4WOZA

Crystal structures of cdnal from clostridium difficile in complex with mannosamine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
290
structure length
290
Chain Sequence
TDMKGIYSALLVSFDKEGNINEKGLRQIIRHNIDVCKVDGLYVGGSTGENFMLSTDEKKRIFEIAKDEVKEEIKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVTPFYYKFDFEEIKHYYNTIINSVDNRLIIYSIPFLTGVDMSLDQFGELFENEKIIGVKFTAADFYLLERMRKTFPNKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGVRARQIFELTKNEKISEALEVQHVTNDLITDILGNGLYQTIKLLLEEQGVEAGYCRQPMKEATDEMKSRAKEIYRKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate lyase
publication title Crystal Structures of CdNal from Clostridium difficile in complex with mannosamine
rcsb
source organism Peptoclostridium difficile
molecule tags Lyase
total genus 125
structure length 290
sequence length 290
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wozA00
5AC6A 2ZBTA 1AL7A 1AW2A 3KVKA 3OG3A 4ADTA 1YPFA 3G1AA 1Z41A 2JKEA 3HQ1A 1OK6A 3JS3A 4ZVJA 3IIXA 3QRHA 3O6YX 3R12A 3LLDA 3QMSA 1YTKA 3IVUA 1OK4A 1P0KA 3NO5A 1DQXA 4PL2A 5DCBA 1SQ7A 1VHNA 2QCDA 4ORMA 1VS1A 1GVSA 1UASA 5TIMA 2X16A 8TIMA 4WUIA 2BXVA 1D3HA 3O8AA 2RDWA 4WY0A 2F7FA 5L6UA 3I7QA 1XCFA 2H3BA 1Q6OA 1DVJA 1RPXA 2V81A 5L9FA 1QO2A 1PE1A 1W5NA 3DFNA 3NVTA 1YDOA 1VJIA 3LM7A 4Z0JA 3QW3A 1IGSA 2OT1A 1KFEA 2W6RA 4UTIA 3SGZA 3BG3A 3TX9A 4EF8A 3M41A 3LDVA 4LUIA 4ZQOA 3THAA 1VC4A 4KFPA 3I7RA 3P81A 5DY3A 3IIPA 3CIWA 3A9IA 2E77A 1SO5A 3MHUA 1SSGA 1OYAA 3UPWA 3K30A 1H50A 3F4WA 3EX4A 4NJHA 3NG3A 1H51A 2QEZA 3RF9A 3DBPA 3P82A 1JULA 3INPA 3W1XA 4GUHA 1OF6A 2C13A 3QZEA 4DF0A 3NYZA 2V9DA 5HJLA 5G2IA 3QQ0A 2J6XA 4Z1AA 5HQEA 1VYSX 3O05A 5A5WA 5FF2A 2DZXA 2WSYA 3TDFA 5C54A 1M7OA 4YL2A 1JRBA 3L0GA 2NX1A 1Y0EA 3EX2A 1UCWA 4JD4A 2E1DA 3LCLA 2PRLA 3GNDA 1DJNA 4MVAA 4GUIA 3ZWTA 2ZZ3A 3PUOA 2Y89A 4N2YA 2NUWA 1TREA 2ZRUA 1L9WA 4GUGA 4UTLA 1MEIA 1GZGA 2GVGA 3HO8A 4OV4A 5CG7A 4E2DA 4HHPA 2PRMA 3A23A 3GXTA 1F5ZA 1LZOA 4O57A 4I7UA 3O16A 5LGXA 1MEHA 5G1TA 3UWQA 3NQGA 2DU2A 1K3UA 2QCGA 3DFPA 3MP4A 1FCUA 5G2HA 2QUVA 3TA6A 3C3NA 4N4QA 2ZZ5A 2DORA 2V8ZA 4JX6A 3FA5A 2OT0A 1W37A 2GOUA 3W73A 4ZQPA 1T0OA 3N3MA 1PV8A 4JYFA 3STEA 1JVNA 4ZQCA 1QO5A 1LLZA 1W56A 4UTHA 1HO1A 3TC7A 1AW5A 1VR6A 2A0NA 2WNQA 5K9DA 2VFHA 2V2DA 3IVTA 4Z1BA 3W87A 4S1FA 3BG5A 3VFLA 1ZAJA 1K8XA 4RX0A 2HS8A 5LSMA 2ATMA 1T99A 3ATZA 3N2MA 4W9TA 7TIMA 4HSNA 4IOTA 4NZFA 4PA8A 5H2ZA 2VENA 1OFEA 2TSYA 4QNWA 3OIXA 4FNRA 3PUEA 4P61A 3NQ8A 5AB3A 1WXJA 4LVBA 3ANYA 1I4NA 1I2RA 3KVJA 1JCLA 4A22A 3SIZA 1K8YA 2C6QA 4M6PA 3G1SA 1X7FA 3SFKA 3LCWA 5FEPA 1L6SA 1OFQA 4Y96A 5AOUA 1W5MA 1QNVA 3E02A 4DXVA 2CU0A 2Y6ZA 1H1ZA 1B4EA 1GEQA 3E49A 3RU6A 5HWMA 2PCQA 4UUIA 3W7CA 5K4XA 3B03A 2LLEA 3GKAA 4XKYA 1EP2A 3CB8A 1LOQA 2CFFA 2TRSA 3M6YA 3LTPA 4LC8A 4KFOA 4HN4A 1AG1O 2JKPA 5EMUA 1IIGA 1GVFA 1VPXA 5F2IA 3GNNA 1YPIA 3MP3A 3Q58A 5EYWA 3W07A 4HIBA 4LWWA 1GWJA 1P0NA 1TB3A 1TTJA 3O15A 3P60A 3TE9A 1B4KA 3STFA 1FWRA 2NXGA 2NX9A 2OMAA 1C9DA 3EEGA 1ZALA 3TSDA 3G1HA 3L5LA 5CZTA 3EWBX 1T96A 5CGQA 1X6UA 2YW3A 4UFIA 1QR7A 4PODA 2B7OA 2QCCA 4ZQRA 1W54A 1C8VA 1G4TA 3DXIA 3BVJA 3PC0A 2QCMA 1UJPA 2VKZG 3W2KA 4A29A 3W7DA 2DJXA 2G95A 2GJNA 4LC6A 2NUYA 3R2GA 4LTSA 3UWWA 2J24A 3EKZA 3UNDA 3O06A 1L2UA 3QSRA 1KM5A 3E96A 4FNTA 5D2VA 3MP5A 2O7SA 5EBUA 3DAQA 2ABBA 4XKYB 3TIMA 1IF2A 3UWYA 1Q3NA 4NVTA 3SR7A 4GWEA 3G18A 1LDCA 2QUUA 4FNUA 4UFHA 3DFQA 3PBUA 1ZAIA 3G8RA 4K7VA 2YXGA 1JRCA 4O13A 1DBTA 4LOCA 1W0MA 4K36A 3UWZA 1XUUA 1ZNNA 3S0CA 4DO5A 1TV8A 3M16A 1X8FA 3KVMA 1BKSA 1EP1A 4OU1A 1JQVA 2V5BA 2CZDA 5F2LA 3NQAA 3WK1A 4BK9A 4Y8FA 3HGJA 3WFAA 3WK3A 1Q6LA 2YX0A 2Z0IA 5K2ZA 1TJPA 2ZZ1A 2A85A 2B4GA 3NL6A 2Z1BA 1LP6A 3BGJA 1SZFA 2BLEA 1Q6RA 1TRDA 1EP3A 4MKNA 4O14A 1WA3A 4QISA 3S8HA 4RXFA 3LRMA 4JICA 3VCRA 2ZRVA 1YDNA 3FKRA 3IVSA 3C61A 1QAPA 3IV3A 1RZMA 3OVQA 5D2YA 2V2CA 3NZ1A 5FESA 3JR2A 3GAKA 1XBZA 4AF0B 4HPXA 2QCHA 3GDMA 3QW4B 2ZRWA 4LV9A 3N2XA 3QMTA 4RV8A 3BO9A 1H7NA 5HINA 2E6FA 3TUUA 1X1ZA 1NF7A 1N55A 2CLOA 5D30A 3G0XA 2V30A 2V0TA 1JCYA 3LXCA 4JN6A 5C5YA 1OFBA 5AHLA 4JY9A 2QJIA 2W79A 3LRLA 4MY1A 5G2WA 3GYEA 3C4UA 3GR8A 1SSDA 4UIOA 1YADA 3PY2A 4WY0F 3T7VA 4IMCA 4JX4A 3KRUA 4AAJA 3L9CA 2PC4A 4NQ1A 2CLIA 1S5WA 3UZ5A 4XQ6A 2YYUA 4E0CA 1G6CA 4LVDA 2P0OA 3C2FA 3NPXA 3IGSA 4H6KA 1OABA 4UCGA 4ZQMA 2E5DA 4KKXA 4H4IA 3UPBA 1GVOA 2TMDA 3MYOA 1TPDA 4YCOA 5DCDA 4NX0A 1MSSA 1Z44A 3THQA 4AWTA 5E1QA 3TXVA 5FEXA 2F84A 3FJ6A 2IQTA 4N02A 4JTUA 2RKXA 3M5XA 3TFCA 5EPDA 5D03A 1RQBA 3E9AA 3EKLA 4WX2A 2Y7FA 3N9SA 2Z6IA 4K37A 5K9XA 2P1FA 5F2GA 2ZA2A 2X2GA 4MPQA 5CZJA 3W1PA 3RK8A 4MFEA 3CM4A 3TROA 1XXXA 4GXMA 4OWGA 3FLUA 1KBIA 1K7EA 3S1UA 4MFDA 2Y85A 1QPNA 2Z6JA 5K9CA 4Y6GA 2C0AA 3G0UA 2A7NA 4TMBA 4TO8A 3P84A 3T55A 3G1FA 1TPWA 2RHGA 2H90A 1Z48A 1GYLA 3EWYA 5AYZA 2H8ZA 3VKJA 3GAYA 4LW7A 1CX9A 2JK2A 1EUAA 3A21A 1SFLA 3PM6A 4XTIA 1F7BA 2Y70A 4QM1A 3STCA 1WYIA 3YPIA 3P8IA 4MJMA 5AHMA 3VNDA 4JTLA 5AYYA 4RKAA 5CPOA 5ABTA 3NPUA 3W22A 3A22A 3G22A 4CQ8A 5G4EA 5HR6A 2OCZA 1YTEA 3LTYA 3R13A 2VEKA 4FNSA 4QQ3A 1B9BA 4NJKA 2DZWA 1KM4A 1KTCA 4JY8A 1EEPA 4FB7A 1DOSA 1XFBA 4BI6A 