1JPKA

Gly156asp mutant of human urod, human uroporphyrinogen iii decarboxylase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFADAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROPORPHYRINOGEN DECARBOXYLASE
publication title Functional consequences of naturally occurring mutations in human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 126
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1jpkA00
3PPHA 1XDJA 3GVQA 2INFA 1JPHA 2EJAA 1J93A 1R3QA 3GW3A 1XPGA 1T7LA 1R3RA 4ZR8A 1JPKA 1UROA 2Q71A 4L5ZA 4L65A 3GVWA 3PPCA 4ZTXA 3T0CA 3CYVA 1R3VA 1U1HA 4AY8A 4WSHA 1U22A 1U1JA 3PPFA 2Q6ZA 4L61A 4EXQA 1YPXA 1U1UA 3BQ5A 1JPIA 2NQ5A 4L64A 4QQUA 4L6OA 4L6HA 3PPGA 1R3WA 3BQ6A 1R3TA 1R3SA 1XR2A 3GVRA 3L7RA 4AY7A 1R3YA 3GVVA 3RPDA 3GW0A 4ZTYA
chains in the Genus database with same CATH superfamily
4LVBA 3NQMA 3LI0A 3REQA 4AZ7A 3GIQA 2GZXA 3GXIA 3VE9A 1UKOA 4IT1A 3QEZA 1AW1A 3O06A 2PGWA 4FIQA 3AS0A 3LBCA 3D0CA 1J5SA 3O0FA 4H7CA 1DIKA 1OIFA 4C5ZA 2PBGA 2PUZA 1RSCA 3CHEA 4L5ZA 1VQTA 2I14A 3IJ6A 4FLSA 1OFBA 5LNUA 4GC3A 3G0UA 4NILA 1FH8A 1XBYA 1IEIA 2POTA 3ZLHA 3L5MA 5E93A 4GFIA 3H53A 1TRIA 4LX4A 1GYMA 4S3KA 1B4EA 2DFAA 3N34A 3NYZA 1KR1A 1QHPA 3RXZA 2PU1A 2J77A 4H2CA 3CPUA 3GKAA 4GVGA 1LL6A 2XM1A 5FJJA 1JR1A 7REQA 4UUIA 5E9AA 2R24A 2Y89A 2Z7KA 4NJJA 3FDGA 4KWVA 3GE7A 2YDRA 2YXOA 5A6AA 4XZMX 2SFPA 1KBBA 1LCOA 5BU9A 1VAHA 3UQNA 1PHWA 5F2IA 4F0MA 5E0FA 1DWHM 3II1A 2BDQA 3TTOA 4KFPA 3TLQA 2W27A 3WQEA 1E6NA 2J24A 5I6SA 3W7LA 3PY2A 2OWWA 2NXGA 3EB2A 4GMEA 4PULA 4F2UA 4J3TA 2IS7A 5IBXC 3LHTA 2ICSA 1UZ4A 1VFTA 3PSWA 3CUJA 4JFTA 3WH6A 1DEDA 1FWHC 3AALA 2Y5SA 2VWSA 4HBKA 5I07A 7TAAA 4GINA 1DXFA 2EKCA 3AZRA 4AHOA 2WLZA 3ARVA 3WX7A 2GGGA 3QZEA 3IIZA 4C1NA 4PUNA 3ITGA 3GTHA 1UKTA 2GVYA 3AUOA 4Y8EA 5BMXA 1KCLA 3CWHA 3ALFA 3KTSA 1NJJA 2PP3A 4PODA 4C6PA 3ARZA 2I17A 3MMDA 3TJLA 1KBKA 3EWXA 4HNTA 4KRZA 1ZALA 8XIMA 4QR6A 4JEQA 3ECQA 4CKQA 4HNLA 4K6AA 1AK5A 1GZ1A 2R1PA 5LXXA 4JBRA 4GJJA 4PL1A 2VUNA 1WOAA 3TOPA 3BSMA 7CGTA 1ONRA 4K1WA 1FP8A 3IEBA 3QPYA 3WUEA 3LBOA 1K7XA 1ME8A 2O9OA 1P0BA 4C6EA 3EKGA 4NUWA 3WNOA 4Z42C 3HG3A 3M0ZA 4RE3A 2HS6A 1LRTA 2HPIA 1Z89A 2V3FA 3U8GA 4ZOAA 1Z9AA 1Z8AA 5HULA 1OABA 1W5QA 4FNUA 4WSKA 1SO6A 3H2FA 2BGNE 1G4TA 2HBVA 3SN0A 2JIEA 3VX1A 3L2LA 1YBQA 2ACRA 3IWPA 1WQ5A 1Z44A 1A5MC 3NZQA 3MO7A 2IUZA 3IIVA 3HMJG 3GNNA 3B05A 2E8YA 1TUXA 1ADOA 3ABZA 3UJEA 4EXBA 3NCOA 4F2TA 3R94A 4IGHA 3CO8A 4GYPC 1VS1A 4CEXC 1GVRA 1TR1A 3JR2A 5JU6A 2G3FA 2QDGA 3B9OA 1V3HA 3W7EA 3W7CA 5HQMA 2FGBA 4AX6A 3E1F1 4DVOA 4CCZA 1GOMA 4O19A 1W32A 2Z2BA 3PBVA 4LFYA 3ARQA 3VDCA 5D2WA 2BLEA 3REQB 4CN6A 3PJXA 1IT7A 6REQA 3MV11 3PZIA 4X9SA 2IMRA 3GHRA 3HN3A 4MB1A 2WZEA 2PEVA 4XISA 1TIWA 2GQ3A 5F1UA 3FYOA 2AGTA 4ZZ9A 1ZU8A 3CASA 1WP6A 5HNRA 3UG4A 4IQDA 2WZIA 1EOMA 3CUZA 2DZAA 3FY1A 1H62A 3URBA 4H01A 1U5JA 4LBUA 1JRCA 5D9PA 1GYLA 2VX7A 4XKYA 1AODA 4MWAB 3FA5A 1H5VA 1T6MA 1KKOA 1P7TB 3MUAA 4DQWA 2ODOA 3THAA 2WMFA 3L4ZA 3KCJA 2W79A 3AU6A 2NW0A 1G4PA 2Z28A 1LWHA 4MPKA 4K36A 4KWWA 1V6WA 7REQB 3TN4A 3UXDA 3WUGA 4XTIA 3NWRA 5AOUA 3BWWA 1FCVA 4ZQNA 1JCMP 3UD6A 4IIBA 3UY7A 2VEIA 1M7JA 5H8MA 3N2MA 2PCQA 2XM2A 3GR8A 3G6MA 3ME3A 4C6DA 3BSGA 3P74A 3UERA 2FGLA 4IICA 3WQ5A 4IPIA 5FI8A 1W3HA 3LV6A 2GGIA 1TWSA 4JQ2A 3TMLA 1SZNA 2CHOA 4B4HA 2CZVA 2Y61A 1V6XA 3PBGA 1OSEA 2OYKA 3I4EA 1OF8A 4JTUA 3WEZA 5XIMA 1JQXA 4GKLA 1SZRA 3FXGA 5TIMA 4UFLA 3NQ8A 4CUCA 1QDSA 3UZYA 1K6WA 4ERGA 1UUQA 4C6NA 3WQPA 3E38A 1QPKA 2XG9A 1GCYA 4GACA 5CBIA 4ZSUA 1O68A 3DHFA 3G1SA 4Y6GA 3M4HA 1H11A 1O5RA 3WN6A 3TW7A 1EPXA 3NDOA 2V5BA 1XLLA 3WF2A 4C1NB 5EFDA 2PDUA 4Q8PA 4HSHA 4WX2A 3P5YA 4GKTA 3U4FA 4MWAC 4K8GA 4QLLA 4RV8A 3VNIA 2GUBA 1KM6A 2OKOA 3W7QA 1NQ6A 2ZVIA 5C6MA 2A3AA 4Z17A 3GAYA 3UXIA 4PTVA 1XIMA 2V63A 1R3SA 3EOLA 3FSTA 3WBXA 1BXBA 3T09A 4DUWA 4IXXA 1DIDA 4Z2JA 4QNWA 1M03A 4XVDA 4QSHA 3L4YA 1W9UA 4LANA 4LUJA 5FJTA 4L9XA 3LK6A 1SSDA 4HTYA 4ORMA 1YNQA 3WO8A 1R3YA 5IFPA 4UOZA 4YWSA 1W9VA 3PUGA 2XPKA 3AJXA 2CBIA 3KP1A 3TW6A 3GY1A 5KZ6A 1G0CA 2O9RA 1MRQA 3LTYA 1BSIA 3N13A 2R1KA 5REQA 2HNEA 3DERA 1Q45A 3SFWA 5FJIA 3L66A 4LUSB 1BEUA 4UQAA 1F4AA 4V1XA 2F6XA 4POCA 2E77A 4HPNA 3GM8A 5I03A 5KZMA 2O9PA 3M46A 2DT3A 4JHMA 2WB5A 3U0HA 3DU0A 2HROA 3K4WA 1ICPA 4H8NA 3P0XA 1YBQB 5AN7A 4PEEA 4YPJA 3MHUA 2ZRUA 3B0PA 4N6EA 1ISYA 4U3AA 3R0KA 2XWEA 1VIWA 3GXDA 4R9XA 3ZO9A 2Y63A 1QMLA 4NZJA 1AL7A 4I7VA 1IGSA 2FDSA 2Y7FA 1ONXA 3KVLA 3CAWA 1RALA 2VC7A 3Q58A 2YXGA 4B4FA 2RDUA 4ZB0A 3GC4A 3VGBA 5DN1A 4QISA 4IHCA 4KH2A 3DOPA 2IPJA 4GUFA 1NWUA 4FNRA 1W3KA 3UWYA 4H19A 2OX4A 3DBPA 3UYIA 1DJYA 5C2GA 4OV9A 3WQOA 3CH0A 3WCZA 1R47A 2ZZ4A 2CYGA 2J7EA 4W4QA 1OCNA 1EQPA 2V81A 3AOFA 2A3BA 2WXDM 1AUSL 2OQHA 1X97A 3VUPA 4L56A 1QPQA 3TOYA 2VKZG 1X96A 3ITCA 2WCGA 3M47A 3C2RA 4JX6A 4L7ZA 4QDMA 3QW4B 1W5PA 2NX3A 1LBMA 2QUTA 1FY6A 1KM3A 9XIMA 4YVVA 1O60A 4E6MA 3VOIA 1B3VA 1DQWA 1C91A 2W91A 3AZSA 2FHBA 2YCLA 2QVHA 2NUWA 3DIPA 1A3WA 4XO7A 3VTRA 3UZWA 1XYAA 2F61A 1V77A 2VCAA 3OYZA 3OJGA 1RLDA 3W7KA 5CLWA 3KL5A 2QQ6A 4EIVA 4JTFA 4MJMA 