3RLVA

Crystal structure of the mutant y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
220
structure length
220
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 86
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rlvA00
3CHVA 2P0OA 4FXSA 3T4CA 1ZNNA 3AJXA 2YYTA 2AQWA 1FY6A 3WK0A 1UB3A 3G1FA 4N4QA 4P2VA 4QJ1A 2D73A 2WOQA 3QM3A 3DFOA 3TFXA 1TPC1 3P84A 3W1AA 2JKAA 3OBKA 4FIQA 5EYWA 3S5YA 5EY5A 1ME9A 1VQTA 3M5ZA 3WFAA 3E0IA 3W9ZA 3EWUA 4XBKA 3L66A 2VENA 5CSSA 4O1CA 3N9RA 3IIXA 4I7UA 3M5YA 1HG3A 1O4UA 1ZAIA 5FF7A 2A7PA 3PBYA 2OT1A 1L9WA 3TA6A 4E2BA 5C2XA 2DJLA 1MEHA 5D2VA 1RV8A 3FLUA 2PURA 5CSRA 4ZQRA 3QYQA 1B3OA 1XUZA 1OFDA 4MJZA 1QFEA 1XC4A 1KV8A 3S9YA 4TMBA 2QCLA 4S2CA 1EIXA 5EKYA 2Z0IA 1VJIA 3OIXA 4H4IA 4JR5A 4K7VA 4CCEA 4R7JA 1H7XA 1CX9A 2WKJA 1KTCA 3ATZA 1FUYA 1BKSA 1QNVA 1R30A 3O07A 1DKWA 3JS3A 2Z6IA 3N2MA 3LX9A 5HR6A 2A0NA 3H54A 4ADSA 3EKZA 5HQEA 4OU1A 3TK7A 5U7SA 3TH6A 3NPWA 3GVGA 3SR7A 1TTIA 4POCA 1G4EA 4DXVA 2F84A 3UZ5A 3W70A 3R5EA 3TAKA 3DFNA 1DBTA 3M47A 2VFGA 1H51A 2O7SA 3W2UA 3VI2A 2V9DA 2LLEA 3P7YA 1KM2A 1EWDA 5LHFA 1OFRA 2B0MA 1JULA 4ML9A 4IXHA 3G1YA 5AFDA 1K8YA 3HG3A 3WJXA 1KM1A 1XM3A 4N9BA 5LKYA 1P5BA 2W79A 4JGDA 1L2UA 1OK4A 1IXNA 1GZGA 1Q6QA 4JX4A 1W3TA 4DEFA 4Q4KA 4R34A 4LT9A 1ZAJA 1VPXA 2ABAA 2ALDA 1YADA 2VEKA 1FDZA 4R53A 4FX6M 1CW2A 3G8RA 1W5PA 1HUVA 4NT0A 4LV9A 3E9AA 5G1TA 1Z41A 1O94A 3KVMA 3CQ0A 3IRDA 2NX1A 4JIQA 4O12A 2GVLA 3W2JA 3C52A 4BWLA 2A5HA 5CZTA 1W5MA 1W3NA 3S1UA 4Z0JA 3BVJA 3EWWA 2QR6A 1S3HA 2VEMA 3MWAA 4CQ9A 3U2OA 2ZFAA 1SZFA 1KFJA 1O60A 4JEQA 4NX5A 1A5AA 4O0KA 4AHOA 1TV7A 3GNNA 3UYCA 4PH6A 3CB8A 3N14A 3B0PA 4NJHA 3V1PA 4O4WA 1M7PA 2FTPA 7TIMA 1Q6OA 4ZVJA 3GR8A 3CM4A 1GWJA 1KFCA 4GUJA 3M7WA 6TIMA 3W2NA 4QM1A 4UMAA 1WDWA 3W2MA 3GAKA 3TKFA 3BW3A 1G6CA 2ZBTA 4M6PA 2NUXA 4M6QA 5I3GA 1TQXA 4WUIA 3W1MA 3MUXA 3O1NA 3ATYA 4FB7A 5DN1A 3NQEA 4HT3A 1RR2A 2QKFA 1FQ0A 3S1VA 1XI3A 3BK0A 3TC7A 1F05A 4AF0B 1P0NA 3PC0A 4NJIA 1YTKA 3QEZA 4UCGA 1SSDA 2DORA 5D05A 1FCQA 2QF7A 2ZZ1A 3LCFA 1PHWA 3P82A 4HKPA 3FKRA 2Y7EA 5K4ZA 3FJLA 1Y0EA 3IIOA 3W7KA 1G7UA 5FF0A 1SQ7A 1X8FA 3P80A 2YW3A 2ZZ3A 2VEIA 3GNDA 3IVUA 3KRZA 4I7VA 4UTHA 3VE9A 3W86A 1AMKA 4HSOA 1H1YA 4GFSA 3KRSA 1QPRA 3FIGA 5DCEA 4DO4A 3G1SA 2GOUA 3W7IA 1WBJA 1QOQA 1M6JA 4NQ1A 1D3GA 4BWLC 2GQ9A 2X1TA 4LOCA 4Y9AA 3GXTA 4UTJA 3TMQA 4JY8A 3EX3A 1B4EA 2CLOA 5G1YA 2DZPA 2H8ZA 3NM3A 2OCZA 3LRMA 3B06A 2DZSA 1EP2A 5DY2A 3QMSA 1DQWA 2X30A 1GT8A 2B7PA 3EX1A 4GUGA 3IGXA 4HSNA 4Q33A 1A5BA 2EF9A 2YW4A 5A5WA 3PG9A 1TJPA 3GAYA 1LOQA 3BLEA 5HWJA 2BX7A 1Z48A 3B03A 4Z1AA 3TSMA 3HBLA 2GUUA 3NZ1A 3QW4B 5KZMA 3QSRA 2X16A 2A7RA 2V2HA 1FCUA 3BGJA 3GZ3A 1JCLA 1R47A 4M7SA 2C1HA 4L4LA 5IBXC 2CLLA 2YCEA 4I7WA 3PY2A 4N9EA 4IOTA 3QC3A 3VE7A 1P0KA 5EL1A 5LSMA 5D2TA 4WOZA 4DELA 1KFLA 2V2CA 1OF8A 4GRSA 2Z6JA 3P60A 1XCFA 1I2RA 5AC7A 8TIMA 4AAJA 3G3MA 2NUWA 1KM0A 1H7OA 3T78A 1XUUA 1YXDA 3G22A 4NXSA 2VFFA 1XL9A 3TW6A 3NXFA 4UFLA 5DLCA 4DF2A 4IUOA 4EVZA 3LOTA 3W7LA 1F6KA 4WX2A 3TQKA 3W1RA 2X1UA 2CZDA 3KHJA 3LGEA 3LHWA 3QQ1A 3M44A 3ABRA 1W5NA 5EA9A 1Z44A 4IXXA 4Z1DA 2FDSA 3OEXA 1TPDA 2P1FA 3L65A 2XN1A 3G3DA 3LTSA 5HJLA 1W3IA 3NAVA 1KV5A 3ZFHA 3N9SA 3MBDA 4FHAA 1OYAA 3MMTA 1LP6A 2YYUA 4JTLA 2A2IA 1B9BA 1ZFJA 3NQ2A 4UFKA 4N02A 3TROA 3EB2A 3MYPA 4MZ8A 1TTPA 3O15A 4GUFA 2OT0A 1D3HA 1MEWA 3RNDA 4N6FA 1D9EA 2GQAA 1FWSA 2GVGA 4HN4A 5G4EA 3A24A 5DXYA 3W1PA 1NFBA 3SSJA 4UNLA 1XDMA 3QH2A 1GYLA 4TU1A 3H55A 2F7FA 3TQVA 3LV5A 1N8FA 1KW1A 1W37A 1MZHA 1MXSA 1P1XA 3Q58A 4KWVA 3B04A 3C2EA 3VNDA 1EB3A 3GKFA 5AB3A 5T26A 3S6DA 4AWUA 3UY7A 1X6UA 3W1UA 3WJZA 3VCRA 1UCWA 1JCYA 4MKNA 2H3DA 4ALDA 1WBHA 5F1VA 1QR7A 2TYSA 1NEYA 4O16A 4AVFA 5DBUA 1LLZA 3SECA 5DELA 1OABA 3LXAA 2BLEA 2O7QA 3B4UA 2FLIA 2Z2UA 1KTNA 3EX2A 5I3FA 3TX9A 5FEPA 1OK6A 1TPVA 1PE1A 3DHFA 3Q2DA 1B57A 3SW6A 3HPSA 4FNRA 4N4PA 4O1AA 3M5VA 3LB0A 4HIBA 5D37A 3GXNA 3BLIA 2JGYA 4UR8A 3A9IA 1F2JA 1W5OA 4JIPA 2ZZ7A 4H3DA 2J27A 1F73A 2CW6A 2NWRA 4JICA 3HGSA 1Q6LA 1VR6A 2ZTKA 2TSYA 3HMJG 1FBAA 3OA3A 4UMBA 2B7OA 3N2XA 2IQTA 2W0UA 3L5LA 4LTSA 3O6CA 5A8GA 2QAPA 5LZLA 3W84A 4WXZA 3LV6A 2QCEA 1M5WA 2RFGA 2PCQA 2J88A 2Y70A 2ZRZA 1N55A 4UTWC 5AC8A 4KFNA 4MY9A 2QCDB 4JXCA 2VFDA 3DH7A 4JY9A 2Q8LA 1DV7A 1SZEA 1EWEA 2YFOA 2ZCGA 2E6AA 3NQAA 3IIZA 3C2OA 4X22A 4DF0A 3QMTA 5SWUA 2X1SA 3BGGA 3B0UX 3HG4A 2B7QA 3BG5A 5CPLA 4IQLA 5H91A 3A5FA 2J9XA 4DPPA 3W7OA 3WK3A 2NZLA 3BO9A 3NM1A 4UXDA 1KA9F 5I3KA 5TBOA 2ZYFA 4A3UA 1WOAA 3E12A 4GC4A 4LWWA 3NL6A 5C55A 4KWWA 1QOPA 4NZFA 5BMWA 1K8ZA 3M16A 1TO3A 1NF7A 2V8ZA 5F2GA 2PRMA 3G1XA 4AEOA 2CLHA 1PV8A 3U6WA 3UWVA 3QFEA 1LLWA 4LVAA 1KM5A 4UFJA 3NGJA 5BW6A 2PRLA 3S5NA 1L6WA 3G0XA 4EWND 1L6SA 3GDLA 4LU0A 3M43A 3WJWA 1G69A 4HNUA 3TUUA 3STFA 4JTIA 4LRSA 3HGOA 2OMAA 4UFIA 4UNKA 2BTMA 1JCMP 1SU5A 1JVNA 1SUXA 3TV8A 5MHBA 2CLIA 1LOSA 2RKXA 5K9DA 3UZJA 1OF6A 3A5VA 3W7RA 4MOZA 5FEZA 4K8HA 3S1WA 4JN6A 2G96A 4P61A 4E2DA 4NJJA 1RPXA 1NF0A 2E5DA 1T99A 1H60A 3ABOA 4IWWA 4QSHA 2QCMA 2Y61A 2YR1A 4S2BA 3PBUA 1JRBA 