPC 1V7YA 4MJZA 2J78A 4DI8A 1K7XA 1SO3A 1RJQA 3TP4A 4WSHA 5G1MA 3ARUA 4UNIA 4F0KA 2W79A 3ZJ8A 3GTFA 5FL0A 3N19B 3C2EA 5XIAA 1I1XA 3NNTA 3UR7A 4MKVA 1V3JA 2PDJA 2X0SA 4AZCB 1VFSA 2BXYA 2X2YA 4DLFA 4F2BA 4PR4A 4IIBA 2G5WA 3IVTA 4DRSA 1VB9A 3BMWA 1UJQA 3BVJA 4PRTA 3V0TA 4PB3A 4AWTA 4LVFA 4IHCA 3MI3A 4XB3A 3KL0A 4RNHA 4CCZA 3LD5A 5A8GA 4C6DA 3UVAA 3MKKA 4K6AA 5M2FX 3WLRA 5BRBA 5H8MA 1MSSA 2BLEA 4IGMA 1PKLA 3POCA 2QCNA 1DWFM 4NF7A 3BLOA 3TAKA 1RPXA 4NILA 3U2ZA 4Q7IA 4A3QA 1VR6A 1ZQ5A 1DJXA 3L4ZA 3LPFA 1RPKA 4LCRA 3O15A 4HP5A 1V02A 4O15A 1H4PA 3YPIA 3ZT5A 1HIZA 2QF8A 3SURA 3KS5A 1E73M 3TW7A 1XUZA 4LB3A 3EDJA 2BDQA 1J01A 3O6AA 1DYSA 1FHDA 2YBUA 1B1YA 2OYLA 1VF8A 3AUJA 2XIQA 2NUYA 3O05A 5I3KA 1H1NA 1FWNA 1H2JA 2NUWA 1ONRA 4WF7A 3UR2A 4B90A 5ECVA 3PJTA 3RM8A 1P0BA 3MCMA 1UBSA 1ITQA 1YE4A 1EEXA 4GLEA 2IQTA 3IV8A 2QUNA 3B0VC 4LCSA 2E7FA 4LFYA 2YDQA 3GNRA 4P8VA 4N6EA 4Q4PA 4RX0A 3LTPA 4DPPA 3AO0A 1ITXA 1C9DA 2WCSA 3GDMA 3V35A 3EDFA 3VIJA 5DY2A 5EA9A 4IMCA 1EJUC 4R88A 2FGZA 3CHEA 3G77A 2XVGA 3KOYA 4J27A 5A8OA 2Z7KA 2NW0A 5LGXA 3FKRA 2J9ZA 2FGBA 1NFGA 1DJHA 1ICPA 3DIPA 3SUUA 4GI4A 1EB3A 3N3MA 3RN6A 4F0HA 3WNLA 4LC8A 4E0CA 5IFTA 3N17A 5T91A 1K8CA 4FX6M 3GE7A 1AW2A 1KM0A 4O4VA 4LVDA 1EDQA 1S2VA 4IX0A 3WL1A 4DNMA 3HPZA 5ENLA 4FSAA 3QSTA 4QE4A 4HPHA 3MV01 1J6PA 4CNUA 3D3AA 1RD5A 4K8EA 3PZMA 4GCAA 1LUCA 1VBUA 1KBIA 1XRTA 2Q01A 2WK2A 1UWTA 1C9WA 1V77A 3CJPA 4L9XA 4A8LA 1RSCA 3HFYA 3B06A 3S1UA 1KO0A 3W38A 1N8WA 4L4OA 4PA8A 1GYLA 3KX6A 3QV8A 5PTDA 4C6MA 1RK6A 2F6XA 3G0SA 1PX4A 1ZP3A 2NV9A 4KKXA 2ZZ2A 4ERAA 2QR6A 2QXWA 1VH7A 1BYBA 3PJWA 3FAWA 4W8LA 5D04C 1PL9A 1TPH1 3UY8A 2WKLA 4LAZA 2XZ9A 3EWCA 3GBDA 4ICMA 4BA0A 5CPTA 1F05A 2CLOA 1FTXA 1TYGA 3ARRA 2PWHA 2WO5A 3GLCA 5AECA 2PU1A 3WNKA 4FPSA 3THQA 3S3GA 4DUWA 2OLSA 1DWIM 4ZB0A 1KTNA 1ZCCA 