1JPKA

Gly156asp mutant of human urod, human uroporphyrinogen iii decarboxylase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFADAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROPORPHYRINOGEN DECARBOXYLASE
publication title Functional consequences of naturally occurring mutations in human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 126
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1jpkA00
2INFA 4L5ZA 4WSHA 3GW0A 1J93A 4L64A 3RPDA 1R3QA 4L6OA 2NQ5A 3GVWA 2Q6ZA 4L6HA 3GVRA 1R3TA 1U1UA 1JPHA 3CYVA 2Q71A 1U1JA 1R3WA 3GVVA 3GVQA 3BQ6A 4L61A 3L7RA 1UROA 4L65A 1R3SA 1JPIA 3BQ5A 2EJAA 1U22A 4AY7A 1YPXA 3PPCA 4ZR8A 3GW3A 4AY8A 1XR2A 1T7LA 1JPKA 1R3RA 4ZTXA 1XDJA 1XPGA 4QQUA 4EXQA 4ZTYA 3PPHA 1R3VA 1U1HA 3PPFA 3T0CA 1R3YA 3PPGA
chains in the Genus database with same CATH superfamily
1QPRA 4AY1A 4IGSA 2PMQA 2XSBA 1GEHA 1FH7A 4GQQA 4Q4SA 3IWPA 4CNOA 1IZCA 5E6YA 1XLAA 3K30A 4UTIA 3G1YA 4NILA 3AALA 1CGVA 5FOOA 4D72A 2D2OA 4JHMA 3UP8A 1M6JA 4PMVA 3U8GA 2QJNA 5LNUA 3KTSA 1AMYA 3BCJA 2EEXA 5C8BB 2A6NA 4ZVJA 5GJMA 3DFOA 4A8IA 3C56A 3LNPA 2ZE0A 3GTXA 2ZUNA 3TA6A 4F0RA 3W1PA 1KM2A 5LHFA 1PTGA 1KXVA 3E2RA 4MKVA 1Z41A 1R3TA 3OVPA 1WA3A 3KTXA 3N9SA 1V08A 3GXDA 3HGOA 3T78A 1V7AA 2YXGA 2YL9A 3WQFA 2VM8A 4UQDA 3G2GA 4PCSA 1EHAA 1FHLA 3TTEA 2WLYA 2Z1SA 3MBDA 8XIAA 3G1XA 5XIMA 3UWZA 3IARA 1ME7A 1FDYA 4UFHA 1D3CA 2Y62A 1VHNA 4F2BA 1UWUA 3GVVA 1B4KA 2EPLX 1TZ9A 3S2LA 3WF3A 1OX6A 3PHAA 3W0KA 4IHCA 3UXDA 4E2OA 3U48A 3TWBA 4TMBA 3SO7A 4Y7EA 1J5SA 1V0MA 2GGIA 4ACZB 3L5MA 3CMFA 4XD4A 1VBRA 1R7OA 4IL0A 1LZOA 2WM1A 4LNCA 1W2VA 1WP6A 4IMEA 5E9XA 1P6WA 2AGKA 3NDYA 4AHPA 1WKDA 2HVOA 4RK8A 1UZDA 3VNMA 2EG6A 5HWMA 1WYIA 5D2TA 1MW2A 1AZ1A 3D47A 2BG5A 2XIBA 1MZRA 1ZAJA 4LUSA 4FO4A 4JTKA 4Z1AA 1YTKA 4XBSA 4URIA 1DJHA 3VCNA 1YDYA 3A9IA 4XUGA 2HEJA 1RCXB 1XDMA 3R1ZA 4S1FA 4V33A 3HG5A 4FX6M 2ZIDA 3N2TA 2H90A 5CZSA 1YLVA 4LAOA 1ZBWA 3ONBA 3PWIA 2QQ6A 4GKLA 5BMWA 1RXOB 4MJ4A 3WN6A 4A05A 1JF5A 4OGZA 2Q8XA 2BOFX 4ZOCA 1RJPA 2NSXA 5TAOA 1PKLA 1XSIA 1UR9A 4NKCA 4IPPA 1Y8BA 3VZXA 4GLEA 5FD0A 4AFYA 7A3HA 4F0HA 4GIYA 2DVXA 3BLOA 4E3TA 5TQLA 4P5UA 5FEXA 1FXQA 4GK8A 5IHRA 3LU2A 4WSJA 4RLIA 3L4ZA 3MVIA 3P0XA 4IIHA 1EJWC 2ZX6A 5C70A 2NVAA 3A3XA 3AXHA 3QN3A 3A3WA 3BANA 1TPWA 2QVNA 4GI8A 4ZO8A 2ZZ3A 1SMAA 3EPMA 1KRMA 3RJXA 3H24A 5H1WA 3LV5A 4FX7A 3LBOA 1JF6A 2ZZ4A 3W81A 1Q6DA 2PWUA 2F6KA 3BL3A 4PBGA 4DWSD 1OCQA 2ZICA 1V3KA 3CT7A 4I6VA 1GHRA 3S5ZA 1GOKA 4JD4A 2QVHA 2OX1A 1QHPA 3MSYA 2E0PA 5DMMA 5D33A 3UY8A 2QV5A 4NSBA 1P6CA 1E0UA 4QEEA 5JBFA 3GXFA 3KOZA 3E49A 4IH3A 4IIBA 1F3WA 3E6EA 2WKLA 3TYBA 4UTTC 2G3IA 4EXAA 2YA0A 1CNVA 2HBXA 3PS7A 4QDMA 4QITA 2JFEX 3NCOA 2XU2A 3WFAA 1MO0A 5A95A 3M64A 2Z29A 2FZNA 4LC6A 3RMEA 3U5YA 1Q85A 1Q13A 4HZ8A 1E6PA 3AYRA 4OHQA 1RR2A 3VIOA 3JRKA 1PE1A 1UWRA 4GX8A 4HNVA 3LN3A 3M6YA 3TFXA 2RH9A 4TR9A 3S1WA 4I90A 1C9WA 2D0FA 3F1QA 5CLTA 4C6OA 2BY0A 2F7FA 3LB0A 3HBLA 4HU0A 1VCVA 1B54A 1PX4A 1EWDA 5C7VA 4GIEA 3OP2A 3CM4A 1W9UA 5MKGA 1CGYA 1R9ZA 3VKBA 1UD5A 1V77A 5CC5A 1F5ZA 3E0LA 2XZ7A 3GUGA 3ITYA 4WDUA 2PWVA 3M9YA 3WQDA 1ISVA 5CZJA 3GKFA 1KCZA 4DQWA 3P74A 3NO5A 3EOLA 1W32A 2BB0A 2DIJA 4MY1A 3TTSA 2KX9A 1ECEA 3PJTA 1PDZA 3OW1A 4AU0A 2ISSA 2V5JA 2CLMA 2Z2UA 4LTSA 1IEVA 1NVMA 1XC6A 3CZEA 1DHPA 2Y7GA 1B3WA 3KLKA 1Z6KA 2GSJA 4PSRA 2ISDA 5IBXA 1FWAC 4XV0A 4AUBA 3PJWA 1KV5A 2CITA 3D46A 3B9DA 4D6EA 1DV7A 5D2YA 6REQB 3GH5A 1S39A 4BQ3A 4C6KA 5A94A 3KDOA 1VLWA 1W9BM 4GZJA 4HIBA 4MJMA 1OEPA 1UOZA 1UW9A 3RFAA 1CB2A 3M7WA 4AX7A 3LDVA 1NIUA 4EWJA 4PB4A 1I1XA 3V5OA 1XICA 2WJZA 4QS5A 4YVPA 3VNDA 4EXBA 4HCDA 2CZEA 1L6WA 6ENLA 3OQEA 4GQRA 3A23A 5ABFA 1UASA 3W2NA 5FEZA 3NZ1A 5CAKA 5HUPA 4O12A 1JZ7A 1XCXA 2GPTA 2UWFA 1J8VA 2DEPA 2GDUA 2PZNA 3VD4A 1WV2A 4IT1A 3SQSA 3AU2A 5LKYA 4FF7A 3DHFA 5JBEA 3SRHA 3O16A 4GINA 5E5CA 4LYRA 4Q4KA 4N6EA 1UCWA 1IR1A 5CZKA 1DWAM 1VBHA 2Y7EA 3RU8X 2Y85A 3L23A 4LYPA 1EUAA 3CS2A 3RF9A 4J9JA 2DZBA 4LRSA 1XGDA 4H7CA 5EKYA 1CENA 3ZZ1A 3M0IA 2CERA 1MQPA 1NEYA 3B03A 2XPKA 1XLKA 1WDPA 3TC6A 3O9NA 1W5QA 3MO7A 2OG9A 2OYKA 3S5NA 2CKSA 3G1RA 3NDOA 1K4GA 5RUBA 2W4XA 2AKZA 1P0BA 3WO8A 3ZMRA 2QW5A 4UTKA 2FDMA 2PDIA 1WBJA 3QW4B 3VIPA 1OFEA 3KL5A 1PWMA 1DWGM 3HZ3A 2CLHA 3P93A 3SCUA 1R7AA 3PZGA 1GQJA 3ZFHA 4B15A 3LPOA 4MUPA 1E15A 4WJEA 4QDWA 4KS0A 3BUVA 1X7FA 1X1ZA 2VEIA 3LGEA 5FF7A 3NSMA 4W86A 1FHUA 1Q6EA 3N13A 3P8IA 3R58A 4QM1A 2W27A 1IXPA 2Z4GA 4LAUA 3V0SA 3AROA 4L6DA 2P0IA 4PUMA 5I78A 4J3ZA 3PUOA 4N02A 1DIDA 2XM1A 4AVNA 5A69A 4Q4OA 4DWSA 1XLBA 1DWHM 4QX4A 1LCOA 1PXGA 3M07A 1UMLA 2QDGA 9XIMA 4US5D 4GNVA 2W6RA 1DP0A 4M6PA 3QY7A 2HS8A 3PTMA 4LUJA 4MWAC 3HOJA 3LLDA 2WYSA 3E0VA 4ERIA 1R6WA 3WSUA 3KW3A 1G67A 1E5NA 4CU6A 3NG3A 3ABXA 5FF3A 3EOOA 4GYJA 1PO9A 2PA6A 5AC5A 2CLFA 3MUAA 1ZLPA 1X8CA 1PKMA 4B90A 2XISA 4ADSA 4AZIA 3SM0A 3EB4A 3GG8A 3KBSA 1Q6CA 2E1WA 1F2JA 4BI5A 1V6TA 1K4HA 1UG6A 5HAOA 3T6CA 4KEMA 5LIYX 3GNXA 1CIUA 1CXLA 3W71A 2JF6A 4NZJA 4MYXA 3WLNA 4W9TA 1KKOA 4DAIA 2KZHA 2PURA 4GKTA 1POJA 3S1UA 5HANA 3KOXA 2WSKA 3D3FA 3KXQA 4Q8MA 