1WX0A

Crystal structure of transaldolase from thermus thermophilus hb8
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
211
structure length
211
Chain Sequence
MELYLDTASLEEIREIAAWGVLSGVTTNPTLVAKAFAAKGEALTEEAFAAHLRAICETVGGPVSAEVTALEAEAMVAEGRRLAAIHPNIVVKLPTTEEGLKACKRLSAEGIKVNMTLIFSANQALLAARAGASYVSPFLGRVDDISWDGGELLREIVEMIQVQDLPVKVIAASIRHPRHVTEAALLGADIATMPHAVFKQLLKHPLTDIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords transaldolase
publication title Crystal structure of transaldolase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus hb8
total genus 82
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1wx0A00
3O63A 1TV7A 3F03K 4WUIA 3EEGA 1G7VA 2DZUA 1UBSA 3QQ0A 2V5LA 4OWGA 1GTEA 4PCFA 2NX1A 3BLFA 3A23A 3M47A 2Y63A 3N19B 1JVNA 3RK8A 4JDBA 1EP2A 2V9DA 1AL8A 3QPYA 4JTHA 1XBYA 4S2BA 1ICSA 2X2GA 1O5XA 4MZYA 1H7XA 3W7IA 2YR1A 3LCGA 3MP4A 3IGXA 2Z0IA 2I1OA 1FWTA 5C54A 3W76A 4AAJA 2H8XA 3GAKA 3TROA 1P5BA 1YLVA 1ZALA 4X22A 1N8FA 4FIRA 3QH2A 2HS8A 1HO4A 2W6RA 3KFTA 3GDMA 3C2EA 3M16A 3NQDA 3W75A 1T99A 3C0JA 3B0VC 2QKFA 1OFRA 3EWXA 1KA9F 3W84A 1LBFA 1MXSA 1MZHA 3EXRA 5HWJA 3BW2A 2DZWA 2ZQ0A 4TR9A 2YW4A 2TYSA 4HKPA 2HSAA 1QPNA 1JCYA 4JTSA 3HPZA 1OFQA 1Z48A 5LNVA 1QMLA 1SW0A 2Z1BA 1VHCA 3QJAA 1I2PA 2VEPA 1R2RA 3G0UA 2EKCA 4IXHA 4UTWA 1LCOA 4AH7A 1KM3A 2FB2A 3GIYA 3S1WA 3E9AA 4ORIA 2ATMA 4WOZA 2P1FA 3I7QA 2VEKA 3IGSA 1N7KA 4O1CA 3GKFA 1PE1A 4UTTA 5T26A 3EWWA 3G24A 2TMDA 2Q3OA 2NUWA 2GVGA 3M5ZA 4O14A 3M41A 3W1XA 1RR2A 2ZRUA 3UWVA 4WXYA 3W88A 2DZSA 3NQMA 2GVLA 3HBLA 2ZTKA 4GXMA 2NV2A 3LTYA 4N4QA 2CFFA 3W2UA 2A7RA 4NJGA 4M6VA 3W71A 2WOQA 3LBCA 1TQXA 1RZMA 2J24A 4O18A 3R13A 4MFEA 1XL9A 3C2VA 4A22A 5D37A 1EUNA 5HR6A 2BTMA 2QAPA 3I68A 4JDYA 5TIMA 2QUUA 4EF8A 5HNRA 2X16A 3HOJA 1Z42A 3P7YA 1W5OA 4FX8A 4NVTA 1F7BA 3M6YA 4WQ6A 3M5YA 3DHFA 5AHNA 3BPWA 3TCEA 3LHZA 3DFOA 2Q8LA 3NQAA 3W9ZA 2C19A 4N9BA 1KTNA 3ABQA 3PG9A 3NA8A 4NU7A 2A85A 5K7JA 3FJLA 2WKJA 1ICQA 3GDLA 4IWWA 1TPFA 3P82A 3KOFA 3LB0A 1MEHA 4O28A 3DFPA 1TIMA 3R12A 3LRKA 3SY5A 3NAVA 2PRHA 2B7NA 4O19A 3QQ1A 1GOXA 2JKAA 5LHFA 5AHMA 3O6CA 5AC8A 3DZ1A 4KWWA 4UFHA 2BXVA 3MHGA 4UTHA 1J5TA 3LCWA 4PL2A 2H3DA 1J4EA 4FNQA 3WK1A 3R8RA 3N2XA 3W7GA 3OVPA 1RQEA 4HPXA 1HFBA 5U4NA 1H7RA 2JKEA 4R34A 5C2XA 2YFOA 5KZMA 4UNKA 2FTPA 3NPUA 1LRQA 1ZNNA 4A2SA 3NNTA 1EPXA 3SI9A 4O50A 4DO4A 3NXFA 2DP3A 4CCCA 1NVMA 4JX6A 3CM4A 1KLYA 1U5JA 3ZWSA 4MJMA 4UTWC 1O94A 3SFKA 1XDMA 2QCDB 1ZJIA 1JUBA 3NPWA 1YYAA 2A6NA 1DV7A 1YTDA 2ABAA 3CEUA 4ZQNA 4IXXA 1WXJA 4ADUA 2CZDA 4JX4A 4K38A 1KV8A 4UTTC 5U7SA 1EA0A 2P10A 3W1MA 4K39A 3IEBA 3G1SA 3HG4A 4UTKA 4O4VA 5K4ZA 2VFGA 4N9CA 1HUVA 4NT0A 4PODA 3O6DA 2BLEA 2WNZA 4MZ1A 1TREA 4Z1CA 2Y70A 1GJPA 2ZZ1A 3W1UA 4TO8A 1OFPA 3W1RA 2CWNA 2QCLA 3Q2DA 4HN4A 1OFDA 1VRDA 5J5DA 5KZDA 4S2CA 3MW7A 4XZ9A 1K7FA 3SGZA 3SZ8A 3HG2A 2JGQA 2ATSA 4JR5A 2HS6A 3FIGA 3U8GA 3STEA 1JCLA 1S5WA 1Y0EA 1ME9A 4RJEA 1QCWA 3NL5A 1TO3A 3T4CA 3B0PA 1Q3NA 2F84A 2ZRZA 5F1UA 4I7WA 2YFNA 3UWYA 1W0MA 3NZRA 5C55A 1C8VA 2C15A 4JXCA 1VHNA 5FEPA 2TRSA 2PE4A 2YXGA 3UZJA 1RV8A 4ORMA 4UTUA 3L21A 3DENA 1EUAA 2G95A 3MHUA 3B8DA 1R2SA 7TIMA 5SWUA 5HUPA 1VCFA 4MJZA 1PHWA 1TPDA 2R94A 2D73A 2GOUA 4HSNA 4Q32A 4NQ1A 3L0KA 2RDTA 3IVUA 1OF6A 4X2RA 1FDYA 1N55A 4PC8A 1H7NA 3W1LA 3MI2A 2ZA3A 5HQEA 4M7SA 3HGSA 2GQAA 1GZGA 2NUYA 2QAFA 4GUHA 3QMRA 2YYTA 3LHUA 2FJKA 1AW5A 3GNNA 3ZFHA 2B0MA 1TPUA 1AW2A 3L2IA 1FX6A 2V2DA 1GG0A 4RX0A 1QFEA 1OK6A 3CEPA 1LP6A 3NM3A 1FCBA 1WYIA 1I4NA 4FXSA 4PFMA 4P2VA 4UTJA 3PBUA 1GWJA 3H53A 2Y6ZA 4NZFA 3W2NA 3K30A 4IGHA 3EX3A 1TTPA 1DQXA 4WY0F 3PSWA 2Y88A 2EAWA 4DO5A 4FNRA 4H6KA 2X30A 3DFQA 5J5RA 3TIMA 1BWLA 1VR6A 1M5WA 3UPWA 1FCVA 1YTEA 3A24A 4YMZA 3FOKA 4WJEA 4RK8A 3LM7A 1ZY9A 3W7JA 4PA8A 3S9YA 2E68A 2WPBA 3S5OA 2B4GA 3L0NA 2FDSA 5F2GA 4IX0A 4XWUA 1ZHAA 1HL2A 3FKKA 4Q4KA 4QQ3A 2Y7EA 3LTSA 4PEKA 1OX4A 1G7UA 4LU0A 3DKLA 1KM0A 1OK4A 3SR7A 4EVZA 2DORA 4QITA 3NPXA 4UFLA 1H61A 1XM3A 2EF9A 3WJXA 3G1HA 5CZTA 2DJLA 4LVFA 1A5AA 4Y6GA 2C18A 1MSSA 3RU6A 3FKRA 1YPIA 1TJRA 4L4MA 2V5BA 1VYPX 2NWRA 1FDJA 1PHQA 3MJYA 1EEPA 4YWIA 1TCDA 5KITA 3GNDA 4EWND 1OABA 1ALDA 4OQVA 4JTTA 3ELFA 3W85A 2VEMA 1W8SA 1KM5A 4FIQA 3VE9A 1FCQA 2Z2UA 3Q37A 4HT3A 5DXXA 1WV2A 4JTKA 4LVDA 1VLIA 2F7FA 3O15A 3A5VA 5A8GA 1W5QA 5AHFA 1SO3A 3G1FA 1SO6A 4Y8FA 4JTGA 3E12A 3SSJA 3EXTA 3W2MA 2XN1A 2Y89A 3PWAA 1FDZA 3W6YA 4J9JA 1W5MA 1XFBA 4MY1A 1T0OA 1LM1A 4NJKA 2FPTA 3P80A 4MLRA 3E0IA 1TSIA 1VYSX 3STGA 4DF2A 3G1YA 3PULA 5HJLA 5TQLA 1DVJA 2PRLA 2UV8G 3TA6A 3T78A 3W23A 1KFBA 3CPRA 5KSWA 3W7MA 3RFAA 3C2RA 3HPXA 3W74A 3GDTA 2O7QA 3M7WA 4M6QA 4BI7A 3FJ6A 4PTNA 1CW2A 1W37A 4LTSA 4IMDA 3EWBX 3LCLA 3H55A 2VFFA 3NL2A 2DZXA 3DH7A 3WJWA 4BWLC 3TH6A 2V8ZA 4O1BA 3QM3A 3O6YX 1QNVA 1H5YA 3R89A 1LROA 1FBAA 3LV5A 1IIHA 2QR6A 5HINA 2ZZ7A 3NQ6A 2A0NA 3DI0A 5FEWA 3IIXA 3NDOA 2PC4A 1NEYA 4QJ1A 3NQCA 4OU1A 2VENA 1XBZA 2G96A 3ATZA 3TXZA 1VYRA 4C1LA 3ZS4A 1DKWA 2RDWA 4IJBA 1G4SA 4JY8A 3UQNA 3TXVA 4OV9A 2DZPA 4KFNA 4QSHA 1IF2A 4RCXA 4ADTA 3H54A 2YYUA 3CTLA 2OCZA 4O57A 4UMBA 5CPOA 1OF8A 1B9BA 