3G0SA 3S5ZA 5D04C 4GWEA 4YL2A 3IV3A 1IGSA 4JX6A 1K7EA 3TJLA 3OVQA 4KFOA 5AHEA 3C3NA 2V81A 4UTLA 1MO0A 3P8IA 3QMRA 1ZALA 3RK8A 1DOSA 2ZDRA 3W7MA 5HNRA 3C6CA 2CLEA 3W7PA 3UXAA 1OFQA 1SFLA 2G5WA 3PB0A 3QJAA 3CC1A 1DQXA 3L5AA 4M7TA 1K8XA 5L6UA 4AMAA 4YLWA 1GG0A 3SZ8A 1HO1A 1XBYA 4HNVA 2ZA3A 1FX6A 3W3OA 5K2ZA 4O10A 4WXYA 1OVDA 2QJIA 1QDSA 1TPB1 5G2WA 3OVRA 5KITA 4PFMA 3NL2A 2DJXA 3N19B 4XBSA 2FPYA 1EPXA 4XKYB 1TYGA 4RKAA 1UASA 1WA3A 2ZRWA 1YPIA 2VFHA 4RXGA 2YGYA 3OHIA 1NVMA 1TQJA 4IX2A 1LBFA 5K9CA 1GVOA 4Y8FA 3W72A 2TMDA 3PUEA 4O1DA 4UFMA 3NPXA 3NQGA 2J9ZA 1LROA 2A1YA 3UWYA 2WQPA 1QMLA 3LHUA 2G97A 2QJGA 2WNQA 2VOMA 3LCLA 4PL2A 4MJMA 3M41A 4JTJA 2DZXA 4OGZA 1VLIA 3FJ6A 3ZS4A 3I68A 1KM6A 2OZ0A 2I14A 3DKJA 4NJKA 3S0CA 3TXZA 1RQEA 3W22A 4QIUA 4Y6GA 1X1OA 4C1LA 3INPA 2FIQA 1KLZA 4MIMA 4NJGA 1I2OA 1V7YA 3KFTA 3NO5A 2ZRXA 4Q32A 1W31A 2GJNA 3W1LA 4AXKA 3TDFA 4YMZA 2NLIA 1YDVA 3WK1A 3NQ7A 5D2YA 4JYFA 2R91A 1R2RA 4OWGA 3LCIA 3NPVA 5D32A 4M19A 1G67A 4L4MA 4UTTC 1K3UA 4JD4A 2Q3OA 5D02A 3L21A 5IBXA 3I7QA 3EKLA 1GG1A 3NZRA 4FX7A 1O5XA 2A6LA 2C16A 4LVFA 1K7FA 1AK5A 3DAQA 2C6QA 1YTEA 2Y63A 3FS2A 4FF7A 1QCWA 4K37A 4BI6A 1PL9A 4NNBA 3QRHA 1SZGA 3QF0A 3NVTA 2FPVA 4ADUA 3TXVA 4EIVA 3HGJA 4LVGA 3L67A 4TIMA 3CU2A 3RFAA 4BK9A 1JQVA 1FWRA 2TRSA 1AL7A 2ZQ0A 5K7JA 2ATSA 1EEPA 3GKAA 5HUPA 3CIWA 3W7GA 1S5VA 4CNPA 3BG3A 1HO4A 2V0TA 5J5RA 2WNNA 1TSIA 3W83A 3BW4A 3R8RA 2BZNA 2C18A 1GPWA 1RQBA 1LBLA 3ZWTA 4UTMA 3SJ3A 1IIGA 3TU9A 1UBSA 4MY1A 3EWYA 2A4AA 1TTJA 4UMCA 4WZHA 1EUNA 4NNAA 5CZJA 1EP1A 3EWZA 3GR7A 4CCCA 4AHPA 1YTDA 1KTBA 4JX5A 3DFPA 5D03A 3FA5A 3W85A 1PVNA 4GUHA 1OX5A 3B05A 1Q3NA 1X7FA 1VHCA 2VELA 1F5ZA 2VFEA 5F2MA 3MI2A 4IMGA 5AYXA 3P62A 1W56A 2JK2A 2TPSA 2VEPA 2C0AA 3LLFA 3O6YX 3BLFA 1SFJA 3LCXA 4NXKA 1TPWA 3O05A 3TJXA 2V2DA 5BOOA 4PL1A 5AHLA 5HUOA 5LGXA 3W2LA 2ZRYA 3S1XA 1W0MA 1ADOA 1KFEA 3SGUA 4R33A 3IIVA 3M0ZA 1QPOA 4DPQA 2E6DA 1TV8A 2Q3RA 4LVBA 4O8RA 3L68A 2RDWA 3C56A 3L9CA 4RJEA 4GUIA 4C1KA 3IGUA 3UWWA 1Q6RA 5FF3A 3EXRA 1C9DA 3MJYA 3PM6A 1A50A 2YX0A 4UC5A 3I7RA 2Z1BA 5HWMA 5HULA 3NR0A 1LTDA 3UXDA 5KSWA 3UPBA 4AWSA 3LBMA 5FF4A 2YFNA 5I3JA 2JKPA 3P8JA 2I9EA 2ZRVA 2QDHA 2Y7DA 2C14A 4JS3A 1H7WA 2FB2A 1Q45A 4IJBA 4OBTA 2NWSA 3O6DA 3G1HA 4EF8A 4JDBA 3UWQA 3F03K 4OE7A 1OFPA 4K39A 2NX3A 3KOFA 4WQ6A 2PRHA 5G5IA 1J5TA 1LORA 5I3HA 4NNCA 4O57A 4LUIA 3PWAA 2QJHA 5F2IA 1O95A 3MHFA 1BEUA 4I9AA 4AHQA 3KVJA 4K7YA 5D09A 4UFHA 4QQ3A 2R94A 4XTDA 2QUTA 1T8XA 1TMHA 3STEA 1ZHAA 4NZJA 5C54A 4NU7A 1LRQA 2JKEA 3UY8A 5LNRA 4KFPA 3V75A 3LTPA 2RHGA 4UTWA 3KVLA 4IX0A 3NG3A 4BR1A 1PHQA 2WV8A 3DHDA 4LS0A 1LM1A 4YXGA 3DI1A 2ZA1A 3T7VA 5BRBA 1K02A 2QCHA 4ZQMA 1ZAHA 1F7BA 2DZVA 3ANYA 1SO5A 1T96A 1A53A 3NEVA 5EBUA 5F2LA 2J9YA 3BARA 4H6KA 4B5NA 1VLWA 3PR2A 3M9YA 1UJPA 4RZ4A 4WD0A 3DXIA 2CLKA 3GX9A 4D2JA 3HG2A 4LS2A 3W1NA 2QEZA 1KFBA 3MP5A 3LHTA 1FWNA 3O16A 3I65A 4LW7A 3FOKA 3TC6A 4IGHA 4HNNA 1A5CA 4FNQA 3TFCA 2HS8A 1XDLA 3NQ8A 1FXQA 2FPTA 4MYAA 3W76A 4IPJA 4JYDA 5FI8A 1TPEA 1CI1A 3LI0A 3S5OA 3F4NA 4Y96A 3ZWSA 3DU0A 1WX0A 4UTIA 3LI1A 1I2QA 1VYPX 3DZ1A 3E49A 4TMCA 3RLVA 3GK0A 4XKYA 3L5MA 3NQMA 4NVTA 2EHHA 3LCWA 4FEZA 2WJZA 3QSTA 3W1QA 5HMSA 5E1QA 5AYZA 3E96A 3MHGA 1H7RA 3PS7A 1V5XA 3L0KA 2AAMA 3MBFA 3FYOA 2V5BA 3HQ1A 4UUIA 5AOUA 4PODA 3ABSA 2ZRUA 2X2GA 1PS9A 3IEBA 4JTGA 4AH7A 1JCNA 1PCKA 2WSQA 1NAL1 2A85A 3TSBA 2AGKA 2C15A 3F4WA 2Y88A 1KFKA 2ZA2A 2CZEA 2RDTA 1G4PA 3MW7A 4EOUA 3KX6A 1UUOA 3Q94A 1WV2A 3LRKA 4PC8A 1W1ZA 3PUOA 2J6XA 4X2RA 1A5SA 4IMCA 3W7HA 2DP3A 3LRLA 4MYXA 1ML1A 3W88A 4X9SA 2ZZ5A 3T55A 1IXQA 1RZMA 4QNWA 4O52A 1YXYA 4BF9A 1HL2A 1SW3A 2ATMA 2C13A 1KBIA 1ALDA 3ZR4A 3G0UA 2CLFA 1TCDA 2H3BA 4LNYA 4M5PA 1IXPA 3KXQA 4GNJA 4LRTA 1KM3A 2B7NA 4DQWA 1U5JA 1GEQA 4DBEA 1AW1A 1DJQA 1H5YA 2RDUA 3A23A 5F4WA 5F4XA 5BMXA 2GJLA 3K30A 4XZ9A 3HO8A 5KMYA 4AF0A 4FNTA 3W6YA 3W7DA 5CPOA 2XN2A 3LTYA 2CWNA 3DENA 3GYEA 1VCVA 3QW3A 1U83A 3HG5A 3EWBX 1TIMA 1G4SA 3ABQA 2ZZ6A 4JTFA 5C5YA 1GYNA 4M6VA 1VS1A 5G4WA 3C61A 3MI6A 2C3ZA 5H2ZA 3MHUA 1QO5A 1XBZA 3W7CA 1R2TA 2FQIA 2A6NA 3R89A 2QDGA 5LNWA 3BW2A 3W7JA 3HIJA 3HJZA 3NQCA 3A21A 1OX6A 2BXVA 2E77A 3GDMA 1I4NA 1I8JA 2NV1A 3C8FA 4RLIA 4O4VA 4WOQA 3EWXA 2V5LA 5I3IA 1TV5A 2VC6A 3LXBA 4CCDA 3WJSA 2QUUA 2ZZ2A 1SSGA 1TPFA 3BV4A 2A21A 2UV8G 2ABBA 4LUJA 4MUZA 1N7KA 1R46A 3KAOA 4XTIA 4JYEA 3C4UA 2H8XA 5FEWA 5FESA 3USBA 1GJPA 4PTNA 1B4KA 1XKYA 4A21A 2ISSA 1GOXA 3JRKA 4Y90A 1JCXA 3GIYA 4MFEA 3HPXA 3NOEA 4LVDA 1EX5A 4CQ8A 4O17A 4RV8A 2CU0A 5EMUA 3C2VA 2ZZ4A 5AYYA 4UTTA 1VCFA 1OX4B 3SY5A 1GTHA 2VKZG 3LCGA 1SO6A 3IVSA 3THQA 1TPH1 1HFBA 6ALDA 4O1BA 4DF1A 5HINA 2R8WA 1OFEA 3YPIA 1LRNA 3PUDA 5CZSA 1TTQA 2QUVA 1G4TA 3P67A 1VYRA 3NL3A 2WO5A 3CIXA 4WY0F 1AW5A 2X1RA 1ICPA 5LGZA 5G2IA 4RZ6A 2WSYA 1AL8A 3IIPA 3EXTA 1H1ZA 1H61A 2CZFA 3NPUA 4BI5A 2VXNA 3NDOA 1FDYA 5CKSA 5AC6A 1UUMA 1LBMA 5D30A 1ME8A 1VHNA 1I2NA 4IMEA 1JCJA 1ZY9A 1C8VA 4WY0B 2HSAA 3OVPA 4JTSA 2YDAA 4O28A 3EX6A 4CNNA 4DO6A 1VC4A 1OFAA 3RLUA 3OG3A 3N73A 3MP3A 1WXJA 1JJKA 1LDCA 