5HNNA

Crystal structure of the endo-beta-1,4-glucanase (xac0030) from xanthomonas axonopodis pv. citri with the triple mutation his174trp, tyr211ala and lys227arg.
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
MLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAWSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDASGTKPVCTSDSVGQERLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the endo-beta-1,4-glucanase (Xac0030) from Xanthomonas axonopodis pv. citri with the triple mutation His174Trp, Tyr211Ala and Lys227Arg.
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
molecule keywords Cellulase
total genus 128
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hnnA00
1N82A 5IHRA 5FOOA 5I79A 4WF7A 4D72A 2DIJA 1GJWA 3RCNA 2WMIB 1CZ1A 2J7GA 2J62A 3IJ7A 3N9KA 3VDHA 1CDGA 1JGIA 4BCEA 3PTMA 3ZT6A 4KMQA 1CXLA 3VD7A 1UD3A 2QPSA 5FIPA 4AMCA 4F66A 3O9NA 3F5KA 3UR7A 3WY1A 5C71A 2WMFA 3II1A 5E70A 4D6DA 1FHLA 2ESCA 3S6TA 2CITA 3WD0A 1EDQA 4MJ4A 3T08A 2GFTA 4NRRA 3CBWA 3AHVA 1BSIA 2QLYA 1E4MM 5A8OA 2WVTA 3WH8A 3FW6A 1CWYA 5DFAA 2EPNA 3AISA 5FCZA 5GNXA 1E1EA 1W1YA 4QAWA 3KL5A 4HA1A 4MTVA 4D1IA 3IJ9A 2BY1A 1V02E 2C8NA 3OZOA 5M17A 1G0CA 5LA0A 1UD6A 4BQ5A 2O9PA 1E55A 3QHOA 5E6ZA 1MFVA 3AS3A 3PZ9A 3M46A 3U7BA 1V0LA 2J78A 4M56A 4E4PA 2DT0A 4W5UA 3SCTA 5JIWA 4CD4A 1V0NA 2X0YA 1SMDA 3I3BA 2WW5A 1KQZA 1JAKA 1BF2A 2QMKA 2EQDA 4JCMA 2WBKA 4PUDA 7TAAA 1OWQA 2GUYA 5A3HA 1E4IA 2D2OA 1IZKA 3WQWA 1QNOA 2X1IA 4CN4A 6A3HA 4H8VA 2WZEA 3ZJ6A 3OLDA 3CHCA 5DF0A 1CENA 4HMEA 4HMDA 1KBKA 4UOZA 4ZE5A 1J12A 3O6AA 3ZT5A 1SR0A 4TTGA 4MB1A 1GQKA 2PWFA 3U57A 2EJ1A 1GQIA 1BAGA 1KQYA 4AEFA 3DHPA 5ECUA 1ZB5A 4ACZB 2WHMA 4WSKA 3SUSA 4Z2GA 2WWCA 1M7XA 3MMUA 1QI5A 2NT0A 1NH6A 1FP8A 1GQLA 4J3WA 4OUEA 1FH7A 1RD6A 2CETA 1VENA 3EDDA 7A3HA 2J7FA 2CBVA 2CHOA 2G4FA 1HX0A 1NWTA 2VI0A 4DWSB 4B15A 2DQXA 2VT0A 2PBGA 2VQUA 1KXVA 2ZUWA 5IXEA 2DEPA 1VFOA 6CGTA 5CPSA 1OM0A 4B3LA 4CU8A 1VFUA 3W26A 3ARXA 4GXPA 4OBSA 1MW0A 1W1VA 4AZCA 4AIUA 1ZBVA 2EO7A 1L8NA 3SCNA 3ZR6A 2ZIDA 1MXDA 2WYSA 3W53A 2W67A 1B3WA 3AIWA 1QI2A 2IXVA 1B31A 1W1PA 1VJSA 3SCQA 1MYRA 4CD6A 4Q22A 3UG3A 2Y4SA 3LPGA 4GI8A 3WFLA 2NSXA 4M24A 1V6UA 1OIFA 3SEPA 1G1YA 3MMDA 1XD0A 2WANA 1J0KA 1HVXA 3L4XA 5EBAA 2D0HA 1S46A 1BQCA 1EH9A 1RP8A 1X6LA 1WE5A 3TA9A 4U5IA 1H09A 4H8UA 3CZ8A 2DT1A 1XSIA 3MUZ1 1JYXA 4HZ7A 1B3VA 4CUCA 1F4HA 3MS8A 4TVUA 4IPNB 1E71M 4V27A 1XGZA 1I1WA 1WO2A 4H8HA 4DUXA 3ZJ8A 3RM9A 1CGVA 2EPKX 2E0PA 3CTTA 5AYBA 2WHKA 2YL8A 1GZJA 5CLTA 3ZQ9A 4R5EA 2CKRA 4UQAA 2GJPA 2PBOA 4U31A 3ARVA 3L4TA 1C7TA 4KH2A 4H04A 1K6AA 3VIFA 1E4NA 2MANA 1GOWA 4J3UA 3A4AA 3VIMA 1B0IA 4MAVA 3AHYA 4D6GA 2BVTA 5FL0A 3HN3A 4M8UA 1J01A 3APGA 1DHKA 4A3HA 3CZLA 1RPKA 1VFMA 3GTNA 2W61A 3OLIA 1V3KA 4PYSA 3BC9A 3BCFA 4C7DA 1NOWA 4NI3A 3AXXA 1C91A 1HXJA 1EDGA 1E15A 3N1AA 1LG1A 3WQ6A 1H4PA 3QOKA 3N15A 4CCCA 4E8DA 2FGLA 3DYOA 1CYGA 3N04A 4PEEA 4CVUA 4NZCA 1HL8A 3U5UA 3WNNA 1PPIA 3W27A 2VCCA 2ZUTA 1R7AA 5ABHA 3OG2A 1UWUA 1CGXA 1OB0A 2WM0A 2BXZA 4NSBA 3SCPA 4CN6A 2ZUMA 1HF6A 6TAAA 1TMQA 1ZBCA 4CD8A 3WH9A 3AIVA 3U7VA 1M01A 4ZXLA 2VNCA 3PZNA 4AD0A 5D9MA 3W81A 3B9DA 3AMLA 2DSUA 1C8YA 2TAAA 3RM8A 4DM2A 3VOCA 1JNDA 1B9ZA 1UWTA 2XJ7A 3PZUA 1X6NA 1W2PA 1ISYA 4OOZA 2JEPA 3VM7A 1GUVA 1CPUA 4PRWA 4W84A 2JALA 4XB3A 2FH8A 4AD4A 5CJ5A 1BGGA 5BRPA 3VILA 3L4VA 1L0PA 3VDAA 3EBVA 4PN2A 1PX4A 3CUGA 2BY2A 1QI0A 2WVVA 2XVPA 1WDSA 4L4PA 1E0VA 2O92A 3RIKA 5E0FA 1M03A 1OINA 4Z2JA 1H5VA 1GONA 1E3ZA 1UH2A 3ZJ7A 1K9FA 1EGZA 1HJVA 4TXEA 1UA3A 2XWEA 3N18A 3NJ3A 3FN9A 4PCTA 5CGTA 4LGXA 2O9OA 3ARUA 2WVUA 2W63A 4TX8A 5CPTA 1CECA 1Y7VA 1HKMA 1V6XA 1QBAA 5A6SA 2EXOA 4UFKA 5A6BD 1EQCA 2DH2A 1IT0A 2VX6A 3SIMA 3GH5A 1BVZA 1LJYA 5E9AA 4AY1A 4W86A 2QHAA 1UH3A 1YQ2A 3VU2A 1QVBA 4X9YA 1BYDA 2BY0A 3WUBA 2WKLA 1C93A 2GK1A 4HOZA 3SCSA 3WDIA 3VIKA 3TTQA 2OYKA 2OWWA 1KBBA 1NP0A 4P7QA 3K8LA 5GPRA 3CZEA 4D71A 1CGUA 3D5HA 4DUWA 1JNEA 2DIEA 1XV8A 1HKJA 1CTNA 2YA1A 1G01A 1W2VA 2WB5A 2W4XA 4CU6A 1UWSA 3MO4A 5DT7A 1E0WA 2WXDM 3K8KA 3RDKA 5I0DA 1J0ZA 1NWSA 3BLPX 2VUYA 4LPCA 1E5NA 4C7FA 1CLXA 3UCQA 5A8NA 4ATLA 1VEMA 1Q6FA 3NUKA 1MQPA 1XSJA 3CUJA 4PMOA 2XHYA 4Z2HA 1JZ5A 3L4UA 3VIOA 4UZUA 4JKKA 2VR4A 1TA3A 1A47A 5E09A 2ZWYA 5M03A 4OBRA 2E9LA 2ZOXA 3SCUA 1E6NA 2QMJA 3AIUA 3AZRA 4AZ7A 4N42A 2GVYA 4EE9A 5EB8A 1HP5A 2D0GA 3AJ7A 1EHNA 4A3YA 3BH4A 3WNKA 3AFBA 1UD5A 5EFDA 2W91A 3VGFA 1VRXA 4QFUA 3F5LA 1XYZA 1W9DM 2CEQA 4ATDA 4GZIA 2PC8A 1UR1A 2PWGA 1LF1A 5JUVA 1BG4A 1AQHA 3MUY1 4LYRA 3N12A 3AXIA 3B8SA 4HZ6A 3W4RA 4ZE4A 2VZOA 3CLWA 2A3BA 2D24A 2BHYA 2J8FA 1PX8A 4HMCA 1BVNP 2YL9A 4MADA 1LQ0A 4J3XA 2JIEA 3WNOA 1H0GA 4P8VA 5BRQA 4Z2LA 4ZENA 5D8WA 2W92A 3CIVA 4W7VA 2HISA 3J7HA 3OLGA 1E56A 5A6AA 5CQ1A 1HNYA 3MUIA 4HU0A 1OT1A 1JD9A 1B3XA 1ECEA 3AMCA 4LXFA 2ZXBA 3GXDA 2XTKA 4OIFA 1WPCA 3GM8A 5HOSA 4UQ9A 3M07A 1G5AA 1W3KA 1CXFA 3WH6A 1C7SA 2AAAA 2WC3A 4MNJA 1NARA 3KWXA 2BFGA 2WZIA 1V08A 1JYNA 2WMIA 4CVWA 3PBGA 4LYPA 3OA5A 4HA4A 4HZ8A 4D6HA 3PZOA 1HP4A 3PTKA 3W82A 1JI1A 4PTWA 3LMYA 1W9VA 3VNYA 3VDCA 1B1YA 1KB3A 2A3CA 4OKDA 1WZKA 