1TB3A

Crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
332
Chain Sequence
PLVCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKRNQLNLEAKDLRALKEASFCWNDLSLLQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREVVAAVKGKIEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISPDLIQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydroxyacid oxidase 3
publication title Crystal Structure Analysis of Recombinant Rat Kidney Long Chain Hydroxy Acid Oxidase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 118
structure length 332
sequence length 349
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tb3A00
4UMCA 3JS3A 4UMBA 2CLOA 2O7SA 4IOTA 2Y63A 2AGKA 4OQVA 4ZQPA 5CZ0A 3TKFA 5D09A 3G1YA 3HGSA 4Y9AA 4HN4A 3QQ0A 2Q8ZA 5FEXA 4JTIA 2DORA 1KM1A 3A5VA 3CM4A 5DELA 5G5IA 2DZXA 3HGOA 4M5PA 5J5RA 4O12A 1OYAA 4QAIA 4TX9A 5BMWA 2JGYA 4YL2A 3W88A 2Q8LA 1QPQA 3M47A 1PL9A 3CT7A 4JEQA 2H90A 1PIIA 3MYOA 3CLMA 1J2WA 1PHWA 3S5YA 3PAJA 1FDJA 1WAUA 1KFBA 4DO5A 2QAFA 2VEIA 4FNTA 4MFDA 4N9EA 1GVRA 1QO5A 2Y7GA 1QDSA 1WXJA 1G69A 3EXSA 3W75A 1ZY9A 2ZDRA 2X1TA 3LCGA 3E12A 4AXKA 5E93A 1QFEA 4A3UA 2NXHA 4FXRA 4RX0A 1MO0A 5H2ZA 2C14A 3IGXA 4AEOA 3BG5A 3W86A 4O52A 4FXSA 3W3OA 1LM1A 1KFEA 4UFKA 3IIZA 3QM3A 5GVJA 2VEKA 4MYAA 3KRZA 4AF0A 2W79A 1JULA 4UTTC 3P67A 2Z2UA 5BRBA 3S1VA 2WSQA 4O11A 4DO6A 1GVQA 3NQMA 1VQTA 1A50A 4GWEA 3MUXA 2GJLA 5LNSA 2CZDA 1H62A 3G0UA 3NEVA 4NVTA 1AW5A 3QFEA 3M5ZA 1V7YA 1ALDA 1SW7A 1KFCA 1A5BA 4UFLA 1RQEA 4JTLA 4IMGA 1YLVA 2FB2A 3FLUA 4NX0A 4LUJA 3ZS4A 3PC0A 1YTDA 5LNRA 1V5XA 4WY0A 4WX2A 3M0ZA 5F2LA 4UTJA 3N34A 3VE9A 2YXGA 3H54A 4JXCA 5EMUA 3R12A 4Q32A 1GG0A 3DBPA 3OIXA 3TSDA 1OX6A 4MKNA 3PSWA 3FIGA 4NJHA 3BLIA 3FKKA 4LV9A 5D32A 4K37A 3O6DA 3WFAA 2NX3A 2ZRXA 5HQEA 1HFBA 4CNNA 3W2LA 3C2FA 2NXGA 4N9BA 4MFEA 4QJ1A 4WZHA 3LHZA 1LZOA 1GVOA 3W85A 3OA3A 2G95A 5K4XA 2QUTA 2WO5A 4NX5A 3ABQA 3KAOA 4D2JA 5I3HA 2CWNA 3DENA 4B5NA 4LVFA 1TQXA 5HUOA 2G96A 3HGJA 4RXGA 3TJLA 2A4AA 1IXOA 1EWEA 3O6CA 4ZQCA 1UB3A 2NUYA 4MVAA 4AWTA 1OK6A 1W0MA 1XBXA 2VXNA 1XM3A 3PY2A 3IVTA 1LP6A 5KZEA 1ZCOA 2QCMA 2EHHA 4Y96A 4Z1AA 4QISA 4S2CA 2BSLA 2C13A 4GBUA 3N2XA 3NPWA 2ABAA 3ZR4A 2YFNA 1XBYA 2ZQ0A 3FOKA 3MHGA 3N3MA 4PA8A 3GXTA 2J9YA 3TIMA 4LWWA 1RQHA 1H61A 3QMTA 3LBMA 1UASA 5FF4A 1LROA 4JTJA 1YPIA 3LXAA 5D2WA 3C4UA 4KWVA 2JKAA 3M5YA 3NVTA 4KFNA 4KFPA 3PUDA 3KX6A 1UUMA 3MP4A 4JY8A 2OZ0A 1DL3A 3F4WA 4UTHA 5DLCA 1OFRA 1HTIA 1GVFA 4AB4A 3OEXA 3NDOA 3TK7A 1SFJA 2VKZG 3W07A 2NZLA 3NA8A 1ZAHA 5LNVA 1ZHAA 3BK0A 1P0KA 3TXZA 3IIVA 4O14A 3MO7A 5KSWA 1TPC1 2B7QA 2F7FA 2FJKA 3IIOA 1EP2A 5I3JA 3VFLA 1FWWA 2EGZA 5A5WA 1EUNA 1EP3A 3GLCA 3R89A 3G8EA 4EWND 3P60A 3LM7A 4TR9A 1K7FA 1SZFA 4RJEA 3SI9A 3B0VC 5K2ZA 1F76A 4CNOA 1M7PA 5K9XA 3P62A 1G7UA 3P7YA 1Z42A 1VGAA 1GVSA 2GQ9A 1LCOA 4H4IA 1DV7A 4KFOA 1J5TA 4E0CA 4O17A 3C2VA 4O1DA 3F4NA 2ZZ4A 4BR1A 2ATMA 5LSMA 2Y88A 3G3DA 1CW2A 3PUOA 2DJLA 5AHMA 1ZENA 3MW7A 3GYEA 1DHPA 2UV8G 4XUGA 4EF9A 1VJIA 2CLLA 1GZGA 5EL1A 2WPBA 4WOQA 1NF7A 4ZZ9A 2E6FA 3T4CA 3CWNA 2CW6A 3GNNA 2V9DA 2QJIA 4A21A 3IVUA 3HG2A 3MYPA 4LY8A 2QCCA 4GUJA 1DBTA 3MBDA 1W56A 5D03A 4I7VA 3N14A 1LOSA 2HS6A 3SJ3A 4M6PA 2HSAA 3CIXA 3T55A 4OU1A 4MJZA 4BWLA 3SIZA 4FNRA 4DO4A 3CEPA 1DKWA 3QSTA 1GT8A 4K39A 2FPYA 4WY0F 5AHNA 2QR6A 4HNNA 3QQ1A 3G1AA 1A5SA 1UBSA 3HIJA 3HG5A 3VKJA 5K9CA 4J9JA 3P80A 4ZL1A 4K7YA 5D37A 4AF0B 4EF8A 4OV9A 1OFPA 5CGQA 3H53A 2QCGA 3DZ1A 3DFPA 4A2RA 4N6EA 1RZMA 3W7OA 2E5BA 1TJPA 3B03A 3HF3A 1ZFJA 3BARA 3QSRA 4ZQMA 4R53A 1Q6QA 3W74A 4UCGA 3A22A 4LW7A 3LHYA 5EYWA 1JQVA 2J88A 5FEWA 3P5YA 4Z08A 2P10A 1BWLA 1K8XA 1I8JA 1RPXA 2ZZ7A 3EWXA 3ABSA 4PC8A 5AFDA 1DQWA 1TPEA 1X1ZA 3BV4A 4O18A 2C16A 1F74A 2VEMA 3STEA 4YCPA 5LNUA 1KFJA 4WJEA 3S42A 1WOBA 2RDWA 4JX4A 4JTKA 4QNWA 4OT7A 3KVMA 3TMLA 3W1QA 3UPWA 3P8IA 1T99A 1YDOA 3A21A 1HO1A 4LTSA 3NPVA 1FWTA 5AYYA 4R33A 3KRSA 4JTSA 1ZAJA 2QKFA 1P0NA 4NNCA 2DP3A 1SZEA 2A85A 1WYIA 1ZAIA 1N7KA 1VCFA 2E6YA 3FJ6A 4ORMA 5CG7A 1Z41A 2DZTA 3T40A 2H6RA 3UWVA 3BG9A 3NQGA 1IF2A 3DU0A 3O63A 1ONRA 2NWSA 4FX8A 2CLEA 1PCWA 1KV5A 3Q37A 4NJKA 1TPVA 3IIPA 4GC4A 4O57A 1OG0A 1FWSA 1XUUA 4NJIA 5FF2A 3U6WA 1NSJA 4QQ3A 4NZFA 2VC6A 1LTDA 3BO9A 3PULA 1H60A 2PURA 1U83A 1A5CA 3P82A 1R30A 3TNOA 4UFIA 1PV8A 4PEKA 2ZA1A 1MEHA 2C0AA 3LLDA 2YCEA 4A22A 1A5AA 4M7TA 2ZFAA 2ZTKA 4E38A 1BTMA 4JDYA 5AN7A 5HINA 3O1NA 4HKPA 1CI1A 5D30A 1M5WA 1MEIA 2NX9A 2BXVA 3BW3A 2J24A 2ZCGA 5AHFA 4UIOA 3M43A 1XFBA 3TV8A 1QPOA 3KVKA 3NZRA 2ZRYA 3NL3A 2RDUA 3OVRA 1MZHA 2RKXA 1T8XA 1W31A 4GUGA 4X2RA 1JUEA 3LTYA 3M5VA 5ABTA 1WBHA 2ZZ2A 2WKJA 3TQVA 1K3UA 1XUZA 2QDGA 1JCXA 5G2IA 4FNSA 3KXQA 2YGYA 1OJXA 5AYXA 2JBMA 4DF1A 3S5OA 4WXYA 1PE1A 4CQ9A 4UNLA 4ML9A 5E0KA 3PR2A 1EX5A 5I3IA 4NQ1A 3QRHA 4JGDA 1FCVA 4DXVA 3LXBA 3MJYA 5I3FA 5HWNA 4FO4A 4M7SA 1DQXA 4MY8A 3LV6A 1IXPA 4N9CA 1JQXA 5DXXA 3NQCA 5DCBA 2VFHA 4JN6A 3W2KA 3WJSA 5AC7A 3DFTA 1VYPX 1XCFA 3G3MA 3EWZA 2RFGA 2QUVA 4BK9A 2C19A 5EA9A 1KFKA 1L9WA 1N8FA 1X1OA 1LRTA 2G5WA 3HB9A 2P0OA 4O15A 4RLIA 1TSIA 1VLWA 5BOOA 3V1PA 5MHBA 1TMHA 1TV7A 3WJWA 