3DBPA 4JTKA 1H7NA 3TMLA 4FX8A 3NQVA 2G95A 1IIHA 3G1DA 4JTEA 2FFCA 3G1AA 3W2KA 2E6FA 4BI7A 3STCA 4WJEA 4JTTA 4ORIA 4PA8A 2EGZA 3M1ZA 4OV9A 1VZWA 2P10A 4U4MA 2E09A 2GPTA 1SR9A 4S1FA 2ISVA 3THAA 2YSWA 4Z08A 2RH9A 3T40A 2DZUA 1PCWA 3I7SA 3CEUA 2OX1A 4G1KA 4MFDA 3DGRA 4Z0SA 4RCXA 3UQNA 1OFOA 1BTMA 4UIOA 2J24A 5L9FA 4ICNA 1BWKA 3MYOA 3LERA 4FO4A 4UR7A 1QWGA 3DFSA 1TB3A 1GVFA 3RF9A 3GB6A 1GVRA 3NL5A 3GDRA 4K6AA 4ZQNA 3LLDA 2CFFA 1FWWA 5AN7A 4GXMA 1OJXA 4N9DA 2E6YA 4MVAA 1H63A 1LOLA 1ICQA 4LY8A 3KVKA 4O18A 3UWUA 5CG7A 1EA0A 3TCEA 5J5DA 1YDNA 2WPBA 3QZEA 1OYBA 2BWGA 1S5WA 3STGA 4QITA 1OYCA 3L2IA 1GVQA 1XBVA 5DBTA 3SFKA 3W1TA 4FIRA 1TREA 1SO4A 4O53A 1ZJIA 2E1DA 4Z1CA 1SO3A 5DCBA 5DXXA 4FXRA 3TR2A 2XFWA 5F4SA 2E5BA 3CTLA 2NV2A 4HPJA 1KM4A 5CPNA 4QAIA 2HS6A 2NUYA 3B0VC 1SZNA 3C0JA 1DHPA 3PVFA 1OHLA 3W7QA 4K8EA 1RD5A 2PC4A 5U4NA 3NA8A 1MSSA 4ZL1A 3IGSA 3O63A 4RK8A 3LXCA 3TW7A 3O8AA 2BSLA 1C29A 4GJ1A 1LRTA 4QNEA 1JQXA 4DBDA 1JUKA 1WQ5A 3CEPA 4O50A 3Q37A 3EX4A 1VCGA 2YPIA 4ZQPA 3MI3A 4FNUA 3PBWA 4CLMA 3DFQA 3CWOX 2DZWA 4A29A 4HHPA 3D0CA 4E38A 4PCFA 3CLMA 3PG8A 1X1ZA 4A22A 4JTUA 4BFAA 5KINA 1E51A 1F76A 3GDKA 3IVTA 3QPYA 2EAWA 5K9XA 3N3MA 1YPFA 3QQ0A 3NYZA 3UPWA 3EXSA 4ORMA 3W71A 4CNOA 4NX0A 2EKCA 1FCBA 2ISWA 2XN0A 2Y62A 4HPXA 1ME7A 3EEGA 2YZRA 1W8SA 3AO0A 3TAOA 1SW7A 4OQVA 5C6MA 5FEXA 2QCCA 3LHZA 3DI0A 1VH7A 3SGZA 5LNSA 4O14A 3SIZA 1P4CA 4AWTA 2Q8ZA 1BWLA 4PEKA 1DVJA 3G1VA 4ZZ9A 4ZQOA 1XBXA 2A7NA 4LC8A 1OFBA 1TPUA 2QCDA 4X3ZA 5AHNA 3TQ0A 4MY8A 4NUWA 1XXXA 3DFTA 2R14A 4RZ5A 5D38A 1I45A 1GVSA 2OJPA 4TX9A 1QO2A 1ZCOA 4ZQCA 3HPZA 1O5KA 2HMCA 3C2FA 3PAJA 2GQ8A 5TIMA 3CT7A 4U28A 3HF3A 3NQ6A 1FWTA 2NXGA 5KZEA 2H90A 2YXGA 2I1OA 1KBJA 1AW2A 1F6PA 3VKJA 3LM7A 2QCFA 1THFD 1HTIA 1L6YA 1KLYA 4N2YA 4MZ1A 4IPIA 3PSWA 1LZOA 4RX0A 2E68A 2Y85A 4K36A 1YYAA 5D2WA 3LDVA 1OG0A 2CLMA 2V30A 5IM51 1ICSA 1T0OA 3RMJA 2QAFA 3ELFA 1H62A 3G8EA 4TO8A 1YXCA 4LS1A 4IMFA 1VGAA 3DKLA 1M7OA 3S42A 4YCPA 3LBCA 3N34A 2NXHA 3QPZA 3O06A 1W54A 4FNPA 3R2GA 5CGQA 2QCGA 4XWUA 1J4EA 2ZTJA 3CPRA 2KZHA 1DL3A 2Y6ZA 3L0NA 1LYXA 1QAPA 4JDYA 3PB2A 1DJNA 5EPDA 2NXIA 5E93A 3UNDA 1GQNA 4OHQA 3GDTA 3NQDA 3P74A 4OV4A 2EPHA 1LCOA 2C19A 5LNUA 2V82A 1R2SA 4QISA 3NQFA 3P81A 1TRDA 2JGQA 3WJYA 1IXOA 5HR7A 3FFSA 3TNOA 1G7VA 1JR1A 1WYIA 1QPNA 3FKKA 3RU6A 1GTEA 3W74A 1S5TA 2PE4A 5K3VA 1ONRA 1DORA 1OX4A 4O0ZA 4CQAA 4UTUA 4MZYA 2JBMA 2H6RA 3E02A 3KRUA 5F1UA 4JNMA 1NSJA 1FCVA 3MP4A 4YWIA 1XFBA 5AHMA 3NNTA 3M5XA 1JUEA 4LC6A 4TR9A 5DCDA 2Y7FA 3B8DA 3HGRA 3HB9A 5DY3A 1WOBA 3W07A 1YLVA 1TRIA 5AHIA 1F74A 4GBUA 4E0CA 2FJKA 2QCNA 5CPMA 3U8GA 2W6RA 1K7XA 3LHVA 2GVJA 5KTLA 3HOJA 4N9CA 4ONVA 3TIMA 1VYSX 5KZDA 5G2HA 3FYPA 3W1XA 2FB3A 4O54A 4MLJA 3GLCA 4RR4A 4ZMGA 3P61A 1H7PA 3C2RA 1QPQA 4WY0A 3LCHA 3LHYA 3W7NA 2VFIA 2CZ5A 3L0GA 3H53A 1RVGA 4O11A 3R12A 4J9JA 4UTKA 1H50A 3F1QA 3R13A 3I6RA 3M6YA 3W23A 4IMDA 3W87A 4RXFA 4O13A 4Z1BA 5D33A 5CZ0A 4A2RA 5K4XA 3BPWA 2WNZA 2HTMA 1JRCA 2DU2A 1SPQA 2NX9A 5ABTA 3BG9A 5LNVA 4MLRA 1FXPA 3PULA 5GVJA 3S8HA 1YDOA 4GE8A 1JUBA 3MO7A 3SI9A 3A22A 1W5QA 5LHEA 1MEIA 4EF9A 3PSVA 4A2SA 4KKXA 5FF2A 4FNSA 1TJRA 1SW0A 4O19A 2DZTA 3G24A 3JR2A 1J2WA 3T44A 3TSDA 1EP3A 1IF2A 5D2XA 3W7EA 1ZENA 4LV4A 3TE9A 3UD6A 1VRDA 1RQHA 3G18A 4XQ6A 1I2PA 3PF3A 3UWZA 3P5ZA 2Y7GA 1WAUA 2Y89A 4ADTA 2B4GA 5HWNA 3W75A 1K03A 4MPQA 4OT7A 3WK2A 1PIIA 3GXPA 4YCOA 4HNTA 2WSRA 5BNKA 3CWNA 4AB4A 4DO5A 3VFLA 4W9TA 5TQLA 3W73A 5AHFA 1Z42A 4XUGA 1FDJA 5E0KA 4K38A 4N6EA 2E5CA 3P5YA 3FEMA 4O15A 1AG1O 4JTHA 3PBVA 1EUAA
chains in the Genus database with same CATH superfamily
2L5HA 4FXSA 1XYAA 2GVYA 1ZNNA 5C2CA 3SCVA 3NSXA 2W66A 3V0TA 1UB3A 4QJ1A 4E4PA 2D73A 1H5VA 1OC5A 2CNCA 5I24A 1ZCCA 4QJ5B 1NWUA 3TFXA 2JKAA 2BVDA 5EYWA 3S5YA 4UWMA 1ME9A 5DQPA 1O1ZA 1Q6FA 3WFAA 8RUCA 2WSKA 2BOGX 1J5SA 3QHNA 2J62A 1NDZA 4O1CA 3N9RA 3IIXA 3AWOA 3MUY1 2HDJA 3B8WA 5FF7A 4LXFA 4C1NA 3VM7A 5C2XA 1EGMA 5CSRA 4ZQRA 4US5A 3SRFA 4TMBA 3VPLA 1XDJA 4H8VA 3ORWA 1IQ8A 2Z0IA 4JR5A 3LPPA 5HPOA 4K7VA 3PPGA 3MMDA 2OGYA 1FUYA 4MNJA 1BKSA 3O07A 3JS3A 3WMBA 4F9DA 4TVUA 4HZ8A 1IV8A 3PZQA 4S38A 1R38A 4DJFA 4BKNA 4G7EA 5AC4A 5HQEA 2HRWA 3APYA 5U7SA 3TK7A 3NPWA 4JHZA 5I7GA 1QU4A 1R85A 4DXVA 3W70A 3DFNA 1IZKA 3HV8A 4JNZA 5M1TA 3A4AA 3W2UA 2E9BA 1UJQA 1KM2A 1ODZA 5LHFA 3L7RA 4IXHA 4L9XA 3W29A 3HG3A 1ONEA 1XM3A 1KCKA 4R5EA 1SJBA 2VGIA 1L2UA 1OK4A 1GZGA 2J75A 4D72A 3PTMA 1YNPA 1CT5A 4EPEC 1K77A 4IG2B 3UJEA 3F4DA 4R34A 1ZAJA 1JZ5A 1VPXA 1MFUA 5IFPA 5I79A 2ALDA 3H23A 4QLLA 4R53A 3K4DA 2J66A 3UU0A 3G8RA 1ADDA 3NXLA 5G1TA 1V6XA 1J0HA 4NKCA 4YS1A 3KVMA 1Y7VA 1EQCA 1XYZA 3GYCA 3NGFA 4O12A 2GVLA 3W2JA 4JTCA 1K70A 1W5MA 1W3NA 4LAMA 4QLJA 1CZ1A 3BVJA 4L4OA 3UW6A 2VDIA 2VEMA 4JHOA 2YL6A 4DXXA 1KFJA 3AHXA 3AS3A 4JEQA 1JAEA 2V63A 5FL1A 3BICA 3GNNA 4QTGA 4PH6A 2HXUA 4EK7A 2ZDSA 7TIMA 5FJPA 1Q6OA 5G4HC 3GR8A 1QUMA 3RAOA 4PCPA 4LAZA 3VNIA 2FKPA 1KFCA 3M7WA 3WLIA 4UMAA 2HQAA 3RLHA 3GAKA 3TKFA 4JOMA 3TLQA 2ZBTA 1XC6A 4M6PA 4A8RA 1NELA 5ABFA 1W1TA 2Z7KA 4G9PA 