3RLVA

Crystal structure of the mutant y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
220
structure length
220
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 86
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rlvA00
2A0NA 1TQXA 3CWOX 4O54A 3DU0A 2J9XA 4BI5A 2PE4A 1GT8A 3QYQA 4QM1A 3N9RA 1LZOA 4YMZA 3G8RA 4UTHA 4M7SA 5KZMA 3PWAA 4JNMA 2I1OA 3U6WA 1F73A 4UTKA 1ALDA 2E68A 2B7PA 2CLKA 4ZQMA 3BVJA 4IMFA 4RV8A 2V82A 4KFPA 1FCQA 4S1FA 4AWTA 3ZWSA 2I9EA 1RVGA 3NL2A 1ZENA 2BWGA 5G4WA 3DFPA 2VOMA 3SGUA 5HR7A 3ZR4A 2QEZA 4DELA 1B4KA 3L66A 2FIQA 3W86A 3DFQA 5FEXA 2JGYA 1SZFA 5LGXA 2NXHA 4KWWA 3BW4A 1R2RA 1M7PA 3IIOA 4GC4A 4JN6A 1QWGA 1G4TA 5D38A 3N2MA 4A2SA 1OX4A 3EWXA 4ZL1A 3LBCA 1PIIA 5I3GA 1O95A 1XUZA 1WXJA 1O94A 3TJLA 3MI6A 1X6UA 3EXRA 1C29A 3LCHA 3GAYA 4ZZ9A 1I2QA 4E0CA 3TW7A 1PHWA 1QPNA 2DZTA 3RFAA 3TIMA 3QZEA 4TR9A 1XFBA 3RU6A 3SZ8A 3NZ1A 4M7TA 2WNZA 1T0OA 2C15A 2ZA3A 4HHPA 1HUVA 1VQTA 4FXSA 2GPTA 1F7BA 3KXQA 3DFSA 3LHYA 1JCYA 3FLUA 4GBUA 1ZFJA 4KWVA 3TH6A 6ALDA 1YTKA 4UFLA 1MEHA 2FPVA 3HPXA 2VFIA 3W7KA 4I7WA 4OQVA 5HWMA 4HNNA 3S5YA 5F4XA 2LLEA 2Y70A 2BXVA 1H50A 4A2RA 5I3JA 1H7XA 3CQ0A 3BO9A 3W2JA 3MBFA 4HPJA 5FF4A 5AC7A 2R91A 3RK8A 5ABTA 5LNVA 2E5BA 1DJQA 2AQWA 4ADTA 2OX1A 5FF3A 4O1CA 2EAWA 1J2WA 3CEPA 2VFGA 4RLIA 1Q6QA 3LGEA 1OG0A 3CU2A 3CWNA 3TSMA 3W1MA 2Q8ZA 1J5TA 1UBSA 3QH2A 3SIZA 2QAPA 3NQAA 5LSMA 1I4NA 2H90A 2H6RA 4FNRA 4XBKA 3TW6A 4WY0F 3PBVA 3C2EA 4IX0A 4OU1A 4IQLA 2KZHA 5G1TA 3VKJA 1VLWA 4MOZA 2ALDA 1M5WA 3HPZA 4TMBA 3HGSA 2YZRA 4D2JA 2I14A 1RQEA 4AVFA 2GUUA 1ZCOA 4GRSA 3OEXA 5LNUA 3EWZA 5LNWA 3S9YA 3GK0A 1A5AA 1PCKA 3P74A 2QUVA 1XUUA 1XDLA 2ZZ1A 3KVKA 5C2XA 1QNVA 2A6LA 2GVJA 4O15A 5H2ZA 4AF0B 3G1AA 5AHEA 4UFJA 4NJGA 1A5BA 5CPOA 3RLVA 4UMAA 3NG3A 2ZFAA 3QSTA 4Z1CA 1UB3A 5FF2A 4G1KA 1YXYA 2OMAA 3W74A 4N9CA 5E93A 3UY8A 4CNPA 3DXIA 5EA9A 1G6CA 2V2DA 1HO1A 3JS3A 2ZQ0A 3N2XA 4UTIA 3W07A 1Y0EA 2C3ZA 2E09A 3UPWA 3W71A 1TJRA 3A24A 3M5XA 1R2SA 2E5DA 3M16A 1QAPA 2G5WA 5BMXA 3NPXA 1JCLA 1K7EA 4MVAA 1M6JA 4TX9A 4UFHA 3TQVA 1CI1A 3S1WA 4O52A 1VCVA 4GNJA 3B0PA 1LRNA 3C0JA 3T78A 4LU0A 4O11A 2OT1A 1SO6A 3G1XA 3HGJA 5G5IA 4UIOA 4PODA 4UUIA 3S1XA 3LXBA 4BWLC 5HWNA 2QUTA 3G1HA 4M6PA 2JKEA 4OV4A 1GEQA 3R8RA 4U4MA 4MKNA 1KM4A 1G7VA 3MW7A 1S5WA 1KFBA 1QOPA 4NJKA 3PC0A 3W7RA 4FX8A 2YXGA 3W1UA 3DAQA 3HGRA 3HQ1A 3LV5A 2B7NA 1TV8A 4NJJA 3LLDA 3PUEA 4UTTA 1LOSA 1JCJA 3MYOA 1W8SA 1FWTA 5AYZA 2F7FA 3M0ZA 2C16A 3CC1A 1Z41A 3NQ8A 3GXNA 1XKYA 4JY9A 4O12A 1YADA 1X1OA 3W88A 3W75A 1OK6A 3IIZA 1TPWA 3KX6A 1KTBA 3SI9A 4J9JA 3W7EA 1H5YA 2F84A 4E38A 1L2UA 4JYEA 3B8DA 3C2VA 4NJIA 3BLFA 4XUGA 4GE8A 4FNUA 1ZNNA 3ZFHA 2WSRA 1KFJA 4ZQCA 4CQ9A 1BWKA 4UC5A 2CLFA 2J27A 5K4XA 3QMRA 1R46A 3W1TA 2QCFA 1KA9F 2ZZ6A 4B5NA 3C52A 3CIXA 1R30A 1VS1A 2RDWA 4Y90A 1LLZA 4LS0A 3CTLA 1SW3A 3ZWTA 1WBHA 3GB6A 4CQ8A 4YWIA 2QCDB 4UFKA 1UJPA 4IOTA 4ALDA 5DY3A 3QQ0A 1EP1A 1G4SA 3LLFA 4LVDA 4LNYA 1TIMA 4JIQA 1WOBA 1EX5A 4ZVJA 2YFOA 2CLIA 3NQFA 3C4UA 2PC4A 2V0TA 4AF0A 3GDLA 2NUYA 3W73A 3QQ1A 4JTIA 4O0ZA 1KV8A 5CSSA 2ATMA 3FA5A 1JQXA 4JY8A 1VHCA 1FCBA 1Z44A 2X30A 4YCOA 4S2BA 5IM51 1IXOA 3UNDA 3U2OA 3VI2A 1L6YA 2VFDA 3G3DA 1KFEA 1S3HA 5A8GA 2Z6JA 3S5ZA 1P1XA 2PRMA 3THAA 3W7JA 4ZQOA 3QC3A 2DORA 5BW6A 2ZZ2A 3N19B 4KKXA 1OABA 4K38A 3OG3A 3W7GA 3A23A 3F03K 1J4EA 1ADOA 3PUDA 3NO5A 2QJIA 4N4QA 5F2MA 4LVGA 3MP4A 1GYLA 3FJ6A 3UZ5A 2DZSA 1OYCA 3PVFA 1B3OA 1GOXA 2WNNA 3EX2A 5AYXA 1P0NA 2RDTA 4WOZA 1C9DA 3HO8A 3VCRA 1GVRA 2ZYFA 4ZQNA 1I8JA 3TAKA 2ZDRA 2NX3A 3LI0A 3L5MA 1QCWA 3QMSA 3M47A 1YTDA 5U7SA 4GUHA 1WBJA 5AC8A 5AN7A 1SU5A 4JEQA 4XQ6A 3W1QA 1IIHA 2ATSA 3C2OA 4EF9A 2RH9A 1XDMA 3L68A 3N3MA 3OVQA 2QCEA 2Y85A 5D05A 1KLZA 1WDWA 5DCDA 5FF7A 4EF8A 3OIXA 4UFMA 1P0KA 3C6CA 4HNVA 4XKYB 1BTMA 4UTLA 1L6WA 3U8GA 4JX5A 5D2TA 4IJBA 1F6PA 3PSWA 4CNOA 2ABAA 4K37A 1DKWA 1A53A 1CX9A 3P67A 1H51A 3N9SA 1FCUA 1WOAA 4GUGA 3FEMA 4QQ3A 3TU9A 4PL1A 4IXHA 1TPC1 3G22A 1B57A 3F4NA 5D33A 5EPDA 2QCDA 2VEKA 3M6YA 1YDOA 4JICA 1H61A 1D9EA 1IXPA 1QPOA 5IBXC 1FWNA 2JKAA 4AHQA 2C0AA 3G3MA 3LTPA 4Z1BA 3NPWA 1W5QA 1H62A 3NQEA 5HUOA 5DN1A 4L4LA 4O1BA 1GTHA 2EGZA 3NGJA 3W84A 4S2CA 1GVFA 1NF0A 1DOSA 3A22A 3BG5A 4NU7A 1ICSA 5G2IA 1K8ZA 3P62A 4O0KA 5KSWA 1YLVA 3UY7A 5HJLA 1DVJA 2Z1BA 4AAJA 4JDBA 4DO6A 3BW2A 3R13A 3WK3A 4LY8A 2C1HA 1SFLA 2NXIA 4NT0A 1O4UA 1KTNA 1SZGA 1H7NA 5BNKA 3ELFA 2ISSA 3P8JA 5GVJA 2VFEA 1JRBA 3UWUA 2Q3RA 1GG1A 1ZAHA 3NA8A 5CG7A 4TO8A 1SFJA 1OFOA 3TDFA 5LNSA 4PL2A 4O16A 5AC6A 3G0SA 3LXCA 4BFAA 4EOUA 4IMGA 1OYAA 3W7MA 1H7WA 2YR1A 3ATZA 2NV2A 4UR7A 3BLEA 3STGA 3ZS4A 4POCA 4PEKA 3IVTA 1KV5A 2P1FA 2QDGA 3H55A 2ZRYA 3LHUA 4M6QA 3TQ0A 3O6DA 3O05A 4QNWA 1RZMA 1OFDA 3W87A 3C61A 1VH7A 2O7SA 5F1UA 3OHIA 3TXZA 5F2IA 3P7YA 3DH7A 3QFEA 1EEPA 3ABSA 2QAFA 2ZRVA 4RZ6A 3G1DA 3OA3A 4JYFA 1L6SA 1VYRA 3SR7A 4XKYA 3MI2A 3JR2A 4RKAA 4RZ5A 3DZ1A 4WXZA 2Y89A 2GQ9A 1DBTA 1TPB1 4MJMA 3GR8A 1QOQA 2V5LA 3HPSA 5AFDA 3PG8A 5TQLA 3F1QA 1Q6LA 1VJIA 2GVGA 1TTPA 1PS9A 3UPBA 1AL8A 3L0NA 3E0IA 3EX6A 