4WOZA

Crystal structures of cdnal from clostridium difficile in complex with mannosamine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
290
structure length
290
Chain Sequence
TDMKGIYSALLVSFDKEGNINEKGLRQIIRHNIDVCKVDGLYVGGSTGENFMLSTDEKKRIFEIAKDEVKEEIKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVTPFYYKFDFEEIKHYYNTIINSVDNRLIIYSIPFLTGVDMSLDQFGELFENEKIIGVKFTAADFYLLERMRKTFPNKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGVRARQIFELTKNEKISEALEVQHVTNDLITDILGNGLYQTIKLLLEEQGVEAGYCRQPMKEATDEMKSRAKEIYRKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of CdNal from Clostridium difficile in complex with mannosamine
rcsb
source organism Peptoclostridium difficile
molecule tags Lyase
molecule keywords N-acetylneuraminate lyase
total genus 125
structure length 290
sequence length 290
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wozA00
1DJNA 1I2RA 2ZDRA 3DGRA 1X6UA 4YL2A 1EP1A 1EUNA 2Y6ZA 4X22A 3UNDA 1R30A 3IIOA 1VH7A 4O15A 1KV5A 3HG4A 4O18A 4CNPA 3S5YA 4C1LA 4LWWA 2RKXA 3S5OA 5EBUA 3KHJA 3P60A 2E09A 1ZENA 5FF4A 3M41A 3Q58A 2AQWA 1WOBA 3L21A 1QPRA 1P1XA 1F6KA 2GQAA 4FIRA 5G5IA 3NDOA 3QPYA 3W87A 4JD4A 2A85A 2QDGA 1W5PA 4KFOA 1DJQA 1ZAJA 3DI0A 3NL2A 3C52A 3KVMA 1EX5A 4GE8A 2QCEA 3EWUA 4O19A 3IGSA 3OBKA 4NX5A 3BGGA 4PA8A 3L66A 3NQDA 4UC5A 1JCJA 3N2MA 5CG7A 2X2GA 3PG8A 1MO0A 5L6UA 1VRDA 1TJPA 3I7SA 3LCFA 1H7XA 1UCWA 3EX6A 5FEXA 3UWYA 2Y7GA 3LOTA 2NX9A 1KA9F 2I1OA 3P74A 1OK6A 3LV5A 3W07A 2FQIA 4QIUA 1G67A 1YDOA 1JRCA 3R5EA 3JRKA 3HO8A 3W86A 4MFDA 1F2JA 3L68A 2C6QA 5DELA 4JTLA 1FCUA 3QH2A 3W1LA 2W79A 3PC0A 5EPDA 3T78A 3G1AA 3W7QA 2GQ9A 1XCFA 4RR4A 2I14A 2QF7A 1QPNA 4K38A 2HSAA 1RQBA 1IF2A 3P67A 2J9ZA 3M16A 1JCLA 3QC3A 1OX6A 2C3ZA 1VJIA 4IXXA 4W9TA 5LNSA 4R53A 1G6CA 5D38A 3W1RA 3SI9A 2ISVA 5K4ZA 4ZQNA 5C6MA 1ZAHA 4XBSA 2Y7FA 3QQ0A 2OCZA 4PODA 1SW7A 3HIJA 2OJPA 1YDVA 1DBTA 1ZALA 1HO1A 1FY6A 3E49A 4UTKA 2KZHA 2CLMA 5KINA 4QJ1A 3E96A 5KTLA 1VHNA 1G4SA 1B4EA 4FF7A 4EOUA 3DFQA 4PL1A 3N2XA 4UTIA 5KMYA 1QWGA 5I3FA 2CZDA 2QCLA 2CLFA 4JYFA 1UUOA 1TTIA 1JQVA 1ADOA 3LX9A 3O6YX 4ADSA 3TNOA 2QCDB 3LHWA 3NL5A 4JX5A 4ZQCA 3G8RA 3STEA 2QCDA 3ATYA 3VKJA 3UYCA 4DBDA 3EWWA 4M19A 5TIMA 4N9DA 2WOQA 4O53A 3W1UA 4OV9A 2TYSA 3C8FA 2NV2A 3W3OA 1T99A 3MMTA 3NM3A 2E1DA 1SW0A 3W83A 1HG3A 4R34A 3W2NA 5C55A 3E0IA 3LCWA 4O57A 2F7FA 1K8ZA 3GXTA 1P0KA 3SR7A 4LVBA 4MY1A 4HNVA 1TPVA 1N8FA 3LI1A 4WY0A 5C54A 5HWMA 1XL9A 4Y90A 3MUXA 4AWUA 1TPDA 4IPIA 1H5YA 1XI3A 3MBFA 1SO3A 1B4KA 1GG1A 1A5SA 4O14A 3L0NA 1H1YA 1RD5A 1G4TA 2ZTKA 4HSOA 2ABBA 3NNTA 5LNUA 1JCXA 4LT9A 3M43A 3TMLA 3CWOX 1U5JA 3DFTA 3M5ZA 1SZEA 2RDTA 3LCLA 2J9XA 1VS1A 1KV8A 2ZCGA 3QYQA 4EWND 1GYLA 3BG5A 4JTKA 1LCOA 4L4LA 4JY8A 2WSYA 1FCBA 2NUYA 5D2YA 3PAJA 4WQ6A 3FIGA 4N9EA 4GFSA 1KLZA 2YYUA 4LS2A 2G96A 4MJZA 4TIMA 1OFAA 1LBMA 4N6FA 4CCDA 2QEZA 4FX7A 3SZ8A 1OX4B 5LNRA 3QRHA 1LLWA 4AHOA 3T55A 4UXDA 1F6PA 5HJLA 1QPOA 3MP4A 3QEZA 4DEFA 4ZVJA 2ATMA 4FO4A 4TR9A 2NUWA 1J5TA 2GVJA 4NJKA 3HPSA 3P5ZA 3P8JA 1EA0A 3W7KA 4KFNA 5DY2A 1F73A 4MJMA 3PSVA 1SUXA 3ANYA 1M5WA 2Y88A 4H3DA 5DBUA 3NOEA 1SO6A 5G2HA 3IGUA 4AWTA 2A6LA 4O0ZA 1K8YA 4X3ZA 3W1TA 3CQ0A 3N3MA 5FEPA 1YPIA 1LROA 3C56A 4Z08A 1JCMP 2FPTA 5I3KA 1AMKA 1GVQA 1XBXA 2EGZA 4LV9A 3G1SA 1YTKA 5LNVA 3A9IA 3A24A 4GXMA 3W7GA 3NPXA 4FNQA 2CLOA 1TPH1 4IWWA 1H63A 5AHIA 4ZQOA 1V5XA 3TW7A 4DO5A 1IXNA 2QCNA 1WA3A 1RZMA 4MOZA 5AHFA 3TFCA 3FEMA 4I9AA 3NQ2A 5MHBA 4NNAA 4A2RA 5T26A 4WXZA 1GVFA 1WV2A 1KW1A 1HL2A 3G3DA 4WUIA 1LRTA 3PS7A 4K37A 3WJXA 3BV4A 4BR1A 5AB3A 2E68A 3NZRA 3P84A 1A53A 2BLEA 1YPFA 1OF8A 5G1TA 1W54A 3L67A 1KM2A 5HR6A 1PVNA 2WSQA 3C4UA 1XUUA 3SY5A 3GR7A 4A2SA 3I7RA 2WSRA 4JNMA 4EVZA 1KFBA 1YTDA 4WX2A 2R91A 5EY5A 5FESA 2ZZ1A 2B7QA 3LBCA 3KAOA 1QFEA 3QPZA 2X30A 2Y61A 5KSWA 1L6YA 2PC4A 1ICQA 3N34A 3NQ8A 1X1ZA 4JS3A 1OG0A 4UFMA 5D2XA 3WJYA 4BI6A 3TKFA 3NQEA 3GKFA 4O11A 1XC4A 5I3HA 3I68A 1THFD 3OVQA 2WKJA 3DFSA 4RZ5A 4ZQMA 4HSNA 3C6CA 1NSJA 3CTLA 3VNDA 2Q3OA 4M6VA 4IMGA 4UTWC 1NEYA 3SIZA 1JR1A 4JTTA 3HJZA 2E5DA 3B06A 1EP3A 1DHPA 3W9ZA 3GNDA 4LC6A 2PRMA 3ZWSA 1XDLA 3W7DA 1UB3A 2ZZ3A 3W70A 3BW3A 2V5BA 3UD6A 5F1VA 2H3DA 2YFNA 2J88A 3R12A 2GQ8A 4FX6M 3HG2A 5AYYA 3N14A 1TPWA 5KZEA 4RX0A 1L2UA 1DOSA 4X9SA 1OFRA 2X1TA 2E6FA 2VELA 4Q32A 3G1XA 2ZA1A 2JBMA 1KFKA 2V8ZA 3MP5A 5AN7A 5AC6A 3TC6A 3L0GA 3ZR4A 4UNLA 2CZEA 1DKWA 3NQ7A 4KWVA 1M6JA 5D04C 1KLYA 1NVMA 3MW7A 2VFGA 1VCGA 4K7VA 3TH6A 1VZWA 1YXDA 5DY3A 3W7IA 1VLIA 3NA8A 1GOXA 1DQWA 3LLDA 4IXHA 3MI3A 4ICNA 1ZCOA 1WOAA 4HHPA 4LNYA 5A8GA 3TCEA 1R2TA 1W31A 3GR8A 4NNCA 1TPEA 2EHHA 1JUEA 1I2QA 4BI5A 1SO4A 2YW3A 1NF0A 3O15A 3B8DA 2ZQ0A 3VE7A 3K30A 5U4NA 2V82A 2ZA3A 3H54A 1PL9A 3PB2A 1C8VA 3M0ZA 4ADTA 1KFLA 1S3HA 2I9EA 3DFNA 3DU0A 4B5NA 5FF0A 1KTCA 2A4AA 5KZMA 1JUBA 1VYPX 4LUIA 3W1XA 3ABSA 3S8HA 4IMEA 4EF9A 4K8HA 3EKLA 3EKZA 1OFDA 1AW1A 3TW6A 4FB7A 4K7YA 2QJGA 3GDMA 4WJEA 2VENA 2YR1A 1VCFA 3A22A 4MFEA 2C13A 4MZYA 3HGJA 3UY7A 1OFPA 3B0UX 5CKSA 1W8SA 4QITA 4JDBA 1H61A 1CW2A 1ICSA 2CWNA 4A22A 4LVDA 4RCXA 5HUOA 3EX3A 3THAA 3TSBA 1X7FA 3SJ3A 4AXKA 2P0OA 1QMLA 3BG9A 3DHFA 