7TIMA 3VE7A 1TRDA 3TX9A 1IGSA 1W8SA 1I45A 1G4PA 1P5BA 1H7OA 3DGRA 3GX9A 3OHIA 3QC3A 4LNYA 1A53A 3W1XA 3B05A 3LCFA 2BWGA 3LCWA 2R91A 3DXIA 4MLRA 3FFSA 4NNBA 2X1RA 3GK0A 4Q33A 3HOJA 3QZEA 3KVJA 1F7BA 3LOTA 3KOFA 2OMAA 4IJBA 3NYZA 2PRMA 1TPDA 5F1VA 2NWRA 4FNQA 1FXPA 4M6QA 1XC4A 1CX9A 4MJMA 2B7PA 2E09A 3O8AA 3O6YX 3HQ1A 3IVSA 3PB0A 1QOQA 1G4TA 1TV5A 5HNRA 4Y8FA 1QMLA 3IIXA 1PS9A 3W1NA 1KM4A 1SO5A 1VYSX 1JUKA 2R14A 4QSHA 1NEYA 1I2QA 3G1DA 4LRTA 1O5XA 1NVMA 1UCWA 3G1XA 4JTFA 3W76A 1SZNA 3MHUA 3FYOA 1TTQA 1I2OA 3QPYA 4JYFA 3GKFA 3I7QA 1X6UA 2CZ5A 3NR0A 1FCUA 2YW3A 1W5PA 1NAL1 2YZRA 3TC7A 1LRNA 2A1YA 5DY2A 1X8FA 1X7FA 2R94A 4MUZA 1VYRA 3QPZA 2PCQA 2ZZ1A 3BW2A 3LTPA 2J6XA 5HWJA 1ME9A 4LC6A 4K38A 1KM3A 1GTHA 5DBUA 5BW6A 1XBVA 4IPIA 1OVDA 1DJNA 2Y85A 1JCMP 1Y0EA 5E1QA 3TCEA 5LKYA 2CU0A 1K03A 4NT0A 3S0CA 1VCGA 1C9DA 2X2GA 4BI6A 4UTWC 2ZA3A 1EWDA 2E1DA 1T0OA 4IUOA 3L5MA 3NQ2A 1J4EA 4XWUA 3E49A 5G1TA 2E6AA 4OGZA 3L0KA 4IXXA 1W3TA 1DJQA 1VCVA 3L0NA 4KKXA 1XDLA 3CIWA 1THFD 3RU6A 4CCCA 3VCRA 3WK2A 4O1AA 4DEFA 1SO6A 2ZZ5A 2V5BA 2XN2A 3W84A 5L9FA 3LV5A 1XI3A 3GIYA 2J9ZA 3ATYA 1SQ7A 1B57A 3NOEA 4RKAA 1OFAA 4LRSA 3M5XA 3LHVA 3WK3A 5D05A 1Q3NA 4EIVA 3M1ZA 3UPBA 3UNDA 1GEQA 2E5DA 4PH6A 1KM6A 3BPWA 4X22A 3UD6A 3OBKA 1Q6LA 2QCEA 2QCDA 4JX5A 2B4GA 3FKRA 3LTSA 4ICNA 2TMDA 3W7GA 2GUUA 3CWOX 1TPUA 1H1ZA 2ISWA 5D2YA 5I3KA 4MYXA 3BW4A 4C1KA 1F5ZA 3W7EA 1K8ZA 2GQ8A 4DF0A 3QMRA 4JNMA 1SU5A 1H7NA 3TROA 3EWWA 3C8FA 4I9AA 1Q6RA 1IIGA 1UJPA 3EWYA 3NM3A 1K7EA 3SGUA 3M7WA 1RV8A 2RDTA 4WD0A 5D38A 5TIMA 1OFOA 4LT9A 1LOQA 2A21A 3A9IA 1S5VA 1JVNA 4MPQA 2Z0IA 4ALDA 3QJAA 4JDBA 1O94A 2CLKA 4RZ5A 2ZTJA 1R2TA 3PBVA 4RV8A 3S8HA 2GVLA 2Z6IA 4I7WA 4LVAA 5I3GA 5AHIA 3W7NA 4QM1A 5CPOA 2QCLA 1K7XA 4IMDA 3NQ6A 3LCHA 2QJHA 3O07A 4HPJA 1OFBA 2CLFA 2VENA 4GE8A 5TQLA 4JX6A 1E51A 1FXQA 4IX0A 3W71A 2O7QA 3W87A 5U4NA 3TW6A 1KLYA 4POCA 2RH9A 3LHWA 3G18A 2TSYA 1WV2A 3PSVA 1N55A 1XXXA 2Y7DA 1W5MA 3TC6A 1JRCA 5FF3A 2ZYFA 2DZSA 3M41A 3EX2A 3ZWSA 3O15A 8TIMA 4YMZA 4ADUA 5KITA 2QF7A 4FNUA 2DJXA 4GJ1A 2I14A 2DU2A 1QOPA 3JR2A 4LU0A 3E02A 4QNEA 1OABA 4UR7A 2TRSA 2J9XA 1BWKA 4Q4KA 1G67A 4XQ6A 1LLWA 4PL2A 4OWGA 3NQ7A 3W22A 1B9BA 6TIMA 4EVZA 1FWRA 3TSBA 3C2EA 4TO8A 4O13A 2VFDA 1S5WA 3UWQA 2QJGA 4UTUA 3B04A 3TU9A 1VR6A 3MBFA 2WNQA 3ABRA 4NXKA 3PWAA 3OVQA 2FPTA 3EWBX 3LHTA 5CPMA 1TPWA 1OFQA 3DKLA 3C52A 4JICA 1HL2A 1MSSA 3S5ZA 2V82A 4LS2A 3V75A 5AC8A 2Q3RA 1SUXA 2GQAA 3B06A 1H1YA 3W7MA 3NGJA 2PE4A 4IXHA 3B8DA 5HR7A 2HS8A 3G1VA 3THAA 4UXDA 1GYNA 3DI1A 3HPXA 3LI1A 3EX1A 4FEZA 4O10A 2QCFA 1YXYA 2VELA 3H55A 3HPSA 5C5YA 3CU2A 1WDWA 3NQDA 3I65A 1YYAA 2A0NA 3HJZA 1Z44A 1WOAA 3TQKA 1SO4A 3NQEA 2NUXA 3AJXA 2GOUA 2FPVA 1QNVA 1ZNNA 3DFNA 4LS1A 4RR4A 3GXNA 2DZVA 4MZ1A 5F1UA 4HNTA 3SSJA 4ONVA 3GXPA 4WOZA 4IX2A 3GDRA 3P84A 3LXCA 1KM2A 1NF0A 4DF2A 4MIMA 1TTIA 4KWWA 5D2VA 3VNDA 2OT0A 3NXFA 1K8YA 1F73A 3W2NA 3P74A 3W7PA 5KTLA 1VLIA 2V2DA 3C61A 1O5KA 3L67A 2C3ZA 3W2MA 2V0TA 4JIPA 1SPQA 4WY0B 2A7RA 3RLVA 3SFKA 4A2SA 1OX5A 3O06A 4CNPA 2KZHA 3TQ0A 3TMQA 1D9EA 3GDLA 3UWZA 1R46A 5HMSA 4AHOA 2FQIA 1SO3A 1LRQA 1OHLA 1YTEA 3NL2A 2NUWA 3YPIA 3G24A 2C6QA 2Y7FA 1TB3A 3F1QA 3FEMA 3W7JA 3HBLA 3MP3A 4N9DA 1KBIA 4AHQA 4RCXA 5AYZA 2E5CA 3PVFA 4NU7A 2ZRZA 3LRKA 3NQAA 2CFFA 2V5LA 3DH7A 1IXQA 1LOLA 2QCDB 2JGQA 3I6RA 5EBUA 2Y7EA 1F2JA 5EY5A 4O0ZA 1JUBA 2A7PA 4R34A 4CCDA 3LCXA 4JTHA 2VOMA 2EKCA 1SZGA 2Y70A 4N4QA 3WJZA 2B0MA 3NQFA 3TJXA 2AAMA 5EKYA 3TR2A 1QCWA 5F2MA 5G1YA 1L6SA 2ZZ6A 1VH7A 2A6NA 3TAKA 3W6YA 2V30A 4S2BA 3U2OA 1VS1A 3GAYA 4YXGA 2H3DA 1XL9A 2CLMA 2GPTA 4O8RA 4O1BA 3UY7A 1YDNA 3NM1A 3RNDA 1IXNA 1MXSA 4NJJA 2Y61A 5HWMA 2WSRA 3WJXA 3RF9A 3QEZA 1FWNA 1L6YA 4BWLC 4UTTA 4IMCA 3USBA 2E77A 2W0UA 4N2YA 1G4SA 1W5NA 4Z1DA 4ADSA 2D73A 2JKPA 3HG3A 4JD4A 4ZQOA 1DVJA 2X16A 1SW3A 4ZQRA 5FEPA 1G6CA 1I2PA 3KRUA 1AMKA 3G0SA 3CPRA 3I68A 1H51A 4LS0A 4EOUA 4XTIA 1H63A 2NXIA 3W23A 4WQ6A 4ZQNA 4NNAA 3NAVA 1RVGA 1VHNA 5F4SA 4NZJA 3SGZA 1I4NA 1W3NA 4X9SA 3GNDA 3M9YA 5F2IA 1OF8A 3PF3A 3TSMA 3W1MA 1S3HA 1VHCA 3N9SA 1YXDA 4E2BA 2YW4A 4GXMA 3BVJA 1KBJA 5DXYA 1LYXA 4UFJA 2QDHA 2R8WA 2ZRUA 2B7NA 1YDVA 5HUPA 4TMBA 5AB3A 2F84A 3G1FA 3THQA 1RQBA 3EWUA 1NFBA 2YYUA 3K30A 3UWWA 4WUIA 3L5LA 3GR8A 5SWUA 4JS3A 3UWUA 3KVLA 3C56A 1AW1A 3W1RA 2X1UA 1C29A 2ABBA 4IGHA 3CEUA 4AWSA 2J27A 1FX6A 3NNTA 3HG4A 2HMCA 3BGGA 2VFFA 1FCQA 3CC1A 1G4EA 5G4WA 1FDZA 2C1HA 4Y90A 3DFSA 2Y62A 4PODA 3SECA 1DOSA 1EIXA 2WOQA 3TUUA 5DCEA 1AL7A 2FB3A 3RMJA 1LLZA 2HTMA 1F6KA 4FX7A 1EP1A 3NQ8A 5F4WA 3W7CA 4O1CA 4DQWA 3W7QA 4AAJA 1FQ0A 1KW1A 2ZRVA 4LV4A 1FDYA 4LVBA 3O16A 4NUWA 1GOXA 1VC4A 2C18A 5CPNA 1JJKA 3L9CA 3E9AA 4LVDA 4Z1CA 1FBAA 1OX4A 2EPHA 4RZ6A 2V2HA 4OHQA 4FIQA 3TA6A 3HPZA 1XKYA 4L4LA 2WJZA 1YADA 1QO2A 1TPH1 1D3GA 2A7NA 1W54A 2DZUA 3IGSA 3GDTA 3QW3A 1VZWA 2P1FA 2YFOA 3R13A 4IMEA 2DZPA 3W1TA 3INPA 4BF9A 1GWJA 4BI7A 3MI2A 3N9RA 1PCKA 1TTJA 3PBUA 4MOZA 4OV4A 3T7VA 3ATZA 2G97A 2RHGA 2WQPA 4HT3A 2H8XA 3A23A 4JIQA 1YPFA 2LLEA 1M7OA 1W5QA 2QEZA 3G1HA 5FF7A 3OVPA 3TDFA 3TFCA 5EPDA 3N19B 4XTDA 3T78A 4AH7A 