1TB3A

Crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
332
Chain Sequence
b'PLVCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKRNQLNLEAKDLRALKEASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREVVAAVKGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISPDLIQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyacid oxidase 3
publication title Crystal Structure Analysis of Recombinant Rat Kidney Long Chain Hydroxy Acid Oxidase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 118
structure length 332
sequence length 349
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tb3A00
4OV9A 3A5FA 4O16A 2QAFA 5D09A 4WOQA 4PA8A 3PBUA 5D37A 2I14A 3NEVA 3ZWSA 4UFIA 1QCWA 1XUUA 1LBMA 2GPTA 3VI2A 4JGDA 3WJSA 2V0TA 5AHNA 2EF9A 2VENA 2WO5A 1F76A 4I9AA 5D05A 5LHEA 2YFNA 5BMXA 3T55A 2LLEA 3NL2A 1TV5A 3G1DA 4UFMA 5AHIA 2C16A 2C13A 2NZLA 5D38A 3GDLA 3C2FA 3NR0A 3O15A 3M5YA 5U4NA 2ISVA 4Z1AA 5CPOA 2H90A 2YPIA 3PVFA 3EX4A 2ZTJA 4ZQCA 1GQNA 4NT0A 1B57A 1P5BA 3GKFA 3KFTA 1B4EA 1OYAA 1KFKA 1SW0A 4JTTA 2PC4A 2HS8A 3GX9A 5FF0A 1VLWA 5DCBA 3LBCA 4RK8A 3CIWA 4JEQA 3ZFHA 2BXVA 1ICQA 1F6KA 3ATZA 4A22A 4CCEA 1RZMA 2OZ0A 1I4NA 2NX3A 1GT8A 4OU1A 2C19A 3LTSA 2YFOA 4Z1CA 3LHVA 3NQMA 4IWWA 3FYPA 4HHPA 1I45A 4DPQA 1LRNA 1YLVA 1H1YA 1T8XA 4NJHA 4LW7A 1EWEA 1KLZA 3G3MA 2QCCA 3PAJA 3OG3A 4JTLA 2AAMA 3LRMA 3UWQA 4HIBA 2WKJA 3MI6A 3C52A 4LVFA 1HL2A 1IGSA 2Z6JA 4ZVJA 1XI3A 4HNVA 4A2RA 5CPLA 3W85A 4NJIA 1MEHA 4Y9AA 2DP3A 2HTMA 3NG3A 3IIXA 2CW6A 4IPJA 4JYEA 4NX5A 1X6UA 4TO8A 2WSRA 1H60A 3TAOA 2NWRA 5IM51 5A5WA 4JS3A 3P5YA 2ZZ3A 4OWGA 3P81A 3DHFA 3LOTA 1U5JA 5C5YA 4GUIA 4IX2A 1B4KA 3NQDA 3O05A 3TQKA 2VELA 4WY0F 3W84A 2UV8G 3N34A 3USBA 3L65A 4N2YA 3FEMA 3NZ1A 3GYEA 3M47A 2JKEA 3E9AA 3N2MA 1K02A 2X1UA 1RVGA 1YTEA 1IXPA 4Y8FA 2C15A 5KZEA 3HO8A 1FDZA 1AW2A 3HF3A 3G8EA 1ZCOA 1VRDA 1HO4A 2KZHA 1GVFA 3PUEA 4N9EA 1SW3A 4N02A 3MP4A 2QF7A 1XBVA 5D2TA 4FXSA 3VNDA 1OJXA 4QSHA 2G97A 1G69A 5A8GA 3DKJA 1SFJA 4RXGA 1TPH1 5G1YA 2B7OA 7TIMA 2BWGA 1PCKA 2QCNA 1R2RA 2CLOA 1ZJIA 4GUGA 1TJPA 2E5CA 1W3IA 1VYSX 3ATYA 4UMBA 3BGGA 4IMDA 2RDTA 4YMZA 3C61A 4JTEA 3EWUA 3QW4B 4WJEA 2R91A 4TX9A 1VH7A 3KVMA 1EUAA 4UFLA 1W31A 4K38A 3W1QA 1JCXA 2TPSA 5F2LA 4S1FA 3QM3A 4FXRA 1SZGA 3GR8A 4HNNA 2FPYA 4AHOA 2RH9A 3TKFA 4R53A 4TR9A 5EA9A 3VFLA 1MEIA 4CQ8A 3F4NA 1YADA 2ZRWA 2CZEA 2TMDA 1MEWA 2RKXA 4ICNA 1M5WA 1CX9A 3B0PA 2Z0IA 3PG9A 3W7CA 2D73A 2BSLA 4XBSA 4BF9A 1OFOA 1SFLA 3KXQA 4N6FA 4QQ3A 3HG2A 4P61A 1DKWA 1M7PA 3W1NA 4MVAA 1H1ZA 1TPFA 3O6CA 4JYDA 1FDJA 4M7TA 1PV8A 1VZWA 2WV8A 3N2XA 1KM0A 1UJPA 1WOAA 3E02A 5AHMA 2NX1A 3W2KA 4LS2A 4JY9A 1HUVA 1OK6A 4PCFA 2FLIA 3LGEA 1XCFA 4HN4A 2ZZ1A 3DFNA 1FX6A 2X16A 5I3KA 5K4ZA 4JTGA 3NM3A 4MKNA 2R94A 1MO0A 1LOSA 3CM4A 2CFFA 4WD0A 5G4EA 4PEKA 4MLRA 2CWNA 4MOZA 3NGJA 1PE1A 1TQJA 2DJLA 1D9EA 4UIOA 3BARA 5LZLA 4KFOA 3CPRA 2RFGA 3W22A 4K7YA 2NUXA 3G1FA 1FY6A 3CQ0A 3PBVA 3W74A 1DVJA 4JDYA 2Z6IA 5F2GA 3P7YA 3OA3A 3JRKA 1Q6LA 4WZHA 1B9BA 2CZFA 2TSYA 4MYAA 1R2SA 1SO3A 3NL6A 5FF4A 1KV5A 5DBUA 1EP1A 5TIMA 3LTYA 3NZRA 3L21A 1KBIA 1SUXA 5HULA 2FJKA 3SIZA 2ZRUA 1FCBA 4PL2A 4GUHA 3C3NA 1LORA 3GZ3A 1TYGA 4LC6A 1L6SA 4WQ6A 2Y85A 3UWYA 4KKXA 4MY9A 3B06A 3IIVA 4MZ8A 3W9ZA 1SSGA 3S1UA 4UCGA 3STGA 1PCWA 1A5SA 3Q37A 3CU2A 1H51A 1QR7A 1GVQA 1WYIA 3TUUA 1SW7A 4NQ1A 3W7IA 3L0KA 2HSAA 1S5WA 1S5TA 4FNSA 3IGXA 4ALDA 2VKZG 3MUXA 3W7RA 1OFQA 2B7QA 3NA8A 5EMUA 3RMJA 1UCWA 3L66A 5LKYA 2XN2A 4WX2A 5CG7A 3O16A 3C2VA 1HO1A 2J24A 2R8WA 1VJIA 5K9CA 4AH7A 2H3BA 6ALDA 4QAIA 3WK3A 1EA0A 2ZRYA 3G0UA 1SZFA 1Z42A 5KITA 3W7QA 1KFCA 2E5BA 3W7JA 4K6AA 2FQIA 4AHPA 1MZHA 2WJZA 3H54A 3I7QA 1JCMP 5FF3A 4AMAA 2J27A 3RLUA 1WA3A 4AWUA 2V9DA 2DZUA 1VGAA 1W54A 3T4CA 2OT1A 5DELA 2V30A 5HUPA 3B4UA 3QJAA 5D2VA 4HPJA 3P84A 2W79A 2A2IA 3DBPA 1F7BA 3G18A 5CZTA 1YXDA 1I8JA 4Y90A 4RCXA 1R2TA 2FPVA 3B0UX 1TPUA 1W3TA 1YPFA 2ZFAA 3TK7A 4E0CA 1I2QA 1XBZA 3NQVA 3W7OA 1U83A 5D33A 1KM5A 1FCUA 1VCGA 4LU0A 1LBLA 1X8FA 3QC3A 1GYNA 3O07A 3GNNA 4O28A 1JJKA 1EIXA 1XFBA 3EWYA 5AC6A 1JULA 4UFHA 2QCEA 4A21A 3TMQA 4FNPA 3U2OA 1DJQA 3A23A 1LZOA 3D0CA 4O11A 3R5EA 4LVGA 4RZ4A 5I3HA 4N9BA 5ABTA 3CWNA 2QCMA 1TB3A 3MMTA 2XN0A 4UR7A 4X22A 4O1DA 3ZR4A 1IXOA 3LERA 3SGZA 5KZMA 3BW2A 4PL1A 3R89A 4AWTA 6TIMA 3S5OA 3BLFA 4QM1A 3TXZA 1OFPA 1R46A 3S1XA 1I2PA 5F4WA 3S8HA 4EF9A 3R8RA 5I3GA 1X1OA 1QDSA 4BR1A 4ZQOA 3NL5A 2H8ZA 5D30A 4IGHA 3W23A 4W9TA 3H55A 4OV4A 1K7XA 4PC8A 3GAYA 5HUOA 3NQ2A 3P60A 3LXBA 4Z1BA 4K36A 3EX6A 1TPB1 4YCOA 2G95A 1FQ0A 2O7SA 3NO5A 1O5XA 4FEZA 4JNMA 4GFSA 2PRHA 4NX0A 4DBDA 3FOKA 3M5XA 3GDTA 4H6KA 4O14A 3UYCA 1V7YA 1LOQA 3DU0A 4JY8A 3IEBA 1K7FA 1WXJA 3G24A 3P74A 4FIQA 2C0AA 4O8RA 1I2RA 3EX2A 2V2HA 2ZRZA 3W72A 3BO9A 1R47A 3FLUA 3RFAA 3PC0A 2R14A 4LT9A 5D02A 2A85A 4Z1DA 4JTFA 1GJPA 4KFPA 2QJGA 1YXYA 2B0MA 1RQBA 3GR7A 3W1TA 3W2MA 1T99A 3JS3A 3P82A 1LRTA 4YCPA 4ZQRA 5I3FA 2NXIA 3SZ8A 4BI7A 2ISSA 1OG0A 3MW7A 5HWJA 2ABAA 4U4MA 3DI0A 1VYRA 3R12A 3W75A 1LCOA 3OVPA 4O0KA 4O10A 1L6WA 4UFJA 2Y7EA 5HWNA 5CZSA 1XBXA 5AC8A 4JD4A 4PODA 4N4QA 