5HNNA

Crystal structure of the endo-beta-1,4-glucanase (xac0030) from xanthomonas axonopodis pv. citri with the triple mutation his174trp, tyr211ala and lys227arg.
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
b'MLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAWSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDASGTKPVCTSDSVGQERLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYARRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title Crystal structure of the endo-beta-1,4-glucanase (Xac0030) from Xanthomonas axonopodis pv. citri with the triple mutation His174Trp, Tyr211Ala and Lys227Arg.
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 128
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hnnA00
3D5HA 1ECEA 4MB3A 1WZKA 1NM9A 2FH6A 1CWYA 2YL9A 4UOJA 4EKJA 4C7DA 1LWJA 1J10A 3SCWA 4MAVA 4IUGA 1U33A 2E0PA 4MAZA 4CCDA 4DM1A 1Q4NX 2WC4A 2WBKA 3S2CA 3F5JA 8A3HA 3VIJA 4ACZA 4PMVA 1E6XM 2G3JA 5AYBA 3VVGA 4P8XA 4F66A 3VGHA 3THCA 4HOWA 2MANA 3N9KA 3MUY1 1C8QA 3DYOA 2YL8A 4N0RA 1OIFA 1EQCA 4J3SA 5E9AA 3OLDA 3ZQ9A 3AOFA 1E0VA 2WKLA 3QR3A 1EOMA 1PEZA 4U31A 4LYQA 4PTXA 3MUIA 4MNKA 1MQPA 1XSIA 2CIPA 4J27A 3TP4A 2BHZA 1H49A 1LF1A 5A8PA 1JZ4A 2ZIDA 1B3VA 4U2ZA 2FH8A 4CN1A 1E5NA 1CYGA 2VRKA 1LG2A 1TUXA 1TR1A 2G3IA 1HP5A 3AS1A 1UKPA 5A8NA 3PZMA 4AZBA 4LYPA 4D6FA 1QPKA 2BY3A 3EDEA 3OBAA 4MJ4A 4AZ7A 1E40A 1V02A 3AI0A 2PWEA 3UESA 3BLPX 1UKTA 1UWIA 3PZTA 1TVNA 5GPRA 4FLOA 4NRRA 1QW9A 2IXUA 3VM5A 1WE5A 3SCUA 2JE8A 5HPOA 1OGSA 2WVUA 4GI9A 1G9HA 4FMVA 2WLZA 1K9DA 4JFSA 1VENA 1EDTA 4AD4A 1H09A 2FDMA 1QNPA 1QOXA 1ISWA 1WPCA 1UG6A 1SFSA 4PCTA 3RM9A 3NJ3A 2ZUTA 1VFFA 4BQ4A 4CU7A 2BVTA 5BXTA 1V6VA 1MW2A 3VIMA 1EIBA 2GVYA 1UD4A 5CGMA 4WSKA 1PIFA 3WH9A 1XH1A 4EAMA 4WLCA 5I6SA 2XJ7A 3AIBA 3GNRA 1O7AA 2DSZA 4J3TA 5JBEA 4AZCB 3L4WA 4AEFA 1BG4A 4C7FA 1CPUA 1NARA 4BF7A 1KWGA 3VIIA 2XG9A 1HT6A 2EPMX 1UWTA 5BRPA 3UG5A 2ZWYA 4Y7EA 3BAKA 3AMKA 4MTVA 1CGXA 3OA5A 4CN6A 4WKHA 1V08A 2O9RA 