3CHVA 1O95A 3V75A 4JTEA 4GNJA 4JNMA 4K7YA 2J6XA 3E49A 1W3IA 3NZ1A 4FB7A 1EB3A 3E96A 4QISA 3KRZA 2HMCA 5LNRA 2Y62A 4GWEA 4DPQA 3TSMA 2V2CA 4S1FA 1YXCA 2OMAA 1WAUA 2DU2A 1TPVA 4MLJA 5LNSA 4HPJA 1GYNA 3L5AA 1K03A 4IPIA 3C61A 4Z1BA 3DFNA 1F6PA 3KX6A 4H4IA 3NGJA 3PUEA 1DQWA 1SZFA 2A4AA 2X1RA 4OV4A 1H62A 2X1SA 5D02A 5G1TA 4QNEA 3WJYA 3BARA 4G1KA 2A21A 3HJZA 4XUGA 4DQWA 5BMXA 5AYYA 3VI2A 4AHPA 3DHDA 1RVGA 4OBTA 1KFKA 3PB0A 1KFJA 3A21A 4HNTA 2C3ZA 2I14A 1YXDA 1FY6A 2H3BA 1JCXA 1LTDA 1AG1O 2VFIA 1TYGA 3CWNA 2ZRXA 4DBDA 4FEZA 3EWZA 4L4LA 4MIMA 3V1PA 3HQ1A 3W2LA 3QF0A 6TIMA 4GUFA 1GVQA 5AHEA 1P1XA 3LLDA 4H3DA 2CZEA 3GXTA 4JTIA 1KFEA 4JTLA 5DCDA 4AWUA 4LUIA 3LGEA 1V5XA 2E6DA 4ZVJA 1H63A 1MEWA 3EX6A 4TIMA 3PY2A 4UUIA 4ZQRA 3GLCA 2WSRA 3O05A 2OX1A 4DXVA 3GB6A 3ABSA 2WO5A 2C16A 4Y90A 4JYDA 4LRSA 2QCNA 3UZ5A 1ICPA 3THAA 2ZZ3A 4CNOA 3DXIA 3C52A 1NF7A 5C5YA 5AHIA 1WOBA 3S1VA 1QDSA 3PUDA 5I3HA 2NX9A 2ZYFA 2H8ZA 1FCUA 5FF2A 2HTMA 4CNNA 3USBA 1F6KA 3W7RA 4JX5A 5IBXA 4NNAA 5ABTA 1GT8A 2BWGA 2ZA1A 3EX2A 5D2WA 3PR2A 1TPB1 2QJIA 1I8JA 2ZFAA 4OHQA 4AF0A 4K6AA 1LORA 4E2DA 1I2OA 8TIMA 4POCA 2E6AA 4N9DA 4LS1A 4KFPA 2ABBA 4RZ6A 5LSMA 4JTFA 4UMAA 1L6WA 3TC6A 2GQ8A 3MBDA 4MY9A 2NV1A 4GRSA 4QM1A 4UR7A 3TQ0A 1EIXA 1DHPA 3VE7A 2Z6IA 4NJIA 1H1ZA 1SSDA 3STCA 1DORA 1SR9A 4NJJA 2A5HA 4LS2A 2ZZ4A 1QR7A 4CNPA 1A53A 4N6EA 2VOMA 3G1VA 4CQ9A 1VCVA 2NXIA 3TKFA 4D2JA 1QOPA 3NQEA 1MEIA 3T44A 3KXQA 5DBTA 4O0KA 2JK2A 3WK2A 2VXNA 4DF1A 3PF3A 3LXCA 4P61A 1O4UA 1RPXA 4FNSA 3P8JA 3UD6A 1TPC1 3VKJA 4DBEA 1KW1A 2QUVA 3B05A 3HPSA 3UY7A 3L5LA 1VLWA 4M7TA 4O16A 4UFIA 2QF7A 1F76A 1BEUA 2RFGA 4WX2A 1AW1A 5BW6A 3O1NA 3MI3A 1W56A 4IQLA 3FFSA 1RQHA 1YDVA 3B04A 3GYEA 2GJNA 1UASA 4I7VA 1VJIA 3NOEA 1GG1A 1TJPA 3ABOA 3WFAA 3TSBA 2ISSA 4O0ZA 3TC7A 2LLEA 3G1AA 5D05A 3PSVA 3NO5A 2NLIA 3MP5A 3PUOA 4UFKA 5D2XA 4ZZ9A 4MVAA 4BF9A 3EKLA 4IOTA 4AHQA 3LI0A 2WSQA 3G1DA 3W87A 1XXXA 5HMSA 5FF0A 3L5MA 5LGXA 2XFWA 2ZCGA 3QFEA 3W7LA 1D9EA 1J2WA 4EOUA 4UFMA 1YTKA 5G4WA 1PIIA 4FNTA 1KM6A 3A5FA 2VELA 3M9YA 1ZFJA 5DELA 3HGOA 5HR7A 1K3UA 1ZAJA 4O1DA 1OYBA 4K8EA 5G2WA 3KAOA 5F2MA 3LCXA 1PCKA 3QMTA 5G2IA 1RD5A 4JTUA 2E5BA 3C8FA 3GR7A 3PG8A 3JRKA 1SPQA 5DY3A 4Z08A 3HF3A 2NWSA 5K9CA 1JQVA 3VNDA 4U4MA 1TRIA 1O60A 5KZEA 3OEXA 1PVNA 1DBTA 5IBXC 3IIOA 3B06A 5I3GA 4TU1A 4CLMA 3PC0A 1SFLA 3L67A 2ZZ5A 1I2QA 1VC4A 1T96A 3C4UA 4EF9A 3FS2A 3HG5A 3MMTA 3ATYA 3P62A 4CQ8A 1Q6LA 3C6CA 3PS7A 2YW3A 3MHFA 3QEZA 4MKNA 4DPPA 3M43A 2CLIA 5D30A 3KVLA 1X1OA 1XDLA 1PS9A 4MPQA 4K7VA 4XTIA 2V82A 2VC6A 2E6FA 4Z0JA 4XQ6A 1XBVA 4UTMA 3I6RA 3PAJA 3M44A 3IIZA 3NG3A 2QDHA 3TFXA 2FPYA 1IXOA 2C6QA 1C9DA 3FEMA 2C1HA 4UC5A 1H60A 2Y61A 3GXNA 5DBUA 3NYZA 1ZCOA 1LOQA 5CSSA 3M1ZA 4TX9A 4MYXA 2NXHA 4JYFA 2ZRWA 1GVSA 5G5IA 4AWTA 3W7OA 2Y7DA 1NAL1 3E02A 4Z1AA 4LV4A 5DCEA 1JR1A 4R53A 4N6FA 1YDOA 1ZENA 3GAYA 3KRSA 4RXFA 3I7SA 3QW4B 4GJ1A 5F2LA 4BR1A 3LHVA 4JYEA 5LNWA 5I3KA 3G22A 3TMQA 2J9XA 2R8WA 1QO5A 5DY2A 1NSJA 3N34A 4UR8A 3MP3A 3TFCA 2V81A 2VFDA 1IXQA 1W31A 2QDGA 1S5VA 1QPQA 4IX2A 2G5WA 1HO1A 3OHIA 2YZRA 1MO0A 3TQVA 1DJNA 4IMFA 5F4SA 3CB8A 5EPDA 5K4XA 2J88A 4JY9A 4IMGA 2GPTA 2FQIA 5FEZA 2QCGA 3AO0A 3O07A 3P67A 3W7PA 3LLFA 4HHPA 3QMSA 1QPRA 4OE7A 1OX6A 1RQBA 5K9XA 4TMBA 1HG3A 3DGRA 1L6SA 5EA9A 1L9WA 4Z0SA 5CG7A 1F74A 4IPJA 1JULA 3QSTA 2FLIA 1IXPA 1A5BA 5G4EA 1ME8A 2YX0A 1LYXA 3QZEA 3QYQA 5K3VA 4UTIA 3DAQA 1SFJA 4UFJA 3IIPA 3L66A 5IM51 4RV8A 3PBWA 4K36A 1LZOA 3G0SA 2B7OA 4UTLA 1EX5A 2C0AA 1F5ZA 1GPWA 1JQXA 3LRLA 5LZLA 1GVRA 4OT7A 4MYAA 5G1YA 3C2FA 3WJZA 3HG3A 3OIXA 3SW6A 2V30A 2Y7GA 5D04C 5D2TA 1V7YA 2YCEA 2CLFA 4RZ5A 5AYXA 4A2RA 3W7HA 3NEVA 1H50A 3BGGA 3S1XA 2NZLA 3KRUA 1X8FA 4JIPA 3P61A 3MBFA 3QSRA 3BW3A 2QCDA 5HWMA 1K02A 3W22A 3LV6A 2BX7A 2FPVA 1QPOA 3TDFA 2QCHA 1WOAA 3MI6A 1X7FA 5D32A 3TSDA 4AF0B 1ONRA 3TK7A 3GX9A 1G4EA 3GDRA 1TB3A 5BRBA 1LLWA 5E0KA 3O8AA 3GDKA 2WQPA 5DCBA 3BK0A 2CLOA 1H7WA 4LWWA 4RZ4A 2C13A 2Q3RA 1A5SA 1GQNA 1ML1A 4UIOA 4LUJA 4WY0A 1SZGA 2VKZG 1BKSA 2V2HA 3JR2A 5E1QA 2CW6A 1TPWA 5TBOA 1OYCA 4Y96A 4N4PA 2J27A 1THFD 3NQ8A 3WK3A 2QCEA 4X9SA 1GTHA 3CQ0A 1JRCA 4C1KA 3G3MA 3BG3A 2I9EA 2GQ9A 5H2ZA 4NJHA 1IIGA 1SQ7A 3TJLA 4Q33A 3S8HA 3Q94A 3T40A 3W1QA 1IGSA 4O13A 1AMKA 4O52A 4YL2A 3W1NA 1W1ZA 3KVJA 5CPLA 4ZQOA 1F05A 4E0CA 5I3JA 1QO2A 3W1AA 3C56A 3FA5A 1D3GA 3HMJG 3NR0A 1G6CA 1VS1A 4FF7A 3HGRA 3SGUA 3NQFA 3KHJA 1KFLA 2XN2A 1JCMP 2E5CA 4JS3A 2QEZA 1S5TA 1SZNA 2QCCA 3BG9A 1JJKA 4FNPA 2Q8ZA 2QCMA 3MUXA 2X1UA 4M6PA 1KM1A 2ZA2A 3HIJA 3N9RA 3CLMA 1TPEA 2PURA 1VZWA 3NPVA 3QRHA 4O4WA 3TW7A 2QJHA 3DFTA 3L9CA 2WSYA 5I3IA 3MO7A 2DZVA 4O10A 3IIVA 1G67A 3ZR4A 2JKPA 5AHLA 4TMCA 1VPXA 4HIBA 2PCQA 1U83A 1JUEA 1T8XA 2DZTA 3D0CA 2A6LA 4GUJA 1H51A 1OFEA 4AHOA 5MHBA 2GUUA 3RF9A 1R2TA 1ADOA 1KM2A 2CZFA 4O17A 3W7DA 3LRMA 5DXYA 1SU5A 3HO8A 2O7SA 1QAPA 2EGZA 2A7PA 1YDNA 3L0GA 4GC4A 2AAMA 4GUIA 3W73A 2JGYA 5LKYA 4ZQPA 4DEFA 1EWDA 3LXAA 3O06A 5GVJA 4Z1DA 4JEQA 3L65A 3WK0A 3DI1A 2CLEA 1XUUA 4LW7A 4RLIA 3W7CA 4FHAA 4YCOA 2NUXA 4NNBA 4WOQA 2ZRYA 4YXGA 4ZL1A 2J9ZA 2WV8A 2VEIA 3P74A 1F2JA 