4WOZA

Crystal structures of cdnal from clostridium difficile in complex with mannosamine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
290
structure length
290
Chain Sequence
TDMKGIYSALLVSFDKEGNINEKGLRQIIRHNIDVCKVDGLYVGGSTGENFMLSTDEKKRIFEIAKDEVKEEIKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVTPFYYKFDFEEIKHYYNTIINSVDNRLIIYSIPFLTGVDMSLDQFGELFENEKIIGVKFTAADFYLLERMRKTFPNKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGVRARQIFELTKNEKISEALEVQHVTNDLITDILGNGLYQTIKLLLEEQGVEAGYCRQPMKEATDEMKSRAKEIYRKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N-acetylneuraminate lyase
publication title Crystal Structures of CdNal from Clostridium difficile in complex with mannosamine
rcsb
source organism Peptoclostridium difficile
total genus 125
structure length 290
sequence length 290
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4wozA00
4CQAA 1OFBA 2AGKA 2RDTA 3EB2A 1XUZA 4NX0A 1GZGA 3HG4A 3AO0A 3O05A 5LGZA 1K8ZA 2DZWA 5HUPA 3SR7A 4N4QA 3L0KA 3EX4A 4HNTA 3DBPA 5HR7A 3W22A 4XUGA 2YW4A 3C2RA 2DJXA 3WK2A 4BFAA 5G2IA 1F05A 1Q6OA 2YR1A 1KLZA 2VFIA 3PF3A 1MO0A 1YXYA 3TU9A 3E12A 1FQ0A 4UTMA 5LGXA 1BTMA 3W2JA 1YLVA 1NAL1 3QM3A 3HPXA 3TROA 4K6AA 2XFWA 3R13A 3UWVA 5LKYA 3MI2A 4UFIA 3TCEA 5DCEA 4FNTA 4H4IA 2O7QA 2HS8A 1SZFA 3GVGA 3RLUA 3PC0A 3TFCA 2YXGA 1H61A 3PVFA 2BXVA 4LUIA 2FDSA 3K30A 3UPWA 5BRBA 5D2TA 4NJHA 3EWBX 2ZRUA 3GKFA 5HNRA 2YFNA 1O5XA 1YDOA 2QJHA 2DZTA 3W2NA 1KM1A 2DP3A 3T4CA 2VEMA 1EWDA 3FJLA 4NZFA 4UC5A 2BZNA 1SW0A 3S8HA 1FXPA 1G67A 5SWUA 2WQPA 4BWLA 3S0CA 3HGOA 1G7VA 2TRSA 3E02A 1VLIA 3TQKA 4CNNA 3KVJA 2GUUA 1DKWA 4WOQA 4M5PA 3IEBA 3CB8A 5FF7A 3G8RA 3T44A 2PURA 1HG3A 3ABRA 3VE9A 3NDOA 3KRSA 4JTFA 1ZENA 3DFNA 2J88A 3G1SA 1KA9F 2YSWA 3EKZA 1QOPA 3EWWA 4O15A 4JIPA 1LOLA 2ZTKA 4MJZA 4UTUA 4CLMA 4XBSA 5D09A 1GPWA 3DKJA 3UNDA 5CZ0A 5LNVA 3CT7A 4JTLA 1W5OA 2NWRA 3A24A 3LHUA 3WJSA 3THAA 2ZZ6A 4TIMA 1TTQA 4AH7A 1LDCA 3LTYA 3NL3A 1IF2A 1W8SA 2ZRVA 4MYXA 3MO7A 2H8XA 1XI3A 4NXKA 3W7EA 1H62A 1VGAA 3TSDA 5KZMA 1D3GA 3DHDA 3QPYA 5CPNA 2VEKA 5KSWA 1IIHA 1K7FA 4Y9AA 3E49A 4NJIA 5LNUA 3W6YA 3L66A 1OABA 1KV5A 5LHFA 3W7IA 3S1UA 3NA8A 2ATSA 4KWVA 2Z6JA 4BF9A 1LLWA 1EWEA 5FF2A 3W2MA 4HSOA 4GE8A 1AW1A 2E5DA 3S5YA 3L5MA 3O16A 3DFPA 1UBSA 2VFDA 2PE4A 5KZEA 2RHGA 3O6YX 1JCXA 3N34A 4QQ3A 3RNDA 3TAOA 4X9SA 1OVDA 3NM3A 3H55A 1BKSA 4Z1DA 1OYCA 4GNJA 5C5YA 3TQVA 3RU6A 5D2YA 3F4WA 1GVRA 3TKFA 4GXMA 4TR9A 4Y8FA 5LZLA 2QCFA 4I7UA 3HOJA 4IOTA 3LCXA 1NF0A 1QWGA 3ABSA 2A7PA 5D04C 3HGSA 5H91A 3BO9A 1V5XA 1SFLA 3LV6A 3A5FA 2BTMA 4RXGA 3F4NA 5K4XA 1QAPA 2E6YA 4ZQCA 4AF0A 1A5AA 3GDLA 1PS9A 2VFEA 4HPJA 5AC7A 1OJXA 3CHVA 3GX9A 4QIUA 3IRDA 2H8ZA 5EYWA 5HULA 4MPQA 4CQ8A 4JX6A 2TYSA 5CGQA 2H90A 3W2UA 1CX9A 3GXPA 3UWUA 2V5LA 4AAJA 3ZR4A 5D2XA 4DPPA 2FPTA 5CZSA 1XDLA 4UFJA 3M0ZA 1UJPA 1OFDA 2FJKA 2WNNA 3C2FA 4AF0B 3L0GA 1K03A 5HINA 4XQ6A 1VHCA 5K9CA 4UMCA 3FKRA 1W0MA 1GVFA 3IIZA 1LOQA 2E5CA 2VFFA 1FWSA 1A50A 1OYAA 3QMTA 4IX2A 1B4KA 2J9ZA 3GAYA 1DQXA 1SUXA 4O13A 4UIOA 3Q2DA 2JGYA 1Z42A 4ADTA 1MEIA 3W7KA 2B7QA 2ABBA 3GAKA 3M5XA 3W2KA 1I2RA 3LHVA 1TQJA 3G3DA 4FXRA 3GR7A 4XWUA 2F7FA 4RK8A 2HSAA 1TV7A 1H7WA 4BI6A 4GUHA 1XUUA 1W3IA 4WY0F 4I7WA 3MYPA 4UCGA 5AC8A 3I7SA 1AL8A 3TK7A 3YPIA 3CIWA 4DBEA 3W3OA 1LROA 2OT0A 3G24A 4FNQA 4AXKA 4ML9A 3GXNA 1TPH1 2ZYFA 4UFMA 3SGUA 3W2LA 3IIXA 3EXSA 3P5YA 1W5QA 1KFEA 3W7QA 3WFAA 2NX3A 3KXQA 3LHZA 3NL2A 2J6XA 2AAMA 3LGEA 3UYCA 2NUXA 2JKAA 3BW4A 2Z1BA 5CSSA 4AWSA 2I1OA 5HUOA 4CCCA 1SU5A 3CLMA 3ELFA 1TTJA 5BMWA 3PS7A 3W7CA 5KINA 1H5YA 2VEPA 4IX0A 3QZEA 1SZNA 4DEFA 1QOQA 1TJPA 4M6QA 2XN2A 3DENA 4GWEA 4N9BA 3UY8A 1OFOA 2JGQA 1BWKA 2R8WA 2V9DA 4MLRA 1GEQA 3GNDA 4JTTA 4Q4KA 4O1CA 3G18A 3P8IA 4A2RA 1XDMA 4WJEA 1AK5A 2WNZA 5FESA 4P2VA 4WXZA 2NWSA 1W5MA 3U6WA 4N4PA 1LYXA 4GRSA 3TX9A 2V5BA 3UWYA 3USBA 3DFTA 2XN0A 4L4LA 3SGZA 1X1OA 4ZQMA 5J5DA 1EA0A 5G1TA 2C6QA 1X6UA 3G0UA 1JCYA 5E0KA 4CNPA 3SECA 2CU0A 5D32A 3BARA 1SW7A 1Q45A 1Z41A 1VQTA 4ICNA 3G1XA 4NUWA 1WA3A 2Q3RA 3V1PA 3LM7A 2A1YA 3ABQA 2R91A 1G4EA 1YADA 2VFGA 4DF1A 1R30A 3UWQA 2ZA2A 2A7NA 3QYQA 3W1XA 3P80A 2A21A 2GVGA 4AHPA 1G7UA 4DO4A 5CG7A 3Q37A 3L68A 2OT1A 1DL3A 1T96A 4JS3A 3N9RA 3LLDA 4C1LA 3NL5A 1OFEA 3FIGA 2FLIA 4RZ6A 5DLCA 1FUYA 1LP6A 1SO6A 3M47A 1CW2A 1B57A 1H50A 3W7RA 3PM6A 4MZ8A 3W07A 3TC6A 4LC6A 4E2DA 1KTNA 1JRBA 5LSMA 3M5YA 3DH7A 5IM51 1X7FA 4IMFA 5G5IA 3O6CA 3DFOA 2BLEA 3QRHA 5G4EA 4IMGA 3NQFA 5HQEA 1OF8A 2I9EA 2FPYA 4C1KA 3W76A 2Y6ZA 3TDFA 1QNVA 2Y7FA 1PCKA 1VLWA 1YTDA 1TV5A 2PCQA 1O60A 4R53A 4CCEA 3W7LA 4LUJA 1PHWA 3P7YA 1TREA 5IBXA 4N6EA 4K7VA 2CWNA 4ZVJA 5DN1A 2VFHA 4FNPA 4RCXA 1GYNA 5F4XA 3U8GA 4OU1A 2YZRA 3TXVA 2ISVA 1I8JA 3N2XA 5C55A 1JQVA 1YXDA 3OHIA 4OT7A 4PEKA 1FBAA 1JCLA 4UMBA 4GC4A 1RQEA 3O6DA 1JRCA 4JTHA 3NVTA 1WOBA 4AVFA 2OJPA 2OZ0A 1EPXA 3NQCA 1TPC1 4HIBA 4RV8A 1DV7A 3NEVA 1SSDA 3TXZA 1LORA 4KFOA 3IGUA 1WQ5A 3S5OA 2PRLA 3PBUA 4MFEA 3LTPA 3RF9A 1KFKA 3GLCA 3QQ1A 2NXIA 3GKAA 3CQ0A 3HF3A 2DZUA 4EVZA 2DU2A 1HTIA 1ZHAA 1TIMA 4JDYA 4YL2A 1ZFJA 3A9IA 1H60A 3KRZA 3LCHA 1YTKA 1EB3A 2DORA 2EF9A 4AMAA 1XC4A 