4Z0JA 1O5KA 1XKYA 3WJSA 5BMWA 4A29A 1D3HA 1T96A 8TIMA 4OU1A 3FKRA 1AK5A 5BNKA 5G4WA 3PUEA 3G1VA 1G69A 1Z41A 5EL1A 2X16A 1NAL1 5SWUA 4MZ1A 2VKZG 4RZ4A 3T4CA 4N4PA 1GZGA 3PBUA 4AVFA 2E77A 1J2WA 3NQVA 4JX6A 5D37A 4UTJA 4O1CA 5HINA 3W22A 3IVSA 3TXVA 3G1DA 1PS9A 3W1QA 4OQVA 4XUGA 1MZHA 3PG9A 1EIXA 4HPXA 6TIMA 4FNRA 4OE7A 5LZLA 5DBTA 3MHUA 2NUXA 2CLEA 3FA5A 1TPC1 2W0UA 3EWYA 1MSSA 4K8EA 3IIXA 4QSHA 3CC1A 2O7SA 4U28A 3HBLA 2WQPA 2CLHA 3KFTA 3KOFA 3BK0A 1KM0A 2A1YA 3LBMA 2VFHA 1K02A 2HS6A 2YYTA 2Z1BA 3CB8A 3W7MA 4MUZA 3NEVA 1O95A 1AL8A 1VGAA 4PL2A 1SR9A 4E0CA 3HGSA 3SGZA 2QR6A 3LCGA 3QZEA 5CZJA 5LHEA 3HPZA 1W5MA 2ZRZA 2BTMA 4IUOA 3IIVA 4NX0A 3C3NA 1JRBA 1OFQA 3NQAA 1Z42A 5HNRA 4ORMA 1GYNA 3LRKA 5AOUA 2ISSA 1F76A 1YDNA 1QDSA 1OJXA 1EWDA 3GIYA 4FXRA 3P61A 2BXVA 3S1WA 1Q6RA 3R13A 3S9YA 3T40A 2DJLA 3E12A 3E9AA 3WJZA 2VFDA 1TRDA 3GVGA 1XXXA 3O8AA 3W1MA 3W85A 3C0JA 1KBIA 3LHUA 4O50A 2NXGA 1HTIA 1GVSA 4MY8A 3B0PA 3RF9A 2NX1A 1YXYA 3FKKA 3HG5A 4UTHA 2A0NA 3M5XA 1VC4A 1SO5A 2QJHA 4ZZ9A 5EMUA 3W72A 3ELFA 2JK2A 5D2TA 4O13A 3C2EA 4WY0F 5DCDA 1WBJA 4AMAA 3LB0A 3B03A 2WV8A 1P0NA 3EXRA 3MYOA 1IXQA 2JKAA 1XFBA 2QUUA 3DKJA 3OVPA 2TPSA 3S0CA 2NX3A 1TTPA 4UTWA 1K7XA 5HUPA 3LXAA 3RLUA 3LHVA 3Q94A 3BLFA 1H7OA 3GDLA 5AC8A 4DQWA 3KRSA 3BGJA 1TTQA 3TE9A 4K6AA 1RR2A 4CQAA 3NPWA 1W1ZA 5G1YA 2DZUA 2JKPA 1Q6OA 4GRSA 2Y63A 3P62A 4Z0SA 1LOQA 2QCHA 2OMAA 3LHTA 1GVOA 1LYXA 2FPYA 3FJ6A 3N9SA 3S5NA 1GT8A 3BPWA 4WY0B 3O07A 4Z1DA 1LBLA 4IQLA 4YCPA 3CPRA 4LRSA 1Z48A 1K7FA 3F4NA 5LSMA 5AFDA 1QR7A 3A21A 3NPVA 3LCHA 3QF0A 4RJEA 1O5XA 3TUUA 4HT3A 4O17A 1DQXA 4UR8A 2WPBA 4K36A 1WDWA 3W2LA 3L0KA 1SFLA 2CU0A 4MLJA 5D05A 3TA6A 1OVDA 5A5WA 3RK8A 2R94A 4JTHA 3L2IA 3TC7A 1FDZA 2Q8LA 1GVRA 5F2LA 2NWSA 3Q37A 1FCVA 2YW4A 1XUZA 3LRMA 1W5OA 1RQEA 3GX9A 1HFBA 1HUVA 4HNUA 4O1AA 1PHWA 1ONRA 4JTUA 2ATSA 2FB2A 1I2PA 1G4PA 1PIIA 5F2GA 1FBAA 2E5CA 4D2JA 5CPLA 1SSGA 3M44A 1FWTA 4DF2A 5DCBA 1W37A 3VI2A 3G24A 2PURA 3W7PA 2GJLA 4LRTA 4GBUA 4AAJA 4WZHA 2ISWA 3EEGA 4RV8A 1A50A 1TMHA 4DELA 4I7WA 3TXZA 2YXGA 3DFOA 1U83A 2WNQA 4IMFA 4CNNA 4UTLA 4PH6A 1SZNA 1K7EA 3L9CA 4OBTA 1PHQA 4BK9A 3SGUA 2Z0IA 3NAVA 4PCFA 3UZJA 1RVGA 1SPQA 4LTSA 2CW6A 2G97A 3BW4A 4E38A 5I3GA 1QO5A 4JY9A 2FLIA 5D02A 3W7RA 3KVJA 3L5MA 1OHLA 1TTJA 3W7OA 5DXXA 2JKEA 4Z1CA 4LVAA 1FXQA 1MEIA 3MBDA 4HNNA 3S5ZA 2CZ5A 4JYDA 3MP3A 1SZFA 4JTJA 4M7SA 1AW5A 3STFA 3LHYA 1X1OA 3OEXA 3LCIA 5F4XA 3M5VA 4POCA 2C14A 3I65A 3JS3A 3W76A 2XN2A 1N55A 3QSTA 4ONVA 1G7VA 1RPXA 2BX7A 4N9CA 4M6PA 3RU6A 4AH7A 3W84A 1GTHA 1IXPA 4ZMGA 4LOCA 3G1HA 2ZTJA 1ZAIA 4RXFA 3USBA 1IGSA 2GUUA 1OF6A 5I3IA 2ZRUA 3L5LA 1DORA 3B04A 5CPOA 3W2JA 4NT0A 3EWXA 3LI0A 1QCWA 4J9JA 2C15A 3ABOA 1AW2A 2DZXA 5AYZA 3UXDA 4Y6GA 1UBSA 4M7TA 4UTTA 3FOKA 1W0MA 3S1UA 2B0MA 4AEOA 1YADA 3NR0A 4RXGA 3CM4A 2DZWA 3B4UA 4FEZA 4N9BA 3G1YA 2FJKA 3DXIA 5IBXC 3SSJA 1S5VA 3BW2A 4BWLA 2C0AA 3MHFA 4QQ3A 2B4GA 2H90A 4U4MA 3TQ0A 4ALDA 2C1HA 1T0OA 3CHVA 4QM1A 4LVFA 1EWEA 4UR7A 3LERA 1O4UA 1OYAA 2F84A 1FWWA 5CZSA 5EKYA 4OWGA 4A21A 4DBEA 1QO2A 1IIGA 3LDVA 4GWEA 5AHEA 4AF0B 5K7JA 1W5NA 5FI8A 4O4WA 1VQTA 2QCGA 3N73A 4CQ8A 3QW3A 3SW6A 2EKCA 3LHZA 5HQEA 3FS2A 3NQ6A 2B7NA 4UTMA 4JTGA 1OFEA 3BVJA 1W3TA 3HG3A 1FX6A 1R2RA 2YPIA 1FWNA 1B9BA 2X1UA 5L9FA 1TJRA 1ZNNA 3OG3A 4GUFA 3AJXA 4KKXA 5LGZA 4JN6A 5F2MA 3IGXA 4L4MA 3THQA 3QM3A 3CLMA 3LLFA 2ZBTA 4UFIA 1LOSA 1A5CA 5AHNA 5F4SA 4CCEA 1KTBA 3LGEA 3QW4B 4UIOA 4JXCA 4WOZA 4X2RA 2C19A 3FYOA 4K39A 1TV8A 4S2BA 1DV7A 4UNKA 3F03K 5FF3A 4BI7A 3DFPA 1DVJA 2V2HA 4TU1A 1ZFJA 3B0VC 5DXYA 4IOTA 4ORIA 5E93A 3LXCA 2BZNA 2VXNA 5FEZA 2ZA2A 3UXAA 4TO8A 3QQ1A 4AHPA 4R33A 3NVTA 3W2MA 5K3VA 1Q45A 1SU5A 3HGRA 2GVLA 2QCMA 1F74A 4MY9A 3P5YA 4I7VA 4KWWA 2Y62A 4N4QA 2ZZ7A 3UWUA 4XKYB 1LLZA 1Q3NA 4WD0A 2B7OA 3IV3A 4MZ8A 3G0XA 1F05A 2X1SA 4LU0A 1PCKA 1KFJA 4NUWA 3M6YA 1N7KA 3I6RA 1KM6A 2V5LA 3UWVA 5H91A 1FWSA 4MYXA 3UWZA 1NFBA 1H50A 3W6YA 1I4NA 4MPQA 1F7BA 2CZFA 5CPNA 3BG3A 3HPXA 5CPMA 1BTMA 4RK8A 3HGOA 1XBZA 1I8JA 2C18A 4O16A 3C2VA 1GG0A 1AG1O 2ZZ4A 3TJLA 4NZFA 1JVNA 2Z6JA 5HWNA 3IEBA 1ALDA 1R2SA 2A7PA 4IGHA 3UWQA 4O8RA 3LRLA 3NO5A 1OABA 1JCYA 4YWIA 5J5DA 2XN0A 1MEHA 1L9WA 1V7YA 4HN4A 2V2DA 1OFBA 4P2VA 4Z1AA 4ZL1A 1S5WA 3KXQA 1MEWA 4O12A 3G0SA 5AYXA 3H55A 4NZJA 1SQ7A 4DPQA 3CEUA 1R47A 1WX0A 3PR2A 1YTEA 4MIMA 5TQLA 1H7NA 1KM5A 3VFLA 1ML1A 1TO3A 4MVAA 1P4CA 1H62A 3TV8A 4FNTA 4A3UA 3W1PA 1TQJA 3UWWA 1CX9A 3HB9A 3INPA 1H7WA 3W23A 1J4EA 4IPJA 2Q3RA 3TDFA 2QCCA 1GEQA 4OGZA 2DORA 2ZYFA 5C5YA 5LGXA 3UQNA 3IVTA 4UMCA 2ZRYA 4QISA 2WO5A 3W7NA 2Y89A 1TREA 4OT7A 4YLWA 1EPXA 3CT7A 2ZRVA 3P82A 4PEKA 2LLEA 1EEPA 1WYIA 4XWUA 2G5WA 3BLEA 3I7QA 3L5AA 3LCXA 1GQNA 2BWGA 2PRLA 3SFKA 3IIPA 1VYRA 3NQGA 3O05A 3PB0A 4UFHA 4FXSA 1W3IA 1LOLA 3BARA 2ZZ2A 4JIPA 5FEWA 1TIMA 4JGDA 1KFEA 2QAFA 2E6DA 5DN1A 4NU7A 2TMDA 3TAKA 2YSWA 5K9CA 3TSMA 2EAWA 2CLIA 2XFWA 3TJXA 1GPWA 4HIBA 4GNJA 3W2KA 3BO9A 3CWNA 2A21A 2O7QA 5K9XA 3H53A 3W7JA 1IIHA 3WK2A 4GUHA 4HKPA 3YPIA 1K8XA 4QNWA 1LRNA 4N6EA 4XTIA 4RKAA 1SFJA 4O54A 1PV8A 3W75A 3DBPA 4NQ1A 3TR2A 4FX8A 1TYGA 3TROA 1GJPA 3HMJG 3U6WA 