4AD4A 1EPVA 1W31A 2ANUA 3AMCA 5CAKA 1J6OA 5C9RA 3WQFA 1O12A 4L1XA 4DM1A 3MDUA 1W1YA 3R58A 3UZJA 4ZENA 4S23A 3SCSA 3W0KA 2CBVA 4GO8A 3SCRA 2GSJA 2B7PA 3NZ1A 5TF0A 2TMDA 1NM9A 1E4MM 3RLGA 1KB3A 1XGEA 5I3GA 2OXNA 3ZR4A 3PJTA 3K2GA 1C3FA 1F3EA 5I0DA 3BLKA 1EH9A 2YKKA 4LUYA 3TA9A 1NTHA 4DBWA 1MSSA 2XDFA 4UQEA 2G41A 4ZMGA 3GBEA 5AZ1A 1RP9A 1MDRA 4PH6A 3ES7A 2NQHA 5KZDA 1O5XA 4LS0A 3PAOA 3P82A 3VIKA 1LT7A 1PL9A 2YPIA 3ZSTA 3TCEA 4BF5A 4IGSA 2AL1A 2JE8A 4IGNA 3TQ0A 1JUBA 3CNYA 5DLCA 4GOAA 5D8WA 1KLZA 1C9DA 5HMDA 4CCCA 3EPOA 1HW6A 4TX6A 4RZ5A 4GGHA 3NAVA 4Q8TA 5ABFA 5G1YA 3T4CA 4GA8A 3WD4A 4L1GA 1TSIA 2POZA 1UUOA 1VZWA 4JZ5A 4A8RA 1PV8A 1K02A 1I1XA 2C1IA 3R13A 1Q6RA 2V68A 4RW5A 4AYGA 3UPWA 3ARRA 2BGQA 1H7WA 3WJWA 3L0GA 4AEOA 1G01A 4XD4A 4KIEA 3QMSA 3PZGA 3GZ3A 4GJ1A 2HXUA 1OWQA 2W67A 5CG7A 3KHJA 1ZP3A 1XBZA 2JF6A 1E5NA 4DHGA 4WKFA 1V3LA 3DESA 3QM3A 2XZ7A 1GVFA 1YDOA 5D03A 2I56A 3GHUA 1FWCC 5C2CA 3SCNA 3NL6A 5CG0A 4Y9PA 3QBUA 1M53A 3V1PA 1UC5A 1PKYA 3L5LA 4IMGA 2E6AA 1OFAA 4RXGA 4HKPA 4QDWA 3XINA 4IMDA 1BWKA 5HWJA 4P7NA 5REQB 2VTFA 4GFSA 3USBA 1E4IA 2RDWA 3T08A 2F7FA 4AIEA 1B57A 5KITA 1P6BA 3W24A 5CSRA 3NZRA 4HB7A 3QF0A 1JGMA 1FVPA 1UPPA 4S3CA 1U33A 2Z1KA 2ZUNA 4XO6A 1NDYA 3AISA 4FR6A 2OFJA 1Q7MA 3K8MA 2Z1WA 1V03A 3N6HA 5D09A 4XIMA 2B31A 4UNIA 1US3A 1QHZA 3UWZA 4PFHA 3W6YA 2VT0A 3C0QA 2P0OA 5HDRA 3HPAA 3SN4A 3NYDA 1F7BA 2PGEA 2WQDA 2Y7EA 3N73A 2QXWA 5A8OA 5EMMA 1A5OC 2Y5EA 2B7OA 5AKQA 3B9NA 3N11A 2ALRA 3OTRA 3ABXA 5E70A 3WD0A 1RQHA 4YWIA 3OGSA 4IMAA 4C6KA 3CPRA 1D3GA 2FVLA 4LTSA 1UWAA 3OB8A 4X22A 4GUJA 1I45A 3DDMA 4OBSA 1HKKA 1OCBA 4K39A 1VB9A 5A8MA 4LWWA 2CLMA 4CU8A 1WA3A 4D6GA 1RHCA 2HSAA 4N42A 4B5UA 1SW7A 3UWUA 3M0IA 2Q01A 4H9MA 2OYLA 5GNZA 5A1AA 1R3QA 4D8ZA 3WD3A 1D3CA 2YCLB 2PE4A 3C2YA 3PB2A 1BPLB 1Q66A 5I23A 1XD0A 2NLYA 3W83A 2QKFA 4NNBA 4ROPA 2HDJA 3AI0A 3EMQA 3CQJA 3KCOA 2ZXAA 2D1ZA 4RNIA 2C16A 1W3LA 5DO8A 3W2JA 5CZ0A 4WDXA 4FI4A 3IK2A 5D2XA 4RW3A 2HVNA 2VFEA 3GNPA 3CC1A 4BI6A 4DYKA 3FAWA 1GEHA 5HPCA 4WJ8A 4ENLA 1OIMA 3ARXA 4P8WA 3CLWA 1ICSA 2VCBA 2DZTA 3G1XA 5FJUA 3LGDA 1VRXA 3VILA 3KHDA 3WQVA 4NXSA 4X60A 4KPLA 4D72A 2WHKA 2J8TA 3M0MA 3W02A 4Y2WA 4U31A 2W0UA 3V5OA 4BCEA 2HRWA 2Z0IA 1EC8A 1E43A 1E40A 2ZUWA 3IUIA 4Q8OA 2VFGA 5D33A 2B7QA 2DZBA 3PK7A 3W74A 2GVEA 2PD5A 5EMJA 3W01A 4L6DA 1NU5A 4WJEA 2H8XA 2BTMA 1LWIA 2GJLA 4IFKA 3R25A 1G67A 1KFJA 2HJPA 4UTWA 1SO4A 5IOBA 5ABFB 3AXMA 2MUCA 4GCXA 1Q6OA 2PURA 3WLNA 1E72M 3U57A 1S3HA 1IZCA 1XWYA 4QCEA 1BGAA 4MTVA 1E4LA 3L23A 1W54A 3VD5A 2H90A 1D8CA 1LQAA 4JIIX 3WQ8A 3HGRA 4AD5A 1B90A 3EOUA 3K8KA 3BCJA 4FIRA 1OGBA 5BXSA 3IIXA 2JBMA 3KRBA 2ZRXA 4S2BA 3TX9A 4E2BA 5LIUX 5HNTA 1YPFA 2X0HA 5DRIA 3S9IA 1T96A 3PZMA 4GK8A 1LM1A 4ATLA 2Y0FA 3VIGA 2OSXA 2QCHA 1VEPA 4W89A 9XIAA 2QCLA 1XCWA 2A6LA 2GL5A 4I6KA 2PLCA 3A12A 4ZQMA 3TAKA 1L6FA 2DPEA 4NX0A 2WKJA 4NP7A 2P53A 1E6PA 3JZUA 3K5XA 1R3TA 1O94A 3SB0A 2J6VA 3H23A 3SCPA 3V0UA 1WDPA 1C8XA 3QHMA 1OD0A 4O52A 3PHAA 3CH9A 1EJXC 2J25A 2WBGA 1IE7C 4GIEA 5D30A 4Q4KA 2CZ5A 3U2ZA 2Z1VA 2Q3OA 1W1ZA 1S3TC 3LNMA 3MANA 3TFXA 3HPXA 1UOZA 4O0ZA 3OLDA 4IPNB 2QUNA 2Y8UA 3WLTA 2EJAA 4H9UA 3CAVA 2QT3A 2RDXA 2QCMA 1R3RA 4UQCA 3C6CA 1M5WA 3T0AA 2A79A 4BR1A 4BEQA 1XIEA 1NFPA 3DG6A 3TZFA 3WBEA 4PMDA 4OUIA 1LROA 2VRQA 1E1EA 4CNOA 3AIUA 3F5KA 3IGSA 5CQ1A 4ROQA 2XN2A 1K8ZA 1KGWA 4O54A 3OVGA 3UG5A 3STCA 3GDMA 1P1MA 3VOGA 1UBSA 1Q6QA 1IF2A 5A8PA 3KE0A 2XN1A 2XIOA 5HR7A 4JX5A 4IIEA 3U6WA 1IWBA 3FFSA 4NI3A 1XRVA 2GK1B 1JCTA 3L5AA 5F7UA 2J7FA 1LTDA 1K4HA 1X1ZA 3EOOA 4YVPA 1IXNA 1BTMA 3ATZA 1DL3A 3HIJA 2REQA 3MA8A 3U9IA 1XPGA 1EF3A 1H51A 2CFFA 1XYCA 3GFXA 3TC3A 3I6EA 4HHHA 5I7GA 3DN5A 3WD1A 4D8LA 1XLIA 2Q8ZA 4PEKA 3TMQA 3MC5A 3L2MA 3EXRA 2Z7GA 1EJUC 3O6AA 1UH3A 3T44A 5ABHA 1DIEA 3ZT5A 2P76A 3ZT6A 1CXHA 4XWUA 3RM8A 1PZ1A 3VNYA 1GW1A 3T2QA 3G0XA 1TVLA 1XRSA 4PRWA 5AYYA 5IM51 2VC9A 3ZXWA 1TV7A 3NNTA 2I5IA 1JULA 3TC7A 3HMCA 4OV4A 3VD3A 4EVZA 2ZA1A 5CCZA 4DXXA 1Q6EA 1VEMA 2UY4A 4LUTA 1KWKA 1H0IA 1TPFA 2WSKA 4QLKA 3EBVA 2XFWA 2ZCGA 4HNOA 1S1PA 3APYA 4Q3MA 3WLKX 2I5QA 1XH0A 1OC5A 2Z26A 1X6UA 3LYEA 2JQXA 1Q6LA 3VDHA 5LKYA 4DWSB 4ERIA 1IR2A 4G6CA 1E9LA 1CDGA 4O11A 4M7SA 1OQFA 4AZBA 4B3ZA 3NQ7A 1XP3A 2YFNA 2FDMA 1GOIA 3TVAA 4GISA 4HSNA 4FLOA 2FB2A 3WEMA 2V2DA 1RUSA 5JIPA 3CB8A 3AIQA 1JCLA 1C8VA 4IFKB 3RITA 4ECLA 3OO2A 4D8AA 1RCXB 2Z1XA 4QX4A 4NI8A 1WZAA 1T8QA 2FTPA 4JFSA 1JD9A 3IGXA 4AEFA 1S39A 3WFAA 3TN5A 4O50A 1RV8A 3PWGA 3DXIA 2R8WA 3VK5A 1QWKA 1VKFA 1OX4A 2YR1A 3E9AA 2EPNA 1RPXA 3EWWA 3CL7A 4G56A 4IISA 3AS1A 3AHXA 4LB4A 2XVPA 1JI2A 2ATSA 2GVLA 3MU7A 3CMJA 1DE6A 3LSBA 2VXNA 2EBNA 4RPPA 3OIXA 1UD8A 1GT8A 4TO8A 3L4VA 1OCJA 4MAVA 3RRAA 3EDDA 3UNTA 2FJUB 1FA2A 5DMNA 1LRQA 2OWCA 1HKWA 5A6JA 3OLEA 4W87A 3P8IA 3QSRA 2E9BA 2WC4A 5C2XA 2ZA3A 5AHFA 1AH3A 4QQ3A 1F6PA 1MXGA 5T9BG 1PWLA 2Y7GA 5EB8A 1NOWA 4UMCA 5A94A 4WLCA 5G4WA 2YLLA 5D9MA 1FXQA 3LQGA 4QROA 3LV5A 1CGXA 3VD9A 5EBUA 4DWSC 2Z4GA 1K6AA 1LLWA 2FB3A 1V93A 2NWSA 3VMOA 4MWAE 1AW5A 3BURA 1WUEA 2VWTA 3CAQA 1W5OA 2PRMA 2PD9A 1MFVA 