1TB3A

Crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
332
Chain Sequence
b'PLVCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKRNQLNLEAKDLRALKEASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREVVAAVKGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISPDLIQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyacid oxidase 3
molecule tags Oxidoreductase
source organism Rattus norvegicus
publication title Crystal Structure Analysis of Recombinant Rat Kidney Long Chain Hydroxy Acid Oxidase.
pubmed doi rcsb
total genus 118
structure length 332
sequence length 349
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tb3A00
3W75A 3KVJA 3E9AA 2NX1A 3LHUA 3IGXA 3W7PA 4NT0A 3FJLA 2E6YA 1QDSA 3BLFA 5DELA 4P61A 3NQAA 1IXOA 4LC6A 2ZZ2A 4OQVA 2G95A 1CW2A 1K02A 3DZ1A 3G18A 4GUFA 1JCYA 4WD0A 3QYQA 3TCEA 3TJLA 1MXSA 2FPTA 2J6XA 2CLHA 3MI2A 1AL7A 5HUOA 1DV7A 1G4PA 4LVDA 3R8RA 3LLFA 1BKSA 3W83A 1GG0A 3MHFA 3QM3A 3LV5A 4XBSA 4DQWA 3CT7A 3UY7A 2X1TA 4JIQA 4UTIA 1OF8A 1ZNNA 2V9DA 3B05A 4ZQCA 3G1FA 1F73A 5EA9A 1SFLA 1KLYA 1JCNA 1R2RA 5AHFA 1GG1A 3M43A 2YXGA 1EA0A 3EB2A 4I7VA 1Z42A 1H63A 4XZ9A 4BWLA 1M7PA 4UFKA 4LS0A 1WDWA 3MP3A 1JQVA 2Y7FA 5FF3A 4O13A 2G96A 1LYXA 3LM7A 4LS1A 3HGRA 3CEUA 3NQMA 2Z0IA 3DFQA 1LCOA 3LHVA 1AG1O 1FDZA 3VI2A 1W5MA 3L21A 3HG4A 3TSDA 5HR7A 2CZ5A 3GAYA 2B7PA 5EYWA 4K7VA 3WK2A 3DFNA 4EF8A 1JR1A 1LOSA 4TR9A 3NEVA 3C2EA 2J9XA 3SJ3A 4MZ1A 3S0CA 1SR9A 4ZZ9A 2D73A 1OX4B 4GUJA 1KTCA 4MFEA 1MO0A 3VE7A 4JTJA 5L6UA 2CLOA 5U4NA 5I3GA 3NQDA 1UUMA 4MJZA 4IWWA 1BTMA 3PY2A 4UFIA 5CZJA 5CG7A 1VLWA 3A5FA 4BI5A 1TPUA 1Q6LA 1YPFA 5FF7A 4LS2A 2J9ZA 1ME7A 1EWEA 2QAPA 2ZTJA 3WJZA 4N02A 4RZ4A 1Q6RA 1O95A 2OT0A 3BARA 4ONVA 4LW7A 2OCZA 3IIZA 3BV4A 3LOTA 3STFA 4KKXA 4AH7A 2VXNA 3K30A 4N4PA 1G6CA 1LDCA 1TTJA 3DU0A 3EWYA 4JTUA 5TIMA 2DZSA 5D37A 3C6CA 3Q94A 4BF9A 5DY2A 1S5WA 1W56A 3TKFA 4K37A 3W9ZA 1DBTA 4FX7A 3HPXA 2A1YA 5G1YA 5AYXA 1PHWA 1VQTA 3W1XA 4AWSA 3C52A 3IIXA 3W07A 3BVJA 5BW6A 1I8JA 4JNMA 5F1VA 4JX6A 3W1TA 3PS7A 2ZRYA 1H7OA 4QAIA 2XFWA 1OFBA 4A2RA 2GUUA 3W7GA 4CQ8A 1FDYA 3GR8A 4HSOA 2ZZ4A 3S5ZA 4OV9A 3TQKA 2RH9A 1SSGA 1R2TA 3GDLA 3G1YA 5I3IA 2NXHA 4O12A 2VOMA 2VFHA 3SFKA 3HJZA 1P0KA 3W88A 2WSYA 3MYPA 3NQGA 3UPWA 1I2OA 3OIXA 4LVFA 5F4XA 5AHNA 3P60A 4GNJA 1W5QA 1L6SA 3TNOA 4O50A 3QW3A 1EB3A 5K2ZA 2R91A 2CZFA 2V2DA 3C2OA 2QAFA 3HGJA 3LTYA 1EP3A 1FWNA 4K8HA 3PUDA 4S2CA 1H60A 4LU0A 5C55A 3FKRA 5E1QA 5BRBA 1L2UA 1KM6A 4O28A 4AB4A 4NU7A 3BG3A 4X3ZA 2J88A 4PCFA 4XKYB 3N19B 1OJXA 4MIMA 1KV8A 2V82A 4RV8A 3TX9A 3PVFA 3NM3A 1DORA 1H62A 1B3OA 1G7UA 4NQ1A 2FDSA 4UMAA 2QCDA 3IIPA 3GDRA 3L0KA 3SGUA 2Q8ZA 1FXPA 3Q37A 1FCQA 3GR7A 5CSRA 3UNDA 5KSWA 3EXRA 2A6LA 1OFPA 1KFEA 4E2BA 3P82A 5C2XA 2ISVA 3M44A 2HTMA 4YLWA 4ALDA 2VFIA 4R7JA 4O1CA 3QH2A 2QCLA 4DELA 2CZEA 1XM3A 4IJBA 3SZ8A 2WNZA 4B5NA 1J5TA 3YPIA 5G2WA 5I3JA 1M7OA 1FQ0A 3MO7A 2PE4A 2QKFA 3I68A 3LI0A 1VYRA 2YGYA 1UBSA 1ZJIA 3GNDA 3O1NA 3HG2A 1D9EA 4E2DA 1L6WA 4C1KA 2NX9A 1DQXA 1OFOA 5LZLA 1HL2A 4ZMGA 2PURA 2F84A 3P67A 2LLEA 2QCFA 3TIMA 1ZY9A 1W1ZA 1DKWA 1RQEA 3FS2A 5BMXA 3RFAA 2I14A 3MHUA 2C6QA 3ABRA 3P62A 5DBUA 3THQA 3R2GA 1M5WA 2H90A 5I3KA 5HWJA 1KBIA 1KM2A 1OFDA 3LRMA 5AN7A 2O7QA 4LUJA 3I65A 4UTMA 1I2QA 3PM6A 1GVQA 4X9SA 3HPZA 1ME8A 1N55A 4YWIA 4EOUA 1ZHAA 2OX1A 3TE9A 1RVGA 3IGUA 1LZOA 3WJWA 5CZSA 4XUGA 1Q45A 3DXIA 2FJKA 4LVGA 4ORMA 1I2PA 4O17A 3JR2A 3ZFHA 1YYAA 1TPB1 2XN1A 2EKCA 2R94A 3C2VA 4CNOA 3W1PA 1RPXA 1TPC1 3NQVA 5A8GA 3IVUA 3VCRA 1VS1A 3W7RA 1KFCA 4FXSA 2GVJA 4UR8A 1Q3NA 1SPQA 3PR2A 5DY3A 4JTGA 2PRMA 4MLJA 3CHVA 2FIQA 2NUYA 3LHWA 3TW6A 2C13A 3R13A 3GLCA 1SUXA 2PRLA 4AHQA 1ICPA 3ATYA 4Z1AA 2V2CA 1PIIA 1KTNA 1L9WA 2QDGA 3TSBA 3CLMA 1QR7A 3ANYA 3G0XA 2FB2A 5TQLA 1XL9A 3G1DA 4FB7A 2QCDB 3SGZA 4HNNA 2Y6ZA 3Q58A 2CLFA 2VEPA 4K7YA 3NPUA 3C2FA 2DJXA 3NL6A 4CCCA 3MI6A 3DGRA 5D2WA 4JTFA 3T40A 3LERA 3O6YX 1VR6A 2H3BA 1TTQA 2FFCA 1SZEA 2KZHA 1ZAJA 3MHGA 3I7QA 1B4EA 1ZAHA 1TIMA 1SW3A 3QW4B 1VC4A 1MSSA 3PSVA 3BW2A 3HF3A 1EEPA 2ZRWA 4RX0A 2ISWA 3MBFA 3M5XA 3KVLA 1FCVA 1AMKA 1TQJA 3BK0A 1NAL1 5CPMA 3W1RA 3I7RA 4UTKA 3AJXA 5D03A 4Y8FA 3ATZA 3HO8A 3FA5A 2GOUA 2YSWA 1TQXA 5KITA 4KFOA 4M6QA 1FCBA 2C14A 4PL1A 1LROA 5CPLA 1B9BA 2YDAA 2ZRXA 4ZQMA 1QMLA 2IQTA 2J24A 1QPQA 2DZUA 2OJPA 4KFNA 1TCDA 4Z1CA 1QPNA 2JKPA 3G1HA 2TPSA 5G5IA 5GVJA 3LCLA 3LCFA 5J5RA 5K9XA 1LBLA 5F4SA 5LNRA 3ZWSA 1LM1A 5C5YA 1DJNA 1QAPA 2NUWA 2V81A 1OFAA 1XUZA 2VEKA 3LGEA 3W87A 1OX6A 1JCJA 3EXSA 3H53A 1EUNA 3QFEA 1XDMA 2YYUA 4NX0A 5D02A 4OU1A 4GC4A 3SR7A 3QPYA 2DZVA 3W2KA 2X30A 5K4ZA 2Z1BA 1KW1A 3TH6A 4A2SA 1R47A 4GUHA 3NQEA 2ZA3A 5D38A 4LVAA 1X6UA 2H8ZA 4O18A 4O10A 1C8VA 3GKAA 2A21A 4N2YA 3NM1A 4H4IA 5LGZA 3EWWA 4FHAA 3EX2A 1MEHA 2ZA1A 4O4WA 1ML1A 3W7KA 3QSRA 4E38A 3GDMA 5LSMA 1EPXA 2YFNA 5HMSA 4DEFA 3OG3A 1P4CA 3OEXA 1RR2A 3IVSA 2TMDA 3UYCA 3INPA 1QPRA 2ISSA 1E51A 4XTDA 1RQBA 5AOUA 3NVTA 2UV8G 3WJSA 1GTEA 1H61A 3P8IA 4RK8A 2WPBA 2ZZ3A 3WK1A 2CLEA 1WQ5A 4BWLC 3TR2A 1TJRA 1XDLA 2B7NA 3L9CA 1LTDA 1LRTA 1JULA 1FX6A 4QNEA 1CX9A 3TFXA 3OBKA 