1O4UA 2ISVA 3FS2A 1H7XA 3LRLA 3NPUA 1L6WA 3TFXA 5H91A 5G4EA 2WNNA 4O16A 3T44A 2E68A 1H7RA 1O95A 3EX6A 3QMSA 1QWGA 4JTGA 4TU1A 3W1PA 3BG3A 1AK5A 3RLUA 3LI0A 4Y6GA 1W5OA 3UYCA 4LC8A 1H50A 4DBEA 3G22A 1HUVA 4DPPA 4P61A 4AWUA 5FEZA 3L66A 1AW2A 1QPRA 2V81A 3C3NA 4GNJA 4JR5A 5K9DA 2PRLA 4IWWA 3DAQA 3STFA 1WX0A 3LX9A 4UUIA 2YDAA 4E2DA 5BNKA 1TO3A 3L0GA 5AC6A 5KINA 3R8RA 4O50A 1OF6A 1R2RA 4UNKA 3L21A 4YWIA 2WSYA 2A6LA 1U5JA 3G0XA 1W1ZA 1WQ5A 2TYSA 3NZ1A 2BTMA 5TBOA 3W7RA 2TPSA 4UTIA 3B0UX 1YTKA 2ZA2A 1KTBA 5G2HA 4CLMA 3S1UA 4DPQA 5DBTA 2Z1BA 1Q6OA 4L4MA 3MHFA 3S1WA 3NL6A 3UY8A 4N4PA 3W1LA 4K7VA 4Z1BA 1LBFA 1H7WA 4O28A 1OK4A 1BEUA 4MZ8A 3UQNA 3STCA 4TMCA 2Y6ZA 3BLFA 3KFTA 5K3VA 1SR9A 3W70A 4DBDA 3UXAA 3PB2A 4NXSA 4UR8A 1SFLA 3ELFA 1WBJA 3QF0A 4HNUA 3TH6A 1G7VA 1H7PA 2VFIA 4TIMA 1YXCA 4FNPA 2CZEA 4IPJA 4S1FA 1TPFA 2NX1A 1TIMA 5DN1A 2ATSA 2BLEA 1ML1A 1OYCA 3DI0A 2YR1A 4ZMGA 1B4KA 3PBWA 4Z0SA 4AMAA 4FF7A 3LB0A 5D02A 2FDSA 1KFLA 3GKAA 3RK8A 1FY6A 1SW0A 1LDCA 3GAKA 3STGA 2ZZ3A 4JTTA 4N02A 3SR7A 1TV8A 3NO5A 3ZWTA 4RXFA 4XKYA 1P4CA 4M19A 2Q3OA 3MI3A 5U7SA 5CKSA 2YYTA 4N6FA 3CB8A 2FLIA 1TCDA 1Q45A 2VFEA 3DFQA 3W9ZA 4PFMA 3W83A 4LOCA 1H5YA 3UZJA 4GUIA 5IBXA 3W7IA 3G8RA 2IQTA 2JK2A 1GYLA 5T26A 4O19A 5F2GA 1KM5A 1ADOA 4HSNA 4PTNA 1KV8A 3MI6A 4I7UA 1JCJA 1M6JA 3HGRA 1S5TA 4MY1A 3M44A 2H8ZA 4CQ8A 3L5AA 3S6DA 2A2IA 5LHEA 4ADTA 5D04C 4Z0JA 1FCBA 2Y89A 3GB6A 4O0KA 4UC5A 1BKSA 3W73A 4GRSA 5FESA 4JTEA 3W1UA 4UTMA 1QAPA 2GVGA 4UFHA 3D0CA 3MP5A 2QUUA 3C2OA 1AL8A 5LGZA 4IQLA 2YPIA 4IMFA 4JY9A 3MWAA 3QH2A 3KHJA 3GZ3A 4UTLA 1TTPA 4GUFA 5LGXA 4FX6M 5HR6A 3IEBA 2AQWA 2WNZA 2B7OA 1SSGA 3TAOA 1T96A 3Q94A 1TQJA 3HMJG 4PL1A 1KLZA 4UMAA 5CPLA 1L2UA 1WA3A 3DHDA 3PG9A 4RZ4A 1ICPA 3PUEA 3QW4B 2C15A 2QCHA 4XBKA 1K02A 3SZ8A 5C2XA 5LHFA 1EEPA 2FTPA 2I1OA 3EKZA 3P61A 1XBZA 5LZLA 4A29A 3E0IA 4MZYA 1D3HA 5FI8A 4JTUA 3W72A 2A5HA 3WK0A 2NLIA 4GFSA 3W2JA 3TW7A 5DY3A 5CZSA 1MEWA 4XBSA 2XN0A 4HHPA 3PM6A 4W9TA 3ANYA 5C55A 4DELA 2ISSA 3BLEA 3I7RA 3GDMA 3NPXA 3DHFA 1OX4B 1B3OA 5F4XA 4ZVJA 3FYPA 3GR7A 1UUOA 1QR7A 2X30A 4ORIA 4OE7A 1W37A 2JKEA 3M6YA 1EPXA 4PCFA 2GJNA 5AHEA 3PS7A 3EEGA 2OJPA 4O53A 1ICQA 2CLIA 3UZ5A 3W1AA 1LBMA 3PG8A 1GPWA 4M6VA 1OFEA 1JR1A 1F05A 2DZWA 3EX3A 3SY5A 1I2RA 4GUHA 4C1LA 1TJRA 3N73A 4U28A 3C0JA 4LUIA 1OFDA 3EX4A 1QPNA 1OYBA 2PC4A 4H3DA 3W7HA 5C54A 1PHQA 4H6KA 5J5DA 4R7JA 2XN1A 5G2WA 1GG1A 1SSDA 2ZBTA 2CZFA 3B4UA 5CZTA 1RR2A 3BGJA 2NV1A 3W7DA 4MY9A 3R2GA 1EUAA 4CCEA 3TXVA 4X3ZA 5LNWA 5IM51 3LRMA 2BX7A 5CSRA 1DORA 3S1XA 3IGUA 1I2NA 2PRHA 1F6PA 2VEPA 2VFGA 4FIRA 4CQAA 3CQ0A 5CSSA 1ZJIA 1GQNA 4O54A 3O05A 4JYEA 3L65A 5IBXC 3OG3A 2H3BA 3EB2A 2XFWA 4FB7A 6ALDA 4UTKA 5HJLA 3IRDA 3S9YA 3LHUA 3EXRA 1W3IA 1KTNA 1AG1O 3L68A 3MMTA 4HSOA 3WK1A 3GDKA 3U8GA 1VRDA 1EB3A 3DKJA 3C6CA 4AVFA 1GJPA 5D33A 4K8EA 2I9EA 3S5NA 1TRIA 1RD5A 1JCYA 3FA5A 3Q2DA 3P81A 5D2XA 4K8HA 3N2MA 1LORA 3EKLA 3GVGA 3W2UA 5A8GA 1LBLA 1KA9F 3Q58A 1HG3A 4HPXA 1TREA 3EXTA 1R47A 3LBCA 4K36A 3CHVA 2ALDA 5AHLA 1ZALA 4P2VA 2OX1A 3UXDA 2GVJA 3IV3A 4YLWA 1ME7A 4BI5A 1EA0A 3ABOA 3NQVA 2X1SA 1TPB1 3M16A 4JYDA 2YSWA 3CTLA 3VI2A 4UFMA 2WV8A 2CLHA 4MLJA 3FJLA 4LVGA 3P5ZA 3ZFHA 1O60A 3TE9A 3LDVA 2E6DA 2OCZA 5DCDA 2V2CA 3A24A 4K6AA 3LCIA 5L6UA 3RFAA 3C2RA 4BFAA 3G1SA 3UWYA 3NL5A 2FIQA 3PBYA 3E96A 3P8JA 3DFOA 1KM0A 2QAPA 2YX0A 4UTWA 2BZNA 4HIBA 3LLFA 4AHPA 4XKYB 1PVNA 2EF9A 4O4VA 5CZJA 5K4ZA 1ME8A 1FUYA 1IIHA 3A5FA 2NV2A 3LERA 4QIUA 3JRKA 3W7KA 3R5EA 3F03K 4OBTA 1B4EA 2QCNA 1ICSA 5KZDA 3LCLA 1JRBA 1GTEA 1TYGA 1Z48A 5D2TA 1C8VA 2ZRWA 5C6MA 3L2IA 3B0PA 4FHAA 1HO4A 5KZMA 3HO8A 4RK8A 3SW6A 2FFCA 3AO0A 5FF0A 2Z6JA 5BMXA 5HULA 1KTCA 2OT1A 4XZ9A 1XDMA 5K7JA 3NG3A 4HNVA 1JCLA 4NJGA 2V8ZA 3LGEA 4G1KA 3W7LA 5KMYA 2EAWA 4WXZA 1P1XA 1R2SA 4U4MA 4QITA 3QYQA 2W6RA 1JCNA 5AOUA 4O4WA 3WJYA 3I7SA 4YCOA 1VPXA
chains in the Genus database with same CATH superfamily
4W88A 4IOTA 2Y63A 4ZQPA 4IHCA 3RPTA 1UOKA 3EDEA 1X8CA 3WQEA 4L1XA 2Q8ZA 2DORA 3V18A 1KM1A 3A5VA 5LA2A 4O12A 2QUMA 2IW0A 2Q8LA 2VRJA 3E74A 1R0MA 1A3XA 2QDDA 3U7BA 2HZGA 3KBJA 1ENUA 3SY1A 3S5YA 5BRPA 2QAFA 4FNTA 1QO5A 1K9DA 3T2PA 3SUSA 5D4YA 3T08A 1SVDA 3E2RA 3DX5A 3OBEA 3B8IA 2ZDRA 2BVDA 3W38A 4DBSA 4DI8A 4A3UA 3PFMA 3RIKA 1UROA 4PSPA 3GIPA 1V3LA 3W3OA 1LM1A 4LBUA 3MSRA 1XH1A 3SADA 3KRZA 1JULA 5A6LA 3S1VA 2WSQA 4O11A 4DO6A 4OECA 4DJFD 3TLQA 1A50A 4C65A 2GJLA 2CZDA 3G0UA 4NVTA 1AW5A 3OZPA 2XVPA 3IJDA 4J7RA 3E5PA 1A5BA 4LNCA 4JTLA 4IMGA 4WY0A 1MW0A 1MWOA 5C9RA 1PKLA 2OLAA 3VE9A 4P8XA 2YXGA 4XZWA 3WQDA 5EMUA 4AZIA 2Y24A 1GG0A 3DBPA 4CD8A 2WVUA 3FIGA 4NJHA 4XZLX 5D32A 3O6DA 3WFAA 2ZRXA 4DUVA 4ZO7A 4H6EA 1U33A 2ZUNA 1V0MA 1CEOA 2REQB 1JDFA 3KS6A 1SFSA 1GQJA 4L4PA 1HNYA 5A6JA 1LZOA 1PYFA 2G95A 5K4XA 2WO5A 4J27A 3ABQA 5I3HA 1H49A 2CWNA 5I07A 1UWSA 2XIMA 4B5NA 5CPSA 3KHDA 1M7XA 1FWIC 3Q67A 3FK4A 1KXTA 1XS2A 1XW8A 1EWEA 5EBAA 3TTQA 2GGIA 1OK6A 1W0MA 4XO6A 4IFKB 2CNCA 2VXNA 2VP8A 2Z26A 3NXLA 2D20A 4JFVA 3CWHA 1FWFC 4S2CA 4S3KA 2MANA 3N2XA 3NPWA 2YFNA 4MB4A 5C9XA 4LWWA 3LBMA 5FF4A 4KFPA 3NVTA 2WHKA 