1JQXA 3EWZA 1TPUA 2TRSA 1C29A 2JGQA 1KM4A 3C2RA 3GZ3A 5AHLA 5D2VA 3B05A 3NZ1A 3TAOA 4C1KA 2Q8ZA 4ZQRA 4UCGA 3A23A 3TFXA 3QSRA 4NXKA 3GAKA 3HF3A 2QUTA 3NG3A 3GLCA 2V9DA 3KRZA 3GDRA 3QMRA 2H3BA 1LM1A 2NWRA 3FFSA 1W3NA 3CIWA 4H6KA 4E2BA 4O10A 2E5BA 5K4XA 3G22A 3P7YA 1M7OA 4JR5A 1X8FA 4UUIA 3RNDA 2V0TA 5F1UA 1FWRA 4R7JA 4JTSA 4NJIA 3MHGA 3CIXA 4GUIA 2PE4A 4O52A 3PVFA 1QPQA 2OT1A 4O28A 5HWJA 1UUMA 3ABQA 1LP6A 1BEUA 1SW3A 2DZTA 1D9EA 4M5PA 5IBXA 1Q6LA 2NXHA 5D30A 3DHDA 1ZJIA 2NZLA 4FIQA 3WJWA 1FDYA 2J6XA 4LC8A 4I7UA 5LNWA 4IX2A 5H2ZA 2FPVA 2CLLA 3NM1A 2ALDA 1WBHA 5AHMA 3VCRA 3W7HA 3NGJA 1I2NA 3LM7A 4NJJA 3NQFA 2DJXA 3OA3A 2A6NA 3GYEA 3PBVA 5DLCA 3DI1A 1I45A 5HULA 3UZ5A 3RFAA 4CQ9A 1L6WA 4UMBA 1LRQA 7TIMA 2GPTA 1S5TA 3GAYA 2Z2UA 1Q6QA 2YCEA 1EB3A 1P5BA 5IM51 2OX1A 1W56A 1OYBA 3PM6A 3W7CA 3G18A 3TU9A 2VEPA 2OZ0A 4AWSA 4AF0A 2A2IA 2GJNA 1KM1A 4LW7A 2VFEA 1PE1A 5G4EA 1RQHA 2H6RA 4FHAA 3M9YA 1JCNA 1XDMA 3A5FA 2A7NA 4UMAA 1LORA 1GWJA 4DXVA 1BKSA 4Z1BA 3RLVA 3O6CA 1EUAA 2ZZ6A 1QOPA 1XBYA 2H8XA 5U7SA 4DO4A 3NL3A 1YXCA 4JTIA 5D32A 2RDUA 5CZ0A 1SZGA 2B7PA 5KZDA 5ABTA 3EXSA 3UY8A 3ZFHA 1VHCA 2HTMA 2VEMA 4UFJA 3MI6A 4PFMA 5HMSA 1TRIA 3U8GA 4HNTA 1WXJA 2WJZA 2CFFA 3DZ1A 2Y7EA 4JTEA 2H8ZA 3M5YA 4ZQPA 1TQXA 1ZY9A 3KX6A 3V1PA 3P8IA 3GDTA 1HO4A 2J24A 3SECA 4AHQA 3O63A 1M7PA 3AO0A 3W1NA 5CSRA 4FNUA 3W7LA 2ZFAA 2VEKA 4XTDA 3JR2A 3F1QA 3PBWA 1JJKA 1TPB1 2E6AA 2J27A 1XBVA 1R46A 3DAQA 3EX2A 1FQ0A 1VPXA 4JX4A 3EX1A 4N02A 2CLKA 2FTPA 3R89A 3TQKA 3FLUA 4YXGA 3PF3A 1VLWA 4H4IA 3STCA 2OT0A 4MYAA 4UTTC 4Q33A 3S1XA 3T7VA 4RZ6A 4LUJA 4DO6A 3QMTA 4RLIA 5E1QA 1H7RA 1B57A 2R14A 1ME8A 2JGYA 1LDCA 3TQVA 3W88A 4XBKA 4BFAA 2QKFA 1H7PA 3DENA 1EP2A 3IVUA 3N19B 1WAUA 3STGA 3TSDA 2RH9A 3GNNA 1FCQA 2DZSA 5K2ZA 1BWKA 1FUYA 2Y7DA 3W7EA 2QJIA 2X1RA 4QNEA 3A5VA 3F4WA 5HR7A 5CGQA 3QMSA 4FNPA 4UTUA 5FF2A 1VYSX 2GVGA 2YX0A 3FYPA 3O1NA 5D2WA 2Z6IA 3EWBX 3TX9A 4E2DA 4M6QA 3WFAA 2QUVA 3R2GA 2V30A 5F2IA 3ABRA 3L65A 1RV8A 2QAPA 1BWLA 3O06A 1WQ5A 3PUDA 3Q2DA 3NXFA 3NYZA 2YFOA 4EIVA 4GUGA 4GJ1A 4N2YA 2G95A 2VOMA 3TK7A 4Y9AA 3R8RA 1KBJA 3MO7A 3PY2A 3O16A 4UFKA 2GOUA 3V75A 1UJPA 3OHIA 2ABAA 4O0KA 4TMBA 5KITA 2PCQA 4JTFA 5D33A 4YMZA 4G1KA 3G1FA 4LVGA 4OHQA 4XKYA 2XN1A 3GDKA 5J5RA 3RMJA 1TV5A 2R8WA 4WOQA 4PTNA 5BRBA 3C61A 3W74A 4ADUA 3KVKA 3U2OA 1ME7A 3EB2A 3UPWA 1VCVA 4JDYA 2PRHA 2P10A 3C2FA 3W2UA 1TB3A 4LS0A 1QOQA 1C9DA 1YYAA 1F5ZA 2EPHA 5EYWA 1LBFA 2RDWA 3M7WA 5DCEA 4JIQA 2QCFA 3PWAA 3KRUA 1GTEA 1PCWA 4QAIA 4MLRA 3KVLA 3QFEA 4CCCA 3FJLA 2E6YA 2WNNA 4AB4A 2YGYA 1TSIA 1LTDA 1KFCA 4PC8A 3D0CA 1A5AA 1XM3A 3DH7A 1B3OA 4XZ9A 1DL3A 1T8XA 2RFGA 5K9DA 2IQTA 1IXOA 3ZWTA 5GVJA 3E02A 3MI2A 1OX4A 3MJYA 1JULA 4ML9A 4YCOA 4CLMA 3GKAA 4BWLC 1ME9A 4BF9A 1K3UA 3W1AA 3TMQA 1NF7A 1G7UA 3MWAA 1JUKA 5D03A 4NJHA 3P80A 1SSDA 3WK3A 4S2CA 5FF7A 1OYCA 1CI1A 1OK4A 4O1DA 2A5HA 2VFFA 1H60A 3DKLA 3N9RA 1TCDA 3LTPA 2WNZA 3NQCA 2A7RA 3WK0A 2DP3A 2HS8A 3GB6A 1OX5A 2HMCA 4TMCA 2V81A 1D3GA 2Y85A 2DZVA 2TSYA 4EF8A 5CSSA 2C16A 3PBYA 5BOOA 4P61A 3LXBA 3LTYA 1Z44A 4FNSA 2AGKA 4S1FA 3PSWA 3NL6A 5E0KA 1TPFA 4GUJA 3UPBA 3P81A 4XQ6A 3S6DA 1FXPA 1QNVA 4Q4KA 2P1FA 3VE9A 2D73A 2DZPA 2V2CA 2Y70A 2YZRA 1H51A 1ICPA 4JYEA 5D09A 2UV8G 1FDJA 4IMCA 2ZRXA 2J9YA 3LV6A 5I3JA 5BMXA 3GXNA 4GC4A 4WXYA 1AL7A 1YLVA 5AC7A 2NV1A 3G8EA 3G3MA 1K03A 1A5BA 1H1ZA 4MKNA 4CNOA 4UFLA 3BLIA 2VC6A 3OIXA 3PULA 3QJAA 3W71A 4NJGA 5F4WA 3T44A 1LZOA 1KM3A 3TIMA 4OV4A 4O1BA 3CEPA 3S1VA 3GXPA 4O4VA 1W5QA 2FDSA 2QDHA 4IX0A 3PUOA 4DF1A 3G0UA 2ZZ5A 4IMDA 1MXSA 1Y0EA 3NPUA 4LS1A 1ZHAA 2W6RA 3GK0A 2NXIA 2FB3A 2AAMA 3OVRA 3M47A 4Y8FA 1I2OA 1G4EA 4HPJA 3NQMA 3ATZA 6ALDA 1KTNA 2VFIA 3M1ZA 2BSLA 2YDAA 2DU2A 5CZTA 1O94A 1VR6A 3S42A 1UASA 3IRDA 2FIQA 3WK1A 5BW6A 3HOJA 4Y96A 4NVTA 1O60A 4JICA 4LY8A 2RHGA 5G2WA 4JEQA 4DPPA 1OFOA 3O6DA 3IIZA 3W73A 3CU2A 4IJBA 2FFCA 3EXTA 5TBOA 5C2XA 5EA9A 1QAPA 5LHFA 2EF9A 4NNBA 5G2IA 4LV4A 2VEIA 3EX4A 4DF0A 4KFPA 4TX9A 5LKYA 3LTSA 3MYPA 1L6SA 2NLIA 4NXSA 3HQ1A 1TV7A 2ZRWA 1E51A 3ZS4A 3C2OA
chains in the Genus database with same CATH superfamily
1E73M 4GZEA 4JFSA 2ZDRA 4HHHA 2INEA 1EP1A 1W2VA 4Y9NA 1RJQA 2O4QA 1ZP4A 4DM1A 1UKTA 4R27A 4CNPA 3VOHA 3AIRA 1RY0A 1TE1A 1DHKA 2NQHA 3ZLGA 1UD2A 4DWSA 3BMXA 3E1F1 2W63A 3Q58A 4B5WA 3TC3A 4GXPA 3H7VA 3W87A 2A85A 1EEXA 2J77A 4Q8QA 4V15A 1JIBA 3B40A 1ZAJA 2YBTA 3BTNA 4L61A 2QJNA 1VFHA 1EX5A 1FFRA 1Q2SA 1W9PA 4O19A 4HYVA 3OBKA 1NFPA 4XG1A 4OJYA 3L66A 3NQDA 4UC5A 3U57A 4QDMA 3CUFA 1AA1B 1P1MA 2X2GA 5CG7A 2CBVA 1WZKA 1DEDA 3LCFA 3ARRA 1RH9A 5FEXA 4AVNA 2QVNA 1V7AA 4F2UA 2ACUA 4F9JA 1OK6A 3AWNA 3SRDA 2UBPC 3GS6A 4QJ4B 3R5EA 2YCIX 3HO8A 3SFWA 3WUBA 2Y5SA 4H83A 3L68A 2C6QA 1FCUA 3QH2A 3PC0A 3T78A 5EPDA 3QC0A 4RR4A 4CD7A 3QPEA 2HSAA 2PWFA 3P67A 3M16A 3QR1A 3PBGA 1OX6A 1A4MA 4ERGA 4R53A 3W1RA 3SI9A 2ISVA 3B8TA 5C6MA 3RJXA 4XBSA 1GVEA 4PODA 1FKWA 2PUZA 2PTYA 1WKYA 1DBTA 2DSWA 3B9EA 4KCVA 4E4UA 5KINA 2CLMA 4DZ5A 3V5FA 1VHNA 2WVSA 4LEQA 1E6RA 4RPQA 4PL1A 3N2XA 1KCLA 3CL7A 2CXGA 4XVDA 4YTQA 3LBOA 3TP4A 1R38A 1ADOA 1UR1A 1HP4A 1YHTA 3O6YX 4PFHA 3ENLA 1X6LA 4ZQCA 3STEA 