5HNNA

Crystal structure of the endo-beta-1,4-glucanase (xac0030) from xanthomonas axonopodis pv. citri with the triple mutation his174trp, tyr211ala and lys227arg.
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
MLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAWSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDASGTKPVCTSDSVGQERLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title Crystal structure of the endo-beta-1,4-glucanase (Xac0030) from Xanthomonas axonopodis pv. citri with the triple mutation His174Trp, Tyr211Ala and Lys227Arg.
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 128
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hnnA00
4PTMA 2BHZA 1QNQA 3PHAA 3TONA 3VD3A 5LA1A 3WD4A 2F61A 4AC1X 2WWDA 3BGAA 5I79A 3B9AA 2A3HA 3IAQA 3WQ6A 3OG2A 2BXYA 4UOJA 2A3BA 2DQXA 5C71A 2J7EA 5A6MA 3WH5A 2EBNA 1OT1A 4P8WA 3LPOA 3GXIA 1AQMA 3GNPA 4RE4A 4JFTA 5DEZA 3U7VA 2EQDA 1TE1A 2J79A 4U2ZA 4KGJA 3A4XA 4N0RA 3AMLA 4W86A 2IXVA 3I3EA 1JXKA 1GOKA 3FNDA 3L4UA 3PTQA 4QLJA 1UKQA 3WUEA 1TA3A 1QI4A 1LLOA 2XVPA 5A69A 4L4PA 4PEEA 4OOZA 5I2UA 2V38A 2ZX7A 1OIMA 1UH4A 1HVQA 1RPKA 1UOKA 3BXWA 3MV01 1GHSA 3F5KA 4FLRA 5E9AA 2BY2A 1U30A 4D1IA 1HT6A 3CO4A 5I0DA 5JUVA 5GNXA 3W53A 4W5UA 2GUYA 4E2OA 1QI3A 4TTGA 1K9TA 3QHNA 1CIUA 2VI0A 2WVTA 3S6TA 3WNOA 1V08A 3MMWA 1W3JA 3PBGA 4NSBA 3UG5A 1H0GA 2DT3A 1FP9A 1JYNA 3ARXA 5I3DA 2DT2A 5E0FA 2CITA 3CPUA 2YL5A 3ARPA 2ZXDA 3TTSA 2OWXA 2EPOA 1VRXA 3VGHA 5KEZA 4PTWA 1EQCA 3GH5A 3VIOA 2XIIA 1UR2A 2YLLA 4Q22A 4HOXA 7TAAA 1VAHA 1ZS2A 3W6LA 1Z32X 2VRJA 4HPHA 2UY5A 3ZSSA 3G6MA 4HPGA 3EBVA 2J8FA 1KGWA 1CGWA 4UQEA 2J4GA 1CGTA 3WQ4A 1E0WA 3NSMA 4PUEA 4W8BA 3L4VA 1CBGA 5DT7A 4WLCA 2W67A 2VUYA 1WAWA 1GZJA 3VDBA 4V27A 3AMKA 3PTKA 1XHGA 5LA2A 2CKRA 1E9LA 2GVYA 4M56A 5A6BD 1GOMA 4OBSA 4KMQA 4PMDA 4MB4A 2BY0A 1EH9A 1C91A 4KRUA 1TA3B 1G94A 1UKPA 1IZJA 1V6UA 2XSBA 3EMZA 1G1YA 5HXMA 4LX4A 5ABGA 1ITCA 3AS0A 3WMSA 3G6LA 1SMAA 2WK2A 1ZU8A 3CHDA 4W88A 3UR8A 4ZE5A 4J3SA 3VNYA 1E6QM 4CN1A 3GH4A 3AI0A 5EMYA 3VM7A 1V0KA 3AXHA 3KWXA 3L4TA 1GORA 2DH2A 1E1FA 3OLDA 2OSWA 2VR4A 1DWAM 4DUWA 4CKQA 3SCTA 2E0PA 1OD0A 3IJ9A 3EDKA 2DIEA 3BAJA 3O2LA 5BXSA 1C3FA 9CGTA 5E6ZA 5D8WA 1W1TA 3HMCA 1ISXA 1BHGA 2J7HA 3DYMA 4PCSA 1E71M 3WNLA 1DWFM 3WELA 1TFVA 3NSXA 2J7CA 3WBAA 1BYCA 1XYFA 4GPNA 2CIPA 2FGZA 3UG3A 4CCDA 1KR1A 2WBGA 1DWJM 1C8XA 2BHUA 1J0IA 1MVYA 2BVDA 2WLZA 3UESA 4M81A 1C8YA 3T09A 3UEQA 2OYKA 3AICA 4JCLA 5CJ5A 2EO7A 2WHKA 1J9YA 1RD6A 1E6SM 1NH6A 4UZUA 5HPCA 4PBGA 4A3HA 3EDEA 5D9PA 2X2YA 4NRRA 3WUGA 4AY1A 1QVBA 3AS2A 1TUXA 3AIUA 4LYPA 1M04A 2UY2A 1LWJA 4CU7A 3ZQ9A 3PZUA 2VNCA 2VCBA 4QP0A 1UA3A 4BQ3A 1TVPA 3AIRA 4MB3A 3VD7A 2EEXA 1V6XA 1HKKA 2ZX8A 2DPEA 1ZBCA 1XH1A 5BXTA 5HOSA 3AS1A 3DYPA 2VX4A 3WEMA 4CU8A 2WMGA 1US3A 2YLAA 2E4TA 2WAGA 3QHMA 3SUWA 2VMFA 3GTNA 3CLWA 3A6OA 5D9MA 4FLQA 3EMQA 2OLHA 4D6FA 4JFSA 2XPKA 3SUUA 1MFUA 1B90A 1E4LA 4EKJA 4XZWA 3RILA 1UKTA 2JIWA 1N82A 4XZBA 2G8ZA 3OBAA 1EA9C 2XM1A 2WCAA 4UZSA 2EPLX 2Y24A 4Z2HA 1V03A 3W29A 1HXJA 2ZUWA 1W1PA 2QMJA 5JIWA 5A6KA 5JBDA 1B3WA 1NWTA 2IXUA 5CGMA 1CZ1A 3PTMA 3SCPA 1EDQA 4AZCA 1AVAA 3TTOA 1QHZA 1QBBA 7A3HA 2JF7A 3AHTA 1PIFA 3VTRA 3WD1A 1AMYA 2WPGA 4JKMA 2FH8A 1WZLA 4R5EA 4D6JA 1JDAA 4GQQA 4UCFA 3BAWA 3VX0A 1ODZA 4UFIA 3AYSA 1VBRA 3ARTA 2NT0A 1UG6A 1HP5A 1JZ5A 2XUCA 1XD1A 3CZEA 3GXFA 2ZE0A 3LPPA 1NWRA 5DF0A 5ECUA 1EO5A 4AIEA 3GNRA 4U31A 3BAIA 5IFPA 2VJXA 4JFUA 3SCVA 1ZJBA 3OGSA 1CXLA 3W28A 4PYSA 3MKKA 1PBGA 4BZYA 1ISZA 2D20A 3CUJA 4WKHA 4D6IA 1E55A 3N13A 4JFVA 4ZXLA 3ARWA 3UCQA 2PB1A 1VIWA 3L4XA 2XWDA 3OB8A 4JFWA 2FHBA 3SCRA 1E6XM 2BY3A 2YDQA 2D2OA 3ARVA 1W9VA 1UWSA 3WF3A 4MDOA 2YL6A 1R87A 1M53A 2CETA 1G01A 5FD0A 3KL3A 3PZOA 2VZOA 2XIBA 1CXIA 2WB5A 5BXRA 3WDJA 4AXNA 4QAWA 5A3HA 1JD7A 4C7FA 1C92A 5ABHA 4IUGA 3WQ8A 1JZ8A 3ZSTA 1E4NA 3B8SA 4PMVA 3AIWA 4AZ6A 1FFQA 1VFUA 4NRSA 3AMCA 2CBJA 3FHQA 4OIFA 2VURA 2PC8A 3BAKA 4MAVA 3WL0A 2G41A 2VCCA 1J0HA 3SURA 2ZXBA 4L4OA 2O9TA 1EHNA 4BA0A 2EPKX 3M6DA 4TVUA 4XX6A 4AZCB 2VTFA 5BWFA 4AD1A 3THCA 2C0HA 5EFFA 3TA9A 1UA7A 3WF1A 1LF1A 5A8NA 1CNVA 3VVGA 2HISA 5JBFA 3VGBA 4U3CA 1JYVA 3VIGA 2CBVA 1GONA 2J7GA 4B9YA 2CEQA 2RGMA 3VNZA 1HJUA 1EOKA 1HL9A 3N04A 2YA0A 1V3MA 4Z2KA 1OBAA 4W7VA 3CZ8A 5IDIA 3WH7A 1PEZA 2EXOA 4URIA 3WD3A 2PBGA 1UR4A 2WM0A 3LPFA 3WSUA 2CBUA 2O9OA 4GZIA 4H04A 1OSEA 4P8UA 4W7UA 5LYRA 3WDHA 1B1YA 2J77A 2ZXQA 5EB8A 1DHKA 1HP4A 4FF5A 4OUEA 1KR0A 4ACZA 5I6SA 4OOUA 4YHGA 3SUVA 4AZBA 4P8VA 1O6IA 4U2YA 4MNLA 3MUAA 1UHVA 5A2BA 1FA2A 5BROA 4AZ7A 2D1ZA 3BAYA 3N1AA 1TG7A 3ARSA 1LJYA 4D6GA 3EDDA 1J01A 2WBKA 4HP5A 2PWHA 4PMYA 2GK1A 3OLEA 3CUHA 1V6YA 2E3ZA 5A8PA 5AC4A 1IZKA 4AD3A 4TXEA 5I77A 1JYXA 1HJQA 4PMRA 1CLVA 1JZ2A 2GJPA 3NCOA 3SCNA 3NDYA 2J75A 4HOWA 1PX8A 1W3KA 1UWTA 1WDQA 3EMCA 3EDFA 4WKFA 1JNDA 1W3LA 2V3EA 1CGXA 4XUYA 5EFDA 4D6CA 2UY4A 3AIEA 3VIFA 2MANA 3WNPA 3VKKA 4W7WA 3CIVA 1WDSA 3CHCA 3K1DA 5A2CA 1BGAA 1CGUA 1ISWA 4U33A 2ZUVA 3QHOA 1XSKA 4AZIA 3ALFA 3POCA 1OGBA 2V3DA 5D8ZA 2A3CA 3W24A 1SFSA 3IAPA 4YHEA 4XV0A 3CMJA 1CGYA 1KXHA 2D22A 