3S42A 1KTBA 3TR2A 5F1VA 1OX5A 4YCPA 4PH6A 3TAKA 5L6UA 4KWVA 4NX5A 1A50A 5AB3A 4N2YA 3LX9A 3C3NA 1L6YA 6ALDA 2YGYA 1YPFA 5FEXA 2W79A 1I45A 2QUTA 1XKYA 2CLLA 1K8ZA 5K9DA 3W1PA 4UXDA 3VFLA 2WJZA 3CIXA 1BTMA 3BO9A 2OT0A 2YPIA 3EXSA 4O54A 1OG0A 3SECA 3NL3A 1I2NA 1R47A 2CZ5A 3IV3A 2OT1A 3U6WA 2QJGA 2R91A 1AK5A 1AL7A 2C14A 4FX7A 3P81A 3TU9A 3P5ZA 1JUKA 4XBSA 3NVTA 2ZRVA 1KBIA 3YPIA 1D3HA 2CLKA 2P0OA 3P84A 3M0ZA 1W5PA 5F4XA 3F4NA 3AJXA 4OGZA 2Z6JA 4JGDA 4UCGA 4LVGA 3SIZA 5FESA 3RLVA 3TV8A 3W2KA 2EPHA 5AC7A 1K8XA 1OFAA 2H90A 3F1QA 3NM1A 3TNOA 2EHHA 3W83A 3LCIA 4NZJA 4AWSA 1TQJA 3CU2A 1VCGA 1S3HA 1SUXA 3BVJA 4O15A 3TJXA 5CSRA 4LT9A 4NXSA 1BWKA 3T7VA 3UXDA 1OX4B 4FXRA 1VH7A 3EWUA 4DF0A 3N3MA 3LCFA 3M5VA 1LBLA 5DLCA 1XUZA 4NNCA 1R30A 1Z41A 3G8RA 1W3TA 5LNUA 1H7OA 4AVFA 2E1DA 3LDVA 1EP1A 2CU0A 3LHYA 1Q6QA 5FF4A 1LRNA 4NUWA 1WX0A 5CPMA 1K7XA 3PBYA 4XKYA 5HUOA 4ALDA 1KTCA 2VFEA 1SW3A 1P0KA 1FWSA 1HTIA 1OHLA 4HSOA 4ICNA 3PBVA 5E93A 3G0XA 3N14A 3G18A 1LRTA 3IGUA 2QCFA 4DELA 4LVAA 1VQTA 3BG5A 3LOTA 5DN1A 1W54A 4LC6A 2E77A 4HNVA 1L2UA 5I3FA 3BGJA 4DO6A 3FYPA 4I7UA 3GXPA 4FNUA 1IXNA 1NFBA 2R14A 1FXPA 3OG3A 1PCWA 1UCWA 4GBUA 4GE8A 1LDCA 2NXGA 1KV5A 4LRTA 1WA3A 2X1TA 2RDUA 5H91A 3W86A 1GYLA 1VGAA 3NQGA 1K7EA 3LXBA 2XN0A 3A22A 1KBJA 1JCJA 5CZJA 5F2IA 5C6MA 1GVOA 3ZWTA 4ADSA 4W9TA 3GK0A 4GUGA 3TE9A 1UB3A 4ONVA 5CZSA 5CZ0A 3ABRA 3RMJA 3C2OA 4BI5A 1G4PA 2PRMA 2OJPA 4WZHA 1UJPA 4IMEA 3S0CA 4LVBA 4WY0B 3S6DA 1M7OA 3L68A 3N9SA 3NQ2A 1DJQA 4JIQA 4MFDA 4O11A 1QWGA 3I7RA 1WQ5A 3DBPA 3EX1A 1NF0A 3LHTA 3S5YA 1B3OA 3W72A 1TRDA 1B57A 3UWUA 5BOOA 1A5CA 2ZZ2A 3NL6A 4FX6M 3JS3A 3W3OA 1DOSA 3NQVA 4N02A 4RKAA 4JN6A 1Q45A 2YDAA 2B7QA 4RXGA 4UMCA 5FF7A 1X6UA 2A7NA 3A9IA 5D38A 2FIQA 5CKSA 5CGQA 3CWOX 3HGJA 3N73A 5L9FA 3PM6A 3VCRA 3TX9A 4B5NA 5AC6A 3W7EA 3STFA 2WNNA 1FUYA 4BK9A 1TMHA 5KTLA 4RR4A 2VFHA 1FXQA 2A2IA 1ZAHA 1KM4A 3UXAA 2GJLA 5KINA 4LC8A 3W7QA 1P0NA 4KKXA 4O1AA 4YLWA 3W1TA 2CLMA 3S5ZA 3UWZA 1KLZA 2BSLA 2E6YA 3CT7A 5BMWA 2FFCA 3EKZA 1XCFA 4ZQMA 3OVQA 1OYAA 2E09A 4O12A 3B0UX 3CC1A 1LOLA 4O8RA 4BI6A 2IQTA 1TV5A 1X1ZA 3MYOA 3OBKA 5HULA 3UPBA 4CCEA 3THQA 1ME7A 1M7PA 1TV8A 3OVRA 3P8IA 3FYOA 4GFSA 3LERA 1WBHA 2J9YA 5LHEA 1Q6RA 3P60A 4Y9AA 2ISVA 1LBMA 3DFSA 3IVTA 4IMCA 1WBJA 4CCDA 2A1YA 2Y7FA 4AEOA 2OZ0A 4HNNA 5EY5A 3T55A 2JBMA 1WDWA 4HNUA 2RKXA 3BW4A 5FF3A 1TTQA 3OA3A 4A21A 4QIUA 4WD0A 3HB9A 1OJXA 3EX4A 4X3ZA 3N2MA 3QC3A 1FWNA 4ZQCA 1TTJA 1M6JA 4XBKA 4AXKA 1XBXA 4JICA 1EP3A 4IUOA 2CLHA 2ISWA 4R33A 4AB4A 1OVDA 4BWLA 4JTJA 5KMYA 1QOQA 3UY8A 1EWEA 3W07A 3PB2A 4LOCA 4JD4A 4MOZA 3UWWA 1SO5A 3W7NA 4K37A 3LHWA 4MUZA 5CPNA 4QAIA 1E51A 3GZ3A 4N9EA 4WXZA 1G69A 3QW3A 1FWRA 3INPA 4MZ8A 3SJ3A 4U28A 3QPZA 1YXYA 5AN7A 5AYZA 3NQ7A 3UNDA 2RHGA 2YSWA 4NX0A 5F4WA 2H6RA 2ZZ6A 3O16A 3B4UA 3LTPA 2NX3A 1SSGA 3LBMA 5EBUA 3R2GA 1KFCA 3DKJA 3GKAA 3GVGA 1B4EA 1CI1A 5EKYA 3BLEA 3PVFA 4PL1A 2FB3A 2TSYA 2TPSA 3MWAA 3S1UA 4A29A 1Q6OA 3DU0A 3IRDA 3RNDA 1FWWA 3EB2A 4LS0A 3TW6A 3B03A 3KVMA 1FQ0A 1GEQA 4E2BA 4EIVA 5K2ZA 2AGKA 3UYCA 5D03A 1LOSA 1G4TA 2DJXA 4E38A 2ZTJA 3TAOA 3G8EA 3TUUA 2W0UA 1F73A 3KVKA 4M5PA 5D33A 5BNKA 4ZMGA 4O53A 4BFAA 1O5KA 3LCHA 2B7PA 1P4CA 3LI1A 4UNLA 1TTIA 3I65A 5G2HA 3G3DA 1W3NA 2AQWA 3M5XA 1DL3A 1C29A 4I9AA 4XTDA 4ML9A 1B4KA 2KZHA 4LNYA 4QNWA 4MY8A 2Y85A 5EMUA 4LV9A 2RH9A 1OFBA 1OFOA 3RLUA 1TPH1 1PV8A 3ANYA 3TMLA 1UUMA 1GVFA 1H7PA 1Z44A 2BZNA 5D2VA 4AMAA 5D2YA 3W2JA 4R7JA 4LY8A 1SZEA 3W7KA 3BLIA 4FO4A 1CX9A 1W5NA 5AOUA 2GVJA 1H1YA 4K8HA 3G1XA 4CQAA 1JRBA 1SO4A 5D09A 3R5EA 3TQKA 1R46A 1PL9A 5HWNA 2ZDRA 1LLZA 5LGZA 2V0TA 5A5WA 3GR8A 1XC4A 1JCNA 4XKYB 3P5YA 3FLUA 3F4WA 3BV4A 3CIWA 3EWYA 3WJSA 4NXKA 1I2RA 3U2OA 4KFOA 5EL1A 2ALDA 4A3UA 1UUOA 3UWQA 1XI3A 1ZAIA 1YADA 2ZBTA 1K8YA 5FI8A 3S5NA 3W70A 3Q58A 2WNQA 2G97A 3IVSA 2E5DA 4M19A 1SW7A 5EYWA 3MYPA 5AFDA
chains in the Genus database with same CATH superfamily
2XJ7A 3EEGA 1G7VA 1UBSA 4UZSA 3LPGA 2CZVA 2WZTA 1GVIA 3BQ6A 5C9WA 2EG7A 2UY5A 3I4KA 4PCFA 3BLFA 3NYDA 1MDLA 1NU5A 2Y63A 3N19B 1AD4A 4QJ4B 2ZE0A 1AL8A 4JTHA 2QV4A 2WMGA 3T2OA 4S2BA 1O5XA 2ZWZA 4MZYA 5I5RA 2DQWA 3MP4A 3IRSA 3FCPA 1DXIA 2BMBA 2H8XA 5ABGA 4S39A 1EJXC 3WEOA 5T91A 3KFTA 4FXJA 3CL7A 2XH4A 3C2EA 2PP3A 3W75A 2FVMA 2QKFA 1OFRA 3ZT7A 1LBFA 2VGFA 3BW2A 3LEPA 1CXHA 1T41A 1TVPA 3BJFA 1QPNA 2PWFA 3PJUA 1V6YA 1EXPA 3B9AA 3BGAA 1OFQA 1Z48A 4B2DA 4KBXA 1SW0A 3UNTA 1DJIA 2FGBA 3W0KA 1VFFA 5DT5A 1VHCA 4Y9MA 1R2RA 2EKCA 4IXHA 2IPWA 3CHEA 3B8TA 2ZUNA 4ROPA 1A47A 2X09A 5HDRA 4ORIA 1UP3A 2EQDA 2CESA 1S1PA 3EPOA 3WX7A 2G37A 1SZRA 2Q3OA 3KP1A 1H0IA 3M5ZA 4O14A 3M41A 1YIXA 2XVNA 1B3XA 2GVLA 4GXMA 2CFFA 1RVKA 1V0LA 2A7RA 3W71A 3CGTA 4BJHA 4S3CA 5BXPA 4KERA 1YX1A 1RZMA 1V3KA 1XL9A 1Z9AA 5HR6A 2BTMA 2QAPA 1P0BA 5TIMA 1X98A 3ARYA 3T8QA 5HNRA 1HVXA 2X16A 3L4XA 1O5QA 1W5OA 4GISA 2GJXA 1IEVA 1TUFA 1W1VA 4WQ6A 3M5YA 5AHNA 3TCEA 3CAQA 1TE1A 2E9MA 5IOBA 3FN9A 3ICJA 3PG9A 4NU7A 4EXAA 4KWSA 2FZNA 3OU8A 4DZHA 4C6DA 4CD5A 2NVDA 1TPFA 3LB0A 1WDQA 2P0IA 2O56A 3IJ7A 1HP4A 3AMDA 1VBGA 2VDHA 3EAUA 3LRKA 3NAVA 4G7FA 2B7NA 