3RLVA

Crystal structure of the mutant y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
220
structure length
220
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 86
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3rlvA00
3OIXA 1W5PA 3LDVA 3LERA 3RFAA 2DZTA 3IGSA 1T96A 1RQHA 1I2QA 1TPVA 3W7MA 3P5YA 3MI6A 3OA3A 1SO4A 4IPJA 4J9JA 4X2RA 4CQ9A 3QMRA 3N34A 3DI0A 2VKZG 3YPIA 4DF0A 2YSWA 4IGHA 1EP1A 2ZRYA 4WY0B 5CPOA 4CCCA 4K39A 2QAFA 4RXGA 1SZGA 3C2OA 4PCFA 1I2OA 1PHQA 2ISVA 4JN6A 2E6DA 3RLUA 1VCGA 1TPWA 5FF4A 3MYOA 1FXQA 3GXTA 3M44A 2ISSA 2O7QA 3NPWA 1F6KA 1LOLA 5DCEA 3W7PA 4C1KA 3USBA 2H6RA 5I3GA 5F4WA 3R5EA 2ABAA 2AQWA 3DU0A 3G1DA 1K8XA 1JQXA 3M5XA 3W2KA 3M7WA 1FDYA 1L6WA 4OU1A 1QFEA 2YGYA 2ZRZA 4IJBA 5HR7A 2QJGA 4R34A 5KITA 1VYSX 3P84A 3M47A 4K6AA 3OBKA 4M6QA 3STCA 2QCFA 3NQGA 3IV3A 1KFLA 1OFPA 5HR6A 4RZ4A 4GFSA 3R89A 4OHQA 3LI0A 3R2GA 4PL1A 4A22A 2FB3A 2ALDA 3W7LA 5H2ZA 3INPA 3L5MA 1TV7A 1Z44A 1FBAA 5BMXA 4O15A 5K9CA 3FIGA 1F76A 3ZWTA 4H3DA 5G4EA 1SSDA 2NX1A 2CW6A 1YPIA 1E51A 3HMJG 4QM1A 1PHWA 3THAA 3W7OA 3E0IA 3MO7A 2WSYA 3CWOX 4Z1CA 5HNRA 2PRLA 2H3BA 1IXOA 1KTBA 3GDTA 4IOTA 5EBUA 3PUOA 4LRTA 4MKNA 3FYPA 1OK4A 2ABBA 1IIHA 3O8AA 3L67A 4L4MA 4MY8A 5AHFA 2ZZ2A 4DBEA 4UCGA 1Z42A 4FIQA 3U6WA 2I14A 3ABOA 3L2IA 5F4SA 1LBLA 2ZCGA 3TR2A 3G1XA 4YLWA 5BMWA 5LNRA 4RLIA 3TQKA 4ZZ9A 4BI7A 4N2YA 1KTNA 3C56A 1SW7A 2DJXA 3G1SA 3HB9A 5DBTA 2NZLA 1JUKA 1JCXA 3KVMA 4JXCA 2CLEA 1OG0A 4ADSA 4ADTA 4DBDA 3R12A 4WJEA 1KV8A 2VFHA 3I65A 1RVGA 3W73A 3N73A 4S1FA 2CLIA 5AHMA 4I7WA 4WQ6A 1CW2A 2A7PA 3TQVA 4LVBA 5F1UA 3W7QA 3GR8A 5K7JA 4CLMA 3TK7A 3QFEA 3WK2A 4OE7A 3SECA 1OFQA 4O13A 1FDZA 4WUIA 3QW3A 1VZWA 3HIJA 3GNDA 3LHTA 2W79A 1LRTA 1KM0A 3G0SA 4YL2A 5KINA 1VR6A 3M5YA 1EEPA 4O54A 1BWLA 3G3MA 3EWYA 4N4PA 1XKYA 1NEYA 3TX9A 3P7YA 3P8IA 4JYEA 2WPBA 1DBTA 1X6UA 1YDVA 4K8HA 5A8GA 4IWWA 1TTIA 3MI3A 4NT0A 3NEVA 3NQ6A 4ZQCA 3MP3A 3T7VA 5AYXA 1A5SA 2PURA 1R2SA 2FDSA 1Z48A 3SR7A 2GVLA 2AGKA 1Q3NA 4N9DA 1PIIA 3E96A 3F4NA 3S9YA 4UFMA 1JCJA 2E68A 1RD5A 4RCXA 1ICSA 2YCEA 3WK3A 4KWVA 5MHBA 3UWZA 3NZ1A 2W0UA 1GYLA 3PULA 4UFKA 8TIMA 1WOAA 5G2HA 4N4QA 3EB2A 2QAPA 2YW4A 4NQ1A 3N9SA 2CU0A 4H6KA 3IVTA 3TSDA 1OFBA 1A5CA 2J9ZA 4OQVA 2WQPA 3LOTA 1QWGA 3ELFA 2FPTA 3BGGA 1WBJA 4W9TA 1JCMP 2NX9A 1U83A 3OG3A 4E0CA 1TJRA 5TQLA 1QMLA 3HO8A 4AAJA 2V8ZA 3FKKA 2QCLA 1LOSA 1PCWA 4PH6A 3TW6A 2ZRWA 1LBFA 4IX0A 3EX6A 1AW2A 3I6RA 5LSMA 4MIMA 4HNVA 2J9XA 2NXIA 5KZDA 3EWBX 1DORA 1FWTA 5I3HA 3G18A 4NJGA 1W8SA 1ALDA 4HN4A 1OYAA 5K4ZA 1SFJA 3GDMA 1BKSA 3F1QA 5ABTA 1TPDA 2VEKA 1TV8A 2I9EA 1GTEA 3W86A 1L2UA 4MYXA 5HJLA 3WJWA 3C3NA 1LRQA 5AHIA 3DFNA 3UPWA 3L68A 1X7FA 1G4TA 3NL3A 1NF7A 2EAWA 1OX4A 4N9CA 1LM1A 3M5ZA 2NUWA 2X16A 1FX6A 3O05A 3GR7A 3Q37A 2YX0A 1P0KA 1IGSA 4XTDA 1DV7A 3P80A 3W1RA 2TRSA 3RMJA 1TPUA 1H5YA 3WJSA 3T4CA 5CKSA 3N2MA 3VI2A 4RK8A 1QCWA 2CFFA 4MPQA 4QAIA 3LGEA 3W7DA 1K8YA 4XTIA 1W0MA 2Z6IA 4OV9A 4GRSA 4UTMA 2NWRA 4JTGA 5IBXC 3S5ZA 2V81A 3W7KA 4R7JA 3C6CA 2RDTA 5D02A 4LUJA 4FNUA 1D3GA 4UTJA 4GUJA 1KFBA 5CPLA 5BW6A 1ZENA 2QCEA 1ZCOA 2VFDA 4LC6A 1YADA 4LVGA 1XUUA 4GE8A 1Y0EA 1Q6QA 4FHAA 2OCZA 1F05A 1IXNA 2E5CA 3QH2A 3OVPA 3E02A 4O11A 2FQIA 3Q94A 4M5PA 4MJZA 3A22A 2ATMA 3A24A 2FPYA 5D30A 4IXXA 5DCDA 3UWYA 2V0TA 1LLWA 2CLFA 4E2DA 4JIPA 1GTHA 3G1FA 5E93A 3DENA 4FNPA 4LTSA 3CIXA 2ZTKA 5DBUA 1KM6A 1H51A 1TV5A 3ABRA 5D2VA 3TA6A 1P5BA 5AC8A 3MHFA 4RKAA 4FNSA 3NQDA 1EUAA 4GC4A 5F1VA 1FXPA 3C2RA 3TW7A 3AO0A 3GDRA 3MW7A 5LZLA 1H63A 3FLUA 2E77A 5F2LA 4UTWC 1I2NA 2ZDRA 4O4VA 2P10A 1YXDA 1YDOA 3MJYA 4MZ8A 1JCLA 1O94A 1BEUA 1HO4A 2OMAA 3LCFA 3FKRA 3FJ6A 2NV1A 3W75A 5F2MA 5FI8A 3TXVA 3WJZA 1ICPA 3PB2A 4M6VA 2HTMA 3G1HA 3NPXA 1EWEA 2OZ0A 2PCQA 5HINA 1CI1A 3C4UA 2Y88A 1FWRA 5G1TA 5TBOA 2NUYA 4WOZA 3BO9A 3KRZA 2A5HA 3W74A 1P4CA 1LZOA 1FCQA 1QR7A 2R8WA 3EWZA 4GXMA 1UUOA 1LRNA 4DPPA 1W3IA 5AHNA 2ISWA 2XN2A 1LCOA 2YYTA 2HSAA 5LNVA 3TIMA 3LTPA 1WYIA 3PG8A 4QIUA 3CM4A 1O4UA 2NV2A 3EX4A 2E5BA 3QZEA 3TJXA 4ALDA 2GJNA 1L6YA 3S1VA 4QNEA 4HIBA 2EHHA 5D38A 3UZ5A 2ZA1A 5HULA 5CPMA 1GT8A 3DHDA 3RNDA 1IXQA 3VCRA 4IUOA 4Z1DA 3TSBA 4LVDA 1TPEA 1P0NA 1R46A 4RV8A 2X2GA 1YYAA 3KXQA 1FWSA 4XZ9A 4P2VA 4XBSA 5K9XA 1O5XA 4NJIA 3QC3A 3T55A 1HTIA 4ICNA 3TQ0A 1LDCA 1XBXA 2ZYFA 1C8VA 2TPSA 2I1OA 5G2WA 1W5QA 3U2OA 1M6JA 3Q58A 4RZ5A 1DQXA 1H7XA 4M19A 1KLYA 4AWUA 1QOPA 2FTPA 4IX2A 1AW1A 3F4WA 2IQTA 4TIMA 5K4XA 3DFQA 2CZ5A 3PSWA 3QM3A 2CZDA 2BX7A 3G3DA 3P74A 5D2XA 3UD6A 4DO5A 3NNTA 2R91A 3CWNA 4AH7A 1D3HA 3L21A 1XCFA 3W83A 4NXSA 3LCGA 2NXGA 3NGJA 1KM1A 5KZEA 2J9YA 3QEZA 4MY1A 3GK0A 3O07A 1U5JA 4MOZA 2DZPA 1H50A 1BTMA 1K3UA 1OX6A 1ZY9A 4DEFA 4O12A 3BGJA 4UR7A 1OYBA 4A2SA 3G0XA 4QNWA 3T44A 5BRBA 3L66A 1Q6LA 2EKCA 3DFSA 5CG7A 5EYWA 3UYCA 1OFEA 3MHGA 1JCNA 1GVQA 1PVNA 3LBCA 3F03K 2DZXA 3T40A 5I3IA 2VXNA 4FX7A 3OVRA 1K02A 1S5TA 3LLDA 1DOSA 3WK0A 1YTEA 4M7SA 4JTUA 3ATZA 3IEBA 3QF0A 1N55A 2QF7A 3OHIA 4NVTA 4WD0A 5EPDA 4WZHA 5LNUA 1PV8A 3ZR4A 3LCWA 3LTSA 2PE4A 2X1SA 1IXPA 3N3MA 5AYZA 1YXYA 