3H8AA 2YYTA 3POCA 3SCVA 2GFTA 4S3AA 2Y6ZA 3GM8A 5EMYA 2GGJA 2Z7KA 3IPWA 3OZMA 4Q8QA 1RA5A 4UBPC 4GCXA 1BSLA 2E5BA 1C8VA 4YWSA 2WW5A 3ECQA 1OYAA 3QEZA 1HJQA 3MC5A 3HG4A 3GC5A 1H0IA 3AIBA 3T0CA 2VL4A 2CESA 1UQZA 1W8SA 3SIMA 1WZKA 2I5IA 3HFTA 1UKTA 4YTRA 4GVIA 1NOFA 2J8FA 4GA8A 1HKMA 3S9IA 1UKPA 2XSAA 1VCFA 1GORA 1PJ9A 5DY2A 3STGA 4E8DA 3B8DA 5FA5A 3GG1A 4JN6A 3NPXA 4JTCA 4AY8A 1RZMA 2Y5JA 3TC7A 2RDXA 5MF5A 5C0QA 4PC8A 2DSVA 1B0IA 2QKFA 2BVDA 4REQB 1UUOA 1TREA 4FR6A 3VAVA 2BHZA 3W75A 5LIUX 4CD6A 3AOFA 2HCVA 4LJ3A 1OX5A 1H1ZA 1XGEA 3AXIA 2XSXA 1HNYA 4KBXA 2IKGA 1UKOA 5CKSA 1WXYA 5FJUA 1UB3A 3AC0A 4ZOEA 5LIKX 2BHYA 3AI0A 4JIQA 2FPVA 1NJJA 2DZVA 3VGBA 4PTNA 3LI1A 3UERA 3QH2A 4DO5A 3VE7A 4PUNA 3N17A 1AL8A 2XDFA 1S3HA 4JAWA 4IFRA 4HPGA 5AECA 4NNAA 2Y7FA 3LMZA 2PP0A 4OKDA 1YPXA 3CV6A 4HHHA 4QLLA 1LQ2A 3IGXA 1ZZMA 1BSIA 4JL2A 4JNYA 4EXQA 2FB3A 3NQAA 5I3JA 3KRUA 3HU7A 3THDA 5CH9A 5LNVA 1QNRA 1TPB1 3W7CA 5BWAA 2OQLA 2BMBA 2XVNA 2P10A 3GX9A 2OEKA 3W37A 2YXOA 2B7OA 3RCYA 4S3EA 1HZYA 1KBLA 1P0NA 4RX0A 5G1YA 1XSJA 3UG8A 3QGAC 4YTQA 3UG5A 5C54A 2Y2WA 2CBVA 2J7HA 4ACYA 3T8LA 1QK2A 1AUSL 3MA8A 4FOKA 3AS0A 4F0SA 1SO3A 4I3GA 3P5ZA 3VD9A 2PWHA 3WLQA 2FVMA 3K4AA 1ZJAA 5CPQA 2R1MA 4M6UA 1M7XA 4LRTA 4US5A 5ECVA 4F40A 3BAJA 5I3GA 3B4UA 4US6A 3BCFA 1DJIA 1L6GA 2QGHA 3PM6A 4XZMX 3V1HA 3PUGA 4BFAA 1J0IA 2OKTA 4MZ1A 4CD7A 1F8IA 4LNYA 1SO4A 1TCDA 3MTWA 3QV8A 5KINA 4PFMA 2RKXA 1KFWA 1KBKA 2YW4A 4NYYA 2A3AA 3ICJA 5EY5A 1C8YA 3ZWSA 3OLEA 1T40A 3ITLA 3NA8A 5AHMA 1Q5MA 3TCSA 2O7QA 3AJ7A 3WBEA 3VIJA 3VGFA 3WLHA 1HL9A 2VOMA 5D32A 2BODX 2VI0A 2DZWA 3D5HA 2P3ZA 4GBDA 4DJED 2X16A 3WLTA 2FYMA 1VFMA 2GSEA 4Y9MA 1QUMA 4K38A 3FW6A 3HMCA 3MU7A 3UJFA 4BZYA 1YMYA 4D8AA 3MHFA 1XRSA 1IZKA 2OXNA 1YIXA 1K9TA 1FA2A 1MVYA 2EQDA 3G3DA 1ONRA 2BXYA 1A4MA 3WJZA 3M4HA 1KC7A 3WQWA 4RPQA 4NI8A 1HL8A 1QAPA 3QHNA 4HKPA 2WZMA 3E74A 3WLLA 1J0YA 1W1IE 4QE5A 3AMGA 1A3WA 4PMXA 3UZYA 4DELA 4NG3A 1BD0A 3RLUA 2OO6A 4U2ZA 1IT8A 3EGJA 2GUBA 2GK1A 4Z1YA 4C5YA 3HURA 3VILA 4JCLA 1KFBA 2XJ7A 4KRTA 3XINA 3OJGA 3IVUA 1Y0EA 1XR2A 4MAVA 4L1XA 4CQ8A 2INEA 3I4KA 3VM7A 3UG3A 3UG4A 1ME9A 4JNMA 4O53A 2RAGA 4GY1A 3LYEA 1XYLA 2I56A 3ENLA 4AVOA 2BVYA 4C60A 3TSBA 4D6IA 3QV7A 1LQAA 1U33A 4D8LA 3ARSA 3O2LA 2WJDA 4IFKA 3WDHA 5AYIA 3GXTA 1HKIA 2VWSA 4ZO6A 4QP0A 1MFVA 4CQDA 3QLDA 4AIBA 2GVLA 1E1EA 4MB1A 3LPGA 3BGGA 1P48A 1H7RA 3PG8A 4FLSA 3TK7A 3VU2A 4S23A 5B80A 3CZ8A 2ADAA 3DAQA 3GW3A 3W84A 5A6MA 3LD5A 2I14A 5DMYA 3L4UA 2HZGA 1RHCA 2QCNA 3OEXA 1QHOA 1XIEA 3AHTA 3FAXA 4JHOA 2DDXA 1XRTA 2YCLA 3W27A 4WCJA 2GDVA 4ZENA 4GI9A 2B31A 2UY4A 4JTFA 2XWDA 5BW6A 1W1PA 3H55A 4O28A 4D8ZA 4C1NB 3JR2A 1LOLA 4Y2WA 3CAVA 1BYCA 4S38A 3SY1A 2JEQA 3S6OA 3MCMA 4F66A 1NY1A 4RXGA 4AD0A 3EZ4A 5EA9A 3VC6A 3T09A 1GYLA 4AF0A 3DKJA 4O16A 2E6FA 1GKPA 2G3JA 4HPHA 1NTHA 2VDHA 2AAAA 4MJZA 1Z9AA 2ZZ5A 4FIRA 4PZVA 4PTDA 1BGAA 1XKYA 3WH7A 4IZGA 1OF6A 1VEMA 3VIHA 3W25A 1CX9A 2PTDA 1XUUA 1UP3A 5M03A 2RGLA 1DJXA 1P0KA 3CQIA 2YLLA 2ZRZA 2J24A 1S2UA 1DBTA 1NWRA 5DMNA 3IANA 2Y0FA 3LM7A 1AJ0A 3BLKA 3GXMA 7REQB 1G7UA 1A5LC 1GPWA 3NQ8A 1FWCC 1E0TA 3MYOA 2BY3A 3LX9A 2Y4SA 4IQDA 3SIZA 1OFBA 4P7NA 3NEHA 3LCFA 3B06A 4H1ZA 3OIXA 3RLHA 3S6DA 1CPUA 5DCDA 5HMEA 1UMYA 1DIOA 1YDOA 2VGGA 2XIIA 5ENLA 3WCZA 4ZTXA 1P6BA 3NQ6A 3NYZA 3VM5A 3BC9A 3VGDA 2TMDA 1H63A 3GD6A 1ZCOA 2PF0A 1HKJA 3NDZA 3W24A 3DENA 4EAYA 4XZ9A 1SYTA 4IUOA 3MKCA 2VT0A 3B8VA 1HL2A 3M41A 3S9YA 3H2CA 1TVNA 1R3YA 1Z32X 5G5IA 1W5NA 5BZAA 4IM4A 2RUSA 3AZTA 2YJQA 3MSRA 2HPIA 1RSCA 2VMFA 2UY2A 4C1KA 3MSGA 1UR2A 3R4IA 2XVGA 2V3GA 4BHYA 2FTWA 1N8FA 4LVBA 1FWFC 1S3TC 3KVKA 4O1EA 2BGQA 2ZBTA 1A5BA 3F4WA 3AXMA 2BFGA 1W6TA 1K3UA 5IHSA 4O1BA 2V0TA 5K9CA 3KP0A 2IW0A 1UPMB 2V5LA 4DJEA 3NQMA 3BGJA 1H7NA 1RQHA 3U2ZA 4QROA 4HPXA 2E28A 1BQGA 3BAWA 1KXQA 3NXFA 3GC2A 2G95A 1AVAA 1XLGA 4M6VA 3WNPA 2BWGA 4DO4A 2PWGA 1NWSA 4XZIA 2PBGA 1MUCA 1E55A 2FGLA 1JPMA 1VD6A 4GVHA 3DI0A 1P0EA 2Q3OA 3VKKA 3W3OA 4K1GA 1P7TB 2HXTA 3G5EA 2CLLA 4GVFA 2E67A 4TXEA 1TYGA 3BSHA 1E70M 1LWJA 1RP9A 4WKFA 3HPSA 3GDBA 3UCQA 5C5YA 2PC8A 1SFSA 3T42A 4AYGA 5CC3A 5HQLA 4LYKA 5HR7A 2XVPA 4KT2A 3BGAA 4HTBA 3BLEA 2QF8A 2NV9A 3OG3A 4LY4A 1F6KA 3Q37A 3EXSA 3KRBA 4RJEA 2YW3A 1G6CA 4PTXA 2ZUTA 1OC5A 2PLJA 3WQ5A 2NQHA 1V6WA 3M0MA 1QRQA 1TB3A 2A3LA 1GVOA 2E8ZA 5I24A 4Z1BA 5DCEA 1GVSA 2HROA 3B8WA 2YB1A 4IMCA 2IXVA 1W3NA 4M1RA 2D2GA 1REQB 2VQTA 3NZPA 4X63A 2WQPA 3I6TA 1E1CB 4AZ5A 4HMDA 4IJCA 1FWJC 3KOFA 4ATDA 4IIDA 2CWXA 1CI1A 2ASHA 1SUXA 4PUEA 1SR9A 3TQ0A 1E9ZB 3EMZA 2X05A 4LBRA 2ZA3A 2G4JA 3F4VA 2FJUB 3NQ7A 5J8LA 5A8GA 1MUWA 3M6DA 2DUAA 2Q71A 3HQOA 5CSYA 3V5CA 5PTDA 3EDDA 2ZUMA 4XX6A 2X0HA 1EX1A 3L21A 2VWTA 1HGWA 5CPMA 1GHSA 3M0KA 1K70A 3ZSSA 4FIQA 3UZWA 1Q4NX 2EJAA 3BOLA 1E1FA 4L80A 4AMCA 1F3TA 2GL5A 1FWBC 3CASA 4REQA 4KW2A 2YZRA 3SSZA 1MI3A 3VFCA 1AW2A 1L0PA 2V3EA 1K6WA 3UZ5A 5HNNA 1ZJIA 1E4LA 2PF8A 1HP5A 2X1IA 3R8RA 1CWYA 3W7GA 1QT1A 1E51A 3MVTA 1A5MC 1YHTA 3C6CA 4PGLA 3VZZA 2E09A 1E71M 1EUNA 1DJGA 1WDSA 1OFPA 2GVEA 4ZR8A 4FEZA 5A2BA 4S3FA 3GZ3A 3GFZA 