4RLIA 2YYTA 4ZMGA 1ICPA 3ATYA 3JS3A 3HPSA 3HMJG 3RMJA 2QCMA 4QITA 3SY5A 2F84A 1IXQA 1KFBA 2CLMA 1OX4B 4HSNA 2XN1A 1VYSX 1LRNA 4A22A 4MY8A 1LBFA 4FNSA 2X1SA 1VCFA 1R46A 3INPA 2Y61A 3S9YA 1KBIA 1XKYA 5D30A 3PSWA 1QPOA 2HS6A 2JKPA 3IV3A 3P5ZA 1XBYA 3UZJA 5KZDA 1OFRA 1R47A 2A85A 4UNKA 1T8XA 3TSBA 2QAFA 3KVKA 5F4WA 3PAJA 2EGZA 1UUMA 2QEZA 3WK3A 4UR7A 1YTEA 3MBDA 3I7QA 1FDJA 4QNWA 4JEQA 4DO6A 4O53A 4Q33A 1DORA 4Q32A 1V7YA 4QM1A 2G5WA 3EEGA 1VPXA 1F73A 1W54A 3P67A 1O94A 2WSQA 4N6FA 2FTPA 4O54A 1AW2A 4OWGA 3MJYA 3HPZA 4PFMA 5AYZA 3JR2A 4UTWA 3D0CA 4AWUA 4FB7A 3W7NA 1IXNA 4JYEA 2TSYA 3DXIA 3I6RA 4CNOA 1LTDA 3N9SA 5EA9A 1RQHA 6TIMA 1O4UA 1Z44A 3NQMA 1PCWA 1OHLA 3EXRA 2H6RA 1VC4A 3CIXA 1H7PA 5D2VA 8TIMA 2HTMA 2NZLA 2CLIA 2X2GA 4S2BA 4IQLA 5D2WA 1EEPA 2G95A 4PL1A 1WOAA 3O1NA 4QNEA 5G2WA 4X22A 4BK9A 3C4UA 3A5VA 3W1PA 2H3BA 1ZAJA 2QCHA 3OIXA 1YDVA 4DELA 1KM5A 4M19A 2C19A 2WKJA 1BWLA 2Q8ZA 1GYLA 1GT8A 1UUOA 3B03A 4QJ1A 2A5HA 4RZ5A 3DU0A 5U4NA 1JULA 3NPWA 2ATMA 1Y0EA 2R14A 1TPVA 5DCDA 1TTPA 3RFAA 2FB3A 4Z1AA 1LBLA 3HBLA 5L9FA 3PY2A 4MLJA 4JTEA 5D03A 4Y90A 2Y89A 4A29A 3EX3A 3G22A 2ZQ0A 2G96A 4FF7A 4JTGA 2CLHA 3Q58A 1J2WA 1OFAA 3CPRA 3B06A 1KM0A 3L9CA 4UFLA 1OK6A 4JD4A 2B7NA 5KTLA 4GUIA 4S1FA 3LI1A 4O19A 2AQWA 1A53A 3LCIA 5BNKA 1RZMA 3LHTA 3QF0A 2NUWA 5K4ZA 1ME8A 1I45A 3N3MA 5FF3A 4UTHA 3H54A 5EL1A 5LNWA 3R8RA 2NX1A 2E6AA 3NZ1A 1W3NA 1BEUA 4PTNA 1ZCOA 2VENA 1ME9A 5T26A 1FWNA 1ME7A 3WJWA 3DFQA 2V2HA 3W84A 1QPQA 3PWAA 3GB6A 1OFQA 1K7EA 4LT9A 1LBMA 4LV4A 4WOZA 4QAIA 5D05A 3B0VC 1RQBA 1I2NA 1GWJA 1GQNA 2O7SA 3IGSA 3R12A 3W1QA 3BGGA 3BG9A 2A6NA 3W23A 1HUVA 5FEXA 1TPEA 5DXXA 2ABAA 3T55A 3IIPA 3S5NA 3LTSA 4RJEA 3H53A 3QSTA 3EWUA 1DBTA 3ZWSA 4Z08A 1FY6A 2TMDA 1UCWA 3NZRA 3CWNA 4FO4A 2E1DA 3L5AA 3KVLA 3NO5A 1VCGA 5CZJA 1YPIA 3KOFA 3PUDA 2UV8G 3MBFA 3LCGA 4M7SA 1EP1A 5H2ZA 3M9YA 1H7NA 3KFTA 1WV2A 1S3HA 1XM3A 4UTTA 1QO5A 4ORMA 1ZAHA 3S1VA 3NR0A 1FCBA 1M7PA 1OG0A 1TRDA 2NXGA 4HPXA 2Y7GA 5DCBA 2JKEA 3P84A 3GDKA 2OX1A 2EPHA 4M6PA 3FJ6A 4UNLA 3NYZA 1KM3A 4GBUA 1A5SA 3BGJA 1JUKA 1DHPA 3NGJA 2C16A 3TA6A 1JJKA 3CC1A 5TQLA 3MHFA 5LHEA 3NQEA 4JICA 2E77A 1R2SA 2Y62A 3M7WA 4LNYA 2QCDA 4LC8A 3SZ8A 2HMCA 3TV8A 4NZJA 1NSJA 4HNNA 4JTIA 3EWXA 3TW6A 2A4AA 3WJXA 1TTIA 3NQDA 3EX1A 3S42A 5IBXC 2Q8LA 3T78A 3C2OA 5HR6A 2Z6IA 4XBKA 1OX5A 2YYUA 4JIQA 4LVFA 3N19B 3W7JA 1ONRA 1THFD 2QCDB 2PRHA 1MSSA 2QF7A 3NM1A 4LWWA 3LV5A 1DJNA 3KVMA 3MP3A 2I14A 3FKKA 3PUOA 1H7RA 1WYIA 4O52A 4CCDA 2FIQA 3QW4B 4FIQA 3P81A 3PULA 1FWRA 3NQ2A 1B9BA 3LHYA 1H1YA 2GJLA 5D37A 1O95A 1FX6A 5G4WA 4A21A 3W70A 1GVOA 2GQ9A 2J27A 5I3KA 4PODA 3WK0A 3B05A 4LS1A 1ZNNA 4HNVA 3TQ0A 4LVDA 2J24A 1W5PA 4RKAA 1FCUA 5FI8A 3G0XA 3G0SA 2V8ZA 3TR2A 3MP5A 3S5ZA 3C61A 4JTUA 1KFJA 2B7PA 1SSGA 4MKNA 1ALDA 4MIMA 3L21A 2V30A 2ZRZA 1UASA 3W83A 1E51A 5HJLA 1AMKA 3LERA 3T40A 4L4MA 3W71A 3LXAA 5HWNA 1RD5A 3DI0A 2NX9A 5TIMA 3LBMA 5I3FA 4DXVA 4HHPA 1G4TA 2ZFAA 4NT0A 3QFEA 4N9EA 3BW3A 1P0NA 5AOUA 2C13A 4HT3A 3HQ1A 3TNOA 2GQAA 1GVQA 4UR8A 4IXXA 4WUIA 3ZWTA 3EXTA 4IMEA 3G8EA 4G1KA 2ZDRA 5AC6A 1XBXA 3VKJA 3SIZA 4EF9A 2ZRXA 1T0OA 4XZ9A 4YCOA 3M44A 3MMTA 2E5BA 2WPBA 3THQA 4JX5A 4NJKA 1L6SA 2BX7A 3BW2A 3CTLA 1WBHA 1KW1A 1TPFA 4HKPA 3CEUA 3RK8A 4XKYA 3SW6A 2RFGA 4JY8A 2QCGA 3OBKA 2QCLA 1YPFA 2GVJA 3G3MA 3LRKA 1F6KA 3LXBA 4TMCA 1SO3A 1PHQA 3QC3A 4RXFA 4IGHA 3BG3A 3U2OA 4N2YA 3B4UA 4WQ6A 4UUIA 1R2TA 1C8VA 3ABOA 3NAVA 4O50A 4EOUA 5D38A 3C3NA 1IXPA 1YDNA 5FF0A 4A2SA 1I4NA 4XKYB 4LY8A 4UTWC 4MVAA 4GJ1A 1FWWA 3MHGA 1EP3A 4NJGA 2C14A 5F2GA 1I2OA 1G69A 2CW6A 1K8XA 4K8EA 5D33A 2QDHA 1GVSA 2ZZ4A 1J5TA 5BMXA 1JVNA 3SSJA 1EUAA 3GIYA 3ZS4A 1N55A 1XL9A 2YDAA 4MZ1A 1C29A 3B0PA 1U83A 2FPVA 4O1BA 1ICQA 4FX8A 3FYOA 1D3HA 4HN4A 3STEA 3W75A 3N73A 1H51A 2P0OA 4MY9A 1LRQA 1JCJA 3W74A 3T7VA 3R2GA 1KTCA 4FIRA 1F6PA 2EAWA 3Q94A 4PCFA 3UQNA 3W7HA 5AHMA 1F5ZA 3PBVA 1P4CA 1NF7A 2VXNA 4FNUA 4BWLC 5AYYA 2Z0IA 2ZZ5A 1PL9A 3M6YA 3W7PA 3F1QA 3MW7A 1TB3A 3NXFA 1H7XA 4FNRA 1SZEA 4QISA 7TIMA 5I3GA 5AFDA 1PVNA 1W1ZA 1WAUA 2X30A 3G1AA 1SPQA 2X16A 2E6DA 3TJXA 4LVBA 1HO4A 1VS1A 3P82A 4O4VA 2ZZ2A 1EP2A 3M43A 4TMBA 2VEIA 4O57A 3HJZA 3SI9A 4O10A 1QPNA 3W72A 1TMHA 3O8AA 2BSLA 3RLVA 2GPTA 4LRTA 1G4SA 3BLIA 3HG2A 5FEWA 3NQGA 1ML1A 4MUZA 3LXCA 1FCQA 3IGXA 4YCPA 3LBCA 3QSRA 4LV9A 1SO4A 4IPJA 1KM4A 2W79A 3UPBA 3I65A 5FEZA 4GUFA 1VJIA 3P60A 3A23A 1TQXA 3C2VA 1M5WA 2GQ8A 2Y85A 2QDGA 1IGSA 2NV1A 3M5VA 1WBJA 3W7GA 1K02A 3N14A 4LTSA 4O8RA 4DF0A 2QJGA 2WNQA 2RDUA 2W0UA 5KITA 3W7DA 5C54A 3CWOX 3G1FA 2C3ZA 3BLEA 4IMCA 5G1YA 4ZZ9A 3STFA 1LZOA 4K7YA 2QUTA 2GJNA 1VR6A 2VELA 4JTJA 2H3DA 4YMZA 3UXAA 2DZSA 3STCA 3TMLA 1SQ7A 1OF6A 3NQVA 3P74A 1H63A 3P8JA 1GJPA 2RH9A 4OV9A 3MUXA 2QR6A 1MXSA 1AW5A 1FXQA 3NPUA 3GXTA 4KFPA 4NXSA 3BG5A 4M6VA 3WK1A 4NJJA 2B7OA 3FS2A 4DO5A 4JTSA 5D02A 2P1FA 1R2RA 4YLWA 3FLUA 3IVSA 1M6JA 4UTJA 3IIOA 2Z2UA 1SR9A 4UTTC 4R7JA 3NNTA 1D9EA 5DELA 2DJLA 4LS2A 5EY5A 3UY7A 2E09A 4NX5A 1NEYA 1VRDA 4AB4A 3HGRA 3EKLA 3TMQA 4S2CA 5K7JA 3CM4A 3S1XA 3W9ZA 1N8FA 2ISWA 4KWWA 1ZAIA 1ICSA 3W7MA 2KZHA 1Z48A 1ADOA 1HO1A 4NNAA 2YGYA 2WOQA 