3RLVA

Crystal structure of the mutant y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
220
structure length
220
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 86
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rlvA00
1ZJIA 4K39A 2A21A 4RKAA 4CCCA 5IM51 5E0KA 3C8FA 1KM1A 3MHGA 4XUGA 2VENA 5D2WA 3NPXA 2UV8G 4LS0A 1GVQA 4JX5A 2E1DA 3HQ1A 1OX4B 2G5WA 1TPUA 4LRTA 4IQLA 4O0ZA 3O05A 3QQ0A 4UNKA 1RPXA 4KFNA 2C15A 1EUAA 4JYDA 4KFPA 3TR2A 4RXFA 3GDMA 3PWAA 4WOZA 1T99A 1S5VA 2YX0A 4PC8A 3TC6A 1HUVA 1UUMA 3O16A 5LGZA 3PC0A 4JY9A 3F03K 4EWND 1QAPA 2PRHA 1EWEA 1S5TA 1IF2A 4QSHA 2NV1A 4DELA 1DBTA 2W0UA 2A6NA 4JTJA 4NQ1A 1AL7A 1I2QA 2HTMA 3B06A 1M7PA 3EEGA 4NVTA 3FYOA 3LGEA 4M7SA 4QQ3A 1KTBA 3C61A 3IVUA 2QKFA 3CHVA 2X30A 3L21A 2J6XA 4LS1A 2ISSA 3SR7A 4RLIA 3LXAA 3GDLA 1UBSA 2E6AA 2P10A 5EA9A 3W7CA 1F74A 1IGSA 3UY8A 1LLWA 3P7YA 1AL8A 4OBTA 5K9CA 1OK4A 1SPQA 2H3DA 1W3TA 4NXKA 3LBCA 4UR8A 1KFBA 2ZCGA 1OYAA 4WJEA 4NT0A 4OV4A 4A29A 5KITA 4FB7A 3IIPA 2ZRZA 2Y85A 4JYEA 3F1QA 4ZQMA 4NUWA 3W7IA 4N9BA 3KAOA 1GPWA 1SR9A 2QJGA 3MWAA 4U28A 4AF0B 4FIQA 5CZSA 2A7PA 2OMAA 1SQ7A 4HSNA 3TQVA 3LOTA 4WZHA 1W1ZA 1MEHA 1MEIA 2R94A 3G1SA 4R34A 3S5NA 1X6UA 3TSBA 7TIMA 4QNWA 3PY2A 1LOLA 3WJZA 3EXTA 1PIIA 1LBFA 4LW7A 1SO4A 5KTLA 1SW3A 4LY8A 1VCVA 1IIGA 2E5BA 2CU0A 4XWUA 4JS3A 4HSOA 3PM6A 3MI6A 1B57A 2I1OA 1K7XA 1SW0A 3KVMA 3W7JA 1KW1A 1ZENA 1B4EA 1OFEA 1XFBA 2DJLA 3PBWA 3TFCA 2C13A 2Q3RA 4FHAA 1X1ZA 2BXVA 3CEPA 1LM1A 4M7TA 3EX6A 1W5OA 4FX8A 1LRQA 3NQMA 4RXGA 1PCWA 4E0CA 1ZAHA 1A5AA 3SGZA 1B9BA 4UTLA 4FNRA 2ISWA 2LLEA 3NAVA 4UMBA 4ADUA 1DORA 3WJWA 5LSMA 2YGYA 4HPXA 1V5XA 3LCIA 5HWMA 2OCZA 3N34A 2DU2A 4JTFA 4O53A 1F73A 3EWXA 4FF7A 4AXKA 4YLWA 3HGOA 4AAJA 1QO2A 3TXZA 3E96A 3LTSA 2YYTA 1TJRA 4DPQA 3DHFA 1LDCA 2VEKA 4RJEA 1NSJA 5I3JA 3OBKA 4LU0A 4WOQA 4E2BA 2YPIA 2GVJA 3HBLA 1PHQA 2R8WA 1Q6RA 2QCHA 4IPIA 2NX3A 1KFCA 5K7JA 1QMLA 1QDSA 4WX2A 3F4NA 3TSDA 1RD5A 1R30A 5KZMA 3BARA 1WOAA 1WX0A 3AJXA 4GFSA 5EL1A 1O60A 1WXJA 2J27A 3BLFA 5AHFA 4OU1A 1Q6OA 4UTWC 2XN1A 1SSGA 3L0NA 1L6YA 3L5AA 5K4ZA 1OX6A 3LM7A 3LXCA 4NU7A 3BK0A 2QAPA 4M5PA 5HUPA 3E12A 5G5IA 3CM4A 1R2RA 4O17A 2NXGA 3NL3A 2B7OA 3O6YX 3S5YA 1RVGA 2XN0A 4DPPA 5D04C 2TYSA 3FJLA 1EWDA 3NXFA 2A5HA 4S2CA 1OF6A 2EKCA 3ABRA 2YZRA 4MY1A 3KXQA 3Q94A 5F2LA 2Z2UA 1UASA 3MHFA 3MYOA 4N4QA 5F2IA 3T40A 1HTIA 3QMSA 4UC5A 4R33A 3LHTA 2BSLA 3FJ6A 4NJJA 1FCVA 4JIQA 3QW4B 3FLUA 1OG0A 2PE4A 1G4SA 4HNNA 4GNJA 1I2OA 2A1YA 2RDTA 3ATYA 1K8ZA 1LROA 2V2DA 2ZZ6A 1HL2A 5KMYA 1IXNA 3FKKA 2DJXA 3W7GA 1FXQA 1TTQA 1U5JA 1VH7A 4S2BA 1RQHA 1GEQA 4IJBA 3EX3A 3SY5A 5CPNA 3TIMA 3PVFA 5DCDA 2YW3A 1W5PA 5AC7A 3NPVA 5LGXA 1I45A 3M5YA 3M16A 4ONVA 3G3MA 2W79A 3B04A 2P1FA 3B0UX 1YLVA 3DHDA 5LNRA 5CZ0A 1WAUA 1FWNA 4MOZA 3MO7A 2P0OA 1FCUA 3W1LA 4O1BA 3S1UA 2ZYFA 1XM3A 5TBOA 1JRCA 1XCFA 4Z1CA 3ANYA 4YMZA 3VCRA 1A5BA 3W2UA 1I2PA 5MHBA 1NFBA 1G69A 1TPH1 3PSVA 3HGJA 2ZZ7A 4ICNA 1G6CA 3S0CA 3UZJA 2C1HA 4I7WA 3TE9A 1SUXA 1YDNA 1SSDA 3TQ0A 2Z6JA 2A85A 5U4NA 4ZVJA 3B05A 4JY8A 3HG2A 1Z44A 2ZZ3A 3LBMA 4NZJA 4ZZ9A 3QH2A 4K7YA 5A5WA 3GDTA 4LC6A 1XUUA 4KKXA 3C2FA 2J9YA 1DQWA 4M6PA 1OX4A 2ABAA 3PF3A 3HPZA 4TX9A 3UWYA 4NNAA 2WNQA 5CZTA 4Z1BA 1O95A 1PS9A 2VELA 4O12A 2QAFA 3STCA 3TFXA 4NX5A 3NO5A 1L6SA 4O52A 4IMGA 3QMRA 4O16A 5DCEA 2DZXA 3ZWSA 1JUEA 1I2NA 3KRUA 4O0KA 4GUIA 5CSRA 5IBXA 3UD6A 5AHLA 1SO6A 3NQDA 1XBZA 3W86A 3BW3A 1FWTA 1QNVA 2WSQA 3LLFA 3W2LA 4Y6GA 1GT8A 3R13A 3GIYA 3FFSA 4M6VA 1RQBA 3IIXA 5T26A 3P61A 3LX9A 1B3OA 4ZQNA 1DHPA 4Z08A 4E38A 4H6KA 1FXPA 2E68A 2VFHA 4J9JA 5H2ZA 4K8EA 1X8FA 2OZ0A 4FIRA 4LNYA 2V5LA 3S1XA 1FWRA 2C16A 4O11A 5HNRA 1TTIA 3IGSA 5AC8A 1PVNA 2EAWA 2EHHA 2NWSA 1TV5A 4MLRA 1TPVA 5D38A 4MYXA 4C1KA 1GTHA 3RLUA 1L6WA 4ALDA 1JQXA 3W23A 3I65A 4LVBA 3U8GA 3NQVA 3PG8A 4WXZA 3FIGA 4A3UA 3NQ2A 3LTYA 3N2XA 4ORIA 1D9EA 2YR1A 3RNDA 5HWJA 5LHFA 3PBVA 5DXXA 3HMJG 2CZDA 2BZNA 4P61A 5DBUA 1TJPA 2B7QA 1JUKA 2JKPA 3E0IA 3LRKA 5F4XA 3I7RA 3LB0A 3CWOX 1KBJA 2Z0IA 3G1YA 1JQVA 3W6YA 1A50A 2X1UA 2RFGA 3P80A 1K8XA 3RFAA 3QYQA 2OT1A 3HG5A 5HR6A 3TAOA 2ABBA 2TSYA 1LCOA 2YFNA 4FXRA 4UFLA 5I3IA 3EXSA 3N2MA 4NNCA 3NEVA 1YXCA 2BX7A 4UTKA 2O7QA 3W1MA 3R12A 2V30A 2RDWA 3QC3A 2BWGA 5LNVA 2X16A 3S5OA 1R2SA 3MP4A 2JK2A 5I3GA 3I7QA 4HNTA 1QFEA 1W56A 4RZ5A 3DFTA 1L2UA 1G4PA 2JBMA 3P60A 3F4WA 3VKJA 3NG3A 3P74A 2B0MA 4Q4KA 3STFA 3KOFA 4ZQPA 4WY0F 2CLOA 4JTSA 3E9AA 4Y8FA 3BW4A 1JCYA 3HG3A 4JICA 1LRTA 1H7WA 1TMHA 1LORA 5HINA 5K4XA 3DZ1A 3W1RA 3LCXA 1FDYA 4LVGA 1ME7A 5CZJA 5E1QA 3PUEA 4FEZA 1Z42A 1KFJA 3G24A 4RX0A 5TIMA 3QPZA 1SFJA 3KHJA 2PURA 3CIWA 3UWUA 4O57A 2F84A 3W84A 4H3DA 4A2SA 5TQLA 4FNPA 4RZ6A 3LI0A 4A22A 4CQAA 2J9ZA 1M7OA 4ZQCA 1X7FA 3UWVA 1VJIA 2WO5A 5D02A 4N6FA 1B4KA 2NUWA 3R5EA 2E6FA 1GYNA 4MZ8A 3CT7A 3W1PA 3GKAA 3JRKA 3CB8A 3EWZA 4DBDA 1TO3A 3DFQA 1GVOA 2CZFA 2Q8LA 3T44A 2GVLA 5FEPA 4JNMA 1F6KA 2DZPA 4AWSA 3HIJA 4PCFA 3C56A 3WJYA 1N7KA 3ATZA 5HR7A 3GR7A 1OF8A 5AC6A 4DO6A 4RZ4A 4IXHA 3HOJA 2HS6A 5EY5A 1H50A 3DBPA 3PB0A 4R53A 