3OVRA 1JCLA 1PL9A 3E96A 1KV5A 5DXYA 3UXAA 3O15A 4OBTA 3GIYA 5LNWA 4GXMA 1XBVA 2P10A 2CLKA 2NV2A 2V30A 3BW3A 4NXKA 1ZENA 4O19A 3NR0A 1LP6A 3Q2DA 3KVMA 1VYPX 4YXGA 2E6AA 1Y0EA 5AYZA 1WX0A 3S42A 1JQXA 2DZTA 3SSJA 3LB0A 1XI3A 2YCEA 2Y7EA 4I7WA 5D04C 1ICQA 4DBEA 1WYIA 2H3DA 3LCHA 1KA9F 3G1XA 2CLLA 3W7DA 1EUAA 2AQWA 3IGSA 4G1KA 3NYZA 4NNAA 4LT9A 1SZFA 1HG3A 4JD4A 3N3MA 3R89A 4K39A 1CI1A 3W2UA 1KLZA 3R12A 1FXQA 5HR6A 4HNTA 1G67A 3LBMA 4MLRA 3DFPA 5AHIA 4UTWA 1GVFA 4ZQRA 2E1DA 1X8FA 4ZVJA 2Z2UA 4JDBA 5F2GA 1VHCA 2VC6A 2DZPA 4QISA 5LNSA 3WJXA 4TO8A 3G8EA 1UASA 1TPVA 2YW4A 5EY5A 4I9AA 1TRIA 4NX5A 4FNPA 3FJ6A 3LCGA 2RDWA 3DENA 3C2RA 1YADA 3DI0A 1Z44A 3DHFA 3T4CA 1GVRA 1F7BA 5FEPA 3CWOX 3UWZA 4UTTC 1VH7A 1PHQA 1XBZA 2QCCA 2ZQ0A 4MVAA 3CEPA 4ORIA 1BWKA 4LY8A 1UJPA 1YTKA 1F2JA 5DN1A 3PG8A 3L65A 2QUVA 4M7SA 1HFBA 2FB3A 1WAUA 1ME9A 2X1SA 4AMAA 3OA3A 2BZNA 3SECA 3B8DA 2R14A 2VFGA 3EWUA 5AHMA 5D33A 4WX2A 3DKLA 4DPQA 4FNTA 2X2GA 4U28A 2C0AA 3SY5A 4M6PA 4MUZA 3L68A 2CZDA 3AO0A 1IXPA 4UIOA 2ZDRA 3RMJA 2Y61A 3P61A 2WV8A 4O0KA 4LRTA 4PA8A 4BI6A 1O4UA 2X16A 1YTDA 3P80A 3L0GA 1TYGA 3P84A 4EIVA 3L5MA 3CWNA 2BXVA 2DZWA 3LLDA 3L0NA 3VKJA 1I45A 2RDUA 1GYNA 3DFSA 1JJKA 3OHIA 4IGHA 3BW4A 3CC1A 2WJZA 4ADSA 4BI7A 3FEMA 5FF0A 4AXKA 1K7XA 1ZFJA 2E5CA 5DCDA 4JTIA 2GVGA 2OT1A 3JS3A 4UFMA 4R53A 1KBJA 5D2XA 4WXZA 3QQ0A 4EF9A 1HTIA 1OABA 4P2VA 2YX0A 3U8GA 4NJHA 3FFSA 3W2MA 4JY8A 3W7JA 3C3NA 4JYFA 1O60A 3LTPA 2QCMA 2I1OA 2JKAA 3UD6A 4CQ9A 2C18A 3ABSA 1NSJA 4LV4A 3HGOA 5K3VA 4JX5A 4UMCA 2CU0A 4GFSA 1JCXA 3FOKA 3G1SA 4X2RA 5HWMA 4IMEA 3W86A 2VFEA 3M7WA 2NWSA 4GBUA 4HPJA 5E0KA 1SW7A 3TDFA 3QJAA 4JTSA 4O53A 1PV8A 3TUUA 1KM0A 5BOOA 3NL2A 4LNYA 3LCXA 3L2IA 1V7YA 3EX1A 2C16A 3P8JA 3B03A 3UQNA 2HSAA 5HQEA 1FUYA 3A23A 2NUXA 6TIMA 1YDVA 1TTIA 1TV7A 5HINA 4N9EA 1YDOA 3UZ5A 3P81A 1RD5A 2EAWA 3TA6A 2OMAA 4HKPA 5D32A 4DO6A 3PBVA 1TREA 4JX4A 1VCVA 1OFRA 3QMTA 3TXVA 4MYAA 3MUXA 5CPOA 4IQLA 4KWVA 1WA3A 1XCFA 4O0ZA 2EF9A 4FNSA 1WV2A 4QJ1A 3DKJA 4OE7A 2CFFA 4YL2A 2QCNA 4FEZA 2WSQA 1JUKA 3BG5A 3LDVA 4JXCA 4L4LA 3NXFA 2GQ9A 3NPXA 3PBUA 3W7QA 4N6EA 1LRNA 3HB9A 2V8ZA 4DO5A 3W7MA 3STEA 1IXNA 4O1BA 2QCEA 2B7OA 4EWND 2E5DA 2PRHA 2DP3A 3PBYA 2ZFAA 4O57A 1H1ZA 2GPTA 3H54A 3M6YA 3STCA 5FI8A 3QRHA 1K8XA 1N8FA 2A7PA 3P5YA 4M6VA 2GJLA 1RZMA 3D0CA 5FEZA 3W70A 4O16A 4UTUA 3NZ1A 4EVZA 1DVJA 3KRSA 3A21A 3ABOA 1QNVA 1HO4A 2FPYA 4S1FA 4UFLA 2J9YA 1OX4A 3W1MA 5LKYA 5DLCA 1W0MA 4GWEA 4JTLA 1F05A 1OYAA 3PBWA 4LWWA 3W71A 3LI1A 1FCUA 1MZHA 5HJLA 5AC7A 3CQ0A 4XKYA 1A5CA 3WK0A 2Q3OA 1D3HA 5AC6A 2H6RA 3NA8A 3DI1A 4IMFA 3NG3A 3QEZA 3RNDA 1IIGA 1XBXA 4I7UA 1A5AA 4UFHA 3W7IA 5LHFA 4UC5A 3KXQA 1UB3A 2TRSA 3C4UA 4N4QA 2RFGA 3BO9A 5AYYA 1ICSA 2E6FA 4QQ3A 3GXPA 2QDHA 3S5OA 3W1NA 1RQHA 3QF0A 3M9YA 4IXHA 2BSLA 3C61A 1GEQA 3QMSA 5K7JA 1K7FA 1TMHA 2C15A 3O06A 3S9YA 1GYLA 7TIMA 3QSTA 2ZBTA 1G4TA 2G97A 3SI9A 4M7TA 2BWGA 3DBPA 3N34A 4JR5A 2C1HA 3LRKA 2A85A 4JTHA 3EX3A 3F1QA 3NNTA 1UUOA 5CKSA 3W1AA 1V5XA 1K3UA 5F2LA 4NVTA 4Z0JA 2ZRUA 1LBMA 1VPXA 3HQ1A 4K6AA 3TAOA 4AVFA 2YW3A 5H2ZA 3KRZA 4JYDA 1GTHA 4IMCA 4UFJA 5AC8A 3UPBA 4WXYA 4JS3A 1TPEA 2CWNA 1F5ZA 5HULA 1IF2A 4XWUA 2QEZA 4C1LA 1X1OA 5LGXA 5LNVA 4NXSA 4CCDA 1JVNA 5C54A 3MW7A 2X1UA 2HMCA 4ZQPA 3W3OA 3VNDA 1F76A 1DHPA 2A0NA 3C8FA 1DOSA 3ZWTA 3ABQA 4JN6A 2GQ8A 1AL8A 1KFKA 2YPIA 4MZYA 3GZ3A 1GVSA 4YMZA 1OK4A 4PTNA 2ATSA 3WK3A 3TJXA 1O94A 3EKLA 3O6CA 3T44A 3UWQA 4MY9A 3NPVA 4PODA 4NNCA 1K03A 3A5VA 2QUUA 5HWNA 4Q33A 2NXIA 1G69A 1OF6A 2A7RA 4D2JA 4HT3A 3GVGA 1PE1A 4Y9AA 5KZMA 2PCQA 4O4VA 4IPJA 2C3ZA 4MJMA 1W5NA 3CM4A 4NNBA 1QOPA 4RR4A 4RLIA 3DHDA 4IX0A 1GT8A 3TSMA 2QCHA 5E93A 1EP2A 3EWXA 3MP5A 1P5BA 3O07A 1ZCOA 2V5LA 1GZGA 5FEWA 3LV6A 1Z48A 1I2NA 3TQ0A 2JGQA 3UWUA 4LC8A 4OGZA 5KMYA 3EKZA 4AF0A 1UCWA 1T8XA 4XQ6A 4ZQOA 2NZLA 4UMBA 5H91A 1JRCA 3U6WA 4WUIA 1SQ7A 5IM51 3RLVA 1T0OA 3N9SA 4UTJA 1YLVA 1BEUA 1OK6A 1EIXA 1C9DA 3GK0A 2A2IA 1NF0A 2XN2A 5J5DA 4LOCA 3LHTA 1W3IA 3B0PA 3N9RA 4UXDA 4GJ1A 4UTTA 1WBHA 1TPH1 3N14A 2V0TA 1SO6A 4FIQA 4MYXA 5SWUA 1AK5A 3UWYA 1NEYA 1XKYA 4MKNA 3TXZA 3L5AA 4UTHA 5AB3A 3PG9A 4WY0F 1WBJA 4FIRA 3E0IA 1S5VA 4IOTA 3NZRA 4O1AA 4WOZA 2ZA2A 4TIMA 4A21A 2QCGA 1SZNA 3M16A 3KAOA 4HNUA 3M1ZA 1KM3A 1B57A 4UNKA 2TYSA 4JTEA 4UTWC 3TQVA 4KFPA 4BR1A 1PS9A 3NL3A 1VZWA 4BK9A 4JGDA 2ATMA 3QPZA 2Y88A 4LRSA 1LOLA 1QCWA 4JYEA 1FDJA 4LUIA 3C56A 3PUEA 4M5PA 2ZRVA 4FNRA 5AFDA 3S5YA 2YYTA 3TC7A 2V2HA 5DBTA 3MMTA 3UXDA 3DH7A 3BLIA 4R34A 4AHPA 4QSHA 1DJQA 2G5WA 3IV3A 4OT7A 2WKJA 5A5WA 1FY6A 1JUEA 2GQAA 3KX6A 1H7PA 2RKXA 4FX6M 1ADOA 3IEBA 3W76A 1K7EA 3U2OA 1QFEA 1NFBA 2E77A 2ZZ5A 3CPRA 3EX6A 3IRDA 3B4UA 3N2XA 1KTBA 3HOJA 3G0SA 3CTLA 4JDYA 4DF0A 4DO4A 5ABTA 1OYBA 3H55A 3VFLA 3NGJA 3NPWA 5D09A 4O1DA 3PULA 4PEKA 1TJPA 4O11A 5K9CA 3PF3A 1XBYA 3F4WA 4OV4A 1ZAIA 3NO5A 3LCIA 3I6RA 4Q4KA 3MWAA 1SZGA 1A53A 2ABBA 4IX2A 1GVOA 4LTSA 1LLZA 2WQPA 3CB8A 1YXCA 3M47A 4MZ8A 2YR1A 2ZZ7A 1WOAA 1H50A 1KM5A 1P1XA 1VYSX 4QM1A 2P1FA 4GUIA 5AHEA 4MPQA 1JRBA 4U4MA 3DFTA 3GNNA 3LHZA 1OX5A 4NJJA 3W73A 4O14A 4UTLA 1R2SA 5DXXA 