1EBGA 1KXQA 4F3HA 4Z2IA 3AFBA 5I77A 3NWRA 1EF3A 3MHGA 1UWAA 7PTDA 4LUTA 1DIKA 1RQEA 3WLMA 3FK4A 2ZKMX 2YFOA 3N4EA 2PZNA 5KZMA 3H2MA 4D72A 4ERIA 4A2SA 1HJUA 4KRUA 3OZMA 4DO4A 3NXFA 1NVMA 3UJFA 1O94A 4QLLA 1BYBA 2QCDB 3NPWA 4KGJA 1XIFA 1YYAA 4WK9A 1DV7A 3R0KA 1YTDA 3CEUA 1WKEA 2FFIA 5HA7A 4LYRA 4ADUA 4JX4A 2HROA 3P3BA 4L4PA 2D1ZA 1ITQA 1EA0A 2ISDA 1FVPA 7A3HA 2WC4A 4ATWA 4DBSA 4DJDD 2CKRA 3HG4A 1B31A 4N9CA 3L2LA 3O6DA 3A3XA 4Y9OA 1XICA 2CWNA 4M6UA 4CQBA 2YJQA 2HPMA 1OY0A 5HOSA 3FV9A 4H19A 4S2CA 4XAPA 1K7FA 3BMVA 1K9FA 3SZ8A 4E4FA 3EWDA 2Z7KA 3FIGA 3NVDA 3U8GA 1S5WA 5MKGB 1ME9A 3PANA 1JAKA 1TO3A 3B0PA 1CB2A 3V7PA 1U33A 2ZRZA 1W0MA 3NZRA 4AW7A 3COTA 1BYAA 1UKQA 2YBVA 1VHNA 5FEPA 2CCRA 2PE4A 5CAKA 5CXPA 1IE7C 4KCUA 2G95A 2DPEA 4TUFA 1VCFA 4MJZA 2ZXDA 5XIMA 2PEVA 2GOUA 3LBOA 2RDTA 1A5NC 5AVNA 4U2ZA 3SQSA 3F4CA 1IV8A 2DT2A 2PTXA 3W1LA 5CC3A 2PGFA 2R1KA 3MI2A 3APTA 3HGSA 2V6AA 3GQYA 2QAFA 5EFFA 3QMRA 1R86A 3LHUA 3Q4DA 5LIXX 4DUOA 1NP0A 3GO2A 1K1DA 3WDPP 1GORA 3L2IA 5HNNA 5FSEC 5D8ZA 4U5IA 1DEDA 1ZP4A 1XWYA 3WL0A 1F9CA 2B81A 1MYRA 3UESA 1WYIA 4FXSA 4PFMA 1OEPA 3S83A 1GWJA 4MNJA 3FX4A 3K30A 2VWTA 4UQAA 2PDYA 4OUEA 1DQXA 4WY0F 2Y88A 4Z2HA 2INEA 3OLDA 1OWQA 4DO5A 2NSXA 4G2DA 4EAMA 2XIIA 2WJFA 2Z7GA 3ZR6A 2HXUA 2O92A 4IQEA 1BWLA 3AYTA 1M5WA 1R0MA 3KUMA 1YTEA 4CKQA 1ZY9A 3W7JA 4PA8A 2E68A 3ONBA 2WPBA 3F4VA 5JMUA 4Q4SA 3E5PA 3WLOA 4IX0A 3OQEA 2BOGX 3FKKA 3DGBA 3PFMA 3JUGA 3N6QA 1I75A 2UWFA 1G7UA 4EVZA 2AGTA 4XD5A 2QVHA 2DZAA 3PTDA 2XIQA 2MNRA 3TW9A 5CZTA 1GQJA 4JTAA 3GXDA 1PYMA 4ACYA 3WUEA 3OLIA 5XINA 1WUFA 3RU6A 4P7LA 5I0DA 3ARSA 3B97A 2HNHA 3R43A 1MWOA 3GVWA 4IM4A 3QN3A 3GNDA 4BEUA 5CJ5A 3W85A 1AUSL 4FIQA 3TYCA 2Z2UA 3Q37A 3ITXA 3LLXA 5DXXA 1WDRA 4GYPC 1FKXA 4LVDA 3AMLA 4UOQA 5TD4A 1W5QA 4BHYA 4PB4A 1SO6A 2YB1A 4AZBA 1XKJA 1POJA 4JTGA 1XCXA 3S4TA 3PWAA 4IGMA 1UQYA 1W5MA 4DWSD 5EMJA 1XFBA 4NJKA 4TX8A 3TLLA 2FGLA 1RALA 1VYSX 3G1YA 2WPGA 2PRLA 4ZE5A 1OB0A 3BZJA 4HHLA 1V4YA 3T78A 4JAWA 5KSWA 3AS3A 3RFAA 3HPXA 3QTPA 3W74A 3GG8A 4HU3A 3FXGA 5BXSA 4M6QA 4BI7A 3FJ6A 5FJPA 5FJIA 1JZ7A 3E2RA 5A2AA 1HL8A 4HYRA 3WJWA 2XGIA 3VZXA 2V8ZA 4O1BA 3FEQA 3QM3A 3O6YX 4GXWA 1LROA 2EBNA 1H5VA 1DQUA 1B90A 3IJLA 4ZO9A 5HINA 3V0UA 4BQ3A 2J7EA 2ZZ7A 3PZGA 2HNEA 1PX4A 3WQ8A 3OP2A 1ISYA 3IJ6A 5FEWA 1JPKA 1NEYA 4Z42C 4PMUA 3ATZA 1LL4A 3RO8A 4Q8NA 3PTQA 4IPNB 4XSMA 1K9DA 2RDWA 3UQNA 2C7FA 3PNZA 2C79A 1TELA 4LX4A 4OV9A 3ISIX 3KBMA 1VBUA 2PGWA 3QHNA 2WVVA 3CTLA 2G50A 1FKWA 1YEYA 3CHVA 4JTEA 4GNJA 4HZMA 3QV9A 2YDQA 3E49A 3EOEA 3NZ1A 2IQDA 4B9YA 4QS6A 1Q6DA 3GHRA 3MUY1 5CPSA 4Q8MA 3KRZA 2HMCA 4LCSA 3MV01 4D6EA 2Y62A 3TSMA 4CD7A 1GYNA 4S3AA 4IFKB 3DFNA 3KX6A 3KTSA 3BQ5A 4H4IA 4GX9A 2QF8A 3BLPX 3NGJA 3PUEA 1DQWA 1IZKA 2A4AA 3OOQA 2CLPA 3AIWA 2ACRA 4BEQA 2DGAA 5G1TA 2ZICA 3L4TA 2A21A 3RITA 5TF0A 2I5QA 1U30A 3K13A 4F48A 1JIBA 4QG6A 4YWSA 1XLKA 1RVGA 2DSKA 1LLOA 1KFKA 1NIUA 2I7GA 2C3ZA 3PPFA 4CEXC 2AAAA 4JFVA 1AG1O 1TYGA 4QE5A 3W38A 1BQGA 3EWZA 4FEZA 6PTDA 1LWJA 2YA2A 4AZ6A 2ZUTA 3QGKC 2XPKA 4UQ9A 3PNUA 3F2CA 2CZEA 4FP1A 1KFEA 5A2CA 1UR0A 4YVXA 3BTNA 3L23A 1PKYA 3WZ0E 3MDWA 3DG6A 3AMCA 3EX6A 1GUVA 3PY2A 1YHTA 1SMAA 1Q2RA 3O05A 2OX1A 3GB6A 4JYDA 1MQRA 2ZX6A 3UZ5A 5JU6A 2W63A 3CB3A 3ZIZA 5AHIA 5DRCA 3PJTA 2R1PA 5I3HA 1F8MA 5FF2A 3WFLA 1D3CA 4PTXA 4AFYA 3QYSA 4JX5A 1HF6A 3MZ2A 1YNYA 5A6JA 3HTWA 5ABTA 1GT8A 2BWGA 2EPOA 3E38A 1X38A 4HU8A 1J11A 5IHSA 3E2SA 2QJIA 2ZFAA 1H1NA 4OHQA 2ZX7A 4POCA 3GXIA 1LQ2A 2ABBA 1L6WA 2FHFA 1TMQA 1H1ZA 1QOXA 1BF6A 3STCA 1SR9A 4D6CA 2A5HA 4QTGA 2ZZ4A 1QR7A 1G94A 4N6EA 1ZBKA 3MB9A 3K8LA 1QW8A 4LEFA 3CZ8A 5DBTA 3O0KA 4GBDA 4O0KA 3S2MA 1RSCA 5EMLA 1RPXA 5EGRA 2WWCA 1C7TA 4FNSA 2WW5A 3UD6A 2WMHA 2QUVA 4JNYA 1JXJA 2JQXA 1VLWA 4M7TA 3QZAA 1BEUA 2RFGA 4WX2A 5BW6A 1JCTA 3ZLHA 1HZYA 1CXKA 3KDNA 1VJIA 4F2BA 5C71A 4H6RA 1Z32X 1R8LA 2J62A 1CGTA 4C6OA 1QI2A 3TYEA 1TX2A 2OLSA 1PPIA 2GWNA 2LLEA 3A13A 2NLIA 1X96A 4UFKA 4MVAA 4BF9A 4H9XA 3AIEA 4AHQA 2WSQA 1XCWA 2R24A 3MSYA 3SCTA 5HMSA 4LAKA 5LGXA 4BF7A 2VC5A 3A6OA 3ARPA 2DVXA 5CC7A 2F8QA 3VDCA 1VBJA 1Z89A 1ZAJA 4IIHA 5E6ZA 5G2WA 1OYBA 4IT1A 1SVDA 1A3WA 1PCKA 2OODA 3VD4A 1RD5A 2E5BA 4HTBA 4F79A 5FJJA 1B3WA 5DY3A 1WAWA 4Z08A 5K9CA 3TA9A 1TRIA 5KZEA 4BQ4A 3T0TA 5IBXC 4BQ5A 5JXQA 3ORWA 3B9NA 4CLMA 3PC0A 1I2QA 2XYLA 4Q4MA 2VCBA 4XUYA 2E25A 4U31A 4EF9A 3HG5A 3ATYA 2YW3A 3LYEA 4AIOA 4E3TA 4YTRA 3M43A 4GIYA 5D30A 3OO2A 4FXFA 1M9HA 3B8SA 5C9RA 1XYLA 4XQ6A 2J7BA 1IZCA 4GC3A 5DMMA 4D6GA 4LUSB 4AZIA 2C1HA 4UC5A 3N2BA 1LOQA 3M1ZA 3E0VA 1QK0A 4JCMA 4TX9A 2NXHA 3LNPA 2ZRWA 4GACA 1RUSA 4B15A 1GVSA 1E6XM 4AWTA 3C0LA 4K2SA 1JGMA 4RDWA 3U4AA 1KB3A 2DSZA 2WQDA 5CBJA 2Y5JA 2FZDA 3R6IA 1XYMA 3KRSA 4RXFA 3QW4B 2OZ3A 1GOMA 2VT0A 3G22A 2R8WA 3HFTA 1QO5A 2OEKA 5DY2A 8A3HA 5I78A 2G5WA 4IMAA 3ITVA 3OHIA 2AQVA 4IMFA 3HMCA 5EPDA 1TMLA 1H4PA 1A0CA 2GPTA 1B0IA 1TZZA 4OE7A 1HG3A 3DGRA 1L6SA 5CG7A 3FY1A 1JULA 3W81A 1X6NA 4ICCX 1ME8A 1SFJA 4NP7A 2CC0A 4IP4A 2YIHA 3LNMA 4RV8A 5IM51 1J0JA 5JH2A 1PSCA 1CCWB 3C0QA 4UTLA 3IUHA 1W9BM 2YKKA 3AHTA 1GVRA 2WHJA 3SW6A 1UWQA 2Y7GA 