4U33A 3BLKA 4PUEA 1H0IA 1UKOA 3WF1A 4J3TA 1MW3A 5IHSA 5ABFA 4W8BA 2G3IA 1V3JA 3CHFA 1ZBWA 4YHGA 1UH4A 2D22A 3DYPA 3QR3A 3VM5A 3WD4A 4KGLA 1C92A 3KL0A 2G3JA 1G9HA 2ZUNA 1ITCA 3WD1A 2WC4A 1GVIA 2EPOA 4E2OA 3BSHA 5C8BB 2WNWA 3ARYA 5BXPA 1ZJAA 2C0HA 2DT3A 4UOJA 1BHGA 2ZUVA 1V02A 1KCKA 2AMGA 4P7RA 1W3LA 2F8QA 1B3YA 3GBDA 1E70M 3CUIA 2Y8KA 1UD2A 1WB0A 1FFRA 4D6IA 1E6RA 1CGTA 3ECQA 4WIWA 2FHCA 4J27A 1I75A 2YDSA 2Z1KA 3SUUA 3IAPA 2D3LA 3AQUA 4AZBA 1HJWA 2J75A 1CGYA 1Q6GA 1JG9A 3PN8A 1NOUA 4AC1X 2D3NA 1CGWA 5BYWA 1SYTA 3U5YA 2YL6A 1E4LA 4P7OA 1TUXA 2OWXA 3WUGA 1GCYA 2WMGA 3WDHA 1EA9C 5BXTA 1H2JA 2YBTA 5HDRA 3VVGA 4PMUA 4GPNA 2XG9A 4F9DA 1UWRA 1SFSA 1MQQA 4UQEA 1V3MA 1H41A 1OSEA 4UFJA 4OOUA 1U2YA 2AOSA 3W37A 2J7BA 2VMFA 5A8MA 4DWSD 3OIHA 3SURA 1AQ0A 1HT6A 2E3ZA 1PJ9A 4HOXA 1IZJA 1JI2A 1HVQA 3CH9A 1QHOA 1XCXA 4JFVA 1WAWA 1EHAA 1KGUA 1VIWA 1E1FA 2JIWA 5M3WA 3GYCA 1JDDA 3WQVA 4HOWA 1PIGA 3AROA 1QNPA 3W6MA 5JBEA 2BVYA 4KRUA 3AS1A 3BCDA 5KZ6A 4AZGA 1PZ2A 1KXQA 2A3AA 2VC9A 4U2YA 4FMVA 5A6KA 2WMJA 1BG9A 1Q4NX 2CHNA 2ZUUA 4JKMA 2WK2A 3WBAA 3AIEA 1MW1A 4B9YA 3BMWA 4OZOA 3ZMRA 4HPHA 2YA0A 3ALFA 3M6DA 2VZUA 1E5JA 3ARSA 4H7VA 1GVYA 2UY5A 4U5KA 4GINA 1JAEA 3W0KA 1E6QM 3ZIZA 2YLAA 3WL0A 2EPMX 5DO8A 4D6CA 4HP5A 1UR4A 2XWDA 2XVGA 1BYAA 3AZTA 3WDRA 1XH1A 2FHBA 2E8YA 2WCAA 2VVNA 4J7RA 5GQBA 3WN6A 1UA7A 3PZVA 1FFQA 5A6JA 1JL8A 4MB5A 1JFHA 1X1NA 2PWHA 3PHAA 2CBIA 1W3HA 5I3DA 3RJXA 5FD0A 1F4AA 2D20A 4GQRA 1HN1A 3FY1A 1W91A 2WCSA 8A3HA 1QBBA 5DEZA 2GJXB 1Q6CA 5D8ZA 1UKPA 4PMRA 3WDJA 1YHTA 4JHZA 1SMAA 2WHJA 3ZJKA 1UKTA 4JFWA 3KE0A 2VRQA 3ARWA 2CYGA 2DPEA 5CLWA 1UUQA 1E73M 3BAXA 1GW1A 3FHQA 3CGTA 4QP0A 1V6VA 5BWFA 3ZO9A 1MXGA 2X2YA 4CCDA 4DWSA 1E40A 2VTFA 2ZX8A 4ATWA 3FAXA 4M1RA 2XVNA 3WIJA 1UWQA 1CXEA 3WENA 2CESA 1XD1A 1A3HA 4UQDA 2FHFA 4WKAA 2E40A 3EDFA 4YPJA 2VL4A 3S2CA 1OD0A 3M7SA 4RE3A 3VIIA 1UD4A 1D2KA 2VRJA 1UKQA 1UD8A 2JEQA 4HTYA 3VIPA 3CPUA 4MNKA 1V3IA 1KWKA 1O7AA 3WF4A 3CHEA 4FLQA 4GIAA 1V6WA 4P8XA 4AZ5A 2CPUA 4AYSA 1VEOA 2B31A 2DDXA 3RMEA 3NSMA 4C7GA 1KWGA 2XVKA 2OSXA 4BQ2A 2DH3A 1CNVA 1XYFA 3WELA 3B9AA 1DWHM 3N11A 2WVVB 2XFYA 1VBUA 4WLCA 1RH9A 3EMQA 1HJQA 4CGTA 1MW2A 3PZQA 1J0IA 1R87A 5GNZA 2XPKA 4PCSA 4W88A 1UZ4A 1B2YA 4KRTA 2WMKA 1AQMA 1KXHA 1XC6A 1US3A 2CBJA 3ARPA 4IM4A 5FL1A 1DWAM 3VGGA 3VX1A 3VKKA 4AD2A 1BLIA 2ZE0A 3GH7A 1J0JA 2OSWA 1H3GA 2XSBA 2GDVA 3FXYA 3EDJA 3K4AA 3K4DA 3MUAA 1EO7A 4TX6A 2ZXQA 2C7FA 1JIBA 2J7EA 1OBAA 3AHXA 4PTMA 2WVSA 4JHOA 2PI6A 4JFTA 2PF0A 2BVDA 2DSKA 3TP4A 1M04A 3L4WA 3ZOAA 3W29A 4B16A 4AIEA 4LYQA 3MMWA 5M5DA 4AZIA 3WDQA 4UCFA 1W9BM 1QW8A 3WMBA 1GJUA 4P7NA 2BNJA 4HU8A 1ZL1A 3VMPA 3W24A 2XGIA 4S3JA 2J25A 4AZ6A 3VMOA 3ZT7A 3TTOA 1QI4A 4WSJA 1C90A 9CGTA 1K9TA 4U2ZA 1CEOA 2DGAA 1PEZA 2UY3A 2ZXAA 3SCOA 4W5ZA 3NSXA 3UETA 2XM1A 2CIPA 1C8QA 4GI9A 1E6XM 5A6BA 1W9UA 2W62A 3SCWA 5TD4A 2PWDA 3PZTA 3UR8A 3VMNA 4JL1A 5JBDA 1EQPA 4HPGA 2YKKA 4P7LA 3CO4A 3WEOA 4U3CA 1W1TA 1W3JA 4EK7A 3NDYA 4K68A 5I6SA 4WJXA 2J8GA 3GZAA 4FLRA 4Z2KA 5A2BA 5A6LA 4PMXA 3A3HA 3UG4A 3HU7A 1H49A 3T0DA 3AHTA 4XX6A 2J77A 2G3MA 3W6LA 3MSGA 3NDZA 1UYQA 3DC0A 4URIA 1E43A 2YOCA 4PBGA 4JIEA 4CCEA 3BXWA 1WDQA 2VJXA 1ZU8A 2CCRA 1WNOA 1OGBA 2UY4A 4OJYA 5A1AA 5BROA 1JDCA 4X0NA 1US2A 4WKHA 2VR5A 1ODUA 1OIMA 1M53A 3BAIA 4GI6A 3TONA 5GNYA 3HMCA 1U30A 3AIQA 3QHMA 1UQZA 4AD1A 2Y2WA 4B3KA 3G6LA 1UG6A 3NYDA 5LA1A 4FF5A 1FHDA 1V3LA 1O6IA 4BA0A 2V5DA 3W28A 4AZHA 3AI0A 3VINA 1G94A 4MB3A 1NP2A 3OLEA 4GKLA 3RILA 1W9XA 2WWDA 3GNOA 1XH2A 3LPPA 4RL3A 5CXPA 2V3DA 4JL2A 4UNIA 5A95A 1OGGA 3ALGA 1TCMA 4PMNA 5IDIA 3POCA 4XUYA 1BYCA 3W38A 1CXHA 1JF6A 3OGRA 3WD3A 1CLVA 3VGBA 1DP0A 4XZBA 3VGEA 1J10A 3KZSA 4B9ZA 1U33A 1W32A 1UQYA 5HPOA 2W5FA 5I24A 3IJ8A 1KGXA 1QW9A 4N0RA 1C8XA 2Z1SA 2D1ZA 2GSJA 2G41A 5HPCA 4UFMA 3BAJA 2UWFA 2QV4A 4W7WA 1K9EA 1JFXA 3K1DA 3PTQA 2OLHA 5ABFB 1OD8A 4QLKA 1JYVA 4UZSA 5I23A 5C70A 3ZM8A 4RE2A 4CU7A 4GZEA 4J3SA 1UR0A 1PZ3A 4V28A 2V3FA 1H1NA 1OT2A 3WQ4A 4MPKA 2XYLA 3AS0A 5CSUA 1TE1A 1E3XA 2ZXDA 3O2LA 1MWOA 4MB4A 2BV9A 5A6MA 1J9YA 2QPUA 1PIFA 4FK9A 3SCVA 3EYPA 1ZS2A 3FAWA 2QF8A 4ZXOA 1V0KA 2X09A 2UY2A 2WKGA 2NT1A 4QCFA 3QGVA 4M80A 4D1JA 3FNDA 5E0CA 1DTUA 1Q6EA 1TZ7A 2JFEX 2YBUA 1ITXA 4UTFA 1HKIA 3TTSA 3SUTA 3L2LA 3VD4A 2VRKA 2WSPA 2E9BA 4S3KA 1KR1A 2V3GA 3VTRA 2WSKA 3VD3A 3WD2A 2JE8A 3HJEA 1FOBA 1QNRA 4W8LA 4JCLA 1BGAA 3CUFA 3QHNA 5AC4A 3VGDA 3TTYA 3N13A 1J11A 3WMCA 3VDBA 4TOQA 1V03A 2ZX7A 4AD5A 5EFFA 3PZMA 4W8AA 1HKKA 4W93A 2Q8XA 3ARQA 4PTXA 1ZJBA 2ZX9A 1LL7A 2GK1B 5DT5A 4JKLA 2J79A 1LLOA 3CMGA 1FP9A 1NOFA 3WH7A 1WP6A 3UESA 1EO5A 2XFRA 5FKYA 3WDPP 4UQCA 2CNCA 3OGSA 3ARTA 2X0HA 2ZX6A 3L4YA 1KGWA 2VCBA 7CGTA 3T0BA 2DSVA 3MV11 5HXMA 3WNLA 3ARRA 2NW0A 3SUVA 3GDBA 3IANA 1QNQA 4H2CA 1E0XA 1MQRA 4P8UA 2O9RA 1LL4A 5JIPA 3THDA 1OGSA 2ZX5A 1GORA 4D6FA 2YL5A 2WBGA 3VIJA 1EOKA 3AZSA 4QLJA 4UFHA 3WKZA 3BGAA 5E6YA 2FH6A 5IFTA 1UR2A 1WDRA 3AYRA 3GBEA 2BS9A 1HL9A 5D9PA 1E9LA 1EXPA 3AHZA 4BZYA 1JF5A 2OSYA 1P6WA 2XUCA 2CERA 4GO8A 4PMDA 3AIRA 5D9NA 3TOPA 3BSGA 5AC5A 1PBGA 2YJQA 5HBFA 4GO9A 4WKFA 4UFIA 1KFWA 