1X1ZA 3KFTA 3PUOA 2EHHA 3HGSA 4UR7A 1PCKA 1F74A 2CW6A 3V1PA 1EP1A 3NL5A 4S2BA 3W7EA 4KWWA 1TPWA 2QJHA 5F2MA 2Z6JA 1L6YA 1H7WA 3HPSA 1W5OA 3BPWA 1GQNA 2H8XA 1VHNA 4AEOA 3TMLA 2WSRA 5G2HA 5IBXA 3IIOA 2A7NA 3FYPA 3ZS4A 5C6MA 3FYOA 1W54A 1NVMA 5KTLA 1SU5A 2Z6IA 3QMRA 3M5VA 1W37A 5D2TA 4O52A 3NQFA 3LTSA 1K8YA 3SIZA 1HO1A 2QR6A 1G4SA 1XXXA 3WFAA 4Z08A 3W6YA 2HS6A 2E09A 6ALDA 4O54A 1TV8A 1A50A 3HG5A 5DCEA 5L9FA 5I3HA 2BX7A 1H7RA 3EEGA 4GRSA 1VCGA 3GYEA 2I9EA 4N9CA 2X1RA 3L67A 3EWZA 3FLUA 1W5PA 3HMJG 1MEIA 1OYCA 4NZFA 2EPHA 1H7NA 3W7LA 2F7FA 3G8RA 4IMGA 2Q3RA 1NF7A 3W72A 3BLEA 5EMUA 1ONRA 5DCBA 3KRUA 1EWDA 1FBAA 3I7SA 1TPFA 1H7XA 2WNNA 3O05A 4K8EA 3GB6A 5G1TA 1XC4A 3O8AA 4RXGA 4WZHA 4UCGA 4PFMA 4JICA 5CZTA 5D2VA 1H51A 3NAVA 3UWWA 1O5KA 3MP4A 3USBA 3NQCA 3NQ2A 3F03K 4N9DA 2JK2A 2R8WA 3IIVA 5KZDA 2NWRA 4NJKA 3TC6A 2YFOA 2Y62A 1SW0A 1XFBA 4AWTA 5LHEA 4UUIA 4PH6A 4AF0B 5IBXC 1T99A 1J4EA 1XUUA 3G24A 4J9JA 4FNQA 4QNWA 5EPDA 4JTTA 2DU2A 1AW5A 1ZALA 1M6JA 1G4EA 5U7SA 3THAA 1YXYA 3BGJA 1LBFA 4YCPA 3UWVA 4FX8A 5G4WA 4R33A 3GDTA 5D05A 1WOBA 4H6KA 4AWUA 1T96A 3M0ZA 3C0JA 2Q8LA 1R46A 5F2IA 2FLIA 1GJPA 1OVDA 3E12A 4Q32A 3TW7A 3KOFA 4NJIA 1DQWA 4NJGA 4HNVA 3M5YA 5FEXA 5HUPA 1Q6QA 5MHBA 2A6NA 2Y70A 4TU1A 2VELA 4M19A 1W3TA 4JEQA 2QJGA 4GE8A 4MOZA 1F6PA 1GWJA 5D30A 3W23A 2NXGA 5AHLA 1K8ZA 1KM1A 1W3NA 4PL2A 3W7NA 3GKFA 2B7QA 2NX3A 2P0OA 4QITA 3W7CA 4AHOA 1QWGA 3O63A 3TFCA 3LXCA 1QPOA 2ZTKA 4Y90A 5F1UA 3GXNA 3G3DA 2OZ0A 1PVNA 1X7FA 3MI3A 2ZRZA 5CGQA 3TU9A 2Y63A 1S5TA 4CQAA 3S1WA 4XTIA 3W22A 1J2WA 3W84A 4ADTA 1S3HA 1QOQA 1YPIA 1OG0A 1G7VA 2AGKA 3T78A 1SSDA 1W31A 3W85A 2V5BA 1U83A 5T26A 3NQ7A 1SO4A 4FF7A 2XN0A 2VFFA 4HHPA 4MFDA 4K38A 4JY9A 3KVKA 3W7OA 5D2YA 5CZ0A 1JUBA 4OWGA 4DF2A 4RZ5A 5HNRA 3MBDA 1JCMP 2ALDA 3TMQA 1Z41A 1VLIA 1Q6OA 3B0UX 4A29A 1GOXA 1YTEA 3W74A 3RU6A 3PB2A 4FO4A 3A9IA 3TV8A 4ICNA 3E49A 2JGYA 4TX9A 3IVTA 1U5JA 4TMBA 5G4EA 3EWBX 4W9TA 4IPIA 1VGAA 4L4MA 4RKAA 4DPPA 3UZJA 2A5HA 3FIGA 3MJYA 3TROA 3A22A 3B0VC 4N6FA 3S6DA 3M41A 3LHYA 1YXDA 4Z1BA 2W6RA 4IMDA 1OHLA 3S1UA 3W1UA 5KINA 4GUGA 2C19A 4BFAA 3WJYA 1GPWA 4O8RA 3DFOA 4RXFA 2GVLA 4FNUA 1LORA 4OHQA 5BNKA 4WQ6A 1TB3A 3ELFA 2BTMA 2RHGA 4LVBA 1IGSA 3HG3A 1VCFA 3LXBA 4CLMA 4NUWA 3TAKA 3BG9A 2CLIA 1IIHA 3W2JA 1LLWA 4CCEA 2VENA 3W1LA 1TV5A 3PC0A 1O5XA 1SFJA 3LCWA 2Y7GA 3B04A 3R5EA 5CPNA 4DXVA 3NDOA 1LOQA 1FWTA 2Y85A 2VEMA 4Y96A 3O16A 1FWWA 3QC3A 2TSYA 4MY1A 5FF2A 3LXAA 4PC8A 3RF9A 1P0NA 2O7SA 1KM4A 4X22A 2FPVA 3GX9A 1I2RA 8TIMA 1TSIA 3QQ1A 3V75A 1R30A 3P74A 4HPXA 4IUOA 5G2IA 3S1XA 1OFEA 3UY8A 1TRDA 3G22A 1I4NA 2WOQA 1BWLA 4HIBA 5FF4A 1VJIA 1A5BA 5CSSA 3CU2A 3N2MA 1EX5A 1D3GA 2W0UA 3G0UA 4N9BA 4ADUA 2ZZ6A 3M5ZA 4ML9A 1TO3A 1TPDA 1THFD 5EKYA 4YCOA 2WNQA 3EXTA 3BGGA 1H1YA 4H3DA 2ABAA 5KZEA 3QZEA 3F4NA 3VE9A 4HN4A 3PSWA 4FXRA 2BLEA 5K4XA 2JBMA 5EBUA 5F4WA 1KFBA 1SO5A 4QIUA 3OVQA 1VRDA 1RV8A 2B0MA 1DL3A 3CIWA 1AW2A 2E68A 1ALDA 2DZXA 3P7YA 3GXTA 2EGZA 1WXJA 3P5ZA 3S5NA 3W1QA 2FQIA 4NZJA 3T55A 4Z0SA 1AW1A 1KFJA 2VEIA 2HS8A 3S8HA 4ZQNA 4JTKA 3L5LA 3O6DA 3SW6A 2ZZ1A 2NV1A 4RCXA 3JRKA 2VKZG 2FTPA 1C29A 2GJNA 4XBKA 1TTPA 3GDKA 4TMCA 2PC4A 5K9DA 1QO5A 3W2NA 2QJIA 3MYOA 4LV9A 2Y89A 1H5YA 1KFLA 3PWAA 1HUVA 2QUTA 1IXQA 1MEWA 3NOEA 3W2LA 4AAJA 3L66A 1A5SA 1PCWA 4JIPA 3RK8A 2B4GA 4IXXA 2A4AA 3FKKA 4A3UA 2VFDA 4DBDA 3CIXA 2ZCGA 3G1AA 3HIJA 3T7VA 2YZRA 3A24A 4Y6GA 5LNUA 2RDTA 2E5BA 4POCA 3DAQA 3ZR4A 2W79A 2AAMA 3HBLA 2ZYFA 1W8SA 3NQ8A 2E6DA 2Y7DA 1LRQA 1YDNA 2J27A 3E02A 4ZL1A 3TK7A 1B4KA 3KHJA 3RLUA 3N73A 4CNNA 1QO2A 5TBOA 3S1VA 2NLIA 4CNPA 3LBCA 4WJEA 2DORA 4HSNA 3G3MA 1N7KA 4WY0A 4A22A 4E0CA 5BMWA 2WO5A 2JKEA 4K36A 3NQ6A 3LX9A 4MY8A 2QF7A 4WOQA 5EL1A 1OFQA 1FWSA 4Z1DA 3EX4A 4UNLA 1F6KA 3G1VA 4RZ6A 4WY0B 3B06A 3PB0A 3LRLA 2DJLA 1FWRA 4RJEA 3GAKA 3STGA 3W7HA 3OVPA 3PAJA 4O15A 1SO3A 5I3FA 2CLMA 4DF1A 5FESA
chains in the Genus database with same CATH superfamily
3W75A 4IM4A 3KVJA 3E9AA 3KTSA 5REQB 4QSFA 4BKNA 4P61A 4OQVA 2G95A 1K02A 3H2AA 4WJXA 3DZ1A 4DAIA 1JCYA 4LBRA 3VXGA 2WVVB 3KLLA 2WPGA 1MXSA 3EMQA 4GACA 2J6XA 1V0MA 3I4KA 1ITXA 3QHOA 5HUOA 1DV7A 1XLAA 1W9DM 4JAWA 3W83A 2CPUA 3MMUA 3CUFA 3IJLA 3MHFA 4FXFA 4DQWA 1ZLPA 4DXXA 1OT1A 3CT7A 2X1TA 4JIQA 4UTIA 5DX7A 2V9DA 4ZQCA 3CHFA 3G1FA 3L4WA 3E0LA 3PTMA 3MC5A 3P0XA 1U1UA 5EA9A 3KBNA 4ZBCA 1KLYA 4REQB 4Z42C 1OGGA 2GLKA 3S47A 3EB2A 1H63A 1TV4A 3OODA 1WDWA 1JQVA 3GXMA 3KLKA 4LX4A 3LM7A 1O5RA 1MDRA 3DGBA 1EGVA 1JDAA 1ISVA 1WUEA 3L21A 3VM5A 2QJNA 5EYWA 4ZE5A 4H9VA 2V69A 1IT0A 3WBAA 3S0CA 1SR9A 4ZZ9A 1A4LA 1OX4B 1MO0A 4WR3A 5L6UA 2CLOA 2CHNA 5U4NA 1PO9A 4C65A 3NQDA 1UC4A 1NARA 4UFIA 5CZJA 4S38A 3DFHA 3LQLA 5CH9A 4IL0A 4IFKB 3D3FA 5FF7A 2OSYA 4DN1A 5CEWA 3KOYA 3BWWA 4N02A 3SFWA 1GOWA 1Q6RA 2OT0A 4ONVA 1DWJM 3QGKC 4PN2A 1PBGA 1I9CB 2HNHA 2F6KA 3GU9A 2J77A 2HZGA 4AH7A 2FVLA 3EWYA 4HU3A 5TIMA 1OCQA 2REQA 3C6CA 3Q94A 4BF9A 2YCLA 1W56A 3GIQA 2A1YA 5G1YA 3NQBA 1B3XA 2PLMA 4AWSA 3C52A 1EOKA 3OG2A 5I7GA 4LAMA 4JX6A 3UA3A 1S2AA 1HJQA 2ZRYA 2FZ8A 1H7OA 4QAIA 2XFWA 1OFBA 4MKVA 4PMQA 1FDYA 2FFIA 2P8CA 