2E6YA 1JR1A 2DZVA 1V5XA 3BARA 3INPA 3TSDA 4N2YA 1GPWA 4JTSA 2EKCA 4FNQA 2HSAA 2V81A 4H4IA 3ABQA 5FEPA 1MZHA 4LRSA 1THFD 1JRCA 2V2HA 1ZAIA 3ABOA 4NZFA 1ML1A 2H8XA 1EP2A 1TTIA 2QCNA 5AB3A 4UTMA 1T99A 2J6XA 3S5NA 1TCDA 5D2YA 4FXRA 1WA3A 4E2DA 3C3NA 2ZRXA 3TMLA 1LOLA 5SWUA 4O28A 4FX6M 3M5VA 4WZHA 5F2LA 2XN0A 3BPWA 5G2HA 2YYUA 1NEYA 1YPFA 1X7FA 4UXDA 3WJXA 3W6YA 3UWWA 3UWZA 2YSWA 1F05A 4BWLA 1VGAA 3B4UA 3CEUA 3W7DA 3DI0A 4BI7A 1TJPA 4A21A 3S0CA 2FDSA 2NWRA 4WOQA 1SO3A 3UWQA 3VNDA 4E2BA 4DO4A 2QDHA 1K02A 1GZGA 1TYGA 2VELA 3G0XA 3NYZA 5T26A 2V5BA 2CLHA 5DBTA 1AMKA 2YPIA 1HL2A 3EWUA 2YX0A 4JTJA 4ADSA 1I2RA 1TPUA 5G1YA 3YPIA 1O5KA 4JX6A 1I2NA 3TUUA 3NAVA 3GDMA 1I45A 1B4EA 4X2RA 5HR6A 5D30A 1I2OA 1GVQA 2OT0A 3NQVA 3G18A 1QO2A 3EX4A 4UTWA 1GWJA 3N73A 2PRLA 1JUEA 1Q6OA 3PUOA 3EWBX 5HQEA 2DZUA 5H91A 4Y8FA 3TNOA 2VC6A 4JX4A 3QPZA 5K9DA 4M19A 4NNCA 2GJLA 3P81A 1UCWA 3C8FA 3L5AA 5CZSA 3TXVA 3IVSA 4JD4A 1TMHA 1YYAA 4YL2A 3QMTA 2TPSA 2YCEA 4RCXA 4U28A 4N02A 3STFA 4JXCA 5LHEA 4PC8A 3O6YX 2V9DA 4MZ8A 1QMLA 3LERA 1G7UA 3M5ZA 3NQ2A 4R7JA 5CZTA 3I68A 3A9IA 2NV1A 4GFSA 3KFTA 3NL3A 2Q8LA 4WX2A 4K6AA 4IPJA 4XWUA 3TROA 3PAJA 1IF2A 1LLWA 4DF1A 3MJYA 4O10A 1ICQA 4O53A 1EA0A 1TV7A 4LV4A 1JUKA 1NFBA 3HG2A 3C2RA 4HPXA 3MHGA 5CPLA 4UTJA 1TV5A 1WX0A 5DCEA 3DHDA 5LZLA 1R2TA 3LCXA 5F4WA 3H53A 3FYOA 2J88A 4UCGA 2RKXA 2TSYA 4FEZA 5MHBA 4MYXA 7TIMA 3HG3A 1LCOA 3IRDA 4K7VA 4TU1A 1IIGA 1PHQA 4DXVA 1OX6A 5CZ0A 3DKJA 3S5OA 1XL9A 1LRTA 3WK0A 2QUUA 5E0KA 3B03A 4IWWA 1QDSA 4C1LA 2GOUA 3FFSA 3A21A 3WK2A 3A5VA 5AHIA 2VXNA 4M5PA 2VEMA 2CW6A 4NQ1A 3NDOA 3W7OA 3HBLA 3HIJA 2Z6IA 3EKLA 2IQTA 3FKRA 3W7LA 4XTDA 1MEIA 4NNBA 5C54A 3M41A 3W1AA 1SZNA 1V7YA 3LCWA 3LHWA 3NVTA 5BMWA 3ANYA 1FY6A 3PM6A 2WOQA 1H7PA 5DCBA 1RV8A 3STEA 4UMBA 3LV6A 1W3IA 1FXPA 3HGOA 4O4WA 1JQVA 4FX7A 4UTWC 3P8IA 5D32A 2NWSA 2AAMA 5F4SA 2G97A 3CPRA 1U5JA 3TV8A 1FBAA 4RXFA 1W1ZA 2CLEA 1OFQA 2PCQA 2ZZ5A 4Y6GA 4LVAA 3T44A 4Q33A 3TAOA 2A6NA 5K7JA 1VCFA 4H6KA 3LDVA 3O06A 4ONVA 1AG1O 4CCDA 4YXGA 3P61A 4IPIA 4LOCA 3T4CA 3GDRA 3TC6A 1SO5A 3B06A 2V2CA 1LROA 5CZJA 2J9ZA 3G24A 1LBFA 4GUIA 2YGYA 3UQNA 4CNNA 3W2NA 1KFCA 2X1SA 1ME7A 1DQWA 3P84A 1RPXA 2ISWA 3LTSA 5IBXA 3W1NA 4IUOA 2A4AA 3QM3A 1VZWA 3FKKA 3W7NA 3TFXA 8TIMA 4FIRA 4I7VA 3L9CA 3LBMA 2FFCA 2DZPA 1ZHAA 2FQIA 3ABRA 3RF9A 3P60A 3NQMA 1S5TA 3SJ3A 3PF3A 3W7PA 3TR2A 1OFAA 4NXSA 1L9WA 5KTLA 2NZLA 2E6FA 2Y7EA 1TB3A 2A21A 2BTMA 1UASA 4MY1A 4FNSA 5CSRA 4K36A 2V30A 3S1UA 3DHFA 1M7OA 1VLIA 4CCCA 2OZ0A 4Q4KA 1NF7A 2ZZ7A 4NNAA 3EX1A 5D04C 1Z48A 1ZAJA 4BF9A 4N6EA 5TIMA 3L67A 3QW4B 4WJEA 4HT3A 4GUFA 5HUPA 2QKFA 3FYPA 2Y62A 5HWJA 1TPEA 4RK8A 4O57A 3DI1A 4N6FA 4QISA 1TTJA 3G1SA 3HG4A 1K8XA 4JTUA 1LBMA 4FHAA 4HKPA 2G95A 3G1FA 2GQAA 4QITA 3L65A 2A7NA 3W85A 1OF6A 1K3UA 4XTIA 4BI6A 1WV2A 4JTLA 1AW1A 2CWNA 2J9YA 1FDJA 3LTYA 3GDKA 1PVNA 1W31A 2B0MA 1UUOA 1Z42A 3OVRA 3PULA 3P80A 2E77A 2Z2UA 2C14A 1VR6A 1VHNA 2QCCA 1RR2A 5CPNA 1Q45A 3NQGA 2R8WA 3E9AA 1BWLA 1E51A 1RQBA 4CLMA 4BK9A 4WUIA 1K7FA 4P2VA 1D3GA 1FQ0A 2ZRUA 3MO7A 4JTFA 1OFRA 5J5RA 3QSRA 4O14A 4Z0SA 3BG3A 2CLMA 1JCXA 1B9BA 3L2IA 4MPQA 1ME8A 3A5FA 5K9XA 4AHOA 2B7OA 3O16A 3W23A 1MSSA 4K39A 1YTEA 3G0UA 2Z0IA 3NM3A 3PG9A 2YFNA 3DFTA 2EF9A 3KVLA 1KBJA 4UR8A 2FB2A 3SGZA 5AOUA 3R2GA 1KM0A 1EUNA 3S42A 1PL9A 2DZWA 1N7KA 1FWRA 3F4WA 2O7QA 3STCA 4LWWA 1U83A 2QCLA 1FDZA 4DQWA 5D37A 4AH7A 3B0VC 4N9EA 3PS7A 3KVJA 3M1ZA 2WV8A 3DENA 1PE1A 3D0CA 3PB2A 3SSJA 5F1VA 3LHVA 3LRLA 4QNEA 3LHTA 4N9DA 3NR0A 3MWAA 4HNUA 3WFAA 5D02A 4A22A 3O1NA 1TTQA 1IXQA 3EWWA 2A5HA 3I7RA 4MFDA 2E6AA 3L0KA 4AHPA 4IMDA 1KBIA 4A3UA 1ONRA 1EPXA 3FJLA 4HIBA 3WJWA 4QJ1A 1XI3A 1O5XA 1IGSA 4O13A 4LW7A 3GKAA 2A2IA 3NL6A 4I9AA 4OGZA 2C19A 1SW0A 5FF0A 1TPVA 3AJXA 1MEWA 3HF3A 1VYPX 1IXNA 1KTCA 2W79A 3CLMA 3M7WA 5EY5A 2G96A 4JDYA 1W5MA 5FEWA 4DPQA 4FIQA 3W1XA 1KM2A 1XM3A 1W3NA 1TRDA 4WQ6A 4LC6A 2WJZA 2X16A 3QRHA 2D73A 4ZQRA 3MHUA 2FPTA 3KRUA 4LVFA 1I2PA 1VCGA 3M9YA 2QCMA 4WD0A 3UWVA 2CZFA 3PBUA 5LNRA 1F2JA 3O6CA 2A7RA 5HNRA 1RQHA 1FWWA 1HTIA 4NZJA 4NVTA 5HMSA 5AHFA 2W6RA 4GXMA 3Q94A 2H3DA 3PY2A 4X22A 5BOOA 3MUXA 4JTGA 1EWDA 3PR2A 1OX5A 5EL1A 1SSDA 4MY9A 3TSBA 4JGDA 3DKLA 2FLIA 3Q37A 4K8EA 2WKJA 3B04A 1DHPA 1F5ZA 4NX0A 5L9FA 4AB4A 3NPUA 2TRSA 1W3TA 3RLUA 5DLCA 4Y9AA 2X1UA 2BSLA 3QW3A 1GVSA 2NUXA 2R94A 2XN2A 4JS3A 3T40A 1KM5A 2BX7A 4WY0A 2HTMA 1JVNA 2ZA2A 2QJHA 1WQ5A 5AHLA 4EVZA 1LYXA 2YYTA 3CIWA 5CPMA 5BRBA 2DJLA 3E96A 3LB0A 5I3IA 3DBPA 3W1RA 2YW4A 3NXFA 3KVMA 4GUJA 1K8YA 4DF2A 4CQAA 2Y61A 3CHVA 3MP3A 3WJZA 3BG9A 2B4GA 1TPH1 2X1RA 4TIMA 1FUYA 4Z08A 1QO5A 3NNTA 1GYNA 4MZYA 2YW3A 1JULA 3LX9A 3LCGA 2NX9A 2PURA 1PV8A 1FWSA 2ZBTA 2JBMA 2VFFA 3NM1A 1TREA 4XBSA 3EX3A 2CLLA 1JCMP 3S1VA 4LVBA 3I7SA 1LRQA 3TA6A 1GG0A 1RD5A 3GX9A 4ADUA 1H63A 3BLIA 3W22A 3P5ZA 2RFGA 1Q6RA 1DL3A 5LHFA 4O19A 2C18A 4YCPA 3KRSA 4N9BA 1SUXA 3HJZA 2Y7FA 1AK5A 2H3BA 5TBOA 3BV4A 1LM1A 4RJEA 5C6MA 1KM3A 5DBUA 5D2WA 3W2LA 4MUZA 1XCFA 2WPBA 3IGSA 3SW6A 3O8AA 1ZY9A 1EP3A 1QPRA 2OCZA 3TE9A 