1UUMA 2WVSA 1U1UA 4L61A 3W24A 4C91A 5DLCA 1GVFA 3TK7A 1SFJA 3UZWA 2I57A 3NA8A 2O0TA 3VUSA 1EYWA 2P3ZA 2WANA 3CL7A 4IH3A 2QUNA 3OYZA 3W29A 3BXWA 1Q65A 4KGJA 5JH1A 4URIA 1EP3A 4L56A 3LM7A 1FWCC 2ESCA 3UZXA 3QOMA 3S2NA 3UR7A 4NP7A 3IK2A 2NVDA 3B0VC 1F76A 3M0JA 3IUIA 4CNOA 5K9XA 3ARYA 1L8PA 3P62A 3RDKA 4G9PA 1GVSA 3WLIA 4H4IA 1BRLA 4CNTA 3JZUA 4J3ZA 1MFUA 4BR1A 2ATMA 2Y88A 2BY2A 1UC4A 4GQQA 4E4PA 5A6KA 1WDPA 2XVKA 1WZKA 3VYLA 1WDQA 1NDWA 4IIHA 1TZZA 1G94A 1AD4A 1QBAA 4A21A 3IVUA 2YA0A 3WDPP 4LY8A 5IRPA 4KCWA 1EBHA 3BUVA 4GC3A 2HE8A 2GJXB 4XAYA 2VQUA 1XLDA 1YBQA 2HS6A 3CUZA 3AHXA 3AMDA 4D8LA 4ASTA 1QNPA 1PYMA 2XGIA 2J7DA 4FNRA 3K1DA 3CUHA 1DKWA 4K39A 2WC7A 4QLJA 2FPYA 1F61A 2YBVA 3WH8A 1W32A 1MVYA 2POZA 4A05A 4F66A 2QVNA 3LY0A 3C8NA 3VKJA 2J74A 2ADAA 3PZ9A 5K9CA 3P80A 2RJHA 4K7YA 1MXDA 2HPIA 5TF0A 3UF9A 3BQ5A 1XIDA 3H53A 3ITVA 5BOFA 2QCGA 3DZ1A 5E0CA 3W7OA 1C90A 2Z1VA 3BARA 3U2ZA 4EK7A 3WBXA 4R53A 4YYCA 1X7IA 4S3GA 2PF0A 2JEQA 1V3IA 5EYWA 3S47A 1ZZMA 1Z6KA 3CV6A 1A3HA 3EWXA 3OZYA 3MCMA 1R8LA 5AFDA 1TPEA 4O18A 1GW9A 2AMGA 3NVDA 3KBSA 4DNHA 2ZVIA 1WOBA 2RDWA 1EHAA 3SDOA 1T99A 1KD0A 4LTSA 3NPVA 1FOBA 4QGCA 2VHLA 1ZAJA 2QKFA 2XGBA 2DP3A 4CKQA 1WYIA 5E6ZA 1VCFA 5CG7A 1Z41A 3T40A 3RXZA 2I5GA 4XX6A 3UPMA 2CLEA 3Q37A 2P3EA 4GY0A 2B81A 4E8GA 1OG0A 4H8HA 3U6WA 4H9YA 2PMQA 5H8MA 3BO9A 3B0YA 4H04A 5BXPA 1ZP4A 3G1RA 4F0SA 2ZA1A 1Y8BA 1MEHA 3KWXA 3V36A 2HE5A 3WFZA 4M7TA 3CZJA 4ZEPA 1F07A 4JDYA 3GXIA 5AN7A 5A69A 3RJYA 4HKPA 1CI1A 2NX9A 4GVHA 2ANUA 2Y8KA 9XIAA 1E4IA 1OT1A 4GVGA 3N12A 1CGXA 3KVKA 2ZRYA 1WZMA 3CHFA 4KWOA 2GGGA 3DBNA 2V5CA 3LTYA 1Q5MA 1P6BA 2XWEA 2PSNA 3VOCA 1WBHA 3UG3A 3M4HA 3S6TA 3H4XA 4U31A 5GQBA 3ARUA 4AZBA 4HSHA 1NARA 4BHYA 1TJ0A 4CQ9A 1W91A 4HPNA 2C71A 1KKOA 1EX5A 3PR2A 3W27A 4NQ1A 4JGDA 1FCVA 4JIIX 3LXBA 4V2XA 3DEQA 3N4EA 4M29A 1NQ6A 4FO4A 4M7SA 2I17A 1DQXA 1IXPA 2PP3A 1E1EA 4QX4A 3T8LA 1JQXA 4LUSA 2EG6A 5DCBA 4W93A 2VFHA 4H2HA 1MQPA 4XZMX 5AC7A 3GFXA 1XCFA 4WJXA 4HYRA 1V93A 3B8VA 2PA6A 1X39A 1IEVA 1HJUA 2C19A 1X96A 2V3GA 1OT2A 4RLIA 4A8IA 4DWSB 1TJ1A 2DSUA 1V0LA 5BOOA 3V1PA 1IE7C 5MHBA 3PPGA 1E1CB 1EC9A 4PZVA 3TX9A 4QEHA 1G4PA 4NAEA 3TLLA 1P5BA 1H7OA 2PDJA 3IAPA 3WH7A 4LNYA 1PZ3A 4PCNA 3VK5A 1XH2A 4Q8WA 3WDHA 4R7OA 3DXIA 4NNBA 1W1A1 4JQ4A 3CH9A 5HXMA 1JDEA 1BWVA 1PZ2A 4FK9A 2NW0A 2X05A 4M6QA 1XC4A 2B7PA 3O6YX 2NQ5A 1TV5A 1PZ0A 3OOQA 2PGFA 3NJ3A 3W1NA 4C90A 3RU8X 1I2QA 3G1DA 2AMXA 3ES7A 3G1XA 1Z69A 4LAZA 2BBFA 3MHUA 1E0UA 2OGYA 1I2OA 3R43A 2ZUWA 3CMFA 3GBDA 3NCOA 1W9VA 3G5EA 2FGBA 1VBGA 2YZRA 3QGVA 4QROA 7A3HA 3LQGA 3ISIX 4K8GA 4MPKA 2D3NA 4DRSA 1PUDA 1Y5XA 5FSEC 5HWJA 3UXLA 4K38A 1KM3A 2HISA 4JAWA 2PDMA 3APTA 2WWCA 1OVDA 1DJNA 1JCMP 3L4TA 4CNSA 4V33A 1IEXA 1VIZA 3WNOA 2W67A 4H9MA 1C9DA 2X2GA 1OIFA 2HCVA 2EPMX 1AQFA 1T0OA 4NZ5A 4NILA 3ITGA 5DRIA 1J4EA 1DJZA 5G1TA 2Y1HA 2VGIA 2IMRA 2BFGA 2R24A 4DIAA 3ME3A 4OGZA 4XSLA 1DXFA 1E71M 1XDLA 2WM0A 3CIWA 3GRIA 5IDIA 3RU6A 4CCCA 1HP4A 3VCRA 1VBJA 1F6YA 4GNVA 4O1AA 4DEFA 3QHMA 2VMFA 2XN2A 3G6LA 1GZ1A 3GIYA 2YJQA 2J9ZA 1SQ7A 4LRSA 2WK2A 3M5XA 3LHVA 1W1IE 4EIVA 4DYEA 4BY3A 5REQB 1OEPA 3UPBA 2E5DA 2YCIX 2V5JA 2B4GA 2YZ5A 3W01A 2VGBA 4NY2A 3W7GA 3GZAA 3CWOX 1TPUA 1J2BA 2AGTA 2GK1A 2QZRA 2ISWA 5D2YA 5HNNA 4GQGA 1JI1A 4C1KA 3OPSA 1K8ZA 1ZS2A 4F2TA 2XIQA 3PZIA 3II1A 3TROA 3EWWA 4JNZA 2W27A 4I9AA 1FHDA 4WSKA 3NM3A 4YNGA 4AC7C 4HOWA 1RJQA 4RE0A 4WD0A 4HU8A 4E4FA 2PWUA 1WE5A 1CCWB 5E9XA 2Z0IA 2F38A 3QJAA 1OCQA 4RE4A 1R2TA 5M03A 3PBVA 3S8HA 3PZVA 2GVLA 3LGDA 1QXLA 1IWPA 4I7WA 4R9XA 4AD3A 4QM1A 2X0SA 5CPOA 1JAKA 4GXWA 1K7XA 4IMDA 1TJ2A 3GFYA 1P1MA 3VOIA 2CLFA 2VENA 4AEFA 1R7AA 2HWGA 1FXQA 1UWUA 5U4NA 3ZIZA 3O2LA 3UG4A 3LHWA 2WHJA 3QZ6A 1M65A 4M82A 5IXEA 1DIKA 2I7GA 4RDZA 1BYAA 3FW6A 3GIQA 1JRCA 3RYSA 3ZWSA 4GYJA 3O15A 4YMZA 2J47A 5KITA 1ZBKA 1QU4A 4FNUA 4I8DA 1W1B1 2I14A 2E40A 3BAKA 2DU2A 3OYXA 4LU0A 1W3HA 1XCXA 3KDNA 4UR7A 2TRSA 4I9JA 1W9UA 1TWDA 2XSBA 3CQKA 4NYYA 4XQ6A 4GACA 3JW7A 2YLLA 4OWGA 2C0HA 3TSBA 3C2YA 4O13A 3RILA 1H0IA 1UJQA 3AIRA 3BDKA 1RCOB 3P93A 3ABRA 1ZCCA 3NIYA 1UWAA 3FXGA 3PWAA 4MWAC 3V3WA 3GNOA 1JEZA 1AFSA 3R10A 1XRSA 4MNKA 1M04A 1MSSA 2V82A 4C6LA 1MNZA 3V75A 5LXXA 1JXKA 1UD4A 3ZT5A 3FNDA 2GQAA 3B06A 4XZHA 4RDYA 3D5HA 5J8LA 3NGJA 2PE4A 4IXHA 3B8DA 5HR7A 2YB4A 2HS8A 3THAA 2WM1A 4IG2A 1MNSA 3HPXA 4F79A 4DO7A 4FEZA 5C5YA 2ICSA 1C8XA 2XWDA 3NQDA 4FR1A 1QHOA 4W86A 4B3ZA 1YYAA 3HJZA 1Z44A 4YVPA 1WUEA 3NQEA 2NUXA 4IL2A 3ERPA 3QTPA 1A4LA 2GOUA 1Y7VA 2FPVA 3NTYA 5EFDA 3VKCA 1ZNNA 4LS1A 3T07A 5LIYX 1EOMA 3DECA 3BZJA 1YHTA 3MDUA 3I6TA 3GS6A 4Q7BA 4WOZA 2R1NA 4KWWA 3NXFA 3W2NA 3W7PA 1VLIA 2V2DA 1JZ6A 3L67A 3W2MA 1PAMA 3FX4A 4PN2A 1NOUA 3RPMA 3S9IA 2AQVA 1N82A 1GQLA 3WF4A 1U30A 2X8RA 3K5XA 4ACZA 3TMQA 1OIMA 3ENLA 1K9FA 3VNZA 3YPIA 4PMDA 1TB3A 4C6JA 2AL2B 5LIUX 4AZCA 3U0HA 5M1TA 4P8WA 1SM9A 1CLXA 2DIEA 1WKDA 2IQDA 4WSJA 3SCWA 4F48A 1NFPA 3WY1A 1WKFA 1XRFA 4GINA 3NQAA 4B3LA 3MSDA 2D0GA 2Y7EA 3H26A 4QLKA 1JUBA 2VQTA 4KMQA 3DG7A 4CCDA 4JTHA 4PRRA 1E9LA 3WQCA 2VR5A 3NQFA 1ODZA 2EQDA 5EKYA 3G77A 3CTTA 4FXFA 