3AHVA 5KEZA 2YJQA 4UQCA 3GDLA 3DN5A 5I3IA 5CXPA 4FLQA 3UCDA 3JZEA 5KZ6A 3SFKA 3HJZA 2V5CA 3W88A 3B3DA 3GG0A 5E6ZA 3G6MA 4GK8A 4WJ8A 2DFAA 5F4XA 1XLMA 3AIRA 1L6SA 2BV9A 1MQRA 1HGYA 4L9YA 1ECEA 3ZYZA 1EB3A 3K1GA 9CGTA 3ZVHA 2QAFA 3GIPA 2JF7A 4YPJA 2VDIA 3EB3A 4S2CA 3B8IA 1H60A 5C55A 3H7UA 4FS9A 1KM6A 4O28A 4AB4A 4NU7A 4XKYB 3GNOA 3CNYA 3M46A 1NQKA 2BGNE 4JZ5A 2V82A 1CGTA 4FA3A 4NAEB 3NM3A 1UMLA 3LY0A 4PTDA 1AQMA 4P7QA 4NQ1A 3MU7A 1JG9A 2CIPA 2FDSA 3II1A 2UBPC 5A6SA 2F8QA 2XISA 3SGUA 5HMFA 4JHZA 1FXPA 3OVGA 1E9ZB 3ZMRA 3AMGA 2CBVA 1OFPA 1KFEA 2OSXA 3P82A 4HN8A 2ISVA 1E6PA 4ACZB 4G2DA 4C7DA 3QH2A 2ZIDA 2J25A 4DELA 3M7SA 2PI6A 3SZ8A 1JPIA 2WNZA 3DERA 1J5TA 2WBGA 1FQ0A 5GNXA 3ABXA 2QKFA 3LI0A 4HHMA 3RLGA 4QS5A 4C1NA 1ZJIA 2DT3A 1FWGC 4C1KA 3MSRA 1Q6CA 1UD8A 4E6MA 3ALFA 3WNOA 5LZLA 2L5HA 3P67A 5BOFA 2VI0A 2E8ZA 4LAKA 3WF4A 2XU2A 4JIEA 4AIOA 1DKWA 2XVKA 3KL3A 3FS2A 1F3XA 2XZ9A 3RFAA 3MHUA 2C6QA 2FZBA 2WAGA 5CSUA 1R5YA 1W17A 4UWMA 2H90A 4HK5A 1CWYA 1KBIA 2VDGA 3L4VA 1KGXA 5FSDC 1H11A 2O7QA 1YQ2A 4LUJA 3M0VA 3QQWA 3PM6A 1GVQA 1E1FA 1RVGA 3REQB 2PTXA 3QBUA 1DQUA 1Q45A 3EOEA 4EXAA 1EZWA 2FJKA 4Y9OA 4ORMA 2PP0A 3JR2A 4KW2A 3ZFHA 2XN1A 2VR4A 4CNOA 5LYRA 3NQVA 2VC5A 4W4QA 4ES4A 3VCRA 1XQLA 3VILA 3VNMA 1W1IE 1DJGA 2PWVA 3W7RA 1KFCA 2PTDA 2GVJA 1RHCA 4HZ8A 5IOBA 2Q02A 5DY3A 3RU8X 2FIQA 2Y4SA 1Z7AA 4XUYA 1Y65A 2PRLA 5A8QA 1L0PA 3CLMA 1QR7A 5C71A 3BDKA 1Q8JA 3WD1A 3SGZA 2VEPA 1EC9A 1IR1A 3VZYA 4CCCA 4Q22A 1CYGA 3UR2A 3IK4A 4I3GA 4KPLA 3MMWA 4ACYA 3O6YX 5FJUA 3MHGA 1TIMA 1U5HA 1VC4A 1SW3A 2VGGA 1MSSA 3N2BA 3OZOA 2ZRWA 5LIWX 4RX0A 3KVLA 3M5XA 3MBFA 1TQJA 1AMKA 4M24A 3VZZA 3ITCA 1JNEA 3AZTA 3NWRA 1FWBC 1UD2A 3ATZA 3HO8A 2GOUA 2YSWA 4KFOA 1CB2A 4PL1A 1ZTVA 5CPLA 2XH0A 1B9BA 4ZQMA 2GOKA 4KETA 4JHMA 1QPQA 3K8KA 2OJPA 4RDVA 5I06A 1J93A 4QCEA 4HA0A 5G5IA 1P6WA 5EMKA 2NLYA 1Z89A 4XAFA 5AZ1A 5K9XA 4EPBC 3W02A 5C5YA 4YTSA 3H22A 3O6AA 3MUAA 1EUNA 3QFEA 1KWGA 4LQ1A 2YYUA 3OP2A 1EX1A 2WWCA 4GX9A 4ZXOA 2X30A 3RPTA 1R47A 3H2EA 3BCJA 3WBYA 6TAAA 4DUOA 4PCTA 4LVAA 5JVLA 3ITLA 3RUBL 1C8VA 2XTKA 2BGQA 1UUQA 3EWWA 3VO0A 3PZMA 4LGXA 3V36A 2P0IA 3W7KA 4L5ZA 3NVDA 4E38A 2O9TA 1EPXA 5HMSA 4DEFA 3C0QA 1P4CA 1RR2A 1LWJA 1QPRA 2ISSA 1DHKA 4PRWA 1UWAA 1GKPA 4PMOA 1RQBA 5I6SA 4TV5A 3KWXA 2AMXA 1YE4A 2UV8G 1FP8A 3L4XA 2CHOA 3EMZA 2WPBA 1WQ5A 2FJUB 4ATDA 3NO1A 3GWQA 1TJ2A 3VZXA 2B7NA 5AC5A 4JFTA 2PF8A 2Z1SA 4XBJA 1CX9A 2QHAA 3OVRA 3F4CA 3CUZA 4IICA 4GXMA 2P10A 5XINA 4O19A 4HYVA 3KVMA 4YXGA 2E6AA 1JQXA 2DUXA 6XIAA 1XI3A 1DWFM 5AYBA 5HMEA 5D04C 2VVNA 4L6DA 2H3DA 1KA9F 1CIUA 4MPKA 2W4XA 1KRAC 4H7VA 1EUAA 3W7DA 2AQWA 3IGSA 1PDYA 4G1KA 3GXIA 4LT9A 4UB9A 1EYWA 1HG3A 5HNNA 1GOKA 3V3WA 5E9AA 1W9UA 3W2UA 3WQVA 4GC3A 1EJTC 1PTGA 4DJFD 4HNTA 1MW2A 2P3ZA 5CSYA 1XGZA 4UTWA 1GVFA 4W84A 2D0FA 4V2XA 4ZQRA 4ZVJA 2WKGA 3CZ8A 2VC6A 2ZX6A 4DWSD 5LNSA 3WJXA 1LQAA 3N6HA 1TWWA 2YW4A 1XIJA 4IPLA 5EY5A 4HSHA 2ZXQA 1FKXA 1JPHA 1E0XA 3DI0A 4FPSA 4KWOA 1Z44A 3DHFA 2Y5JA 1GVRA 1F7BA 5FEPA 3QKEA 3CWOX 3CUIA 3UWZA 4C6MA 2ZQ0A 4PCNA 4F0KA 2IUZA 2JEPA 3M0XA 3NDYA 1F2JA 1MUWA 1M9HA 4B5TA 4GZ7A 3WUGA 4Z2IA 2FB3A 7ENLA 1HNYA 1ME9A 4LUSA 3E5PA 3OA3A 1T41A 4WCJA 1XF0A 3ZSTA 1EZ2A 3TLQA 4WX2A 4GQQA 2X2YA 1XG3A 4FNTA 3NGFA 1M7XA 4U28A 1JFXA 2WVSA 4G6CA 3SY5A 4MUZA 1W1A1 2D3NA 4X0NA 4LB4A 1VFMA 4UIOA 5CG0A 2VX7A 4LRTA 2X16A 3P80A 3L0GA 3ZSSA 3CWNA 3LLDA 2RDUA 4JN7A 4JTDA 1E55A 3L12A 3OHIA 3ZLGA 2RJGA 1UWUA 1K7XA 4JNYA 1AQ0A 2E5CA 1KD0A 3OYZA 5I02A 1D3CA 2OT1A 1MWOA 4H41A 3ME3A 2WSKA 4GY7A 4WXZA 5JH1A 1V51A 4CU7A 1QPKA 1OABA 2X1IA 4PUJA 1O1HA 2Z1WA 2PLKA 3XIMA 5FJJA 1GHRA 4OTKA 3R6IA 4N42A 4CQ9A 4OUIA 2JKAA 3ABSA 3WH9A 2ODOA 4LV4A 5K3VA 4GZEA 1J8VA 2PDLA 2G50A 3FOKA 1C8YA 4X2RA 4ECLA 3AJ7A 4IMEA 4QX4A 3WH7A 4UNIA 2AL2A 4NYYA 4O1FA 5E0KA 2YA1A 5LA0A 3QTPA 2GZXA 4AZIA 3TDFA 3HV9A 4KCWA 3TUUA 5BOOA 4X9YA 2ZC8A 2Z7GA 3BGAA 3GTHA 2A3LA 3PWIA 3NL2A 1S3TC 1WKEA 1MUMA 1YNQA 3QY6A 2C16A 5IHSA 2HSAA 1YEYA 5DFAA 1FUYA 3WFZA 1TTIA 5HINA 1EL3A 1YDOA 4JTRA 4TTGA 1XRVA 3NCOA 4DO6A 2VL4A 3KZPA 4JX4A 3UNTA 3MKCA 3MUXA 3WQ4A 1LL4A 1XCFA 1YX1A 1N8IA 3QC0A 4YL2A 2QCNA 4FEZA 2WSQA 4JXCA 4L4LA 3NXFA 1V0LA 4K8GA 1IV8A 3KW3A 4OECA 2PGEA 3PBUA 2XPKA 2EPMX 4N6EA 3HB9A 4W86A 3STEA 4OVXA 4KCTA 5HA7A 1IWAA 2BY3A 4PRTA 4DYEA 3LS9A 2H9AB 2PRHA 1GVIA 2AAAA 3PBYA 1FVPA 2GPTA 1I0DA 4I5RA 5FI8A 3QRHA 2JFEX 4WGHA 4GO9A 2GJLA 3D0CA 3W70A 6PTDA 4O16A 4GCAA 4W5UA 3ABOA 3BANA 1L6FA 4GIRA 5JIWA 4S1FA 1CGYA 2VCCA 4DUXA 4PMXA 3W81A 1E1CB 3PJXA 3IARA 1OYAA 3WEMA 1FCUA 3SCRA 4QDMA 3TW9A 4XKYA 3WK0A 2Q3OA 1HP4A 1VFHA 2HBXA 3RNDA 3H26A 3KXQA 1UB3A 4N4QA 1OINA 1V77A 1ICSA 3AWOA 4GI4A 1HVXA 4QQ3A 3GXPA 3N17A 3M9YA 1GEQA 3T1GA 1VFFA 1UJQA 5B7ZA 4AFYA 3WF2A 3QSTA 4H8NA 4X63A 3FVMA 4AZ6A 3P14A 3RO8A 3I3DA 2CESA 1W3HA 4PMNA 1QI4A 1TWSA 3DFYA 3VIMA 3F1QA 1UUOA 3W1AA 4Q7BA 5FAJA 1PEZA 2ACUA 3K8MA 4XZIA 3THCA 4AVFA 4I6VA 5FL1A 4AWEA 2AGTA 1GVEA 2D2GA 4G1NA 4D6EA 3PZ9A 1F5ZA 4C90A 1B2YA 3W26A 2QEZA 2PCEA 5LNVA 3NUKA 1QI2A 4CCDA 2NW0A 3SY8A 4HMDA 2VP8A 3E2VA 2NSOA 4CN6A 3MO4A 2PDWA 