1LYXA 4A2SA 1YTKA 1YDVA 4UMAA 3LLDA 3G1AA 3PUDA 1MSSA 1Q6OA 1ONRA 3EKLA 1P0KA 1UASA 4TMCA 2CZDA 2DZXA 2ATMA 1G67A 2E1DA 1W1ZA 2GQ9A 3UQNA 5KINA 3LHTA 4YXGA 3QQ0A 1JUEA 1W8SA 3ZS4A 2DZWA 2NXHA 1DOSA 1W5PA 5H91A 4WOZA 3TH6A 2DZVA 3S1WA 3PBWA 3L0GA 3HB9A 4O53A 3W6YA 4PFMA 3HG3A 2Y61A 5E93A 2YX0A 4O12A 2CLLA 3LRLA 2FIQA 1FWTA 3HJZA 1TPEA 1LOLA 2YDAA 3DAQA 3W86A 4BI6A 1WDWA 4OQVA 5F2IA 5LNVA 2PCQA 4C1LA 4MFDA 4WUIA 4GJ1A 5LNUA 2WPBA 3A9IA 2VXNA 1PHWA 3KHJA 3LRKA 1T0OA 3M16A 4ML9A 3PG8A 2C1HA 4U28A 4DELA 1IIHA 4RLIA 2FDSA 2JGYA 4IUOA 1TJRA 1VHCA 3UXDA 3BG5A 3HOJA 1SU5A 1YDNA 3MHFA 3VCRA 1WX0A 4IMFA 3W71A 3W7PA 4KWVA 4OE7A 1NF0A 2VEIA 5C6MA 1PHQA 2OT0A 1WV2A 4B5NA 2QCDA 1NF7A 3DH7A 3I6RA 3S5YA 3ABRA 1IF2A 3HG4A 3STFA 4FF7A 2CLEA 3W7MA 3F4WA 1GYLA 3LCXA 5EBUA 3PR2A 5LGZA 1IXQA 2ZZ4A 4IMCA 3OBKA 3N3MA 2E77A 3OVQA 2F84A 1OYCA 3NPVA 3Q58A 2BX7A 1L9WA 1VR6A 3UNDA 1J5TA 2A6LA 2A5HA 5G4WA 3DI1A 4UFKA 1Q6QA 4BI5A 2G96A 3DENA 2A6NA 3UXAA 3PS7A 5CKSA 3Q2DA 1VLIA 3HGRA 3I7SA 3DKLA 3WK0A 3NPXA 1XUZA 3C56A 3G1XA 1K8ZA 4WXYA 4MZ1A 1G7VA 5FESA 2ZZ5A 2E09A 1GG0A 2CLKA 2NXGA 1VS1A 3FKRA 4O19A 5K4XA 1GVOA 4E2BA 4LVDA 2E6AA 2G5WA 2I9EA 5E1QA 4JN6A 5DBTA 4HPXA 4JTIA 4LVBA 5FEWA 1DQWA 4UTTC 4DBEA 5G1TA 3TQVA 4AAJA 1F2JA 3C2EA 2J6XA 2ZA3A 4BFAA 3CIXA 3KVKA 5TQLA 1QWGA 3TW6A 2C3ZA 2A21A 5DY3A 1F5ZA 3B8DA 4QJ1A 3E0IA 2GJLA 4TU1A 1DORA 2QCGA 4M7SA 3THAA 4M6QA 1TMHA 3AO0A 1TPVA 2OMAA 4ADTA 1BTMA 3P8IA 3L2IA 4NNCA 5G2WA 1GTHA 1P4CA 3TE9A 2VC6A 1F05A 3NXFA 3HGSA 3GDMA 3TAKA 2H6RA 3S6DA 2PURA 4POCA 1KFJA 1D3HA 2YR1A 3AJXA 1NEYA 3RNDA 4Q32A 1TO3A 1FWNA 3B04A 2X1TA 1J4EA 1I2NA 4OT7A 3ABQA 5U7SA 1H50A 3LM7A 3RLVA 2YW4A 3W3OA 1GZGA 3EXSA 2J9ZA 4A29A 4DQWA 1FWRA 3TIMA 3SECA 1ZY9A 3G3DA 4AF0B 2Q3RA 1DJNA 1FDYA 4GC4A 1H62A 2Y6ZA 1NAL1 1G6CA 3CC1A 2YYTA 1OF8A 3LCHA 3E12A 3L5MA 3TMLA 1XDLA 3EKZA 2NUYA 3LLFA 5AN7A 1AL7A 4BWLC 1QO2A 4GBUA 1W5OA 3IIPA 3UWZA 5J5RA 2GJNA 3S0CA 1OFAA 1TPWA 4LWWA 3E96A 3N14A 4LS1A 3STCA 5HNRA 4AEOA 1GG1A 3M1ZA 5LNRA 3FYOA 3W1MA 3W1AA 2BZNA 1EUNA 4AXKA 3M9YA 3QMSA 3M5VA 3W73A 3S5ZA 4JR5A 5IBXC 1EEPA 2X1RA 1G4EA 1OX4B 3O06A 1LDCA 2EGZA 1W5QA 5BW6A 1N55A 5K9XA 4EF8A 3L68A 4MJZA 5KSWA 2OJPA 1KTBA 2YSWA 3U6WA 4UMCA 1I2OA 3UY7A 2VFIA 2YZRA 2V2CA 3WJZA 5CGQA 3WJWA 3OEXA 5E0KA 2JK2A 3W1RA 5L9FA 1X7FA 2P0OA 2GUUA 3BK0A 4Z0SA 1DL3A 4JX6A 4H4IA 4IX0A 4AF0A 3DFPA 3PWAA 4HNTA 3CT7A 3HQ1A 4RV8A 1K03A 2DZPA 2RDWA 2QDGA 1W5NA 2EAWA 4ADUA 1L6YA 4HT3A 4L4LA 5FF7A 5GVJA 5G5IA 3RK8A 1ME9A 4MIMA 3WJYA 5BOOA 3TSBA 1M6JA 3GDRA 1TV8A 4UUIA 2GQAA 3LHWA 4FHAA 3W83A 1KTNA 3HGOA 4JTJA 4EVZA 4M6PA 1JR1A 2AGKA 4IXXA 3LDVA 5C55A 1QMLA 3TROA 3C2OA 1JUKA 5K2ZA 1SO5A 3KVJA 2QUVA 4FNUA 2YXGA 2FB2A 3OHIA 4ZQMA 3FA5A 1G4SA 3IV3A 2DU2A 2FFCA 3NVTA 4M5PA 3NOEA 2NX9A 1O94A 5DCDA 1F6PA 1B3OA 1OX4A 4AB4A 1Z41A 2NWSA 3W87A 4YWIA 1LLZA 1Z44A 2YGYA 3DHDA 1TV7A 4LV9A 1LM1A 1YDOA 3NNTA 2ABBA 3STEA 1TIMA 5D03A 4MUZA 2Z1BA 1JQVA 4I7UA 1DHPA 3K30A 1TPC1 3GNDA 4LY8A 5BNKA 3MI3A 3O6YX 3NQAA 2W0UA 4K7VA 1GTEA 4NU7A 5G2IA 3NQFA 2FTPA 1AG1O 3LXCA 2E68A 3W1LA 5DCEA 1R30A 3G22A 2ZZ6A 3C4UA 3QZEA 3LCLA 4UTHA 3SJ3A 1QFEA 4R7JA 3LX9A 1PIIA 3MYOA 3NQ8A 2GOUA 1Q45A 4XUGA 1QPRA 2H8XA 3HIJA 1AW5A 1GOXA 4Y96A 3U8GA 2ZZ7A 4CCCA 4JIQA 2A0NA 3A5VA 3INPA 2EPHA 1H61A 3O6DA 1ML1A 1W0MA 3P62A 3NAVA 3DFOA 3SW6A 3HPSA 3LBMA 2QCLA 1PL9A 1LLWA 3QYQA 5EPDA 1KM4A 3OVRA 1A50A 1SO4A 4JYFA 4UTWC 2CLMA 5AHFA 2WNQA 4UNLA 2Y7FA 3NQEA 2ZBTA 4LV4A 3NQ6A 1C9DA 5BRBA 1YXCA 4FX8A 1LRQA 4X3ZA 5F1UA 1N8FA 1FCQA 3N19B 3QMTA 4JTKA 4QNEA 5EL1A 2NUWA 3L0NA 3BGJA 3TA6A 1WAUA 2VEKA 4EOUA 1MXSA 2E6FA 1GVRA 4XKYA 3VE9A 3KRSA 2C14A 2GVJA 1KM1A 3DXIA 3G0SA 4CNOA 8TIMA 3SSJA 1EP2A 3DZ1A 1NVMA 4MYXA 1ALDA 3TSMA 1WBHA 2YCEA 5G2HA 3I68A 4NNAA 1XC4A 2CU0A 2A4AA 2QKFA 4FNQA 4XTDA 3UPWA 3QPYA 2B7NA 4UR8A 1SQ7A 4UTTA 3Q94A 2A7RA 2V81A 1OVDA 3C2RA 5F1VA 3R2GA 3LHYA 3IVUA 3N9RA 2GQ8A 3G1HA 4MY8A 2GVGA 2VOMA 3G0XA 3UD6A 2J9XA 4YLWA 1ZALA 5CZ0A 1CW2A 3W70A 2VFEA 3BPWA 3THQA 1ICSA 2V2DA 1SSDA 2ZRVA 4FO4A 3TW7A 2TYSA 2X30A 3LI1A 2CZ5A 1QPNA 1NSJA 3V1PA 5LHFA 2IQTA 2ZDRA 5HINA 1O5KA 5AB3A 3T78A 1BWKA 3CTLA 3W7KA 3WJXA 1QOPA 1ME7A 2OX1A 4LNYA 3MJYA 5HMSA 4K8HA 4J9JA 4K39A 3F03K 3O8AA 4O57A 3NM1A 5CSSA 4Y6GA 4EIVA 3M41A 4O54A 3ANYA 2QCDB 1UUOA 4Z08A 3L67A 1THFD 3M0ZA 3W07A 1W37A 5LNWA 3DFQA 3LHUA 3W2JA 1H7WA 2V8ZA 1VQTA 3PB2A 1G4TA 1OHLA 1H7RA 3M5ZA 3N9SA 3NPUA 1OF6A 3TJLA 4LOCA 3P80A 3JR2A 2XFWA 4O15A 3TFXA 1EWDA 3QF0A 4NNBA 1L2UA 1TREA 4UC5A 4BWLA 3KVLA 3M44A 1OFBA 4XBKA 4IMGA 4A3UA 4NXSA 4HNUA 4HSOA 4C1KA 4HKPA 3S5NA 2Q8LA 5DY2A 5HWMA 2FPTA 4X2RA 5CPNA 1JCJA 4GUFA 3I65A 1K7EA 4O1CA 3QPZA 3B05A 1Y0EA 3T44A 2WNZA 5D2XA 4GUJA 3DFSA 5FF2A 3FIGA 1P0NA 3L9CA 2B7PA 3B0VC 3EWBX 1FBAA 1X1ZA 5IBXA 3IVTA 2J88A 2Y89A 4AHQA 3S1VA 4FX6M 3IGSA 1TTPA 4NVTA 3HPXA 5T26A 3HG5A 5F4XA 3QRHA 2VEMA 1EB3A 1FWSA 1W3NA 4JXCA 4O4VA 1FXPA 2DJXA 3KX6A 3M6YA 3ABSA 2VFDA 5HR6A 5I3JA 2VFHA 3IIOA 4N6EA 4S2CA 1RQEA 4IMEA 3LB0A 2Y7DA 1FUYA 3BV4A 5D32A 3EXTA 4MFEA 4NJGA 1GPWA 1GVSA 2V5BA 4CLMA 4NZFA 