4HU8A 1RR2A 2QKFA 3S1VA 4H9MA 3T0AA 7ENLA 2J4GA 1F05A 3TC7A 3WD2A 1E0WA 2ONEA 4AF0B 4NJIA 3TOPA 5FOOA 1SSDA 2PZNA 2DORA 2QF7A 1OINA 4XAZA 4YHGA 4PE8A 3FDGA 5A6BA 2NLYA 3FJLA 1Y0EA 1UD3A 1G7UA 4Q4PA 1M04A 2C0HA 2YW3A 2ZZ3A 3IVUA 4MGGA 5D9MA 4WDTA 4IPLA 2VX6A 2I5QA 4GFSA 2P53A 5TAOA 5AVNA 1PTGA 1QPRA 3A3HA 2VZUA 2GOUA 3VA8A 4W8LA 4ZBCA 4NQ1A 1D3GA 4BWLC 5D9PA 4ATWA 1J12A 1ZJAA 1POJA 4ES4A 3EX3A 1B4EA 1V6TA 3TVAA 3VNMA 4S39A 4H9YA 2QT3A 3QGAC 1EP2A 3ES8A 3AIWA 3IGXA 3PG9A 4CD7A 4HBKA 4D9PA 3GAYA 5M3WA 3EPOA 5C9WA 1QATA 3HBLA 2F61A 1LT7A 2GUUA 4B2DD 3H4XA 5KZMA 3VC5A 3S46A 1FCUA 3ABZA 3EYPA 4C6LA 1R47A 4M7SA 4CN1A 2CLLA 5CJ5A 4N9EA 5LSMA 3CTTA 4QEEA 3ZXWA 5HNTA 5CG0A 4DELA 4B4FA 3H2OA 1KFLA 4GRSA 3QTPA 3P60A 1XCFA 3ZJ7A 3WYZA 4JFSA 1CGWA 1KM0A 3T78A 4ZOCA 3UG4A 1YXDA 3W24A 4NXSA 1XL9A 1U30A 1F6KA 3ME3A 4WX2A 4GQQA 2X1UA 3QQ1A 3VIGA 4IXXA 5A69A 3LA4A 2D22A 3VNZA 3G3DA 1KV5A 3UGVA 3ARQA 2HVNA 1FHLA 4IJRA 3MMTA 4JTLA 1REQA 4C6QA 4UFKA 4N02A 3TROA 1HP5A 3EB2A 1GOWA 4MZ8A 1TTPA 4PB3A 5JIPA 4ENLA 1VFMA 4DUOA 2AL2A 2DVXA 2R1LA 3MQTA 2PS2A 1V3JA 2YB4A 3UJ2A 4YPJA 3SSJA 1XDMA 4C6BA 1OC7A 3H55A 2F7FA 1M65A 4BF7A 1N8FA 5BROA 1ZB5A 1B54A 3BQ5A 4J2MA 3USZA 3MUIA 4FPSA 3Q58A 5I23A 3L2LA 3S6DA 3GD6A 4AUBA 4ERGA 4LAUA 1XSIA 4MB5A 3WQVA 2ZXAA 3RCNA 1WBHA 2TYSA 4IGNA 2J78A 1E73M 2ODOA 1W9PA 2UY5A 4ERIA 2F6KA 3OBAA 3B4UA 2FLIA 1EJVC 4MTVA 3TX9A 5EGRA 1GW1A 2A79A 1HGYA 3VD7A 2PU1A 3DG6A 3BOXA 4KS0A 2QS8A 2V3FA 4JEJA 1B57A 3K13A 3FGCA 3SW6A 3HURA 2VR4A 4OECA 4AMCA 1W9XA 3WQ4A 4JIPA 3UG5A 1X39A 1E0TA 3KP0A 3GH7A 2XJ7A 3UJFA 3GUGA 2ZTKA 4OZOA 4UMBA 1A4MA 3L5LA 4LTSA 3QKZA 3O6CA 3M0JA 2P3ZA 5A8GA 5LZLA 5I03A 4WXZA 4IFOA 1M5WA 5ECUA 7REQB 2RFGA 1N55A 3NURA 3CV6A 1JDCA 1K1DA 5AC8A 3BJFA 4KFNA 3RMEA 2QCDB 2VFDA 4JY9A 3H4GA 4ZEPA 1V6WA 3CT2A 1UPMB 2WB5A 1HKKA 3IIZA 4MB1A 1EEXA 4X22A 2HK0A 1J10A 4W84A 3B0UX 1IGWA 4J2PA 5H91A 2WMKA 4C5ZA 3W81A 1CPUA 3RUBL 4KEZA 1B0IA 1EBHA 3A3WA 2NZLA 4UXDA 4IF2A 1K9DA 3UWEA 2WM0A 5I3KA 1HJUA 2ZYFA 4GC4A 4NILA 3NL6A 1TVNA 5FJTA 2OVLA 5C55A 4KWWA 3VK5A 4GACA 5ABHA 3CZ8A 1EDQA 2XIQA 5F2GA 2PRMA 2CLHA 3Q45A 4L1GA 1PV8A 4RE0A 2DVTA 4UFJA 5BW6A 4IIDA 3S5NA 3G0XA 4R9XA 4U5IA 4EWND 4DVOA 6REQB 4E8GA 1G69A 1RXOB 4HNUA 3E5PA 3ICJA 2IKIA 3ZIZA 4D1IA 2G4FA 4UNKA 1JCMP 1SUXA 2CLIA 2RKXA 5H6HA 5K9DA 2CETA 3UZJA 4H19A 1B90A 3FXYA 3RYSA 3W7RA 4MOZA 5FEZA 4UQBA 4JN6A 3L4WA 5XIAA 2XIJA 1NF0A 1T99A 1ZBWA 1W3KA 2OSXA 1UR2A 1XGEA 3DGBA 2I17A 1JRBA 3G0SA 4GWEA 3IV3A 3DG7A 3OVQA 3W82A 4KFOA 4M8UA 2V81A 3WBYA 1L6GA 3QMRA 4FK9A 3UEQA 3RK8A 4R3UA 3LS9A 3W7PA 3UXAA 4NZ5A 1J0KA 1SFLA 3PB0A 4IT1A 2XVGA 1L0PA 4AMAA 2G3NA 4DO7A 3UETA 5GPRA 1DTNA 2QPUA 2ZA3A 5K2ZA 4WXYA 1E6SM 1TPB1 5G2WA 3OVRA 1CGVA 4XZLX 2Q01A 8CGTA 3KBJA 3C3UA 4S3EA 1ZLPA 3PJUA 1PIFA 4D71A 2YLAA 4RKAA 1KXHA 2Y5SA 4GQGA 5M03A 1WA3A 2ZRWA 3OGRA 4RXGA 4KWOA 2F9RA 1C90A 4LY4A 4EXQA 1S2TA 2WJEA 2PGRA 4O1DA 3NPXA 3ZJKA 2J9ZA 2HROA 1VJSA 5BRQA 2G97A 2QJGA 4K68A 2VD9A 2VOMA 2XFYA 3LCLA 4PL2A 1VLIA 5C71A 1XLIA 3UCQA 5HOSA 1QWKA 4P5UA 4CU6A 4DLMA 1EJ7L 1J18A 2BY2A 2VWSA 3TXZA 3W22A 1O12A 4LEQA 3KCLA 4LYQA 4TTGA 2EG8A 3F7JA 2EPOA 3INPA 4PYSA 4P7QA 1R3QA 4MIMA 4NJGA 3MV01 3H70A 2XIOA 3U5UA 3KFTA 4Q32A 3WNMA 3W1LA 5I07A 3TDFA 1E1FA 4ZXOA 3RG6A 4CNSA 1QK0A 5D2YA 1XGZA 1Y5WA 1R2RA 3LCIA 1G67A 3VIPA 5M5DA 2C7FA 2Q3OA 3H24A 4OFCA 5AYBA 5BU6A 5D02A 2OQLA 1FHVA 1E4NA 1GG1A 3N11A 4EKJA 3GFZA 4Q7NA 2VC7A 2WPGA 3OW1A 3DAQA 4JN7A 4KMQA 1YTEA 2Y63A 4NNBA 4EWJA 4ZOAA 3QRHA 1SZGA 1FKWA 4G5DA 1YNQA 2XHYA 3KL3A 3R25A 3L4YA 5GJMA 6TAAA 1PKYA 1Q6DA 2J6VA 4IIFA 4J3WA 2REQA 4D6CA 3WELA 4GA8A 2I56A 4CNPA 2VOTA 2V0TA 1TSIA 3W83A 1XLLA 1HF6A 4GI6A 1GPWA 4Y8EA 3SJ3A 1IIGA 4H9TA 2HE5A 1XQLA 2GK1A 4MY1A 5CGMA 3SCNA 2A4AA 1S2AA 1EUNA 5BXTA 1E4LA 2Y0FA 4OUIA 4C6NA 1YE6A 3OQEA 1X8CA 1KTBA 2OFJA 3GS6A 2BY3A 2FZNA 3W85A 1PVNA 2VCBA 1VHCA 2VELA 5AYXA 2VFEA 3MI2A 3FSTA 4IMGA 4NL1A 4IIEA 3P62A 3V5CA 1SJDA 2JK2A 2TPSA 3CXOA 4I9MA 4RUBA 2D69A 3PWGA 3O05A 2D23A 1E43A 2V2DA 4PL1A 1JF6A 3GY1A 4G7EB 3PHAA 5HUOA 1TJ1A 3AUJA 2VGBA 4BQ2A 4HHHA 1DIKA 1KFEA 2ZUNA 4ZR8A 3SGUA 4R33A 4J5NA 1QPOA 4PMOA 2Q3RA 4O8RA 5C8BB 4V1YA 3WQCA 3IGUA 1Q6RA 1RLDA 2VCAA 3EXRA 3SUUA 3MJYA 2G8ZA 3OYXA 1SYTA 2Z1BA 1XLDA 4ML4A 3VMPA 2DIEA 2YFNA 1ITXA 5I3JA 2JKPA 2I9EA 2QDHA 2FB2A 3F2DA 3HV9A 1OGGA 3AXIA 1P43A 2FGLA 3FK4A 4OBTA 2NWSA 3SB0A 3G1HA 4EF8A 4JDBA 4U3AA 1KRBC 2PRHA 3D3FA 2FHCA 2YLLA 3B8SA 5FD0A 2C91A 1Q4NX 3WNPA 4AHQA 1F3TA 4GKLA 4K7YA 1XH2A 1X97A 1GOKA 1MUWA 5TNVA 5C54A 3BZJA 2VVNA 3PBMA 3V75A 3LTPA 5HNNA 1PHQA 2WV8A 3B9DA 4BF5A 2WC7A 3DHDA 2VWTA 3PNUA 1QJWA 1PO9A 4H6RA 1XINA 3M0YA 1UYQA 5BRBA 4WLCA 4F8XA 1K02A 1T6MA 1E15A 3RDKA 3S6OA 1PXGA 1EYWA 3EWCA 3GH5A 4Q8NA 1HVQA 4BEQA 4H6KA 3TN4A 4ZA0A 4PUDA 3H2EA 2CLKA 3GX9A 3S4TA 4W85A 3W1NA 4D6IA 5ABFB 2WKLA 3LHTA 3O16A 4LW7A 3TC6A 3K46A 1A5CA 1DWIM 1JPKA 4Z2JA 5LXEA 4J3ZA 4FOKA 4Y9PA 3E2RA 5CSYA 1UOZA 1TPEA 2OPJA 2FH6A 4LYPA 3KHDA 3S5OA 2E28A 3ZWSA 4EXAA 3DU0A 3ITYA 4NAEB 