4JYFA 3L9CA 4QJ1A 1ZNNA 4FO4A 4EOUA 4YWIA 1QPNA 4GBUA 3HPZA 2C3ZA 2RH9A 4Y8FA 3MBFA 4FNQA 1QAPA 5D2YA 2A6LA 1L9WA 4WX2A 3UXAA 4UTHA 5IBXA 3MMTA 1SQ7A 5K2ZA 4MZ1A 4O1CA 4D2JA 3IGXA 1MO0A 4XKYA 5F2GA 1TO3A 4FXRA 4UMAA 2CLOA 3W1PA 3W1NA 1O95A 1ONRA 3CHVA 3GB6A 1NSJA 1OHLA 1SZNA 4K36A 3W6YA 5FEZA 1GPWA 1H61A 2R94A 1RPXA 3GKFA 4KKXA 5U7SA 2VEIA 5IM51 1C9DA 1W56A 4NNAA 2YW3A 1TTJA 2EGZA 4BWLC 3TH6A 4KFNA 1EPXA 4JYDA 4NJHA 4AHPA 2ZRVA 4LS0A 1Q45A 2ZRXA 2ZQ0A 4Q4KA 4JTKA 4LS1A 4AF0A 4C1LA 4OWGA 1XM3A 2Z1BA 3C8FA 4NX5A 3L5LA 1EWDA 3G8RA 4TX9A 3PB0A 1XBYA 1MSSA 2QUVA 3CB8A 3STGA 6TIMA 1LYXA 3KFTA 2E1DA 4AMAA 3LHWA 1K8ZA 1EP3A 4RX0A 5CPNA 1T0OA 3TCEA 5FF3A 4PTNA 2Y7DA 3EWUA 4UTWA 1IF2A 2XN0A 1ME7A 3PG9A 3TXZA 4JICA 3N9RA 3DGRA 5LNWA 3FYOA 3MP5A 5G4WA 1K7EA 1TB3A 3LM7A 3PF3A 3TE9A 3TMQA 1A53A 2CWNA 3P60A 2PRHA 4NZJA 1GVOA 1VYPX 3QRHA 2V82A 2QCCA 4KFPA 5AHLA 1AL8A 5AC7A 3W2MA 4TU1A 2R14A 1Q6RA 2CZEA 3W1QA 3IIPA 1FWNA 3UZJA 2A4AA 3IVSA 3ABSA 4YMZA 3LHYA 4XUGA 1VRDA 2RHGA 3V75A 4OT7A 3O6CA 5CZJA 2RDWA 1QO5A 3PWAA 4NZFA 2YXGA 4M7TA 4LU0A 3S5NA 2Z0IA 1OYCA 3MUXA 3SI9A 2FB2A 2GOUA 1OX4B 1V5XA 1A5AA 1XUZA 3LCXA 3DBPA 3G8EA 3C52A 3B03A 3M0ZA 3W23A 3W2UA 5GVJA 1VPXA 2CLKA 1S5WA 1J2WA 3KHJA 4UNKA 4BR1A 3UWUA 4K7YA 2TSYA 4MLJA 2BZNA 1SW0A 3EX2A 5SWUA 1HO1A 1FCBA 3P81A 2RDUA 1EUNA 3P82A 4UUIA 4UTIA 3WJYA 3WJXA 1TQJA 3CEUA 4EF8A 2A6NA 2Y63A 5D37A 3LHVA 4O1AA 3LTYA 2QUTA 1C29A 1PCKA 4LS2A 1W31A 1W37A 1VH7A 2CLHA 3NM1A 2XN1A 1NAL1 2QCGA 2UV8G 2FJKA 1OX5A 3G1VA 3DKLA 4OGZA 5FESA 1PE1A 1LTDA 3TV8A 3LCIA 5FEXA 1X1OA 5HUOA 5K3VA 2C18A 3BLEA 2PC4A 1SFLA 3W7CA 5DXXA 4U4MA 4WY0F 4P61A 5E1QA 2VFGA 5D09A 4RR4A 2JKEA 4U28A 1A50A 3PBWA 5CGQA 3W88A 3W76A 4N9EA 4IMEA 4UXDA 1ZAJA 1G69A 1XC4A 1MEIA 1R2RA 1I2RA 1OFDA 2B0MA 3HG2A 5FF2A 3DXIA 4HSOA 1OFAA 3W1UA 4JGDA 2E6YA 5HUPA 3S8HA 3IIVA 2GVGA 4CQAA 5C6MA 2WV8A 3KRSA 1B4KA 5DXYA 3W7EA 4MFDA 1H7OA 1VLWA 3GXNA 4CCEA 1TPH1 1ML1A 3MP4A 1ADOA 4UTTC 3THQA 2QCHA 3HG3A 1Z41A 1YTDA 4ADUA 4LT9A 1EP2A 1B57A 1ICQA 3B0VC 1GVRA 3W7RA 2GUUA 3L0KA 4E2BA 2OJPA 1EIXA 2J24A 3VE9A 1OFOA 1UCWA 4LNYA 1F5ZA 4X3ZA 1AMKA 3NL2A 4HT3A 1I2PA 5LGZA 1XFBA 4DPQA 1VHNA 4NXKA 4YCPA 5CSRA 1X1ZA 3OVQA 4PFMA 3QJAA 3TAKA 4DXVA 2NLIA 2VENA 3O06A 4PA8A 3DFOA 1O60A 2LLEA 5D03A 3GYEA 4Y90A 1TRIA 1KBJA 3L0NA 4OV4A 3W71A 4S2CA 3IIXA 4BWLA 4S2BA 1RV8A 4I9AA 1PL9A 1LLZA 4H4IA 3TFCA 5T26A 3W1XA 4DELA 4TMBA 3CU2A 2VEMA 2QJIA 2YFNA 3QQ0A 3DFTA 2JGQA 1JVNA 1W1ZA 1JRCA 3CT7A 4GUFA 5D2TA 2YPIA 3CEPA 4FF7A 3CQ0A 1PS9A 2F7FA 2V2CA 4BF9A 1VYRA 1K03A 3IIZA 3W70A 1SO5A 3KVLA 2P0OA 2V5LA 1NVMA 1AW5A 4JX4A 3M1ZA 3SGUA 3C2EA 4NJKA 2NWSA 2YDAA 3LRMA 1H7WA 2RFGA 3QMTA 5H91A 1T99A 2QCDA 3TSMA 1GYNA 1HL2A 4O17A 2JBMA 4NU7A 2HS6A 2JKPA 5AB3A 1RQEA 3P67A 3FA5A 1F74A 2Z2UA 5CZSA 3G24A 1XBZA 1T8XA 3R13A 4JD4A 1GVSA 1RR2A 3W9ZA 1G7UA 4PC8A 4X9SA 3GVGA 3E9AA 5FEWA 3BW2A 4ML9A 3W85A 1H60A 2Q8ZA 4A2RA 3SSJA 4O1BA 3LCHA 3L65A 3ZFHA 1JJKA 3S1WA 3NL5A 4PODA 4Z1BA 1F73A 4KWWA 3PS7A 4ZVJA 3EXTA 3FJLA 3S5OA 4O52A 4FNRA 3V1PA 4N02A 5A5WA 4IMDA 1THFD 1SZFA 1SUXA 2F84A 3NDOA 3LHZA 4AVFA 5DELA 1DHPA 4AHQA 1LORA 3PUEA 4XWUA 4FIRA 1D9EA 1A5BA 4K7VA 4Y6GA 4KFOA 1SPQA 5AN7A 1SW3A 3DHFA 4JTTA 3C0JA 3LHUA 1QPRA 5I3KA 2C13A 3LV6A 3B4UA 4HHPA 4UMCA 3W7IA 3W7GA 4XKYB 4FB7A 4K8EA 2GVJA 3A5FA 3DI1A 4FXSA 2VEPA 5U4NA 3SJ3A 1S3HA 3GNNA 4JDYA 1JUBA 1X8FA 2A7RA 1GEQA 3GZ3A 3TJLA 2ZA2A 1WA3A 1GVFA 1F6PA 1H1ZA 3BVJA 5D2WA 4ZQPA 3GKAA 1M7OA 3P62A 3PVFA 3RLVA 5KMYA 4UR8A 1XXXA 1CX9A 2Q3OA 3VFLA 1ZFJA 5BNKA 2VFIA 4Y96A 3QW4B 5EL1A 3BV4A 4AF0B 2WSQA 4Z1AA 1UJPA 1TPC1 3LCLA 2AAMA 3QQ1A 1WX0A 2Z6JA 1YPFA 4N6EA 4ZMGA 3M43A 2C6QA 2O7SA 1M5WA 3GDKA 3PC0A 3GXPA 2DU2A 2Y70A 3VKJA 2G5WA 1UASA 5DN1A 2H8XA 2A7NA 1TCDA 3N14A 1AG1O 5C54A 1TSIA 1OK6A 4ORIA 5KTLA 1F2JA 5LHEA 3O1NA 1VGAA 5TIMA 4AHOA 4JX5A 2FIQA 2V30A 4ZQOA 1WDWA 4LV4A 1G67A 3QSTA 2A21A 3LI1A 3IVUA 1TPFA 3PUDA 1W3TA 3RK8A 1KTCA 4JY8A 2ZZ7A 4ZQRA 4UTTA 1UB3A 1VQTA 2G96A 1AL7A 3W22A 3NG3A 3B04A 3EWXA 4PEKA 4UNLA 4CNNA 2A1YA 5BOOA 3NXFA 3LXCA 4GUHA 3MHUA 1GJPA 4HNNA 4B5NA 3HBLA 4WXYA 2BTMA 1XL9A 1SR9A 1TRDA 4OBTA 4JS3A 4NNBA 2DZWA 4GUIA 1J4EA 1FQ0A 3ZS4A 4A29A 3GAKA 1EB3A 5LHFA 1W54A 1KFJA 1S5VA 1K7XA 1SSGA 5FEPA 1GOXA 1V7YA 2YZRA 1SO6A 2ZBTA 4BK9A 2QKFA 4PL2A 3EKLA 1FY6A 3QSRA 2ZA3A 3W2NA 2A0NA 4JY9A 2G97A 2DZSA 4O8RA 2C15A 4O0ZA 1BWKA 1MZHA 3PAJA 3HGJA 2V2HA 4MJMA 1YLVA 3T78A 3HF3A 3O6YX 3H53A 2V5BA 2QEZA 4Z08A 3C2VA 3EX3A 3NQFA 1TJPA 3LXAA 2Y7EA 3B05A 3DAQA 4R33A 3W2JA 3WK1A 4NNCA 2QCMA 3HGSA 1G7VA 4RXFA 1FCVA 4JDBA 3KOFA 4O0KA 3NM3A 1I8JA 4JTIA 3E49A 3B0UX 3NPVA 4WXZA 5HMSA 4Y9AA 3B8DA 2DORA 4HKPA 1NF0A 3QMSA 1KM5A 4DO6A 2KZHA 1F7BA 1ZALA 1WV2A 3TNOA 1HUVA 3CIWA 5C2XA 1XI3A 3KVKA 1B4EA 2C14A 2RKXA 1H7NA 1QPQA 3W1LA 1DJNA 4HSNA 3W2LA 3S1XA 5EKYA 3W7JA 4O28A 2P1FA 2A85A 3LRLA 4L4LA 2H8ZA 1RQBA 2DZVA 3UWWA 4JNMA 4LC8A 4O53A 1I45A 4HPJA 4N9BA 1XDMA 3HGOA 3JRKA 4EIVA 3OEXA 2ZZ1A 5E0KA 4CNOA 3L0GA 5D32A 4RJEA 4UFLA 5DLCA 5HQEA 2W6RA 