1XQKA 4ONVA 1GOQA 3MUXA 2I5QA 3TJ4A 3VX1A 4MZYA 2IKIA 1B9ZA 1UA7A 4QAIA 3GY1A 4AISA 4B4HA 4PEKA 5H8PA 5BXTA 1QWGA 3W4RA 3LHVA 1OWQA 4S3BA 3NZRA 1GVFA 4PB5A 5CXPA 3SCQA 3UWQA 3NL3A 1Q6QA 1KM6A 1XJBA 2ZXBA 2GYIA 4UFJA 3I65A 4QCFA 2TRSA 1A5CA 4XZHA 1XYZA 4ZB2A 4J7RA 4M3PA 3W7HA 1XLHA 5HXMA 4IMDA 1G4TA 3UWUA 1DOSA 5EB8A 3Q2DA 1VC4A 4CVUA 3LCIA 2X2YA 3M5YA 4Q4MA 2HDJA 3B8IA 3KZPA 1XH1A 1SJDA 2QGYA 3PBMA 4J1OA 1HF6A 4S2BA 1RALA 4GVGA 3EDKA 1ZENA 4UFLA 3BXWA 1LBFA 2PDUA 3HF3A 3ZVHB 1XLMA 4HHLA 1E0XA 2WOQA 1JZ8A 1ICPA 1DYSA 3OLIA 2A79A 3UF9A 1EQCA 3N25A 2QZRA 2WCSA 1JI2A 2BVWA 2EF9A 1YADA 3I7QA 5C9WA 1Q6LA 4O52A 3BCDA 1NF0A 1FKWA 3IV3A 2KAUC 3VIMA 4AYSA 4B3KA 2NQ9A 2WMGA 4R5EA 2XH0A 4PRTA 2X0YA 4AD4A 2J4GA 4XAPA 2EO7A 2QPSA 3M0ZA 2FMOA 2ZRUA 2CU0A 4ADUA 3BG3A 1IEQA 4X9SA 2MUCA 4CQAA 1WUEA 3TIMA 3O7UA 1Q4WA 4YHEA 3T0DA 3WNOA 2V30A 3JW7A 1WUFA 3I68A 3QR3A 2WSYA 3FYPA 3AJXA 2E9BA 4F8XA 2NUWA 1K7FA 1J0HA 4N0RA 1X38A 2I7GA 2YBVA 1Z42A 4J3WA 4I5RA 1N55A 2FHBA 1KCLA 1R2TA 2YXXA 3WUEA 4MFEA 5MHBA 3EB3A 4GE8A 1F6YA 1P5BA 5AFDA 1LOQA 1XI3A 4PRRA 4IJBA 2OLSA 2HSAA 4JTDA 3AMLA 1AFSA 3N04A 4G5DA 3H2AA 2FB2A 4V1YA 4GGHA 4N2YA 1JNDA 3W9ZA 1HGYA 2POTA 4C7DA 4CCCA 3NZGA 4GFSA 1KQYA 5KMYA 2WMFA 1E3XA 3AIVA 3V36A 3TLLA 2YZ5A 4GH1A 4H8HA 4LVDA 3VNZA 1XWYA 4GXMA 4A6GA 1I8JA 5T9CE 1FWTA 2HISA 4XO6A 4LWWA 1FTXA 2CZDA 2PDCA 2PU0A 4HTYA 1DQXA 1I2PA 1A0DA 3LCLA 4HMCA 4R9OA 4AD2A 3PBGA 3MKVA 3T4WA 3KVJA 2VRKA 1WXZA 3TTYA 1EC7A 1KRCC 3SJNA 3IJLA 5D03A 4Z2HA 1Z89A 3HGJA 1FY6A 1N2VA 3FY1A 1SM9A 3CTTA 2G97A 4RKAA 4NAEA 2YGYA 4L4LA 3WQEA 1CTNA 5JH2A 1BXNA 3SN4A 3KCJA 2A7NA 2QCFA 4U10A 1GVEA 2PS2A 1T5AA 3OZYA 1ELSA 5IFTA 4G9PA 2GQ8A 1I2NA 1C7TA 3LUTA 1PAMA 1M9HA 1T8XA 2VDGA 3Q65A 4K6AA 1H2JA 3SUSA 1UD4A 4QAWA 3KVLA 4LCRA 4AXNA 1MEWA 1UWQA 1H1YA 1WO2A 2L5HA 3UXAA 3QC0A 3QQ1A 4C1NA 3AYSA 3KAOA 3M1ZA 2O56A 3KL0A 3N9RA 2Y5EA 5D02A 4JIEA 3EX6A 3VOHA 3G24A 1TR1A 3BLPX 1X97A 1Q8JA 1E6SM 1FFRA 4JKLA 2OTDA 3LCXA 2C79A 4NNBA 4KMQA 2VC6A 3E38A 3IIXA 4WXYA 3M0YA 2VYOA 4UTWA 2PTWA 5A8NA 4ICCX 3QR1A 2J78A 1XPGA 3N4AA 4HHPA 3TYUA 3PN8A 2WVSA 4KFOA 3VXGA 4ORIA 3E5PA 2C3ZA 2NUXA 3I7SA 4PCPA 5G1TA 5D9MA 3BICA 2VRJA 3BMXA 4UXDA 2ZC1A 5FJJA 4AH7A 2WHMA 3V0UA 2Y5SA 3HQ1A 3JS3A 2AMXA 2I57A 3CJPA 4GUIA 4GO8A 5EYWA 3FSUA 3VNYA 1AMKA 3HB9A 3VFLA 3FFSA 3K13A 5DLCA 4LUTA 3OU8A 3ZJ7A 2QEZA 1XINA 2OKOA 3JVAA 1LWHA 4W85A 3PUEA 5E70A 3MW7A 5DQPA 5I00A 3WQ8A 4EIVA 4KRZA 4HJWA 2WC4A 5D37A 4D6DA 4GGBA 4C6JA 1WOBA 2GJNA 4N7QA 5HPCA 3A6OA 1JJKA 4NJHA 5A6LA 3QBUA 1NF7A 4C6MA 1LP6A 1M7JA 1XPYA 1CBGA 3QOMA 1WCGA 3T0BA 2IPFA 4M8UA 1B31A 1TUXA 3FK4A 1H50A 1PIIA 1W9XA 3EOUA 1E4NA 2HQAA 4XKYB 2C8NA 4L6HA 3QZ6A 1QU4A 3FGCA 1VPYA 5KZDA 3WQPA 3K8MA 4GX9A 4O57A 5BROA 3FYYA 1SFLA 3ZT5A 3PNUA 3GG7A 1WQ5A 3IRSA 4Z2GA 1UWAA 2FVKA 3EDFA 3L12A 3CUFA 3CH0A 1JXJA 4PCTA 4Q4RA 3ZR5A 3QGVA 4D6CA 2QJGA 4LT9A 1DJQA 1TPH1 2YPIA 1QNSA 3VTRA 3DG3A 4DPPA 1UR0A 2VFFA 2VCBA 2BNJA 1EF3A 1OD0A 2NQ5A 1XG4A 3DKLA 3DG7A 4XZNX 4GXWA 4A29A 3IJ6A 4CU8A 1OG6A 3NXLA 1CW2A 5ABTA 5DT7A 4NZ1A 4YL2A 3W83A 4Q8PA 3SGUA 3GWQA 1TMLA 3S8HA 4BK9A 1N8IA 4J35A 3WH6A 1WXJA 3WD1A 1QI5A 1A0EA 3SW6A 2FZ8A 3A21A 4NIRA 4H9VA 3TYDA 3SY8A 3TYEA 3WDJA 5IXEA 4UWMA 3QMTA 3LGGA 2F84A 4BQ2A 3LSBA 2EG8A 2Q02A 1EP2A 5TF0A 3CBWA 1Q2SA 4W87A 1LOSA 3LCWA 5AYZA 2QXWA 2Z7GA 2OQYA 4C5ZA 1XIDA 1R2RA 3BLIA 4P8UA 2WNWA 2XZ9A 4FOJA 4ZODA 1RQEA 1HX0A 3CMJA 1NSJA 7TIMA 3DHUA 1LROA 1QW9A 4ZE5A 1XHGA 2YL8A 1K9EA 1HJXA 2H8XA 3SRKA 4GY7A 1GZJA 1E6RA 2NLYA 2QUMA 2PODA 4Y90A 3ITTA 4LU0A 3E02A 3F4NA 2Q8ZA 1QI2A 4DYEA 5KZMA 4V2XA 3RR4A 3RO8A 2VX7A 4I5UA 1UD8A 3F03K 3AS2A 1LRNA 2HS6A 3VD7A 1SQ7A 3EB2A 2QCLA 3TW9A 2R1KA 4MDOA 4B3ZA 3URAA 1ZU8A 3AIEA 4LSBA 3LCHA 3KZSA 4WXZA 2BY2A 3WK3A 1V03A 2QUNA 4CNNA 4QE1A 1OZQA 5AB3A 2Q09A 3PFRA 1HFBA 2FZ9A 4ZMGA 3LLXA 3SN0A 1L2UA 2WSPA 3BAXA 3O8AA 4WLCA 3LG3A 3M47A 3G77A 3GB6A 2XFFA 3GTIA 3QQWA 4EACA 4JKMA 1AD4A 3L2MA 4M81A 4PODA 4L9XA 3NQEA 5A3HA 1ZAHA 1MMFA 4G6CA 2GUUA 1XC4A 4ASTA 1MRAA 2DZSA 4H7ZA 1KXTA 3HG2A 2F61A 1VS1A 1K8YA 3ZJ6A 1JI1A 2VKZG 3W7PA 2J79A 3W74A 5AHFA 1RLCL 4DWDA 4PUJA 1TELA 1VIWA 4QG9A 3MUY1 1DWJM 1PL9A 4LW7A 5GVJA 5BXSA 2XGIA 1WE5A 1UUMA 4C6LA 3C2YA 3I3EA 3F5KA 3ARUA 3VIIA 3TFCA 4GI4A 5C2XA 3ARVA 1VBJA 3NL5A 1EEXA 1MWOA 2J7GA 4XAGA 5FL1A 1UP2A 3Q45A 2ZZ2A 3JZUA 1WBHA 1XLJA 3NQDA 3STCA 3EXRA 1UROA 4Q4PA 2VZUA 1TFVA 2PGFA 3GAYA 4NAFB 3OGVA 1VRXA 1QPOA 1E43A 1GPFA 1GG0A 1HO1A 2VP8A 4K8GA 2JIWA 3W1UA 1EJTC 3VOJA 1V02A 1H7PA 3C2RA 5M2FX 2ISVA 2JGYA 5DN1A 1E5JA 5CBBA 2EPHA 3CZLA 2YFNA 1R3SA 5FACA 4X0VA 4Y9OA 4J2PA 4DLMA 1E9IA 1YBQA 1YE4A 3NYDA 2QIIA 1MUMA 3K1GA 1ZBKA 1UPPA 1BKHA 5I2UA 1ZS2A 3H4XA 4WQ6A 1J93A 4PFHA 3PBVA 1KBIA 1QFEA 3ZO9A 4LB3A 2HXUA 3VNLA 3FKKA 4QNEA 4EP8C 4EWND 1BWKA 1TG7A 3I10A 3B9NA 2OO0A 1J11A 4JEQA 3FDGA 3GH4A 2XVKA 3W7JA 4D71A 3HV8A 4DXVA 4W88A 1QWKA 3MPGA 1KCXA 1V3JA 2VOTA 1BTMA 1ZPTA 5CSRA 4L56A 3K46A 5CJ5A 1RBLA 1A47A 4WY0F 1K02A 1OD8A 3M16A 4J3TA 1VZWA 4JTAA 1XIHA 2G37A 3KBMA 2R82A 1XLEA 4LVFA 3H54A 