1RVGA 2QCCA 3QMRA 3DKLA 3GZ3A 1P0KA 4QSHA 3C2EA 4OE7A 2V82A 4O16A 5K9XA 5E1QA 1TO3A 4ALDA 1KV8A 3OG3A 1TPWA 3E96A 2V2DA 2WSRA 3NOEA 4OHQA 4PA8A 1DQWA 1VH7A 3O06A 4GUGA 2CZDA 2V2CA 3MWAA 2DZPA 3QW3A 1K3UA 2W6RA 2CLOA 1PV8A 1WX0A 5G2HA 5CSRA 4WXYA 3O63A 3L5LA 3MP4A 3LDVA 2PC4A 4O1AA 4ZL1A 5K3VA 3GR8A 5CPMA 1S5WA 3MYOA 1JUEA 3PBYA 1AL7A 4O17A 5AHNA 5AN7A 1X8FA 2ZBTA 3TFXA 5F4SA 1TCDA 4O28A 5BOOA 1XFBA 3C56A 3LHWA 3FYPA 3IIVA 3PG8A 4OQVA 1W37A 2QCNA 3DZ1A 4UXDA 5A8GA 4TU1A 1GOXA 3PB0A 1B4EA 3W1AA 4MOZA 4AWTA 3F03K 1DVJA 1TPUA 5HWJA 4JYDA 2JK2A 3HO8A 3GDRA 5ABTA 3C6CA 3G1VA 4O1DA 2DZXA 3NQAA 2ISSA 4RX0A 3SFKA 4ZQPA 4IUOA 1SFJA 2NUYA 2ZRYA 4YXGA 1MZHA 1W56A 2WJZA 2DZVA 2LLEA 4R34A 4JXCA 5AHEA 4FHAA 3UXDA 3QH2A 4UTLA 1JQXA 1SZGA 4RZ4A 3TC7A 3TE9A 2PRMA 4JX4A 1A5CA 1OX6A 2CLEA 2D73A 4UFKA 3KAOA 4E38A 4H6KA 4FEZA 2X1RA 1MEWA 3GNNA 1I2PA 1DJQA 3W1NA 4XTIA 1GTHA 4WZHA 4N9CA 4D2JA 1F74A 4IPIA 1VYPX 4IXHA 4AEOA 1EIXA 4EWND 3DFSA 1Q3NA 1FDZA 1KLYA 5LNRA 1P1XA 2JBMA 3OEXA 3W1TA 3ZFHA 3BV4A 1UB3A 4OV4A 4HNUA 1XCFA 4K36A 2C15A 3HB9A 5HMSA 4LU0A 3IVUA 3LRLA 1O5KA 3W1UA 1KFLA 5DBUA 3QPZA 4U28A 1OYBA 5EPDA 3W7OA 1P5BA 4O4WA 1EX5A 3W73A 3I68A 4LOCA 2C1HA 2VKZG 5F2LA 2NV2A 1TYGA 3CEPA 1QPRA 4XTDA 4LVGA 1JCMP 2X1TA 4IWWA 3HG3A 3TUUA 1Q6LA 4JN6A 5BW6A 4X2RA 3UZ5A 1QDSA 2C18A 1QMLA 4MFDA 1W5NA 1CI1A 1FCVA 1GG1A 4LVAA 2ZZ1A 1X1ZA 3GDMA 4ZQNA 3M5ZA 4PH6A 5MHBA 4H3DA 4N02A 3TH6A 1MEHA 4PL2A 2RKXA 2GOUA 4ORIA 3NPVA 1VHNA 2A6LA 4JYFA 4U4MA 4Z1BA 3WJZA 2FQIA 2QAPA 2OCZA 1NFBA 1OFPA 4ADSA 3VNDA 4FXSA 5DY3A 1AG1O 1Q6QA 5I3JA 1B3OA 2CZEA 4N9DA 5AHFA 3W86A 3BVJA 1M7OA 2FB2A 5DY2A 5TBOA 3MI6A 3OA3A 1F7BA 4OBTA 4JR5A 1T99A 4AHQA 6ALDA 3NG3A 4NVTA 4LW7A 3PG9A 3WJYA 3I7RA 4DQWA 1I2QA 2R94A 5J5RA 3ANYA 1KBJA 2VC6A 2YFOA 1L6WA 3W87A 4K37A 4KFNA 3CU2A 5A5WA 4UFHA 4POCA 2YCEA 4K8HA 3DHFA 3QEZA 3M16A 1TSIA 3LB0A 3MI3A 4LS0A 3DI1A 3LOTA 3EWYA 3OVRA 3TW7A 5F2IA 3S6DA 2YPIA 3LRMA 1PE1A 3OVQA 4WY0A 5DBTA 3HGJA 1KM2A 2ZA1A 4KKXA 4GUJA 1YYAA 1VYRA 4ONVA 1SW3A 2ZZ3A 1KFCA 4UTIA 1H1ZA 4DF2A 5EKYA 2ZZ7A 5FEPA 4GFSA 2ZTJA 2CLLA 3ATZA 3P61A 4X3ZA 2CLFA 3EX2A 3PBWA 1F2JA 2A0NA 3C8FA 3NQ7A 5AYXA 3N2MA 4WY0B 5CPLA 5AHLA 3O15A 5GVJA 1OK4A 5I3IA 4M7TA 4WX2A 4O14A 1KTBA 3W1RA 2B4GA 4O18A 1RR2A 3C52A 4JNMA 4BI5A 4I7VA 4WD0A 4W9TA 3G1DA 3HG5A 3W1MA 3QQ0A 5CKSA 4Z1CA 4BR1A 2EHHA 2Q3OA 4DBDA 2E68A 3E9AA 1H7OA 4FX6M 4NNCA 3S1WA 3V75A 2ALDA 1L2UA 1QFEA 3EWZA 3KHJA 2CZ5A 2ZA3A 5F2MA 4UMAA 5E93A 4MJMA 4K39A 2TPSA 5EBUA 5C6MA 2A7RA 2OMAA 3OVPA 3W88A 3DAQA 1TV8A 4NQ1A 1ZALA 3B8DA 1IIGA 3KX6A 4K38A 2GVLA 3TJLA 1TPB1 3JRKA 3SJ3A 4R33A 4A3UA 3PB2A 1K8YA 3KRUA 2YX0A 1GG0A 4IMDA 4EIVA 2VOMA 3QJAA 4I9AA 1LRTA 2WV8A 4CQ9A 1S5VA 3L67A 1TPDA 3LX9A 4NU7A 3B0UX 3FEMA 4ZQOA 2Y63A 2P10A 1VCVA 1YXCA 2CLKA 1NVMA 3NQ6A 4TO8A 2Y7EA 1JR1A 4TX9A 3QMSA 1L6YA 4Z0SA 1FWTA 1FDYA 3EX6A 3BK0A 3L2IA 4MY1A 5I3HA 4UTKA 4Y96A 4IJBA 1XXXA 1LCOA 1QCWA 3FOKA 4JGDA 3TAKA 1QO2A 4OGZA 1TRIA 5DXYA 3G1YA 3IVTA 3UWWA 5AB3A 2ZCGA 3UD6A 3B04A 2CFFA 3STGA 2V81A 1XBZA 1VZWA 4BI7A 2EKCA 3LCWA 3R89A 5FF4A 5K9DA 2A2IA 1C9DA 3FA5A 3GYEA 3MHUA 2NLIA 3E0IA 5CPOA 1Q6RA 4Z0JA 2WO5A 4E2BA 1DOSA 4FX7A 4LRSA 3UWZA 3A22A 1SO5A 1G4PA 1ZJIA 5KMYA 1GTEA 1JCNA 4O0KA 2BWGA 2RDWA 1A5BA 3LCLA 3TIMA 2FFCA 4NNBA 2ZRWA 2QUUA 3PR2A 2NXHA 1EUNA 4DPQA 1U5JA 2V0TA 3NL6A 3P62A 3HIJA 1JUBA 2IQTA 1HL2A 4AHOA 3W85A 1S5TA 1LOSA 1PIIA 4J9JA 2WSYA 5HWMA 4P61A 4Y6GA 3NQ8A 5LNSA 1QR7A 4JY9A 4PC8A 2QCEA 3R5EA 4RR4A 1K7XA 2Y70A 1J4EA 3PUEA 2G97A 1HFBA 5F1VA 1XBVA 4EF8A 3G1HA 2E6FA 2YW3A 4JTKA 2CZFA 5CZTA 3M1ZA 1N7KA 4E0CA 1ZY9A 2J9YA 1IXOA 3VCRA 4MYAA 2B0MA 3FFSA 1OX4A 4MZYA 3VFLA 1RV8A 4ADUA 3LI0A 1LM1A 2J9XA 3L65A 4O12A 1LLZA 5AHIA 3BLFA 5EMUA 4O11A 3AJXA 2QJIA 4JDBA 1TJRA 5K2ZA 5L6UA 3NPXA 3TSMA 3L0NA 3O07A 1KM6A 4ZQRA 2QUVA 5U7SA 5C2XA 3VE7A 3DGRA 1W31A 1G6CA 3GK0A 3A21A 3BPWA 1W3TA 3LLFA 3PSVA 2X1UA 4O0ZA 3VI2A 2Y88A 3GDTA 3C0JA 3W1LA 3LCFA 2Y7DA 4YWIA 1L9WA 2QKFA 1WXJA 5F1UA 1WDWA 4B5NA 1RPXA 3M41A 2C0AA 1F76A
chains in the Genus database with same CATH superfamily
4CQAA 3A4XA 3MSDA 1OFBA 5C0QA 2AGKA 1NARA 2BDQA 1XUZA 1S2VA 4LSBA 4CUCA 4NX0A 3SR7A 2QT3A 5HR7A 3C2RA 1ONWA 5LA2A 1NY1A 1KLZA 3ZJKA 3W01A 1Z3NA 1FQ0A 3IAQA 2ICSA 5LGXA 3ZOAA 9CGTA 4GYPA 4X63A 3TROA 3VIHA 2XFWA 2BOFX 2IPGA 4LAUA 3UWVA 5DCEA 2V3FA 3QV8A 2HS8A 1YPXA 1YX1A 4IFRA 3GVGA 1G01A 4OBSA 3PC0A 4A3HA 1X8CA 4Y2WA 2BXVA 1MMFA 2OLHA 1EOMA 4PUEA 5BRBA 2PGFA 5D2TA 4C1NB 4NJHA 2ZRUA 4KIEA 5HANA 4AD0A 1O5XA 3DUGA 1FHDA 4BF5A 2PTXA 2DP3A 3DYOA 4NRSA 2Z2AA 3S8HA 1UQYA 1MUWA 3S0CA 4REQB 3HGOA 2JF7A 1G7VA 3E02A 1VLIA 1RBLA 3KVJA 4WKFA 4K1GA 1FP8A 2GDVA 3VCNA 4U31A 4KWUA 4M5PA 3IEBA 5FF7A 1V93A 3G8RA 3VCCA 2PURA 3U2CA 3NDOA 1ZENA 3GWQA 3WLPA 1GVYA 1KRBC 2YL6A 5ECVA 1KR0A 3MY9A 4UTUA 2VNCA 4NYUA 3UNDA 4PFHA 1ADSA 3DCPA 3H2EA 3GH4A 3CV2A 1ZBWA 3LHUA 3THAA 5IHSA 3PWIA 4TIMA 4ACYA 4B3ZA 1CENA 1R87A 4S3EA 3LTYA 1TZ9A 1E0TA 4JFSA 2QMJA 4F2BA 7REQA 1S3TC 3ITOA 1VRXA 3D46A 4YVXA 2HPMA 5E5CA 3MO7A 2H8XA 1XI3A 3W7EA 4AZBA 1VGAA 1D3GA 4XO6A 5LIUX 5CPNA 2VEKA 1IIHA 4W4QA 