4MFEA 2PRMA 4YXGA 3LRKA 3W1MA 4CNPA 3A23A 4K38A 3IRDA 2J88A 5AYYA 2WO5A 3QPYA 4IXHA 1ME9A 5AHEA 2OT1A 3S42A 4ONVA 3KX6A 1N7KA 2C1HA 2EPHA 2J6XA 2GJLA 1TTPA 4HNTA 2FFCA 3KAOA 2WNZA 3CTLA 4ZQMA 1I4NA 3BG9A 5J5DA 3H54A 4FX8A 4GUGA 1EX5A 4DO4A 3HQ1A 1VS1A 1OJXA 3CLMA 1TIMA 3HGRA 1W3NA 1QO2A 3M6YA 5L6UA 1WXJA 1GZGA 2D73A 4HNUA 5D05A 1KLZA 3BARA 6ALDA 3I7QA 1WQ5A 3EXRA 4CCDA 4HPXA 3K30A 3P5ZA 4UTLA 4GWEA 4R53A 4TMCA 1FCUA 4WY0A 4O50A 2WOQA 3SFKA 1KFCA 2VFFA 1SZEA 3G0UA 5FF7A 1GWJA 3D0CA 2CLLA 4O14A 3RU6A 1SU5A 3S0CA 1R47A 3FS2A 1R2TA 3S6DA 4XBKA 3KVJA 4LY8A 2QUUA 4JX6A 4NX0A 3UXDA 2BWGA 4GJ1A 1LROA 4DF2A 3JR2A 2X1UA 4LWWA 4O4WA 1KM2A 3TC7A 2E09A 2TYSA 4M6PA 4FNTA 3UWVA 3C61A 3UNDA 3LBMA 2ZZ3A 4UFJA 3NQ8A 3GDLA 1Q6OA 3TFXA 3HG5A 2Y89A 3PBYA 3BG5A 2QCDB 3A5VA 5G2IA 3NQEA 2NUXA 1HFBA 2ATSA 4MY9A 5K9DA 2BLEA 3A9IA 3VNDA 3NVTA 3W72A 3TKFA 1KA9F 3G22A 3G1YA 3W7NA 2QCNA 3W7HA 2OX1A 3EXSA 4POCA 1RZMA 2GQ8A 5HWMA 5KZMA 3NQMA 2FLIA 3EEGA 1KM4A 2WJZA 5J5RA 2NXHA 5F2IA 1TTQA 1GG1A 3BPWA 1TREA 1ZJIA 3W87A 4IMGA 3SZ8A 4LRSA 1M7PA 1JQVA 1JCYA 2B7PA 3NAVA 4LV9A 2WNNA 4K37A 1FWWA 4MVAA 2HMCA 4Q33A 2CZFA 1H7RA 3LXBA 4YCOA 4MZYA 2TMDA 3W1TA 4UC5A 5AOUA 4LOCA 4O1DA 2ZFAA 2B4GA 2YFOA 4UFHA 2GQAA 1YTKA 2QJHA 2Y7FA 5DY3A 2X1TA 5D04C 1HG3A 3O6DA 5FF0A 5EY5A 1K7FA 3NPUA 4NJJA 3UPBA 1ZHAA 3UQNA 1DQWA 3M41A 3QYQA 5CZTA 4IQLA 5KSWA 2X30A 4LVAA 1G6CA 3B06A 3NR0A 3PM6A 1QPOA 4LW7A 2DZUA 4EF9A 4Z0JA 1B9BA 3LV5A 3N2XA 2DJLA 2E6FA 3W07A 2QDHA 4JTHA 3AJXA 1OABA 3EKZA 1VLIA 1JUEA 3LB0A 3BLFA 5CZ0A 4Q32A 4O18A 2ZZ4A 2G95A 1UUMA 2DP3A 1TMHA 2Y62A 3JS3A 1DJQA 4QSHA 3HPSA 1GQNA 3M9YA 3NQ7A 3S5YA 4JIQA 2NX3A 2XFWA 3DFPA 1TYGA 4O16A 4A21A 3IGUA 2ZRUA 1KW1A 4ZQNA 4G1KA 4MYAA 2VC6A 5C5YA 3TROA 1H7PA 3W3OA 3SW6A 3MYPA 1MEHA 2B7NA 3HOJA 4AWTA 5LKYA 4E38A 1W5OA 4UTUA 5LGXA 5DY2A 2WNQA 3B0PA 1J5TA 4JR5A 3NQAA 3RF9A 1WAUA 3PBUA 1JULA 1WOBA 2B7OA 3W84A 2X1RA 3MI2A 3HG4A 4MUZA 3O15A 1G4PA 4AB4A 2OT0A 3ABQA 3HPXA 3STEA 4IPIA 5I3FA 3DH7A 1LOQA 5G5IA 4AEOA 1MEWA 3UY7A 3NQVA 3IIOA 3N19B 2E5DA 2JKAA 4LVFA 3CC1A 3ATYA 4JTSA 2Q3RA 4ZL1A 2GPTA 1XDLA 3NL6A 3FOKA 3EX1A 2WSRA 2V9DA 1H62A 3NOEA 3W1AA 1MXSA 3LX9A 3UWQA 4BI5A 3GLCA 1G4SA 4X22A 1YDNA 2E6AA 2Y85A 4A3UA 4QISA 2VELA 4I7VA 1O5KA 4JEQA 3M5VA 2GQ9A 1L6SA 1TPB1 4TR9A 3I68A 3TUUA 3Q2DA 3TAOA 3PY2A 1FDJA 3WFAA 4DF1A 1QOQA 2C16A 1WBHA 2JK2A 3LLFA 3UY8A 3GIYA 3H55A 3FFSA 4MLRA 3P61A 1IIGA 3TDFA 3CPRA 4DQWA 2A2IA 3KRUA 4UMBA 1VCVA 5C55A 3PBVA 3O63A 3NYZA 3NQCA 3TC6A 3BG3A 3STFA 1QNVA 4NUWA 3BLIA 3FEMA 2EF9A 4FX6M 3I7SA 3BW4A 3P8JA 2WKJA 1VHCA 1KM3A 1OF8A 2Y61A 1SO3A 2YYUA 2VOMA 4WOQA 5AFDA 3NO5A 3DKJA 3SY5A 2FPVA 4AXKA 5L9FA 3E12A 2QR6A 1W5MA 1UBSA 4UIOA 4QITA 2BSLA 4BI6A 2C0AA 1KFKA 3BW3A 4JTFA 2CLMA 2V2DA 4FEZA 1KFEA 3SGZA 3ANYA 7TIMA 1OF6A 1JRBA 5AC6A 2Y6ZA 5D33A 3S1UA 4LUIA 1B3OA 4JTLA 1VC4A 1ZAIA 1KV5A 4EVZA 2H90A 4UTKA 1DKWA 3M16A 4ORMA 5LNSA 2B7QA 1XBVA 1P1XA 2QDGA 4Z0SA 4I7UA 3ZWSA 1OFRA 5HWNA 1GG0A 4IMFA 1N8FA 1KBIA 3MWAA 1QDSA 4JTEA 4O57A 3R8RA 5CSSA 3O16A 1R30A 1FUYA 3VE7A 3L5AA 1DVJA 1H1YA 4QQ3A 1VCFA 3QPZA 1AK5A 4GNJA 4IMCA 1NFBA 2Y7GA 3NZRA 5F4XA 4XQ6A 5EA9A 4O19A 5EMUA 1VJIA 2C19A 5G1YA 4N6FA 4O10A 3HJZA 2H3DA 2JGYA 1LBMA 3A21A 3C2FA 3PR2A 2HS8A 2ZTJA 2ZZ5A 3TU9A 1DL3A 5HWJA 4RZ6A 1YXCA 1ZAHA 2ZZ6A 2J27A 3GX9A 2VFEA 3I7RA 3U8GA 5I3JA 1W5NA 3NQ2A 3NA8A 4CQ8A 1ME8A 3SIZA 1JR1A 3G1AA 1LP6A 3EWWA 4AWSA 3BK0A 3TMLA 4UFIA 2BXVA 3MBDA 4EWND 2YR1A 5DCBA 1TQXA 1EA0A 2Q8LA 3GAYA 4JTJA 1OVDA 4TO8A 3PSVA 3DZ1A 1G4EA 4BFAA
chains in the Genus database with same CATH superfamily
4PCPA 5GPRA 2DZTA 1T96A 1RQHA 3WLSA 4EANA 3OA3A 1SO4A 2PP3A 1LL4A 2W5FA 3GHRA 3RJYA 3U5UA 3NWRA 3ANVA 3YPIA 2YSWA 2PBGA 1EP1A 2ZRYA 2IKIA 4WY0B 1K1DA 2HVOA 4L1GA 1SZGA 2VNCA 1JZ3A 3RLHA 2ISVA 4HNOA 2QPUA 4BQ5A 3E5BA 1VCGA 2OSXA 4XD5A 2CHOA 1LWHA 2VX6A 3GXTA 3OB8A 1P48A 4CU7A 3NPWA 5C2GA 3USBA 1LL7A 3LK6A 1BXCA 1HL8A 3BOLA 4W8AA 1Y5WA 2I57A 1UYQA 3RO6A 1PX4A 3WLOA 4UQCA 5TAOA 3M7WA 1RLDA 1L6WA 1QFEA 2ZRZA 2P0IA 3WQ6A 4R34A 7XIMA 2J6VA 3P84A 2BDQA 4MUPA 5EB8A 4S39A 3WNPA 1KCXA 3NXLA 1NP2A 1P0BA 1XDJA 1ADDA 3CYVA 1XGZA 3KEHA 3IV3A 1OFPA 3UETA 3WF0A 3VIIA 2J7HA 1V6XA 4ZOAA 4PL1A 4A22A 4FOJA 4L6DA 1XFCA 3QGVA 3INPA 3F2DA 1DWJM 3UXKA 5BMXA 4O15A 3VOFA 1BRLB 1XD0A 3L4ZA 3LZ5A 3V0SA 1JG9A 2NX1A 2R24A 4KESA 2CW6A 1UZHA 5EU9A 3WQFA 1E51A 4QM1A 4DN1A 2WSYA 2HXUA 2Z2BA 2PRLA 2H3BA 4PUEA 4B3KA 4ACZA 1UR3M 4IOTA 4C6KA 1KRMA 3MQTA 1ZSXA 1HW6A 2QT3A 4YHGA 1OGSA 3L67A 3S5SA 4AD0A 1ISXA 1Z42A 2X09A 3U6WA 1CB7B 2I14A 3GUWA 1W9BM 1FP9A 3DDMA 4D6HA 3AC0A 1LBLA 1MQPA 4MWAD 3PPCA 3T0DA 1V3HA 4CNTA 4PMZA 1ELSA 5LA0A 4WSKA 5LNRA 2EPMX 3TQKA 4BI7A 2FVKA 3HB9A 3WMSA 3ALGA 4UQ9A 1YNQA 3ZT6A 1VPQA 3MVTA 4LUTB 2EPLX 3FHQA 1Q6CA 4WJEA 4HU8A 1AQFA 3BH4A 2WCGA 3W73A 2C91A 1WE5A 4S1FA 1VBGA 5JU6A 5I24A 6REQB 1CW2A 4OECA 3WZ0E 3GFYA 3SCSA 3WK2A 1Q7QA 3S2MA 3EDJA 3SECA 4HZMA 1PDYA 4WUIA 1JL8A 4G8TA 3GNDA 3AIEA 1VFTA 1P6CA 4MAVA 3LHTA 1RH9A 1TWSA 4C5YA 5AC4A 1T8QA 