1UP3A 2FTWA 1WV2A 1YIXA 1XPGA 3WUBA 1E9YB 4E8CA 1OX4A 4HNCA 1S3TC 4FR6A 4V2XA 4UNLA 1C29A 1J0IA 3RO6A 2DY3A 2DIJA 3T44A 3OPSA 2W62A 4JIRA 3VNJA 3LHUA 4GYJA 4DZAA 4QISA 3NQVA 2AKZA 4TMCA 4ORIA 4XBSA 4O10A 5LIWX 4TX8A 3P0WA 4MB5A 2GLKA 1DVJA 3OZOA 3MYOA 3Q2DA 1OCJA 3NWRA 4IGSA 3MP4A 1WDQA 3IIPA 7TIMA 4MWAA 1MW1A 5I09A 2REQA 3ABRA 3PWGA 2BVTA 4JX6A 5EMLA 4PL1A 2JKPA 1BSIA 1NARA 4CD5A 4MUPA 9XIAA 2BXZA 4N4QA 5AC4A 2YKKA 3M4HA 2NQJA 1PDZA 1XLBA 4Q8TA 4UTUA 2J24A 1XG3A 5A6BD 3RJXA 3L2IA 1R9XA 3WQ8A 1QNPA 2R1PA 4AIEA 1EHAA 1NIUA 3SCVA 3VIKA 4MAZA 4HNUA 2VEPA 1V6YA 1F5ZA 1GOIA 4QGCA 4A3RA 3WD1A 1CXIA 3KCLA 2PUZA 1DJIA 4XVDA 3T0AA 3IPWA 2CBUA 4DBSA 2EQDA 5HR7A 3W88A 2BTMA 1X8FA 3E3HA 3UG5A 2O92A 4DBWA 1QO2A 4REQA 2YJQA 2IKHA 4B3LA 2CHOA 3WQEA 1TG7A 2Z6JA 2XN2A 4D6JA 1XRFA 4DBUA 3V7PA 4JFSA 1VIZA 3CLMA 3VI2A 3LGEA 1RQHA 3FYPA 1UROA 1JAEA 3T08A 4X0VA 2Z0IA 1J2BA 2PDLA 3ZVHB 4GGHA 4UFJA 4RPQA 4JNYA 4BR1A 1HL9A 3GTHA 1GW9A 2O9OA 1ENUA 4NL1A 3A13A 3CH9A 1WBHA 3NSXA 4INFA 4OU1A 4UXDA 4DJED 2CU0A 4AWUA 1KBKA 2YL5A 4FA3A 4U5IA 4R3UA 3RPTA 4QBXA 3NQMA 4GUGA 1OGSA 3VKDA 4GIEA 1Z32X 3UJFA 3USBA 4FEZA 2VZVA 3I6TA 3C2OA 2V2HA 3LV5A 3KAOA 1I2QA 1Q6FA 2V3DA 3S1WA 5HATA 3PG8A 1JJKA 2VJXA 4HN4A 2NWSA 1W1ZA 1B57A 3R79A 5T26A 2ACSA 3KCOA 2XH0A 2HXUA 5FJIA 3B0UX 3VFLA 2QKFA 2YXOA 4HNNA 3GQYA 3R1ZA 1XLCA 3I68A 4Q3MA 3F7JA 4B9YA 2PDCA 3L4TA 1M7XA 1A3WA 1SJDA 3K4DA 3SCRA 2D0HA 4GINA 1LM1A 4YTRA 1VYSX 2YGYA 3NPXA 1E6ZA 5FL1A 2OU4A 1RCOB 3W28A 1FWDC 1ZBWA 1HL2A 1I2OA 2CEQA 3I6EA 1T41A 4I7UA 4ZZ9A 1UMYA 1VBHA 3URQA 4H04A 2PDIA 6REQA 2NX9A 3M0HA 5I3DA 1OZMA 1D2KA 4PUUA 2RUSA 4HNTA 3A3WA 1VEMA 3EXRA 1QHZA 1NY1A 2FKPA 3VZZA 2Y61A 3HPAA 3LPOA 1KWKA 5DMYA 4HPJA 4LCQA 1A5LC 4HMNA 3N2CA 1PZ1A 3E0WA 3RCYA 4AMCA 2Y63A 2Z25A 1LG1A 1UD5A 2CWXA 1OFRA 3MKVA 2WANA 