1ICSA 4MJMA 4MUZA 3CLMA 1TPEA 1LYXA 3HGRA 1VR6A 3WK3A 4O1CA 3GZ3A 1O94A 3UWWA 1YTEA 4IMFA 4K36A 2Y70A 3A23A 3QFEA 3MP3A 5FI8A 3Q37A 1DOSA 1XI3A 1GVFA 2EF9A 3P67A 3NR0A 4NJGA 4TU1A 5E93A 4O14A 1VYPX 3CWNA 1GYLA 4N9DA 4DF1A 3USBA 3MMTA 3P62A 1JCMP 1QPQA 1MSSA 2ZRYA 3ZWTA 3O06A 2JKAA 3ABQA 3L67A 4ADSA 4LVFA 4DEFA 4UFKA 1O5KA 1VHNA 4JTHA 3K30A 5H91A 4Z0JA 4OGZA 5DY3A 4JTUA 5EBUA 3PBYA 1WA3A 5HQEA 3W3OA 2WQPA 4JTKA 5HJLA 3EKZA 3W7PA 4LTSA 2VFEA 2DP3A 1QPOA 1OFRA 2WKJA 4JDYA 1H63A 2AGKA 4MKNA 4UFMA 5C54A 5LKYA 1T0OA 3MI3A 1WYIA 1X1OA 4Y96A 1G4TA 2AAMA 5CPLA 3VE9A 3VNDA 3L2IA 1OJXA 2QR6A 4BWLA 2A4AA 3NA8A 3FOKA 2B7PA 1UCWA 1YDVA 3NOEA 2C3ZA 1SO3A 4PODA 4QM1A 1GZGA 1T96A 1VCGA 1V7YA 1QCWA 3TXVA 2Z1BA 3HGSA 3W88A 3QPYA 2CW6A 3INPA 4AH7A 3A21A 3CC1A 4K6AA 5DLCA 3GYEA 1G7VA 2CLKA 5EYWA 5C6MA 1AW1A 2VFGA 3KX6A 4XTIA 3W73A 4A2RA 2CLMA 3L5LA 4NJHA 4O4WA 1FBAA 4JTEA 4LWWA 4K38A 5AYYA 1WBHA 4ML9A 5A8GA 4MLJA 1NEYA 2H6RA 1TPB1 3W72A 3BV4A 4Q33A 3EWUA 5DY2A 5J5RA 5AHMA 3DFPA 2CFFA 1GJPA 3DAQA 4GWEA 3NL5A 1OFDA 2V82A 3JR2A 1PV8A 1KM2A 3C2RA 4PTNA 1OABA 1ICQA 1TPDA 3TC7A 3PUOA 1TV7A 3W1AA 3W2JA 3HO8A 4EOUA 1OFBA 2CZ5A 3G0UA 2IQTA 3S1VA 1Z48A 3NYZA 3G3DA 2ALDA 1F7BA 5KZEA 4JIPA 3UPBA 1SW7A 3MW7A 3HPXA 4EF9A 3A5VA 1QR7A 2E09A 5LNUA 4JR5A 5AFDA 1DQXA 5LNSA 3QSRA 2ATSA 1CX9A 1H7XA 2VOMA 4GBUA 5FEXA 3LCWA 3FKRA 1H60A 1VHCA 2Y6ZA 3N9RA 4MZYA 1GG1A 4AMAA 1Z41A 2YSWA 2VXNA 3M7WA 1EUNA 4Z1AA 4PH6A 3S42A 2V8ZA 2A7RA 3YPIA 5DN1A 1AMKA 5CPMA 1I4NA 1EB3A 1FY6A 1SZNA 1XKYA 4BI5A 3BVJA 3QRHA 1BWKA 4U4MA 1PHWA 3O07A 5DCBA 5FESA 3DFSA 2X2GA 3DXIA 2XFWA 4PA8A 1JULA 3BG9A 3KRZA 4O50A 3S9YA 4X3ZA 3WJSA 4UTHA 2QEZA 1FUYA 4JTLA 1OK6A 1KBIA 2GOUA 2YW4A 4JEQA 1QO5A 2Y89A 3RU6A 1O5XA 2FJKA 2FPVA 3GKFA 4HIBA 5D2VA 3LCFA 3TW7A 1G7UA 1TV8A 1CW2A 1ADOA 3W9ZA 4O54A 6ALDA 3IIOA 1HG3A 1ZNNA 3FEMA 3VI2A 1M6JA 1KM3A 2D73A 2JGQA 3TW6A 3W2NA 3S1WA 2QF7A 1M5WA 1W3NA 1W31A 4POCA 4JYFA 3GDRA 3M5XA 1JVNA 4O13A 5HUOA 3HG4A 3IV3A 3M0ZA 4JXCA 3H54A 1KM0A 1DVJA 3C6CA 4YCOA 4O19A 1WBJA 1Y0EA 2A0NA 1S3HA 1R46A 1KM4A 1ML1A 4UTUA 5D33A 5D32A 3DKJA 1TQJA 3CIXA 2QJHA 1GWJA 3EX4A 5F1UA 1R2TA 1EIXA 1H62A 3OHIA 1WOBA 4XKYB 4TMBA 3L0KA 2WNZA 1H5YA 2ZRXA 4BK9A 3QSTA 3G1AA 3MI2A 4N2YA 3UPWA 3LCGA 2FQIA 2V5BA 3NM3A 4WQ6A 2WJZA 4I7VA 5BOOA 4KWVA 4DF0A 3GNNA 5CKSA 3TSMA 3SZ8A 4XQ6A 5K2ZA 1J5TA 2DZUA 1YDOA 5GVJA 2A7NA 2GQ9A 1OFQA 2QUTA 2Y7EA 3IGUA 1TTJA 2Q3OA 1IXPA 1MZHA 4JDBA 5U7SA 3TCEA 3C0JA 1KLYA 1KFLA 1A53A 1VZWA 2C18A 1TTPA 3MJYA 1JR1A 4N9EA 1H1YA 1TSIA 5SWUA 4LS2A 3W70A 1T8XA 4OWGA 4Z0SA 3TAKA 2ZFAA 2RHGA 5G2WA 2RDUA 1P0KA 4TR9A 3W1TA 1GOXA 2X1RA 1N55A 2VKZG 2GPTA 5DXYA 2Y62A 4OE7A 1R47A 1EP3A 1UJPA 2ZA1A 1H7RA 3W7LA 4AB4A 2I9EA 4HNVA 4IUOA 5BRBA 3GLCA 5CG7A 1FQ0A 1TPC1 3KFTA 4TO8A 1JRBA 3BG3A 2FTPA 3WJXA 4CLMA 1KM6A 3TH6A 4BWLC 3NGJA 4X2RA 3G22A 4B5NA 5DBTA 3EX1A 1P0NA 1KTCA 8TIMA 3TJXA 4BFAA 4IOTA 4UR7A 1QOQA 3DU0A 2NX9A 3W7EA 1FWWA 1DKWA 1VC4A 3SFKA 2WOQA 4O1AA 1L9WA 2YXGA 2JGYA 4LUIA 3P8JA 1TRIA 1YTDA 1AG1O 3ABOA 4LVAA 3W7QA 2V2HA 4JTGA 2VFDA 2BLEA 4Y9AA 5BMWA 1LRNA 4CCDA 4H4IA 4AHPA 3LERA 4QNEA 4IGHA 3T78A 1VYRA 3G8EA 4UTMA 2CLHA 2FPTA 3W7HA 4OHQA 1MEWA 4RR4A 5BW6A 1BTMA 3TK7A 3B03A 1SU5A 5F2MA 3W2KA 1NF0A 1D3GA 1KM5A 3VFLA 5AHIA 4D2JA 4HNUA 1GVRA 1C29A 1K7EA 4CQ8A 1FDZA 6TIMA 1XBXA 1SFLA 1K8YA 2VFIA 4X22A 2YFOA 3IGXA 2O7SA 3Q58A 3T7VA 3V75A 5BMXA 3PAJA 4E2DA 3M43A 2ATMA 4XBSA 3N9SA 3M41A 4UFHA 1SZGA 3NVTA 3NDOA 5AHNA 3W87A 1HFBA 4AHOA 1LOQA 5I3KA 3GNDA 4MJZA 2Y88A 3R8RA 5EKYA 1TB3A 4DO4A 3GR8A 3TMQA 2CLLA 4YL2A 3PG9A 3R2GA 1H1ZA 2CLFA 2WNNA 4DBEA 1EEPA 3QM3A 3OEXA 3TQKA 4YXGA 3O8AA 4I7UA 3L9CA 4LUJA 3W7KA 2G95A 2ZTJA 2NXHA 3QQ1A 1H7OA 3V1PA 4O28A 4GXMA 4O18A 2NUXA 2ZQ0A 3QW3A 3MBDA 1I2RA 3LRMA 3C2EA 4XZ9A 1U83A 1TCDA 1JCLA 1VCFA 4EIVA 1GQNA 1JCXA 2PCQA 2XN2A 3B4UA 3LHVA 3W83A 1XDLA 1RV8A 4W9TA 1YPIA 2B7NA 3PSWA 2A2IA 2QCDA 3Q2DA 1ZY9A 4IMCA 3C3NA 3OA3A 3M47A 2ZA2A 5G2IA 3D0CA 1GVSA 3ABSA 3LLDA 1BEUA 1THFD 3A9IA 3TX9A 1VS1A 2PRLA 2J9XA 2H3BA 3M6YA 4P2VA 3G1VA 3EB2A 2C0AA 3PR2A 1K03A 3W71A 1ZALA 4FXSA 3O63A 3QZEA 4FNSA 3EX2A 4CQ9A 3H55A 2W6RA 5AYZA 1RQEA 1XC4A 2TRSA 5FEZA 1A5CA 3G18A 3W1UA 1ZCOA 3T55A 4N9CA 1JCNA 4S1FA 5CPOA 4ADTA 2FPYA 4PL2A 4N6EA 3B0VC 3B8DA 2VC6A 1P5BA 5BNKA 4ORMA 2J24A 4PL1A 3NZ1A 1LP6A 4L4MA 5F1VA 3IIVA 3IVSA 3RMJA 5K9XA 1QPNA 3NQEA 3W85A 3PUDA 3WK1A 2G96A 2CWNA 2YDAA 3W74A 2ZRUA 4JGDA 5KZDA 1LBLA 4MPQA 1XBVA 2AQWA 2QCNA 1XBYA 2GJNA 1K02A 2FLIA 3MUXA 5LZLA 4EVZA 4ZQOA 3P84A 3NQCA 4UXDA 2NLIA 1K7FA 1W5MA 4UNLA 2WPBA 5I3FA 2Y63A 2CZEA 3TMLA 4UTJA 5LNWA 3GB6A 3B0PA 3EWWA 4LT9A 2VFFA 3GAKA 4HN4A 2GQ8A 3N14A 1VPXA 2C19A 5HULA 4RK8A 4BI7A 3TA6A 1MO0A 3LV6A 1W0MA 1FCBA 1AK5A 2CLIA 2QCGA 1LZOA 2YCEA 3UWZA 4O1DA 1DJNA 2RKXA 1GTEA 3BLIA 1W8SA 5LHEA 3HF3A 1LTDA 2FB3A 3G1FA 1QWGA 3CQ0A 4GUFA 5G1TA 2WSRA 5CSSA 3M1ZA 2E5CA 4UMCA 1NVMA 4C1LA 3QJAA 5F4WA 5FF7A 3BGJA 4MFEA 3W07A 5L9FA 3TKFA 4K7VA 1I8JA 2ISVA 4ZL1A 5F4SA 3O6DA 3SIZA 3W1NA 5G4EA 4L4LA 