3QOMA 1W9VA 2CLFA 3MZNA 1KXVA 3W7HA 3S1XA 3I4EA 1RJPA 1TJ0A 1KR0A 1EGVA 1O68A 3URNA 4UQBA 3BW3A 5J04A 2QCDA 3W22A 5BRPA 3LV6A 1P48A 2BBFA 1QPOA 3GSMA 4IISA 4XSLA 3MI6A 4G1NA 5D32A 3AXIA 1UD4A 2C8NA 4AF0B 1G4EA 1TB3A 3K46A 4W89A 3WD0A 5E0KA 2J77A 2C13A 1J10A 1T7LA 4LUJA 2WMFA 2P3EA 3CYVA 4QXIA 1TPWA 3FA3A 4CU6A 1THFD 3A3WA 3WK3A 3CQ0A 3CTTA 2E67A 2I9EA 4GABA 5FIPA 2PP0A 4NJHA 1IIGA 1K8CA 3F2DA 4Q33A 1WO2A 1TE6A 1W1ZA 1RA5A 5CPLA 1GKPA 1LQ0A 2ZUVA 4GZEA 2J7CA 9RUBA 3W1AA 3FA5A 3NR0A 3QLDA 3WDQA 1IWBA 1OGBA 1EL3A 2PODA 1QU4A 2E5CA 4GJIA 3ZJ6A 2QCCA 2DH3A 1EJUC 5JIWA 1GJWA 4QLKA 2X1UA 1KM1A 4P7RA 2INFA 5KETA 1TPEA 1VZWA 4O4WA 4S3KA 1IQ8A 1V02A 3DFTA 3R58A 4U10A 1JDFA 3EOUA 2WHKA 1G67A 3ZR4A 4L6HA 3UZWA 1T8XA 5DQPA 2DZTA 3D47A 1V6XA 5BOEA 7REQB 2FVLA 2KAUC 4Q7BA 1A5KC 3RF9A 1GONA 1ADOA 2CZFA 3GDBA 3W7DA 4X0VA 5DXYA 3MUIA 2YDSA 1TVLA 3VM5A 3ME3A 2A7PA 2YCKX 4L80A 5JUVA 3FAWA 1BXCA 2AAMA 2QMKA 2JGYA 2BXZA 5LKYA 2OKTA 3BOFA 3C5QA 4LB4A 1EHAA 1U5HA 2DT3A 2E9BA 4LCQA 2X41A 3KOWA 1DWGM 3C86A 4FHAA 3S46A 5D9PA 1FP8A 1E9YB 2OWXA 3AYVA 3ZJ8A 2PDIA 3PZOA 2XINA 4AD5A 4FR6A 3P74A 1YDYA 2FVKA 4IQDA 1JFXA 3S42A 4OIFA 1KTBA 3TR2A 3TYZA 2EO7A 3S9IA 2XH0A 1F8IA 1S5NA 3MMUA 4DWSB 3LX9A 2BV9A 1F3WA 3NSXA 3C3NA 1L6YA 5DANA 3LA4A 3MY9A 2YOCA 1RCOB 3PJWA 2CLLA 3P0XA 3VIPA 3W1PA 4AEEA 3DHPA 1IWPA 4O54A 3NL3A 1EZ2A 3IV3A 4ZB5A 1EJSC 2QJGA 2R91A 1AL7A 2C14A 1WNOA 3EBVA 3DIPA 1J0KA 1P6WA 1S2TA 3WBWA 3QTGA 2P3ZA 3P84A 4Q4QA 1DWJM 1XJBA 4OGZA 2Z6JA 4JGDA 4WIWA 4LVGA 5FESA 5AC7A 4H7VA 4AY8A 2GK1B 3F1QA 3RR1A 2XGBA 1XGEA 4N42A 3TNOA 1OZQA 2V5CA 2YL9A 1I9CB 1TV3A 3AXMA 2PWUA 3WEMA 1S3HA 1VD6A 4D6FA 1SUXA 2GYIA 3QHOA 1XYAA 1XLFA 3TJXA 4NXSA 1XLDA 1R9XA 3BE7A 5HNUA 3O3RA 3M5VA 2I5GA 3WNKA 2WC3A 4JQ1A 1W3TA 4AVFA 2ZE3A 2E1DA 3RN6A 1KD0A 4AZ7A 3SCOA 4KMQA 1UZHA 4DWDA 3LHYA 3AZSA 3UETA 4PGLA 5FF4A 1XW8A 5FAGA 3VOFA 8XIMA 3CZKA 3UEQA 1UOZA 4ALDA 5HMEA 1KTCA 2VFEA 4HVXA 1SW3A 1HTIA 4ICNA 3WNMA 3JU2A 2AOSA 2ACSA 4J3TA 1NOUA 1V6UA 2FZ8A 5A1AA 4LVAA 3W37A 1CEOA 4W4QA 4PUJA 2E77A 1UR3M 1JYNA 3VOCA 4DIAA 2RJHA 1IXNA 1NFBA 2R14A 1DWIM 1UCWA 4MNMA 2I5IA 2C0HA 3TN3A 3W86A 2D0GA 1VGAA 5BXRA 1RD6A 5I7GA 1IHIA 2Y8KA 2VD8A 1EC8A 1N8WA 1V02E 2XN0A 2PMQA 1P7TA 4MSSA 2INZA 1NQKA 1GVOA 3OGSA 3T6CA 4LBRA 4D6HA 4GKLA 1UB3A 4IJCA 2CEQA 5CZSA 1MQQA 1TVNA 4GNVA 2A3LA 1G4PA 2PRMA 3V5CA 2Y1HA 5JQ9A 3FDKA 3FGCB 4IMEA 1JZ6A 3PZIA 3S6DA 1M7OA 3N9SA 4ACZB 2QHAA 2QVNA 3E74A 4JIQA 4NKCA 4ZEPA 3I7RA 3Q65A 3DBPA 1NF0A 3S5YA 1ZU8A 1TRDA 1B57A 1XD0A 3UWUA 3VIHA 4A6GA 3EA2A 2YDAA 3WQOA 3M0IA 5FF7A 1X6UA 3DFHA 2PWHA 2FIQA 3DECA 3CWOX 5L9FA 3VCRA 3STFA 3SQLA 3GRIA 4U33A 2VFHA 1FXQA 4IFOA 2HE5A 1ZAHA 3V1HA 3BV7A 2GJLA 1JF5A 3LSCA 4KKXA 4O1AA 4YLWA 4PBFA 3AUOA 2CLMA 2XFFA 2UY3A 1KLZA 4L1GA 5BMWA 4J3XA 3OVQA 1MW2A 2E09A 5HQLA 4DYEA 2HQAA 1LOLA 3WLTA 4O8RA 2Q01A 1UQZA 1TV5A 1E5NA 1X1ZA 3THQA 1UG6A 5EB8A 2E4TA 3P8IA 1WBHA 2Q09A 5IRPA 1Q6RA 3P60A 3T0BA 2ISVA 3G2GA 3AHVA 3REQB 3K4WA 2JBMA 1WDWA 3NSNA 1JF6A 2V3GA 3BW4A 4HB7A 3VOIA 1S1RA 3RIKA 3EX4A 1JYWA 4QCEA 4WR3A 1M6JA 2V3FA 3CPUA 3VNKA 4IUOA 2CLHA 2ISWA 4R33A 3GUWA 4AB4A 1OVDA 5KMYA 4JTJA 1WXYA 3AIRA 4RDZA 4LOCA 4JD4A 2AMXA 1BRLB 3UWWA 3W7NA 1ZBWA 4JIEA 4L65A 4EPEC 3LHWA 5CPNA 2EPMX 3QFWA 3VKKA 4QAIA 3BXWA 1E51A 3GZ3A 1XGDA 2O9OA 1IWAA 4PMJA 4R5EA 2A79A 4ZOCA 4MZ8A 4LB3A 5HPOA 3EWCA 4GI9A 1Q13A 3PFRA 3AZRA 2D22A 2QJMA 3K5XA 3UNDA 4NX0A 2RHGA 2VTFA 2YSWA 1I0BA 4R9XA 4V15A 2ZZ6A 1NWUA 3B4UA 1XLJA 5EBUA 1CGXA 1CI1A 4PL1A 2HCVA 2TPSA 3SRKA 3THCA 4MPKA 3DU0A 4DI9A 3B03A 4EIVA 1GEQA 2AGKA 3DG7A 3UYCA 1EYWA 5D03A 5CPQA 3IJDA 4Y9PA 4E4UA 1LJYA 3F7JA 3AIUA 4PYSA 3VDHA 1UPMB 3BOXA 3CV1A 4NL1A 1XSJA 4BFAA 1O5KA 1ZPTA 2AL2B 3KEHA 4GY1A 4MWAA 1ZRQA 3S5SA 2C1GA 2J8FA 4Q8OA 3VOJA 4Q7IA 2AQWA 2PDMA 1DL3A 4I9AA 4LNYA 2WZEA 1IT0A 1ZJAA 3RMEA 1XLLA 1OFBA 1OFOA 1W3KA 3ANYA 3SRDA 1UUMA 3IARA 4JIHA 1ZTVA 4OKDA 2Y0FA 2QT3A 2P76A 2D3NA 3MKKA 1EBHA 1EIBA 3U5UA 4FO4A 4RNJA 2R1MA 3WNPA 4K8HA 3WMLA 3A3HA 3G1XA 4XK2A 2Z4GA 1VJZA 2E8YA 4MADA 3UERA 5A5WA 4WGXA 3QR3A 2VHLA 3TJ4A 1RCQA 5D9MA 3EWYA 1WE5A 1I2RA 4L7ZA 2VOTA 4US6A 4A3UA 3UWQA 4LALA 4NILA 2ZBTA 3VIIA 4JTCA 6TAAA 3SGGA 1EQPA 1UP0A 2E5DA 4XZMX 5FKYA 1ZP3A 3MYPA 3OB8A 3TOPA 1TV7A 3F03K 3ITGA 1WXZA 4Q8QA 1JFHA 3ITLA 1PWLA 2VR5A 2QYGA 3AQUA 3QLLA 2Z2AA 2O9TA 3GU2A 1JVNA 1O1HA 3RK8A 1WCGA 1EP2A 3QPYA 2R82A 3IPWA 3DYPA 2X2GA 1CLXA 2EJAA 3LCGA 1JD7A 2I1OA 2Z0IA 3H4GA 5C54A 3C0SA 3GM8A 3SFWA 1V8EA 1AFSA 1E4NA 1ZALA 3BSGA 1XRSA 1JZ2A 1FH7A 2BGQA 4AMCA 3M16A 1GQLA 1UD8A 3SO7A 3NQDA 2PDQA 5HWJA 1M01A 2ZQ0A 1UIOA 2TYSA 2YBTA 2HSAA 3PK7A 3HPZA 5LNVA 4BZYA 2W67A 2DDXA 4IGSA 4KS0A 5I07A 1I2PA 2J6VA 2NW0A 3U2EA 5A6AA 1VENA 3KOXA 4UTWA 4PFHA 3GIYA 2DVUA 4TVUA 2HVNA 3S1WA 1ADSA 3FVMA 5A6KA 3DBNA 1V6TA 1XRVA 2P1FA 3I7QA 3IGSA 1N7KA 1XIDA 4FK9A 1GOKA 1PE1A 1C8YA 4UTTA 4AQLA 3EWWA 5A8QA 1LL7A 1AVAA 2NUWA 2GDQA 4XBJA 2ZRUA 5DRIA 4DNMA 4NRSA 1Q66A 1R85A 3NQMA 1AQHA 3HBLA 4QDWA 3S2JA 1KR1A 1J9YA 2ZTKA 2NV2A 4NJGA 4M6VA 4CU8A 1YW1A 1TA3B 2J24A 4O18A 4MFEA 3C2VA 4HZ6A 