4OECA 1QOPA 2XISA 2FIQA 2G8ZA 2J7BA 2QCFA 5D9OA 2CZFA 1X6NA 4JIQA 2EPKX 2XIQA 4PSPA 2V5CA 2OR2A 5BOOA 1LDCA 1TMLA 1ODZA 2NVAA 4A35A 5FF3A 4F9DA 2HV5A 4JKKA 2X2YA 2YA0A 3QC0A 4CNSA 5DQPA 4AG0A 3BOFA 4U2YA 1KFWA 4O1FA 3BAWA 3T8QA 3MHFA 5HUPA 1B5TA 2BS9A 4PYSA 3S2JA 3LI1A 3QR1A 3V1HA 1I1WA 2BGSA 2W63A 4RK8A 4WXZA 3UJ2A 4Y9OA 2GSEA 3CT7A 4XSLA 3VKCA 2DW7A 1E1CB 1WZKA 2VEMA 3KW3A 3KVMA 1W9DM 4U5IA 1Q3NA 1DJHA 2WNNA 3BZJA 3HOJA 1GHSA 2QPXA 1R3WA 4HHMA 3GXNA 2D2OA 1CECA 1V3MA 3BGGA 3B4UA 3GG7A 1PTDA 3H2AA 1AMYA 2REQB 2HXTA 4GUIA 2WZHA 4IJRA 3H8AA 2G3MA 4E3TA 3MZNA 1V8EA 1WKFA 1J5TA 2YOCA 1HFBA 4WJXA 4ZOCA 1YTEA 4ADSA 4B9YA 2CZDA 2OO6A 2C91A 3M07A 1RY8A 1KQYA 4NRSA 5IHRA 1W5NA 3W7JA 3PJWA 3UU0A 2ZX6A 4K8HA 4IL2A 4B5WA 2CLHA 1W9XA 3AJ7A 3GRIA 9RUBA 2ALDA 3NL2A 3RM4A 2A1YA 1P48A 5LIWX 4MDOA 4R7WA 1RJQA 3VNLA 4ZQOA 2OLAA 1KLYA 1H2JA 1QI2A 1XX1A 4E2DA 4XIAA 1GVIA 1VC4A 1FRBA 4Y7EA 3GX9A 3C0LA 3VOCA 1TJ2A 4WR3A 5XINA 1CXEA 1CWYA 3DUGA 1D2KA 2DZWA 5D4YA 1XYFA 3N4EA 5FKYA 4LUTB 4PE8A 5K9DA 1Q6FA 4S3EA 4UB9A 3IIOA 1UWRA 4AVNA 4GBDA 1XLMA 3U2EA 4EACA 1JIBA 4FNSA 4ATDA 3H2EA 4KEVA 4IMCA 4JDYA 1S2TA 1LQ2A 2WPGA 2WMIA 3VFLA 3ENLA 4Y9MA 3SBFA 1P0KA 5B80A 1LRNA 4E2VA 2ABBA 3FGCB 3WLRA 1BQGA 2QPSA 2DUZA 4DO7A 3RLUA 4G7FA 3A23A 4TVDA 3LRLA 4R5EA 3APTA 5A6SA 5GQBA 3L2IA 4M8UA 3N4AA 1OX4B 1RCOB 5AVNA 2XH7A 3QOMA 5G1MA 2QVNA 1GJUA 2CWNA 3GG8A 4J7RA 1R9XA 3RM9A 1IEVA 3QY8A 1QI4A 5CPTA 4DPQA 2CLPA 4XVEA 2Y24A 4NKCA 2DGAA 3DFOA 2I9UA 5DCBA 3UXKA 4N7QA 5A69A 2X41A 1DWFM 3WLOA 4AVOA 4LF2A 4FEZA 4DO4A 2G37A 1KWGA 1UP3A 1Z6KA 5EGRA 1XLAA 1O5QA 4I6VA 2G96A 3RRXA 1A0DA 4G2DA 3TR9A 4LUIA 3U4AA 2DU2A 2ISWA 4PUDA 3MUIA 4IPPA 2Q3RA 2YXXA 1XYMA 3QR3A 3MCOA 3SQLA 3HV8A 1OVDA 2A3HA 1HJSA 2OZ8A 3BJFA 2CHRA 2VZVA 2PTWA 1Y0EA 3FJ6A 4F3HA 1GOQA 1UZ1A 4O4WA 3FCPA 3WK1A 3GHTA 1B4KA 2MANA 3KOXA 1WOBA 3OIHA 3UNDA 5DMYA 5LHEA 1W17A 1L8NA 4U28A 3F4NA 5F4XA 4QE4A 1XGDA 3E2SA 4W7WA 4JTIA 3WNPA 3W27A 1F2JA 4A3RA 2D23A 3KTXA 3C0SA 4GYFA 5JBDA 3QYSA 1SZFA 4GXMA 1ZY9A 2ZADA 1TYGA 4RR4A 1UQZA 2NXHA 2CU0A 3PPCA 5AHLA 3SM0A 1KR0A 4DZAA 4DXKA 1QRQA 5MHBA 4YTQA 4PL2A 5DXYA 3CWNA 1UR2A 3I3BA 4XG1A 1NQKA 2Z1BA 3BZGA 5LZLA 2PC8A 4DO5A 3K30A 4DAIA 4S3GA 4F0HA 1XLDA 3O9NA 4MADA 3WY1A 2BHYA 1RQBA 4G1NA 1TO3A 2CLEA 3BAXA 2BASA 5JBEA 2GSHA 1RBLA 3HB9A 4ASTA 3OVPA 1G4SA 3BCFA 1J0ZA 2QDHA 3IV3A 4E4PA 1WDSA 5HJXA 3E3HA 3T81A 4LPCA 3G1RA 2OX1A 1VH7A 1OBAA 3EX1A 2A4AA 4RL3A 3M64A 1PZ2A 3WH7A 2R94A 2A6NA 3PJUA 4P61A 3TN6A 3URAA 1YKWA 2DZUA 5C7VA 3LPGA 2FPTA 3GC2A 2E9LA 3B8UA 2UY2A 2F2KA 4C90A 3UR7A 4I9AA 2VZOA 3OW1A 4Z2KA 3LSCA 2QCNA 1JI1A 1M04A 2KX9A 2GOKA 4A05A 4KRTA 2GJXB 3HJZA 1A5UA 1H60A 5EL1A 4NAFA 4E3VA 4S2CA 4H1ZA 3CHCA 4CQDA 2PDLA 1XH2A 4PTWA 3WLQA 4YTTA 1FCUA 3IIPA 3B8IA 4HMCA 3GG1A 1GKPA 5FJOA 5A6KA 4FALA 2DJLA 1J18A 1FKXA 4PCNA 1UJPA 1CLVA 3A4XA 1VPQA 3O2LA 4B5TA 1AH0A 3TYEA 2BY2A 2CXGA 3SRDA 1HGYA 5CSYA 4X0NA 2PDJA 4Z0JA 1J4EA 2WMIB 3AAMA 4HMNA 4OKDA 2QGYA 3DZ1A 4OWGA 3LXCA 2ZVRA 6XIAA 4XAZA 2ZZ7A 1UWUA 4PUUA 1Q13A 1TQXA 1ONWA 2WVTA 5D9NA 1ZJHA 4UTLA 1L8PA 5ECVA 3SO7A 3E5BA 6A3HA 1XCXA 4HU3A 4KCUA 3LEPA 4DJDC 1GKRA 3POHA 4D6JA 4HGXA 5H8PA 2TRSA 3CZ8A 1XF0A 2W92A 3G8EA 1TZZA 1XLBA 5HMEA 3TYDA 4E4UA 1SM9A 2OZ3A 1RVKA 3TSDA 2FZDA 2YW4A 4LW7A 1W6TA 3WQDA 3CZEA 3OLIA 4PCSA 5HUOA 3TLLA 4A29A 2H6RA 1Z41A 4JQAA 4EOUA 3S42A 1R86A 4O16A 5FEPA 1F3WA 2PFHA 5BU6A 2CITA 3U7BA 5AC7A 3L68A 1J8VA 3BAIA 3DC0A 5CZJA 4XBSA 1DJZA 3QJAA 2PF0A 3A47A 4U10A 1US2A 2I57A 3KLLA 4EAMA 4C1KA 4DAFA 1GOOA 1TR9A 4O0QA 1QNRA 2GVJA 3R43A 3W53A 3XIMA 1Z48A 2QYGA 4OHQA 1HJXA 1XUUA 3G1YA 3WH5A 1QTWA 1MMFA 1TELA 1OFEA 2QJGA 1G6CA 2WC3A 3PULA 4HQVA 3EA3A 1KXQA 1CB2A 1UWQA 5XIAA 3J7HA 3Q94A 4J4KA 2DJXA 4E0CA 4PMJA 4WY0F 3E2QA 3HFYA 3LZ3A 3TQVA 3GVWA 3HFTA 3FIGA 3W38A 2HWGA 4XSMA 2WLYA 4V2XA 2NWRA 1EYEA 1MO0A 1GOWA 3I68A 2VP8A 3FJNA 4KCVA 3PUOA 5BOEA 4EP8C 1IT0A 1XLFA 2VGIA 2ZICA 1OHLA 3A3HA 3L4TA 2W66A 3W73A 2QJNA 1KCZA 2PU0A 4H9YA 3D3FA 3TEVA 2VVNA 4E4FA 1GK8A 1VR6A 4UCGA 4IFOA 4IIGA 4YJ5A 3CHVA 4MKNA 1VRDA 1LG1A 5E1QA 4G1KA 3PTMA 3T40A 3JUGA 3H54A 4AZ5A 1MQPA 5ABEA 2NQJA 4JFVA 4X9YA 1ECEA 1ZL1A 3D47A 3SCTA 3VOJA 1JEZA 5AYBA 4LCRA 1W8SA 1ICQA 2EPOA 3NL3A 5T9CE 5GJNA 3TCSA 4DBUA 2XIBA 4LYPA 3EDKA 3N18A 5K7JA 4LGXA 5CSUA 1FWFC 1VBJA 5DT7A 1QR7A 4O0KA 4JX4A 2YL9A 1JDAA 1JCJA 1J12A 4AWEA 4PUWA 4PTXA 4MZ8A 2OOGA 1B3WA 3NURA 4AIBA 3GIYA 4Y9NA 4DF2A 2E40A 2FFIA 3W86A 3PPFA 2WMGA 3S3GA 7A3HA 2WM0A 3P81A 3RCNA 4WKHA 4PSRA 3I6TA 1LQ0A 2P88A 2DVTA 1S1RA 2QW5A 3WQ6A 4DPPA 1OC6A 4GXWA 4ZO7A 5LGZA 1WYIA 4HNCA 1Y7VA 4RLIA 2QAFA 3MSYA 1PZ3A 2D3NA 4GUGA 4O12A 1H7OA 1KFBA 3AROA 3VNKA 1JRBA 3WNKA 1MQQA 1AW2A 5K9CA 4QAWA 4C6MA 4KETA 4S38A 1BHGA 4K1GA 3TQPA 2PDCA 4HN8A 5G1TA 3LQLA 3W7IA 1ZGDA 3H70A 2OOFA 3G0SA 3AMDA 1YW1A 3AIBA 3QMRA 3KRZA 1M41A 2DSVA 1GOXA 2R14A 3LN3A 4HHLA 1QPRA 4LSBA 1UA7A 1BKHA 2VYOA 2IQTA 3OA3A 3B0VC 3ISIX 1NH6A 3LLDA 3IVSA 1A5LC 4TX8A 3LCLA 3BJSA 3LZ5A 2PPGA 4JKMA 4OBTA 4AHQA 5J5RA 3PPGA 1Q6CA 4W5UA 1OFQA 2NUXA 4IIHA 