4WOZA

Crystal structures of cdnal from clostridium difficile in complex with mannosamine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
290
structure length
290
Chain Sequence
TDMKGIYSALLVSFDKEGNINEKGLRQIIRHNIDVCKVDGLYVGGSTGENFMLSTDEKKRIFEIAKDEVKEEIKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVTPFYYKFDFEEIKHYYNTIINSVDNRLIIYSIPFLTGVDMSLDQFGELFENEKIIGVKFTAADFYLLERMRKTFPNKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGVRARQIFELTKNEKISEALEVQHVTNDLITDILGNGLYQTIKLLLEEQGVEAGYCRQPMKEATDEMKSRAKEIYRKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate lyase
publication title Crystal Structures of CdNal from Clostridium difficile in complex with mannosamine
rcsb
source organism Peptoclostridium difficile
molecule tags Lyase
total genus 125
structure length 290
sequence length 290
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wozA00
4BF9A 3NYZA 3HPZA 1OYBA 4IX2A 3SW6A 3EWBX 1R30A 3L67A 4IGHA 1SZFA 2NWSA 3NQ8A 2C3ZA 2C14A 5FF4A 3MW7A 3G1YA 3W7CA 1TB3A 2QCGA 1JRCA 4UMBA 1TJPA 4AWUA 3W7RA 4PA8A 1I2RA 3UWQA 5CSSA 3ABOA 1KFKA 1QPQA 4AF0B 4BR1A 3M16A 3W1PA 1KM6A 3TMQA 4WOQA 3B06A 2VFGA 5CG7A 3LBMA 3GDTA 4O19A 4Q32A 2YXGA 4POCA 3WFAA 4H6KA 1YDOA 4WXZA 3UY8A 3W1NA 4PL2A 3T7VA 3L5LA 2QCFA 3P67A 2FPVA 1W5PA 1RPXA 1LOQA 5E93A 4DBDA 4QAIA 2GJLA 1QAPA 4GUFA 1ZHAA 4WXYA 1VLIA 3W7PA 2X1UA 4GWEA 1EEPA 5DY3A 3UXAA 3EX3A 5G2HA 1F6KA 3SGUA 2RDTA 3W1AA 3GK0A 3UQNA 1Z44A 1KTBA 3NPVA 4TIMA 1TQXA 2GVGA 4WY0B 5AYYA 3EB2A 1K8XA 2GUUA 4FB7A 3S8HA 3SI9A 3IIPA 3UWVA 1ICQA 1XDLA 4NJJA 1O5XA 5I3KA 1XL9A 1AK5A 4O10A 3CU2A 2C19A 2JBMA 3F03K 4JNMA 2QJGA 1TPEA 4AVFA 1TMHA 3I7RA 5T26A 5K4ZA 3B0VC 1K7FA 1FWRA 3S5OA 3G3MA 4JTEA 2KZHA 3HG2A 3W1LA 2E6DA 4ALDA 2QF7A 3QMSA 2GVJA 2CLHA 2O7SA 1IXPA 1BWKA 4FNSA 1DJNA 3P8IA 4GJ1A 2ZA2A 5I3JA 1XBXA 2GQAA 2DP3A 2XN2A 5D02A 1VRDA 5HJLA 2J88A 1Q45A 4GXMA 8TIMA 1TPUA 1R46A 3HG5A 3HF3A 2WSRA 4S2CA 2V0TA 1W56A 1MEIA 3FLUA 3TJXA 1L6SA 1EIXA 5BNKA 2QJHA 1TSIA 2TPSA 3TSDA 1JCXA 4FF7A 4ZQOA 3M44A 1YPIA 3NPWA 4CLMA 3NL3A 1AL8A 3I7QA 1GYNA 4KFNA 2CZFA 1K7EA 1W8SA 3DZ1A 2NXIA 1LLZA 3PBUA 4UFJA 4GBUA 1SSDA 1DBTA 2G95A 4JTSA 2ABBA 4LVDA 4IXHA 1RQHA 4Y8FA 4WZHA 3KRZA 4K8HA 2CLMA 5HUPA 3LHUA 2DU2A 3L9CA 4FIQA 5CZSA 2QCEA 4CNOA 3P5ZA 1XKYA 1VGAA 1N55A 3ZWTA 3R2GA 3C8FA 2ZTKA 3G1HA 1SZGA 3G1XA 2NV1A 2H3BA 1PCWA 3N2XA 2C16A 1WXJA 3LCIA 3LGEA 1O5KA 2LLEA 3G18A 3NA8A 1VHCA 2Y62A 4BK9A 1G4TA 3GKFA 5IBXA 1YXDA 2V5BA 2EKCA 1LYXA 4PC8A 3OHIA 1HO4A 3MP3A 3NOEA 4GUIA 1I2QA 5LNVA 4FX6M 4MUZA 3S9YA 2ZZ2A 3IVTA 2OZ0A 1TTQA 2NUXA 3EXSA 1LRTA 3VNDA 3M5XA 3PBYA 1OX5A 2D73A 4X22A 1TREA 1TPB1 1UUMA 2ATSA 1W5QA 3M6YA 1FWSA 1UBSA 4LWWA 2OMAA 2A4AA 3W86A 3PSVA 1SZNA 4UR7A 5DLCA 2WV8A 4R33A 4MOZA 1JRBA 5I3FA 1UASA 3KRSA 3N2MA 1FY6A 1KM3A 3RNDA 2DORA 1UJPA 1H5YA 3I7SA 5EY5A 2OX1A 4M5PA 3OVPA 3M5ZA 1TTJA 2ZRVA 2FIQA 1AMKA 1L9WA 2ZFAA 4MLRA 3MP5A 2TRSA 3I65A 1VCGA 4XKYB 1WV2A 4X9SA 3W87A 2YDAA 4BWLA 3OVRA 4JY9A 1XCFA 1R2TA 2Y89A 3HPXA 2RHGA 2VFDA 2I1OA 4RX0A 3UWYA 5D33A 2DZPA 1F76A 3TSMA 3S1VA 1BEUA 3ABRA 3WK0A 2FJKA 4JTHA 4GC4A 3FJLA 1PHQA 3GAYA 4A21A 1GEQA 4LVAA 4YCPA 5LHEA 1G4EA 3P81A 4M19A 3W7QA 1BKSA 1PE1A 1GVQA 3UWZA 3QMRA 4AMAA 4DELA 3W7IA 3Q2DA 5FF2A 4JTKA 4O13A 2QDHA 1HFBA 4JTGA 4WJEA 3TW7A 3TXZA 3FYOA 1A50A 1G69A 2QDGA 4C1KA 3P82A 1Q6RA 1EP3A 1IXQA 2DJXA 4UNKA 1SSGA 3V1PA 2E6AA 4ZMGA 3DKLA 3IIVA 3LB0A 2BSLA 4KFOA 2YX0A 3VCRA 4UFLA 3NQ7A 3I6RA 2GQ8A 1CI1A 1TV5A 3MJYA 3PB0A 4MLJA 5TBOA 5D04C 2FTPA 3SSJA 1T8XA 2GQ9A 1H1YA 3W7OA 1OHLA 4CCCA 1KTNA 5IM51 3SR7A 1R2SA 1U83A 3F4NA 3W71A 1IF2A 1W37A 1SZEA 1IGSA 3EWUA 3W83A 2Y6ZA 1GWJA 4LOCA 2Q3OA 1KLYA 1SPQA 4O1DA 3TAKA 5K4XA 1KM1A 5AC7A 5CZJA 1DL3A 2E68A 4JYFA 3PS7A 1X1ZA 2NV2A 3LCHA 4NZJA 2UV8G 3SFKA 3GNDA 4O1CA 3QPZA 1X7FA 4NX0A 1C9DA 4OE7A 2E5DA 3EKZA 5DY2A 1K8YA 5BMWA 1XC4A 2H8XA 5TIMA 2QCHA 3FKRA 2QKFA 3B05A 4WOZA 3EWZA 1B9BA 3TW6A 4JR5A 5K9XA 3W76A 1GPWA 2VELA 4LW7A 3UZ5A 3NPXA 3NQVA 2ZZ7A 2A1YA 5CPLA 4CNNA 2TYSA 3GVGA 3CIWA 3G0XA 2PCQA 1XM3A 2ZRZA 1D9EA 1GTEA 4Z1BA 3USBA 1P5BA 1TIMA 4FIRA 3UNDA 3MP4A 3ELFA 3W9ZA 4O52A 3ATYA 1OFEA 4MY1A 3CLMA 3NAVA 3PULA 5G2WA 2A5HA 2Y88A 1Q3NA 4EIVA 3RK8A 3WK2A 1PCKA 3BG5A 4QISA 3THAA 3PUDA 4QM1A 1JCLA 3N73A 1RZMA 3L68A 2Q3RA 1JR1A 4MY8A 1QOQA 3P84A 3LRKA 3G8RA 3NQGA 1D3GA 2V8ZA 4ZQMA 5G5IA 4ZQRA 5HULA 2WKJA 4JX5A 2PE4A 2QUUA 4O0KA 2FPYA 3DFPA 5C54A 2OCZA 1O94A 5D2TA 4DF2A 4JX4A 1AW1A 5DN1A 1FCQA 3G22A 4ICNA 5HINA 3TKFA 3RLVA 1OYCA 5C6MA 1IIHA 2ZQ0A 2NX9A 3WJZA 3DFTA 4N9DA 3EWYA 2W79A 3QF0A 4LTSA 1J4EA 3ZR4A 3E9AA 1LROA 2ABAA 4RXGA 4X2RA 2E5BA 4G1KA 1FUYA 3TJLA 1N8FA 2EF9A 3HOJA 4GUGA 4PL1A 1KM5A 2XN1A 1LLWA 3T55A 3W7NA 1FQ0A 2FB2A 2H6RA 3W7GA 4FNPA 5C55A 4OQVA 1KV8A 2QAFA 1SO6A 1OFBA 3TE9A 4O1BA 1EP1A 3C0JA 4N2YA 3LM7A 2X1SA 1LORA 5KZEA 5D2XA 1EUAA 2VEMA 5ABTA 1ZY9A 2GVLA 5LGZA 1IXOA 3TSBA 4M6PA 1QPRA 4O54A 5CPNA 3O06A 4W9TA 1QPNA 3V75A 1GQNA 3MUXA 3Q37A 3G0SA 2AQWA 2VEKA 1XI3A 4MJMA 3E02A 3KAOA 4IUOA 1UUOA 1W3IA 1VYRA 4GE8A 2W0UA 1TTIA 1YTKA 2R91A 1R2RA 1SQ7A 4LVGA 3HPSA 3LV5A 1KFCA 4IWWA 