2TMDA 3N14A 4IMCA 4MY8A 3LRMA 3C56A 1BKSA 3MHFA 1K7XA 1NAL1 3TQKA 2Y6ZA 2ZA1A 5G2WA 2Q3OA 1VC4A 1GQNA 4DBEA 2R14A 5K2ZA 3MBDA 1K03A 3AO0A 1G69A 3NQDA 1O60A 1F6KA 2YDAA 2Y88A 1HO4A 3E12A 3JRKA 4LUIA 5KITA 5HULA 4NX5A 3GXPA 1KLYA 2QJGA 3TC7A 2ZZ4A 5EYWA 2VEIA 4R34A 3M44A 3GAKA 4RZ4A 4LV9A 4IXXA 2OJPA 4MIMA 3E49A 2J24A 3NZRA 3O15A 1CW2A 5F2GA 3LOTA 1TRIA 2Y7GA 4IX2A 3E02A 1XC4A 3B05A 1XBVA 1W5NA 4AMAA 1WAUA 4O18A 4PH6A 1W54A 3DGRA 5D09A 5FESA 4UFIA 1GJPA 2VENA 2DZXA 1SQ7A 2FTPA 4ICNA 4NXKA 4EWND 4ML9A 3GIYA 1T8XA 2DU2A 4Z1DA 4JIPA 2RDUA 3SY5A 5EBUA 1DJNA 1KM1A 3Q2DA 2PRHA 4R53A 3W9ZA 5AHNA 4A29A 3BW3A 4JYDA 4Y96A 1DQXA 3Q58A 2H8ZA 4TMCA 4FNTA 1SZEA 3HB9A 4W9TA 3IEBA 4RXGA 5FI8A 4AEOA 2BZNA 3MI3A 3IGXA 1H1ZA 4BR1A 5LKYA 3O07A 3QEZA 1FXQA 5L6UA 1ME9A 2HS8A 2CLOA 2W0UA 3IGUA 3I65A 1A5CA 3EB2A 4JTTA 3TFCA 3G8EA 3PSVA 3P5YA 1P5BA 1SSGA 4O1DA 3M5YA 3TX9A 1LP6A 1KFLA 3EEGA 3K30A 3PB0A 1EWEA 1HG3A 1G4EA 4LS2A 4Q32A 5DXXA 4MZ1A 2GJNA 2EPHA 1W37A 4HN4A 5G4EA 4JTKA 1DV7A 3L5LA 2E1DA 5D2XA 3RMJA 2P0OA 3WK1A 3GXTA 4CCEA 3EXTA 4UNLA 4I7UA 3ATYA 2AGKA 4HSOA 4NJHA 5FEZA 1YPIA 1OK4A 3L21A 2NXGA 3NEVA 1S5VA 1XBYA 3H54A 3NQCA 4PTNA 3HG5A 1W5OA 1LOQA 1LDCA 2Y63A 3GR7A 5AYYA 1H7RA 4O4VA 3RNDA 3T55A 4NUWA 5CKSA 4XZ9A 4ZQPA 3HMJG 1FCVA 3W7IA 2DJXA 3PBWA 4O50A 1TO3A 4MLJA 4AWSA 4LUJA 2EHHA 1OF8A 2XFWA 4MJZA 3IIVA 3WJYA 5E1QA 4O1AA 1D3HA 4ORIA 5DELA 3UWYA 3G1VA 3W7CA 1VYSX 4LRTA 3W7HA 3R12A 3IV3A 3UZJA 1QPQA 3DFNA 2VKZG 4X3ZA 1H60A 1OFPA 1G4PA 3I6RA 3LM7A 5KINA 1W56A 3TJXA 3BGGA 3EXSA 3NQ6A 3KOFA 1N8FA 1TPFA 4DO5A 4O17A 1ZJIA 4OE7A 5D2VA 3W1PA 1LORA 1XBXA 2ZCGA 1KW1A 2JGQA 5LGZA 4JTEA 5K4ZA 4MFEA 2ISVA 1OHLA 3GDTA 3FS2A 2E6DA 3GYEA 2GVLA 4YLWA 5C5YA 3G1YA 2Y7DA 3BK0A 1GVOA 1G67A 4GJ1A 3MP5A 4UTUA 5C55A 3GNDA 1EIXA 4MYAA 3N34A 3TCEA 1XXXA 1SR9A 3IIPA 4QAIA 3OVPA 4X9SA 4JTHA 3LHZA 2E5CA 3UYCA 4DF0A 4PA8A 2WSYA 4K7YA 3QJAA 5I3KA 4OHQA 3FIGA 4EIVA 2ABBA 1YDNA 1QR7A 2WQPA 3LCIA 3GVGA 4OWGA 4UNKA 2FPYA 3L0GA 1A5SA 3TMQA 1JJKA 3NL5A 4R33A 3UXDA 1TQJA 3MMTA 1NVMA 2QCGA 5CGQA 3GLCA 1GTEA 1TSIA 3IIXA 1BEUA 4FO4A 5HINA 5J5DA 5AHMA 1OFBA 2CFFA 1HFBA 4KFNA 3W76A 1H1YA 3LI1A 5I3HA 3CM4A 3P82A 4FB7A 1AL7A 2FJKA 1SO4A 3W2MA 3TKFA 3S6DA 3R5EA 4UTTC 2C6QA 4QSHA 3GNNA 3CB8A 2UV8G 4Z0JA 1P4CA 4AWUA 1QFEA 2ZRZA 1SW7A 1XBZA 5EMUA 2WNQA 2DP3A 1MXSA 2XN1A 3VFLA 3T7VA 1DORA 4H3DA 4DEFA 3V1PA 4WXYA 1NSJA 1ICPA 4AXKA 3MYPA 3S8HA 2A85A 2ZTKA 4UMCA 2C13A 4LT9A 1PCWA 4DPPA 1OJXA 1W5PA 2GQ8A 1X1ZA 1X8FA 1YXCA 4IGHA 5KMYA 1W0MA 3V75A 4C1KA 1WYIA 1YXDA 4LC8A 1EUAA 3QPYA 5DXYA 3NPVA 3B0UX 3DFOA 2VEPA 4LTSA 3USBA 2A7PA 3W7QA 1JCNA 4WY0B 1UUMA 4K8HA 2HS6A 1N55A 2P10A 2RHGA 2QR6A 1OYBA 3WJSA 4OBTA 3LCFA 3VE9A 6TIMA 4HSNA 3UXAA 5EKYA 2V8ZA 2WO5A 5U4NA 1C8VA 3THQA 3SFKA 2A1YA 2JKPA 4N4PA 1Q3NA 1LTDA 2CZEA 1LBLA 3EKZA 4IMEA 1F76A 1H7OA 3GKFA 3TK7A 4DBDA 5K9CA 1AW5A 1FDYA 2QCHA 3FOKA 3W2KA 1OX4B 2CZ5A 4RR4A 5KZDA 3PBYA 1VRDA 1KFKA 4RX0A 3IVUA 2BLEA 2X1TA 1AW2A 2JK2A 3HOJA 3LCLA 3W83A 1SPQA 2ZRWA 2ZTJA 2CU0A 2CZDA 1A50A 1OFEA 3NOEA 3LXAA 4FF7A 4LS1A 4OT7A 4HNTA 4M6VA 5D03A 1R47A 2TYSA 1ZALA 2ZZ3A 2HMCA 2QF7A 1KM6A 4L4MA 4P61A 4KFOA 3VE7A 5I3FA 3OBKA 3KHJA 1YDVA 3M43A 3SECA 3W72A 2NX1A 3I7QA 3C2FA 4ORMA 4FNPA 1TPDA 4GWEA 4OV9A 2X2GA 3KRZA 5DY2A 3KAOA 5A5WA 1OVDA 1T96A 3W2UA 3CT7A 2B7QA 4MLRA 3W70A 2VFHA 3GZ3A 1VPXA 3EWYA 3W3OA 1JUBA 2NUWA 4Z1AA 1FX6A 3QF0A 4PCFA 2WSQA 4O8RA 1F74A 3BGJA 3R89A 5KZEA 2NLIA 4QIUA 4ZMGA 3LRKA 3UD6A 2FB3A 1EB3A 3NQ7A 3W1LA 5K3VA 3O63A 4PFMA 1MO0A 4JR5A
chains in the Genus database with same CATH superfamily
3MZ2A 2A0NA 3CWOX 2I5IA 2GSEA 4HK5A 4QM1A 1P48A 1ODZA 1HL9A 2GJXB 3LYEA 3SDOA 3G8RA 3TVAA 5KZMA 3L4TA 4PUJA 3SCTA 3XINA 3U6WA 1F73A 3QKEA 5A2CA 4ZOBA 3BVJA 1FCQA 3E38A 3ZWSA 2I9EA 1RVGA 3NL2A 1JPHA 3ZR4A 1FTXA 4ZXLA 3TA9A 2DY3A 2JGYA 4JN8A 5FJPA 2NVCA 4GZJA 3IIOA 3C0SA 4JN6A 5H8PA 4IGSA 1TVNA 3MCMA 4MWAC 3NCOA 3EWXA 4ZL1A 2I17A 3LBCA 1NOWA 4AZGA 1PIIA 2IXUA 4HA3A 3VNMA 4LH8A 5H8MA 3IWPA 3AU2A 1KWGA 2WPGA 4CKQA 4W87A 4Z2JA 1HKMA 5BXSA 4ZZ9A 3T08A 5I23A 3G5EA 2WJEA 4E0CA 4AYSA 2GDUA 2ICSA 1QPNA 3BTNA 1YX1A 3QZEA 2EBNA 4HB7A 4M7TA 3BMXA 2C15A 2G3NA 4PRWA 1JYNA 3KXQA 4MDOA 3FLUA 1ZFJA 3E1F1 4KWVA 1A0EA 6ALDA 1QVBA 3AYTA 4UFLA 1W9DM 5HWMA 1HGYA 3S5YA 5HQMA 4CQBA 4OKDA 2Y70A 2XIOA 1W9UA 3BO9A 1UKOA 3DHUA 1E6ZA 2F6KA 2WZHA 3GUGA 3BQ5A 4HGXA 3A3XA 2AQWA 4Y9OA 3E2QA 2Z29A 3GC4A 3PFMA 1JAEA 4O1CA 1JPIA 1OZMA 4DNHA 3L2LA 3CQIA 1Q6QA 3WQEA 1PX4A 1OG0A 3TSMA 1G0CA 4AWEA 1F9CA 1FKWA 2H6RA 1IQ8A 4XBKA 5D9OA 3C2EA 4FA3A 1GKRA 4OU1A 4IQLA 1UZHA 2BY1A 5G1TA 3GWQA 1ZGDA 4F9DA 5HAOA 5CG0A 5DX7A 1IHIA 2X41A 4QSFA 2I14A 2XWEA 1RQEA 3AISA 4AVFA 1BSIA 4GRSA 2O4QA 1XUUA 3KVKA 5C2XA 2VEGA 1MRAA 1GVEA 1A5BA 1MUMA 1ZPTA 1K77A 3II1A 4Z1CA 4ZE4A 3VD4A 1UB3A 4G1KA 1YXYA 4XD4A 1Z89A 4N9CA 5RUBA 1KBLA 1EBGA 3ICJA 1CGWA 3N2XA 4MNMA 3ZOAA 3WLHA 4IG2B 1RH9A 2E3ZA 5T9CE 1R2SA 1QAPA 3KRBA 1JCLA 1K7EA 4TX9A 3P6LA 1XYBA 1VCVA 2VRKA 1NP2A 4O11A 2CC0A 1SO6A 2W67A 2YA1A 