5C8BB 3DOPA 2VP8A 3ATYA 4DBDA 5TIMA 3W1UA 1IEQA 2TYSA 4IMAA 5HOSA 3PZVA 3NM3A 3ZVHB 1SW0A 1HG3A 3QV6A 5C55A 4ILSA 3E0IA 4E5TA 4O57A 3CQHA 3VKKA 4TTUA 2V3FA 3SR7A 1CEOA 4ZTXA 1N8FA 1RD6A 2QJJA 5C54A 1I60A 4JN8A 3OLIA 3WBYA 2F2KA 3NQBA 1TX2A 4TVUA 2VGBA 1R3YA 1G4TA 4HSOA 2ABBA 3NNTA 2VGFA 4GD0A 1JCXA 5KEZA 4LT9A 2VMFA 3CWOX 4WHBA 2WB5A 1ZBCA 3DFTA 2RDTA 1BYCA 2GDVA 4EWND 1S5NA 4IFRA 4CKQA 3MC5A 3BG5A 1E3ZA 3S3GA 2Z7KA 3ANVA 3APYA 2WSYA 5D2YA 4F0HA 1QASA 4CNTA 4WQ6A 4N9EA 2YYUA 1LT8A 5FAJA 4FR6A 4DBSA 1LBMA 4CCDA 2QEZA 5GNYA 4FX7A 1OX4B 5LNRA 3QRHA 4PMOA 1JI1A 4AHOA 1UP3A 1F6PA 2PDCA 1E6ZA 3MP4A 3SM0A 1F9CA 3N6JA 4H2CA 2NUWA 3P5ZA 5AC4A 4GPNA 1EA0A 3BANA 1EPVA 4FMVA 1RCQA 3ANYA 4DWDA 1M5WA 1V6XA 2VUNA 4GC3A 3RN6A 1JF6A 3NSXA 1XLJA 1SO6A 5G2HA 2OSXA 1XHGA 4H7CA 2FMNA 1PIFA 2A6LA 2QF8A 3NWRA 4O0ZA 4UNIA 5FEPA 3M07A 1U33A 3LD5A 2REQB 1Q4NX 5HDRA 4IF2A 1V0LA 5JH1A 3A9IA 4DJEA 1TPH1 3H7RA 4FR1A 1WA3A 3SRHA 2G8ZA 1CB2A 5CG0A 3KEHA 5MHBA 3BOFA 1TG7A 4JKMA 5H1WA 1QK0A 5T26A 5LXXA 4WUIA 1A49A 3PS7A 3WJXA 4BR1A 1TV3A 4I9MA 3CGTA 1KXTA 1W54A 1CGUA 4KRZA 3MV11 1V0NA 3ITTA 3C4UA 2VJXA 3UXLA 2CETA 2JALA 3GR7A 2PP0A 3BAXA 3I7RA 3ZJKA 4JNMA 4EVZA 3VILA 2WPGA 2QIWA 5EY5A 4ZB0A 2E28A 5FJOA 3TZFA 1B2YA 4U2ZA 4PUWA 5BWFA 5KSWA 3GTFA 4LUSB 2HVOA 1QNPA 3VIFA 3RRXA 4EPKA 4BI6A 3KBSA 3NQEA 1GZJA 2WLZA 2Z00A 3EWDA 5I3HA 2GVEA 2J8TA 1THFD 1JNDA 4ZQMA 1FP8A 4AIOA 3GYCA 4IPLA 2NT0A 1GW1A 1NSJA 2Z25A 5IFTA 1JZ4A 3SADA 2XVGA 5D8WA 1JR1A 4NI3A 1E9IA 1XC6A 1EP3A 3W9ZA 3DECA 3GNDA 1ZPTA 1YBQA 1XDLA 2BDQA 4C90A 3SCWA 1DJWA 3BW3A 3UD6A 3WIJA 2J88A 5GJMA 4GX8A 1ZS2A 3HG2A 1IEWA 4RX0A 1L2UA 1HXJA 1OFRA 1WDPA 1BLIA 3G1XA 2ZA1A 1IT0A 2UWFA 4RPPA 2PDBA 1XYBA 1DKWA 1X38A 3KLKA 2PP1A 1KLYA 3MW7A 1VZWA 1W1PA 5DY3A 5A8OA 2OLAA 3UETA 4DLMA 1GOXA 4E4PA 3FYYA 4NSBA 3WLSA 3VPLA 4HHPA 4LNYA 3TCEA 2OGYA 4B9ZA 3EZ4A 4G7FA 2D20A 4NNCA 3H2EA 1B30A 1GORA 1HJSA 2OYMA 1S38A 3OB8A 1LQ0A 1UA3A 3VE7A 5U4NA 4OBRA 1PL9A 2DQXA 4WJ8A 1JD9A 4KEUA 4ADTA 1XCWA 2GJRA 4FALA 2PDXA 2R1KA 1E6PA 5FL0A 5FJJA 4LUIA 4MKVA 4PBEA 1KC7A 1M68A 3PWGA 3EKLA 3EKZA 4AY7A 3ONCA 2YCJA 4IGNA 3UJSA 3EAUA 3A22A 1VCFA 4AIBA 3VNIA 3UY7A 3GRIA 1POKA 2XGIA 3DDMA 3B0UX 4CQCA 2XUCA 2FHCA 4JDBA 1IQ8A 5BOEA 3R94A 5HUOA 3EX3A 3POHA 3THAA 3TSBA 3B8UA 2P0OA 1QMLA 1Q85A 1O5KA 3SEPA 1DIOA 4V33A 2CCRA 2J66A 1AK5A 3PNZA 3O2LA 3OU8A 3G1VA 1G69A 1XYMA 1ZL1A 4XAGA 4MZ1A 3DYOA 4L65A 3PBUA 3TEVA 5AZ1A 1PX4A 3NQVA 4QSFA 1DQUA 4E3VA 4X0NA 2WVVA 5LIYX 1XLHA 3KS6A 4LB4A 2J8GA 1PYMA 4XUGA 3QN3A 4ZSTA 4HPXA 1U5HA 6TIMA 3CPGA 2UZ9A 5EFFA 4YTRA 5DBTA 4M8UA 4J5NA 3MHUA 2WVVB 2NUXA 3AS0A 3FA5A 5EMYA 3UYIA 2YCKX 1OBAA 3NSMA 3TWBA 3K4AA 3DYPA 1HVXA 3FAWA 3CTTA 1UWQA 3H24A 4RW3A 2CLHA 4S3GA 2A1YA 3PFMA 2PLMA 4HQVA 3TN5A 1K02A 4JTQA 3CB8A 4MUZA 2R24A 2BY3A 1AL8A 2VC9A 3HGSA 4F8XA 3AJ7A 2QR6A 3FX4A 3QZEA 4DJDD 3RCNA 3VU2A 1EXBA 3BAWA 2ZRZA 2WMGA 1TZ9A 3UFYA 4K3ZA 3C3NA 1JRBA 1OFQA 3NQAA 3KTSA 5HNRA 5AOUA 2ISSA 4MWAE 1F76A 1EOKA 1YDNA 3A4XA 2G3FA 3GIYA 3H22A 4HK7A 2I17A 4JNYA 4UQEA 3GVGA 3W1MA 3LHUA 1KBIA 1G1YA 4O50A 2NSXA 2X0HA 4MY8A 3WFLA 4PRRA 3MTWA 3R4IA 4Y9PA 3KDNA 4ZZ9A 3UXKA 5EMUA 2OODA 3W72A 5EMMA 3AMLA 1I0BA 3AWOA 4XZLX 4DI8A 3MWCA 1MUMA 3KBVA 4WY0F 1AQHA 3B03A 3SB0A 1E6SM 1VFLA 1W2PA 3EXRA 1IXQA 3LQGA 2JKAA 2ZX7A 4H6QA 1XFBA 2QUUA 4A8IA 2I5GA 1T5AA 2VI0A 1ISVA 3H2NA 3ONBA 3FA4A 3W0KA 1BYBA 1LG2A 5AC8A 3UNTA 3UBPC 3OLDA 3BGJA 1TTQA 4CQAA 2OOGA 3NPWA 4PN2A 4X63A 4ATLA 4Z0SA 2PDYA 1LOQA 3HTWA 1GVOA 1GT8A 3B8VA 1DJIA 3O07A 2VX6A 3CPRA 5CAHA 3ARPA 2XGBA 1ZJHA 3F4NA 3F5JA 2VZSA 3QF0A 4RJEA 1I1WA 1SFTA 4O17A 3CK5A 4UR8A 4K36A 5E6YA 3V36A 1SFLA 3U2CA 3VZZA 4Q6XA 1OVDA 5A5WA 4NILA 5DMLA 2E9LA 4JTHA 3L2IA 3TTOA 1QK2A 4Z1YA 5A1AA 1IWAA 5HNTA 4E8CA 1FCVA 4W8BA 1XUZA 3MUAA 4V27A 2G4JA 5AVHA 4J1OA 3EOOA 4O1AA 2GVYA 4BQ2A 4ACZA 5I78A 2FB2A 1G4PA 1FBAA 2E5CA 2HV5A 3VGBA 3VC5A 3RX4A 1FWTA 2Y24A 5DCBA 1W37A 4K2SA 2PURA 3W7PA 4GBUA 4BEQA 2ISWA 3N4EA 3TXZA 1Q5MA 2HBXA 3WKZA 5ECVA 4M3PA 2WNQA 4UTLA 4WDUA 1SZNA 4OBTA 5HATA 2V5DA 2Z0IA 3C0SA 4PCFA 3WH6A 4LTSA 2CW6A 1Q4WA 2G97A 3BW4A 1DP0A 4JY9A 4C6KA 1Y7VA 5I03A 3L5MA 1OHLA 1ISZA 3SN4A 2PF8A 3AXHA 4LVAA 1YE4A 3MBDA 5IDIA 5BYWA 5I3DA 4M7SA 1SZFA 4JTJA 4B2DD 5DFAA 2EJ1A 1C3FA 4XO7A 5A6BA 4PZVA 4ACZB 1GW9A 2Q8XA 3QSTA 1SYTA 4ONVA 4Q8NA 1CLXA 3BH4A 1RPXA 2YLAA 3E0WA 4M6PA 3RU6A 4AH7A 4EXBA 2JEPA 1IXPA 4LOCA 2ZTJA 1ZAIA 3WLOA 3USBA 1IGSA 3MU7A 3CUIA 2HRWA 1OF6A 3IJ7A 2ZIDA 5LA2A 5GJPA 4J9JA 2V67A 4Y6GA 4KGJA 4UTTA 4EP8C 3G1RA 3NR0A 4D6FA 3B4UA 4FEZA 3G1YA 2FJKA 5A6JA 1MFVA 2PDKA 2YCLA 1S5VA 3THCA 3U0HA 3GNPA 2B4GA 4WLCA 3TQ0A 3ZT7A 4JFVA 2QPSA 4LVFA 1JZ2A 1IT8A 4UR7A 5CJNA 2F84A 2Y5EA 1FWWA 1NOFA 1Q6EA 5EKYA 3F2DA 2WWCA 4NYYA 2FH6A 3S2NA 2PFHA 2OQYA 2WJEA 4CQ8A 3UR5A 3SW6A 4Q8TA 3CH9A 3LHZA 5HQEA 1XLLA 2B7NA 3SCQA 2IPFA 1OFEA 2Z7GA 4HB7A 2CKRA 3BVJA 5I79A 4D6EA 1CLVA 4PTXA 4PMUA 1W32A 2XM2A 3NURA 1WXZA 1FWNA 1B9BA 2J74A 1PBGA 5L9FA 1ZNNA 3AJXA 3IAQA 4P7LA 3QLLA 5I2UA 3LLXA 3TONA 3KW3A 4UFIA 1LOSA 1A5CA 3EMQA 2DH2A 1C8QA 2C19A 3GY1A 3UZZA 2FFIA 3URBA 3EOLA 