2J7HA 3T2PA 2VQTA 1NM9A 3EMZA 5F7UA 1QHZA 1B3ZA 4PSPA 3VD5A 4GQQA 3WEZA 2FGZA 1TA3B 1J0HA 3BAKA 3RO8A 2A3HA 3CHDA 4ZEPA 2OYLA 4W85A 1ISWA 3VX0A 3AICA 3WQ5A 4PMYA 1WKYA 2RGMA 1QNSA 3MV01 3SUWA 5EMYA 4QLLA 3KEHA 1HJUA 4M82A 1HJSA 1E72M 1UKSA 3NIYA 1R8LA 3WBEA 3VIGA 3L2MA 1ISVA 2XIIA 3F4VA 2G8ZA 3IK2A 1HIZA 4D6EA 1UR8A 3WNMA 1Z32X 3VIHA 1NQ6A 3I3DA 2VCAA 4BQ4A 5I5RA 2O9TA 1GNXA 1TFVA 4ML4A 4YN5A 2J74A 1WZMA 1VB9A 3GXMA 5DMYA 3SCRA 5AY7A 3VD9A 2VO5A 2VX7A 1KR0A 5BXSA 4AW7A 1LL6A 2JF6A 3IAQA 3LPFA 3MANA 2F2HA 3VPLA 2JF7A 4JAWA 3WFZA 2X05A 4V2XA 1VJZA 1QPKA 4J28A 2CBUA 2Y5EA 4AZCB 1OCQA 1FA2A 1GOQA 3OGVA 2OYMA 3OB8A 1FH9A 3K46A 4EANA 3G6MA 3AS2A 4PTVA 4JFSA 4LX4A 1LG2A 3DYMA 3OZPA 1W9PA 2W66A 5A94A 3ARZA 1H11A 1GOKA 3PZIA 1E6SM 3UG5A 5D4YA 1B90A 3CUHA 2XIBA 1ISXA 1DWGM 2YA2A 1JYWA 3CZKA 4DUVA 2XFFA 1DEDA 1PAMA 2VURA 3K8MA 3WL1A 1XCWA 2YDRA 4A4AA 1GOOA 5I78A 1UOKA 1JZ2A 1J0YA 4TVCA 1GHSA 3NCOA 4GZJA 5BCAA 3MU7A 4E8CA 3ZR5A 2WPGA 3AMKA 2DT2A 4YHEA 4EKJA 1WCGA 3UERA 3BAWA 4WK9A 5JBFA 2PWEA 4IISA 4D6JA 1BFNA 5KEZA 2PB1A 3RPMA 4QDMA 3OBAA 3GH4A 3T09A 1CXIA 5D9OA 1TG7A 3BMVA 5ABEA 3EMCA 1DWIM 2V38A 4MNLA 3AOFA 1VBRA 2Y8VA 1E6ZA 5LA2A 3CZJA 1B30A 1CBGA 2XM2A 4P8WA 5BXRA 4UR9A 1Q6DA 4J3VA 4M81A 4R27A 1UWIA 3JUGA 1D7FA 2GDUA 4CKQA 4HA3A 2VOTA 2WAGA 1R7OA 5CSYA 3WUFA 1DWFM 1UZ1A 5AYIA 2EPLX 1JZ7A 1QI3A 5CGMA 3D3AA 4TTUA 4ACYA 2YLLA 3THCA 1LWJA 1TR1A 1XRVA 1JD7A 5LYRA 1GOIA 3NSNA 4DWSC 1GPFA 3A47A 3WUEA 4X0VA 2EEXA 3I3EA 4JFUA 4M29A 1VFFA 1HJXA 3CMJA 4AWEA 3VO0A 2ZWZA 4BQ3A 4FLSA 1WZLA 2IXUA 2ZUSA 1MFUA 2IUZA 4FLOA 3GXIA 3WF2A 4AEEA 1LWHA 2XVLA 3WF3A 5ABGA 2GJRA 1JXJA 3QOMA 1TVPA 1JDAA 4ZFMA 4AISA 2X8RA 4NF7A 3MKKA 3AXHA 3GNPA 3A4WA 4F8XA 1BYBA 2J4GA 1JXKA 2ZICA 3EDKA 2DSZA 1VF8A 4LQ1A 4MAZA 4W87A 4Z2IA 3VUPA 1FH8A 3E1F1 3WEMA 4MDOA 1QHPA 3POHA 4PMZA 4XV0A 1WZAA 2CXGA 2WMHA 1GHRA 2J47A 1GOMA 1BTCA 5A2CA 3UEQA 2Y24A 2WZHA 2V5CA 4PMVA 3FHAA 2OWCA 5I77A 4CD5A 3CZGA 3RM4A 4W89A 3F5JA 1CXKA 3L4ZA 1XH0A 3DECA 2EBNA 1ZBKA 2VX5A 1J18A 2WC7A 1V6YA 4MNMA 2FDMA 1ESWA 1JZ6A 1K9DA 4MJ2A 1EIBA 1R86A 1XHGA 2E4TA 1I1XA 2G3NA 4KGJA 1NWUA 2VX4A 1PX3A 1E6PA 4DM1A 3PZGA 3AMDA 1EOMA 5IFPA 2A3EA 3LPOA 1C3FA 3N17A 1IV8A 4U3AA 4RE4A 4TVDA 2D23A 1ISZA 1VAHA 4MDPA 3T2OA 2CKSA 3RJYA 1D3CA 5HNNA 4EAMA 2J7DA 3DHUA 4XZWA 4BF7A 3AMGA 1GQJA 4JZ5A 4ACZA 1JZ4A 1XSKA 3AYSA 1V0MA 3WSUA 2HVMA 4NRSA 4IPLA 5I2UA 1BPLB 2DSWA 2WLZA 2VVSA 2YIHA 2BHZA 1KXTA 8CGTA 1AVAA 1AMYA 3WH5A 1RP9A 3A4XA 3WMSA 3GNRA 3WNPA 1VEPA 4UOQA 2E9MA 2BY3A 4BS0A 1TVNA 4AD3A 4PMQA 4KWUA 2XSAA 4W7UA 1WDPA 2YDQA 4UFLA 2V3EA 5A69A 5A8PA 3BAYA 3W25A 3T2QA 2WCGA 2BHUA 4F9JA 3GXFA 5A8QA 1CIUA 3WQ8A 4Q7NA 1UR9A 2VZSA 1ODZA 5CG0A 2D0FA 2J7CA 1EDTA 2WLYA 4CN1A 4H41A 1V3HA 2RGLA 3B9EA 2XGBA 4UQBA 1NWRA 1R85A 3ZSSA 4L4OA 4IUGA 5CZKA 3MSDA 2F61A 5CPQA 3A6OA 2BXYA 3AIBA 1QOXA 2WHLA 4TUFA 5A2AA 4CD7A 3WF0A 3VGHA 2VZTA 4AXNA 2VZVA 4PSRA 3VNZA 3KL3A 4AIOA 2GJXA 4Y7EA 1KCLA 1JZ3A 3EDEA 1DWJM 1MVYA 4F79A 4QCEA 2E8ZA 3T0AA 3ZSTA 1UHVA 1JZ8A
chains in the Genus database with same CATH superfamily
1VP5A 5IHRA 4K7VA 4AMAA 1SGJA 2OMAA 3TFCA 3ZVHB 3DCPA 2J7GA 1S2TA 2J62A 1XDJA 1CDGA 1JGIA 3PTMA 4NNAA 2QCEA 4KMQA 1XS2A 5I03A 2O0TA 2VC7A 1I2PA 4A8IA 1UD3A 2FIQA 2J9ZA 5FIPA 3MC5A 4HNNA 3SSJA 4GJ1A 3UFYA 5C71A 1LQ2A 2HTMA 2WMFA 3SY1A 4LF2A 1FHLA 5D02A 4HHPA 7REQB 3S6TA 2CITA 1EDQA 4EXAA 4AAJA 3PJUA 3P0XA 3IRSA 1F07A 3H6OA 1RVKA 3ATZA 1XGEA 3U2CA 5FCZA 4QHRA 2OKTA 5GNXA 5EYWA 4CNUA 4MTVA 1TRIA 3UZJA 2OG9A 4OUIA 4AVNA 1W5OA 1KFBA 4F48A 3E49A 2O9PA 3QHOA 3AS3A 1H1YA 2RDWA 3DERA 4AWSA 4DO5A 3GIQA 4W5UA 5JIWA 1OFDA 5FJRA 2VEKA 1SMDA 1TV5A 2WW5A 4IH3A 2O4QA 2QMKA 1GYMA 1EYEA 4JCMA 1ICPA 1IE7C 3TMQA 4R85A 1LOQA 1E1CB 4U10A 3PULA 2X1IA 3HPAA 6A3HA 2WZEA 1EPXA 3E3HA 4LC6A 4HMDA 4FNUA 1KBKA 3NTYA 4MYXA 2AQOA 3N2MA 1X7IA 3FX4A 1R6WA 1SR0A 4GUIA 1YKWA 5BZAA 5FF0A 5E0KA 1GQIA 1BAGA 1XLEA 4WDWA 2WWCA 2FZ8A 3HV9A 1FP8A 2XGZA 1GQLA 3S4TA 1OZQA 3EDDA 1F8MA 1BEUA 2J7FA 2CBVA 2CHOA 1HX0A 4H9YA 3PFRA 3LRLA 2VT0A 2EKGA 3KW3A 1YBQB 2BVWA 4O52A 4CU8A 3U2ZA 1R38A 4OBSA 1W1VA 1OK6A 5DCEA 3BOXA 1XICA 4AIUA 5REQA 1FDYA 3LCFA 1L8NA 2Q01A 2A6LA 1B3WA 5BNKA 3ABXA 4NJJA 3UPMA 1QI2A 1TIWA 1Q66A 3THAA 2C14A 1W1PA 3SCQA 4EPDC 3A5FA 1HUVA 1D8CA 2NSXA 2DJXA 4HNUA 1FWRA 3TXZA 3LLXA 1G1YA 5IM51 3BLFA 1AK5A 3UA3A 2WANA 5JQ9A 2ZRWA 3LX9A 1IXOA 1HVXA 3L4XA 4Y9OA 1I4NA 3NM3A 3RXZA 1TTPA 1X6LA 3F4NA 4ALDA 1O60A 4DJEA 8XIAA 3CZ8A 2DT1A 3NQ8A 1W8SA 1JYXA 3BQ6A 3L0GA 5A6TC 3LCXA 1XGZA 1Q4WA 1J2BA 3RM9A 3VDGA 1IEVA 2FFCA 1DOSA 2WHKA 2YL8A 4NX5A 3WQCA 1PDZA 1FBAA 4UQAA 2PBOA 5AVHA 2F6XA 1R2TA 2C19A 4H04A 5T26A 3EA3A 1E4NA 3MHFA 4H1ZA 2MANA 4S1FA 2FTPA 1YPXA 2ACUA 2R6OA 3LZ5A 1B0IA 4MAVA 3AHYA 3W7CA 5FL0A 4JICA 1NDWA 1DHKA 4A3HA 5L6UA 3GKAA 3OLIA 1TVLA 1V3KA 4LYKA 4GHRA 1WXZA 2DZXA 4IQJA 4NI3A 2QGYA 3AXXA 5AOUA 1C91A 1HXJA 1EDGA 1E15A 1IEXA 2EF9A 2P8BA 3QOKA 4YWIA 4CCCA 1W0MA 1EEPA 4PEEA 3UJSA 1UCWA 3R0KA 1RY8A 2VCCA 1W3TA 3KHJA 2ZUTA 2JKPA 3UT0A 5DY3A 4IIFA 2UBPC 4YWSA 1OB0A 1X39A 4YIWA 4CN6A 4TV5A 4I6VA 