5EMUA 3G1DA 2ZZ1A 1EX5A 3L66A 3M44A 1AW5A 4FX6M 2WSYA 1WDWA 3LI1A 3GK0A 3GAYA 1VYSX 1IXOA 4AVFA 4FX7A 1TQXA 1VQTA 3IVTA 4M19A 1H61A 4NXSA 3WK2A 2EPHA 4WXYA 2E5DA 3AO0A 2GVGA 1HO1A 3UXDA 3GVGA 3N19B 4UTTC 4JN6A 2DZVA 1OYBA 4O4VA 2ZZ2A 2HSAA 2GJLA 3NL6A 5FEWA 2QJIA 4AF0A 3NPUA 2Z6IA 3IIZA 1LOSA 1LLZA 4NX0A 2QCMA 4BI6A 3TU9A 2DZTA 1WQ5A 1D3HA 2ZDRA 4AEOA 3ZFHA 1KFKA 1KV5A 3SJ3A 5C2XA 3I7SA 3EKLA 5KSWA 2OJPA 4R7JA 3A5FA 3G1HA 3LHWA 3DFOA 1FWSA 3RK8A 4QJ1A 3U2OA 2QUUA 4LRSA 1OHLA 3LXBA 2FFCA 4IX0A 3P5ZA 1F05A 4FNUA 1XXXA 5FF2A 1F5ZA 3L0GA 2V0TA 2X1TA 3A22A 4JTIA 1OFAA 5D03A 4CCEA 2OT0A 3I6RA 3I68A 5KINA 3VE7A 3H53A 2ZBTA 2Y7DA 4WY0B 1KLZA 5AOUA 3C2VA 5G4WA 3OG3A 2C6QA 3P82A 4Y90A 5K9DA 3M9YA 3HPSA 3OVRA 3L65A 4HKPA 4HPJA 1C8VA 3IRDA 4Z1DA 2VEIA 1OYCA 3N73A 2Y7FA 5FF3A 2B4GA 3BGGA 3NQ6A 2QCDB 4Q32A 4GC4A 4IPJA 4JD4A 4JTTA 2ZZ5A 3W7MA 4NZFA 2DZSA 4YWIA 4I9AA 1VLIA 1SO5A 4FO4A 3W22A 5D2YA 4QITA 1IIHA 4O15A 5G1YA 4K37A 3WFAA 3TROA 1RZMA 4OT7A 3FA5A 3NQ7A 1Q45A 3W7DA 2X1SA 1NF7A 1XUZA 3LTPA 4UFJA 3DI1A 3HB9A 1W37A 3HJZA 4PFMA 3MP5A 4NJKA 4GUJA 1F76A 2G97A 4JX4A 4MYAA 2NXIA 3NZRA 1N8FA 4JX6A 3GXTA 1ZAJA 4AWTA 3TJLA 4IX2A 1JUBA 3THQA 2PRMA 2NV2A 1F6PA 1H51A 3THAA 1TREA 4QISA 3WK0A 3NQ8A 3BPWA 1W5NA 2A6LA 2GQAA 3G1XA 4CNNA 3W7NA 3CTLA 3MBFA 3EXRA 2Y61A 5L6UA 1ZAIA 4O10A 5D05A 2V81A 4DQWA 3GDKA 1EPXA 2ZA3A 1H7PA 1QPRA 3MYPA 1ZHAA 3BG5A 3OVQA 4TIMA 3PB2A 3STGA 1W54A 3S6DA 2KZHA 2OX1A 4BF9A 1TIMA 3JS3A 1OFOA 3C52A 3QF0A 3G0SA 3UWQA 5C55A 1E51A 1EA0A 4MFDA 5J5DA 3M5ZA 4ZQRA 1OVDA 2FB2A 1ALDA 3BLEA 1PL9A 4N02A 3NL2A 4NNBA 3UQNA 4WUIA 3LV5A 3PS7A 3DFNA 5G2HA 1ME8A 1OFPA 3PULA 4K8HA 3E49A 2JKEA 4MZ1A 1ZFJA 1G67A 3G0XA 4GUHA 3FYPA 3CPRA 1DV7A 1JJKA 1W5QA 2ZRWA 4AWUA 2NWRA 1EP2A 4UMAA 1J2WA 2R14A 2H8XA 1VGAA 1W3IA 4DXVA 4X9SA 2Y7GA 3OVPA 3GX9A 3G8RA 3EWBX 1DJQA 3LRLA 5AYXA 3LDVA 1XDMA 2NZLA 1KTNA 2RH9A 3UYCA 1HO4A 3P8IA 4UFIA 4BR1A 3LCLA 5D30A 4ZMGA 2PC4A 1TPWA 2HS8A 3S5ZA 1YYAA 5D2TA 3KVJA 3KVLA 4NJIA 4UTIA 4IWWA 1KFEA 3UZ5A 2BTMA 3SECA 4EF8A 5AB3A 4QIUA 1FX6A 1AW2A 2V2CA 1MXSA 3T4CA 4DF2A 1UUOA 1P1XA 3QEZA 3GXNA 4YCPA 3W7OA 4LV9A 3TV8A 3PBUA 3DH7A 3N3MA 3O1NA 1K3UA 1TPFA 4N4PA 2CLEA 1VLWA 1QOPA 1S5WA 2NX1A 2E77A 5ABTA 4UTTA 3RF9A 3TDFA 3UY7A 3UXAA 2Q8ZA 3KRSA 5HMSA 2QCFA 1NAL1 4MY8A 3NM1A 3SSJA 2QCLA 2FIQA 4UTWA 4RCXA 2F7FA 4IXXA 1JCJA 2QUVA 1A5SA 1EP1A 2R91A 3LCHA 5K3VA 3W1XA 1YXDA 4A21A 1C9DA 3NQAA 5IBXC 3TUUA 1YPFA 2WV8A 3NNTA 1XL9A 2YYUA 1OX5A 3UNDA 3KVKA 3W2MA 5FF0A 5CGQA 4WY0A 2DZWA 5FF4A 2QDGA 1O4UA 5EPDA 4MY9A 5DELA 1H7NA 3ZR4A 4OQVA 3LHZA 2I14A 5AN7A 4GE8A 5D09A 1TYGA 3W75A 1SZEA 1Q3NA 3S8HA 4WD0A 4GUGA 2FDSA 1BWLA 1F2JA 3DKLA 2V9DA 1FCQA 3L5MA 1Q6LA 3RLVA 1GG0A 3W1QA 3R89A 2H8ZA 3SI9A 1YXYA 1ME9A 3NQFA 1RR2A 3TNOA 4HT3A 3ZS4A 2NUYA 3NPWA 4IMEA 4MIMA 3SGUA 2TPSA 1DL3A 5F2GA 4GRSA 4TMCA 1ICPA 1KV8A 4LOCA 3CU2A 3LHUA 1TRDA 2QDHA 4OV9A 3BW2A 3P81A 4QAIA 1PCKA 4LVDA 4FNQA 3DGRA 1IXQA 1VRDA 4LV4A 4O8RA 1FDJA 3QMTA 1Q6QA 4HHPA 2DORA 4AHQA 3FS2A 3C2OA 3CEUA 3EWYA 4GJ1A 3O6CA 2HMCA 2VEMA 3W7RA 4UIOA 4DO5A 1J4EA 4G1KA 3NQGA 3O15A 5AHEA 3ELFA 4PEKA 2H90A 3P5YA 2C14A 1SZFA 1G4EA 4LC8A 3BO9A 3A24A 3M5VA 2ZTKA 4CNOA 3C4UA 2ZZ4A 4CNPA 3STEA 4UCGA 3IEBA 5HWNA 3DENA 3LHYA 4FNTA 3E02A 3U6WA 2VEPA 5I3HA 1BKSA 5D37A 3OIXA 4IMDA 3L68A 2EGZA 1CI1A 3MHUA 4RV8A 1UB3A 1KA9F 2QCCA 1YTKA 3W76A 4KFOA 4MVAA 2GUUA 4XBKA 2TMDA 1WV2A 3SW6A 2E6YA 5D2XA 4KWWA 4M6QA 1PE1A 2QCEA 3GXPA 2J88A 1ONRA 2E6DA 4UUIA 1P4CA 1LBMA 4XKYA 5C5YA 3DI0A 1YADA 2ZRVA 4XTDA
chains in the Genus database with same CATH superfamily
1XICA 1FHLA 2R82A 2Y8VA 1KM1A 1UD4A 1W32A 2UV8G 4M24A 4YNGA 3DN5A 1GVQA 4W7WA 1OX4B 3R11A 3IJLA 2G5WA 1TPUA 2ZVIA 3SUVA 2JEPA 2QV4A 4KFNA 4KFPA 4RXFA 1UQZA 3PWAA 1VBGA 1IWBA 1KXVA 4PC8A 4YYCA 1JXJA 1FFRA 1MXGA 1JFXA 2A3CA 2BGQA 2XVGA 4EWND 1LT8A 1S5TA 2EJ1A 1JI1A 1RUSA 3FV9A 1UWSA 1IF2A 4JKMA 4L7ZA 1DBTA 2A6NA 4JTJA 3ZLHA 2YL8A 1I2QA 2NV9A 3CL6A 4CQCA 2J7GA 5FJJA 4IM4A 3QPEA 3FYOA 1F9CA 3VXGA 4UNIA 3C61A 3W53A 4LBSA 1EKOA 1Q6CA 2X30A 3L21A 3UFYA 4JIRA 4DN1A 3WNMA 4GC3A 1DIOA 3GXMA 3PJWA 3SCUA 2E6AA 2DEPA 4FLSA 1HKJA 1S38A 3WF1A 4BQ5A 3TJ4A 4OBTA 5FIPA 1OK4A 1SPQA 1R3SA 3RX2A 1O1HA 4PMOA 3TR9A 4NXKA 3LBCA 2ZCGA 4NP7A 4NT0A 1O12A 5I0DA 4DWSC 5KITA 3TYEA 3R7MA 1XLIA 2I17A 5LA0A 3MUY1 6TAAA 4N9BA 3KAOA 2QJGA 5IDZA 3MWAA 4FOJA 4RZBA 4PCSA 3WD0A 1CLVA 3IJDA 1GQKA 3GTHA 1E6XM 2VGBA 3GU1A 3TQVA 4HSNA 2PGEA 5A1AA 2P3ZA 4DRSA 2VX4A 4WZHA 1W9DM 3DEQA 4DJDD 4CNUA 2W92A 4R34A 3S5NA 2DSVA 4F8XA 7TIMA 3WJZA 1H09A 1DXFA 4LCSA 4RL3A 4LW7A 3EMQA 3H2FA 4P8VA 4QCEA 5KTLA 2JE8A 2I7GA 4C7DA 1BYAA 3IJ6A 2XIJA 1L6GA 5HOSA 1SVDA 1PAMA 1SW0A 3R25A 3B8WA 3WUFA 1DWAM 1XFBA 1BRLA 4BY3A 3V18A 1XPYA 4FHAA 5IFTA 1HKVA 3GG7A 3DGBA 4C1NB 1GEHA 4HMEA 1PCWA 2WZTA 1RAKA 4Z1YA 1ZAHA 5AECA 1A5AA 2VDHA 2XH0A 5E6YA 3SY8A 4UMBA 1BVWA 5LSMA 2YGYA 4HPXA 2B31A 4KEZA 3CMJA 4MWAA 5HWMA 2X0YA 2DU2A 4O53A 1F73A 2VX5A 3VOFA 3WLOA 1XIDA 2BASA 1QO2A 2W67A 4GY0A 3E96A 2HDJA 4DPQA 