5K9DA 4JTUA 5CLWA 3W83A 4ZQNA 4L9ZA 1A53A 4MB1A 1AD1A 1TMHA 5I00A 7ODCA 3VOJA 2H9AA 1DIEA 2PDWA 1CXKA 4RKAA 3B9DA 3W2JA 1W91A 2A0NA 1SFTA 1DHKA 4QP0A 4IP4A 4E4PA 2OPJA 3PUDA 3QXBA 5JBFA 4GXPA 2V67A 1E6QM 5KZMA 3N04A 6TIMA 1TUXA 2FJKA 3CYJA 3WMCA 1WNOA 4HCHA 1V3HA 3WCZA 4LEQA 4S2CA 4GX9A 2GYIA 3PJXA 3FV9A 4G7EA 4DWSD 1GPWA 2Q8ZA 3EYPA 2E6DA 3BZJA 4BQ4A 5FEWA 4I5RA 4Z2KA 3KP1A 4NI3A 2Z1KA 4QLJA 3DYOA 4W86A 4GMEA 3CK5A 3VNLA 1WX0A 3GWQA 1W17A 2ISVA 1AQ0A 1M7OA 4LAKA 1VFUA 3S9YA 2XFYA 3VGBA 4MKSA 3ABQA 2RKXA 1TJ0A 3VGFA 4X3ZA 1JYXA 4HHPA 1BTMA 5D2YA 3MQTA 3W1AA 4RE4A 2YFOA 2XU2A 4WIWA 4NZCA 1V03A 1FFRA 1DXIA 1OC7A 3UYCA 3QBUA 2PWVA 3THAA 5FA5A 3H2FA 1R6WA 2Z2BA 4DUOA 1E1EA 1E9IA 2GVLA 3SB0A 1OG0A 3JRKA 3CB8A 1UP2A 3TDFA 3TZNA 1UR4A 4X9YA 3O2LA 2NVCA 2HVNA 4LS2A 3N3TA 2Z1XA 3I65A 3TWAA 3SN4A 3N11A 3VUPA 4HNVA 3WH7A 5DEZA 2RGMA 4IMDA 4XZHA 3BSHA 4N02A 4C6JA 1K6AA 2CZFA 1RUSA 3W74A 3KM8A 4OIFA 1A0EA 1MFVA 3IIOA 1A4MA 1EHNA 1YTDA 1E5NA 1E0TA 1RVGA 3RHGA 2B7PA 1EO7A 3GY1A 4F0SA 3M0VA 4WSJA 2QJJA 4O16A 3EKGA 1GZ1A 2BVWA 2PAJA 5IM51 1ME8A 1IQ8A 1TE1A 4EKJA 1CGWA 2QCEA 4LF2A 4RZ6A 4XV0A 5H6HA 1VGAA 1B3WA 2NWRA 3U48A 3ZXWA 3OQEA 5FAGA 1RBAA 4GWEA 1IWPA 3PSWA 3G1FA 2UY3A 1R9ZA 3UCCA 5AC7A 3U6WA 4ZO9A 3WQPA 3MBDA 5DQPA 2FZNA 1A3XA 4ACZA 5EFDA 3UZ5A 5I3IA 3TOYA 1GVYA 1NOUA 2IS7A 3A12A 1TUFA 4GD0A 1LQ0A 4JTTA 5G4HC 3VDBA 5CPQA 2YOCA 3VABA 2PS2A 1OYAA 5KSWA 2OVLA 4X2PA 5FI8A 2BVYA 3KCJA 3VD7A 3IAPA 4K8HA 2OCZA 4MLJA 4K8GA 4R34A 1G01A 5K2ZA 1XH1A 4JDYA 3PZGA 4IPIA 1GPFA 2E68A 1VKFA 2PODA 1KV5A 3E6EA 4G7FA 2FZDA 4C6IA 4Z2GA 3CQJA 1Q6DA 1PDYA 4GX8A 2NV1A 3LPGA 3N73A 1VC4A 1UR0A 4ATDA 1ISXA 1ECQA 3N2BA 2ZUWA 1QI0A 4BS0A 4Q8WA 3UESA 4I7WA 4GJIA 4JOMA 2VEKA 3P0XA 3IIXA 3QY6A 3UY7A 3C0JA 3ELFA 1Y5XA 5ABTA 1LWJA 1ML1A 4IWWA 4GVIA 4TUFA 2PTZA 