1K7FA 3E49A 3EOEA 3L66A 1OABA 5PTDA 1Q66A 2NVDA 3UZYA 1H2JA 2BY0A 2O4MA 3MCMA 3NA8A 1LL7A 1DPMA 5CBIA 4CCZA 2YL5A 3NZQA 3UR8A 2FZMA 3A13A 2V38A 4GE8A 3S5YA 3UXLA 1JDDA 2VFDA 2OQYA 1A3HA 1VEOA 4Y9OA 1OVDA 2X7WA 3H55A 3B0XA 5I77A 1OYCA 2X0HA 3HTWA 3F4WA 5D2YA 3TKFA 3STPA 3MKKA 4M24A 2CC0A 3LCXA 1AMYA 1OZQA 1QWGA 3GG7A 2UY4A 1ZZMA 1V5XA 3VM7A 2PWGA 3A5FA 3F4NA 1QAPA 2YDSA 2E6YA 4ZQCA 3PP7A 2WSKA 4P7RA 5AC7A 3GTIA 3CHVA 1M41A 3VX1A 4DI8A 3IRDA 2CNCA 2GVEA 4J5NA 5CGQA 3WF3A 3MMDA 3DFHA 1CX9A 3UWUA 2V5LA 3ZR4A 5D2XA 2DUZA 2YBTA 2XIQA 1PZ1A 5IFPA 5JBDA 1WZAA 4HCDA 4HJWA 1UJPA 3VIOA 4F2UA 2FJKA 3C2FA 1K03A 1E43A 1KB3A 3CL8A 1W0MA 1NDVA 3SRKA 4ROPA 2VQUA 4IX2A 2CWXA 2D2HA 1XGEA 3Q2DA 4HVXA 2JGYA 4S3AA 3OODA 3VD3A 3PJXA 1OM0A 3W7KA 4GY0A 4XB3A 1Q2SA 1IWBA 1GKPA 2PDQA 1I2RA 3DG3A 3G3DA 3PZMA 4LBRA 4XWUA 2F7FA 2P50A 3T0BA 1ZUAX 4J7RA 4WY0F 1KQYA 3I7SA 4DN1A 3TK7A 1HN1A 1LROA 4Q22A 3E74A 2GZXA 5FJOA 2ZYFA 5HQLA 3W2LA 2OODA 4GVGA 3WMLA 1I1WA 3KXQA 4IZGA 3WL1A 3TR9A 4DY1A 1JDCA 3GXIA 7PTDA 3LGEA 2NUXA 2JKAA 1XIEA 3IS4A 3WLNA 2WAGA 4AWSA 5HUOA 3ELFA 4B5SA 1QOQA 4LANA 2QLYA 3UY8A 1CPUA 3TYAA 2V9DA 4MLRA 3GNDA 1BGGA 3BLOA 1XLKA 3P8IA 4WJEA 2WNZA 5FESA 4OOUA 1W9DM 3TX9A 3UWYA 6A3HA 1JYWA 4C5YA 4GBDA 4GGBA 4AZ7A 2JIWA 3N11A 4PB4A 1JCYA 2ZX6A 1P6WA 1US0A 1B31A 4H9UA 4AYGA 3KP1A 1I9CB 4ICNA 4GYPC 4GHRA 2Q3RA 3V1PA 3LM7A 2Y5JA 3UVAA 4MAVA 2R91A 1V4YA 2OQHA 3M07A 2A7NA 3KCLA 3OG2A 3QYQA 4AHPA 1E4IA 3SCTA 5B80A 3LM3A 5C9UA 1KFWA 3NL5A 3V0UA 2FLIA 4RZ6A 5DLCA 1FUYA 5C70A 4PMJA 2OOFA 2ISFA 1B57A 4LQ1A 4N42A 2PP3A 1H50A 3NCOA 3PZIA 3TC6A 4LC6A 2O9PA 2Y4SA 1U1HA 3DH7A 4A35A 2XZ7A 1WB0A 3AS1A 4KCWA 5C7VA 1XR2A 1XYFA 1J96A 2I9EA 1TA3A 3WDRA 4YYCA 2WJDA 4HU8A 2J25A 2Y7FA 2PCQA 1O60A 1XLIA 3GNOA 2WANA 1DP0A 3P7YA 4K7VA 4HNOA 2QYGA 2VFHA 1PSCA 2DIKA 2SFPA 1RH9A 4RCXA 3DDMA 5F4XA 2PDUA 4QJ5B 3TXVA 2BGQA 3OHIA 1OT1A 4PEKA 1OD0A 3CPUA 2QUNA 3ME3A 3H7VA 3ARYA 4AVFA 4AFYA 4GIEA 4AXNA 1YE4A 2PWDA 1OCQA 1WDDA 1MQPA 1WKYA 4C6JA 2ZWZA 1Y5XA 3V36A 3Q45A 3UGVA 4H6RA 1KFKA 2E40A 1OGSA 2XVKA 5HNTA 1IYXA 2NXIA 3GKAA 3HF3A 2DZUA 3VUSA 4EVZA 2CBJA 2WVVA 1C3FA 1J0IA 4GYFA 2WNWA 1H60A 1YTKA 2Y1HA 5D9PA 2NQLA 1NIUA 1XC4A 4ZMGA 1RHCA 1XLMA 4XZHA 4XZIA 3SY5A 3WLMA 1KWKA 4CVWA 2EEXA 3L4UA 2CLMA 1OX4B 3LPGA 2BY3A 3VKCA 4HSNA 1U22A 1VYSX 2VD8A 2X1SA 1VCFA 2NT0A 4ZO8A 4J3SA 2Y61A 3S9YA 3KWXA 4P8UA 3B8SA 1Q6EA 2GUBA 4ZO6A 5A2CA 4IFOA 4Q6JA 3P5ZA 2JIEA 1T40A 4E8DA 1XBYA 5KZDA 3UF9A 1O5QA 1R47A 1T8XA 3BZGA 3CTTA 3TSBA 2QAFA 1V51A 1KRCC 2EGZA 1UUMA 3BDKA 3WK3A 3I7QA 1FDJA 4JEQA 3R6IA 3LA4A 4O53A 4HU4A 5HJXA 1DORA 4KS0A 4QM1A 4UZUA 3AHTA 1W54A 4QCEA 4LBUA 2FH6A 3GBDA 4GNKB 2UY3A 1AW2A 5JIWA 4HU0A 3CHDA 4KIRA 5AYZA 4CN4A 4UTWA 4AWUA 4FB7A 3UNTA 4JYEA 1CB2A 3DXIA 6TIMA 1O4UA 2WMIA 1Z44A 1PCWA 1NJJA 2IXVA 1VC4A 3CIXA 1NQKA 3WBWA 2I56A 1F4HA 1BSLA 3GG8A 1EEPA 4PL1A 1AH4A 1KXTA 4TQTA 3BE7A 2GSEA 1WZMA 3GC5A 4R7OA 4KRTA 1GJUA 2QCHA 1YDVA 1KM5A 4M19A 1KXQA 2WKJA 1M65A 4YTTA 3S9IA 5HDRA 1LL6A 5EGRA 4IMAA 1W6TA 1Y0EA 4D9PA 3RFAA 4KMQA 3HV9A 5CEWA 3UJFA 3MDUA 4MLJA 4JTEA 3WBYA 1Q4NX 3G22A 2MUCA 3DECA 3MJMA 3Q58A 1F61A 1R6WA 4UFLA 3BURA 3GXDA 1OK6A 1PZ0A 4JD4A 3WLIA 1HKIA 4GUIA 4JFWA 4Q8MA 1POKA 1RZMA 2NUWA 5K4ZA 1ME8A 5HAOA 3KP0A 5FF3A 3MC5A 5EL1A 5A6MA 2QDDA 4PB5A 4H01A 1JF6A 1ZCOA 1FWNA 3WJWA 3DFQA 4OBRA 1QPQA 3VNKA 4RDZA 3PZVA 2VVSA 4LV4A 4QJ3B 4QAIA 5D05A 2FH8A 3AS3A 3LZ3A 4I9TA 2OVLA 1BRLB 1CBGA 3VOIA 4NP7A 4PCTA 1J9YA 4KGJA 4DWSD 4CVUA 3BGGA 3BG9A 1OC5A 2A6NA 3QHNA 1AODA 5FEXA 1IHIA 2ABAA 4AD3A 1PAMA 3IIPA 4RJEA 4TXEA 4C7DA 2XISA 1VEMA 1E40A 3RO8A 3T1GA 1KGXA 1UCWA 3WQVA 1J93A 3OGSA 3WD1A 1E9LA 1XIBA 1EXBA 3KOFA 2UV8G 1RJPA 3MKVA 2XVPA 3OIHA 5H2ZA 4BJHA 2VL4A 4JTAA 4MJ4A 3KFTA 3HPFA 3VOHA 1S3HA 1XM3A 3T0DA 3MS8A 3FA4A 1E0VA 4ORMA 1F07A 3VA8A 1AQHA 1FCBA 2PDFA 1M7PA 3WQ4A 2D69A 4HPXA 5DCBA 3E0FA 2X0SA 2OX1A 1Z32X 4M6PA 1UC5A 1XJBA 3NYZA 5I0DA 1DHPA 3NGJA 3A47A 3WQGA 3CC1A 2DVUA 3UG5A 4LXFA 5LHEA 1KC7A 3NQEA 3VGDA 2E77A 2G8ZA 3M7WA 4LNYA 4DJDA 3DC0A 2PA6A 1NSJA 5JXQA 1Q7ZA 3EWXA 2A4AA 3NQDA 4DVOA 3AIWA 3S42A 4FLOA 2Q8LA 1RK5A 3T78A 3C2OA 1XISA 2PUZA 1R3WA 2RGMA 3LMYA 4XV0A 4PMXA 3AUJA 1EJRC 2QCDB 2FVLA 2QXWA 1HQTA 3QR0A 3S5SA 4JPGA 3CUHA 1OC7A 1TMLA 2R1KA 5D8WA 1RK6A 2FIQA 1ZCCA 2XUCA 1RY8A 3VZYA 3LHYA 1H1YA 4A21A 1E72M 4PODA 3VNZA 2ZADA 2YDQA 4LS1A 4HNVA 2G3JA 4LVDA 3WD0A 1S5MA 1K9TA 1JDAA 3G0SA 4KWSA 2WCSA 2F9RA 2V3GA 3SBFA 2DPEA 3L21A 4V15A 2VGBA 2PDPA 3BXWA 3WDIA 2NQHA 4KW2A 1AMKA 2F38A 2CLPA 3LS9A 1PKYA 3T42A 4HQVA 3W71A 5HWNA 1OGBA 4L1GA 4E3TA 1E9IA 3DHPA 2VWSA 1U5HA 2L5HA 4HHPA 2W91A 2NVCA 2ZFAA 3O3RA 2PDNA 1JYXA 1XLGA 2GQAA 1GVQA 4UR8A 3ZWTA 3CXOA 1K4HA 1W1PA 3G8EA 5AC6A 1XBXA 1EDQA 2PTWA 4L4OA 4XZ9A 4JIHA 3QLLA 4JX5A 1L6SA 1F9CA 4CN6A 3BW2A 4KETA 1TPFA 3KL0A 3RDKA 4H9TA 4XKYA 3RGTA 3NFUA 2RFGA 2Y5EA 2GVJA 3G3MA 3LRKA 4D72A 3QOMA 3LXBA 3GZAA 1PHQA 2PF0A 4PMVA 3QC3A 4RXFA 4OTKA 2VGFA 4N2YA 2OTDA 4IP4A 1A80A 3ICJA 1IZKA 1EJTC 1BQCA 5AECA 4Q8NA 4DJFA 1I4NA 4BEUA 4UTWC 2ZUVA 1SR0A 4JHMA 1VKFA 1FWWA 5ABEA 3CUJA 4HK6A 3MHGA 1HJXA 