1KTNA 2WNZA 4UXDA 1LBLA 4MZ8A 3QM3A 1PCKA 2JBMA 1U83A 4DO6A 5CSSA 3CU2A 5DLCA 3T44A 1W1ZA 4RJEA 3EXSA 4A2RA 3NQEA 1FX6A 2Q3RA 2NWRA 2X1SA 4OGZA 1EUNA 3MI6A 3PWAA 4RCXA 5HR7A 1U5JA 4K38A 2GQ9A 1ZHAA 1PVNA 2EGZA 1SO4A 1WBHA 1M7PA 4Z1DA 3TV8A 3NEVA 1LORA 1OVDA 2YSWA 4Y9AA 2V2HA 2NV2A 3CIXA 3QSTA 3TNOA 2DZVA 3NQ2A 3ZWSA 4AHOA 2XFWA 3LI1A 4RZ6A 4MUZA 4CNOA 2E6DA 3CWOX 5G5IA 1NF0A 4LS1A 2YGYA 4FNPA 5D33A 3GIYA 2GPTA 4DEFA 3S5OA 3ABRA 4JTFA 1BWKA 1XDLA 4HNNA 3FOKA 3G1XA 2A2IA 3LXAA 3M9YA 5K7JA 3EX6A 1J2WA 1FDYA 3MW7A 3S9YA 1ZCOA 5E93A 4IMDA 5HMSA 3SZ8A 4AHPA 1WBJA 4CNPA 3TC6A 4E38A 2OZ0A 5LKYA 3HGOA 4UC5A 5AHIA 1HUVA 1UUMA 1YXCA 1EPXA 3TH6A 1XI3A 2ZZ6A 1KBJA 5D38A 3S5ZA 1I2PA 2WKJA 3KRZA 2QCEA 1ZJIA 1XC4A 3LV5A 3GDTA 3HPXA 2Y88A 3W83A 4IWWA 5K3VA 4IGHA 3NQDA 3W72A 3W7LA 1SZGA 3MUXA 3NQFA 4UFJA 2NLIA 5HUPA 3W70A 3W1NA 2A6NA 3L65A 2ZZ2A 3PSWA 2ALDA 3M44A 3LHUA 5EY5A 2Q8ZA 2XN0A 4WOQA 3DGRA 4GUFA 5DY2A 4JNMA 1KFBA 4NT0A 3P80A 4NNCA 4MIMA 2QCDB 1O94A 1THFD 1Q6QA 4JYEA 5AHFA 1OFDA 4FEZA 4WY0B 2GQAA 2E5BA 4K8EA 1WV2A 3GR7A 5CPNA 3RFAA 4HNUA 3UWVA 3LOTA 3VI2A 5TQLA 3NM1A 5AHEA 4LY8A 2VFGA 1WOBA 4I9AA 3RLUA 2DJLA 1KFJA 1QDSA 1OHLA 1G7VA 4IXHA 2CLFA 3NAVA 2FPTA 2GVLA 3E0IA 4UTUA 2ZZ7A 5I3IA 1H5YA 4NUWA 4MZ1A 3TR2A 5F4SA 4NX5A 4X9SA 3TMQA 1P1XA 3F03K 3PBWA 3I6RA 1VCGA 4FX6M 4PH6A 3M5VA 3GDLA 4O17A 1VQTA 4MOZA 1KA9F 3W2NA 3W1LA 1VZWA 2AGKA 3S5YA 2HS6A 2Q8LA 5KTLA 4YLWA 1TQXA 4M6QA 2CZFA 3MHGA 1FDJA 3B0VC 2C1HA 3OA3A 1TJRA 1G7UA 4GRSA 1I2NA 3CTLA 1A53A 4JTIA 2P10A 3UWUA 1WQ5A 3OEXA 5HNRA 1VRDA 3DI0A 4JX5A 3HB9A 5HULA 3LLFA 5CSRA 2Y7GA 3I7SA 2Y7DA 2ZTKA 3TK7A 4X22A 4GUJA 1A50A 5LNUA 4UMAA 4FNQA 4CCDA 1MZHA 3UYCA 3FYOA 1SO6A 3ATYA 4P2VA 3DENA 2J88A 4O0KA 1FWWA 4QAIA 2QUTA 4DF2A 3R89A 3W2JA 2YW4A 4RR4A 5F4XA 4WZHA 1F2JA 3GXPA 4N9DA 3GX9A 3TQVA 1YTDA 1XKYA 1AK5A 4NU7A 3GZ3A 3W7EA 1MO0A 1ME9A 4DBEA 1WDWA 2DP3A 4UR7A 1S5TA 2CW6A 5IM51 6ALDA 1V7YA 2J9XA 4PL1A 4M5PA 5FF4A 3U2OA 4FX8A 4I7VA 3S1XA 4O1BA 1A5BA 4UFKA 4NXKA 3W2UA 1A5AA 3SY5A 3TFXA 1HFBA 3W85A 3M5ZA 1N7KA 1OX6A 3FKKA 3C8FA 2AAMA 1OJXA 1ZFJA 3P74A 3LHZA 3RMJA 1TRIA 1TO3A 3EX3A 2V5LA 4OHQA 2VFEA 1B57A 2QJHA 3ABQA 2ISWA 5SWUA 3PF3A 3DI1A 4K7YA 3LBCA 1EWDA 1HG3A 3W7RA 2FTPA 5EKYA 1DQWA 4X2RA 4UTMA 3M43A 3F1QA 1NAL1 1TPUA 1SFJA 1YYAA 3A5FA 4A2SA 1N8FA 3Q94A 3WK2A 1H61A 5E0KA 4POCA 3VE7A 3HG5A 5DBTA 4CCCA 3HBLA 5LNVA 1TPFA 4O10A 4O18A 4NNBA 2PURA 1OX4A 3I68A 3E12A 3W7GA 4JTSA 3LCHA 3STGA 3EWUA 3W6YA 3TKFA 2WO5A 2ZCGA 3ABOA 3B04A 2A21A 5BMWA 2FPVA 3LTSA 2ZRYA 1X1OA 3S42A 5LNRA 3L5AA 1W8SA 1A5CA 3MHFA 3QMRA 1FUYA 3O63A 5CZ0A 3AO0A 3IIVA 3W7OA 3IRDA 1JUBA 1H7OA 4O53A 4JTTA 2ZA1A 4K39A 4OV9A 3PG9A 3G1DA 3LCFA 4LNYA 1D3GA 2ABAA 2V82A 3LHYA 5KITA 5DELA 4XBKA 1B3OA 5C55A 2XN2A 4J9JA 4RK8A 4TIMA 3SJ3A 4JTEA 1IXOA 4LRSA 1TMHA 1YXDA 2B7NA 3B4UA 4O1AA 1KM3A 5TBOA 4BWLC 1SW0A 4RXGA 1LROA 3PR2A 4OT7A 3PVFA 2WSQA 3PULA 3KAOA 1F6KA 3W7MA 3UY8A 1HL2A 1W3TA 3CQ0A 1KFKA 1TV5A 3IIOA 5LNSA 2NX3A 4X3ZA 1H62A 3O1NA 1S3HA 4GFSA 2Y61A 4JTKA 4O16A 4ZZ9A 5D09A 2YDAA 3BV4A 3DHDA 3O6CA 3TQKA 1JQXA 1MEWA 3O07A 1J5TA 5EA9A 1YXYA 3A5VA 5D37A 3IEBA 2H8XA 1TYGA 2Y7EA 3P67A 4XBSA 3F4NA 1LOLA 3BK0A 4GE8A 3S6DA 2FB2A 3V1PA 3R8RA 1QCWA 1R2SA 3L21A 4WQ6A 4A3UA 1EWEA 3T4CA 1KM1A 5C6MA 1I2OA 2XN1A 1SO3A 3CEUA 1GG0A 3B8DA 3GVGA 5AYXA 2NZLA 3GK0A 1NEYA 3LCXA 3EWWA 1W5OA 3P62A 4PTNA 5K4ZA 3EXTA 1GYNA 5HWNA 3C2RA 4LS0A 2YFOA 1L6YA 1Q45A 1O95A 3LHTA 5KZMA 3UXAA 4ADUA 2VFDA 1P4CA 2R94A 5D2TA 2WV8A 3H53A 1TSIA 5AC7A 2Q3OA 4O50A 2DZTA 5LZLA 1XBXA 3T78A 5LGZA 5F4WA 4O28A 3OHIA 3SW6A 5D05A 2Y62A 4BFAA 3UZJA 4DQWA 4AVFA 4IMGA 2AQWA 3Q37A 3TU9A 3A24A 3WK0A 1KV8A 5I3GA 1ADOA 2ISSA 3U6WA 4NXSA 3GLCA 2A1YA 3U8GA 4C1LA 4KWWA 1F6PA 4Q4KA 5BOOA 4K8HA 4AH7A 2X1UA 1GVQA 1SPQA 3TMLA 3G8EA 4GC4A 1EIXA 1G69A 1RQEA 2VFIA 2QCNA 4UMCA 3SGUA 1W5PA 3TW6A 5DXYA 3FS2A 5FI8A 3QPYA 5D04C 2O7QA 4I7WA 4ICNA 4S2BA 3C2VA 3DFSA 4O8RA 2RFGA 2KZHA 1JUEA 4YWIA 4U28A 1TIMA 3RNDA 1LCOA 3HG4A 3NDOA 4EIVA 4NJIA 4ZQNA 3P5ZA 3KRSA 3CT7A 1DORA 2RH9A 3W86A 3ELFA 4IX2A 1HO4A 3TW7A 1SUXA 1FWSA 2WJZA 4MYAA 3NXFA 4DELA 1I8JA 3WJSA 3N73A 2NXIA 3G3MA 4YMZA 4BI5A 5CPMA 2JGQA 5F1UA 3DKLA 1HTIA 2ZZ4A 1DJQA 1TTIA 4WOZA 5KZEA 3ZFHA 1O5XA 4PEKA 1TTQA 4FXSA 2EHHA 1XDMA 3FJLA 3W84A 3NQVA 3W74A 1ME8A 1M6JA 4Z08A 5DBUA 4HKPA 3NPWA 1OYCA 3BPWA 1FY6A 1NVMA 2PE4A 1DL3A 1FCQA 4NNAA 2WPBA 4UTWA 3V75A 2YCEA 4MZYA 1W3NA 4QITA 4Y90A 4UTTC 4ONVA 1YLVA 3W1AA 4MY8A 3W1QA 5J5RA 4UNLA 4L4LA 3LCGA 3M1ZA 4HNTA 3C2EA 3TXZA 1K7XA 4AHQA 4AB4A 4OBTA 2VC6A 3W76A 1VYRA 3SSJA 1EB3A 2CWNA 2HMCA 3LRKA 1AMKA 1GG1A 1EA0A 3MWAA 4R33A 3BW3A 5KSWA 3ZR4A 3L5MA 4DF1A 4N6FA 3R5EA 4JEQA 3HF3A 1RQHA 4XWUA 3QJAA 1BEUA 1G4SA 1FCBA 1I2QA 3BW2A 3WJXA 4IMFA 1JUKA 3TSBA 4AWSA 2YZRA 4UFMA 1H7PA 1G67A 4LRTA 4IPIA 4R53A 2RDTA 2B7PA 3GKFA 2JKAA 2BWGA 3W7PA 4MYXA 3W2MA 1KLZA 1VCVA 2A4AA 4N4PA 3W7HA 1KV5A 3LV6A 4IX0A 4NJJA 1TCDA 2ZRZA 3ZS4A 4ZMGA 4H3DA 1EX5A 2TYSA 3PG8A 3NQMA 5C2XA 1R30A 3FEMA 3DKJA 4C1KA 1KW1A 4O4WA 5HWJA 1PHQA 3N19B 1SR9A 3ABSA 2BTMA 3L0NA 1LM1A 1J4EA 1LRTA 1OFRA 4ML9A 