1Q2RA 2WC3A 2VO5A 4L9ZA 4TUFA 4C91A 3MWCA 4WSKA 5AHNA 1KD0A 5D9OA 1EHNA 3M0HA 2O9TA 2G3NA 3PZ9A 3WKZA 3D0CA 3KCOA 2Y8VA 4ZFMA 1ZHAA 3FJ4A 3B3DA 2CHOA 1U22A 4PMQA 1OYBA 2J6XA 3OLDA 4MWAD 1IXQA 3TQVA 4XTDA 5M17A 1RBOB 5U4NA 4GRSA 3PJUA 4GZIA 2A3HA 3PB0A 4HB7A 3ALGA 4D6HA 4HOXA 3GVQA 4E0CA 4UTTA 1ALDA 4RV8A 1QI4A 3TE9A 3SUUA 4IIFA 2PRHA 4PL2A 1RJQA 4HN4A 3VIGA 2ZRYA 4DYKA 3N6HA 4LOCA 1JYVA 1SFTA 2GOKA 5G4EA 4JTHA 1GW1A 3LQGA 4TX8A 3W22A 4HYVA 3IIPA 2ABBA 4PCNA 1YQ2A 3KBWA 2X1TA 3VA8A 5EMKA 4GPNA 3DI1A 2XH7A 3SFWA 4JYDA 5FJOA 2E3ZA 3U7BA 2JEPA 5F1UA 4TO8A 1TWWA 6ALDA 3QGKC 2DUZA 3WLKX 5EPDA 1K03A 4GIAA 4HCHA 4WJXA 7PTDA 1YPIA 4K7YA 1VRDA 4JKKA 5AOUA 1MNZA 3STFA 4JCMA 1H7OA 5JXQA 3H7UA 4K8HA 3F4DA 1L2QA 4RZ5A 4ICNA 5DEZA 1LYXA 4LEFA 1BTCA 3M0JA 3TROA 1ZB5A 2TYSA 3II1A 2C18A 2ZQ0A 3EWWA 1JYWA 4DVOA 2NXGA 2QR6A 1GK8A 1GEQA 4MFDA 1EB3A 3PUDA 1I4NA 1E3ZA 2XUCA 1U5VA 3LXBA 4AVFA 3HIJA 1I45A 2PAJA 4WZHA 3T44A 5C6MA 4MNJA 1WB0A 5A6SA 1R30A 1K7XA 3LI0A 3IGSA 2FJKA 1JZ3A 2D24A 1JCLA 3WH9A 3W01A 1J12A 3WH5A 2PLKA 3LENA 2GVJA 2GGEA 4Y9AA 4RE3A 2RDWA 3WLPA 1UOKA 4MLRA 4KETA 4PTVA 3UD6A 3TSMA 1R3RA 4P7LA 5BMXA 5G4WA 4K1WA 1DJYA 3BMVA 5CLWA 5CZ0A 1KM0A 1JQXA 3PC0A 2Q6ZA 3GAKA 3DC0A 4NL1A 4JIRA 4H2CA 4NUWA 2WNNA 4WVXA 3BQ5A 1TPVA 4FNPA 4ENLA 4JTJA 1UUQA 1ODUA 3M5XA 5J5DA 2C15A 4M80A 3H2OA 4KEUA 4QS6A 4HA1A 4XIMA 2I17A 3MV11 2P50A 4UMCA 3IUIA 4JN7A 1VF8A 2ZZ6A 2EHHA 2B81A 3MS8A 4MTVA 3QM3A 2O9PA 3MV01 4ZQMA 1VAHA 3CWHA 4Q8TA 4U31A 1J9YA 2IQ0A 3HN3A 2FHCA 2O7SA 3CQHA 3RLGA 2WLZA 1HTIA 3WZ0E 1C92A 2XWEA 5M1TA 3THQA 1KM3A 3RX2A 3UJSA 5BOFA 3GDKA 1VFSA 1DXFA 1XYMA 4YIWA 4JIIX 4XKYA 4DJDC 4EK7A 3O1NA 4PSPA 2X1RA 1JCMP 1B3YA 5CGMA 1XH0A 4PMRA 1PB0A 2GGGA 4Z0JA 4LBUA 4QFUA 1M5WA 1M3UA 8TIMA 3GC4A 1O5RA 2OLAA 4CNPA 4LALA 1R2SA 1I1WA 3TZNA 3AHYA 4XD5A 1NQ6A 4H9XA 2CC0A 3IACA 3RR1A 1BAGA 1N8WA 1SZGA 3PZUA 4AZHA 1S2WA 3L7RA 1X8FA 1ITQA 4QJ5B 3SI9A 4NU7A 3ITGA 1XYCA 1K77A 1X6UA 2OLHA 3QMSA 3F2CA 3DN5A 5A1AA 3MMTA 3FA4A 4DPQA 1XD0A 5DO8A 1GOWA 5C2GA 3E0WA 5K4XA 1BYDA 2FH8A 2PDPA 4XSLA 3PANA 4KEVA 1V6UA 3W2JA 4ZB5A 1W56A 4PMUA 4X61A 1POKA 4MWAA 4XZBA 2D1ZA 2QT3A 3T55A 1V93A 2HV5A 3UW6A 1V0NA 4FNSA 3LS9A 4A3YA 1JAEA 1F07A 4FNTA 3EWDA 1WKYA 2VENA 4RDVA 2DW6A 1L6SA 3VD5A 4F0MA 3LHYA 2QDEA 4WUIA 4F3HA 3VGGA 3EX3A 3AHXA 1X6LA 3R43A 5D05A 3O05A 1TWZA 1MXSA 3C8FA 1LRTA 1MDRA 3FNDA 3W72A 1EC9A 1RP8A 4FALA 3T8QA 5HNUA 2Y8UA 1R3VA 4J4KA 4J3UA 4HPJA 4UUIA 1FP8A 1PZ2A 2QF7A 3AIRA 1KA9F 3GNPA 1YDVA 4I9AA 5CG0A 1RAKA 3DFPA 3K4WA 1GVYA 3TN4A 5G2WA 3URBA 2HNHA 2YYUA 1H60A 1RVGA 4HN8A 2CHNA 4JQ1A 1GZGA 5CBIA 1W17A 3W88A 3WDQA 1QASA 1V0LA 2DH3A 1G4SA 1P0DA 1VPQA 3DCPA 1OGGA 1PZ1A 4IICA 3BPWA 2XHYA 4RUBA 5J5RA 4BCEA 3GU2A 1G4EA 4JFWA 2D0HA 2YCEA 5FESA 1EJRC 3GXPA 4QRNA 2ON3A 3NJ3A 3S2JA 5LGZA 3ZWTA 1HIZA 1XLCA 1W9PA 3U3HA 1ONEA 4GBUA 2Y8KA 2ZRWA 4PMNA 4UTMA 1JPHA 3W2MA 1IEXA 1QBBA 3SN1A 1RV8A 2WMIA 3COTA 4ILSA 2VEGA 4LF1A 1H7WA 3DG6A 1TIWA 2A5HA 1UKSA 4H8UA 4WOQA 1DIKA 4HK6A 5I3IA 3DGBA 3DYPA 3MUZ1 2EKCA 4KWUA 3DXIA 4KWSA 3UNTA 4JY8A 3BWWA 3U0HA 1VIZA 3UNDA 2QCMA 3UA4A 3R94A 1OT1A 1G9HA 2A3EA 4LH8A 2ZFAA 2DV0A 2VELA 3E2SA 3WIJA 4W5UA 2GZXA 1C3FA 3TAOA 3DGRA 4DI9A 1I75A 2O92A 2PCQA 1JPDX 4CCZA 1RY0A 2DZTA 5KEZA 2RDTA 1E6XM 4Q6JA 1VH7A 4UNLA 2F38A 3DYOA 1VP5A 2Z1WA 4KH2A 3EEZA 3LTPA 2V63A 4RNFA 1K6AA 3S2CA 3J7HA 3CV7A 4ZXOA 1OK6A 5GJNA 3GIPA 3BAYA 4Q33A 4FMVA 5HWNA 1KWGA 3UBPC 3POHA 5CC7A 3NPWA 3AZRA 4AG0A 3HPAA 4UZSA 2PWFA 1QNVA 1TA3A 5XIAA 2WWDA 3NO1A 1M7OA 3UY7A 4P8VA 1JYXA 4OV9A 1HUVA 4ERGA 4OQVA 3W7IA 4XISA 4WF7A 3L68A 3O06A 4W89A 4KIEA 4ERAA 3WLIA 1T41A 2A7PA 1ADOA 4ZXLA 3WLSA 4PEEA 1J01A 3LRLA 3E9AA 4UOZA 5JIWA 2PP3A 3E1F1 3CUHA 3EWYA 3SECA 1R8LA 4EOUA 1QOPA 2V69A 1DQUA 3WEOA 2Y89A 2QS8A 1TPUA 1UR3M 2EPOA 1U1UA 3BO9A 1DL3A 1CT5A 2BDQA 3N1AA 1CLXA 2XM2A 3OA5A 1ZP3A 2NV1A 2I9EA 4JYFA 3UVAA 4UCGA 2DFAA 3E0FA 3OHIA 1FCVA 1XRVA 4PE8A 1BPLB 1IR2A 1DWIM 1JCJA 4FOUA 5LA2A 1KFEA 2W63A 4YWIA 4DYJA 2DIKA 3SQLA 4OZOA 1BXCA 1B2YA 1G1YA 1LG1A 3GDTA 4D6FA 1CLKA 1XQLA 3EOSA 4H9YA 3GTNA 3O6YX 4PULA 3T40A 3WL0A 5AYXA 4NZ4A 2DT0A 3GUWA 2C14A 1O95A 3CH9A 2ICSA 2PBOA 2QCDB 5AVNA 4L4OA 1NP2A 4IUGA 1YXYA 5JIPA 2PDXA 5CC6A 1EGVA 3QSTA 3ZYZA 2WPBA 5D38A 3NVDA 3P8JA 1KBJA 3WLRA 1TV3A 4FX8A 1Q7MA 2XGBA 1H49A 1BKSA 4Z08A 2NQLA 4ZQRA 1RD5A 2BHUA 3P80A 5EMLA 1UHVA 3CIVA 3P82A 4FSAA 3W1TA 4HMNA 1JDAA 1V51A 1NU5A 1GVRA 8RUCA 2WHKA 5EU9A 4R85A 4EANA 3SCRA 1MNSA 2FGBA 5JQ9A 3DHPA 3OBAA 3DFHA 4L61A 4UTJA 5I3DA 4M7SA 4GJJA 1O5KA 2GJRA 3IIZA 1V3MA 2RDUA 2XH2A 1VFFA 4EPKA 3W38A 4BI7A 3TXVA 3CIXA 3NQCA 2W91A 2JKEA 1T8QA 4N9CA 1H11A 5DBUA 3M44A 4GQBA 3ZS4A 1UD6A 4LUIA 2XIQA 1FWRA 5HINA 3OG2A 3G1DA 3DZ1A 4Z1DA 1FDJA 4AHOA 2NWRA 4W84A 1MDLA 3FXGA 3HA1A 1E0VA 4AEEA 1WOAA 3LHUA 4U5IA 1B9BA 4W7UA 2JKAA 2J25A 1UZ1A 4LAKA 4HZ6A 2ZWZA 1SFJA 2J7CA 1CDGA 3R5EA 3H2EA 2BXZA 5I77A 4GZEA 5K9XA 1TQXA 3CQJA 3L4YA 5EMUA 4F48A 5JVLA 1BHGA 1UZHA 4C7GA 1VBUA 1WDQA 3HPXA 5C55A 3OB8A 3G0UA 1QK0A 1UP0A 2YLAA 1KW1A 1K1DA 