4PTMA 2CBUA 4UQAA 3SUTA 2D3NA 2WVSA 4DWSD 4HA1A 2EO7A 3OGSA 1JZ7A 2JF6A 5E09A 2HISA 5BYWA 1G01A 3VDBA 1CXFA 1UD8A 4BQ3A 1E6ZA 3WQWA 3OZOA 3FW6A 1WDSA 1K9TA 5LYRA 1GVYA 5TD4A 2JEQA 4PMUA 1SMAA 4PMDA 3T2QA 3SUUA 5HBFA 2YL6A 3W0KA 3CMGA 3WQ5A 4QLKA 3VMNA 4KMQA 3CZEA 2XFRA 1PPIA 2YDSA 5A8MA 1JZ6A 3OLEA 5D9MA 1CGWA 1SR0A 3BAIA 5FOOA 3CH9A 1OINA 3T0DA 3GNPA 4P8WA 1JIBA 2DIJA 4PMXA 3KL0A 4HZ7A 2WXDM 1C93A 1C7TA 2WZEA 1NOWA 4HP5A 4JFVA 3ZIZA 3KE0A 1BQCA 1KXQA 3L4XA 1X6LA 3GH7A 3BAYA 3FHQA 4UFKA 4CD8A 3DHUA 1VEPA 1G94A 4ZEPA 2Y5EA 2E9LA 4WKAA 4B16A 2PB1A 2VX5A 4WF7A 2DT3A 1H5VA 2GUYA 3MUAA 1MFVA 3T2OA 3N12A 1F4AA 2ZICA 5FCZA 1ESWA 3IAQA 2WM0A 1D3CA 2OWWA 1WO2A 5GNYA 3WQ6A 2YLLA 1VEMA 3K8MA 3ARPA 4JL2A 1BGAA 1C8XA 4MB4A 1CBGA 5D9OA 1V0LA 4M8UA 2VQUA 2XVKA 1FP8A 1C90A 4IM4A 1ITCA 1KGUA 3PTQA 1BHGA 3W82A 1KB3A 2Y8KA 3SURA 9CGTA 4P8VA 2O9OA 3W6LA 1E4MM 3WN6A 4RE3A 2DSWA 3CZJA 1B3YA 1VJSA 4N42A 3WMCA 3HMCA 1Q6GA 3GBDA 1K6AA 3POCA 2ZUUA 2CEQA 2EPNA 2D2OA 3ARVA 1B0IA 4U5IA 4E8DA 1JXJA 1C91A 1V3IA 5DFAA 1VBRA 4V2XA 4DUWA 2WHMA 2CPUA 3SEPA 4W7WA 1S46A 3MUZ1 2UWFA 2XFYA 5DEZA 2WMFA 2WVVB 3AYRA 1HKIA 2JEPA 5A69A 2PC8A 3VMOA 1MW0A 4JHOA 2X2YA 2D23A 5D9NA 3IANA 5A6MA 4MDOA 2FGLA 2X0HA 3W28A 3A4AA 4YPJA 5HXMA 4MDPA 4OUEA 1J18A 3PZGA 4Z2GA 2OYKA 1E1EA 2J8GA 1FH7A 3WMSA 1JZ8A 4AMCA 2XM2A 1CTNA 5CPSA 1QHZA 4QLJA 3K4AA 4GI6A 1LLOA 4MNLA 1E71M 1D7FA 4JAWA 3ZT5A 1UHVA 4W88A 1AMYA 1ZU8A 2G3MA 4ML4A 3AIQA 4PMYA 4GQQA 2EPKX 3SCVA 5ABFB 3L4VA 2J47A 1CLVA 5DO8A 4FK9A 1WDPA 2WMIA 1ISYA 4MNJA 3CTTA 3VILA 2VMFA 1HJVA 2G4FA 4GO8A 1CLXA 2YA0A 3MANA 2DT1A 5A94A 1GNXA 1NOUA 1OT1A 3G6LA 5ECUA 1DWJM 3GH5A 4MB1A 3T0BA 1E73M 4YHEA 3EMCA 4FF5A 2ZUNA 2W61A 1E56A 1WZMA 4KRTA 3NIYA 3WBEA 2ZX8A 3NDYA 2VI0A 2XYLA 1QHPA 2E3ZA 2J7GA 1PZ3A 1V6YA 2BY2A 5CZKA 5EFFA 3A3HA 3AYSA 5CSYA 3DYMA 2VO5A 4KGLA 1CGVA 4D1IA 4ZFMA 1V3KA 5M3WA 1VJZA 1GQLA 2NT0A 4DM2A 1PZ2A 3GM8A 1CGYA 1JAEA 2Z1KA 4XX6A 4OBSA 2CKRA 3PZOA 5ABHA 3LPPA 2WSPA 3WDPP 2CHNA 3AHYA 