1G7UA 1QO2A 4FNUA 4OV9A 3UXDA 3W7JA 2YYUA 5J5DA 5G2IA 1H7NA 4BI6A 1WQ5A 4O14A 1QMLA 4LT9A 4AEOA 5I3GA 2A0NA 3AJXA 2CLFA 3MMTA 3FS2A 4AWSA 3TQKA 3BGJA 3GDKA 3TFXA 1OFAA 5EPDA 1FX6A 4UNLA 1JUBA 3KVLA 3W84A 2QCNA 2X1RA 1TV7A 1RD5A 4ADTA 1LBMA 2WO5A 2CZDA 1OFPA 1RV8A 3TQ0A 5LSMA 4JX6A 5CZ0A 1C29A 3CTLA 4HHPA 3EX1A 2RDUA 5L6UA 1QCWA 1KM2A 4AF0A 4RR4A 3DGRA 1WAUA 5D2YA 1I4NA 3MI6A 3GAKA 3BK0A 4GFSA 4WX2A 1SU5A 2DJLA 1OF8A 5TQLA 3MWAA 3FYPA 4YWIA 3PG9A 3TC7A 1W3TA 3NZRA 5KMYA 4YCOA 1CW2A 1NVMA 4M6VA 1W0MA 4N4PA 4JYEA 4LS0A 3TCEA 3GLCA 2A7RA 3GIYA 3C56A 4Q33A 3IIZA 2NX3A 1ME9A 3N34A 3LCGA 4WY0A 2C15A 1XUUA 3EWXA 3PVFA 3LLDA 1TTPA 2VFIA 1LM1A 2ISWA 3W7EA 2DZUA 3ZFHA 2FDSA 2Q8ZA 4M6QA 1J2WA 3N14A 1OX4B 2WSYA 4NJKA 4GUJA 4M7SA 1V7YA 2EGZA 5DCEA 1S3HA 4ONVA 3PBWA 5D2VA 4UFMA 2X1TA 5L9FA 4JDYA 4RV8A 1DHPA 5KZDA 5AHNA 5K9CA 4H3DA 3A5FA 1FDZA 2EPHA 3MBFA 1ADOA 2Q8LA 5FEXA 3QW3A 2PURA 5D09A 1A5BA 4AXKA 3BW2A 3KXQA 4E0CA 5IBXC 3H53A 3DHFA 5F4SA 5CKSA 5GVJA 2J27A 1OFDA 3UY7A 4Z0JA 3E12A 4ORIA 5AFDA 2NUYA 3G0UA 4PFMA 3C52A 3DI0A 2NXHA 3BVJA 1GZGA 2CLKA 3T44A 3TH6A 1P4CA 1H62A 1L6WA 2H3DA 3G3DA 3SGZA 1T96A 3C61A 4NXKA 5HWJA 3SZ8A 5U7SA 1NF7A 4IX0A 3GXTA 3DFNA 1W3NA 1WYIA 4XUGA 3RFAA 2TSYA 2AAMA 1OX6A 1A5SA 2YYTA 3OG3A 5HMSA 4QQ3A 1K03A 3TU9A 2X16A 3A5VA 3S1XA 4AB4A 3W1QA 4UR8A 1O4UA 3UWUA 1OABA 2R8WA 1TCDA 3U8GA 4DXVA 2V82A 5H91A 3NQFA 1WBHA 3WJWA 3BARA 4A3UA 5HQEA 3M43A 4YLWA 5EKYA 5AN7A 2TMDA 1AW2A 3HB9A 4BWLC 5DXXA 3M47A 2IQTA 3LDVA 1LTDA 2WPBA 1G4SA 3ZS4A 3TUUA 1F2JA 1FCUA 4IPJA 4JIPA 4MFEA 1S5VA 1G7VA 2YCEA 1AL7A 2VC6A 1LZOA 4AHPA 1HUVA 3DKJA 2EHHA 2QAPA 1YXYA 3QRHA 4O28A 3QFEA 5K7JA 5I3IA 4RJEA 2DZSA 1W5MA 4NJGA 3C2FA 4UTIA 2H90A 1GOXA 1XUZA 3EX4A 1F05A 4HSNA 1LOLA 3DXIA 3P61A 4UCGA 4A22A 1YADA 3NQAA 1JVNA 4O50A 3WJXA 2F7FA 2G97A 4KWVA 4I7VA 5AOUA 4FNTA 5G4EA 3GDLA 3WJSA 1B3OA 2X30A 3KVMA 3RF9A 2GOUA 3MHUA 4OWGA 4IMDA 2XFWA 4O4WA 4AH7A 1PS9A 4XKYA 4RK8A 1ZAHA 3KFTA 3CWOX 3W7KA 2VXNA 3MHGA 3MYPA 3KOFA 2ATMA 5MHBA 2B7PA 3JR2A 1H7WA 1NF0A 3A9IA 1ME8A 2OT0A 2Z2UA 3B03A 1TV8A 4I9AA 4Z1CA 5AYXA 2HTMA 4LUIA 3QH2A 4Y9AA 4RZ5A 2O7QA 3LV6A 1M6JA 3Q58A 1LRQA 1JUKA 3NO5A 1KTCA 3BO9A 3IVUA 5D30A 2QCCA 3RMJA 2ZTJA 3TA6A 3F1QA 3NG3A 2I9EA 1TPFA 2WNZA 3NR0A 4JICA 1DKWA 1PVNA 3DU0A 4UC5A 5FEZA 3LXAA 4FXSA 3BG3A 3W22A 1YTDA 2J6XA 5A5WA 4ADSA 4EF8A 2B7NA 2BTMA 1KLZA 2VFHA 4DF0A 1QDSA 3NM1A 4QJ1A 3CT7A 4O4VA 3QQ0A 1H7XA 3EKLA 3W2NA 3HGJA 4YXGA 1C8VA 3LHTA 4RKAA 3NQ2A 5H2ZA 3W74A 3ZWSA 5AC6A 5G1YA 3G1DA 4IOTA 5KTLA 3NPUA 3L21A 2DZWA 4O53A 4YMZA 1ZENA 3PUEA 3LHYA 1OFOA 1F74A 3WK3A 3LHWA 4UTWA 1OFRA 1JQVA 1Z41A 4JD4A 2VOMA 4QIUA 1KFJA 4RZ6A 3L5AA 2Z6JA 4IMGA 1JCJA 1L2UA 3NQEA 4NZFA 4IXXA 4HSOA 4MYAA 4XTDA 4ZL1A 1OFQA 2G5WA 5D38A 4JIQA 2E6FA 5EMUA 5D37A 4E2BA 1KV5A 4FO4A 1I2NA 3TK7A 3ABSA 2Y61A 3O63A 2PRHA 1MZHA 1RQEA 3C2VA 3B04A 2FLIA 4LC8A 4O15A 4DO6A 3W85A 1G67A 3IRDA 3L0KA 1KFLA 2VFFA 1JUEA 4LU0A 3GR7A 3GKAA 2RDWA 2QCDA 2E6YA 5AHIA 4X3ZA 1OK4A 1B4KA 5DBUA 2V2CA 3NL2A 1I2PA 3LTYA 4BI7A 2RKXA 1FBAA 1OJXA 4R7JA 2V9DA 1DV7A 2HS8A 3A24A 4GNJA 3W3OA 1W31A 2GJNA 1S5WA 2QUVA 5F2MA 2ZZ6A 1YDVA 2YW4A 4FNRA 5LGXA 5I3HA 4LS1A 2FPTA 3NQ6A 3DFQA 4NX5A 4DO5A 2GPTA 1KFBA 3C4UA 1HTIA 3L0GA 2YW3A 4RLIA 3DI1A 3TXVA 4TU1A 2ZA1A 4FNQA 2RH9A 3G1AA 4UMAA 3N19B 4AHOA 4DEFA 4HPJA 6TIMA 2HMCA 3STEA 4Y90A 1GVOA 2ZRXA 4UTTA 1TPC1 1WOBA 3C2EA 1HL2A 1O60A 3PAJA 5LNSA 1SW0A 4K7VA 2A6NA 2QCLA 1F7BA 1SW3A 2E1DA 4HNNA 2ALDA 3B0PA 4ZQNA 4QNWA 4CCEA 3QM3A 3MBDA 5EA9A 1WA3A 5K9DA 4Q4KA 3HG4A 4IQLA 5F4XA 4MY9A 4UTLA 3SIZA 1OG0A 4UTUA 5HNRA 3SJ3A 3N3MA 4DF1A 4I7UA 4OT7A 1P0NA 1YDNA 3HMJG 1FDYA 2ISVA 1JJKA 2NX1A 4HT3A 3ATZA 3W1TA 1L6YA 4NNCA 2ZDRA 1A53A 5F2LA 3GDRA 3B4UA 3P74A 2C18A 4UTJA 1LCOA 1A5AA 1QPOA 5F4WA 4L4LA 3L65A 1XBVA 4XWUA 2Y7DA 5AYZA 3OBKA 4R34A 4MZ8A 1KW1A 2J9XA 3O07A 4JS3A 4D2JA 5HR6A 2CU0A 2FB3A 3QPYA 1NEYA 1X1OA 3MI2A 4XTIA 1K3UA 4UIOA 2ZBTA 3M5VA 1NSJA 3BW3A 4A2RA 3QSRA 4Y6GA 3PBVA 1H60A 4XBSA 3NL6A 1VCVA 3TX9A 4TR9A 5LNWA 3IGXA 4WD0A 1H51A 3LCXA 4K38A 1OYAA 3M5YA 3LX9A 1X6UA 4UTHA 2A6LA 4N9EA 4OV4A 2CLEA 2YFOA 3S1WA 3QJAA 4O16A 4O17A 4FX8A 1FXQA 5AHEA 1Z42A 4N9BA 4PODA 1U5JA 3O8AA 3DFOA 1GG1A 1H50A 1GTHA 1XXXA 2J9YA 3A21A 3BG9A 1EA0A 4K39A 1RR2A 2CFFA 2QEZA 3CEPA 4CCDA 1ZALA 1M7PA 4Z0SA 2B4GA 2R14A 4LUJA 1K7XA 3N9SA 3EWWA 1YXCA 5BW6A 3S5YA 4GUHA 1YPFA 2BXVA 2RFGA 2Z6IA 4DPQA 1SFJA 2YSWA 3TNOA 1F6PA 1Q6QA 1KM4A 3CM4A 1JCYA 4OGZA 3P62A 4O18A 4UMCA 3W07A 1F73A 1S5TA 3LI0A 1FXPA 3FEMA 4WQ6A 4TO8A 3F4WA 3NQDA 1Q6OA 4HPXA 5BOOA 2Y70A 3M1ZA 3BPWA 3HGOA 3DHDA 3PUOA 3LBCA 4CNPA 2E5CA 2Y85A 2CWNA 5G4WA 3IGSA 3S42A 3L66A 3W7DA 2W6RA 1LBFA 3DAQA 2B7QA 3W7LA 3PWAA 4N6EA 4A2SA 3GZ3A 2P10A 1OK6A 1T0OA 5D05A 3GX9A 5D32A 1I2OA 3G24A 5DCBA 1H7PA 3LXBA 4DBEA 1LP6A 3DFSA 3UWWA 3CEUA 2DZTA 1KA9F 1P1XA 4KWWA 1B57A 1Z48A 4YL2A 2WJZA 4LRSA 2CLOA 3CQ0A 4TMCA 1FWTA 1W54A 5KINA 1EB3A 5U4NA 1ALDA 2YFNA 3PB2A 4MZYA 3W2MA 1TYGA 1VCFA 3W23A 1TO3A 3BLEA 1LOSA 3TR2A 3W1UA 4BFAA 1QFEA 1SUXA 4O57A 4RXFA 4UFHA 3GDMA 5LZLA 3CIXA 1GVSA 3MYOA 4Z1DA 3QC3A 1FWNA 