1WPCA 4FA3A 1EZ2A 3CU2A 2WB5A 3B9EA 1SSGA 3HGSA 4NY2A 7ENLA 3R8GA 1XIMA 3EWZA 4TIMA 3B0XA 2WHJA 1NDWA 3PWGA 2HNEA 3BK0A 3VMOA 2CLIA 5IM51 3SCNA 1CGXA 3VOGA 1GZ1A 5HPOA 1TZ7A 4PUKA 3RM8A 3GFXA 1W31A 5CPSA 2VD9A 4LAMA 5AHIA 3FHAA 4I9TA 5T26A 4KRUA 1L6FA 2RFGA 5EMMA 3DOPA 4OJYA 5F2LA 1SU5A 2ZUVA 4GYPC 3KUMA 3WH8A 1FWEC 3RRXA 4PMOA 2X8RA 4K68A 3PPHA 1ZBCA 3H2FA 1T0OA 4WY0B 2ZVIA 4TOQA 2FTYA 1JFXA 2YDAA 2HE8A 5AHEA 4HNTA 1OC6A 2DW7A 3DERA 2JE8A 4MSSA 3GO2A 3SADA 3C0QA 4MZ8A 3TR2A 4G1KA 3NZQA 4AX6A 1LTDA 4FZIA 1RCQA 2UY5A 1LQ0A 1GQKA 3WMCA 1TJ2A 4A8NA 3IS4A 2X1SA 4LS2A 5AC7A 3CZGA 5I03A 4GABA 4B5SA 2XIJA 3YPIA 6XIMA 4O1CA 2J9XA 3NQ2A 1IIGA 1MW3A 3DFNA 3N2XA 3H6OA 5FJPA 3THCA 2NQJA 2LLEA 2WAGA 5KTLA 3NM3A 4CKQA 3QFWA 3LSCA 1VJZA 4FP1A 3A5VA 2OMAA 3RCMA 1JYNA 4OBRA 1S5MA 1EP3A 2C16A 4K8EA 3ARXA 3A4XA 3W7QA 1QNPA 4HZMA 2EBNA 3ARQA 3RAOA 3RXZA 1VR6A 2WHLA 4Q8WA 1HG3A 3W7DA 2XH4A 1IGSA 1DORA 3IK2A 4HBKA 4JY9A 2NT0A 5ABGA 1HJSA 4UQ9A 3LHTA 2C1HA 2HE5A 1XBYA 1A5OC 3LHZA 1VFTA 3N29A 4FXSA 1RJRA 3TN3A 1A3XA 1EH9A 4PTMA 2PTYA 2XN2A 1IQ8A 1IT0A 2ZOXA 1VYRA 1VB9A 3T2QA 2XIMA 4X22A 3WQOA 4PR4A 2DSKA 4DZAA 3WBXA 3T81A 3OTRA 1ZL1A 2QNEA 4FNRA 1BF6A 3WF4A 4E4PA 5D04C 2C6QA 2CEQA 1XH2A 3ID7A 3PNZA 2GSHA 5K4ZA 2Z27A 3HQPA 1AQFA 1K9DA 3V7PA 5D4YA 1AJZA 3V4BA 4JTUA 3W86A 1KBBA 1Y5XA 3FA3A 5K7JA 2YBUA 4N6FA 5AZ0A 4OFCA 2C0HA 2OYLA 2P5NA 1AH3A 4TTGA 4QBXA 1SW7A 4LBSA 2YL6A 3N18A 2P53A 5FKYA 5HQMA 3VK5A 2OT0A 3ONCA 1J0KA 1FUYA 2PWDA 2GVGA 2D23A 1WDWA 4G2DA 4DBUA 2D0GA 1TTIA 1TE6A 3AYVA 4NX5A 3IK4A 4FHAA 3F5LA 3HG3A 3L0GA 4AZ7A 2Y7DA 4KEZA 3OZOA 1I9CB 2PLCA 4C6DA 3L66A 4UQAA 5T8GA 3FJ6A 4A21A 4JQ3A 3SEPA 2C7FA 2FZMA 2NX1A 4JNZA 1I6NA 4BEQA 1JCXA 2R8WA 3VUSA 4GJIA 2BP1A 2CZ5A 4QSHA 1X96A 4OVXA 2FHFA 4Y8FA 1H5VA 4ATLA 2V3FA 3EWCA 3BDKA 1W0MA 2IS7A 1RA0A 3A9BA 3P61A 2ATSA 4JR5A 4BQ4A 4D9PA 3CYVA 3CQKA 3T1GA 4ZQPA 1OCJA 5GJPA 3E0IA 4QNWA 4EF8A 1V3HA 3OVGA 5BU9A 4DRSA 1J0ZA 2PSNA 3MB9A 4FXRA 2GWGA 1KRAC 3GYEA 1OCNA 1YKWA 1ECQA 4EPBC 4RNHA 4IG2B 3MO4A 1UD2A 4CN4A 1KM1A 2J7FA 3P5YA 4AZ6A 1Z7AA 3MMDA 5E6ZA 4HZ7A 4XIAA 2WMKA 2YFOA 3V35A 1FOBA 2VFIA 2R14A 1WDRA 5BRPA 5AZ1A 1YTDA 2OWWA 3OODA 1WZAA 2NVDA 1MFUA 1RQBA 4HNOA 3WJXA 2INFA 1HKKA 4V1XA 1AQMA 3LY0A 4OU1A 3G1AA 4Q8OA 3UXKA 2VUYA 4XAYA 4X0NA 4O1DA 5T9BG 1AQHA 4IF2A 1Q6FA 3ABQA 2WJFA 3PR2A 5EGRA 1NWTA 3N4FA 4HK7A 1ZSXA 4LEQA 1CXEA 4N42A 2FPTA 4B3LA 2R6OA 4JBRA 2HK0A 2V2CA 3UWYA 1W3TA 1DXEA 2R1PA 1B57A 4IGMA 4IPNB 3R0DA 4HNCA 4E5TA 2EPNA 2GJXA 4O8AA 4JDYA 4LAZA 3EKGA 4M19A 4QCEA 3B40A 2PC4A 3ZT6A 4LUSB 1ML1A 3LBCA 1KR1A 3NSXA 1TRDA 1XYFA 5FEPA 1H51A 2PDLA 1W3IA 3A47A 3DECA 2OSXA 4DXKA 4R88A 5G1MA 5HULA 2PTZA 3SUTA 4A2SA 4F2TA 1HJVA 4LYQA 2VVNA 3IEBA 3UGVA 2J74A 2DZAA 2V3DA 3NM1A 2DT2A 1Z3NA 4GC4A 1GONA 1LUCA 4HK5A 3N3TA 4A4AA 2I5GA 3I6EA 5LYRA 2DJLA 1H41A 5HA7A 3W1RA 3P62A 2GQAA 2CXGA 4CD4A 1MXGA 5LHEA 2WNZA 3CL8A 3S1XA 3UWEA 1D2KA 3N3MA 1TV8A 1L8PA 4JQ4A 1R85A 3R11A 4MNLA 2VC7A 5CJMA 3TTQA 1EX5A 2FIQA 2P8BA 2QCDA 4OBSA 1BVWA 3ARPA 1YW1A 1QHZA 1DIEA 4L4MA 3WJWA 3HFYA 3WF1A 5AVHA 4ZBCA 1OFOA 3OQ8A 2O0TA 3UR8A 2GJLA 1L8NA 1AH0A 5HDRA 3CO4A 2H8ZA 5HBFA 4LVGA 4HA0A 3AMCA 4QEHA 5FIPA 1LBLA 1XLIA 1UH3A 2ZUSA 1IWPA 2VHLA 3LRMA 1FCBA 3QY6A 2W79A 5CPTA 3CGTA 4YVVA 1GJWA 4GG9A 5EFFA 2AQVA 4UQBA 7TAAA 4JTEA 2ABAA 3UQNA 5C9XA 1UWSA 4K3ZA 3CIWA 2CZFA 4HSNA 2GUYA 3CZJA 2IPWA 2QV4A 4G1NA 2E4TA 4Q8VA 2QJJA 3H12A 1W1A1 2ZWYA 4HQVA 3TCEA 4QGCA 2UBPC 4YTSA 3WUFA 4AZCB 3UPMA 1O1HA 1WKEA 2ZUUA 1MYRA 3IGHX 1E9LA 4Q22A 3WD0A 3UU0A 1TV2A 1W54A 4CQ9A 3P60A 2ZXQA 4M24A 3MCOA 4ACZA 5G2HA 3TXZA 1D3GA 3KBJA 3JUGA 2YL5A 1GKQA 1HN1A 3K8KA 3TA9A 2V82A 4PMYA 2BASA 1US3A 1GJPA 3NOEA 2FZBA 5FF2A 2OQHA 1I0DA 2OWCA 1K8CA 2BOGX 3M5VA 4FR1A 3L2LA 5I06A 1YTEA 1I2QA 3EBVA 1FVPA 1WZMA 1A80A 3M5ZA 4DI8A 2P3EA 3TYAA 3KOWA 2VGIA 3R8HA 1M7PA 3KX6A 4AB4A 1JG9A 5AHLA 4HHMA 3NQVA 5CPLA 3UWWA 2FQIA 5HOSA 3QSRA 3WY1A 4JYEA 1E0WA 3S0CA 3NAVA 3IJ8A 1TJPA 3QKZA 3WQCA 1V79A 3GHUA 3STEA 4ZQOA 2WZHA 1JL8A 2B7NA 4IMGA 6PTDA 3CHCA 4H2HA 3P81A 1V4YA 2PDHA 1G0CA 3THUA 5ABFB 3FEQA 5C7HA 4FS9A 4C6EA 3MZNA 3S5SA 3N12A 3Q94A 2FFIA 4UB9A 3AYTA 1KGXA 1BFNA 5DFAA 4ZZ9A 5DCBA 4WY0A 1YEYA 2CCRA 4ROQA 2PDNA 3NWRA 4J5NA 2C71A 3DIPA 3N73A 3ITXA 2D20A 1M03A 3BLDA 5CEWA 3CPGA 1QR7A 1X98A 1O94A 2ZZ7A 2QUVA 1X39A 1GYNA 2EKGA 2GGHA 1C29A 1TQJA 2QUTA 2P0OA 4HNLA 4XWUA 3DBPA 3GHTA 1NARA 3CHEA 3KRSA 2BGNE 3PWAA 1VFUA 4E8GA 1QNOA 1D8WA 5D8WA 3TJLA 2NWSA 4FNUA 2E5DA 4RZ6A 3BZGA 3S6TA 3R6IA 3CAKA 5BU6A 4JQAA 1SPQA 4F9DA 3S3GA 4P8WA 1CGUA 3ARWA 1E6QM 3T2PA 3QC3A 3CB3A 2G3MA 4L6OA 2VFEA 3LPFA 4GUHA 4NJJA 3GVRA 3ME3A 4O15A 4OT7A 4M51A 5E09A 3WEZA 4AC7C 3WLJA 1WKFA 3AZSA 3MP4A 2A4AA 1VENA 3W76A 1P43A 1VJSA 5A8QA 1DE6A 3SDOA 3CLMA 4JL1A 5D9NA 4A3UA 1MW1A 4ORMA 1GUVA 2DJXA 4TVCA 3WBWA 3S47A 1ZQ5A 4PYSA 2J9ZA 1TV4A 3LV6A 3WL1A 1PCKA 1S2AA 1E73M 4I9JA 3N34A 4EVZA 4DWSB 4V15A 2VUNA 4XZLX 5E93A 2J62A 1K8XA 3CHVA 1GYMA 1I2RA 5I3KA 4ZA0A 4DF2A 4O0KA 4JTQA 1KFKA 4AD5A 1EIBA 2IPGA 2CETA 3E3HA 3L9CA 