3URAA 3THQA 6TAAA 1QR7A 1XRFA 3W71A 5HMDA 2Y63A 3HPSA 4XTDA 4JTCA 3AMLA 4C1KA 2HV5A 4ZTYA 2QW5A 3A4JA 3R94A 4DM2A 4QDPA 1TO3A 3WO8A 5CC5A 1UWTA 1CLKA 1QK2A 3GS6A 1G4SA 1ISYA 3NQ2A 1GUVA 5FEWA 3GB6A 1MSSA 4W84A 1SUXA 2JALA 4XB3A 3M0XA 3T78A 1FCVA 4PE8A 3PK7A 3R13A 3VDAA 1QFEA 4IQDA 4QR6A 1PX4A 4WSHA 4IP5A 1SZRA 2BY2A 1QI0A 5CC7A 1IZCA 1WDSA 1KV8A 2O92A 5E0FA 4Z2JA 1H5VA 3R8RA 4HSHA 3HV8A 2C91A 1K9FA 3MCOA 1HJVA 4TXEA 1UA3A 3CAQA 1K8XA 4L9YA 4TX8A 2B81A 4L80A 1M41A 4GXMA 3IGXA 1Y7VA 3DG6A 3WBYA 5J8LA 4HYWA 4LH8A 3BK0A 2EXOA 4UFKA 2DH2A 2HPIA 4AY1A 3C0SA 1LZOA 2VP8A 4R9OA 3WZ0E 1OEPA 4JOMA 4MFEA 4JN6A 3TTQA 1Q2RA 2OYKA 1KBBA 3PS7A 3CQKA 2V69A 2XIJA 3CZEA 3WQFA 1XV8A 5HWMA 4HSNA 1GVSA 3QM3A 5DY2A 2WB5A 4CU6A 2AL2A 3R0DA 1UWSA 3MO4A 5DT7A 4LS2A 1W54A 5I0DA 1E5NA 5D04C 4ATLA 1SZGA 1VEMA 1Q6FA 3NUKA 1IXNA 2BTMA 1XSJA 1JZ5A 4JNMA 2XHYA 1WV2A 3QBUA 4Z2HA 4QIUA 2GWNA 2A7NA 4WEVX 1X1OA 2ZWYA 5C7VA 3KX6A 2E9LA 3QSTA 3W7LA 3MA8A 2KX9A 4N42A 1BVWA 1TPFA 2D0GA 2YB4A 4XKYA 3BH4A 2HJPA 1KRMA 3AFBA 2W91A 3S1XA 3KRSA 3VGFA 3SIZA 7ENLA 3S1VA 3F5LA 3R10A 1L9WA 3UGRA 4BKNA 1JCYA 3WLIA 1H1ZA 2PWGA 3LK6A 1DVJA 1I0BA 3MUY1 4LYRA 1JUEA 3W4RA 3LTSA 3CYJA 1AJ2A 2A3BA 3M16A 1M3UA 1LBFA 4RLIA 1BVNP 2WKJA 3W1QA 2PDPA 4J3XA 2JIEA 4P8VA 1J2WA 4H00A 5D8WA 5FF2A 2TSYA 2QUVA 2VM8A 1VCGA 1IXPA 3OLGA 1E56A 3TFXA 5HNTA 4CQBA 3E2SA 3G3DA 3LSBA 5A6AA 2C18A 4I3GA 3GG1A 1JPIA 2D2JA 2GQ3A 4KWOA 2H9AA 2W0UA 3AMCA 1JRBA 2XTKA 1U22A 1G4TA 2TODA 1A5MC 3M07A 1W3KA 1VFTA 2WC3A 3R58A 3R89A 2Z2BA 3KWXA 4GQGA 1PIIA 2IPJA 4HHLA 1V08A 1L6SA 3PUGA 1QASA 1GVFA 3D6NA 1GVRA 4HA4A 4HZ8A 1HP4A 4O1EA 3LMYA 1R9YA 2XN0A 4ML9A 4FOJA 1KB3A 3MJYA 3QTGA 3ATYA 1XLMA 1H0IA 3EA2A 1PKMA 3ID7A 3NO1A 4J3TA 1MW3A 5IHSA 4A8LA 3P3BA 3UZWA 4QTGA 2BP1A 3BZJA 1EL3A 4YHGA 3HGOA 4YYCA 3VM5A 3NWRA 3Q65A 2V0TA 1A5NC 3GK0A 4L65A 2IQ0A 4WUIA 1EIXA 1GVIA 1UW9A 4JS3A 4GG9A 4NXSA 3S42A 4QE1A 4C5YA 1OYCA 2EPOA 3KOXA 4E2OA 5IRPA 1QAPA 5C8BB 2WNWA 3ARYA 5BXPA 1T6MA 2QAPA 4MZ8A 2ZUVA 1SZFA 2QS8A 2YXGA 4LBRA 5FJOA 2Y8KA 3I7RA 3KRBA 4NL1A 1UD2A 3CL6A 4MVAA 2R9RA 4J27A 2FHCA 3N19B 4UC5A 3TQ0A 4UTIA 4QEEA 1LROA 2D3LA 4PCNA 4AZBA 1HJWA 1XCFA 3DOPA 4YCOA 1CGYA 1KBIA 3PN8A 1NOUA 1CGWA 3FA5A 1TREA 4R7WA 4H9MA 3U5YA 1E4LA 1Q3NA 3WUGA 1EA9C 1H2JA 2YBTA 4PMUA 4GPNA 3V18A 5EPDA 2VC5A 4UQEA 1H41A 1KRBC 4LF1A 2F6KA 1NELA 2ZTJA 3TCSA 2VMFA 3B05A 4DF2A 3K13A 4KEMA 5C9XA 2E3ZA 4O54A 1V93A 4GIEA 1JI2A 2P76A 4N4QA 1XCXA 1DJQA 1MUWA 4XIMA 1WAWA 3PJTA 5BOFA 1RY0A 1E1FA 2JIWA 1EJTC 4XIAA 1O5RA 1JDDA 2FPTA 3TJLA 3EB4A 5F4XA 3ZLHA 2BVYA 4KRUA 4FF7A 3VCNA 4FO4A 2A3AA 2VC9A 4U2YA 4FMVA 2RHGA 7REQA 1BG9A 1K77A 4XBKA 3W7MA 4BEUA 2QJHA 3QZEA 4JKMA 3WBAA 3AIEA 4B9YA 3R5EA 1XG4A 4DX3A 3M6DA 2VZUA 4H9TA 3OA3A 3ZIZA 1YIXA 3WL0A 2EPMX 5CH9A 4D6CA 4HP5A 3E2RA 4AU0A 3VOIA 4J7RA 5GQBA 5AHMA 1UA7A 4MB5A 2Z4GA 2PWHA 1IXQA 4O14A 2ZA3A 2CBIA 1W3HA 1D3GA 4QS6A 2DZTA 5FD0A 3XIMA 1F4AA 3ITGA 1PE1A 3N4AA 1W91A 8A3HA 4BI5A 4S23A 1AUSL 5DMLA 2YPIA 3I65A 4GYKA 3H4XA 4PMRA 3B0XA 3B0YA 4DBDA 4JFWA 3WJXA 3A3XA 1PKNA 3BMXA 1Q6OA 4CQ8A 2FPVA 5CLWA 1UUQA 1K1DA 3FHQA 3CUXA 2FLIA 3FVMA 4BFAA 2X2YA 4ZOAA 3UBPC 1A5CA 2VTFA 4ATWA 1TQXA 5EMLA 2I14A 1NFGA 3SY8A 1UWQA 3L0KA 2E40A 2VL4A 3HQNA 4QRNA 3RK8A 3M7SA 3TLLA 3VIIA 3TWAA 1UKQA 1MEIA 2H90A 3VIPA 1E9IA 2J6XA 1KWKA 2EPHA 4CNTA 2VHLA 1XISA 2PUZA 1SZEA 4P8XA 4QROA 2CPUA 3K2GA 4UTKA 1AW2A 3P5ZA 3NSMA 3T9PA 5G1YA 1KWGA 2XH0A 3P80A 2DH3A 4XVDA 1RBAA 1US0A 3UNDA 5U4NA 2Y70A 3FDGA 3UYCA 3N11A 1G7VA 2V30A 3N4EA 2XFYA 1RK5A 4CGTA 3PZQA 1R87A 3GE7A 1TPDA 1UZ4A 5G4EA 3WLMA 1AQMA 2VR2A 1O5KA 4IM4A 1BLIA 2ZE0A 5HUPA 1H3GA 2GDVA 3EDJA 3MP3A 5C5YA 5TF0A 2J7EA 1A5AA 2VFIA 3R1ZA 2B0MA 4H19A 2BVDA 3W7RA 4DJDD 3UNTA 4AB4A 1S2VA 4JX4A 4QBXA 1BXNA 5LHEA 5F4SA 6XIMA 1QW8A 3UPWA 2BNJA 4C6IA 2CLFA 2OJPA 3W24A 2F7FA 3VMOA 1KRAC 3RYSA 3PM6A 4EVZA 4XSMA 3M43A 5LSMA 4WSJA 4JN8A 2PF8A 3H2CA 4GUJA 3UR5A 2PU0A 2DGAA 3EAUA 3UETA 2XM1A 3HO8A 3H4GA 4LBUA 3PZTA 3TDFA 2YKKA 3WEOA 3CO4A 4U3CA 3A9BA 1G4PA 3TUUA 4RZBA 3NDYA 2OEJA 4Y9MA 3E0IA 4KEZA 2EG6A 4C6EA 4PMXA 3A3HA 5CEWA 2Y7DA 1H49A 1CI1A 3S3GA 2ISFA 4HJFA 4N9BA 1D8WA 3TAKA 4URIA 3BDKA 1QPNA 4UTUA 4CCEA 1F3XA 1TWZA 4HVXA 2FZBA 1ZU8A 1VC4A 4RNIA 2OZ3A 1IWAA 1LCOA 2YFOA 1NF0A 4OJYA 4ZO9A 4WKHA 5F4WA 1UASA 4D8ZA 2VEMA 1M53A 3SN4A 2QJNA 1MI3A 3G18A 2GQAA 3HMCA 5GNYA 1U30A 2QR6A 2ADAA 3AIQA 4NX0A 3QHMA 1UQZA 3AXMA 2GSHA 4RR4A 4AD1A 4TMCA 2PDKA 5IBXC 1M68A 1XKYA 4FF5A 2C1HA 1O6IA 4N9DA 1GW9A 4XWUA 2V5DA 5LXXA 3AI0A 1KA9F 2IPFA 3VINA 1C9DA 2P10A 2WQPA 3OLEA 1VBJA 4K3ZA 4LB3A 3LPPA 5CXPA 2V3DA 5HMSA 2QDGA 5G2WA 4KWVA 2X1UA 1TWSA 4L5ZA 2QIIA 5HJXA 2QGHA 3OU8A 4PMNA 3POCA 3CHVA 4XUYA 1CXHA 1JF6A 3VGBA 1E1CA 3WLNA 4UNLA 1XIIA 2FQIA 3AC0A 1UQYA 1YXDA 3PBVA 4YLWA 2W5FA 1W17A 1KGXA 2ZVIA 4IQLA 3ZZ1A 1C8XA 2D69A 4LAZA 3FFSA 1AZ1A 3W1AA 1P0NA 4W7WA 3K1DA 1W6TA 3KLKA 5ABFB 1JYVA 4Q8NA 4LT9A 2D2GA 4RE2A 2GLKA 5H6HA 4DVOA 1TTJA 2JGYA 4IJBA 1H1NA 3STFA 3GDLA 1Q6LA 5CSUA 2QJMA 1E3XA 1THFD 3SQSA 2ZXDA 3KXQA 5FJPA 2BV9A 1AD1A 2QPUA 1EJRC 3EYPA 3FAWA 2V5KA 