1XDMA 2QEZA 4KFNA 4WY0B 5D2YA 5CPMA 1VCFA 4AWSA 4UTMA 1JCLA 2P10A 3MWAA 2QJHA 2RHGA 4O50A 3G8RA 1K3UA 1IIGA 3GAKA 4P2VA 4M6VA 1DV7A 5H2ZA 1Q3NA 4DXVA 1KA9F 3NQ7A 1S3HA 1EPXA 1TCDA 4N9CA 1RQHA 5FI8A 1K8XA 1OYBA 5LNSA 1HTIA 3BVJA 1O60A 2PE4A 2TRSA 4MPQA 4KWWA 1KTCA 5DN1A 3KRZA 3SY5A 3P5ZA 4FNRA 2EKCA 5D04C 1ZENA 4E2DA 3CEUA 3TC7A 1BKSA 1K8YA 3EB2A 1NFBA 2E5DA 4LUIA 4CQ9A 2NLIA 3UZJA 1FCVA 4D2JA 3TSDA 3TFCA 4FB7A 4NXKA 1V5XA 4I7WA 1PS9A 4UTLA 1JRCA 1HG3A 3MI2A 4QIUA 3T7VA 3ZWTA 1SO6A 3LXAA 2J9YA 4E38A 3TNOA 2JBMA 4O13A 3UY8A 4DF1A 4ZMGA 3WK2A 1KM3A 1DQXA 3BG9A 1CI1A 1G4PA 2QAPA 3BLEA 2CLIA 3P67A 2HS6A 3GLCA 3MP5A 3QFEA 3BW4A 3MYPA 1KV8A 4K37A 4IQLA 1WOBA 4ZZ9A 4DF0A 1OFEA 2QCHA 3TV8A 3QH2A 4XTIA 2Y88A 3W7GA 1SPQA 1UUMA 3LI0A 3UPBA 4R33A 4FIRA 4L4MA 1Q6RA 4NUWA 4CNNA 1D3GA 4MJMA 1N7KA 3W1PA 3BW3A 1ICPA 4WY0A 1YTDA 1ZFJA 4RZ5A 4EWND 3MP3A 3PSVA 4IJBA 2B4GA 5DXYA 5HQEA 3HPZA 2ZRXA 1GEQA 1TQXA 3NL3A 3PUOA 4ZQNA 4GNJA 3GIYA 3L5LA 4JIPA 5HR7A 2YW3A 5F2MA 3G1VA 3PULA 2FB3A 1KFLA 3TX9A 2WOQA 3MO7A 2EHHA 4NJKA 1AK5A 4GRSA 3NQCA 3DGRA 1ZAJA 4OHQA 1GWJA 3H53A 4UXDA 3W7LA 4WXZA 4I7VA 4UTWA 4JICA 2QR6A 3NQGA 2Y70A 2QUUA 2JGQA 3W2UA 3SFKA 2Y7GA 4LTSA 1RPXA 1HFBA 1TTJA 4QISA 1RV8A 4GE8A 2A1YA 3RF9A 1F73A 1O95A 2O7QA 3VKJA 1QPOA 2DZTA 3C0JA 1A5AA 1OABA 1OX6A 4IOTA 3BG3A 3W7HA 3BLIA 3GXPA 1ZAHA 1J2WA 3MHUA 3S42A 3FS2A 3GB6A 5AFDA 3TQ0A 1H7XA 1W56A 1WBJA 3PY2A 1IXNA 2QJIA 4BK9A 1ZHAA 5BMWA 1W5MA 4QNWA 5HJLA 5SWUA 4LUJA 1UB3A 4JX5A 1VHNA 3V75A 3LTPA 4Q4KA 3C8FA 3I7RA 5K3VA 3GDKA 1KW1A 3NDOA 3EWWA 4PH6A 2C18A 4Q33A 3LV6A 1FXQA 1YPIA 5AYXA 3IVSA 4X9SA 2JKPA 1O4UA 4OBTA 3EWXA 1S5VA 4O18A 4O17A 3PBYA 5DXXA 3W2NA 3QSRA 1EX5A 4RR4A 3UWVA 4XQ6A 3CWOX 5MHBA 4CNPA 3PSWA 1AL8A 4XZ9A 3QMRA 1RD5A 5F4SA 1VPXA 4CCDA 3N73A 4O4WA 5D2WA 2ZCGA 2NV1A 2HMCA 2DZSA 2RDUA 4UTIA 2E6YA 3NPWA 2WQPA 3RU6A 1WQ5A 3TXVA 1XL9A 2W6RA 2ZYFA 4IXHA 4CQAA 5L6UA 2CLFA 4FNTA 2Y62A 3SI9A 3QW3A 2P1FA 5CZJA 3L5AA 4MZYA 2Q8ZA 3TDFA 4N9DA 1LTDA 1XKYA 3HBLA 1QNVA 1A5BA 1KFEA 1VC4A 3GXNA 3MBFA 5FEZA 3UZ5A 4TMBA 3CLMA 3W88A 1H7OA 3PM6A 3QSTA 4RX0A 4G1KA 4DEFA 5AHLA 1JCNA 5AYZA 5K7JA 4ZL1A 1RR2A 4UTKA 1DBTA 4O1BA 5TBOA 4FX7A 5LSMA 4DO4A 1QPQA 1G7UA 3W2LA 4K8EA 2V82A 1TTIA 1T96A 4R34A 1JUBA 1KM6A 1TRDA 2H3DA 2DORA 3LV5A 3EX1A 1XBYA 4XKYB 3EX3A 2QCFA 4GWEA 3ABOA 4OGZA 3IRDA 2WSQA 5LGXA 5DLCA 3TU9A 3A24A 2GVLA 2WSYA 1ZNNA 1JCYA 1KBJA 1OFRA 1UBSA 5FEPA 3O1NA 3P8JA 3A22A 2VEPA 2C6QA 1LROA 4YL2A 4LRSA 1E51A 2X2GA 2XN1A 4O52A 2ZZ2A 4JTSA 3QEZA 1A53A 1SZNA 3W76A 1TTQA 1Z48A 1JQXA 2Q3OA 4UTJA 4Z0JA 3WK1A 2NV2A 1QO5A 2ZQ0A 3P61A 4JTUA 4RZ6A 3VE7A 1AW1A 2F7FA 3GK0A 3A21A 2PRMA 3HGJA 2ZTKA 3IGUA 3UWUA 4DO6A 4MY1A 4ONVA 4UTUA 1M7OA 1XXXA 1JRBA 3CHVA 5I3IA 4ORMA 5KTLA 2QDHA 3SR7A 2CLHA 3LHZA 3SGUA 3KOFA 5FEXA 3UWWA 1ME8A 3ELFA 3CEPA 3G1YA 4H3DA 1BWLA 1P1XA 5C54A 3LCFA 3G1SA 3YPIA 1F74A 4N4PA 1KM2A 1OK4A 2Y63A 4GXMA 1C8VA 1YYAA 4JDBA 1TSIA 2AQWA 4LRTA 4ZQPA 1LP6A 3W7EA 1PVNA 4ADSA 1KLYA 4DF2A 2ALDA 3TCEA 3DFTA 3TJXA 5J5DA 3WFAA 4TIMA 1TPDA 2I1OA 2YYUA 4NJJA 1ADOA 2BTMA 3GXTA 2X1SA 2Z2UA 2PRLA 1BEUA 1FWWA 1H63A 1VCVA 3CB8A 1LBFA 3FJLA 4XWUA 4AVFA 5K9DA 2ZA1A 3W1XA 2A7NA 1H7PA 1QOQA 4O0ZA 3TC6A 3FFSA 4LS0A 1H5YA 4ORIA 3O63A 2ATSA 2QUTA 4DPPA 3B03A 3W1UA 4JTHA 1TRIA 4QITA 2BLEA 3M7WA 5EYWA 3C6CA 4UNKA 1H7NA 2VFFA 4LVAA 3F1QA 3LCIA 3M43A 2A7PA 5EKYA 2WNNA 3EWZA 4S2BA 4NZJA 3PB0A 3GKAA 3PF3A 5AOUA 3NYZA 4O1AA 4PTNA 4DO5A 3HMJG 3E49A 5KZDA 5C2XA 4MLJA 3LCWA 3FJ6A 3IIZA 5AC7A 4JX4A 1XM3A 4M19A 3KRUA 1EP3A 5AYYA 3MHGA 3MBDA 4HSNA 3OIXA 1QAPA 2ISWA 5CSRA 2VFGA 2E6DA 3LCGA 1KFBA 1SR9A 3R13A 1A5CA 1AMKA 1C29A 3KAOA 4RXFA 3T40A 3EEGA 3S9YA 2ZA2A 4RKAA 1VYPX 1JVNA 5EY5A 3TR2A 1ZAIA 2V5LA 5KMYA 4LC8A 3GVGA 1OX5A 1SZEA 5AHEA 3QQ1A 3W7NA 1OFDA 2OCZA 3FKKA 3W7DA 4RJEA 3EXRA 2JKAA 4IPIA
chains in the Genus database with same CATH superfamily
3L4XA 5D09A 4BF7A 2O9OA 3WBYA 1DWHM 2E25A 3PBUA 5D37A 3ZWSA 3OP2A 1QCWA 1XUUA 1KXVA 1TMLA 4ECLA 4ILSA 2GJXB 1DWAM 2VJXA 4XVEA 5D05A 2AMGA 4HPHA 3H23A 3NL2A 4IICA 3G1DA 1G01A 1YW1A 1KCXA 2IXVA 3GDLA 3IUIA 2Z1SA 1W3LA 3PZTA 2WMIA 2BGNE 2YPIA 3GNRA 3EX4A 4ZQCA 5GJMA 3QTGA 3TTQA 1B57A 1E0XA 1P5BA 3GKFA 2W27A 1GKQA 1OYAA 1KFKA 3M4HA 2YA0A 2EPKX 2HS8A 1EF3A 4GLEA 1NFPA 3GX9A 3KBWA 3DERA 2C1GA 4S3JA 3M0XA 1UA7A 3ATZA 1XS2A 4CU8A 1I4NA 4H9UA 4OU1A 1IZJA 1GOOA 2ZX8A 2YFOA 1YMYA 2QIWA 4LSBA 1UG6A 3FYPA 3E5BA 4DWSB 4F0SA 1XRVA 4LW7A 4NJHA 4ZSUA 3G3MA 3OG3A 2AAMA 3LRMA 2WKJA 3MI6A 1YEYA 3VIMA 4LVFA 3THCA 4ZVJA 1XI3A 1JNDA 2ANUA 4UQBA 2WMFA 3WF2A 3BJFA 4NJIA 3FV9A 3UBPC 2PLJA 2CW6A 4FXJA 3KOWA 2Z29A 2GGHA 2WSRA 4W7VA 1A3WA 3P5YA 1ZBCA 1EF2A 1U5JA 1X6LA 1UPPA 1HQTA 1W1PA 4DYJA 5T9BG 2BG5A 1BWVA 2FHFA 3DC0A 3K4AA 2XISA 2PWHA 1J79A 4JN7A 3N15A 3M47A 3WLHA 2X1UA 1UKQA 1BYCA 1RVGA 1VBJA 4I8DA 3KUMA 3RM4A 1X7IA 3U2ZA 3W00A 1NOFA 1FDZA 4P8VA 3K2GA 3TP4A 3HF3A 1XG3A 4E2OA 1A5OC 4KCTA 3E3HA 4N9EA 1SW3A 4L80A 1JPKA 3UZZA 5D2TA 1J10A 4IGSA 3TLQA 3CAQA 4W7WA 4UOZA 4H6QA 3IJ8A 1V3KA 3W37A 3UXLA 2VC5A 3VIIA 3K13A 3BMXA 4AY1A 