1QPOA 2FLIA 4H04A 1H3GA 2XYLA 3EX3A 2QMJA 3FK4A 2BHZA 3MWAA 4JQ3A 3GDBA 3NFUA 1N7KA 3KCLA 2XFRA 1IEXA 2CLFA 3WYZA 3CPGA 4GZIA 2QHAA 2OT0A 2ISVA 1TV5A 1XM3A 2WJZA 1ZZMA 1F76A 1EEXA 1I2PA 1M68A 4NL1A 2CBUA 3GSMA 2E4TA 3TYBA 3S6DA 4HCHA 1H1NA 3OGRA 2VFHA 3FKRA 1JZ5A 2CBJA 1R2RA 3CO4A 1GWJA 2NSXA 4B3LA 4C7GA 2I9EA 3ZWTA 4DUOA 1XISA 4O10A 5JUVA 4Y9AA 3EX2A 1EX5A 4NJHA 5H8UA 5A6MA 1HN1A 1Y5XA 1CIUA 1I0BA 2VD9A 1SJCA 2Z24A 2X8RA 1TMQA 2Y62A 2C13A 5DY2A 4ZXLA 1N8WA 3A4AA 2IKIA 3W07A 4NY2A 4M19A 3STFA 5E0KA 2BZNA 2D2HA 4XUYA 4LAMA 1L9WA 1REQA 4UR7A 2G50A 4M5PA 3AYSA 1AG1O 3UG8A 5D2TA 4Z08A 5IRPA 1WDWA 2HE8A 3PS7A 4AIOA 1R2SA 3LXAA 1EHNA 3QPZA 3PZQA 3N4FA 2ACUA 1JFHA 5DMMA 1AFSA 3K4AA 4DUXA 1L6SA 2VX6A 3Q37A 4ILSA 1LBLA 5BOFA 3QN3A 2B7NA 1SJBA 3TSMA 1V6VA 2W4XA 5D04C 4QRNA 2GQ9A 2Q6ZA 4EXQA 4XZHA 2RJHA 3AHZA 3A5VA 3B97A 3FA3A 3PTKA 4W84A 5C54A 1UR9A 3HPZA 3ZQ9A 3ZS4A 4CD5A 4KEUA 4ZBCA 4GY1A 3TSBA 4KGJA 1IXOA 1E3ZA 4MB3A 1A5SA 2J13A 3VDAA 3THUA 5KTLA 3CEPA 1QT1A 3NSNA 4EPBC 1S2UA 1D9EA 1AQMA 1EUAA 1CENA 3AYRA 3FX4A 3NXLA 4WDTA 1YDYA 1XSKA 3CMFA 1AQ0A 2W61A 1QAPA 1UPMB 4OVXA 3G77A 2V0TA 3C86A 1TJPA 2O55A 1CGVA 2ZKMX 3MCNA 8CGTA 1YIXA 2ZX8A 3G5EA 2LLEA 3DFPA 1J9YA 1EIXA 1QVBA 4JTKA 3M5XA 3RO6A 3MUXA 3RMEA 4H7VA 3C2EA 3FA4A 2CEQA 2PWDA 3CV2A 4WRHA 1GVSA 4QG6A 3HQ1A 5HPOA 3PG8A 3BAYA 3H2OA 4OBRA 4TTUA 3HA1A 2X1IA 4NAEA 1DKWA 5CZTA 5I3IA 5K9XA 1GQNA 2UWFA 1GJWA 1JNEA 3AXKA 4FF5A 4QJ4B 3ZOAA 4EPEC 4TOQA 1EX1A 3LRKA 4FSAA 4GE8A 3K13A 1YDVA 2W6RA 4LY8A 3LD5A 2PDBA 3O6DA 4F8XA 4OQVA 2ZTJA 5DBTA 3S5NA 2G4FA 2PWUA 1G7VA 2Z2UA 4ICCX 3PWIA 1G9HA 2X40A 3KBJA 2ZC8A 3NQ2A 3UGVA 1K8YA 4PUMA 4S3BA 2H9AB 1GONA 2ZRVA 4RKAA 5HWNA 1LP6A 3EGJA 3BANA 1VBGA 4MLJA 1BF2A 2NT1A 5AYZA 3VGEA 7XIMA 1KD0A 3OBKA 2YBTA 2JGYA 3MSDA 1OYAA 3OBEA 3N9KA 3UR5A 2QGHA 4HU8A 5CPOA 4JHOA 2YFOA 3S0CA 1NIUA 1OT1A 1IV8A 3P14A 1A47A 3W70A 2RH9A 3RX4A 1ZSXA 4J3ZA 2ZXDA 1K03A 1TIMA 5CC5A 5M2FX 3ZVHB 1FBAA 4I7UA 1GPFA 2C0AA 2OB3A 2ZZ1A 2O9TA 1ZFJA 2FYMA 3CQIA 4NZCA 1D3HA 4M3PA 3VGDA 1Z69A 1A5KC 2DSWA 3MUCA 2PODA 2VURA 3GXMA 1EFZA 1H63A 1F73A 2I7GA 2D0FA 4EX4A 2GJPA 3I7SA 1S2CA 2VNCA 1LWJA 1ML1A 4QEHA 2C79A 2PLKA 2HS8A 3D6NA 3OA5A 3BL3A 4QFUA 1M7OA 4YCOA 3FEQA 1N55A 1XIDA 2PLMA 5IDIA 4ZQPA 4UTJA 1OG6A 1JDEA 3PR2A 3BG5A 1PB0A 1YPXA 4M80A 2DH2A 4H6RA 1V6UA 1DWJM 2GPTA 4KBXA 4FR1A 3V4BA 5LA0A 5AC6A 4G5DA 2WAGA 4X3ZA 1WZMA 3P6LA 1WXZA 1DXIA 1MNSA 3O0KA 1AJ2A 1EA9C 4JY9A 2ZX9A 2EPLX 2ABAA 3MS8A 3NOYA 3S2CA 2QCDA 3KWXA 4EPKA 4R27A 3HPSA 2ONEA 3DFHA 3BJTA 3HU7A 1J01A 4UQ9A 2H3DA 2FVMA 3ZR6A 1S5VA 1W1IE 1JXJA 3QTGA 2Q8LA 3O6YX 4XD3A 1E6RA 4ZOBA 2J4GA 3VCRA 2E3ZA 1OF6A 2Z6IA 4LXFA 3WKZA 3F4CA 4UFJA 4MUPA 5EMYA 1UHVA 1MZHA 3IPWA 4K2SA 3HPFA 4PCTA 2Y7DA 3GBDA 4AX7A 2WW5A 4E8CA 3EAUA 2GGEA 3MI3A 3ORWA 1FWRA 4H00A 1X1OA 1OFRA 3T4WA 3NZPA 2RJGA 2E6DA 2X2GA 2W3ZA 3RIKA 3SRHA 4ZO9A 3MMTA 2WZTA 1OGSA 2ACQA 3VDGA 4LOCA 3BSHA 1ZJAA 1M3UA 2XGBA 5I3DA 4G7EA 4AY7A 1VJIA 1XR2A 4JKLA 4GD0A 5I5RA 3N2OA 1MI3A 3WMLA 2VR2A 1NWTA 4I8YA 3D46A 5CH9A 5JH1A 1E51A 2FZ9A 2BG5A 4IF2A 1S2WA 2X0YA 4DN1A 4B91A 3ITVA 1ZBCA 1XLHA 2AMXA 4INFA 4TV6A 4QG8A 2PDPA 1ZHAA 1NEYA 1FWGC 3JVAA 1R85A 4CNTA 3PPHA 2P0IA 3K1GA 5U4NA 4J2MA 3EB4A 3A9IA 1BSLA 4O1CA 3WMSA 2WVVA 2O56A 4OU1A 5FL1A 5AHIA 4AMAA 4DF1A 1OGGA 1MUCA 2OELA 1IQ8A 3FW6A 3KS6A 1R0MA 3R10A 4F48A 4JR5A 4CCEA 1TJ1A 4ERAA 3W87A 3WFZA 5CSSA 3TJIA 2J8FA 4Q8VA 3ATYA 4HJWA 5BROA 2D0HA 1GQLA 2J66A 3OZOA 3UZZA 1H7NA 4JTDA 4AD0A 4RPQA 3P8JA 1Q2RA 4KWOA 3TN3A 1HKMA 1S5WA 3LM3A 2PTZA 2XFFA 3WF1A 3FLUA 3W9ZA 4PRRA 2GQAA 2YBUA 3CTTA 3GS6A 2HCVA 4AISA 2A2IA 4GXPA 1JDCA 3I7RA 4D6HA 2FTYA 4AH7A 4PRTA 2PA6A 3CT2A 3P62A 5AB3A 4O14A 4IUOA 1Y8BA 3SCUA 1SFLA 4UTUA 4HK5A 1FWDC 1HIZA 1K7FA 1H50A 2OCZA 1MXDA 3K46A 2DIJA 4YVXA 1MDLA 5DRCA 5FF2A 1BVZA 4MMWA 3XISA 1BQCA 3RGTA 5CAHA 2EEXA 3UW6A 1HT6A 3CU2A 1EJVC 4I7WA 3H7UA 3N1AA 1KFKA 3BQ5A 3LTPA 1NFBA 3M0HA 4CNUA 4ZQCA 4J28A 4JTQA 3RLHA 1W3TA 5C8BB 3VIHA 4AZCB 4IP5A 2PWGA 3PWAA 2E28A 2BVYA 1XLCA 3U2CA 1UD2A 4YIWA 1GTHA 5BXPA 3N2TA 1SMDA 4UTKA 1MEIA 4AW7A 4V15A 5AC5A 3GH5A 1KXTA 3H4XA 3UWWA 3C4UA 2XHYA 4W9TA 1RH9A 1EO7A 3UFYA 1Z32X 1YYAA 2IKJA 3N17A 3B0XA 3BAJA 4PZVA 3FYPA 1JXKA 3LHYA 5EMUA 4M6QA 4DUVA 3FDKA 1XLGA 3TE9A 5D02A 3SCVA 3QQWA 2XGIA 1QOQA 3COTA 4LRSA 4JL1A 1TB3A 3SJNA 3S8HA 4PCFA 2PDWA 4NVTA 1FHUA 1DV7A 3VAVA 1FDJA 4GZ7A 4JYFA 2XVKA 3ARUA 3ID7A 1N8IA 1P43A 4LEFA 1X8FA 2R82A 3A3XA 2GUYA 3MP3A 3R12A 1KRAC 3C56A 3N12A 4PUEA 1PVNA 1S2AA 5TAOA 1E9ZB 1XW8A 4ADTA 2VX5A 1BRLA 4Q6JA 5BXRA 3BLIA 1H4PA 3MSGA 3B9AA 5ECUA 3F2BA 5TNVA 3HGSA 3WIJA 3A24A 3G18A 4RZBA 2OLSA 4ZTYA 4UOQA 3VPLA 4HA3A 4HNUA 1T0OA 6TAAA 2CLOA 4JICA 1EGVA 1AA1B 5LA1A 3P2VA 3CUIA 1J0IA 4G7EB 1S5NA 3U5UA 4GIYA 3MYOA 2YW3A 1MEWA 4DRSA 1QOXA 3JS3A 4CD7A 2WBKA 2QV4A 4RE4A 1NP0A 3M9YA 2V5KA 2H8ZA 3MHGA 3FXYA 1A3HA 4WXYA 3BW2A 3B0UX 1CI1A 4Q8QA 3SFKA 4OJYA 3ITTA 4FLRA 3KRUA 3SQMA 4LCQA 3G3DA 3DECA 4AF0B 2GDVA 4AXKA 5JBFA 3LNPA 3RPTA 4KKXA 3GR7A 3P3BA 2WVVB 3ZJ7A 1UMLA 4HMDA 