2FQIA 3GXNA 3L2IA 4RZ5A 3MBDA 3WJWA 4UNKA 1M5WA 1ICPA 2QAFA 3G0SA 1CW2A 4NJGA 4MY9A 4M6VA 3PSVA 1NFBA 2R91A 5AN7A 1LOSA 3DH7A 4IMEA 3W7KA 2CLLA 3Q2DA 3HJZA 4Z0SA 4PFMA 3CHVA 3TAKA 1OYBA 5U4NA 2B7QA 1E51A 5LNWA 4WXYA 3EWZA 1RR2A 4ZL1A 5AFDA 1H7WA 3BG9A 5CKSA 4CCEA 3IIZA 2C15A 4O1DA 4LVGA 3W7QA 1GTHA 2ZTJA 5EL1A 4LVAA 1H7XA 4M7SA 4JTHA 1XBVA 1RD5A 3T40A 1R46A 3NL3A 4HT3A 4IQLA 3NOEA 3CWNA 5FF0A 2VELA 3QF0A 2VFFA 3QFEA 3MMTA 2TPSA 1LBFA 5IBXA 4IJBA 3N34A 1ML1A 1VHCA 3LHWA 1W3IA 1ZENA 2G96A 5I3KA 2WNNA 3C52A 1FQ0A 3FFSA 3LCIA 1F73A 5J5DA 3AJXA 1LRNA 3I65A 4HPJA 1ICQA 4OQVA 4FXRA 4NZJA 4KFNA 2OJPA 1LTDA 3M7WA 1W5QA 1O5KA 2FJKA 1S5VA 4UTWC 3HGSA 4FX7A 1IXPA 4WJEA 4QSHA 1ALDA 4G1KA 3S1VA 3S5NA 3HIJA 3M47A 1P5BA 3BW4A 4A21A 1KM6A 3W1RA 3M5YA 1FBAA 1TPEA 2FLIA 3UQNA 2ZDRA 3IGUA 2BZNA 1O60A 1XL9A 4OE7A 4BWLA 3PB2A 5F2MA 1FDZA 3OBKA 3W2LA 2DZUA 4JTGA 1UBSA 5H91A 3MBFA 2FFCA 1SW7A 5D02A 4DPQA 3L66A 3SI9A 1PIIA 2I14A 4FO4A 1KFLA 1Z42A 3G3DA 2QJGA 1XUZA 3UY7A 1LBMA 1JCXA 1AL8A 3G1YA 4N9CA 3KX6A 5I3JA 3DU0A 1D9EA 3NZRA 3NM3A 1BTMA 2GQ8A 2W0UA 2CLKA 3CEPA 3NQCA 2FDSA 4B5NA 4ADSA 4JS3A 3C2OA 2BX7A 4R34A 1OFPA 2NXHA 4IUOA 3W71A 2E09A 4LVFA 3MYPA 1TQJA 3GB6A 4Z1CA 3W7JA 2G97A 3FYPA 2B0MA 2C19A 2X1RA 4LV4A 5DXXA 2VEMA 2QCFA 2QF7A 4FF7A 2A6LA 3JRKA 3W88A 4EF9A 3HG2A 3QC3A 3B05A 4QNEA 2EAWA 4UTJA 5MHBA 2R8WA 3LERA 2EPHA 3LX9A 1WAUA 2Z2UA 3W75A 3NR0A 5AHNA 3PBYA 2QDHA 3UXDA 1O4UA 3QH2A 4N9BA 3MO7A 3TJLA 2H3DA 1SU5A 2ZA3A 3W1MA 1OFAA 2VEPA 3H55A 2ISVA 4CLMA 3B06A 4AXKA 2J9ZA 2QCLA 2X30A 3S1WA 1OX5A 2A5HA 1FXQA 3QYQA 4BF9A 1GOXA 1BWLA 4EOUA 3PBVA 1FCVA 4IPJA 1LYXA 4CNNA 5FF3A 1SW3A 3NL5A 1C29A 2E6YA 5LHFA 3L68A 1W31A 3LXBA 2NV1A 3B0PA 4QIUA 3KXQA 3PS7A 4O19A 5IBXC 2ZRXA 2E5CA 1F05A 5F1VA 1UUOA 2WOQA 4WXZA 4L4MA 1H1YA 3PUDA 1VH7A 2X1TA 1UB3A 4E2BA 2VOMA 2QDGA 3BLIA 3BLFA 3NA8A 3HPSA 4RLIA 1XM3A 1K7FA 1QPRA 4BI7A 1PCWA 1RVGA 4XTDA 4HSOA 4LU0A 3N9RA 2HTMA 1I45A 1IXQA 5GVJA 1ZAHA 1KTBA 2QR6A 2DZSA 2ZQ0A 1TPC1 1K02A 3WJYA 2NUXA 3DFOA 1TV7A 4ALDA 3EXRA 4UFLA 4MLJA 3D0CA 4MLRA 2FB3A 1SZNA 3CC1A 4PC8A 2GVJA 3VE9A 1A5SA 1V5XA 3MI2A 5BNKA 1VLWA 3TSMA 4O4VA 4UMBA 2I1OA 1GPWA 5KINA 1OX4B 4JDYA 4AF0A 1AW1A 3NNTA 4YXGA 3CPRA 3W3OA 3WJZA 1PS9A 2YPIA 4R7JA 2G5WA 4JGDA 4CQ9A 1H60A 1OG0A 5D2XA 4Q32A 3BLEA 4BR1A 3GDRA 3MI3A 2GUUA 3KFTA 3O6DA 4JYDA 5DCEA 3LI0A 1KLYA 2CLEA 4N9EA 2C3ZA 3P7YA 4O0ZA 3G24A 2WQPA 4XUGA 1KM0A 5FF7A 3KHJA 5I3FA 3BGGA 2ATSA 4UTTA 2C14A 5CPLA 1QMLA 3TJXA 3NGJA 4HNVA 6TIMA 2CLHA 3EX1A 4GBUA 2ZYFA 1OFOA 4FIRA 3C56A 4PCFA 4DBDA 4YCPA 2I9EA 2RDUA 4LT9A 3IGXA 3N14A 2A7RA 3MJYA 3LB0A 4M7TA 2R14A 2A7PA 4AWUA 4TMCA 3KOFA 4Q33A 3W23A 1F76A 1IIHA 3W7IA 4K6AA 1VCFA 4O15A 3LBMA 1ME7A 2E68A 1G4EA 1QPQA 5D2WA 4CQAA 2WSRA 4O52A 3W7NA 1XBYA 3RLVA 2FPYA 2J27A 1FWTA 3DHFA 3QQ1A 3HPZA 4UR8A 1JCJA 4JIPA 4S2CA 1KFCA 3EWXA 3DZ1A 5CZSA 1JCNA 1VYPX 3P61A 5U7SA 3EB2A 3QEZA 4N6EA 4FIQA 3HG3A 4FHAA 4AMAA 3HOJA 3PAJA 3L0KA 1PHWA 1DV7A 1VLIA 2CZ5A 3SECA 1R2TA 1GQNA 3DFTA 2PRHA 2C16A 2CZEA 3OVRA 1H63A 2HSAA 2QKFA 1LRQA 2EKCA 3TCEA 1LLWA 5FEWA 1ONRA 2UV8G 1QOQA 4JDBA 2YFNA 1RV8A 3G1VA 1WX0A 1WOAA 1DKWA 2C18A 2FIQA 3LGEA 1NSJA 2D73A 4JR5A 1F74A 1PL9A 4D2JA 3W1TA 1DHPA 1JR1A 5DN1A 1TPB1 4IXXA 3CLMA 4M19A 4JTJA 1ICSA 1ZY9A 2BSLA 3B0UX 1H7RA 2VXNA 3P5YA 1GVRA 3TQ0A 2CLMA 3M0ZA 3W1UA 1OF8A 1MXSA 1T8XA 1R2RA 3QPZA 3C0JA 4O11A 2JGYA 3OVPA 3P8JA 4LUJA 1VGAA 1TPH1 4AEOA 1GTEA 3C6CA 1JJKA 5HUOA 3KVLA 4GNJA 2GJLA 1KM2A 2OX1A 3NQ7A 5G1YA 3H54A 5KZDA 2J9YA 5G4WA 2EF9A 1L6WA 3NQ6A 3NL2A 3HMJG 1FXPA 1G4PA 1QFEA 1GJPA 1CI1A 3HGRA 1GT8A 2DZPA 4TU1A 2VEIA 5BMXA 3BARA 2NWSA 3NPVA 4O54A 2QAPA 4KWVA 4U4MA 4TR9A 2E6AA 4QJ1A 5D32A 1K8ZA 4JXCA 4UTKA 4RZ4A 4XZ9A 4O12A 5T26A 1QPOA 1FWNA 3GDKA 5BRBA 1TPVA 5FEZA 1TTPA 4TX9A 1QOPA 1SZEA 4O1CA 4DPPA 3USBA 4MJZA 3UD6A 4JIQA 4EWND 2YYTA 5A8GA 2Y63A 4WD0A 3FIGA 5I3HA 4DO4A 4EVZA 5LHEA 3LHVA 3TAOA 5BW6A 1R47A 5KMYA 3W9ZA 3PB0A 4LS2A 1YDVA 4GJ1A 5AC8A 1K03A 2ZFAA 3L67A 2H6RA 4ORIA 1QWGA 1IXNA 1JCMP 2YR1A
chains in the Genus database with same CATH superfamily
5AC6A 4HZMA 1AL7A 1AW2A 1IEXA 4AYGA 4ADTA 1MI3A 1QW8A 4L65A 2DIJA 3JS3A 4ZVJA 3QRHA 3R6IA 1KC7A 1IV8A 2XSXA 1P0KA 3NO5A 1US0A 1TCMA 4PL2A 3KL3A 1AD4A 1VHNA 2QCDA 4ORMA 1K70A 5IXEA 1BVNP 4KRZA 1T6MA 1GVSA 2XYLA 1UASA 2E9LA 4KIRA 1E15A 2BXVA 3O8AA 4B92A 1C7SA 4M82A 4CVUA 1TR1A 1YEYA 1DVJA 3S6OA 1B3WA 5L9FA 2PI6A 1VJIA 3FY1A 1EJVC 1IGSA 2OT1A 1KQZA 1KFEA 4LGXA 4GHRA 3VA8A 1UR2A 1UH2A 3PZ9A 3W6MA 4C6JA 1VC4A 1G9HA 4QP0A 3I7RA 4LH8A 3V7PA 1CGYA 1YNQA 1H41A 1JD7A 3CIWA 2UY5A 3A9IA 4EWJA 1SO5A 3MHUA 1VP5A 1OYAA 3UPWA 1WZLA 3F4WA 3R58A 2DSZA 2OTDA 4I6VA 3KP1A 2DUAA 5I6SA 4AD2A 3W1XA 2O0TA 1OF6A 3EPMA 6CGTA 1NTHA 3IK2A 4DF0A 1EHAA 2QJJA 1V08A 1Q7QA 3L4XA 3OHMB 2CNCA 5G2IA 1FWHC 2PGEA 2J6XA 4P8UA 4H6EA 3O05A 5HA7A 2WSYA 2BY0A 4DJFC 4YL2A 1UCWA 3LCLA 1KQYA 4M56A 2ADAA 5EMYA 1I75A 1KKRA 2OX4A 3OP2A 1X97A 3W25A 2PEVA 2NUWA 1P6CA 1TREA 4GUGA 4P7RA 4UTLA 4UOZA 3R43A 3RM9A 2P3ZA 2PRMA 1HGYA 1Y5VA 3FX4A 4GIYA 3QZAA 3O16A 4NILA 1K3UA 3A4JA 3GR4A 1FCUA 1WZAA 5G2HA 