3SCRA 1LUCA 4IL0A 1G69A 1J5TA 3PZTA 5BMXA 1JVNA 1EUAA 1N55A 1GK8A 4PBFA 1IV8A 1FH7A 2VX7A 1EIBA 4DJEA 1PEZA 3CZEA 2GL5A 2OSYA 4L61A 3N73A 4J2PA 1VFMA 1LRQA 1RA5A 1JCJA 3T7VA 1KTCA 2FZ9A 1F6PA 2QZRA 3Q94A 2YKKA 4XX6A 2XFFA 5AYYA 2ZZ5A 3VXGA 1PL9A 1L8PA 4DYJA 4MKVA 4MNMA 4GQBA 3WEOA 1HT6A 5EMYA 3TJXA 4CQDA 1J8VA 3BAIA 1HVXA 2ZE3A 4TMBA 1XKJA 2VEIA 3HJZA 3GG0A 4O10A 3O8AA 1JG9A 3I4KA 1G4SA 1ML1A 4HOXA 1FCQA 3IGXA 4UQCA 4LV9A 4IPJA 2OZTA 1MW1A 3FSUA 3QGKC 3CAWA 3BH4A 5FEZA 2O9TA 2GGJA 2QDGA 4H1ZA 1EJXC 1DWAM 3H24A 1K02A 3M46A 4O8RA 2QJGA 2W0UA 1QI3A 4L5ZA 4XO7A 2MANA 4PTDA 3G1FA 1A4LA 4B3LA 3EDEA 4QQUA 3PPHA 4KGLA 3F4CA 5BOFA 4ZZ9A 3GU2A 2OO6A 2GJNA 2XM2A 1NU5A 3OZMA 2O92A 1H09A 2CYGA 4GZJA 1H63A 1HJSA 3LSBA 1O5RA 3QN3A 4FLSA 4EACA 3FCPA 3P8JA 3UJEA 1GJPA 2RH9A 2XWEA 3MUXA 5FOOA 2DZBA 4KFPA 4IIEA 3BG5A 2PAJA 3FXYA 3N15A 4J3VA 4JTSA 2XM1A 1M6JA 3UG3A 2XDFA 4UTJA 2Z2UA 5A94A 1VPYA 3NNTA 1XRTA 4LS2A 3UY7A 2VEFA 2VUYA 4X60A 5DFAA 3RHGA 3MVTA 4MTVA 3T8QA 3EKLA 3W24A 3N2TA 4M80A 1EQCA 4GO8A 3S1XA 3R58A 5D9NA 4AIEA 5TAOA 2VZSA 1XS2A 3W7MA 2KZHA 2VM8A 2Y0FA 1HJUA 3BCFA 1HO1A 3NDYA 3QMRA 3DKLA 4E8CA 3M0KA 2QNEA 3C2EA 4DJDC 5CCZA 4O16A 5E1QA 1TO3A 3OG3A 4H2HA 5A8QA 3W81A 5CBJA 5JU6A 2J47A 3WDHA 4H7CA 2EPNA 3LK6A 1DQWA 4IUGA 4EANA 4YIWA 1KRAC 4D6GA 2DZPA 3W82A 1K3UA 2W6RA 1EOKA 1V0KA 3HQNA 3AXHA 4IIHA 4WXYA 5DMLA 1JZ3A 3O63A 3W26A 2PB1A 5B7ZA 2PC4A 2DH3A 3S47A 2PP0A 3APTA 3OBEA 3PBYA 4H9XA 2DY3A 1DJXA 3SCSA 1TIWA 2IQ0A 1UWRA 4LYKA 4HPHA 1KCXA 3WG6A 5A69A 3W6MA 4WR3A 1V77A 1Q6GA 3QY6A 3IIVA 3PG8A 2WJEA 2QCNA 4UXDA 3LD5A 1NWTA 3ZXWA 4G7EB 2V5JA 1JXKA 1K6AA 3JW7A 4MOZA 4AWTA 1J0ZA 1WXZA 2A3HA 3HO8A 1S2CA 1UMLA 3NQAA 1K4GA 1R0MA 4KRUA 3EOLA 4ZQPA 5EFFA 1SFJA 3KWSA 3D3FA 4BHYA 1XC6A 4LUTB 4R34A 4JXCA 3VGGA 2JE8A 4Q4MA 3GFZA 4RNHA 1BYCA 4OJYA 1SZGA 4RE0A 1RXOB 4W87A 5BYWA 3GD6A 2PRMA 4J3WA 4JX4A 2PP1A 3FY1A 1A5CA 9RUBA 3VOFA 3RJYA 2D73A 4UFKA 4D6EA 4E8GA 1Q6FA 5C2GA 4DM1A 4LUSB 2C0AA 1W9XA 2FVMA 4UB9A 1NFPA 1H5VA 1X7IA 4IPIA 4IXHA 3BLLA 4E5TA 1EIXA 4EWND 1VFFA 1LQ0A 4G56A 3F2DA 5HBFA 5LNRA 4L6OA 2JBMA 1S39A 1J6OA 3KLKA 5CJNA 3VOJA 1J0KA 1OEPA 2I5GA 1D7KA 1JPMA 3AISA 5A8OA 4R5EA 3HB9A 1C7TA 5DT7A 4DJFC 3IVUA 1HP5A 1O5KA 3AFBA 4WF7A 4U28A 1HP4A 4OZOA 5EPDA 3UW6A 4LOCA 1I0BA 4H6EA 3S83A 4DZAA 1I60A 4ZOCA 2P3EA 4QG8A 1EJVC 3V18A 3HJEA 3NYDA 4GI8A 3CL6A 3QTPA 2WMGA 4NKCA 3WLOA 1VJZA 2IUZA 4IWWA 4DJEC 3WH6A 3HFYA 3RM9A 1Q6LA 1W32A 3UZ5A 3OTRA 1W5NA 5F7UA 1TWDA 1W2VA 2ZZ1A 4U5IA 3RMEA 1X1ZA 3GDMA 3NVDA 4ZQNA 3M5ZA 5XIAA 2YDRA 2YLAA 1MEHA 2A3CA 4PL2A 2HROA 1UYQA 2YB4A 4EAYA 1VHNA 4Z1BA 2DW6A 2E3ZA 4EPBC 2YCKX 2QAPA 2FDMA 2OCZA 1OFPA 1KCZA 2W66A 4HGXA 2BODX 1O66A 4GMEA 2P53A 3QFWA 4U33A 3KL5A 1M7OA 4QEHA 3URBA 3SRFA 4JR5A 4TX8A 1T99A 6ALDA 4PMQA 1E1FA 4NVTA 2PU1A 5IFTA 4UQAA 3PG9A 3G2GA 1DE6A 1L6WA 2J7CA 1XIDA 3AXXA 3ABZA 3BC9A 3CU2A 4KFNA 5A5WA 1P6BA 3RG6A 1ZLPA 2YCEA 1F8IA 3QVQA 1ITCA 3LPOA 2OFJA 4ICMA 3LOTA 3MCOA 4AQLA 4M1BA 3LRMA 1HKJA 3RLHA 3FK4A 3HGJA 3VGBA 2ZA1A 2WHLA 3CYVA 2OYMA 4ONVA 2AMXA 1SW3A 3WUFA 3QXBA 4PRRA 4UCFA 3PUGA 4EKJA 1H1ZA 3BV7A 2JQXA 5FEPA 1J01A 4X3ZA 1PTDA 2A3EA 2WMKA 1JFXA 3N2MA 1GHSA 4WY0B 5CPLA 3BLPX 5LIYX 1KTBA 2I7GA 3WL0A 3Q4DA 1RR2A 1O12A 3SCPA 3H2CA 4W9TA 4WD0A 3ARWA 3G1DA 3W1MA 3QQ0A 4DXKA 5LIXX 4TUFA 2ALDA 2QPUA 2FGBA 1PDZA 3PZOA 3KHJA 5F2MA 3UCDA 3U9IA 5C6MA 3M6DA 2OMAA 4R88A 3DAQA 3PTDA 5I24A 3V3WA 3S2NA 4RV3A 4R33A 1RCOB 3USZA 2O9RA 3PB2A 2YX0A 4YYFA 4IMDA 3VDAA 3PZQA 3WQWA 3QJAA 4NYYA 3LX9A 4L64A 1VCVA 3ZSTA 2CLKA 1ENUA 1KXVA 1CLVA 4Z0SA 1FWTA 3BK0A 3L2IA 4RE4A 1HKVA 3ZQ9A 5I3HA 3UXKA 5BWFA 1GZJA 3KDNA 4UTKA 3AI0A 3B8UA 4XUYA 3E2RA 1LCOA 3FOKA 4OGZA 3H4WA 3UYIA 3IVTA 1K70A 4I6VA 3STGA 5DF0A 1JIBA 2ZXBA 1FTXA 4C6IA 2XIBA 4MDPA 2A2IA 3UT0A 1SJCA 2P5NA 3FHQA 3FA5A 1QW8A 2XH0A 1Q6RA 2ZVIA 4GQRA 2P88A 4CU8A 1DEDA 4P5UA 4ERGA 1UZ1A 4LRSA 1Q7MA 1SO5A 1R86A 3K4DA 4Q8VA 3IK4A 1EGMA 1GTEA 1UIOA 1YNQA 3BTNA 3RN6A 1T6MA 2XU2A 1A5BA 1OD8A 2FFCA 1V0NA 3VKBA 3CGTA 4ZO9A 2A3AA 3NL6A 3HIJA 4A8RA 4GACA 4GKLA 1LOSA 1ZJAA 4A3QA 3LGGA 4QLJA 5CAHA 2WBGA 4GI6A 1UWQA 3NQ8A 5JQ9A 3R5EA 4QG9A 4RR4A 3VKAA 2PD9A 2Y70A 1P48A 2VDGA 4IISA 3T2QA 2G97A 3O7UA 4BS0A 3G1HA 2CZFA 3A4AA 5CZTA 1N7KA 1L2QA 3BLDA 2VZTA 1ZY9A 3UA4A 4E0CA 2DSVA 2B0MA 3FFSA 4MZYA 3VFLA 1RV8A 5CJMA 4ADUA 4LAOA 2QULA 3B4YA 2AKMA 2E9BA 4XZLX 2CKRA 3H4XA 5EMUA 4TOQA 3K8MA 1JPDX 4AISA 3JZEA 4KRZA 3NPXA 3TSMA 4NZ1A 1LF1A 1TE1A 3MMWA 3UJSA 1KM6A 2GK1A 1JPKA 2QUVA 5U7SA 1TV4A 3VE7A 2E67A 3GK0A 2OGYA 3BPWA 1W3TA 2OLAA 3PSVA 4ICCX 2Y88A 3IJ8A 3KZSA 3LCFA 1L9WA 3HFTA 5F1UA 2XZ9A 1EF2A 4JKMA 1V3LA 1B2YA 3M41A 4JIIX 4IG2A 1F76A 3EB2A 2EPOA 4NZ4A 1EJUC 2WZIA 1HJQA 1QHZA 1GZGA 3AO0A 3O05A 2DQXA 1IEVA 1K8ZA 5HUPA 2ISDA 3V1HA 2Q8XA 3KW3A 5BXTA 4L9XA 2CEQA 3GNRA 2YW4A 4BFAA 1E1CB 2YR1A 2VFIA 3V5CA 1MO0A 1YXYA 3T8LA 4UTMA 1JPHA 5G1MA 1NWUA 1DXFA 4C1NA 1BTMA 2VVNA 1YLVA 3QM3A 3HPXA 4FR6A 3W27A 2D20A 1HIZA 4C90A 3NZPA 3R13A 4OUIA 2OZ3A 5ABFB 4UFIA 5DEZA 3EWDA 2XWDA 2YXGA 3T4WA 1H61A 1MW2A 4TVUA 4GGHA 1RD6A 1T8QA 4REQA 2YFNA 3I6EA 3WD3A 2QVHA 