4A22A 5I23A 4GGHA 4MGGA 2ZUUA 4EF8A 2G4JA 3HPAA 1Q7QA 3GD6A 1Z42A 1E4LA 1F7BA 4Q8WA 4FLRA 4NYYA 4J1OA 2OYLA 1UR2A 4CQDA 2B31A 1J93A 8RUCA 1IYXA 3ABQA 4E2VA 1V3LA 4KEMA 3FJLA 5AECA 1DJHA 1DP0A 2BHZA 2WKJA 1ICQA 2DSVA 4IWWA 3KOFA 1WZAA 1R9ZA 4XKMA 1MEHA 4FALA 3ZJKA 3R12A 4LBSA 3SY5A 1IR2A 2PRHA 4Y9NA 1S5MA 3QQ1A 3M0HA 3WDHA 5AHMA 1MW3A 3PPCA 4I9TA 3DZ1A 5C2GA 1F4HA 2AMGA 2PPGA 2BXVA 1FFQA 5IFPA 1UW9A 1XDJA 4UTHA 3EMZA 3LCWA 9XIAA 2H3DA 1J4EA 3VYLA 3KS5A 3HFYA 3N2XA 2DSUA 2W62A 4PR4A 4HYWA 4HPXA 3EPMA 1H7RA 1M1BA 4R34A 4WGHA 2ACQA 3R79A 3FNDA 1LRQA 4X2PA 4JFWA 3B8IA 4DHGA 3WH5A 3MTWA 1AA1B 1DJZA 4J3UA 5A6BA 3CM4A 1UH3A 1KLYA 2F6XA 1U5JA 2WCSA 2JALA 3M0KA 4CNTA 3RLHA 4AYSA 4DNHA 4Q8TA 4DYKA 2A6NA 2ABAA 1Q5MA 1KRAC 4DX3A 1BQCA 3E0WA 4W87A 5U7SA 2CHOA 3ARWA 5E6YA 3VIOA 2BDQA 1BSIA 1VIWA 4UTKA 4O4VA 3TYAA 5CG0A 3PJXA 4NT0A 4PTVA 4Z1CA 2Y70A 1GJPA 2ADAA 5I24A 3BAWA 3WH9A 1UBPC 1UH4A 1Q6EA 4HP5A 1XH1A 4U3CA 2XDFA 1MMFA 3HG2A 3HQPA 1PX8A 3STEA 2NQ5A 7REQA 2P8CA 2WMIA 4ASTA 1BXNA 5HANA 3T42A 3WQFA 2VR2A 4WVXA 5C55A 1KO0A 2WVSA 4JXCA 2FDMA 3K1DA 5CLWA 2XZ7A 3BLKA 3L4YA 2YXGA 4FAMA 1JDDA 1RV8A 4UTUA 1QNSA 3IWPA 3IUIA 3SM0A 3DENA 2O55A 3GU1A 4B5TA 3HU7A 2X0HA 2A3EA 4JIRA 1TPDA 2R94A 2D73A 3WF2A 4HSNA 4Q32A 3L0KA 3IVUA 1FDYA 1N55A 1DIEA 5A95A 3DDMA 4GY7A 4A3HA 3RJYA 2GQAA 1Q7MA 4RPQA 1GZGA 4GUHA 4LF2A 1CIUA 3ZFHA 2ZDSA 1DWFM 1AW2A 2HWGA 1C93A 4B5XA 4IPPA 2D2JA 5C2CA 2D69A 1GG0A 4UCFA 3H26A 2BGNE 1J2BA 3UG3A 4UTJA 4H9MA 4KETA 1P6CA 4NZFA 3PWIA 3DCPA 4IGHA 3EX3A 7XIMA 3PSWA 4KPLA 2EAWA 1RBOB 4FNRA 4NAFB 3K4DA 1KBBA 4FLOA 1UIPA 1VIZA 3TIMA 2HV5A 3L4VA 2ESCA 3UPWA 1FCVA 3A24A 1H2JA 4WJEA 3RM9A 1GNXA 3CMFA 3QOKA 3LM7A 3GG0A 3S9YA 1O1ZA 3S5OA 3AHXA 4QG8A 6A3HA 3AXXA 3JVAA 3W27A 3RO6A 2C1IA 2Y7EA 4RW3A 3W02A 4PEKA 4LU0A 2WBKA 4XAZA 2PDCA 1KM0A 1OK4A 3ARUA 3AJ7A 2DORA 3NPXA 4UFLA 2EF9A 4M24A 2GJRA 2VQTA 4H9VA 3G1HA 3SRFA 4GO8A 1A5AA 3AXHA 4Y6GA 1ZSXA 4EK7A 5A6SA 4IZGA 4PBGA 2GDVA 3FKRA 1UKSA 1YPIA 2PDGA 1TWWA 2NWRA 1FDJA 3MJYA 1RHCA 1EEPA 2PUZA 5KITA 1NWSA 3ZVHA 1QI3A 1KNWA 1M41A 3ELFA 2GJXB 4L1WA 4TXEA 2VEMA 1W8SA 4F0SA 4GCAA 1BVWA 4A3YA 2RJGA 4C5ZA 4HT3A 4AISA 3MKCA 2FH6A 3O15A 2DFAA 3A5VA 5A8GA 5AHFA 4F8XA 3BCFA 3VNZA 3ID7A 1YRRA 3EXTA 1DIDA 3W2MA 4RL3A 1FDZA 3UVAA 3W6YA 2ZOXA 3CUJA 1F61A 4B3KA 4MY1A 4AZGA 1T0OA 1GOOA 3E0IA 4EPKA 1F6YA 4DF2A 5I02A 2X05A 1A80A 3N2OA 3A4JA 3ARZA 2QS8A 1L8PA 3I3DA 4H83A 3FGCA 2GSEA 1R3YA 5BU6A 4LUTB 4W8LA 2XISA 1EKOA 4AUBA 1CW2A 3H55A 4FOUA 2VFFA 3NL2A 2XIMA 1BXBA 3TH6A 2WXDM 4EXBA 1H5YA 1QASA 1FBAA 3LV5A 1IIHA 1OC6A 1E70M 3VK5A 2WB5A 4IL2A 3DI0A 1O7AA 4RNIA 3IIXA 2CXEA 1HIZA 3NQCA 3M07A 2BOEX 2G96A 3MWCA 3UA3A 4GIRA 2OTDA 5EMMA 2PDLA 2D24A 4IJBA 1G4SA 4JY8A 3RM8A 4IP7A 4B4HA 3FSUA 4M81A 3V35A 1IF2A 3H54A 4HQVA 2OCZA 4E8GA 1OF8A 1MI3A 3B3DA 3KE0A 1J6PA 4NZ5A 1EB3A 1E0TA 3E96A 4TOQA 1ZGDA 4G9PA 3H7VA 3WLQA 3ANVA 1A49A 4PBEA 2PU1A 2V2CA 4LXFA 4S1FA 2OMAA 2QJNA 3BAXA 4MWAC 3W00A 3L5AA 1K03A 3C61A 4Z1BA 1TV4A 3B8WA 4JOMA 4K8GA 1QT1A 4OV4A 2X1SA 5D02A 3AYRA 3WJYA 2PP1A 3HJZA 3H2AA 4XUGA 4DQWA 4XZIA 3D46A 1N2VA 3UYIA 4AHPA 4C6LA 1Y5XA 2IQ0A 3H22A 3TZNA 1UWIA 2OYMA 3M0MA 1LTDA 1OT1A 2ZRXA 3GVVA 4DBDA 4CVUA 5M1TA 4MIMA 3W2LA 3BUVA 4LPCA 1P1XA 3LLDA 1PJ9A 4C6QA 3GXTA 4AU0A 2WM0A 5XIAA 3LGEA 1V5XA 2E6DA 4J3ZA 4ZVJA 3H4WA 3N13A 4AD1A 4HK6A 1BTCA 4EANA 4QEEA 4LRSA 3S9ZA 2QCNA 3OGRA 1ICPA 4J5NA 3THAA 5IHRA 1GZJA 3DXIA 5C5YA 3S1VA 1QDSA 3PUDA 4PCTA 4N7QA 2NX9A 2ZYFA 2H8ZA 5IDIA 3E0LA 4KCWA 4NNAA 3CBWA 4WRHA 2ZA1A 3EX2A 5D2WA 1TPB1 1XLGA 3QKZA 1QK2A 4QHRA 4CD4A 1LORA 1I2OA 4NASA 5DEZA 4EWJA 1XSKA 3N4FA 1OIFA 2E6AA 4LS1A 4KFPA 3H70A 4LNCA 4JTFA 4UR7A 1EIXA 1B9ZA 1DHPA 2HZGA 2Z6IA 1JZ8A 1SSDA 4NJJA 1A53A 2EG8A 2PSNA 4CQ9A 3F2BA 4YIWA 1GYMA 1VCVA 3O9NA 1QOPA 3FHQA 1XIEA 3EB3A 2VC7A 3SUTA 1E43A 4FI4A 2PWEA 1S2CA 4P61A 1EA9C 5DMYA 4YTQA 1JDEA 1H11A 3VKJA 4DBEA 1O66A 4IJRA 3RRAA 4DN1A 3KBWA 2VGGA 1F76A 4HU0A 4UOJA 5AY7A 3MI3A 1W56A 4L5ZA 1RQHA 1W32A 2GJNA 4I9MA 3NOEA 4U5KA 1D8WA 3WLIA 3MSDA 4O0ZA 3B4YA 1JNDA 3G1AA 4U2YA 3PSVA 4CD8A 3NO5A 5DX7A 4RE3A 4ZZ9A 4PB5A 4PTDA 1D2KA 3LI0A 4ZXOA 1SFSA 3TN5A 3TTQA 5FF0A 3L5MA 4L1XA 2XFWA 1MQPA 1DJYA 3QFEA 3GHUA 1ZQ5A 2Y2WA 1J2WA 3IS4A 3VVGA 4AY7A 4EOUA 4UFMA 4FNTA 4GH3A 1V0KA 4DLMA 3VIKA 1K3UA 3UPMA 4O1DA 3PTKA 5F2MA 1FHVA 3UCQA 5B80A 3QMTA 5G2IA 1XINA 1VEPA 4F0KA 4JTUA 4IQJA 2F61A 1RH9A 3I3BA 2PGRA 3SN4A 3VNDA 1CLVA 1O60A 4ZOBA 2PWDA 1PVNA 1DBTA 1VFUA 5I3GA 3OA5A 3W6LA 5CSYA 3L67A 2ZZ5A 1S2AA 1NDVA 5JIPA 4IIDA 1CB7B 3EZ4A 4PTWA 1PZ0A 3W6MA 4HOWA 2DZBA 4RE2A 3NCOA 4MKNA 3QEZA 4DPPA 2CLIA 4YN5A 4OOUA 4JCLA 5AC5A 1QVBA 1QI5A 4Q4PA 1CGYA 4Z0JA 3B8UA 4GK8A 1DPMA 3I6RA 3PAJA 3M44A 4NHVA 4CNUA 3WFZA 3NG3A 4HNLA 2FPYA 1IXOA 2C6QA 3LQGA 2WVUA 4NZCA 4GQRA 3TYBA 2Y61A 3GXNA 2GDUA 4MDPA 3WQGA 1T40A 5AKQA 3UCDA 1ZCOA 1B30A 4MYXA 2WLYA 4QE4A 5G5IA 2V67A 1TA3A 1JI1A 5TNVA 2ZC1A 4Y2WA 1SMDA 4WCJA 2FTWA 1CGVA 2PU0A 1EO5A 3KTCA 1ZENA 3GAYA 4F0RA 4HOZA 4GJ1A 4A8LA 2VEGA 1MRQA 3AISA 4KRZA 2Z1XA 3N34A 3MP3A 1W3JA 3TFCA 2EXOA 2FTYA 