1KGUA 4RXGA 2BWGA 1PCKA 4LAUA 1NDYA 3ID7A 2CLOA 4BF5A 1ZJIA 1W3IA 4A8NA 3STPA 1UOZA 1VYSX 1WUEA 4GO9A 3ARQA 1QJWA 3BGGA 3BICA 3EWUA 1H3GA 4PGLA 4E4UA 1V6YA 4A8RA 3KVMA 3T08A 3K4WA 4UFLA 5GPRA 1XD0A 4K38A 4DJED 2OWWA 1KQYA 1QHZA 4GIRA 3UFYA 2EXOA 2TPSA 3F7JA 4S1FA 3GR8A 1WDDA 3IK2A 4AHOA 3R8HA 4OUEA 1W2VA 1DP0A 4R53A 4B5TA 2QV5A 5ECVA 4M1BA 4CQ8A 3F4NA 1YADA 2ZRWA 2TMDA 4NI3A 4ICNA 4AX6A 1IV8A 3PG9A 3W7CA 1S2TA 5A6MA 5A95A 2HWGA 4D6FA 1OFOA 3KXQA 1F61A 4P61A 1DKWA 3SGGA 4IFKB 1TPFA 4JYDA 3KLLA 4M7TA 1UJPA 1EC7A 2J77A 3E02A 3WNOA 3VNLA 1O5RA 3CQIA 1TVLA 1D7KA 4B16A 3ERPA 1SR0A 3VYLA 4FZIA 1XLAA 2OVLA 4XB3A 3A9BA 1V02A 2IKIA 1OK6A 2FLIA 1PEZA 3MS8A 3SUUA 2X16A 4L9YA 5I3KA 2WZTA 4MWAB 2PD5A 1JZ6A 1KBBA 4WD0A 8CGTA 5G4EA 4PEKA 4GCAA 3C0LA 3NGJA 1M68A 2G3FA 3WLTA 1PE1A 4HTYA 2DJLA 4UIOA 4KFOA 4K7YA 2NUXA 4Q4PA 2ACUA 3PBVA 3VNKA 4QDPA 4JDYA 4PCSA 4MG4A 4EACA 2O92A 5F2GA 3DYMA 1POJA 3M7SA 1Q6LA 4WZHA 5DMMA 2CZFA 3ANVA 3T0BA 2J7FA 3VMNA 3TTEA 4JFWA 4HTBA 3LS9A 3LTYA 1KBIA 1SUXA 3V0SA 3SIZA 3WUBA 3U4FA 1FCBA 1K6WA 4XISA 3OIHA 3FNDA 2IPGA 3H22A 1L6SA 2PDJA 3DOPA 4NZ5A 3UWYA 1FTXA 3B06A 1S2CA 1OC5A 3RHGA 4MZ8A 3WL1A 4UCGA 1HKKA 3SM0A 1JYVA 1PCWA 1A5SA 3GG8A 1E40A 4ZB0A 5DQPA 3GC5A 3GO2A 3KL5A 3L0KA 3NOYA 3EOSA 2OYKA 4ALDA 1V3LA 2ZUNA 2DGAA 2JQXA 2DZBA 3NA8A 5EMUA 3WX7A 1PZ3A 4NI8A 3WMLA 4AY7A 3CIVA 1TIWA 3O16A 5CG7A 1HO1A 2J24A 4C6FA 1BF6A 4Z2GA 1O1HA 2H3BA 4XZIA 1EA0A 5H1WA 2ZRYA 4CU6A 1Z42A 3FK4A 4NAFA 4MNLA 1B90A 1MZHA 2GUBA 2JIEA 5FF3A 1H0GA 2Q6ZA 2EG8A 1VGAA 5ABGA 3VNMA 1S39A 1V0LA 2W79A 1KGWA 3CQJA 3I3EA 2C91A 2ISFA 3M64A 4FSAA 1YXDA 4KF1A 5I5RA 1R2TA 2FPVA 2BY1A 4JIRA 2EG7A 3LD5A 4LNCA 2ZFAA 3TK7A 1XBZA 3NQVA 3N17A 3U57A 5ABFB 3EKGA 4NZ4A 1M3UA 1CGVA 1W9BM 2E9MA 4KCWA 2XFFA 1E0VA 1EIXA 3ZM8A 2DIJA 2DT2A 4FA3A 4A21A 3OLIA 3C0SA 5A6AA 3S2JA 3H2EA 1PIGA 4S39A 3U2OA 3A23A 4O11A 2F2HA 1QOXA 1SYTA 3DG7A 4RZ4A 1VJZA 2ZVIA 4H6RA 4H8VA 4CVUA 4ZOBA 3ITGA 1XIEA 1TB3A 3ZR4A 1QXLA 4O1DA 4HU0A 1QRQA 3U9IA 1DJGA 4K2SA 5KZMA 2Z4GA 3S83A 3WD4A 3BW2A 4PL1A 3R89A 3UZXA 4S3BA 1EZWA 3BLFA 3LMYA 2J7GA 3OBAA 4LF1A 3WFLA 1ISWA 1NFGA 2PTWA 3H7RA 4EF9A 4GZ7A 4PCPA 4J4KA 1E43A 4U3AA 4Q6JA 4XO6A 5TNVA 4AIOA 4DBWA 4REQB 3B9DA 2DQXA 1V3MA 5HUOA 3OO2A 3LENA 4K36A 3S9IA 2D1ZA 3AIEA 4JKKA 5KEZA 5FCZA 4OTKA 1RJRA 5I03A 1TWDA 3FOKA 1PWLA 1Y5VA 2UY2A 4O14A 1CXLA 4JY8A 5I24A 3IEBA 4L56A 1HJWA 5BOFA 3G24A 3APGA 1M7JA 4US5D 2C0AA 4B9YA 1RALA 2V2HA 4TOQA 2QQ6A 3E2SA 4HBKA 2E9BA 3PC0A 3R8GA 2UY3A 1LG1A 4JTFA 1DJIA 4PCNA 2QJGA 4H6EA 3EAUA 3RPTA 1IGWA 1MW2A 5I3FA 1W1TA 5CH9A 2X2YA 3DI0A 3VU2A 1HJUA 3GRIA 2TODA 1UWAA 4KW2A 3W75A 3RYSA 3OVPA 4QE1A 1XGEA 1EXPA 2PU1A 1E6RA 4KCUA 3NO1A 1Q6OA 3EKLA 4TMCA 3FHAA 2ATMA 4XZHA 2GZXA 3BDKA 4DX3A 4LQ1A 1Q65A 1EKOA 4GVGA 2NSOA 4KS0A 5FJPA 3O0KA 3ZS4A 2H9AA 1A5MC 1JZ5A 3RDKA 3PBWA 3UR5A 3RM9A 4LBSA 3B8WA 3CHCA 3HG3A 3SCRA 2YX0A 3EGJA 3LRLA 3QYSA 3VZZA 1DJWA 3A3HA 3BZJA 5BOEA 4W93A 4L5ZA 3DAQA 4DY1A 1WDWA 2VCAA 2E4TA 2IKJA 4QS6A 4AYGA 4GJ1A 5LNUA 1TVPA 2WPBA 3A9IA 2NVCA 2W67A 1QNPA 3M16A 3FGCA 4ML9A 2JEPA 4DELA 2PWVA 2FDSA 5HA7A 1DIKA 2C71A 4RDWA 3NGFA 3U4AA 5FIPA 4XAFA 1GW1A 3A13A 1W91A 2EJAA 1WX0A 4PMZA 2I5QA 4C6OA 1ZUAX 1AUSL 1BVZA 2BOFX 2Z00A 4FPSA 3OG2A 1PHQA 2OT0A 1XLHA 1WV2A 2QCDA 3TWBA 3A12A 4GISA 2GOKA 3WL0A 3HG4A 4DZHA 4UQDA 3AHXA 3LCXA 5EBUA 2I16A 2X7VA 5A6JA 3PR2A 2C79A 4P7RA 2ALRA 1US0A 2XWEA 5HBFA 3OBKA 3N3MA 2BX7A 2HROA 4G5DA 2A6LA 1EX1A 2PTYA 1KKRA 1PDZA 2G96A 3DIPA 3DENA 3UXAA 1HF6A 3D46A 4JOMA 2X1IA 2CBJA 2YA2A 5CJNA 3IJ7A 4RPPA 3G1XA 1FHLA 2X8RA 5CC6A 1FP8A 2E09A 4QBXA 1JDFA 1VS1A 4R3UA 4OKDA 4O19A 3WSUA 3KBVA 2G5WA 3GG7A 3LN3A 4LVBA 5FEWA 2ZA3A 3KVKA 5FACA 3N4AA 1QWGA 1VBRA 1R86A 3N3TA 3TW6A 4IPNB 2A21A 3RRXA 5DY3A 2HVOA 4QJ1A 3ZT6A 3GBEA 2AL1A 1MYRA 2QCGA 1TMHA 4C6MA 4HPGA 3LUTA 3M6DA 4ADTA 3P8IA 2EG6A 1V6WA 3CUFA 3WF1A 4AZBA 1Q7MA 4PCTA 1IEWA 1J0JA 3BQ6A 1OY0A 3AJ7A 3QKZA 3GDMA 5I23A 4H1ZA 3S6DA 3P6LA 4POCA 1FWCC 2OEKA 4KWOA 4HHLA 4Q32A 2WZMA 5C71A 2E67A 3B04A 3IUHA 4HD5A 1J4EA 1PIFA 3ABQA 1NQKA 4J28A 1RP9A 2YW4A 2WHJA 3N1AA 1DJXA 2GK1A 2ZOXA 1Z89A 3CV2A 3EB3A 6PTDA 4MGGA 1ZY9A 5J04A 4ZXLA 4NYUA 1RAKA 3W6MA 3OYZA 1NARA 1FDYA 4GC4A 1V02E 1NAL1 3CC1A 1ZZMA 2YYTA 4TX6A 1Z32X 3RCMA 3E12A 3I6EA 3N2CA 3EKZA 4QHRA 1WDSA 2C0HA 4JIEA 1I1XA 2G3IA 3ITCA 4ZO9A 4DUWA 4HOZA 1EJVC 3IAQA 4GBUA 5J5RA 1R3RA 2J8FA 1TPWA 4RDVA 4FP1A 6XIAA 3WDQA 4DYEA 2RDXA 2OZ8A 4PUMA 1R38A 3M1ZA 5E6ZA 4I9MA 3FYOA 3W1MA 3NSXA 4QDMA 3LLXA 4HHMA 3M5VA 3W73A 1VENA 1YNPA 2BBFA 4AZCA 1ZBKA 1R3QA 3O06A 4GJIA 1W5QA 1UWRA 5K9XA 4P8XA 1M53A 5LA2A 4L1GA 3C2YA 2VFIA 2V2CA 1ITQA 1EDGA 3LPFA 4I5RA 1FVPA 3W1RA 2P0OA 3BK0A 4F79A 1DL3A 2VVNA 1B3VA 4H4IA 4AEFA 4IX0A 1Q6EA 2P0IA 4HNTA 1VJSA 1A5LC 3H7VA 1K03A 2DZPA 5B7ZA 1W5NA 1QNQA 3WQ6A 4V1XA 5G5IA 3BUVA 3REQB 1ME9A 5BOOA 3TSBA 1HKIA 2JF7A 3GDRA 3WH5A 4UUIA 3Q65A 3WBXA 3W83A 1KTNA 3A4WA 4JTJA 1NTHA 1XGDA 4A3QA 4O1EA 1GQJA 3BCJA 4HPNA 3N11A 1A3XA 1JUKA 9CGTA 1SO5A 3AIBA 2QUVA 2WVVB 1EPVA 2ACRA 2FB2A 1TE6A 3FA5A 1HT6A 2DU2A 2FFCA 