1Z9AA 4W84A 2GQ3A 2HPIA 5CPQA 3AHTA 5I23A 1V7AA 2WBGA 5I3JA 1AJZA 3CTTA 4GCAA 1ZJAA 1W1B1 1KFWA 2B81A 4HPHA 3KTXA 1RCXB 3BARA 3T07A 2WMGA 1P1MA 3L2LA 4OU1A 1SSGA 3CGTA 2OSWA 7REQB 3FX4A 4NU7A 2HISA 1MDLA 5E09A 4M5PA 5HUPA 4US5A 5E70A 4O17A 2WQDA 5ABFB 5CC5A 5CEWA 4PMZA 4AEEA 5D04C 1PO9A 4C7GA 2TYSA 1LG1A 2QUMA 3M0LA 3ABRA 1C3FA 1I60A 1MUCA 2F6XA 1E6NA 3Q94A 4XZLX 5LIYX 1XYLA 3TN4A 4JHZA 1YNQA 4MHBA 4WGHA 2D22A 4S3BA 3WD3A 4GIRA 7XIMA 2BSLA 4NJJA 1FCVA 4C6FA 3FLUA 3N2BA 2BVWA 4HNNA 3T0TA 1UJQA 1GOWA 2CKRA 1I2OA 3S1GA 5T91A 1K8ZA 2ZZ6A 4P7QA 2DJXA 4XISA 1VH7A 1A3HA 3RJXA 1J0KA 5LGXA 1I45A 2O56A 3UR5A 4Q8UA 4ONVA 3HMCA 2HZGA 3CHDA 3DHDA 5LNRA 1FWNA 4DZ5A 3M4HA 3W1LA 2DDXA 5G1MA 4O1BA 1EJRC 4YHGA 3VIOA 3MVTA 2MNRA 1XCFA 4Z1CA 1VRXA 3N4EA 3ANYA 1JZ3A 3V0SA 1I2PA 3WMSA 1NFBA 1MQPA 1TPH1 3PSVA 1XYMA 1G6CA 2HEJA 5D8WA 1X96A 1SUXA 1YDNA 4GIYA 1DPMA 2VMFA 5U4NA 3B05A 4HSHA 1S1PA 4ZOAA 3JU2A 4ZZ9A 3QH2A 1DWHM 5A5WA 4LC6A 3KBVA 1BKHA 2OG9A 4GQ0A 1MQRA 2IKIA 4MJ4A 4IIHA 3APYA 4EP8C 4K1GA 1DE6A 1GKRA 4TX9A 3UWYA 1ZL1A 1E0UA 3IAPA 4O12A 1MNZA 1NFGA 3PPFA 4XZNX 5MF5A 3GU2A 3ZWSA 1CNVA 4I5UA 1OGBA 4GUIA 5C0QA 5AHLA 3BW3A 4E4UA 1W9BM 1R3WA 3HTWA 1A5MC 4M6VA 3AYRA 1RQBA 2QVNA 3EDFA 5T26A 3CNYA 2C1IA 4BA0A 1ISVA 1X97A 4HHMA 4H6KA 1FXPA 2E68A 2VFHA 4J9JA 3HQOA 1X8FA 2OZ0A 3NVDA 4W89A 1UWTA 1P6WA 2V5LA 1PBGA 1O5QA 5CXPA 3WUBA 1IEXA 2HNEA 1TTIA 2CBUA 4EK7A 1UZDA 5AC8A 2NWSA 2WCSA 3FGCB 1TPVA 5D38A 1B1YA 4MYXA 5DMMA 3VDBA 1KQZA 4GA8A 3K46A 1RSCA 1L6WA 4ALDA 1E9YB 1JQXA 3W23A 3U8GA 1Q6DA 1PXGA 3NQVA 5I5RA 3PG8A 2CIPA 3AIBA 3NQ2A 3N2XA 4TVCA 3ZR5A 2OSYA 1D9EA 4X63A 2OWCA 4JCLA 1W1A1 2D0FA 3HMJG 2YLLA 2CZDA 2BZNA 1JNEA 2WC3A 3WQGA 1XG4A 1TVPA 5DBUA 4B15A 1EDQA 4UQ9A 3LRKA 2WNWA 3LB0A 4JN8A 1XYBA 1BSLA 1G9HA 4Z2GA 1A50A 3QKEA 1ITCA 3LQLA 1DJGA 3QFWA 3HG5A 1IE7C 3EWDA 5HR6A 3TCSA 2GJPA 1E56A 5HMFA 1LCOA 3PZOA 5EBAA 1LQ0A 4CEUC 2OOFA 3WQOA 3V7PA 1YXCA 2BX7A 4UTKA 4KCVA 2V30A 3NZQA 3OGRA 2BWGA 2JK2A 1NWTA 1XQKA 1W56A 2JIWA 3DFTA 1G4PA 4LX4A 3NG3A 2IW0A 1PIFA 2B0MA 4AQLA 4ZQPA 2WMKA 2DUAA 1KBKA 4ZE4A 1B2YA 1VPYA 2BXZA 1LORA 2V3EA 5HINA 3L12A 3W1RA 1FDYA 2XSXA 1MUWA 1E0TA 5CZJA 4KWSA 5JU6A 3REQB 3PUEA 4A8NA 1Z42A 4P8WA 1EA9C 1J93A 3G24A 5TIMA 3QR1A 1HGWA 4QROA 3JVAA 2GGJA 5BU6A 4Q8VA 2J6VA 3WLIA 4QG8A 3ANVA 2Q71A 4FNPA 3AXXA 1DJWA 4I6KA 3ONBA 4H9UA 1OB0A 3VZZA 3U5UA 4Q8QA 3W24A 3AMLA 4N6FA 3F2BA 1XLLA 4GACA 3KLLA 3VKAA 2AQVA 3KCLA 5T9BG 4PSPA 2Q8LA 1OC5A 2VC9A 2YKKA 2OYLA 4RNJA 2AMGA 3WEZA 4PCFA 3ARXA 4GYKA 1N7KA 1TX0A 4YWSA 5AC6A 4GKLA 4RZ4A 3AI0A 1X39A 2EEXA 2PI6A 2WZEA 5EY5A 4R53A 3WD4A 1ICSA 4MUZA 1LYXA 4KWOA 2CBJA 4BHYA 1O94A 3UWWA 2Y70A 4NRSA 2QQ6A 3A23A 3QFEA 3ZMRA 5FI8A 4IT1A 3MB9A 2YOCA 1CGVA 3RCNA 1SJCA 3O9NA 4B16A 2H9AA 1SJDA 3NR0A 4O14A 1VPQA 5JIPA 4IIDA 1QPQA 1O66A 4YVXA 3NJ3A 3FJNA 4HD5A 2PDQA 3TYAA 4H01A 1VHNA 4JTHA 4IF2A 1CYGA 3K30A 2J78A 4GYPA 5H91A 4Z0JA 5BRPA 3LPFA 5HQEA 1EO5A 1QU4A 3CHEA 5HJLA 3EKZA 2XFRA 3GVQA 2UY2A 2CC0A 2NQLA 3AROA 4MUPA 4UFMA 2Y4SA 2E0PA 3VABA 4EKJA 1X1OA 4IGMA 2XYLA 5FJRA 1J0HA 4AD2A 1JL8A 3NA8A 3FOKA 3KBJA 1YPXA 4A05A 3N15A 2C3ZA 4QM1A 2R1MA 3SRDA 4G6CA 1T96A 1A5OC 1BWVA 3TXVA 3WSUA 1DWGM 1ISZA 3CZGA 1RBLA 2XISA 2X05A 5E5CA 3WENA 4K6AA 1OADA 4WF7A 1G7VA 1AW1A 1IR1A 1GGOA 1K4HA 1V93A 4A2RA 1B3VA 1DWJM 1XISA 3WFLA 4LWWA 4ROPA 4ML9A 3WNKA 6XIMA 5IHSA 3ITGA 1U2YA 2WM1A 3GNRA 1TPB1 3GW3A 2G3NA 3AXIA 2I57A 4HA4A 4LPCA 4Q33A 3GW0A 4A3RA 4WJ8A 3O0KA 4ZOBA 4IP5A 4ES4A 5I77A 3NL5A 2QS8A 1AH0A 3N6HA 3JR2A 5HNTA 1ICQA 5CPTA 3UGRA 3UXKA 3MCMA 1WXYA 5FJOA 2YCIX 4GABA 3S1VA 1X98A 4H6QA 1J11A 4PUEA 1MFUA 4M8UA 3MW7A 1PIGA 4EF9A 1QR7A 1S2VA 5LNUA 4DI9A 5HANA 1UWRA 3G1RA 1E0VA 3MV01 4YN5A 3B3DA 4LB4A 2PD5A 1OCBA 3KOYA 3BLDA 2Y6ZA 1GOOA 4J3XA 4MZYA 4BEUA 1Z41A 3M7WA 2V8ZA 1AVAA 3WEOA 5DN1A 1EB3A 3RAOA 5A2BA 4X61A 1NDWA 3O07A 4JNZA 2DIKA 4PMRA 4DAFA 1GNXA 3KRZA 3TOPA 4ASTA 2PWUA 2YW4A 4H7VA 1UOZA 2Y89A 3VKCA 1LT7A 1EO7A 2X41A 1EDGA 4CD7A 3LCFA 1G7UA 1Q2RA 1J0YA 4WKAA 5LIXX 6ALDA 2GSEA 4ATDA 3IIOA 5XIMA 4ZOEA 1W3LA 1HG3A 1ZNNA 4ERAA 3VI2A 1KM3A 2D73A 3FDKA 1RA0A 4OJYA 4J3WA 1JDAA 1W31A 5I03A 4POCA 4JYFA 5A69A 1XR2A 2BDQA 4L9XA 3M0ZA 2ZWZA 4X9YA 3LLXA 5FAJA 2GUBA 1GQJA 4YCOA 2A0NA 1H0GA 1VFHA 4ZR8A 4AZCA 3TC3A 1EEXA 1E9ZB 3QYSA 3DKJA 3CIXA 2NSXA 1JAEA 3EX4A 2GGIA 1DJXA 5F1UA 2ESCA 3LYEA 3OA5A 5FA5A 4NHVA 3L7RA 4C65A 1BQCA 2ZRXA 1H5YA 4BK9A 3QSTA 3TTSA 3CMGA 4NYUA 3MI2A 4F9DA 2QYGA 3H70A 4GXPA 2NQ9A 4WQ6A 1BYCA 2BY0A 1LG2A 2FTYA 5CKSA 1NY1A 1SYTA 4D6GA 4L64A 5GPRA 3P14A 4XQ6A 1K9EA 4D9PA 4YTUA 1CXLA 2QUTA 1N82A 2C18A 2XSAA 5LIWX 1JR1A 2C7FA 4TR9A 4Y8EA 3W1TA 1GOXA 2GPTA 1JDFA 3OB8A 5DXYA 1DE5A 3FNDA 1R47A 2Z1XA 1N8IA 3W7LA 5BRBA 3GLCA 1FQ0A 1TPC1 4IP4A 3VDHA 4AIUA 3TH6A 1IWPA 3NGJA 4X2RA 1XIBA 3BAYA 4B5NA 4S3FA 4QS6A 5H6HA 1KTCA 1P43A 1VEOA 1OSEA 4M81A 4IOTA 1RLCL 2ZWYA 4ZXOA 2NX9A 1FWWA 4W85A 4ZB2A 1VC4A 3Q45A 1L9WA 4LUIA 3P8JA 3TW9A 1T8QA 1TRIA 1I9CB 1A5LC 3VD3A 1KGUA 3RLHA 4LVAA 2RUSA 2PDKA 3W7QA 