4AF0A 5I2UA 4NSBA 3SCUA 1WXZA 4ZL1A 2J7FA 1QI5A 1JDEA 3LBMA 2BB0A 1B9ZA 3LG3A 4EACA 4TMBA 3TYDA 3WD0A 1C7SA 2GUUA 2WNZA 1F3WA 3IUDA 4QDMA 4M6VA 3L23A 1T7LA 5I24A 3NFUA 2O9TA 1I0BA 3WBEA 3OZYA 7REQB 1Q85A 4F4RA 1BAGA 2VOMA 1M68A 3RYSA 4MNMA 1FH9A 4HU8A 4OWGA 2C18A 6A3HA 3XIMA 2GVJA 1J18A 1P4CA 4W8BA 1J4EA 3AS1A 1VYPX 4B3ZA 4NQ1A 5CJMA 4ZOEA 5HA7A 3WNMA 5IOBA 2HK0A 1HO1A 4C1NB 3NO1A 1PYMA 4X61A 4Z17A 1H7PA 1HX0A 4GNKB 2LLEA 3ZR6A 1BPLB 2C1IA 2VFDA 5J04A 1M7JA 2PWFA 5FJRA 4B3KA 4NAEB 3GDRA 3HQNA 1ZJHA 4AB4A 1C8VA 3OG3A 3IGSA 3B40A 3WLHA 3HG5A 2QDHA 3KWSA 1KGWA 5K4XA 4ZENA 2QCMA 1ZJAA 5HJLA 5CCZA 3PZQA 3AISA 1HL8A 2ATSA 1LL7A 4DXXA 5AYBA 2CIPA 4AZCA 2CC0A 2WVVB 4C91A 2POZA 1LDCA 1JFHA 1QW9A 3GG1A 3GC2A 3JR2A 5BZAA 4FLQA 4CD8A 2GSHA 1FRBA 3WNNA 1O7AA 1MW2A 1XSJA 2DH3A 3SQLA 1O94A 4M56A 4O50A 4YN5A 5HNTA 1ZBCA 4AY7A 1W9PA 2QT3A 3W84A 1DWAM 3EDDA 5G2WA 1UD8A 3HFTA 4QCFA 3OA5A 3R2GA 1EGVA 3KVJA 2J74A 4ML9A 5C55A 2CXEA 2C79A 3DU0A 4KERA 4XO6A 1Z3NA 2CYGA 4MWAE 4IICA 3W7KA 1SPQA 4GXMA 2BX7A 4GO8A 1JCNA 5GNZA 1MFUA 3RPDA 3MUXA 3UJEA 1HNYA 2CWNA 1XV8A 3ISIX 2R94A 1A0DA 1XINA 1NQ6A 3P6LA 2C8NA 1EEPA 1ODUA 3TNOA 4M7TA 4AW7A 4Q32A 3HQPA 4LYPA 5F2GA 3OVPA 4I9JA 4CN4A 3H53A 2QCFA 2G37A 2QIIA 2G41A 4ZA0A 4UTIA 3H70A 2BY0A 2YSWA 3W1MA 4PCFA 3L0NA 2E6YA 3W6YA 3P8IA 5J5RA 2VELA 1OVDA 4YTQA 3WD4A 1TVNA 3RITA 3CUFA 1UH2A 4MYXA 4JQ1A 3W81A 1UUQA 3K13A 3ZR4A 3R0DA 3SY1A 3LUTA 2JFEX 2DT2A 4AISA 2XSAA 1LBLA 5A6TC 3AS3A 3UBPC 4MGGA 4O28A 1OCBA 3T2OA 4IF2A 4JEQA 3LNMA 2TMDA 3CXOA 3FKKA 4MG4A 3TFCA 5I3HA 3CUXA 3NQCA 1J93A 1G4PA 3STEA 2ZC8A 3KP0A 4K2SA 4H8NA 4DIAA 2E5DA 2VFIA 4MSSA 1MO0A 2Y4SA 3D5HA 4HOZA 5DFAA 3F5JA 1T40A 3CV6A 3WKZA 4PUNA 2WJFA 1S2AA 4AD2A 3R58A 3WMSA 3HOJA 1IWBA 3GFZA 2QPXA 1X7FA 1C8XA 1E71M 1YNYA 2ZICA 1XLHA 2O0TA 1D8WA 5AHFA 