3W27A 1OBAA 4OZOA 1H11A 1W1TA 2WC7A 2XM1A 1X1NA 3SCNA 1Q6CA 2GJRA 4DUXA 1DWIM 2VJXA 1EO7A 1XYFA 5DF0A 3BCFA 3CGTA 1V3MA 2WHJA 1WNOA 4OJYA 3CHDA 1NWSA 3AZRA 4GZJA 1W2VA 3WDRA 4AYSA 5A8OA 2YBUA 2Z1SA 3VDHA 4AZGA 1JYVA 3J7HA 1XSKA 1VEOA 1BF2A 4W8BA 1R8LA 2BVDA 1W9XA 1JNDA 3BXWA 4JL1A 4DWSB 1C3FA 4E2OA 5IFTA 1R87A 1GOQA 1V0KA 4JFWA 1CIUA 2CBJA 4YHGA 3PTKA 1GOMA 1E6PA 1R85A 1H2JA 3PZ9A 4W86A 3AICA 1JI2A 2BXYA 4UCFA 1JF5A 1E72M 5I77A 1JFHA 1OWQA 2F2HA 1PJ9A 2EPLX 1KFWA 1CXLA 4AZ6A 4W93A 3AHVA 4AD0A 1EA9C 3L4TA 1TA3B 1JAKA 1B2YA 1US2A 3QOMA 4HZ6A 4AW7A 3SCQA 2GFTA 5E0FA 2YDQA 2A3BA 4AIOA 4R5EA 4HMCA 2CERA 5A3HA 2W67A 3W24A 3PZNA 4MJ2A 5FD0A 2W66A 6A3HA 3MV01 1UWUA 3VD9A 4M56A 2AMGA 3WF3A 1BYCA 5A2CA 3AQUA 3U57A 4TVUA 2VX4A 2GK1A 3OG2A 4TX6A 3VIKA 1QNQA 1EDGA 1TG7A 5DT7A 4K68A 4QP0A 3K8KA 1ITXA 1HKJA 1M53A 4M80A 3BMWA 1KR1A 3AHZA 3SUVA 3PZIA 2OWCA 4UFIA 1XCWA 3UERA 1KBKA 4ATLA 3WUEA 2BY1A 2VR4A 4KWUA 4BA0A 1CGUA 1VBUA 4CD7A 3K46A 2NW0A 5EMYA 3VD4A 5A6AA 2CYGA 3RIKA 2ZOXA 3T08A 4PUEA 2YDRA 4FLRA 3UETA 2YL5A 4QFUA 5HNNA 1A3HA 5A6JA 3VU2A 1TVPA 2BNJA 2RGLA 1HIZA 2V5CA 4KGJA 5AC5A 5I79A 1LJYA 2QLYA 2G8ZA 3CUJA 4QCFA 4AZCA 3AIVA 3N1AA 1W1VA 4W89A 4HOXA 2XVPA 1Q6EA 3VD3A 1HX0A 1W1PA 1J0KA 2OYLA 4AWEA 5CSUA 1IV8A 2V3EA 3AXHA 1DWGM 1WDRA 4AZIA 3RILA 2WPGA 1KXTA 2J77A 2D0HA 4BZYA 1WKYA 1UOKA 2A3CA 4PN2A 1EGZA 3ARRA 4OOZA 1PBGA 1WZLA 3AMGA 3TTOA 3UG3A 5E6ZA 3TTYA 2DGAA 1JNEA 3O6AA 2XIIA 1SMDA 2VZUA 7CGTA 4AIUA 4C7GA 4AD3A 2YLAA 1TE1A 3N11A 1Z32X 2A3AA 4WKFA 4WSJA 4X9YA 4PRWA 1JYNA 1XRVA 3O2LA 3CUFA 3N17A 3AHXA 3RPMA 1GPFA 5FKYA 1EOKA 3WNOA 1GVIA 1TCMA 4JZ5A 1OM0A 2DQXA 4LPCA 1NH6A 3M7SA 1J0HA 1SYTA 3WH5A 1BTCA 2J7EA 3VGEA 3ALGA 2XSAA 4TXEA 1V0MA 1KCLA 1MWOA 1LWHA 1OSEA 3AXIA 3U7VA 1ZBVA 4TOQA 3ZJKA 4CCCA 1NWUA 2EEXA 4AISA 5BRQA 1W2PA 1GOIA 3ZM8A 3BMVA 3ARUA 3LMYA 4JIEA 4W7UA 1CEOA 3RJYA 2Q8XA 4IPLA 2EXOA 3WEOA 3SUWA 1E5JA 3UR7A 3ZO9A 1OB0A 2QHAA 3KWXA 3RO8A 1CGTA 1VF8A 4H8HA 1G0CA 3N04A 1VB9A 4HA3A 