4JNYA 2VFDA 2BLEA 4LY4A 2DT3A 4AHPA 3WBXA 1AD1A 1RK6A 1VYRA 5HNUA 3GC4A 3T81A 3B03A 1SU5A 2WJDA 1RY0A 1NF0A 1KM5A 3VFLA 5AHIA 4DWSD 4OUIA 3H2NA 1B3YA 1XBXA 3URBA 3KBMA 1EQCA 3CH0A 3UERA 3AFBA 3PAJA 4M80A 2ATMA 2PSNA 4AW7A 4Q3MA 5C71A 4F9JA 1SGJA 3HV9A 2V5CA 3M41A 1SZGA 3HURA 3NDOA 3N13A 3W87A 4FR1A 1HFBA 2FVLA 1Y7VA 2Y8UA 2Y88A 3KTCA 4H7ZA 1TB3A 1Q7QA 3WBAA 2CLLA 3R2GA 1OCQA 4V1YA 1MWOA 2Z7GA 2WNNA 3VNYA 3QBUA 4DBEA 4H6EA 2Q09A 1EEPA 3ZSSA 3QM3A 3BSGA 2EQDA 4U5KA 3O8AA 4I7UA 3L9CA 3TYZA 4HNCA 2NXHA 4AZCB 4KWUA 3KWXA 2NUXA 4LJ3A 2ZQ0A 4RE2A 5CGMA 3MBDA 1D8WA 4IHCA 3LRMA 5AVNA 3WEMA 4LCRA 1U83A 3W4RA 1TKKA 2F9RA 5EFDA 1JCXA 2PCQA 2QULA 2J7CA 1HKMA 3B4UA 3Q65A 3LHVA 1XDLA 4V15A 4K68A 4AUBA 3KOWA 3Q2DA 1ZY9A 4IMCA 3VIGA 2BS9A 3BV7A 5A3HA 3M47A 2ZA2A 2DQWA 1DYSA 4DWDA 1VS1A 4LBUA 2H3BA 3ZT7A 4MB5A 2G4JA 4Z2JA 3W71A 1ZALA 3QZEA 4JHOA 4XO6A 4KGJA 1ECQA 2W6RA 5AYZA 1RQEA 4ZO7A 1A5CA 3ES8A 4N9CA 1OINA 5HPOA 5CPOA 2NSOA 1P5BA 1YX1A 1Q6GA 2WZMA 6ENLA 3B40A 3EDEA 4B3KA 3IVSA 3RMJA 5K9XA 4H2HA 1J96A 3IGHX 1XD0A 3NQEA 5HMEA 3LENA 3PPCA 2YDAA 5I02A 5HJYA 2ZRUA 3KHDA 3S2CA 5I24A 3LN3A 4MPQA 4UB9A 1RP8A 4FP1A 4MSSA 1JDEA 4WEVX 3MUXA 3XIMA 5LZLA 4EVZA 2ZICA 1UWAA 3PZ9A 1UA3A 3O2LA 3F5JA 4ZO6A 5D9NA 4UTJA 5LNWA 3B0PA 1XH1A 4LT9A 4YTRA 2VFFA 3GAKA 4HN4A 2GQ8A 3DFYA 3U48A 1UZ4A 5HULA 4RK8A 4GGHA 4BI7A 3LV6A 1W0MA 4I5XA 1AK5A 1HKKA 4UQBA 3N04A 5M5DA 1OD8A 3DG7A 1XRVA 1W8SA 3L4VA 1BFNA 3G1FA 2G4FA 3RCYA 4UMCA 3R58A 1W91A 4C1LA 2I5QA 1OBAA 1VFSA 2PP0A 4PB5A 5L9FA 1V3HA 2CBVA 4DZHA 1I8JA 4ZL1A 3SIZA 3G1DA 4DO7A 1EX5A 3L66A 4I5RA 4PBEA 1WDWA 5DMLA 1X8CA 1IXOA 3IVTA 1ZP3A 4NXSA 1EF2A 4AY8A 4WXYA 2VZOA 3AO0A 3RYSA 1HO1A 2HV5A 4CNTA 4UTTC 1UH4A 3DECA 1NWSA 4JBRA 1BF6A 4XAGA 5FEWA 2FDMA 2Z6IA 3IIZA 1C8YA 4TOQA 3WLHA 2QCMA 4BI6A 3GH5A 2ZDRA 4X0VA 3ZFHA 1KV5A 4QRNA 3GRIA 1MRQA 1ZTVA 3F2DA 4J3TA 2VRKA 3G1HA 3LHWA 3SUTA 3U2OA 2DSWA 3RITA 4V1XA 3ICJA 2PFHA 3WL0A 3K2GA 3E74A 4B4FA 5J8LA 1XXXA 2X1TA 3AUJA 3W82A 3T0AA 3SADA 2YDSA 4IIBA 4ERGA 4GVGA 4WY0B 5AOUA 3FHQA 1HNYA 1CXEA 3L65A 3C8NA 4HKPA 3IRDA 4Z1DA 3VVGA 1ADSA 1OYCA 1SFTA 1UC4A 3EPOA 3KM8A 4QDWA 3T2PA 4BQ3A 3BGGA 3NQ6A 2QCDB 4YVPA 1XYFA 1ECEA 4D6CA 1Q2SA 1JGIA 3H4GA 4XIAA 1EX1A 4YWIA 3VPLA 2PMQA 1VLIA 3J7HA 3TVAA 3KOZA 3VYLA 3W22A 1V0KA 4CN6A 3BLOA 4H8HA 3EGJA 2I5GA 2I16A 3OBEA 1JF5A 4EPKA 2NQZA 1NF7A 1XUZA 3MZ2A 3LTPA 3DI1A 2RDXA 3SGGA 1GOMA 3HJZA 5FJUA 2DV0A 2XGIA 3CQHA 3MP5A 2J77A 1E9LA 1NTHA 2WHMA 4S3JA 2BVTA 3NZRA 4CQDA 3IV8A 1N8FA 1TV2A 4JX6A 4JQ3A 3PZMA 4AWTA 3T42A 1UR0A 2PRMA 3M07A 4CD5A 3WLSA 3THAA 4QISA 2PDJA 1DJZA 4Q22A 2WMFA 1V02E 3G1XA 4CNNA 2IMRA 2VZTA 2Y61A 5L6UA 3WCZA 5I6SA 3EDJA 3WLRA 1FHVA 1V6UA 3SCOA 1EPXA 1YKWA 1XIGA 4UWMA 3BG5A 3NUKA 2I9UA 4TIMA 3PB2A 1E0WA 2OX1A 4F2TA 4PE8A 1A47A 4D8AA 3RILA 3BLKA 2O55A 3T6CA 1ITUA 4MFDA 4XB3A 3M5ZA 5J5DA 3CHCA 4NNBA 3UQNA 3EOEA 3A3HA 2WVVA 2D0HA 1WP6A 5C9WA 1T7LA 3ARYA 3PULA 4K8HA 4C6LA 2JKEA 3IJ8A 3PZUA 3PBMA 2WCAA 1TCMA 1GONA 4MF4A 1G67A 2VWTA 4BS0A 3KL3A 1E55A 3FYPA 1I75A 2ZRWA 4OTKA 1NH6A 4LYRA 2HVOA 1J2WA 2H8XA 3R94A 4DXVA 3V16A 4UZSA 3OVPA 3G8RA 3EWBX 5DFAA 4UOZA 5AYXA 2ACUA 5BXTA 9CGTA 1KWGA 3GH7A 3MCNA 1OCJA 4BR1A 1QNQA 2PC4A 3H2EA 4C5YA 2ZUMA 4PCNA 1L6FA 3R79A 3KVLA 4NJIA 3PANA 1S5NA 4G7EA 1MXSA 4E2OA 3GHRA 2XH7A 2IQ0A 4GI9A 3U7VA 1E3XA 1W8GA 1TPFA 4PTWA 1VLWA 2NX1A 1VIZA 2CXEA 5ABTA 4HK7A 3TDFA 3UY7A 3UXAA 3MY9A 2QCFA 4H8UA 3CAQA 2F7FA 2HRWA 3DG6A 2D20A 5K3VA 5HDRA 2VOTA 4A21A 3GY1A 1C9DA 5DANA 3TUUA 1YPFA 1ISWA 2P76A 2YYUA 3W2MA 4DM2A 1JYWA 3CUXA 1XLDA 2DZWA 2XM1A 5EPDA 2RGMA 1H7NA 3N3TA 3SUWA 2XG9A 3QHNA 1TYGA 5I7GA 5LXEA 5B80A 1TZ9A 3VZXA 4WD0A 3DKLA 1FCQA 4GZIA 2XUCA 4XZHA 2H8ZA 2FZ8A 3SI9A 1YXYA 1H41A 2A3HA 3TNOA 2OYMA 4MIMA 1P0BA 4WSJA 4GRSA 1KV8A 1FWIC 5EU9A 3CU2A 2QDHA 2C91A 3HV8A 4LVDA 4FNQA 2FGBA 1EJTC 3AOFA 3E0FA 4ZTXA 1KGXA 2VCAA 4ZFMA 2VEMA 1UH3A 1XLCA 1KWKA 4DO5A 4W7VA 4G1KA 3SDOA 3EOSA 3SSZA 4E6MA 4MWAC 1FKWA 5LIKX 3OLGA 1HT6A 3HQNA 4HNOA 1XDJA 4D6JA 2OU4A 5CJMA 4LUYA 4L9ZA 1O5RA 3RIKA 4HHLA 4LC8A 2ZZ4A 1F3TA 3FHAA 4ERIA 4UCGA 3SN0A 2MANA 4LXFA 3LHYA 4W93A 4FNTA 4OFCA 3E02A 4EPBC 3U6WA 2GUYA 3OIXA 4IMDA 1M3UA 3VU2A 1VFFA 5HA7A 1CI1A 3VOHA 2ON3A 3WX7A 3W76A 1TUFA 3UT0A 2E8ZA 4IJRA 1WV2A 4WR3A 3PAOA 4KWWA 4TQTA 1JXKA 4M0XA 2E9LA 4WDTA 2E1WA 3OLIA 1EJXC 1H2JA 3AIRA 4NF7A 2ZRVA 2QVHA 1ZJIA 5AC4A 2A21A 4RKAA 5IM51 1FWJC 5FL1A 1KRMA 4XUGA 2VENA 5B7YA 3NPXA 1UH2A 1D2KA 1NWUA 1TA3B 2OQYA 2PA6A 4LUSA 4N0RA 2JQXA 4E4FA 2ZDSA 2INEA 4PRTA 4EXAA 1RPXA 3VNIA 2C15A 3HA1A 5BWFA 3ISIX 4AEFA 4MTVA 3VDGA 1Z8AA 2YX0A 4KRUA 4P8UA 4OUEA 1QAPA 2PRHA 5DO8A 4EPDC 1JYVA 3BCJA 4GINA 3P6LA 4QSHA 3RPMA 4F0LA 1JPKA 4WK9A 1AL7A 4A6GA 3IS4A 3EEGA 4DYEA 3VGBA 3K4DA 4M7SA 2EO7A 3IVUA 3W00A 5AYBA 1WE5A 4D6EA 3BL3A 4CVWA 2J6XA 3M0KA 1EC7A 1QI5A 4RLIA 4MAZA 2Z28A 2CHRA 3GDLA 1K6WA 1MW3A 2P10A 4AVNA 5EA9A 3W7CA 3LNPA 3UY8A 1FH9A 4I8YA 5K9CA 2H3DA 2XWEA 2XFYA 5BXSA 1O68A 1R86A 1XIIA 4C6KA 3FVMA 2W91A 5JMUA 3JZUA 3MS8A 2Y85A 