4UTKA 3JRKA 4PH6A 1VYSX 1VH7A 4O0ZA 2CLLA 3P60A 5BRBA 2G96A 1FWWA 3G1VA 3L2IA 4EF9A 1R47A 4NT0A 2PC4A 3NQMA 4I7WA 3NDOA 2DZXA 3M41A 1Y0EA 1FDJA 3D0CA 4P2VA 4NQ1A 3W6YA 3CB8A 1EWEA 1KFEA 4C1LA 1TPDA 3VKJA 2EAWA 1LBLA 2CW6A 2R94A 2QR6A 5SWUA 1K02A 2ZRUA 3YPIA 1SO3A 4S2BA 1EP2A 4N9CA 1YYAA 1EPXA 5F2GA 5FESA 1ZCOA 2JKAA 2XN0A 1X8FA 1ICPA 1THFD 2BLEA 5CPMA 1XBZA 3OEXA 2YZRA 1VYPX 3PC0A 3HGRA 4NVTA 5AB3A 5F1VA 2JKPA 2ZYFA 3WK1A 5C2XA 1VLWA 4AAJA 1I8JA 2ZA3A 1WDWA 3HQ1A 3PR2A 5EBUA 2ZZ3A 3CPRA 4PEKA 1VS1A 1ML1A 3P8JA 4DPPA 5CZTA 3O05A 1TRDA 3W2KA 3EXTA 3AO0A 1JULA 2ISSA 4NNBA 5KZMA 1G6CA 1QO5A 3P80A 5CPOA 4NJIA 3KVKA 2FQIA 1JQXA 4XQ6A 4PTNA 1EWDA 1T99A 3PG8A 3W88A 3QEZA 1K8ZA 3QZEA 3CWNA 3KVJA 2YR1A 3KX6A 3THQA 3TIMA 3O6DA 4K37A 2JKEA 1H63A 2FFCA 3GB6A 1I45A 3O6CA 3NM3A 4TMBA 3CC1A 3BW4A 3B0UX 3LRMA 3GR8A 1H1ZA 4MKNA 3CHVA 3BGGA 5DCDA 3VI2A 4UFKA 5K2ZA 5HWNA 4UTWC 1MEHA 4ORMA 3OVQA 4LS2A 2WNNA 1VPXA 3MI3A 5AHLA 2ZRYA 3BLIA 4UFIA 3LTSA 2QJIA 2NXGA 4MVAA 3U2OA 4JEQA 5DBTA 1E51A 1HO1A 3C2OA 3ANYA 1M7OA 3EX6A 3G8EA 1RQBA 1SR9A 3W7MA 4QITA 3ABQA 4MYXA 3O15A 4HIBA 1SW7A 3LOTA 2BX7A 1V5XA 4AHQA 4ADUA 1DOSA 5LHFA 1OF6A 1SO4A 2OJPA 2NUWA 1PHWA 1RVGA 1XDMA 2PRLA 2Z0IA 4ML9A 2J9ZA 1XBYA 4ZVJA 3FA5A 2YGYA 1JCMP 3S6DA 1NFBA 1KBJA 4LRTA 4HNVA 2VFEA 1ZFJA 3STFA 1MEWA 1DQWA 1DJQA 2QCMA 3INPA 1GT8A 2C13A 2VKZG 3IIXA 1ZJIA 4K36A 2E09A 1LRNA 1QWGA 5E0KA 4A29A 1WBJA 1GG0A 1MO0A 1LDCA 4E38A 3FIGA 1UCWA 1GVRA 1W1ZA 3HG3A 3FFSA 4N02A 3VFLA 4KKXA 1MXSA 5K3VA 5FF7A 4IJBA 4H4IA 3QW4B 4NU7A 3W70A 3KRUA 4CQ8A 4EOUA 2ZZ1A 4NNAA 2JGQA 1ONRA 4KFPA 3TV8A 2C1HA 3R89A 4K6AA 3W1MA 3TDFA 3NZ1A 3SECA 5G1TA 2P1FA 2JK2A 4XZ9A 3W73A 4P61A 3GXPA 2V2DA 3EX2A 3L5MA 4O12A 4Y96A 5HWMA 5D03A 2A85A 1D3HA 2Y63A 4UTTC 2HS6A 2E77A 3LLFA 4GRSA 4PCFA 4IMCA 1WX0A 3MHFA 2Y7FA 3TROA 2V5LA 2V30A 5HR7A 4N4QA 3OIXA 2X2GA 5AHMA 5D2WA 1KBIA 3LERA 3STGA 4WY0F 2C6QA 1PL9A 3B8DA 3HGSA 4OU1A 2A7PA 2V2HA 4K7YA 3MO7A 4RCXA 5CGQA 1FCVA 2A21A 2PRMA 4LC6A 3S1UA 4MPQA 5FEWA 1TRIA 1TJRA 5F2IA 4ZQPA 3RU6A 5FI8A 3RLUA 3LHVA 2VENA 3R13A 4HNTA 4R53A 5AHFA 4NJHA 3UPBA 1G4PA 3A22A 1CX9A 4Z08A 1Q6LA 3M7WA 5EYWA 1PV8A 4JTFA 3DBPA 3A23A 3LXCA 1ME7A 2VEPA 4MZ1A 1QOPA 4O1AA 2BWGA 2Z1BA 3VE9A 4JTJA 1EUNA 4S1FA 4U28A 5C5YA 4LV4A 3PY2A 1J5TA 3BV4A 1BWLA 1ZAIA 1EX5A 3DH7A 3K30A 4FHAA 3FJ6A 3QSTA 5A8GA 1VZWA 2NWRA 5AC8A 2V81A 5E1QA 4L4MA 4MJZA 1YTEA 3S5ZA 1TQJA 3LI1A 3STCA 3O6YX 2NLIA 4HKPA 4MFDA 1AG1O 3PSWA 3W1RA 4HNUA 2CZ5A 1VC4A 3PF3A 2JGYA 4OBTA 1A5CA 1ICSA 3NEVA 1F5ZA 2F84A 4B5NA 4HN4A 1FCBA 3U6WA 4JGDA 2WSQA 4UTMA 3NNTA 4JDBA 4UUIA 4OHQA 1VR6A 3NL5A 5KITA 4JTTA 2P0OA 4ZZ9A 1H61A 4O8RA 3M0ZA 5CSRA 2VEIA 1VJIA 1UB3A 3NQCA 3W2LA 3HO8A 3PM6A 3WJYA 2BZNA 3LRLA 3TQVA 3M9YA 2QCDB 2DZVA 4J9JA 1W5NA 2J24A 2AGKA 1SFLA 4JTIA 2ZRWA 5KSWA 1IXNA 4LY8A 4NUWA 1P0KA 2ZCGA 2B7OA 3SY5A 5LNUA 2WQPA 1N7KA 1ZNNA 3IV3A 1TPWA 5DELA 3W1XA 3S0CA 3E49A 3UD6A 2A2IA 3G1SA 4JYDA 3HIJA 3L0NA 3O1NA 1QR7A 5FF3A 4E2DA 2OT1A 4K8EA 4IMEA 6ALDA 3O16A 3UPWA 3IVSA 5DXYA 3C2RA 2ZZ4A 4DO4A 3LCWA 3BLFA 5EL1A 5F1UA 3H55A 4FX7A 1BTMA 1GYLA 3GYEA 4NXSA 3HJZA 3W2UA 2HSAA 3T40A 1DVJA 4M7TA 1H7OA 4BI5A 1QNVA 3NXFA 2Y7GA 4U4MA 3I68A 4Z1AA 4LV9A 1NAL1 1GVFA 4JXCA 4LVBA 3TMLA 3EXRA 3H54A 4QNEA 3DENA 1PIIA 4EWND 4IPIA 2I14A 3QQ1A 1YLVA 4MIMA 3R12A 4QSHA 3IIOA 3W7HA 1ZAJA 1OVDA 1B4EA 3T4CA 3KHJA 3W75A 3NVTA 3T78A 2C0AA 3FOKA 3E0IA 3LTPA 5FF0A 3E96A 3TAOA 3QYQA 3GXNA 4TX9A 2YPIA 1O95A 1VQTA 2Y7EA 3P7YA 2A7NA 1JCNA 1SO5A 4FEZA 4AWTA 3UZJA 5LNRA 4O11A 1IIGA 1XFBA 4ZQCA 3R8RA 4JN6A 4DQWA 3W72A 4RZ4A 4FXRA 5BMXA 1HG3A 4EVZA 1VHNA 2CZEA 3S5NA 3UYCA 2H8ZA 5FEPA 1AW5A 3EEGA 3W2JA 3P5YA 1W5OA 3R5EA 2ZZ5A 1DQXA 3TC6A 1WOAA 3LHZA 7TIMA 3VE7A 3NGJA 4XBKA 1GJPA 4UXDA 2WNQA 2CLIA 1H7RA 1MSSA 3G1FA 3TFCA 4CQAA 2QUTA 4LVFA 4WUIA 1DORA 4IMFA 5HUOA 3OA3A 3FKKA 4LNYA 3HBLA 4JTLA 4CQ9A 1TPH1 3IEBA 4JTUA 3N9RA 2WOQA 3QMTA 4N6FA 5J5RA 2B0MA 1KM0A 5LKYA 3LCLA 3Q94A 1OX4A 2NZLA 3GNNA 3IGUA 3JS3A 4JY8A 3LCFA 3C6CA 1TPVA 1M5WA 3C3NA
chains in the Genus database with same CATH superfamily
2PC8A 3PZIA 2FZ9A 1R30A 3L67A 4Q8NA 4E8CA 4IGHA 3NQ8A 5JXQA 3PPFA 4RV3A 3VZXA 2G3IA 1TB3A 1JRCA 4E8DA 1TJPA 1GW9A 4LB3A 3CHEA 3QTGA 1G94A 3VNIA 3WLNA 2ZUTA 1KFKA 1QPQA 3WUGA 1Z8AA 2WMHA 4AF0B 4BR1A 3W1PA 2YBTA 2VFGA 5CG7A 3H26A 3MCNA 3N4FA 2E25A 3UZXA 1KXTA 1EX1A 2YXGA 4MJ4A 1P1MA 1YDOA 3SCVA 3IV8A 3UY8A 4PL2A 2QCFA 4G1NA 4L4OA 3FJNA 3AIBA 1X6NA 3B0YA 1W5PA 2XVNA 1LOQA 5TAOA 3WL1A 1Z7AA 1QAPA 4GIAA 1UH3A 2XG9A 2X1UA 5DY3A 4PFHA 3EX3A 3UGRA 2VGFA 3W1AA 2JEQA 1Z44A 2CESA 3EB2A 2GUUA 4CN4A 3SI9A 3V18A 3GTFA 3UWVA 1W9XA 4YYFA 1UMYA 3ENLA 5I3KA 1XYCA 1AK5A 2YA0A 3GU2A 1V3IA 2C19A 3ITYA 1XYFA 1IE7C 4GY7A 3BSGA 3GUGA 2ZXDA 2AAAA 5T26A 2BXZA 4MNMA 1PKLA 2WMJA 3IAPA 2O7SA 3WELA 3B8UA 3MU7A 4HA0A 2XN2A 3CK5A 3B8SA 4F2TA 8TIMA 1US0A 4IL2A 4F0MA 2WSRA 2J7GA 2V0TA 1UROA 3ARYA 5C2GA 5CC3A 3TJXA 1L6SA 4NZ3A 5BNKA 2PDJA 2ZE3A 2TPSA 3TSDA 1BHGA 3NPWA 4CLMA 1EF2A 1AL8A 3GM8A 1W8SA 1IEIA 3DZ1A 2Q8XA 3ONCA 4UFJA 1SSDA 4JTSA 2ABBA 1GJWA 4IXHA 4V1YA 4Y8FA 1ODZA 1VFHA 