2F8QA 3A47A 4TX6A 3VMPA 1GW1A 2DT1A 2BVTA 2W5FA 3OGVA 1MQPA 3BH4A 1CXHA 1JNEA 4A4AA 1E40A 1B3VA 1J18A 1ITXA 1UD2A 2QLYA 3BSGA 2D24A 5FOOA 4MAZA 3RMEA 3EYPA 4YPJA 1V3JA 4ACZB 2G3IA 5D9NA 5AY7A 3UERA 3VIPA 1VB9A 2WWCA 2O92A 4UQDA 1KFWA 4AIUA 1MW3A 2CCRA 2Q8XA 4EANA 4ATLA 2Y2WA 2OYMA 3T08A 2WC4A 3VDCA 3AZSA 3WDIA 3M07A 2FGLA 2V3GA 1LL6A 3WH6A 3VGDA 2E9LA 2GK1B 5DMYA 4IPNB 1SR0A 4ML4A 4UFKA 3AS3A 4W5ZA 3WH8A 1L0PA 3SCUA 5EBAA 2CBIA 2BV9A 2WSKA 1V3KA 1BTCA 2ZOXA 3K46A 4GI9A 1CTNA 4ZE4A 4MNKA 1V02A 4NF7A 1WDPA 2YBUA 4GQRA 1CYGA 5FL0A 4AZGA 4X0NA 4HZ7A 3PZVA 3AISA 5FIPA 4RE3A 3FW6A 3PZQA 2E9MA 3AHYA 3SCWA 1MW2A 3J7HA 5A8OA 4UTFA 2WW5A 3BMWA 3DECA 5CZKA 1PAMA 3F5LA 6TAAA 1HIZA 2XVLA 3CUFA 4W8AA 2J7BA 3PZTA 2D3LA 5FL1A 2V3FA 1WB0A 2PF0A 2GJXA 3LMYA 4HTYA 1DTUA 3WNMA 5FKYA 3AMDA 4BF7A 3PZMA 4TX8A 5IFTA 1VEMA 3F4VA 4PUDA 3LPGA 2W66A 4W87A 3U5UA 1OINA 3N18A 4CD4A 4E8DA 2WHLA 4UR9A 1QBAA 1JAEA 1GOOA 3EDJA 1WDRA 4B15A 4S3JA 2XGBA 2VX6A 4Y7EA 3T2OA 1PZ2A 4CU6A 3L4WA 3B9DA 1X6NA 1KGXA 4WJXA 1OB0A 5A6BA 1NWUA 3D5HA 1TR1A 2OWWA 4AZ5A 5CG0A 3W38A 1I1XA 1WO2A 1PJ9A 1JFXA 1L8NA 3AOFA 1BYDA 4D1JA 1UD3A 3WD2A 3AIVA 3N9KA 1U2YA 4MTVA 2OYLA 1B3ZA 2FHFA 2VL4A 1ODUA 3BSHA 2XVGA 4WSKA 4UFHA 5IHRA 1EDTA 1B3YA 1Q4NX 5D4YA 1Y7VA 3N11A 3QOMA 1UUQA 4X9YA 1WE5A 3VM5A 2OWCA 2VR5A 3WDQA 4MPKA 1ESWA 1XH2A 4HZ6A 4NZCA 3NJ3A 5ABFA 4F8XA 3T0BA 5BCAA 2G3NA 1QHPA 5M17A 2OSYA 3SCOA 4M82A 4BQ5A 1PX3A 3VUPA 1J0ZA 4LPCA 1VBUA 1OT2A 4JZ5A 1JDDA 2E8ZA 1BVZA 1FFRA 3AIBA 5HPOA 1CECA 2D3NA 2DSUA 1H5VA 4AMCA 3FY1A 1MYRA 3L4YA 1H09A 4PRWA 4D72A 1TCMA 1DEDA 1C7TA 2GJXB 4B3KA 1MXDA 1A47A 5E0CA 2CPUA 2CERA 1QPKA 5E70A 5A94A 1GQJA 2XVNA 3MUZ1 4AW7A 5M03A 2WKLA 2JF6A 1R86A 2JE8A 1UR8A 1CXEA 2EPNA 3WFLA 4HA4A 1HN1A 2QF8A 3T2PA 4S3KA 5TD4A 3IJ8A 2Z1KA 3ARRA 1RP9A 4ZXOA 5AC5A 3VU2A 1U33A 1B0IA 3WDPP 5C8BB 2E40A 2G3JA 3VINA 3WEOA 1M01A 1W2VA 3WKZA 1LL7A 5I23A 3N15A 1ZL1A 3M46A 4MNMA 1G5AA 3KZSA 5CPQA 1I1WA 3UG4A 3VIIA 1SMDA 1WZKA 4JAWA 1ZBWA 1GUVA 1PX4A 2GSJA 3ZT6A 2GFTA 2WXDM 3ZR6A 4WSJA 5E6YA 4QLKA 1NQ6A 1HX0A 5ABFB 2DGAA 1OGGA 2NT1A 2W4XA 1J0KA 4D6EA 4CD6A 5HBFA 2Z1SA 4H7VA 5A8MA 4YN5A 5IHSA 2Y8VA 1E6PA 1MWOA 1OIFA 1UYQA 1AQ0A 5IXEA 2G3MA 2YBTA 3ARYA 1EQPA 3VO0A 4JHZA 2VZSA 3OIHA 3TOPA 1GOQA 2YDSA 4DWSD 1B30A 1G9HA 4AZHA 1ZB5A 4BQ2A 1O7AA 1V0NA 1JDCA 1FP8A 4KH2A 4AEFA 2VX7A 4FK9A 2PWGA 2ZICA 1GVYA 3RDKA 5FCZA 1XD0A 2WYSA 1UWRA 4GINA 3WNNA 1R85A 4K68A 3N12A 4LXFA 5A6AA 5AYBA 2J7FA 4J3XA 3L2MA 5CSUA 3WD0A 2WLYA 5CXPA 4HOZA 3W26A 4V2XA 1GCYA 4CCCA 2CHOA 1CLXA 3RPMA 5DO8A 3DC0A 4KRTA 3VMNA 7CGTA 2PWEA 1FOBA 2AAAA 4CUCA 1W9UA 2D0FA 1QI0A 4IM4A 4AYSA 4GZEA 1HNYA 3MSGA 2VQUA 1MW1A 2J62A 1UR0A 2PWDA 4QDMA 2PI6A 1B9ZA 1HJVA 2W91A 4JCMA 3SEPA 1JZ3A 3W4RA 3DHUA 4H8UA 4PMNA 3WN6A 1WKYA 1LQ0A 3PN8A 3AIQA 1VFFA 2CXGA 4W84A 4ZFMA 4H8VA 5DFAA 4FLSA 2EPMX 4UNIA 5CLTA 3ZO9A 3VD5A 1QNSA 1W91A 4JKLA 4Z2JA 3RIKA 3L4ZA 1JZ6A 1KB3A 8CGTA 1V0LA 3IK2A 2DH3A 3MMDA 3CZJA 1JL8A 2J47A 2WVSA 4TVCA 2FHCA 2C7FA 4J27A 1US2A 3GNOA 2WC3A 4GI8A 4GIAA 4H8HA 3QGVA 1GOIA 2Y5EA 4AEEA 1ISYA 1GPFA 4EAMA 3UETA 2BY1A 2DIJA 1X1NA 3MS8A 1BPLB 1KBBA 3BAXA 2WVVA 1W1VA 3ZT7A 3U7BA 3TTQA 2F2HA 4HU0A 3WF4A 1AQHA 3PZIA 4W8LA 1W9PA 1D7FA 1BGGA 4QCEA 1UWIA 4JHOA 1EO7A 2X8RA 3DHPA 1NP2A 2ZUNA 3AMGA 4V28A 2WZHA 3WMBA 3MANA 1KBKA 4HA3A 4BCEA 2X0YA 3GZAA 4W93A 4Z2LA 2VC9A 3MSDA 2XG9A 4GO9A 4F66A 2VZVA 4J28A 3VILA 4Z2IA 3PZGA 1J0JA 3BLKA 2XGIA 4OJYA 3RO8A 2VQTA 3MMUA 3FN9A 4JL1A 4E4PA 4LGXA 1MFVA 1OGSA 1E6NA 4OZOA 1B31A 2YIHA 2DSZA 3SCSA 1B3XA 4B3LA 1GOWA 3WY1A 2YDRA 5KZ6A 2JFEX 2XM2A 4Q7NA 4N42A 1E5JA 1V6VA 4HU8A 3UR7A 1Q6GA 2VZTA 4DM2A 4M80A 2QPSA 4AD5A 4E8CA 1W9BM 4MB1A 5M5DA 1J11A 1HKJA 1H49A 3B9EA 1C93A 1BQCA 1V3IA 1W32A 2Y8KA 1I75A 2WMJA 1FHLA 1LG2A 2ZX9A 2AMGA 2W63A 1W9XA 2XWEA 3O9NA 3OA5A 2RGLA 2UWFA 3OLGA 3BLPX 2X0HA 1NOWA 1F4AA 1E4MM 1G0CA 5I24A 1UWQA 2D0HA 2J25A 2WZEA 1E15A 3WUFA 2GJRA 1VF8A 4HMCA 1HKMA 3U57A 1YHTA 3OZOA 1E73M 1NOUA 1YQ2A 3CZLA 3RM9A 4TVDA 3K8KA 5A1AA 3PZ9A 5BXPA 1HL8A 1F4HA 1KCKA 2WVVB 1LWHA 1GJWA 3I3BA 3SUTA 1P6WA 3E1F1 2WNWA 1K9DA 2XTKA 1JG9A 1OWQA 3T2QA 1ISVA 4TTUA 3W37A 3AJ7A 4OKDA 2YL9A 5HDRA 3JUGA 1JGIA 4R27A 1KQYA 3WEZA 4W85A 4J3VA 3T0AA 1UD4A 2QPUA 1JI1A 4MADA 3U5YA 2HVMA 3NSNA 4AWEA 1VJSA 2YA1A 3BCFA 1V0MA 2FH6A 2XVKA 3TTYA 2WHJA 4UOZA 1M03A 1E3XA 1UR9A 4EE9A 1UKOA 1WNOA 3N17A 3POHA 1HF6A 4GI6A 2PBOA 3ZJKA 3MV11 2Y4SA 1X6LA 4U5KA 5I5RA 1BYBA 1OM0A 4FLOA 3T0DA 3QR3A 3L2LA 4DUVA 4HZ8A 1V3LA 4M29A 3OGRA 1EGZA 3CBWA 4AISA 4HA1A 1BVNP 1JI2A 3W6MA 4CN4A 3RM4A 2XFFA 4P7RA 1TMQA 2WCGA 4MJ4A 1VEPA 1BFNA 2VVSA 1FH8A 1E43A 4J3WA 4AD4A 2E8YA 2XHYA 3AFBA 3GYCA 3MU7A 3WDRA 4AIOA 4H41A 2B31A 2AOSA 4F79A 3VD4A 2C8NA 4QCFA 1BG9A 4PMZA 3AROA 1J12A 1CXFA 1KXVA 1H11A 2BFGA 1KWKA 2WVUA 3WH9A 1CENA 6A3HA 4CGTA 3TP4A 4M24A 3W0KA 3GM8A 1GJUA 4CN6A 3HU7A 1CDGA 1EOMA 1IT0A 2CKSA 4CVUA 1R7AA 4GO8A 2W61A 5CQ1A 1D2KA 2ZUTA 4DUXA 1KQZA 4P7NA 3WF2A 5M3WA 4W89A 3THDA 1UD5A 3CUIA 1J10A 1OD8A 1H4PA 4U3AA 2O9RA 1V02E 3KE0A 2XSAA 1EIBA 4UQ9A 2CNCA 3A4AA 1S46A 