4K39A 3MUIA 3VDGA 5JIPA 3H2OA 2GJXB 3V4BA 4ZODA 4BI7A 2JFEX 1ZFJA 2EG7A 5DXYA 4IOTA 5E93A 2GJXA 3WH8A 5JU6A 2BZNA 3AZTA 4KRUA 2GGEA 3GC4A 4AHPA 3E5PA 3NVTA 4B91A 3HGRA 2QCMA 2ZUUA 4I7VA 4KWWA 3IJQA 3WNLA 4HU4A 3FAXA 4WD0A 1VBUA 2X1SA 2Z1SA 3MB9A 3LG3A 4NUWA 1HIZA 1P0DA 1N7KA 2XISA 3I6RA 1XQLA 3WCZA 4HYWA 1WE5A 2BVDA 5H91A 1FWSA 4MYXA 1B3YA 1NFBA 4U33A 4JCLA 4PB3A 1F7BA 2G3NA 3BG3A 5EU9A 2CBIA 3HGOA 3EMZA 4JAWA 3OVGA 1VFOA 4IGMA 3A3XA 2RAGA 4O16A 1GG0A 3UZYA 3GVWA 4IIHA 3TJLA 2XSAA 1JVNA 5HWNA 3KP1A 1ALDA 2Y2WA 3UWQA 5BZAA 3RG6A 1ESWA 4LAOA 2VUYA 1PZ0A 3GR4A 5CQ1A 2EG8A 4P2VA 2ZWYA 4ZL1A 2XFRA 4YTUA 5DRIA 3T2PA 1MEWA 4PCTA 4O12A 4DUVA 3H55A 5FAGA 1GK8A 3S2JA 1R47A 3PR2A 4L56A 1C93A 3WNMA 1KM5A 3CUXA 2DVUA 1P4CA 4MWAC 4PMYA 4GZ7A 1OGSA 4U3AA 4H8NA 2HVNA 2XIBA 1KB3A 3LK6A 2VGGA 4YVXA 2QCCA 4DBWA 3WD3A 1GEQA 2ZYFA 3ZSSA 3SUTA 5C5YA 5BROA 3CV6A 2ZRYA 2P8CA 2X0SA 1EPXA 1TX0A 3CT7A 4DYKA 4PEKA 2LLEA 4BY3A 5CLWA 1EEPA 2G5WA 3BLEA 2EQDA 4S3KA 4GNKB 4YIWA 1BG4A 1HVQA 5B7YA 1VJSA 5GNZA 3QGKC 4NHVA 4XX6A 4FXSA 2PWDA 3AIUA 4QS6A 3T6CA 4L7ZA 2WCSA 2E6DA 3O6AA 1KBKA 3IUHA 3TAKA 5K9CA 3TSMA 2EAWA 1XLAA 3TJXA 3NTYA 3UEQA 4HIBA 3EDKA 3W2KA 1AJ2A 4XSMA 2BP1A 2F6KA 3WLJA 2R1NA 2REQA 4GUHA 1MDRA 4CN1A 3URQA 1K8XA 1XD0A 3QLDA 1PZ1A 4XTIA 4UQAA 1VB9A 4LB3A 3W75A 1NWUA 1SR0A 4FX8A 1S46A 3TROA 4HU8A 3SY8A 5HMFA 3EWZA 1TPUA 4MG4A 3GZ3A 5AKQA 4ZOCA 4Q3MA 4UZUA 4AUBA 4ZSUA 4GQQA 1JZ6A 1FTXA 4QFUA 1BVWA 3A23A 4IH3A 5IHSA 4NXKA 2CKSA 2QUTA 3NG3A 4V1XA 3KRZA 2W62A 1E0UA 4PULA 2AL2A 3VIHA 2H3BA 4Q7IA 2NWRA 3FFSA 4E2BA 3G22A 2ZC8A 4UUIA 1HZYA 2V0TA 1O1HA 4R7JA 2PODA 4KPLA 1U1UA 1EQPA 1QVBA 4JTSA 4NJIA 1MNSA 2E3ZA 4GUIA 3BMVA 4O52A 2WHKA 3S2MA 4JKLA 1YNPA 1AODA 3UR7A 2VQUA 2IUZA 2BGSA 1NDWA 3VNZA 4O28A 5HWJA 4FXJA 3ABQA 3NVDA 3VZYA 4D6HA 3ID7A 2CESA 4L6HA 1UR4A 5IBXA 1HKKA 1JFXA 3LENA 3HFTA 3EEZA 4AC7C 1E4IA 1ZJIA 4LNCA 3KE0A 1NM9A 2QHAA 3SCVA 3NM1A 5AHMA 4QDWA 3WY1A 1PJ9A 1WP6A 3LM7A 2BOFX 4FI4A 1TUXA 3PBVA 1JPKA 4RDZA 4IM4A 4I5XA 3RFAA 3SCNA 1XH0A 4TVCA 5FKYA 2Z2UA 1Y65A 1EXPA 1P5BA 3KTXA 5IM51 1OYBA 1JPDX 4LUTB 4IIFA 4XKMA 3TU9A 4AF0A 2A2IA 2FHFA 1FHVA 4PUKA 1PE1A 2H6RA 5LIKX 4FHAA 4EACA 3U4FA 2A7NA 4W4QA 1U1JA 1BKSA 4Z1BA 4D1IA 3O6CA 5D9MA 3FNDA 3VD3A 2GDUA 2VCAA 1XBYA 3AFBA 4DO4A 1QNSA 3CQIA 5CJMA 5D32A 3SCSA 2RDUA 5ABTA 2PB1A 3LMZA 3ZFHA 3QBUA 3SN1A 4HMDA 5A6MA 4PMNA 1OC6A 1YMYA 4JTEA 1TQXA 3VUPA 3P8IA 3TLQA 4PB4A 4AHQA 1WDRA 3W1NA 2O4MA 2VEKA 1EBHA 2IPJA 4WRHA 5DEZA 1JJKA 1C91A 1R46A 4JX4A 2C1IA 3EX1A 3WQCA 4HNOA 1TMQA 1V02A 3ISIX 4DAIA 6REQA 4YXGA 3RILA 1JZ5A 3GC5A 4KF1A 4H9XA 4MYAA 3S1XA 4RZ6A 4HK5A 4LUJA 4DO6A 3QMTA 4RLIA 3SY1A 5E1QA 1TVNA 1GQLA 1B57A 3GSMA 4LCSA 1K1DA 3W88A 3WBXA 2QKFA 1XX1A 4W86A 1XDJA 4Q4PA 3O0FA 3GNNA 4XBJA 2Q02A 2Y7DA 3W7EA 2X1RA 3A5VA 3LNMA 2ZE3A 2Z27A 3EDJA 3N15A 1VYSX 1BSIA 4Z17A 2YX0A 3FYPA 1KGWA 5D2WA 3PN8A 4E2DA 1AZ2A 3R2GA 2HK0A 4P8UA 1BWLA 1VFUA 1VFSA 3GU2A 4PUDA 1EJWC 3NYZA 1VBJA 1RK6A 4W7WA 4DWSC 3A13A 2ONEA 4NAFB 2G95A 4H9TA 3F4VA 1KBJA 2TAAA 1W1B1 3GXIA 1CGXA 1UJPA 2ABAA 4TMBA 1E71M 5KITA 4JTFA 3G1FA 2FHBA 2BHUA 1POJA 3RMJA 2R8WA 3T0BA 3T2OA 1GYMA 1GQIA 1CTNA 3U2OA 3SGGA 3EB2A 4GVFA 4QP0A 2P10A 1XJBA 5A8MA 3AU6A 1YYAA 2WSPA 1EHNA 2RDWA 3GVVA 4Y8EA 2WCAA 3P6LA 1VFTA 3AIVA 3KVLA 4CCCA 2J13A 1V3KA 4AB4A 2YGYA 1XIEA 2I7GA 1CENA 1LTDA 1KFCA 2QV4A 1W91A 3CHFA 4DXKA 3DH7A 4QJ5B 2GDQA 1DL3A 4IIGA 1UROA 2QDDA 5K9DA 2YKKA 1IXOA 1TV4A 1J11A 3ZWTA 3E02A 3MI2A 4FA3A 3OQ8A 4W7VA 3MDWA 3TCSA 4E3TA 2VZOA 2P3EA 4DJEC 1G7UA 1JUKA 4CN4A 3GH4A 2DT1A 3M6DA 4NJHA 1SSDA 3QVQA 4S2CA 3WF4A 2FVLA 4O1DA 2A5HA 3WQ4A 4C6DA 1H60A 3DKLA 4AZIA 3N04A 1YEYA 4BEUA 3SRKA 1F4HA 2A7RA 2HS8A 3GB6A 3UG8A 1RP8A 3LPOA 2V81A 1D3GA 2NVAA 2Y85A 4EWJA 3K46A 4ERAA 2DZVA 1W3KA 4WKAA 5CSSA 1OY0A 5BOOA 1UWUA 3LXBA 1Z44A 4FNSA 1QHPA 4S1FA 3TYEA 2BY2A 1XLMA 4ZA0A 1Q2RA 3UGVA 3ZJ7A 3IJLA 3VE9A 1G9HA 1BWVA 4W85A 1KR0A 2YZRA 3T2QA 3BCDA 1TJ2A 4JYEA 4A3QA 4CNUA 1J6PA 2UV8G 1FDJA 3HFYA 2ZRXA 3VYLA 1XPYA 2QT3A 4DN1A 1REQA 1EGZA 2ISFA 4AZHA 3CAWA 3CUHA 1OD8A 1JDEA 2DZBA 2PDQA 4R88A 1XPGA 3TLLA 1TVLA 4W8AA 1A5BA 2WHLA 1UYQA 4ASTA 3OIXA 4NJGA 3SUWA 3T44A 4XD4A 4XVEA 1ISYA 2O55A 3GXPA 3CAKA 4GYPA 2PDPA 1A0EA 4DWSD 3L4YA 4HJFA 4EPEC 1OZQA 3OVRA 1EH9A 3WLMA 1EO5A 3EOSA 3UVAA 1UWTA 1I2OA 3UJEA 4LY4A 2ZXBA 3M1ZA 2WSKA 3UT0A 4NZCA 3IRDA 3C5QA 3LEPA 3WK1A 3T0CA 7ODCA 3BZJA 3NO1A 3NZQA 4Y96A 4NVTA 2JE8A 2PEVA 2BVYA 4JICA 3ITGA 4AZCA 2XTKA 4RNJA 4AX6A 4PBGA 5DANA 1H2JA 1WDQA 4DPPA 2V6AA 3R7MA 3RHGA 4AYGA 2IKJA 5LHFA 2EF9A 4NNBA 2O56A 1S2VA 4GLEA 3CL8A 1UQYA 2WYSA 1PKYA 3L4VA 1Y8BA 1E51A 1S2WA 1AH0A 1BRLB 4IZGA 2AL1A 5T8GA 1I2RA 1DWHM 4HCDA 3DGRA 1X6UA 4YL2A 4EPDC 1X6NA 1AQMA 2PGEA 4IG2B 1VH7A 3V0SA 1AH3A 4O15A 4XZWA 3HG4A 3M46A 3AZRA 3S5OA 3GQYA 3TOPA 3QR0A 4E8GA 3W53A 2UY5A 3M41A 3L21A 2IKIA 3V0UA 5BU6A 1QPRA 1P1XA 3KDOA 3IJIA 3QPYA 4BS0A 4KFOA 1DJQA 3OIHA 3WQPA 4Y7EA 4W5ZA 3C52A 1KWKA 2QCEA 2NQ9A 4C6LA 3B97A 4NX5A 1Z6KA 3BGGA 1JCJA 4QR6A 1MO0A 2ASHA 5L6UA 1TJPA 3I7SA 1UBPC 2DH3A 1FHDA 1GVYA 3UWYA 3SSZA 3VOGA 1KA9F 3TYZA 1ZLPA 