3DERA 3WFZA 1YDOA 2YOCA 1C8XA 2E9LA 2HXTA 4D6CA 2XGBA 8XIAA 3CZGA 3H7UA 4AZIA 2PTDA 1EWDA 5C9WA 3FJLA 4NZFA 4UC5A 1CGUA 4HTYA 4UWMA 2OYLA 4B16A 1OY0A 5SWUA 3QHOA 1MZRA 2WQPA 3M0JA 2YBVA 1EC7A 5CGTA 2TRSA 4WVXA 3K13A 1BYDA 3G6LA 1DKWA 1OINA 4YTRA 1JNDA 3D3AA 4WOQA 3GQYA 3CB8A 1KBKA 1HG3A 3VE9A 2X1IA 4GX9A 4JTFA 4QTGA 3DFNA 2J88A 1ISWA 3GS6A 1GNXA 4JAWA 4ZB2A 3S6OA 4AZCB 3EWWA 4ZGYA 4Z2IA 2CITA 1LOLA 2NV9A 2IS7A 2IPFA 4RDVA 3DKJA 4C6LA 5CZ0A 1A0EA 4DI9A 1AZ2A 3TTQA 1LWJA 2NWRA 3A64A 4GYJA 4QE1A 1RUSA 4H8HA 3QR1A 3IWPA 1JZ5A 2D23A 3SEPA 4AWEA 3NL3A 1IF2A 1PYMA 2AL2B 1E56A 2ZRVA 3TYZA 4UZSA 1DYSA 2X8RA 1E5NA 4DBUA 4MYXA 1F4AA 4JCLA 2ZUSA 3UXIA 4EP8C 5KZMA 4P7NA 3LQLA 2BBFA 2V69A 1HL9A 4NJIA 5LNUA 1Z8AA 1KV5A 3WH7A 3D5HA 3L7RA 2Z25A 4KERA 2DZAA 1LLWA 1UKPA 3BJTA 3SRDA 3WBXA 1C8YA 3W2MA 4R9OA 4HSOA 4IIBA 2DSZA 4H9MA 1XYBA 3HA1A 1TZ7A 3DFPA 4DUVA 2PE4A 3O6YX 2HE8A 2FZBA 1JCXA 3TAOA 1BKSA 1N8IA 4X0VA 4ATWA 4GNJA 2OWXA 3TQVA 3RU6A 3TTEA 4GXMA 5LXXA 1VD6A 4NASA 2QCFA 3HOJA 3VIIA 3LY0A 3ABSA 1XLEA 5D04C 4V1YA 1SFLA 3FJNA 5K4XA 1FVPA 1BYAA 1BXCA 1BXNA 1PS9A 1CXIA 4GZEA 2VFEA 4HPJA 2ZWYA 4PSPA 5FSDC 5HULA 2YZ5A 2TYSA 3THUA 1V79A 3DHUA 1V3IA 2CHRA 2VRJA 1LT8A 3OZOA 1IEWA 4RDWA 2FPTA 5CZSA 1XDLA 2OPJA 3HQPA 3L0GA 4QGCA 4XQ6A 1VHCA 4UMCA 3FKRA 4X9YA 3CYJA 3IIZA 5I7GA 2VFFA 4FZIA 3GIPA 1FWSA 1A50A 1K77A 3QMTA 3V16A 3GAYA 1X98A 4H19A 1SUXA 4UIOA 3KE0A 1KKOA 2V3DA 2ABBA 1UG6A 3LHVA 4PTVA 4W8AA 4FXRA 3KS5A 4JIRA 2HSAA 1H7WA 1UPPA 5E70A 1XUUA 6REQB 2PDLA 2XVGA 4AUBA 5T9CE 4C7GA 3CIWA 4DBEA 1XSIA 1ZP4A 2OT0A 1E0UA 3BQ6A 1NDZA 4ZE5A 2PDXA 1TPH1 2BV9A 4UFMA 4W85A 5CC3A 3M0IA 3GFYA 3P5YA 1XSJA 1XLBA 1W91A 3LHZA 5FCZA 4B2DA 1XYCA 2AAMA 5H8MA 1CXEA 3UESA 2I1OA 3PPGA 4CCCA 1H5YA 4IX0A 3WZ0E 1A3XA 3QZEA 4DEFA 4AU0A 2XN2A 1TZZA 1YW1A 3OVGA 3OGRA 2XHYA 2PI6A 3MKCA 4TV6A 5G4HC 4MF4A 2PWFA 4Q4KA 1UP2A 2WJFA 4P2VA 2CZVA 4WXZA 4N4PA 1LYXA 1XQLA 2V5BA 3KOZA 3USBA 5IXEA 2XN0A 4L4LA 4JCMA 1GEHA 1D8CA 5J5DA 5G1TA 1B3WA 1X6UA 4FP1A 2WMJA 3G0UA 1VENA 5E0KA 4P7OA 4PMRA 5D32A 1E4LA 1MDRA 1FWDC 2OOGA 4NUWA 5DQPA 3T0AA 4HZ7A 4JBRA 1G4EA 2G50A 3UWQA 2QJNA 2RJHA 2GVGA 2KX9A 2Z2BA 3II1A 1T96A 4JS3A 3N9RA 3LLDA 4DZ5A 4Y9NA 1OFEA 4C60A 3XINA 1SO6A 4XKMA 1CW2A 4DO7A 3PM6A 2P8BA 3ZYZA 1KTNA 2DT3A 4E2DA 1JRBA 3OLDA 1X7FA 3VD5A 1LG2A 5G4EA 4IMGA 3NQFA 3N29A 2IW0A 1F6YA 4C1KA 4S3CA 3W76A 1QI4A 3TDFA 3LN3A 1PCKA 1VLWA 4RPPA 4F66A 4TVDA 4UR9A 4R53A 4NILA 2Z27A 1JF5A 5IBXA 4ZVJA 1DXEA 3AHZA 4FNPA 1US2A 1V6XA 4JTCA 5C9RA 3U8GA 3U7VA 1I8JA 3N2XA 1JQVA 2FJUB 2I9UA 3L4YA 1R5YA 1W1VA 5CPSA 3TP4A 3NZGA 1LWHA 4PCPA 3O6DA 3NVTA 2OJPA 3ITVA 1TPC1 3I4EA 4GH3A 3U5YA 2UBPC 2VOTA 2D0GA 4KFOA 3IGUA 3VAVA 1W3JA 3RLGA 2PRLA 3PBUA 3LTPA 4DYKA 1IQ8A 3AMLA 1C9WA 2GOKA 3CQ0A 1ZHAA 4YL2A 1UR2A 1S38A 3KRZA 1EB3A 3QY7A 4AMAA 2YYTA 2WXDM 4NAFB 1R3TA 4YWSA 1OG6A 2QCMA 4AZ5A 4QITA 1W9VA 1IXQA 1KFBA 3SCOA 1DJWA 4ZOEA 3MCNA 4CD4A 2XN1A 3NSXA 4MY8A 2D1ZA 3INPA 4QDMA 1XPGA 1EL3A 2PTZA 3PSWA 4HYRA 5CSUA 3CZJA 1QPOA 3I3EA 3QKZA 4DJDD 1X39A 3DG6A 5HJYA 3UG4A 1OFRA 4UNKA 4AD2A 4KF1A 2O0TA 1UZHA 1V0MA 2QEZA 3DX5A 3MBDA 4DO6A 4CN1A 1GPFA 3ZVHB 4Q32A 3QKEA 4M6UA 2FTPA 2G4FA 3MJYA 3HPZA 1KBLA 4PFMA 3E1F1 3JR2A 5DANA 4HYWA 3W7NA 4Z42C 2TSYA 4LJ3A 3GR4A 4CNOA 1S2WA 1FOBA 4IGNA 2CHOA 5HNUA 3NQMA 1UR3M 2IPJA 2JEPA 4JEJA 4UBPC 1JI1A 3EA3A 3MPGA 5D2VA 5LIKX 2HTMA 2NZLA 4IQLA 5AYBA 4IIGA 4QFUA 1REQA 4BK9A 1FHLA 3GXMA 3VU2A 2Q01A 2R1NA 3A5VA 3ARSA 2H3BA 3BMWA 3OIXA 4AIBA 2R6OA 1FWAC 4I5XA 1BWLA 3B03A 2DH2A 3RPTA 3TA9A 3R25A 4DNHA 3DU0A 2QHAA 5U4NA 1TPVA 5DCDA 2V5DA 2DUXA 4MB3A 1QBAA 4LPCA 1FWBC 1RVKA 3ES8A 3HBLA 5L9FA 3PY2A 4Y90A 4A29A 3EX3A 4WDTA 3VNJA 1OFAA 3ALFA 4Z2JA 1PO9A 1BD0A 3AXKA 3OYZA 1XWYA 1PX3A 2PGWA 1GCYA 4O19A 5BNKA 3U5UA 4RL3A 4ZXOA 1BRLA 3AMDA 3EA1A 2GSJA 4FOJA 4C6QA 4AIUA 5ABGA 4QLLA 1VFUA 2C7FA 2NX1A 2E6AA 1W3NA 3FVDA 2VENA 1ME9A 3WLLA 1ME7A 3CUIA 4F0SA 2V2HA 3W84A 2D2GA 3VINA 4FLQA 4DJFD 1I2NA 1AUSL 4XAPA 4PMZA 1GWJA 1GQNA 5T8GA 2E0PA 2O7SA 5TNVA 1VB9A 3W23A 2GJPA 3T05A 1TPEA 5DXXA 1ZBVA 3DIPA 2YBUA 2DEPA 4PGLA 3MUCA 1XD1A 1UUQA 4Z08A 2YIHA 2TMDA 5BWAA 4B9ZA 4DJED 3NZRA 2V67A 3GW0A 1ITXA 1N2VA 2EG7A 3MB9A 2GGEA 2E1DA 3L5AA 3S2LA 3WELA 3E2SA 3NO5A 5CZJA 1CXHA 1H41A 3PUDA 4M7SA 3MBFA 3LCGA 3SCVA 1EP1A 1SZRA 5GJMA 3S1GA 4HHHA 3CMFA 2Q09A 4PR4A 4UTTA 1YHTA 1ZAHA 4LF2A 3S1VA 4Q7IA 1OCNA 3NR0A 1B90A 5CG0A 4U3AA 4QE5A 1TRDA 2NXGA 4F0HA 2Y7GA 1UC4A 2JKEA 4HBKA 3P84A 3SN1A 3GDKA 3SN4A 3VZXA 5GNYA 1QT1A 4GBUA 3BGJA 3R0KA 4U5KA 2VTFA 1BQGA 3R0DA 1CXLA 2C16A 4US6A 3OZPA 3B9EA 4JICA 4UOQA 3F5KA 2QCDA 4B90A 4WDXA 3SZ8A 2HMCA 4NZ3A 3QBUA 4JTIA 4I9MA 1TTIA 4NHVA 3RCYA 5IBXC 1SYTA 2OB3A 5A1AA 2J13A 2Z6IA 4XBKA 3RPDA 2O9OA 4IT1A 1OCBA 4JIQA 3ZLGA 5A6SA 3N19B 1V6UA 3W7JA 1ONRA 2OXNA 1UWIA 4TX6A 4LWWA 3ERPA 3PUOA 4O52A 3QW4B 4FIQA 3S9ZA 3P81A 3TW9A 1FWRA 3NQ2A 4R3UA 3SIMA 5LIWX 2VZVA 1V08A 1FX6A 5G4WA 1A5MC 4WSHA 5I3KA 3WK0A 3B05A 3A4JA 1C8QA 1KO0A 4AMCA 2XGIA 4AD5A 1BTCA 5CC6A 1AQ0A 2J24A 5FI8A 1BSIA 2V8ZA 3MP5A 3DYPA 3C61A 1KFJA 2B7PA 1X96A 4MIMA 3PBGA 3GVWA 3VGHA 3M0YA 