2DEPA 1CXKA 1MQQA 3AZTA 2OSXA 3IANA 2W62A 2J7DA 5GPRA 4PSRA 5A2AA 1EHAA 2ESCA 3SCQA 3WNKA 1GQKA 1Q6CA 2YL8A 5JIPA 1XRVA 3DYOA 1QOXA 4ZEPA 5LA0A 1DWGM 4P7QA 4WIWA 1ZBVA 2X1IA 2DSVA 4CD8A 1NP0A 2DT0A 5BYWA 1UH3A 3CHEA 3WFZA 4JL2A 1KCLA 2QHAA 2PWFA 1EDGA 4J3TA 3ARUA 3CTTA 1XH0A 4M1RA 5GQBA 3WL1A 2IUZA 4JKKA 1WCGA 6CGTA 4B16A 3SIMA 4LYRA 4FMVA 3KEHA 1QNPA 2WMFA 2ZX5A 2WANA 2JIEA 1E70M 1XSJA 2WMIA 3VMOA 1K9EA 3M7SA 4WK9A 1KXQA 1NWSA 1TVNA 2JEPA 3CUGA 1UH2A 2VCAA 2UY3A 1E3ZA 1GQLA 4KWUA 4UOQA 3VIMA 1QW9A 3GBEA 3CZGA 1UQZA 4D6DA 2V5CA 2ZXAA 2CHNA 4H2CA 4CCEA 3AQUA 3GH7A 1HKIA 3ZM8A 4UFMA 1H3GA 3FXYA 4NI3A 1QW8A 4HMEA 1JAKA 1Q6FA 2YOCA 8A3HA 2XFRA 1QI5A 3AZRA 4F9JA 3II1A 1FH9A 3W81A 3CMGA 1PPIA 2G4FA 3VIHA 4MJ2A 3PZNA 3AHVA 2DSKA 2VOTA 1NARA 1GVIA 1HJSA 2JALA 2W92A 3RCNA 3MO4A 3NYDA 2XJ7A 1WPCA 2BNJA 4ATDA 2WSPA 4J3UA 3RJYA 3K8MA 4UQCA 2CYGA 1H2JA 1JFHA 1V3HA 1M7XA 5A95A 3MUIA 1C90A 5BRPA 4IISA 1XV8A 1E0XA 2CESA 4B9ZA 2TAAA 1QHOA 1W1YA 3I3DA 4UQBA 1H1NA 1E0VA 2GDVA 2V5DA 1BF2A 1CGVA 2WHMA 3AXIA 4TUFA 4DWSC 1TZ7A 2A3AA 3VGFA 1JYWA 1XYZA 5CPTA 2VZUA 2QV4A 2FDMA 3VDHA 1HJWA 1NM9A 1Q6DA 2WZIA 4CVWA 3WBEA 1EXPA 5C70A 3BC9A 4F9DA 1DWIM 3VIJA 1VEOA 1JZ7A 3ALGA 1BYAA 3NIYA 1VFOA 4WKAA 3IJ7A 4TOQA 3WMCA 4UFJA 5GNZA 3FAWA 3ZMRA 3MUY1 1KXTA 4ATWA 2WMIB 3CHFA 2BXZA 2WC7A 1UD8A 3GXMA 4RE2A 3ZJ6A 1W3HA 4D71A 2YKKA 3K8LA 1CEOA 1OCQA 3FHAA 1E72M 3W25A 3AHZA 3SUSA 1JIBA 4PTVA 3ECQA 5DT5A 5A6LA 5A6SA 4DWSA 1H41A 1FH7A 1MQRA 2ZUSA 1MXGA 3AYRA 1GQIA 2YJQA 1Q6EA 4M8UA 3HN3A 3WQWA 4PMUA 1BG4A 4LQ1A 1QI2A 3F5JA 3WUBA 3A4WA 1BSIA 3VOCA 3A3HA 5A8QA 1A3HA 1GHRA 2WMHA 1WZMA 2JEQA 3CGTA 2O9PA 1HVXA 2VX5A 4P7OA 1CPUA 1JF6A 4AD0A 4IPLA 4PN2A 5CSYA 3OLIA 2J78A 5ABEA 3ARZA 3ZT5A 1UZ1A 3RJXA 3ZJ8A 3WIJA 2E9BA 1JZ4A 4MB5A 1NOFA 3K4AA 3FAXA 3W82A 4GXPA 2EJ1A 3WF0A 1PZ3A 1UD6A 3KL0A 2QMKA 4Z2GA 4DM1A 2WCSA 1XSIA 4PMXA 2ZWYA 4U5IA 5CLWA 2NW0A 4D6HA 1LL4A 1QNRA 2A3EA 2VO5A 1MW0A 2DSWA 3APGA 1HJXA 3HJEA 1IV8A 4PMQA 4A3YA 4P7LA 4C7GA 4HMDA 4QLLA 1LG1A 3BCDA 1FHDA 3GDBA 4CD5A 3WQ5A 4C7DA 3AHXA 4PSPA 1XC6A 3GXDA 1JF5A 3CH9A 4LYQA 5F7UA 1BLIA 1E56A 3RM8A 2J74A 4ACYA 3VPLA 2ZUMA 1R7OA 4RL3A 3ZR5A 3VDAA 3WENA 2BS9A 1VENA 2BHYA 4X0VA 3AXXA 2VT0A 1KWGA 1VJZA 4PCTA 1E1EA 5CGTA 1UZ4A 1RH9A 4J7RA 4ZENA 3O6AA 1CWYA 1ZBKA 3ARQA 1JD9A 2VVNA 1QNOA 2D23A 1PIGA 2BVYA 4MNJA 4EK7A 3VGGA 4MDPA 2X09A 4DWSB 4JIEA 4UQAA 2XFYA 3VX1A 3NUKA 1D3CA 1GNXA 3WQVA 1UR1A 1R8LA 5A6JA 4UFLA 2XYLA 2ZWZA 1J0YA 1ZJAA 5BRQA 1VFMA 1SYTA 1UKSA 3K4DA 4GKLA 3W27A 3ZJ7A 1W2PA 2WMKA 1C7SA 2YA2A 1JXJA 1RP8A 2NSXA 3BMVA 1WZAA 1E4IA 4AD2A 1K6AA 4WF7A 4GZJA 2X05A 4P8XA 4KGLA 1E5NA 1XCXA 1C8QA 4PMOA 3VGEA 3ZIZA 3CZKA 3GBDA 1K9FA 1V6WA 3D3AA 5D9OA 4OBRA 3OZPA 4QFUA 3ZOAA 2DDXA 1E6ZA 4XB3A 2ZUUA 3VIKA 2ZX6A 1XGZA 2ZIDA 1DP0A 4BQ4A 1H0IA 2J8GA 1ECEA 1WP6A 5E09A 5CPSA 2D0GA 1B2YA 4CD7A 1E6RA 3KL5A 1BAGA 1KGUA 1UWUA 1UQYA 5AYIA 4BS0A 5JBEA 2GDUA 5GNYA 2VRQA 3VD9A 2WKGA 5HNNA 4PTXA 3QOKA 5I78A 1DWHM 1XCWA 2VRKA 3NDZA 3S2CA 1W9DM
chains in the Genus database with same CATH superfamily
3G1SA 3TONA 1QNQA 3PHAA 4DEFA 1G7UA 2F61A 1XGEA 1QWGA 1BXCA 3QFEA 2WWDA 5G2IA 3WQ6A 4XVEA 2RDWA 5A6MA 2V2DA 4L9ZA 3FGCA 1ZCOA 3VOFA 3GXIA 3BARA 4Q8OA 3B0XA 3V0SA 2X7WA 4X61A 4KCTA 4EAYA 2GUBA 1YDVA 1Z69A 1TE1A 2J79A 2QULA 2XZ7A 1V79A 4U2ZA 4KGJA 2GDQA 1D3HA 4N0RA 2IXVA 5F1VA 1N55A 1TTPA 5BOFA 3L4UA 2DJLA 4FXRA 3WLOA 3I7QA 5D05A 4O14A 1LLOA 5A69A 1ZALA 3B0PA 3GE7A 1OIMA 4IGMA 1RPKA 4K38A 1HGYA 2VGGA 4GYPC 2Z25A 5E9AA 1EF2A 1X97A 1HT6A 1QO5A 3LHZA 1LORA 4J2MA 3W53A 4JS3A 3A64A 2GUYA 3LHUA 1QI3A 2C71A 1L6YA 3LLFA 5FSEC 1DXIA 4MPQA 2VI0A 2H3BA 1QAPA 3WNOA 1SJCA 1V08A 4Z1DA 1W3JA 3NZ1A 3TFXA 1EUNA 1T8XA 1H0GA 1RV8A 1EX1A 1QFEA 4DYEA 5E0FA 2PD9A 1XYBA 3W83A 3KBVA 2GVGA 3TTSA 3LU2A 5HWMA 3H7VA 1Q4WA 1EQCA 1XFCA 3GH5A 1FWJC 4S3BA 1K02A 2INFA 1SUXA 3MMTA 1VAHA 5AN7A 4RW5A 1H7PA 2EAWA 3CL8A 4GYPA 4HPGA 3DFTA 3KVLA 2J8FA 2RDXA 3KBSA 1K70A 4M19A 2PMQA 4UQEA 3WQ4A 2QNEA 4PUEA 4CNPA 1IXOA 1CBGA 5DT7A 2VUYA 1DJHA 3UBPC 2E1WA 1KM4A 4V27A 2H8XA 4M56A 3W1PA 4OBSA 2P76A 3L0NA 1XYAA 1KBIA 1L6FA 4K6AA 4LY4A 4KRUA 3KVKA 1TA3B 3HG3A 1JRBA 4NIRA 1G1YA 3U9IA 3I7RA 1EPVA 2A85A 5ABGA 3KAOA 1GTHA 2FVKA 4AU0A 3COTA 3UR8A 4ZE5A 4GYFA 1XW8A 5EMYA 1IGWA 1RCXB 4ZB2A 2XH7A 3KWXA 3L4TA 1GORA 1E1FA 4HYRA 2RJGA 1HO1A 4Q8NA 2VR4A 1DWAM 3BL3A 3SCTA 1OD0A 3E0VA 2DIEA 3UGRA 1N8WA 2OXNA 3BAJA 3O2LA 1IGSA 3NZRA 2J7HA 1X38A 4X22A 3DYMA 4PFMA 2PDGA 4PCSA 3WELA 3QTPA 3NSXA 4HHMA 1FCVA 2QKFA 1KLZA 1XYFA 5AVHA 3EWXA 5GJPA 2BHUA 2BVDA 2WLZA 3UESA 4YTTA 4XBSA 2Z24A 3KOWA 3R11A 4MYXA 3KRUA 1QWKA 4Q8UA 5CPLA 4B5XA 3W7DA 3RITA 1VFSA 1RD6A 1FWIC 1E6SM 2PTZA 4N6FA 3EDEA 3TN4A 4HNLA 3CUXA 3QC0A 4NRRA 2YCLA 4AY1A 3BZGA 2QCDA 2R1MA 2UY2A 3CYVA 2HS6A 2VGFA 1VPYA 2VNCA 2VCBA 4RPQA 1UA3A 5K3VA 1EJVC 1RAKA 4H9YA 2DPEA 4NAFA 1VFHA 4CU8A 2WMGA 1M68A 1FKWA 1ZJIA 3IGHX 3SUWA 3ZS4A 1AL8A 7TIMA 3BV4A 3A6OA 1HFBA 4JFSA 2XPKA 3IJ6A 4D6FA 3CPRA 5DCDA 4DLFA 2YX0A 2JGYA 3CH0A 1UKTA 2JIWA 4XZBA 1LROA 3TC3A 4MZ8A 1EA9C 3WLQA 4PL1A 3H4GA 4YCPA 