2W63A 3G3MA 4DWSB 4N4PA 1NEYA 3NOYA 4JYEA 2IPGA 4Q8MA 3NO1A 5AZ0A 1FVPA 4GY1A 2C7FA 3EA2A 4IWWA 3AS2A 3MI3A 3NEVA 3MP3A 4H6QA 3VUSA 4GYPA 5HA7A 1R2SA 2XGZA 1C93A 4FP1A 1Q3NA 2ICSA 3S2JA 4LEFA 2OYLA 3M0IA 3WMCA 2WC3A 1ODZA 2OELA 1RD5A 2YXOA 1NIUA 3NZ1A 3VGFA 3T4WA 1FFRA 1M9HA 4IFRA 3N9SA 3IV8A 2CU0A 1US0A 2VZTA 4H6KA 4IP7A 3IVTA 2OU4A 2GQ3A 2J9ZA 1IWBA 3I10A 3NFUA 3WN6A 1EBHA 3MA8A 1TJ2A 2F6XA 4URIA 3AWNA 5LXEA 3FKKA 3S9IA 2ZUNA 3TW6A 2Z7GA 2ZRWA 1LBFA 1E0XA 1AH0A 2WLYA 1O7AA 4HJFA 2NXIA 5KZDA 1DORA 4KMQA 1JF6A 1MFUA 4JTDA 3G77A 5C71A 3HZ3A 1EHAA 3AIRA 3WUBA 4C6LA 1CBGA 2PLKA 1E1CA 2RGMA 3CUFA 1CXKA 1GTEA 2A3HA 3IAQA 1HKVA 3N12A 4MYXA 4FAMA 2VX7A 1ZTVA 2WBGA 3UPWA 1G4TA 1NF7A 5I3DA 5HNNA 3M5ZA 1IWAA 2PDUA 2J77A 5C7HA 3U3HA 3GR7A 5AVHA 2Y24A 3P80A 4UTFA 3TWBA 3QY8A 4QG8A 4R27A 4DO7A 2FZDA 3N2MA 3GG8A 3VFCA 2QUMA 4MPQA 3M6DA 1K8YA 4OV9A 1RUSA 4HK6A 1UKSA 5IBXC 1DE6A 1T6MA 3MWCA 5M03A 1EYWA 4GACA 1EOKA 1OY0A 1J79A 4GUJA 1KFBA 5CPLA 1ZENA 3KCJA 3OGVA 4LVGA 1XUUA 1YRRA 2F6KA 3GIQA 1ISVA 4DLMA 3QKZA 3PZ9A 3A22A 3KP0A 4UNIA 2ATMA 3EWCA 4DJEC 1LLWA 4NZ1A 2VCCA 4JIPA 4L80A 3G1FA 5E93A 5IFTA 2ZTKA 5DBUA 3ABRA 7REQA 4XIMA 4MB1A 5AC8A 1RK5A 4RE3A 2XISA 1M3UA 1GYMA 4XSMA 4DBSA 4KCWA 3AO0A 3GDRA 1ZBKA 5A6MA 4CVUA 5LIKX 2X0SA 4UTWC 2DIKA 3AXKA 4AW7A 1V0MA 2P10A 2GL5A 2OQHA 1BYCA 2WNWA 1JCLA 1FHVA 1UH3A 2WW5A 4AG0A 4RDVA 3M0LA 3LCFA 3ME3A 1Q6DA 1ZPTA 2NV1A 5F2MA 5FI8A 3WJZA 4E4FA 2OZ0A 4M1BA 5HINA 3R7MA 1FWRA 1TCMA 2NUYA 4US6A 1P4CA 4ZA0A 1M01A 3M0XA 5AHNA 3VXGA 3QZAA 3DOPA 3LTPA 3NURA 3W82A 1WYIA 4G56A 3PG8A 4QIUA 3UVIA 3ITCA 2E5BA 3CASA 1XLBA 3QV7A 4LPCA 1L6YA 1XYMA 4LH8A 1W9VA 3SGGA 2QDEA 1I0BA 2EHHA 4BCEA 3VX0A 2D2JA 1J11A 2ZA1A 3BLOA 5HULA 3RNDA 1IXQA 3QQWA 3MUY1 4HPNA 4IIHA 2ZIDA 3FV9A 1O5RA 1FWSA 1W1YA 4P2VA 4XBSA 5BOFA 5K9XA 1O5XA 3T55A 3TQ0A 4ICNA 1EA9C 1LDCA 4GH1A 2VJXA 1CLVA 1EBGA 2TPSA 2I1OA 4GC3A 3N4EA 3IJQA 1E9IA 5G2WA 4IL2A 2B81A 4PMUA 4PB4A 1E6QM 1QOPA 4HMEA 5FAJA 3KWXA 4HTBA 3PSWA 3QM3A 2PUZA 3URQA 1M7XA 2DUZA 3TTYA 2Y2WA 5D2XA 4EXQA 4DO5A 3EOEA 4AX6A 2WMIA 1XCFA 1QATA 1E0VA 5C9RA 4MY1A 2E67A 3O07A 3OQEA 1K3UA 3JZEA 2JE8A 3LU2A 1CXFA 4GQBA 4WEVX 1IT7A 1SJCA 1DWGM 5BRBA 3EEZA 3WLPA 2EKCA 4V1XA 3UYCA 3ZIZA 3MHGA 1JCNA 3V3WA 2YLAA 2DZXA 1CLKA 2E40A 2WCAA 4FX7A 1K02A 2BVYA 2I9UA 1S5TA 3LLDA 3WK0A 1YTEA 4M7SA 1QPKA 4AIUA 3VZXA 1R8LA 1FWBC 2CZVA 3QF0A 2PTYA 2QF7A 3OHIA 5EPDA 3MU7A 4WZHA 4AVOA 3K5XA 2PE4A 1IXPA 2R1KA 1YXYA 4JYFA 1WNOA 3UJSA 1ZNNA 4FO4A 1XQKA 3CV2A 4WGXA 1NQKA 5BRQA 2RH9A 1LF1A 1XRTA 3MBFA 4FNQA 5D2YA 2PDFA 4TX6A 3UXAA 1SQ7A 4MZ1A 5ABHA 3K4AA 3B8UA 1E73M 1VIZA 3W1NA 3CHVA 1ZB5A 3BJFA 1BYAA 1H61A 1RPXA 5U7SA 5IM51 3UJRA 4PMJA 5D8WA 5EFFA 4JNZA 5FJIA 4BWLC 3REQB 3TH6A 4KFNA 4QLLA 4ZB0A 2ZRXA 2QULA 3OZOA 4C1LA 4KGLA 4B2DD 4W5UA 1QU4A 1XM3A 4NX5A 1EWDA 3G8RA 1XBYA 1MSSA 6TIMA 3CB8A 3M0JA 2X1IA 5DMLA 1F3XA 1XYLA 2J7CA 4JFWA 5T9BG 1AVAA 3LHWA 5CH9A 5CPNA 1W1B1 4D8LA 4LB3A 5FF3A 2C1GA 2Y7DA 2HNEA 1IF2A 1ME7A 3PG9A 3LUTA 3W6MA 3FYOA 3RX2A 3MP5A 1OGGA 3GHTA 1V79A 1J8VA 1TB3A 1NDWA 2WPGA 3LM7A 3PF3A 3TMQA 1A53A 4GQRA 2GDUA 3ANUA 2UY4A 2PDWA 4NZJA 2NVCA 3U2CA 4MWAB 4FLQA 3T0TA 1CWYA 4GZEA 2QCCA 4KFPA 1AL8A 2R14A 3FJNA 1FWNA 2NQJA 2A4AA 3TVAA 3IVSA 3ABSA 2V63A 2PTZA 1E6RA 2RHGA 3L4VA 4H6EA 4QS5A 4MPKA 4S3FA 4Y9PA 2YXGA 7CGTA 1MDRA 2Z0IA 1OYCA 1E4NA 1OX4B 5T8GA 1XV8A 4L5ZA 3GU2A 1EGZA 2AOSA 1S5WA 3KM8A 2CXGA 3NSMA 3A4WA 2FGBA 1UA3A 2PWFA 3UWUA 1SMAA 4YTQA 1BYDA 4JIRA 3EX2A 3C86A 3SB0A 2ACRA 2RDUA 1EUNA 1NQ6A 2V6AA 3V1HA 4UUIA 4UTIA 1RCOB 3WJXA 1TQJA 3CEUA 3GG7A 3LHVA 4XZIA 4O1AA 2X05A 1PKYA 1PCKA 3LNMA 1Q4NX 9XIAA 1W31A 2PODA 3NM1A 1MXGA 2XN1A 1OD8A 1J12A 2UV8G 5I06A 2DSWA 3D6NA 4EPBC 3MMDA 4H83A 3R6IA 4MAZA 1PE1A 1QNSA 5FESA 3TV8A 3UW6A 2WVVB 1GGOA 5FEXA 1X1OA 2WZHA 5HUOA 3BLEA 1WZKA 3W7CA 2EQDA 1C91A 2BGSA 5F7UA 2IXVA 4WY0F 5E1QA 3URAA 3VIOA 2VFGA 1EDQA 4RR4A 2JKEA 3V35A 3W76A 1VFLA 4QEHA 3N2TA 1FTXA 2G3NA 1IZJA 1ZAJA 1G69A 2DSZA 3DIPA 3CL6A 1R2RA 5D9PA 6A3HA 4MNKA 1Z89A 1TR9A 2E6YA 3S8HA 1EJWC 2GVGA 4KCUA 5C6MA 4PUKA 1UWRA 1X6LA 4IIEA 1H7OA 3R10A 3MP4A 3XISA 3THQA 1DE5A 4XAYA 4QSFA 1Z41A 5FSEC 3B8SA 4HPHA 1QW7A 3S2CA 2G4JA 4LT9A 4ATWA 1PIGA 3L0KA 1CENA 4HA4A 4V1YA 2HNHA 3K1GA 1EKOA 1F5ZA 4X3ZA 5FJPA 3NL2A 1UZ1A 1HP5A 5EMJA 1XFBA 3CUZA 4DPQA 4YCPA 5CSRA 4PFMA 4D6DA 4ACYA 2PDXA 7TAAA 2P3ZA 4Y9MA 4K2SA 3AMKA 4C60A 2R1MA 2XH0A 4S2BA 4L7ZA 1X1NA 1RV8A 4KRZA 3CU2A 3WH7A 1E5NA 2Y1HA 3PZTA 2QJIA 3GC5A 1V0NA 3T42A 3AZTA 4OFCA 1ZLPA 3C0QA 4GUFA 3VM7A 1TG7A 4DX3A 3CQ0A 3QR1A 4BF9A 3GG0A 3IIZA 1TVPA 2V5LA 2DPEA 2ZX8A 4TOQA 3SGUA 2OVLA 4NJKA 3EZ4A 2GK1B 5H91A 4EX4A 1MRAA 2JEPA 3ES8A 2QCDA 2QGHA 1WDQA 3CTTA 3SCUA 5CAKA 1EPVA 5AB3A 5BWAA 3FVDA 1F74A 3VX1A 4GVIA 5DT5A 3ARXA 1POKA 3R13A 4AYSA 3HV9A 4PC8A 3GVGA 2WM0A 3E9AA 5FEWA 1PO9A 3RM9A 1H60A 1EGVA 1POJA 4Q8WA 1JJKA 4JCLA 3CMFA 1K77A 1UP3A 1AD4A 4ZVJA 3IJDA 4J5NA 3EXTA 5CC7A 2CCRA 3LENA 2QPSA 2QYGA 5GJNA 3GU1A 2QJMA 1GOWA 4N02A 2Z25A 3WBAA 5DFAA 2F84A 