2A3CA 1SO5A 2OJPA 4G7EB 2ATMA 3TAKA 1VBGA 3O6DA 1EXBA 3B8TA 3EX1A 4G56A 3PB2A 1RH9A 4W8LA 3RPMA 2F8QA 3GG0A 6REQA 2OEJA 3T7VA 2C0AA 4KIRA 1SZFA 4IWWA 1OCBA 5BXRA 3H4GA 4BA0A 2BV9A 4JIPA 4UFKA 2VEMA 4RNJA 1Q6RA 3ANVA 1O5QA 5I6SA 4GQGA 1ISXA 3IRDA 1ICSA 2D73A 2OZTA 5CSUA 3VZYA 2P1FA 2Y88A 2BBFA 3KS6A 1C8XA 1DPMA 4HU8A 4PMDA 3PFMA 2DORA 3G8EA 4UFMA 1B1YA 1W1VA 3DBNA 2AOSA 2X7WA 4JTLA 2WVUA 3A24A 3L4WA 3U2OA 2Z1KA 4GISA 3W00A 3OLGA 1PSCA 2ANUA 1QPKA 1AK5A 3K4DA 2C1GA 3KOYA 4QISA 4GIRA 3TR9A 3PULA 3BG5A 2HJPA 3SB0A 3KFTA 3QXBA 4GH3A 2C19A 1HXJA 2QAPA 2A1YA 3BLLA 1OABA 3MQTA 4O4VA 2A21A 1YE6A 1XS2A 1A53A 3KDNA 1GQNA 3W26A 5CZTA 3A12A 4KWVA 3G0SA 4M5PA 4ZTYA 1UH4A 2CBUA 4EPEC 3VC5A 2JF7A 1PIFA 1G4PA 4U33A 1ZP4A 3U4FA 1C90A 4W7VA 1A4LA 2X40A 3U2EA 2PDKA 1E40A 2NVCA 3GSMA 1AQ0A 3KBNA 3H7RA 4ZL1A 3VKCA 1FRBA 3ABZA 2V81A 4LY8A 1CYGA 3QR0A 1PBGA 1GQIA 3OZPA 3NGJA 3QJAA 4Q7NA 3EDJA 3GTHA 5DXYA 2YBTA 4IG2A 4BKNA 2DH2A 5DX7A 3N2BA 3TMLA 4E2VA 1EJXC 3AXXA 3LM3A 5LA1A 3GH7A 2W3ZA 1M41A 3ZJ8A 3GR8A 3N11A 1FH8A 4OUEA 2VTFA 1SW3A 1VHCA 3F4CA 3LERA 3SUWA 2XYLA 3LMYA 3OIHA 1UJQA 2FDSA 3WMBA 3TDFA 3RMJA 4L1GA 4WKHA 1J4EA 5ABEA 3RITA 1CXHA 4DUOA 3E5BA 4JFTA 1JIBA 1QO2A 4UR8A 1G01A 3GDRA 4Z2IA 1J2WA 2V5CA 3AAMA 3H2MA 1BRLB 4KWOA 3AUJA 3KE0A 1H7XA 2HVNA 4IGNA 4JFVA 4UTFA 1W9DM 3PK7A 3G1FA 3WF2A 1VYSX 3TYZA 1WDDA 2EGZA 4PUUA 1QI3A 3WENA 3M46A 4H6RA 3IGUA 5FF4A 2NLIA 4OIFA 4LCQA 3SJ3A 3HMJG 3VX0A 4WGXA 2WCGA 4JTSA 4JN8A 2SFPA 4XAFA 2E9MA 1HVXA 2V2HA 2F6XA 4ADTA 5K2ZA 5H6HA 4ZFCA 1GT8A 3W1NA 2BS9A 1SZNA 1IZJA 1XIIA 1NDVA 1RPXA 3BW4A 2W5FA 3H21A 3N14A 4RXFA 3RILA 3SCOA 3CYJA 3UJEA 2HRWA 1HO4A 4MLJA 4ICMA 5BYWA 4ATWA 4YPJA 1R87A 3TYCA 1A5KC 5LZLA 2J8GA 1DWFM 5M5DA 2O55A 4IISA 2XIOA 1W3JA 5H91A 3C86A 5A8PA 2WBGA 3L5LA 3WELA 4UC5A 3STPA 1TMHA 8CGTA 3FXYA 5F1VA 1CECA 4CLMA 4C6CA 1LL7A 1RK6A 2Z2AA 1ZFJA 2A6LA 3H4WA 3PP7A 3QV9A 3SSJA 3JU2A 1LT7A 4MG4A 4ZO9A 1F3XA 4C6BA 1PHQA 1LM1A 2R1LA 5B7ZA 2BZNA 3LQLA 2VZTA 4O54A 1NM9A 3BVJA 2XN0A 3O07A 4IPIA 5I3FA 2NSOA 3VCRA 3S46A 3CUGA 2OPJA 1ISWA 1GVQA 2QPXA 2J7EA 3PPGA 4FAMA 3GVGA 3EWXA 3RPDA 2VCAA 4I6KA 4IMAA 2HK1A 3HV9A 2QJHA 3NEVA 1FWWA 2V5KA 4F79A 4DNMA 3BOXA 4S3JA 1IHIA 5A2AA 1UJPA 4I5XA 3KEHA 4KCVA 3T0TA 3TJXA 2CKRA 1TWDA 1Q6GA 3VNIA 2YX0A 4DJDD 1TTQA 3U5UA 2WZTA 3QHOA 2XGZA 3F2BA 2ZXDA 2NXHA 3IAPA 2OGJA 3R0UA 3PPCA 3GNDA 2WVTA 2R9RA 2I16A 2E5CA 4B5TA 4CN6A 5IDZA 2CLKA 2PWEA 4KESA 2PLMA 1TX0A 4DM2A 3FJLA 4H01A 3QOKA 3B8UA 4MVAA 1PZ3A 3ANYA 4UR7A 1IEIA 1W5OA 3C3UA 1GVIA 1U1HA 3PSWA 4MM1A 1BG4A 4NJKA 3MSDA 4NYUA 2OB3A 3NFUA 3VNKA 2J66A 2QULA 3OA3A 4C6IA 4AZCA 2GK1B 3SY5A 2J8TA 2J47A 1XRFA 3IJ7A 1TPEA 3KHDA 3P7YA 1FCUA 2EAWA 1BF2A 3PVFA 3TP4A 4CVWA 3WDRA 1MZHA 1TJ1A 2PDJA 3TJIA 3QZEA 3MDWA 3AIUA 4H6KA 1DKWA 4ALDA 3WD2A 1HJWA 3PF3A 2HPMA 4IFKB 1EFZA 3LK6A 1OQFA 3FSTA 4DEFA 1QCWA 3VIFA 5L6UA 3UGRA 3VKJA 1LL6A 4GCAA 1ICQA 2DSUA 3DFSA 2OODA 3CL6A 3IVSA 1TTPA 2BLEA 2OWXA 2ZYFA 4BF9A 1JRCA 5D2XA 4TX6A 5H8UA 2D2JA 3W7EA 2HVMA 1A3HA 1PEZA 3SRFA 2XINA 2WXDM 3NSNA 5T91A 3W2UA 5EBAA 1EBHA 4F4RA 5A6BD 2YCLB 1YNPA 1J96A 4OBTA 2JALA 2WZEA 4TVDA 1PVNA 3MDUA 2DSWA 1CGTA 1JDDA 3WJSA 4ES4A 4BI6A 4GY0A 1I2OA 2Q01A 4I9MA 2PGRA 5KITA 1CEOA 3MCNA 3BZJA 1XX1A 2RGMA 5CGQA 4I7VA 3BMWA 3PTKA 1OYCA 4IP7A 4J3VA 2QMJA 4KCUA 2ZKMX 1V7YA 4CN1A 1W1ZA 4GXPA 1HW6A 4AF0B 1CGWA 1EDGA 4W93A 2Y70A 5CPNA 1AD1A 3VI2A 3GIYA 2WC7A 4MNMA 5BOEA 4LFYA 1LORA 1M68A 3V3WA 1S1PA 2ISWA 1HVQA 2BY1A 1H3GA 3WQVA 2WSRA 4HGXA 1JGIA 1ISYA 1YDNA 3C0LA 1JFHA 4FLRA 4NVTA 3O6AA 5AC6A 2VEPA 1FBAA 3P14A 4J3SA 3MI2A 1DHKA 2DUXA 2HMCA 3PZOA 2R1NA 2NZLA 3HO8A 1EO7A 4B5WA 1BXBA 2CZVA 5IDIA 4DJFC 5DT5A 2Y61A 2CIPA 1CXFA 4NZ3A 1JDFA 1ONXA 2H3BA 1EF2A 3WD3A 1EC8A 2GJPA 2VC5A 4IPLA 4IXHA 1IIHA 3GU9A 4EE9A 3AFBA 4MY9A 4FI4A 4GQ0A 5D9PA 4NXKA 5F4SA 3ZJKA 3NNTA 3ERPA 2VEKA 1JNEA 4XTIA 4GUFA 3Q67A 1EIXA 1ZJBA 3UWVA 1FDZA 2QJMA 5E1QA 3RLVA 4HYWA 4R53A 4TQTA 3FV9A 1OADA 2EXOA 1DTNA 4IJRA 3SCSA 1IXNA 1J5TA 1TV7A 2IXUA 3AUOA 1LBMA 4WHBA 6TIMA 3A3HA 2V6AA 3FYOA 3PTDA 1DJWA 4Y9NA 1W9VA 4S3DA 3GDLA 4XO7A 2Z1VA 3ARYA 1KV8A 5F4WA 2DZXA 1GKRA 4HD5A 5AYBA 5HMSA 3VD3A 2P76A 4D1JA 2ISFA 2PD5A 1V6VA 4DJDA 2JGQA 1O1ZA 1QXLA 2VURA 4MGGA 4B16A 2I1OA 2ONEA 1KO0A 3TX9A 4PA8A 4G7EA 5JMUA 3MHGA 3GNOA 3SGZA 2PDMA 3Q58A 4S3GA 1MQRA 3WK2A 4IFOA 2XVLA 4PBFA 1TJRA 4ZB0A 5K3VA 4WOZA 4NX0A 3JZEA 2GQ9A 1JPKA 5IOBA 1F6PA 3C8NA 1JDCA 2NV2A 4C90A 3G18A 5U7SA 3H2NA 2Z6IA 2OOGA 2W0UA 4H83A 2VEFA 1NOUA 1THFD 3RK8A 3DYMA 2VR4A 5A8OA 1B3ZA 2X0SA 4O0QA 4GACA 5CQ1A 5A6AA 4DO6A 1RVKA 3W07A 1U83A 4KCTA 2QCEA 1FCQA 3U2CA 3BG9A 2JIEA 1E4MM 5EFDA 4F2UA 3V75A 3OGRA 1XLDA 4L9YA 3S1GA 4HSHA 3HGRA 1FH9A 1KGUA 2W66A 1H5YA 1JZ4A 3ORWA 1OIFA 2Q3RA 2WKJA 1XFCA 4BQ5A 1VFOA 4X3ZA 3FX4A 1VPXA 3EYPA 3H26A 7REQA 1XBVA 1OT2A 3AWOA 1HQTA 1KFLA 4ZO7A 4MOZA 4Q7IA 3TWAA 1PUDA 3B0UX 5C9RA 4FK9A 4HOZA 2NX3A 4H9UA 1WX0A 2QMKA 1JR1A 3QTGA 4AY7A 4U2YA 1SVDA 1EPVA 3ABOA 2DVUA 5HK4A 5A6BA 3TEVA 4HU3A 3VE9A 5DRCA 4J27A 1WNOA 1QATA 4BWLC 4E2BA 