3GTNA 2AMGA 1SU5A 4AWUA 2ZZ5A 3EMCA 2WJEA 3GTXA 4KT2A 3FNDA 1H0GA 2HTMA 4AZIA 1R5YA 1TJRA 7PTDA 2NLIA 5M3WA 1YEYA 2RHGA 3MWCA 1F9CA 4E38A 2A0NA 1A49A 3GYCA 1ZCOA 1LL4A 4HSOA 1EP1A 1F07A 2FKPA 3B03A 4LVAA 5A2AA 2C18A 3BV7A 1PCKA 3VKAA 1MRAA 1NDVA 3PP7A 1TRDA 3AUJA 3NO3A 1E3XA 3M5VA 3GNRA 1FOBA 3K4DA 2OLHA 3DKLA 2FPYA 4I3GA 1V0NA 3MDWA 4CNNA 1IZKA 5FEXA 1RD5A 4FOJA 4GH1A 4LV9A 5BMWA 5M1TA 1WBJA 2PC4A 1UZDA 2P1FA 4Q32A 4R53A 8A3HA 5EFFA 3P60A 4JNZA 5A3HA 1PWMA 3QLLA 4O18A 4PMVA 4UQDA 2W5FA 2YCJA 1GKQA 5AYXA 3LCIA 2PZ0A 1DHKA 2Z25A 4IL0A 2J9YA 2E5DA 3U48A 1XQLA 1Y5WA 5H2ZA 1PXGA 3VNDA 2Y70A 1ZAHA 1JYXA 4Q4SA 4UBPC 1IHIA 5A5WA 4XBJA 3L65A 4O57A 3EWCA 3N9RA 1UMYA 1HF6A 3F1QA 3B8TA 4ES4A 3RCYA 4ALDA 3QW3A 3VX0A 5HK4A 4L6HA 3VGFA 4GUHA 4CQBA 1AJZA 4JD4A 4CNPA 3S6TA 4TU1A 1LOSA 3ZJKA 4RCXA 2DIKA 1KRCC 1HJWA 3M41A 1Z7AA 3ARPA 4J27A 4FXFA 4I5UA 4PCPA 4O53A 2V82A 3TONA 3W75A 1KA9F 3IS4A 3EPMA 4ZVJA 3QHNA 2DT0A 4ZR8A 2YB4A 3R6IA 2VENA 4LAZA 1MEHA 4DI8A 1VBHA 2J47A 3WDHA 1HL2A 1GEQA 4UXDA 4AWTA 2P3ZA 3QLDA 4RE2A 4AFYA 3SSJA 4ZSTA 3DI1A 3EDJA 2WMHA 1YADA 2YCKX 4L1WA 3IVTA 5M03A 3MW7A 3E74A 2TSYA 4V28A 3NGFA 1TPWA 5A8NA 1VLWA 2OGYA 2PRHA 1C9WA 2H3BA 3CHDA 4WSJA 4OT7A 4HNVA 3QZAA 2A21A 5HAOA 2XIJA 2WC7A 3H4GA 4NZ5A 3ABRA 4YYCA 4GGBA 4HA4A 1DVJA 3ZM8A 3O05A 3DI0A 2QCEA 1W1A1 3F7JA 2OEMA 1KBJA 1FWAC 1SVDA 1U1UA 4P8VA 1EZ2A 1JZ2A 3VXGA 1XSIA 3RAOA 3ITOA 1AVAA 1SW0A 1CW2A 2UY3A 1SZEA 2A7RA 4ML4A 1B0IA 1EJRC 1T99A 2Z2AA 1TVPA 3LCXA 3L4UA 2OQYA 2GGJA 3I65A 2BOGX 1FTXA 5BRQA 4ONVA 2YA2A 3MUZ1 1XYZA 1UP0A 2QDEA 3THCA 3F4DA 3AO0A 1SW3A 3PZTA 2WYSA 3FYYA 4N0RA 5GNYA 2BY0A 4I9JA 3MT1A 4HA1A 4HZ7A 3VKJA 4QBXA 3EA2A 4GQBA 4KEZA 4PTDA 1W1TA 3LCHA 3T9PA 2G4JA 4M81A 3UGRA 3S5OA 3M0LA 3ARTA 3T42A 3HQPA 3I3EA 2YLAA 2OPJA 5D8ZA 3SJ3A 1K70A 2L5HA 4B16A 3VM7A 4HU0A 3VKBA 4IGMA 4C1LA 5EU9A 4JY8A 2QV5A 4DBEA 3VMNA 5FEWA 3TTSA 1J0JA 3VO0A 5CJMA 1XUZA 5E6ZA 1WDQA 3GYEA 5LIXX 2QCGA 4GX9A 1S38A 4EANA 4PTMA 1KGXA 2CETA 3S1VA 4N4QA 1NVMA 4A8IA 1TFVA 1DPMA 1RCQA 1Q6GA 2VMFA 3LCWA 1DYSA 2D2JA 3T0CA 3WL1A 3KZPA 1MYRA 1L6GA 4UCFA 3DG7A 4MOZA 3RO8A 1ECQA 1HL8A 1EIBA 1SO3A 1O66A 4N02A 1SJDA 2I1OA 3EA1A 3DAQA 1H09A 1I2NA 3ZT7A 3WL0A 4M29A 1VYSX 4HZ8A 4WCJA 4FO4A 3FV9A 3MZ2A 1G4EA 1TPB1 4HN4A 4JTEA 4NZ3A 4QHRA 3LPOA 1O95A 1ZLPA 2NX9A 3CUFA 2JIWA 3FJ4A 4IZGA 1JNDA 1GTEA 3TJXA 1ZTVA 1LUCA 3S2NA 3JW7A 1WDDA 3OG2A 1HTIA 1TPEA 2VOMA 2G3IA 4QJ3B 3PF3A 6REQB 3R8RA 3CQKA 3NSMA 2IXUA 3MUY1 4UTIA 2QUUA 2DV0A 3WJZA 3KBVA 4I5RA 1KM1A 4CQ8A 3UR2A 2WSYA 4J35A 3T78A 2EG7A 2IQ0A 8TIMA 2WPBA 4D6EA 1Q7ZA 3M0YA 5HMFA 2Y85A 4DJED 3AFBA 3L67A 2Y5JA 2OTDA 3MBDA 1OX5A 1E9YB 2X05A 2QUMA 4XKYB 1HUVA 4W85A 3KDNA 4Q4QA 3DFYA 4MZYA 1NDZA 2YZRA 3GWQA 3O3RA 1CLKA 3WJSA 1XG3A 4IWWA 2PDXA 2DUXA 5H6HA 2ZXQA 2G5WA 4LV4A 1UP2A 2AGKA 4JN6A 4QS6A 3V75A 4AZ6A 1CT5A 4HMEA 3ANUA 1B1YA 4P7QA 4FB7A 4HP5A 4NRRA 5C7HA 2AKMA 3AHVA 2J7HA 1OT2A 3GG0A 3V36A 4UMBA 4X2RA 2NV9A 3HJEA 1Q85A 3WNMA 3AMLA 3VOFA 4LBSA 1ENUA 4CCDA 3T6CA 1JPKA 3OP2A 2VFDA 3A13A 2RDTA 3MYPA 3QKEA 4D1JA 5HBFA 4KQNA 2EAWA 3LMYA 1C93A 5KSWA 1JPIA 1H41A 1OZQA 2MNRA 3CUGA 4I9MA 1HVXA 1WBHA 2BXYA 4F2BA 2PB1A 1OYCA 1A5CA 1YE6A 3QOKA 3T0BA 4N9CA 4KRUA 4US5D 4FNPA 4BJHA 4M56A 4F66A 1A4LA 4YMZA 1UZHA 5CGQA 4X2PA 3URNA 2VEPA 2WMKA 3LS9A 1E55A 1UIPA 4M1RA 3RDKA 3LUTA 5KETA 3MKCA 3W23A 5CXPA 4DLFA 4J3UA 1W2VA 2BOFX 3S46A 4QG9A 2QMKA 5HA7A 3NR0A 1GHRA 1RZMA 3R0DA 1XDLA 1HGWA 2FGZA 4WQ6A 5MKGA 1K1DA 2HVOA 2ZYFA 2O4QA 4MWAD 5JIWA 3AU2A 3E5PA 3ZWSA 3W7RA 4KWSA 3WF3A 1UROA 5CZKA 1N2VA 5ABTA 2R1NA 4FX7A 5B7YA 2I5GA 3VNZA 4MY1A 2JEQA 2QJMA 3LRMA 2VDGA 3UPMA 2P3EA 1AZ2A 3BAKA 2XTKA 4JL2A 1R38A 4AYSA 3PG9A 1V02E 4HZMA 1BKSA 3LA4A 2E9MA 1EYWA 3WDPP 2DZVA 1XFCA 2ZUUA 2OQLA 3H26A 1Q8JA 4C6OA 4RJEA 3ZVIA 1JGIA 5H91A 1NELA 4Z2HA 1V7YA 1F6KA 1YTDA 2PDNA 5DELA 4BF7A 4C6IA 3NPVA 2BV9A 2XVNA 3B8VA 4W7VA 1V4YA 2PLJA 4NHVA 3A3WA 5EY5A 1W91A 3GHSA 1KXHA 2ZX5A 4Q22A 3LU2A 4AWSA 1DWGM 3RFAA 3NSXA 4I9TA 1EWDA 3F4WA 3WLSA 9CGTA 2OEKA 4ZODA 1W1PA 3IUHA 3KS5A 2Y4SA 2BXZA 3PB0A 5FA5A 1B3ZA 3DGBA 4TIMA 4FOUA 3MP4A 2WSQA 1LL7A 3RX3A 4MNMA 1GQJA 1KCKA 3UP8A 5JMUA 1RY0A 4W8AA 1PTGA 4H2HA 1QK2A 4NX5A 1ODUA 1PIFA 2ON3A 1ZENA 3AS2A 5CC7A 4YU1A 4P7LA 2WO5A 3QTPA 2X1TA 4BY3A 3VIFA 2GOUA 5HQEA 1W5MA 5BWFA 2J75A 4L4LA 1ZS2A 2VO5A 3BLLA 4Q4PA 4HPGA 4R33A 2PSNA 3OQEA 4QS5A 3HTWA 3CMGA 5I79A 3S1GA 2E5BA 4MDPA 4DWDA 2OZ0A 1HJUA 3CBWA 3CL6A 4R9OA 5DMLA 4P8UA 4KERA 5C0QA 3LLFA 3WD2A 4MG4A 3VIPA 1M9HA 1T40A 2BOEX 2F8QA 1H7RA 3WUFA 2JF7A 3RR1A 1CGWA 2EF9A 1JPHA 3BICA 4FX6M 4PMXA 4MJZA 3PUEA 1VGAA 1FWIC 4XTDA 2IPFA 1U1JA 3WLHA 5I2UA 1JDFA 2JK2A 3S5SA 3QH2A 1KO0A 3LBMA 2DEPA 5AZ0A 1R6WA 3A64A 1WKDA 4XAPA 2YL8A 1XLJA 3SRKA 1BYDA 1EWEA 1EJTC 2XJ7A 4QJ5B 1SO5A 4MNJA 3L9CA 1Y65A 4PBEA 3M7SA 4TXEA 2YDQA 1HX0A 2HZGA 4TVCA 1I2OA 4TMBA 3WDJA 4NZ4A 1BWVA 2PWVA 2YA1A 1K7EA 1CX9A 3W6LA 1BLIA 3OG3A 3W1RA 3OVQA 5A2CA 5L6UA 5HXMA 4L64A 2D20A 1QBBA 4YNGA 3IJDA 3WEOA 4DYEA 4DX3A 2GUUA 2E6YA 1X1NA 4S3FA 2WWCA 1IR1A 4AVFA 