2E77A 4O1FA 3EOEA 1FWJC 2HNEA 4ZA0A 2RDXA 4M80A 3E9AA 1M6JA 4QITA 1DTUA 1EP2A 2JFEX 3NQAA 3TTSA 1BXCA 3DFOA 3VD4A 3QGAC 4IL0A 3B8DA 1XLFA 3S9IA 4S3KA 4DLFA 1O94A 1UWAA 1JUKA 2XN1A 2REQA 2ACRA 3HJEA 1FOBA 4W8LA 2HBXA 2OTDA 3RHGA 3CUFA 3PBMA 3R7MA 4M1BA 1UP0A 3M0HA 2I17A 2QDEA 3TTYA 1J11A 3M0IA 2CU0A 3WMCA 3UF9A 3VDBA 1POKA 3DFTA 4WQ6A 3REQA 4GNKB 1VYRA 2VGIA 1YMYA 3KCJA 3QSRA 1DQUA 1GVQA 4IMFA 4E2DA 3PZMA 3T4WA 1XX1A 5HR7A 1VPQA 1PHWA 5HNUA 2BWGA 1X98A 2ZZ2A 3B8WA 3TQVA 4JKLA 4JY8A 1O12A 3B97A 2NWRA 2LLEA 1A5OC 3RO6A 2HEJA 1TELA 3U3HA 5FJUA 4HPJA 2Z7KA 3HG3A 3WYZA 2HS8A 5FKYA 4JTGA 3B0VC 2WJFA 1UB3A 1XYCA 2X0HA 2ZX6A 1KGWA 4GYPC 1A5KC 1XINA 3Q58A 3ARRA 4IPPA 3LBMA 3TYUA 4MWAC 1BRLB 1RALA 4KFOA 3E2QA 4PTNA 3LBOA 5JIPA 1OGSA 6TIMA 3HBLA 3GD6A 4MPQA 3GU9A 1KO0A 2J13A 5EKYA 3Q2DA 1UR2A 3GBEA 1ZALA 3G1DA 2OSYA 1FRBA 4PMDA 1EBGA 3AIRA 3GVVA 1H7RA 3CT2A 3CWNA 3TOPA 3I6TA 1W5QA 2YJQA 4MM1A 3FK4A 1H7WA 3LV6A 1MZHA 3CIWA 1F6PA 1QHZA 2PEVA 2DVUA 3GTHA 3KOWA 1J79A 2NQLA 5DCBA 1M65A 4GQQA 3WEZA 1TA3B 2Z25A 5MKGB 1J0HA 3OTRA 2Q3OA 4P61A 2BGQA 4A21A 5TNVA 4W85A 1ISWA 3GG7A 4GVHA 1VLWA 8TIMA 1MNSA 3W1XA 5EMYA 2OKOA 4QLLA 4HSOA 1HJSA 5HK4A 1PV8A 1CT5A 4LJ3A 5D05A 2ACQA 4ZO7A 1IWBA 1V4YA 4ADTA 5HQEA 4B4FA 1ISVA 2H3DA 1O5QA 4JTTA 1JPDX 4LWWA 5CCZA 1PHQA 4UMAA 1UR8A 1R3SA 3VIHA 3Q45A 3T0TA 3HJZA 2Y5SA 1TFVA 4YN5A 2GVGA 1XBXA 3RNDA 5DMYA 4NVTA 4L1WA 1B57A 1AJZA 3GAKA 3I68A 2VO5A 5DRIA 1KR0A 2PDLA 4YTSA 3NEHA 3IAQA 3LPFA 3TXVA 1WXJA 4JAWA 3WFZA 2QCNA 3EOUA 2QYGA 3IUDA 2V5JA 1IHIA 3DG3A 1DIDA 1KM6A 3OGVA 2OYMA 3QPYA 4OECA 4H83A 3VZXA 2OOGA 4EANA 3AS2A 4PTVA 5K3VA 2QVHA 3PAOA 2E1DA 1JDFA 5CG7A 1GOKA 3FJLA 5H2ZA 1SW0A 1ISXA 2YA2A 2RDTA 3OZYA 1KM3A 3CZKA 3N3TA 4DUVA 2NV9A 9XIMA 1XCWA 4A4AA 3G77A 2W79A 2VDHA 3MB9A 4XO6A 1YYAA 3WLHA 2NUXA 4HQVA 3ZR5A 1G67A 1I2QA 4K1WA 2WPGA 3AMKA 1QCWA 1WCGA 3STGA 3UERA 4L4MA 3BAWA 2PWEA 4MF4A 1SZNA 3P6LA 3MPGA 4DJED 4D6JA 3FGCB 3ITLA 1KBLA 2QUTA 2J24A 5AC6A 2PB1A 3RPMA 3OBAA 3GH4A 4E0CA 2Z6JA 3SGUA 3PSWA 4JIRA 3LI1A 3EMCA 3NQDA 1FWSA 5IOBA 1F9CA 4RW5A 2GSEA 1B30A 1XYAA 1PXGA 4KEUA 3W1NA 2XM2A 4P8WA 1KBJA 2Z2UA 3SB0A 4GIRA 4R27A 3JUGA 1QTWA 2GDUA 2FVKA 4HA3A 3KVJA 3WX7A 5CSYA 3WUFA 1DWFM 2PWVA 3GR4A 1QI3A 3D3AA 2YLLA 1KM2A 1LWJA 5LYRA 1JD7A 2EEXA 4JFUA 3G1AA 4POCA 1R5YA 4IUOA 3SFWA 3IJDA 5LKYA 3W7DA 1LORA 4BQ3A 2QEZA 1WZLA 4HBKA 3S0CA 4FLOA 4TU1A 3OVPA 4Q7BA 4CQDA 5C2XA 2ZYFA 3ANVA 3QR1A 5ENLA 3EKZA 5G4HC 3P82A 3CAWA 1T8XA 4UTWC 1PVNA 2RUSA 2OLAA 3D47A 3EDKA 2DSZA 3BVJA 3OVRA 2HPMA 3FXGA 3WEMA 4MDOA 1Q7QA 3JS3A 1QHPA 1WZAA 2VEGA 2WMHA 4NZ1A 1GHRA 4Z1AA 2HROA 4LS0A 4PBEA 1WXYA 1PDYA 4JTJA 3W74A 1A5UA 3PUDA 4N6EA 4NNBA 5HUOA 1MUCA 1X6UA 3RM4A 3KRZA 1D3HA 3F5JA 3SGZA 1CXKA 4LAUA 3L4ZA 3RR4A 3GIYA 4M51A 2V67A 4Z1YA 2VX5A 4AVFA 1JZ6A 2FDMA 1ESWA 2A5HA 3USBA 1XLIA 3LZ3A 3WLQA 1XBVA 2E4TA 3LNPA 2PCEA 4KGJA 2IQTA 1EC8A 2VX4A 1E9YB 1VHNA 1E6PA 2C1GA 3T81A 3AMDA 2X1RA 4A3UA 1K70A 4DLMA 1IV8A 4U3AA 4JTUA 3NOEA 4RE4A 4G6CA 3DDMA 2VUNA 4OGZA 2OODA 4CQ9A 2I56A 1D3CA 2J7DA 2NVDA 1DJIA 1KFLA 4XZWA 1F6YA 4PCPA 4JHMA 4KCVA 3LA4A 4HN8A 1IWPA 4H6EA 1K4GA 3MP4A 4EPKA 1XBYA 1TTQA 1VRDA 2VYOA 3FA3A 2E6AA 4Y8FA 3T0CA 4A6GA 5JH2A 1R3RA 1TPEA 5I06A 3WNPA 2DORA 2E9MA 4DI9A 1ZNNA 3N2BA 4AD3A 4PMQA 4Q4MA 2ACSA 2XSAA 1WDPA 2YDQA 2V3EA 4K36A 4ILSA 3DZ1A 4ZQPA 3HMJG 2BHUA 3W23A 1YDOA 3GXFA 5A8QA 3QPEA 4XD6A 1O1HA 5D09A 2D0FA 4DZIA 4KCWA 4E6MA 3VOJA 1EDTA 4CN1A 1EWDA 1V3HA 4WVXA 2RGLA 2WV8A 1EJSC 1FWDC 3B9EA 1Y5VA 4OV9A 5HNRA 5K2ZA 4IUGA 3MSDA 3SQLA 5CPQA 3A6OA 2BXYA 3AIBA 3I7SA 2F9RA 2WHLA 1GEHA 4FX7A 3MJMA 4J1OA 2VZTA 4AXNA 4V1YA 2VZVA 3BLLA 4HYRA 5CJNA 2R14A 3WK1A 6XIAA 4PUKA 3KL3A 4S3CA 1KCLA 1JZ3A 3STPA 4QJ3B 5C2GA 4QCEA 1BQGA 2E8ZA 1DV7A 3T0AA 1JZ8A 3QEZA 4B5WA 5AZ1A 1N82A 2OU4A 5FOOA 5I79A 4WF7A 4D72A 4D2JA 3AO0A 4HPXA 1DJNA 3P67A 4UTJA 1CZ1A 1RUSA 4REQB 4E3TA 3IJ7A 3WLRA 2PGWA 4HNLA 3UP8A 1NDYA 3OW1A 4EAYA 3QVQA 4H2HA 3EX4A 3VD7A 1P0BA 3GYEA 4WXZA 5LZLA 1K8YA 3S1WA 2QPSA 1OYBA 4AMCA 4F66A 3BLEA 2QV5A 3QKZA 3F5KA 3C2EA 3OYZA 5CAHA 2ESCA 2BLEA 4QSHA 3H8AA 3WD0A 2Z6IA 4NU7A 3T55A 2GFTA 2ZZ7A 2QLYA 1A53A 5A8OA 3FW6A 1PS9A 5DFAA 2EPNA 3AWOA 3EWCA 1UOZA 4QAWA 3CASA 3T40A 1QOQA 3IJ9A 1TX2A 2C8NA 3LCHA 5LA0A 1W37A 1EGMA 1E55A 3EKGA 3M46A 2YYTA 2J78A 4E4PA 5KZDA 4K8GA 3SAZA 1TZ9A 4X61A 3CV6A 1KQZA 3EOOA 5TAOA 5EMJA 1BF2A 3TN4A 4NZFA 1KFEA 3B0UX 4WGXA 4PUDA 1OWQA 2V2CA 5A3HA 3UW6A 2DZWA 3VABA 3GUGA 4H8VA 2E28A 3ZJ6A 2QULA 2PPGA 1CENA 1M9HA 3QMTA 3NR0A 1PWMA 4ZE5A 3LU2A 2FYMA 3U57A 4LNYA 4UTTC 3U4FA 1L6FA 5I07A 3ZVIA 4B5NA 2ICSA 2PDBA 3MZNA 5ECUA 5HJLA 3FYYA 4ACZB 5HWJA 3W84A 1ONEA 4JPGA 1H7NA 2PD5A 3XISA 1J96A 1M7XA 4MLRA 3P14A 1NH6A 1IEWA 2POTA 3NOYA 2CETA 1RD6A 7A3HA 3OVQA 2VI0A 3NQVA 1UIPA 4KESA 5DXYA 1KXVA 4DJFA 2OZTA 6CGTA 1QNVA 3SRFA 1XR2A 1I0DA 1OM0A 2FVMA 1VFUA 3ARXA 4GXPA 2R91A 3R0UA 4TQTA 1MW0A 4MLJA 2X41A 4AZCA 3UD6A 3ZR6A 4UB9A 1MXDA 2WYSA 3O1NA 4GVFA 4HMNA 3AIWA 4MKVA 1NQKA 1BRLA 2XZ7A 2XSXA 1DQWA 1MYRA 1SPQA 5F2LA 3UG3A 2Y4SA 3LPGA 3WFLA 3TC6A 3QZ6A 3SEPA 3W70A 