1FWHC 1LF1A 2V5BA 3R89A 5KETA 4Y8EA 3N6QA 2Q8LA 2FMNA 1QDSA 3ANUA 3CHFA 3Q4DA 2OSYA 2ZA1A 3BV4A 4DZHA 4KF1A 4ZGYA 1FP9A 4JGDA 3APGA 4QG8A 5BXPA 2XFRA 4B9YA 1W3KA 4UQCA 4ZCWA 4IX0A 5FSDC 2QIWA 3OYZA 1X6NA 4D2JA 4MJ2A 4A3HA 1F74A 5FJIA 1ADSA 3I4EA 4BY3A 1MXDA 4C6PA 4FF5A 3U4AA 3C3NA 4HA4A 4WGHA 4Q8UA 4QQ3A 1LLOA 1F05A 4LVAA 3VPLA 4HNNA 3B9OA 2YB4A 3MZ2A 1ZBVA 5H8MA 5JU6A 1BRLA 2GOUA 3WLMA 1OG0A 3RUBL 2UY3A 3UPWA 3VABA 4NHVA 2E7FA 4H8NA 3W85A 1SZEA 1B3VA 4U28A 2B7QA 5GNZA 1KFJA 1A5SA 2PDFA 4AWSA 4NZCA 3QPEA 3OHMB 3R10A 4HCLA 3WDPP 1DJNA 1KFCA 1MQQA 3GLCA 3L0KA 4Q4QA 4WRHA 1JUKA 3CQ0A 1P7TA 3LZ5A 6XIAA 1OFRA 2ZA2A 3EKLA 1Q7QA 3WX7A 2INZA 3GDMA 1H09A 2YDSA 3VKAA 1EYWA 1MSSA 4QR6A 5EMJA 1TMQA 4H3DA 2ZRXA 3QYSA 2YA1A 3BE7A 1SZRA 4GUJA 4IIGA 2E25A 2ZC8A 3W1XA 1I0BA 2YA2A 1XXXA 1JD7A 1Q63A 3O6CA 3MI6A 3ELFA 2VX5A 3BAKA 4O14A 3AS3A 3V5FA 4JX6A 2YDRA 1NOWA 3PPFA 3RM4A 3EEGA 4IX2A 1UIPA 1TSIA 4HPNA 4I7UA 4B5UA 1Z48A 1REQA 3MUIA 4CD5A 2C13A 3W2KA 1E1CA 3C61A 3QFEA 1A5NC 1EXPA 3T07A 4YYCA 2A2IA 4NF7A 3WYZA 3L65A 3PBWA 1U30A 4YJ5A 1EO5A 2FKPA 4H00A 1OB0A 3R13A 4DNHA 4DBDA 1D3HA 2FH6A 1PKYA 2CLPA 4IIEA 4NJGA 3S42A 1QNQA 3EA1A 1Q7ZA 4CU7A 1DJZA 1ISZA 3DH7A 4BJHA 3AO0A 5REQB 3THAA 1TTJA 3EMCA 3N2MA 3T2OA 2NT1A 1VQTA 1LJYA 3M0XA 4QG6A 3VOCA 4ECLA 3UA3A 3UPBA 4DY1A 3AICA 4K7VA 2PGWA 1J6PA 3WNLA 2G5WA 2F6UA 4KFNA 1D9EA 3MI3A 3B05A 1LRQA 1OBAA 3KLLA 1XBZA 1XLFA 3P67A 1KLYA 4CCDA 1Q6OA 2D2HA 2PEVA 4NI3A 3BQ6A 3O0FA 3TH6A 2MNRA 3GHSA 4XAZA 3ABSA 4PN2A 1H0GA 3S2MA 3HJEA 1L9WA 1GGOA 2ZDSA 2JBMA 1YPFA 3VDAA 1JVNA 2ALDA 3BSMA 1H4PA 4GYFA 1PDYA 4FB7A 2GVYA 3MYPA 4XK2A 4S2CA 1BWLA 4ROPA 3FIGA 2CFFA 3ZLFA 1QW8A 3ZLGA 4LB4A 3CXOA 2AL1A 1UQYA 4O17A 4P7RA 4GO9A 3BTNA 3VMPA 4CUCA 3NQBA 4YCPA 3CZKA 1PCWA 3RIKA 3W7RA 4HU4A 2AQWA 2QLYA 1JRBA 5FAGA 3ITOA 3KRZA 5ECUA 1C7SA 3RDKA 1CCWB 1ZTVA 4I8DA 5I09A 5E9AA 2DY3A 5GNXA 3K2GA 3DDMA 2VRQA 1W8GA 4INFA 2BX7A 4RW3A 4NAEB 3DUGA 4DUWA 5I0DA 4O0ZA 3A4JA 1R86A 3OVQA 4K37A 5F7UA 2TODA 1XIBA 2ZX9A 4L64A 4YVXA 3SQMA 1HT6A 3VMNA 2ZCGA 4MPKA 3DX5A 1XW8A 5D8ZA 4O18A 4BR1A 2G50A 1JCNA 2J27A 3KVMA 1OK4A 3ZVHA 3QYQA 3TLQA 5AC4A 1F8MA 3F7JA 1JZ6A 1M01A 3SURA 5FCZA 3RO6A 1XDJA 5CJNA 4DBWA 2DQWA 1Y5VA 3O63A 3C2OA 1XIFA 3G0XA 5KSWA 1SSDA 4E38A 5AKQA 4AQLA 3IAQA 4IQEA 1T99A 3FOKA 1EBGA 1CB7B 2G41A 3GU1A 2QCHA 4LQ1A 1XIGA 2YSWA 2B7PA 3PZTA 1TWSA 3CL7A 4E4UA 4AIEA 4GYPA 4Z0SA 1LLWA 1XBXA 4JEJA 3A4WA 5G4HC 2IPJA 5HATA 2UV8G 1JAKA 4IXXA 1M53A 3U9IA 3MT1A 3SCTA 1PZ0A 4XVDA 4U3AA 3VVGA 3I6RA 2P88A 5CSSA 1AA1B 6A3HA 1LL4A 1EA9C 4E2DA 4LUTB 3GHRA 1K9FA 2PUZA 4YXGA 3WQ6A 3BV7A 1R3WA 1YXCA 3NR0A 5HJYA 3PAJA 5DXXA 3LRKA 4O13A 4QJ3B 4LANA 3VDGA 5I79A 3UYIA 4RZ4A 3LXCA 3PAOA 5BOOA 4JTGA 3M0VA 3VNJA 4AD1A 5M3WA 1YNQA 2EPKX 2VZOA 3MJYA 2VZSA 3TV8A 2J6VA 4H9ZA 1R5YA 5LIWX 4JFSA 1W37A 2RJGA 4XQ6A 4OWGA 2ZUWA 4YTUA 5J04A 3EX4A 3R25A 4L7ZA 2ZE3A 3WUBA 4B92A 1JCTA 3DHDA 4X2RA 1EA0A 3WQGA 4B91A 1AODA 1NQKA 3C2VA 3L4VA 5FSEC 3FGCB 4NJIA 2DT3A 5FAJA 1S1RA 4AEOA 4JICA 5IBXC 1PX8A 2OVLA 3KTCA 1OX4B 1IXOA 1GWJA 5F2MA 3PZQA 3W1LA 4JXCA 4JIHA 1FFQA 1BLIA 4AXKA 1JCYA 4M7TA 1NDYA 1E4IA 2J13A 3LOTA 3QMRA 4HT3A 4AAJA 1W2PA 2CHRA 1J6OA 2A0NA 4NQ1A 4GJ1A 4MKNA 4MF4A 1VLIA 3NL2A 4AWUA 1V6YA 1SMDA 1J2BA 4OECA 5I07A 4TV6A 4DZIA 4H41A 4Z2KA 1IV8A 4DBSA 1XP3A 3TSDA 3URNA 3SR7A 4H6QA 3FAWA 1TO3A 4M0XA 4JZ5A 3C5QA 4YN5A 3PZMA 1W5PA 1JEZA 3OO2A 1U2YA 3DFTA 2IKHA 1RLDA 1B30A 1JZ2A 3OPSA 3NO3A 3GXNA 5CCZA 1UBSA 4A35A 3UR2A 3VGEA 1CXIA 4UFIA 3WK0A 4IQLA 1A49A 4AEFA 4QJ4B 4NT0A 1R9YA 2PU1A 3N9KA 3VDCA 5KZEA 4MAZA 1UR1A 3NUKA 5FI8A 2E77A 2IQTA 1XYBA 2VR5A 4P7OA 4OE7A 1OFQA 3UXLA 2QUUA 1DVJA 3T9PA 1F7BA 3NL6A 1GCYA 4RE2A 3TZFA 1ITUA 3EXTA 2EPMX 5DANA 3H22A 3LHWA 1JZ5A 3MY9A 1UWTA 5HUOA 1S5TA 3T05A 1XIJA 6CGTA 4ZE4A 4AWEA 3I7RA 1OIMA 5FF0A 5LGXA 5DF0A 1UR4A 2VVSA 3BSGA 1PIGA 3EDEA 1F3EA 3GW0A 4HP5A 4KGLA 2REQB 5I3HA 4QXIA 3DFQA 4QIUA 4DWSC 2TSYA 2F9RA 1JD9A 1PYFA 4W4QA 3VIKA 4ZQCA 3CPUA 1QJWA 3BH4A 1VGAA 1BGGA 4NP7A 4Z2LA 4DAFA 3MHUA 4QTGA 1ZRQA 1E6NA 2OU4A 4POCA 1RBAA 1M04A 5CPOA 4JTIA 3W7NA 2ZX5A 2VNCA 1QBAA 4GNKB 1EJUC 4NASA 4W7WA 4FLQA 2PGEA 3AHZA 3UYCA 3B0VC 3CUZA 2V2DA 2PDBA 1O60A 4CQBA 1EOMA 4RPPA 3TOYA 3H7VA 4O11A 1SR0A 2D3LA 1AZ2A 3ES8A 3BARA 3NPVA 2FGZA 3ALFA 4CNUA 4C1LA 1MRQA 4KKXA 5C9UA 2A85A 2PD9A 3CT2A 3NGFA 1R3QA 4P2VA 1PPIA 3GVWA 1RPKA 1XD1A 1EGMA 4AMAA 4HJFA 4MNKA 1MEHA 4QLJA 3ZIZA 3CUIA 3S2NA 2W67A 2EG7A 3AS1A 4M29A 3FVDA 8A3HA 4K39A 1QTWA 2H9AB 4JPGA 5AYYA 2DSZA 2VD8A 1F4HA 3NTYA 5CBJA 1ZGDA 3TW7A 4UTLA 4LGXA 4GC3A 3W6YA 1AW5A 3TMQA 4IGHA 4V28A 2OOFA 2YCIX 3IUHA 1GTEA 1B90A 1TE1A 5LNWA 3ARZA 5LIXX 5BWFA 3OBEA 3W7MA 2WK2A 3VOFA 4Y6GA 2VFHA 3MMWA 3LEPA 1KR0A 2PRLA 3GS6A 1JUBA 3DEQA 4TTUA 2G8ZA 3L0NA 4RNIA 3QHMA 2BVTA 9CGTA 1IWBA 1N7KA 2PFHA 1YRRA 4PUWA 1YBQB 3KCLA 3CMGA 3E96A 3G22A 3G1HA 3CUJA 3HPZA 3USZA 3N15A 5HQEA 5L9FA 3W29A 1V3IA 2OX4A 2Z24A 4CEUC 4D6GA 3XIMA 4CEXC 3W70A 1NWUA 1ESWA 3RPTA 2W9MA 3RM9A 1KNWA 1G7VA 1SJCA 3GNRA 3NIYA 4M6QA 1W3HA 2J9YA 