5G1YA 4NSBA 2PDXA 1ISZA 3OP2A 1BYBA 1Q6FA 4S2BA 1CBGA 5HMFA 3WLOA 2H3DA 1XL9A 1R3RA 3WLRA 3RNDA 4ZR8A 1VENA 3E6EA 1S2UA 5A2BA 5AYIA 2QYGA 3NOYA 3ZXWA 5BCAA 3VIIA 2EG7A 4M0XA 3RF9A 3PJWA 1QT1A 4H9VA 1ITXA 5AYBA 3USBA 2WW5A 2UY3A 1V3KA 4FAMA 4Z1DA 4PMRA 4I90A 1J0YA 5HK4A 4IL0A 1PKNA 2JKPA 3ARSA 4ZQOA 1EF3A 1SW3A 3B9AA 4HMCA 4XO7A 2XFFA 3VAVA 3K1GA 4EOUA 1BKHA 3MVIA 3WLJA 3WN6A 1Q4WA 5HPOA 3L7RA 6TAAA 4C6DA 4W5ZA 4WQ6A 4DUOA 4NNAA 1RVGA 3AU6A 1VHNA 3GTHA 4NZJA 2DDXA 4JQ3A 3SGZA 1I4NA 4X9SA 1E55A 3PPFA 1N8IA 1OF8A 4EPEC 3TSMA 4QP0A 4U3CA 5GNXA 1XIHA 2G4JA 3N9SA 3VD9A 1YXDA 2YW4A 4PE8A 3ZSTA 4M24A 3BVJA 1YDVA 5HUPA 1BFNA 4TMBA 2WXDM 3G6MA 4JTRA 1F4HA 1NFBA 2XFRA 4WUIA 3L5LA 2OOGA 5A6BD 1LG1A 3OGRA 3AHYA 1QHPA 2FZNA 3TYCA 1GQKA 3CEUA 3LSCA 1PTDA 3M64A 3HG4A 4RV3A 4MDPA 3U4FA 1JZ7A 2VURA 4IPPA 2C1HA 1R6WA 1W9PA 2Y62A 1MDRA 5DCEA 3MU7A 4G7EB 2FB3A 3WBYA 1XLMA 1VFHA 1EP1A 3NQ8A 3W7CA 4O1CA 3OJGA 3Q65A 1V8EA 2ZRVA 1FDYA 4L1WA 4GG9A 4IIBA 5HOSA 3TWBA 4Q7IA 2C18A 3PJUA 3E9AA 3ES8A 5CJ5A 4Z1CA 1YPXA 2G0WA 3F5KA 1FBAA 5MF5A 4DY1A 3HPZA 2NVCA 1TPH1 1D3GA 2A7NA 1XKJA 1VEPA 3CV7A 1W1YA 2DZPA 3CH0A 4BF9A 3VABA 4DUWA 2V5DA 4UQBA 3T7VA 1AQHA 3ATZA 2RHGA 3HJEA 3UU0A 3RLGA 2E9BA 1E72M 2QXWA 4JIQA 3WMLA 2LLEA 3IJIA 1PTGA 3UJEA 4XTDA 1RUSA 4H1ZA 4G1NA 3RR4A 4PYSA 4HA4A 4IGSA 1H7XA 3LRLA 3TFXA 4JTDA 2OQHA 4O16A 3T44A 1H7RA 2XIBA 4JTGA 1QWGA 3CK5A 3RRAA 5BXSA 3RLUA 1V7AA 3FAXA 1RXOB 4XD4A 3RM8A 1H50A 3G22A 4DPPA 2FGZA 4W4QA 5FEZA 1RY8A 4INFA 4B3KA 3WMBA 5FAJA 4DJEC 3LMZA 1XGEA 1D7KA 5I23A 2CKSA 4GIEA 1CLVA 3STFA 1XLBA 2HVOA 2D2JA 2E1WA 1FHVA 2X41A 1EOKA 5AC6A 3CNYA 1R2RA 3BAIA 4LAKA 1P0DA 1U5JA 1G0CA 1M01A 3NZ1A 2YBUA 1KR1A 2BTMA 3QGAC 3W7RA 5CCZA 2TPSA 4AD4A 1J18A 3B0UX 4JTQA 1YTKA 2ZA2A 1KTBA 5DBTA 4V27A 4C5YA 4J3WA 3W1LA 3BURA 2J13A 2BMBA 2HRWA 2YXXA 4AY8A 4HK7A 2F9RA 4KCTA 2VEGA 1KGUA 3BLFA 3UYIA 2QHAA 3AI0A 5CSUA 2J77A 5GNZA 1V02E 1SFLA 3UETA 4HNUA 1G7VA 2VFIA 4TIMA 3DG3A 4YTUA 2E0PA 2NX1A 5DN1A 2OTDA 2ATSA 4AD1A 1OYCA 3DI0A 1YNQA 1B4KA 3PBWA 4Z0SA 5E6YA 6ENLA 3PWIA 2DH2A 3GKAA 1FY6A 1J79A 1SW0A 3H22A 1WXZA 2OR2A 2QV5A 3SR7A 1XRTA 2EPOA 2Q6ZA 1P4CA 5U7SA 3WL0A 3CB8A 1TCDA 4IQEA 4J35A 3VNJA 4JHZA 2QLYA 3W83A 4LOCA 2DH3A 2IQTA 2XIIA 5T26A 3T0AA 1P7TB 5F2GA 1XSKA 3MI6A 2XHYA 4FP1A 4GMEA 3WYZA 3TYEA 5C7HA 1JYXA 1EQPA 2G3FA 2OZ3A 2QGHA 2Z28A 1HQTA 3GR4A 1UW9A 4H6RA 5LIWX 1QAPA 2PTXA 3UVAA 1AL8A 1S5NA 3CAKA 4UTLA 4DJFC 3IEBA 2AQWA 5CBIA 4TXEA 4UMAA 5CLWA 2QMJA 1LQAA 3PUEA 3QW4B 1E4NA 3W25A 1B3YA 4CU6A 3B0XA 4L9YA 5H8UA 2GVYA 5LZLA 3E0IA 3W72A 1DTUA 3W2JA 5DY3A 1L6GA 1ZBCA 1S5MA 4W9TA 3BLEA 1P43A 3CHDA 3DHFA 4JNYA 3FYPA 4A4AA 1XCWA 2X30A 2WWDA 1W37A 2D2OA 1VKFA 5T9BG 1UMLA 4FALA 3OW1A 3F7JA 2PAJA 1LQ2A 2GJNA 4B92A 2PDGA 3PS7A 3EEGA 1J0JA 2XINA 2ZADA 3WUBA 1GPWA 3QR3A 1OFEA 3U48A 1ZB5A 2PGRA 1I75A 4U28A 2PDQA 3C0JA 4LUIA 1K4HA 1OGBA 1QPNA 5C54A 2IXUA 4QXIA 3ZM8A 3CAWA 2PZNA 3KLLA 2CZFA 3AICA 4W89A 3RUBL 3SFWA 4GHRA 3GVVA 4AZ7A 4CCEA 4D6EA 1RLDA 4X3ZA 5LNWA 3SUWA 5IM51 2WLZA 2BX7A 4CU7A 5CSRA 2BNJA 3IGUA 1WDSA 2VEPA 2VFGA 1XLHA 1QNSA 4CQAA 5CSSA 4U2ZA 1XIFA 1GQNA 4JN7A 4JYEA 4DAFA 3L65A 5IBXC 3MCOA 4ZO8A 1I0DA 5HJLA 3IRDA 3NGFA 4L6DA 4ZTXA 1CB7B 3EXRA 1HKKA 1KCLA 2REQA 3L68A 1DYSA 1TA3B 4J40A 4GABA 1GZJA 1FRBA 1XYZA 2YB1A 1VRDA 4IP4A 3C6CA 2PODA 2XVNA 3C5QA 4DWDA 3UP8A 5CAHA 1Q6DA 4I9MA 1V02A 2PTDA 1RD5A 2G3NA 3FA5A 4JN8A 2DPEA 4AYGA 3N2MA 1LORA 3EKLA 3W2UA 4MWAE 5A8GA 1UD3A 4WDUA 1LBLA 3SCUA 1HG3A 4K36A 3EKGA 4MKSA 2ALDA 5AHLA 2XGZA 3UXDA 3C86A 2GVJA 3B8UA 1Z8AA 3I4EA 4I5UA 4OUEA 1I1WA 3AS2A 4XAGA 3NQVA 2F2HA 5A6TC 3H21A 2CLHA 1RK5A 4MLJA 1UQZA 4H41A 2XVLA 3TE9A 1Z7AA 2OCZA 5DCDA 4OZOA 3GNPA 5AZ1A 3LCIA 2J7CA 2WYSA 3UR8A 3PZNA 3NL5A 1O68A 3DFOA 1FH9A 3GTFA 2Z4GA 2YX0A 2BZNA 3ZJKA 3QY6A 1PVNA 1R38A 5I3DA 2EF9A 5CZJA 1CGWA 1O5QA 2R9RA 3VNMA 5CBBA 2ZXQA 3WIJA 2NV2A 2FVKA 4GVFA 2P88A 4OBTA 2EJ1A 3N11A 1JRBA 4JTAA 3B40A 5I06A 5C6MA 3SURA 8XIAA 5KZMA 4HU0A 3EDKA 1XC6A 1LLOA 4PFHA 1QPKA 3SW6A 3FDKA 5BMXA 1S2TA 5HULA 2C7FA 4XZ9A 3WF1A 5K7JA 3E2QA 4F0RA 1JZ5A 5A2CA 1HL8A 4Q3MA 3W7LA 2EAWA 3TC3A 4WR3A 1J0KA 4ATLA 3JU2A 4U4MA 4XZNX 3QYQA 1MRQA 1JCNA 5AOUA 3VIGA 3P2VA 2CLOA 3GU1A 1AA1B 4GQRA 2OODA 1F3TA 3FHAA 4Y9AA 3QQ0A 2YCJA 2OEMA 4ZFMA 3CT2A 5DELA 5G5IA 2DZXA 3ZOAA 1OYAA 4TX9A 2VZSA 1D2KA 1A49A 1QI4A 3GU2A 2O4QA 3M47A 3AMCA 3TN4A 2YDRA 4JEQA 2H90A 1JDAA 1J2WA 1PHWA 3T42A 1VFTA 4XZIA 1R3TA 1FDJA 1WAUA 3LD5A 1KFBA 2DVXA 1Q6GA 2VEIA 1RP8A 1V6YA 1GVRA 1K6WA 4LALA 2Y7GA 1YEYA 1WXJA 2PGWA 3W75A 2X1TA 3E12A 1DWHM 5E93A 4RX0A 3QY8A 1EC7A 4O52A 1GOOA 3IIZA 3VZYA 3R25A 3QBUA 2VEKA 2I5QA 4MYAA 3BH4A 1RA5A 3ZJ6A 2Z2UA 2VC9A 5BRBA 3NQMA 5LNSA 1GOKA 1SYTA 3WF2A 1V7YA 1WO2A 4QS5A 3SM0A 4PB3A 3DYMA 1RQEA 1S2AA 2DV0A 4YWSA 2FB2A 3MQTA 4LUJA 3PC0A 4QBXA 1YTDA 4F9DA 3M0ZA 5F2LA 2PB1A 1VJZA 3LG3A 3QHNA 1Q85A 4JXCA 1L8NA 4QEEA 3OIXA 1KR0A 3TSDA 4D9PA 4BA0A 1EEXA 2VDGA 5A8PA 3BLIA 4I3GA 4LV9A 4OBRA 4F4RA 3HQPA 1B9ZA 1HGWA 2OQYA 4CNNA 3AYVA 3EDDA 3C2FA 2NXGA 2INZA 4D8ZA 1ITQA 4WZHA 3LHZA 5A3HA 4PMZA 