4YNGA 4UQDA 3S1XA 1OIMA 4BWLC 4IIBA 3G1HA 1UZDA 3VGDA 2ZUWA 4OV4A 2Q09A 3AFBA 1WKEA 1KM4A 3WLNA 1S5WA 4NJKA 3WLSA 1RAKA 1JDFA 4FX8A 6A3HA 4OUIA 4H04A 3LV5A 2ZVIA 3AC0A 1LOSA 9RUBA 2POTA 2F7FA 5LA2A 1LWJA 1PUDA 5JIWA 1ONEA 5BU9A 1YADA 1X1OA 4HCDA 3W88A 4CGTA 4GFIA 4K1GA 3WBAA 3KX6A 1KTBA 2BY0A 3SI9A 1H5YA 3Q45A 3TTYA 4IL0A 4DI9A 1M9HA 1L2UA 5HANA 3AJ7A 5A8NA 4DXKA 4HBKA 1A47A 3RM9A 2NSOA 4K68A 1B30A 3ZFHA 5LA1A 1KFJA 2V5KA 4W86A 2CLFA 1R46A 2JF6A 2QCFA 4GI4A 2H9AB 3VO0A 3PPFA 4Y90A 2AL1A 1LLZA 4H6QA 2PCEA 4ZE5A 3UW6A 4GX8A 4EPKA 1GVYA 5CPSA 3VDBA 2QT3A 1R3TA 1G4SA 3LLFA 4LF2A 4MB5A 4XB3A 1Y8BA 2YFOA 4NAFA 1TWZA 2F2KA 2IXVA 2HISA 1BXCA 1RUSA 2IKHA 3WLKX 1KXVA 2ATMA 1JQXA 1EOMA 3BOFA 2AMGA 3WO8A 4JY8A 1FCBA 4DB7A 2XH2A 4DZIA 3PZUA 1VIZA 4LAUA 2VJXA 1XSKA 3B0YA 3UT0A 3U2OA 1GZ1A 1L6YA 2VFDA 2OFJA 4JFUA 1TA3B 1BLIA 3GH7A 1XFCA 3P0XA 5I3DA 4PTVA 1P1XA 2R1KA 4LFYA 3U57A 3RDKA 3QC3A 4G9PA 1XYZA 2ZZ2A 2ZUTA 1CGYA 3FEQA 5REQB 1NWTA 5HPCA 4WLCA 3PANA 4N4QA 3FJ6A 1PDYA 4DAFA 1OYCA 4LYPA 3NZGA 3PVFA 1B3OA 1GOXA 2WNNA 3LD5A 1AUSL 2ZYFA 4ZQNA 3CQKA 3U48A 3TLQA 1X7IA 3T0BA 3CWHA 1ENUA 3ITVA 3QMSA 1YTDA 5U7SA 4GUHA 4G56A 5B7YA 4HTBA 1SU5A 2PAJA 4JEQA 3TN3A 3KBNA 2VZUA 3N3MA 3RITA 5D05A 1WDWA 4DJFA 2YA2A 1ISWA 3H26A 4TTGA 3W82A 6TAAA 4Q8TA 1FWIC 3WEMA 1YPXA 1Q13A 4YTUA 4QDMA 5CJ5A 1F6PA 2ABAA 1A53A 1B54A 3P67A 4QQ3A 1WOAA 4WSJA 3WQVA 1NWSA 3G22A 4IGMA 4DWSB 5D33A 1CXKA 2VEKA 1CEOA 4HD5A 4AHQA 4W7WA 1EFZA 5BYWA 2GFTA 1U1HA 3NQEA 2EGZA 3FAWA 4QROA 4S2CA 1NF0A 2VVNA 3BG5A 4NU7A 5G2IA 2X7WA 3FN9A 3PBGA 3P62A 3ZQ9A 1OSEA 3D47A 4DBSA 3PZOA 5HJLA 2Z1WA 4P7LA 3L4UA 4M81A 5CGMA 3BW2A 3N25A 3LQGA 3I3EA 3CL8A 2EKGA 4GXPA 5PTDA 5E9XA 4NT0A 1UIOA 3PTMA 3TOYA 4LUTB 3ELFA 1PWLA 1AD4A 4PUNA 2VFEA 1JRBA 4D6IA 1KRBC 6XIAA 1ZAHA 5CG7A 4HQVA 1GQKA 1UH3A 3CQJA 4TO8A 4XK2A 4PL2A 4O16A 3G0SA 4BFAA 1C9WA 3AIEA 4IMGA 1OYAA 3FXGA 2CKSA 3E5BA 1UZ4A 2JIEA 4GJJA 2NV2A 5CC5A 1V3HA 4UR7A 2PI6A 3STGA 5IFTA 1DTNA 5EGRA 3SQMA 2ZWZA 3N13A 2EPKX 4M6QA 2E8ZA 3BV7A 3O6DA 2HE8A 4U5IA 1SR0A 3DG7A 1VH7A 1XCXA 1B9ZA 3TXZA 3L4WA 5F2IA 3AI0A 3DH7A 1CBGA 3QFEA 4JTAA 3ABSA 3DG3A 3OA3A 5I24A 4B3LA 3SR7A 4XKYA 3MI2A 2D2HA 4F0MA 4QJ3B 2ZADA 4YPJA 3M46A 1FOBA 4RZ5A 1UWQA 1ZRQA 2WK2A 1H1NA 1ZTVA 2Y89A 2GQ9A 4HHLA 4H2CA 1TZ9A 3HPSA 4L1XA 3F1QA 4NAEB 2FMNA 1G5AA 2GVGA 4W7VA 5GJNA 2E1WA 3MV01 2CIPA 1JFHA 4Q6JA 1V5XA 4M3PA 1LWIA 1GKQA 3LZ5A 5IOBA 2HSAA 2YCJA 2V81A 1DIDA 4UR9A 4LBRA 3K8MA 5JH2A 1ML1A 3R1ZA 4Q8NA 2DVTA 3APYA 2BY3A 3OLIA 5D2YA 3SCUA 3QHNA 2GGHA 3A4JA 3SADA 1E15A 1UR4A 3WN6A 4GYFA 1PKMA 3M5VA 1EPVA 2BOEX 5DF0A 3TYUA 3FJNA 2BHYA 2P53A 5F2LA 2XN0A 2YYUA 4ZOEA 4C91A 5MF5A 3SM0A 1NDZA 3CL7A 3G6LA 2I16A 3UWZA 2X09A 3QV6A 3WF4A 1LL4A 1TJPA 3H12A 4WOQA 2BG5A 1C93A 2UZ9A 4M1BA 1IZJA 1UG6A 3UG5A 1XLDA 1E4IA 1GW1A 4QE5A 1CDGA 3I4EA 3WQ8A 1AMKA 2IMRA 2GQ3A 2YPIA 4HNOA 1HL2A 2DZBA 5IHRA 5TAOA 3FJ4A 4JTJA 5G1YA 3UCDA 3YPIA 1O5KA 1I2NA 6ENLA 3GDMA 2YIHA 4X2RA 3TTQA 1I2OA 1XISA 4J3SA 1KKRA 4L6DA 3RJYA 1OCJA 1UD6A 5FL0A 1EJVC 2NQ9A 2G8ZA 3RAOA 2PRLA 3M64A 3UA4A 5H91A 1BGAA 3GM8A 1L8NA 4XKMA 1JDEA 3KZSA 3P81A 3WQCA 1NTHA 3WF2A 1YYAA 2YCEA 2PWHA 1KKOA 4V1XA 5LHEA 4PC8A 3O6YX 2BGSA 3I68A 4GFSA 5G1MA 3KFTA 1D7FA 2Q8LA 4XISA 2VX7A 4XO6A 3A12A 3E0VA 4EPBC 4O10A 4O53A 1TUXA 3LS9A 1XYLA 3LEPA 1MNSA 1IEIA 1LWHA 1TV7A 3T4WA 1NFBA 4Q8QA 5BWAA 4UTJA 1S5MA 1TV5A 3ARWA 3SEPA 5DCEA 3DHDA 3PNZA 1R2TA 4QEEA 3FYOA 3MSGA 4YN5A 3VOIA 2BGNE 7TIMA 2BHUA 1PJ9A 3WBWA 2B81A 4PCSA 9CGTA 3IS4A 4DJEC 2R82A 3ITXA 5CZ0A 5DO8A 2VX4A 5CSYA 4DXXA 1AD1A 1FWEC 4HU3A 1DEDA 2QUUA 5E0KA 4H6RA 3O9NA 2GOUA 3P0WA 3FFSA 3A21A 1I60A 3ZT5A 4TQTA 3A5VA 3WK2A 2VXNA 4H8HA 4M5PA 2CW6A 3JZUA 3HBLA 3EKLA 2IQTA 1AQMA 3VKCA 3MC5A 1RA0A 4XTDA 1MEIA 4FXJA 2WCAA 4H41A 1V0NA 3LHWA 3GVRA 1WDPA 1M3UA 3MPGA 1FY6A 3GNXA 1CLKA 2WOQA 1H7PA 3STEA 4UMBA 3LV6A 3U3HA 3C2YA 1JQVA 3PTQA 2G97A 3S3GA 3KW3A 1U5JA 1XLJA 2CLEA 1OFQA 2ZZ5A 4GA8A 5HK4A 4Q33A 3LNMA 1OGGA 1U22A 1VCFA 4ONVA 1AG1O 5A1AA 4CCDA 2O0TA 1CB7B 2FGLA 1ZBCA 2QGYA 1LBFA 4UZUA 5I78A 4I9JA 3VMNA 2VDIA 1F3WA 2X1SA 1DQWA 4JQ4A 2JEPA 3VGHA 3KCOA 3EA1A 5IBXA 3H2CA 4NZ4A 2BVYA 2XH7A 1PKNA 3VCCA 3GU9A 4RW3A 2D2GA 8TIMA 4J27A 1A5KC 3N6HA 4QS5A 3WZ0E 3RF9A 3P60A 2Z25A 1S5TA 3W7PA 1OFAA 3T2PA 3WDIA 4EANA 2CPUA 1EIBA 2MUCA 2E6FA 2Y7EA 1V6VA 4HPHA 1TB3A 3VMPA 1WPCA 2OO6A 4K36A 3FGCA 5CPTA 4PEEA 5GJMA 3S2LA 2PMQA 1M7OA 4WJ8A 1NF7A 4NNAA 3WEOA 1OC7A 1ZAJA 4I6VA 4N6EA 2Y5JA 5XINA 1VFFA 1SMDA 3C0LA 5HUPA 2VUNA 3NOYA 3RMEA 3DI1A 3GRIA 4LYKA 2IQ0A 1TTJA 1EJRC 2YCIX 1LBMA 4FHAA 4HKPA 3MDWA 1V3KA 4NZ1A 3KTCA 2F61A 2J62A 3SUSA 1VP5A 1K3UA 3T8QA 4BI6A 1EYEA 1WV2A 3IV8A 4JTLA 1V0KA 3H4XA 2J9YA 2WZTA 4QHRA 3VZXA 1UUOA 4OOZA 3KZPA 3P80A 2E77A 4Z1YA 1VHNA 4TTUA 2QCCA 3E0FA 4ZTYA 1B90A 3H2FA 4ZB5A 1YIXA 3VXGA 1QI4A 3E9AA 1E51A 1EJWC 1RQBA 4P2VA 3WCZA 5IHSA 4IP7A 3QSRA 5CXPA 4J3TA 1WKYA 1B9BA 1I0BA 3OA5A 4L65A 4WSKA 1QRQA 2WLZA 2XFFA 3RX3A 2W5FA 5CBBA 2B7OA 2OODA 1JNDA 1XS2A 3G0UA 1N8WA 2FVLA 