3TYUA 3QTGA 4HB7A 1AH3A 3B9AA 3N9KA 3T40A 4L4MA 3DBNA 4L9ZA 3LXAA 1RD5A 4XISA 1QTWA 2NX9A 3WENA 5TIMA 4CU6A 2WVUA 4DXVA 1EYWA 2Y24A 1G4TA 4LB4A 3QFEA 1DJHA 4N9EA 5AOUA 3HQ1A 2PLMA 3VTRA 3WNMA 4IXXA 4NF7A 3EXTA 2ZDRA 3TZNA 4M82A 5A8MA 1XIFA 1TWIA 3M44A 2E5BA 4CEXC 2PDGA 1XFCA 3AXMA 3M0VA 2BX7A 2OKTA 1WBHA 1CCWB 1KW1A 2C8NA 1QNOA 4C6EA 2QCLA 3CQIA 4XD6A 1SO3A 3U2OA 4WQ6A 1R2TA 3MA8A 1XLFA 5D38A 4NZCA 3IPWA 1YDNA 4LH8A 1BVWA 3HN3A 4KESA 3KL3A 5FF0A 2PZ0A 2XSAA 2Z00A 3GBEA 3PJWA 4GLEA 6XIMA 4AY8A 1T41A 1P7TB 4MWAB 3SQSA 3H12A 2FMOA 1EP3A 3KEHA 5T91A 1ZL1A 2CW6A 1K8XA 3HURA 1BWVA 4Q6XA 5D33A 2ZZ4A 3SSJA 3ZS4A 4GZ7A 1U83A 6CGTA 4O1BA 4G9PA 4HN4A 3W75A 2P0OA 4MY9A 4IJRA 3VPLA 4R7WA 3R2GA 1VPQA 2FHCA 4LB3A 4XIMA 5AHMA 5CC5A 2QIWA 1PTGA 4BWLC 3TJIA 4JFVA 4XSMA 3ONCA 3M6YA 1C92A 4YHGA 3NXFA 1TB3A 4M3PA 4QISA 5A2AA 1EHAA 4LNCA 1PVNA 3N3TA 1W1ZA 1GYMA 1WAUA 2X30A 1OB0A 1GOWA 2X16A 3NDZA 4S3DA 5CPTA 3GG1A 4LVBA 4MJ2A 3TQPA 1NOWA 5C8BB 1EP2A 3AQUA 3URAA 4PTMA 4O57A 2DT2A 2BSLA 3RLVA 2GPTA 3BLIA 3HG2A 5FEWA 2CESA 2XVNA 3LXCA 2YXOA 3C3UA 3U3HA 1EBHA 3QSRA 5FL1A 2POTA 1KM4A 4ZR8A 4KEMA 2W79A 4GJIA 2OEKA 1VJIA 3P60A 4Z1YA 4GVIA 5I3DA 3TYBA 4FOUA 2PWHA 3N14A 1UKQA 2WNQA 2RDUA 5I5RA 5KITA 3TONA 2VT0A 5C54A 4NAEB 2D24A 3HPAA 3T09A 2QV5A 1E71M 3PFRA 3BLEA 4IMCA 2INZA 3SUSA 1LZOA 4K7YA 1QHPA 2I5QA 3UVIA 2C79A 1UD4A 5CLWA 2CERA 4Z2KA 3URNA 3UXAA 1IT8A 2YJQA 1SQ7A 3TC3A 4OKDA 3KS6A 4LF1A 4MG4A 1S2UA 1MXSA 1AW5A 3MO4A 1FXQA 3GXTA 4G2DA 4IIFA 4NXSA 4JZ5A 2PLKA 4IGSA 1EO7A 4NJJA 2BY1A 1M7JA 2P1FA 2EBNA 4YLWA 5I2UA 3N25A 1QW9A 2FFIA 3FLUA 4HK5A 3KLLA 4UTTC 1SR9A 3ZIZA 1GW9A 3E0WA 1MXGA 3NURA 4F8XA 2A3BA 1NEYA 4AB4A 1E9YB 4DYEA 3MSRA 4I8YA 5K7JA 4WHBA 3CM4A 3AROA 2NSXA 1MW0A 3ITLA 1N8FA 2PBGA 3GTNA 3N4AA 1NDWA 3WNKA 1ZAIA 4P7QA 1Z48A 2BB0A 2G3IA 3C8NA 3PZ9A 2YGYA 2QCCA 1EDTA 4QSHA 1PPIA 4HSHA 4GD0A 3COTA 1ITQA 2B31A 3MUIA 2OR2A 3OZYA 2V2DA 1HKKA 3K46A 1MW3A 3NOEA 3PWGA 1VH7A 2V2CA 3MWAA 3QW3A 2R24A 1IR1A 2CLOA 3F4VA 1QK0A 4C5ZA 4V27A 1IEQA 4J3ZA 4IIDA 5K3VA 3VOCA 1FWCC 4BKNA 1UOZA 1DWIM 3C0LA 2GGIA 3F4DA 1AL7A 2DV0A 4LFYA 3K4AA 1EC9A 3GH5A 2D2OA 2P3ZA 1UR9A 3FHAA 1X8FA 2ZBTA 3TFXA 4P8XA 5F4SA 2HXUA 4ML4A 1XFBA 3LHWA 4DM2A 3JVAA 5A8GA 1W37A 4B4FA 4LUTA 3PB0A 3BSGA 3W1AA 4HTBA 4A8LA 1B9ZA 1XLLA 7TAAA 5GJPA 5ABTA 3G1VA 4O1DA 3WLHA 5FAGA 2DZXA 2YA1A 2PLJA 4RX0A 5ECUA 4YXGA 1W56A 3VD7A 3W0KA 2WJZA 3WX7A 4GFIA 4EPEC 1QHOA 1B30A 3H2MA 4LUSA 5AHEA 3FAXA 2OEMA 3QH2A 1B3YA 4F79A 2IKHA 1SJAA 3CO8A 4D1IA 2YCLB 3FJ4A 4FEZA 1F8MA 2X1RA 1RCXB 4FSAA 3BJFA 4Y9MA 2PDJA 1J0HA 4AVOA 4GINA 5IOBA 1DJQA 4XTIA 4B4HA 2E8ZA 4D2JA 1F74A 1J10A 3B8VA 1KLYA 3OEXA 2HV5A 3R4IA 2QPSA 1XCFA 1CTNA 3PAOA 5HMSA 4IL2A 3W1UA 2FTYA 1E73M 2WVTA 1PXGA 1QNSA 4AD1A 2WC3A 3W7OA 1P5BA 3U2ZA 3W73A 3H2NA 1O1ZA 5F2LA 1TYGA 2VR5A 3VABA 1CGVA 4IGMA 5D9MA 4OVXA 4QROA 1NOFA 4XTDA 5BXRA 3CHEA 5FJPA 2DFAA 3U2EA 4IQDA 3QLDA 3TUUA 2VR2A 2WCGA 1D7FA 5T9BG 3RR1A 2G3FA 4MFDA 1CI1A 1WUEA 1LQAA 1GG1A 4LVAA 3SQMA 3KRBA 1OWQA 3QV6A 2XIMA 1UR8A 3B9DA 6TAAA 2BXYA 4W8LA 4H3DA 1IWPA 1MQQA 4ILSA 2PEVA 1UHVA 1B54A 4AW7A 2W5FA 3ZR6A 1RPKA 2A6LA 3WJZA 1Y5WA 1KR1A 2RJGA 3LLXA 2CHNA 2OQLA 2ODOA 4NSBA 4ADSA 3TTOA 5DY3A 1HJWA 1Q5MA 8XIMA 1YQ2A 1Q4WA 3ZJ6A 1HVQA 3E5BA 3W86A 3WLTA 2FB2A 1FHVA 3N6HA 1XINA 2OWCA 3OA3A 1F7BA 4RNIA 4KEVA 3BUVA 3NG3A 4UOJA 3VDHA 4HMNA 5KZ6A 3WJYA 1H0GA 3UCCA 3RJXA 2GDUA 3I7RA 4DQWA 1CZ1A 2R94A 1XW8A 3LG3A 3ANYA 1HGWA 2VC6A 4J40A 4POCA 5C7HA 3DHFA 3QEZA 3M16A 3LB0A 3MI3A 1VAHA 3P93A 1ISYA 4IP7A 5CAKA 4XZWA 2YPIA 4QSFA 1M03A 3OVQA 4WY0A 1D2KA 4WLCA 1KM2A 3SY1A 3WNNA 1UR1A 1Q63A 2WYSA 1KFCA 5HPOA 2ZDSA 3CHFA 3O0FA 1W1TA 1UW9A 3P61A 3EX2A 2A0NA 5GVJA 3O15A 1OK4A 1W3KA 3QR3A 4IF2A 3W1RA 2E1WA 3KBNA 2NQ5A 3XIMA 4JNMA 4I7VA 1V3JA 4WKHA 2X40A 1TVPA 4U3CA 1B0IA 1CGYA 1F3XA 2VZUA 5D9OA 3RPMA 1C93A 4DBDA 3L12A 2E68A 1H7OA 3W4RA 4FX6M 1R3YA 4NNCA 2ZIDA 1GKRA 4XAGA 1PTAA 2CZ5A 1NQ6A 2WW5A 4K39A 5EBUA 3UPMA 2A7RA 1XIMA 3OVPA 1PX4A 1TVNA 2Y5SA 2NLYA 3KX6A 4UNIA 3TJLA 3SB0A 3ENLA 1E6XM 3CHCA 1K8YA 3KRUA 4BQ5A 4EIVA 2VOMA 4I9AA 1LRTA 1CLKA 1S5VA 3L67A 4H6QA 1TPDA 4YU1A 1AQFA 3EDKA 3B0UX 4UQDA 4ZQOA 2YL8A 7ENLA 5LXEA 1YXCA 1NM9A 1E0XA 2Y7EA 3UZXA 4KT2A 4TX9A 5I07A 6PTDA 2OKOA 2RUSA 3NQBA 1BG9A 3EX6A 4LYPA 4J3XA 4HZ8A 3AYRA 1XXXA 4JGDA 2WC7A 3TAKA 3EA2A 1FKXA 1TRIA 5DXYA 4W5UA 3AZTA 3H70A 3UD6A 1MI3A 1CGXA 2PDIA 2W67A 2DGAA 2R1MA 3K2GA 4RZBA 2V81A 1XIIA 3OQ8A 3WUEA 4BI7A 3LCWA 3R89A 3JUGA 3MTWA 1C9DA 2X42A 5HMDA 2XIJA 2NLIA 2F6UA 1MQRA 4WIWA 1UZ4A 4IQEA 3A22A 2C0HA 4DLMA 4PYSA 2PZNA 2REQA 5I02A 2RDWA 3LCLA 2GJXB 3TIMA 3VM5A 2VCAA 2ZRWA 5FA5A 4H00A 2Y8UA 2V0TA 4LCRA 1HL2A 3EOSA 1UP3A 3BZJA 1S5TA 5GPRA 1PIIA 2WSYA 5HWMA 2E25A 2RGLA 4PMNA 4Y6GA 3ES7A 1J4EA 1XCXA 1G5AA 1CXKA 3AXIA 4WJ8A 1HFBA 2Q02A 2GSHA 5F1VA 4EF8A 2PSNA 1ZU8A 4JTKA 3ZMRA 3UERA 1E6ZA 2J9YA 3VCRA 3QGVA 5AC4A 4L6DA 4NG3A 1Y7VA 1WDQA 4GQQA 4F9DA 1R3RA 1AZ1A 5BCAA 3H2FA 1R3VA 2BP1A 3AJXA 4H8UA 4MMWA 3BAJA 4HA4A 4L4PA 5K2ZA 1MDLA 1YBQB 5L6UA 3IANA 2X0YA 4AIOA 1BYBA 3IV8A 4QS5A 3UETA 2WCAA 3O07A 1TUXA 