3AMLA 2WMIB 1VYPX 3E49A 2WMFA 2XSBA 3NQMA 4FEZA 4C91A 2EJAA 5HMSA 4PTMA 2PTZA 4QFUA 5AYZA 7ODCA 3MHGA 3IJ7A 3PS7A 4AQLA 3L0KA 3PNZA 5CC7A 2AAMA 1GVEA 4GD0A 5D4YA 3FYOA 2VRKA 3AHVA 3WUGA 2H9AA 4UUIA 4PODA 2EEXA 3N6HA 3VNJA 1PS9A 3PWIA 1JCNA 1PCKA 2WSQA 3FA3A 2ZICA 4GXPA 1MXDA 2YCLA 2E40A 2FZBA 2GFTA 1GZ1A 1Q8JA 1KFKA 2XWEA 2PD9A 2CZEA 4Y2WA 4KCUA 3KX6A 1UUOA 3Q94A 1VFLA 4PC8A 3AYRA 1Q63A 1XGDA 4IMCA 2DP3A 3ITGA 3LRLA 4CEXC 1AJZA 5FJJA 2YDSA 3UNTA 4O52A 4BF9A 4B9ZA 2VR5A 1C92A 1QK2A 1JYWA 4YNGA 3K4WA 1IXPA 3KXQA 3BLOA 4DQWA 1U5JA 3SCWA 3V5FA 4E2OA 4J27A 1XF0A 4ZE4A 2XM2A 4J3VA 4XAPA 4DY1A 4OBRA 5BMXA 2GJLA 1DJIA 3STPA 4FNTA 3TTOA 4H8UA 2Z1VA 3SCQA 2Q09A 1CGUA 3BLPX 4IGSA 4M6VA 4I9TA 3C61A 5H2ZA 1WUEA 1XBZA 4HOWA 2FQIA 4WHBA 1CTNA 3BW2A 3W7JA 3HJZA 3VKDA 3A21A 3S6TA 1ZTVA 2XVNA 5JMUA 4N7QA 1I4NA 3C8FA 4ERAA 3QV8A 4O4VA 2V5LA 4D6HA 1TV5A 4CCDA 2ZZ2A 3V36A 1TPFA 2UV8G 3NFUA 3AZTA 4MUZA 1XLBA 1R46A 2Y8KA 3KAOA 4HA3A 2YA0A 1KC7A 2BHYA 1FWEC 3C4UA 1EOKA 3WEZA 4JQ4A 1I1WA 3GBDA 3CUFA 4PTNA 1B4KA 3GXDA 3ANVA 4A21A 2ISSA 1GOXA 1JCXA 2PBGA 1RP8A 1CWYA 5IOBA 1EKOA 2CERA 3L4XA 4HYRA 2AL2B 1HP4A 1YNYA 1NTHA 1HL8A 3C2VA 1G01A 1VCFA 3S2JA 2DEPA 2Z28A 3R94A 2PWUA 1SO6A 3IVSA 4C7DA 1UWSA 1OCQA 4DF1A 5HINA 1OFEA 4GYFA 5CZSA 2Q8XA 4KWSA 1BSLA 4I5RA 1VYRA 3KL0A 2X1RA 4RDVA 5LGZA 1GGOA 1M1BA 3IJLA 4PMVA 2CZFA 3THUA 3NPUA 4BI5A 4Q8MA 2XPKA 5AC6A 1NQKA 4FR1A 2P8BA 1JCJA 3EBVA 4DO6A 4XZNX 1RCOB 3IGHX 1A4LA 4CNTA 2G41A 4HB7A 4Q6JA 1U33A 1OFAA 3RLUA 1TELA 2BVWA 3MP3A 1WXJA 4L6DA 5FJIA 3DBPA 3FNDA 3H4WA 3TMLA 1GK8A 1HKVA 5CCZA 4RZBA 2J7EA 2YKKA 2G95A 3G1DA 4DRSA 3G1AA 1CBGA 2MUCA 1MXGA 3M1ZA 4H8HA 4OV9A 3OZOA 1TUXA 4PTVA 1SR9A 4S1FA 3THAA 2GZXA 3LBOA 2RH9A 4S3FA 1PCWA 4L6OA 1VFHA 1SGJA 3AQUA 3CEUA 4G1KA 4Z0SA 3WLOA 1OFOA 2J24A 3WF3A 4PEEA 4ICNA 3VKBA 3MYOA 1XLHA 2QJMA 2VC9A 4ZQNA 2V67A 4UTFA 3DEQA 1X1NA 2QGYA 4O18A 4ZB0A 3T2PA 2HVMA 4AYSA 1XV8A 4HYWA 3BE7A 2WPBA 5A8NA 3HJEA 4OBSA 3SCPA 1PPIA 3STGA 4PSPA 3L2IA 2VGGA 1GVQA 5DBTA 4FIRA 1TREA 1SO4A 4O53A 2E1DA 1XLAA 5DXXA 1BG4A 5FIPA 2ZUMA 5F4SA 2QMJA 3PZVA 4QAIA 5A95A 1EIBA 2J47A 4RL3A 3IJ6A 4K8EA 1RD5A 1MSSA 2CPUA 4XAGA 1GHRA 2V5CA 4HGXA 3O8AA 1I9CB 1NP2A 1JQXA 1O1HA 1DJYA 3CEPA 4S3CA 3EX4A 5HQMA 5RUBA 3FW6A 3T08A 2WHJA 4FNUA 2PD5A 1R9ZA 2Y2WA 1VENA 1QBAA 4E38A 4PCFA 1X1ZA 2OSWA 1IHIA 4P7LA 1SJAA 1H2JA 3KM8A 4C6PA 1W9BM 1U1HA 3GDKA 3QPYA 1OD8A 1TV2A 5K9XA 1XIDA 1YPFA 3QQ0A 3NYZA 1JDEA 3OIHA 3EXSA 3U3HA 3WEOA 4CNOA 3H2FA 4NX0A 2EKCA 2OEJA 2Z4GA 2J13A 2E67A 4Y9OA 2ASHA 3TAOA 4HHLA 1CENA 2QCCA 3DI0A 4NHVA 3IJQA 4E3VA 3EB3A 2VQUA 4P7OA 1PDYA 4PMDA 3KRBA 1BQCA 3RILA 3FHAA 4HOXA 1XBXA 2A7NA 4LC8A 4B3LA 2XGIA 4X3ZA 2IPFA 3TQ0A 4NUWA 4CN4A 3LG3A 1KQYA 3M0XA 1P0EA 4B5UA 2IXUA 3HQOA 1EZ2A 1QO2A 1BYDA 4DAIA 3IUHA 3KCOA 3HPZA 4GG9A 3WDRA 4GBDA 4AVOA 2GQ8A 3CT7A 1XRSA 2PP1A 3WH6A 1XKJA 4CQBA 1W3HA 2H90A 3PPHA 3H2CA 1AW2A 3ZZ1A 2QCFA 4C6OA 2HWGA 3AHTA 4IPIA 3CB3A 2QDEA 3O7UA 3KS5A 3ZJ8A 4IM4A 2ZXDA 4GQ0A 3S9IA 2QF8A 1EC9A 3NZPA 4TO8A 2PDIA 4IMFA 3MY9A 4R7WA 5BOFA 3S42A 3LBCA 4YVVA 3QHMA 3ITOA 2ADAA 3MSRA 1GW9A 3JW7A 5CGQA 2KAUC 3R7MA 2CZVA 5CC6A 4QE4A 1W9UA 3VD5A 1DJNA 4UCFA 5FAGA 4QX4A 4DUXA 1UH2A 1MUCA 2MANA 3NQDA 4U2YA 2C19A 2P0IA 1TRDA 3WJYA 1IXOA 4RDYA 3FFSA 3TNOA 5FJUA 3RU6A 3EWDA 4NI8A 1JIBA 2OOFA 2ANUA 4WCJA 5K3VA 1F4AA 2BNJA 1DORA 1OX4A 3FSUA 2ZOXA 3APTA 4HZMA 4RE2A 5F1UA 3BH4A 3C0SA 3MP4A 4YWIA 3ARVA 4LC6A 1I0DA 3B8DA 3HGRA 4Q8UA 3VUPA 5I5RA 3W07A 2OO0A 4GBUA 2W6RA 5KTLA 3HOJA 4ONVA 2HPMA 5I09A 4FLOA 5G2HA 1VB9A 3KE0A 1SMAA 4O54A 3T07A 4XV0A 1K6AA 2XYLA 1H7PA 2VP8A 1QPQA 3LCHA 1PB0A 2WJFA 2VFIA 1BD0A 2CZ5A 4IH3A 3W28A 3G77A 3H53A 1RVGA 4PULA 3LZ5A 1OIFA 5MKGB 3I6RA 5HMFA 3M6YA 3EA1A 3W87A 4C6KA 1R86A 2NVDA 3GDBA 3OTRA 5GNXA 3NEHA 2R24A 4A2RA 5IHSA 2WNZA 3BPWA 2HTMA 1GZJA 2J8GA 2GK1B 4NG3A 2WM1A 5LNVA 1K9TA 4GE8A 1JUBA 3V7PA 3A22A 4LCSA 1SVDA 4RNFA 3M07A 5FF2A 1WDDA 1Q4WA 1VBGA 4FNSA 4BS0A 5D2XA 2WVUA 3TE9A 4DWDA 3OZYA 4GY1A 2J7CA 3UGRA 3EOSA 3P5ZA 2QVHA 2Y7GA 1WAUA 2Y89A 5HWNA 1HX0A 1XIGA 4DJDC 4GIAA 2OX4A 2CEQA 2VC5A 4MPQA 4OT7A 3RR1A 2GGEA 3GXPA 2CHNA 4HNTA 2P50A 2AL1A 4ZCWA 4HSHA 1TWWA 4WR3A 1Z42A 4XUGA 5E0KA 2EG6A 2J7FA 3P5YA 3FEMA 4O15A 3TTEA 4PRWA 5HMDA 2XH2A 2PBOA 4K1GA 2YYTA 3OA5A 4PUMA 3WK0A 4N4QA 1QW9A 3G1FA 2C1GA 2RUSA 3P0XA 3DFOA 1TPC1 4W7WA 4FIQA 3TN5A 4PMJA 4AIBA 1S2VA 1VQTA 1JPMA 2IQDA 2PTDA 3E0IA 3W9ZA 3EWUA 2DUAA 3L66A 2VENA 5CSSA 5BZAA 4HN8A 4HNLA 3M5YA 1O4UA 4PCNA 3L4TA 1L9WA 4Z17A 3TA6A 2PGWA 4C7GA 3N13A 1MEHA 4MHBA 2X40A 3B8UA 3QYQA 1B3OA 1OFDA 1OD0A 4M29A 1KV8A 2QCLA 4S2CA 1E4MM 5LIUX 4KCVA 3WMSA 2WKJA 1KTCA 3ATZA 1QNVA 2O0TA 3BAYA 4D6DA 4XSLA 3UBPC 2NQ9A 2Z6IA 2E25A 4KRTA 4QQUA 1UR3M 1G1YA 3EKZA 4OU1A 3H7RA 4LH8A 3TH6A 3SR7A 3WBWA 1KRAC 1TTIA 4POCA 3AAMA 2GJRA 3A13A 1G4EA 5DRIA 2F84A 3UZ5A 3R5EA 2AMGA 1YBQB 5T91A 1TVLA 1H51A 4J35A 4IIBA 4XKMA 3VI2A 2V9DA 4NZ4A 3P7YA 1EWDA 1OFRA 1EC7A 1K8YA 4PMYA 3OO2A 1JZ7A 3K8LA 1OY0A 2W79A 3VGGA 4I5XA 4F48A 2O56A 