1B9BA 4DY1A 3QMTA 1MFUA 5A6TC 1JJKA 1QO2A 4DJEA 3POCA 4F0LA 5LXEA 1RA0A 3AS3A 2YSWA 4I90A 2ACSA 4ML9A 4MYXA 1PYFA 3CAKA 3GKFA 3NVDA 3N15A 2XH2A 3PTQA 4K37A 3UCDA 4US6A 4PMOA 5CPQA 1M7PA 4JYDA 3V7PA 1SUXA 4JS3A 4YYFA 1ZJBA 3G1FA 4DZIA 5EBAA 1THFD 5AC4A 1B3OA 2WV8A 4LYQA 2BODX 3KOZA 4UTMA 2ZBTA 1BWLA 5MKGB 4HOWA 2CLIA 3RK8A 1WCGA 3RJXA 2FHFA 2YBVA 4QQUA 3EEZA 3BVJA 3A5FA 4ICNA 6CGTA 4QM1A 2X42A 4QAIA 1UB3A 3GW3A 1SSGA 1P0EA 3U2OA 3E12A 3GNXA 3A4WA 1CPUA 1MW1A 4U33A 1QNQA 1UIOA 1EJ7L 1QFEA 4LQ1A 2ZRWA 3F2DA 4F0SA 4LC6A 3VIOA 3TQKA 1R7OA 4ZQRA 1RJRA 3GNOA 4EWJA 5LNSA 3DYPA 1EUNA 3Q2DA 5GVJA 1QI5A 2J79A 4U5KA 2DT2A 4O8RA 3CV7A 4WDUA 1V3IA 1NARA 1X7FA 3T07A 2Q8XA 4FZIA 2DUAA 4A8NA 3BLDA 1KFCA 4US5A 1KTBA 4C6LA 4MJ2A 3VM5A 3TYCA 1VPYA 4FHAA 1LOLA 3VC5A 4B3KA 3W1LA 3WDRA 2WANA 1GYNA 2WSRA 3IJLA 3WK0A 3W6MA 1UASA 1Z3NA 4LAOA 4W88A 4QITA 3I10A 1OINA 3SEPA 3T7VA 4ZXOA 1LF1A 2E1DA 5D2YA 2BVDA 4PN2A 2VZTA 4IP4A 4LVGA 3QV7A 1XS2A 3B40A 4MWAA 3QVQA 2IW0A 3KL0A 3E0LA 3VUSA 2J78A 1P7TA 3BLFA 1IT8A 3ICJA 2ZUMA 4JQ4A 3BE7A 3W1QA 4KGLA 5FCZA 4K7YA 5ABGA 2JEPA 1WXJA 1XIJA 3MSRA 4ZA0A 2PWEA 1O5KA 2PP1A 1HP5A 1BYBA 4MAZA 3HGJA 1I0DA 3NL5A 5CPMA 1E70M 4Y90A 3W26A 2WK2A 5LIKX 2WNQA 4I8DA 3OHIA 4AY8A 3QV6A 1Q63A 2GJRA 5LYRA 4ADUA 3NQDA 2ZUVA 4N6FA 3M1ZA 4Q4OA 3TZNA 2DZSA 2TAAA 1TV3A 3TNOA 5EKYA 2P8CA 4PGLA 2AQOA 1CEOA 4LC8A 8RUCA 4GHRA 4DNHA 4CD6A 4Z2GA 3RYSA 5CGTA 3BLPX 2X16A 4MJ4A 4J40A 1KKRA 4UNLA 3KOYA 2C71A 3UJFA 1DHPA 3B3DA 5CPNA 1XINA 3ITXA 2VDHA 5BYWA 2BWGA 5HNUA 3QY6A 4JFUA 4IIDA 4KFNA 1JF6A 2V2HA 3FAXA 4EK7A 4CU6A 2Y8KA 2J7CA 4EPDC 2D22A 4E8GA 3SAZA 5AECA 5J5DA 3HGOA 1QNVA 1ALDA 4W8BA 1LLZA 1QW7A 3CUHA 3KVKA 1JAEA 1HJQA 1KBIA 1TMHA 4JIPA 2GQ8A 4BQ5A 5BZAA 3H2NA 5F2GA 4FS9A 1P4CA 1TPC1 2J7DA 1ONEA 1X38A 2X1SA 3DENA 3ES8A 2WOQA 2ZX7A 1QWGA 1TZ7A 1OEPA 4AEEA 2QLYA 4MYAA 3WSUA 1TUFA 4MKVA 1QASA 1W56A 1YNPA 4H83A 4NYYA 4Z1YA 1UWSA 4DZHA 3I3DA 4J5NA 4ZEPA 5CGMA 1M01A 4JCMA 4IQEA 3V5FA 3E49A 4QEEA 3UESA 1ELSA 4J9JA 4CQAA 1HZYA 2EO7A 4CD8A 3VINA 1GVEA 3IK4A 1XGZA 2E0PA 1C90A 1RQEA 1E4NA 1VFSA 4OGZA 1F5ZA 4LUSA 3G24A 3MV01 4B5SA 3UXLA 3N9SA 1JYVA 4NIRA 3SDOA 1V5XA 2CW6A 3L0NA 4JTSA 1A4MA 3SIZA 4NXKA 3D3AA 1RLCL 2BY3A 4GNJA 2J6XA 3LLXA 2J74A 1QI0A 3BLEA 1GW9A 3KEHA 1XBXA 3U3HA 1LZOA 3B0YA 3CZJA 1BYAA 3FVDA 1I2QA 3NQ6A 1I2RA 1UUMA 1UWTA 2VR4A 4HNNA 4Q8UA 2CLLA 3F5JA 3KDOA 4B15A 4Z1DA 1JQVA 3G3MA 4V33A 3S6OA 5G2WA 5AHMA 3QXBA 1W1VA 5EMLA 1TZ9A 3NVTA 1ESWA 4HU4A 2HK1A 4MHBA 5I06A 4H8UA 2PDFA 3GTFA 1EQCA 4H3DA 3EWZA 4D9PA 2QULA 5HINA 4H7ZA 2PZNA 2QS8A 1C7SA 5FJPA 4DJEC 1L6WA 4B92A 4IJCA 3SCWA 3A4JA 1R3VA 4ACYA 2DDXA 4GCAA 4UTWC 3TWBA 4Q8WA 3H6OA 4GNVA 4LS2A 1P1XA 3TJ4A 4JIHA 4QCFA 5LIYX 5KEZA 2HQAA 5C55A 1I8JA 3TTYA 5F4WA 1AH4A 3ZMRA 4J3XA 3AZTA 1XYLA 4H9ZA 1JZ4A 3T8LA 3WG6A 3R1ZA 1C8QA 4YTRA 3DYMA 2EJ1A 4Z1CA 4LS1A 1IXQA 1AQHA 2XUCA 3CHFA 4UR8A 3UBPC 3ZJ8A 1ZP4A 3V0TA 6ALDA 3C3UA 3G2GA 3SCOA 3P93A 4W93A 4C6QA 1BFNA 3WNLA 4GABA 3BMWA 1DBTA 1JL8A 1UD4A 4AQLA 3SUUA 5F1VA 2WHLA 3VCCA 4JTJA 2CNCA 3TK7A 4L4PA 2YB1A 1PKMA 3PNUA 3E02A 5J8LA 4UFHA 2OYMA 1XIFA 3OZPA 4ZFCA 1IIHA 3E0IA 4TMCA 3AWOA 4DB7A 2JALA 1ISXA 1UH4A 1TCDA 4GVHA 1CGTA 2E8ZA 1PE1A 2BSLA 4DI9A 2Y88A 2HMCA 2ISFA 1RPKA 1DXEA 4JEJA 4MUZA 4REQA 2DY3A 1P0DA 1CXIA 2VC5A 1E0XA 3VZYA 1NDWA 2A3EA 3PM6A 1XIBA 2VZUA 2FFCA 3TC6A 3QHOA 1DE5A 5A8GA 2VEFA 4GRSA 3BO9A 2CC0A 3CQ0A 1I4NA 3KM8A 3UA4A 4P7RA 1R46A 2A3LA 2NQ9A 4B5NA 2Z29A 1GORA 1XXXA 1NFGA 2EG8A 3M7WA 3GC5A 3QV8A 3CIWA 4KWUA 1T5AA 2V3EA 1FKWA 4LT9A 4E5TA 1XPYA 2VCCA 1TG7A 4G9PA 4A2SA 4P5UA 5D2VA 3TXZA 5C9UA 5KINA 4UFIA 4A22A 3GU2A 1FHVA 1DP0A 3TIMA 3BK0A 1SZGA 3ANYA 1CGUA 3M0KA 4JTRA 3ZLGA 3WH9A 2X0SA 1F74A 3C2FA 4NU7A 2YDSA 3RU6A 4GI8A 3W81A 5T26A 3B9DA 2WQPA 4AD1A 3CK5A 1BXCA 1RXOB 3C61A 3G1VA 1EB3A 1TX2A 1ZNNA 3T0TA 3WUBA 1HO1A 1WKYA 3K1DA 1WXYA 3SR7A 2FMNA 4RDZA 2CHNA 2O7SA 2YJQA 3IAQA 2AKZA 5LHFA 1BYCA 3PN8A 3VZXA 2C1GA 3E0FA 3M5ZA 4PUKA 1X7IA 2VQUA 1EHAA 3WLPA 5GJMA 3EYPA 4RDYA 4PTNA 3W85A 2NSOA 1V51A 4A3QA 4FAMA 3VDBA 4HYVA 4E2OA 3R89A 1OX6A 4GPNA 3KAOA 3FVMA 3FS2A 2BBFA 2EXOA 4N9DA 2PGRA 3WQGA 2DZPA 2FTWA 4MZ1A 1FH7A 2XWDA 4Z2IA 3M43A 1MQRA 3NG3A 4MB4A 2GJNA 2RUSA 4Z0SA 4R85A 4N2YA 3WQCA 1E56A 1XCFA 4GYJA 4NQ1A 1SPQA 2A7PA 5J04A 3RLVA 2WHMA 2CPUA 5EMKA 3CQHA 5F4SA 1VYPX 4GZJA 3TNBA 3OU8A 3N6JA 1N82A 4FP1A 3DCPA 3H7VA 4FF7A 1EDGA 1F8IA 5DT5A 4GYKA 3E0VA 1KV5A 1K9EA 3KBNA 3PZUA 4MY9A 1UR4A 1X8CA 3KOFA 3WBYA 1V6TA 5EPDA 3MBFA 1VFOA 5A2BA 1UD6A 4DWSD 3TROA 3FHAA 3GVGA 5BW6A 3NQBA 4L65A 4P7OA 1F3TA 4FLQA 1UWIA 1ZBVA 1GZGA 1CNVA 2IXVA 4Z2LA 2J7GA 3KX6A 5IXEA 3E96A 2AQVA 6TIMA 5E6YA 4O4VA 2PMQA 3PZOA 1BAGA 2F2HA 1QI3A 3VGHA 1V6YA 1J79A 2BB0A 4BA0A 4N9EA 4K8EA 2WCAA 1FHLA 2JKAA 4UZSA 2F6UA 3W72A 4K38A 1U1HA 1O7AA 2VC6A 3CXOA 3PUDA 3W7MA 3LG3A 1AMKA 2V6AA 2HK0A 1QU4A 3EWUA 1DWAM 3MI6A 1CB7B 1ZQ5A 1KFLA 2VGFA 1HL9A 4Q4MA 5AYIA 3TA6A 1SR9A 3NQEA 4IP7A 1UC4A 5T8GA 3STGA 2ZUSA 3PZ9A 2TODA 4RX0A 3Q4DA 1T41A 2BP1A 1MW0A 1DQUA 2INZA 1PDYA 1G69A 