4FI4A 2WMFA 3T07A 3DG7A 3QYSA 3R79A 4EWJA 4JL1A 2X1UA 1E6QM 3L23A 3GDTA 3W1LA 2Y7DA 1FFQA 2H9AB 2QKFA 1E1CA 4QG6A 2QJMA 4E6MA 2BASA 4JQAA 4HCLA 3AIQA 5E0CA 1ZBCA 2RDTA 3R94A 3O9NA 4F40A 3HG4A 3PZGA 5AC5A 5LGZA 4XG1A 3VKDA 5ABFA 3L0KA 4HNTA 1S1PA 1L6GA 3WK2A 2O4QA 1F05A 1Q6OA 3PF3A 3TU9A 1C90A 5DMNA 3VK5A 3E12A 3MSGA 1J0YA 1MRAA 4DBSA 3W2JA 2DSKA 4K6AA 3H23A 1XLJA 4EX4A 3TCEA 4FNTA 1CYGA 2O7QA 1SZFA 5DO8A 1KNWA 4BEQA 1FWGC 3AUOA 3H8AA 3RLUA 4C6NA 1WKFA 1XPYA 2EQDA 3PVFA 4LUIA 1L0PA 1E6NA 2FDSA 3NO3A 1XLDA 3EWBX 1HNYA 4GY7A 4W89A 3MDWA 4C6PA 2NVAA 1HZYA 2DZTA 1KQZA 2W4XA 1OCJA 1WNOA 4WDWA 2VEMA 1US3A 1W8GA 4B2DD 2ASHA 4CD7A 1FXPA 1G67A 3QOKA 4FA3A 2F2KA 3OYXA 5BOEA 4AZCA 2GGHA 3TQKA 3ZM8A 3IARA 1Q8AA 2J7EA 2OSXA 4ERAA 3AU2A 3T44A 3ABRA 3BAKA 3KRSA 1DJGA 4GK8A 3EKZA 3A3XA 2ZX8A 3B3DA 2AL2A 3EZ4A 1WXYA 2VDHA 2VURA 3R43A 3TEVA 3VMNA 4XBSA 3TWBA 5D09A 1GPWA 3N18A 5LNVA 2P0IA 3KOXA 1W5OA 4YTQA 1UOKA 1VBJA 1NP0A 2HDJA 2VUNA 5REQB 2FHFA 3B9OA 3N6JA 1LDCA 2Z24A 1EEXA 3U48A 2DUAA 1Q13A 2J7GA 1XYMA 4JKLA 1C91A 4NXKA 1BF6A 5I03A 3EWCA 4K2SA 3QPYA 5KSWA 4GI9A 4GIRA 1GJWA 3BJSA 3W6YA 1I6NA 5CQ1A 4MM1A 1IZCA 3JZUA 3WQFA 1X97A 2ATSA 2Z6JA 1FWEC 3TTSA 3CUZA 1EWEA 1RBAA 4GC3A 5FF2A 3WQCA 1H49A 3PNZA 1DQUA 4B92A 4IQJA 1SFSA 2E5DA 3AIBA 3L5MA 3ONBA 3O16A 1UBSA 1VFSA 1UWTA 5KZEA 2RHGA 3FNDA 2ACQA 3EDDA 3N34A 3BOFA 4Z1DA 1VBRA 4P7LA 4YTUA 4TR9A 5LZLA 3FSTA 3W6LA 3D6NA 3AZSA 2A7PA 3KBVA 1JYNA 5H91A 2EKGA 4GA8A 3LV6A 3VD4A 2BTMA 1ZGDA 4RXGA 4X2PA 1XH0A 1A5AA 2WM0A 3NWRA 1E6SM 2IKJA 3GX9A 4QIUA 1YE6A 2H8ZA 4MPQA 4CQ8A 4JX6A 1QJWA 1WDSA 3GY1A 2QW5A 3C86A 1J2BA 4AAJA 5A6LA 1WKEA 3CIVA 4PUNA 2BHZA 4UFJA 3ITXA 2WNNA 4AF0B 4GX8A 2YCIX 3K1GA 4GNVA 1WZKA 1LOQA 3L2MA 2C1GA 5DT5A 2J9ZA 1V6YA 4EXQA 1DQXA 4C6FA 2F61A 3N1AA 1W3LA 1Z42A 2X7VA 4ADTA 1MEIA 2B7QA 3GAKA 3OPSA 5I23A 2I57A 3CK5A 4QE4A 4QXIA 3WD2A 3E6EA 4H41A 4PMOA 4TVCA 1ZS2A 3N2CA 3CL7A 1WZLA 4Q7NA 4RK8A 4F0LA 3UP8A 4BI6A 4GUHA 5A3HA 3GO2A 4D6HA 5RUBA 1W3IA 4UCGA 5AC8A 4JTRA 3YPIA 1EA9C 3FXGA 3G24A 4FNQA 4AXKA 4GISA 4GQGA 5HQMA 2V3EA 3IIXA 1UH3A 2DW7A 2PDCA 2VC5A 1W5QA 1KFEA 3GYCA 1OADA 4YVVA 3AIVA 3NOYA 2VI0A 3SM0A 3NL2A 3WY1A 1TUFA 3UYCA 1UA3A 2Z1BA 5CSSA 3TJ4A 3CLMA 4LEFA 1E4NA 3W7CA 5HPCA 2VEPA 1SZNA 3AMGA 4M6QA 3DENA 3LENA 1QW7A 3WF0A 2JGQA 4ZB0A 2R8WA 1UMYA 5FJUA 1Z69A 4JTTA 3WIJA 4P8VA 4M0XA 1QU4A 4E2VA 3N2OA 4A2RA 1XDMA 2INFA 3SGZA 3H4GA 5AYIA 2HVNA 2J62A 4ZQMA 4FXJA 1EA0A 2FTWA 2C6QA 2Z1SA 1GVIA 3DEQA 1DTNA 3IJQA 4PUWA 3SECA 2QVNA 3MMUA 2CU0A 3I3BA 1EX1A 1H4PA 4GQ0A 1SW7A 3IGHX 2RDXA 3G1XA 3T81A 1K9DA 3WO8A 1B5TA 3ABQA 3WBEA 1XRSA 1YADA 2PBOA 2VFGA 4JQ1A 4Q8QA 2A21A 2OELA 1G7UA 4DO4A 5CG7A 3L68A 1JD9A 2ZC1A 5GJNA 4BA0A 3FIGA 2GWGA 2POZA 1SJDA 3M47A 1TJ0A 4WSKA 4AX7A 2ZE0A 4NL1A 3W7RA 3W07A 3A3WA 3NUKA 4YTSA 2BG5A 5CC7A 4L1XA 4JL2A 3BAYA 5IM51 3VOGA 4IMFA 1R8LA 5G5IA 4FAMA 3DFOA 2FZ8A 3HMCA 3R8HA 4AEEA 4CNSA 5JBFA 3EDJA 2BVYA 1N8WA 2OWWA 4AZ6A 4OECA 1YTDA 1TV5A 4Q8PA 1E6RA 4CCEA 3H21A 1TREA 3VIMA 2VC9A 3KUMA 3GC2A 3VO0A 4K8GA 1GYNA 2WWDA 3G77A 1X6NA 1NP2A 3WLKX 4HMCA 4OU1A 3T08A 2YZRA 3TN3A 4HD5A 1YXDA 3LQGA 1YNPA 1UKOA 3AU6A 2EO7A 2WK2A 3AS2A 1A47A 1JRCA 1TG7A 1WPCA 2XTKA 1WOBA 3Q65A 2OZ0A 2E8YA 3U0HA 3V0TA 1SSDA 3BOLA 2NQZA 5MF5A 3FDGA 3S5OA 4MFEA 3RF9A 1HGYA 1OQFA 4NAFA 2IPWA 1H0IA 1V03A 4D8AA 3LGDA 3N13A 3GLCA 3QQ1A 5DRIA 4ZO7A 2DU2A 1TIMA 5C2CA 5M17A 1ZFJA 4URIA 3LCHA 2QPXA 2DORA 5JIPA 4ZB5A 4RLIA 4A3YA 3CV7A 4ZSUA 3ATYA 5BU6A 3HPSA 2F84A 1DXIA 3ZR5A 4D6IA 5MKGB 3TTYA 5BXSA 4A22A 1LBFA 3SUWA 3MZNA 1R38A 1XKYA 5D30A 3IV3A 3ZVHA 3MV01 4JN8A 2ALRA 4ASTA 4Q4PA 1EYEA 3UZJA 1DHKA 3HZ3A 2ZXDA 3KVKA 4PRWA 5F4WA 3SCUA 3PAJA 1QNQA 2YXXA 4MPKA 4JHOA 3MUAA 1SFTA 3HM7A 4Y8EA 4Q33A 3T0TA 3K8KA 1V7YA 4H9YA 1KCKA 2G5WA 1VPXA 2Z28A 2XINA 5EMKA 3P67A 3DFYA 4N6FA 1WUFA 2VO5A 4O54A 4OWGA 3N2BA 1U1JA 2XGZA 1W1IE 1J6PA 4IG2B 5A95A 4GCAA 2YB1A 2PODA 1IXNA 3KOWA 1CDGA 3G5EA 3I6RA 1LTDA 3C2YA 5EA9A 1RQHA 4C6OA 2UZ9A 1OHLA 3EXRA 2H6RA 4HU3A 1FWHC 2CLIA 2X2GA 1AJZA 3UR2A 1MXDA 4E4PA 1ESWA 2G95A 1WOAA 4QNEA 1AJ0A 1Q6DA 2QJJA 3RUBL 4BZYA 2WM1A 4HHLA 1DWHM 4B5TA 3W1PA 1ZAJA 3HQOA 3NEHA 3B9NA 4B9YA 4GZIA 2C19A 2Q8ZA 1UUOA 2J8GA 4QJ1A 2RAGA 2A5HA 2PDWA 4RZ5A 2ON3A 1MVYA 1JULA 1P0EA 2YA0A 3NPWA 2ATMA 2R14A 2AQOA 1CIUA 2FB3A 3G1RA 2VX4A 1LBLA 1UP0A 1XRVA 3F7JA 3WQ6A 1A5OC 4AY1A 4M8UA 5M2FX 3VC5A 2G96A 4FF7A 4JTGA 2CLHA 1R3SA 3CPRA 3KCJA 2HWGA 3B06A 2WHMA 3CZLA 3THDA 2B7NA 5KTLA 3LI1A 2AQWA 3M0XA 3FA3A 3LHTA 1EZWA 3QF0A 2VX5A 2Z7GA 5GQBA 4RE2A 4UTHA 3H54A 3KBMA 4G1NA 3ZSSA 5LNWA 4XVEA 3R8RA 1HX0A 2WQDA 4PTNA 1BEUA 1UR0A 1DE5A 4ECLA 3GB6A 2J7HA 2VWTA 4KEUA 1K7EA 2QMKA 3UCQA 1LBMA 4I9JA 3B0VC 1RQBA 1OIMA 3UZZA 4Q4RA 3WUGA 4CD6A 2YCJA 2WLZA 4PUKA 1PUDA 3M0MA 4ZXLA 1HUVA 4KCTA 3AICA 3T55A 2X41A 3T6CA 1PKMA 3AYSA 1QRQA 3EWUA 4G5DA 4JHZA 4Z2GA 3ZWSA 3VNMA 4DNMA 1E0WA 3ID7A 4PSRA 1V0LA 3CWNA 1QUMA 1KRMA 5LYRA 1JL8A 2AMGA 4FO4A 4PUJA 3EMCA 3KVLA 2V63A 2VP8A 3KTXA 3WUBA 3H2OA 3OJGA 3M9YA 5E6ZA 1O7AA 3H2AA 5KETA 1XIJA 1WV2A 1P0BA 3GUWA 1QO5A 4A4AA 3ECQA 2GJRA 3CUXA 3NSMA 4GCXA