4WCJA 2EBNA 4N4QA 4AX6A 2QYGA 4JX6A 4P7NA 3SUUA 3L4YA 3W73A 1NOWA 1T0OA 4KETA 4MDOA 1XLAA 3RCNA 1A5UA 3ITOA 3PZUA 1W56A 4UTHA 2XUCA 2I9UA 1KO0A 4H83A 3V0UA 3IVTA 3K1GA 4S1FA 3H2FA 3PJTA 2HS8A 1F3TA 3M0IA 4FF5A 1T41A 1W9UA 4HSNA 1XGZA 4E8DA 5DANA 4Z2KA 5H2ZA 3O2LA 1FOBA 2HVMA 4WSKA 3WF4A 3SCWA 1OFEA 1XW8A 4FI4A 2FJUB 3MDUA 1ITXA 3UEQA 3PUEA 4F0HA 3ANYA 3PZNA 2FZNA 4P8WA 3Q4DA 4LEQA 1SFTA 3CMGA 3G1SA 1X7FA 1CT5A 3LCWA 1L6SA 3L4UA 1OFQA 1GPFA 4Y96A 1W5MA 3LGGA 2IQDA 4DBWA 1GEQA 2PCQA 5A8OA 5M3WA 4LUSB 3VC6A 2F2KA 3B03A 5K4XA 3UR2A 3WEZA 4XKYA 1EP2A 3CB8A 1LOQA 2CFFA 3CASA 3SUSA 5JXQA 2A3BA 2VR5A 1IIGA 4A4AA 2Q01A 4C7GA 1VPXA 3GNNA 3Q58A 2FHFA 1XYBA 5EYWA 2WZEA 3EDJA 5AKQA 3PJXA 1TB3A 4HA4A 1TTJA 3AU2A 2G41A 3O15A 3TE9A 2VC7A 2XH0A 4F9DA 3GH7A 4JIEA 4Z2HA 2PDCA 1MQQA 4UFIA 3K4AA 1VBJA 3DXIA 3BVJA 3PC0A 3PZTA 1B2YA 3W7DA 4EPDC 4U2ZA 4V2XA 2G95A 4Q8TA 5FL1A 2GJNA 4LC6A 5HNTA 3UWWA 1CIUA 3GVQA 4XD6A 3SRHA 5EBUA 4RDWA 2V5CA 3UESA 2ABBA 1IF2A 3D47A 1E0XA 4H1ZA 2XGBA 1TZ9A 3R4IA 4LUTB 1QHPA 3W0KA 4GY0A 1LT7A 4FNUA 3PBUA 4J40A 1XLIA 3B8TA 2YXGA 1JRCA 4K36A 1DE5A 3S0CA 5M17A 1EFZA 5CJNA 3T08A 2VC9A 3ARYA 1C92A 2V5BA 2VNCA 2VX4A 2Q09A 4GNVA 4BK9A 2CKRA 3WFAA 1Q6LA 3LA4A 4TTGA 2VCAA 3GUGA 2ZXQA 1RXOB 1I6NA 3AS0A 1SZFA 2BLEA 3PZMA 4IMAA 1QHOA 3V36A 2WYSA 1BVZA 4RXFA 1TV3A 3LRMA 4JICA 4LEFA 2ZRVA 4LNCA 4XAYA 2G3JA 3IV3A 4JEJA 1RZMA 3OVQA 4GA8A 2V2CA 3JR2A 3AXIA 1S5NA 1XBZA 5BXTA 1LL7A 3QW4B 4UZSA 5C7VA 5DT7A 5HINA 1SGJA 5I3DA 4MB5A 3TUUA 1N55A 3KS5A 2V30A 1JCYA 5C5YA 1OFBA 4JHZA 3LRLA 4ZTYA 4MY1A 4IIEA 4Z42C 3ZJ6A 3GR8A 2GK1A 3MSDA 2IUZA 2OZTA 1S5WA 3UZ5A 2BVTA 4E0CA 2CCRA 2YCKX 3C2FA 5FACA 3IGSA 1OABA 3CQKA 4ZQMA 4H4IA 1GVOA 4CN1A 4L6OA 2PWUA 1CZ1A 5M5DA 4YCOA 2YXOA 5DCDA 2BB0A 3H2AA 4AWTA 2DVUA 3FJ6A 2BOFX 1VFTA 3M5XA 3EKLA 4AD5A 5A6BA 2Y7FA 2ZC8A 3N9SA 3IJDA 3OG2A 2Z6IA 1E1CB 4C7FA 4K37A 2I5GA 4R5EA 5K9XA 5F2GA 1CEOA 4MPQA 1H0GA 2PFHA 3TROA 4F2UA 2FGLA 3FLUA 3OLIA 3S1UA 2BASA 2Y85A 5K9CA 2D3NA 4Y6GA 4TMBA 4D6JA 1TPWA 2RHGA 2H90A 1Q6EA 1RCQA 1O1HA 4NAEB 5EMMA 3WZ0E 5BU6A 2JK2A 3VD4A 4QM1A 3K4DA 3STCA 3W24A 4EK7A 4HYRA 3NPUA 4CQ8A 2DSKA 3ALFA 6XIAA 1YTEA 2IXVA 3R13A 2VEKA 4B5XA 5H8MA 3H2CA 4JY8A 4FB7A 1DOSA 3WNMA 1O66A 3DCPA 3REQA 5CPSA 3RRXA 4AFYA 4F66A 1LBLA 1E1EA 4HCLA 3QM3A 1PCKA 2JBMA 2VGIA 3EDEA 1H11A 5C7HA 2PSNA 4A2RA 2X42A 4OGZA 1DXFA 3PWAA 3DG6A 3MCNA 3QBUA 4K38A 2NQLA 4XIAA 3AIUA 4L9YA 1PVNA 4PB5A 2EGZA 3RG6A 1SO4A 2W91A 3TV8A 1OVDA 4H7VA 4Y9AA 2P88A 3CIXA 4AY1A 3QSTA 3TNOA 3RRAA 2DZVA 5FJRA 2OQHA 2XFWA 4XAGA 3NZGA 3VDBA 1MDRA 4RZ6A 1KXHA 4IQJA 3CWOX 4F2TA 3V5FA 2WCSA 3E2QA 3CTTA 1NWSA 3OGSA 4J3VA 4M8UA 3CB3A 3UCDA 1UP2A 4HNNA 4YTUA 1PX4A 5K7JA 1VFSA 2D0GA 3MW7A 3S9YA 3VIPA 1J0JA 4CNPA 3TC6A 3W37A 1XC6A 5LKYA 3HGOA 2PDPA 1XI3A 4DJDD 4DUWA 2A3HA 4J3TA 4DZIA 2WKJA 3KRZA 1R9YA 1ZJIA 4JFTA 3GM8A 5GJPA 2D0HA 1EOKA 3FXYA 3I3EA 2AKMA 3WQOA 3VGHA 3C2YA 4W8BA 3P3BA 5K3VA 4XKMA 3NQDA 3NQFA 3GNOA 3DBNA 4H9YA 4IG2A 1KRBC 2JEQA 3RX2A 3L65A 2ALDA 3M44A 1PZ2A 1TVNA 4K68A 4ZOEA 2ZXAA 2XN0A 4JTQA 3M6DA 1AODA 1KFBA 3DFYA 4PFHA 4EXQA 4Z2GA 4Y2WA 5H8PA 3I3DA 4KEUA 2QCDB 1EPVA 1Q6QA 3DC8A 4W7VA 2GVEA 3ORWA 4YHEA 5ECUA 4RDVA 2IMRA 1IYXA 4HNUA 3VI2A 3NM1A 1F8MA 5HPOA 1WOBA 1KFJA 4DHGA 1XCXA 2CLFA 2PDNA 2GVLA 3VYLA 3E0IA 3U7VA 3R8GA 2NSOA 4ASTA 4PH6A 3CUFA 4LCQA 2DH2A 1OT2A 1R0MA 3W1LA 3W2NA 3CQHA 2ZE0A 2HS6A 4HZ7A 2Q8LA 4YLWA 1TQXA 3OLEA 4M6QA 2PTDA 1FDJA 4QX4A 3B0VC 2UZ9A 3DG3A 4QHRA 1TJRA 3AMCA 1UD2A 3WUGA 4JTIA 2P10A 1S1RA 4ZOAA 4F8XA 1TWSA 3AJ7A 3OEXA 2FGBA 2F8QA 9XIAA 1UG6A 5CSRA 4U3AA 3CAVA 1JDDA 2WM0A 4PSRA 2BHUA 3H12A 4C6PA 4GUJA 3VILA 2CBUA 4HU4A 3M07A 1VEOA 1FHUA 1WKEA 3WMBA 3FYOA 1EDQA 5C71A 3DENA 3MANA 5EGRA 3ARTA 3R89A 1L2QA 3E6EA 1F2JA 2ZXBA 2O9RA 2PGWA 3S2JA 4F0MA 1A49A 4OUEA 1XKYA 1AK5A 3MKKA 3P14A 4Q7IA 3QFWA 1ME9A 4DBEA 3GDBA 5H8UA 3UGVA 1S5TA 3W38A 1HL8A 1EYWA 2ODOA 3WL1A 1V7YA 4CUCA 3MCMA 4M5PA 5FF4A 1BXCA 4U2YA 1J18A 1A4LA 4PRRA 2WZTA 1A5AA 3SY5A 1OEPA 3CZ8A 1HFBA 3W85A 3EB4A 1N7KA 5H1WA 1OX6A 1KCKA 4Q4RA 1PBGA 4S23A 4FLQA 1CBGA 1EA9C 3UJ2A 1R3VA 5CC7A 1W6TA 3HQOA 2V5LA 4OHQA 1UR8A 1B57A 3MVTA 2QW5A 4HMNA 5REQA 4W5ZA 3LBCA 1AQFA 3RUBL 4FP1A 1GOQA 1VFHA 1GEHA 4H7ZA 1F3EA 5EKYA 1DQWA 5LXEA 2HE5A 4UTMA 4GZ7A 2ALRA 2XTKA 4XAPA 1YYAA 4GYFA 3A5FA 4XZNX 1N8FA 3Q94A 4IIHA 3PFMA 2JFEX 5E0KA 5TNVA 3VE7A 3HG5A 1TPFA 2QGYA 4O10A 4O18A 3UETA 4F2BA 3UCQA 3LLXA 3I68A 4ZEPA 2ZXDA 3BQ5A 1P0EA 4JTSA 2D0FA 3LCHA 3TKFA 2WO5A 2FH8A 3VABA 3J7HA 1AFSA 3LTSA 1E73M 1A5CA 3QMRA 3IIVA 2HISA 3DX5A 5FSDC 4JTTA 3GH5A 4QG6A 2A3CA 5E9XA 1D3GA 2ABAA 2V82A 2VD8A 3FK4A 2W5FA 4WKHA 5DELA 4Y8EA 3WQ6A 1B3OA 3SAZA 3LYEA 1UP3A 1DWHM 4J9JA 3SJ3A 4LRSA 1IEQA 4PMDA 4GGHA 2VGGA 3B4UA 3BAYA 1P0BA 1L6FA 5LIUX 3ZM8A 3FAWA 2BODX 1SW0A 1XRFA 4BWLC 4DIAA 1LROA 5D9PA 3PVFA 2VCBA 1JXJA 3W02A 1F6KA 3BXWA 4H8UA 1R7OA 1FH9A 1ECEA 1KBLA 4XG1A 3IIOA 1PSCA 4X3ZA 1MYRA 4YWSA 2Y61A 4ZZ9A 3XINA 2PDIA 3H7VA 4XX6A 3O6CA 3TQKA 1OGGA 3O07A 1ODUA 2JALA 1RPKA 3A5VA 1TYGA 5LA0A 3P67A 1EF2A 4AU0A 4C5YA 3VGDA 4GE8A 2FB2A 5E0CA 4A3UA 1EWEA 4RNHA 