2Y24A 1H50A 4C1NB 2Q01A 2XH2A 3WLJA 6ENLA 1B3WA 1A0DA 1NWTA 1ZY9A 3QMRA 5CGMA 1CZ1A 3W70A 4IFOA 3PTMA 4BI5A 3N9RA 2REQB 1EDQA 4IMGA 1QBBA 5F2GA 3P84A 1PIFA 3WD1A 4Y9NA 1AMYA 4OU1A 4GWEA 4JD4A 3ZZ1A 4UFIA 3QFWA 4L6DA 4X3ZA 2XIOA 1CX9A 1XIGA 4FAMA 2ZE0A 1O12A 3LPPA 1NWRA 1A3WA 5ECUA 4PCPA 2BOGX 3GNRA 5IFPA 1FDJA 3FEMA 3SCVA 1CXLA 3W28A 1PBGA 3VI2A 4XD5A 1FWEC 2EG6A 3N13A 1VKFA 3UCQA 2NV9A 1VIWA 1RBLA 1OFDA 4ALDA 3FK4A 2BY3A 1XFBA 2VWTA 4JTGA 1G01A 5FD0A 2XIBA 3GB6A 3H21A 1H7XA 2HJPA 2WB5A 5A3HA 3MDUA 1JD7A 1AG1O 2P0IA 5IM51 3HG4A 4A21A 4DYJA 2P5NA 5CGQA 1YXCA 1VFUA 3NZQA 4NRSA 1TR9A 3GR8A 4L6OA 4GJJA 8TIMA 4OIFA 1VHNA 4Z0JA 2QJMA 4ZZ9A 1MDRA 1PDZA 1ECQA 3SJ3A 2VFDA 2GZXA 2PP1A 5D04C 2VCCA 3HZ3A 1S1PA 4M3PA 5AB3A 1JCNA 3PWGA 2CC0A 3O0FA 1EHNA 3M6DA 4XX6A 3I68A 3SECA 2VTFA 5BWFA 3NR0A 3KBWA 3THCA 4Y8FA 5EFFA 3TA9A 7XIMA 3ANVA 4R88A 3SFKA 2HISA 4U3CA 2BBFA 2HQAA 3VNZA 1HJUA 4RUBA 3N04A 1P1XA 5DANA 3LY0A 2B7OA 4XZNX 1GYNA 1PEZA 2EXOA 3WJXA 4URIA 1GG0A 4B5UA 3SRKA 2PBGA 3IJIA 1DE5A 3WSUA 1KM5A 5LYRA 4NAEA 2GGEA 2IKHA 3FV9A 3L65A 5I6SA 3U6WA 2HSAA 2J8TA 3SUVA 4JTHA 4M7TA 4AZBA 1O6IA 4U2YA 4MNLA 3WQGA 4ORIA 4O28A 1P5BA 3HG5A 1MI3A 1T7LA 3H8AA 3F2DA 1FA2A 4WDUA 3BAYA 4XTDA 1DL3A 1OABA 2ZRZA 1J01A 3CT7A 4WDXA 2GK1A 3W72A 1T99A 5EY5A 1V6YA 3ITXA 2E3ZA 1K7XA 3GUGA 4AD3A 4PMRA 1FWBC 4IFRA 4HNTA 4HCDA 1JZ2A 5CC5A 1XICA 1XLDA 3P14A 5ENLA 3SCNA 4O10A 2J75A 4HOWA 3CWHA 2I9EA 4FIQA 3ZLGA 3PUGA 1R47A 2V0TA 4AWTA 3FJ6A 4WKFA 4WRHA 4D6CA 3AIEA 2MANA 4HKPA 5HMDA 3RAOA 3BZJA 3VKKA 3PFRA 2FLIA 5C2CA 3HIJA 3CHCA 2IS7A 5G5IA 5A6TC 3QHOA 5AVNA 3P3BA 1R9ZA 3W2NA 3POCA 4DJFC 3GLCA 4H6EA 5D8ZA 3W24A 4YJ5A 1SW7A 5B7ZA 1SFSA 5FEZA 3F4WA 3EWYA 4Q7BA 4ADSA 3TQVA 4XV0A 2IPGA 4NNAA 4R34A 2Q3RA 2O7QA 3QN3A 3M47A 3VMPA 1GW1A 2VD8A 4HJWA 2XN1A 4ENLA 1CXHA 4KIRA 3UPWA 4B92A 1EGMA 4ACZB 2HS8A 4UTLA 1OX6A 1IXNA 2A21A 4AIUA 4ATLA 4IMDA 2Y2WA 2OYMA 3VA8A 4IQLA 3BGGA 1KFLA 3M07A 2FGLA 4E3TA 5DMYA 4ML4A 3WH8A 3NPWA 1L0PA 2CBIA 2H9AA 2ZOXA 1S2CA 3T1GA 3P60A 4MNKA 4NF7A 2YBUA 2ABAA 2BTMA 3VE7A 1R3YA 4X0NA 3AWOA 2A0NA 3EX3A 5T91A 3FW6A 4XSLA 1EGVA 4JTRA 3NEHA 5A8OA 2Z29A 4DB7A 4O15A 2XVLA 2NX3A 4YTQA 3CUFA 2J7BA 1FWTA 2D3LA 5FL1A 1EP3A 1ONRA 1TZZA 2F7FA 4QROA 4WJEA 4HTBA 1F9CA 3TC7A 3WNMA 4GJIA 5IFTA 4GQBA 4YIWA 2W66A 4JX6A 4IXHA 1DJXA 3HPAA 4CD4A 3T78A 4UR9A 1JAEA 4B15A 4XSMA 4X2PA 4S3JA 3S83A 4K1WA 2VX6A 3PPHA 4Y7EA 1GPWA 1YYAA 3LLDA 4LS1A 1X6NA 4ICMA 4QE1A 4RZ6A 3SQSA 3KRZA 4LVDA 2CU0A 1U1UA 4JTDA 1NWUA 4RX0A 3PSWA 5MKGB 4LEFA 1YTDA 1IXQA 2INEA 1I1XA 5AHIA 4Y2WA 1WO2A 3AOFA 1L8NA 2DZXA 4UNLA 3MPGA 3N9KA 1U2YA 1B3ZA 1ELSA 2FHFA 2PRHA 2VL4A 2XVGA 3NGJA 1Q4NX 3GG0A 3P5YA 3W2MA 1JCMP 5KZMA 5IBXA 3N11A 3WLNA 2DQWA 3OVRA 2OWCA 3WJWA 3WDQA 5D2YA 3CPGA 1VS1A 1XH2A 4NZCA 4NXKA 2YCIX 4MFEA 5ABFA 5BCAA 2DZVA 1QHPA 3VUSA 4HN8A 3SCOA 4M82A 4X2RA 3ABZA 3MQTA 1PX3A 5J8LA 3MI2A 1UB3A 1TV7A 3VUPA 2CFFA 4JZ5A 2UZ9A 1DJWA 1I6NA 1BVZA 5C55A 1CECA 3WLMA 1XLBA 3FY1A 1K8YA 2X1UA 1XG4A 3S9IA 1H09A 2QCFA 4JN8A 1TCMA 3UXLA 2GJXB 5E0CA 1A47A 5TQLA 5JU6A 1BF6A 5HJLA 3NQAA 3FLUA 5LXXA 4V15A 2XVNA 3FA4A 3TNOA 8XIAA 3KTXA 4AW7A 3NQEA 3G1FA 4HHPA 3NQVA 1UR8A 2EPNA 4ZB0A 3DG3A 1P43A 4HA4A 3W1LA 3C8NA 2QVHA 4S3AA 4QG6A 3BICA 3AXKA 4NYUA 2P3EA 3VU2A 4DZHA 3G5EA 3KP1A 3M0ZA 3P82A 2MNRA 3A9BA 4NASA 4GI4A 3TQKA 3LCLA 4DBSA 2CLFA 4B4HA 1M01A 1TJRA 2Y7EA 1OZQA 4PUJA 4WOZA 2OKOA 1I1WA 3VIIA 1A5MC 2POTA 3E3HA 4UMAA 3ZT6A 2GFTA 3NQ7A 2H3DA 3K2GA 1NQ6A 3WCZA 1ONWA 1K8XA 4CD6A 1SZGA 4D8ZA 5HBFA 2Y8VA 1OIFA 1UYQA 1AQ0A 1U1HA 3S2LA 3O3RA 3ANUA 3UF9A 2E6DA 4JTQA 3TOPA 1GOQA 1VFTA 1IHIA 1B30A 4JTSA 1JDCA 4O12A 4AEFA 1L6SA 5EL1A 2PLJA 2VD9A 2WYSA 4PB3A 4L1WA 3KX6A 1SFLA 2OPJA 4JQ4A 3GWQA 1R85A 4K68A 3ELFA 4HJFA 2J7FA 4L65A 3STCA 2NLIA 3L2MA 6TIMA 1BXBA 3W26A 2BWGA 1LZOA 3C86A 3PNUA 1M5WA 2CHOA 3RPMA 3C2FA 3PTDA 4MUZA 4AVFA 2AAAA 2D0FA 3R10A 5BZAA 1GVOA 2P10A 1HNYA 5FAGA 1RJRA 3A12A 2PDIA 4LSBA 3CC1A 2J62A 2P1FA 1EKOA 1B9ZA 3SEPA 1ZUAX 1FBAA 3SY5A 3DHUA 4H8UA 3WN6A 5AKQA 2SFPA 3AIQA 1I0DA 3OJGA 3BUVA 4FLSA 1S38A 3R7MA 3ENLA 5EMKA 3ZO9A 1M1BA 1GGOA 1FQ0A 1JZ6A 4BI6A 1KB3A 2GQ8A 4P5UA 2QDGA 5H91A 2A4AA 2W9MA 1XLAA 4H00A 4WX2A 1XQKA 1JL8A 1LRQA 1B4KA 1UMLA 4TVCA 4UTJA 4WOQA 4H6QA 2QVNA 1JPKA 4HK6A 1T40A 3CMFA 2A7PA 4J27A 1US2A 3GNOA 1YW1A 1PKNA 2ZRVA 4H8HA 1GOIA 3AJXA 4AEEA 1GPFA 3UR2A 1GOXA 4EVZA 3MS8A 3BAXA 4UTTC 2NV1A 2O55A 2OEMA 1KTNA 1W1VA 3ZT7A 1N8FA 2F2HA 1AQHA 3PZIA 2OT1A 3DG7A 1W9PA 2CXEA 3EA3A 2FDSA 2X1TA 1OHLA 2A1YA 3W7PA 3DHPA 2RKXA 1P6CA 7ODCA 1KBKA 1T5AA 3TV8A 4YYCA 5E93A 3F2BA 2VC9A 1GEHA 3N73A 4J28A 3VILA 4AH7A 5G1TA 4Z2IA 1S5VA 1Y5VA 4L56A 4L9YA 4RV3A 4JL1A 2NSOA 4LGXA 2ZRYA 1GK8A 3GTIA 3JZEA 4OZOA 5DQPA 4QG9A 4DAIA 1EJTC 1B3XA 2TRSA 4AVNA 1GOWA 2AL1A 3WY1A 4B3LA 4UTTA 2X30A 2Q8ZA 2JFEX 3QXBA 2XM2A 4N42A 4M6PA 2FB3A 2VZTA 4M6UA 3DG6A 3F03K 4MB1A 3W02A 2Y8UA 1BQCA 2PDNA 1W32A 2Y8KA 1QOPA 1W1IE 8XIMA 4JYFA 2RDUA 1H7OA 2OQYA 3HQPA 4KEUA 3W1XA 4CNSA 2QJHA 3JW7A 2DUZA 3BLPX 1UWQA 2D0HA 1HG3A 1ITQA 2J25A 3G0UA 1UASA 4S23A 1VF8A 6PTDA 