1EO5A 3WDJA 1PIGA 2OSWA 1W32A 2EPOA 3T2PA 5ABEA 5I5RA 1VIWA 3VGBA 3W81A 5M03A 2JF7A 4TX8A 3ECQA 4ATWA 2WCSA 4D71A 1QI3A 2CETA 1W91A 2JIWA 2HVMA 4GQRA 4AZ5A 3VM7A 1JXKA 1DEDA 3T09A 1GHRA 2WAGA 1UD5A 5GQBA 3HJEA 1E43A 4CD5A 1B9ZA 4D6HA 3VIFA 4PTWA 3VIHA 1W9VA 4H41A 1UA3A 1OIMA 1K9EA 1XGZA 4J7RA 3WH7A 4W87A 2BVYA 2VR5A 3A4XA 1PAMA 3VGDA 5A95A 5AY7A 2X0YA 2QV4A 2XIBA 1QNRA 4V28A 1CXEA 3IK2A 1ISXA 3ARWA 4XUYA 1V0NA 1B31A 2YA2A 3M07A 8CGTA 2DT0A 2Y2WA 3VIPA 4XZBA 2F61A 2FHCA 2D24A 3LPOA 3WMBA 1JG9A 1JYWA 5CQ1A 4D1JA 3GXDA 4B3LA 1VRXA 2WZHA 3WELA 3WD2A 2X09A 7A3HA 3SIMA 1DHKA 3AIWA 1E0XA 4KRUA 2O9PA 4P7OA 4CUCA 4AC1X 4KH2A 1MQQA 3A6OA 1DWFM 1UR9A 3RDKA 2WVVA 5BCAA 1E4IA 4A3HA 1EHNA 4J28A 3DYPA 1XC6A 3TOPA 4GI8A 4CGTA 4W85A 1IT0A 4LXFA 2FGZA 3W25A 4M1RA 2WHKA 3LPFA 3DECA 4TTUA 3B9DA 3L4YA 1UH3A 3VX0A 1UR2A 1UKOA 1MW3A 3RMEA 3UR8A 3GXFA 1JF6A 1FH9A 1GOKA 4BQ5A 4JHZA 1QNSA 3ZR5A 1FOBA 1HKMA 4RL3A 3WD0A 2CITA 5GNXA 1Q6DA 2XWEA 3GDBA 3WF2A 1XYZA 3WDQA 1MW1A 3W29A 4GZIA 3VDAA 4RE2A 4E4PA 3T0AA 4W7VA 1M7XA 2C8NA 5KZ6A 4A4AA 3ZT7A 3UCQA 3WF0A 5BXSA 3VO0A 4JKLA 4WK9A 4HPHA 2X8RA 3BAJA 3CHFA 3VDCA 3AXXA 1K9FA 3M46A 1CZ1A 4D6IA 3GYCA 1JL8A 3OLGA 5A6SA 2WW5A 1W9PA 2VZOA 3AMLA 1L8NA 1QW8A 4NRSA 1A47A 1FHLA 3FXYA 2C7FA 1EXPA 3WD4A 1JGIA 3K1DA 1AQHA 3CUHA 4HOZA 1HJSA 4CD6A 1YHTA 1WP6A 4W8LA 1UD6A 1ZBCA 1AVAA 2BHYA 2CNCA 1GOOA 1FH8A 2QMKA 1EH9A 2CXGA 3BLKA 2YJQA 4HPGA 5IHRA 2WYSA 2XVNA 1J9YA 3QGVA 3WDIA 1HVQA 2W63A 4PUDA 3VINA 3VPLA 3W6MA 3NSXA 3TONA 1FHDA 4EANA 1CECA 3AS3A 3CPUA 3ZMRA 1B90A 1VFUA 2X1IA 3N15A 1E4LA 2UY4A 1EQPA 4HU0A 2CCRA 1H41A 3SUSA 3RM4A 4PEEA 1MXDA 5D8ZA 4AD1A 1E1FA 4U5KA 1UA7A 2DEPA 3OZPA 1QVBA 5F7UA 1W3JA 1MVYA 2PWDA 2QMJA 4JCMA 5A6KA 4U3AA 5CLTA 3AS0A 3PBGA 4RE4A 4GO9A 2ZX9A 4UTFA 2JFEX 3MMWA 3WD1A 1CDGA 2WNWA 2J7HA 3GNOA 4B9YA 4OKDA 2WMJA 3CHCA 4MB5A 2X05A 2CESA 4F9JA 4M81A 4Z2IA 3QHNA 2VCCA 4IISA 1KQYA 3RCNA 5M5DA 5I24A 1GQKA 3DHPA 2OYMA 4UZSA 3EDFA 2B31A 1H3GA 1MXGA 3B8SA 1XHGA 