4HZ6A 4M5PA 3F5KA 1XLKA 1O94A 3H26A 2I56A 1Z41A 4QLLA 1U1HA 3W87A 4QJ4B 4GFIA 2Y5JA 2A79A 2GGEA 1BXBA 2OGYA 1CGWA 3DHDA 1TV7A 4LV9A 2ABBA 3STEA 1P6WA 4JFSA 3SFWA 5D03A 3QC0A 3MUZ1 4QLKA 1BF2A 2Z1BA 1JQVA 2CKSA 5I77A 5H8PA 3MI3A 4D8AA 4N0RA 2DUAA 2A3BA 3FVDA 2QYGA 4K7VA 3EA1A 5LA0A 3TA9A 5G2IA 2Y8VA 4CD4A 4Q4OA 3LCLA 5I7GA 3SUVA 4H8HA 3OPSA 5FD0A 1RP8A 3V16A 4IGMA 2H8XA 3HIJA 1PO9A 3CZKA 3U7VA 1OT1A 4IIBA 4Y96A 3U8GA 2VX5A 4CCCA 1R3WA 4M81A 2A0NA 3WF4A 2WMJA 4KPLA 4UQEA 3PK7A 1WZKA 1XRSA 1UR1A 3SW6A 1TX0A 2PD9A 2A3LA 2XH4A 3F4VA 1RY8A 1A5NC 1XRFA 1E4NA 1CB2A 3C0QA 3XIMA 4G2DA 4V28A 1A50A 2CLMA 5IHRA 1JYNA 1B2YA 4DLFA 1GPFA 2ZBTA 1EGZA 1S1PA 2F6XA 3RLHA 3SUWA 3VGEA 4QJ5B 4JTKA 3GTHA 3GNXA 3L0NA 3BGJA 1WAUA 2VEKA 1BHGA 1MXSA 3U5UA 3I6TA 4C6IA 3OHMB 3DUGA 3T0AA 3WDJA 3E0LA 3DXIA 8TIMA 3SSJA 3R1ZA 1ALDA 3GG0A 5G2HA 2ZUVA 3UETA 4RNFA 3BWWA 3APTA 3UPWA 4UR8A 1ZL1A 1VFFA 2CETA 1WAWA 2C1IA 3WLIA 2ZX6A 1KNWA 3FY1A 3T8QA 3WDIA 4K8GA 3LHYA 4XO7A 3FSTA 1U2YA 1SVDA 3CZEA 3PWIA 1KCZA 4QCFA 2NQJA 1B54A 5C9UA 2VCCA 1X96A 1UD4A 2ZRVA 1XYAA 1J18A 5B80A 2TYSA 3LI1A 2CZ5A 3RLGA 5LHFA 4QG6A 4D6HA 5AVNA 2OO6A 4JCMA 4J3VA 1BWKA 5DRCA 4W84A 3W7KA 3AI0A 4M29A 3GTIA 2BXZA 4MAVA 2QW5A 2HJPA 2HXTA 2ZUWA 4J9JA 1YBQB 3O8AA 3AHVA 4CNTA 3BJSA 3RMEA 4IIDA 2HEJA 3FJNA 4OFCA 4XBJA 1UUOA 4KEMA 3WMBA 3POHA 4CEUC 5LNWA 2RGMA 3GU2A 4MWAC 3W2JA 4QR6A 4GI6A 4B90A 1G4TA 1OF6A 3TJLA 5BXSA 4LOCA 4UB9A 4X0VA 2IQ0A 3JR2A 4GNKB 2XFWA 3WLMA 4QP0A 3QF0A 3WD3A 4CQBA 1FH8A 3KVLA 1XPYA 1AJZA 3M44A 4ZCWA 3BGAA 4MB3A 4NXSA 4HNUA 4HSOA 3W82A 4HKPA 1TCMA 5HWMA 2FPTA 2O4QA 3N4EA 3TN4A 4X63A 2Y5SA 3VCNA 1PSCA 3I65A 3R11A 3B05A 4PZVA 1B3XA 5CGTA 5ECUA 2IPJA 4IL2A 2XGBA 1F3WA 4GUJA 3DFSA 3DECA 3B0VC 2J7CA 4GCXA 3IVTA 3GBDA 3D47A 5I0DA 3UG8A 3IGSA 1B31A 2VYOA 4A8IA 2QGYA 3HPXA 2WZHA 2X0SA 5HQLA 1NDWA 3QRHA 1D2KA 3I4KA 3HFYA 1EB3A 2DJXA 3OZYA 3KX6A 3HV8A 3ABSA 1JZ7A 2VFDA 1VFLA 3IIOA 1RQEA 2XIOA 4PUDA 2I57A 3OGSA 2GJXA 1W1IE 1CNVA 4RL3A 3BSHA 3TR9A 1W1YA 5D2YA 2FTYA 1ZP4A 4S3EA 4C6JA 1K3UA 4DBUA 3NQ7A 1TV2A 1K8XA 1XP3A 4C5ZA 2PDKA 3IACA 2L5HA 3SCUA 1ZP3A 4B5XA 4XD6A 4MPQA 3T81A 3VIFA 3H21A 3NIYA 3SY5A 1XISA 4FNRA 3GUGA 2EKCA 4JFUA 3CEUA 3P0XA 1K8YA 5CBBA 1NFBA 4YHEA 4QSFA 1FCVA 4Q8TA 4FB7A 3GHUA 1M41A 1OINA 2W92A 3ZSSA 4HMDA 3OJGA 3EDEA 4WIWA 3GXFA 3QY7A 2DUZA 3BAWA 3CQKA 3LXAA 3WNNA 4E38A 3TNOA 4O13A 2XUCA 4ZMGA 3WK2A 2WW5A 1KM3A 4GY7A 1TZ7A 4QFUA 1CI1A 5IDIA 4ZGYA 2HS6A 4ZTXA 4IJRA 1J0HA 3MP5A 2V38A 3R25A 1K8CA 4K37A 4ZZ9A 3UP8A 3QH2A 4XTIA 3W7GA 4AVNA 4C7DA 1R6WA 1V79A 4DAIA 1Q6RA 4NUWA 4HU8A 3L4TA 1W9VA 1ICPA 4QAWA 4ICMA 4EWND 3WO8A 4IJBA 2HXUA 4G56A 4H9VA 3AROA 4H9XA 2NT0A 3BOLA 4JNZA 3T0CA 3L5LA 3PULA 3SQSA 2WOQA 3MO7A 5CZKA 4NJKA 1AK5A 2QF8A 1GWJA 3H53A 2XIIA 4I7VA 3BAKA 2QR6A 2DDXA 2QUUA 4DB7A 1XX1A 3W2UA 1MRAA 2HK1A 4XVDA 2XHYA 4B4HA 5E0FA 1HFBA 1TTJA 4GX8A 1F73A 3IANA 1O95A 2XH0A 1LUCB 1Q6CA 1PB0A 4H41A 1OABA 1OX6A 4IOTA 3BG3A 3W7HA 3ALFA 3MHUA 3S42A 2NVDA 4IISA 3PY2A 3HMCA 2QJIA 3WF3A 1JAEA 2XIMA 4CQCA 1NH6A 3CMJA 3PZVA 1EZ2A 4QEEA 4UZUA 3ZJ7A 4MNJA 3C8FA 2Y0FA 3AWNA 3MDUA 4PH6A 4KIRA 2QIIA 2WCAA 3LV6A 3AHTA 1M01A 2WSPA 1FXQA 5AYXA 3IVSA 4OBTA 1XC6A 1S5VA 1DWGM 4O18A 1A4LA 2PP3A 4O17A 1P0DA 5DXXA 3QSRA 1EX5A 5A1AA 1FRBA 1J5SA 2R24A 2J8TA 3CK5A 1E15A 1D8WA 2WNWA 1VPXA 3PBMA 2DZSA 2RDUA 1Z69A 1BYAA 3BXWA 3RU6A 1WQ5A 1DJYA 4L61A 3BSGA 3SY8A 3TXVA 2ZYFA 5AC4A 4IXHA 4CQAA 4IP5A 2R1LA 2O56A 4B15A 2QUMA 1HP4A 5CZJA 2VEGA 1T41A 3PTDA 1A5BA 1KFEA 3GXNA 4TMBA 1EJUC 3TN3A 3TQPA 3UCDA 4RX0A 3B8TA 4PYSA 2YJQA 1V6UA 2FFIA 4G1KA 4KH2A 4ZL1A 4MWAA 4O1BA 3LZ3A 3NCOA 4Z17A 1VPYA 4FX7A 3W2LA 4IIFA 3E38A 1JDCA 1WDRA 1T96A 1JUBA 1POKA 2H3DA 1HKMA 2KX9A 3EX1A 1XBYA 4IJCA 2QCFA 5E0CA 4H9MA 3IRDA 2OQLA 2Q01A 1XLLA 3BE7A 3HZ3A 3TTYA 1F9CA 4DZ5A 3QHMA 3A24A 1KBJA 5FEPA 4KERA 3ZO9A 4AIUA 1UR8A 2PCEA 5A6BA 1RJQA 2WB5A 2X2GA 2XVKA 2PLKA 4JTSA 3A6OA 5CSYA 5IDZA 4BQ2A 5DT5A 3HM7A 2Q3OA 3BANA 4RZ6A 2F7FA 3A21A 1UZDA 1E72M 1KXTA 3VVGA 2ZTKA 3FA3A 4P5UA 2FVMA 4F8XA 1M7OA 1XXXA 2PB1A 2OGJA 3BV7A 4JFVA 3W27A 3SGUA 3UWWA 3CEPA 4UR9A 2ODOA 1LWHA 1S5NA 4C6PA 2Z7GA 2GVEA 3WELA 1EXBA 1KM2A 4GXMA 1C8VA 2AQWA 4ZQPA 4GMEA 1LP6A 1JIBA 1WE5A 2NVAA 1KLYA 1U22A 4Q4MA 3KP1A 4DF2A 5HAOA 3TJXA 4GINA 2BVDA 2I1OA 4ENLA 2PRLA 3KM8A 5FOOA 2ZA1A 3L7RA 1YE6A 4I8YA 3W1XA 4FR1A 2A7NA 5HMEA 4Z2KA 1W3KA 3I3BA 3S1GA 2ATSA 4DPPA 3SSZA 3B03A 2GDQA 2BLEA 1LT7A 1H7NA 2VFFA 2YBUA 4XAYA 4GH3A 4GIEA 3M43A 3VX1A 4DNHA 1E6NA 2WMIB 3NYZA 4O1AA 4MLJA 2YCLA 2J4GA 5AC7A 5JIPA 1A5KC 3FDKA 2VNCA 4M19A 4LH8A 3ZIZA 4A3HA 5CSRA 3WH7A 1ZSXA 3EMCA 2VM8A 3RAOA 3VD7A 1HJXA 3LPGA 1GK8A 4X60A 2PGEA 3T40A 3EEGA 3VDCA 2INZA 2ZA2A 1JZ2A 5EY5A 1X38A 2INFA 1M04A 2QJNA 1OX5A 2Z28A 3MTWA 2JKAA 5A3HA 4IPIA 2DIEA 1RA5A 4H04A 2J7EA 3UXKA 5A8PA 3S4TA 2P8BA 4PA8A 2PAJA 2I14A 4H7VA 4UFIA 1IHIA 2VRKA 3M0VA 2GPTA 3WJSA 3M0YA 2V0TA 5AHNA 2EF9A 2VENA 2WO5A 4L1XA 5EFDA 1SZRA 4WGHA 5BMXA 2LLEA 1C8QA 1W1VA 5M03A 5AHIA 4ZEPA 2C13A 2FZNA 3C2FA 1C7TA 4ZTYA 5U4NA 1UYQA 5I02A 1JNEA 1HL8A 2CWXA 