3PG9A 2R1MA 2O4MA 1I75A 4LY4A 4X2PA 4HOWA 1FFQA 4IIHA 1EUNA 3OYXA 2DZWA 3STCA 4NY2A 1MW0A 1U83A 3TONA 2QCLA 1CGUA 2FTWA 3UZWA 3N4AA 4N9EA 4R7WA 4PE8A 3P2VA 2O55A 2WXDM 3DENA 1PE1A 3D0CA 1MFVA 4DJDA 1XLFA 4INFA 2DT1A 3MWAA 4A22A 3SQSA 3WFLA 4K8GA 2WSKA 2A5HA 1XC6A 2PP1A 4S3FA 3BSHA 4IMDA 4HIBA 4I6KA 4LW7A 3IJQA 3UFYA 3UVIA 4HPGA 4OGZA 1SW0A 2FZ8A 1VYPX 3BXWA 3B40A 3CLMA 3ALFA 1QBAA 4CD4A 2GK1A 3GFYA 4JQ1A 4EACA 4XZWA 1PKYA 1DJYA 5JU6A 2QGHA 3SIMA 1ZQ5A 4Q8OA 2HBXA 1TRDA 3ARPA 3V5OA 2EO7A 4LC6A 2X16A 3UR8A 5A8OA 4Y7EA 1VCGA 5LNRA 3EZ4A 2A7RA 4V27A 1QXLA 5HNRA 5HBFA 5AVNA 3AAMA 1FWAC 4NZJA 3GFZA 4BEQA 2W6RA 4F48A 3ANUA 4F0LA 2P3EA 5D9MA 3ZJ6A 5EL1A 1PZ1A 1SSDA 1A5OC 4MY9A 3TSBA 4JGDA 1JZ3A 2ZXDA 1J12A 3UP8A 1EF2A 3CLWA 3UG8A 3NSNA 2BSLA 2UBPC 4D71A 1KM5A 4US5A 1R3WA 2DQWA 2HTMA 1A49A 3UERA 1R9XA 3GC2A 3ZIZA 3G1RA 2CHOA 4ES4A 4XAPA 2YW4A 1T7LA 3UR5A 4GIEA 4GQGA 3NXFA 3KVMA 4DJFD 4LUYA 2B4GA 2V3GA 4FK9A 4HA1A 4Z08A 4B5XA 4MZYA 3CTTA 4RE2A 4GQQA 3HPAA 3KOXA 3LCGA 3RX2A 3WUGA 2HVNA 3GG0A 3L2MA 3ZVIA 2ZBTA 1TREA 2Z1KA 4ML4A 3BJFA 4XBSA 2INEA 4G7EB 4YYCA 5GJPA 1EA9C 1LRQA 1T6MA 1H63A 5LHFA 4YCPA 5DMNA 4B3KA 3T0TA 4DX3A 3E2VA 1AK5A 1Q7MA 5GNZA 1LM1A 3SFWA 5DBUA 5D2WA 3W2LA 4P7OA 3AYSA 1MVYA 1E6PA 4WVXA 1QPRA 3VGEA 3N14A 4IMCA 4JCLA 3WBXA 1GCYA 3MHFA 1JD7A 2ZA1A 5G2WA 1VC4A 1DIOA 2Z26A 3VX0A 5K2ZA 1F07A 4Z42C 4AZHA 1XD0A 1OG6A 2GUBA 3NQDA 1XSIA 1HO4A 3JRKA 2Z1VA 4B5TA 2QPUA 4G1NA 2QJGA 3EPMA 3TC7A 3TYEA 1EDTA 3M44A 4MGGA 4RZ4A 5FL1A 4IXXA 4L1WA 1DXFA 2VX6A 1JPMA 1CW2A 1ISZA 1DJZA 1TRIA 4IX2A 1OD0A 3B05A 3VZYA 1W5NA 5I03A 4PH6A 1QW9A 1JZ2A 5BXPA 4UFIA 5B7ZA 4Q4OA 2VENA 1SQ7A 2GGIA 4QDWA 1XX1A 2DU2A 4JIPA 3SY5A 4AD4A 3U9IA 2DIEA 2QV5A 1FWFC 4Y96A 5LA0A 2QQ6A 3REQA 4TMCA 3HB9A 3BICA 4W9TA 4PRTA 2XSAA 4J1OA 1Z9AA 2XIJA 4I5RA 2HS8A 2CLOA 2C79A 3EDJA 3IGUA 5ABFB 3HV8A 5EU9A 1GHSA 3TFCA 1ZJBA 3P5YA 1CT5A 1V0MA 3PB0A 2Z1SA 4GO8A 5DXXA 2GJNA 2A3BA 1DV7A 4R5EA 2OWCA 3E5PA 2WB5A 2P0OA 2PDQA 2OEKA 4CCEA 3EXTA 2YL6A 1UQZA 2BS9A 3OJGA 2Y8UA 4NJHA 4MB4A 4IQDA 1RXOB 3R0UA 1O6IA 1JG9A 4HMDA 3H54A 3NQCA 4D8LA 1LDCA 4ZENA 4AD0A 1NDYA 4O4VA 1FKXA 1GOKA 3T55A 4NUWA 4ZFCA 1QW8A 3S1GA 4ZQPA 3POCA 4JN7A 1CNVA 4O50A 1TO3A 4MLJA 1XH2A 4LUJA 1QI3A 2EHHA 1CTNA 2BFGA 4O1AA 3UWYA 1GHRA 4GY7A 3WQ5A 2DV0A 3ITGA 1VYSX 2ZUVA 3AXIA 1BWVA 3IV3A 4JKMA 1EQCA 2J7FA 4X3ZA 1HP5A 5A8PA 2JQXA 2AKMA 2XU2A 3SY8A 1EQPA 3T42A 3FDKA 2Y0FA 1E6QM 1EDGA 1ZJIA 1LORA 1XBXA 3T9PA 1KW1A 2J7BA 2JGQA 4L64A 1M65A 5K4ZA 3CUZA 3GDTA 7CGTA 3FS2A 2E6DA 4YLWA 4Q8UA 4DBUA 1Y65A 1TMQA 1G67A 4MWAB 1W9BM 4MYAA 1XXXA 2Y2WA 4PN2A 1TV2A 4KEMA 3H7VA 4X9SA 3UR7A 3M0MA 2WSYA 4K7YA 4Q4PA 1NWRA 1JEZA 5I3KA 2FVMA 4EIVA 3TWBA 3R94A 2QDEA 3GVGA 1VFLA 3PZ9A 2FZDA 2PTZA 1N8IA 3TOPA 4R33A 5HMDA 4A3QA 3GLCA 1GVIA 1QBBA 2EJ1A 4QG8A 4FO4A 2QJNA 1XLAA 3LSBA 1R3YA 5HA7A 4IFRA 2CFFA 3NUKA 1HFBA 2VCAA 1LG1A 3LI1A 5DQPA 3CM4A 2BDQA 2OSYA 2CBJA 3QHMA 2FJKA 1VFMA 5I2UA 1P0EA 3W2MA 3S6DA 5DMYA 5AYBA 2C6QA 3IJDA 4E4UA 3KL3A 4F40A 2UV8G 4MKVA 1P4CA 4GISA 1ZBKA 1PEZA 1QNRA 3VK5A 2ZRZA 1SW7A 3I6TA 2WNQA 3ABXA 3VMOA 1DORA 4H3DA 5FSEC 3V1PA 1NSJA 1ICPA 2A85A 1OZQA 2X7VA 3PTDA 4P7NA 3OGVA 4IGHA 1X96A 1WYIA 1YXDA 1EUAA 3PK7A 1KWKA 3B0UX 1R85A 4MUPA 3USBA 3W7QA 3PZIA 1NOFA 1JCNA 3R0KA 2P10A 1OYBA 1XHGA 3LCFA 4AEFA 2V8ZA 1AODA 4N4PA 1LBLA 5BU6A 1XH0A 2IPGA 1ZSXA 1FDYA 2QCHA 1OX4B 1ISVA 3S4TA 1BF2A 4C7GA 2J7DA 1AZ1A 1AW2A 2JK2A 1LUCB 1C7TA 2ZTJA 2CZDA 4QE1A 1OFEA 4FF7A 4LALA 4D6GA 2VD8A 2VM8A 1SZRA 3HZ3A 1ZALA 2HMCA 4P61A 3KTXA 5I3FA 2GSHA 3VAVA 3VILA 3CS2A 8CGTA 4FNPA 4YVPA 1ZJHA 3M0KA 5A5WA 1FVPA 1R6WA 3GZ3A 1A5MC 1FX6A 2VC5A 3QF0A 1E4NA 5A6BA 3MCOA 1UWSA 2SFPA 2NLIA 3FW6A 1V51A 3UD6A 1WZAA 4MJ2A 2GSJA 4NRSA 5A6MA 3SCVA 4HPNA 4PFMA 1UP2A 1TWWA 3BE7A 2J9XA 2D2OA 1GT8A 3O0KA 1LZOA 4P8UA 2DZAA 3UJ2A 1O7AA 3PWAA 3W27A 2I1OA 1IR2A 4F2BA 1OT2A 1AH0A 1ALDA 4ZO9A 4J3ZA 2DH3A 2CLKA 4EPEC 4RV8A 3EDFA 4KFPA 4S1FA 3GW3A 1UWIA 1ZENA 2VOMA 2V63A 2NQJA 1OT1A 2QEZA 4DELA 4IMAA 4HZ7A 4OTKA 3DFQA 4PYSA 4H7CA 1E0WA 3A64A 3R8GA 1PIGA 2DFAA 1M7PA 3ARYA 2OQHA 4I90A 2WQDA 2ISFA 3IRSA 3WY1A 4TX8A 1JI2A 3OLDA 4PBEA 5I3GA 1WDDA 2V67A 1XUZA 3CNYA 4BQ5A 1FP8A 1X6UA 3OG2A 3VIFA 2Y1HA 1YDYA 3PZGA 4DM2A 3RFAA 2GUYA 2V38A 1HZYA 2CBVA 2ZX8A 3NZ1A 4CEXC 1T0OA 4HHPA 4FXSA 2GPTA 1JCYA 2CBIA 3CIVA 4OBSA 4W88A 1PYMA 1KXHA 1MEHA 1W2PA 1E9YB 3W7KA 1GGOA 3IJ7A 4I7WA 1W9PA 4PMZA 4A3RA 3KBJA 2LLEA 3IUDA 3CQ0A 2QJJA 1O68A 2E9BA 3CAQA 3WLTA 4D6CA 3VD5A 3GG8A 2OX1A 3GIQA 3CBWA 1E4MM 1E9ZB 4S3JA 2PDLA 4HU8A 4EXQA 2GWNA 3CEPA 3V5FA 4AD1A 3U7VA 1RHCA 5D9NA 3VNYA 1R3SA 1J5TA 3SIZA 2W61A 4DHGA 4FMVA 1EGZA 2WC7A 1PWMA 1I4NA 3H70A 3S9ZA 4IX0A 3HURA 1S38A 1EZWA 2KZHA 1KO0A 4LQ1A 2AL2A 2ALDA 3HPZA 1BKHA 4HHHA 3HGSA 2V3FA 1ECQA 3N4FA 4D2JA 2L5HA 3DESA 2GJPA 3OEXA 5LNUA 1OINA 3GK0A 3P74A 4PRRA 4JL1A 1DIKA 5HOSA 3BAJA 1RA5A 5LIUX 3RG6A 4AD3A 3G1AA 5AHEA 1NH6A 4GQ0A 1Q6FA 4UMAA 3NG3A 4XD3A 1Y7VA 4G8TA 4HZMA 1SGJA 3ARVA 4GVGA 4RW5A 3APGA 4B3ZA 3AMDA 3VCNA 