1UWUA 1OC5A 2JFEX 1A0EA 5JU6A 2DU2A 4GPNA 3V0SA 3IJIA 4K2SA 4CNOA 1W1IE 3S1GA 1N55A 2W9MA 1WP6A 3G1HA 1SZGA 1PCWA 4CD7A 3S5SA 5I6SA 2VUNA 3LGEA 4QG8A 1GVEA 1RBAA 3G18A 3U4FA 3LQLA 2OVLA 1VHCA 2Z27A 4BK9A 5A8OA 3GKFA 5IBXA 1MNSA 3GH5A 2C0HA 1EEXA 3WH6A 3R8HA 3GFZA 4I5XA 1LYXA 2MANA 2QT3A 4C5YA 3OHIA 3ZT5A 1TMQA 3MP3A 4XD3A 1I2QA 5ABFB 2J74A 2OZ0A 1B3ZA 4MWAA 3EXSA 4W89A 1LRTA 3CBWA 3GD6A 1B3YA 2NLYA 1GHSA 5CC7A 5DQPA 3GSMA 1TREA 1UUMA 1W5QA 4IP4A 1OQFA 3VKBA 1FWSA 1R3SA 4LWWA 3W86A 2X05A 1BGGA 4J7RA 1UASA 5AZ1A 3LPOA 3RNDA 4KMQA 1UJPA 3I7SA 5EY5A 1HW6A 3PNUA 4M5PA 2HZGA 5C9XA 1TTJA 2ALRA 2ZFAA 2TRSA 4LNCA 4XKYB 2WSPA 5M2FX 2XZ7A 4LH8A 1JFXA 2Y89A 4AWEA 5CSYA 1TX0A 5D33A 3TSMA 1VP5A 2QV5A 1FFQA 3S1VA 3RPMA 4D6FA 1HKIA 2YOCA 4JTHA 3HMCA 3HA1A 4HK5A 1PHQA 3GAYA 4A21A 3P14A 4LVAA 4YCPA 5D9OA 1K8CA 3W7QA 5T8GA 4AMAA 4FI4A 1EZ2A 1NP2A 5FF2A 1HFBA 4WJEA 3WLLA 3TW7A 2QZRA 1G69A 3APYA 2IPGA 2PGRA 4C1KA 2DJXA 1IXQA 4IF2A 3DKLA 3BUVA 4Q7IA 4GVGA 4KFOA 3W28A 4UNIA 3NQ7A 3PB0A 2GQ8A 1UZ1A 3QPEA 2IXVA 4TXEA 2FTPA 1DJHA 4L5ZA 2Z26A 3W0KA 2F61A 1H1YA 2DQXA 3PJTA 3W7OA 5IM51 3SR7A 1R2SA 5BZAA 1A3HA 1SZEA 1IGSA 1VFLA 3NZPA 4JAWA 3W83A 1GWJA 1JXJA 1XGDA 4Y8EA 4O1DA 5ENLA 4ZENA 3WIJA 4ZFMA 5CZJA 1TWWA 1J0JA 5BYWA 3UJFA 4JYFA 1X1ZA 2NV2A 3AS1A 4NYUA 3L4XA 4NZJA 2GJRA 3EDDA 7PTDA 2V63A 1NDYA 3S46A 4L9YA 5D9NA 4OE7A 3N04A 1ADSA 2D3LA 3EKZA 5TIMA 3CUXA 2OSXA 3FKRA 3QZAA 3B05A 4HTBA 3CUHA 1Y7VA 5K9XA 1GPWA 2GUBA 4DO7A 3UZ5A 2VYOA 2P53A 3ITGA 2F6XA 2A1YA 4QCEA 3SAZA 1E0UA 4DJFC 2TYSA 2VCCA 4AVNA 1S38A 2ZRZA 4XZHA 2EEXA 1WDSA 3O9NA 2HBXA 2YLLA 4Z1BA 2NSOA 1FWBC 3USBA 3VNMA 1FWIC 1P5BA 2QDDA 4QDWA 3MP4A 4O52A 3PTDA 1R7OA 4MY1A 1H3GA 1E9YB 2FJUB 4TV5A 2VRKA 5A1AA 2I57A 4F0KA 4HVXA 3PUDA 1JCLA 1EJXC 1DYSA 1JR1A 1WDQA 1RCOB 3H4XA 4W87A 4UQEA 3V1HA 1PKYA 3KBSA 4DB7A 4C1NA 5CQ1A 4LB4A 3KRBA 2PE4A 2QUUA 5HMFA 4KEUA 4C7GA 4NILA 1O94A 2D1ZA 4JX4A 1TZ7A 1LUCA 4BQ3A 3HV9A 3PK7A 1XJBA 5HINA 4F8XA 4B5SA 2DH2A 3TYDA 3EWYA 2W79A 1X7IA 4Z2JA 5C9UA 2ZC1A 1LROA 1TZ9A 4X2RA 2E5BA 5IOBA 3NQBA 3UYIA 3R0UA 3JW7A 4UQCA 2EF9A 1L2QA 1J8VA 1HJWA 1I75A 1UIOA 3HOJA 4GUGA 3W7NA 2XN1A 2NQ9A 2Z29A 1F4HA 2QYGA 4RDWA 4FR1A 2VNCA 4OQVA 3LMZA 3BSMA 4O1BA 1IEXA 3VKDA 1LG1A 2HWGA 4Y9OA 2ISFA 1V6TA 4AC1X 1XF0A 2FHFA 5KZEA 3CJPA 1EUAA 2O9OA 1FVPA 3WLRA 1BXCA 4IPPA 4EWJA 3O06A 4W9TA 1QPNA 2IMRA 5A3HA 1QHPA 2ZIDA 5LXEA 3W25A 1CLVA 2O55A 3FGCB 2F9RA 1CWYA 1Y5WA 3DG7A 4AZ5A 1NTHA 3E2SA 4S3JA 5J04A 4AZCB 4M81A 3LV5A 4IWWA 3KS5A 4QJ3B 3W7JA 3UXDA 4WDUA 2YYUA 1RPKA 4QX4A 5DT7A 4C6OA 1H7NA 2REQA 2WSKA 1QMLA 4DNHA 3LSCA 2A0NA 3U5UA 3VIJA 3WDQA 2WW5A 1NWTA 5EPDA 2DT2A 1Z9AA 1KXQA 2X1RA 4ADTA 1LBMA 1Q6FA 3EA1A 3KOXA 2IPWA 2WO5A 2WVVB 2CZDA 1RV8A 3MSRA 3FXGA 4W5ZA 3CTLA 3M64A 4HHPA 2PDQA 3DHUA 4HK7A 4LSBA 1J93A 3T09A 4D8AA 3MUIA 3QHMA 3MI6A 4HNCA 1SFSA 4BEQA 1TV3A 2OKTA 1MVYA 1GZ1A 3MWAA 1QWKA 1VBHA 2VDHA 1ZP4A 3CUIA 1W3TA 1ZRQA 1CW2A 3NIYA 3PWGA 1DIEA 5HOSA 4JHZA 3MTWA 4QJ4B 2A7RA 3GIYA 4XAYA 1DXIA 1MW2A 3SCTA 4PCNA 1UD3A 2V6AA 2CC0A 2OQHA 2P88A 3VIMA 1VFUA 4WY0A 3GBDA 3LG3A 2AQOA 3PVFA 1LM1A 4D6CA 3ZFHA 2FDSA 1J2WA 4XD6A 4GUJA 1VEPA 1NELA 2PLCA 4C6PA 4C91A 5DCEA 4ONVA 1YE4A 3PBWA 1SJBA 2X1TA 1XGZA 1K6AA 3EZ4A 2PTDA 2J79A 4RV8A 4H8HA 2VHLA 4HYVA 2QLYA 1U30A 1XLIA 1FDZA 1RK5A 4BF5A 3MDWA 3REQB 6REQB 1NQKA 4RL3A 1B3VA 2ZX7A 5F4SA 2Y4SA 5CKSA 4D1IA 1EIBA 3HQOA 3WUEA 1YQ2A 2UY3A 4DHGA 3BAYA 3BVJA 1IEWA 3TH6A 4ZOAA 1KBBA 2H3DA 1K70A 3SZ8A 2J7EA 3ONBA 4IX0A 3BOXA 5JBDA 1WYIA 1HNYA 1PTAA 4KWUA 5A6BD 1UD4A 4JTDA 2PLMA 2YYTA 3N29A 1AFSA 3W1QA 1O4UA 3OO2A 1NH6A 1UR4A 4B3ZA 4DXVA 2V82A 1K9EA 1WBHA 1ONXA 3KBNA 4A3UA 3M43A 4UTFA 4YLWA 5AN7A 4PUMA 2ICSA 2DSKA 5IFPA 2OSWA 4WSKA 3ZS4A 3TUUA 4CUCA 2IXUA 2E40A 4MFEA 2YCEA 1AL7A 1HUVA 3DKJA 2QAPA 4U33A 1YXYA 4GQ0A 4NAEA 3QRHA 1KCKA 3QFEA 5K7JA 1VFOA 5A8QA 5I3IA 4RJEA 2DZSA 1W5MA 4UTIA 2WC7A 2H90A 2QDEA 1OEPA 4NKCA 3IJ9A 5A6LA 3DXIA 3P61A 4JCMA 1GORA 4UCGA 1UKTA 3M0IA 3BAJA 3NQAA 5CEWA 3WJXA 2F7FA 3WL0A 1CB2A 2ZUUA 2NVCA 1FFRA 4GK8A 4IMDA 4AH7A 3AMCA 1E15A 3CL7A 1ZAHA 2Z1SA 2IS7A 2DUAA 3RITA 3WNLA 3JR2A 4YTTA 3JZEA 4DJED 2J25A 1QBAA 3EWCA 1EHNA 3AIUA 4Q6JA 4Y9AA 4RZ5A 1DXFA 3K13A 1T40A 4NL1A 1M6JA 3Q58A 4YVXA 4AISA 5CH9A 3BO9A 2QCCA 3LS9A 1MRAA 3NG3A 2WLYA 1S46A 1TPFA 2X8RA 5XINA 4H6QA 1E5JA 1PVNA 2YBVA 3KCJA 5FEZA 2OZTA 3BG3A 4Y9NA 4QJ1A 3QQ0A 3W2NA 4RE0A 4GISA 1TZZA 3TQPA 4CGTA 2W3ZA 5H2ZA 3F7JA 3ZWSA 5G1YA 2PZNA 2WC4A 3URBA 2OO0A 1ZENA 1R3WA 4H19A 3MB9A 1CDGA 1OFOA 1OC6A 2WZHA 4RDZA 5MF5A 1KFJA 1T8QA 3BZJA 4HP5A 4NAFA 4QS6A 5REQA 4HSOA 4MYAA 4XTDA 3URAA 1OFQA 3BMXA 4JIQA 4E2BA 1EOMA 3PTMA 3ABSA 1B54A 1LWIA 3BAIA 1JZ4A 2ANUA 1GOOA 3C2VA 2FLIA 4FPSA 2QHAA 4GI6A 4WGHA 1CEOA 3IRDA 4JFUA 2VFFA 3T0CA 1JUEA 3GR7A 3ARUA 5AHIA 3ITVA 3M0YA 4Q4RA 2Y2WA 1CGYA 3CL6A 2RKXA 4Y7EA 2VX4A 4GNJA 3W3OA 1BVZA 1W31A 4FLSA 4TV6A 1S5WA 1YDVA 4FNRA 2P8CA 4LS1A 3V0TA 2FPTA 2PI6A 4G9PA 1KFBA 1D7FA 1J18A 4IIHA 5BWFA 3L0GA 1EKOA 2YW3A 4O1EA 1EZWA 4UMAA 3WG6A 3MUAA 3N19B 4AHOA 4DWSA 1QI0A 4G6CA 1B1YA 1JPHA 3STEA 4Q8TA 2ADAA 2ZRXA 2BOFX 4XD4A 