3P74A 4K68A 1GNXA 1P6CA 1G67A 3E2SA 1YDOA 4S3FA 3QHMA 4UQDA 4MFDA 3UCQA 2HE5A 2GUYA 4HMNA 4JTRA 2QGYA 4CQBA 3PZGA 1JF5A 4U5KA 3OG2A 5C2CA 2QF7A 1QPNA 4ZGYA 3R0UA 1UOKA 3QC3A 1UP0A 3WF2A 3OP2A 1A5MC 2JQXA 4OECA 3PPGA 5D4YA 2AMXA 5D38A 5K4ZA 1ITQA 5E09A 1ZAHA 2VD9A 2Y7FA 3QYSA 3A4JA 2GGJA 3KL3A 5C0QA 2FVMA 3UJFA 4UTKA 2KZHA 4RNIA 3E96A 1MFUA 4QE4A 1XIDA 3DFQA 4EOUA 4UTIA 4DB7A 3SO7A 1QWGA 2CZDA 3A3WA 3N6HA 1TTIA 3CZEA 4M80A 3LX9A 5CBBA 2QCDB 1RHCA 3ITLA 3M0VA 3PTDA 3NL5A 2QIIA 2QCDA 3VKJA 3UYCA 3T07A 3EWWA 2WOQA 4J7RA 1V8EA 3C8FA 3C8NA 2NV2A 3V5CA 4FOUA 3CMGA 3T9PA 3AXKA 3GXTA 4HD5A 4LVBA 4MY1A 4HNVA 2OEMA 2PP3A 1XL9A 4PR4A 4AWUA 1K6AA 1H5YA 3PUGA 1SO3A 3CXOA 4MKSA 5FJTA 4O14A 3L0NA 3I10A 3M43A 3TMLA 3OYZA 2FVKA 2ZVRA 5GPRA 4HNCA 2J9XA 1KV8A 2Q09A 3OYXA 3QYQA 1L6GA 4KWOA 1TWIA 3TWAA 3SQLA 4JTKA 3RPDA 1HGYA 3BLKA 3E6EA 1O6IA 1SM9A 1TWWA 1CECA 4LYKA 3FIGA 1KLZA 4LS2A 1HF6A 2ZKMX 3BJTA 2O9PA 5FJUA 3W02A 4MMWA 1RBLA 4WF7A 1XSIA 3P0WA 2A3LA 3S6OA 1VRXA 4TR9A 1J5TA 3P8JA 3W81A 1QW9A 3W7KA 3K2GA 5DY2A 1S5MA 4CD4A 1NWTA 2XIJA 1VEMA 1SUXA 1F61A 5DBUA 3IGUA 4GFIA 3SN0A 4AWTA 4HA0A 5AYBA 1VJZA 2PA6A 3RX2A 1E5JA 1JAKA 2CHRA 2QUNA 2FTWA 1KFWA 3PPCA 1YPIA 5JBDA 1LROA 1OEPA 1JCMP 4NF7A 4GY1A 3WEZA 1GVQA 4L64A 2EGZA 5I00A 2OELA 4LV9A 3G1SA 3PWIA 5LNVA 3LU2A 3UP8A 4ZE4A 1NWSA 2CLOA 4IWWA 1DXEA 1E0VA 1H63A 4J3WA 4HMCA 3GFYA 3O0KA 2O0TA 1KQYA 4YHGA 2QCNA 2VM8A 2DFAA 1I0DA 4I9AA 2J75A 1E15A 1UR2A 3NQ2A 4NNAA 4A2RA 4WXZA 1GVFA 3KCOA 1HL2A 3AIEA 5LA1A 1LRTA 4L80A 4S3BA 3BV4A 5AB3A 2AKMA 4DJFC 1VBRA 3KS5A 2BLEA 3BQ5A 1OF8A 5C9ZA 5G1TA 5XIMA 1C7TA 2WSQA 4UQBA 3SY5A 2WSRA 4MGGA 4XIAA 4PCPA 1GPFA 1A3HA 1QFEA 3QPZA 2X30A 1D3CA 2J7CA 1ICQA 3N34A 2OGJA 2WC7A 5EFDA 2WZHA 3NQ8A 1X1ZA 4MB3A 3FXGA 3WJYA 1PB0A 3TKFA 4O11A 2QZRA 3WELA 4Q8PA 4KT2A 3OVQA 4RZ5A 2WKJA 3CASA 4DBUA 3CLWA 3C6CA 3CTLA 4ZOAA 4IMGA 1NEYA 3SIZA 4IHCA 4V28A 3UG5A 3OTRA 2Y4SA 3B06A 1IHIA 3EA2A 3OGVA 3VX1A 3ZWSA 2J6VA 3W7DA 3EPOA 3W70A 2H3DA 1Q7MA 4NI8A 3P2VA 1JPIA 1J0YA 4A3YA 2GQ8A 4FX6M 4UCFA 3N14A 4X9SA 4AZCB 2VELA 3IK2A 2V8ZA 5AC6A 5AN7A 2TODA 3L0GA 1S2AA 3ZR4A 4AG0A 3MCMA 1A3XA 2OLHA 3NQ7A 1MW3A 1M6JA 1WKDA 4OOZA 4CU7A 4GK8A 2VFGA 4K7VA 3CAQA 3VD4A 3W7IA 5TAOA 1MUWA 3T8LA 1VLIA 3NA8A 4YHEA 5HK4A 3VABA 2OWCA 3LLDA 1HGWA 4ICNA 2ADAA 4XD6A 4TVDA 5J8LA 4BA0A 1TPEA 2EHHA 1QHOA 1PX3A 1W9UA 1V3IA 2YW3A 3L4WA 5A2CA 2ESCA 1XR2A 3K30A 3GTNA 3RU8X 2ZA3A 3PB2A 4A4AA 1C8VA 1KCXA 4UBPC 2XGZA 3T08A 3DFNA 1XICA 4G9PA 1IE7C 5KZMA 5DMNA 5BRPA 4IFKB 4AQLA 4ECLA 3UU0A 4IMEA 3U7BA 1JYXA 3EBVA 1B31A 4FB7A 4K7YA 2QJGA 1A5KC 5H8UA 5JVLA 4WJEA 2W92A 2IQ0A 2C7FA 4MZYA 3HGJA 1GVIA 4D9PA 1W8SA 5A6AA 4HOZA 5JUVA 1H61A 1ISXA 1CW2A 4LVDA 1W3LA 4XZIA 3DEQA 3WQDA 3TTSA 1XKYA 3PHAA 1DE6A 5BMWA 1T96A 1J8VA 5CBJA 4OU1A 3VGDA 5BNKA 1QW7A 4G2DA 3PUEA 1W3JA 4D71A 2D0HA 2Z2AA 4NRRA 3MVIA 4N4PA 4B3ZA 2E77A 1IV8A 2CITA 5D37A 3GU1A 3RLGA 4WIWA 3WUFA 1NY1A 2DUXA 3W22A 3TYBA 2OU4A 1PS9A 2Z1VA 4H9YA 1UD4A 3H2FA 1PYFA 2ZC1A 3PG9A 1EIXA 4RNFA 3DUGA 5A3HA 1OZMA 3BZGA 3OGRA 3RLHA 2WZEA 4U2YA 2PZNA 1TPC1 3WMCA 1QTWA 3IIXA 3WN6A 4HPNA 4MJ4A 4PTVA 5HJXA 3CC1A 3VAVA 4U28A 3HBLA 3KOFA 1JDCA 4L1GA 4W93A 1WZLA 3TJ4A 3LBMA 2KAUC 2YYTA 1OC7A 2Q6ZA 1FH9A 1O95A 1XCXA 2CC0A 4W88A 4E0CA 4PSRA 2QUMA 3SGZA 4AD0A 5IFPA 1HJXA 4B4HA 3LNPA 2FKPA 1MWOA 3SCUA 3RM8A 1WCGA 4ORMA 3WDHA 1M3UA 1AVAA 5JIWA 4LEFA 3GHSA 3EWCA 3MSYA 2BXVA 3S1WA 3R13A 2GSJA 4HA4A 1AZ1A 3AMDA 3E12A 1FWEC 1D7KA 4M56A 4D6GA 1BQGA 1GHRA 1HTIA 4I8DA 2VWSA 3CB3A 3MVTA 4UTHA 3MSRA 3M5XA 1VC4A 1RVKA 2QJHA 4OVXA 5DCDA 4AMAA 2Y8UA 1E1CB 3LB0A 2BHZA 3T81A 2WV8A 1P0NA 3D6NA 1JAEA 1J2BA 3MO4A 1GGOA 2TPSA 1CXEA 2E25A 3G77A 4PTWA 1YRRA 4UTWA 1J79A 1JG9A 3IRSA 3GDLA 3WNNA 2OZTA 5B7ZA 2DIKA 4K6AA 1U22A 1ZQ5A 2BY1A 4C6PA 5G1YA 5T9BG 2JKPA 1Q6OA 2Y63A 4GRSA 3BV7A 3LHTA 4MNJA 1CYGA 3AC0A 4LF2A 1XSJA 3BPWA 4HGXA 3GVQA 4LRSA 3AALA 4EXAA 1V4YA 1K7FA 1EGMA 5AFDA 3A21A 3KOXA 4B2DA 4CUCA 4ZR8A 4JQ2A 3AMGA 2VVNA 1DQXA 4HT3A 3W2LA 3T05A 2OG9A 2CU0A 3EB4A 2ACQA 3AHVA 3RK8A 4S3CA 2PDUA 1WZAA 1GONA 1PX8A 1VFMA 2RGLA 1GVRA 1KR1A 4XZHA 3Q37A 2YW4A 3R0KA 8RUCA 1ISWA 1KBBA 1F8MA 2F9RA 3APGA 3BICA 1W5OA 1J10A 3GX9A 1HFBA 4NZ4A 4FXFA 1FOBA 1PHWA 9XIAA 3E38A 1PIIA 5A8QA 3F5KA 4DF2A 4B4FA 1I75A 4GY0A 4A3HA 4S23A 4LRTA 3R25A 3KWXA 4KGLA 4RV8A 3Q65A 3LUTA 1MMFA 4HHMA 1TMHA 2A3EA 3CBWA 1DWGM 3AROA 2YXGA 3T0AA 3DFOA 1GEHA 1N2VA 3CMJA 5M2FX 5MKGB 4CNNA 4ZO6A 4JQ1A 2BVTA 4Q6JA 1PHQA 2W67A 4ERIA 2ZUNA 1RVGA 4KEMA 1SPQA 4R85A 4E38A 2VT0A 1XLEA 1EYEA 1TTJA 3IJ8A 1UR3M 1X97A 5DXXA 2JKEA 4AU0A 4JFUA 1T7LA 4RZBA 1HX0A 1FXQA 1Q65A 1MEIA 4HNNA 3A4AA 3WLHA 1X1OA 3OEXA 3LCIA 3RCYA 1RBAA 3M5VA 4POCA 4QCFA 1UH4A 2BMBA 1HKJA 2NQ5A 4C6MA 4N9CA 4GJJA 1GTHA 3H4GA 3VVGA 3CZJA 4AC1X 2PWEA 3B3DA 2GUUA 3MPGA 3ABZA 2QW5A 5BOFA 1RLDA 5CPOA 1LWIA 4NT0A 3EWXA 3LI0A 2C15A 3ABOA 1AW2A 3UXDA 1UBSA 4WCJA 2CLPA 2YB1A 3S1UA 1QHZA 1YADA 3QGVA 2YCLB 4RXGA 4C6JA 4M0XA 3DXIA 4YU1A 5IBXC 1XG3A 4AISA 2RJHA 1NOUA 4U31A 2SFPA 3BW2A 4BWLA 2GK1A 3AXIA 4L9YA 3MHFA 4OUEA 4U4MA 2QYGA 3D3FA 2C1HA 4QM1A 2HNHA 4NZ1A 