4UQAA 1TR1A 3W7IA 1R3RA 1WUEA 2IPWA 1B54A 1XCWA 4GX9A 1BYBA 5C7HA 4URIA 5CQ1A 1SQ7A 1M1BA 2BGNE 3N4FA 8A3HA 3LOTA 4U2ZA 2JALA 1W1ZA 1DIKA 1MEIA 3G1SA 5XIAA 3O7UA 1X6UA 4QHRA 1OWQA 4P8XA 1PIIA 3SM0A 2V5KA 3VKKA 2XIQA 1QK2A 1SW3A 4LY8A 1VCVA 3PP7A 4GI8A 2E5BA 3W02A 1KCZA 4MNLA 2YCLA 3ARRA 1C91A 6REQA 3GHSA 2E9BA 2YB4A 2PF8A 2OGYA 3OW1A 1KW1A 1ZENA 4AD0A 1NM9A 2QHAA 2X0HA 3B9OA 3TFCA 4BF7A 1X1ZA 3CEPA 1LM1A 1W1IE 4M7TA 3UWEA 3VGGA 5JBEA 3ARWA 1LRQA 3NQMA 4E0CA 2O4QA 1A5KC 3SGZA 3VMOA 1QRQA 4FNRA 2QUNA 5CBIA 2ISWA 3UYIA 4DBWA 3WJWA 1E43A 1US3A 1V5XA 3F5LA 1HGYA 2UWFA 3BAKA 4PR4A 3VNJA 3EWXA 4AVOA 4AXKA 3TXZA 3LTSA 4R88A 3PZVA 2WVTA 3DHFA 1NSJA 2VCCA 2GDVA 4V2XA 4WOQA 4JFSA 2WHKA 2GVJA 3HBLA 2OR2A 2NX3A 1QMLA 1QDSA 1CT5A 2OZ3A 1QUMA 3TSDA 3OVGA 1EJUC 1P7TA 1EZ2A 3AJXA 3K4AA 1Z6KA 4HZ7A 1JIBA 3W01A 1O60A 1WXJA 5JIWA 5BRQA 3S3GA 2Z27A 1Z3NA 4XZWA 3GFXA 3MA8A 1L6YA 3CXOA 1H5VA 3W26A 1OX6A 3LM7A 3BK0A 3FK4A 3E12A 5G5IA 4WDXA 1M68A 1TMLA 2B7OA 1YW1A 1RVKA 3FSUA 2XN0A 4IPNB 1GOQA 4DPPA 3URQA 5FACA 3NXFA 2A5HA 2FGLA 1OF6A 2EKCA 1HJQA 2YZRA 5MKGB 3KXQA 2J25A 4H00A 3Q67A 1ITQA 1UASA 2BY1A 1A0CA 3MYOA 4QQUA 5F2IA 1BAGA 3QMSA 3UZYA 4RE4A 2EG7A 4D6DA 4CD6A 5AZ1A 4J3UA 1OM0A 1S46A 3QW4B 1O1ZA 4KCTA 3CQKA 4DJFA 3NGFA 2A1YA 3M0JA 1Q7ZA 1HL2A 3DFHA 5KMYA 1TE1A 5C8BB 4V27A 1TTQA 4IJBA 3EX3A 3VTRA 3MDUA 4AC1X 1ZZMA 1W5PA 4I9JA 3WMCA 3B9EA 3B4YA 3WLQA 2WVSA 1GJUA 1UWQA 1Q63A 1YLVA 3V0UA 4WIWA 3WF3A 2P0OA 3S1UA 1F4AA 2ZYFA 1XM3A 3VD4A 5TBOA 1JRCA 3B97A 3VD9A 3VCRA 5MHBA 1CLXA 1G69A 1KRBC 3HGJA 2C1HA 3BE7A 1SSDA 3TQ0A 2FHBA 3D47A 3PPGA 1Z44A 2XIBA 4NZJA 5FJTA 3NO3A 1AMYA 1W3HA 2YBVA 3GDTA 1NELA 1XUUA 4KKXA 2EG8A 2GSJA 4J3ZA 3WQ5A 3TLQA 1OX4A 3EDDA 3MANA 1E6PA 5CCZA 2QPUA 4O1FA 3VDAA 4NNAA 1VFLA 3AAMA 5CZTA 3GC2A 2X7WA 2ALRA 3KP1A 3STCA 2FYMA 4YTTA 3NO5A 4IMGA 4S3EA 3QMRA 4O16A 1FWDC 4CD4A 4XZMX 1E1EA 1JUEA 3A3WA 3VIKA 2Y5SA 3T0DA 2FJUB 4GK8A 5CSRA 5IBXA 4C6JA 3NQDA 1XBZA 2OEJA 3W86A 1QNVA 2WSQA 4FK9A 1KKRA 1NOWA 1GT8A 2O9OA 3BLPX 2UY5A 4GVIA 3A12A 1NWRA 3FFSA 3CV1A 4Q6XA 3SRKA 1HJUA 4G9PA 1WZKA 1H1NA 4ZQNA 1PTDA 2V67A 4Z08A 1JD7A 2AAAA 5ABHA 3ARZA 3M0HA 4PYSA 3MTWA 1XGEA 1FWRA 1ZCCA 3AZTA 2YCJA 4P7LA 4MWAE 3USZA 4JL1A 3GWQA 4Y9PA 4C1KA 1HVXA 3RG6A 1MI3A 2HWGA 3LEPA 3I6EA 4S38A 3IJ9A 5B7ZA 2YR1A 3RNDA 5HWJA 3UCDA 5DXXA 3A6OA 4H9XA 5FSEC 2PDBA 4P61A 2O9PA 4H9MA 1JUKA 4X0NA 4BJHA 5F4XA 3I7RA 1UMYA 4KEUA 2ZX9A 3W6YA 3SEPA 3P80A 4HTBA 3OIHA 3QYQA 5BXPA 3WDHA 1S2TA 1UR9A 1U5HA 4OOZA 4DNHA 5A6JA 2BHYA 5D4YA 2J7DA 5JBFA 1WNOA 2TSYA 4XAPA 4GH3A 3OYXA 4F40A 4FXRA 4UFLA 3DUGA 5I3IA 1TUXA 3EXSA 2HQAA 3MO4A 4QSFA 4NNCA 3QGAC 4PSRA 2RDWA 2RAGA 1S3TC 4B9YA 5LNVA 3ERPA 1J2BA 3U7BA 3S5OA 2E28A 1UA7A 1VFMA 1PX4A 3I7QA 4RZ5A 3P60A 3F4WA 2YDRA 3UCCA 3SFWA 2C1GA 4Q4KA 1JZ5A 3KOFA 4WY0F 3E9AA 3QLDA 4GQQA 4AY7A 1TA3A 1QHZA 1E6QM 1YHTA 3RM9A 4JICA 1Y5XA 3LD5A 5BOFA 3HFYA 4PTDA 2E40A 3N18A 3GNXA 4FLQA 4D8ZA 2DIEA 3WQ4A 1TVNA 3KOXA 1T6MA 1PTAA 1ME7A 4PMNA 5E1QA 4H1ZA 1GCYA 4Q8NA 3QPZA 4DUWA 4KMQA 2ACRA 3KHJA 3CIWA 1GORA 1QBBA 4H3DA 4XSMA 5TQLA 3LI0A 3S47A 2J9ZA 1M7OA 1BGGA 4CN4A 4Q8WA 1XLEA 2WSKA 5FAGA 1OC6A 1AD4A 2CETA 2WO5A 1NOFA 1U33A 5CH9A 5D02A 1W1YA 1B4KA 3MQTA 4HYVA 2XM2A 2ZXQA 5FL0A 1UKQA 2E6FA 4MZ8A 3CT7A 1FWBC 5H1WA 3UP8A 1WZAA 5REQB 2GVLA 5FEPA 1JPIA 1F6KA 4AWSA 1XGDA 3G5EA 3WJYA 1AZ1A 3ATZA 5HR7A 2EPOA 5E0FA 3U4AA 2BODX 2KAUC 4MJMA 3VD5A 4C7FA 1VR6A 1L2QA 5D9MA 1F4HA 5GJPA 1YTEA 3ZLFA 4W86A 1C8XA 2FTWA 2Z4GA 2C8NA 1DOSA 4HCDA 2EF9A 4LAKA 4NJGA 2V3DA 3CWNA 1GYLA 1FWCC 4H6RA 1JCMP 1UHVA 3VILA 3ZWTA 1V0LA 2YL6A 2OSXA 2JKAA 4NSBA 4F79A 3L67A 4ADSA 2BY2A 3PBYA 1VJZA 3W3OA 2WQPA 2VFEA 2DP3A 4QE5A 1QPOA 1OFRA 4J2PA 4H9YA 4J28A 1QK0A 2D3NA 2VD8A 2WKJA 4JDYA 5LA1A 1H63A 1XSIA 1XJBA 4V28A 1TWSA 2AAMA 5CPLA 2X1IA 3OLDA 4Q8MA 2EBNA 3VE9A 3VNDA 4O0QA 2QR6A 3AMDA 2A4AA 2PF0A 2B7PA 4P5UA 2ZADA 3NOEA 3BAWA 4PUDA 1GZGA 3CK5A 1V7YA 4MNKA 5AZ0A 5CPSA 3PK7A 3R8HA 2WZHA 2BV9A 3CC1A 4FAMA 4OIFA 2BVYA 5HAOA 3GYEA 3KX6A 4JFUA 3N11A 1GW1A 3ZYZA 2EKGA 4B2DD 4JTEA 3DDMA 3B8UA 4TTGA 2QPXA 1WBHA 1GVYA 3QXBA 5BROA 3F4DA 3AMKA 1IZCA 1FHUA 2GGGA 4AC7C 1HKWA 3W72A 3BV4A 1ZU8A 4AD4A 2X2YA 5AHMA 2C0HA 3N6JA 4RPQA 1VJSA 2CFFA 6CGTA 2ZIDA 1GJPA 4FA3A 1OFDA 3NCOA 1OABA 1REQB 3XINA 5HNNA 4DJDA 3ZQ9A 1AH3A 3HO8A 1CCWB 2IQTA 1SJAA 4W4QA 5KZEA 1WKFA 2D2HA 3BSMA 3HPXA 3A5VA 2E09A 4HYWA 1AH4A 4HZ8A 1F3EA 1EHNA 1H7XA 2AKZA 4GY1A 3IPWA 3LNMA 1VHCA 3DIPA 4S3CA 1E4LA 1EUNA 4BF5A 2VC5A 4FOUA 4W8LA 1AZ2A 1O7AA 4NZ5A 4ICCX 5DQPA 1AMKA 2PP3A 4AYGA 3C0LA 1FY6A 1SZNA 1WKDA 3FA4A 3VCCA 4PZVA 2HVNA 3AICA 3UG4A 5M3WA 3L4TA 4E5TA 2Z26A 2QT3A 3WD2A 5DCBA 2XFWA 4PA8A 4XIMA 2VGGA 2DH2A 3BQ6A 3WJSA 4S3DA 2QEZA 4JTLA 1OK6A 1KBIA 4DB7A 2F6UA 4WDWA 3N2TA 1OEPA 1ZGDA 2FJKA 2FPVA 2YA2A 2V68A 4HIBA 5D2VA 4HP5A 3TW7A 3AU2A 3W25A 4FSAA 1ADOA 4LBRA 3W9ZA 3BCDA 4PBFA 1JFHA 4LYPA 2VJXA 2YXOA 1LF1A 4PTVA 2HBXA 4DUVA 1M6JA 1EJSC 1HN1A 3ZXWA 2JGQA 2DSKA 1R8LA 3W2NA 2QF7A 2YXXA 1M5WA 2CEQA 7PTDA 1YQ2A 