1XD0A 2QZRA 4D8LA 2BODX 2AAMA 1BQCA 4JTSA 3W75A 4O18A 1RP8A 4DF1A 1XIFA 3ITCA 5FAJA 2V9DA 1H09A 3P74A 4H8UA 1SR9A 1F4HA 4TVUA 4IPNB 1I1WA 2V8ZA 2J6VA 3O0KA 1ZAIA 4OU1A 4XUGA 4B91A 4DELA 1SO6A 1NJJA 3FYPA 3LOTA 3S2JA 5AYBA 3QKEA 4R5EA 4U31A 1Q45A 2ALDA 1NFPA 2X16A 4XTIA 3EWZA 3RLHA 1XGDA 3CU2A 5FJTA 1F05A 5C9ZA 4J3UA 3IIVA 3A4AA 4QJ5B 3F4DA 2RDUA 4Q8VA 2GGHA 3TQPA 4E2BA 1M7OA 3HN3A 4L9ZA 1J01A 3M5YA 2PD9A 2CLMA 4PYSA 1ME9A 3BC9A 4FXJA 3BCFA 3V16A 2W27A 1NOWA 3V0UA 4LSBA 4P2VA 5RUBA 3N1AA 1LG1A 1I8JA 1H4PA 1OF6A 3QF0A 4E8DA 3MSRA 1CYGA 3N04A 3C86A 3ES8A 3MTWA 3W27A 5AHIA 1T0OA 1EJXC 3E12A 2PTDA 3OG2A 4GQ0A 4A05A 2FZDA 1CGXA 3NQ7A 3VC6A 1Y5XA 4L7ZA 1KTNA 2ZUMA 1HL2A 1HF6A 3C2FA 1ZBCA 1JUBA 4I7UA 3WH9A 2CHRA 4V33A 3OP2A 3PZNA 4PBFA 4AD0A 3B9DA 1MMFA 3CQHA 3NQCA 3DIPA 2ATMA 4OOZA 3VM7A 1SW3A 1CPUA 4PRWA 3M44A 3TTEA 2GGGA 1U1UA 1VFHA 5J5DA 2PTYA 4M5PA 2FH8A 1EPVA 3GNDA 4AD4A 1JJKA 1BGGA 5BRPA 2VEPA 4FIQA 3VILA 4O19A 4PB4A 3KRUA 5I3KA 1QATA 1KC7A 3EBVA 4NZ3A 5KMYA 4NZJA 4O50A 4L4PA 1LLWA 5J5RA 1M03A 1OINA 4HPNA 4IMGA 1E3ZA 3N18A 1C8VA 2A85A 5CGTA 4LGXA 2W63A 3M5VA 3F1QA 1CECA 3QV8A 3PBWA 5EMKA 1GQNA 1YBQA 3KDNA 5A6SA 3OHIA 4EPBC 3ITOA 3ZR4A 1IT0A 2QCHA 2VX6A 3E2VA 5E9AA 1BVZA 4W86A 4B92A 1UH3A 5ECVA 4WJ8A 3O8AA 3PP7A 5LNSA 1MRQA 1BYDA 2BY0A 3C61A 1SJAA 2WKLA 1C93A 4HOZA 1ONRA 4YYFA 4JIIX 3MUCA 3VIKA 3S2MA 2REQB 4OBTA 2FPYA 3QRHA 5DN1A 3UWZA 1N7KA 2B7QA 3RUBL 1X96A 1CTNA 2GQ9A 1NTHA 1W2VA 2RJHA 1E0WA 3OODA 2WXDM 3K8KA 3BJSA 3BW3A 3RDKA 2GGIA 3G0SA 1NWSA 4LPCA 4C7FA 1CLXA 1P48A 1M7JA 5A8NA 1PCKA 4A2SA 4DB7A 5C9WA 2A6NA 1MQPA 3L4UA 3VIOA 4JKKA 2VR4A 2PU1A 3BG5A 4LAOA 2Z29A 3GG8A 3KHDA 2QMJA 1XIJA 1LRNA 4AZ7A 2O7QA 3CV2A 2GVYA 4EE9A 3TJIA 4I7WA 1RD5A 4NILA 4A3YA 1AFSA 2QPXA 2CZ5A 4M7TA 1A4MA 1O4UA 2ZZ4A 3V3WA 3WNKA 1SSGA 1EP3A 3BGJA 1Y65A 2BZNA 3P61A 1TPB1 3QZAA 2X7VA 2DFAA 4H8NA 4ZB0A 4GZIA 4H9ZA 2PC8A 1U5VA 3EB2A 4JEJA 1LF1A 1ZHAA 4RXGA 1R3QA 1AQHA 3N12A 3AXIA 4ZE4A 3W2KA 5CSSA 1TB3A 3HGSA 2J8FA 1SO3A 3PR2A 4Q32A 3V4BA 4Z2LA 1RV8A 2DZUA 3GNNA 4IP4A 3B03A 3J7HA 3V7PA 3U4AA 1HNYA 3ZVHA 4CNNA 4HU0A 4CLMA 1DJXA 1B3XA 1ECEA 5BU9A 4LXFA 2ZXBA 4OIFA 1KLYA 3TK7A 1WPCA 3GM8A 4UQ9A 3H2AA 1G5AA 4QNEA 4ZCWA 3WH6A 2AAAA 3A13A 5AHEA 3MYOA 1ZJIA 2ISWA 2HCVA 4UR7A 3ME3A 3PBGA 3OA5A 4ZQCA 5I09A 4D6HA 3PZOA 1F3WA 3W82A 3V1PA 2HSAA 5G1MA 3VNYA 3VDCA 4OTKA 2BSLA 4U33A 3AWNA 3BLKA 7XIMA 4MKNA 4ZOCA 1OVDA 5ABFA 1DJGA 1MUMA 2G3IA 4YMZA 4Q8OA 5LIYX 4RV8A 1ZBWA 1UH4A 3QR3A 3LCGA 4DI8A 2Z1WA 1JQVA 2A4AA 2G3JA 3WBXA 1V5XA 1XQKA 4DRSA 2C16A 3G22A 3V5OA 2NZLA 2DT3A 1BHGA 5K9DA 1A5BA 4GX8A 2AMGA 2F8QA 3BLIA 1XLAA 3CUIA 3C52A 2C6QA 1B9BA 2X40A 4FOKA 3APYA 1YNPA 3ZWSA 3ECQA 3H2MA 4Q4OA 4IOTA 1I75A 4GYJA 2Z1KA 1ZSXA 3EWYA 1YRRA 1PO9A 1Z9AA 2GUUA 3AQUA 4CQCA 2J75A 1FVPA 4AC1X 2QNEA 1ZAJA 2Q8ZA 2OWXA 4IJRA 5D38A 1GCYA 2H8XA 3WDHA 3RR1A 4Q8UA 3IVTA 5HDRA 5BXTA 3KWSA 1S2AA 2XG9A 5AN7A 1HO1A 1MQQA 1QT1A 3KM8A 4UFJA 5JMUA 2AOSA 4DWSD 2IKJA 3IIPA 4EX4A 4RK8A 1AQ0A 1HT6A 1OX4A 2DW7A 3M0MA 4W9TA 4S3FA 3LGDA 2A21A 1CB2A 1TJ2A 1VIWA 4JQAA 3ABSA 3L12A 3WQVA 3IJQA 4UMBA 1Z6KA 1PIGA 3AROA 3GRIA 1U83A 3W6MA 3IGSA 3AS1A 5KZ6A 4JYDA 4AZGA 1PZ2A 2YCEA 3PWAA 5BMWA 2XH2A 5A6KA 2WMJA 1Q4NX 1XL9A 3EZ4A 2WK2A 3S6DA 4OZOA 4ZGYA 3W00A 3R2GA 4DAFA 3ALFA 5H8MA 3ARSA 1UMLA 1SJBA 3VOFA 3O3RA 4ONVA 3TQKA 1JAEA 1XKJA 3RX3A 3W0KA 2YLAA 3ITTA 2H3BA 2Y1HA 5HULA 1LT8A 3CAKA 2XVGA 3G1SA 3WDRA 3VKAA 4YTTA 3IS4A 3F4WA 3P5YA 1F74A 1RXOB 3NL6A 4UXDA 3VOGA 2ON3A 3UJEA 4I9JA 1AQFA 5I3DA 2PDUA 5K7JA 1R30A 1HN1A 3I7QA 3Q37A 1QBBA 3N3MA 4H9UA 4WX2A 1DXEA 1FHVA 2X1TA 1H63A 1UKPA 3WQOA 3WDJA 5B80A 1YHTA 5G4WA 4JHZA 1UBSA 3LHYA 2DJLA 3ARWA 2V2HA 4Z08A 2CYGA 4PODA 3N25A 1MDRA 4AFYA 1N2VA 1IQ8A 1F6KA 4QP0A 5EU9A 5J04A 1V6VA 3ZO9A 4K2SA 1E40A 2AKMA 3DKJA 4FNRA 4QXIA 3WIJA 4PL1A 1GPWA 3G5EA 3SZ8A 2E5CA 1Z69A 4RCXA 2Z1BA 1XD1A 4FX6M 1A3HA 3RRXA 4WKAA 4YPJA 1Q2SA 3BW4A 1OD0A 4RE3A 1GOXA 1T8QA 2EG7A 3FGCA 1MO0A 5EMUA 3NEVA 4X63A 1UD8A 2JEQA 5LGXA 5GJPA 4JQ2A 5DELA 1ZTVA 1V3IA 3O7UA 2NWSA 3WG6A 1HGWA 2FZMA 2C71A 4JIQA 1TJRA 3NYZA 4NI8A 2DDXA 1BF6A 2XVKA 1PSCA 1FCQA 4BQ2A 5BOOA 1B3OA 2XH7A 3B9AA 1HZYA 2X0SA 3QLDA 1S38A 4EXBA 1VBUA 5HQLA 1RH9A 4MGGA 1W31A 1MW2A 4ZFCA 3UQNA 5GNZA 1PYMA 2XPKA 4W88A 3EX6A 3H23A 4GYPA 5D32A 1FWGC 3GU1A 1KXHA 3FCPA 3NZQA 4FA3A 5FL1A 4AD2A 3GC5A 1LRQA 3UYIA 3NZRA 2OSWA 1DKWA 4O57A 3K4AA 3AJXA 3Q4DA 4ROPA 3MUAA 2OEMA 2D73A 3AHXA 4RXFA 2PF0A 1IEQA 2CW6A 2AKZA 3DX5A 1M04A 1GYNA 3CB8A 5BRBA 4AIEA 1S2UA 3UVIA 2UZ9A 1GT8A 4RZ5A 5M5DA 2I5GA 2BDQA 1TX0A 3WDQA 4UCFA 3L21A 2IMRA 2GPTA 3WMBA 1GJUA 1Q8AA 5DMNA 4P7NA 4WR3A 2XDFA 1ZL1A 3VMPA 3CL7A 2XGIA 2VELA 2VDIA 1BKHA 5KETA 2G37A 4N9EA 9CGTA 1AH0A 4QQUA 1XI3A 4Y9NA 1PEZA 1YXYA 4REQA 3SCOA 3TJ4A 1C8QA 4GI9A 2IPWA 5A6BA 4EWJA 3IK4A 4QG8A 2Y7EA 5TD4A 3TYEA 3QTPA 4JL1A 1V8EA 1OC6A 4MWAD 3AU2A 4LW7A 1ICQA 3BPWA 1TPH1 4K68A 2ZKMX 3SECA 3OHMB 4BK9A 4WJXA 3IJ6A 1FKWA 4FLRA 3EOSA 3LNMA 4HK5A 4RDZA 4GMEA 4XZNX 3T0DA 4IICA 3AHTA 4DZ5A 1DXIA 3H2FA 3NDZA 1ADSA 3DC0A 1F3EA 2XIQA 2YOCA 5MF5A 