1QMLA 3FS2A 2WSQA 3IV8A 3K8KA 2OQLA 3PZ9A 4KBXA 4C6DA 2WVVB 1GJWA 1FXPA 3N34A 2FPYA 3E2SA 1QJWA 1OWQA 2A7NA 3ZVIA 1Q8JA 1OFOA 1YPIA 3MSYA 3WEZA 2NZLA 3GHTA 4J3VA 2HVOA 1XYMA 3U5YA 4Q4SA 4QS5A 4GBUA 2FH6A 2WHJA 2D69A 2FIQA 1QUMA 1UKOA 3IUDA 4HZMA 2PD5A 3BLDA 3POHA 4TX9A 3NL3A 1NJJA 4AX6A 1XQLA 4GLEA 5FJTA 4U5KA 3IGXA 2VYOA 1OM0A 4ZTYA 4H9TA 3URAA 3QR3A 3L2LA 5HJYA 4IICA 1JCJA 3OGRA 1KC7A 1EGZA 4AISA 3KM8A 1A5KC 4ERIA 4DO4A 3LBOA 3BE7A 5I07A 1DV7A 2WCGA 4PB5A 1DJIA 2G0WA 2E5CA 4UTUA 4LYKA 4AD4A 2ZA1A 1YADA 3GTXA 2C8NA 4GH3A 4PMZA 2AL2B 1J12A 1CXFA 1H11A 1KXVA 4IH3A 1CENA 1REQA 3PM6A 4IPJA 4M24A 7REQA 2PCQA 3IARA 2YSWA 4C5YA 3NQDA 1GJUA 2H6RA 3H7RA 1CDGA 4NXSA 2QDHA 4DZ5A 4W4QA 1KQZA 4WXYA 2E5BA 3HPFA 3LEPA 2BMBA 3CUIA 4ASTA 2O9RA 2Y1HA 4I5UA 1EIBA 2FJUB 4UQ9A 4HNNA 2DEPA 5LNSA 3AZTA 3IANA 1TMHA 1FRBA 2CZ5A 1LBMA 5GPRA 3G18A 3O63A 5A2AA 1VR6A 4ZOEA 1AH3A 1Q6CA 1XYLA 2INZA 3DYOA 1QOXA 3KDOA 2BVWA 4WIWA 4UTWC 1NP0A 4MM1A 4D2JA 1KCLA 2PWFA 1VHCA 3XINA 1AL7A 3W2LA 1BRLA 4M1RA 4GBDA 4I9AA 2Y0FA 3HB9A 4LYRA 3DFSA 1VLWA 2WANA 3SIZA 2JIEA 1E70M 3VMOA 3TNBA 5JXQA 3G8RA 4B4FA 4FOJA 1MZRA 3O05A 1QW9A 4EF8A 3ABQA 2V5CA 1IE7C 2ZXAA 3PBMA 3GAYA 4PGLA 4N02A 4AMAA 3TC6A 3GH7A 1H3GA 4HMEA 1JAKA 1RPXA 8A3HA 4M51A 4LV9A 3E5BA 3VKCA 3W81A 3CMGA 1PPIA 2G4FA 3PZNA 2EF9A 4Q32A 2W92A 2R14A 2G37A 5L6UA 1H1YA 4B2DA 3RJYA 3R1ZA 1H2JA 4H83A 2Y5SA 3LCXA 1E0XA 1O95A 4Q4PA 1Z41A 1TPDA 3BLIA 5F2LA 4MLJA 4UQBA 1G6CA 1ME8A 1CGVA 3KOFA 3ZVHB 3AXIA 3DKLA 3QEZA 4KQNA 5AC8A 3N14A 3GW3A 5TIMA 1XYZA 1HJWA 1NM9A 4HPXA 3WBEA 3LTSA 4KWOA 3BANA 3UPBA 3ALGA 3VZZA 5C9ZA 3STEA 5AYZA 2Q8LA 3USZA 3B8IA 4O1BA 1ZFJA 3DCPA 4JR5A 3KLLA 4L7ZA 4PRRA 1YBQB 3TMQA 1XCFA 4ZQRA 2BXZA 4IIHA 4KKXA 1WA3A 1MO0A 3FHAA 1O5RA 1TE6A 4QQ3A 3AHZA 1KLYA 5A5WA 3SUSA 1W3IA 4PTVA 4JYDA 3LQLA 4HHLA 5DT5A 3RK8A 3N4FA 1H41A 2ZUSA 3I6EA 1MXGA 3LN3A 4AEOA 1GQIA 3THUA 2YJQA 2RH9A 4ZO8A 4M8UA 1QI2A 3F5JA 3W7JA 5A8QA 1VGAA 4PA8A 4GGHA 1DE6A 3CGTA 1A0EA 5FF4A 1EC9A 2ACUA 3H23A 4K7VA 5CEWA 4LB3A 3ARZA 2B81A 4Y8EA 5G2WA 3RJXA 3TA6A 3WIJA 3ZJ8A 1JZ4A 1G7VA 2ZVRA 4MB5A 1NOFA 3K4AA 1PZ3A 1UD6A 4FF7A 4Z2GA 2VP8A 3LTPA 4TO8A 2QT3A 1B54A 1K8CA 4X9SA 3G1DA 4KESA 4HMDA 2YW4A 4QLLA 3WJYA 1FHDA 1NFBA 3GDBA 2HE5A 4I7UA 2PC4A 5FF0A 4Y9MA 3AHXA 3SRHA 2VKZG 3L2IA 3QR0A 3GXDA 5RUBA 1ADOA 3W84A 1QASA 5AHMA 4I9MA 3G3DA 4Y9PA 3NG3A 4NJHA 1M7OA 3VPLA 5BWAA 1R7OA 4RL3A 3VDAA 4O8AA 3WENA 4LANA 2BS9A 4BHYA 4X0VA 3AXXA 3W1AA 2OZ3A 3VNJA 1OEPA 2CLIA 1RH9A 1BWVA 1LQAA 4ZENA 2L5HA 5SWUA 3ARQA 3ERPA 5FF3A 3A21A 1R5YA 4EK7A 5LNRA 1PB0A 3HPXA 3APTA 4LAOA 4JIEA 1TWIA 4KIEA 2Z4GA 2OCZA 2C16A 4PCNA 1GNXA 5J5DA 1UUMA 1R8LA 4ZQCA 5A6JA 2GVEA 2VFHA 3GHSA 2PTYA 4MMWA 3C4UA 2ZYFA 3NTYA 4HPNA 5CAHA 2WMKA 3LX9A 2YA2A 1JXJA 1EJSC 2NSXA 1E0TA 4XIAA 1U83A 3DFYA 4C90A 2VENA 4JTKA 4AG0A 3QQWA 4RPPA 4IFKA 1P0KA 2X05A 1MDLA 2OO0A 3W1TA 1ZRQA 1XIHA 3CV1A 4QFUA 1JUKA 3K5XA 1E6ZA 4HIBA 1A80A 1YE4A 5DY2A 1DP0A 2WJEA 2VGBA 2J8GA 3PK7A 5E09A 1UCWA 5CAKA 5CPSA 4S2CA 4CD7A 4AF0A 2POZA 4EWJA 4AQLA 3CEPA 4KEMA 1AZ2A 3KL5A 4GQ0A 4IL2A 3W1MA 5FJJA 5XINA 2AMXA 3H70A 4O1DA 5LSMA 2GDUA 5GNYA 2VRQA 3VD9A 2IKJA 1TPC1 5HNNA 2OG9A 4HYWA 1F6YA 2DZPA 1XCWA 2XINA 5I2UA 3ABXA 1K77A 2BHZA 5TBOA 1LYXA 1I2PA 5LA1A 4L5ZA 3LNMA 1S1RA 1XKJA 2PDMA 1F6KA 4MKNA 3BGAA 1VCGA 5I79A 3BJFA 2A3HA 3IAQA 2BGNE 4UOJA 2A3BA 4UTHA 5C71A 2NX1A 2J7EA 4ADUA 2WZTA 4P8WA 2Y7GA 4Q7IA 3GNPA 5HUOA 4JFTA 2ZRXA 3S5NA 4DXKA 1XS2A 4G7FA 2EQDA 3EWUA 3S2NA 1JXKA 1GOKA 3FNDA 4S39A 3WUEA 1DJYA 4HHHA 1QI4A 4C6QA 4L4PA 4OOZA 2C13A 1UOKA 1FWSA 4G56A 4K8EA 2BG5A 2WKJA 3SSZA 3CQJA 1M3UA 1F3TA 4O16A 3GUWA 3CS2A 4W5UA 1DIKA 2R1PA 4E2OA 1K9TA 3QHNA 5HMSA 1PO9A 4EXAA 1XLCA 1MUMA 2WVTA 4U10A 2E5DA 3H22A 4NSBA 3UG5A 3RRAA 4WHBA 5I3DA 3CPUA 1SZRA 3NAVA 2YL5A 4QNEA 1M65A 2OWXA 1YDNA 3WQEA 2EPOA 1VRXA 3SJNA 3W7MA 1FWGC 1HZYA 4LAZA 2YLLA 3P81A 1M6JA 4LTSA 1XLKA 2DORA 2RHGA 4JTTA 4XKYA 3ATYA 4N9BA 1V8EA 1YNPA 2G4JA 3P67A 3NGFA 4P2VA 4QSFA 2F6XA 1IEWA 3GDRA 3RCMA 3L4VA 3URQA 1WAWA 1GZJA 3W74A 3VDBA 1Y8BA 4ZOAA 3PTKA 5BOEA 3U2EA 2CKRA 4RXGA 2CLOA 3BWWA 4KERA 1GOMA 4NZ4A 3BJSA 4KMQA 4IGNA 2BDQA 1J79A 1EH9A 1LUCA 3R0KA 5TF0A 3PB0A 3QZAA 3VKBA 5I09A 1LT8A 2XSBA 1OK4A 5HR6A 4KWSA 2NLYA 3I4KA 3XISA 1GVRA 3G6LA 1SMAA 3N29A 4DLMA 5D02A 1W3NA 3R5EA 2FYMA 3I6TA 3N2CA 1E6QM 1K6WA 2Y61A 3VNLA 1S5MA 4DYKA 3AI0A 1XI3A 1V0KA 1EJRC 1RJQA 3KS5A 2E6AA 4LOCA 4DUWA 3GG7A 1V93A 1SO4A 3IJ9A 1ZENA 3P0XA 3TYEA 5D8WA 3REQB 1K3UA 1NIUA 4HSOA 4REQB 5BRBA 4IMAA 1TFVA 4MZYA 1MXSA 1BYCA 3UW6A 2CIPA 2FGZA 3UG3A 1I9CB 4I5XA 1J0IA 1MVYA 1KTBA 4M81A 1RQEA 1C8YA 3TMLA 3UJEA 2QF7A 4NI8A 4JCLA 5L9FA 1J9YA 3LV5A 1NH6A 5HPCA 4PBGA 4A3HA 3UWYA 3P93A 3NQ8A 3QLDA 4FNUA 2NV2A 2YZ5A 2W0UA 1LWJA 3LRLA 7PTDA 2Z7GA 3LHWA 3RPDA 4QP0A 1F76A 1F8IA 3F1QA 3OODA 3BLFA 1FHVA 4MB3A 4H4IA 1V6XA 1PUDA 1UBPC 1UP2A 4FP1A 5FA5A 1XH1A 3UWWA 4FXFA 1LWIA 3HO8A 2C1IA 4OE7A 5HOSA 2VX4A 4XG1A 5D32A 1US3A 2YLAA 1MSSA 3OYXA 4QG8A 1TV3A 2VMFA 3QV6A 4FLQA 1AUSL 1MFUA 4XZWA 4KWWA 2JKAA 1N82A 3RR4A 3CT2A 4LJ3A 3GTFA 3JR2A 