3AHXA 3GH4A 3NDOA 3LHZA 2D0FA 4OZOA 4J3WA 2WK2A 1A5OC 1FWAC 3GNPA 4TV5A 5E9AA 1RJRA 1TWWA 2GJXA 1HP4A 1XSIA 3VMNA 1QUMA 3DHFA 4JTTA 4AXNA 4JKLA 3TN6A 4UMCA 5H6HA 2YCJA 3JUGA 1PWMA 1Y5XA 4S3JA 3IUDA 4ZB5A 1DTUA 3DYPA 3TJIA 1JUBA 1X8FA 2A7RA 1GEQA 3CGTA 5DX7A 4LCQA 2ZA2A 3FA4A 4ZQPA 4DJED 1XIHA 3LQLA 3RLVA 1HJUA 3UCDA 3O0FA 1R3RA 1XXXA 1CX9A 3VFLA 5BNKA 2YCLB 2NQLA 4AF0B 3AXIA 2WSQA 3UG4A 1IR1A 2VZUA 2AAMA 2HE8A 4A4AA 4N6EA 5GNXA 1X97A 4FF5A 1XIFA 4GLEA 4D1JA 4QFUA 1PKLA 3PC0A 2ANUA 2DU2A 2Y70A 2G5WA 1UASA 4RNJA 1H5VA 3E2SA 4OTKA 1FWCC 1UC5A 1OK6A 3BZGA 5LHEA 5BXPA 3O1NA 4JX5A 3O6AA 2V30A 4ZQOA 4LV4A 1G67A 2PB1A 4Y9NA 3IVUA 1YE4A 1TPFA 4RL3A 2X0HA 2DGAA 3NG3A 2XVKA 4MTVA 1LT8A 3WF2A 1B54A 3IJLA 3NXFA 3O0KA 3VCCA 3HBLA 2BTMA 5E09A 2A79A 2QV5A 4C6MA 2W61A 4D6FA 1JF5A 3ZS4A 5C8BB 4G1NA 2XIQA 3GAKA 4HU4A 4MNLA 2YL9A 1XRFA 4XO6A 3ONCA 3SCWA 3UT0A 1XSKA 1VJSA 2ZBTA 2OOGA 3IK2A 1ECEA 3GBDA 4ROPA 3U4AA 4XVEA 4Q7IA 2KX9A 1A80A 1J0KA 1P43A 4TVCA 1W1TA 2C15A 4O0ZA 1BWKA 5ECUA 2W9MA 3PAJA 3UZWA 2J7BA 1YLVA 3VC6A 3PTQA 2DVUA 3EX3A 3NQFA 4H9XA 2WJEA 5LA2A 3NSNA 3SRHA 3B05A 4R33A 2NQ5A 4NNCA 4GGBA 1FHDA 3KOWA 4RXFA 4JDBA 4LBRA 3BSHA 3NM3A 4JTIA 2R82A 1KR1A 4B9YA 1KM5A 2VQUA 2KZHA 1UPPA 4DO6A 3GSMA 1Q8JA 4GBDA 4JTRA 3D3FA 1HUVA 3WLQA 3UG3A 3AJ7A 4C6JA 3KVKA 2IQDA 4E2VA 1A5LC 5DANA 4HSNA 3SCRA 5LIXX 3LRLA 3ITOA 2DZVA 4JNMA 2J7EA 4IPLA 3AYVA 3OEXA 4Q3MA 4RJEA 5HBFA 5HQEA 1I0DA 2PRMA 3LRKA 3W1MA 5LIYX 3IRDA 2VX4A 1EC8A 3QPYA 5AHEA 1QI3A 2Z28A 2OT1A 2XIJA 1MMFA 4EPDC 1HJSA 4YN5A 4JQAA 2J6XA 1K9DA 5EFDA 4QE5A 4HBKA 2FFCA 2WNZA 4ZQMA 2J25A 2WSPA 3BANA 3BG9A 4LUSA 2TODA 4NAFA 1D7FA 3CUJA 1R3WA 3HQ1A 1OJXA 3BGAA 3WH8A 4G7EB 2OFJA 1QO2A 5L6UA 3SADA 2OX4A 1GZGA 1KLZA 4LNCA 2XH4A 2YCIX 3MCNA 3I7QA 1R3VA 3CL7A 5CPTA 3CH9A 3EXRA 4CCDA 4HPXA 3FAWA 3DECA 4R53A 1PAMA 1FCUA 2NT1A 4WY0A 2WOQA 4HOXA 3NEHA 4AZGA 1GWJA 3D0CA 1RBOB 1SU5A 5JQ9A 4AD4A 2REQB 4E4PA 3DFYA 5JBEA 3RJXA 4IGNA 4LY8A 3OHMB 4ZCWA 5E0FA 4ENLA 3U2EA 2GDQA 4JKKA 1VB9A 4MGGA 3UXDA 4GJ1A 2X1UA 3N2CA 3SSZA 4M81A 4WF7A 4RNFA 3KZPA 3UNDA 2OEKA 3TFXA 5HXMA 2XUCA 1XRSA 1FH8A 3R43A 3KWSA 3UZYA 1U33A 3HURA 5IFPA 2R1NA 2QMKA 3GS6A 1A0CA 3W72A 3TKFA 1QTWA 1KA9F 3G22A 2VZSA 3UVAA 2FH6A 1UWSA 3W7NA 2QCNA 1W9UA 5M5DA 1QW9A 3E2VA 3VDBA 1BRLA 5LYRA 3UGRA 5KZMA 1GVEA 4JFVA 5J5RA 1GG1A 4LYPA 4IMGA 4LRSA 4JL2A 3R4IA 4MVAA 4H9MA 5FL0A 3KOYA 1RBLA 4MZYA 3W1TA 4UC5A 2XM1A 4MB4A 3ES7A 3M07A 4LCSA 3OQ8A 5CJNA 2B4GA 1FH7A 4M1RA 1NU5A 1YTKA 5FF0A 1E6NA 3NPUA 5E6YA 1C90A 2XZ7A 1XLMA 4Q22A 6PTDA 1ZHAA 3MV11 2PLMA 4GKTA 1QPOA 2DZUA 4EF9A 4Z0JA 1B9BA 1ISWA 3LV5A 4GJJA 1LWJA 2DJLA 2E6FA 3W07A 3EKZA 1UIPA 2PGWA 4LUTA 1EJUC 4H8NA 1J01A 2ZZ4A 3APGA 3VGBA 1UUMA 1DJQA 4QDWA 2E1WA 1M1BA 4QDMA 3S5YA 5A6KA 4A21A 3IGUA 2ZRUA 1KW1A 6REQA 2J8GA 2JIEA 2AMXA 5C5YA 1H7PA 3MYPA 4HA0A 2B7NA 4B4FA 2YB4A 4E38A 3F5JA 5LGXA 1XIIA 3GU9A 3NQAA 2DT1A 1QOXA 1BGGA 3W84A 3QV8A 3WDHA 3W6LA 2EG8A 3NDYA 3MI2A 2DV0A 3O15A 3UJEA 4G5DA 3V16A 3OLDA 2OT0A 4DWSA 4Y8EA 3N9KA 1QNPA 4H00A 1JYNA 2VM8A 3RPMA 3NO3A 5I3FA 4R7OA 3PNZA 1ADSA 2C8NA 3TYUA 5A6TC 3OBEA 3OU8A 4BQ4A 1ONEA 4M24A 1XPGA 2PDJA 5C7VA 2E5DA 2JKAA 4RDZA 3CC1A 2Q3RA 2INEA 6ENLA 3EX1A 4AEFA 2V9DA 1H62A 4C1NB 2PWGA 3LX9A 2IQ0A 1OINA 4S23A 3K46A 1XD1A 1UHVA 5CGMA 1O5KA 1KD0A 1L6SA 2OKTA 4YTUA 3LMZA 3I68A 3TUUA 4DYJA 3HFTA 4DF1A 1QOQA 4M82A 3UY8A 3H55A 2OZTA 3KBWA 3VO0A 3TDFA 4DQWA 2PD9A 1VCVA 5C55A 4FZIA 5A2BA 3KDNA 3O63A 3TC6A 4V2XA 3BG3A 2D23A 3FEMA 3PZGA 1VHCA 1KM3A 4PUDA 2Y61A 4ECLA 3EAUA 3R0KA 3DKJA 1SMDA 2FPVA 3G5EA 4AXKA 1UROA 2QR6A 1D7KA 2E9MA 1GKRA 3ARRA 1UBSA 4I5RA 2DUAA 2PP1A 4US5A 3V7PA 4KH2A 2G50A 3UU0A 4BI6A 3BW3A 2Z1KA 4GIEA 4JTFA 2V2DA 3SGZA 4P7OA 7TIMA 3CBWA 3ITYA 1JRBA 1NWTA 1O1HA 2VUYA 4LGXA 3GNRA 2GZXA 1H0GA 3ARZA 3T0AA 1IEXA 4ORMA 5LNSA 2B7QA 1P1XA 4Z0SA 3BWWA 4I7UA 5GQBA 3VDAA 3ZWSA 1OFRA 5HWNA 4IMFA 4OIFA 1KBIA 3BDKA 1QDSA 3O7UA 5FAGA 4PEEA 4MM1A 1AQHA 3IWPA 3WLHA 1A0EA 1PSCA 1DVJA 4JQ4A 4QQ3A 4NRRA 3WQ5A 3NZRA 2Y7GA 5EA9A 5EMUA 1VJIA 2ISFA 1GEHA 1GZ1A 3B0YA 8RUCA 3L12A 4O10A 4XD3A 3A21A 1O5QA 2HS8A 4GI9A 1CGTA 3SQMA 1ZAHA 5CPQA 2DSVA 4WCJA 3GX9A 5H8MA 3CH0A 4F9DA 3WQVA 3U7VA 1TX2A 4GJIA 1TMLA 1CECA 1OCBA 3ARUA 3VDCA 3T9PA 1X6NA 2QHAA 3EWWA 4AWSA 3MBDA 2YR1A 2DW6A 4XZHA 2YIHA 2WZTA 3DUGA 3OIXA 1W5PA 4BF7A 3LDVA 3RFAA 3TLQA 4EAYA 1KXQA 5HJYA 4Q4OA 4CQ9A 3QMRA 1E3XA 4TQTA 1VBRA 3DI0A 3P3BA 4AMCA 4DF0A 3SUUA 4NKCA 1EJ7L 5CPOA 4H04A 2OG9A 2QAFA 4RXGA 3C2OA 4JTQA 1I2OA 2PFHA 3VZZA 3GH7A 3AHTA 1TPWA 5FF4A 2BV9A 1XHGA 2ISSA 4A8RA 1GQKA 2O7QA 5A2CA 3ZJKA 1F6KA 3PZOA 5DCEA 4C1KA 3A9BA 5I09A 4GI4A 5F4WA 3EDFA 2AQWA 3DU0A 2XZ9A 3IJIA 3M5XA 3W2KA 4D6CA 4DZAA 2HBVA 1FDYA 4OU1A 4IJBA 4QLJA 3ZSSA 5KITA 5JH1A 3U57A 5REQB 1FA2A 4K6AA 4BJHA 2IPWA 3OBKA 1VD6A 2Y0FA 3STCA 4PRTA 4HGXA 5E0CA 5IDIA 3A12A 4RZ4A 4GFSA 4OHQA 2HXTA 3LI0A 4K3ZA 2ALDA 3W7LA 1KWGA 1BD0A 5DMMA 1HIZA 2PA6A 3WLLA 3B8TA 1N2VA 3PN8A 1V0LA 3UR7A 3FIGA 1F76A 1GORA 1SSDA 1VEPA 1BQGA 8XIAA 3WLRA 