2C8NA 1W1A1 4JX4A 3VO0A 4DEFA 2ZX5A 3GNXA 3I6TA 4OTKA 2W67A 3F5LA 3NDYA 1DHKA 1CW2A 3ZR6A 1W5PA 4NT0A 4LV9A 2PDQA 4MJ2A 3WH8A 5JQ9A 3OQ8A 3T0DA 3LPOA 5FJRA 2Z27A 3BCJA 4IP5A 3IRDA 4WJ8A 4JIQA 4LQ1A 2YDRA 3WBXA 3S1UA 1QNOA 4Z0JA 3EWWA 2QR6A 1V3IA 3MWAA 1E0UA 4MWAD 3QY6A 4FXJA 1O60A 2X0YA 4D8AA 1A5AA 1VFTA 2GSEA 2YA2A 4AHOA 2EBNA 3KP1A 3AU6A 4B3ZA 3CZEA 4D6EA 3CB8A 4NJHA 4JBRA 1UPPA 3V1PA 4O4WA 1M7PA 3KWSA 1KWGA 4LANA 1RJPA 4H7CA 3C8NA 3R1ZA 4P8XA 4DX3A 1HNYA 2PDNA 3AYSA 2W62A 3BW3A 2G37A 4L65A 2RAGA 3C5QA 1XIJA 2NUXA 3TLLA 5I3GA 2XZ9A 3VNYA 1TQXA 3DIPA 3MUXA 4FB7A 3B9NA 4HT3A 1XIFA 4QSFA 1P0NA 1AQMA 3SAZA 3DX5A 1YTKA 1OG6A 1QI0A 5E70A 4AZCA 3I3DA 2WQDA 4AZIA 2DSUA 3P82A 4QS6A 3KLLA 5K4ZA 2IW0A 2I5GA 3W7KA 1BAGA 3RIKA 1GVYA 4S3GA 4JL1A 1VFOA 2OXNA 3N1AA 1BF2A 3FY1A 1NOWA 1L8PA 3VE9A 1NWSA 3W86A 4BHYA 4HSOA 1H1YA 1HT6A 3PZOA 1W9DM 1SJCA 3G1SA 1N82A 1FP9A 3W7IA 3AYTA 1M6JA 1OADA 3U2CA 2GQ9A 1RVKA 3GXTA 1NP0A 4UTJA 5G1YA 3LQLA 2H8ZA 3NM3A 3LRMA 2DZSA 4CD4A 1AMYA 1P6WA 3P0WA 3QMSA 1PKLA 1GT8A 2B7PA 3EX1A 4GUGA 4HYVA 3NZQA 3V18A 3GNRA 2ZX9A 5A5WA 4DNHA 4V1XA 1R7OA 4A3HA 3H2AA 1Z48A 3B03A 4CU8A 4Z1AA 2IPWA 3TSMA 1JCTA 5CJNA 1V79A 3NZ1A 3CV1A 4IQJA 3QW4B 3WDHA 2A7RA 5BWAA 3WNNA 1Q2RA 1S1PA 2C1HA 2PLMA 3FX4A 1TMLA 2I5IA 3WNLA 2YCEA 4GX8A 3QTGA 3VE7A 1WZAA 3MC5A 3WLNA 4ZGYA 2CWXA 5D2TA 4F0KA 4E4UA 4WOZA 5LXXA 3PK7A 3HTWA 2E3ZA 2FZ9A 1GOMA 1QT1A 1YDYA 4AAJA 1D7FA 2WBGA 1H7OA 3N6JA 2VFFA 3TW6A 1R3SA 4UFLA 2NSOA 1A3HA 1S2WA 3TQKA 3VOFA 3W1RA 1XS2A 1G0CA 3J7HA 3KHJA 3LGEA 4OJYA 1QW7A 4GH3A 4PUUA 5EA9A 5M17A 2BMBA 1Z3NA 5H8MA 3OEXA 1K4GA 3L65A 4TX8A 1W91A 1W3IA 3ZFHA 5JIWA 3RX3A 3N9SA 3K4AA 3MBDA 4B15A 6A3HA 7PTDA 3ERPA 3EDEA 2JFEX 3QXBA 2OEKA 3B3DA 4GJIA 2WMJA 2A2IA 4XD6A 4DZIA 3MYPA 3O15A 2VQTA 2OT0A 4GUFA 3GFYA 4WRHA 4I3GA 1TKKA 4NI3A 1FWSA 1UR1A 4DJDA 1U22A 3CUJA 3QH2A 3R0UA 4UOJA 4Z2HA 1E71M 1H41A 1Q6GA 3RPMA 1F61A 4KWVA 3C2EA 4XG1A 4B4HA 1J01A 5T26A 4AWUA 4AD5A 2RJHA 3UY7A 1YX1A 2EJ1A 4F2BA 1S38A 5I2UA 1C91A 3W1UA 3WJZA 3CGTA 1UCWA 3ISIX 1PAMA 8XIMA 3UZWA 2QNEA 2VZOA 3TNBA 4ALDA 1K8CA 3DC8A 1A5LC 3AMCA 4AFYA 4AVFA 3AJ7A 4QAWA 4B3KA 5HQLA 5DELA 2PEVA 5EU9A 4XAYA 3D46A 1CGXA 3OLEA 3VDBA 2J79A 1TPVA 3UR5A 3Q2DA 5C9ZA 2AGTA 4O1AA 3M5VA 4GNVA 4JCLA 4BZYA 2QIWA 4GIRA 3LB0A 3GXNA 3LLXA 3C0LA 1J79A 3A9IA 4HU4A 1H11A 1OGBA 1W5OA 3FXGA 3UZZA 1HGWA 1V93A 3DYMA 4JICA 2VHLA 1GQKA 1R5YA 7A3HA 1Q6LA 4AIUA 3N2XA 5XINA 2IQTA 2V5DA 3NOYA 1QI3A 4G8TA 2CBIA 2BHUA 3W84A 3AXKA 3LV6A 1JNDA 1G5AA 3GO2A 3WD4A 4MY9A 1UKSA 2GGJA 2Q8LA 2POTA 4HA4A 1R8LA 1EWEA 1T7LA 3HZ3A 2ZCGA 4D6JA 3PFRA 1AH3A 3GZAA 1JDAA 4DF0A 3T0BA 5SWUA 2X1SA 5BXPA 3B9AA 2O4MA 4H04A 3BG5A 3QV7A 3V35A 1HJXA 4YTQA 3W7OA 5HNUA 2XH0A 3BO9A 3GHRA 3NM1A 2IS7A 1FTXA 3LMYA 5TBOA 1F8MA 3E0FA 4LWWA 3TTQA 3VILA 5AY7A 4LCQA 4DB7A 2IPGA 5BMWA 1NF7A 3TWAA 3GVRA 1XCXA 1L6WA 2AAAA 3GDLA 3AC0A 3O3RA 5HJXA 3M43A 3E2SA 4UZUA 3WJWA 2YOCA 2QMKA 4PMZA 3GU9A 3HGOA 3I6EA 1JVNA 3GE7A 3TV8A 4UNIA 5E6ZA 4PRRA 2EG7A 4IICA 2XTKA 4DJEA 1OF6A 3A5VA 2GUYA 1UH3A 4M81A 3S1WA 1N8IA 4M56A 1DXIA 3TONA 4FALA 3N12A 4E2DA 3T2QA 1RPXA 1H60A 4GK8A 2WLYA 4IWWA 4QSHA 3TZNA 2QCMA 2YR1A 4S2BA 3MDWA 4JNYA 5AHEA 3C3NA 1S2CA 2IPJA 4A6GA 3BANA 4LUTA 3KTCA 1IEXA 2ZDRA 3PFMA 4UQAA 2E0PA 1CECA 3C6CA 4ZTYA 1EJWC 1KCXA 3QJAA 4JTDA 3JU2A 1D3CA 4RW5A 4M7TA 4YLWA 1GG0A 4PGLA 3GTXA 3U57A 4M0XA 4HNVA 3W3OA 4O10A 3KL5A 1OVDA 3R8HA 2GL5A 5A2CA 4E5TA 4AIEA 2DSKA 2CESA 4PFMA 2DJXA 4D1JA 1XLGA 4C6JA 4CVUA 1UASA 3LZ3A 4PCSA 3SO7A 2W9MA 4TVCA 2YGYA 3UESA 1NVMA 4IX2A 1LBFA 1BXBA 2B31A 3WX7A 4MDPA 1LROA 3CH0A 1QMLA 3LHUA 4JTAA 2WNQA 3GHUA 4MJMA 4JTJA 5A94A 3PJWA 1KM6A 2I14A 1EO7A 3DKJA 1GQLA 1CXIA 4IIHA 1NM9A 4MDOA 3QKEA 1WUFA 1UKOA 2R82A 4GPNA 1GYMA 3THDA 2DPEA 4QIUA 3WDQA 4Y6GA 3ECQA 3F5KA 4C1LA 3M64A 4X9YA 1KLZA 1UP3A 3NO5A 2ZRXA 1W31A 4AXKA 1M7JA 3GVVA 2Q6ZA 3M0IA 1UWUA 1BPLB 4J3TA 4LUSB 4YMZA 2NLIA 3ZLFA 1RLCL 1UWAA 1YDVA 4EACA 2Z1KA 3WK1A 3NQ7A 2R91A 1BVWA 4LX4A 2OKOA 4ACZB 8XIAA 4XO6A 4IGMA 3L21A 3I7QA 4AWEA 2UWFA 3EKLA 4PMXA 1WP6A 1O5XA 1LQAA 2WVSA 4Y7EA 2UBPC 1K7FA 3S9ZA 1AK5A 1RP9A 3Q4DA 3XISA 1QBBA 7XIMA 1RA0A 4K37A 4BQ3A 1PL9A 4NF7A 3CL6A 3WQWA 3TXVA 1DE5A 2PWFA 4TIMA 3LQGA 3CU2A 2QZRA 3QR3A 3N18A 2ATSA 1C8YA 4KEVA 1UMLA 3BG3A 2OODA 1HO4A 3L4ZA 1PUDA 2WNNA 3NIYA 1Z32X 1X96A 3BW4A 3UFYA 3DHUA 3R8RA 3ARWA 3PPCA 3ZWTA 4UTMA 3TU9A 4RNIA 1CGYA 2NVCA 4MUPA 1UBSA 4YVXA 4IMAA 4PR4A 1VKFA 1KD0A 1TTJA 3AXXA 1WKDA 4NNAA 5CZJA 1EP1A 4Q7IA 4G2DA 3GR7A 4AHPA 2I9UA 3BAWA 4DJED 4M51A 1JYNA 5D03A 4GUHA 1X7FA 5E09A 3GHTA 1EYEA 2F8QA 1TV4A 2PWGA 4KH2A 2C0AA 2WC3A 3LLFA 1B3VA 3BLFA 4ZO9A 1PX4A 2WK2A 1NH6A 3A3XA 1JG9A 3ARZA 1XJBA 1Y8BA 1DJZA 5A3HA 2WZHA 3H2NA 1CXHA 1TV8A 5T9BG 1PX8A 2WNWA 2A3AA 4LVBA 1JZ6A 3L9CA 3B4YA 4GUIA 4C1KA 2Z2AA 4XZMX 4R88A 3UWWA 3AIBA 2NQHA 4JCMA 1A50A 4XVEA 1V3LA 3MA8A 1GONA 1ODUA 3LPGA 4GMEA 1PJ9A 2PA6A 1RCXB 4AYGA 4HA1A 3UXDA 1DWFM 3UPBA 3LBMA 5FF4A 5E0CA 1U1JA 4YIWA 1ZJHA 4GKTA 2C14A 4IJBA 2WHKA 4PUEA 