1W5PA 2WCAA 3S9ZA 2EPLX 4NZ5A 3WZ0E 4Z2HA 2ICSA 3R8GA 3BLOA 1LRNA 3CV6A 2P0OA 2RJHA 4GKTA 2ISWA 9XIMA 3H2NA 2NQ5A 2IXUA 2C0AA 3R8RA 1G69A 3N2XA 2R9RA 4MWAA 3SCPA 4Y90A 2WPBA 3LHYA 3TTOA 1QHZA 2JF7A 2GOUA 1XPGA 3PANA 3L5LA 4JKMA 1XISA 4O0QA 2PGFA 1RCQA 4JTAA 4FNTA 1VBRA 1EFZA 1UG6A 4I5RA 4DXVA 3UCDA 1YPXA 3IACA 3U3HA 5IRPA 2ADAA 3HFTA 3TJ4A 5DF0A 3GDLA 5EPDA 2YCLB 1TPEA 4U31A 3FFSA 3INPA 2MUCA 3BAIA 3N3MA 4JFUA 1WBJA 1ZNNA 1ZJBA 4PYSA 3RXZA 4BZYA 1N7KA 3IUHA 2DW6A 4D6IA 5CPOA 3WLIA 4JFVA 5E0KA 4ZXLA 3ARWA 2XWDA 3FKKA 4WCJA 3W9ZA 4JFWA 2X0SA 3M0KA 3SCRA 2TMDA 3D0CA 3H6OA 3FVMA 2NQ9A 2XU2A 3S1XA 2YL6A 1R87A 3EEZA 4CQAA 3BO9A 4LY8A 3UA3A 3KL3A 1F07A 1BTMA 3DX5A 1CXIA 4V1XA 2O0TA 3DFHA 3H4XA 1C92A 4PUWA 1R6WA 4RDZA 4IUGA 3WQ8A 3GIPA 3ZSTA 3OVGA 3B8SA 4PMVA 1FFQA 3M5XA 2ZFAA 2BLEA 1PKYA 4UBPC 1I2OA 3AMCA 3B8DA 4JQ2A 3P74A 2VURA 3NXLA 2OFJA 2HVNA 3VCCA 3O06A 2PC8A 3TN5A 2XH0A 2XN0A 4INFA 4MAVA 4UTMA 3N6QA 3WL0A 2G41A 2I17A 3SURA 3LRMA 2O9TA 2EPKX 2PRMA 4F4RA 4AD1A 1PYMA 3DIPA 5KETA 2QCGA 1Q6LA 4KRZA 5A8NA 9RUBA 5M2FX 3PY2A 3VGBA 1T0OA 1S2WA 2CBVA 1GONA 1R9XA 1YXYA 1JGMA 2CEQA 2RGMA 1HL9A 4IP7A 2YA0A 2P53A 1BEUA 1W3TA 4W7VA 3WG6A 4HNOA 4XK2A 3HQOA 1P7TB 2WM0A 3MSRA 4LVAA 2CBUA 2O9OA 3WLSA 4H04A 1OSEA 3WDHA 5DBTA 4I9JA 3IEBA 3C6CA 3L66A 2J9ZA 2GJLA 2X2GA 4Z17A 4OOUA 5BMXA 4YHGA 4GIYA 3MUAA 3CAWA 5BROA 4AZ7A 2D1ZA 3N1AA 3ARSA 3URNA 4D6GA 4TR9A 2WBKA 3BK0A 5CKSA 4PMYA 3THQA 1XX1A 3NL5A 1TPVA 1XXXA 3LGGA 4YMZA 3G77A 4K3ZA 5I77A 4EIVA 3WK3A 3NPXA 3WLTA 2C3ZA 1UWTA 1WDQA 1TWZA 1YDOA 3BDKA 4GUGA 1PTGA 2V3EA 4JNMA 1CGXA 2GUUA 5EMLA 2UY4A 2PCEA 3VIFA 3DI1A 1MNSA 1NF0A 3TLLA 3KZPA 4ZOCA 3RU6A 1NSJA 4AB4A 1Q7ZA 4W7WA 2FPTA 2W6RA 5C2GA 1CGUA 1ISWA 3WK1A 5HULA 2V8ZA 4AZIA 3ALFA 2DVXA 5REQA 4BK9A 3QR1A 3CL6A 4S38A 3O16A 2A3CA 4A05A 1DQWA 3IAPA 4YHEA 3W7RA 3HA1A 3CMJA 1CGYA 1PCKA 2F8QA 3WLRA 3TYZA 3HGJA 3FKRA 4M5PA 1AK5A 2ZA2A 5H8UA 3PSVA 1KV8A 1AFSA 3ATZA 2Z2BA 3DEQA 1FWHC 1S2TA 4HK7A 3GVGA 1J18A 4HBKA 4NAEB 4JDYA 1UD2A 4AAJA 1W1ZA 4FOUA 5AY7A 3U2ZA 1EC7A 2HPMA 3VIPA 1VB9A 2WWCA 3GFYA 4O11A 1MW3A 2A5HA 3W85A 1G4PA 3S6OA 3AZSA 3WDIA 3W7LA 2V3GA 4NY2A 2IMRA 3VGDA 2E9LA 2GK1B 1SR0A 1ZCCA 2HROA 4UFKA 4W5ZA 5EBAA 1ZGDA 2X1RA 3UJSA 1SR9A 1CTNA 1PL9A 3H2MA 4DXXA 4GCAA 1WBHA 3E2VA 4IF2A 1WDPA 1B57A 4O1FA 4QX4A 3N3TA 2QCEA 2XFWA 2OU4A 2XN2A 4GUJA 4YVXA 3TYBA 4OHQA 5TNVA 4HQVA 3PZQA 2E9MA 3SCWA 4NX0A 3J7HA 1ONXA 4XKMA 3BMWA 4LNYA 3HF3A 6TAAA 4CQCA 2ZZ3A 1FWFC 4W8AA 2R82A 1W5QA 2V3FA 4Z0SA 1WB0A 1X1ZA 2OOFA 2Z27A 3LMYA 4HTYA 3VCRA 3PZMA 4JTEA 5BW6A 3RU8X 2YYUA 3F4VA 4X60A 4H2HA 4JNYA 2FTWA 3CTLA 3U5UA 1OINA 1JCTA 3NOEA 4NP7A 1NELA 1QBAA 2DUAA 5DMLA 2HCVA 1NTHA 5DXYA 2XGBA 3T2OA 1PZ2A 2OQHA 3NPUA 4DZIA 3G1VA 4IPPA 5A6BA 1D9EA 1TR1A 2Z0IA 3I6RA 2QCNA 4AZ5A 3A24A 3V1PA 6REQB 4D1JA 2YGYA 1YIXA 2OYLA 4Q4RA 3P5ZA 5DXXA 5IHRA 4C1NA 1U1JA 3Q4DA 2ZZ1A 3MP5A 3QOMA 3NM3A 1UUQA 2YFOA 3VM5A 2H9AB 2VR5A 4MPKA 5I03A 1ZQ5A 3GQYA 4F8XA 3T0BA 5M17A 3TW7A 3KXQA 2Q02A 4UR8A 4ZA0A 4BQ5A 3W87A 3V5FA 4GVHA 4GFSA 4LPCA 1VBUA 5CSRA 2E8ZA 4R85A 5DN1A 1Q8AA 3S1UA 3TCEA 4A22A 5HPOA 2DSUA 1K4GA 3R89A 3HJZA 1KFJA 2BZNA 2NWRA 4D72A 1SFTA 1C7TA 2CPUA 1FX6A 1JR1A 1QU4A 1RY0A 1GQJA 3C0QA 3GKAA 3W7EA 3SI9A 4N6EA 3VOGA 2WKLA 1R86A 1OYCA 2JE8A 4PUNA 4B2DD 1CXEA 2VDIA 3WFLA 4C6FA 2QF8A 3C61A 4GMEA 4DNHA 4IJBA 4S3KA 5TD4A 3IJ8A 2ATSA 2Z1KA 1QT1A 3WLLA 5AC5A 2YYTA 3KOXA 2QUTA 1U33A 1ZTVA 4UNKA 1B0IA 4DPQA 5C8BB 2CLMA 1NU5A 3UWVA 2E40A 1QTWA 3O1NA 1WOBA 3B8UA 2VFIA 1I2NA 4I7VA 3WEOA 2C15A 1W2VA 5I23A 2PGWA 3N15A 1J8VA 1GVQA 5FI8A 3S5YA 1VBJA 3KZSA 3D6NA 2GGHA 5AHLA 1QNVA 1ZBWA 1GUVA 2GSJA 3QQ0A 3L21A 1PSCA 5CBJA 1YXDA 4A29A 1HX0A 2FB2A 1F3EA 3USBA 5ABFB 2DGAA 2NT1A 4AWSA 4E6MA 3UT0A 4YWSA 2FJKA 3B06A 3I4EA 2EGZA 3EOLA 5JMUA 1GZ1A 1E6PA 1MWOA 1EBHA 4O19A 4MIMA 4XZLX 4EPDC 3CQHA 2OZ8A 1V7AA 3VO0A 3W7NA 5HQEA 3R4IA 1V6TA 4H01A 1V0NA 1FP8A 4KH2A 3L0KA 2VX7A 2PWGA 3ME3A 5DCBA 1Z44A 2EHHA 1XD0A 2PLMA 1A49A 3BW4A 4LXFA 4QEHA 3U2CA 5AYBA 1YLVA 4J3XA 2V2CA 3Q45A 4PB4A 3CWNA 3HQ1A 1EB3A 3QMTA 1CLXA 1GKRA 3VMNA 7CGTA 5T26A 5FACA 4CUCA 1QI0A 4IM4A 3N2OA 1R2RA 3MSGA 5G2HA 1NY1A 1XIBA 2VQUA 1MW1A 1NF7A 3CAVA 3OZMA 4XBJA 1FCUA 2YZRA 2PI6A 2OEKA 1OG6A 3W4RA 4CNOA 3IJDA 5E1QA 4U28A 2PDLA 3PN8A 3NL2A 2CXGA 2XGZA 3LSCA 5DFAA 4UNIA 4O1AA 5CLTA 3WK2A 3QSTA 3VD5A 2PTDA 1W91A 3L4ZA 2J9YA 2B4GA 4OWGA 1NFGA 4A3UA 3HV8A 3LZ3A 5CCZA 1KBLA 1R3TA 3MMDA 3QVQA 3CZJA 2GPTA 3M16A 1A5OC 4JTCA 2NWSA 4F2BA 3AXMA 4ES4A 1R30A 1Z8AA 3F4DA 1PE1A 3M9YA 1BD0A 3AUOA 4GIAA 1IR2A 3Q58A 3GU9A 1S3HA 1JCLA 5FJIA 4N7QA 2ATMA 4MY8A 3UETA 4KPLA 3WLKX 3U7BA 4ZO7A 3EX6A 2FZNA 4DF1A 4QM1A 4QE5A 5DELA 4UMCA 2X8RA 3TTEA 1IWPA 3GC5A 3DGRA 4E38A 2WZHA 1K03A 3WMBA 3DN5A 3GVRA 4ROPA 5AYXA 4BCEA 2X0YA 3KOYA 1XLIA 2HRWA 4RDVA 2KX9A 1OVDA 4XZIA 5GVJA 4F66A 3THAA 2PTXA 1J4EA 3GXNA 3RF9A 3MCOA 2F38A 3MMUA 3FN9A 3G2GA 2HK0A 1E6NA 3OQ8A 5LGXA 3OBKA 3WQDA 2DSZA 2DZSA 2WO5A 3PR2A 4ZQPA 3T4CA 1VBGA 1E5JA 5CZSA 1V6VA 3L0GA 4MLRA 1FWRA 1UJQA 4XAPA 4DM2A 4M80A 3QYQA 3MBDA 4E8CA 1AZ1A 1Q45A 