2HMCA 3VNDA 1DHPA 2XGZA 1Z6KA 1AL8A 1KFKA 4MGGA 1E0VA 4YMZA 3AYRA 1TMLA 3WK3A 1C7SA 1UIOA 2IXUA 3WNNA 1U1HA 4IT1A 4ML4A 2A3BA 2OO6A 1O94A 2GGHA 3EKLA 3KCLA 3O6CA 3HM7A 3UWQA 3MANA 4QE4A 1EA9C 3H23A 3ZIZA 1Z32X 1E1CA 5JBDA 1FWCC 2PCQA 4D6JA 3PTQA 3AMCA 3T0TA 4MWAA 3UYIA 1D2KA 4KEMA 3SRDA 3OGRA 4RR4A 3NFUA 3WUEA 3WQOA 2QCHA 1O7AA 3OZMA 1P5BA 3O07A 2V5LA 2GGGA 3T4WA 4B3ZA 1Z48A 1I2NA 4GABA 4UQAA 1C91A 4BS0A 3WNLA 4AF0A 7ODCA 1T8XA 3WF1A 4ZQOA 2QW5A 4UMBA 3U6WA 3VKDA 1IT8A 3NDZA 2ZUSA 1UKTA 1T0OA 3N9SA 1E6NA 1OK6A 2WW5A 2NT1A 2HVOA 1C9DA 3WLRA 1NF0A 5J5DA 3VD9A 1IE7C 6REQB 5XIMA 3N14A 2V0TA 4MYXA 1HJWA 5SWUA 1NEYA 1IEWA 3PNUA 4BF7A 4XZNX 3SJNA 3TXZA 3CMGA 4WRHA 3PG9A 4PBGA 4WOZA 3TCSA 3LM3A 5E5CA 2ZA2A 1XSJA 1QU4A 2WVVA 3QPEA 1KM3A 1B57A 5JIPA 1JDDA 2Y5SA 3O0KA 1PS9A 3NL3A 4PEEA 5ABEA 1C3FA 2PZNA 5CBBA 2Y88A 1LOLA 4Q6JA 4I9TA 2OLSA 3C56A 4M5PA 1K1DA 1VBRA 4F0RA 2X41A 3MMTA 1H09A 4ROPA 4R34A 4JTQA 3MV11 4QSHA 4Q8MA 5C7HA 2G5WA 1V3IA 1NOUA 3BMXA 1FY6A 2NV9A 2WCAA 4FX6M 1V6UA 5A6KA 3DC8A 2X0SA 4IIEA 3W76A 1K7EA 3BLLA 4KGJA 4AIUA 2VQTA 1Y7VA 5ECVA 1FKWA 3K13A 3EX6A 3IRDA 1F61A 4UQ9A 5A6BA 1YNYA 1OYBA 3KCJA 3CMJA 4ENLA 4BQ4A 1TJPA 4GINA 1XBYA 2WHKA 3M0YA 4FR1A 3AIUA 3MWAA 1EHAA 3C86A 4MG4A 1DIKA 3VDGA 3PTKA 4QP0A 2WQPA 3BLKA 3UJRA 3P2VA 3VGFA 1P1XA 1KM5A 4TXEA 3MCOA 2BNJA 1WO2A 2P1FA 2PTZA 4GUIA 5AHEA 4MPQA 1WKDA 3PJWA 1JRBA 4URIA 3W73A 1R2SA 4A4AA 3R79A 4LYKA 4UR7A 2WZEA 1PCKA 1F74A 3MKKA 3NSMA 2CW6A 2OSWA 5M3WA 1EP1A 3NL5A 2ZX9A 3T2QA 2QJHA 1P0DA 4LALA 1UPMB 1HJSA 3BPWA 4H01A 1E6QM 3GDBA 4E4FA 4AEOA 3NZGA 4Q4MA 3TYEA 5G2HA 1A5KC 3ZS4A 3ARSA 1W54A 1NVMA 4AISA 3U4AA 4O52A 2WC7A 4RUBA 3LTSA 3EZ4A 4QJ3B 1XXXA 5JUVA 4F48A 3T0DA 3MZNA 4O54A 3TYCA 1A50A 3IJQA 2QMKA 3FX4A 2QJMA 3GHSA 4ZO8A 1CXLA 1R87A 4J35A 3XINA 4IISA 3EEGA 4GRSA 3APGA 1EGMA 1Q6GA 2EXOA 3OB8A 3WL1A 4NZFA 1H7NA 3W7LA 4KCVA 1EF3A 3SO7A 4IMGA 4QROA 1S5MA 4KEUA 1PZ0A 4O1EA 1RP8A 1HGWA 1QATA 3U3HA 2PDNA 3C2YA 1F4AA 3CZLA 4DZ5A 2WNNA 5M03A 2QIWA 5G1TA 3O8AA 5D2VA 4WK9A 2PSNA 4Q8PA 3WENA 3NQCA 3NQ2A 4B90A 2PUZA 5KZDA 4AU0A 3VAVA 4GIAA 4GH1A 2P5NA 1JYXA 1XFBA 1OG6A 4AF0B 3CUXA 5IBXC 1J4EA 2J7DA 4XO6A 1BYAA 1R3WA 3ITOA 5EPDA 4HBKA 1ZBVA 1AW5A 1ZALA 3DYPA 4A8IA 1G4EA 2PDUA 5U7SA 1PSCA 1YXYA 2OKTA 3FV9A 3UWVA 4ZTYA 5I09A 3GDTA 5D05A 3TR9A 3GNRA 1T96A 2E9MA 5F2IA 4DI8A 3FSTA 4Q32A 2Z2AA 4NJIA 2QMJA 3N12A 1M03A 5HUPA 3CQKA 4JNZA 2GVYA 1ZBWA 3E5BA 3VINA 1IEXA 3WMSA 4IPPA 2WXDM 3EDKA 3NSXA 1TR9A 4TU1A 2VELA 3FJ4A 4RW5A 1W3TA 1KRMA 3TN6A 1WAWA 4DJDC 4GHRA 2BHZA 1GWJA 1TWZA 4DAFA 5D30A 3W23A 1H5VA 4PL2A 1DWHM 1BHGA 5CPSA 3WUBA 1UH2A 2B7QA 2NX3A 2P0OA 4AHOA 3V1HA 1QPOA 1SMAA 4YWSA 3GXNA 2OZ0A 3PPGA 5CLWA 1X7FA 1LQ2A 2ZRZA 1WKYA 2PF0A 3S1WA 4XTIA 1V3JA 3SEPA 1J2WA 1E0WA 5XIAA 3W84A 4WKHA 1G1YA 1B3WA 1S3HA 1QOQA 1YPIA 5DEZA 1G7VA 5J04A 3C3UA 1SSDA 1U83A 4FF7A 2XN0A 2VFFA 1BF6A 2C91A 1BD0A 1NTHA 5G1MA 4EPEC 1XR2A 2J7HA 5HNRA 1V93A 1VLIA 1C7TA 4LPCA 2ZDSA 4U10A 1O6IA 3APYA 1OGSA 2PDCA 3WNMA 1QBAA 3A9IA 3UG4A 4XVDA 3RM4A 2OELA 3UR7A 4W9TA 4IPIA 2E4TA 1XIGA 4DPPA 2HNEA 2ALRA 3L4UA 4HPNA 3UWEA 3LQGA 4N6FA 5GNZA 3UVIA 4UQDA 3GH5A 4Z1BA 3R25A 5KINA 3W1UA 3JUGA 2QVNA 1OADA 4O8RA 4QCFA 4RXFA 3R4IA 4IH3A 1ZQ5A 4OHQA 3IS4A 6XIMA 4Q8VA 3WDHA 3A9BA 2EQDA 4DJDD 4H9YA 3LXBA 2PAJA 5EFDA 3ITVA 3BG9A 2CLIA 1MXGA 2FZDA 4D6CA 1KKOA 4B9ZA 3W1LA 3PC0A 4LB3A 3B04A 3R5EA 3THUA 3NDOA 1FWTA 2Y85A 4DYKA 4W85A 3QC3A 3VIFA 1HKJA 2PDKA 2O7SA 3CH9A 2FPVA 3SCNA 1DIEA 3BQ5A 3PBGA 2OYLA 1PXGA 3V75A 4Q8NA 2WC4A 4ERGA 2AMGA 3S1XA 4DNMA 4LUYA 1C90A 1V7AA 1OFEA 3OO2A 4LCRA 3VOGA 4PUMA 5A6MA 1RPKA 1F8IA 3CU2A 3MVTA 3CLWA 3VNKA 2ZZ6A 3M5ZA 2PTWA 1TO3A 3WDQA 4HMNA 4HNLA 2W63A 5KZEA 4ZCWA 3F4NA 4Q4PA 3SN0A 3OLDA 4QLKA 4FXRA 3VC5A 4JL2A 4PE8A 5EBUA 3FDKA 2W5FA 1V3LA 2BOEX 4RDZA 4MKSA 1AW2A 2E68A 1QNOA 3D47A 3GXTA 2EGZA 2RGLA 5T9BG 2A79A 3ARRA 2VEIA 1CXIA 4ZQNA 3O6DA 3SW6A 3UT0A 3CWHA 4RCXA 2V3EA 2FTPA 1C29A 3AZRA 3URAA 1TTPA 4U33A 3WQ5A 3HZ3A 1QO5A 5BXTA 5H8UA 2WQDA 4V28A 1CLXA 1KFLA 1HX0A 4JIPA 4XAGA 4W7VA 1XYFA 4XIAA 2V3DA 2XM1A 4S3AA 4XZHA 2VFDA 3CIXA 4LBSA 3HIJA 4WDUA 3E2RA 5RUBA 2PWUA 3KWSA 3NZPA 3A24A 4D1IA 3IJ9A 2E5BA 1CBGA 4POCA 2PODA 3ZR4A 4X60A 4Z2HA 2YDQA 1E9LA 3HBLA 3TP4A 3E0VA 1W8SA 3TJIA 3LZ5A 2VD9A 4HMEA 4B16A 2J27A 1PZ1A 1VD6A 4LAZA 4F4RA 1KFWA 4P8XA 3S1VA 4KBXA 3LBCA 4WJEA 3UG8A 4ZSUA 1AH3A 3WH5A 1EBHA 3GY1A 3ARQA 2P88A 3HFYA 4A22A 1A5OC 2BHYA 2JKEA 4XG1A 3KS5A 4MY8A 3NTYA 4Y9PA 1FWSA 4UNLA 3G1VA 3EKGA 3B06A 2DJLA 3AHZA 1FWRA 4RJEA 3GAKA 3STGA 3VOCA 3OVPA 3M0JA 4O15A 2R24A 1SM9A 5I3FA 4DF1A 4Q7IA 3IGXA 4ERIA 5C8BB 2DVUA 4E4UA 1FTXA 3AUJA 1IXOA 2XYLA 2Y8KA 1RBAA 3AFBA 1B3YA 5CJNA 4WD0A 4GG9A 1Q7QA 3CZJA 3WG6A 3ECQA 2QLYA 3IWPA 1AL7A 3AIQA 4WDXA 1CCWB 2XWDA 3R8RA 3T2OA 5BRQA 2R1KA 3QM3A 3LV5A 3CHEA 3AS2A 2HDJA 5HXMA 1CGWA 2GUYA 3UY7A 1KC7A 3WLHA 1P0EA 4KRZA 3B05A 3F5JA 1D7FA 3ZT5A 3LEPA 2VX5A 1SFLA 2WMGA 2QVHA 5AHFA 1S2UA 3M43A 3HJEA 1EA0A 3O3RA 1Z42A 2HVNA 1R3RA 1R3TA 4XZ9A 4UFKA 4LS0A 4XVEA 3MP3A 3AQUA 2Y7FA 1G9HA 1UIPA 1KBBA 1UR4A 