2W67A 1X7IA 1YNPA 3GYCA 3MO7A 2ASHA 2HV5A 4Z1CA 5HNRA 5I79A 3QKEA 1KTBA 1OSEA 3IAPA 4LRTA 4MKNA 2D1ZA 1XRVA 4I6VA 2ABBA 1IIHA 3UP8A 4AUBA 1Q8AA 4L4MA 4GG9A 4MY8A 4NI8A 4DBEA 4FIQA 4GCAA 4KERA 2P76A 1V02A 5LXXA 3ZLFA 2UWFA 2RGLA 3VKCA 5I0DA 1GQIA 4RLIA 2FH8A 4W89A 4N2YA 1KTNA 3C56A 2DJXA 5DBTA 3WSUA 2NW0A 1U1HA 1BG9A 4JXCA 1QK0A 5FSDC 2CEQA 3W24A 1F8MA 5A1AA 3MKKA 2PU1A 2VFHA 1OWQA 3I65A 3UF9A 5E9XA 1B3ZA 2FKPA 2CLIA 4I7WA 4WQ6A 4HP5A 4DUXA 2A7PA 1WKYA 3TQVA 3T2QA 5F1UA 5K7JA 1V6UA 1BTCA 3E2RA 3URBA 4ATLA 3VZYA 2XSAA 1Q7ZA 2XVLA 4O13A 3PZUA 3HIJA 2BHZA 3IARA 3ZMRA 3TZFA 4O54A 1TZ7A 3EB4A 3WEOA 1XKYA 3WLMA 4PUWA 3P7YA 2D69A 3GO2A 1X6UA 1PUDA 2PDQA 4S3CA 2W91A 4K8HA 2VUNA 3OVGA 4ZO9A 4F8XA 5AYXA 1A5SA 6CGTA 2ZICA 5GNYA 3MVIA 5A6LA 1UWTA 4P8VA 5FL1A 1PIIA 3S9YA 1MDLA 2H9AB 3L4WA 2AL1A 3UCQA 1ICSA 1BSIA 2YCEA 1KCZA 3WK3A 2GGGA 4O1EA 5EBAA 5FJUA 1EL3A 2PDIA 4UBPC 5B80A 1OC7A 4BQ2A 4KEMA 1UQZA 1UKPA 1XIBA 2EEXA 1LQ0A 4R85A 3HFYA 3TSDA 1OFBA 4ILSA 4QXIA 3UEQA 5C2CA 5HPOA 3ARVA 4D8ZA 2YBUA 3LOTA 1QWGA 3OGRA 4W9TA 1MI3A 3GTNA 5TQLA 1QMLA 1VBJA 3PFMA 3F4CA 1Z69A 1LOSA 1PCWA 4PH6A 1J9YA 3VNKA 4NF7A 4MWAA 3UGVA 4UQEA 4W4QA 2VZOA 2CETA 4NJGA 5K4ZA 1SFJA 3GDMA 4HJWA 5EGRA 4PBGA 5ABTA 3CZLA 3PTDA 1TV8A 4M80A 3GW3A 1G0CA 3C3NA 4IM4A 1S1RA 1AQMA 4F2UA 5EMLA 2EAWA 1D3CA 1XLIA 1OX4A 4N9CA 3U9IA 4TUFA 2E0PA 3O05A 1JDEA 1IGSA 1DV7A 3CZJA 3VNIA 3W1RA 3RMJA 1TPUA 4U31A 3WJSA 5BZAA 5CKSA 1HL9A 3VI2A 4ZOEA 1QW8A 3W29A 3ENLA 1UD3A 3W7DA 4XTIA 2Z6IA 2HK1A 4RE4A 2NWRA 4CD5A 1TV2A 4KT2A 4ERIA 4CUCA 2HPIA 3S5ZA 5E5CA 2EJ1A 1D3GA 2XH2A 1C9WA 1ZCOA 4LC6A 1YADA 3N6HA 2GUBA 4L6OA 4GPNA 4XB3A 1F05A 2E5CA 2WVVA 4MJZA 1EHNA 3A24A 4Z2IA 4IXXA 4PZVA 1Q85A 1GTHA 3ABZA 3PTKA 4FNPA 4LTSA 2QIWA 3EA3A 3MCMA 1KM6A 1H51A 5BCAA 1P5BA 3MHFA 4JQ2A 3NQDA 1EUAA 1FXPA 4CD7A 5MKGB 4FALA 3TW7A 3SY8A 1PKNA 2I5IA 4CN6A 3FLUA 3UR2A 2E77A 3EMQA 1BXNA 1FWEC 4H7VA 3OZMA 1I2NA 4O4VA 1YXDA 3PZQA 3BCDA 1FHLA 3MJYA 4MZ8A 2BVWA 3K8KA 3IJ9A 3PK7A 3Q45A 4I3GA 2PZ0A 3FKRA 1ICPA 3PB2A 2HTMA 4CN4A 1EO5A 3G1HA 4NILA 1EWEA 2XWEA 1CI1A 3C4UA 2Y88A 4I6KA 1NOFA 3BO9A 1LZOA 3OP2A 1FCQA 1QR7A 4ATDA 1PDZA 3A47A 2WHMA 1UUOA 1W3IA 3DC8A 2ISWA 4J35A 4GNVA 1BVZA 2HSAA 1P6BA 2XM2A 2ZWYA 3OYXA 1E1FA 1UP2A 3AIBA 2ESCA 4RPQA 3EX4A 3TJXA 3UZXA 2F9RA 4S3AA 3A4JA 3NDZA 4AYGA 4HIBA 3WH9A 4C6CA 5D38A 3UZ5A 1F61A 1ZBCA 1FWGC 3DHDA 1J0YA 4IUOA 4OVXA 2YCKX 3TSBA 4NZ5A 1P0NA 5DO8A 1QASA 2OWXA 2X2GA 1U1JA 3GTFA 5ABGA 3EDDA 1QXLA 2WKGA 4XZ9A 4NJIA 3UJ2A 4WSJA 1WP6A 3WDPP 4DZIA 1W5QA 3ID7A 4DUWA 3Q58A 3GM8A 4AWUA 1CCWB 2DUXA 2FTPA 3WD4A 3ERPA 1FWFC 2CZ5A 4W7WA 3FYYA 3RRAA 3P74A 4S3DA 1Q6GA 4E3VA 1D3HA 1JFXA 2OEJA 2GK1A 3CV1A 3C3UA 2CBIA 3GK0A 4IIBA 1JPMA 4MOZA 4GZ7A 4KCVA 5JVLA 1WB0A 5KZ6A 3T0BA 1ZY9A 1DXIA 4DEFA 1KC7A 4O12A 3WUFA 1OYBA 3T44A 3L66A 5CG7A 1XH2A 1UR1A 5D9NA 3FVMA 5EYWA 2NSXA 4LBSA 4A3HA 3T40A 2XWDA 4E8GA 1V08A 2XGBA 4GQ0A 5H1WA 3WDIA 4AIBA 1DIKA 4S38A 1W9XA 2C71A 2A3EA 4NVTA 3LPOA 5LNUA 1PV8A 4H9UA 3LTSA 2VO5A 5AYZA 3L9CA 4QJ1A 4EOUA 5CJ5A 3OZYA 2VHLA 1QAPA 5BU9A 2A6LA 4MADA 4J2MA 3ZZ1A 2ZUUA 4L1XA 4WX2A 4UTHA 3WBWA 4AEEA 2VEGA 1MO0A 1XF0A 4FXRA 3EDEA 1O12A 3DX5A 4UZUA 1V6TA 3OIHA 4JBRA 1Q65A 3FDGA 4KKXA 4J1OA 3RILA 2YLLA 1XKJA 2EGZA 1EPXA 4NJHA 4Q8UA 2YCLA 4LS0A 3VGHA 4XAGA 4Q4KA 1SM9A 4LS1A 4OUIA 4AF0A 3WQGA 1W32A 3C8FA 1BF6A 3DGBA 2F38A 1PZ3A 1LYXA 3KFTA 2E1DA 3PWGA 3ZM8A 1K8ZA 4RX0A 1GW9A 2PWDA 1OADA 4L9ZA 4PTNA 3ZOAA 4HZ6A 5GJMA 4AZHA 4JICA 1F3WA 1UD2A 3DGRA 2BVDA 1W6TA 5LNWA 3V5OA 4PYSA 3GVRA 3WQCA 4L9YA 1PYMA 1GQLA 1VYPX 3QRHA 4FOKA 3GXFA 3CB3A 4W8LA 4ZOCA 2IKGA 3ARSA 3IIPA 4WDXA 2CERA 4YMZA 3LHYA 4XUGA 1MUCA 4W8BA 3O6CA 2AKZA 5CZJA 2RDWA 1QO5A 2GLKA 2OYMA 4M7TA 1I1WA 1GCYA 4JCMA 3E74A 4ZE5A 3MUXA 3SI9A 1V5XA 2AAAA 3KP1A 3LCXA 3RYSA 3DBPA 1PTAA 3C52A 4GXPA 3W23A 1IT8A 3W2UA 5GVJA 4BZYA 2J74A 1RCQA 1J2WA 1EZWA 3VPLA 2ZXBA 3KHDA 1CXEA 3L2MA 4MLJA 2WC4A 2BZNA 1HO1A 2ZX7A 4ML4A 4QAWA 3BXWA 1D2KA 3WJYA 4LAMA 3RX3A 1KWKA 2Z1WA 4AIOA 3LTYA 1G01A 4IICA 3WNKA 1K4GA 3UNTA 1DP0A 1XIJA 3ECQA 1S39A 1QHPA 5A69A 2VRQA 4XZBA 3R8HA 3G1VA 2W92A 3A3XA 3DYMA 4KGJA 2C18A 1HJQA 3N2BA 2O9TA 2W66A 4AY8A 2O9OA 2PC4A 1SFLA 4B5WA 5A8PA 1Z32X 2HISA 3WQPA 4P61A 3AHZA 4U28A 4C6EA 7ENLA 3N15A 4B2DA 1P7TB 1AZ2A 3H23A 1NARA 3MUZ1 1K8CA 2EPNA 4LYKA 3ORWA 1I2RA 1OFDA 4W86A 3NZPA 2QQ6A 2PLJA 3DXIA 4BA0A 1RK6A 3W1UA 4JGDA 2KAUC 5HNUA 1QJWA 4CQAA 1LG2A 2WV8A 3KRSA 3W7EA 3AYRA 2NVAA 2YA1A 3GXNA 1B90A 4DBUA 1ML1A 2HBXA 3EMZA 1E15A 1EGMA 4UQDA 4WIWA 1R5YA 2YB1A 1J5SA 5CGTA 2J8TA 4J3TA 3B9DA 3W7RA 4MB5A 4MDPA 3VE9A 1OFOA 3GZAA 4LNYA 2ZKMX 4G7EA 3WDJA 5HOSA 1TKKA 3ZYZA 3A3WA 1W3JA 4L4OA 1I2PA 3EPNA 1VHNA 4NXKA 3QJAA 3TAKA 2NLIA 4L9XA 2E25A 3VABA 3UXLA 4Y90A 1TRIA 3L0NA 3W71A 2Y4SA 5CBIA 3U4FA 3RPTA 4ERGA 3DCPA 3S2LA 4U33A 2ZVRA 2E7FA 4HMCA 3VYLA 4H4IA 3F4VA 2BY0A 2X41A 3W1XA 1E6XM 4TMBA 4PMDA 2REQA 3WNMA 3KCLA 1MNSA 3BC9A 1S2CA 1TWZA 2YPIA 3CEPA 4FF7A 2V2CA 1UR9A 1KXVA 1K03A 4FK9A 3ZVIA 1SO5A 2ZE3A 1NVMA 