3VNKA 3BXWA 3L67A 1WDQA 3B9NA 1ADDA 1OGBA 5D2TA 1HTIA 4HHMA 3PFMA 5BROA 4GA8A 3WJZA 1K7EA 2VR5A 5AYZA 1OIMA 4JTDA 5CGQA 2PRHA 4B3KA 3NYDA 4AZHA 3TEVA 2P1FA 1WX0A 3UCCA 4GH3A 4LU0A 5M1TA 1NP2A 1DIEA 1W9XA 1T41A 3M64A 3GNOA 3WJSA 5I00A 3QQ0A 5C0QA 3VFCA 4ES4A 1OGGA 3NPVA 1NSJA 1TCMA 4O12A 1G4EA 3W83A 3W38A 5IDZA 3C3UA 1DP0A 4Q3MA 2ZRXA 4B9ZA 1W32A 2G4JA 3R25A 5HPOA 5I24A 2Z1SA 1ITUA 2D1ZA 3PAJA 2YZRA 1I2OA 4IPIA 2PGEA 2Y62A 2UWFA 3OO2A 2QV4A 1NDZA 3LRKA 3S5YA 2VXNA 4FXFA 4J3SA 5CC3A 4Z0SA 3G1RA 2OQHA 2R94A 4LUTA 1LUCB 1I9CB 4DXVA 4YJ5A 3B4UA 1OADA 5EA9A 4MB4A 5A6MA 1PIFA 4FK9A 4C90A 1ALDA 1ZS2A 2WZMA 5HJYA 2XZ9A 2UY2A 4IIEA 4DY1A 3QGVA 5E0CA 3VCCA 4GJJA 1TZ7A 2O4MA 2PLCA 4MYAA 1KM1A 2WSPA 2E9BA 3I6EA 3QC0A 1KR1A 4YTUA 4YXGA 2V3GA 1U5HA 4JDBA 5LIXX 1SJDA 2JE8A 3G1YA 4DNMA 5DRCA 4JCLA 1RA5A 1UJQA 3QHNA 5FJIA 4DIAA 5AC4A 4GNJA 3HTWA 3N13A 3RN6A 4C6QA 3R11A 1V03A 1Y8BA 1OCNA 3K4WA 2ZX7A 4AD5A 1R3VA 4B5UA 1TJ1A 5EFFA 4W8AA 4W93A 1XQLA 1ZJBA 4O8AA 1LL7A 4L9XA 1LLOA 1FP9A 2ABAA 3W1RA 3EOLA 1O66A 3UESA 3MKCA 4UTHA 4FS9A 3C2RA 3WDPP 4UQCA 1JDEA 6ALDA 3GHUA 3ZFHA 3PJWA 1S39A 1T99A 2VCBA 4CNPA 3T0BA 2RJGA 1XLGA 2ZFAA 1VCFA 2QCMA 2DSVA 4AHPA 2Z1XA 3PNUA 2YDAA 1FWIC 7ODCA 3IANA 1MQRA 4P8UA 3QC3A 4E4FA 3EA1A 1LL4A 2A7RA 1W5PA 3THDA 3A21A 1GORA 4WJEA 3MHUA 4WY0A 2WBGA 3M0LA 3R8HA 2DZBA 1EOKA 2HK0A 3AZSA 1ZPTA 4QLJA 3W7HA 1Y0EA 1PTGA 3SFKA 2FH6A 5IFTA 1WDRA 1Q63A 2PP0A 3F4CA 5D9PA 1E9LA 1W8GA 4PEKA 4AX6A 4N4PA 5AC5A 1PBGA 5HBFA 4O13A 3LDVA 2J7HA 1W3NA 3T2PA 2VQTA 4E3VA 3L68A 1V7YA 3EMZA 3NL3A 4DO7A 4Q7IA 5F7UA 5H91A 2PSNA 3VD5A 4KF1A 4KRZA 3KOFA 1GKPA 3UWYA 2YB1A 4ICNA 3MV01 2YXXA 4PGLA 2ZA1A 4PCFA 1HJUA 4XBJA 4M82A 5MHBA 2Y85A 4WD0A 4JDYA 1UKSA 3WBEA 1X8CA 3DFYA 2YGYA 4C6NA 2VFHA 1TV4A 2J8TA 3L2MA 4ICMA 3KTXA 3F4VA 3NZGA 1N8WA 3IK2A 4D6EA 4XAGA 2O56A 3TYDA 4FEZA 1YXCA 5I5RA 4FI4A 4C6DA 4ML4A 1AG1O 2VEFA 1VB9A 4K38A 5JH1A 4XQ6A 5BOEA 2YCJA 4O16A 3NPUA 1R47A 4RX0A 4AW7A 1LL6A 3MANA 1EUNA 1KTBA 3KVKA 3TH6A 4D8AA 1VJZA 4AZCB 1RBOB 4K6AA 2PDMA 4IFKA 1PTAA 3AUOA 1FH9A 3K46A 2QQ6A 4RDWA 4JFSA 4NZ5A 4LX4A 2CC0A 4E38A 3BTNA 3T8QA 1Q6RA 1E6SM 3LI0A 3UG5A 1RQHA 3OIXA 3ZS4A 1VS1A 3CUHA 2XIBA 4WRHA 2INZA 1FHUA 1PKLA 2EJAA 2XFFA 1ICSA 1TJ0A 3WL1A 1FWWA 3AUJA 4UIOA 3N73A 3GC2A 3F2CA 5LIWX 3MI6A 4TVCA 4LVGA 1GHSA 1Z48A 5BCAA 4LCQA 2WJDA 4UUIA 3TW7A 4ZOEA 4UMCA 2NUWA 4EKJA 1HG3A 5JBFA 4WK9A 1H60A 5K9XA 1W1IE 4JR5A 1UZDA 2BOFX 4HT3A 4R9XA 3EXSA 4X22A 4RW3A 1CXIA 1UMYA 3TSMA 1TG7A 5ABEA 1AL7A 2HVOA 4QG9A 3U2OA 1DWIM 2WJZA 2AQVA 2V38A 3GXTA 5LXEA 1L6GA 2Y8VA 4UCGA 1E6ZA 4ERIA 5LA2A 2ZE3A 3CZJA 5HWNA 5EGRA 1CBGA 2OCZA 2QDHA 4UR9A 2YW4A 1Q6DA 2XFWA 3KP1A 4XBSA 1D7FA 1RHCA 4CKQA 1LBLA 4O1CA 5TBOA 4YVPA 2WAGA 3TZNA 3FDKA 1H50A 4IL2A 2HRWA 5HANA 1RJQA 4LV4A 3HA1A 1UZ1A 3UWEA 3DXIA 1JZ7A 3LV5A 3THCA 3OQ8A 4JBRA 1TR1A 1XRVA 3LY0A 4I90A 1LQAA 5C55A 4DWSC 3A47A 3CM4A 3VNJA 3WUEA 4X0VA 1Q6QA 5FEPA 2CXEA 4WDTA 2NQHA 1XPGA 3C56A 3VOHA 5CZJA 4IHCA 2Z2AA 3GXIA 3UJ2A 3WF2A 1LWHA 4J2PA 1QPOA 3E5BA 4NAFA 5A8GA 2GOUA 5BW6A 1JXJA 3QOMA 5B7YA 4F4RA 4ZFMA 5HA7A 3TMLA 3ABOA 4AISA 4FAMA 3MKKA 3AXHA 1AD4A 2XIMA 3TU9A 4F0LA 1VF8A 1XIEA 4KKXA 4I6KA 3VUPA 3E1F1 3MZ2A 3KBVA 3LXBA 4AVOA 4PMZA 3DU0A 1T40A 2CXGA 1UUOA 5G2HA 3H12A 3VZYA 3ITYA 1IR1A 5LIKX 3UEQA 2Y24A 2V5CA 3L0NA 3FHAA 2OWCA 3ZYZA 1E0UA 4H9VA 4S2BA 4GCXA 4LUYA 4HK6A 2KZHA 4ORIA 1XH0A 2I9EA 3EEGA 4YVVA 1V6YA 1K9DA 2CLPA 2P8CA 3GHRA 2YFNA 2QUNA 4O0ZA 4LUSA 3IJIA 1XYLA 1ZAHA 1EOMA 3VKJA 2Y6ZA 2A3EA 3LPOA 3TROA 3N17A 4F40A 3R8GA 3C5QA 2OO6A 3F2BA 4R53A 3FA4A 1VAHA 1Z7AA 4AEOA 4O0KA 1A5SA 5AC7A 4BF7A 3CV7A 2ZRUA 3AMGA 1GQJA 1OFOA 1J93A 4JZ5A 5HAOA 1J5SA 4MFDA 4PRTA 1J8VA 1L6YA 1H5YA 3T42A 3L23A 4I5RA 5D2XA 1BPLB 3E74A 1IT8A 3C8FA 4DYEA 4HNVA 1AMYA 3WH5A 1UIOA 4IXHA 4FPSA 2XH4A 2YR1A 2BY3A 4BS0A 1QWKA 2V6AA 3A12A 4KWUA 4G8TA 2DZVA 5E9XA 4UFLA 1DJHA 3H70A 3VE7A 2R24A 2W9MA 3S8HA 3SI9A 3N2XA 5I3HA 1A80A 3CL8A 1CIUA 5CG0A 4ZOBA 3QQ1A 2J7CA 2SFPA 4NP7A 3NQBA 4H41A 4R7JA 3GDTA 4H7ZA 3T6CA 2EHHA 5D03A 4HNTA 1R85A 3ZSSA 4XZ9A 2ATSA 3QYSA 4JX5A 4R7OA 1QOXA 5FAGA 5A2AA 3OVGA 4MHBA 3VGHA 3TYAA 1SU5A 4Z1CA 1XLKA 3VNZA 2IKIA 4AIOA 4RJEA 3EDEA 4AUBA 1KM5A 4S3DA 3GVWA 4NKCA 4KPLA 1FWNA 1F76A 3B8VA 2VGGA 4YNGA 3NAVA 4X2RA 4GE8A 2PTWA 1NF7A 5FSEC 4KERA 1H62A 3W7JA 1FCUA 3ZT6A 2QIWA 3W1TA 1TKKA 3UR7A 3EPMA 3II1A 4D6DA 4GBDA 1VGAA 4QSFA 3GDKA 3BO9A 4I8YA 4IGMA 2PDXA 3U2EA 2JKAA 4MJ4A 3PNZA 3W1PA 4CQAA 3T08A 4NRRA 1LUCA 3AHVA 3H21A 3W7IA 1E4MM 4Z1BA 2WVTA 3UWWA 3WH8A 2HZGA 3BG9A 1JEZA 4QM1A 2POZA 1E1EA 1W1YA 4N9CA 3KL5A 3GVQA 3N6HA 4NXKA 3MWCA 4IGSA 3OZOA 5M17A 3N6QA 1G0CA 2OT0A 4HA0A 1UD6A 4BQ5A 1RSCA 3K5XA 1J4EA 3BE7A 4M56A 1XXXA 4Q8PA 2X0YA 3LRMA 4JYFA 1ZLPA 2X7WA 4IWWA 1JAKA 9XIAA 1W56A 1DTNA 5AB3A 1PWLA 4LBSA 7TAAA 2HQAA 1IZKA 1SFTA 3H26A 1TUFA 3WQWA 1QNOA 4GIYA 1JCNA 3V5FA 2ZRVA 3OLDA 3BSMA 3CHCA 5DF0A 4HMEA 3QV6A 5CBBA 3TA6A 3O6AA 3ZT5A 2BX7A 4MB1A 4QG6A 2V82A 2EJ1A 4RDYA 5LGZA 4MIMA 4JTKA 5DX7A 2GGJA 3CWHA 2WHMA 3GXNA 1YNQA 3SRHA 3L65A 2WPBA 3EB3A 3SUSA 3LM7A 3MMUA 1QI5A 