4KW2A 3OA3A 4MWAA 2W9MA 1HKIA 2OEKA 3GG7A 3KAOA 1KXQA 2OGJA 4QE5A 3P6LA 2RAGA 1TQXA 5HUOA 3BICA 3HGJA 3CL6A 1V6WA 4RXGA 1IXOA 1QK0A 3TN5A 1F3XA 1LL4A 4XAPA 2PDCA 3FGCA 3KL0A 5GNYA 3MANA 1XM3A 2HEJA 3IVTA 5KZEA 5ENLA 1ZCOA 2EHHA 4AIOA 1TVNA 4HU4A 4Q8OA 4Z1AA 2BSLA 3PPCA 2J8TA 1MUMA 4GBUA 2JALA 2ABAA 3ZR4A 1XBYA 2ZQ0A 3OG2A 3MHGA 4PA8A 3BOXA 4GX9A 1UASA 3M0YA 3BTNA 5AC4A 4JTJA 1YPIA 5D2WA 5HDRA 3C4UA 3M5YA 3MUZ1 1BG9A 3KX6A 4US5A 3LUTA 3MP4A 1UG6A 2OZ0A 3AHTA 3WX7A 1KWGA 3NDOA 1Y65A 2NZLA 3CZEA 1CXLA 3F4DA 5HMDA 3R8HA 1ZHAA 4E6MA 3GC2A 4AG0A 2AL1A 1P0KA 2OSXA 3M0HA 3IIVA 1CGYA 1B3ZA 3IIOA 3N18A 1CXEA 1MYRA 2EGZA 1EUNA 3L12A 3R89A 3P60A 4TR9A 1K7FA 1SZFA 3S1GA 4NRRA 3SI9A 5FAGA 2Q02A 2PCEA 4UNIA 2GQ9A 1LCOA 4PUDA 3M07A 1DV7A 4UQEA 3E38A 2H9AB 1UZHA 3RO8A 2GOKA 5LSMA 3BAYA 3RM9A 1CXKA 3PUOA 2DJLA 2IUZA 3PAOA 3MW7A 3V5OA 1VD6A 4XUGA 1E1CA 1XGDA 4O8AA 1V3JA 1GZGA 3EOOA 2WPBA 1RY0A 1BGGA 1NF7A 3TTYA 4K1WA 2E6FA 4LF2A 3WDJA 5CAKA 4ZFCA 1UR8A 3HG2A 5DT5A 3KUMA 3MBDA 1UR1A 1LOSA 4PTXA 2IPFA 3SJ3A 4JEJA 2HSAA 1HKWA 3CIXA 3SIZA 3ALGA 3EB4A 2E8ZA 1DXEA 7REQA 3M0MA 1GT8A 1EJUC 4CN1A 4HNNA 3QQ1A 3EZ4A 1A5SA 1S2WA 1UBSA 2OSYA 2G3IA 4J9JA 2OZTA 1WZLA 5A94A 2CERA 5D37A 4AF0B 4TX8A 4BKNA 4OV9A 3FJ4A 5CGQA 4U2YA 3DFPA 1C91A 3B03A 5CJNA 1GQIA 4QSFA 3E0LA 4AVNA 4HVXA 4UCGA 3A3HA 3SRDA 4XBJA 2ZC1A 3LHYA 4DJDA 1JQVA 5FEWA 3P5YA 1K8XA 4KIEA 2PDLA 2X7VA 4JQ2A 2YCLB 4FOKA 3ABSA 1QOXA 1DQWA 1ISVA 1EH9A 2C16A 3L4UA 4YCPA 1KFJA 3PBMA 3S42A 4B2DA 3L4XA 4QNWA 4IJRA 1VBUA 5EMLA 2GLKA 5IHRA 2ZICA 2OO0A 3REQB 2VC7A 3P8IA 1UR2A 1YDOA 4QQUA 3A4XA 1HO1A 4R33A 3TVAA 5IHSA 4PB4A 1P0NA 4NNCA 4BCEA 2A85A 3LENA 2E9LA 3WNKA 2E6YA 4ORMA 2XSAA 3GVRA 3UWVA 4UQ9A 1R9YA 3O9NA 3DU0A 4AWEA 3WMSA 2WVVB 1ZSXA 1UYQA 2NWSA 4FX8A 1KV5A 1PCWA 4NJKA 4J2MA 1TPVA 4GC4A 1BPLB 4H19A 4O57A 3WUFA 5FF2A 1PX8A 3MUIA 1NSJA 4LUTB 4QQ3A 2VC6A 1XQKA 1HXJA 5REQA 2PURA 2WZMA 1A5CA 1R30A 2V63A 4RNHA 3HPAA 3LLDA 5FD0A 2YCEA 2ZFAA 4R88A 3N2BA 3UJSA 3R79A 5D9OA 3TOYA 3O1NA 1DE6A 5D30A 1FKWA 1M5WA 3MC5A 2BXVA 3BW3A 2J24A 5FJRA 2ZCGA 4ZBCA 4UIOA 1UIPA 3U5YA 4D6HA 3WO8A 4QCEA 1BTCA 3NZRA 3NL3A 3OVRA 2Y0FA 2GGEA 4GIYA 4C7DA 4AEEA 2O9RA 2J8GA 1XF0A 1W31A 4GUGA 1T6MA 1JUEA 4KEVA 3TZNA 5ABTA 4ENLA 2WKJA 2PP1A 4RPQA 1K3UA 2EPNA 1PX3A 2YGYA 2JBMA 2VM8A 4WXYA 1J93A 3UZZA 4PSRA 3H7UA 4UNLA 3XIMA 2BB0A 5E0KA 2CXGA 1W2VA 4F0LA 4N0RA 1CT5A 4GBDA 2R1LA 3MJYA 4HMEA 3T81A 3OZMA 3BSHA 4XV0A 3KP0A 1OD0A 4JN6A 3W2KA 3WH5A 1KKRA 5A95A 3TYDA 4WLCA 3G3MA 3SJNA 1EBGA 3SRKA 3GM8A 5A6AA 2RFGA 4BK9A 5EA9A 3HB9A 2P0OA 4O15A 1TSIA 4DJEA 3AZTA 1VLWA 3V5FA 3HQOA 4AZ5A 4N42A 1TMHA 1TV7A 4BQ4A 4QJ5B 1O66A 3K4DA 1DTNA 2ZX5A 3WLHA 3DGRA 4QE1A 2WMIB 3QC3A 4B4FA 2HDJA 1A53A 3W1XA 2ODOA 3QLDA 3B05A 4Z2GA 1EPVA 1NFGA 4A3RA 3LCFA 3LCWA 1JZ8A 1E4MM 2WMHA 1ZRQA 4Q33A 3K8MA 4Q8PA 1QTWA 1W1PA 2PRMA 2J6VA 2FZDA 3RHGA 2YIHA 3MUCA 5A6SA 5F1VA 3R0UA 3EPMA 4HCHA 3HQ1A 3PB0A 2TAAA 4Y8FA 4IIDA 1DIDA 3AIWA 3W28A 2R14A 1UH3A 4QSHA 3HURA 2J25A 1O5XA 1UCWA 3SUVA 6XIMA 2NT1A 4JYFA 2RUSA 3I7QA 4JKLA 2CZ5A 2IPWA 5CZKA 4DYKA 3NR0A 3DC0A 2Z7GA 2Y5SA 4KBXA 5DQPA 3WBEA 1ODUA 2FTYA 4FS9A 1RVKA 1LRNA 5DY2A 4LSBA 2PDIA 4MUZA 3S6OA 3AYSA 3BMVA 2ZZ1A 4DLMA 3QHOA 1PB0A 2PWEA 3P0XA 4JIEA 5DBUA 5BW6A 2Y85A 3MUY1 1Y0EA 4Q8TA 5E1QA 4U3AA 2CU0A 4JIHA 1K03A 4BI6A 1E6NA 3CAVA 4NAFA 3VMPA 2WC4A 1GEHA 1EWDA 2E1DA 3EOEA 3SGGA 1UR4A 2CKRA 1CDGA 1FHLA 2E6AA 4WK9A 3L0KA 1VCVA 3L0NA 1M3UA 4WGHA 4S23A 3WK2A 2BVTA 2ZZ5A 4UQAA 2ZDSA 5E9AA 2PDKA 2V5BA 3LPPA 2AL2A 3HV8A 4DJFA 5L9FA 5XIAA 4JL2A 1O6IA 2OWCA 4D6FA 3TYZA 4RKAA 1OFAA 1VFSA 3WK3A 5D05A 1ZU8A 3NDZA 1F8MA 3V16A 4J28A 5BWFA 2WBKA 4XIAA 4ROPA 3EDJA 1EO5A 1ESWA 1FKXA 3FKRA 3LTSA 2TMDA 2GUUA 3NYDA 1H1ZA 5I3KA 3RM4A 4FLRA 4YIWA 3MMWA 4MYXA 4ROQA 4GNKB 4KPLA 4JNMA 2Y5EA 3CUGA 3VDAA 3ICJA 3BAXA 1VEMA 1IIGA 1YQ2A 1NWUA 4B5XA 3M7WA 4LB3A 3ZVHB 2Z1WA 1NP0A 1R3YA 1HKJA 5D38A 4I6KA 4CUCA 3S4TA 2DIJA 2AQOA 4LT9A 4ZXOA 2A21A 3A9IA 3WF0A 3WEMA 2A3CA 4MPQA 4J3XA 2HXUA 4TQTA 4HA0A 1KNWA 2DQXA 4JDBA 1O94A 2CLKA 4FPSA 1E9ZB 5I3GA 1B3VA 1HJXA 2HPMA 3TN6A 3NWRA 3W53A 4V1YA 9CGTA 3MZNA 5A8MA 1C93A 3N25A 3NQ6A 1XLFA 3D46A 1OINA 1EXPA 3ARPA 2VDHA 4WRHA 3O07A 2PD9A 4GE8A 5TQLA 3V0TA 1E51A 2O7QA 3URNA 3GD6A 1EGVA 5C71A 4GI8A 4CD6A 3ITLA 4WF7A 4PCTA 4REQA 4FF5A 3BJTA 5I0DA 4WDTA 1G01A 2DZSA 3EX2A 3CV1A 4ACYA 5I77A 8TIMA 4ADUA 4DM1A 3EOLA 2QPUA 1W1TA 3T6CA 3VKAA 5FJPA 4Z2LA 4GXPA 3UR5A 1OC5A 1E56A 2PDFA 3TR9A 3NQ7A 4GYFA 3W22A 2Z2AA 4X63A 2GYIA 4OOUA 4TO8A 2QJGA 3GH5A 5CC6A 3MBFA 2W92A 4NXKA 3MO4A 4PGLA 2V3EA 4HNCA 2IKIA 3CB3A 1SUXA 4AUBA 1TUFA 1F3WA 5KEZA 1FVPA 1DIEA 2DVTA 4W7UA 3UCDA 3W7MA 4PUMA 3G1VA 3W6MA 4M80A 3WNPA 4G7EA 2R1MA 3DI1A 2DT3A 3ITTA 4Q8MA 4IISA 3EX1A 2G3JA 4O10A 4D8AA 1K77A 2VELA 3H55A 3CU2A 2QJNA 1NY1A 4W7WA 3VDCA 3I65A 2ZUTA 5FACA 2A0NA 2VO5A 3TQKA 3CS2A 4MJ2A 3GXNA 1ZP3A 4MZ1A 2XVGA 4XD6A 3AIEA 3VMNA 1DIOA 4ONVA 1KM2A 1NF0A 4US6A 1TTIA 2OT0A 4PUKA 1F73A 3P74A 3C61A 1O5KA 4GA8A 3UEQA 3W00A 3DC8A 2C3ZA 2W4XA 4GI9A 2V0TA 1J0HA 3RRXA 4WY0B 2A7RA 