3ZZ1A 1KM1A 2XN1A 5FJPA 3FCPA 1R38A 1AZ1A 4E5TA 2NZLA 3GK0A 3EWWA 1A0EA 5BZAA 3EXTA 5K4ZA 1DPMA 4AEEA 4Z2IA 3QOMA 4LS0A 1X7IA 3TTSA 2YFOA 1L6YA 1O95A 2EKGA 3EOEA 3H70A 2EQDA 1S2VA 4QDMA 3FA4A 1ISXA 3WDQA 2R1LA 1A3HA 1TSIA 2NT0A 3H53A 2Q3OA 4O50A 2VHLA 3E0LA 4HK5A 4O28A 4U5IA 1ISYA 2Y62A 3BMXA 2DH3A 4V1YA 4AVFA 3TU9A 3CUHA 5IHSA 6ENLA 2P8CA 3C0LA 1RD6A 3O9NA 4C1LA 3ZR5A 2VP8A 5BOOA 1WKDA 1CWYA 4QEHA 2GK1B 2PD9A 2W27A 1GVQA 2X1UA 4XZMX 3WSUA 3G8EA 4GC4A 1LWHA 4KCUA 3GIQA 5DXYA 3FS2A 4XZWA 3RPDA 3CMJA 3N17A 1EBGA 3F4DA 4O8RA 4PMQA 4ZCWA 4PMJA 4U28A 3QY6A 3RNDA 3WQFA 2AL1A 3HG4A 4ZSUA 4NJIA 3GC5A 2PPGA 1HO4A 2XSAA 1KRMA 4Y9NA 2WJZA 3BSMA 3NXFA 2XSBA 4KWSA 4DELA 1KB3A 2OYLA 1RJRA 4ZSTA 3L4ZA 4MSSA 2ZZ4A 1WXZA 1O5XA 1Z89A 4PTXA 4PEKA 1KR1A 4LFYA 3L2MA 1XDMA 3NQVA 1J93A 3ZSSA 1P6BA 2WM1A 3UYIA 3WLHA 3BPWA 5T9BG 1FCQA 1AH4A 2A3EA 4RE2A 1QOXA 2WWDA 2YCLA 1J5SA 1W3NA 4QITA 4Y90A 3AROA 3HTWA 1B30A 1TE1A 5J5RA 4L4LA 3UBPC 4AHQA 3AHZA 4QXIA 2Y8UA 3REQB 2HMCA 1GHSA 3SEPA 1QWKA 2OG9A 2CHRA 3MWAA 3BW3A 3ZR4A 3L5MA 3R5EA 5DMYA 1RQHA 4DJFD 1BEUA 5EMLA 1FCBA 1I2QA 1JUKA 2E8YA 2WK2A 3TSBA 1OD8A 2J79A 1R3SA 1EO7A 1QTWA 4IPIA 2QPXA 3V5CA 3GKFA 1PIGA 2BWGA 3U5YA 1QXLA 1Q8JA 2VZOA 2VI0A 4MYXA 1X1NA 3VIHA 1UPMB 2JEPA 4IX0A 4B5VA 1TCDA 4H3DA 3FJNA 1JNEA 4PUUA 2HNHA 1S46A 5HWJA 1QI0A 3WMCA 4IGNA 5AZ0A 2FHCA 1LRTA 1I1WA 1VPYA 4LB3A 3GXNA 4B9YA 1M5WA 1CW2A 1CXFA 4EXAA 1DJZA 2E67A 4M6VA 1T40A 3KBSA 3DH7A 4HB7A 3Q2DA 5DRCA 3NO3A 2VOTA 5A8NA 3VX1A 1E51A 5LNWA 2DQXA 4MWAA 5CKSA 1IQ8A 4C6QA 3B0XA 3WF0A 1HVXA 1E4IA 3W7QA 3IUIA 3OB8A 1R46A 4HT3A 4IQLA 4MNMA 5I06A 3UR7A 4XO7A 4GKLA 1DIEA 1LWIA 1KCXA 2VFFA 3CJPA 4YVPA 5D9NA 4Q7BA 1LBFA 3KUMA 5IBXA 1J6PA 4IG2B 1DE6A 1X38A 1K9EA 3OBEA 3VUSA 1PKMA 2WLYA 1E9LA 3KOXA 3WLLA 5I3KA 4HYVA 1SR0A 4ZE4A 1E9ZB 1YPXA 4RUBA 4GC3A 1V02A 1B31A 2POZA 4NZJA 4KFNA 3SCRA 3M7WA 1NM9A 3H4GA 4S3FA 4WJEA 4G1KA 3S5NA 3M47A 1R87A 3BW4A 1KM6A 3CPGA 3R11A 1ONWA 1TPEA 4TV6A 5DFAA 1O60A 2BZNA 4PUKA 3NZQA 4W5UA 3SO7A 2VRJA 4JCMA 1KBBA 4BWLA 4ERIA 5F2MA 1FDZA 1RA5A 5HK4A 3OBKA 1NDZA 3OU8A 2DZUA 4J1OA 1XKJA 3JU2A 1ZB5A 1PIIA 2I14A 1BQGA 1VAHA 4FO4A 5AYBA 1KFLA 1Z42A 2CESA 3L23A 4J35A 1XUZA 1JCXA 1JPMA 3BJSA 4KCVA 1UWSA 1IGWA 2X09A 1UIPA 2P5NA 1XPYA 1WCGA 2UBPC 4URIA 2CLKA 1TJ1A 2HVNA 3ARWA 2FDSA 4BQ2A 1LQ0A 1EQPA 4MADA 4O0QA 3QHOA 3AIVA 4KEZA 2NXHA 4IUOA 3GG1A 4LVFA 4H6RA 3VMNA 4JQ2A 3ICJA 1DJXA 2HV5A 2OKOA 3GB6A 3WELA 3MKCA 2G97A 3GS6A 4HMCA 4PUJA 1XPGA 1GVYA 2J7HA 3OO2A 1RHCA 4FR1A 2BOGX 1GOOA 3CK5A 4CN4A 3TOPA 1H4PA 4MB3A 1NELA 4GK8A 4QNEA 3ZJ7A 1LWJA 1QU4A 3W75A 3PBYA 4PUWA 3UXDA 3QH2A 3WF3A 1R86A 1EF3A 4EP8C 3MO7A 3W28A 3TJLA 1OFAA 2EPMX 3B06A 2QCLA 4UOQA 3U3HA 3S1WA 2ZVIA 3ZLHA 2X05A 3LPFA 1EOMA 2RDXA 3QYQA 5A6SA 1LYXA 1EC8A 1C29A 4XV0A 3L68A 3FA3A 4FLOA 3D46A 1E4MM 1W1VA 3A4WA 3B0PA 4QIUA 4PTVA 5I78A 4TXEA 3PS7A 1K6AA 3T07A 4RE4A 2YL5A 4HU0A 1F05A 5C9ZA 1HP5A 4HZ6A 2YA0A 1BG9A 1XLBA 5CBBA 4PCSA 3OGVA 1KGUA 2VRQA 3BLIA 2ZE3A 3BLFA 1PWMA 2HVOA 1XM3A 5REQB 2D1ZA 1K7FA 3VIKA 1QPRA 3N9RA 2HTMA 1JG9A 5E70A 3GD6A 5BWAA 1TPC1 3EPOA 2GGHA 3TOYA 3N6QA 3DFOA 4ALDA 3E2RA 4UFLA 1K8CA 3NTYA 4HNCA 2F61A 1SZNA 3OTRA 2PDWA 3EAUA 1QI5A 4PMVA 5BNKA 3MS8A 3VDHA 2I1OA 5I03A 5KINA 4JDYA 1AW1A 1GQKA 4YXGA 1PS9A 1O5QA 2G5WA 2OLHA 3CGTA 4CEXC 1E0UA 3LPGA 3VKAA 1OG0A 3KWSA 5D2XA 3BLEA 1A5OC 4N9EA 5I7GA 3TLQA 3POHA 2V68A 2ZUWA 1PJ9A 1R3RA 4TOQA 5BOEA 3T4WA 4OBRA 2ATSA 4CNTA 4NL1A 1QMLA 2F9RA 1OFOA 3A3WA 4S3CA 2W62A 2FZBA 2Y8KA 1UKSA 1VEPA 4LAZA 1W9BM 1TWWA 3I10A 1UWQA 3N14A 1OSEA 2R14A 9XIMA 4J7RA 4QDPA 3Q65A 4AWUA 1XH1A 4Q33A 1VENA 1XLDA 3W23A 5JIWA 1Q8AA 4P8XA 4P7OA 2HXUA 3APYA 2VRKA 1QUMA 2CC0A 3MU7A 1IIHA 4Q4SA 2DSWA 4K6AA 5LIYX 3KOWA 4BA0A 4IJCA 3LBMA 2DVTA 4X0VA 4O52A 4XD5A 4X60A 1XBYA 1UW9A 3U48A 1U33A 1FWTA 2D2JA 2INZA 2PDMA 2AGTA 2XVLA 3HPZA 4H8NA 5D8ZA 1Q2SA 3VCCA 1JCJA 4K8GA 4JIPA 1KFCA 5CZSA 2G3IA 3AMDA 1JCNA 2X40A 4H00A 4N6EA 2WMHA 4HNLA 2RUSA 1OG6A 1ESWA 3TR9A 2WZMA 3IACA 2XZ7A 3FSUA 4WVXA 2CZEA 3OVRA 7ENLA 1H63A 2XINA 1LRQA 5BXRA 1PAMA 1LLWA 2A3LA 2UV8G 5RUBA 1G94A 2OO6A 1DKWA 2C18A 2FIQA 2GSHA 5D4YA 4MNLA 3L4VA 3F2DA 1F74A 4KQNA 4D2JA 1X39A 4BKNA 2XIIA 2Z4GA 1TPB1 4RNFA 3CLMA 1ELSA 4M19A 4JTJA 1JF6A 3B0UX 3ARZA 1CPUA 1OGBA 3MJMA 4B91A 4PUMA 3TQ0A 1QHZA 3M0ZA 1OF8A 3QPZA 3QHMA 3CQIA 2E8ZA 1DTUA 2VX7A 3UT0A 2WBKA 1VGAA 3C6CA 3W01A 4LCRA 5CGMA 2YOCA 3GFYA 4GNJA 3VAVA 1KM2A 3IK4A 3NQ7A 3H54A 4HHLA 5G4WA 2EF9A 4O8AA 3NQ6A 3NL2A 3VNJA 1GYMA 1G4PA 2V5JA 1NDVA 4UQDA 4QE4A 1JYXA 3TC3A 4PBGA 3OW1A 1CECA 3CZJA 2FH6A 3QY7A 1P7TA 3CO4A 4YU1A 4NZ4A 3NPVA 4O54A 2QAPA 3UG5A 1X98A 4TR9A 4DM2A 1D8CA 1VPQA 4QJ1A 4B3LA 1KWGA 4CD7A 4OVXA 5T26A 1QPOA 3U4FA 4I6KA 1KGWA 3EA1A 5AC5A 2XISA 4NAFA 1XQLA 2YYTA 3ITYA 3FIGA 5I3HA 3LHVA 1EO5A 5KMYA 4OBSA 1AJ0A 2PUZA 4LS2A 1YDVA 3O7UA 1KGXA 3VXGA 2H6RA 3WLRA 3LQLA 1TJ0A 2AQOA 3H4WA 4GVIA 1JCMP 1VFOA 2H9AA 3RXZA 5D9OA 2R24A 2ISFA 3BJTA 1GKPA 1YNPA 4C6OA 1VBUA 3WLPA 3OG3A 1WDRA 1Z41A 2DT0A 2ISDA 2FHBA 1E0VA 2YCLB 3QMSA 5A2CA 1JNDA 7A3HA 4JFWA 1OK4A 1UQZA 1DQXA 4NKCA 5CCZA 3H2MA 