3M5XA 1NIUA 3HG4A 4DJDC 3AS2A 4O1EA 3CZLA 1Y0EA 2PU1A 1KM4A 4JCMA 5A6SA 3ZJ6A 5D32A 4XZIA 2W4XA 4QDPA 4OKDA 2QJHA 3T8LA 2Y2WA 1DP0A 1EIXA 1XW8A 5DX7A 4XKYB 1WOBA 3AYTA 2WNZA 1IT7A 2PS2A 3UU0A 3EA2A 1VEPA 4N2YA 3UPWA 2PPGA 4DAIA 2V5BA 3NM3A 3GH4A 5BOOA 4PCTA 4KWVA 1J0JA 4UQEA 2D23A 3OG2A 4ZSTA 1PZ0A 2Z2AA 4YTQA 2GQ9A 3IGUA 1TTJA 3IK4A 1S1RA 1MZHA 1RLDA 3C0JA 5HMDA 4N9EA 2BHUA 1H1YA 1TSIA 4LS2A 4E3TA 1T8XA 4Z0SA 2ZFAA 2RHGA 5G2WA 2QIIA 4ECLA 2VKZG 1N55A 2DUXA 1EOKA 2NQJA 2Y62A 2ZUTA 1H7RA 2R1NA 3TYUA 3ZLGA 4TO8A 1JRBA 3WJXA 3DYOA 4WVXA 2WVUA 4PUKA 4BWLC 4L9YA 5DBTA 4AIBA 1F8MA 3AXHA 4INFA 1FOBA 4GVHA 3GFYA 3TJXA 3BCFA 4BFAA 5IFPA 4UR7A 1IWAA 4GD0A 1DKWA 4XVDA 4O1AA 4WSHA 3EPMA 1U22A 1YTDA 1AG1O 3DESA 4K1WA 1DTNA 3OYZA 4Y9AA 5BMWA 1LRNA 3LERA 5A8NA 5FD0A 1UD8A 4JZ5A 3W7HA 2E3ZA 4OHQA 3VMPA 5F2MA 5LIUX 1AQ0A 4HNUA 1GVRA 5AY7A 1K7EA 6TIMA 3AHZA 2HXUA 1K8YA 2VFIA 2G8ZA 4X22A 3VIMA 2VDGA 2YFOA 3V75A 5BMXA 4KQNA 5CC6A 4E2DA 1HZYA 1M03A 3V5CA 5H8UA 1TIWA 4UFHA 3NVTA 3CAVA 1CBGA 2V69A 4H8NA 4CCZA 2Z1WA 3GNDA 1PJ9A 4MWAD 4YL2A 3WLLA 3ARQA 3MKCA 3TNBA 3GYCA 3TWBA 4XZBA 3KBWA 1ELSA 5HQMA 2ZTJA 2OODA 2P50A 3PTDA 2QPSA 1RJQA 3P2VA 4IG2A 2YL5A 1BF2A 1R6WA 1EYEA 5C2GA 3AIUA 1CXHA 1W9PA 2PWDA 1GQNA 4HK6A 1GKQA 3W83A 2Q02A 4W9TA 1RXOB 2VRQA 2POTA 2GK1B 4ZTYA 4IGNA 1BHGA 2OZTA 1UR2A 2HPMA 3M46A 1GVSA 1BEUA 3TX9A 2PRLA 3WQ6A 1WDQA 4RW5A 4P2VA 4QP0A 4KEVA 1E73M 4W8AA 3G1VA 2G3MA 4C6CA 2FH8A 3PR2A 4DM1A 4ZEPA 4FXSA 3ZVIA 2GGEA 5AKQA 3H55A 1RK5A 2F38A 3LSBA 2PLCA 2PU0A 5C7VA 3EOOA 3T55A 2GLKA 4PL2A 3B0VC 2ICSA 4AZ6A 2R24A 2J24A 5F1VA 3IIVA 3OZMA 4NG3A 1VBHA 3T05A 1QPNA 2YDQA 2J62A 2IKJA 3W85A 3H2CA 3LZ3A 3WK1A 2CWNA 1G1YA 3H2AA 3QTGA 5EMKA 4JGDA 1GVIA 5KZDA 5C9RA 2GJNA 2PGWA 3NQCA 4UXDA 2NLIA 1K7FA 3UESA 3IACA 1E40A 1KCKA 3GVWA 3CIVA 2X0SA 3TMLA 1EGZA 3ALGA 4IMAA 3GB6A 3V1HA 3EWWA 4MDPA 3QLLA 3BZGA 3HPAA 3E3HA 1XRTA 1ZUAX 3N14A 1VPXA 2C19A 4M29A 4WRHA 2XGBA 3HJEA 2DQXA 1ONWA 3TA6A 1MO0A 4NRRA 1LZOA 1E1FA 1MMFA 3UWZA 4QDMA 3OP2A 2QNEA 3BLIA 4L1XA 1RJRA 5LHEA 3CQ0A 4L1WA 4RDWA 4V33A 4IQDA 1IEWA 3BGAA 1LWHA 3BGJA 4MFEA 4PEEA 1QT1A 2VL4A 2FH6A 2ISVA 5F4SA 4L4LA 5EMUA 3OZOA 3M44A 1AW5A 3H7UA 2FMOA 3LI1A 4L65A 1VYSX 3ITXA 3TA9A 4AVFA 1KKOA 1H61A 3GTXA 2EPHA 1US0A 3MJMA 3UXDA 1QBAA 2DVXA 3N19B 2QLYA 2J7FA 1VKFA 3WLNA 2ISDA 2DZVA 1OYBA 4RE3A 1W9VA 3BH4A 1YE6A 3RO6A 2OYKA 2HSAA 2GJLA 1TJ0A 4AF0A 3UBPC 4GYFA 2D1ZA 2ZC1A 1AQHA 1R9XA 3SCWA 3M0MA 3NFUA 1PB0A 3CO4A 1NJJA 1RCQA 1D3HA 3GM8A 4QLLA 4GNKB 2G37A 4NAFA 2OLAA 3SJ3A 1Q6FA 3I7SA 5I07A 4LGXA 1U1HA 2OJPA 4JAWA 3A5FA 1H0IA 3DFOA 3N29A 2QUUA 3PFRA 1GVEA 3VCNA 2WKLA 1V0MA 3AJ7A 1RCOB 4JQAA 3P5ZA 1E71M 4JTIA 4ZGYA 1GHSA 2OT0A 3I6RA 3VE7A 3H53A 2ZBTA 3PWGA 2BMBA 1E6SM 4DXXA 3OG3A 3P82A 4Y90A 5K9DA 3M9YA 2WC4A 4QEHA 3T2OA 1BXNA 3OVRA 4GYPC 4HPJA 1G94A 3N73A 3BZJA 2B4GA 3S9ZA 3VINA 3C0SA 4GC4A 4JTTA 3W7MA 3XISA 2INZA 4NZFA 5I78A 4PGLA 1IEIA 4A3HA 1MVYA 5KEZA 2XWDA 3M64A 3RUBL 2NLYA 5D2YA 4QITA 4S23A 4IFOA 4O15A 2QIWA 3NXLA 1WKYA 4OT7A 1E0XA 3FA5A 3NQ7A 1FHDA 1LWJA 3T08A 3IWPA 3D46A 1PWMA 3HB9A 3VA8A 4NJKA 1R87A 1F76A 1ZBWA 2PDYA 2R6OA 4DJFC 4HNLA 1DTUA 2FGZA 2PWVA 4PRWA 4ZBCA 4RDZA 5H8PA 3TJLA 4EE9A 2DSUA 1F6PA 2W63A 2QXWA 1GK8A 1TREA 4IZGA 3MPGA 3NQBA 2A3LA 1RHCA 3BPWA 1W5NA 5F7UA 2GQAA 3W7NA 3EXRA 2ZX6A 5D05A 3DYPA 1VAHA 5JH2A 1JYNA 1S2CA 4AISA 1QPRA 4M6UA 3NWRA 2WMHA 4L1GA 3S6DA 4Q7BA 1OFOA 3C52A 3UWQA 5C55A 4E4PA 3KUMA 1EA0A 1VP5A 3BC9A 1FH7A 4B4HA 3N2OA 1ALDA 1PL9A 3NL2A 4JL2A 4WUIA 3LV5A 3LG3A 3PS7A 3V35A 2FKPA 5ABEA 4LAMA 4DJED 1XWYA 3E49A 3PZNA 3NDYA 3RR1A 3S2LA 4C6OA 2P8CA 1ZFJA 3APGA 3ITYA 5DMNA 3CV2A 2BVDA 1UC5A 1JJKA 1W5QA 3A4XA 3QY7A 4AWUA 3IARA 4E8CA 1EP2A 4UMAA 3KDNA 1W3IA 1W2PA 4KERA 3U57A 2Y7GA 3LDVA 1XDMA 3SCNA 8RUCA 1CGUA 5EB8A 3UYCA 2QGYA 2YBUA 3CQIA 4DNMA 2VRJA 3TZFA 5D30A 4ZMGA 1TPWA 3QOMA 1YYAA 5D2TA 1M7XA 4FMVA 4P7OA 3LSCA 4EF8A 1ZS2A 1FX6A 4WKFA 9XIMA 1AW2A 1FA2A 2V2CA 5BZAA 4C6QA 3QEZA 3GXNA 2VUNA 5EMMA 4LV9A 1BQGA 3E2QA 3PBUA 3RU8X 3N3MA 5A2AA 3O1NA 1EH9A 1W6TA 1R9ZA 1QOPA 3VNZA 2VEFA 3RF9A 3UGVA 5HMSA 1NAL1 3NM1A 3SSJA 3KL0A 3N6QA 1BTCA 1D7KA 2VQUA 2QUVA 1CXKA 1PKYA 1OIFA 4GVFA 3W1XA 3EOLA 2P5NA 5IBXC 2WV8A 1XL9A 4NZ4A 3O0FA 3GNOA 3KVKA 3TN5A 3M0IA 3WF2A 2QDGA 2WK2A 5DELA 4OQVA 2BOGX 2I14A 5AN7A 3ARUA 5D09A 4MADA 1SZEA 4CU7A 1HJVA 1Q3NA 1JDDA 3UG5A 3G2GA 4GUGA 3UZWA 1BWLA 3ITVA 1AQFA 2YLAA 1Q6LA 2EG6A 3ZZ1A 2GK1A 4D6IA 1ME9A 1J0ZA 4FS9A 2NUYA 5A95A 3U3HA 2VURA 3SGUA 1Z69A 3V5OA 5A8QA 3MSGA 4BKNA 4LOCA 3LHUA 1GQIA 1TRDA 1UR1A 3ALFA 3BDKA 3THCA 3BMWA 1BGAA 3DGRA 3QMTA 1POJA 4HHPA 4MM1A 3WMLA 2WJEA 3CEUA 3WDPP 4M51A 3W7RA 4EXBA 3NSMA 4REQA 1UKPA 5AHEA 3ELFA 1GUVA 5A94A 1F6YA 1U30A 3FJ4A 1ISXA 3KS6A 5HBFA 1XIEA 1G4EA 2GWNA 3A24A 3LMZA 3M5VA 4Q7NA 3STEA 3IEBA 1E1CB 2W27A 4R9OA 4UCFA 2GJXA 2J74A 7ODCA 4JKKA 2VEPA 5D37A 1GW9A 3L68A 4XD5A 4G2DA 3CB3A 4LANA 3UPMA 4G8TA 1KA9F 2QCCA 1OCNA 1KXQA 5JUVA 4KFOA 5I3DA 3E5BA 2VEGA 2GFTA 1OIMA 2HCVA 2E4TA 2OWWA 3KL5A 4D8LA 