3W74A 3H24A 2V2DA 1V77A 3JS3A 2XPKA 1Y0EA 1V03A 3MMWA 1LF1A 2C3ZA 3PJXA 4GNVA 4UTFA 3W71A 1Q2SA 3RPDA 2D0GA 4QRNA 1UBPC 1JXJA 4AW7A 4AIOA 4O8AA 4MVAA 3TQVA 1M6JA 3URQA 1CI1A 4MSSA 3BZGA 3S1WA 3B0PA 3F2BA 1OADA 4LU0A 2OT1A 3G1XA 3HGJA 1Y5VA 4DI8A 2PF8A 5FIPA 4PODA 3RPTA 5HWNA 2GOKA 1GEQA 3R8RA 3VPLA 1G7VA 1QOPA 2ZUSA 3W1UA 5I07A 3PZVA 2WMIB 3CV2A 3LLDA 1DE5A 4ZBCA 4UTTA 2TAAA 3MYOA 4C5YA 1FWTA 4W5UA 4UOZA 2C16A 3CC1A 1PPIA 1RALA 1XKYA 4DYKA 2DT3A 1OBAA 4O12A 3WH8A 3W75A 2AOSA 4NI8A 1B3YA 3QN3A 4GGHA 4R27A 3W7EA 1ZBWA 3LPPA 2C71A 3R11A 2NQLA 4QG6A 2WJDA 1HKWA 4NJIA 3BLFA 1E73M 3EDKA 4D1IA 1ZL1A 4ZQCA 3VDGA 4CQ9A 1BWKA 4GX9A 4UC5A 2J27A 2BXYA 3B8VA 3QMRA 3MQTA 5C9XA 3BSGA 1RBOB 5AVHA 1R30A 1C8XA 4M51A 5FAJA 4JTDA 2RDWA 4LS0A 3U5UA 3GB6A 3AS2A 4YWIA 4HNCA 3WLIA 1E1FA 4ZO8A 4IOTA 4ALDA 5DY3A 3QQ0A 1EP1A 1JCTA 2Z00A 4DUWA 1TIMA 4XIMA 3WD3A 4JIQA 1WOBA 2P8CA 3AHZA 3CUJA 3WQOA 3OPSA 2BMBA 5I09A 3C4UA 5T9BG 2V0TA 4AF0A 2NUYA 1FH8A 3PAOA 1B3XA 1KV8A 5C9WA 4C6DA 2PDPA 2MANA 1VHCA 4YCOA 1EL3A 4XIAA 5IM51 4UQEA 4NIRA 3BGAA 3B9DA 4D6DA 3VI2A 2QHAA 2OYKA 4KCWA 3CAKA 3KBVA 4AEEA 2BODX 2WMKA 2XDFA 5A8GA 1RLDA 2BVDA 3S5ZA 4CN1A 3OBEA 3GTHA 1C91A 3W7JA 1S1PA 2DORA 1JPKA 4KKXA 3TN5A 1WZKA 4K38A 4YTTA 1W9XA 3W7GA 2WMHA 3F03K 1NY1A 1J4EA 1ADOA 4IPNB 3NO5A 2QVNA 4AIEA 5F2MA 1GYLA 4WK9A 2DZSA 2VHLA 4AX7A 3KTSA 1P0NA 5ECVA 4H01A 2XWDA 1H0GA 3A3HA 3HO8A 3VCRA 1GVRA 5BZAA 5IFPA 3W26A 1BYAA 3TAKA 2ZVRA 3LI0A 5AZ0A 1NDWA 4D6EA 3RLHA 3JU2A 3EB3A 5CPQA 1JZ6A 1P6WA 4XQ6A 1IIHA 2ATSA 1J93A 3C2OA 4EF9A 2RH9A 1XDMA 2ZKMX 1LQAA 2HPIA 1KLZA 4M80A 5DCDA 4HNVA 3WQPA 3D3AA 3BLDA 1BTMA 2V5DA 1VKFA 3U8GA 5D2TA 3DCPA 4IJBA 3RRAA 4CNOA 4K37A 3BAIA 1CX9A 1Q65A 1H51A 1FCUA 3FEMA 3TU9A 4PL1A 4WDWA 1YMYA 3EPNA 3F4NA 2E4TA 4X9YA 3PJUA 2QCDA 4WDTA 2VR5A 1YDOA 4JICA 4J28A 1D9EA 1X6NA 4WGHA 3WNKA 2C0AA 3G3MA 4Z1BA 5CCZA 3LUTA 2CKRA 1H62A 5HUOA 4JBRA 1GTHA 3KS6A 3CAVA 4GC3A 3CHDA 1P6CA 1DOSA 1J18A 3A22A 1XH1A 4QX4A 1VFTA 1PTDA 3I10A 4XD5A 3AXKA 4O0KA 3WF3A 5KSWA 3KBSA 1DVJA 1XQLA 4AAJA 4BQ2A 3I3BA 4ZOAA 4IL2A 4DO6A 4J3XA 3R13A 1X1NA 2WHMA 1SFLA 2EEXA 1R7OA 3R58A 3MANA 4IFKB 4KCVA 1H7NA 2ISSA 3QOKA 1KGXA 1GNXA 5CEWA 3VIOA 1D7KA 2WVSA 2CESA 5LNSA 4X61A 5CC3A 4EOUA 3KUMA 1OGSA 2Y5SA 2XYLA 3EAUA 4C6IA 3WYZA 4CN4A 2YR1A 5FAGA 4YTRA 1XCWA 3GQYA 5M17A 2XH4A 3ARRA 2XIQA 1QPKA 1Y5WA 2QIWA 1ITXA 2P1FA 2ZX7A 2ZRYA 3LHUA 5EFFA 3QV7A 5E6ZA 4Y9MA 3BLPX 3O05A 4UCFA 3V0TA 1OFDA 1UQYA 1DWIM 5F1UA 2F6XA 1ITQA 2HK1A 3RR1A 3ZLHA 1Q7ZA 3BAKA 3JR2A 3LNPA 3PUGA 4WXZA 4EWJA 1VBGA 1TPB1 4MJMA 2ON3A 4KEUA 5TQLA 1B3WA 2AL2B 3WSUA 2DSZA 2VL4A 5DT5A 1E3ZA 1X8CA 4LB4A 4QDPA 1BRLA 1TVLA 4PMQA 5C8BB 3BARA 3TSDA 3KOYA 3GZAA 3VC5A 4XZNX 4GZEA 3KEHA 3ABQA 3E2RA 2YLAA 3AIRA 2ZE0A 3RUBL 2V2HA 1E9IA 5ABGA 3ABOA 1EP2A 4XAYA 2P88A 4UTMA 1T99A 1TCDA 1UZ1A 1ZP4A 4KWOA 3VKBA 1WA3A 4E2DA 1UPMB 2WM0A 2EPNA 1M53A 1U1JA 5IDIA 3MO4A 3WQGA 5LXXA 1OB0A 1NQ6A 2XSXA 4FX6M 3CHCA 2EJAA 4WZHA 4B16A 3B8UA 5AZ1A 1NEYA 3EMQA 4UXDA 4MAZA 5JXQA 3W6YA 4OJYA 2E8YA 3L4ZA 4PTDA 1MUWA 4BWLA 1QU4A 3B4UA 3WMBA 3DI0A 4BI7A 3H2NA 1DE6A 2NWRA 3CQHA 4IGNA 2BHZA 3VNDA 3CH9A 3PN8A 4DO4A 1K02A 1JL8A 2X42A 1GZGA 1TYGA 3NYZA 5E6YA 5DBTA 1K9TA 3W37A 1UR2A 3BQ6A 3AOFA 3EWUA 2YX0A 2FH6A 2PTYA 1CCWB 4JX6A 2WWCA 4BZYA 4IZGA 1I9CB 5D30A 3R7MA 2OT0A 1UR0A 3G18A 3EOOA 4UTWA 3RU8X 1WDQA 1W2VA 1JUEA 1Q6OA 3PUOA 3QFWA 1FWBC 1GOMA 4JEJA 4PMDA 4MADA 2DZUA 3TNOA 4ROQA 3V18A 3IK2A 3CJPA 3VIIA 2AKZA 1NELA 1UCWA 5CZSA 3TXVA 3IVSA 1TMHA 1TG7A 3QMTA 1C3FA 3GUWA 4N02A 4EPDC 2W92A 2V9DA 4MZ8A 3QLDA 1QMLA 3LERA 3NQ2A 4R7JA 1A80A 2ZUNA 3NL3A 4WX2A 2PGWA 4K6AA 1UC4A 3ARUA 1K9DA 1IF2A 4DF1A 1U1UA 4TUFA 3MJYA 1J0KA 1H5VA 2D69A 5A6TC 4RNFA 1EA0A 3WQDA 5BRQA 3AZTA 2YCLA 4E8DA 5CPLA 3KS5A 4RDVA 4GACA 1O5RA 1D3CA 4PUWA 4LAZA 2RKXA 2AGTA 1KFWA 2ZUMA 5MHBA 4MYXA 3M0JA 2WKGA 1LCOA 3AQUA 3IRDA 4K7VA 4TU1A 1PTGA 1RY0A 4H7VA 1PHQA 3K2GA 4DXVA 3OGSA 4JQ3A 1OX6A 3THCA 1UKSA 2E9MA 4IM4A 2HXUA 3WK0A 1UR8A 4K3ZA 3U2CA 1TV3A 5EMLA 1QDSA 4C1LA 4ERGA 4C1NA 3QVQA 2DSWA 1ZU8A 3COTA 3NDOA 2XHYA 2CYGA 1K4HA 1KRCC 2Y4SA 2XH0A 2PDBA 1MDLA 4XG1A 4IIGA 3W7LA 5JIPA 4NNBA 5C54A 3ZLGA 3M41A 3W1AA 3K8LA 1V7YA 3LCWA 3H22A 5BMWA 3H2MA 3ANYA 2PZ0A 3RX4A 1RV8A 2PF0A 4B90A 1FXPA 4O4WA 2YBVA 3P8IA 2QUNA 2GWGA 3CPRA 1VEOA 4JFSA 3TV8A 2WVVA 3LSCA 2PCQA 4ERIA 1GQJA 3T44A 3H7RA 3OGRA 4H6KA 5BROA 3WUBA 3TLLA 1BAGA 1IT0A 3TC6A 1SO5A 1LROA 4H9ZA 4ZCWA 2PA6A 3KBMA 1GOIA 4CNNA 2BXZA 1KFCA 1ME7A 1LQ2A 1XLBA 2OEJA 5C7HA 4OVXA 4D6JA 2PDXA 3DBNA 1Q7QA 1RJRA 1RPXA 2WZIA 3R4IA 5ENLA 4XBJA 3W1NA 2PP3A 2GLKA 2A4AA 3QM3A 3W7NA 5LIKX 3QHOA 3SQLA 1HQTA 1ITUA 4FIRA 2NLYA 3LPGA 3GS6A 2G0WA 3ABRA 4Y9PA 2HBVA 1O1HA 3VKAA 4WF7A 1NFPA 1L9WA 2POZA 5KTLA 1V3LA 1PBGA 4IJCA 5CAHA 4C6LA 3RLGA 2BTMA 2YB1A 2W62A 2FHBA 4XZBA 3VABA 3S1UA 2B31A 4HNLA 2BNJA 1J0HA 4Q4KA 2ZZ7A 1C92A 2WLYA 2PPGA 1Z48A 5EMJA 2VQUA 2XZ9A 5TIMA 3L67A 4GUFA 2Y62A 4RK8A 4N6FA 4P7RA 2VZTA 2X8RA 2EPOA 1F3EA 1UWAA 2BB0A 4GBDA 3UU0A 3G1FA 