1GQNA 3KFTA 1EGMA 3N04A 3QXBA 1BAGA 1VBUA 2PC4A 4JTTA 1R3VA 3V36A 2F6KA 1VLWA 3LBCA 3T05A 4JEQA 4UQCA 3QOKA 4ZSTA 1ICQA 4WLCA 1CLXA 2OZ0A 2HRWA 1GT8A 3AS0A 5IOBA 1TR1A 1C90A 4IWWA 4HHPA 1E3ZA 4DPQA 1YLVA 4LUYA 4NIRA 1EWEA 4AZ5A 1KLZA 4JTLA 3SCNA 4P7NA 4CKQA 3A3WA 2AOSA 3SAZA 3K8LA 5CPLA 4YTTA 3H8AA 3MANA 2HTMA 1G0CA 1X6UA 1XIGA 3QHOA 3B9EA 1H60A 3EMQA 2NWRA 1VB9A 4JS3A 5CCZA 1TV4A 3P81A 4PTDA 4JQ3A 4S3KA 3LOTA 4ZB5A 1ISXA 3VM7A 4GUIA 2J7BA 1B4KA 3VOJA 2DPEA 2WJFA 1X98A 1XLBA 3KTSA 1OT2A 2INEA 3OA5A 4N2YA 4J1OA 1VIZA 1YTEA 3IS4A 1UR0A 1IXPA 2PFHA 1IQ8A 4Z2LA 4EXAA 1AW2A 3EOLA 1I9CB 1IT0A 1XIJA 4XZNX 2CZVA 1XBVA 5BXTA 3NWRA 1IZCA 1H11A 3GR4A 3LGDA 5HK4A 3VNDA 3CV1A 4ZO8A 4NKCA 3DKJA 2YZ5A 3BAIA 1Q4WA 1ZJBA 2B7OA 3UWEA 2QCNA 1A0DA 4A8LA 2E5CA 1XWYA 2FVLA 1TELA 3C61A 1U1JA 3QW4B 2BNJA 4D6GA 3AIVA 3GXIA 3MT1A 1EUAA 2V69A 1W31A 1H09A 2P3EA 3W1QA 4WF7A 4GO8A 1CXFA 1OC6A 4DJFD 4HNNA 4FOKA 1RH9A 2CBUA 2RH9A 1EJSC 4TR9A 2Z26A 3VFLA 2OTDA 2PMQA 2W62A 2BSLA 4BF9A 3MB9A 3V5FA 4N6FA 4F0KA 3BC9A 1M7PA 3W1NA 4GGHA 1L8NA 3AHYA 4NL1A 4HU4A 2Y8UA 1K1DA 4Y2WA 1VZWA 5EMMA 3UU0A 2WV8A 1WOAA 3EZ4A 2I7GA 2SFPA 1N82A 4C6EA 4NZ1A 2XFRA 5AY7A 2G3MA 4LS2A 2PWDA 1HUVA 1BQGA 3TW9A 1P6BA 3EEZA 3LGEA 3WN6A 4ASTA 1E6ZA 3DFNA 3ITYA 1FX6A 2D24A 4KRUA 1TJ2A 5K4ZA 4JTGA 8RUCA 2R94A 3AZTA 3W29A 4AD2A 2FZDA 3V35A 3VOCA 4YNGA 3CUHA 5HQMA 5EU9A 3G1FA 1FY6A 1JF5A 1TWWA 4JTRA 5A8OA 1NQ6A 3ZSTA 2ZVRA 3JRKA 4HK6A 4ZO7A 4DJEC 4MYAA 3BOXA 3DHPA 3NL6A 5BCAA 4WRHA 2DVUA 5TIMA 3L21A 4FAMA 4LYKA 4S3DA 3EPNA 3M0KA 2ZRUA 4PL2A 2FZ8A 3C3NA 4QE4A 4YTQA 1TYGA 4QRNA 2Y4SA 4GXWA 3RPDA 4LCSA 4KKXA 4HNCA 4HA1A 2A3HA 3IIVA 1J0KA 2BVTA 3PTMA 1EC9A 2UWFA 4DXXA 2O4MA 3CU2A 3G6LA 1QR7A 3TUUA 1WYIA 4GQGA 4NQ1A 5DFAA 3W7IA 3LU2A 4JQ4A 4FNSA 3IGXA 1XH1A 2XFYA 3W7RA 2B7QA 1W8GA 1ZS2A 3DBNA 1UCWA 3GC4A 3L66A 4WX2A 4MADA 1PZ2A 4R27A 4RNJA 1FWIC 4AH7A 6ALDA 2GJRA 3AUOA 3MJMA 2DSUA 2R6OA 2F6UA 4K6AA 3PPCA 4AHPA 1MXGA 3H54A 2ZWYA 1JCMP 4AMAA 3RLUA 2X0YA 4GH1A 5CPSA 2OZTA 2DZUA 3WLQA 1W54A 1RCXB 3T4CA 1MFVA 2OT1A 1L6FA 5A8QA 1BXNA 2YL8A 2PP0A 5DELA 1Q85A 5MF5A 2J79A 3A47A 3QJAA 2MANA 3ONCA 4HPJA 4BEQA 1ADDA 3P84A 1F7BA 3QFWA 4RCXA 2NT1A 4BA0A 3B0UX 1W3TA 3VX0A 1YPFA 2VQTA 5LYRA 5BU9A 3E0WA 4Q7IA 1M1BA 3REQA 1FKXA 3AIQA 1SJCA 4HJFA 2WHKA 1X8FA 3GDBA 3GNNA 4O28A 1JJKA 5AECA 1M65A 5JH1A 1E73M 5AC6A 1JULA 1XYFA 1O5QA 3NJ3A 4UFHA 3GNPA 2PLCA 1DJQA 1LZOA 1SFSA 3R5EA 5I3HA 4N9BA 5ABTA 4PE8A 2CESA 3CWNA 4X2PA 2P50A 1UP0A 4X22A 5I06A 1B30A 3WQ8A 1GOQA 2UBPC 5HJXA 3FW6A 4AZGA 4AWTA 4AFYA 4XD3A 4QM1A 3TXZA 2VR2A 1AJ0A 2FJUB 4ZOCA 3IAPA 3R8RA 5I3GA 1QDSA 3NFUA 4KGJA 4BR1A 3NL5A 4A4AA 3VOIA 1Y7VA 2VZTA 3PJXA 4LFYA 1VKFA 5I79A 4U5IA 2G95A 3NO5A 1E5NA 1O5XA 3ZXWA 4JNMA 4DBDA 1XRTA 3MSRA 3M5XA 2H9AB 3GDTA 4H6KA 4D6CA 4Q7BA 2PGRA 1FWFC 4RDZA 1XSIA 2ZRZA 3W72A 5JBEA 5JMUA 3VNYA 2Z1VA 4JTAA 3RFAA 4R9XA 4AZ7A 3ICJA 5D02A 4MNKA 3GXMA 2ZX9A 2PGFA 1W1A1 1HP5A 2B0MA 1JI2A 4IM4A 4GNVA 3MUY1 3VCCA 5FA5A 2PTZA 2OWXA 3JS3A 4YCPA 4TQTA 4BI7A 2E8YA 2CPUA 1PTAA 1OG0A 3E1F1 3O3RA 5HWJA 4U4MA 1NU5A 3FGCB 4WDUA 1VYRA 3R12A 5CXPA 1EBHA 1L6WA 5HWNA 2Y7EA 1Y5XA 4C7GA 4CD6A 2FMOA 4PMJA 3G1AA 1RBLA 1ONRA 4YPJA 4MKSA 2WLZA 2AL2A 1E9LA 2E1DA 1MI3A 2GQ9A 4AUBA 1HW6A 2GGJA 1XR2A 2RJGA 3UG3A 4AC1X 1LWJA 4C1NB 3E2QA 1JUEA 3WNKA 1DXEA 1JD7A 1YQ2A 4Q3MA 1F6YA 3IK4A 3TH6A 2DZVA 1AJ2A 3L0GA 3AOFA 3D6NA 4O53A 1WZLA 1KBKA 3EOEA 2OYLA 4JHOA 2FIQA 2PF0A 4I90A 1TPEA 3V18A 1FWHC 2I5GA 2VRQA 4OQVA 3KTXA 2PCQA 4WUIA 1SM9A 1XICA 2VXNA 2YB4A 1TMQA 2OELA 1G9HA 4GIAA 3LRKA 3F2DA 1KR1A 2OSXA 1E3XA 3PG8A 1IIHA 4RLIA 2JGYA 1TJRA 3POCA 3UXDA 4G1NA 1UH4A 1DIEA 1YDNA 1JXKA 3VCRA 4DJEA 3W71A 3W7PA 2BODX 2E3ZA 2WK2A 2WMKA 2QMKA 2DT0A 5FSEC 3DH7A 2VZSA 3I6RA 3AXXA 4FF7A 3DCPA 4Z2IA 1TUXA 1GYLA 4BQ4A 1XIBA 3ARSA 3C3UA 1GKPA 2E77A 2F84A 4GD0A 2BHUA 1XYMA 1J5TA 2A5HA 7A3HA 4UFKA 4IMAA 2XVNA 5ENLA 4BI5A 3UVIA 2A6NA 5CKSA 1IE7C 3Q2DA 3AIRA 3WQFA 3ZQ9A 3I7SA 1NOWA 3B8UA 3NPXA 5C2GA 1XUZA 3N4FA 1K8ZA 2XSXA 4WXYA 2XH2A 4MZ1A 3AWOA 5D4YA 4CEXC 2CLKA 2E6AA 2NQZA 2I9EA 4JIIX 3RXZA 2A3AA 5DBTA 3R7MA 1F2JA 3EYPA 4MM1A 2YL6A 4B4FA 4BFAA 2AQVA 5TQLA 4S3AA 1K70A 3S2MA 2VT0A 2C3ZA 5B7YA 2VC9A 3H70A 5J8LA 5AVHA 2GJLA 2XZ9A 3M0IA 4I9JA 3THAA 4M6QA 1KXHA 4EK7A 1TPVA 4PUWA 3RO6A 3MSDA 4E3VA 4B3ZA 2HE8A 1BTMA 3CO4A 3L2IA 4NNCA 1V3IA 4LYQA 1K4HA 2VC6A 3TN5A 3WQGA 1F05A 4QS5A 2CNCA 3TAKA 4AZCB 3NVDA 2PDGA 1JZ4A 4YJ5A 5HNTA 1KFJA 2VO5A 4C65A 3AJXA 2PBGA 1EQCA 4H9TA 1FOBA 3WLOA 2X1TA 1GVYA 4OT7A 5U7SA 4NILA 1UR2A 3H24A 2HV5A 3GVVA 4HA0A 1NWSA 3EXSA 2J9ZA 2PWEA 4TTUA 3VD9A 3G3DA 2W61A 1DJNA 1H62A 2Y6ZA 3AFBA 3RX3A 1QI4A 3JZEA 4R7OA 1QBBA 3E6EA 1NELA 2HE5A 1QNOA 1BG4A 4NAEB 3VNZA 1GYMA 4HZ7A 3IIPA 2GJNA 1ISZA 1ITCA 4LS1A 4PUEA 3KOXA 5XIAA 4LF2A 2NQLA 1P0EA 3EDDA 1GG1A 1EQPA 1PKYA 1ZTVA 5LNRA 4PTVA 4RV3A 3RGTA 4QX4A 3W1AA 1QASA 4BY3A 4AXKA 2P76A 2CKRA 2XINA 4M8UA 1QW7A 1C91A 4JR5A 3TNBA 3KP0A 5IBXC 5PTDA 2PWFA 2X1RA 2VGFA 1G4EA 5EMYA 3S6TA 4O1FA 4ZXOA 2F2KA 2XVLA 4MJZA 5KSWA 3LYEA 1KTBA 2YSWA 4UMCA 4G6CA 