4JX4A 2PTXA 1RCXB 1CNVA 4GO8A 2HROA 3L4UA 2YDAA 1DWIM 2RFGA 5I07A 4KRTA 3VTRA 3BL3A 3MMUA 3TN5A 4R9XA 5I02A 1HL2A 3VU2A 4NU7A 2JKPA 3MO4A 3SFWA 4AZIA 1X38A 3ZJ8A 3LGGA 1UMYA 4D8AA 1XBZA 5CSYA 3TWAA 5FIPA 4X9SA 2RAGA 4ML9A 4E5TA 1XIMA 2Q8ZA 4A2RA 3EBVA 3SSJA 2BHUA 4Z2LA 2BG5A 1UOZA 5CZKA 3PS7A 1W3LA 1AUSL 4WSHA 2ZXDA 2FFIA 1V6YA 3ARWA 4FNRA 3N04A 1R7AA 5A5WA 1THFD 1SUXA 4M3PA 3H4WA 3M0HA 4LALA 5DELA 5XIAA 1DHPA 1BPLB 2IW0A 3G2GA 3TYDA 1LORA 3PUEA 4XWUA 2QIIA 3GFXA 4KFOA 5AN7A 3RHGA 2W3ZA 5I3KA 5HPCA 4IQJA 5BYWA 4HHPA 3W7IA 4XKYB 3QLDA 2GVJA 4O0QA 4C6NA 4FXSA 3SJ3A 4GY0A 4L6HA 1KRAC 3E0WA 3TJLA 1WA3A 1H1ZA 3WQWA 1XYCA 1M7OA 3PVFA 1J0ZA 2P3EA 4G7FA 4IZGA 5KMYA 4UR8A 1CDGA 2J7FA 3BAKA 5TF0A 1ZFJA 3WDQA 1IEIA 4Y96A 3PHAA 5EL1A 3WD0A 3W37A 2VDGA 1GQJA 4MMWA 4L1WA 4J7RA 1UKOA 3UR5A 3F2CA 4LJ3A 5B7ZA 1WAWA 3ALFA 2PD5A 3KDOA 4F2BA 4ZMGA 3M43A 3NIYA 2WMGA 1GONA 2Z1VA 3DBNA 2D20A 3SRFA 3HPFA 2H8XA 5BRPA 4F79A 1AG1O 3TR9A 5C54A 1TSIA 4ORIA 5KTLA 1F2JA 3QHMA 4F0SA 5FCZA 1VGAA 4B92A 4XSLA 1XH0A 3W38A 5TIMA 4AHOA 4WDUA 3MKVA 2FIQA 1XGDA 3FNDA 4ZO8A 1Q2RA 1WDWA 2GJPA 1F3EA 3PUDA 3E0LA 4H1ZA 1GUVA 2WZIA 4LBUA 4AVNA 4O8AA 4W7UA 3I4EA 4JY8A 1R9XA 1TIWA 1K6AA 4UTTA 1UB3A 1VQTA 2G96A 2BFGA 1XLHA 2VWSA 3CIVA 4XAZA 3W22A 5JIWA 2A1YA 3PP7A 4I5UA 1KBLA 1ITUA 1QBBA 3Q65A 2QGYA 4B5NA 7A3HA 1UUQA 1KXHA 3DG7A 1SYTA 2DIEA 1FQ0A 2VOTA 4RNHA 4A29A 2E9LA 3CO8A 3V18A 2VD9A 1HVQA 1KFJA 2VWTA 5FEPA 1PX8A 1GOXA 1V7YA 1B3XA 3H7VA 4Q6XA 5AYIA 1DQUA 1UR2A 2QKFA 1PKMA 5CEWA 1YIXA 4Q7BA 1NDZA 3M0YA 2ZA3A 3VD3A 4PCSA 4JY9A 1Y7VA 4LYQA 1HXJA 1Q6FA 1JFHA 4INFA 3BE7A 2V3EA 2DEPA 1V02E 4LXFA 1XINA 1BLIA 1L0PA 2PF0A 4MJMA 4I9JA 3D46A 1WZLA 3H53A 1M03A 4WDWA 2R6OA 1XH1A 2QEZA 3GFZA 4Z08A 5AC5A 3IJ8A 4U3CA 4WJ8A 1UZDA 3N4FA 3W2JA 4QR6A 3HGSA 1G7VA 1JZ7A 4Q4QA 3VAVA 3VVGA 4O0KA 3FXGA 4ES4A 3UPMA 4K68A 3E49A 3B0UX 5CG0A 3B8DA 2QZRA 4PCTA 1ZALA 3H2MA 3CHEA 4DJEA 5FOOA 3I4KA 3SUWA 2OO6A 1XI3A 2ZUSA 1QPQA 3UWEA 2G37A 4KIRA 1DJNA 3B4YA 4NASA 3S1XA 1KCKA 5EKYA 4PMNA 4GNKB 2Z1XA 3VKBA 3P93A 1EH9A 4J28A 4N9BA 1XDMA 3IJ6A 3JRKA 1XLJA 5E0KA 4ZGYA 1XIDA 1FWIC 5E70A 1OIFA 2P50A 4DXKA 4RW3A 4MFEA 2W6RA 3AALA 1BAGA 3BLKA 4DWSC 4RZBA 1XLEA 4C6QA 5AYYA 2WO5A 3GDBA 2VCBA 3VOJA 4IXHA 2CWXA 1ME9A 1NOUA 1TJ1A 3LY0A 3S42A 4ONVA 4HNLA 2C1HA 4AWEA 2VGFA 4HNTA 3KAOA 3CTLA 2NQHA 4NAEB 1UW9A 2YDQA 3W4RA 3H54A 2V5JA 4KWSA 1MW3A 1EX5A 1CXLA 1KO0A 5H8UA 1VS1A 5A8QA 2ZXQA 5DMNA 1TIMA 3PAOA 1L2QA 2CITA 4X61A 3PZMA 3M6YA 2IPJA 4HNUA 1U5HA 3TYZA 2Q6ZA 3BARA 6ALDA 1TE6A 4L64A 1XWYA 3GTXA 1ZBWA 2GFTA 4W5ZA 3PWIA 4GWEA 4O50A 1DJXA 1KFCA 4NIRA 2VFFA 2VX5A 1SZEA 1DXEA 3PBMA 1R47A 3QTGA 4WHBA 3FS2A 4DJDA 3H7RA 1B3VA 1GOMA 4YNGA 4P7QA 1OD0A 2QUUA 3BJSA 2VR5A 4MWAE 1TUXA 4NX0A 3ITTA 4DF2A 3QHNA 4HHMA 3MT1A 1C3FA 2BP1A 3T8QA 2E09A 2TYSA 4MKSA 5A3HA 3LBMA 3AMCA 2ZZ3A 4JL1A 5REQA 4LAOA 2JF7A 4GXWA 4PMVA 3NQEA 4Q4MA 1HFBA 3PJUA 4YTSA 2ATSA 4MY9A 3ZO9A 2NQ9A 2BLEA 1HGYA 1WZMA 3CQJA 3NVTA 3CQKA 1V3LA 2VD8A 3ZR5A 4UCFA 3WFZA 1V6VA 2WZEA 4W88A 4IUGA 2X8RA 4C90A 2EPKX 3H2AA 2J7GA 3UESA 4DNMA 2FLIA 2I5QA 2VDIA 3AMLA 2NSOA 4GVGA 1PPIA 2NXHA 4FLRA 3ZVHB 2OLAA 3AYTA 4J3SA 3QOKA 3SZ8A 1M7PA 1JQVA 3PZIA 2B7PA 4LV9A 3NAVA 2YDRA 1IWPA 3BUVA 2HMCA 4ZSTA 2R1PA 4YCOA 5AOUA 1JD9A 4LOCA 4O1DA 4D6IA 4JEJA 4UFHA 4HHHA 4GINA 3O6DA 1E43A 4FS9A 1MUMA 2VYOA 1UWAA 2JF6A 2CBUA 3NSXA 1BYBA 1R3SA 4FLOA 3UQNA 1S5NA 5CZTA 1JZ2A 2X30A 1MQQA 4LVAA 1G6CA 2WJDA 3PM6A 4DHGA 3DC0A 2V69A 5BXSA 5HAOA 4LAKA 3LB0A 4LFYA 1Z9AA 4MB3A 4GYFA 5CZ0A 2Y62A 3JS3A 4QSHA 3WUEA 1Y8BA 1IGWA 1K70A 4JIQA 4L65A 2XFWA 1TYGA 4O16A 3RIKA 4N7QA 3COTA 4YPJA 4RPPA 4G1KA 2VC6A 4FOUA 3NGFA 3N4AA 1E0UA 1MEHA 4B91A 2G3FA 1W5OA 2FTWA 1A5UA 4HTYA 3RF9A 3ARQA 1Y5VA 1WAUA 4BS0A 2QDDA 3PBUA 2AGTA 2B7OA 3WEMA 2PU0A 1A5NC 4MUZA 4Z2KA 2FGLA 3CHCA 1G4PA 3D3AA 1NELA 4WKAA 3NZQA 3SCOA 1LOQA 4AEOA 4D6GA 2FZ8A 1FWHC 4QJ4B 4JTSA 2GPTA 3W1AA 3ZXWA 3SCVA 2WCSA 1KBBA 4X22A 2OO0A 1GHSA 2EPOA 2Y85A 3R58A 4A3UA 2H9AA 2VELA 2O0TA 3VM5A 4I7VA 2VT0A 3M5VA 1UWQA 3Q2DA 4LB4A 4S3EA 3RM8A 2C16A 4RDWA 1WBHA 2JK2A 3LLFA 4B9ZA 1JPHA 2XJ7A 1G1YA 3FFSA 3KL3A 4MLRA 1IIGA 3CPRA 4UMBA 2VVNA 4XUYA 1A5KC 4RE0A 3NYZA 3NQCA 4XV0A 2D2HA 4NUWA 2EF9A 3I7SA 1RAKA 1BWVA 4PTWA 3P8JA 1JXKA 1W1IE 3T2PA 5AFDA 4B90A 4UOQA 1CXIA 1TJ0A 1E3ZA 5AVNA 2VMFA 3GY1A 3PPGA 3A13A 1S5MA 4PFHA 2XINA 1KFKA 1I6NA 3N11A 4FEZA 2O9RA 4QG6A 2WMKA 1D8CA 5D33A 3SCTA 1B3OA 3WY1A 4XKMA 4D1IA 1LG1A 1MW2A 2VI0A 2OGJA 3M16A 3DYOA 1XBVA 5T9CE 3TQPA 4PUNA 1N8IA 1N8FA 1GKQA 4R9OA 1B3WA 1T41A 1WXZA 2XFFA 3MWAA 2R9RA 1S38A 1W3HA 3O16A 2EO7A 4D71A 3RR4A 8XIMA 1UA7A 3VE7A 1VCFA 1VBHA 2C19A 1XG4A 4B5XA 3PANA 3GHSA 3RPDA 1LBMA 1L6GA 4FLSA 4Y2WA 2OKOA 1DL3A 3KBMA 2J27A 4FR6A 3L2LA 1XG3A 5I3JA 3H2CA 2GVYA 1JXJA 3W01A 3EOOA 1E4MM 2IMRA 2YJQA 3MDWA 3TTSA 3BK0A 4PE8A 4HVXA 1RALA 1EA0A 2Q8LA 1OVDA 4TO8A 1BF2A 3PSVA 3SUTA 4BFAA 3LPGA 3LERA 1N82A 1MW0A 3IGSA 1TPVA 3W7MA 3P5YA 3MI6A 4J9JA 4MF4A 3BMWA 9RUBA 2PTWA 2CNCA 1SR0A 2XTKA 1PTGA 5MKGA 