2GQAA 4HA4A 1L6GA 2Q02A 3W85A 2HEJA 1OF6A 4BQ3A 3XIMA 4XTIA 4I9TA 1LT8A 4F79A 1V6YA 4YHEA 3PULA 3OVRA 4GPNA 4GG9A 3UYIA 2VURA 2YZ5A 3ABZA 3LU2A 1OCBA 4B92A 3N6JA 1HKIA 3WLQA 5C2GA 1BWLA 3GNRA 1KRMA 3EB4A 4CLMA 5IRPA 4WUIA 1K7FA 1GK8A 1D3GA 2ZRUA 1IZKA 1OFRA 4H8NA 4GCAA 1TZ7A 3CHFA 3VDAA 2QJMA 3AMLA 3L2IA 1ME8A 5HQLA 4AHOA 1S2WA 1E55A 4XAGA 4A05A 1YTEA 4CD5A 1D8WA 1MW3A 2PC8A 4HZ6A 1WDRA 2EF9A 3KVLA 1KBJA 2FB2A 3SGZA 5AOUA 2YBUA 3R2GA 3S42A 1PL9A 4H83A 3WELA 3F4WA 4FR6A 4LWWA 4ILSA 1UC5A 2XISA 2CWXA 1CGVA 5D37A 4AH7A 3UVAA 3M1ZA 2O9TA 2VGBA 3CZKA 2OOGA 1E1CA 2OG9A 3PB2A 2G41A 3SSJA 4A8RA 5F1VA 3RM4A 3AIWA 3VKKA 1DJIA 4F66A 5D02A 3WFAA 3URBA 3O1NA 3CH0A 1TTQA 1MFUA 2E6AA 2FYMA 1KCLA 4MNKA 1KBKA 4QJ1A 3VOCA 1XI3A 1MQPA 1UWTA 2HV5A 4O13A 3KL5A 3DGBA 1R5YA 4HN8A 3GKAA 3OBAA 4B15A 3WQ6A 2QPXA 2C19A 1VFSA 4GJIA 3AJXA 3UJRA 2J7CA 2XGZA 2W79A 1Q66A 2G96A 4JDYA 1Q8AA 1JD9A 4KRUA 4Y8EA 4LSBA 1EC8A 3LPFA 3JZEA 1W3NA 3T09A 3ENLA 2Z2BA 5EFDA 2D73A 2J8FA 3MHUA 5FJIA 3AUOA 4ZO7A 4MG4A 5J8LA 2DSKA 2WMJA 1I2PA 2PGFA 4Q7BA 3H2AA 5MKGB 1UIPA 1QK0A 2OEMA 4TV5A 2PDIA 4C90A 2VZOA 1ZS2A 2G4FA 1V6XA 4XV0A 1HTIA 1ONXA 2QS8A 5HMSA 3SUVA 4DUXA 3C8NA 4PMYA 1J0IA 4Q7IA 3PR2A 3DKLA 2FLIA 3Q37A 1JF5A 3WD1A 3GXDA 8RUCA 1DHPA 1WNOA 4LCQA 3QW3A 1GVSA 4ATDA 2XN2A 4C6CA 3T40A 5J04A 3KOZA 2BX7A 4WY0A 1JVNA 3EKGA 3V1HA 2HNEA 2ZA2A 1EYWA 1X39A 1IWPA 1WQ5A 3WENA 2YCLB 1TUFA 1E0TA 3C3UA 3OYZA 3LB0A 3DBPA 1VPQA 1ZBVA 4GUJA 3GXMA 2A3AA 3WJZA 3BG9A 2PGEA 1JDCA 1R3RA 4NYYA 1CZ1A 1UMYA 3G6MA 3N11A 3NNTA 1GYNA 2I7GA 4K2SA 3ANVA 4DJDC 2GYIA 1FWDC 3W02A 3HQNA 4G6CA 4HJWA 4AZCA 4DJEA 1R7AA 2NX9A 2A3HA 2VT0A 2JBMA 4LJ3A 1CXEA 3NM1A 1PIFA 3S1VA 1ONWA 2DSVA 5H6HA 1RD5A 3MB9A 3SN4A 3BLIA 1EJUC 3CK5A 3TNBA 1POKA 1Q6RA 3HV9A 3IUIA 2IPJA 3IACA 1K4GA 4MPKA 3CUGA 4ZB0A 5TBOA 5C6MA 1YBQB 1KM3A 3O7UA 3G77A 1TX0A 1XCFA 3JW7A 1R8LA 3IGSA 2ZC8A 1CWYA 3TE9A 3UXIA 3A13A 3C56A 4E3TA 3TQKA 3PPGA 1XW8A 2VWSA 3R79A 5ABEA 1FFRA 3AXHA 1XINA 1G69A 2DQXA 4G2DA 1F6KA 1KQZA 2YDAA 1AQ0A 4JHOA 2D1ZA 3O6AA 3GTIA 1A4MA 3VGFA 4YVXA 1X97A 1PX3A 1W17A 1BXNA 4KMQA 4KETA 5E0FA 3SCNA 4MIMA 3BAXA 3RJXA 3NZRA 3AS1A 2Y7GA 3S47A 3RILA 2IPWA 3TZNA 1BYDA 5JBDA 3WX7A 4AMAA 1WAUA 3V3WA 5FESA 1KRAC 1P1MA 2YKKA 4KGJA 2QVHA 1SM9A 2ZICA 4GQRA 4ML9A 3V7PA 4EWND 4AU0A 1TWSA 3GIYA 2QMKA 1XJBA 2Q71A 3Q2DA 2PRHA 4R53A 3W9ZA 4YHGA 3PP7A 4JYDA 2FHFA 3Q58A 5F7UA 2PODA 1SZEA 5HNUA 3IEBA 3AU6A 3IUHA 2IS7A 5FI8A 2PTXA 2E25A 1MXGA 3GVWA 3DC0A 3EA2A 5LKYA 1DXIA 4L9YA 2W0UA 1EJTC 4Q8VA 2HNHA 2D2JA 1RCXB 1R3VA 3K4DA 4LUSB 2R24A 2E0PA 4PUUA 3M5YA 1KFLA 3EEGA 4RNJA 3K30A 2E40A 2J66A 4LS2A 3L4VA 4Q32A 4MZ1A 3H4WA 1W37A 3IJ9A 4HN4A 3N2TA 4JTKA 1HGWA 4DLFA 1D8CA 4UNLA 4HSHA 2AGKA 3L21A 4X0VA 3NEVA 1S5VA 2HROA 3E6EA 4ZFMA 4DM1A 5AYYA 4KPLA 1H7RA 2FZNA 5CKSA 1LLOA 1P6BA 3ZMRA 5C7VA 3HMJG 1FCVA 3W7IA 3WKZA 2DJXA 4J35A 3ZR6A 1EKOA 2XFWA 3CPGA 3DIPA 2EXOA 2J7GA 2RDXA 3TYZA 3G1VA 4H9XA 4WSHA 3W7CA 3W7HA 2C7FA 1BXBA 1QPQA 1KGUA 4M82A 1DPMA 5KINA 1B3ZA 2JFEX 5JVLA 4TVCA 4IPPA 3BCDA 2VEFA 1UJQA 1N8FA 4DY1A 4Q22A 4XVDA 4OZOA 1U5HA 1BVNP 5D2VA 1QTWA 3LMZA 2ISVA 1XD1A 3GYEA 1GOOA 1GVOA 4GJ1A 3MP5A 2OSWA 5D8WA 2YDRA 5DFAA 2ACSA 1ZLPA 1ZUAX 3IIPA 2NT1A 2IKJA 2E5CA 3LHZA 4PA8A 3QQWA 4QCFA 3AYRA 3P3BA 3V0UA 2XGBA 4Q8MA 2FPYA 4F0KA 3F4CA 4L4PA 4V15A 3WBEA 1JJKA 4HVXA 4BF7A 1WE5A 1TQJA 5GNXA 5CQ1A 1NVMA 1I1XA 2QCGA 2DIKA 1GTEA 3IIXA 6REQA 4OIFA 5EMMA 5J5DA 5AHMA 4KFNA 3NDYA 3QGVA 2XGIA 3A9BA 3P82A 4KEVA 1SO4A 4S3EA 3NO1A 3EYPA 3VNIA 1BG9A 3A4AA 3CB8A 3TTEA 3A6OA 1Z7AA 4Z0JA 2REQA 3WMLA 1FWCC 3WL0A 2AMXA 1QFEA 3C86A 4NL1A 3GXFA 2XN1A 1QNQA 4RZBA 3ZM8A 4AXKA 2WANA 4LF1A 2C13A 2DT2A 3EBVA 1UP0A 3T0DA 4RE4A 2QF8A 3VTRA 1W1B1 3MMUA 5KMYA 3V75A 4BEUA 4C1KA 3QPYA 2P3ZA 1YRRA 2VEPA 4LTSA 4L6HA 2A7PA 4WY0B 3FAXA 3MUCA 1HW6A 2D20A 5ABHA 4WR3A 4LCSA 4OBTA 6TIMA 1E56A 3GU2A 4HSNA 4WDXA 1HJQA 1C8VA 3WLMA 1DJXA 1YNYA 4AXNA 1Q3NA 4F8XA 5TNVA 1UKQA 4U2ZA 5BRPA 4X0NA 1F76A 3TK7A 4QAWA 1HP4A 4RR4A 1VRDA 3ZJ8A 1KFKA 2F38A 4RX0A 2X1TA 3VD9A 3HOJA 2J47A 1SPQA 4WRHA 3UETA 2X0HA 4KBXA 3VYLA 3AWNA 3LXAA 1XWYA 4KRTA 4M6VA 5D03A 1R47A 2TYSA 2RUSA 1KM6A 3FSTA 5T8GA 3GDBA 1IR1A 3VE7A 4R85A 3KHJA 1V7AA 4DUOA 3M43A 3SECA 2NX1A 1H2JA 3I7QA 3C2FA 4ORMA 1XKJA 1XDJA 3W81A 4GWEA 2ESCA 1SJBA 2ZXBA 2BGQA 5DRCA 2Z7GA 1EC9A 1T96A 3WQ4A 4MLRA 2VFHA 3EWYA 1JUBA 2NUWA 3VUPA 1A5LC 1HKJA 3B8IA 3M0XA 1CYGA 2YXOA 4O8RA 5ECUA 4A4AA 3BGJA 3BURA 2R1PA 4ZMGA 3PPHA 3LRKA 5KETA 1BYBA 3S6TA 4H9YA 2X40A 2ACRA 4TOQA 3PWGA 5K3VA 3O63A 4R9XA 2OKOA 4XZMX 3EMCA 1DJWA 4O54A 1KCZA 3DU0A 4BI5A 3MUY1 3N9RA 1DP0A 1Q6DA 4UTHA 3W01A 3SURA 5A6JA 4PCNA 4JNMA 2DPEA 2Y8KA 1XGEA 2XG9A 4UTKA 1ITCA 4HZ8A 2B7PA 2OQYA 4IMFA 4MF4A 2FGBA 3BCJA 1IE7C 3SGUA 5HR7A 4KERA 3L66A 1BG4A 3W86A 4JIRA 1PSCA 1J2BA 5FEXA 3UGRA 1AFSA 3CZJA 1SZFA 1TIWA 4S3KA 2NXHA 3VC6A 4KWWA 3IJIA 3BW4A 1EHAA 3NQBA 1QI0A 3TYBA 1CIUA 1G4TA 5D38A 4F9JA 3N2MA 1OWQA 2GL5A 3VOJA 4CVUA 3VOGA 4E4PA 1WXJA 3TJLA 3VINA 2HVMA 3MI6A 4ASTA 