2Y5JA 3WENA 2ZOXA 3EDKA 2ZWYA 1H2JA 3I7QA 1XCFA 4ZB2A 4A8IA 1L0PA 2PGFA 4DJEC 8A3HA 4QLKA 1PE1A 3NVTA 3OYXA 4GX8A 3ARXA 4ACZA 1YDOA 1RY0A 3QW3A 4V15A 4UTIA 1B90A 3F7JA 3TX9A 3CWHA 3URAA 1QNRA 4QFUA 3LDVA 3ZLFA 3VCNA 3T0AA 4ZQOA 1E6NA 1R85A 1UQYA 3P81A 4D9PA 5GNYA 2E40A 3K30A 4KBXA 2EPLX 4QLLA 1H51A 3RF9A 1W2PA 2C13A 1L8NA 4GIAA 5T9CE 3I4KA 2NV9A 3H6OA 3NYZA 5F7UA 3WQ4A 1IHIA 3T0BA 4Z1AA 5I24A 4S3EA 5LIWX 2VVSA 4S3AA 2DT3A 4JQ4A 2NX1A 1Y0EA 3RJXA 4LAUA 3AZRA 2BGQA 1LG1A 2ZZ3A 3ANVA 3PUOA 2Y89A 4GZEA 2ZRUA 3ZJKA 4MWAB 1UD3A 4IP5A 2GVGA 3HO8A 3N9KA 3R94A 3GO2A 4E2DA 3POCA 1RALA 3A23A 4QTGA 3GXTA 4JZ5A 4O57A 3TN5A 5LGXA 4WLCA 5G1TA 3NQGA 2DU2A 1RLDA 3NSNA 1OM0A 3MP4A 1KXVA 2IKJA 4JN7A 2WPGA 3K8MA 3P6LA 5JH2A 4OUIA 1V51A 4B9ZA 1W37A 2GOUA 3WBXA 3MSYA 4L1WA 5XINA 3WH7A 2X0SA 3STEA 2OSYA 1DIKA 2DT2A 3T0TA 4ZQCA 2QGHA 3P0XA 4AZIA 3TC7A 3GY1A 2ZC1A 2WNQA 2VFHA 2V2DA 3ITTA 2OXNA 1IT8A 3BG5A 3DHUA 3VOFA 1T8QA 4Q4QA 1OWQA 3C3UA 2INEA 2ATMA 3RR4A 1T99A 3ATZA 3B97A 3LQGA 3N2MA 7TIMA 2GJXA 4QBXA 3SRDA 2J77A 5BXSA 1I9CB 3KRBA 3AS3A 3AXXA 1SVDA 2VENA 2V6AA 3OIXA 2P3EA 3UXKA 4FNRA 3NQ8A 1XYAA 1W8GA 4LVBA 3QPEA 4MWAE 1Q7ZA 1I2RA 4J3SA 2AL2A 3KVJA 5DMLA 1K8YA 4WSJA 2DV0A 2C6QA 1XRTA 5G4HC 4AXNA 5A2BA 1QNVA 3E02A 2QV5A 2Y6ZA 2TODA 3MC5A 3VZZA 5HWMA 2JIWA 4UUIA 2Q6ZA 1GK8A 3LTPA 3DYMA 1AG1O 2PODA 5F2IA 2P0IA 2VO5A 2ZUTA 1RSCA 4LWWA 4UOJA 4XAZA 4DWSA 5BROA 7PTDA 3KBNA 1E71M 3SCTA 1B4KA 4KT2A 2Y4SA 3STFA 5KZ6A 1FWRA 2NX9A 1K1DA 1V02E 5CZTA 1C8XA 4DZ5A 1FWBC 3NWRA 5CGQA 3T8LA 4PODA 2QCCA 3C86A 2PDUA 3TCSA 1JL8A 1GOKA 3M0MA 2DJXA 2FGZA 3WQGA 3WBEA 1S2TA 4MJ4A 4GYJA 2J24A 3E96A 1FFRA 3CT2A 4FNTA 1VFFA 1QVBA 5D2VA 2XVPA 1R7AA 2X1IA 4ZB0A 1RBLA 3UWYA 3SR7A 4GWEA 4PMYA 4ATDA 3G8RA 6PTDA 1RCOB 3EOUA 5BXPA 2WVVA 1WUEA 1W0MA 3UWZA 1XUUA 1TV8A 4I9TA 1X8FA 4TUFA 3KVMA 4KERA 2O55A 5IFTA 5A8MA 2CZDA 5CJ5A 3K13A 3NQAA 4Y8FA 4EE9A 2J7DA 2Z0IA 1GZ1A 3PJUA 5K2ZA 1WDQA 3FVDA 3WEMA 5ABFA 2B4GA 1DIOA 3NL6A 3BZJA 4LYQA 1CNVA 3BGJA 4L80A 4MNKA 2J8TA 3ITLA 1EP3A 3BCDA 4QISA 3S8HA 4D6EA 3VCRA 2AMXA 3BANA 3U7BA 1JEZA 4W87A 3C61A 3NZ1A 5FESA 4LF1A 2XIOA 1K4GA 4U5KA 2MNRA 3WMSA 5EFDA 2VUNA 5HPCA 1PYFA 4DAFA 3BO9A 4GIEA 4DZAA 4IPLA 3KBMA 3TYCA 2Z29A 1K6WA 3G0XA 3LXCA 3R79A 5AHLA 5J04A 4H9XA 1FWIC 5G2WA 1D7FA 3GYEA 1M04A 3T9PA 3C4UA 5FAJA 4UIOA 1MXGA 2QUMA 2CLIA 4FMVA 1Z3NA 4LVDA 2QIIA 4Q8MA 3WFZA 4H6KA 4UCGA 3TW9A 2EJAA 3RHGA 3UPBA 4PRTA 2TMDA 4NX0A 1MSSA 1Z44A 3THQA 3RIKA 3TXVA 5FEXA 1FWAC 2F84A 2WMJA 3VVGA 4UTFA 4UQEA 4L9ZA 2J7CA 4N02A 2RKXA 2G0WA 3E9AA 1A5KC 1MQRA 2P1FA 1XD0A 2X2GA 5CZJA 4GVGA 4YS1A 4OWGA 2VVNA 4RDYA 1QPNA 2WW5A 2C0AA 2A7NA 3V4BA 4TO8A 3BWWA 3T55A 1E55A 2FTWA 2XVNA 4E8CA 1Z48A 2ZUVA 4HK6A 4XTIA 3RAOA 1F7BA 3YPIA 3P8IA 4JTLA 4QJ3B 4AZCA 4RKAA 3WMLA 3A22A 5G4EA 2Z1KA 1D7KA 4Y9MA 3UR5A 5J8LA 4AD0A 3LTYA 1M9HA 1XIGA 1J10A 4U31A 4WIWA 1BPLB 3VGGA 2Q02A 1IZJA 4QE1A 4IQDA 4XB3A 1XFBA 1KTNA 1DJIA 1SMAA 3WBAA 4LBSA 3WX7A 5CSSA 3EZ4A 1BQCA 4BJHA 3T44A 3QC0A 4RJEA 3EXSA 4D6CA 2Q3RA 4JCLA 4X2PA 2NWRA 3IJIA 3W00A 3MI6A 1U5JA 1V6TA 1VFMA 1ZHAA 4PCNA 1M53A 1IEWA 1HN1A 1FWDC 3QGAC 1WBHA 1M7PA 2HDJA 2VX5A 3IAQA 4QS6A 2YSWA 2V2HA 4ILSA 1RK6A 4JNZA 4DWDA 4FOUA 2J8FA 3RCYA 3N1AA 4F48A 5D33A 3GIYA 1ADDA 2GPTA 3KWXA 1DQUA 4BQ5A 3E38A 4K1WA 3MCOA 1NWRA 2OWWA 1P7TB 4JTFA 1BWKA 4PMOA 1UZ1A 1UD6A 3N04A 3G1XA 2I7GA 2IXUA 3AYVA 3M9YA 2NVCA 1J2WA 4XUYA 2OEKA 3WLQA 1PKYA 3KOZA 3UG3A 3LS9A 4MJ2A 2P50A 4HPNA 2OZ0A 3VGEA 4UC5A 1HUVA 1UUMA 1ZBWA 1EPXA 1ISZA 2O9PA 5D38A 2PDJA 4Z2LA 3G6LA 1I2PA 3GG0A 4NAFB 4PMNA 1EH9A 2PF0A 2QCEA 4H9ZA 4F0RA 4MKVA 1FHVA 3T2QA 4N0RA 3DECA 1N8IA 3HPXA 3W83A 2WQDA 3IJ9A 4QCFA 4GMEA 4IGHA 3W72A 3T8QA 1IT0A 1A4MA 4GKTA 3MUXA 2NLIA 5HUPA 8XIMA 4YVVA 3CZEA 3RU8X 2IKIA 2H9AB 2ZZ2A 3D5HA 2QHAA 2NQ9A 1XYMA 2Q8ZA 4AVOA 4WOQA 3RGTA 3DGRA 4GUFA 3GVWA 4JNMA 4GACA 3IJ8A 3P80A 4GXPA 4NNCA 1V6UA 4DUVA 4MPKA 4N7QA 3VMPA 3SCOA 2GQAA 3B9DA 4K8EA 3RFAA 5CPNA 3UWVA 3MUAA 4LY8A 1FWGC 2VFGA 4GABA 3RLUA 1QDSA 3V18A 1OHLA 1G7VA 4ACZB 3WQEA 1QNQA 2OELA 5A3HA 2C7FA 1DYSA 4UCFA 3SFWA 4Q8WA 1H5YA 3MUZ1 3HURA 4NUWA 1LL6A 4X9SA 3TMQA 3LBOA 3PBWA 4C6KA 4W88A 3TTOA 2V3GA 3VUPA 3GDLA 4GJJA 4OZOA 1VQTA 3ZIZA 1B3YA 2AGKA 4A8LA 5KTLA 4ZO7A 2A79A 1XLGA 3EMZA 1F61A 3SRKA 3AYSA 2YB4A 5LIKX 1LF1A 1G7UA 3BDKA 1A53A 1SJCA 1ZP4A 4GI9A 1XICA 4DJDC 4GY1A 4Q8UA 4RNJA 1XH2A 3KOYA 3HB9A 1XLLA 1CCWB 3KHDA 2Y7GA 3I7SA 2Y7DA 3WFLA 2ZTKA 1VBHA 4HN8A 5LNUA 1BXNA 1RUSA 4CCDA 3MV01 1MW0A 1V7AA 3KBWA 3UYCA 3OPSA 3AHXA 2J88A 4O0KA 1FWWA 1TWZA 3VIOA 2HZGA 3WLKX 4DF2A 4HPHA 4GI4A 3EWDA 4RR4A 3TJ4A 1GQLA 3W7EA 3THUA 2V5DA 1UR0A 1F8IA 1MO0A 1XLEA 1WDWA 2PDHA 4UR7A 4FAMA 2CW6A 3RO6A 3CIVA 1W3HA 5CPQA 4PL1A 2QIWA 1YE6A 3U2OA 4O1BA 3N12A 1R6WA 3M46A 1A5BA 1BD0A 4PBEA 3RCMA 3APTA 2NQ5A 5FOOA 3H22A 3RX4A 1S39A 5T8GA 1ZFJA 3P74A 3LHZA 4HCDA 1A80A 1JZ6A 3WQWA 3XISA 2ISWA 3PF3A 4ZA0A 1YDYA 3LD5A 3LK6A 4GQ0A 1GVIA 1EWDA 1HG3A 3FXGA 2GJXB 3O6AA 1ZBKA 3AMGA 1HJVA 2OEJA 1UD4A 4B2DD 1L8PA 3WD2A 1W9XA 1MW2A 1X6LA 5C9WA 3GU1A 2IKGA 1R9XA 3G5EA 3WK2A 4POCA 4B4FA 2AL2B 7ODCA 