2WZMA 3KBSA 3PZTA 4EP8C 3NQMA 2Z0IA 3DFQA 5DMYA 1Z69A 3HTWA 1DTNA 1FDZA 1TE1A 3VI2A 1A80A 4ZOAA 2OLHA 5HR7A 1V6YA 1X38A 1FP9A 3ZR5A 3UZYA 4I5UA 1J10A 1LOSA 4TR9A 4PMYA 3SUWA 2D73A 3MSDA 4I6KA 4MFEA 3VE7A 4AYGA 2ICSA 1UUMA 1BTMA 2XFFA 1EJUC 4BI5A 1TPUA 4LAUA 1ME7A 3TJ4A 4BZYA 3H4XA 3EA2A 3V16A 1EWEA 1UBPC 4RZ4A 1S2WA 4L4PA 4LW7A 2O92A 4P8WA 3BV4A 4QTGA 3STFA 2ASHA 2NVAA 1G6CA 2YDRA 4IG2A 1CXKA 3PP7A 4IJCA 5B7YA 5DY2A 1S5WA 3B8UA 3TKFA 3WF3A 4IGMA 3HPXA 1PHWA 2Y8UA 3IIXA 3W07A 3KEHA 5BW6A 1SYTA 4GIYA 1I8JA 2W92A 4JNMA 4H9MA 5M5DA 1UH3A 2G37A 3RCMA 1JGMA 2DT2A 3GR8A 1P48A 2OYMA 4HSOA 3CHDA 3S5ZA 5CGTA 3ARUA 3PPFA 2RH9A 1VKFA 3MT1A 4HCHA 3UXIA 3M64A 1R2TA 4O12A 4GQRA 3NYDA 3AHTA 3MYPA 1WCGA 4LVFA 5AHNA 4J1OA 3TNOA 1B3ZA 1X6LA 2WC3A 3MV01 3QW3A 4AEFA 2R91A 1ZSXA 3K2GA 4PGLA 5HQMA 2AKZA 1EP3A 1FWNA 1MQPA 1WZLA 3IANA 5IDZA 4AC7C 1DE6A 2FKPA 1W1VA 3TNBA 4AUBA 1ZPTA 5E1QA 1MW1A 4CD6A 5D9PA 4X3ZA 2J88A 2O9OA 4B5WA 1OJXA 3K4AA 2FVKA 3O9NA 2BHUA 1LT8A 3M4HA 3DG6A 1RD6A 3TX9A 4ZO6A 1Q85A 1TZZA 3CH0A 1H62A 1B3OA 2G3FA 1G7UA 2VZOA 2WK2A 4UMAA 3GDRA 2QZRA 2Y0FA 4D8LA 2Q8ZA 3MB9A 1CENA 2FZMA 2GGJA 3UNDA 5KSWA 2AQVA 2A6LA 4OFCA 1R9ZA 3OIHA 2WZIA 2CKSA 4ALDA 2VFIA 2QCLA 1XM3A 3RLHA 4B5NA 2I57A 3YPIA 1M7OA 4G7EA 3I68A 4CQBA 5HPCA 2PDHA 9XIAA 2YXXA 2UY4A 1UBSA 1Q2SA 4DYJA 4E2DA 1L6WA 2OZ3A 2Z4GA 2C8NA 1DQXA 1OFOA 1PIGA 1HL9A 1NIUA 1UPPA 4GYKA 3VIHA 2F84A 4ZSTA 1WUFA 4PYSA 3WELA 4XSLA 4FSAA 3KBWA 1HKIA 1RQEA 3QVQA 2YOCA 3P62A 2WMIA 1S38A 2MNRA 3LLXA 5M17A 5AN7A 3REQA 5TAOA 4EK7A 4HPHA 1XSKA 3BMVA 1DPMA 4YWIA 4EOUA 3TE9A 1VFUA 5CZSA 4S3FA 4XUGA 5DMLA 1DP0A 3OGSA 5CAHA 1XICA 1R7AA 4ILSA 2J47A 3RN6A 1YYAA 5BU9A 4M1BA 2EKCA 2R94A 3C2VA 3W1PA 2WLZA 4NI8A 3UR5A 4GH3A 1TPC1 1BFNA 5JQ9A 3L4YA 3M6DA 4A3HA 1JAEA 4FXSA 1ITCA 3SUUA 3KBVA 1GYMA 1AD4A 4TQTA 4JTGA 2PRMA 4DNHA 4MLJA 4WKFA 2NUYA 3LHWA 3OYXA 3FSUA 1XD0A 1B90A 3R13A 1A3HA 3GLCA 4BEQA 2OXNA 3WF0A 1PIIA 3N4AA 2DSWA 1V4YA 3TSBA 3VU2A 3G0XA 4M51A 2FB2A 4KCUA 5TQLA 3WO8A 1JI1A 4FB7A 2QCDB 2Y6ZA 1IT7A 3URNA 1EJWC 2DJXA 2JEQA 4Y7EA 1NM9A 1IWPA 4UTFA 1VPYA 2ZUTA 1Z9AA 1DJZA 1VR6A 2CXGA 4CD5A 1WZMA 2YBTA 3PSVA 3BW2A 3WIJA 2ISWA 5EMLA 3BK0A 4L6OA 5CPMA 3W01A 4UTKA 3AJXA 2GJXA 1MYRA 4Y8FA 1SZRA 1VIZA 3B40A 1TQXA 2XVPA 4YHEA 2CYGA 2VURA 2CHRA 4ATLA 3F5LA 4ZFMA 2IQTA 1RBLA 2J24A 2OGJA 2DZUA 1TCDA 4Z1CA 1QPNA 1UOZA 3G1HA 2TPSA 1XRFA 4JKMA 1I1XA 1LBLA 1LM1A 1EXBA 1TVPA 3W87A 3H53A 1RSCA 3EXSA 3VNZA 4ASTA 4L56A 3S2MA 3VMPA 4DRSA 3QPYA 2DZVA 4A8LA 5FSEC 3T0AA 4GUHA 1BKHA 1E4NA 3URQA 2ZX5A 3BUVA 3BLDA 4O10A 5AYIA 3GKAA 5PTDA 2G3JA 3NM1A 4H4IA 4KERA 2F6UA 1CZ1A 2GSEA 5LSMA 3N4EA 3OG3A 3WQGA 1XIEA 5E9XA 1QNPA 5AZ0A 3GW3A 4IZGA 2PFHA 4D6DA 1AD1A 3SGGA 3NVTA 3D6NA 3OBEA 1EYEA 1H61A 4RK8A 1GOQA 2CLEA 4BA0A 1EBGA 1W2VA 2B81A 1XDLA 1V0NA 4XD5A 4QE5A 3B9AA 1LTDA 1LRTA 1BVNP 2VDHA 4CD8A 1GPFA 1XIIA 2VEGA 4G7EB 2FMOA 3SSZA 1L2QA 5E0CA 3OBKA 1JCLA 1KV5A 1WP6A 3TN4A 1AA1B 3GIYA 5LNWA 3VPLA 2OYKA 3NR0A 1LP6A 2XGIA 5A2BA 1BXCA 1Q63A 1Y0EA 1MNSA 3EB4A 3MDUA 4LFYA 1C93A 2YCEA 4AYSA 2NVCA 4PFHA 4DBEA 1WYIA 3DOPA 3BJFA 3CASA 1UWQA 2FHCA 4JD4A 2IW0A 3RX3A 1CI1A 1FXQA 5BRPA 2FHFA 2WLYA 5HR6A 4J7RA 3CYJA 3LBMA 4MLRA 3DFPA 5AHIA 3CGTA 2E1DA 2ZXBA 1JZ7A 2W66A 1VHCA 3E74A 4TO8A 4MWAB 1WDRA 2VRQA 4I9AA 1PYFA 4NX5A 3FJ6A 2YBVA 2J75A 3P93A 4IQDA 1RY8A 3O0FA 3H2CA 5EMJA 1XBZA 5GPRA 3VMNA 1BWVA 5BCAA 2DSVA 1MI3A 1R7OA 1B31A 3PG8A 3V4BA 1ADSA 3L65A 3PZNA 1JD7A 4M7SA 1HFBA 2BASA 4ZA0A 3RXZA 4JFSA 4IGSA 4AMAA 3FDGA 3OBAA 2OPJA 3TN5A 3B8DA 3FHQA 3DKLA 4DPQA 2WZTA 4F9DA 2POZA 1XLIA 4M6PA 4J27A 1KO0A 4UQEA 1M3UA 3UPMA 1IXPA 2ZDRA 4F2BA 4JL1A 1MW3A 6A3HA 5FJIA 4NIRA 1FHUA 4NRSA 1TYGA 4HD5A 4LAOA 2BXVA 4F2UA 4JFVA 2DY3A 3VKJA 3UZXA 1AQFA 1SR0A 4V27A 2ZUVA 3CC1A 3W27A 3FEMA 4M56A 1ZFJA 1TJ1A 4U31A 4RZBA 1DTUA 4UFMA 1FH8A 4R53A 1MUCA 3B0XA 5D2XA 2WM1A 3RRXA 4Q8TA 1B9ZA 4PUDA 3U8GA 4NJHA 5A1AA 3FFSA 1A0DA 4JY8A 2XSAA 3TZFA 1E6ZA 3DYMA 2BMBA 1JPKA 2QCMA 1IZCA 4UMCA 1CXFA 2R6OA 3EPNA 4YTRA 2WBKA 3W86A 3M7WA 1OT2A 3SCPA 5GQBA 3A47A 3CV7A 1KQYA 1SW7A 3WLPA 3QGVA 3U7BA 4A6GA 2AL2B 1KM0A 3V18A 1M53A 3QR1A 4B4FA 2W61A 3MZ2A 3WLLA 3CV2A 1V7YA 3B03A 4CQDA 3A23A 3MUIA 1J0YA 1F3TA 4N9EA 3KUMA 1RD5A 1V3MA 1NFPA 4HKPA 3PBVA 2XSBA 1TREA 1VCVA 4PR4A 2BY1A 4LYQA 3VKKA 4FOKA 4GFIA 4MYAA 2Q01A 2XVNA 3IGHX 4ICMA 4AD0A 1VBHA 4O0ZA 2EF9A 3EBVA 3RHGA 2WSPA 1XH1A 3V5FA 2DGAA 1JPDX 2ONEA 3OQ8A 2GQ9A 4PB5A 3NPXA 1EXPA 3W7QA 2Z27A 2PWDA 1LRNA 3U5YA 4B3LA 1TUFA 3GU1A 1IXNA 5ABHA 3RX4A 2DP3A 3H54A 3M6YA 3STCA 1R3VA 4QG9A 5FEZA 3TTYA 1S1PA 4JQ2A 4P7OA 4XZBA 3KRSA 3A21A 1KNWA 3T0CA 2FPYA 4UFLA 4QS6A 1UA3A 1DWIM 1W0MA 4GWEA 5AVHA 4R5EA 1BGAA 3A3XA 3CUGA 1LQ0A 1MZHA 5AC7A 4IL2A 4B5SA 3F2BA 2H6RA 4YTUA 3DI1A 1A5LC 4HJWA 1XCWA 4NAEA 1A5AA 3LPOA 3W7IA 1IGWA 4AZ5A 2NQ5A 3C4UA 3BO9A 4RDWA 4IJRA 2QDHA 3S5OA 1RQHA 1XISA 3C61A 4ACZA 1K7FA 1TMHA 4RNJA 3O06A 1XLJA 2FMNA 3R0UA 3BURA 3FYYA 3KOWA 3SI9A 4M7TA 4Y8EA 1C9WA 4JR5A 2NQ9A 2A85A 3EX3A 2DT1A 4PCPA 4HGXA 1PAMA 5F2LA 1FH9A 2XINA 4JFWA 1OGBA 2ZRUA 1LBMA 3HQ1A 