3AIBA 3LERA 5EMKA 4DJFA 4GQBA 1KNWA 2E40A 4A21A 1R3SA 2UY4A 4DBEA 2VX4A 3RM4A 1RCXB 2D2OA 3ARUA 1AJ0A 5IDZA 3VIGA 1W5NA 1R87A 1LUCB 3QW3A 1QI0A 4DYEA 1OT1A 4UR9A 4UTMA 4DM2A 1RPKA 1B5TA 3JZUA 3DG6A 4ROPA 1R2RA 1VF8A 4CU8A 2J25A 2OZ3A 3GXDA 1TJRA 4JZ5A 4G7EA 4ZO8A 2P5NA 7A3HA 4DUXA 1UQZA 1NP0A 4JN6A 2UY2A 3IGXA 4J3UA 1I1XA 3THQA 3QM3A 2X7VA 4XISA 4MAVA 3LGEA 4UIOA 3HMCA 3FYOA 2ZVIA 3U4AA 2QNEA 2X41A 3KTCA 3EB3A 4UNKA 4KS0A 2HBVA 4TXEA 5FF3A 4HN8A 5JH2A 1DVJA 4TU1A 1RJPA 4ORIA 2VXNA 3KL5A 5FEZA 3HA1A 1QXLA 4ZOBA 1V3MA 3GU9A 1VPYA 2AAAA 3PZUA 3CV1A 3D46A 4R33A 1R9ZA 2W61A 1V0KA 4RE3A 3FCPA 1VFFA 5K3VA 1SU5A 1F74A 5D9PA 3P5YA 2Y62A 3RUBL 4JHOA 1ZBWA 4LH8A 2AMGA 1LLZA 1GOQA 3KZSA 3E5BA 1F05A 2XWEA 1KFJA 2XIIA 3BAYA 5FJIA 4Q4SA 2V5LA 3UWVA 4EAYA 4J3ZA 3FSUA 1KXVA 4WSHA 2YDRA 3MZ2A 3W6YA 3S1GA 1E1EA 2CZFA 5CPNA 5CPMA 4KBXA 3MANA 1OCJA 2H9AA 4JQ4A 1X1NA 4XAZA 3WLRA 4B5UA 4JL2A 3IEBA 4O8RA 1U30A 1JCYA 1H5VA 5J5DA 5TNVA 5LIUX 3BCJA 1B3ZA 1MEHA 1L9WA 1UR0A 1V7YA 3L4UA 3H2MA 1ONEA 2NVCA 5AYXA 1OADA 1QRQA 2DUAA 1JNEA 1YTEA 1ML1A 2YA0A 4OFCA 1PSCA 3WLIA 1MNZA 1UKSA 3H7UA 4FNTA 1AJZA 5REQB 1ITUA 4WSKA 3GHUA 1CX9A 3HB9A 4B15A 3INPA 1H7WA 1QNQA 4GKTA 3VXGA 3IVTA 3BSMA 2HISA 4QISA 2AGTA 3VIOA 3P82A 4J27A 3RJYA 1XW8A 3HN3A 2V5JA 4YVVA 3U7VA 1L8PA 3I7QA 2PDMA 2OFJA 3PAOA 1TKKA 7REQB 2XZ9A 2FTYA 3Q4DA 3RMEA 3SFKA 4CN6A 5D9NA 3IIPA 2OB3A 4JIHA 1IZKA 3ZT5A 4L1WA 3BARA 5FEWA 5CC5A 3REQA 4HZ7A 4JGDA 3D3AA 4M81A 3ZIZA 5DN1A 3PPHA 1ZSXA 4GIAA 4AD5A 2YSWA 4Z2GA 2CLIA 1Q7QA 2XFWA 2DGAA 1GPWA 2XSBA 4INFA 1JXKA 3G6LA 3H12A 3H53A 4F66A 1IIHA 3VKBA 1MW0A 2WMIA 3WUEA 5CC6A 3AS2A 2WVTA 4HKPA 3YPIA 3GFXA 3HQNA 1MW2A 1ZZMA 4RKAA 3KBWA 4O54A 3TN4A 1AD4A 5KZ6A 4LF1A 4HZMA 2ZX6A 1XYAA 1K4GA 3MKVA 1JQXA 4HPHA 4D6JA 2BODX 3C2RA 3BL3A 1V6UA 5AHLA 1ECEA 1E9LA 2J7EA 4C1KA 2E8ZA 4ZQRA 4UCGA 1VPQA 3HF3A 2HK1A 3OOQA 1R3QA 1ZU8A 5LIWX 4O10A 3VTRA 1H0IA 1XLFA 5K4XA 1VAHA 1M7OA 1U5VA 1X8FA 2J7GA 4MADA 4J3SA 1UIOA 1TFVA 4U5IA 3MHGA 4ZB2A 5FA5A 1BKHA 5A6BD 4FAMA 3W25A 1BPLB 1LL4A 4HYRA 4H41A 2V69A 2VDHA 3VD5A 1EX1A 1SW3A 1V93A 3JZEA 3DHDA 3WJWA 5KETA 4S39A 4AY1A 3XINA 2ALDA 2NT1A 4NASA 4CQDA 1WB0A 3GYEA 3NZGA 3VGGA 1XGZA 4PUJA 2XSXA 1W9DM 4CQ9A 1RLCL 4UMBA 1GKPA 4Y2WA 1V51A 4M82A 3GAYA 1A4LA 1EIBA 4PUUA 1E4LA 5ECUA 4XO6A 1EB3A 6CGTA 4RDVA 4BF5A 3WH9A 3W7CA 3G18A 4RE0A 4LCRA 2GJNA 4WSJA 5CPTA 1W1YA 1MXGA 5G4EA 1D2KA 3GC2A 2C91A 2WW5A 3GNXA 3A5FA 2Y8VA 1GWJA 2FH8A 1H11A 3N2CA 5I07A 3CQKA 1VKFA 5U7SA 4YYFA 2ICSA 3NUKA 1WPCA 1DJHA 4L6DA 1SZGA 2B7PA 4FF5A 5KZDA 3DERA 1XIMA 3EXSA 2HEJA 2VEMA 4WJXA 2PDNA 4PFMA 1KXHA 3K1GA 5H8PA 2WJZA 3DZ1A 3RPTA 3SCRA 3V1PA 1ZY9A 4LAMA 3SECA 4H01A 3O63A 5E9AA 3AO0A 5CAKA 2ZFAA 3N11A 2Y5JA 3QGAC 4CGTA 4L6OA 4XTDA 2MANA 3UPMA 1YNYA 5XIAA 1TPB1 4IFKA 1G5AA 3TNBA 3DAQA 1FQ0A 5GJNA 4N02A 3I3BA 1VEPA 3R89A 5BXSA 2DT3A 1TE6A 1VLWA 4H4IA 2Q01A 2DT2A 4XSLA 4Q33A 1Z8AA 3T7VA 3W4RA 1PDYA 6TAAA 3CUGA 1B54A 4WGHA 4H7VA 1AFSA 5EMJA 2R14A 3VKAA 1JEZA 5I0DA 2RUSA 4XBKA 1H7PA 3U2ZA 3VC6A 3DENA 3THDA 3IVUA 5CPQA 1WAUA 2DY3A 4KH2A 3TSDA 2VOTA 3IANA 3PZIA 2DZSA 1UUQA 5E70A 1RCOB 4S38A 3F4WA 4UTUA 3I4EA 3L4XA 1JYVA 2GVGA 3ORWA 3P0XA 3EWBX 2EO7A 4DWSB 1NDYA 1OC5A 5F2IA 4IP4A 2VEGA 3L65A 2QAPA 4W84A 4LBRA 4IQEA 3UJRA 3PUDA 3MV01 2GWGA 4PMZA 2QJMA 1WZMA 5FD0A 2YFOA 1FRBA 4EIVA 3PZTA 2VOMA 2PSNA 4C65A 3R8RA 2VD8A 3JU2A 3VO0A 3O16A 3SJNA 2GOUA 3OHIA 3B8IA 2PCQA 4IQDA 2J7HA 3ARVA 1PWMA 3F2BA 3NSNA 1BF6A 4G1KA 4LVGA 3GIQA 1HJQA 2XN1A 4YNGA 3SCTA 3WLNA 4AFYA 1TV5A 4PTNA 5BRBA 4OUIA 5CEWA 3A3HA 3KVKA 2PF0A 1ME7A 4DX3A 3C2YA 4B5TA 4JDYA 2PRHA 4Q8WA 1UD3A 1C9DA 2JF7A 1F5ZA 3WD4A 3RR4A 1SJCA 4J4KA 3PWAA 1FWHC 3KRUA 3B0YA 4J35A 3CO4A 4N0RA 1K77A 2W3ZA 1TZ7A 4C1NB 1UKOA 1A5AA 3NDYA 4LQ1A 4LYPA 1ZB5A 3WQ6A 5GVJA 1F3TA 3MJYA 3UG3A 4HTBA 2F6XA 3N2OA 4BF9A 2FZ8A 3W1AA 3EGJA 4M24A 2FYMA 3SRFA 4GGHA 3P80A 3WK3A 2NQLA 5FF7A 1OK4A 2P0IA 3N9RA 1DXIA 3O3RA 1XYFA 4GXWA 2WJFA 1DXFA 4GH3A 4EF8A 3M0LA 2ALRA 2AGKA 4I5UA 4WDTA 3MUCA 3P81A 4O1FA 4O8AA 4XQ6A 2ZUMA 1FXPA 3LZ5A 2P1FA 1J12A 2V2CA 2A3BA 1UH3A 4J3TA 4Y9OA 3DBNA 1K9FA 2P3ZA 3V35A 1HW6A 5D09A 4IICA 2RJGA 4NIRA 4GACA 1F3EA 2J9YA 2OQHA 4QG9A 5BMXA 5D9OA 2QDEA 5LXEA 5AC7A 1YLVA 3G8EA 2DPEA 1K03A 1H1ZA 3QOMA 2I16A 2WWDA 4CNOA 4UFLA 2BS9A 3BLIA 4GHRA 2VC6A 1R7AA 1MQQA 2HPIA 3PULA 5F4WA 1BVZA 4OV4A 2X7WA 3CEPA 3S1VA 5PTDA 4O4VA 2R1MA 2FDSA 2QDHA 4IX0A 5E0FA 4IMDA 1FHUA 5J04A 1ZHAA 1TV2A 1T6MA 3PTQA 2POTA 3VOFA 1M04A 2YA1A 2YIHA 3SQMA 4Y8FA 2ZDSA 4HPJA 3NQMA 3ATZA 3QY7A 3REQB 3MY9A 2YDAA 3WBWA 1UZ1A 1OIMA 1R9YA 4URIA 3PK7A 4D72A 2D2HA 5BW6A 1IZCA 3O9NA 4LAUA 4P5UA 5DQPA 2G3IA 5A6TC 1TWSA 3K8MA 4DHGA 3WH5A 3NZPA 4F2TA 3ZT6A 1XISA 1R9XA 2VRJA 3W73A 2FFCA 3QFWA 6REQB 3TTYA 3AYTA 4J2PA 5TF0A 5TBOA 4B3KA 3CUZA 4LV4A 1E0TA 1TR1A 5D8ZA 5AVNA 5EBAA 3KWSA 4KFPA 5LKYA 1UC5A 4IP5A 1UG6A 1NWRA 3K8LA 2IS7A 5DX7A 3HQPA 1H0GA 4NXSA 1TV7A 1IWBA 3IUIA 2ZRWA 2PWHA 1QPKA 3C2OA 1DJNA 1XRTA 1EYWA 1PEZA 5ABGA 4Q8OA 2ZE0A 4GVHA 4M6UA 2NQJA 1J93A 3QKZA 3W38A 1EUNA 2GLKA 4X22A 3OW1A 1FKXA 3EA1A 3VDHA 1KV5A 4O18A 