1XC6A 1W31A 2QDGA 4DYJA 1QPQA 4MNKA 4IX2A 2JFEX 1HO1A 3N1AA 2YZRA 3H2EA 4ZO8A 3TQVA 4LSBA 2Z00A 3UVIA 4RPPA 1M3UA 2QCGA 4PCPA 3O07A 3W7PA 5AC4A 3S2NA 5IXEA 4HHPA 1QPRA 2OZ8A 1OX6A 1RQBA 3PZMA 5K9XA 5I3DA 3EKGA 1PKMA 3KWSA 1L9WA 3KW3A 1KBKA 3QSTA 2E3ZA 5G4EA 3TTYA 2YX0A 3W01A 1LYXA 5K3VA 3DAQA 4UFJA 1NWTA 1SYTA 4OVXA 1YKWA 3PBWA 1LZOA 2B7OA 6REQA 3H23A 3KL5A 3KHDA 3LPPA 1UMYA 5D2TA 5D04C 3MDUA 2YCEA 4RZ5A 4HBKA 3BL3A 3NEVA 1UR9A 3KLLA 2NZLA 3KRUA 4WDWA 1X8FA 4RZBA 4JIPA 1Q8JA 3MBFA 2YCLA 1J01A 1K02A 3VOGA 4DUXA 4Q7NA 4PRWA 3WLNA 1E1EA 1FWFC 3NIYA 3TDFA 2ICSA 1TFVA 1X7FA 3E3HA 3TSDA 3TK7A 3GDRA 1XIBA 2WNWA 1Z6KA 2WQPA 3BK0A 2CLOA 1F3XA 1HT6A 4ROQA 1REQB 3VNLA 2QLYA 2ZXQA 4WY0A 3KBSA 1SZGA 4OTKA 2QDDA 2V2HA 3JR2A 3SQMA 1RJQA 4Y96A 1EJVC 1Z3NA 3NQ8A 1OCNA 2QUNA 4X9SA 3G3MA 2DIJA 2REQA 5H2ZA 1H49A 3SCVA 1CECA 1SQ7A 4US5D 3S8HA 4HA3A 1OGGA 3T40A 3W1QA 5FSDC 1TR9A 1I1XA 3KVJA 4ZQOA 4NI3A 1Q63A 4NZ4A 1JD9A 5I3JA 2X0SA 1QO2A 4GY0A 3ZR5A 3VD3A 5E70A 5D4YA 3HGRA 3W25A 3NQFA 2XN2A 3KHJA 2HE8A 7ODCA 1JCMP 1S5TA 4GX8A 3BG9A 4FNPA 4FZIA 3TQPA 1TWSA 4LF1A 2DY3A 1JDAA 3CLMA 4M8UA 3ARVA 3FJ4A 3QRHA 4J2PA 2QJHA 4M56A 3MO7A 2DZVA 2XH7A 1EX1A 1GKQA 2JKPA 4L9YA 1VPXA 2PCQA 5A6MA 1U83A 1QW9A 4K1GA 3H7UA 3NGFA 4GUJA 4QDMA 4XZLX 4B5SA 3KTXA 1TJ2A 2GUUA 1R2TA 4O17A 1HL9A 3LRMA 1I0DA 2O7SA 3VKCA 1DTUA 1YDNA 1VFOA 1HX0A 4GC4A 3TJIA 4DUVA 2ZUMA 4AIEA 1KKOA 1H09A 1XLIA 1KGUA 4RLIA 4LW7A 3W7CA 4YCOA 1UD5A 1F3TA 2MANA 5FACA 2ZRYA 2NLYA 4MWAD 3ZVIA 4ZL1A 1XLCA 4NAFA 2WV8A 2QGYA 5BWAA 1F2JA 4DI8A 4GHRA 2G4FA 1GGOA 4NIRA 4YCPA 4PH6A 1XG3A 4C91A 4F0HA 3BICA 4KWVA 3UR8A 1A50A 5A8NA 2OU4A 2PTDA 4NY2A 2W79A 2QUTA 1XKYA 1PBGA 4CN4A 5K9DA 2QV5A 4PRRA 3CQJA 2YPIA 1RXOB 1UWUA 1R47A 2CZ5A 3U7BA 1AK5A 3S3GA 3P81A 3P5ZA 1WZLA 1JUKA 4YTUA 4XBSA 4F9JA 3FHAA 2IKJA 3YPIA 5A8PA 2R1NA 2XSXA 3PAOA 2ACUA 2OXNA 2W5FA 4Q4OA 4RE0A 3ARQA 4UCGA 3W2KA 3TV8A 2EPHA 4PTMA 1W3LA 4A05A 3CUFA 4GCXA 1EC7A 3UZYA 1NDYA 2H90A 1FTXA 1RLCL 3BJSA 3EMQA 5H8PA 4ECLA 3UR7A 4D8ZA 4HMNA 3N6HA 5DF0A 3W83A 2PB1A 1E72M 2YL6A 1VCGA 2AKMA 3CU2A 4UQEA 5IFTA 2HBVA 3VNJA 6XIMA 1U22A 5M03A 4LT9A 1BWKA 1A5LC 1VH7A 2WJEA 2C91A 4D1IA 3LCFA 3VMNA 1IEQA 3BANA 5DLCA 1XUZA 3RX3A 2OVLA 3APGA 2D23A 4YTSA 3HV9A 3GNRA 1VFTA 1N8IA 1Q6QA 2PTZA 3OJGA 4Z17A 1LRNA 3E5BA 5CPMA 1UC4A 1FWSA 1UR1A 4HSOA 3EDEA 3G0XA 2EPLX 1LRTA 1TUXA 3IGUA 3UG4A 1FHUA 1ZLPA 2BY1A 4AD2A 1PEZA 1Q6GA 3VMOA 1UUQA 1W54A 3C3UA 2ASHA 3UWEA 1R3TA 2HISA 1FXPA 3OG3A 4DAIA 1PCWA 4GE8A 2NQZA 2NXGA 3CO8A 3NQGA 3CJPA 1HN1A 4B91A 4GNKB 3RYSA 3ZWTA 3GK0A 4GUGA 1TJ1A 3UBPC 3RMJA 1A5MC 4H2CA 1M65A 4BI5A 1SJAA 1V6VA 3S0CA 3AMGA 1CGWA 1DJQA 3SN1A 1UWRA 2CERA 3W72A 4XD4A 4I5XA 1A5CA 4FX6M 3W3OA 3Q45A 2VX7A 2R1LA 1JDCA 3NQVA 4RKAA 4O1FA 3GG1A 3N3TA 3H2FA 3AIVA 1V3IA 4XD6A 1XIGA 3PM6A 4NSBA 4B5NA 4INFA 4PB3A 4XV0A 3GIPA 3W7EA 2PWGA 2HJPA 2TODA 4RR4A 2A2IA 3WIJA 3SAZA 3UXAA 3GHTA 4DZ5A 1BGAA 1R3SA 3W7QA 1SR0A 4KEUA 4V1XA 3PUGA 3W1TA 1M03A 3VIFA 1GJUA 4DB7A 4ZODA 2BSLA 2E6YA 3CT7A 2OYKA 2QPUA 1WPCA 1FWEC 4O12A 4OBRA 4V33A 3MT1A 3T0CA 4BI6A 2IQTA 4EPDC 1V3JA 4JQAA 1K4GA 2G0WA 4TVDA 3DX5A 1I60A 3LQLA 3OVRA 3UGVA 4JBRA 2QNEA 2WZMA 4IMCA 1WBJA 2A1YA 2Y7FA 1KQYA 2VCCA 1ZCCA 4PMYA 2GVYA 5A6BD 3HB9A 1CXLA 1JPIA 4I8DA 2BFGA 4HCDA 4AXKA 2OSWA 1KGWA 4BWLA 4IUGA 3MSRA 3W07A 3PB2A 3BDKA 3TYDA 5CSUA 4F2UA 4JN8A 2QXWA 3VTRA 3E0FA 4FPSA 4WXZA 1G69A 5E0FA 1FWRA 4ZSUA 4I6KA 3SJ3A 3QPZA 5AN7A 4XVEA 2I56A 4D9PA 2WSKA 4ES4A 3GIQA 2H6RA 3O16A 4JEJA 4CU7A 4KCTA 1M04A 4QX4A 1B4EA 3R11A 3BLEA 3MWAA 5JBEA 3UFYA 1Q4WA 4A29A 1JAEA 1Q6OA 1OINA 3RNDA 4LS0A 3TW6A 3KVMA 3KZSA 3WKZA 5K2ZA 1WKYA 3MJMA 2VZTA 4IF2A 1E6QM 4ZA0A 3WY1A 3VX0A 2JIWA 2ZTJA 5F7UA 3TAOA 3AWNA 4YHEA 1A0DA 3G8EA 2V5DA 3KVKA 4H8VA 1SJDA 4ZMGA 1EDQA 3I3EA 5C7VA 2V63A 2BB0A 4WDTA 4R9OA 3GW3A 4YTTA 4W5UA 2FH8A 5H1WA 2VYOA 4MY8A 3VNMA 1CXIA 1QJWA 2OX4A 4PMRA 3B0YA 5D9NA 2V69A 5HQMA 1H7PA 2NSOA 2BZNA 4TTGA 2BG5A 1X6LA 3W2JA 4OZOA 4R7JA 3MCOA 1SZEA 1TZ9A 1CX9A 1QXLA 1H1YA 3U5YA 6XIAA 4CQAA 3TQKA 4OJYA 1FP9A 1VKFA 1PL9A 5HWNA 2ZDRA 2O4MA 3GR8A 2OELA 1JCNA 1A0EA 4MM1A 1NWRA 5LIWX 1E6PA 3VGHA 3CIWA 3VDGA 3VINA 3ONCA 4H8NA 4KFOA 4I6VA 2ALDA 2CHRA 1UUOA 2NT1A 1E6RA 4PEEA 3M7SA 4TTUA 3ITTA 3W70A 4GQGA 1QHPA 2WNQA 4S3JA 3IVSA 4M1BA 1MFVA 4M19A 4HNCA 4UTFA 3RG6A 2WK2A 1SW7A 1C7SA 2OEMA 1FWDC 1PWMA 1Q8AA 4WUIA 4H7CA 5C0QA 5AYBA 1A5UA 2V5LA 2DIKA 3R10A 2YCIX 2NX1A 3A23A 3BH4A 4GMEA 1VEOA 1P7TB 3ARRA 4H04A 4GYKA 1V0NA 3J7HA 1ZBVA 1GZ1A 1XBYA 4H41A 3WENA 3W7IA 1H7XA 5A6TC 3CAKA 2YDRA 2YR1A 3CHCA 4M51A 4C65A 4IICA 3W76A 5IDZA 4AAJA 3RILA 1P5BA 1YLVA 3RGTA 4B5WA 4HMEA 4FIRA 1HW6A 3QH2A 2VJXA 3ZM8A 1WKDA 1T99A 3B0VC 1JG9A 3EWXA 4DO7A 1J0YA 3W84A 1MZHA 2DZWA 4HKPA 3IV8A 3T09A 3OLEA 3CO4A 1JCYA 4JTSA 3MMDA 2Z1BA 5H6HA 4FS9A 3QJAA 1Y8BA 1W9XA 3R4IA 4P7OA 1XYCA 4JIIX 3WQCA 1DWHM 1KM3A 2FB2A 2VQUA 2ATMA 4F0LA 1DHKA 4WOZA 5BYWA 5CEWA 4P5UA 4E2OA 3RM4A 5C9XA 3TR9A 1GHRA 3QZ6A 3N17A 2P50A 3A9BA 4C6CA 4EACA 3V18A 2J8GA 2GVGA 5C7HA 3W1XA 3WF0A 4H00A 4WXYA 3W88A 2DZSA 2HBXA 3VFCA 