3W2UA 4LTSA 1KGUA 2BNJA 3V0SA 1W9BM 3RX3A 1DQXA 1XYBA 2YL9A 4GFIA 3H2MA 5ABEA 2OGJA 4JKMA 5E9XA 4O1CA 1Z8AA 1BQGA 2DT3A 4RZBA 4RXGA 3IVSA 1LBMA 1JNDA 5KINA 1G67A 3LLXA 5DT5A 1M7PA 3UWZA 4HK5A 1OQFA 3SRHA 4GRSA 3AMGA 4LBRA 5E93A 1C90A 2XYLA 2G3MA 2C16A 2JBMA 3TXVA 4NX0A 3TNBA 4BI5A 1P7TB 1QI3A 3GU2A 3KHJA 3OVRA 3PSVA 2XDFA 4PSRA 3QJAA 2VRQA 1HKIA 4JTAA 1WYIA 4XZBA 2XH7A 2HROA 1DE6A 4CQ9A 2CLFA 3FHQA 5EKYA 3THUA 5HJXA 4DO7A 5BOFA 4G8TA 5MHBA 4EXBA 4KH2A 5I3FA 1B54A 1JI1A 1FVPA 4Q4MA 1EC9A 4JBRA 3CASA 3HB9A 2CNCA 2DDXA 3QLLA 2E28A 4F9JA 1VBGA 3OOQA 1F73A 1BKHA 2J25A 1Q2RA 4L1GA 4GUJA 4CNOA 3OQ8A 1MW0A 3M47A 4GA8A 4GKTA 2CBVA 1DJNA 2YW4A 4S39A 1FH8A 1JCYA 2PLMA 2VP8A 4GH3A 4IPPA 3WJWA 5A6MA 5C6MA 3S5YA 7CGTA 4W85A 1LT8A 2PI6A 2PP0A 3FYOA 4L1XA 5EMKA 2VCBA 3TK7A 3WLNA 2B81A 4NJJA 3VOHA 1Q4WA 2DZBA 1HUVA 3KRUA 3ZZ1A 3AWNA 1IXPA 3ZJKA 4LUYA 1ZENA 4DO6A 1TV7A 5BXPA 3GM8A 3FCPA 1Q7MA 1J12A 5I3GA 4OBTA 1QPKA 2V5JA 5EY5A 1ADDA 3W7IA 3NQFA 5CZTA 4D1IA 3C8NA 2CXGA 4OTKA 4ATWA 2F2HA 3G24A 4X63A 1P0DA 2GDVA 1A5UA 3S8HA 3QHNA 3FEQA 4I8YA 1OYCA 1GVQA 3ZVHA 3W29A 4WOQA 3EPOA 2CITA 3TZFA 2H6RA 4Q4SA 1MYRA 4DN1A 2HJPA 5D33A 2ZX6A 4M7SA 3MWAA 3IJ7A 3CMJA 3TSMA 1KTCA 3WEMA 4FF5A 5AN7A 3CM4A 3CZJA 1IZCA 1YX1A 4H7ZA 3R8RA 2ZRUA 2NXHA 2YCJA 4JCMA 4XX6A 4S3AA 1A3HA 2C91A 5FEZA 3ORWA 4S3EA 5HWMA 4NIRA 3V5OA 1XUUA 4US5D 5LIUX 4LWWA 3WDJA 4KEVA 3W7JA 3VX0A 4MFDA 1PX3A 4PMXA 4U3AA 2VZUA 3ABZA 2INZA 2YB1A 3NR0A 3WJXA 2QVNA 2GGJA 1RCXB 1K03A 1DIOA 2PD9A 4Y8EA 3IGXA 4UUIA 1Z48A 3IJ6A 3EB3A 3WX7A 4HKPA 1E3ZA 3ATZA 4J2MA 3M5VA 1XLIA 1XIJA 1CT5A 1N82A 4JPGA 4UTMA 3Q67A 3URBA 3NDYA 3PULA 4Z0SA 1T96A 1EPXA 3K4AA 2CZVA 3GU1A 1NWTA 3H55A 3HPXA 1GKRA 3D6NA 5CSUA 2JK2A 2ISSA 3OP2A 1ZALA 3GDTA 5C9WA 4E6MA 1P1XA 3KDNA 4RNIA 5KZ6A 2WV8A 3ICJA 1XS2A 3TW9A 1B2YA 