5LNVA 4CCCA 3HBLA 4S3GA 2PURA 2VL4A 3CV2A 3W7GA 2GSEA 2WANA 1W32A 1A5MC 3BURA 2ZCGA 1Z9AA 2DW6A 2VGFA 2A21A 4DY1A 5BMWA 2FPVA 2ZRYA 3L5AA 3UGRA 1W8SA 5CG0A 2VZUA 3AO0A 3ARRA 4YVXA 1K9DA 2O92A 4Q22A 3LPOA 5I0DA 4MHBA 1JI2A 4DWSB 4K39A 1SFSA 3PG9A 4US5D 3DGBA 2GJRA 1VJZA 3CAKA 3AALA 3PP7A 4I8DA 4IIBA 5C55A 3S2CA 4GQQA 2EO7A 5AYIA 4HGXA 3BGAA 3PULA 3FW6A 3TYDA 1I0BA 1XIHA 3FV9A 4F0SA 2DIEA 3GXFA 3CQ0A 3MMDA 1EJUC 1HJXA 5LNSA 1H62A 3O1NA 4C90A 4AIBA 4O16A 5D09A 1OZMA 1AA1B 2GWGA 2YDAA 3UJEA 1JGIA 3DHDA 1C8QA 3ITCA 2VUYA 4BF7A 1JYVA 1J5TA 1QI2A 1YXYA 4V28A 2WVVB 3M7SA 1QBAA 3F4NA 4AZBA 3E5PA 3V1PA 1QCWA 1R2SA 2W9MA 3CZLA 1I2OA 1SO3A 3CEUA 4INFA 3IJ7A 1GG0A 1IWAA 1QNSA 1ZCCA 5ABFB 4C6CA 1W5OA 5GJNA 1EJRC 5HWNA 1F4AA 3CV1A 1XV8A 3HQNA 3WBYA 1EYEA 3NJ3A 1R5YA 3WD4A 1SYTA 2WHJA 2HBXA 4ZOBA 2VFDA 4ADUA 3IPWA 3WH6A 4G56A 2WV8A 3O3RA 5PTDA 1VFLA 5AC7A 2HBVA 1XBXA 5LGZA 1CGWA 3PZQA 3OHIA 3SW6A 1GGOA 1TR9A 5D05A 4XK2A 1WKYA 4BFAA 1UKQA 4QQUA 3TN4A 3UZJA 4DQWA 4ACYA 1Q6GA 3TTQA 4C6FA 3PTQA 3WK0A 5I3GA 1S1PA 1XX1A 3U6WA 4NXSA 1MNZA 1TVPA 4I5RA 3PAOA 3AXHA 1KKOA 2WC3A 3WYZA 2VFIA 4UMCA 3EDDA 1BGAA 4UQ9A 3BC9A 1NIUA 5FI8A 2O7QA 4I7WA 3C2VA 2G3MA 3PNZA 3AI0A 4UB9A 4EXBA 4HZ8A 5EB8A 3B8UA 1LCOA 1O6IA 5FIPA 1Q4NX 1TUXA 1GCYA 1GORA 4NRRA 1UH3A 3BQ6A 4M29A 4DJED 4WDWA 4MYAA 1CXIA 1I8JA 3WJSA 5TF0A 2FZMA 2NXIA 3VIFA 3OODA 3RILA 3HJEA 4BI5A 2DUXA 5BWFA 1M7XA 2OLSA 4JAWA 1TTIA 3CHFA 1QW7A 2C1GA 4HA1A 5KZEA 2WKLA 3BOLA 2EHHA 4OECA 1CXEA 1ME8A 1O12A 5DBUA 1VJSA 2ZX5A 3NPWA 4HKPA 1OYCA 1TZZA 1FY6A 2PE4A 2XFRA 3LN3A 4AZCB 4OIFA 3THDA 4CQBA 4CU8A 4DJDA 3N25A 2NLYA 5CGTA 4ONVA 3W1AA 4UNLA 3ONCA 2P53A 2QPUA 2VC6A 1VYRA 1D3CA 5BRQA 3GFXA 4YTRA 2WMIA 4NG3A 4PTMA 4CEUC 1FHDA 1JPHA 1WP6A 2OODA 2V63A 3NSXA 1WZMA 4IQEA 2F6XA 4FSAA 4JEQA 3QXBA 1G4SA 5HNNA 3WJXA 4GG9A 3IAPA 1CXKA 5I77A 2RDTA 2AQVA 2Y5EA 3VKDA 2JKAA 3ZT6A 4O1FA 1QBBA 3W7PA 4NI3A 1WXYA 4JHOA 1KLZA 1VCVA 2AAAA 4DAIA 3W7HA 1KV5A 2VT0A 4ATWA 3ME3A 6REQB 3U2CA 2ZRZA 4ZXLA 3ZS4A 4ZMGA 4YJ5A 1EX5A 2J74A 4PZVA 3GQYA 3DKJA 2YBVA 2ANUA 1PHQA 3N19B 1SR9A 2BTMA 3SCVA 1XD1A 1VIZA 3HN3A 3KS6A 2FQIA 2RGMA 3L2IA 1ICPA 2I57A 3G0SA 4QROA 4NJGA 1NDYA 3L12A 3MO4A 4MY9A 1E70M 1POJA 1NFBA 4RZBA 2R91A 4IMEA 3W7KA 3ALGA 1BYAA 1OYBA 1U30A 1NY1A 4IF2A 1RR2A 4ZL1A 5AFDA 5JBEA 4JTRA 3BG9A 3TJIA 1A0DA 3IIZA 2PLCA 1OCNA 3GNXA 5EL1A 3VDCA 1H7XA 3PTMA 4JTHA 1XBVA 4DZHA 3T40A 2HE8A 1ZP3A 3NOEA 3CWNA 3VNZA 5FF0A 4CU7A 2I5IA 1ZS2A 3QFEA 3MMTA 4XZHA 2BG5A 2Z2AA 3ISIX 2TPSA 2GGEA 3F2CA 1ZSXA 2QZRA 1VHCA 3BTNA 3TVAA 1ZENA 2BY2A 1IEVA 1Q63A 4JHMA 4F79A 5CAHA 3QTGA 3LCIA 5A6JA 2I16A 1F73A 1KNWA 4QGCA 2Z27A 2OKTA 4RW3A 4M6UA 4FXRA 4GYKA 2OJPA 3WO8A 3TYBA 3T0DA 1O5KA 1WO2A 1S5VA 4UTWC 3HGSA 1MMFA 4QAWA 3ZVIA 4Z1YA 1ALDA 3S1VA 5I23A 4PTWA 3M5YA 2OLAA 4GVFA 1FBAA 3AS1A 3IARA 4LBUA 1XL9A 3N2OA 3BAJA 4R7OA 4L4OA 3ES7A 4OE7A 4WJXA 3LMYA 5CQ1A 1M65A 3EPNA 1UC4A 4FOJA 1F3WA 1Z8AA 5FJJA 5H91A 1JZ4A 5I02A 3L66A 3WY1A 3XIMA 2YLAA 3W4RA 3EDFA 2QV4A 4CD8A 4NYUA 1LBMA 1AL8A 4N9CA 5I3JA 3IS4A 3LNPA 4IISA 3NM3A 4F0LA 1HKJA 4J4KA 2GQ8A 3CEPA 2CEQA 3NQCA 4GOAA 1J0HA 4B5NA 2Z28A 4JS3A 1UD5A 3RX3A 2ZWZA 2BX7A 1W3LA 3L4TA 2R82A 1Q65A 3HV9A 2E09A 4GO8A 1TQJA 4Z1CA 3W7JA 2O9TA 3D6NA 3TN3A 4W7UA 3NGFA 2ZUSA 2B0MA 3BCFA 1RJQA 4WGXA 4LV4A 4QS5A 5DXXA 2QF7A 3ECQA 1QNPA 1W2VA 5DT5A 3V3WA 4EF9A 3B05A 5LIXX 2EAWA 5FCZA 2CERA 2NW0A 2R8WA 2EPHA 5AHNA 3E1F1 3L2LA 1RP8A 1EJWC 4Q4OA 3K8LA 3G77A 1E5JA 1VD6A 2H3DA 1AD1A 1SU5A 3CBWA 2QMJA 4Q8QA 2J9ZA 2X30A 4J5NA 1OX5A 2A5HA 4ZGYA 1NJJA 3UG8A 1FXQA 2MUCA 1V6XA 4EOUA 1JGMA 3PBVA 4IPJA 3S2LA 4CNNA 5FF3A 1SW3A 3RO8A 1W31A 3TONA 3LXBA 3M0YA 3M0VA 2YKKA 1QT1A 4LXFA 4DM1A 4WXZA 3PTDA 1OIMA 3M0JA 5HOSA 1H1YA 4IIGA 3CLWA 3F4CA 2QDGA 3K4WA 3N4AA 2F2HA 3QKEA 3HPSA 4RLIA 3UZYA 4WKFA 1F07A 5BYWA 3QHNA 3NCOA 1ZAHA 4GZJA 2DZSA 3WJYA 1K02A 4WF7A 4FOKA 4L5ZA 4PMXA 1XR2A 3EXRA 4LB4A 2VZTA 2FB3A 3TYAA 9RUBA 4GYPA 3VD5A 3VE9A 2E25A 1P1MA 3UA4A 4Q8OA 1ONXA 4B90A 3QGVA 1PX3A 3NNTA 2Z25A 3CPRA 3W3OA 1PXGA 3WJZA 2QVHA 3VNMA 1ECQA 1F9CA 1NWTA 3TZFA 3T0CA 2Z26A 3KFTA 4GJIA 1KLYA 4W4QA 2C3ZA 3P7YA 4O0ZA 1Y5XA 2VDIA 2PB1A 7XIMA 3KHJA 2GGJA 1FTXA 4E2VA 2C14A 5CPLA 1TV4A 2CLHA 4GBUA 2ZYFA 1YMYA 3C56A 4PCFA 5LA2A 4DBDA 4W8AA 4AY7A 7REQA 4PN2A 2RDUA 1RP9A 2TAAA 4YNGA 3H21A 4GZIA 4I5UA 1ZBCA 3ARSA 5HMDA 1TMQA 3B0YA 1RAKA 2CXEA 3KCLA 1DJHA 3CHDA 3UJFA 3W27A 1ODZA 3W7IA 4UBPC 3AOFA 2UY3A 1BF6A 4H9MA 4G7EA 4EKJA 1UR4A 3UPMA 4LYKA 4CQAA 3WD1A 1DWFM 5IOBA 3KZPA 1XRSA 2J27A 3II1A 4UR8A 4C5ZA 2UY4A 4FLSA 3SCQA 5U7SA 5E6YA 4FIQA 1UROA 4FHAA 4AMAA 3HOJA 3UNTA 2YBTA 1DV7A 4Q8NA 1VLIA 4LYPA 1R2TA 1ZQ5A 3MWCA 1VIWA 2C16A 1BSLA 4BS0A 3OZOA 3GH4A 3URQA 3K8KA 4G9PA 3TCEA 4JDBA 3ITXA 1RV8A 3G1VA 1WX0A 3LGEA 4AIEA 1NSJA 4JR5A 1PL9A 4W8LA 3W1TA 1DHPA 1JR1A 4IXXA 6TAAA 1EL3A 1CTNA 3CUJA 5C2CA 1GVRA 1EC9A 1MXSA 3CAQA 2QLYA 2F6KA 5CSUA 3P8JA 2X0YA 4AEOA 3VINA 3PBGA 5HUOA 1NWUA 4GFIA 2PWGA 2BOEX 2OX1A 1KXQA 2HNEA 4ECLA 4DVOA 3ARQA 1GKRA 5KZDA 1MUWA 4D6FA 1EJXC 1GJPA 4HVXA 3VIJA 3C5QA 2EXOA 4FXJA 3QTPA 2DIKA 4CVWA 3HGRA 4DJFA 