4Z42C 2UV8G 1J6OA 1V3IA 4LS0A 1FHLA 1LG2A 1OC5A 1TQJA 4I8DA 3H2EA 1NVMA 4S3DA 3OA5A 4RKAA 4GUHA 4BEQA 2X0HA 4QDWA 1NOWA 4LB4A 3M0HA 2FZ8A 2WZEA 1NDWA 1TPFA 2GJRA 2YXOA 4LVBA 1MEIA 1OFQA 1YHTA 3M64A 4FNPA 3TE9A 3CZLA 2J27A 4KFPA 3BPWA 4XD6A 4YL2A 2I16A 5BXPA 3MWCA 1F4HA 3OVPA 1LWHA 3EPMA 4QBXA 4Q4KA 1JG9A 2V9DA 1ISVA 1S39A 4TTUA 3W37A 1H51A 2X40A 5MKGA 5HDRA 3JUGA 1JGIA 3F4NA 3IVUA 1EPXA 1UD4A 2QPUA 1JI1A 2Y70A 4KFNA 2YXXA 5G4WA 2OLAA 3UWQA 2YA1A 3BCFA 1V0MA 4G9PA 5CZJA 3TTYA 4E4UA 1E3XA 1UR9A 1WNOA 5DRIA 1A3XA 1MZHA 3QPZA 1GZGA 4GI6A 3ZJKA 3XIMA 3CQKA 1WKFA 5AC7A 1BWLA 4F40A 3T0DA 1IEXA 3WJSA 2XIMA 3Q94A 5CJNA 2ZTJA 1WUEA 5I06A 1FCQA 1V3LA 3CBWA 4CN4A 4LAUA 3RM4A 4PODA 3GR7A 4P7RA 4MKVA 3GXPA 3D46A 2YFNA 5GJNA 1TMQA 4MJ4A 4UC5A 2Z6IA 4HGXA 4H9VA 1XUZA 1E43A 3BGJA 3KVMA 1XIFA 3MU7A 4AIOA 4H41A 4BKNA 3MDWA 2ZZ6A 2AOSA 3VD4A 4QCFA 1BG9A 3BG3A 3QV7A 1KWKA 3CO8A 1XC4A 2PLCA 4G1NA 3WH9A 4C6LA 6A3HA 3T81A 3RO6A 3CWOX 3BCJA 5KTLA 2C14A 3F2CA 4N9DA 3W0KA 4KFOA 3GM8A 3IIXA 1UC4A 1LRTA 3HQNA 5LKYA 3HU7A 4LS2A 1OZMA 5D2XA 4GO8A 3LENA 2PZ0A 1AH0A 2W61A 3K30A 2ZUTA 2V2HA 2C6QA 1SFJA 3QM3A 1V02E 2XSAA 3V36A 3TQ0A 3P2VA 2CNCA 3HPZA 2RFGA 2E7FA 1MQQA 4LT9A 2XIJA 2W62A 4HCLA 1R9YA 4CQDA 1EHAA 3WNKA 1GQKA 1DQUA 5JIPA 4LUTA 1W1A1 5LA0A 1DWGM 4B5TA 1OFAA 4P7QA 2FTPA 4XBKA 3CHEA 4JL2A 2QHAA 1EDGA 4J3TA 3ARUA 3WL1A 5GQBA 3GY1A 4DO6A 1UC5A 3KEHA 1QNPA 1X39A 3VC6A 1Y5XA 4DBUA 1Q6RA 4DF0A 1WKEA 2WMIA 3M7SA 1JPIA 4WK9A 5CC7A 3ZXWA 2VCAA 5IDZA 1IQ8A 2FFIA 1E3ZA 4A2SA 4KWUA 2D2GA 3RRXA 3GBEA 3CZGA 4D6DA 2QXWA 4E2DA 4XO7A 1HKIA 4DHGA 4UFMA 1EXBA 1REQB 1EP1A 3VNKA 3AU2A 7REQB 3O6CA 4O4WA 3ZLFA 1F05A 2E28A 4OUIA 1Q2SA 1PKMA 3II1A 3S5ZA 3VIHA 4C6BA 4MJ2A 4TU1A 1HJSA 3RCNA 4JY9A 1DYSA 2BNJA 1G4EA 3ZLHA 1XPYA 2WSPA 3K8MA 1VYPX 1JFHA 1WXJA 1M7XA 3M5VA 4MY9A 1C90A 3ABOA 1F61A 4IISA 2VFEA 3EXSA 2QV5A 4Q6XA 4J1OA 4MVAA 1QHOA 1W1YA 2YB4A 1H1NA 1E0VA 4LVGA 3W88A 4B5WA 2WHMA 1XRFA 1WYIA 2A3AA 1JYWA 4WGHA 5CPTA 1W6TA 4M1BA 1LOLA 2VZUA 1OFPA 1OJXA 4C6PA 1TZ9A 3S0CA 4CVWA 2NQJA 2KAUC 3FEQA 5C70A 4Q4QA 4ZQOA 2DZBA 1UP0A 4RXFA 1OQFA 1JZ7A 5FEWA 4S3FA 2G95A 4F2TA 4XAFA 5E5CA 1BRLB 3OHIA 4WKAA 3PAOA 4TOQA 2PF8A 4UFJA 2ZZ5A 5GNZA 3TSDA 3LBMA 3MUY1 3BLEA 4DBDA 4ATWA 5FF7A 3CHFA 4RE2A 1UD8A 3W00A 4D71A 2YKKA 3RLHA 2G50A 1E72M 3W25A 1G67A 3WX7A 1FXQA 4GRSA 1JIBA 3G1RA 3ECQA 4L80A 3H4WA 1LQ2A 3PPFA 4O17A 5FSDC 1RBOB 1E51A 5FAJA 3ORWA 5KITA 3V4BA 1Q6EA 4PMUA 3KBMA 1EF3A 2HTMA 3A4WA 1BSIA 3DHFA 1EZWA 3A3HA 5KINA 1A3HA 2JEQA 1M7JA 3AAMA 3AALA 2VX5A 1ME9A 3SGUA 3CQ0A 1CPUA 4DO7A 4AD0A 2J78A 3CV2A 1R3RA 1WXZA 3ZT5A 3M7WA 5I7GA 2F2KA 2AKZA 2E9BA 2V5KA 3P80A 3TSBA 3PJWA 1QOQA 3M6YA 3FAXA 4CQBA 3MWAA 4N2YA 2EJ1A 2Z1XA 3KL0A 2QMKA 4UTKA 4JGDA 4DM1A 3SY8A 4JIHA 4U5IA 4KEZA 4ZO6A 4D6HA 2A3EA 2VO5A 4Y96A 1MW0A 3APGA 1L6WA 3HJEA 3QYSA 1Z6KA 1I60A 5HMEA 3KFTA 4LRSA 1LG1A 2CLHA 2YXGA 3EX2A 1TWSA 3IGUA 1S2VA 4CD5A 1XLMA 3IJQA 2R1LA 4H1ZA 4Q4MA 3BQ6A 4PMJA 4IP5A 1BVWA 1FDZA 2V82A 3P61A 3BLLA 5I3HA 1J5TA 1BLIA 1E56A 3RM8A 2J74A 1CCWB 5G4HC 4QJ3B 1ZP3A 1F3XA 1VENA 2BHYA 2VT0A 3V75A 1VJZA 5CGTA 3W1UA 2BGQA 3O6AA 1ALDA 2C79A 2C19A 3HOJA 2R1KA 3SGGA 1PIGA 1DOSA 2Z28A 4MNJA 3VGGA 3GIQA 1F6PA 4MDPA 2ZDSA 3NQFA 5KSWA 4O1EA 2XFYA 5MHBA 2XISA 2HNHA 1XIIA 4GIRA 4UFLA 4MY1A 4IT1A 4IX0A 3PWIA 3M0LA 1FUYA 3OZYA 3QJAA 1W5OA 1CLKA 1W2PA 1C7SA 2ON3A 1RP8A 2BOEX 5EYWA 1GVEA 1WZAA 4AD2A 4S3EA 2ZZ4A 3LCHA 3G0SA 1C8QA 3APYA 5EBUA 3L5AA 1V6WA 5HANA 4OBRA 3GXTA 3T0CA 1TV5A 2ZIDA 1ECEA 1WP6A 1J2WA 4HU3A 4HVXA 5HINA 3WJZA 4FNQA 1XBZA 5K4ZA 4DBWA 4US5A 1ADSA 2I14A 2X1SA 1E6RA 2C1GA 2OB3A 3PUEA 3MYPA 3IIVA 5G1YA 4MZ1A 4PTXA 2BP1A 1OCBA 3QH2A 5I78A 2VRKA 1VQTA 3TFCA 4PTMA 3VD3A 3W76A 5HATA 2NVAA 3NDOA 1B9BA 3S42A 3B8TA 4H6KA 4AC1X 3EX1A 1DTNA 4ZQNA 4DELA 1NDZA 1R38A 3OG2A 2BXYA 2DQXA 1Q85A 2B7PA 1SGJA 4K39A 3H2CA 3WH5A 5MF5A 1Z9AA 2QAFA 3LPOA 3SAZA 1IT7A 2X41A 4RE4A 5D09A 5DEZA 4DY1A 5LNUA 3U7VA 4NU7A 4KCWA 3RHGA 4KS0A 4NNCA 2VR2A 4W86A 3I3EA 4JX5A 3PTQA 4QLJA 4RLIA 2XVPA 4PEEA 1ZP4A 3UR5A 2V38A 2ZX7A 3R6IA 3BXWA 2Y85A 3U48A 3BJTA 3MV01 4GIEA 3F5KA 1E9YB 2PU1A 1U30A 3TN3A 4GVIA 3CO4A 2E77A 5JUVA 4L6HA 5GNXA 1YPFA 2QJGA 3P8JA 3E38A 4V33A 3MMWA 3EKLA 1P6BA 2OVLA 3PBGA 2YBVA 4B5NA 2RAGA 1FP9A 1JYNA 2CITA 3BSMA 3ARPA 1RCOB 4MF4A 3TH6A 5KEZA 3VIOA 4E2BA 1FTXA 3MY9A 2XIIA 3QZ6A 1AQFA 5HWJA 1UR2A 5LZLA 3PS7A 4Q22A 4HOXA 7TAAA 1ZS2A 3W6LA 4HPHA 1ZZMA 2UY5A 5F2IA 3WQCA 3UNDA 3LCGA 5D37A 2D73A 3N4AA 4HU4A 1TSIA 5I3KA 1FWNA 2JK2A 2OJPA 3GZ3A 5IBXC 3Q65A 3BQ5A 4W8BA 4QAIA 1TMLA 1HO4A 4WLCA 4YTSA 5HAOA 1FWCC 2A7RA 3C3NA 1E9LA 1F74A 2GVYA 1MNZA 5A6BD 4GNJA 1Q7QA 4O18A 4PMDA 4OT7A 2BY0A 4BY3A 3JS3A 4DWDA 3LSBA 3FJNA 1C91A 3E96A 2WJFA 1UKPA 1G94A 1V6UA 1IZJA 3ITVA 3EMZA 1KRMA 4NZFA 1L2UA 4LWWA 3MZNA 3AO0A 1X1OA 5HXMA 3LERA 4LX4A 2HXTA 3NM1A 3AS0A 3WLPA 4IQDA 1RK5A 1VLIA 4PH6A 2CWNA 4FOKA 1SZFA 4J3SA 1POKA 3CNYA 3VNYA 3PBVA 4WZHA 4CN1A 3TIMA 1YKWA 2DH2A 3OLDA 3O7UA 4CKQA 1VPQA 1DVJA 3EDKA 2NUWA 1XG3A 2JGQA 3H2OA 3DDMA 3PB2A 4GISA 4MJZA 1IEVA 3K4WA 1ISXA 1AJ0A 