3AFBA 2DW7A 2VVNA 2YL9A 4WKFA 2QCLA 1SW3A 4GYPC 1KCXA 3I4KA 5BOEA 1POJA 1KXHA 4MPKA 2W91A 5EA9A 3SSZA 5K9DA 4PCSA 4IQLA 1X8CA 3ZVHB 3WNKA 4JQ2A 2YDRA 2B31A 5KZ6A 3GXDA 2ACQA 3SJ3A 4AW7A 4MM1A 1HT6A 1FDYA 2ISVA 4PULA 5G4HC 4HT3A 1XDJA 3VDAA 1FP9A 5IHSA 2ZDRA 3L7RA 2BB0A 4UTJA 3L4ZA 2VX6A 3E74A 5F4WA 3GNRA 4L4LA 1M1BA 3L65A 3UNTA 1XBVA 4H1ZA 3WD0A 2Y7DA 2E1WA 1HGWA 4OOZA 3O07A 3RILA 4KGLA 2QULA 1NEYA 1X1OA 2YBUA 4XSLA 4GVIA 3W00A 1WB0A 3U5YA 3M5VA 1NSJA 1KGWA 2OLSA 1H51A 3LCXA 1GQKA 1N8IA 4J2PA 3WNMA 4BQ4A 4J3XA 4B4HA 4UTHA 4N9EA 4OV4A 2CLEA 4FX8A 4CD4A 1POKA 1P6BA 1Z42A 4PODA 1U5JA 2CBIA 1VFTA 1ZCCA 1GTHA 1JI1A 1WKDA 1IT0A 1VBUA 3QLDA 1RR2A 2AQVA 2CFFA 3RXZA 3CEPA 1ZALA 4XKMA 3MCMA 1K7XA 2QIWA 3N9SA 1JF6A 3HQPA 1YXCA 3BSHA 4GUHA 4F4RA 2OOFA 2X0SA 1LQ0A 2YKKA 5I24A 2DGAA 2YZ5A 1NQ6A 3EOSA 4UMCA 3W07A 3S2JA 4JNZA 3W6MA 1F73A 1YBQA 3CZKA 4HZ8A 2JF7A 3F4WA 3FW6A 2HJPA 3FAXA 2Y70A 3ITCA 3DHDA 1KFWA 3PUOA 3ECQA 2FZMA 4GI9A 2BS9A 2CWNA 5G4WA 1QU4A 3S42A 5BXRA 1MWOA 3L66A 3W7DA 3H22A 4M8UA 3IUHA 1LBFA 3WLJA 1ZTVA 5B7YA 1XH0A 3PWAA 5C9WA 4HGXA 4M80A 3AYVA 1T0OA 5D05A 1I2OA 1H7PA 3LXBA 3SGGA 2FH8A 3IJQA 4KBXA 5C7VA 4TTUA 4R7OA 1EB3A 3MZNA 5U4NA 5CSUA 4DM2A 3PB2A 4M1BA 3W2MA 3VDBA 1TYGA 4E3TA 3B9NA 1VCFA 1E72M 3BLEA 3OOQA 4BFAA 4O57A 2R82A 4GY0A 3VUSA 2WYSA 3VOGA 2PDIA 4IICA 2PTYA 2X7WA 3ZVIA 3XINA 2DUZA 4UQ9A 3MYOA 3G77A 4XO7A 5DMYA 4HZ7A 5FJTA 4UTKA 1KCLA 4PH6A 3SQMA 3P60A 4ZXOA 3RLHA 3MUY1 1F4AA 3A4AA 1VAHA 4ZTXA 1EJVC 3G2GA 2DZXA 1ZBCA 3M41A 2XIIA 4LX4A 3KTCA 1XLGA 3DFHA 1ONEA 2WAGA 3CB8A 4IIDA 4RNHA 4W85A 2VZOA 1KFEA 1MXGA 3E0FA 3R1ZA 1TE6A 3GNPA 1QI2A 3AALA 2QR6A 5SWUA 4EAYA 4GCXA 3THUA 4GNKB 2FZ8A 2ZUNA 4DI8A 5FA5A 1EPXA 5FESA 3IJ7A 3MV01 4XO6A 4NZ1A 4L56A 3KP0A 1TUFA 2BLEA 1XYZA 3PC0A 3WN6A 3CAWA 2PWHA 3HGRA 4F66A 3UJ2A 2FDMA 4YS1A 5F1VA 2OG9A 1BXNA 3E2VA 4EPDC 5GNXA 3K8MA 3DERA 1TV2A 4JQAA 4F0HA 2OWCA 4PEKA 1MMFA 5CC6A 2PODA 1K1DA 1ML1A 1TRDA 1CYGA 3W2KA 2X1IA 1EJTC 1JZ7A 2IKIA 3BV7A 2NQLA 1QO5A 2D0GA 3P80A 4MAZA 1JQXA 3CO8A 5EB8A 1OG6A 1T99A 3QEZA 3CWNA 2ZADA 3O6DA 4LCQA 2ZUVA 4BHYA 2DUXA 1H63A 3ARQA 3E6EA 1I45A 3ISIX 3O6CA 4TMBA 4GI8A 3BW4A 3B0UX 3CYJA 3CHVA 2XIMA 3WBXA 1JYNA 1KR0A 3CS2A 4UTWC 1Y5XA 4ORMA 4LS2A 5FJJA 4HNLA 4UFIA 3VDCA 3S2LA 3PZNA 2V5JA 4MVAA 4LAUA 2V3EA 2GLKA 3C2OA 4C6QA 4HA1A 3WQ5A 3FAWA 3LBOA 1LL6A 3T07A 4DIAA 4GIRA 1R6WA 4QITA 3WENA 2AGTA 3QQWA 3FNDA 3VAVA 1PZ1A 1UWRA 3TWBA 2OJPA 3HURA 1E0XA 1PHWA 1RVGA 1DEDA 2Z0IA 1AH0A 4S3CA 2J9ZA 3FA5A 1JCMP 3S6DA 1NFBA 4LRTA 4W8BA 2VFEA 3M46A 3QR0A 2HK0A 2QCMA 4DWDA 2VKZG 1PZ2A 4GFIA 1XSIA 4A29A 2YL5A 1GG0A 4KEZA 4GY1A 2J66A 1PZ3A 1PX3A 1EDQA 1W1ZA 3ANVA 3HG3A 2SFPA 3IRSA 4NU7A 4H4IA 3KRUA 2CZVA 7ENLA 4M56A 3LD5A 4ERIA 1ONRA 3MUZ1 4DZIA 3L4YA 4MADA 4CN6A 4K6AA 3CH9A 3NZ1A 1JPKA 2ZX6A 4RZBA 2JK2A 4TVUA 4LANA 2QQ6A 4P61A 4HYRA 3OVGA 4AC7C 3GG1A 1MFVA 4UTTC 3B9AA 3VGBA 3T0TA 3TYUA 4IMCA 4OBSA 4GO9A 4GQBA 4RPPA 2V5LA 2V3GA 2QGHA 2V30A 3OIXA 2X2GA 5AHMA 5D2WA 3B8DA 1E6ZA 4OU1A 3IK4A 4JHOA 2A21A 2PRMA 1TKKA 2PDBA 4HMCA 5FIPA 1TJRA 1VPYA 5FI8A 1S2UA 3TTOA 1Y65A 3A22A 1WE5A 4X0NA 4ACZA 3PPCA 3M7WA 4FK9A 1WZMA 3P93A 1PV8A 4REQA 2VEPA 4DXXA 1UQYA 4O1AA 3POCA 3GXMA 3RMEA 4C6FA 4U28A 2NVDA 3MKVA 3CTTA 3BV4A 1UZ4A 3DH7A 4DZ5A 3FJ6A 3QSTA 3TYBA 1IT8A 1Y5VA 5AC8A 1RJRA 3HPAA 1LL4A 4RNJA 3ZT7A 8A3HA 4MJZA 1PB0A 3S5ZA 4KETA 4IM4A 3LI1A 5DMNA 1LWJA 2NLIA 4JKKA 3W1RA 2CZ5A 2FZNA 4NIRA 1ICSA 4Z1YA 4J3SA 1R3YA 2PGWA 1KKOA 2FTYA 4B5NA 4HN4A 1FCBA 1UP3A 3PUGA 4H6RA 1ZZMA 2GL5A 1DJIA 4C90A 2WLZA 3SUWA 2P0OA 4KESA 4ZZ9A 5KETA 4XZBA 4O8RA 4QEEA 2VEIA 1UB3A 3NQCA 1GZJA 3H4WA 3WJYA 1DWIM 2QCDB 4J9JA 3WX7A 1V3KA 3NEHA 4AEFA 1R3TA 2PUZA 1BRLB 5EMYA 5IXEA 5LNUA 1N7KA 4Q3MA 5I07A 3TN4A 2A2IA 3UCQA 2E3ZA 2RJGA 3TTYA 1IQ8A 3L0NA 3O1NA 1QR7A 4E2DA 2OT1A 3WDRA 3O16A 2OR2A 4D6GA 4X61A 3C2RA 2AL2A 1TUXA 2VWTA 5EL1A 2VZSA 3Q65A 8XIMA 3HJZA 2YCKX 3T40A 3NO3A 3ARPA 4AU0A 3VZYA 3KM8A 4J4KA 1H09A 3NXFA 3WD3A 1P6WA 4US6A 4U4MA 3I68A 1EPVA 2NQJA 1GVFA 1PIIA 2PWEA 3VOHA 3AZRA 3TNBA 1B4EA 3KHJA 4H41A 2C0AA 4LAZA 3HV8A 2PBOA 1W3JA 2CBJA 1WDPA 4LY4A 5E5CA 1O95A 2PDPA 3WD2A 1DJZA 5JIPA 2QUNA 1SO5A 3LENA 1G5AA 1YE6A 2WCAA 3MPGA 1B2YA 2IW0A 5LNRA 1U5HA 1KRAC 1UR8A 2W61A 4S3BA 4RZ4A 1GK8A 2AMGA 3WQCA 1Z89A 2QPSA 3UYCA 4INFA 2WZIA 5FEPA 3NSXA 3W4RA 3W2JA 3WQDA 1BG4A 2XSBA 1TWIA 4GHRA 2ZZ5A 5MKGA 1YRRA 7TIMA 2JF6A 3FHAA 1AMYA 1NARA 2CHOA 1E0TA 1HL8A 5A95A 1MSSA 2CCRA 1V08A 2QUTA 2WMIA 4P7NA 2DDXA 5LYRA 1SMAA 1YX1A 4GQQA 2ZUWA 1O6IA 1RJQA 3HBLA 4JTLA 4HHLA 4J5NA 5A6MA 2PP1A 5FOOA 2BY0A 5M5DA 4U3AA 3GNNA 2PDNA 4JY8A 1QNQA 1QATA 4BF9A 4ML4A 3HPZA 1OYBA 4XG1A 2D2HA 3SW6A 3EWBX 2C3ZA 3ME3A 1BFNA 2FKPA 2OX4A 3G1YA 3SJNA 1X1NA 2WHMA 4UMBA 4AWUA 2D0FA 5C8BB 1TA3A 1NOWA 3UWQA 1B0IA 5CSSA 5A8MA 2EQDA 3M16A 1KM6A 1LT8A 4WOQA 4L6OA 5FJUA 1UBPC 4QBXA 4Q32A 4AY1A 4HZMA 1U5VA 3WFAA 2GWGA 1ISWA 3SRHA 3P67A 1GYMA 1NOFA 2FPVA 3CIVA 2Z00A 2O0TA 4V2XA 5CLWA 3EKGA 3URNA 4B16A 1RPXA 2OEMA 4DBDA 4QAIA 2GJLA 1KO0A 3I10A 5AVHA 4GUFA 1ZHAA 4WXYA 1VLIA 3W7PA 2QGYA 1W2PA 3UXAA 2VC5A 1F6KA 5G2HA 