1RY8A 4QSFA 1EDTA 2DIEA 5HJXA 3U7VA 2BXVA 2IUZA 3QPYA 3ARTA 2X09A 4OUIA 4EF9A 5FEWA 1H1NA 2YCJA 4RZBA 5D2WA 2DT1A 5A5WA 5K9DA 4B5XA 3RU6A 4O10A 3LZ3A 5KZ6A 2X7VA 5REQA 1QPNA 3UEQA 1AH4A 1UBPC 3REQB 4AZGA 1VEOA 1HKVA 3MJMA 3M43A 5A6KA 2WSQA 1D7FA 2G0WA 4GI6A 1DXIA 2A7RA 2ZTJA 3TN6A 2WZIA 2ZRVA 5GPRA 1NP0A 2O9RA 4LS0A 5LXXA 3TKFA 3UCCA 4RCXA 3S5OA 2V67A 3B0PA 3B04A 3GBDA 1QW7A 3TN5A 1V02E 3IIVA 1EKOA 1V3LA 3A13A 3UCDA 3DC8A 6TAAA 3A22A 4LF2A 3GE7A 3UVIA 1FWDC 3K8LA 2CNCA 3W53A 1FQ0A 3EMQA 3W02A 2PDQA 1P4CA 5LA0A 4RR4A 3QRHA 2AAMA 1EP1A 1XGZA 4XKMA 4OOUA 4YMZA 1EJ7L 1DQWA 4HMEA 4A8LA 1EOKA 2VC9A 4LV4A 2QPUA 2W62A 1TZZA 3R79A 1VCGA 5E0KA 4Q6XA 1VKFA 4OOZA 1ADDA 1EZWA 1TWIA 1KTCA 2DPEA 1OJXA 4WR3A 1NFPA 1XDLA 3SCPA 5A6TC 5I23A 5C71A 1H61A 3N19B 1UYQA 4X60A 1DE5A 4YHGA 4FXFA 3BAIA 3ARRA 3M0LA 1T96A 2DP3A 3HJZA 1GOIA 3L67A 3C0SA 3W23A 4J28A 3N6JA 1F73A 4IP4A 3TUUA 2VR2A 3FS2A 2PI6A 2C1IA 4WEVX 1BVNP 4D1IA 3TQKA 1VFHA 3SRDA 3FDKA 3QPZA 3TTOA 1P1XA 4NAFA 1EQPA 1ZY9A 5DELA 1A5AA 3D6NA 4I7WA 1IGWA 3O0KA 3PZIA 4XBJA 4F9JA 2E6AA 1TUFA 3RGTA 5DRIA 3W6MA 3KBVA 2MANA 1IT7A 3LXAA 1E9YB 4CGTA 4NZ5A 2X42A 4N9EA 2NW0A 1ODZA 2WVVB 4AWTA 2POZA 1TIMA 1F9CA 3T0AA 1XM3A 1PTDA 2QJIA 4UZUA 4A3QA 4PH6A 4MUZA 4RW5A 4ML9A 1UD3A 5F2IA 4JOMA 4W5ZA 2FTPA 2NXIA 1FWSA 1TPDA 3MUCA 3AXKA 3QZAA 4C6QA 3GNNA 4PCFA 4JS3A 1E56A 3SAZA 4NRRA 3H70A 2D3NA 5A8MA 4RV3A 1K7EA 3R0KA 2Z28A 1M1BA 1X1NA 2FLIA 3G6LA 3ZQ9A 3ZXWA 1FX6A 1EDQA 2Z25A 1JUEA 2ACRA 1AW1A 4NRSA 2AGTA 1Q8AA 3AQUA 1Q3NA 1OGBA 4UCFA 1RCOB 1V6XA 1OF8A 2B4GA 2Z1BA 1ZCCA 2Z26A 3FN9A 3AMKA 3NPUA 3W7OA 1ONWA 1GTHA 4U3CA 3TC3A 5HMFA 4C7FA 4DO7A 3GK0A 1MEIA 4JTTA 3TOPA 1VFLA 3DU0A 3LA4A 4DIAA 1QOQA 4XB3A 2CXEA 3CEUA 4R7JA 1LLZA 3AIQA 2Z6JA 1OFDA 4FPSA 2RHGA 2CWNA 4OTKA 4E3VA 1OVDA 1BQCA 4V27A 1R9XA 1JDEA 1ZJHA 3E2QA 1X1OA 4IPJA 2WPGA 4O4WA 1OX4A 2QYGA 3T08A 3SBFA 3LPPA 3LGDA 4M56A 1W91A 1RD6A 1OHLA 3LNMA 3ATZA 3PZNA 3R12A 3I3BA 3GYCA 3ZR4A 5LNSA 1PYMA 4UQEA 3WLOA 4O1FA 2E9LA 3AMDA 5DBTA 4AD3A 3OVRA 4B5NA 4HVXA 1K8ZA 2HTMA 8XIMA 2TPSA 5LXEA 3LCGA 3A5FA 3URQA 1O68A 1T6MA 4ZOBA 4EAMA 4KWWA 3O15A 5FJRA 5E0CA 1EWEA 3C2EA 1TPC1 3C2FA 3PJXA 4MWAB 4F0LA 2P8CA 4W8BA 3VKDA 3WNKA 2O4MA 2XN1A 3W7LA 2ZZ1A 1EL3A 7XIMA 1Y5WA 3E12A 4O19A 2OGYA 1PWLA 5BRQA 3ES7A 4HSOA 2YCKX 1GW9A 1GQLA 3N2CA 1JQVA 4C65A 2NUYA 3WEMA 1A0CA 5LSMA 3OGSA 3UZZA 9XIAA 3NVTA 3OBKA 3RHGA 3SFKA 1YX1A 4U5KA 1XCFA 4AHQA 1KCKA 4Q8NA 1XYAA 1B4EA 1O12A 2CLOA 1DTUA 1KM4A 4D6JA 1FHDA 4H9MA 2X2GA 4A2RA 2YOCA 1J18A 4HYRA 2BGSA 5E0FA 4KPLA 1ZUAX 1C93A 1SJBA 3N2OA 2V8ZA 2ZDRA 3APYA 1KLZA 4J2MA 3W6LA 1ENUA 1QI0A 2WBKA 3CV2A 4GOAA 3QLLA 3CAQA 2E40A 3GRIA 1OFAA 1O4UA 2NQZA 4XZWA 1XCWA 4TU1A 4BEUA 2QDDA 3L4XA 4UOJA 2V9DA 4MWAE 4DF1A 4YNGA 1VEPA 4GHRA 3UR7A 3U57A 2OZ0A 1VYPX 4Y9PA 4KERA 3G1VA 1UKQA 1TVLA 2WMIB 1FXPA 3DESA 4A8RA 3L2IA 2ZADA 2REQA 1CLVA 3NOYA 3GR4A 3TONA 1XF0A 2XTKA 4Z42C 3V18A 5G2IA 2W61A 5TNVA 1KQZA 2GDQA 4UMAA 2F2KA 2JQXA 4FLOA 4AIOA 1NFBA 4DJEC 4TMCA 2DZUA 1GJUA 3OYXA 2UZ9A 2WANA 3LTYA 1CXKA 3IUDA 1ZAIA 4NNCA 1LT8A 2ALRA 4G8TA 5BNKA 1S38A 4IQJA 1YNYA 4DUXA 3EA2A 3VGHA 1IYXA 3GTFA 2OR2A 2ACQA 3ATYA 3NQFA 3EOEA 4DF0A 3G8RA 1R38A 2AL2B 3PY2A 3W1QA 1I60A 4XD6A 4MY8A 2DZPA 2TAAA 3KWXA 1TX2A 1GOOA 2QDHA 3GIQA 5HWJA 4PBEA 4XBKA 3AWNA 3EWBX 4CNSA 1QPQA 1SW0A 4AZBA 1TA3B 3EPOA 2OFJA 4NZFA 4QQUA 1UC4A 2BSLA 4YU1A 1RUSA 1US2A 3VUPA 1J79A 2J75A 4EKJA 1E6ZA 3WMLA 2VQUA 5D2VA 3USBA 2H9AA 3S1VA 2D22A 1JXKA 1XFBA 4M1BA 2VCCA 3EPNA 1BG9A 4H9TA 4H7VA 3HQNA 2J88A 3CNYA 2PDGA 4IMFA 4QJ1A 1SO6A 4Q32A 4C6FA 4LS1A 2E6YA 2YIHA 4E8CA 3L5AA 3BURA 3ITVA 3VOIA 4B4FA 4XUYA 3FCPA 4WIWA 4GMEA 1U5HA 1GG1A 3RRAA 1HJUA 4XG1A 1LG2A 1ME8A 2J77A 2ACUA 3CEPA 5F4XA 3WD4A 1PHWA 2IQDA 2V38A 4LUYA 3G1SA 1DEDA 3FA5A 1NELA 5EBUA 2X1UA 4PMZA 1XLLA 3VCCA 4Q3MA 3NQGA 2B0MA 1C9DA 3FVMA 1GOXA 3QVQA 4I8YA 4PUDA 1TCMA 3IJIA 4DJFD 1D8CA 4CCEA 4MB4A 4MYAA 5BRBA 4N9DA 1Q66A 3CWOX 4B2DD 1OZMA 2PPGA 4R7OA 1O6IA 3BLFA 2VJXA 3RN6A 4L65A 1UH2A 5I7GA 4ML4A 2WMHA 3AHVA 2PTXA 4JQ2A 4BF7A 3C52A 4GFIA 1WAUA 2CPUA 3WFZA 4CQCA 3B8SA 2QCGA 2PRMA 5A2CA 3AU6A 4HNUA 2YDQA 3K1DA 3GXIA 2GLKA 3BOFA 3UT0A 3QY8A 2J7BA 3EA3A 5DY3A 4WK9A 1V8EA 4ZQNA 3VINA 4P61A 3GQYA 4JHZA 3HPFA 4E6MA 4M82A 5CG7A 4H6EA 1FWIC 3REQA 4MHBA 1BYBA 3BJTA 2OZ3A 3NURA 4CD8A 1PKNA 1XKJA 2JK2A 1KXHA 3ITCA 1R46A 4EPDC 1WAWA 4ZOAA 4FNQA 3F2DA 2BOEX 4YCOA 5SWUA 3PZVA 3V16A 4N9BA 1F61A 1WZLA 4H4IA 4Q7BA 1ITCA 1BEUA 2OYMA 1US0A 2WNQA 4LCSA 2PDYA 4N4QA 3LLFA 3W1MA 2ZX7A 1OM0A 1XG3A 4YS1A 2PDWA 4MMWA 4DLFA 5C9ZA 1A5UA 1S2CA 2FVLA 3CUXA 3LBMA 3TW6A 3FHQA 3VDBA 2R91A 5XINA 2PP1A 1W1TA 3APTA 3CHDA 2OSWA 4DBEA 1TV5A 3G6MA 2WWCA 3GBEA 3W28A 3ZOAA 5D30A 5CGTA 2PCEA 2CLEA 3CV1A 3B0YA 4HOWA 4DB7A 2X30A 1S5VA 3O3RA 1TVPA 4C6NA 3QV6A 3QQ0A 2WMJA 4K36A 2XFWA 2GWNA 4DXXA 1OY0A 4HA3A 4KCWA 1PS9A 1BVZA 3P6LA 5JUVA 5GNYA 3RJYA 2JKPA 3CK5A 1S2VA 4X9YA 4S3KA 2ACSA 1J10A 2CBIA 5F2GA 1PTAA 1T7LA 3MP5A 3ISIX 1NDZA 5DMLA 1P1MA 4J40A 1S5NA 2AKMA 3WMSA 3GZAA 1NAL1 2FPYA 4CNTA