2GDVA 1C29A 4YTQA 4LXFA 3W6LA 3GAYA 1I2QA 4P8XA 1PHWA 5TF0A 3U2EA 1UKPA 5FD0A 3UPMA 4TR9A 4KEZA 1XFBA 1DJGA 3RU6A 1MQQA 4KESA 3BCFA 4LNCA 3MUZ1 1VQTA 2QUMA 3DFSA 1W1YA 4GBUA 8XIMA 4U5KA 3R0DA 2GGEA 3TH6A 2O9PA 4OFCA 2VFIA 5TD4A 1EJSC 3QR3A 2J78A 5F4XA 1XGDA 2BXVA 5I3JA 1HNYA 1J96A 4H8UA 2YDSA 1I0DA 3W2JA 2BBFA 2FJUB 5BWFA 3WH5A 3RK8A 3VVGA 5ABTA 2A79A 2XJ7A 3TR9A 2XVPA 5LNVA 1CECA 3ARXA 1DJQA 1TE1A 5A2AA 4ADTA 5FF3A 1V6TA 1J6OA 1HVXA 3KLKA 1J2WA 1JYVA 4IUGA 1EO7A 2VFGA 4RLIA 4L61A 3CWNA 3W1MA 2GJXA 2Q8ZA 4H1ZA 4ZODA 3FA4A 3NQAA 5LSMA 3CO4A 2H90A 4R88A 4H6EA 3TW6A 4WY0F 3FYYA 2X1IA 2FVKA 3VKJA 1VLWA 2ZXAA 4CNTA 4JNYA 4AMCA 1M5WA 1OEPA 2YZRA 4NZ3A 1UUQA 4IIDA 1ZCOA 1YNPA 1CPUA 3T6CA 4HCLA 1PCKA 2QUVA 3UXLA 1QNVA 2A6LA 4NAFB 4E2OA 4UFJA 4NJGA 1TJ0A 2VOTA 3RLVA 3MT1A 4NKCA 2A3LA 1SFTA 2ZFAA 4JCMA 4M8UA 3TN6A 1B1YA 3NGFA 2NV9A 2QLYA 2OMAA 4P8VA 1FA2A 4CNPA 1BYCA 3DXIA 5EMYA 1MQRA 3UA3A 3O3RA 3ARZA 2QULA 2E5DA 2G3MA 1GJWA 2FDMA 1CXLA 2G5WA 4U2YA 3K8KA 3DX5A 2WNWA 2WHJA 4S3GA 3WH9A 1LRNA 3M4HA 4AVNA 1LT7A 3C0JA 2PS2A 3T78A 1S2AA 5G5IA 4UIOA 3DEQA 4GINA 1KB3A 1XRFA 4MB3A 2HXTA 1T40A 4J4KA 1RLCL 4MKNA 4GD0A 3GHRA 3W7RA 3DDMA 2QNEA 2VUYA 3GG7A 5KZ6A 2YXGA 2ZUUA 3DAQA 1E0UA 1OGBA 3HQ1A 4ICMA 1Q6CA 2JF7A 1TV8A 4L9XA 4H00A 2YLLA 3PUEA 3SO7A 1JCJA 2BOFX 4O1FA 3UBPC 1VBJA 2WVUA 4WKAA 2J8TA 1U30A 4HA0A 1M41A 1Z41A 2Z4GA 1D2KA 3MVIA 3NQ8A 4DJED 1GQLA 3IIZA 2O92A 3NSMA 2F84A 4E38A 3AZRA 2DVXA 5GQBA 4JYEA 3MCNA 2PU0A 1B3VA 1US3A 4IPLA 3AIVA 1WZLA 4H7ZA 4GH3A 3C2VA 4QXIA 4GE8A 1XIGA 2WSRA 4QCEA 5HATA 1AZ2A 4XVEA 5T91A 3W1TA 1KA9F 3CUHA 2DH2A 2O9RA 4PFHA 1VS1A 1M04A 2PD5A 2ACQA 1FHLA 1SW3A 3ZWTA 1TKKA 1WBHA 4V2XA 4FALA 3BZJA 3SY1A 3M0IA 4UFKA 1IWBA 1UJPA 2YJQA 1XR2A 4LVDA 1UD8A 2WC3A 1TVPA 4BCEA 2OX4A 3OP2A 1Q85A 3NQFA 1W91A 2PC4A 1DWGM 3VIGA 1V79A 3W73A 4O0ZA 2ZWYA 3FA5A 3QKZA 3T8LA 1E6XM 1RBLA 4S2BA 2G3JA 3KCLA 3GH4A 3UNDA 4IHCA 4IG2A 1NWUA 4HOZA 3G3DA 1S3HA 1CXHA 2DIJA 2Z6JA 4CEUC 3CZEA 4KWUA 2PRMA 4GYPA 3THAA 1RD6A 1WXYA 3VIPA 5BW6A 4EP8C 4DNMA 3BL3A 2PP0A 3OG3A 4UOJA 2PLJA 2J7HA 4I9MA 3WUEA 2CHRA 3PUDA 3RO8A 2QJIA 4AZ5A 4GI6A 4NP7A 1E6RA 3AMGA 1E5JA 1XYFA 3EX2A 3U5YA 2RDTA 1C9DA 3FCPA 4PMRA 1OD8A 1QI5A 1QATA 1QHOA 3O2LA 3L5MA 1QCWA 2OKTA 4IP4A 1QASA 3M47A 5AC8A 3T0AA 1WUEA 3W0KA 5AN7A 3W1QA 1E4LA 4U31A 3U2ZA 2VMFA 1IT7A 1E6SM 5HMFA 5FF7A 4EF8A 3OIXA 1P0KA 3C6CA 3FVDA 3CYVA 3RXZA 1VBHA 4XKYB 3SUUA 2MNRA 3KBWA 1L6WA 4JX5A 4JZ5A 1XG3A 4MJ4A 4BJHA 3O0FA 4I8DA 2H9AA 2WYSA 4C6KA 4Q4MA 3MU7A 3N9SA 3S2CA 2ZE3A 5CLWA 3WG6A 1TPC1 3WDJA 3E2SA 1VEMA 3CZLA 1B57A 1R38A 1KXQA 1S39A 3MKKA 1XGZA 1H61A 2JKAA 4E5TA 4FSAA 4CU7A 3TJ4A 3ERPA 1TR9A 2VZSA 3POHA 2Z28A 3BOXA 4MB1A 4IIFA 2DW6A 3W84A 1EGVA 1GVFA 2HQAA 4Q6XA 2Z2AA 1E0VA 4DYEA 4FI4A 1FH7A 2J75A 3OW1A 1K8ZA 5LIWX 4X60A 2Z1BA 1W3KA 4JKLA 4PTXA 4JDBA 2PDFA 1B2YA 2W3ZA 3AIUA 3DN5A 4MMWA 2WAGA 1PX8A 1TA3A 2NXIA 1O4UA 3WBYA 1V93A 2E67A 1BFNA 4FLQA 1XLGA 3B3DA 3UWUA 3L7RA 3UCCA 5M3WA 3ONCA 1SFJA 3IJ6A 1OFOA 3TDFA 5REQA 1BHGA 5AC6A 4XZLX 3AIQA 2OOFA 2XFYA 4JHMA 4AY7A 3MKCA 3SCQA 5D4YA 4AY1A 2BVWA 3BH4A 3NZPA 1M68A 3BLEA 1Q63A 3ZS4A 3MKVA 4LBUA 3VIHA 4PEKA 2WHLA 3HTWA 1KV5A 2QDGA 3H55A 1LL7A 2KAUC 1S3TC 1RJQA 5A69A 4U10A 4B9ZA 3AXMA 1RY8A 4LEFA 2QMJA 2O7SA 3OHIA 4RL3A 1JAKA 1YHTA 3E0WA 2YCKX 3IANA 2D23A 5DMLA 2QAFA 4RDYA 4JYFA 3SJNA 5JBFA 4KF1A 3ITYA 1TMLA 3OHMB 4AD5A 4RKAA 2XIMA 3DZ1A 4CN6A 4UBPC 1J8VA 1TZZA 1DBTA 2ZX9A 4M1RA 1QOQA 4YU1A 3PG8A 2GZXA 1Q6LA 4RPPA 3K4WA 4DWSA 3QGKC 4JTQA 1AL8A 1BTCA 2V3EA 2NVAA 3BOLA 3E0IA 3EX6A 5FOOA 2E6YA 3SCRA 3GH5A 4GI9A 2DZVA 4JAWA 4IJRA 5A8MA 3Q65A 3S2MA 1SYTA 1WCGA 1F3XA 3B8SA 4R9OA 4N2YA 1GPWA 4NILA 5FEPA 3HFYA 1MZHA 3WNNA 2QDDA 1JRCA 3OLGA 1S1RA 1GYMA 2VWTA 4KCTA 1ZAIA 1CENA 4NZFA 1A3HA 3GNOA 1UOKA 2QCNA 4ZXOA 2Q6ZA 4KT2A 1UD5A 1RJPA 5XIMA 3S5NA 2VNCA 3C3NA 4PB4A 2ZRXA 4LUTA 3TMLA 4TXEA 1SJAA 1LOLA 3EOUA 1HJVA 1HVQA 5SWUA 4O28A 4B2DA 1DWFM 3TC3A 1XLHA 3SAZA 1W1TA 5G2HA 1YPFA 1X7FA 4B4FA 4DZHA 3WJXA 1F05A 1RVKA 4CNUA 3IAQA 3CEUA 4DN1A 3W7DA 3D6NA 3S0CA 4MAVA 4E2VA 2QDHA 1R86A 2VELA 1M1BA 9XIAA 2HWGA 2V5BA 2CLHA 1MNZA 3GC5A 2PEVA 4F0HA 3LBOA 3KWSA 1JFXA 3NAVA 4I3GA 5HR6A 1GVQA 3UCQA 1QO2A 3U0HA 4O1EA 5FJRA 7REQA 1GWJA 4HTYA 5FJOA 3EWBX 5HQEA 4L9ZA 2TODA 3LN3A 4JX4A 2J13A 4M19A 2GJLA 4QJ4B 1NOUA 1PYFA 3L5AA 4JD4A 4Z17A 4YL2A 2TPSA 3CV7A 4RCXA 4U28A 2W27A 4NAEA 4JXCA 2CBUA 4AFYA 2ONEA 1G7UA 1AJZA 2W63A 5CZTA 3A9IA 2NV1A 4L56A 3SSZA 4NASA 4NI3A 5AYIA 2Q8XA 4XWUA 1LLWA 3RHGA 1Z3NA 4WDUA 2FZBA 1ZCCA 3USZA 4E3VA 4Q4QA 1TFVA 3W4RA 1JUKA 3BWWA 3HG2A 4Q3MA 3GXIA 2ZXQA 1WX0A 2NSXA 1XPYA 3VOHA 5LZLA 4UQ9A 3SBFA 4FLOA 1J0ZA 2J88A 2XM2A 5AECA 3TN4A 3F7JA 3HG3A 4YS1A 2OPJA 4GY1A 4W8AA 3QC0A 3FGCB 1IIGA 1H49A 1QHPA 4L1GA 3DKJA 4PBFA 3GU1A 4B5WA 1J01A 3S5OA 2BY2A 1LRTA 5AKQA 1V08A 4IWWA 2PDHA 1TV4A 3E0LA 2AQVA 2R1LA 1HJXA 3W7OA 2EPLX 3HIJA 2Z6IA 4QLJA 4D6HA 4X63A 4NHVA 4CQCA 4WGXA 1A5NC 1YEYA 2KX9A 4LANA 3LLXA 3NVTA 4FP1A 4PTWA 4EAYA 1W3IA 4S3AA 4FX7A 4UTW