2RDTA 4BJHA 4MNKA 4LAKA 3UJSA 1KTBA 4TIMA 2GVGA 1HKMA 4DI9A 2BMBA 2YXOA 4FB7A 3S8HA 5DANA 4R85A 1XD0A 4RE3A 2E9BA 2PP0A 3IIPA 3GDBA 1P48A 4V28A 1O5XA 2JBMA 3WLPA 4JNMA 5EMLA 4BEUA 2Z2AA 3UXIA 4C7FA 4V1XA 1S5MA 1XQLA 1JGMA 1FWRA 4MUPA 5CBJA 3G3MA 3MDUA 3N12A 2QF7A 2X0HA 2GVJA 1UD8A 1A5MC 2CLHA 3AXMA 1XSKA 1IXPA 1NDZA 2G50A 4NYYA 4QCFA 6XIAA 1DJNA 3L2LA 3H7VA 1UG6A 1B9ZA 3B9DA 4GJ1A 2ZA2A 4QJ5B 1XBXA 2GQAA 5D02A 1ISZA 3GG8A 2FH6A 3HF3A 4S2CA 3S2CA 1EJWC 1W56A 3H2CA 2XFYA 3FLUA 1XX1A 3UR5A 4B2DD 2QJHA 4U10A 5D8WA 1MZRA 1JCXA 4FF7A 4C6DA 4ZQOA 3M44A 3NL3A 4KFNA 1ITQA 2NXIA 3PBUA 3BDKA 4LVDA 3BJTA 1QT1A 4WZHA 4JKMA 3RX4A 2CLMA 2P5NA 2O92A 4FIQA 3EOOA 4PMVA 3HTWA 1L6FA 3PJWA 2F6UA 1VGAA 4ICMA 3ZWTA 2OEJA 1Y8BA 3H2FA 4JHMA 2ZTKA 2NV1A 2H3BA 2GSHA 4Z42C 3LCIA 3WNOA 3VIIA 4HK6A 3NA8A 3AS0A 1V3LA 2Y62A 1S5NA 3EA3A 5DMLA 5I79A 2GDVA 2V5BA 2UY2A 3FV9A 4LCSA 1E5NA 4FX6M 1XCWA 3IVTA 3KUMA 3M7SA 1H4PA 4U3CA 3KLKA 3VNDA 3M5XA 5LIKX 3PBYA 4J3WA 1RD6A 2X7VA 1K9DA 2ATSA 1EXPA 2A4AA 1JDCA 1HQTA 2P3ZA 5DLCA 2WV8A 4R33A 4H7ZA 1NDWA 4GXPA 3SQLA 3F4CA 2PDKA 1TX2A 3O6AA 3IANA 4YTSA 1KM3A 2DORA 1H5YA 5FSDC 2PGFA 1VIWA 3OVPA 1K9FA 4KRZA 3T0BA 2YDSA 3H21A 3I65A 1VCGA 4OBRA 4F0SA 2WBGA 1WV2A 1B31A 4X9SA 4IG2A 3W87A 4DJDD 1E9ZB 3HPXA 2RHGA 3UWYA 2I1OA 4US5A 2DZPA 1F76A 1XD1A 1BQGA 1DIOA 1A47A 4FLOA 3WD1A 1E71M 3QBUA 4S3EA 2OSYA 2E0PA 3PN8A 4UZUA 3WQWA 5A6TC 4LAMA 1VPQA 1G4EA 3P81A 1HP4A 4M19A 3UWZA 3QMRA 4IQJA 4PMJA 3Q2DA 2I9UA 4JTKA 4S3AA 1QPKA 5M1TA 2POTA 3ARZA 4JTGA 4HMNA 2Q02A 3CO4A 3PP7A 1Q6RA 3SCSA 4Q8UA 4ZEPA 2O4QA 3SEPA 3LB0A 4RW5A 3UESA 1BGAA 1BYCA 1GHRA 2YX0A 5A69A 1QI5A 4K68A 5IDZA 1WZAA 3NSNA 1OT1A 1W32A 2A3AA 2KX9A 1KTNA 1IF2A 3EWUA 1PTDA 2NW0A 4ZO9A 2Q3OA 1SPQA 5K4XA 2E68A 3SFKA 4GNVA 2WBKA 4V27A 4WGXA 3WDHA 2GJXB 4UQDA 1W1VA 3HN3A 4TX8A 3DGBA 4L9ZA 1XC4A 5BMWA 2QKFA 4PMOA 4WOZA 3EWZA 3FYYA 2PF8A 4OECA 3RJYA 1US3A 1AQMA 3H2AA 3KTSA 3AZTA 1XM3A 1P0DA 1EJSC 2VDIA 2GK1A 5DF0A 2CIPA 2VD9A 1GTEA 1DWJM 4C65A 2PU1A 3VD7A 3VM5A 1MQRA 3SRDA 5I2UA 4A3YA 1J10A 3U7VA 1REQB 1OFEA 3CLMA 3KOZA 4IP7A 4YVPA 1W3LA 2A5HA 2VL4A 4PMDA 3UA4A 3RK8A 4GO8A 3AUJA 4DUVA 2DQWA 4QISA 2Y5EA 4QM1A 4WSJA 3L68A 5I09A 3R58A 1QOQA 3P84A 1CGXA 3G8RA 3UP8A 3UVIA 3NQGA 3KZPA 3O3RA 1D3GA 4ZQMA 2HK1A 3S83A 5HULA 4IL0A 2WKJA 2WXDM 2D20A 4JX5A 3B9EA 4B92A 5C54A 2OCZA 2XUCA 4HA3A 1SJDA 5DN1A 3G22A 1QRQA 1SMDA 5GJMA 1OWQA 1KRMA 3RLVA 3VM7A 5C6MA 3M07A 1IIHA 3AHZA 3AXIA 3JZUA 4FALA 2ACSA 1GOIA 4LTSA 3E9AA 3N6QA 2ABAA 4RXGA 1BF2A 2QJNA 5GQBA 3NUKA 3C5QA 1N8FA 2VZTA 3RO8A 5BXPA 1H0GA 2FB2A 2H6RA 7TAAA 4FNPA 2OOGA 3V5CA 1RSCA 4F40A 4DWSD 4E4UA 4N2YA 4CCZA 2GSJA 2X1SA 3K46A 3WEOA 1T6MA 5ABTA 3QN3A 5AYBA 1IXOA 1QPRA 3WD4A 5HATA 1EO5A 1AZ2A 3M6DA 3NXLA 2WKGA 4MJMA 3TCSA 4D8LA 1M65A 4S3DA 3E38A 2R91A 1R2RA 2DT3A 3RM9A 2HE8A 1SQ7A 3U3HA 1PDYA 3P6LA 4LVGA 4R7WA 5EMJA 3HPSA 5CPQA 1KFCA 3WH5A 4OV9A 1WQ5A 3FVMA 1Z3NA 3WNPA 5I3GA 4MHBA 5HPCA 3MMTA 3N11A 1DTNA 3FS2A 1QK0A 4ZO8A 1OFAA 3WNNA 4P7LA 2XH4A 3KVLA 3QR3A 1IWPA 2I7GA 4X2PA 4HZ6A 3TQ0A 2WJFA 1MW3A 2HBVA 3F5LA 1H41A 5CZ0A 1XSJA 3EX1A 2DIJA 3TLQA 4RR4A 3DGRA 1F07A 1I4NA 2HQAA 1KQZA 5FCZA 3GAKA 1ZPTA 3BQ6A 4GFSA 4WX2A 2GZXA 1TIWA 4JZ5A 5TF0A 4I9TA 4M6VA 1J11A 2VD8A 6A3HA 3TCEA 1LT7A 3SY8A 1Z32X 5AC5A 1QHOA 4Q33A 3L4UA 1Q6GA 4Z2LA 1JXKA 4PSPA 1Z6KA 4EKJA 1IWBA 1RA0A 4H83A 4DJEC 3LLDA 1TTPA 4J28A 2XPKA 3VTRA 5E0FA 1P7TB 3KE0A 3T08A 1VF8A 1Q2SA 4NJKA 2WSYA 3LZ5A 3FY1A 3WLTA 2FYMA 5D2VA 4UFMA 4EK7A 1GNXA 5L9FA 2QV4A 4JDYA 1DHPA 3BJFA 5A94A 2V38A 5AHNA 1A4MA 3UF9A 4H3DA 3A5FA 2ZDSA 2EPHA 1F8IA 5GPRA 2X40A 4WIWA 3VKAA 5FEXA 1PKMA 2UY4A 1A5BA 2DEPA 4AXKA 3BW2A 4AD4A 4E0CA 3QOMA 3DHFA 3BANA 4Q4PA 3VO0A 1H5VA 4YNGA 4GG9A 1O1HA 2WHLA 3L2MA 1W9UA 3MS8A 8XIAA 1UD5A 2R1PA 3QGVA 5AFDA 4PUWA 2NUYA 3UR7A 3G0UA 3LU2A 1DP0A 3C52A 4PFMA 1CGWA 3DI0A 2NXHA 3MMDA 3SN0A 2CLKA 3CV6A 3CHFA 1E1FA 1H62A 2BVWA 1L6WA 4FOKA 2ESCA 3G3DA 4A8IA 1T96A 2GFTA 1ZQ5A 4AEEA 1WDDA 4PBGA 1JD9A 3DFNA 1NM9A 3RFAA 3OLEA 5EMMA 4LEFA 2Z1WA 4CU7A 3UPMA 2TSYA 1OX6A 3UETA 3C2YA 1ZJBA 3MV11 2O9PA 4DYKA 1V6WA 3S1XA 3UWUA 4MWAE 4AD5A 5BROA 3U8GA 2W62A 3PZVA 3NQFA 5DMMA 1SJCA 2TMDA 4LPCA 3M47A 2IQTA 1LTDA 1G4SA 4QRNA 1WXYA 1FCUA 4DBUA 2JQXA 1QBBA 1G7VA 1KD0A 2EHHA 4TTGA 4O28A 5IDIA 1XP3A 3T2QA 4PB4A 4X0VA 1GOXA 3PPGA 1XUZA 3O7UA 1F05A 3AIQA 3NWRA 1E1CA 4OKDA 2QMKA 4A22A 2DZBA 2YIHA 3LYEA 4O50A 2G97A 3AS2A 4KWVA 1NWSA 4I7VA 4ROQA 3N3TA 4FNTA 3APGA 3WJSA 1B3OA 2Q01A 2X30A 3KVMA 1KRBC 3R94A 1R5YA 1YMYA 2XFWA 3R6IA 3BAKA 1E6XM 3BL3A 3KFTA 3GNOA 3CWOX 2VXNA 3MHGA 1KBKA 2ATMA 5MHBA 3W01A 4P5UA 1DJWA 4JNYA 1NF0A 1JNDA 2Z2UA 1EQCA 1SM9A 1OD0A 2PU0A 4LUIA 3B3DA 3QH2A 2D2OA 4Z2GA 2O56A 2PWGA 1EC9A 3NO5A 3DX5A 3IVUA 3CYVA 3GE7A 2Y5JA 4B9ZA 2PP3A 1E43A 3FDKA 3RMJA 4XD5A 2DSZA 1VENA 3QGKC 4GZ7A 2CKRA 3F1QA 5IFTA 1UKPA 2XH7A 2X42A 5CZKA 1S2CA 4JICA 1J01A 1DKWA 3DU0A 4WLCA 4M29A 4CU8A 4G56A 3AICA 4X9YA 4FXSA 3VYLA 4ADSA 5A5WA 1BSIA 5CGMA 1QDSA 2J7DA 3NM1A 1C7TA 3HGJA 4YXGA 4JCLA 1T5AA 4P8XA 4B91A 3QVQA 4RKAA 4H9VA 5AC6A 2WM1A 3G1DA 4IOTA 4P7RA 1V02E 