4P8XA 3CWOX 2XH4A 3NO1A 3R4IA 1FCQA 1VP5A 2FVKA 3V0SA 4HOXA 2NQZA 3VC6A 1XDMA 5DANA 4DEFA 5GPRA 1WB0A 1R30A 5EYWA 3CYVA 1K9DA 4PFMA 3ZR5A 5CJNA 3QC3A 1OFPA 3ZIZA 1QJWA 1H1YA 4NJGA 5I24A 3AWNA 3DBNA 3VIJA 2V2CA 1JF5A 4UIOA 4B2DD 1LLOA 1PIIA 4L9YA 4TR9A 2CZEA 3N04A 1UOKA 1XQKA 3H21A 1KM4A 4REQB 4C60A 3M0XA 4WY0A 2FMOA 3EB3A 2FQIA 2C14A 2HISA 2IQDA 1YTKA 1MUMA 4IPJA 3M5YA 3NQGA 4OTKA 4JOMA 1NSJA 1VEOA 1TWIA 1YQ2A 2Q71A 5AVHA 1L6YA 2V67A 4D6IA 4LVFA 3GD6A 4H41A 3VKKA 1E6ZA 3N2BA 4AHPA 4W86A 1C29A 1UR0A 3KBMA 5MF5A 3W22A 2BY1A 3N3TA 1Q6DA 3APGA 2VHLA 3EOEA 2NT0A 3LHUA 3KFTA 3DFTA 2DT1A 3QGAC 4FXJA 1XFBA 4XD5A 1AZ1A 4S39A 3NDZA 5IDZA 3EDEA 1V3KA 3L7RA 5JH2A 2PCEA 1QK0A 2C15A 2J9ZA 3W4RA 3EZ4A 3EX6A 4GVFA 2UBPC 4A6GA 1D8WA 1EGZA 2ZRZA 4JAWA 3SW6A 4DXVA 3KRSA 4NJIA 3RILA 3BGAA 3S83A 1E0TA 2J8GA 4GIRA 2QEZA 1TPDA 3Q67A 5HQLA 1V7AA 2WKGA 3RG6A 4M82A 2ISSA 4JTHA 2O0TA 2YCEA 2ZE0A 3OVRA 5CPSA 3KP0A 1HQTA 4ZTXA 4UNKA 2WVSA 2X7WA 4S3AA 3L0KA 3W2MA 2E09A 4OOZA 3SGUA 3M16A 1TWWA 3THQA 4JFWA 3MKVA 3W2NA 1PAMA 2CERA 5DY3A 5U7SA 4OUEA 2TPSA 4D6FA 5I3FA 2EHHA 2AAAA 4HTBA 3TR2A 3IRSA 4MIMA 3W25A 4HCLA 4QGCA 3P80A 1FXPA 3RUBL 4B5XA 3BW3A 1PDZA 4HPHA 3TXVA 1IGWA 1V0LA 1TPH1 1UJQA 2V69A 4UOJA 1K8XA 1XH1A 2VX4A 3WQ4A 4J2PA 2BNJA 3NZGA 4DO6A 3S2LA 4BHYA 4C6FA 4AIUA 1IEQA 1P6CA 2KZHA 1KM2A 1YXCA 2GK1A 2PDMA 2XH0A 2JGQA 3WQWA 3W2LA 1B3XA 4ZO6A 3C52A 2V5JA 1OD8A 4JGDA 4OOUA 3DG3A 5CC6A 3BPWA 3KVJA 2OO0A 1OY0A 3VE7A 3R2GA 1PX4A 3VD4A 4GI9A 1AL8A 1RAKA 4WEVX 4IMFA 4XBKA 4EE9A 3M44A 2INEA 2YCIX 4QE5A 3ZFHA 3DGRA 5A6BD 2D3LA 1YMYA 1JG9A 3VIIA 3W29A 3SGZA 1WNOA 3C2VA 4UFMA 5C9WA 3IGUA 4QTGA 1W9BM 4L4MA 2VGBA 2PAJA 3ITYA 3SCQA 1PPIA 3D5HA 3GXTA 3HF3A 5HR6A 3LPPA 4NT0A 3A6OA 4ZE4A 1JAKA 5CZSA 2WCSA 3LTSA 4A3HA 3LGEA 1FWWA 2QJJA 3EMZA 4Z1BA 2CWXA 3W7HA 1YXYA 3GUGA 1F05A 3R11A 5AY7A 4MKSA 4DWSA 2C1HA 4GH3A 1YDNA 4RNFA 4H9TA 1EBGA 3W7NA 1XG4A 4NSBA 3UEQA 2XZ9A 1RK6A 4HD5A 1EP2A 5G2HA 5K4ZA 3IJQA 4WY0B 5HJYA 4NZFA 3LHZA 3GXPA 3K8LA 4MFEA 3ELFA 3OZYA 1RR2A 3RPDA 3EWBX 3B8DA 5D38A 3BLOA 1FH9A 3NQFA 4MLRA 2J27A 3VABA 4JN8A 4NAFB 3GK0A 5FACA 3C0JA 1TWZA 4XV0A 2XVGA 3U5YA 1EA0A 4O1AA 1VCFA 1HKJA 3SN1A 4DJFD 5DXXA 4NASA 3BW4A 1HXJA 1VIZA 4RUBA 1JZ6A 4QLJA 5FF7A 4CGTA 3PZVA 1U5HA 1W3NA 5C9XA 3GFZA 4DF0A 1BG9A 1H7XA 3G8RA 2HVMA 5IFTA 3ZSSA 3S1WA 2DW6A 5I78A 1PUDA 1XL9A 1UA3A 3WK2A 4LALA 2ZQ0A 3GU9A 3F2CA 3IGHX 1Q5MA 3ANVA 3C5QA 1TTPA 3QGVA 1FWBC 4GWEA 4O28A 6XIMA 1UR1A 1EC9A 2CKSA 4XZNX 3W7DA 4ZB5A 1Q4NX 1XJBA 2GWNA 4B2DA 2V3DA 3HG4A 1VHNA 4DJDD 1FWNA 1XV8A 1VHCA 3BCDA 4OFCA 1RK5A 1LYXA 4KCTA 1C92A 2FJKA 3TV8A 1AJ0A 3Q65A 3WBAA 2F6KA 3GVQA 1KM5A 4W7UA 2INFA 2O92A 4YCPA 3KLKA 4M24A 5ENLA 1B54A 2JFEX 5C71A 3DFQA 4XD6A 4P2VA 3OPSA 2P5NA 5FEZA 3MKKA 3WELA 2C19A 2GDUA 1RVGA 3LM7A 5K2ZA 1JZ7A 2JKPA 4XZWA 3PBYA 4WD0A 3G22A 3G1HA 3IJ9A 3OEXA 3L4WA 1E6SM 3WLMA 1EGMA 1PX3A 1Q65A 4GQQA 5M5DA 4AZHA 3KZSA 1TV8A 1QCWA 1LOQA 1T8XA 2WJFA 4R88A 1I60A 3GB6A 4MFDA 1E1CA 3URQA 4LB3A 1JYNA 5AHNA 3V5CA 4XX6A 2R91A 5LNVA 1CXFA 2QUVA 1TVNA 4WSHA 1OFOA 1KFEA 3QFEA 4XQ6A 1XBVA 3AXIA 4JTGA 1V0KA 1GVOA 4JTAA 4IOTA 7TIMA 1ADDA 3HV9A 4TTGA 2CXEA 3S5YA 4LU0A 3UCCA 3DKJA 1XKYA 2NUYA 1E1FA 2HEJA 2CESA 2PF8A 3ONCA 3I4KA 3OODA 4C7FA 5AHEA 4CVWA 3LHVA 4MY8A 4KIRA 1IWPA 4L6OA 2NVDA 2VZSA 4ZOEA 3W1XA 2FZMA 2VR5A 3CEUA 3RF9A 3C2OA 3E2RA 3NPXA 5RUBA 3WFLA 1ADSA 3LB0A 1SYTA 4IX0A 1EF2A 1W3JA 1B3YA 3CTLA 4WHBA 2PDIA 3IJIA 3H4WA 4IM4A 3V3WA 4UTTA 4ACZA 1FP9A 5FSEC 4RNJA 2GWGA 3TDFA 2YX0A 2WM1A 3UVAA 2X7VA 4FOKA 3VKDA 4JTTA 5HMSA 2P10A 5I09A 3AXXA 5FD0A 1PIGA 4C5YA 2ZZ2A 3WF4A 3LHWA 3M6DA 4JIEA 1ITXA 3QYQA 4O1EA 5A95A 4LH8A 4NNCA 3RPMA 4CVUA 1MWOA 1SMAA 2CCRA 1FWTA 2F84A 2ZA2A 3MQTA 1JCXA 1KRMA 3SUVA 1ZBWA 2YL5A 4XUGA 3P61A 3M6YA 1FWJC 1ME7A 2A85A 1W2PA 4XAYA 2GDQA 1Y5VA 4PUJA 3FGCA 4BQ2A 1PO9A 3IAPA 2VFFA 1YLVA 1B31A 2E25A 5FSDC 1FQ0A 3O63A 3C8FA 3IACA 3T0DA 1J2WA 3V18A 1L0PA 1KTCA 5FIPA 3ARWA 1EP3A 3ONBA 5A6BA 1LG2A 2BFGA 3NDYA 1FWSA 4O1DA 3PZNA 2QZRA 1R9ZA 4F4RA 1PTAA 4NZ1A 4M0XA 1JVNA 4JYEA 4BI7A 3KXQA 5D37A 4AZGA 1C7TA 1LJYA 5TD4A 4JTLA 2OJPA 1QPNA 1P6WA 1VD6A 4YS1A 2G95A 1OADA 3LCGA 3EKZA 1U22A 3CZGA 3SIMA 3TKFA 2QDDA 4G8TA 2EGZA 1TPVA 5B7ZA 4DIAA 1S5TA 3B06A 4RDWA 4D71A 2YL6A 1A50A 1QNPA 3C3NA 1WKEA 4GNKB 1UD5A 2OMAA 5JXQA 5FOOA 3UPBA 1O4UA 4H9VA 5DF0A 3CGTA 1J0YA 1J11A 3UXAA 4WVXA 4C6CA 2D73A 2C7FA 4PMNA 3RCMA 3UG3A 1FHDA 3N25A 5C5YA 4BFAA 3TYAA 4CQ9A 4CN1A 3IJ7A 3UWQA 4TX9A 4FXSA 1BXNA 4EAYA 2B0MA 3IRDA 2V8ZA 4M6VA 1YNYA 4DJFA 3SSZA 3E2VA 3MCMA 2J9XA 2BVWA 2PDYA 1OFDA 5CJ5A 4ZFMA 1U30A 3UYCA 2BXVA 1E0WA 4WOQA 4WF7A 3DHPA 1OK6A 1NP2A 1K9TA 1YX1A 5DCEA 3MVTA 1ZPTA 5DCDA 3GDKA 2OU4A 4FX8A 2DQXA 2ZIDA 4TV5A 3UJRA 3T2OA 5JQ9A 3GU1A 3EEGA 4LYRA 1REQB 3L12A 1CTNA 3EXSA 3KTCA 3UETA 4AU0A 1XICA 3QSTA 3GAKA 3VI2A 5E0CA 3VFCA 4R7OA 2QJIA 3S1UA 5CEWA 1VFFA 1TQJA 4R34A 1J6PA 2E6FA 4PMZA 5DBUA 1VCVA 2V38A 1A3XA 1PHQA 2VI0A 4NJKA 1A5AA 2ZWYA 1DJQA 2Z1SA 1NWRA 1A80A 2QNEA 3BC9A 1PX8A 2DP3A 3S9ZA 3UA3A 1DWIM 