4C5ZA 2CZFA 1ZQ5A 3P60A 4J3WA 1FH7A 1KW1A 1IYXA 1GVEA 4C1NA 4L6DA 4B15A 3HPFA 2PBGA 2B7NA 4S39A 1K02A 3RU8X 3I6RA 1EJVC 3DHDA 1VFOA 4B3LA 5AECA 1DXFA 3TNOA 2FB2A 3IJLA 2B7OA 4JX6A 4NJHA 1W1B1 1YADA 3HG5A 5CJMA 4C6LA 1ZBVA 3DAQA 3R4IA 5LNRA 2EO7A 1GG0A 1JCLA 2ZIDA 3V1HA 2A3LA 3W53A 1DJWA 4QE4A 2W67A 4CNOA 2VFEA 3KS6A 2PE4A 3I10A 3UZXA 1VJSA 2X2GA 3S9YA 4Q22A 5L9FA 3EX1A 3BLDA 4IGHA 4HD5A 4M24A 1FCBA 1V6UA 5C7HA 2VC6A 4AWTA 5KINA 3MMDA 1J0KA 2J88A 3T05A 4PTDA 1R3YA 4L1GA 2D0HA 1R3TA 3O6CA 4JTHA 1EH9A 3GW3A 1EC9A 2CZEA 1TE6A 4M6QA 3N29A 4KIRA 5U7SA 1VBGA 3MUZ1 4HZ7A 4TIMA 3MS8A 1P5BA 1WO2A 1OG0A 4E8GA 3UXDA 3ZJ8A 4GRSA 1CGVA 5CC6A 3PSVA 2E0PA 4QAIA 4NAFB 1GZJA 3ZQ9A 4X3ZA 2CKRA 2ZBTA 3GZ3A 2GJPA 3MKVA 3L4TA 1J5TA 1K6AA 3VIFA 2KAUC 1EZWA 1ZZMA 1VYSX 1GOWA 3QN3A 4A8RA 3DKLA 5AYYA 3VIMA 1LDCA 4RUBA 1XRSA 5KSWA 3O0FA 4N02A 2CLKA 2ZDRA 4Z0JA 2GVJA 1BD0A 2NV2A 4M8UA 3CLMA 1IIHA 4KWSA 1P0KA 3CZLA 1OC5A 2NX9A 3GTNA 5I3FA 4C7DA 1DJZA 4QQ3A 2G3FA 4GACA 4B3ZA 3N15A 1DHPA 3SM0A 4LRSA 4Q4QA 4PFHA 4AH7A 1XFBA 3DN5A 5ABHA 2DQWA 3AU6A 4QNWA 4JXCA 1OFPA 1XG3A 2WM0A 1V77A 1XPYA 3SCPA 3GX9A 2BOGX 1PZ0A 1H7PA 1TMQA 4CD8A 1NU5A 4HCDA 1M01A 4ZXLA 3W87A 2VNCA 5D9MA 3W81A 1VH7A 3ANYA 2ZZ1A 5MKGA 1S5WA 4M6UA 1UP3A 3VOCA 4MMWA 4Q33A 1G7UA 1XC4A 3M0ZA 4Y8EA 3UXIA 3UZYA 3PZUA 1W2PA 3HGRA 2JEPA 1WDWA 3SADA 3LQGA 4I9AA 1WA3A 4OVXA 1HQTA 5CJ5A 3N34A 3IRDA 1WBHA 3CIXA 2Y7GA 4ZQMA 2WVVA 2GWGA 3TJXA 1X38A 2DZPA 1E0VA 2Z27A 3RIKA 1XUUA 3BJFA 1GONA 2QJIA 1UH2A 3PTDA 1F8IA 1EGZA 5HR6A 1EGVA 3NJ3A 4PCTA 2O7SA 4YU1A 2O9OA 3ARUA 5CPTA 1ZY9A 3AYVA 1R0MA 3LD5A 3O63A 2PTZA 4WCJA 1XFCA 1V6XA 1W1ZA 3SN0A 1QBAA 3VA8A 1P43A 1G6CA 4GLEA 2B4GA 1LJYA 3GH5A 4L6HA 4IGNA 1YQ2A 1LM1A 2C1IA 4GVIA 3VYLA 4RNJA 4RZ6A 4X9YA 3P2VA 4XK2A 3WUBA 2VFFA 1WQ5A 3ONCA 4DO4A 5JVLA 3THUA 3WDIA 3FEQA 2GJLA 2YXOA 2OWWA 1NP0A 4P7QA 1N8IA 3WQPA 4D71A 3D5HA 1FDJA 4DUWA 2DIEA 2WSQA 3SQMA 1HKJA 1G01A 5HQMA 3BLPX 2VUYA 2VGBA 1RAKA 1K7XA 3UCQA 5JU6A 3CQIA 1WKEA 4GWEA 3QJAA 1ELSA 4KCTA 3CUJA 4PMOA 3FYOA 1DJYA 3PF3A 4GD0A 1A47A 1OX6A 5GJMA 4JEQA 5M03A 5DQPA 4PUNA 4FR1A 1I6NA 2ZOXA 3SCUA 1E6NA 4M6PA 3GWQA 3AZRA 1OHLA 3WCZA 3KVMA 2V81A 3ABRA 1HP5A 1D7KA 1EHNA 1RK6A 1UD5A 3T8LA 5EFDA 5FI8A 2QCCA 1QU4A 4IIBA 1XYZA 1W9DM 3GNXA 4B5VA 3MQTA 3MVTA 1MNZA 1UR1A 2PDCA 1BG4A 3NGFA 4JQ1A 4B5XA 3B8SA 4HZ6A 3W2NA 2VZOA 3REQB 1GKRA 2BHYA 1R9XA 2I9UA 4HMCA 1ML1A 2I16A 4YVXA 1LQ0A 3WNOA 1H0GA 2AL1A 2NVCA 3EKLA 4ZENA 1P0DA 4NJGA 1TRDA 3FS2A 2HISA 1OJXA 4BI6A 3QFEA 4M3PA 1TMHA 4Y6GA 1TPC1 4KFPA 1JPKA 3GXDA 3B8IA 2PMQA 4C6KA 3LBCA 2XISA 3Q67A 2ANUA 1CXFA 4K8EA 4IZGA 2C3ZA 4MNJA 4L61A 2WZIA 3NQFA 1JYNA 1RQBA 2WMIA 1AA1B 1R46A 4YL2A 2RFGA 3PTKA 2DUAA 1QRQA 3RFAA 1VQTA 4OWGA 3RX2A 2NQJA 4O1DA 1B1YA 4OKDA 1F2JA 4C6MA 4PUEA 3SW6A 1LLZA 1Z42A 3G3MA 3WF1A 1OQFA 1J6PA 1FTXA 4W8BA 3CC1A 3CHFA 3CPRA 4ZTXA 2D22A 2OGJA 2CLHA 3T44A 2ALRA 3KL0A 7PTDA 3ITVA 1RCOB 1G9HA 3P81A 2ZUNA 4KWWA 3WD1A 3GHSA 3XINA 4ZL1A 3W86A 3S5OA 2X1SA 1KCXA 4I7VA 1Q8JA 2GDQA 4UOJA 4HN4A 2QUUA 3USZA 3LQLA 4P7RA 1G69A 2EG8A 3G2GA 3GBDA 1XP3A 3QXBA 3DUGA 1XW8A 1WB0A 3TCEA 4D6IA 4MUPA 1E6RA 3N6JA 1CGTA 4XSLA 1R9ZA 5F1UA 4WIWA 3SO7A 3BOFA 2AGTA 3NXLA 3KCOA 3IAPA 3HQPA 4M19A 1RCXB 1A50A 1W5NA 1AH3A 4LY4A 4DXKA 3STCA 1MXSA 1SYTA 4PUUA 1XLDA 3P8JA 2YL6A 4HKPA 5F2GA 2TMDA 3VVGA 4WHBA 5FEXA 3ZLGA 1OX4B 1SFSA 3OYXA 4FALA 4NG3A 4HZMA 2OLSA 1V3MA 3U0HA 1FX6A 3HM7A 3ZXWA 2HXTA 4FIRA 5LHFA 1U2YA 1XDMA 3W37A 2J7BA 4G56A 3GQYA 4WDXA 2OX4A 3OIHA 3SURA 4OHQA 1PJ9A 2J9YA 1HVQA 3CH9A 4FNTA 4LVDA 1FWTA 4JFVA 3RX4A 3GU2A 1EHAA 1KGUA 1XLLA 1DIKA 4QDWA 3GYCA 3NGJA 4HOWA 1QNPA 4FSAA 1JGMA 3BCDA 1RQEA 2PDGA 2PODA 1KXQA 1QW7A 3DI0A 4F0MA 5XINA 1ITQA 2Y89A 4B2DD 2CHNA 3BJTA 1YTEA 1SVDA 3LYEA 1E5JA 4JTLA 1GVOA 1GVYA 2WNNA 2UY5A 4U5KA 1E6QM 3AALA 2ZADA 1FQ0A 1TV3A 3T7VA 1UBPC 3GY1A 4AY8A 1XH1A 3JRKA 2FZNA 3WN6A 3MT1A 3QMRA 1B4KA 3LN3A 1NAL1 5A6JA 4IMDA 3GW0A 1JFHA 3PHAA 3B40A 1H7OA 3KOZA 2PLKA 3RJXA 3W22A 2D20A 3EPNA 4GABA 2WCSA 3L5LA 5BMXA 2GJXB 5D8ZA 2HE8A 2IQDA 1SMAA 2WHJA 3ZJKA 3W7EA 3KE0A 2VRQA 3LGGA 2DPEA 1E73M 3UXLA 3BAXA 3CGTA 1REQB 2I5QA 4CCDA 1TSIA 2VKZG 2ZX8A 3QR0A 3NURA 1MRAA 5AVNA 3OEXA 4J3ZA 2G50A 3MI2A 2DVTA 5CPMA 3GDRA 3VZZA 3N14A 4PFMA 1T5AA 3UVAA 1UD4A 3U8GA 4EOUA 2YCKX 1VYPX 2Z00A 1GK8A 3DG7A 4MNKA 1V79A 3NG3A 3WF4A 4O8RA 3CHEA 4FX8A 1ME7A 2QCLA 4AZ5A 4LFYA 4INFA 1Z44A 4AYSA 1I2RA 5KZMA 3RMEA 4C7GA 2Y88A 1GGOA 4QS5A 2OSXA 3PG9A 1CNVA 3W02A 3S5SA 2VGFA 1XYFA 2WNZA 3VCRA 3WLJA 3WELA 4KFNA 2PLJA 3OOQA 3OJGA 3GHTA 1MDLA 1A3XA 3A22A 3EMQA 4MWAA 3AAMA 1J0IA 2BOEX 3C0QA 2CZDA 1B2YA 3FJ6A 4G5DA 4KRTA 1NEYA 2E09A 3TIMA 1FXQA 1VPXA 1US3A 3ARPA 1S5TA 3VX1A 1HW6A 1YPIA 3VKKA 2ZA2A 4NYYA 3GH7A 1J0JA 3LG3A 3FXYA 3K4DA 1S1RA 3DFHA 4AHQA 1Q7MA 4TX6A 2ZXQA 2C7FA 1JIBA 3C2YA 2PI6A 4MKSA 2ISSA 2FMOA 3TP4A 3L4WA 3ZOAA 1L6WA 3W29A 4B16A 1R2SA 2G95A 3MMWA 4AZIA 1S5VA 1W9BM 3GKFA 1TQJA 3WLPA 8XIMA 3W6YA 4O17A 4NHVA 4S3JA 2J25A 4AZ6A 2OQYA 2PDIA 1QI4A 3CJPA 4AG0A 4U2ZA 1CEOA 2V63A 2QKFA 2UY3A 4HK7A 5E93A 1XDLA 3NSXA 4O4WA