3D47A 2I5QA 2OQLA 1W9DM 3LHYA 3LHWA 4UTWA 2GGHA 1JQVA 3W02A 1UWSA 1Z41A 4L64A 3G1RA 2VOMA 3CB3A 5AZ0A 2OELA 2BGSA 3CHDA 2VI0A 3EDEA 1QW7A 4IXXA 2G5WA 5D38A 3N4AA 1T41A 5D37A 5BCAA 4Q4MA 1I2NA 1W6TA 2DW6A 2Y61A 3PZMA 3MSGA 2OFJA 3FVDA 3O63A 3EWDA 1MZHA 3VNYA 3B04A 1UP0A 2V3DA 4DO6A 3GTHA 3NGFA 4Q7NA 1D8CA 1WUFA 1F9CA 3L0KA 2CWXA 1UHVA 2ZXQA 2RGMA 3GKAA 4YTRA 2QCDA 1K4GA 1I9CB 1OK4A 4IH3A 2V2CA 3VC6A 3FDGA 4GQRA 3VINA 1ESWA 4LEQA 4LAOA 2WZTA 4R7JA 2HS8A 4OVXA 1UA7A 1UD6A 2QUVA 5F2MA 4KQNA 1MNZA 5I3HA 2ACRA 1AQHA 2HRWA 1EF3A 4GVHA 4F2BA 2DIEA 4S39A 3WLSA 4NX5A 3RG6A 4L9XA 3PPHA 3PNZA 3U0HA 3SADA 5H8MA 1V0NA 4TU1A 4GD0A 1AUSL 2ZA1A 1TWDA 2RH9A 3G1AA 1O5QA 5DT5A 2QVNA 3SUUA 4DEFA 4EXAA 2PDLA 1E6QM 1GVOA 3GC2A 4UTTA 1HL2A 4QP0A 3PAJA 4GGHA 1OCBA 4Q22A 5FD0A 2E1DA 1TVNA 2ALDA 3B0PA 4ZQNA 2FGZA 4XK2A 3AMGA 1UPPA 3MBDA 1XLKA 1P6CA 3PZTA 3LMYA 5F4XA 1Q4NX 3RX2A 1OG0A 5JBEA 1FHVA 3WQPA 4JEJA 3N3MA 4DF1A 1P0NA 3HMJG 2TAAA 3A13A 3PANA 1JJKA 2G3NA 3T9PA 4ZOEA 3LA4A 4NNCA 4U5KA 5F2LA 1UWIA 3QZ6A 1RBLA 5HJXA 2Z4GA 4NHVA 4J35A 3OBKA 3H2OA 1KW1A 2J9XA 1MW1A 1E1EA 4LGXA 4XTIA 1K3UA 2P8BA 2ZBTA 4A2RA 3BW3A 2PDMA 4Y6GA 4BZYA 1BTCA 2FMOA 5LNWA 4WD0A 2F8QA 3R4IA 1OYAA 3LX9A 1X6UA 3MVTA 3G6LA 2YFOA 4U5IA 4DYEA 3QJAA 4D6IA 4O16A 1FXQA 3GWQA 4FAMA 4IFKB 3K4DA 1Q63A 3UJRA 1H50A 4AYSA 1XXXA 2J9YA 3A21A 1MDRA 4K39A 3RIKA 1HX0A 2XVPA 5GNYA 1OC7A 3VIFA 1JYXA 2QPXA 3SCWA 4LUJA 5BW6A 3SY1A 5BXSA 1ZS2A 2Z6IA 3K5XA 1SFJA 1PDZA 8CGTA 3TNOA 5HMEA 1KM4A 3WCZA 3ITXA 3A4XA 4O18A 5FL0A 4DJFD 3FEMA 4WQ6A 3TYEA 1QI4A 3EDFA 4C7DA 3A47A 4CNPA 1ITUA 2E5CA 2EPLX 2W6RA 4YJ5A 3DAQA 3IK2A 4NG3A 2P10A 1EOKA 1OK6A 2PWDA 4LALA 3UWWA 2XTKA 1KA9F 3A9BA 1P1XA 1B5TA 4YL2A 4TMCA 3I3BA 1W54A 2G3JA 1V79A 3VNLA 5E09A 4UOZA 2OPJA 4FLRA 4L1GA 4B90A 3M4HA 3LM3A 4OJYA 1LOSA 3TR2A 3W82A 4OZOA 4UFHA 3GDMA 3ZJKA 3CIXA 5T9CE 3SUTA 1Q7QA 2BGQA 4HOWA 1Q13A 5AC4A 1N2VA 1IZJA 4D72A 1VBJA 2VMFA 4UWMA 1DE5A 1FWWA 3G1VA 3L2IA 2Y24A 1R47A 3E0VA 1M53A 2PC4A 3QC0A 3NDOA 4RNFA 3IARA 3TZFA 1JGIA 1FDJA 1IT7A 3VC5A 3QOKA 2E4TA 1EWEA 4BA0A 1E6PA 2CHNA 4QG9A 1TWSA 4IGNA 2EAWA 1A4LA 1LBLA 2CW6A 2R94A 5GJNA 1QTWA 1W1A1 3YPIA 1CGUA 4MTVA 2AMXA 1EP2A 4GX9A 4KIEA 4FXJA 1O66A 4S23A 5E6YA 3GVRA 3R7MA 3L12A 1ICPA 4A8LA 3BLLA 3BLDA 1A49A 1MQQA 3EBVA 5HANA 5AECA 1EYWA 1CGTA 2ZYFA 5C2XA 3OGRA 1WXZA 1WDWA 3HQ1A 1E9IA 3ALFA 5H1WA 1RY8A 1Q6EA 1JDEA 3OG2A 5AYIA 2XIQA 2E7FA 1VS1A 1OSEA 1MUCA 2WCSA 5CAHA 3V16A 3O05A 1OIFA 4QLKA 1CENA 3ZMRA 2XISA 3AO0A 4IP5A 1VFSA 1WPCA 2FQIA 3QTPA 2VWSA 3H2NA 3UXLA 2OTDA 4RDVA 5BRPA 4GA8A 3QZEA 2D2GA 4ASTA 1GOWA 4C6EA 2FFCA 3GB6A 3TTEA 3QY6A 4AVOA 3BJSA 5TNVA 3LRMA 3BGGA 5DCDA 4UFKA 3AQUA 1BQCA 2ZRYA 4KF1A 4L65A 2NXGA 4PMQA 3M0MA 1R87A 4KCUA 5A6KA 4FP1A 3VIPA 3PZOA 1SR9A 2OU4A 1EDTA 2CKSA 2VOTA 2EXOA 4QGCA 4XZIA 2RUSA 1OBAA 3O15A 4HIBA 3LOTA 2BX7A 1LF1A 1EDGA 1I60A 4MDOA 4HA4A 1FP8A 3OBEA 5LHFA 3BCJA 3ZLHA 4R27A 5CBIA 1G01A 2NUWA 1XDMA 4H9YA 1XRSA 4O8AA 4MB5A 1XBYA 1UKSA 4ZVJA 3VGFA 3POHA 2HVMA 4HNVA 1VJZA 1PTGA 4AIUA 3WH8A 3STFA 1MEWA 2V67A 3INPA 1L0PA 1XIIA 2C13A 3IIXA 4A35A 3GYCA 1BD0A 1CECA 2QUMA 4V15A 1MO0A 4MWAB 3MY9A 3FIGA 4ZFCA 1Q6DA 3FFSA 4N02A 4IGSA 2WM0A 1MXSA 1D3CA 1WUEA 2VZVA 1PKNA 4NNAA 2C1HA 3R89A 2WPGA 3W1MA 1C92A 4W8AA 2P1FA 1VFMA 3APTA 1YW1A 4UCFA 2HISA 4XZ9A 3SN1A 3N15A 4AY7A 4PN2A 3N2OA 2V2DA 3EX2A 4O12A 3P0XA 2A85A 1D3HA 2E77A 3GBEA 2GJXA 3GFXA 3SCRA 4GRSA 4LF1A 3ES8A 4PUDA 3MZ2A 1U22A 3TROA 1EJUC 5HR7A 2MNRA 4N4QA 1A5UA 2ZX5A 3LERA 3STGA 4WY0F 2C6QA 2V2HA 4K7YA 1E4IA 2OGYA 3MO7A 4LC6A 5FEWA 2ZOXA 3I3EA 4ZO7A 4XVDA 3LGGA 3RU6A 4ATDA 4QG6A 3ZQ9A 5AHFA 1S1PA 3F5KA 1G4PA 4PUUA 3A3HA 4Z08A 1XPGA 2ZICA 3C3UA 1Q6LA 3SIMA 5EYWA 3LXCA 3B9OA 1XLHA 3RAOA 4MZ1A 1QOPA 4J3UA 2Z1BA 3VE9A 4J27A 1PSCA 2UY5A 4LV4A 1J5TA 1ZAIA 1EX5A 1I1XA 5I23A 3E2QA 4WDWA 3L4WA 2C8NA 4J40A 3V5FA 1XLFA 4L4MA 5EGRA 3DYMA 3ES7A 1UC4A 3NZQA 4GVFA 9CGTA 3VDGA 4MFDA 1RJPA 2PDUA 4HNUA 3PF3A 4GYKA 4N42A 3NEVA 4HOZA 4PMRA 3DYOA 3TZNA 1KB3A 3U6WA 4JGDA 1KNWA 3W26A 1CXFA 4UTMA 5I06A 4JTTA 2WJDA 4IHCA 1H61A 3M0ZA 1PAMA 4HCLA 3CV7A 2YCLA 4Q4SA 1HGYA 2BZNA 3LRLA 2J24A 4JTIA 1SFLA 4XAPA 5C9RA 4NUWA 1P0KA 2ZCGA 3SY5A 3VXGA 2CEQA 1YNPA 1JYWA 2WQPA 4W8LA 1OCQA 3S0CA 3UD6A 1XLEA 3GQYA 1GQIA 2JIWA 5I7GA 1DJYA 4JYDA 2V3FA 1C3FA 3VMPA 4AY8A 3GU1A 3NVDA 1DWFM 2W63A 4IMEA 1UYQA 1QUMA 3UPWA 3CAVA 3CQJA 5HQLA 4ROPA 1PPIA 4PCTA 4HU4A 1QI3A 3TC3A 3VGEA 1BTMA 3VGGA 2I5GA 4M7TA 1H7OA 4BI5A 4HB7A 2L5HA 4L80A 3VFCA 4Z1AA 4PB5A 4C1NB 1W9VA 2WMGA 3TMLA 3EXRA 3RRAA 3DENA 4EWND 1SGJA 4LBRA 2I14A 4R9OA 4MIMA 1F3XA 2PAJA 1LUCB 3W7HA 1ZAJA 1GKPA 5FJOA 2WB5A 4GCAA 5HJYA 3E0IA 5FF0A 1XIMA 1A5KC 4LUTB 2X0YA 2E28A 2FMNA 4TX9A 2DV0A 1VQTA 4HNOA 3W37A 3P7YA 3II1A 4RUBA 1FWGC 2IKJA 1M41A 3D3AA 3UZJA 3VOIA 1CXEA 4I8YA 1IIGA 4O11A 1UOZA 3R8RA 1KGUA 1QNSA 4DQWA 1J0HA 5BMXA 4AXNA 1VHNA 3WMCA 1VRXA 4PRTA 5HXMA 1HJSA 3FEQA 1R9XA 4C5ZA 2BVYA 4DUOA 3RM8A 3LNPA 4CNSA 2EPMX 3XISA 3LHZA 4KCVA 4UXDA 2WNQA 2CLIA 3TEVA 4JL2A 3KL5A 4LUSA 3G1FA 3TFCA 4C6IA 4CQAA 3GVVA 3MCOA 2A3HA 2PGEA 4D8ZA 3FKKA 1D7KA 4LNYA 