1JD7A 3O6DA 3NSMA 4U31A 3UWQA 3BQ6A 4GGBA 4K2SA 4K39A 2NX3A 5G5IA 1CLKA 5I3HA 3RXZA 4NNCA 2ZUUA 2QJHA 3T05A 1BEUA 1JF5A 4XTDA 3ZVHA 1TMHA 1JL8A 3STEA 1ZHAA 2PTYA 1KCZA 3N4AA 1EF3A 3NUKA 4NU7A 2JKEA 3UY8A 2WVTA 3ZLGA 3NTYA 3ZSSA 4YTUA 4AD2A 4HJFA 3KVLA 3NG3A 4BR1A 3WLQA 4EX4A 1GJWA 1AJ2A 5XIMA 4LS0A 4B92A 2BBFA 3DI1A 3EMCA 4D6FA 1R0MA 1ZAHA 1QNRA 3PJTA 5C9RA 1VPQA 2P8CA 1XD1A 3WLSA 4W8AA 4B5NA 3M7SA 1NJJA 3EPNA 2W63A 3M9YA 1V6YA 3DXIA 4D2JA 4LS2A 5LA1A 2QEZA 1KFBA 3MP5A 1FWNA 3FOKA 2W4XA 2ACQA 4IGHA 4HNNA 4FNQA 1L8NA 3NQ8A 1FXQA 3GXFA 4MYAA 4IPJA 4JYDA 5FI8A 1CI1A 2Y8VA 1YHTA 4Y96A 3SUTA 1MDLA 3FVMA 2ZC1A 4WDXA 4UTIA 1I2QA 3LI1A 3VABA 2WZMA 4J4KA 3L5MA 3PN8A 2PDHA 5E1QA 1T41A 3NCOA 4JQ1A 1NWRA 3MDUA 1V5XA 3N15A 7CGTA 4ZOBA 4QBXA 4PSRA 2V5BA 2PDKA 3ABSA 2ZX6A 2X2GA 1V0KA 2HJPA 4AH7A 3BMXA 4WK9A 5C7HA 4LSBA 1NAL1 2A85A 3TSBA 1FH7A 3F4WA 1Z6KA 2Y88A 1E72M 2RDTA 1V7AA 1WV2A 3WQ5A 2INZA 3W7HA 1ML1A 4HK5A 4UQ9A 3UA4A 1IXQA 1FH8A 3VIJA 1HL2A 1J96A 2WXDM 4GZ7A 1ZP4A 3QGKC 1V02E 1BXCA 4DWSD 4AZ7A 1GEQA 2PDMA 4DBUA 4FZIA 1J0JA 1DJQA 1UR0A 2RDUA 3CQIA 3GTNA 2X7VA 2PFHA 5JBEA 4LB4A 5F4XA 3WD0A 2PTWA 3K30A 5KMYA 2DT3A 2D24A 4JQ2A 1F9CA 3W7DA 3EDFA 4QDMA 5CPOA 1X6LA 2XN2A 1DJGA 2CWNA 3DENA 4F3HA 3IUIA 1DP0A 1DIOA 3EWBX 1FH9A 1G4SA 3ABQA 4PTDA 2E1WA 5G4WA 9CGTA 3MHUA 4X63A 5I02A 1OM0A 4CUCA 4DZHA 1QXLA 4CCZA 2YCJA 4J7RA 3HIJA 4Q8OA 3NQCA 3PZNA 1XD0A 1MW0A 2XGBA 2VEGA 5B7YA 4WOQA 3S47A 3LXBA 3R0DA 3WJSA 5A6SA 3BV4A 1MVYA 2ABBA 4ZFMA 1JGIA 4OIFA 1N7KA 4G56A 1RCQA 3SUSA 4JYEA 3ZT6A 4F4RA 2ZWYA 2H8XA 4GJJA 1TA3B 2IKJA 4XBJA 3WO8A 2QDDA 4Y90A 1D8WA 2TAAA 4JPGA 1F3XA 4GINA 4PN2A 1KXTA 3GFXA 4LYKA 4DUWA 4O17A 2CU0A 3AHZA 1F4HA 1CB7B 3LNMA 1ZZMA 1GTHA 3LCGA 3ALFA 2VR2A 3THQA 4W87A 1FWGC 1A5KC 4D6GA 4C6IA 6ALDA 1GVIA 3AIRA 2R8WA 3YPIA 1ISWA 2W92A 1LRNA 2R1KA 2BOEX 1G4TA 2PMQA 1XSKA 3H7VA 3CAWA 2XISA 1PWLA 4H9UA 4EANA 3IIPA 3ZT7A 4C6EA 1H1ZA 1H61A 2WWDA 4R85A 4WGHA 5GJPA 3VIOA 2FZMA 3GVQA 1SZRA 2VXNA 4Z2IA 1FDYA 1XYMA 3BXWA 3MTWA 5CKSA 3VIKA 1LBMA 3N29A 3I3BA 1VHNA 3GTHA 1F3WA 4WY0B 3ZQ9A 2AQVA 2HSAA 3OVPA 4CNNA 4O28A 3EX6A 3CYJA 3LM3A 4CKQA 1DXEA 3OG3A 4HMDA 1H7NA 1EJRC 2XIMA 2GOKA 4QEHA 3W2KA 4JTEA 4BI7A 4KBXA 3D5HA 3HU7A 4ATDA 4ORIA 4W86A 4L64A 1VZWA 4LYRA 2P10A 5PTDA 3SRDA 4HMNA 4Q8TA 2DZUA 3I7SA 4MFDA 3TCSA 3QLLA 4RCXA 5ABGA 4UIOA 5L9FA 2VCCA 3IRSA 4Z2GA 1BQGA 1XISA 1BWKA 4FO4A 5HAOA 2IKHA 1B1YA 2DQXA 3DFSA 2P76A 3WLLA 3GB6A 3PZIA 1QTWA 1GVRA 4K6AA 3LLDA 1FWWA 4GXMA 1OJXA 4LY8A 3UWUA 3WQ8A 3CV2A 2INEA 4Y9NA 3QZEA 4WJXA 1OYBA 3COTA 3Q67A 1S5WA 1AQFA 4HNOA 3U2ZA 5E0FA 3SFKA 1E6PA 1FWIC 2QGHA 4Z1CA 3URNA 2XU2A 4GGHA 4FXRA 3TR2A 2O9OA 4Q4QA 3CTLA 4QG6A 2NV2A 2OZ8A 3CMGA 1KXVA 5CPNA 4C6CA 5FJOA 2HS6A 3IK4A 1DHPA 1VFFA 3PVFA 5IFTA 2PC4A 1K9FA 5U4NA 3NA8A 4J40A 1VIWA 1LJYA 1UZHA 3W38A 4RK8A 4NAEA 3TTSA 4JTQA 2WMIA 4GJ1A 4QNEA 1WDSA 4S3JA 5DMMA 4O50A 3Q37A 1VCGA 1WNOA 2WZTA 3MI3A 1UHVA 3PBWA 2JE8A 3DFQA 1J0IA 1MW3A 3DBNA 3D0CA 3JVAA 3QYSA 4PMQA 4EAYA 3PG8A 5CBIA 1BTCA 4JTUA 4BFAA 1F76A 3IVTA 2WKGA 1GORA 1F8IA 1GQIA 2EAWA 3N3MA 4AZ5A 3VXGA 3DUGA 5LIKX 3W71A 5D9OA 2XN0A 2Y62A 3E38A 2PWHA 1W8SA 3AO0A 1UR8A 2ALRA 4G6CA 3W00A 1SW7A 5C6MA 3GG8A 2D3LA 3WDPP 4PB4A 5EFDA 4US5D 5LNSA 3FJNA 1I1XA 4L6HA 5C0QA 3LD5A 1PX3A 4AWTA 1DVJA 1UP2A 2QULA 1NY1A 1OT1A 1XYLA 4FP1A 2PLCA 3V0UA 3OOQA 4MY8A 1JI2A 2X09A 3MSDA 1QI4A 3BSMA 1AQHA 3WFZA 4LUTB 4DJFD 1L2QA 1UA7A 3UT0A 4G1NA 4ZQCA 4UOZA 4YU1A 2GGHA 2PWEA 2GWNA 3W37A 3SUWA 3I10A 4LJ3A 3XINA 3HF3A 3NQ6A 2NXGA 1CXLA 2YXGA 4X60A 2A3EA 1F6PA 4GC3A 3LM7A 3REQA 1J0YA 4LBUA 1TZ7A 1HTIA 1L6YA 1KLYA 2HISA 3SSZA 1UA3A 4MZ1A 3A9BA 4K36A 4QLKA 1Z9AA 3LDVA 3SQSA 1UR9A 1MMFA 4QE1A 1WZMA 3VCCA 2V30A 4PUNA 5IM51 1T0OA 2CCRA 3RMJA 1ZP3A 3ELFA 2NVAA 1AUSL 3G8EA 3GVWA 3R79A 4V27A 3MJMA 2JIEA 2PP3A 3L12A 4LGXA 3ZMRA 5JBDA 4LS1A 1RH9A 3VTRA 1M7OA 3DERA 1XFCA 4DXKA 1SM9A 4AC1X 1E0XA 3O06A 4FNPA 3KDOA 4DAFA 2ZTJA 3CPRA 3R10A 5JU6A 4RPPA 3L0NA 3WDJA 4TTUA 5F7UA 5GQBA 1EJXC 5EPDA 1OSEA 1RPKA 3VZYA 1PBGA 2NXIA 5E93A 3UNDA 1GQNA 1IYXA 1E56A 4UQEA 4FI4A 3P74A 4OV4A 4FOJA 5LNUA 3WY1A 3L4VA 1RUSA 2I57A 3SCUA 1R87A 4L4PA 3P81A 2JGQA 4H7VA 1E5JA 5HR7A 1WYIA 3ARYA 1S5TA 4QG8A 2PE4A 4B9YA 1O5QA 4O0ZA 4CQAA 5HPCA 2JALA 3RLGA 3S3GA 3PZGA 1FCVA 5AHMA 4AY7A 3NNTA 3M5XA 4M3PA 3VGDA 2Y7FA 2EQDA 4OUEA 1QNSA 2DUZA 3HB9A 4MJ4A 4X0NA 5DF0A 4GZIA 4XB3A 4AY8A 4E0CA 2FJKA 2YCIX 2QCNA 1KRMA 1C93A 3U8GA 1GQJA 3T2OA 3LHVA 1FWFC 4N9CA 1M7XA 1VYSX 5AZ1A 2YZ5A 2Z00A 2BHZA 4NP7A 5GNZA 4MLJA 4ZMGA 2FH8A 3ZT5A 4F2UA 3GR4A 4O11A 5A6BD 3R12A 3F1QA 1M53A 3VKCA 1UUQA 2GJXB 4M24A 3W23A 4RXFA 3M0LA 2ZXBA 2CXEA 1SPQA 1BVNP 2NX9A 5ABTA 5CLTA 4DLFA 3BG9A 3SIMA 3IJ8A 1WCGA 2BODX 3BSHA 3IAPA 3MO7A 3ONCA 4I6VA 4PCTA 2FJUB 1US2A 2HV5A 1TR1A 4DYKA 3VIMA 1SW0A 3G24A 3T44A 3B97A 3SDOA 3TSDA 1VRDA 3G18A 3T1GA 3OHMB 3P14A 1I2PA 3PF3A 1E9ZB 3ITXA 1KB3A 1HJWA 4ZTXA 3IJDA 2BXZA 1NU5A 2B4GA 3EOEA 2VRQA 3DDMA 3W25A 1E4IA 1K9EA 1PIIA 3R0KA 1OZQA 3VVGA 2EPMX 1U2YA 3VFLA 