2POZA 1SJAA 4IGHA 3FSUA 4CCCA 1LQAA 1J2BA 4PCFA 3RDKA 4JN6A 2VC7A 2J13A 4S3KA 2E6DA 3VIFA 5I00A 3RLUA 3C0SA 3GG1A 3MYOA 1HQTA 3BAYA 3K4WA 4PTMA 1XIEA 2OZ3A 4ROQA 3U7BA 1JDDA 3M44A 2OGYA 4MWAC 3EOUA 2YKKA 4QCEA 5I3GA 3R5EA 2ABAA 3S4TA 4YJ5A 1K8XA 1JQXA 1XLLA 2DVXA 1VYSX 4LANA 4XG1A 5RUBA 4H9VA 2QCFA 3QZ6A 4IP5A 1GNXA 4DY1A 1EIBA 3R89A 1JZ4A 3UJFA 2XU2A 3N25A 5PTDA 5FKYA 3R2GA 1GK8A 1NH6A 3OZPA 3L5MA 1TV7A 3WLJA 1Z44A 4YU1A 3GXDA 1FBAA 4UOJA 4B15A 1KGXA 1CLXA 5K9CA 1WUEA 4H3DA 3LA4A 1EJRC 2AQVA 3BLLA 4ERAA 2Z29A 3PJTA 3DG3A 3RCMA 1E4IA 4JFSA 4Q8PA 3HMJG 2QS8A 3OGSA 3THAA 4AD3A 4F2TA 3CWOX 4OBRA 3H2FA 3AZSA 3GDTA 3AOFA 3G6MA 3FYPA 1OK4A 2VC9A 3QY7A 3O8AA 1Q63A 2ZZ2A 3ABOA 4BQ3A 4F0MA 3R11A 1LUCB 3ZT5A 1JEZA 4DUVA 3G1XA 3KL5A 4YLWA 2W4XA 2CKRA 3WEZA 1ZGDA 3G1SA 3QN3A 2NZLA 1JUKA 1JCXA 4AC7C 2PI6A 3KVMA 3WNOA 1OGBA 1XSJA 4NL1A 4ADTA 4IFOA 2DZBA 4QLKA 4Z42C 5A8OA 2GWGA 4DBDA 1KV8A 3P6LA 2PWEA 4HA3A 4B4HA 1M7JA 2VL4A 3HTWA 4OOZA 1TUFA 1ZCCA 3NTYA 2YA0A 3W7QA 3GR8A 3P0XA 4CLMA 2PDYA 3TK7A 2O55A 3QFEA 2PWVA 3H8AA 1RP9A 1VAHA 4OE7A 1JZ8A 3KUMA 2V3DA 4AQLA 1OFQA 3KCOA 1FDZA 2WC7A 4QE1A 2WM1A 2W79A 1OCNA 4GMEA 1LRTA 1KM0A 3KBVA 2CXEA 4DWSD 2FZBA 4YL2A 5KINA 4F0KA 1VR6A 3M5YA 3CMGA 5I78A 4JN7A 4PMQA 1BWLA 3PZVA 3EWYA 1CGWA 1EOMA 3CYJA 4ZEPA 4DI9A 3P8IA 1DBTA 3FY1A 4PGLA 3TA9A 4U5IA 1TTIA 4NT0A 1F4AA 2PURA 2OB3A 5FACA 1TVNA 4KRUA 3N17A 2FDSA 1I9CB 1Z48A 2GVLA 3SR7A 3UG8A 4N9DA 3E96A 3F4NA 3CO4A 4UFMA 1ZP3A 3VA8A 4LAUA 5JXQA 1GYLA 2E8YA 4DRSA 3PULA 4ICCX 3R0DA 8TIMA 1WOAA 2BY1A 1U22A 2PDMA 2QAPA 4M56A 1MFVA 2DQWA 2QV4A 4LQ1A 1A5CA 4OQVA 2OODA 4Y9OA 3VNJA 1ISZA 2WQPA 2HCVA 3R8GA 1ONXA 2FPTA 3BGGA 3E1F1 2PWHA 3AUJA 4PB5A 2NX9A 3BSGA 2OOFA 3RX4A 1PZ0A 1U83A 1A3HA 1TJRA 3RUBL 3HO8A 4AAJA 1S46A 2QCLA 4U2YA 4XZMX 1YQ2A 3I6RA 5LSMA 2VTFA 4AIEA 4PBFA 2Q71A 3ONBA 2GGJA 3EWBX 4Q7NA 2PLCA 4H9TA 3PBGA 4AY7A 4HN4A 1OYAA 4XZWA 3IUHA 2BBFA 1K9FA 3F1QA 4NP7A 5D8ZA 3KTCA 4CCZA 3FCPA 3M7SA 2G3JA 3S6OA 1UR0A 3W86A 3AS0A 1W1VA 1EZ2A 3PTMA 1A3WA 5AHIA 3DFNA 1X7FA 3QHOA 3UCCA 3NL3A 2DH3A 3BAXA 2YXXA 5CJMA 2CIPA 3TTOA 2X16A 1FX6A 4XIAA 2V38A 2VP8A 1H5YA 3EWDA 1ISYA 1F07A 1QCWA 4ZENA 1SJBA 3OLIA 3WMLA 3FSTA 3AXMA 3LGEA 4RW5A 2V68A 1W0MA 4GRSA 4JTGA 2OQYA 2V81A 3W7KA 4R7JA 4J3UA 2G0WA 4LUJA 4FNUA 2F2KA 4KEUA 2P5NA 4UTJA 2PSNA 5BW6A 2I5GA 2QCEA 4TV6A 3RLGA 1DJZA 3R25A 2GYIA 3EKGA 1Q6QA 4FHAA 3OVPA 3E02A 3SO7A 4O11A 4K1WA 2FQIA 3URNA 2QMJA 3WF4A 5D30A 1XIGA 5DCDA 2V0TA 4E2DA 2CLFA 1CXHA 3RM4A 3DENA 1TV5A 4M8UA 4RKAA 4FNSA 3VNLA 4NI3A 5F1VA 3SAZA 4DIAA 5I2UA 4JFUA 1P7TA 3C2RA 5LZLA 3MW7A 1I1XA 1A0DA 1XP3A 1J0IA 5B7YA 3K2GA 2ZDRA 4G2DA 3NQBA 1BVNP 1K4HA 4GH3A 2ACUA 1NOWA 1HO4A 2OMAA 3FJ6A 3TXVA 3QC0A 2HDJA 4M6VA 2WVTA 5CC6A 2PCQA 5TBOA 3THUA 3WF1A 2R8WA 4F40A 1Z3NA 1TR1A 2XN2A 4C6PA 3WMBA 5LNVA 1B5TA 1VEMA 2NV2A 1D8WA 4Q6JA 3QZEA 1ODUA 5EMYA 4F3HA 2Z27A 5G4HC 2G3MA 1OEPA 1RD6A 4J3VA 3S1VA 1DJHA 4GABA 1JI2A 1H09A 4C91A 1H2JA 4XO7A 4LVDA 1TPEA 1R46A 5M2FX 1G9HA 1KGWA 4F9JA 1YYAA 3KXQA 2GGIA 3J7HA 4C5ZA 1YKWA 2TAAA 1HTIA 1XGEA 1C8VA 1X8CA 1PJ9A 3U2OA 3PPHA 1DQXA 1BFNA 2IQTA 4TIMA 1M41A 5JIPA 3VOHA 3PFRA 2CZDA 2PAJA 2BX7A 3G3DA 1XYBA 1GKPA 3NNTA 1JNDA 3AISA 3OPSA 1ZZMA 3WD3A 3FEQA 1AJ0A 2UY3A 4NXSA 3LCGA 2NXGA 3NGJA 1KM1A 3OLGA 5KZEA 3IGHX 3JVAA 4CQBA 1AZ1A 4S3BA 1H50A 1Q4WA 4AZ7A 2WLZA 2GSEA 3BGJA 1X96A 2AMGA 4UR7A 1G94A 4A2SA 1K6WA 3G0XA 4QNWA 1Q6LA 5JH2A 3DFSA 3P14A 3TJ4A 1OFEA 1GVQA 1PVNA 3LBCA 3F03K 4UQAA 3USZA 4U5KA 2VXNA 2ADAA 3OVRA 3LYEA 4EP8C 1R3TA 1IT0A 5DEZA 2VDHA 3U2ZA 1N55A 1Z8AA 3KW3A 2ZVIA 2XH7A 3ZR4A 3LCWA 3TC3A 5H8PA 5JUVA 1QRQA 3CWHA 2OLHA 1QPNA 4PSPA 5I03A 3HPZA 4ICMA 1YBQB 4QJ3B 1TV4A 4Y8FA 1UWIA 1WO2A 1L9WA 4GIAA 2VCAA 4O1CA 4D2JA 1Q2SA 1JGIA 1DWHM 4XKYA 3ITGA 1VFHA 4UMAA 3W1PA 4QJ5B 1O95A 1QNOA 1ONRA 1OHLA 1SZNA 4K36A 3SN0A 3GNOA 4AD5A 5FEZA 3QGKC 2R94A 3BOFA 3WG6A 1RA5A 1M04A 4NNAA 1TTJA 4GA8A 4LF1A 4JYDA 2ZRVA 5XINA 1XLAA 4FXJA 4A05A 5HANA 2Z1BA 1GZJA 2QW5A 4TX9A 3STGA 2QUVA 2YDSA 3U0HA 4HOZA 4AMAA 4UOZA 4AZ5A 1H41A 2Q02A 3BLDA 3TCEA 3T09A 1Z6KA 1J6PA 4ZBCA 4YYCA 3POHA 4GD0A 3TXZA 2VGBA 4GCXA 3N9RA 4LF2A 4XZNX 3LS9A 5G4WA 1E5JA 3JW7A 2CWNA 3P60A 4ZTXA 3ARPA 1WPCA 1YW1A 3W2MA 4TU1A 1Q6RA 3W1QA 3TNBA 3UZJA 2FZMA 4H6RA 3V75A 4HK7A 2UZ9A 4ZXOA 1SGJA 1RY0A 2AL2B 2Y8UA 2XIOA 3F5LA 4NZFA 3GXMA 4Z2GA 3S5NA 4X0VA 2GOUA 1XICA 1FP8A 3TCSA 4JFTA 1XUZA 3G8EA 4QBXA 3B03A 6TAAA 3WLKX 4MNJA 3ZQ9A 5CC3A 5D4YA 1LQ2A 1UJQA 2ALRA 4BR1A 4W85A 3CS2A 1CT5A 4K7YA 2TSYA 3PPFA 4Y7EA 7PTDA 4IMAA 1RLCL 1SW0A 4WJXA 6XIMA 5SWUA 1EJTC 1FCBA 1H49A 3I6EA 2FDMA 3E6EA 3GR4A 4EF8A 2A6NA 2Y63A 2DZAA 3MMWA 3AXHA 1O6IA 4LS2A 3B97A 4DZHA 2CLHA 2NQZA 2UY2A 4QTGA 3MTWA 4JOMA 2QCGA 4P8XA 2FJKA 1OX5A 3VIJA 3II1A 3F4DA 3LZ3A 2HWGA 2XVPA 4DJFC 5K3VA 3GH5A 3ARTA 2O4QA 2BGQA 3BAIA 4AZCB 2WXDM 3H24A 1T5AA 2WZMA 5D09A 4CU8A 1EO7A 3MSYA 4E8CA 1A50A 2L5HA 2RJGA 5A6AA 3W88A 4N9EA 2UY5A 4IMEA 3ISIX 4UXDA 4YIWA 2WMFA 2B0MA 5FF2A 4RV3A 1OFAA 4DAFA 3O3RA 2PDKA 3FAXA