3M0HA 4XV0A 4CQ9A 1TPH1 3IEBA 1ODUA 4JTUA 1GJUA 3CNYA 3N9RA 3QMTA 4N6FA 2PEVA 1KM0A 4PMUA 3SCPA 4HCDA 3LCLA 2NZLA 3IGUA 3T6CA 2REQB 1TPVA 1R7AA 3C3NA 1W3KA 5HNUA 1EBHA 2W27A 3G5EA 3NYZA 3AXKA 4E2VA 1A5NC 4IIEA 4WJ8A 1SZFA 2NWSA 2VR4A 2C14A 5FF4A 4B5XA 3W7RA 2CPUA 2W66A 3WDPP 2DVTA 1GKRA 1DXEA 1FRBA 3PFMA 4Q8VA 1IR1A 5LA2A 4ZTYA 4NI3A 5A6BA 4HTYA 1RAKA 2G3FA 2GQ3A 3W1NA 3T7VA 3L5LA 2YCJA 3TN3A 1PX8A 3U2ZA 3FK4A 5E93A 4KRUA 3SRKA 4F9DA 3AISA 2XIOA 1OCJA 1ZB5A 2GYIA 1AQFA 3COTA 1EEPA 3ZIZA 3SGUA 4K8GA 4JOMA 1GUVA 3NPVA 1TQXA 4WY0B 5AYYA 1K8XA 2DSWA 1XIFA 1M68A 1RUSA 5ABHA 4MNLA 5DRCA 4NJJA 4XB3A 3E0WA 1JZ6A 2PSNA 1X97A 4ZO6A 2NV9A 3F03K 1LL7A 3N18A 1KRCC 1TPEA 4MB1A 1TMHA 3E3HA 4GJIA 3I7RA 5K4ZA 1RALA 2ISDA 1K7FA 4K1WA 3S5OA 3W1LA 4ALDA 1GOKA 2GJPA 4YN5A 3BGAA 1ITCA 1HKWA 4CU6A 2NQZA 2PWVA 3EDKA 4FNSA 5I3JA 1HJXA 2WKLA 3GRIA 2QMJA 3CASA 3AROA 1E4NA 1ADDA 1Q45A 1TPUA 1R46A 3BCFA 4XX6A 3HG5A 4PE8A 4MMWA 5H8UA 1OGGA 1U1JA 1EIXA 2UBPC 3AU2A 4LYPA 1TSIA 1RLDA 3HU7A 1YPIA 2DIKA 3I7QA 3KL0A 3KWSA 2CZFA 3K4AA 2C91A 3WMLA 1XLCA 1LLZA 4DJEA 1DBTA 3LNMA 3AWOA 1PIFA 1RQHA 3K1DA 4CNUA 4F0LA 2BFGA 5JQ9A 2CBUA 3L9CA 5LIYX 1OGBA 4GYFA 3WQEA 1GCYA 3N13A 4HD5A 5DFAA 4F79A 3VD5A 2J7CA 3R2GA 5FL1A 3G1XA 1UQZA 5XIAA 4N7QA 1IYXA 2XVKA 1UKQA 3WDJA 3ITLA 1AODA 5D9MA 3T0AA 4WR3A 4EPKA 3CPUA 4DY1A 3IACA 4H2CA 2JE8A 2HCVA 4A8RA 4PMNA 2Q09A 9XIAA 4PC8A 1HO4A 4H9TA 3WMSA 5D8ZA 4HJFA 1ZJHA 5LNVA 4NAEB 4YHGA 4MUZA 5H6HA 3S9YA 1JI2A 4J2MA 1UP2A 2NUXA 1WZLA 4ILSA 3TONA 3ZSSA 2A3BA 4G7EA 1UKOA 2INEA 2PS2A 2D73A 4S3GA 1BYAA 4AD2A 1PJ9A 1UBSA 2OMAA 3RO6A 3PSVA 3CHCA 4ATLA 1BWVA 1XWYA 1W1YA 2HDJA 1F3EA 5RUBA 5I3FA 2Y5SA 3CZJA 3N6JA 1FY6A 3PTKA 3RRXA 2OX1A 3M5ZA 2ZRVA 2FIQA 4LYKA 2GVYA 3OQEA 1L9WA 2XWDA 4UR9A 3T2PA 2XH0A 1JCTA 5EFDA 2W5FA 4PUKA 1XCFA 1R2TA 2DSVA 2PBGA 3BLPX 3WK0A 2FJKA 1GEQA 3VGDA 3PBMA 4D6JA 1BKSA 1PE1A 3URQA 4DELA 3B4YA 1PYFA 1IGWA 1U33A 2PLKA 4PUNA 4W7VA 3S9ZA 1VFFA 3TXZA 3FYOA 3WEMA 3BQ5A 3NO1A 3P82A 3H23A 4M0XA 1EP3A 3BLKA 4UNKA 1SZRA 1SSGA 4I8DA 4KS0A 3NDYA 3UZYA 1I6NA 4UFLA 4MLJA 5TBOA 2FZBA 4JIIX 4FOJA 4KRTA 3SSJA 1G1YA 1NWUA 3F4NA 3EPNA 3Q4DA 3UG5A 1VBGA 3N1AA 2I56A 4LOCA 4NZ4A 1KLYA 1WKFA 3OODA 1F6YA 2AL1A 3ORWA 1J9YA 3H24A 3R0KA 1DL3A 3ABZA 3VNKA 3LCHA 2UV8G 3CUGA 3FSUA 3W24A 3GNDA 3QPZA 1KWGA 1X7FA 4NX0A 2E5DA 1K8YA 3WBYA 5J8LA 2H8XA 3RR4A 4AIOA 1AVAA 3AAMA 3W76A 1H2JA 2VELA 4NAFB 4B5WA 5REQB 2ZZ7A 1I0DA 3GVGA 1BG9A 2PCQA 3VKKA 2J13A 2OQYA 4IIFA 4OIFA 4NF7A 1PUDA 3OZOA 1TIMA 1V0KA 4FIRA 4UOQA 3UCDA 3W9ZA 3ELFA 4YTQA 1NFPA 1OY0A 5G2WA 2Y88A 1TWZA 1AH4A 3WF0A 4EIVA 1PCKA 1XISA 4MKSA 3N73A 1RZMA 1E6NA 5LA0A 2RAGA 1KBLA 4HU0A 3KCOA 3SCOA 4MY8A 1BYBA 1C8XA 3LRKA 2ASHA 4GX8A 4QROA 2W4XA 3P3BA 4ZQRA 3KZSA 2PDXA 4TVDA 3TR9A 3QV6A 1MXDA 1X39A 2A3EA 1OYCA 4XAFA 2OWWA 2NX9A 3WJZA 3QKZA 4L6HA 3V7PA 3QF0A 1J4EA 3AIWA 3VIOA 5A2BA 4DWSB 3ZR4A 3WEZA 4A8NA 4G1KA 2VM8A 4TUFA 3UXKA 3G6MA 3TJLA 4AZHA 1E40A 3QYSA 4PL1A 3IGHX 1LLWA 1C7SA 1FQ0A 2I16A 3WMBA 5C55A 1K6WA 1SO6A 4YTUA 1OFBA 3TE9A 3MANA 3FA3A 4YHEA 4DXKA 1UWTA 3WFZA 1WZKA 1V93A 1LORA 3F2BA 5D2XA 1DTUA 2VEMA 1ZY9A 2GVLA 1S2WA 5LGZA 4M6PA 4S3FA 3T05A 3LLXA 3AS3A 4BS0A 3V75A 2XU2A 3MUXA 3Q37A 3G0SA 2AQWA 2VEKA 3WLIA 3E02A 1EL3A 4IUOA 1UD2A 1VYRA 3K2GA 2W0UA 3LPPA 1FTXA 3PZGA 1TTIA 1YTKA 3A6OA 4A3QA 1ECEA 5C2CA 4WJXA 3KDOA 3UR8A 1RH9A 4AIBA 4AQLA 1QO2A 4FNUA 1R3RA 2D0HA 2Q71A 2RGLA 3HM7A 3KBVA 4WRHA 3S2NA 4BI6A 4O14A 4LT9A 4AEOA 5JUVA 5LXXA 2WZEA 3U2CA 3TQKA 3BGJA 3GDKA 3N25A 3TFXA 1FX6A 4UNLA 3W84A 4JFTA 2QCNA 3NDZA 1TV7A 4GKTA 1A0CA 4I5RA 5LSMA 1OGSA 4JX6A 1QCWA 2VT0A 1KM2A 1IEQA 4AF0A 1WAUA 5D2YA 2VGIA 3D5HA 4YU1A 4JFVA 2DJLA 3I6EA 1CNVA 4CEUC 1UZHA 4YWIA 3QV7A 4AD0A 2Z1XA 3NZRA 4YCOA 1NVMA 4RE4A 5DX7A 5EBAA 1V3MA 4N4PA 5DO8A 1YBQB 3ID7A 3GTIA 3K8LA 3IIZA 2NX3A 3N34A 1XIJA 3FSTA 4ZR8A 5A8PA 2WCGA 3TJIA 1XRTA 2VFIA 4A3HA 1R9YA 3W7EA 3A3XA 2CXEA 3SM0A 4MKVA 4IZGA 1RP8A 1PO9A 2P0IA 4M7SA 1V7YA 4NZCA 1D8WA 2EGZA 3MC5A 1S3HA 3VPLA 5FAJA 4ZB2A 3LQGA 1QK2A 4L61A 5KZDA 1DWHM 5K9CA 3L4VA 2Y8KA 1ADOA 4BQ2A 1C90A 3QW3A 3V3WA 1XKJA 2XM2A 3KXQA 2IQDA 3H53A 3OGSA 2J27A 1OFDA 5I0DA 2J8TA 3P2VA 3U57A 1EC8A 3TLLA 1V6YA 3GO2A 3GFYA 2BASA 1WKYA 3T44A 1P4CA 2PD5A 1J0ZA 3AMKA 3DUGA 5CPTA 3SGZA 4NXKA 5HWJA 2C1IA 4XAGA 5U7SA 1NF7A 1QHZA 3GXTA 4GH3A 4HQVA 2J8GA 3K1GA 1W1B1 4XUGA 3ZJ8A 2FGLA 4WDXA 5HMSA 1KC7A 1UR3M 1K03A 2ZVIA 1QNPA 2X16A 3F5JA 4AB4A 4UR8A 7CGTA 4IQDA 1OABA 1JEZA 2R8WA 4H8VA 1TCDA 3V5OA 2EBNA 4LBSA 1J0KA 3WJWA 1FH7A 3BARA 3I3DA 2PDCA 5EKYA 1ISXA 1AW2A 4BWLC 5DXXA 3PTQA 2WPBA 1HIZA 4WDTA 1F2JA 4IPJA 4JIPA 4H9MA 1S5VA 2VC6A 2FHBA 4RW3A 1E0WA 5ABFA 1GONA 4Q7BA 2PTWA 3NYDA 2HROA 1JZ2A 2XVGA 3TYZA 5I00A 4NJGA 3C2FA 4PTDA 4JN7A 1JDFA 1Q8AA 1LOLA 1UMLA 4HSNA 2XDFA 1O7AA 1ZUAX 3VD4A 2BY1A 3VD9A 3SN4A 4HOXA 2R1KA 4AX7A 3WQ6A 3RCYA 1ITXA 3RF9A 2HE5A 2X09A 4LXFA 3W27A 1T7LA 1PS9A 4W4QA 4XKYA 4H7VA 3ZR5A 1YEYA 4FF5A 3DBNA 3UT0A 3KOFA 4K1GA 5ABEA 1H7WA 1O5RA 4O1FA 5B7ZA 1ME8A 2AKMA 3B03A 1TV8A 4P7QA 4I9AA 4Z1CA 3SO7A 5AYXA 3WLHA 4Q8OA 2HTMA 3WBWA 2BNJA 3CXOA 1SJAA