1I2OA 1F07A 4S3FA 3WJZA 5CGQA 3WJWA 3OEXA 5L9FA 4HJWA 2QNEA 1RHCA 1MUWA 5HPOA 1O12A 4D72A 3K8MA 1OD8A 1V08A 4AF0A 2RGLA 3DFPA 2XIQA 3PWAA 4B5WA 3HQ1A 4RV8A 3SCOA 4HT3A 5GVJA 1T8QA 3HU7A 4PBFA 4MIMA 2X42A 3O6AA 3PPGA 3ECQA 1JL8A 1M6JA 1TV8A 1LUCA 2OR2A 4JL2A 3Q45A 2GQAA 1NDZA 4FHAA 4WVXA 1JZ8A 4HOXA 5I3DA 3ORWA 3M07A 4M6PA 4E4FA 2EPLX 3KBSA 2YKKA 6XIMA 1QMLA 3TYEA 5K2ZA 3VZXA 2OOGA 5EMLA 4GZJA 3ZOAA 3OHIA 4ZQMA 3ZT5A 3IV3A 4L6OA 4PMVA 3NVTA 3R0UA 4MB4A 1MDRA 5CPQA 1OX4A 1M03A 3KDNA 3URBA 1J6PA 4MNMA 4YWIA 1LLZA 2YGYA 4IP4A 3RUBL 1A3HA 1US2A 3KHDA 1DHPA 3GNDA 1J93A 3NQAA 1R5YA 1VIWA 3CZ8A 3OLEA 2J7DA 2W0UA 4TUFA 2G4JA 1AG1O 3B3DA 3VZYA 2VX6A 2OU4A 4AQLA 2ZZ6A 3C4UA 3OZPA 4R7JA 3ITLA 3VOGA 3MYOA 1TV3A 2GOUA 3JZUA 4GK8A 4JQ2A 5KZ6A 1Q45A 1TA3A 1P7TA 4KWSA 1V0NA 3AHZA 3GNOA 2D0HA 2ZZ7A 1U5VA 3BJTA 1XLCA 3O6DA 3P62A 3GQYA 1LLWA 5EPDA 3DHUA 2ZE3A 4PMDA 5AHFA 2WNQA 4UNLA 4GBDA 4F2BA 4Q8NA 1C9DA 1KRCC 4Q7NA 2W9MA 5BRBA 1R9XA 1K9EA 1CIUA 4FX8A 4X3ZA 4QQUA 1FCQA 3N19B 3QMTA 4QNEA 3P0WA 1DTUA 4TVCA 5EL1A 2NUWA 4AXNA 1PKNA 2R1NA 4BQ5A 1TZ9A 4X61A 4F0MA 2GVJA 1KM1A 3N12A 1Q8AA 3I4EA 1H5VA 1NP0A 3RIKA 2QVHA 4QG8A 4QJ3B 4MJ4A 1NVMA 1JZ3A 3TSMA 5HOSA 1WBHA 3I68A 4MB1A 2PTDA 2QKFA 2BS9A 5HMDA 1Q66A 3GE7A 3BAYA 4INFA 3MZ2A 3QPYA 3OZOA 2B7NA 3GHTA 4BCEA 4LB4A 1E6XM 5DMYA 1RBOB 3AQUA 1VEPA 1OBAA 3CV6A 1RLCL 1WKEA 3WQDA 3W0KA 4B2DD 1XV8A 3C2RA 5F1VA 5DMLA 3R2GA 3QZAA 1TJ1A 1RK6A 4XAZA 3N9RA 3UXIA 2GQ8A 3Q4DA 1KC7A 5D8ZA 3G0XA 3UD6A 4P7LA 4PUUA 2C8NA 5CZ0A 4C5YA 3BPWA 2V2DA 3GHRA 2QMJA 1SSDA 3MKCA 3IGHX 4FO4A 4HMNA 1HKJA 5TAOA 1NSJA 2IQTA 5HINA 1O5KA 5AB3A 1UD3A 4E3TA 3CTLA 4D1IA 1LQAA 4ERAA 1RCQA 3M0HA 3APYA 2OX4A 1KRBC 1KO0A 3LA4A 3MJYA 4K8HA 5CAHA 3ZJKA 4Y6GA 4EIVA 3O0FA 4O54A 3WNMA 2PDFA 3PHAA 1THFD 4U31A 3KCLA 4W8BA 3W07A 1W37A 4WKFA 1QWKA 4C60A 3MSYA 5E9XA 2BGQA 3NURA 3W38A 1G5AA 3M5ZA 3T0TA 2C7FA 4DN1A 5HPCA 3P80A 1CGUA 2BP1A 1DWJM 4Q8WA 2WBGA 2J25A 4AX7A 1EWDA 3UGRA 4D6IA 2W63A 4AZIA 1OFBA 1GZ1A 4IMGA 3RG6A 4A3UA 2X09A 2EEXA 4J3UA 3T2PA 5CPNA 5EGRA 5C70A 4G7EA 5GJPA 1HKWA 1Y0EA 3AMGA 5BXRA 3ZZ1A 3V0TA 2WNZA 5D2XA 4Z42C 1H1NA 3FIGA 3L9CA 5CJ5A 3BLPX 1FBAA 1X1ZA 5IBXA 2CIPA 4AHQA 2PZNA 1R7AA 4M82A 3AXHA 3OU8A 4IG2B 1TTPA 1RBAA 2R82A 3ARZA 3AMKA 3GC2A 2J13A 1FWSA 4JXCA 1FXPA 3LNPA 4J3WA 5I3JA 3IJIA 4N6EA 2CC0A 1GW9A 3LB0A 2GVYA 2Y7DA 3BV4A 1UR3M 2HBVA 1KKOA 3WF0A 1GCYA 3PZGA 4J7RA 1GVSA 2V5BA 2PDLA 3WEZA 4C91A 1U33A 2QEZA 2Z1WA 4GQRA 4PRTA 4I6KA 1RCOB 1BTCA 4AWSA 2P10A 2FGBA 3CUJA 2CYGA 3MQTA 2QJHA 2RHGA 4O50A 1AA1B 4MSSA 3KBJA 1OCNA 2QS8A 4M6VA 4P2VA 4DXVA 1S3HA 1EPXA 1TCDA 1V6VA 5FI8A 2WCGA 1HTIA 3BVJA 1ITXA 2A3EA 3BZGA 4WSJA 5DN1A 3KRZA 3HV9A 2GQ3A 3TC7A 1JYWA 3EB2A 1XLJA 3CL6A 3PTQA 2ZIDA 4LUIA 3SN0A 3UZJA 3AU6A 3TFCA 4NRSA 3S2LA 2DIKA 4NXKA 1PS9A 2HISA 2VGIA 1I75A 3ZWTA 4GACA 1CGYA 2J9YA 2PDHA 3GH5A 3R58A 4R7WA 3MSGA 1AZ1A 2JBMA 3UY8A 4AIBA 4HYVA 1WKFA 4J3SA 3MV01 1P1MA 2CLIA 2QULA 1IWAA 3P67A 3BQ5A 4MUPA 2GWGA 1EGVA 3PJTA 1KV8A 1OFEA 3UZYA 1XH0A 4PN2A 4JL1A 1LQ0A 4RDYA 3GXDA 3L2LA 4MMWA 4FIRA 5T8GA 3WDHA 3CUZA 4CNNA 1D3GA 3HQNA 1VPQA 3V0UA 5EB8A 3WZ0E 5DRIA 3L12A 5DXYA 3HPZA 5D9OA 2BV9A 1CDGA 1GEQA 3NL3A 3ARXA 3CS2A 6REQB 5F2MA 1QHPA 3G1VA 1V51A 2FB3A 1KFLA 3TX9A 3W28A 4LB3A 3F2CA 1CPUA 3WLLA 3NQCA 3W7LA 4UXDA 4PRWA 4PTMA 4WXZA 2Y70A 3SFKA 3ARPA 4U33A 1XCXA 4LAKA 1VFSA 3W01A 2PDIA 3WQOA 1MW1A 3C0JA 4CD8A 1XLDA 4HCDA 1J2WA 1Z7AA 5AFDA 3TQ0A 1JPDX 4AU0A 1WBJA 3NEHA 2PWUA 3VDAA 2HZGA 4BK9A 1ZHAA 3GTNA 1W5MA 1UH2A 1ZPTA 4QNWA 3AMDA 1VFUA 4JX5A 3CUXA 4DWSD 2J62A 3ZT7A 3VC6A 4DUVA 4W88A 4Q4KA 2V6AA 3I7RA 1UD2A 2VGGA 3NDOA 3EWWA 2C18A 4Q33A 5AKQA 4G8TA 1EO7A 4GOAA 4HK5A 1YPIA 2JKPA 1LL4A 1E56A 9XIAA 4HK7A 2Q71A 2F38A 4I6VA 3ZR6A 3NTYA 2JIWA 3CL7A 3UWVA 3BURA 4PUNA 4ZE4A 3PSWA 1AZ2A 1RD5A 1OGBA 5GNXA 3WUFA 3N73A 4O4WA 2ZCGA 1QI3A 4UTIA 3VD4A 4BZYA 3NPWA 2Q09A 1XL9A 3BCDA 1N2VA 3VUPA 2FH8A 1XLEA 1PX8A 2G3NA 5BROA 4M1RA 2P1FA 2Q8ZA 3TDFA 4N9DA 4W8LA 3GTFA 2VC7A 1QNVA 1C92A 4YU1A 3CLMA 4W7UA 4F48A 3W88A 1HXJA 3IWPA 3PM6A 4F0LA 2P5NA 3LPOA 4HQVA 1K4GA 2EPOA 1A47A 4UTKA 4OIFA 1UJQA 4KGLA 3E2RA 1L6GA 4B5SA 3VKBA 4TV6A 2V82A 1TRDA 2PODA 2DSKA 3NUKA 3KRBA 1LL7A 1WXZA 4BQ3A 2WSQA 4UZSA 4YTSA 2WSYA 2WSKA 1ZNNA 1JCYA 3MCMA 9XIMA 1J96A 1LROA 4YL2A 4LRSA 1E51A 2XN1A 2ZZ2A 4I9TA 1A53A 3CAVA 3L2MA 1S38A 1EOMA 2G50A 3CHEA 3W76A 1FWDC 1TTQA 1Z48A 1JQXA 3P61A 3HTWA 4JTUA 3OTRA 2XPKA 5JBDA 2VUYA 2ZXQA 1XIMA 4DO6A 4MY1A 4ONVA 4DWDA 1E0WA 1QI2A 3CHVA 2YCLB 5KTLA 4D9PA 3LHZA 3KOFA 4XAGA 3VIKA 2DY3A 2QJJA 1Y65A 2RJHA 3P14A 1J2BA 1UD5A 3TWAA 3YPIA 3L23A 2Y63A 3EBVA 1F3XA 2NLYA 1EYWA 4DO7A 3BOFA 1HX0A 1OZQA 5E70A 3SUTA 4ADSA 1UKPA 3TCEA 3VO0A 3DFTA 3WFAA 4HN8A 4XIMA 3BLKA 1OB0A 1H49A 2BTMA 3GXTA 2X1SA 4J40A 2VUNA 1FWWA 4EP8C 3VGDA 3WENA 4ES4A 1EDTA 4B3LA 4D8LA 3B8SA 3CB8A 3CWHA 3FJLA 4XWUA 3TTSA 1H7PA 1YIXA 3TC6A 3QVQA 3SO7A 4LS0A 2J8GA 4GYFA 1A4MA 3OVGA 2WM0A 3B0XA 4H7ZA 2QUTA 4XD4A 4JTHA 4QITA 2QVNA 1R7OA 3M7WA 1VFMA 3CZJA 5I6SA 3PZIA 3CYJA 1UOKA 3GU9A 2IXUA 1W6TA 2PWGA 2VEFA 