3ZR6A 3M0XA 2INZA 3RX3A 3T0DA 3S5YA 4C1LA 2BXYA 9CGTA 1QJWA 3KHJA 3HQOA 3OZOA 2PDGA 4GO8A 5I06A 1H1NA 2AQWA 4JQ3A 3U9IA 2GQAA 3NDOA 2QDGA 1W5PA 1CWYA 3DCPA 2QS8A 4NZ3A 3AYSA 1XWYA 3EWUA 3GG8A 4QS5A 4IJCA 4PA8A 3N2MA 3PG8A 1VRDA 3HPAA 4GOAA 1H7XA 3EX6A 2WLYA 4W89A 4HU3A 2Y7GA 2I1OA 4P8XA 4ZTYA 3LV5A 4QG8A 2FQIA 3NYDA 4RDWA 4A8RA 2WNWA 1CXIA 2OKOA 3FDGA 1JI2A 3ZO9A 3KBJA 2OWXA 3W86A 5DT7A 2ZX9A 3RIKA 4GABA 1JPMA 5DELA 5H6HA 2VRKA 4D1JA 4JTLA 2ZICA 2I9UA 1B90A 1XCFA 1XQKA 1HKIA 3TR9A 1M65A 3W6MA 4AD2A 3GNRA 1PKLA 4Z2JA 1JCLA 3QKEA 4HU0A 3BSHA 5LNSA 1EC9A 3LSCA 1O66A 5BXPA 4ZQNA 2HXTA 3QQ0A 1EFZA 1MI3A 1SW7A 4KERA 4Z2LA 3P14A 1ZALA 4KWUA 3E49A 4H6EA 3AOFA 3HV9A 4QJ1A 4AY8A 2PBOA 1B4EA 1FH8A 1ZBKA 4A05A 5I3FA 2BGNE 3LGGA 4JYFA 1UUOA 5HPOA 1E6XM 3H4XA 1JQVA 3FHQA 2PMQA 3ZLHA 1VBGA 2MNRA 3GD6A 2F38A 5IXEA 3E0VA 3LHWA 4C6CA 1FWAC 3G8RA 1ADDA 1E9ZB 2I56A 4M19A 3W3OA 2C8NA 4FLRA 2E1DA 3W83A 1BXBA 3W2NA 1UR9A 5I02A 1XFCA 4MDPA 1LJYA 1UW9A 1P0KA 1XRVA 3F4DA 3KHDA 4WY0A 5HWMA 3OLGA 1WNOA 2Z2BA 3FN9A 3MUXA 1DIEA 5DRCA 2JIWA 1XI3A 2IW0A 1GG1A 1A5SA 3W24A 4IIEA 1H1YA 1RD5A 2ZTKA 2CEQA 5LNUA 3S2LA 1V02E 1YIXA 3NJ3A 2JEQA 1PDZA 4AZ7A 4Q7NA 5CSUA 3I4KA 1MQPA 1VS1A 2ZCGA 2ODOA 2WZIA 2O9RA 1LCOA 4L4LA 4JIRA 4JY8A 4PMXA 1ADSA 1FCBA 2NUYA 4AVOA 2VYOA 4X2PA 3PAJA 2IPWA 1UC4A 4ROQA 4MJZA 4TIMA 4N6FA 3V5OA 3MJMA 3SZ8A 3WLKX 3W37A 1LLWA 3T55A 4UXDA 5HJLA 1M03A 4I5RA 3QEZA 4DEFA 4ZVJA 2J7DA 3N9KA 3C3UA 5AY7A 1V77A 2GVJA 4NJKA 3HPSA 4G7EB 3URNA 4KFNA 1LL7A 2IXVA 2EG6A 2XPKA 4H9VA 4H04A 4C6EA 3NOEA 2HZGA 1E72M 3J7HA 2BVWA 1V08A 3B8WA 1K8YA 4V2XA 4X3ZA 2WAGA 3CQ0A 3N3MA 1KO0A 2OX4A 1L0PA 4Z08A 2YXXA 1WKFA 2FPTA 4XZMX 5I3KA 1XH2A 1YTKA 1LQ2A 2Z29A 3W7GA 4KEZA 3L7RA 4ZQOA 1V5XA 1PZ2A 4FP1A 3DHPA 4JFTA 3TW7A 4H9UA 1S39A 3FEMA 3WF0A 4HPGA 1KW1A 1O5RA 3G3DA 4CVUA 2V3DA 4K37A 5C9XA 3DGBA 3NZRA 3IJ9A 3SUUA 5FL1A 1YPFA 3RR1A 2BB0A 1W8GA 3L67A 4PMQA 5C7HA 5HR6A 4GBDA 1XUUA 3QZ6A 3IS4A 2P53A 3E3HA 1SJAA 4A2SA 4C1NA 1XYLA 3FK4A 1YTDA 4WX2A 3K4DA 5GQBA 2B7QA 2ZADA 3R79A 3KAOA 2QVHA 1RP9A 2Y61A 1M53A 1L6YA 2PC4A 2B81A 4EK7A 4K8GA 1OG0A 3WQEA 3UF9A 1AMYA 4DZAA 2FZDA 3I68A 1RA5A 2DVXA 3DFSA 4HSNA 2Q3OA 4M6VA 1O12A 3CHCA 4UTWC 3HJZA 1HP5A 1D8CA 1GQKA 2E5DA 2EPOA 3VUSA 4LC6A 1EOMA 3PPFA 1UB3A 2L5HA 2ZZ3A 5F1VA 1TA3A 3AYVA 2ON3A 4F0KA 3AI0A 4PCNA 2OSYA 5AYYA 2PWGA 5KZEA 1WUEA 1DOSA 2X1TA 2G3JA 4Q32A 5A6KA 1G0CA 4UNLA 2VX5A 2CZEA 4W8LA 3T0TA 5D04C 3R10A 4UTFA 1VCGA 1F8IA 3VZXA 2VZUA 3LSBA 4DO7A 3BOXA 1DQWA 2J62A 2QMKA 4MAZA 5BRQA 4JTDA 1NFGA 1ZCOA 1WOAA 2A3HA 3N3TA 4BCEA 1W31A 1JUEA 1NIUA 4BI5A 1SO4A 1O7AA 1PKNA 1NF0A 3O15A 2ZQ0A 2VZTA 3F2CA 2XZ7A 9XIMA 2E67A 4Y9MA 1KFLA 1S3HA 2I9EA 4CD5A 5HPCA 4ENLA 1QI3A 4JCMA 2BFGA 5FF0A 1KTCA 4QE5A 1VYPX 3RPMA 1EJVC 1EC7A 4MNKA 1K9EA 3W1XA 4PE8A 3S8HA 4L4OA 4K8HA 1OFDA 3APTA 4NG3A 1AW1A 1GOWA 2VCCA 3QV9A 3VNLA 2VENA 3L2MA 4HCLA 3WLTA 3H4WA 2PTXA 4F0SA 3OBEA 1ICSA 4RCXA 4GO9A 4Z2HA 5CZKA 2VO5A 2ISDA 1EC8A 2QV5A 4JQAA 5C9WA 1XSKA 3BG9A 3DHFA 4JOMA 4LUTA 3VM7A 2YL6A 3GIPA 5BXTA 2DDXA 8TIMA 3N2TA 3FKRA 1UP2A 1VIWA 5G4WA 3WD1A 2YDSA 3UWEA 5AZ0A 3GG1A 5EL1A 5SWUA 2VKZG 3LMYA 1T40A 3T4CA 1GZGA 3QHNA 3AIQA 1ODUA 1J2WA 4U3CA 4CU6A 1P6BA 4Q4OA 3ME3A 3BUVA 5HINA 4QLLA 3TXVA 4QCEA 4PRWA 1VP5A 1ONXA 1J5SA 4OQVA 2ACSA 4WKFA 1B0IA 1BRLA 4FNRA 1LQAA 6PTDA 2YL5A 3SAZA 1M7JA 2VVSA 2W0UA 3TOYA 1MSSA 1J0HA 2WC4A 1LF1A 1BYDA 3RO8A 8CGTA 4OBSA 4W87A 3VA8A 1YE6A 4WKHA 2VFHA 3AXXA 3BAJA 2HS6A 2YL9A 3W7MA 3B9OA 3NEVA 2ZUSA 1E6NA 1VGAA 3G6MA 4GI8A 2AL2B 2QPUA 3WLLA 5CZJA 3VIIA 3VFCA 2Z4GA 4B90A 4GNVA 5CBIA 2NLYA 4K1GA 1W1TA 2BTMA 2J79A 3IIVA 1TIWA 4NX0A 4JTAA 3THUA 1CLKA 1Z42A 5MF5A 1EWDA 4RE4A 1KD0A 2NQZA 1FWGC 2XFYA 2DJLA 3GG0A 2WMKA 3E9AA 3WJZA 2VFDA 1TRDA 2OOFA 3O8AA 1UMLA 4Z2KA 3C0JA 4ATDA 1E55A 4C6OA 2NXGA 1JGIA 5F7UA 3RF9A 2VX7A 2NX1A 1YXYA 3FKKA 3HG5A 1MUCA 1SO5A 2EPLX 1XIJA 4GI6A 3ELFA 5D2TA 3MCOA 3UVIA 3M0JA 1LT7A 2ZXQA 3M64A 4GZJA 3NEHA 3MYOA 4RV3A 2FDMA 2ZXDA 3DKJA 3FVMA 4D8AA 3RYSA 3DG7A 5HAOA 3S0CA 4LAKA 3S4TA 4X61A 1K7XA 3L4ZA 5HUPA 4X0VA 3RLUA 1UD5A 3BLFA 1H7OA 3QZAA 3U2EA 3D47A 5A95A 1JFHA 3KRSA 2OXNA 1A5OC 3FV9A 1RR2A 3PJXA 1W1ZA 3UESA 2DZUA 4CD6A 3XISA 1BHGA 4C6BA 2QCHA 2ZUWA 1GOMA 2FPYA 5HMEA 3S5NA 2D3NA 2RDXA 3P93A 1EDTA 4Z1DA 4IQLA 5M03A 4HVXA 1QR7A 4C60A 3LCHA 5AYIA 3I3EA 4A8LA 1O5XA 4GA8A 4AD3A 2WPBA 1WDWA 5HANA 3VM5A 5BU9A 4ZEPA 3L0KA 5D05A 1G94A 3TA6A 4C7GA 1JZ3A 2R94A 3UG4A 1RALA 3TC7A 2PPGA 1FDZA 2Q8LA 3N2BA 3ECQA 5F2LA 4DRSA 1F6YA 2INFA 1RQEA 1PWLA 1HUVA 3AUJA 4GG9A 5HNUA 4JTUA 1GKQA 1I2PA 1O5QA 5CPLA 5A94A 2V3EA 1SSGA 3WEMA 4H6RA 3G24A 3FSTA 1C9WA 2YB4A 2GJLA 3I3DA 4A3RA 4QXIA 4AAJA 4DIAA 4JTCA 2PTDA 4DJDA 4WZHA 4QTGA 4GYKA 5LYRA 3EEGA 4DELA 3MMUA 3B4YA 3NIYA 1FWIC 1K4HA 1GCYA 4IMFA 3L9CA 4RDYA 4CNSA 1XLCA 3NAVA 2Z28A 2CHNA 4GVIA 2FGBA 1QO5A 2XIOA 4GI4A 5EB8A 3W7RA 4HBKA 3LQLA 3HJEA 3W7OA 1Q66A 4E4FA 2D69A 3EPNA 1NQKA 3PP7A 3CQJA 3S5ZA 3MP3A 3NOYA 2POZA 3EPMA 1AW5A 3LHYA 2CERA 4GI9A 1TCMA 2C14A 3JS3A 1LUCA 2CZVA 3W76A 2C79A 1N55A 4DNHA 1UD8A 4HTYA 5I6SA 4GQGA 4MTVA 3GZAA 3G1HA