3UESA 3CMGA 1V79A 4NZ3A 3KEHA 3QV6A 4A2SA 3CZGA 1DE5A 1OX5A 3O06A 2F2KA 4LYPA 1D9EA 3UWZA 3FV9A 1R46A 1XICA 4MHBA 1H4PA 2FQIA 1BQCA 1LRQA 1OHLA 1B5TA 3G24A 4KQNA 1W1VA 4EAYA 3W7JA 3HBLA 3MP3A 1HJWA 3WUGA 1YRRA 1UH4A 4IPLA 1XIMA 2W61A 1PSCA 2KX9A 4RCXA 5AYZA 4Q7NA 3IS4A 3MKCA 3MDWA 1MDLA 2E5CA 4QDWA 2E3ZA 1AJ2A 1ZBWA 2OVLA 5BRQA 4HN8A 3A4JA 4E4UA 3ITYA 3GVWA 1REQB 1ZLPA 2WHLA 1F2JA 3NDYA 1HZYA 4S3CA 2A7PA 4R34A 1V0NA 5DT7A 4QJ4B 2VOMA 2BGSA 3KBMA 3U3HA 3W6LA 3MSYA 4GJIA 2AAMA 3R6IA 4DZHA 3K2GA 1GNXA 1L6SA 2PDNA 2A6NA 1XISA 1TVLA 2V30A 1J12A 3BWWA 1EO7A 3GAYA 4YXGA 4AISA 2DT1A 1DJXA 7TAAA 3T9PA 2Y5JA 3GH4A 3QV8A 3W0KA 4S3AA 5HWMA 2WSRA 2FZBA 3TQPA 2FGLA 2RJGA 3NSNA 3CHCA 3IAQA 3VOGA 2WLYA 3QEZA 3AISA 1L6YA 3IGHX 2Y8UA 4IMCA 2E77A 2W0UA 1U1HA 2VRKA 5T91A 2PTYA 2D73A 3SY8A 4DI9A 5HPCA 3UA4A 2QULA 4JD4A 1D8WA 3GTXA 1HF6A 3BLKA 1AMKA 4Z2HA 3G0SA 3VDBA 3CPRA 3I68A 3BC9A 4XTIA 1DWJM 1GOMA 3W23A 2NQZA 1PDZA 2NSOA 4DN1A 5B7YA 3K8KA 2ZE3A 1BRLB 4IIFA 3PTQA 1JGIA 1OSEA 3WSUA 5F2IA 3FSTA 3MWCA 1OY0A 3W1MA 1Q63A 3CJPA 1S3HA 4R3UA 3T8QA 4E2BA 3LGGA 3R1ZA 4LFYA 4HOZA 1KBJA 5DXYA 4UFJA 2R8WA 1Q8AA 1WXYA 3FDGA 5AB3A 3ITOA 1WCGA 3EWUA 3LEPA 4QG9A 4MAVA 3UWWA 3GR8A 3TW9A 1MUCA 5RUBA 2P53A 2D2GA 5XINA 3W1RA 5FL1A 1C29A 2ABBA 4AWSA 2J27A 4GI6A 3B8SA 5D9PA 1BVZA 1EHNA 2PDHA 1YBQB 3DYOA 1JPKA 3NNTA 5C9ZA 1CGVA 3H2NA 1FCQA 5B7ZA 1X6LA 4L9XA 4L1GA 5I79A 4DB7A 4HNOA 4BEQA 2POTA 1US2A 1AL7A 3USZA 2JEPA 3VC5A 1UKTA 5F4WA 4CQCA 4FLOA 1KW1A 3ARQA 2V5KA 3AZRA 4G8TA 4LV4A 4IPNB 2MNRA 4I9TA 4L64A 2XG9A 5CPNA 1JJKA 3SBFA 1C8QA 4LBSA 1S2VA 4C5ZA 2EPHA 4HTYA 2BHYA 4OHQA 3TA6A 1Q6CA 1ZBVA 4L4LA 1QO2A 3HM7A 1M41A 1R3QA 3R13A 3M0IA 1JNEA 4KCUA 3INPA 1EL3A 1IWAA 1UMYA 4PRWA 5A8NA 3N9RA 1TTJA 4OV4A 3PN8A 2G97A 3KM8A 1JPIA 4HT3A 3SCVA 1BXBA 2I56A 1YPFA 4DZIA 2QEZA 1W5QA 5FF7A 2VRQA 5C0QA 5ABHA 3EPOA 3TFCA 5EPDA 4P8UA 4KRTA 2ACSA 5H91A 5G4EA 2WNNA 3AUOA 3V0SA 3VCCA 3DDMA 3TTOA 1O95A 2MUCA 2YCKX 4TU1A 3QMSA 5CPTA 2QV4A 3B3DA 3THUA 3SSZA 4C6EA 3K46A 2VCAA 3K8LA 2XH2A 3PBGA 1EJXC 4P61A 4AWUA 3F4CA 3L66A 2FDMA 5ABEA 4H7VA 5K9DA 1A0DA 3WUEA 4PTDA 2DEPA 5CH9A 2PRLA 1PWLA 2CEQA 4DXXA 1WX0A 2YDAA 1OC6A 4UZSA 4F0MA 1UKQA 3L0GA 5KINA 3R8RA 3AWNA 1TA3A 3MV01 3IJ9A 3GHSA 4WDWA 4UNKA 4YWIA 3OVGA 2WSYA 2A6LA 3G0XA 2HBVA 2TYSA 1H1NA 4W8AA 3VTRA 3BAJA 1TV3A 3ARXA 5TBOA 3N2OA 3I6EA 1HVXA 1G1YA 4Z2KA 3S2CA 2Z1BA 4L4MA 3MHFA 3UT0A 4F0KA 1B90A 3NL6A 3UY8A 2FKPA 3CQJA 1J6PA 3TN3A 1LBFA 1OK4A 3STCA 1RSCA 3RMEA 3PUGA 4OJYA 4TMCA 2Y6ZA 5JH2A 5T9CE 1Q8JA 3KFTA 4XZBA 1SR9A 4DBDA 3UXAA 3PB2A 4NXSA 2P5NA 5BZAA 2EEXA 3ELFA 4QLLA 4MG4A 3TH6A 2TODA 1H7PA 1DWFM 1YXCA 4FNPA 5ECVA 1U1JA 4GLEA 3BE7A 4CD7A 1ML1A 3GBEA 3TEVA 3NFUA 3FXYA 4AMAA 3LB0A 5D02A 3KCOA 4ERAA 4RW3A 3WD4A 3GWQA 1LDCA 3B8WA 3NO5A 4ZCWA 2Q3OA 1FWAC 1CLKA 1A80A 4N6FA 4PUWA 3MMDA 5DRCA 1A5NC 1JAEA 1RBAA 3DFQA 2FFIA 4GFIA 4PFMA 1F9CA 2E28A 1CPUA 3IUDA 3W7IA 3N04A 1ZJHA 2JK2A 4O19A 4U5KA 3BLOA 4MY1A 3MZ2A 3M44A 1UP2A 4HD5A 4NAEB 2PU0A 4H83A 1K1DA 5D04C 5LIKX 2Y89A 4TVUA 3W73A 4GRSA 3GXFA 3GUWA 1RCXB 4ERGA 2QVHA 1E0WA 3D0CA 4CEXC 4Z2JA 2QUUA 2BP1A 2YPIA 4IMFA 2OX4A 3QH2A 3TWAA 5LGXA 4FX6M 4EX4A 2ZXBA 1BHGA 1TQJA 3LZ3A 3XINA 1QI0A 1L2UA 2GSHA 3A12A 1UKPA 1IR2A 4Q8VA 2XISA 1X38A 4MAZA 4XBKA 3SZ8A 5C2XA 2E67A 5LHFA 2FTPA 1TWZA 1XBZA 1K9TA 4MZYA 1DHKA 4H00A 4JTUA 4C6QA 4MKVA 3WK0A 3WFLA 4GFSA 3COTA 4D6DA 4AD0A 3PM6A 3V5CA 3ANYA 2I16A 2ISSA 3I7RA 1WAWA 3GDMA 3JVAA 2A3HA 4NI8A 3GR7A 1UUOA 1QR7A 1V51A 2VD9A 4OE7A 1DWAM 3CYJA 2WAGA 1D8CA 4J4KA 2JKEA 1WNOA 3M6YA 1K8CA 1X6NA 1IZCA 5AHEA 2OJPA 1ICQA 3N4AA 3PG8A 4U5IA 3AROA 1JFHA 1F05A 3SY5A 3EX3A 2QDEA 4GCXA 4B5WA 4HNLA 1OFDA 3B9NA 5HNUA 1W9BM 4H3DA 1OYBA 2PC4A 3W7HA 2C1GA 1V6VA 3SB0A 3N2CA 1PHQA 1GHRA 3BANA 3H2CA 2ZBTA 3B4UA 1RR2A 3ZZ1A 3BGJA 1E6SM 1VAHA 2PLMA 2GVEA 2NV1A 3W7DA 4MY9A 5BROA 4QRNA 1HGYA 3OTRA 3CYVA 1P48A 5C2GA 1RJRA 3LRMA 3T4WA 4NF7A 3HFTA 1UD6A 4O54A 3ZVIA 1KWKA 2A3BA 5AVHA 1EQCA 4NRSA 5AVNA 6ALDA 1E6XM 2GK1B 5FJJA 1XYCA 2AKMA 4E8DA 1KTNA 3MMTA 3MV11 1GONA 3STPA 1TZ7A 4TV6A 1XYBA 4WIWA 3U8GA 3SN1A 5BXRA 4QCFA 4S3EA 4ZSTA 2P0IA 3KTXA 5D9MA 2DUAA 5D33A 2ISDA 4IQDA 3IV8A 4DYJA 1JCYA 5D2XA 4IICA 1K9EA 5FJTA 4K8HA 1UZDA 3GVGA 4B9YA 3Q58A 1V6UA 3EXTA 1R47A 2O9PA 1I9CB 3AQUA 1C7SA 1M68A 2L5HA 4P2VA 2OX1A 2V67A 5FCZA 3DGBA 4PUNA 3IV3A 4YLWA 1EA0A 3T0CA 2BODX 4B16A 2YSWA 1CB2A 3VDGA 3H6OA 3FJLA 1B54A 4GKTA 3LDVA 1GCYA 3A24A 2XH7A 4K6AA 2OYLA 5L6UA 3C2RA 3HN3A 3SIMA 1KQYA 4M51A 4RPPA 1KM0A 4C6KA 3V0UA 3EBVA 5I7GA 8XIMA 4XKYB 1VB9A 1LJYA 1LWHA 1ME8A 3O7UA 1E9YB 2G8ZA 1JYNA 3NO1A 5HNTA 3TJIA 4GGBA 3W7KA 5JXQA 3F03K 2YDQA 4W7VA 4HMNA 3LCLA 1OB0A 4EAMA 4IJCA 1C8VA 2WKGA 3DESA 3VKKA 3A13A 3LM3A 1QW7A 3W02A 3XISA 3AO0A 4OKDA 5FF0A 4P7QA 1KTCA 1EZ2A 1Z3NA 4ZOEA 3NG3A 1O12A 1KXHA 3F2CA 1AH0A 1B2YA 2V8ZA 4FOJA 1P1XA 4O1FA 2A3AA 3TCSA 4QITA 4YTSA 1V0KA 2W6RA 2H9AA 2GSEA 2VTFA 3U7VA 2PP0A 3I7SA 3BQ6A 3N6HA 1VPXA 4UMBA 4GH1A 2O7SA 4ZXLA 1BAGA 4H8VA 5CZ0A 3UBPC 1DJHA 3G1YA 3HGSA 3KS5A 4HN4A 4RL3A 5FEXA 4JTIA 1L2QA 