5JBFA 1GT8A 4AG0A 1QW9A 3NVDA 1HXJA 5BMXA 4UZUA 3L4WA 1TV2A 4I3GA 1K8ZA 1S5MA 3LGDA 4JXCA 1E3ZA 3R25A 4NZ5A 4UTKA 4RZ4A 1LUCA 4J2MA 3HMCA 4F4RA 3WDRA 4J28A 5BRBA 1TPVA 5B80A 5FEZA 1TTPA 1CXHA 4S38A 3QV9A 4F0KA 4MJZA 4F9JA 4JIQA 4EWND 1WDSA 3UZWA 5DQPA 1V3IA 2XZ9A 4E4PA 1KCLA 1GONA 4DO4A 1IR1A 1R9ZA 3C0SA 4P7LA 5CEWA 3PB0A 3PJWA 2HK0A 3L67A 4ORIA 1IXNA 5TAOA 2YR1A 4NF7A 3COTA 1IZKA 1YPFA 3G1AA 3EMCA 2FMNA 2JKEA 3HQ1A 1OK6A 4PCTA 3AXMA 3LLDA 3BMWA 1YTKA 3IVUA 5HXMA 3HFTA 2ZKMX 2FKPA 3I6TA 5DCBA 1SQ7A 3O0KA 3NDYA 3OZPA 5FJUA 2Z7GA 4IICA 2J7FA 4GPNA 4A3YA 1SJDA 2X16A 8TIMA 4GXWA 3LNMA 2WMIB 3SCSA 3VOCA 1K77A 2GZXA 1RPXA 2V81A 2X2YA 1QO2A 3K5XA 3DFNA 3AUJA 3G1RA 1XQKA 2FZ8A 4Z0JA 1V6WA 3AYRA 4JOMA 3ARVA 1UWRA 1WUFA 3SGZA 1EGZA 2WC7A 4EF8A 3M41A 3JZUA 4FPSA 2VQUA 1HKIA 3THAA 4KFPA 5DY3A 3IIPA 3LPPA 4E4FA 1XSIA 1VKFA 4C6IA 1SSGA 4ZXOA 4OFCA 1FRBA 1EBHA 1UJQA 1XDJA 1LT8A 1GW1A 4KPLA 3KL5A 3PK7A 1JULA 3N2BA 4GUHA 4KRUA 5GNZA 1F6YA 4RNIA 2E1WA 2IW0A 3QZEA 4ZFMA 2I17A 1N8WA 5HJLA 5HQEA 5JQ9A 1VYSX 5A5WA 5FF2A 1XG4A 2DZXA 1P6WA 4H9TA 5C54A 1JRBA 3EX2A 4JD4A 2E1DA 1S2UA 3SURA 2PRLA 1SMDA 1TWIA 2BP1A 4N2YA 1OT1A 3TEVA 1L9WA 5CSYA 2FMOA 1MEIA 3PZGA 1YQ2A 2Z1XA 4OV4A 3BAWA 4TQTA 5CG7A 3LM3A 1K9TA 4G1NA 3NFUA 4GIRA 4F3HA 1H5VA 3UWQA 3IUHA 2XGIA 1J0YA 3UZZA 3DFPA 2ACQA 2GJPA 3ZJ8A 2ZZ5A 1FWCC 4XVDA 3LMZA 4ZO9A 2DEPA 2V8ZA 3R8HA 4PE8A 1W1TA 3FA5A 2OT0A 3N3MA 4JYFA 1LJYA 4DBUA 1FHLA 1AW5A 1ITUA 1X96A 1EXPA 1G5AA 1U1JA 5E9AA 1J11A 2A0NA 4LANA 1B3XA 2REQA 3AMLA 3W87A 3WEOA 2HJPA 3SRFA 1S2AA 1K8XA 3MSRA 4RX0A 2R1KA 2W92A 1BHGA 1MNSA 2E9MA 1Q7MA 1D2KA 4NZFA 4PA8A 1EJ7L 1B5TA 5CC3A 4P61A 6A3HA 4WDXA 5AB3A 1WXJA 2EEXA 1I4NA 3SM0A 3VNKA 4JKKA 1JCLA 4A22A 5FKYA 3SIZA 4M6PA 3MZ2A 1ONEA 2FVMA 1BWVA 1VBRA 1LQ2A 2J62A 5E0FA 5FEPA 3VD7A 2CU0A 1B4EA 4KCTA 3FVMA 1EEXA 2LLEA 3WF1A 3GKAA 3HZ3A 2WNWA 4LC8A 1E3XA 2L5HA 4FA3A 5EMUA 1FFQA 1GVFA 1V6VA 1YPIA 4KGLA 4HIBA 1GWJA 1HJSA 2QUNA 3HPAA 3P60A 4XD3A 4CD5A 1HKKA 5IHRA 1C9DA 3EEGA 3G1HA 3L5LA 1O7AA 3EWBX 1QR7A 4CQDA 4ZQRA 4NY2A 1C8VA 4GH3A 4D8LA 1U2YA 3I6EA 1G4TA 2QCMA 1UJPA 3W2KA 3QVQA 4YIWA 4V27A 2NUYA 3R2GA 2PD5A 4LTSA 1GVEA 4MKSA 3EKZA 3O06A 1L2UA 3QSRA 3MP5A 2O7SA 2V5KA 4HBKA 3ZR6A 5CLTA 1GKQA 3CXOA 4XKYB 3TIMA 4IIFA 2VURA 4NVTA 2XGZA 3AZTA 4IHCA 1LDCA 2QUUA 4MM1A 1UZ4A 3MVIA 3TN6A 5HJXA 1H09A 4K7VA 4W86A 4O13A 1DBTA 4HTBA 1QASA 4DO5A 1OQFA 3M16A 4KEVA 1EDTA 4IPPA 1XFCA 4OU1A 5F2LA 4H6QA 4AYSA 1DXIA 3WK1A 3HGJA 1TWDA 3WK3A 2YX0A 1TJPA 4R27A 2V67A 3ZOAA 2JE8A 3K2GA 3R0DA 3GC2A 1R3YA 1LP6A 3AS2A 5CH9A 2V38A 2FVKA 4ZENA 3PBMA 1TRDA 2SFPA 4O14A 4JFVA 4B5SA 2CYGA 3U9IA 2XIMA 2YL6A 2AKZA 3W29A 2D2OA 3ZYZA 3FKRA 3F5KA 5C9UA 5M2FX 5D2YA 3QQWA 1IT7A 3IV8A 1ZU8A 5H6HA 3GAKA 4HPXA 2QCHA 1PTDA 4BQ4A 4LV9A 3N2XA 1PO9A 4ZBCA 1H7NA 2E6FA 2FDMA 3QOKA 1NF7A 3FYYA 2V0TA 1AH3A 4CN6A 2O4QA 4JY9A 2QJIA 2W79A 4AISA 1W9VA 4PB4A 4JTDA 1SSDA 1YADA 3PY2A 4ZE5A 3T7VA 4IMCA 4OKDA 2X8RA 3KRUA 1K4HA 4AAJA 3L9CA 5HBFA 2YYUA 1UMLA 4FK9A 4Q8VA 1G6CA 3AIQA 1TFVA 3LSCA 1M7JA 3MYOA 7REQB 4Q6JA 1TPDA 2ZUNA 1AH0A 1U5VA 4HD5A 1GOMA 3OVGA 2RJHA 3TFCA 4WX2A 2R1NA 2PLKA 4NIRA 5CAKA 4IFKA 5A8QA 2Z1SA 1EJTC 2ZX8A 2ZA2A 3RK8A 4A6GA 3A4AA 4MFEA 4G7EB 4HU3A 1XXXA 1UWIA 2XWDA 1KBIA 2IKHA 3GBDA 3EYPA 4MFDA 2Z6JA 5JBDA 2GYIA 3HV8A 1NQKA 3CH9A 3EWYA 2H8ZA 3VKJA 3GAYA 1CX9A 1SFLA 3PM6A 4XIMA 3OGRA 2YBUA 3IWPA 3D3AA 4PGLA 3WD0A 4MJMA 3T1GA 3VNDA 5AYYA 5CPOA 5ABTA 4WK9A 1QNOA 3W22A 2P76A 4EANA 5HR6A 4ML4A 3OZYA 4FNSA 1B9BA 3T81A 3BAIA 3T2OA 4NJKA 3R7MA 1KM4A 1KTCA 2DGAA 1EEPA 4S3DA 4D6IA 4BI6A 1EGVA 3UP8A 3K46A 4IFOA 3GHUA 5DLCA 4R9XA 3SGGA 2G37A 1XIFA 3VOIA 1P43A 1W9DM 1WPCA 1O1ZA 5HR7A 4RCXA 1HQTA 1IWBA 3CV7A 1AQMA 2W3ZA 1REQA 3MY9A 4L4PA 3IANA 2VD9A 2D24A 4Z1DA 1BGGA 1LORA 3NYDA 3GWQA 3CUZA 1F3XA 2NV2A 3AIRA 4QRNA 3NQ2A 4HHMA 3WLSA 4AHOA 3LI1A 3CQJA 3PPFA 3USZA 4A05A 5BOFA 1BKHA 2ACUA 1GOWA 1BYDA 2E6DA 5G5IA 3DOPA 1NF0A 4LS1A 3SQMA 4S3JA 2YGYA 1XSKA 4FNPA 3ABRA 2BDQA 3LXAA 3EX6A 1FDYA 3H24A 1ZCOA 5E93A 4AHPA 3SUTA 5CZKA 1WBJA 4MGGA 1LUCB 4E38A 3T42A 3B4YA 1J79A 2VCCA 1TVLA 5C0QA 1XLKA 1YXCA 1ZJAA 4YYCA 2ZZ6A 1KBJA 1QPKA 1MZRA 8RUCA 3RPMA 4CD4A 2XHYA 3GZAA 1NU5A 4IP7A 4V1XA 3GW3A 3TNBA 1UH4A 3W7LA 3BSHA 2GUBA 1RY8A 3W1NA 2GL5A 2QQ6A 3BJFA 4BHYA 1C91A 2WBGA 3DYOA 1I60A 3LHUA 5EY5A 1U22A 2Z00A 4IT1A 5DY2A 2OGYA 4NT0A 4XZIA 4W85A 4MIMA 1CENA 1HVQA 1A47A 3WLOA 1O94A 5C2GA 4D6DA 4MAZA 4FEZA 2WB5A 2E5BA 1WV2A 3GR7A 2RJGA 3LOTA 1YRRA 5TQLA 5AHEA 1DWJM 1XINA 4XSMA 1MQPA 3G6MA 2OFJA 3VNLA 2BFGA 1J12A 4IXHA 2DDXA 3NAVA 4LY4A 1EQCA 2FPTA 1XG3A 4UTUA 2ZZ7A 5I3IA 4HOZA 5F4SA 5IDIA 1P1XA 3F03K 1E6PA 3KBJA 4FX6M 3M5VA 4MOZA 3PN8A 2YCJA 4AD1A 2CZFA 4G5DA 3AC0A 3SJNA 3OA3A 1IEIA 4GRSA 4EPKA 1I2NA 4LALA 1WQ5A 5HNRA 4D8ZA 1POKA 1VRDA 4JX5A 5CPTA 4G8TA 4AIOA 4C6EA 5HULA 1MUCA 4XAFA 1W1YA 2PMQA 1H1NA 1JCTA 2OO0A 1PIFA 2DVXA 4X22A 3SN4A 5MF5A 3FJ4A 4UMAA 4FNQA 3UG4A 1MZHA 5E6ZA 1KR0A 1VEMA 1J96A 3ATYA 3UXIA 4QAIA 4QCEA 3H2EA 2QUTA 3E74A 3W2JA 3V0SA 2YW4A 2DQWA 2WHKA 2A3AA 5CJMA 3GX9A 3KTCA 3TQVA 4NU7A 1AQ0A 3GZ3A 3E0WA 2X7WA