4DJDA 4TUFA 1KGUA 3PNZA 3VD7A 3CIVA 3IVUA 4MB5A 1EZWA 3O8AA 3WENA 3WDIA 4FNQA 3UR8A 1CZ1A 2VUYA 1X39A 3P0WA 1K3UA 3NEHA 4PR4A 3ERPA 5TQLA 4GQGA 1BGGA 1XRFA 4X0VA 4KESA 2ZZ3A 2IKGA 2WKLA 4J3VA 1EXBA 5E09A 5C9ZA 4YHEA 4WZHA 4GQRA 3GFYA 2XVLA 4I5XA 4HK7A 2QPUA 4D6CA 4ORIA 2GJXA 1GJPA 3VOHA 3STEA 1E9IA 4BWLA 3E6EA 4ACZB 4Q7NA 1E71M 3BG3A 4O15A 3HBLA 3OLGA 1KRBC 4M7TA 2ZDSA 2HBXA 2ZDRA 1H1ZA 3IV8A 3VGGA 2V5DA 2ZXBA 2VQTA 4XZ9A 4UWMA 1W37A 1TA3A 1FDYA 2R1MA 3TP4A 1X98A 3ABQA 1PSCA 1Q2SA 4OZOA 1JYWA 2KAUC 4F0RA 3N2XA 2FZNA 5M17A 4WGXA 4IJBA 4NAEB 5D05A 3TFCA 3NXFA 3BG9A 2PTXA 2XSBA 3AIWA 4RE0A 3AC0A 4DBSA 2Y6ZA 1HO4A 2FZ8A 1VBRA 3O16A 3ZYZA 1EOKA 3LXBA 4R3UA 4HJFA 3O6CA 1TPUA 1CYGA 3MPGA 3ZJ6A 4LF1A 5FAGA 2VVSA 1NOFA 1OK4A 5FL0A 2EG6A 3CM4A 1F6YA 2WVUA 1QNSA 5I3JA 4K7VA 1UG6A 3UCQA 3CL8A 3BQ6A 5HJLA 2DSUA 4JDBA 4XK2A 2VM8A 3OZMA 4JNYA 3AYTA 4GIAA 2XFYA 4AB4A 3R8GA 1H5YA 4YL2A 1WUFA 1WAWA 3L4XA 4WIWA 4UTTC 5DX7A 5E5CA 1PCWA 1A0CA 1DORA 3MY9A 4E8DA 3GH7A 1WO2A 3CV6A 3DFSA 1ZBKA 4PB3A 1KBLA 3RMJA 1EDQA 1SR0A 2ZZ6A 4PMYA 5HOSA 1U2YA 3O15A 4JTCA 3GDLA 2DZXA 4WDWA 5FF4A 1OCQA 1WAUA 4MNLA 3W84A 3KBWA 1XLKA 4YTUA 2QIIA 3PBMA 4V27A 1JFXA 2PBOA 3MB9A 3VVGA 1J93A 5HATA 1Q8AA 3SURA 1KTNA 2VELA 2F38A 2GFTA 3R79A 4OE7A 4JXCA 1IWAA 5FESA 4N4PA 3GIPA 4AC1X 3ITLA 5JVLA 4XAGA 4PC8A 3DHUA 1VFUA 2FZBA 4U3CA 3AXHA 1SJAA 3N14A 4KEMA 2ATMA 4A3YA 3O1NA 1KC7A 1XI3A 3N19B 3W00A 1DQXA 4MNKA 1RBAA 3S2MA 3B4YA 4FPSA 5A8QA 4UTHA 3EX4A 4TVUA 3NO5A 1U5VA 2ZRYA 3O07A 4LY4A 2R1LA 4PB4A 3BDKA 3M0VA 1ISZA 1OM0A 3RHGA 1E6XM 3WH8A 1OC7A 1I9CB 2G0WA 2XIIA 3WJYA 4M6PA 1NOUA 1RP8A 5I3HA 3LERA 3W7PA 4ZL1A 4D2JA 4IH3A 5CKSA 3UZ5A 3VCNA 1QXLA 3W1TA 5F2LA 1MZRA 3EWDA 7ODCA 1VCGA 3AHYA 4BK9A 1JCNA 3RN6A 3ALGA 3YPIA 1PKLA 2B81A 4GO9A 4HYWA 4A2RA 2QCDB 4DLMA 2GYIA 2IPGA 5H1WA 5G4HC 1QNOA 4H8HA 4C7DA 2VL4A 2ZTKA 4LAKA 1HP4A 3V16A 4O13A 4EF9A 4KCWA 3GXFA 3RX2A 3IARA 1NF0A 1JCYA 5LGXA 1JPMA 1TCMA 2UV8G 2ZUTA 4KS0A 4XZIA 2X1UA 3F5LA 4AC7C 1O6IA 5BCAA 8XIAA 1TJ0A 3S47A 1VFLA 1LORA 1IXPA 3BTNA 3MO4A 3RU8X 4DYJA 2UY5A 4Q7BA 1M6JA 1Q7QA 1VFMA 2ZOXA 1M65A 3VYLA 4DJFC 1TREA 3LDVA 3PFMA 4W8LA 5FJRA 5BRPA 1V0MA 5HANA 1BVNP 1P0NA 3RJYA 1L2UA 4CEUC 2VRKA 4PMUA 2NV2A 4B5VA 3R5EA 4RDVA 1UKPA 3DHDA 1TA3B 1JPDX 4YTSA 3VMPA 1I75A 2C3ZA 1K8CA 2OSWA 1TWDA 3W28A 4WK9A 1BTCA 4XB3A 5CLTA 1DTNA 3TWAA 1R9YA 2YGYA 3F4VA 1ZRQA 2A7NA 4TQTA 5G4EA 2C0HA 4L4OA 3AYVA 1ITCA 3NQCA 4AMCA 2Y1HA 3C8NA 2ADAA 2PI6A 1CBGA 5CPLA 2IKHA 3SI9A 4LCSA 1IIGA 1BG4A 2BMBA 3TUUA 3Q45A 3T05A 1OYBA 4X61A 2FPVA 2BX7A 1NWSA 2PRLA 3LOTA 4C91A 5LA2A 1SGJA 3W7GA 5BRBA 4CN4A 4NYUA 1G7UA 3GDRA 3TYZA 1HKIA 2NQ5A 4J3WA 2GLKA 1VJZA 2F9RA 1VJSA 1QATA 2B4GA 4ZGYA 3P67A 2OGJA 1TV2A 1U83A 3L21A 2FH6A 4GX8A 3SZ8A 4IQJA 1RJPA 3KWSA 3LMZA 2AAMA 4ICMA 4IIFA 1PS9A 4BWLC 2G97A 2NZLA 4IUGA 6PTDA 1UR3M 3GVRA 4WKAA 4GZEA 1ITQA 1OB0A 4GY0A 1A0EA 1XDJA 4C6JA 4BS0A 3QQ1A 3JRKA 3PSVA 3SQSA 3ARYA 3NM1A 4LEQA 7ENLA 1YRRA 1DJIA 3PTDA 2DSKA 3CLMA 1GG1A 3PANA 5E9XA 1YHTA 3JU2A 2OT1A 3VZZA 3PBWA 1ME9A 4NF7A 4ATWA 1G1YA 2DVXA 3AIVA 4QJ1A 3BARA 4QDPA 4HVXA 3SUWA 5L9FA 3PBUA 3NGJA 3H7RA 3W1NA 4H6KA 1KQZA 2G3NA 1EXPA 3T2PA 1BD0A 3RNDA 2XINA 1VENA 2W62A 2QJHA 4H4IA 4J3SA 1LT8A 2WNZA 4ZO8A 4MF4A 1MW2A 2TYSA 1ISWA 1C8YA 1TE6A 3WLJA 1E0VA 2PGFA 1D7KA 4ZB2A 4AD2A 4N9BA 1AD1A 4EF8A 2O7QA 3VIMA 1ISVA 1BF6A 4IMEA 3GQYA 2E5CA 1S5MA 3OQ8A 1YPIA 4JCLA 3W1UA 3KBSA 5K3VA 1DJXA 3QRHA 3QR0A 1F61A 1TX0A 3NOEA 3B04A 1MVYA 1PYMA 3SY8A 3BOLA 1GUVA 4PMRA 4QIUA 3HURA 4QNEA 3CB3A 1EC7A 2OVLA 3GO2A 3UWVA 3NIYA 1O1ZA 4HA0A 3A9BA 1NY1A 3EWYA 1G5AA 4MPQA 3NTYA 3SUSA 3R0UA 4YLWA 2Y2WA 3UJSA 3W37A 3PFRA 3LX9A 3GR4A 4UZUA 4RZ6A 3WK3A 2J62A 3JZEA 4YN5A 2QAPA 2ZFAA 1W3IA 2JKEA 3CZKA 1PEZA 5KZEA 3LENA 4PBGA 1VFHA 3NA8A 4LRTA 3LY0A 3SY5A 2D24A 1ZB5A 3INPA 4C65A 1EJWC 4HYRA 4JHZA 1BRLB 2QCCA 3MI2A 4GC4A 3NEVA 4PMQA 4LBRA 1ZJIA 4R7JA 1WV2A 1TV4A 1UH2A 2V3GA 4Q8MA 4QP0A 3FSUA 2WJDA 4HOZA 1F8MA 3SY1A 4A4AA 3WJXA 1FDZA 2ZC1A 3EXTA 1V79A 3N6QA 1GZJA 4J1OA 2YYTA 2RGMA 4C6BA 2PTDA 2VFIA 1W1B1 3W1MA 1N8FA 2E67A 5G5IA 1DJNA 1UYQA 2QR6A 3NPUA 1S46A 2YZ5A 4BKNA 1WX0A 3S1XA 2H9AA 4K3ZA 3UT0A 2V5LA 1J0HA 4AD3A 3PAJA 3CZLA 1VLIA 2EQDA 4GQ0A 3W1PA 1H61A 3STPA 2G3JA 3OYXA 4KF1A 2EKGA 4L80A 3W2UA 3LCFA 4KFOA 3VNMA 4F9JA 3AICA 5LNWA 4RNHA 3MMUA 1S2VA 3NUKA 4F0KA 2OG9A 4HPJA 3G6LA 5D32A 5DFAA 2A5HA 2IPWA 1TTIA 4JIRA 3EPNA 1RBOB 4FK9A 3H55A 3SECA 2W9MA 4Q4RA 4UQBA 3I7QA 2FHCA 2WZMA 5FAJA 3HG5A 3ZVHA 5HNNA 2D0GA 1GQKA 3FHQA 4S3JA 1XSJA 3P7YA 4QXIA 3KL3A 1DTUA 1JUKA 2P50A 3VNJA 5BXTA 2VGGA 1V02A 3H22A 4H6QA 1W0MA 3ARSA 3S4TA 3W76A 2CIPA 2Z00A 3W82A 1UW9A 1JUEA 1BVWA 3IANA 4XKMA 1KXVA 1G94A 3GTIA 1FFRA 2OKTA 4FXRA 4QE1A 1JD7A 4M6UA 1QUMA 3NQVA 1WDRA 2VJXA 4HPXA 4V1YA 4IXHA 2ESCA 5LNRA 1KCXA 3GNDA 1ZAIA 2AL2A 1XD1A 3MJMA 2PDHA 3CV1A 3CYJA 3FEMA 1XIGA 1YE4A 4UR9A 4WGHA 5K4XA 3N29A 3H2CA 1IZJA 4XZLX 2RAGA 4EXAA 1GNXA 4L61A 1XKJA 4IX2A 1E6QM 1POKA 1QHOA 4WOZA 4O17A 5AFDA 1SFSA 1O1HA 4HIBA 3H24A 2EPMX 1HKVA 4EWND 4BEUA