3I10A 3CM4A 4D1JA 3HGOA 4QAIA 1EJTC 2NSXA 5BMWA 4YL2A 3W88A 1QPQA 1RBLA 1SJDA 3ARWA 4NASA 2O55A 4GPNA 1PIIA 5I00A 1XX1A 2XM2A 3PAJA 1OZMA 3VIJA 3VIKA 1SZRA 1LT8A 3H2FA 1UKSA 2XU2A 4MFDA 4IGNA 1QDSA 3BGAA 5A6BA 3W81A 3OZOA 3EXSA 1QASA 1GKRA 3DCPA 1MMFA 1ZY9A 1WZAA 3PTKA 1QFEA 3SQLA 3URAA 4FXRA 2C14A 2PLKA 4AEOA 1S39A 3BG5A 3DERA 4IP5A 1LUCA 3VIOA 1HP5A 1KFEA 2WJEA 2BHUA 1Z9AA 3T1GA 3QQWA 3MA8A 4AF0A 2W79A 4DAIA 4D72A 4RW5A 2CITA 2BV9A 3NSXA 4ACZB 2IKGA 1NQKA 3N9KA 5JU6A 5G4HC 1H62A 1R87A 3NEVA 4EXQA 4TUFA 2OSWA 1KB3A 4RUBA 3M5ZA 1ALDA 1SW7A 1KFCA 4EXAA 4CCZA 3H8AA 2GUBA 3FLUA 4D1IA 4RNJA 4NX0A 5LNRA 1V5XA 4HPGA 4WX2A 2NT0A 5H1WA 4UTJA 1BG4A 3T05A 3N34A 3JUGA 4PTMA 1H11A 2NQHA 1A0EA 2PBOA 3POHA 1OX6A 3AS3A 2CCRA 4I6VA 4K37A 3IWPA 1DJIA 2PF8A 1B3XA 2O4MA 3OLIA 1C7TA 5HQEA 1HFBA 4F3HA 1P6WA 4YHEA 4CN4A 3W2LA 4N9BA 2WCAA 3R0KA 1GVOA 1L0PA 4PULA 2QUTA 2PWVA 1GOIA 1UD8A 4KESA 4J3VA 4NX5A 1GGOA 2HJPA 3U57A 1PX4A 4B5UA 1MZRA 4LVFA 4GI4A 4LUTA 3T2OA 4DHGA 1RHCA 3E2VA 4IP7A 1HIZA 3TJLA 4HZ6A 3O6CA 2R1KA 1QHZA 4GO8A 4LBRA 2NUYA 4IFRA 4AWTA 1R86A 1XBXA 3KOWA 1LP6A 3LLXA 2QCMA 4Y96A 4MMWA 3CIVA 3K4AA 1TCMA 2C13A 4MF4A 1JCTA 2BY3A 3WQ4A 3U2EA 3FOKA 3TIMA 3GXTA 1ZJAA 1RK6A 1RQHA 3H4GA 4CU8A 4GQ0A 3LXAA 4ICCX 3VNYA 4KFNA 3PUDA 1E5NA 3PZQA 4JKMA 4MGGA 1KCXA 1G5AA 1DL3A 3A6OA 4UTHA 3VU2A 1OFRA 1HTIA 3OEXA 1JFXA 1W3JA 4EPBC 3W07A 3GVQA 3R7MA 1W9DM 3BK0A 1EF2A 4HGXA 2WMGA 1CNVA 2PLJA 2ZXDA 3DOPA 3TXZA 4Z1YA 3MO7A 5KSWA 3ARZA 3GH7A 2B7QA 1CTNA 3IRSA 2V38A 2F7FA 2FJKA 1EP2A 3T2QA 2OXNA 4S3BA 3SQSA 1LL6A 2VYOA 2OYKA 2NQLA 3LZ5A 2Z24A 1BSIA 1JF5A 1US3A 4HK6A 3CO8A 1I60A 5I6SA 1Q2RA 5FIPA 1VFOA 1M7PA 6REQA 1W3KA 1Z42A 1T40A 3AXMA 1CGTA 4MDOA 4O17A 1A5KC 4RNFA 3SCSA 4HA1A 2ZZ4A 4S3FA 3G3DA 5AHMA 3WQWA 2FZMA 1OGGA 1ZENA 4ATDA 4E2VA 2PTZA 5LIXX 1DHPA 2Z00A 1VJIA 3DG6A 4H8UA 2J78A 4WOQA 5MKGA 1XLIA 1I0BA 4JFSA 3GNNA 1MW2A 2QJIA 1Q13A 2ACRA 4Y9MA 2QCCA 3LPGA 1W56A 4GQBA 4I7VA 5D03A 3W26A 3N14A 1E3XA 3UCCA 1ONWA 4DLFA 2A79A 1VP5A 4M6PA 1PZ1A 3IJ7A 4OU1A 3UERA 5JMUA 3QSTA 4HP5A 3I3DA 2XH0A 3WQPA 4WY0F 5EFFA 5AHNA 2PWHA 1SR0A 3BV7A 3HIJA 3FA3A 4JQ1A 5CC7A 3UW6A 3VGHA 4UB9A 3URBA 3AXXA 1KQZA 1EGZA 3FA4A 3SQMA 1R5YA 4N6EA 1TJPA 2GL5A 4ZQMA 1E40A 4Q4OA 1Q6QA 4C6CA 3W74A 1VBRA 4IF2A 3CHEA 4HZMA 3MB9A 1Q2SA 3E5BA 2ZUVA 1PXGA 2P10A 3BJFA 1BWLA 1RPXA 3QVQA 1JPDX 3VDHA 4KRZA 4KERA 3VCNA 1X1ZA 4AIUA 2QJMA 1F74A 4CNUA 1Q66A 3STEA 3O0FA 1QWKA 3ABZA 5LNUA 4WJEA 4UQDA 2BY0A 4G56A 4JX4A 3LU2A 4JTKA 3KVMA 3TMLA 3W1QA 3GHUA 3UPWA 2YL6A 5I02A 4PTVA 2D0HA 3KRSA 4JTSA 2X0YA 3FN9A 3IK4A 4C1NB 1XHGA 1IT7A 4WJ8A 2C91A 3NQGA 2AAAA 3O63A 4YYFA 1XLKA 1ONRA 3AIVA 4B4HA 4NJIA 4C6IA 1UWRA 3GUGA 1UHVA 4NZFA 3PULA 1XINA 2FTWA 3P82A 3TNOA 2P50A 4C6MA 4UFIA 3MVTA 4PEKA 3CQHA 4A22A 4DWSC 3IJLA 3AJ7A 2ZTKA 1BTMA 5HINA 1UP0A 3F2BA 1KCKA 4EPKA 2WVTA 1O7AA 1MEIA 3SN0A 1NIUA 4C6PA 5JIWA 3M43A 1XFBA 2OO6A 4ZENA 1JI2A 1Z89A 1FWEC 3ZVHA 1YE4A 4AZ6A 1T8XA 4X2RA 4J1OA 4JFTA 3M5VA 1PEZA 4EXBA 1LF1A 1M1BA 3WELA 1XUZA 1JCXA 1OJXA 5AYXA 3I3EA 4BEUA 3DHUA 1J5SA 1XFCA 4L5ZA 5I3IA 1ELSA 1J6OA 4M1BA 1NJJA 1YW1A 1R7OA 2J7EA 5PTDA 1FWDC 3VGEA 5HWNA 3WDQA 5D8ZA 4MY8A 2XYLA 4BF7A 5C9WA 4FMVA 5LA0A 1U22A 3DFTA 1VYPX 3RJXA 3U5UA 1UR3M 4DJDC 3EWZA 3OQ8A 1KFKA 1L9WA 1N8FA 1UR0A 4UQCA 2ASHA 4Z2IA 2GZXA 3APGA 2I5IA 1CWYA 1WDDA 3VE7A 3GG0A 1TRDA 4ZB5A 1IGSA 1W8SA 1I45A 2OQLA 2ACQA 1IT0A 3OHIA 5HATA 3ZMRA 2C1IA 2BWGA 2W62A 3T09A 3TTSA 2R91A 1DP0A 2X1RA 4B15A 2F61A 3N6QA 2OMAA 4IJBA 4RNIA 4ATWA 4QE4A 7PTDA 4H2CA 2XTKA 4R27A 1FXPA 5H6HA 1JDCA 2W63A 4UOQA 3O8AA 5I24A 3IVSA 2DSVA 4X0VA 1QOQA 1G4TA 3N17A 5HNRA 4P7NA 1GHSA 2PDUA 2JQXA 1PS9A 3R94A 4CEUC 3UXIA 4W85A 1VYSX 4GZ7A 1JUKA 1RH9A 4LRTA 4GH3A 1NVMA 4JTFA 3W76A 1SZNA 4W84A 4R85A 3FYOA 1TTQA 4M3PA 3GKFA 1HW6A 2YW3A 4B5VA 1NAL1 2ZUMA 3TC7A 3A3WA 3D6NA 1X8FA 1X7FA 3MS8A 4S39A 2HROA 1A5OC 1VYRA 4IQJA 2PCQA 2WJFA 3OLGA 3LTPA 2J6XA 1FWHC 4LC6A 5AC5A 3H12A 2EG8A 1V3HA 2EJAA 3OU8A 4GY7A 4YTTA 3GNXA 1XBVA 1AUSL 4XAZA 3WLTA 1XYMA 3TCEA 1V6TA 5CGMA 3S0CA 5HA7A 4UTWC 1W17A 3E0VA 4V15A 4FXJA 3U4AA 4XWUA 3NEHA 4FSAA 1PIFA 4IXXA 1W3TA 1DJQA 1QUMA 1THFD 1UOZA 4WKHA 3F4VA 2QF8A 1SO6A 4LF1A 4HBKA 3C0QA 3W84A 4HQVA 1QI5A 4NZ1A 2HVNA 3KZPA 3N13A 3NOEA 1OADA 1J96A 2W5FA 3ZYZA 1Q3NA 4C7FA 2VEFA 4AZHA 2QQ6A 3M1ZA 2BGQA 2WZEA 3GG8A 2BOFX 4PH6A 1KM6A 4X22A 1Q6LA 4IT1A 1REQA 1RAKA 3ZT7A 4JKKA 4RDWA 4ICNA 4L7ZA 4S3DA 1F5ZA 1QNRA 2GQ8A 4CGTA 2INEA 1H7NA 2NQJA 1LQ0A 1VPQA 1GORA 4FI4A 1QNOA 3PWGA 2RDXA 1XPYA 3ARRA 3TNBA 4EE9A 1K7EA 3QFWA 1JG9A 1AH3A 3SGUA 4OBSA 2PEVA 2RDTA 1NM9A 3GSMA 3QGKC 3RLHA 4JBRA 4UOZA 5TIMA 1AZ2A 4YS1A 2XFYA 4V1XA 4BQ3A 1S5VA 2W91A 1EDGA 2VD8A 3AMGA 4ALDA 4K68A 4GGHA 3PHAA 4EANA 4RZ5A 2ZTJA 4RV8A 3KBVA 2Z6IA 1FA2A 1M03A 2YDSA 3AMKA 3W7NA 1NDVA 4LUYA 5GJPA 1Q4NX 3POCA 3LCHA 3HTWA 2ZKMX 3WLSA 4XVDA 2OKTA 1MQQA 3OODA 4GOAA 3WEZA 4HPJA 2PD5A 2XIJA 3VGBA 2Z29A 4IX0A 3W87A 3TW6A 3VNIA 3GYCA 3G18A 2CHRA 3FAWA 1L6FA 2VZOA 4O1EA 1JIBA 2Y7DA 3TC6A 3IARA 5FF3A 1XH0A 2BXZA 3TYAA 2QF7A 1JZ3A 3A4AA 4GJ1A