3QR0A 3KRZA 1G01A 4IMCA 1HQTA 3LZ3A 2HPMA 1X97A 3R11A 4W8AA 2PGWA 5FJRA 2GUBA 3WNKA 4EXQA 3SN4A 1TPEA 5HULA 3EPOA 1IF2A 3UJ2A 4CNSA 4HA4A 4XWUA 4C1LA 1X1OA 2PDPA 4QR6A 1JVNA 1JEZA 5C54A 3MW7A 2X1UA 3U2EA 4ZQPA 1I60A 3C8FA 1NDWA 3DG3A 1DOSA 4JN6A 2J74A 1QRQA 2GQ8A 3KTCA 1U5VA 5DT7A 3GZ3A 4AW7A 1GVSA 3F5KA 1WXZA 4BF5A 3TYAA 2RDXA 4ICCX 1RH9A 2VCBA 3T44A 5CJMA 4MY9A 3SRFA 4PODA 3FW6A 4NP7A 3WH8A 3WZ0E 3A5VA 4QLLA 4Q33A 3BSMA 4C6NA 1OF6A 2A7RA 2GK1B 2VTFA 4CGTA 1K9TA 1PE1A 4CNTA 1CEOA 5KZMA 4O4VA 4W87A 3GBDA 3GZAA 1W5NA 4OZOA 4NNBA 1QOPA 1U33A 1UWRA 4YHGA 4RLIA 2X09A 3DHDA 4IX0A 1GT8A 4KRTA 3EWXA 3MP5A 5A2AA 1ZCOA 1LL7A 3C5QA 5FEWA 1Q5MA 1JL8A 1AMYA 4G5DA 2EG7A 4LC8A 5KMYA 1UCWA 4NSBA 4OOUA 5CBIA 1E1EA 2NZLA 2WMHA 1R9XA 4DZHA 4MDOA 5IM51 3WEOA 2PU1A 1IR2A 3BICA 2F38A 2V63A 5C9ZA 3PNZA 4GKTA 1A5UA 2E9BA 2OKOA 2XN2A 4LOCA 9XIMA 4KEVA 2X0YA 2R1NA 3N04A 1TPH1 1NU5A 2PB1A 1AK5A 1XKYA 3LMZA 4IIBA 1L8PA 2Q8XA 3L5AA 2DZBA 5AB3A 1IEVA 3E0IA 3VX1A 1S5VA 4IOTA 4INFA 3UBPC 4O1AA 1L6GA 8A3HA 3FCPA 4TIMA 4AQLA 1M41A 3M16A 3FY1A 1W9VA 3KAOA 3N4FA 3M1ZA 3EAUA 2TYSA 1OC5A 4JTEA 4UTWC 3TQVA 1ODZA 4BR1A 4BK9A 1XIDA 2G41A 1DYSA 3CZGA 1ZJAA 1QCWA 4LCQA 3E3HA 4JYEA 1BSIA 5AFDA 3S5YA 3UXDA 2RGMA 3GH4A 3H2FA 1XYMA 1EF2A 4PMDA 3BLIA 4AHPA 3COTA 4PMRA 4XB3A 4HJFA 1JUEA 1X1NA 5EU9A 4HHHA 4I90A 4C6LA 2OEKA 1H7PA 1VEOA 2VWSA 3ZT6A 2XFRA 3IEBA 4NZ5A 3V0UA 1RVKA 1H49A 1TMQA 5FACA 4LNCA 1TWIA 2ZZ5A 3B4UA 3HOJA 5IRPA 3G0SA 3G2GA 3CQHA 2I5QA 4JDYA 2CXEA 2DSZA 4DF0A 4DO4A 2O55A 3H55A 3OU8A 5TNVA 4O11A 1FHLA 2BXZA 4I9MA 4OV4A 3LCIA 1SZGA 2OODA 1AUSL 1W32A 1LLZA 1ITUA 4MZ8A 1KCKA 1CXEA 1I6NA 2OZ8A 4M8UA 1AH4A 4QM1A 3LA4A 1A3XA 3DEQA 3FNDA 4TOQA 3GNNA 1WZKA 4Q4QA 4NJJA 4O14A 4UTLA 5T8GA 5DXXA 1X1ZA 3HGSA 3CAVA 2OU4A 2PMQA 4KWWA 4QXIA 4P8UA 1LWIA 3SCSA 1L6YA 4K1GA 1W5OA 4JTCA 3GXFA 3LG3A 4HZMA 4NRRA 2QPXA 2WSRA 1OCNA 2OLAA 2A7NA 4RPPA 1HXJA 3BSGA 4RL3A 2EKGA 2SFPA 3UZWA 4CEUC 1W37A 4M0XA 4KS0A 3UG3A 1K8YA 3SIZA 1EJ7L 3RPDA 2QR6A 3WQ8A 4LXFA 4H6EA 4Z08A 3KOZA 2X0HA 2WVTA 1ZB5A 4H7CA 4NG3A 3A3WA 1XYAA 5DCEA 3VC6A 5HPOA 1RJPA 1TX2A 2I9EA 3MMDA 3L67A 3CUHA 1DXIA 3GTIA 4EPKA 4AZCB 2O9PA 3PHAA 2VJXA 2F7FA 2YB1A 4J3XA 3W72A 1F07A 3BLEA 2D0GA 1ONRA 3KRUA 4ZODA 3HQNA 5I23A 2IPFA 1FBAA 1TPFA 5I5RA 1VFSA 4NY2A 4PTXA 3SIMA 1LG2A 2XIIA 3O05A 4K8EA 3VGGA 3GB6A 2XH4A 3I3EA 1XC4A 3VKAA 4RXGA 2DUZA 1MXDA 4UCGA 3F2CA 4PFMA 4JICA 1TKKA 5CZTA 4XSMA 4PTWA 3NAVA 1PTAA 3MP4A 3USBA 3BXWA 2OQYA 3PFRA 3AWNA 1E3ZA 1XYBA 2HV5A 4N9DA 5I77A 2R8WA 3R7MA 3RIKA 3DX5A 3TC6A 3BLOA 1TX0A 1E5JA 4QRNA 1SW0A 3TYDA 4NKCA 1XUUA 1W6TA 2PEVA 4J9JA 4PB4A 3F7JA 3QHNA 4LSBA 3H6OA 4GXWA 1BYBA 5JBEA 4YCPA 1TA3B 4R33A 2Q6ZA 3EA1A 3AMLA 4HK6A 2DZAA 3C0JA 1R46A 2FLIA 1GJPA 1OVDA 4HCDA 1KCLA 4QEEA 4JKLA 4PUWA 3QTGA 5BXRA 3DHPA 4NJGA 3M5YA 4XX6A 5FEXA 2PTYA 1Q6QA 5CAKA 3CTTA 1Q6EA 2DT0A 1FHDA 3F4DA 2KX9A 1SMDA 3LPPA 4JEQA 3DUGA 2ZICA 4DJEC 1F6PA 1GEHA 1GOMA 1W3NA 4IMAA 4QITA 4Y90A 4V1YA 2G4JA 1PVNA 5CGQA 2W62A 3TU9A 1A4MA 4OKDA 4L1XA 1NOWA 2BVYA 2PDJA 3IUDA 3T78A 2CNCA 3W85A 4C6IA 1SO4A 3R8HA 3UR8A 4HHPA 4MFDA 4JY9A 4JQAA 3W7OA 2HE8A 4QDWA 4DF2A 3UGRA 4MSSA 3MBDA 3CL7A 3RCNA 4NI3A 3TMQA 4GMEA 4A29A 2P50A 3EWCA 1TIWA 1X8CA 4ROQA 3TV8A 3E49A 2D2OA 3PZGA 3JZUA 1U5JA 1H41A 3OHMB 5G4EA 3R0KA 2VUYA 1H4PA 2A5HA 3TROA 2OOGA 2NQHA 2XVLA 3A22A 3POCA 1CLKA 4UCFA 3JU2A 3WKZA 2W6RA 2WWDA 2C19A 1GPWA 2QPUA 1RCXB 2O56A 4PCSA 4R7OA 3DFOA 2GVLA 2GVEA 4FNUA 4H8VA 3ZJ6A 1BAGA 1TB3A 1E56A 1MDLA 3ELFA 2BTMA 2RHGA 1GJWA 1IGSA 1VPQA 4D6IA 4CLMA 4HA3A 3BJTA 1IIHA 3QOKA 3N2TA 1OD0A 1OWQA 3U2CA 3RYSA 2FZ9A 2G8ZA 2J7GA 1J2BA 4YIWA 2Z7KA 4MUPA 1FWWA 2TSYA 4MY1A 2CEQA 5FF2A 2EPNA 3BLPX 3FK4A 3TN3A 2DSKA 3U48A 1NDYA 2XIMA 1E40A 1TVNA 1IQ8A 3ZXWA 5CC5A 4IQEA 1I2RA 2QIIA 1R0MA 1TSIA 3P74A 5M1TA 4IUOA 4Q8QA 3UY8A 1TRDA 1BWLA 4HIBA 1ONXA 5LIXX 1HL8A 1US0A 2IKGA 2YCJA 5CSSA 3N2MA 1EX5A 2W0UA 3AHXA 4ADUA 1D7KA 1EDGA 1TPDA 4YCOA 1TG7A 1H1YA 2ZKMX 1NWRA 5MF5A 2HCVA 3GNXA 4X2PA 4JEJA 5K4XA 1OCJA 2F2HA 2PZ0A 3CV6A 3VUPA 4QIUA 3OVQA 2B0MA 2YA0A 3CIWA 1TZ9A 1ALDA 5H1WA 4GD0A 3SRHA 1WXJA 3QKZA 3S5NA 3W1QA 4NZJA 2C79A 2HS8A 2VQUA 3IJ8A 1HVQA 3S8HA 2DH2A 4JTKA 4DI9A 2NV1A 3S1GA 3GDKA 3VIOA 3LNMA 3WD2A 4K1WA 5K9DA 1EO5A 2QJIA 3CQJA 4LV9A 5C7VA 2BDQA 1HUVA 2QUTA 1NDZA 1MEWA 4YTQA 4AAJA 3B9EA 1A5SA 4AIEA 7TAAA 1LT7A 1EH9A 1QNRA 2BVTA 2NQJA 3WLIA 2INFA 3PWGA 5HNTA 4A3UA 2VZTA 2ZCGA 3G1AA 4XD3A 1DWAM 3DESA 2GK1A 3T7VA 4MMWA 4CVUA 4UOJA 2GGEA 2W79A 1JCTA 2AAMA 3FA3A 3ARXA 2OVLA 1YDNA 2IS7A 4ZL1A 4Z2LA 1B4KA 2VWTA 2WVUA 1XKJA 4CNNA 1GK8A 4U5IA 4CNPA 1A5NC 4HSNA 2KAUC 2VC9A 3VOIA 3IAQA 3TA9A 1N7KA 3QLDA 4GVFA 4WY0A 4J5NA 4E0CA 4RNFA 1TZ7A 4A8NA 1V02A 3LX9A 2XVGA 5EL1A 3CZKA 3EX4A 1F6KA 3T8QA 1ZJBA 3PB0A 2PD9A 2VNCA 3NOYA 3MVIA 3TTSA 1SO3A 2DH3A 2CLMA 4E3VA 2NX1A 4NT0A 3ZZ1A 4WDWA 1A0EA 3FJLA 2GWNA 2E6YA 5DELA 1XQKA 4CU8A 4LC6A 2CKRA 4US6A 2E7FA 1CW2A 1F3EA 3G18A 3IV8A 3MUCA 4C6DA 1PZ3A 3QYQA 3TCEA 4EAMA 2FPTA 3M0MA 2E67A 1ISYA 2B31A 1M7JA 5D8WA 1G4PA 4LVDA 2VGFA 3SCVA 5GJPA 3BCFA 4J28A 