1PZ1A 4D9PA 2HMCA 1E71M 3WNLA 1VCVA 1DWFM 3UNTA 4LFYA 2J7CA 4JIRA 5FESA 5GJMA 3WBAA 2HXUA 3GKFA 1EZ2A 1CB7B 1UZDA 3T09A 4MG4A 2ABBA 4W9TA 3AICA 3MVTA 5CJ5A 2WHKA 1UWAA 3EOSA 4G7EA 4IJCA 4UZUA 3MW7A 4QITA 4XKYB 5D9PA 1Z7AA 3WUGA 1QVBA 1UP3A 4S1FA 4O53A 1QR7A 1IIGA 4LYPA 1M04A 2YR1A 2HBXA 2ZZ2A 4ZSTA 3GIYA 3G1XA 4CU7A 3ZQ9A 4O8RA 2LLEA 3PZUA 4HMNA 5HMFA 3N9SA 4ZCWA 4BQ3A 2GL5A 1TVPA 3AIRA 5A8GA 4XZMX 1WDWA 3UU0A 2EEXA 3C52A 4YVVA 1HKKA 2ZX8A 3GO2A 4DI8A 3BW3A 3ITYA 3DYPA 2Q6ZA 2H90A 1LUCB 4GE8A 4HCHA 2WAGA 3R2GA 3QHMA 3GR4A 3EMQA 2OLHA 2B7QA 3LTYA 3S2MA 3NO3A 1B90A 4EKJA 3W07A 1F73A 3DZ1A 3RILA 5G1MA 4Q6JA 4US6A 2G8ZA 3NXFA 2XM1A 3UY7A 4GNVA 1VC4A 5EA9A 1V03A 3TYDA 4BR1A 4XAZA 1HXJA 2YCJA 2NQLA 2ZUWA 2BSLA 2QMJA 1O5QA 5JIWA 1S3TC 3L67A 2VHLA 1AD4A 4IP4A 3A9IA 4GUFA 3R12A 4AZCA 1V77A 5F4XA 3IV3A 3AHTA 3VTRA 3PUOA 4IG2A 4NL1A 2WPGA 1WZLA 4R5EA 4HNUA 2AGKA 1JDAA 3PC0A 4GQQA 3TJLA 3BAWA 3PUDA 1TELA 4Q8QA 1DBTA 4XD3A 5XIMA 1HP5A 3ES7A 4I9TA 1JZ5A 2XUCA 3CZEA 3GXFA 1D8CA 1YE6A 1TYGA 1OF6A 2CHRA 5DX7A 1MUWA 5IOBA 3NVDA 2VJXA 3R8HA 2E6FA 3OGSA 1UBSA 2BX7A 3WQFA 3MKKA 1ISZA 1PCWA 1R3WA 3ITOA 2D20A 3KW3A 4F3HA 3CUJA 4JQAA 4WKHA 2TYSA 1E55A 4WQ6A 1OADA 1OY0A 4EACA 3FVDA 1PV8A 2D2OA 3ARVA 1W9VA 3H7UA 4YNGA 3WF3A 3CXOA 2VZOA 1OG0A 2PAJA 3DKJA 3WDJA 1E9ZB 2X7VA 5ABHA 5HQLA 1XINA 3U8GA 1VPXA 4IIFA 4XAYA 2G97A 3EOEA 2QAPA 4WVXA 1P4CA 1LM1A 4J3ZA 3PAJA 4HB7A 2HDJA 1JPDX 2Z1WA 1TRIA 2Z2AA 3BAKA 3GDTA 1J0HA 1KRAC 3P0WA 3RMJA 1XDMA 3U0HA 4L4OA 4P61A 4TVUA 3ITCA 3UJRA 5D2VA 1CNVA 3VVGA 1JYVA 1X8FA 2IQ0A 9XIAA 1ZAIA 2J7GA 1XRTA 1OK6A 4ZBCA 3VCNA 4Z2KA 5B7YA 3D3FA 1DHPA 1HUVA 3W01A 1HGWA 3WD3A 3EEGA 4OQVA 4CEXC 3LPFA 4PZVA 4LF2A 4P8UA 2J77A 3L12A 1HP4A 4FF5A 3FDKA 4OUEA 3PULA 1IEQA 4C6NA 3E12A 4JQ1A 2VUNA 2F84A 4P8VA 1XRSA 3T05A 5A2BA 5FEXA 2VEMA 3VZXA 3S1WA 4QGCA 3TR2A 1TG7A 1LJYA 3LHVA 3LQGA 5LGZA 4BI7A 3T9PA 3OLEA 2V5BA 3S8HA 5A8PA 5AC4A 1IZKA 1PZ0A 1ZPTA 1KM0A 1XWYA 1UUOA 4TXEA 1JYXA 2IKIA 1CLVA 4MFDA 2Y89A 2DUXA 3MI6A 3NCOA 1Q66A 1NFPA 1P0NA 5AC6A 2HBVA 3EMCA 3IVTA 1T8QA 4JPGA 1JNDA 3ZWSA 3T42A 4IIDA 5EFDA 3NEVA 2P88A 4AFYA 3NA8A 3WNPA 4MHBA 1I45A 4TMBA 2NXIA 5EGRA 2PODA 5A2CA 4U33A 1RA5A 4PULA 2ZUVA 3NQMA 4AUBA 1D7KA 2Y88A 1OGBA 1OFRA 3CUZA 2V3DA 1SZNA 4A8IA 4F48A 2OEJA 4WY0B 1WDDA 1E9IA 1I2RA 2D22A 3A47A 4TX6A 2DT1A 5JVLA 2BVTA 1OX4B 1P48A 3OGVA 3Q37A 3BH4A 1ITUA 3WO8A 4A4AA 1E40A 3P8IA 3P62A 4CQ9A 3A4JA 2VFFA 2QLYA 1W1B1 3BSGA 5FOOA 3TCSA 2VDHA 3EYPA 3KDNA 3PJUA 5D9NA 2J66A 3T4WA 3UERA 4TMCA 5PTDA 1O66A 1LLWA 3V16A 1D8WA 4UQDA 3TU9A 1KFWA 4JIQA 3VYLA 4HK5A 3T08A 2WC4A 3CQIA 2Y5JA 3HG2A 1LL6A 3WH6A 5H6HA 1RVGA 3AS3A 1AW2A 2WNZA 3SCUA 1XIJA 3VFCA 4FNRA 2BV9A 1V3KA 2PUZA 1BTCA 3REQA 3VZYA 2DZTA 1P0BA 4GI9A 3ITTA 4GQGA 1JULA 4REQA 4ZE4A 5DBUA 3C56A 3T55A 2GQAA 3P6LA 2ZA3A 3EKGA 4GQRA 2PURA 4AVOA 5BU9A 4AZGA 3PZVA 3SRDA 1U5VA 2QCCA 4RE3A 1MUCA 4C6EA 3KRBA 1MW2A 1EEXA 3A5VA 3DECA 5CZKA 3F5LA 2QZRA 1HIZA 3H54A 1THFD 3IRSA 3TUUA 4JDBA 2AQOA 2BODX 3PZTA 4XIMA 2WJDA 5REQB 2PF0A 3ITLA 3OO2A 3IGSA 1OC6A 4J5NA 1DTUA 5DRCA 3PF3A 4UWMA 3AMDA 3UY8A 1VIZA 2H8ZA 1VEMA 4PUDA 3BMXA 1SVDA 4EWND 2R6OA 4C1KA 3DERA 3QBUA 2ZRWA 4E8DA 1NDYA 2WHLA 3GFZA 3MJMA 3EDJA 1WDRA 2NQHA 1SZEA 2V5LA 3TWAA 5CJMA 4BF5A 4CU6A 3B9DA 4H6RA 3OOQA 1OB0A 5FEPA 3LMZA 2OWWA 3A13A 5LNVA 1I8JA 5F4WA 3VK5A 2ISVA 2J88A 4MUPA 3W38A 4NJKA 3TXZA 1YTKA 1BYDA 3WD2A 3AIVA 4H9MA 3RG6A 4S3CA 4ZGYA 4MTVA 3N4EA 3BSHA 1TCDA 1EDTA 1B3YA 4IUOA 3FIGA 4CNNA 1Y7VA 1TV8A 1WE5A 2OGYA 4FHAA 5DCEA 1JJKA 5I00A 4H7ZA 1ESWA 4LH8A 1ZSXA 3KBJA 3NJ3A 3UZJA 3LYEA 2G3NA 4XUGA 2OSYA 3W7IA 1Y5WA 1ME7A 2QJNA 3E2RA 1E0UA 3TOYA 1SM9A 3CIWA 3M41A 1ICPA 1XYCA 1OT2A 1JUBA 1R3VA 1JDDA 1TTQA 1FFRA 3AIBA 1KW1A 1H5VA 1QK0A 3DGBA 5C9WA 3HGOA 2GYIA 1R0MA 1XP3A 3L4YA 4TQTA 2V81A 4EPKA 3SN4A 3B0YA 3QY6A 4UMBA 2JKPA 3LD5A 5A94A 4TIMA 2ACSA 4Z1AA 2GWNA 3DI0A 3MUZ1 2OZ0A 2HE8A 3IIOA 4ADTA 3KLKA 3QGKC 3E0LA 1PWMA 2JF6A 2CZVA 4RE0A 3GVQA 2OKTA 2ASHA 3R0UA 4RCXA 2HK1A 1SW0A 4R7JA 4ZXOA 3M0MA 2WNNA 4UTIA 4GYKA 4JHMA 2OELA 1UW9A 3WDPP 5D30A 4JOMA 2G3JA 3DH7A 2WNQA 1YMYA 1XLLA 4ERAA 3VINA 5C7VA 4R7OA 3WKZA 4D8LA 3M46A 1G5AA 5CPQA 3GG1A 4IQJA 2PWUA 3TAOA 1XLJA 3S1GA 3UG4A 1GKQA 3F4CA 4LU0A 4DVOA 1PX4A 3VKJA 5EMMA 4WSJA 3ZR6A 2KZHA 3GHRA 5E6YA 1MRQA 4QLKA 3MA8A 3UWZA 4OV9A 3UWEA 4DUOA 5DY3A 2Z1SA 3LGDA 1GYMA 1E1CA 1ONEA 1VCFA 3STFA 4QXIA 2BB0A 2CZDA 5IHSA 2ACQA 3AU6A 1DXEA 4OFCA 3M0YA 4ICNA 3OIHA 2DW7A 3EB3A 3DBNA 4L9XA 3C8FA 3PP7A 4AZHA 2Z1VA 4NKCA 4BQ2A 1O7AA 2EJAA 3KCJA 1P7TA 3TEVA 4FK9A 2ZICA 4N4QA 1GVYA 2Y7FA 1UWRA 1SO6A 4GINA 4V1YA 4XAGA 1UJPA 4DX3A 3QLLA 5CSUA 3WD0A 2WLYA 5CXPA 3EXTA 4LUSA 4HOZA 1KFCA 4B91A 2QIIA 5HUPA 2AQWA 3PPGA 1DKWA 4CCCA 1JRCA 2PTWA 4NILA 4FX7A 5DO8A 3DC0A 3E6EA 4KRTA 3F7JA 2PWEA 1FOBA 1W9UA 5DLCA 2FPVA 3LUTA 1ICQA 4M0XA 3VOJA 3MHUA 4AYSA 1OF8A 3CAQA 1RVKA 3H2FA 4QE4A 3MB9A 3GNDA 3G24A 2QCHA 3GK0A 2ACRA 4Q8PA 1KBJA 3O15A 1F8MA 3TLQA 4QDMA 3VOHA 5FJPA 3KCLA 4L4MA 1VFFA 4W84A 1KCXA 1SO5A 3SY1A 2HZGA 1TB3A 2I7GA 4NVTA 3TKFA 4BFAA 1S5NA 1QNSA