3F1QA 1ECEA 2XTKA 5EKYA 1T40A 2WNNA 3PB0A 3GKAA 4LXFA 3E49A 5C2XA 3HMJG 1CWYA 3LCWA 3FJ6A 3GW3A 3M0JA 3KRUA 1EP3A 5AYYA 3MBDA 1S2AA 2VFGA 2E6DA 4WHBA 5HATA 1XSKA 1BXCA 3R13A 2J6VA 1A5CA 1AMKA 3KAOA 2NW0A 4RXFA 3CXOA 2UY5A 3S9YA 1T7LA 1VYPX 3QV8A 3TR2A 1ZAIA 4KBXA 5KMYA 4AISA 2NSXA 1SZEA 3QQ1A 3W7NA 4ERGA 1KCKA 1OFDA 1ZQ5A 2OCZA 3PAOA 1OC7A 4OV9A 3A5FA 4O16A 2QAFA 3NDZA 4JBRA 3K1GA 2D2HA 3F4CA 2BGSA 1QPKA 1WCGA 1KXQA 3NEVA 1J01A 3ALGA 3LQLA 4EE9A 3KS5A 3VI2A 1AODA 2D0GA 3B9AA 5BYWA 4H2HA 4B9ZA 1QK0A 2D2JA 3KZSA 5KETA 5LHEA 2UZ9A 4W8AA 1TV5A 2PGWA 2JF6A 4MPKA 1FA2A 1MRQA 2NZLA 3IPWA 3VGHA 3MDWA 3UEQA 3NR0A 4JFTA 3O15A 4PBGA 1MWOA 3M5YA 4Z1AA 2ISVA 4ZO6A 4KMQA 2Y8KA 2MNRA 3MMUA 4HMCA 1PWMA 2FDMA 1XJBA 2CHNA 2OZ3A 4NT0A 4J2MA 3U5YA 2V3EA 1TZZA 1KGXA 3G5EA 1B4EA 3WQCA 1DEDA 1E1FA 2BHYA 5FF0A 4W87A 2YL5A 1NDVA 2FZBA 1VFTA 4IQJA 4RK8A 3CIWA 1JPIA 3PFMA 6ENLA 3PNZA 4CCEA 2J74A 1RZMA 3EWDA 1AQHA 1XIIA 3DX5A 4CN4A 4Z1CA 4L7ZA 1JDAA 4R88A 5HNUA 3JW7A 1JFHA 2GWNA 2WQDA 1T8XA 2O55A 3NQBA 4H7CA 2VDIA 3VK5A 1IEVA 1S3TC 3PAJA 3WQWA 1CXKA 1VAHA 3UWQA 4HIBA 3PZNA 2F61A 1IGSA 5E5CA 4A2RA 6TAAA 4OECA 3W85A 4HMEA 4A6GA 1UC5A 3NG3A 5HANA 2ISDA 1L0PA 4TO8A 3RR4A 1UWSA 3TAOA 2GSEA 5A5WA 4C1NA 4P8UA 2Z27A 3R6IA 4OWGA 4PMNA 2DT1A 3HN3A 3UJFA 7ODCA 5C5YA 2XWDA 1GZJA 3WBAA 3GVRA 3PN8A 2O9PA 5CJMA 3TYCA 2W3ZA 3O05A 2VELA 1A49A 4WY0F 2UV8G 4LEQA 3N34A 4WSHA 4GKLA 2BVWA 3L65A 1JPHA 1UUQA 1Q5MA 3NZ1A 5TF0A 3N2MA 4YVXA 2C15A 1TX2A 3WH6A 3BAXA 2E40A 3QV6A 3G8EA 1ELSA 3SCSA 5C7HA 3TCSA 3M0MA 1KRMA 4F0HA 2XVGA 4N02A 2QF7A 2REQB 4NZCA 5FJOA 2G97A 1EHNA 1ZU8A 1G69A 5A8GA 4TXEA 1V93A 1TPH1 3U2EA 7TIMA 1UWIA 1R2RA 4M3PA 4BJHA 4Q4SA 4GUGA 3UR8A 1DHKA 4UMBA 1MMFA 2RDTA 1OGSA 4JTEA 4WJEA 5D8WA 1VH7A 1TUFA 5CG0A 2UY4A 4ERIA 5FAJA 4DM1A 4X9YA 1E1CA 1KD0A 4HNLA 2WZIA 1XIFA 3IRSA 4UWMA 5F2LA 4CNSA 5XIMA 2FPYA 3WLSA 1RJPA 3TKFA 3VOFA 2DW7A 1REQA 3CZLA 5IHSA 1B5TA 3B0PA 4QDWA 2Z0IA 3UNTA 2D73A 4XBSA 3KBNA 3N6HA 3ARUA 3UPMA 1H1ZA 2PSNA 1PV8A 3AZSA 1XFCA 3N2XA 4DLMA 3SQLA 1E0TA 5AHMA 4DVOA 4M80A 4GI4A 1BG9A 5DT7A 4JY9A 3DDMA 5H8MA 2V63A 4PCFA 1XW8A 2ZZ1A 3RRAA 3MUIA 1DYSA 4C6BA 3WQVA 1UH3A 3NM3A 3CAKA 1UR4A 1LOSA 3CM4A 2CFFA 4MLRA 1CB7B 4MB5A 5GJNA 3PZMA 1R3TA 5HXMA 3SRDA 1D7FA 2BHZA 1D9EA 4GY1A 3MWCA 1GQLA 3CPRA 1W17A 2KAUC 3AALA 2OB3A 2WJDA 4KIEA 3CQ0A 3W74A 4LAOA 1DVJA 4QEHA 2Z6IA 3P7YA 2ZKMX 1B9BA 2Z25A 2TSYA 1CENA 4AD5A 4DJFC 5DBUA 2OEMA 1JDDA 1EP1A 1XCWA 3VM5A 2E8ZA 2FJKA 2VD9A 1OSEA 2G41A 1XYLA 4GVHA 4GUHA 1LORA 1EJTC 3GZ3A 3SCVA 1U1UA 3UF9A 3H4GA 1UQYA 4GABA 2Y85A 3EDJA 1QW8A 5HMFA 4NAEA 1H51A 3GWQA 3NXLA 1S5WA 1S5TA 1QATA 3A4JA 2DEPA 2VKZG 4UQAA 3MUXA 1OFQA 5A8NA 2OSWA 3R79A 3C2VA 1R9YA 2YCKX 3MV11 2R8WA 4V1YA 1UHVA 3VXGA 4J3ZA 3N18A 2BY3A 4HA3A 2XM2A 3G0UA 4V33A 1SZFA 3B0YA 4WK9A 3B8VA 5KITA 3W7QA 1KFCA 1OG6A 3OB8A 2FQIA 5EBAA 3TYBA 2J27A 3GD6A 4AWUA 1HKVA 2V9DA 1UZ1A 1JPMA 1FH7A 2V30A 5HUPA 4A3YA 2Z2AA 4Q6XA 5D2VA 4US6A 3FVMA 3DBPA 2FHCA 3G18A 5CZTA 5A2AA 1TPUA 2ZUTA 3SADA 4E0CA 1I2QA 4XZMX 3W7OA 4AWEA 1WZMA 1U83A 1W32A 4LU0A 3QC3A 3GM8A 1GYNA 2PUZA 3USZA 3O07A 1ODZA 2QPSA 3MKKA 3TMQA 4YIWA 4FNPA 3D0CA 4KCVA 4LVGA 2YL9A 1P0BA 2IKGA 4HOWA 3LZ5A 4UR7A 3THUA 2BFGA 3SGZA 1AQ0A 6TIMA 3S5OA 1IR1A 1TKKA 4LPCA 1R46A 3N2BA 1MNSA 1HZYA 2HNEA 3S1XA 2VR5A 3RCNA 1I2PA 5F4WA 1UKOA 4RW5A 3E2VA 2E7FA 2H8ZA 5D30A 1W3HA 1YPXA 2AL2B 1K7XA 3GAYA 3NQ2A 3P60A 4Z1BA 1Y5WA 2OFJA 2AKMA 4FEZA 2PRHA 4IP7A 4DHGA 4NX0A 4AW7A 4QXIA 3G77A 4WDTA 1V7YA 2DZAA 4LCQA 1K7FA 1WXJA 3SQMA 1BKHA 2D3LA 5JU6A 5M1TA 1GNXA 1OEPA 3EX2A 5JUVA 3BO9A 1R47A 3FLUA 3Q67A 4D71A 1AMYA 2R14A 4KRTA 4LT9A 3BLLA 4Z1DA 1R87A 4KEZA 1GJPA 1YXYA 2GDVA 4GYKA 2O9RA 3W2MA 1EA9C 1T99A 2F9RA 3P82A 1LRTA 4ZQRA 2NXIA 3KBMA 1ZGDA 1Z8AA 3MW7A 2ABAA 1NWTA 1BSLA 3TEVA 3WMCA 2PC8A 4JHMA 5CZSA 2VP8A 5AC8A 4PODA 4FF5A 3N25A 4N4QA 1LYXA 4A2SA 2DQWA 1YDVA 4UMAA 4MKVA 4AG0A 1JGMA 3UG4A 3PUDA 2YCIX 1UASA 2GUYA 5E09A 4FLQA 2W4XA 1LWIA 1IT8A 1G67A 4WCJA 5KINA 4K68A 4YXGA 3QQ0A 5BWAA 1W8SA 1JAKA 3UA3A 3FCPA 1RUSA 4FOUA 3S1WA 4JHZA 3HB9A 3J7HA 2Y61A 4Q4QA 5E93A 2XZ7A 4O12A 3GG1A 3RX2A 3U48A 4M24A 1LOLA 4BI6A 1NM9A 5FL1A 1UC4A 5CPTA 1JF6A 5FJIA 1VBGA 5HNNA 1CXHA 3KHJA 5CBIA 3LG3A 3IJ6A 4U28A 3P93A 4ATWA 4DJDD 1ECQA 2XYLA 1VHCA 3ARVA 3UA4A 1E9IA 4EAMA 3HOJA 4RNHA 3QPEA 4IMFA 3WKZA 4WSKA 1IEXA 3VKKA 4KWVA 2ZUUA 1NF0A 3MUAA 4DJFA 2CXEA 3AICA 1NF7A 4S3CA 4MF4A 4MAZA 1IF2A 3STFA 2CLEA 3W7MA 2FHBA 1XF0A 2IQDA 5LGZA 1IXQA 3MY9A 2Y24A 4LANA 1XSJA 3Q58A 4KESA 1V6XA 1VR6A 4IGNA 2HCVA 3GFZA 5G4WA 2GSJA 4LEFA 1MQPA 3XINA 1Q6QA 1PAMA 5MKGA 1VLIA 1WXYA 1GQKA 3DKLA 2F8QA 3UYIA 3TZFA 1IEIA 2WMGA 3WD0A 4E8DA 3QOMA 5C9ZA 5FESA 3CPGA 3UR7A 1YE4A 4AVOA 4RE2A 1GG0A 5K4XA 1GVOA 4R9OA 1DIOA 4HPXA 1A0CA 3GH7A 3OQ8A 1DQWA 4UTTC 5G1TA 3GIPA 3C2EA 2BY0A 2WAGA 1EJXC 4B3KA 4IG2A 1P48A 3E0IA 1K9DA 1DORA 4M7SA 5C7VA 3AO0A 1QBAA 2OMAA 1VD6A 1FWJC 4EXBA 2PF8A 4FLSA 1B3YA 1XYBA 1RVKA 1UPMB 2NQ9A 1KR0A 2H6RA 1KWGA 3K8KA 2R1PA 1HJQA 2YDSA 4ZBCA 2PURA 3C5QA 1VF8A 3SBFA 4PMUA 2YR1A 3U0HA 3RNDA