1Q2SA 5TQLA 6XIAA 3HQNA 3TEVA 3WBEA 3UG8A 3IAQA 3MKKA 1E40A 1AG1O 3AYVA 4YVPA 1HKMA 3VIIA 3WLMA 2P0OA 3IJ9A 3T4CA 4MKSA 4N42A 4RW3A 2DIJA 3OPSA 4TV6A 4C6MA 3URQA 2PP0A 5JUVA 4US6A 4GVIA 1XG4A 4W5UA 5E5CA 3W53A 4OKDA 3OBKA 5LYRA 3M5ZA 3ZOAA 3GU1A 3P2VA 1I0BA 3OP2A 4XBKA 2VD8A 4I7UA 1HW6A 1HG3A 1ZAIA 4QROA 2AKMA 3KTXA 1XSJA 4E2BA 1D7KA 3VIHA 3WH7A 1RV8A 3BAJA 2PURA 3KBWA 3L2MA 4A3RA 4YN5A 2YCKX 3ANUA 1QNPA 4HNCA 3S9YA 3A4WA 3PPFA 3ZVHB 3DC0A 1EIXA 1V77A 4GOAA 1VJIA 3OIXA 4H4IA 1UC4A 3BMWA 4LFYA 2ZWZA 5DT5A 1A47A 2QUNA 1R30A 1DKWA 3PBGA 4PUJA 1YQ2A 3QLDA 2X0HA 4IJCA 3LX9A 1FOBA 4Z2KA 2G3MA 3H54A 4ADSA 2PDGA 1W1B1 3GVGA 1TMQA 1J93A 2YL5A 4NZ1A 4QJ4B 2R1NA 1O6IA 2R6OA 3UXLA 3TAKA 1V08A 4ECLA 1KRCC 3BCFA 3THCA 2VFGA 2HNHA 1JXJA 1GNXA 1B3YA 4U3CA 3GQYA 3VDCA 3BURA 2B0MA 3HQPA 1JULA 4ML9A 3VGFA 5AFDA 2GYIA 1ZU8A 3T8LA 1HL9A 3MVIA 1KM1A 5LKYA 3PANA 1WXZA 3GG0A 2J77A 1P5BA 1EDGA 4JGDA 2Z1WA 4B5SA 3WLHA 2XSXA 1Q6QA 3U4FA 3V0SA 4Q4KA 1A3XA 4CD5A 2PLJA 1YADA 2VEKA 1FDZA 4LF1A 3WH5A 3R8GA 4BQ5A 3N2TA 3E9AA 1ISVA 4I9JA 3OB8A 1Z41A 4UB9A 3CBWA 4DYJA 2CYGA 1W32A 4F40A 4ROPA 1FWJC 2BFGA 3M0KA 4XZHA 9XIMA 1ELSA 2NX1A 1XH1A 3H7UA 4CGTA 1GPFA 3C52A 4BWLA 3CH9A 2CXGA 3O2LA 5HBFA 2Y5JA 1AQ0A 3WQFA 1S3HA 1B9ZA 3SBFA 2ZFAA 3ONBA 1SZFA 1Z69A 5DANA 4K3ZA 3UYCA 1IWBA 2HXTA 1JDFA 3EOUA 5BYWA 3N14A 3B0PA 5I06A 2FTPA 1EA9C 3CM4A 3ITVA 2BGSA 5D9NA 4DJFC 2RGLA 3PZTA 4GUJA 3GNPA 6TIMA 1V0NA 3W2NA 1I6NA 4QM1A 3FN9A 4LBSA 4REQB 4EPDC 2J74A 1MQRA 2PODA 1G6CA 2Y4SA 2CBJA 4I8DA 5D8WA 3UZYA 3O1NA 4E8DA 5DN1A 5T9CE 3RO6A 3NQEA 3BK0A 1KNWA 5D05A 2ZZ1A 3LCFA 3GRIA 1Q13A 1W1VA 4M6UA 4L1XA 4HKPA 3FKRA 2WMGA 3FEQA 3IIOA 1CXEA 3QZ6A 5FF0A 1X8FA 3P80A 2VEIA 3GNDA 4DUVA 1XP3A 2E8ZA 2OTDA 4UTHA 4S3AA 1AMKA 5MKGA 3E0LA 3KRSA 1BLIA 3TYAA 4WSKA 5DCEA 4DO4A 4LAOA 1U5HA 1QOQA 3KW3A 4NAFB 3WQ6A 1NFPA 2X1TA 1PZ3A 5JH2A 5CLWA 4JY8A 2CLOA 2DZPA 3GC2A 1TJ0A 2IXVA 2OCZA 3B06A 4L7ZA 2YJQA 5DY2A 1XIEA 3HFTA 4KT2A 4ACYA 1M3UA 2EF9A 2YW4A 1Y5VA 1PZ1A 1BKHA 1PZ0A 2BX7A 4PMNA 2VX5A 1V6UA 1EHNA 5CPQA 2PSNA 2FZDA 1X98A 2ZVRA 3QY7A 4GYJA 2V2HA 4JFWA 1JCLA 4JZ5A 4L4LA 5IBXC 3N2OA 4PBFA 1D2KA 4I7WA 3PY2A 2XGZA 2QV5A 4IOTA 3GTIA 4TUFA 1G9HA 3WL0A 5EL1A 5A6MA 4RE3A 4ZSTA 3M6DA 1DJXA 3LK6A 2V2CA 1OF8A 1TR9A 3K5XA 4G7FA 2Z6JA 1DJHA 2GJPA 2WCGA 5EB8A 3G3MA 5CC5A 3G22A 1W1PA 4FLSA 1WO2A 3NXFA 5DLCA 4IUOA 3SQMA 1TFVA 2CZDA 3GW0A 3LHWA 2FTWA 3M44A 3ABRA 1DQUA 1W5NA 1VBHA 3B0XA 1Z44A 4FA3A 1VIZA 2C79A 2FDSA 4Z1DA 1TPDA 2P1FA 3A64A 2XN1A 1N2VA 2QJJA 1XPGA 1MI3A 4FHAA 5CQ1A 1OYAA 1ISYA 5A2AA 5DEZA 1LP6A 4HD5A 2YYUA 2OGJA 1ZFJA 3ZR5A 1YE4A 4W89A 4S23A 1P1MA 4PBEA 4LAKA 4ZOEA 1UD2A 1MEWA 5CC3A 5CZKA 3RNDA 1S3TC 3ALGA 2GQAA 4HPGA 1XRVA 5MF5A 2GVGA 4ZO8A 5G4EA 3A24A 1NFBA 3AZRA 4HU0A 2ZVIA 1GYLA 4F66A 4TU1A 2HBXA 4IFKA 3LV5A 1MZHA 1P1XA 3KWXA 1EB3A 4XK2A 3GG7A 3WF1A 1Q5MA 4R7OA 1YBQA 1X6UA 5C70A 1WAWA 3M0HA 2G3IA 2WZIA 1UD4A 1JCYA 4MKNA 3RJXA 4MB3A 4HPNA 4WKHA 2QPSA 4RE4A 4O16A 1LLZA 2VTFA 3SECA 1OABA 3DYPA 3LXAA 2BLEA 2X8RA 2O7QA 2XUCA 2Z2UA 2OYKA 2QUMA 5FEPA 5FKYA 3U7BA 1OK6A 3EDKA 1E0VA 2GVEA 4FNRA 3EZ4A 4HIBA 2JGYA 4UR8A 4IIGA 4X61A 4H3DA 2PU0A 5BXSA 5CAKA 2J27A 1R9YA 2WZEA 3HGSA 2BB0A 3HMJG 1FBAA 3JZEA 3OA3A 4DNMA 3A4XA 1MRAA 4KETA 4BCEA 3V16A 4TQTA 1O66A 4GX9A 1X38A 2QAPA 1KBLA 4MWAE 5J8LA 2QCEA 4C6FA 2Y70A 4KGLA 4PBGA 4UTWC 2QHAA 4PZVA 3TYZA 4JXCA 5A8PA 4MMWA 1XLEA 1FFRA 2E6AA 3NQAA 3UXIA 4V33A 2XM1A 1BFNA 4P7NA 3ARSA 3QMTA 3BGGA 2B7QA 5KEZA 1P7TA 4W7UA 2CLPA 2J9XA 3ZYZA 1TZZA 1ADSA 4ICMA 3S2CA 3WK3A 3MCOA 3REQB 4UQDA 1UMYA 4HK7A 1HZYA 3A4JA 1WOAA 1UKQA 5I3DA 1JZ4A 2X41A 1QOPA 4NZFA 4WSJA 1K8ZA 1TO3A 4GCXA 3UWVA 1CGTA 2YBVA 3NGJA 1DWGM 2EO7A 4GIYA 2JEPA 2DFAA 3WLJA 5H1WA 4GY0A 4LRSA 2OMAA 6ENLA 3CJPA 3CUGA 2BTMA 2F6XA 3MKCA 5MHBA 4IP4A 2FDMA 2Z25A 3GSMA 1MUMA 3N04A 3NDZA 2VGFA 4XO7A 4Z1YA 5KETA 4U2ZA 4QGCA 1F6YA 4K8HA 1P0DA 2OEMA 5FACA 2JQXA 3TW9A 3QVQA 3AWNA 4D8ZA 3PBUA 2V5JA 3S5ZA 1WZLA 5D04C 4B2DA 1ITCA 1ISZA 1IGSA 4JX6A 1QASA 3P8IA 1ZALA 2D2GA 5HNRA 2CLEA 1OFQA 1VEOA 2G5WA 1KBBA 3CC1A 1R9XA 1DQXA 1XW8A 3K1DA 2O9TA 3GTFA 3H6OA 4JQAA 3L5AA 4GYKA 3DYOA 1K8XA 2BG5A 1WXYA 3FHQA 1PKNA 2O92A 1XBYA 1UROA 2PDPA 4IISA 3T4WA 2NT1A 5A2BA 1TZ9A 3N19B 4M82A 4XBSA 2CHRA 4GLEA 1R3WA 2FPYA 4XKYB 3IACA 1RJQA 4P7RA 4LCRA 4PTWA 2G4JA 1YMYA 1KWKA 1TQJA 2BDQA 1QHPA 4C65A 5K9CA 2OG9A 3WMCA 1J11A 2D3NA 3BAIA 4UFMA 4Q8VA 3N4FA 3UWYA 1B3ZA 4L9YA 3SY8A 3FA4A 3M41A 4FSAA 1ZRQA 3M0VA 3DCPA 3L4UA 1XPYA 3I4KA 4NJKA 3MV11 2PI6A 2E4TA 1BF6A 3S0CA 2CHOA 4B5XA 1V4YA 1XX1A 1RQEA 4JL2A 1X1OA 3WF4A 2FHBA 4W88A 3EOLA 4M1BA 1LWJA 2GJNA 2BY1A 3KOYA 4MPKA 4NSBA 5AZ0A 5BOEA 5CPTA 4JIRA 4OOZA 1OIMA 1Q65A 4JYFA 2ACRA 5D32A 2WMHA 2ZE0A 2DDXA 2VRJA 4JD4A 5IBXA 5LIWX 1KKRA 4FX7A 2A6LA 2C16A 4LVFA 4KEUA 3FS2A 1UKTA 4H7ZA 4FF7A 3WNKA 4BI6A 1Q6CA 2ACSA 3HGJA 3JUGA 3L67A 1LG1A 4BK9A 3AXMA 3FJ4A 1AL7A 2FZ8A 2ZQ0A 1E9IA 1EEPA 2VX7A 3UPMA 5J5RA 2PDYA 2QPXA 1IE7C 4NZ3A 2O9PA 3TR9A 1A49A 2HPIA 1TV3A 2C18A 1RQBA 1JZ8A