3GUGA 3BLDA 1J8VA 2GGJA 3ES7A 2OGYA 3LTYA 4N4QA 1ZJBA 4HK5A 1AH0A 4ZOEA 2WOQA 2E9LA 3L4ZA 4GI6A 2IKGA 1V0MA 5D37A 4JKMA 1BSLA 4JDYA 2QUUA 1BYCA 3HOJA 5FJUA 3P7YA 8CGTA 4FX8A 5JBDA 2WYSA 2Z2BA 4NVTA 3R25A 2QMJA 3M6YA 3GFXA 3AU6A 2Y5SA 4IIGA 3FW6A 1LF1A 4P8WA 4N9BA 1KTNA 1XIIA 1Q2SA 3NA8A 3S47A 2A85A 3LK6A 4HD5A 5K7JA 2X1IA 1V7AA 4MJ2A 2IKHA 5FCZA 3DFPA 3OG2A 3ZLFA 3B0XA 4M1RA 4G56A 2YA1A 1RLDA 5CC6A 3VIGA 1L8NA 3SY1A 2FHBA 4C1NA 5LHFA 3GR4A 5AC8A 1UHVA 2IPGA 1CLKA 4UFHA 4PMOA 4DJEA 1U5VA 3UXLA 1V08A 4FNQA 1REQA 1W9PA 3IJ8A 1HFBA 2XWEA 3CHDA 2BHYA 1H0GA 5C2XA 2PDHA 3VGGA 2IMRA 2FTPA 3NPUA 1ZNNA 4U3AA 2UBPC 3NNTA 1EPXA 1LT8A 1ZJHA 3SI9A 4Q6XA 3CUGA 4JX6A 3KBJA 2VRJA 4YVPA 3ZWSA 4MJMA 4S3GA 1UYQA 2Z1KA 3OYXA 1DE6A 1ZJIA 4MWAB 2BVYA 1NELA 1DXEA 1DJGA 4ZQNA 4KQNA 4IXXA 1WXJA 2Z28A 2CZDA 3WF4A 4K38A 3ERPA 1ISWA 1KV8A 1OC5A 2P10A 3QQWA 4C5YA 1ISZA 3W1MA 1C3FA 3WBYA 3IEBA 3VCNA 5EU9A 1UD6A 3G1SA 1PTDA 4HPHA 5K4ZA 1RK5A 2RGMA 4V28A 3SCSA 4YYCA 1FWJC 2WNZA 1M7XA 3IAQA 4MZ1A 1TREA 4Z2LA 2ZZ1A 3W1UA 4EX4A 4TO8A 2VVSA 3W1RA 3ALFA 2QCLA 3CYJA 3Q2DA 2I17A 1VRDA 4ZO6A 2J13A 2X2YA 5KZDA 3MW7A 4XZ9A 5M17A 2JGQA 3DESA 3OYZA 1AQ0A 3CAWA 2HS6A 1N82A 1JCLA 3VGEA 1Y0EA 1E56A 1AH4A 4GQ0A 4GIAA 4RJEA 3GNOA 4NAEB 4B5VA 3OLGA 1Q3NA 1XYZA 2F84A 5F1UA 2YFNA 4AY1A 4BY3A 4WF7A 2RUSA 3K4AA 1MNZA 1KXTA 3E1F1 2TRSA 3UF9A 3F4DA 3UZJA 4ORMA 4W85A 3RX4A 3MHUA 1B1YA 1FWHC 1G5AA 3B8DA 1R2SA 7TIMA 5SWUA 1EJRC 4ZFMA 2IXVA 1PHWA 3FSTA 3OZPA 4GFIA 3U0HA 3SCPA 4GPNA 2CNCA 4GVHA 3RCMA 1HKWA 3C2YA 4NQ1A 1ECQA 3QR0A 2O9PA 1OF6A 4QAWA 1S3TC 1RPKA 4GYPA 1OADA 4L9ZA 4PC8A 1H7NA 4PMDA 4H01A 1HJXA 1CXEA 2ZA3A 4FA3A 1W1PA 2DUZA 4ERAA 2NUYA 3R94A 1KRBC 4GG9A 2YYTA 3MUAA 2FJKA 4KIEA 3GNNA 2B0MA 5D8WA 5T9BG 2GOKA 1FX6A 2V2DA 3SJNA 1M7JA 4RX0A 1VJSA 3LPFA 1OK6A 3JZUA 4B90A 3CEPA 3MS8A 3STPA 3NEHA 1I4NA 2OOFA 5T9CE 2D0HA 4GZ7A 2WMJA 1NDZA 1PUDA 1Q6FA 4QP0A 3W2NA 4MB1A 5EBAA 3QBUA 1TTPA 4ZOAA 1JPHA 4GA8A 3GBDA 5GJMA 1X97A 4H6KA 2X30A 3VC6A 5J5RA 3VKAA 1E1CA 1VR6A 4YMZA 3FOKA 4AWEA 1OGSA 4XVDA 4RK8A 4FOKA 4AG0A 2PDBA 2FDSA 1Y7VA 3GVRA 3N9KA 3VU2A 3WUBA 3NZPA 1HL2A 3PPGA 4QQ3A 5ECUA 2E8ZA 2PDKA 4KF1A 2VR4A 1U1HA 3KRBA 3I6TA 4L6DA 2BVWA 1U1UA 2Q71A 4QITA 1D8CA 1XM3A 4W8BA 3WJXA 2J7GA 3KM8A 2W3ZA 5A69A 3QXBA 4AD4A 1TWIA 1BAGA 1MSSA 3ITYA 4XZBA 1TJRA 4L4MA 2V5BA 1VYPX 4AZCB 3BMWA 3ZLGA 4P8XA 3OZYA 3ITCA 4YWIA 5CCZA 1Q7ZA 1AD1A 4EWND 4OQVA 2X7VA 4HHMA 3ZYZA 2BY0A 2W66A 1OIMA 4R88A 3HV8A 1AJZA 3IUDA 1FCQA 1EJTC 3I10A 5FL0A 1WV2A 4JZ5A 4JTKA 4F40A 2F7FA 3QKEA 3DOPA 1SO3A 2XVKA 3G1FA 2OPJA 3E12A 3SSJA 4CN1A 4PSRA 4HJFA 1IGWA 3GG7A 4AVOA 3DERA 2QZRA 2Y89A 4DM1A 3W29A 4J9JA 1C8QA 2X40A 3A47A 4B5UA 3TC3A 1LM1A 2FPTA 3P80A 3BSHA 3STGA 2WSPA 1DVJA 5BU9A 1Q6CA 5DFAA 3K2GA 1BLIA 2G3FA 1YBQA 1HKJA 3C2RA 3CV7A 4F0MA 1XX1A 2O7QA 1Z8AA 3M7WA 2IPJA 4PTNA 4F9DA 1E6NA 4LTSA 3EWBX 9CGTA 3ITOA 2DZXA 4P8VA 4HMCA 2TAAA 4BWLC 3UZXA 3VMPA 3R89A 3MA8A 3CHFA 3MPGA 2PLJA 2QR6A 1V93A 5EMKA 2A0NA 1P43A 2XM2A 2P53A 3CV2A 2PC4A 1QWKA 4JQ2A 4OU1A 2HK1A 3UXKA 1XBZA 1JZ4A 4C1LA 4IFRA 1DKWA 2WZIA 1R38A 3TXVA 3WQPA 3PZQA 2DZPA 4KFNA 4QSHA 4Y8EA 2VDIA 4RCXA 4ADTA 3P93A 2PAJA 4UBPC 2E40A 4UMBA 5CPOA 1A5OC 3VD5A 2D0FA 1SJBA 3F5JA 4JNMA 4K7YA 1K4HA 5FJTA 2J6XA 4D6IA 3VZZA 1VFSA 1W3IA 3TOYA 4FB7A 2JF6A 3CS2A 4S3EA 2JEPA 2J66A 4GLEA 3GC2A 2WMIB 3VUSA 5LNRA 5ABFA 2BS9A 1GK8A 4DPQA 4ZTXA 1WAUA 4J3SA 1L0PA 1TPVA 4MLJA 4HPJA 3AC0A 1HNYA 4IPIA 3LS9A 1F6PA 3EB4A 1ZBCA 3SUUA 1DYSA 3GXMA 3NO3A 2ZVIA 3B9OA 3T4WA 1SZFA 2BHUA 2X1RA 1UD3A 5RUBA 1XPGA 5AYYA 4LANA 3DHDA 2V3DA 1BPLB 2HVOA 3W24A 4OBTA 3WUGA 1BG4A 1VF8A 1PIFA 4HNTA 4KESA 3HN3A 2I14A 1YXDA 5E0CA 1K70A 4RUBA 2H3BA 3AOFA 1JCXA 4H1ZA 4GIEA 4CGTA 2OG9A 3HQ1A 3QF0A 2PTYA 7TAAA 3PZTA 4PCSA 5CJNA 5M2FX 5AHEA 2V38A 4H3DA 4JTIA 3UJRA 4JTLA 4AWUA 3GTXA 1MEWA 4W86A 1JL8A 3UJSA 3RXZA 2WSRA 2ZUSA 3CMGA 1EC9A 5JH1A 3ABSA 2C16A 4PN2A 4H9UA 3GU9A 5JBFA 3WNNA 2ZZ3A 3RCNA 3C52A 1NF7A 3TP4A 2J4GA 5I03A 1FCUA 4A8RA 4NYUA 3H12A 2VGIA 4CNNA 1HVQA 3USBA 5IBXA 1LUCA 3NTYA 1FWBC 4I90A 3OZOA 8TIMA 1ZS2A 3N6JA 1E9LA 3H21A 2I16A 3H4XA 4RZ6A 5LSMA 4UMAA 5EFDA 1O6IA 3TC6A 1XIJA 3MBDA 4MY9A 2NV1A 4QM1A 1BVZA 3FAXA 3T9PA 3ZOAA 2XIJA 3XINA 1UWSA 4MB5A 1DORA 2XVLA 5CLTA 4LS2A 1GKRA 4CNPA 2PGEA 4GQBA 2VOMA 3G1VA 2NXIA 3EDKA 3WSUA 1W1YA 3KXQA 2XTKA 4DJFA 1VP5A 1XRFA 1C9WA 2JK2A 3WK2A 1MFUA 1EHNA 1HQTA 3PF3A 3LXCA 3BZGA 1O4UA 3LGDA 3GFYA 3N2TA 3ZVHB 4IG2A 1TPC1 3CPGA 4MNLA 3HPSA 3EMCA 4HU4A 3V5OA 4O16A 4UFIA 1U2YA 2Z24A 1XGZA 1AW1A 4GD0A 3HZ3A 3O1NA 4IQLA 1P1MA 3FFSA 1YDVA 3GYEA 4B2DD 1UASA 4AZHA 4R7OA 4I7VA 2OOGA 4C6MA 5FJOA 4KGLA 1GG1A 1TJPA 1VFLA 3GVQA 1EGMA 3OW1A 4JL1A 1IT8A 1QNQA 3WFAA 1R7AA 2UZ9A 4BCEA 2ISSA 4FOJA 3TC7A 5D05A 3CWHA 3MP5A 5D2XA 4Z2JA 4KCVA 3CXOA 3NURA 3W87A 2DT1A 4D71A 4Q6JA 2NQJA 1AMYA 1NJJA 4WJXA 4AC7C 2XSBA 3D5HA 3W7LA 4LAOA 2V5KA 2X8RA 2CPUA 3VGBA 3G6MA 1D9EA 3PZ9A 3WG6A 4IL0A 1YTKA 5G4WA 1PIIA 1KM6A 3M9YA 3ZXWA 1ZFJA 2ZWYA 5DELA 2GL5A 5HR7A 4K8EA 1LL6A 2GGIA 4GJJA 2V3EA 3KAOA 3LCXA 4P7QA 5HMDA 1QUMA 3AHZA