3UXKA 2GZXA 1NU5A 1XC6A 3WD2A 1K70A 3B9EA 2GJXB 1JPHA 4V33A 3SCTA 1IIHA 1VPXA 1HJVA 2QJNA 4NXSA 3UU0A 1B3VA 5H8UA 1ITUA 3G3MA 3F4CA 2OTDA 4XZLX 2A1YA 4EWJA 2IPJA 2NSOA 1NOWA 4CNPA 3W01A 3GG7A 3N4EA 2X05A 2DZTA 3Q58A 2G4FA 2H3BA 1C8YA 1W1TA 4EPEC 4EPBC 4WX2A 2ZKMX 1DXFA 4UZSA 5M17A 3DDMA 1PV8A 1IEIA 1YRRA 2EAWA 3PUEA 1W6TA 1Y8BA 2YBVA 1AQHA 2GQAA 5A6BA 2J7HA 3N2OA 2G8ZA 4Z1YA 3P80A 2ZFAA 2J13A 2NXGA 5XINA 3A5FA 2ASHA 4NY2A 1VJSA 1LLZA 3P93A 3MCOA 4UQ9A 3NZPA 1W0MA 4HB7A 3VCCA 1G0CA 3WBYA 2PURA 3ZMRA 3AXIA 1SZEA 1IYXA 1XP3A 3BAWA 3OBEA 4LV4A 1NVMA 3WLJA 3H4GA 1XXXA 1L0PA 3EA1A 3BLLA 3BUVA 1IGWA 4GQRA 3UD6A 4O11A 1RZMA 4YHGA 2IPGA 1XBVA 2X41A 3BMVA 2IQDA 4E8DA 1MQQA 3OGVA 3S6DA 3ITGA 3VC6A 2OZTA 4Y9AA 3R12A 4HA4A 3VMNA 3VDAA 5D2WA 4DF0A 3POHA 1JZ3A 3VNYA 4LBUA 4FOJA 1Z41A 3RO8A 4DJEA 3DOPA 4OOZA 3F2DA 4NVTA 1LG2A 5GPRA 3T0CA 4H4IA 1WOAA 3WLPA 4EWND 3O6YX 1OFAA 3ECQA 1RVKA 3MUAA 4PTNA 5CPOA 1MMFA 4C1KA 1WA3A 5HNNA 2E3ZA 5GJNA 3WQGA 1WDDA 1G4EA 2CHNA 3KFTA 1PIGA 3SJNA 2P3EA 4JCLA 2J7EA 3A3HA 2WBKA 3H7RA 3VNMA 1YLVA 3MMTA 1NQKA 4XAYA 4G9PA 4FIQA 4MM1A 4B9ZA 4D71A 4YIWA 3BGGA 1LTDA 2C1GA 4AZHA 3VIIA 4WDXA 3S2LA 1IZJA 4PBFA 2BWGA 3WQCA 4PTWA 4CVWA 2CETA 2PDMA 4S3JA 1O1HA 3FA3A 4GUHA 1P48A 3PANA 3S0CA 1K9FA 1HKVA 1H11A 3COTA 2QCLA 3QN3A 2R14A 2BHUA 4M6UA 3TYZA 1FWWA 3W2MA 3AFBA 3TN6A 3WJZA 2BV9A 1HKKA 2A3LA 2F6UA 3SM0A 3GXIA 1XIIA 4PEEA 4CNNA 1E5JA 4MNKA 3B8SA 3NG3A 1QDSA 2VGBA 4H9XA 3N9KA 3WELA 4OVXA 3SADA 4AX7A 3GSMA 2ZA3A 3MHGA 3T2PA 4PBEA 2FZBA 1TWSA 1S39A 1KM2A 1WPCA 4CUCA 1LF1A 4AEOA 5L6UA 1U1JA 2ZVRA 1XYZA 1EWDA 2O9PA 1H0IA 2HPIA 2C0AA 4S3CA 1H1YA 2NX3A 3UJSA 2Z27A 4F0LA 3K4WA 1UZHA 3DYPA 2OKTA 3M1ZA 5TF0A 1JCLA 5D2TA 1ME9A 1RY8A 4HZMA 4GI8A 3N6QA 4JIIX 2XWDA 2E8ZA 5AB3A 3G1AA 3JZEA 1EF3A 1BHGA 4J5NA 4MZ8A 3GDBA 1TO3A