4C6PA 3MPGA 1OF8A 1ZNNA 5A94A 1AVAA 1RAKA 5A6TC 2ZOXA 2O4QA 2R1MA 3PFMA 3NIYA 1R2RA 1GJUA 2VZSA 5HNUA 5CBJA 4L1GA 2YXGA 2W3ZA 3IAPA 2XUCA 3LUTA 5MKGA 2V38A 1HKMA 1F8MA 3GC2A 3CS2A 4L64A 1GVYA 2PWHA 5FF3A 2G96A 1LYXA 1RALA 3USZA 4LS1A 3HGRA 3CEUA 5C0QA 1LCOA 2AOSA 4GYPA 4YNGA 2DVXA 2WM0A 1W5MA 3TSDA 3HG4A 3GAYA 2B7PA 5LIYX 3DFNA 1JI2A 2INZA 4PSPA 4XAZA 3NEVA 2Y5EA 2J9XA 1E0TA 3SJ3A 1RLCL 4QE1A 3I6EA 4GUJA 2YBUA 5I3GA 3QY7A 4IWWA 1CNVA 2PLCA 3LPFA 3PY2A 3VKCA 2HK0A 4CVWA 1VLWA 1Y5XA 4WF7A 4M82A 1Q6LA 1YPFA 2I56A 2G3NA 4LS2A 2J9ZA 3CO8A 3EYPA 4RNIA 3GG1A 3EOSA 7CGTA 3MS8A 1XYLA 2C0HA 1O95A 4C6CA 3I3BA 1P6CA 1XYCA 2IPJA 3DDMA 3AU6A 2HBVA 3S9IA 3ICJA 1I0BA 1LDCA 3DU0A 4JTUA 3GFXA 5D37A 5JXQA 4AX7A 1S2CA 4K37A 1V8EA 1J12A 1DBTA 3OW1A 3LNPA 4DX3A 1Q8AA 4U3AA 1RJRA 1XLKA 1AFSA 1XPYA 5F1VA 3W1TA 3OOQA 5LIUX 4A2RA 2GUUA 3W7GA 1GZ1A 3RILA 4HTYA 2WNWA 3WQ6A 4OV9A 1Q66A 2Z24A 1SSGA 4P7RA 1X96A 4B91A 1T6MA 1E15A 2VOMA 3U0HA 1P0KA 1PUDA 4WEVX 3ZJ7A 3Q45A 1PX3A 2WSYA 4LY4A 1I2OA 1QXLA 1OIFA 4YYCA 3P60A 3JVAA 4JKKA 3H70A 4QLJA 5C9XA 8XIAA 4QAWA 2XM2A 2CZFA 2V2DA 3C2OA 4H9TA 3CMFA 3HGJA 4K8HA 3PUDA 3FKRA 5BRBA 3W25A 1L2UA 2ISFA 2ZC1A 3BG3A 4PCFA 1OD8A 2G3IA 4Z2KA 1NJJA 3ZR6A 4RV8A 4AY7A 2X40A 4D9PA 3PVFA 3AXIA 4ZB5A 1D8CA 1V79A 1E72M 4L7ZA 3SCUA 4LJ3A 3QZ6A 1N82A 3L0KA 4S39A 5BXSA 3Q37A 1FCQA 1ODUA 3GR7A 5CSRA 3EXRA 1AJ0A 3UGVA 4E2BA 1BG4A 1KR1A 3AIVA 3M44A 1U22A 2HTMA 4YLWA 4CN1A 1Y8BA 3ARTA 4R7JA 1F3WA 4WSKA 1V6TA 4PULA 4NF7A 4GOAA 1QI0A 4EWJA 3PPHA 3VD5A 3C8NA 2YGYA 3WFLA 1JXJA 4K3ZA 4ZO9A 3O1NA 5I2UA 4R9OA 4H9UA 3VGHA 1E6XM 1P43A 2V5KA 2PURA 1JYNA 2MUCA 2LLEA 3R10A 1YBQB 4DJDA 1ZY9A 1W1ZA 3V35A 4MAZA 5BMXA 5HK4A 1PKYA 4C1NB 5DBUA 3G6LA 3SQLA 4RE4A 4E4PA 1M5WA 4GVGA 3HQOA 5I3KA 5HWJA 1KM2A 3TYZA 3HV8A 1R3SA 4QG8A 4J40A 1F9CA 3I65A 4UTMA 1SJBA 4IIDA 3WD0A 1PDZA 4AD2A 1N55A 3WMBA 1ZHAA 2OX1A 3AALA 1XLEA 3EOOA 3IGUA 3GYCA 1SFTA 1RXOB 2UY2A 1LWHA 3S9ZA 3DXIA 4FXJA 2J4GA 3NEHA 3E0WA 4JQ1A 4LVGA 1ZL1A 3SAZA 1I2PA 4O17A 1UD5A 1TPB1 4OIFA 4JIHA 4XZMX 5C2CA 4KQNA 3N2CA 5A8GA 2PDBA 3GTXA 4FK9A 1V3KA 1VS1A 3PUGA 5TD4A 1Q3NA 2HRWA 3PR2A 3M0KA 4RDYA 3CHVA 3B9NA 2C13A 5H6HA 1AODA 1QK2A 4W7WA 1SUXA 4AHQA 3ATYA 4KWUA 2V2CA 2WANA 3WLJA 1L9WA 4J3ZA 3ANYA 5GJMA 4KF1A 1XL9A 3G1DA 1RA0A 2OQLA 2CLFA 3NPUA 3NL6A 1Y5WA 3MI6A 4UOQA 2P3EA 4JTFA 3T40A 3VCCA 3FXYA 3G1RA 2H3BA 1TTQA 2FFCA 1SZEA 3E2QA 1ZAJA 1NDVA 2HEJA 1B4EA 5A6AA 1ZAHA 3ZM8A 4P7LA 3QW4B 1RLDA 4V33A 5EBAA 5B80A 1FCVA 4D6HA 1AZ2A 3IRSA 5GJNA 1K70A 4OUEA 2XZ7A 4HZ6A 5D03A 2GSJA 4NZ3A 5HQLA 1J0IA 4QBXA 1ZP3A 4M6QA 1FCBA 1FWHC 1LROA 5DRIA 3W0KA 1QMLA 2XH2A 3FEQA 5A69A 5A8OA 1NFGA 2P8BA 4KFNA 3W29A 1UYQA 4R9XA 5GVJA 1ISXA 3N11A 3LCFA 1LUCB 1QI3A 2R1LA 2NUWA 1OFAA 1XUZA 2VEKA 1XS2A 1OX6A 2IQ0A 1RA5A 5CQ1A 1XDMA 4ZB2A 5D02A 5AC4A 1KRCC 3SR7A 2VX6A 3W2KA 2CBUA 3AXHA 4F8XA 3N9KA 2ZX7A 2PA6A 1GW1A 4HU4A 1X6UA 2PDYA 2H8ZA 4FAMA 2ADAA 4N2YA 3IPWA 3EX2A 2W91A 4FHAA 3MKVA 3RRAA 2ZA1A 4O4WA 2YCKX 5H8PA 2V6AA 4C6FA 3GDMA 2YFNA 1B30A 3E0FA 4IP7A 1PIFA 2X05A 2PGRA 2TMDA 2WHLA 3UYCA 1CPUA 4Q8UA 3IJIA 1E51A 4XTDA 5AOUA 1GTEA 3BAIA 4H83A 3TZNA 3VIIA 3UETA 3DCPA 4BWLC 1TJRA 5ENLA 4QGCA 4KWSA 4LBUA 4KMQA 3L9CA 1HZYA 1FX6A 1WDPA 4QNEA 4M6UA 1PPIA 3QGAC 2J7EA 2FH8A 4E3TA 5I0DA 4Q7NA 2J62A 3E96A 4A35A 1DE5A 3BH4A 3PZUA 2NV2A 2V30A 1ZENA 2IXVA 4RPQA 3Q2DA 1VYPX 4DBWA 3WLTA 1W3LA 5AYZA 1WX0A 1XDJA 3KM8A 4UQBA 3SSJA 1UWIA 4XIMA 4H1ZA 3WX7A 4I7WA 1SFSA 1AH0A 3LCHA 2CLLA 3WQEA 5ABFB 2OTDA 1BQCA 2J8FA 4P5UA 3NYZA 1TR1A 1SZFA 2J79A 3N3MA 4K39A 1GONA 7XIMA 4Q8WA 4DWSB 3PN8A 3GQYA 4OOZA 3WQPA 2I5GA 2ZVRA 4JCMA 4ZOEA 2DZPA 4QISA 3G8EA 5C9UA 5CGMA 1UASA 1U2YA 4HMCA 1TPVA 3ZQ9A 1U1JA 1TRIA 3LCGA 3DENA 4HCLA 4BCEA 3AOFA 1Q2RA 2XJ7A 3T4CA 3W00A 4XZLX 3MUY1 1VH7A 2E28A 4XZWA 3I10A 2PWFA 4ORIA 3TTEA 2FDMA 1BWKA 4GNKB 1J0KA 1YTKA 5I24A 2VR2A 4PRRA 1A3WA 2QUVA 3E1F1 4I8DA 4KEZA 2X1SA 4GI9A 1UWSA 1V0KA 4QFUA 3DHUA 3BZJA 1KXVA 1EDQA 4XAYA 2BZNA 3PAOA 2VFGA 5D33A 1UP2A 3HN3A 3UJSA 1VB9A 2G0WA 1FFRA 2X2GA 1JF5A 1MFVA 5TF0A 2C0AA 3VNLA 2ZUMA 2WHMA 2WJFA 4TX6A 3R8GA 2OZTA 1BYCA 1WDSA 3V0SA 1QWKA 2CZDA 3U7VA 3A64A 3ENLA 3RMJA 2WV8A 4O0KA 1T5AA 4BI6A 1O4UA 2J66A 3LMYA 1YTDA 2DVTA 3A4JA 3LSCA 4EIVA 3L5MA 2QF8A 1GYNA 3DFSA 1JJKA 4DJFC 3BW4A 1QW9A 3R0DA 2WJZA 1R85A 4AXKA 2PDFA 2VRJA 3VIPA 3F2DA 3H2OA 4JTIA 2V5DA 4W8BA 3JS3A 4XAPA 2FZNA 2BOGX 3WSUA 4EF9A 4IQJA 1HTIA 3K1DA 4FOUA 4CN4A 1T7LA 3N18A 2YX0A 4IGNA 4ZEPA 4DWSA 3W2MA 4UZSA 2HXUA 4NILA 3VKBA 3UEQA 5HMDA 4JYFA 4A3YA 2C18A 1V6XA 3H7VA 3CQIA 4JX5A 1UD6A 5FL0A 4QJ5B 1ITQA 1JCXA 3G1SA 1HN1A 1FRBA 5HWMA 3Q4DA 3NXLA 2VFEA 3L23A 3HPFA 2NWSA 4GBUA 4HPJA 2D20A 2CETA 4MNKA 4AIBA 1UROA 4GNVA 3ITXA 3QJAA 4GZIA 1PV8A 3W6MA 2Z1XA 1KCZA 3QZAA 4HZ7A 3L2IA 3EX1A 1LLOA 3V5OA 3P8JA 1P7TA 4D8ZA 3UQNA 3EA3A 5HQEA 1NWSA 3O7UA 2EG6A 4HK7A 1EFZA 3BOXA 2WKLA 2YCLB 5D32A 3T05A 2ZE0A 2XSXA 3STPA 3TXVA 4WVXA 4IP4A 2WJDA 4FZIA 1H1NA 6ENLA 4IQLA 1B5TA 4KWVA 4PBFA 4GYJA 4X61A 1YPXA 4FNSA 1FWIC 4QJ1A 3DECA 4OE7A 2CFFA 2BODX 3VIGA 1JUKA 3BG5A 3LDVA