4J7RA 2YA0A 4A8LA 2J88A 1ONRA 4KH2A 1QATA 2E6DA 4UUIA 4A3QA 1P4CA 4XKYA 5C5YA 1EYWA 4GQBA 3C5QA 4XTDA 4HA0A 1VBRA 2IKHA 4ILSA 3C8FA 5D2WA 5D9OA 2VZSA 4DIAA 4LS0A 1H49A 1ESWA 3RMEA 3WF4A 1HX0A 2E1DA 3HQ1A 1UQYA 1MUMA 3U9IA 1W9UA 3CL7A 1UBPC 4DLFA 4LRTA 4IQLA 1WDPA 4O0ZA 3O05A 3QQ0A 4UNKA 5A6MA 3TR2A 4ENLA 3GDMA 4WOZA 1T99A 2VO5A 3KZSA 4U31A 3TC6A 4H9ZA 1UUMA 3O16A 5LGZA 4BQ4A 3PC0A 2OQLA 4JY9A 1EWEA 3NZGA 1K4GA 3EDKA 4NQ1A 3H22A 3EEZA 5M1TA 4YYFA 1UYQA 2Y1HA 1M7PA 3FAXA 1A4MA 1WXZA 4ZXLA 3AXKA 3RDKA 1IV8A 2Z29A 4R9XA 1Y65A 4YJ5A 5IOBA 4US6A 3VC6A 4QQ3A 3CASA 1KTBA 3VM7A 1EBGA 1TV4A 3ARPA 4I90A 2ISSA 2RJHA 3WNLA 4F0KA 4U3AA 2Z1SA 2BG5A 1IGSA 2VR2A 1E72M 1LLWA 3WLJA 3P7YA 1AL8A 3UR8A 2OQHA 3PPHA 3FDGA 4ATLA 2IPJA 4B5UA 3OTRA 4UR8A 1PZ1A 5FJPA 4BCEA 4FB7A 2NVAA 2ZOXA 3F1QA 2PB1A 3H4XA 4QS5A 3WNNA 3WIJA 1SR9A 1VF8A 3GG1A 4AF0B 4QLKA 1KQYA 3SAZA 1Q65A 4RNHA 4L80A 4MGGA 5CZSA 2PDNA 2A7PA 2OMAA 3KS5A 1BG9A 1EXBA 3A4JA 1LLOA 1CENA 3IUHA 3MT1A 4KCWA 4LUSB 3UG8A 3TSBA 1A5UA 3EXTA 1AODA 2VNCA 3CS2A 1LUCA 3AHYA 1ODUA 3MMUA 2BBFA 2HK1A 3APTA 3GXIA 2OELA 4XWUA 4JS3A 3RJYA 1XX1A 2OTDA 4ZCWA 3PM6A 3TTEA 4LAZA 2PWGA 1UUQA 1TWWA 1B57A 2I1OA 1K7XA 3W7JA 3LZ5A 1OFEA 3VM5A 3LU2A 3ZIZA 3H26A 2C13A 1XLJA 2Q3RA 4F0SA 1W3JA 2BXVA 3RRXA 4ACZB 2Q6ZA 3EX6A 2JF7A 2XIMA 3ZM8A 4R27A 1RBOB 1B9BA 4K8GA 4ADUA 1DORA 1UG6A 1W2VA 4TXEA 5C70A 2OCZA 3N34A 2D3LA 4JTFA 1R9YA 2OO6A 4FF7A 4GYJA 4YLWA 1OD0A 2ONEA 4Z42C 2VDIA 3DBNA 1PX3A 3WMBA 2VEKA 3QGKC 4RJEA 2NT0A 1V6YA 2WZIA 3QV7A 3OBKA 1LL4A 3B8VA 3SQSA 3SJNA 2R8WA 1Q6RA 2QCHA 4IPIA 4PB3A 4WX2A 3F4NA 3MVIA 2O0TA 4TVDA 1UP3A 4IJCA 1Q7MA 1WX0A 3PWIA 4GFSA 4HOZA 3QGVA 1K9TA 3MUCA 4F3HA 1Q6OA 4EAYA 1VFOA 4DX3A 5RUBA 3L0NA 5K4ZA 3NEHA 3E0VA 2QAPA 1XLKA 3CM4A 1SMDA 2NXGA 3SCRA 3NL3A 3O6YX 2G50A 3S5YA 1J01A 3FJLA 3CZEA 4S2CA 1FWEC 1W17A 5IHRA 5F2LA 3VX0A 4NZ3A 4FOKA 1FWFC 3MHFA 4N4QA 1HTIA 3CWHA 3CYVA 1PX8A 3G6MA 1RP9A 3FJ6A 2WW5A 1DHKA 2PWEA 2PLMA 1OG0A 1G4SA 4F66A 4GO8A 4JQ1A 1F8IA 3ATYA 1LROA 2V2DA 4JTRA 3VOGA 4YVVA 3FKKA 3W7GA 1YBQA 3AC0A 4S2BA 1RQHA 3SY5A 4PULA 5CPNA 1HF6A 5DCDA 1VFUA 1XLMA 2YW3A 3I3BA 3BOLA 4B3LA 5AC7A 3NPVA 3RGTA 3M5YA 2VVNA 2W79A 3B04A 2P1FA 4GKTA 1OC7A 5CZ0A 3WF0A 3MO7A 3ARTA 3GZAA 2H9AB 2WLZA 1E4MM 2FHCA 4B2DA 2WKGA 4NAEA 3AYSA 2GGHA 2V63A 2OWXA 2ZZ7A 3S0CA 3UZJA 4I7WA 3TE9A 2Z6JA 3ZSTA 4RNIA 2I5IA 4JY8A 4TV5A 3C0QA 5IRPA 4R7WA 4LAUA 3GIQA 4HBKA 3HZ3A 3CUJA 1JGMA 4Q4MA 1KB3A 4M6PA 3EA1A 3PF3A 2FZMA 5LYRA 4BQ2A 3HPZA 1JD9A 1LL6A 2F8QA 2WNQA 3T0BA 1FRBA 4Z1BA 3WLKX 1O95A 1PS9A 3PTMA 2A3BA 1L6SA 3RPTA 2DZXA 1EC9A 4EX4A 4QTGA 1I2NA 1Q8AA 3A9BA 2YL9A 3KRUA 3MV11 4O0KA 3UD6A 1SO6A 4GH1A 3TONA 4QLJA 1FWTA 2ASHA 4NZCA 1LL7A 2A79A 3R13A 7A3HA 3GIYA 4DY1A 3IIXA 3P61A 3H4WA 1B3OA 3BAJA 3PJXA 4M3PA 4RW3A 4E38A 5EGRA 3I10A 4YTSA 1BLIA 4FIRA 2WAGA 2UY3A 5CAHA 3L4UA 4O11A 5TNVA 3IGSA 1NQ6A 2AL2B 3DCPA 1AFSA 1PVNA 2EAWA 3N25A 1TV5A 2CCRA 4R5EA 3E38A 4W5UA 1GTHA 1D8CA 3RLUA 5A2CA 2R9RA 3I65A 3R4IA 4PMVA 4PRRA 4WXZA 3ZJKA 4A3UA 3NO1A 3LTYA 3PTQA 4ORIA 2O9TA 4I9MA 3RXZA 1X6NA 3EB4A 3PBVA 4AG0A 5GNYA 1S5MA 3IAQA 2B7QA 1BYDA 2JKPA 1C7TA 3CWOX 1KBJA 3DYMA 1AUSL 2PBGA 1BXBA 3G1YA 2X1UA 2RFGA 3VGFA 1K8XA 2V3FA 1C90A 5EMYA 2E8YA 3NTYA 1PKMA 3TAOA 2ABBA 2XH2A 1EL3A 5TD4A 2G41A 2YFNA 4KESA 4LAOA 2EPMX 3N2MA 2WSPA 3NEVA 4E2VA 3CYJA 1TWZA 2X16A 3OU8A 3R0UA 3CZKA 4HNTA 3VKJA 3K8KA 2PDFA 4FR6A 4C1NA 1JAKA 2V38A 4Z2HA 2VYOA 3STFA 2ZVRA 5D8ZA 1ZJBA 4L4PA 4Y8FA 2XDFA 2XTKA 3HG3A 1E5NA 3VGHA 3LCXA 3KE0A 3BOXA 1NDZA 1JPDX 4RDVA 4GQGA 1K70A 2CERA 3FY1A 3QOKA 4I8DA 2GDQA 1KFJA 1V4YA 4LUTB 4RX0A 3LPOA 1SFJA 4LFYA 2PURA 2YB1A 1UR8A 4O57A 5LA2A 5A6AA 4A2SA 4B5WA 3ME3A 4Y9OA 2DW7A 4CQAA 4JIHA 2F61A 5REQA 3QVQA 4NI8A 1X7FA 1TELA 2WHJA 1GOKA 2CNCA 2Y8KA 3UWVA 2XVNA 1VJIA 1FVPA 1H11A 5AC5A 3GKAA 4NYYA 3JRKA 3CB8A 3GQYA 3EWZA 4DBDA 3DFQA 1KRCC 5HATA 1GVOA 4Y2WA 3T44A 2AKMA 5HXMA 3KDOA 2ISFA 5ABGA 3HIJA 3C56A 1G0CA 4FI4A 3GR7A 2ZE3A 3ONCA 3IJ7A 3TYBA 3HOJA 2HS6A 2UZ9A 3L4ZA 3UA3A 1H50A 2HK0A 3DBPA 3PB0A 4IPPA 3MKVA 4H8VA 3CLMA 3G77A 3HGRA 3WK3A 4O1CA 3T0CA 1ZP4A 3CUHA 1V0NA 3MP3A 2J8GA 3Q37A 4L5ZA 1RY8A 3P67A 1RBAA 1VYPX 3CBWA 2IXVA 3MMTA 4M82A 3P62A 2Z7KA 1IZKA 4XVEA 1MSSA 2RGLA 1WKEA 2ZRYA 4GO9A 3T9PA 3O06A 3UR7A 3ABQA 2PDWA 4LVFA 4UFKA 1O5KA 3AMGA 1JPHA 2J7BA 2VT0A 3GIPA 4E8DA 4M1RA 5DY3A 4LB3A 5EBUA 1WA3A 1M9HA 4NILA 2IUZA 2XJ7A 1VD6A 4JTKA 4XG1A 3W7PA 4K2SA 3RR4A 4F2UA 3R1ZA 2REQB 1DJHA 2AGKA 4MKNA 1DQUA 5LKYA 4Y96A 1G4TA 3IANA 3OO2A 1OJXA 4BWLA 3W6LA 3IJIA 3A3XA 4PODA 1QNPA 1VCGA 4EACA 3C2YA 3HGSA 1V8EA 2CW6A 3INPA 4OVXA 3A21A 3GD6A 2TAAA 2YZ5A 5EYWA 1XHGA 5C6MA 1UR4A 4Y7EA 2YIHA 3L5LA 3TLLA 1JZ6A 4NJHA 1FBAA 3UW6A 4TTUA 1K9DA 5AYYA 2YJQA 4MDOA 5A8GA 1RJPA 1NEYA 2D2JA 3VDCA 3SUSA 3U2ZA 1X7IA 5DY2A 1U1UA 2OVLA 3TYCA 3MUIA 3ANUA 1Q6EA 4GWEA 3TTQA 2V82A 1PV8A 3C2RA 3U0HA 3C86A 4AIEA 2C79A 1TPDA 1TX2A 3TC7A 2J4GA 3W2JA 1OFBA 2CZ5A 4HTYA 3G0UA 1Z48A 3EBVA 1WDSA 1RALA 2VGFA 1C92A 3M0YA 4DYJA 3UPBA 3KEHA