2WZIA 3VNZA 1RH9A 3AMDA 2GJXA 1ZBKA 1GONA 1WDQA 2WHLA 3CZ8A 1V3HA 2WCAA 3CLWA 1CXIA 3CZKA 4PMNA 4QCEA 1J0IA 4HU8A 3HU7A 4AD5A 2VC9A 3CZLA 3KL3A 4P8UA 4R27A 2W91A 5EBAA 4FLSA 5A1AA 2ZXAA 2E40A 3NUKA 3PZUA 1FP9A 2XTKA 1JDCA 3AIEA 4W8AA 5D9PA 1H0IA 5FL0A 4PSPA 2Y24A 2WK2A 3PTMA 4GINA 3WDHA 3ARZA 4E8CA 1C7SA 2J8FA 4F79A 2WVTA 1Q6FA 4V27A 3POHA 1BYDA 2WLYA 7TAAA 1VFOA 5IFPA 5I0DA 1XSJA 2DSVA 2BHUA 5IHSA 1KGXA 4Z2LA 1CXKA 5A8QA 2ZX5A 3IJ9A 2PWHA 1UR0A 1WB0A 3MV11 5BWFA 2UY2A 4GKLA 1MQRA 2XWDA 5IXEA 1CXHA 1JDDA 4PMZA 1E55A 2YIHA 3NSMA 3VX1A 1N82A 1B30A 2G3NA 3MU7A 2ZUMA 1LQ0A 1D2KA 1E6RA 3NCOA 3WH6A 3A4WA 2BY0A 4GIAA 2XHYA 2VT0A 4X0VA 4CCEA 2ZXQA 3WNNA 1M03A 1I75A 1WAWA 1W9DM 3ARYA 2WWCA 1GW1A 1E6NA 5DMYA 3WFZA 4L4OA 1BFNA 1HN1A 3OGRA 3F4VA 3WEZA 2CHOA 2J7CA 1UD3A 1XH0A 5I23A 1J01A 2GDVA 3WY1A 4GZEA 3U5YA 3L4ZA 2DSKA 2A3HA 4QLLA 2XPKA 3II1A 3QOKA 3ZJ8A 2VCBA 5I2UA 3WQ4A 1UD2A 4PCSA 3ZJ7A 1MFUA 2OSYA 4BQ2A 1AQMA 5CGTA 3VTRA 1ZB5A 2VX6A 4AEEA 3F5LA 2DH2A 1V03A 3EYPA 3CO4A 1HJWA 1EDQA 1M01A 1AQ0A 1B3ZA 2GDUA 1ZBWA 3MSDA 3RM8A 2QPSA 3SCPA 1HKKA 3K4DA 4GXPA 3WF4A 1CNVA 2BFGA 3WQVA 3AFBA 2WMKA 3PN8A 2EBNA 4B9ZA 4ZENA 4ACYA 5JIPA 5JBDA 1LL7A 2UY5A 4PTVA 2V3DA 5BXPA 2WWDA 3ALFA 4XV0A 1BPLB 2ZWZA 4LGXA 3TA9A 2V3GA 2JALA 3FNDA 1ODZA 3MSGA 4MNMA 2VX7A 4TTGA 1IZJA 4UR9A 4ZE4A 3CBWA 1E3ZA 1I1XA 1DTUA 3BAXA 3AJ7A 3BH4A 4Q7NA 4UZUA 5JIWA 3E1F1 3W38A 4H8VA 3PZQA 4P7NA 4TVDA 3UG4A 1TFVA 1LG1A 1HJQA 1ZS2A 3GXIA 3GH4A 4Z2KA 1RP9A 1R7AA 3AIRA 2IUZA 2WCGA 3N13A 4M29A 4CN4A 4DWSC 5BXRA 4UOZA 1KR0A 3DC0A 4H8UA 3ZT6A 4JFUA 3WENA 1V02E 2YOCA 1NP0A 4H2CA 3THDA 2GK1B 1JYXA 4PYSA 5ABGA 2YBTA 3LPGA 4Z2JA 3WUBA 2D20A 2YA1A 2D0GA 1V3JA 4Z2HA 3ZSSA 2WANA 1ODUA 2O92A 3UEQA 3I3EA 5KEZA 1C92A 3GXMA 1UR1A 2QF8A 2PBGA 1LL6A 4OOUA 3ARSA 1HJXA 4UQ9A 3CIVA 1UH4A 4ACZB 3FY1A 3D3AA 1US3A 1E9LA 1NWRA 5EFDA 2V38A 1LL4A 3VKKA 5E6YA 4HMEA 2VL4A 1V6UA 4CKQA 1J0YA 4WIWA 4URIA 1GOWA 3FAXA 5C70A 3MMDA 4U33A 1KBBA 1BSIA 1KXVA 4NSBA 1VFMA 3EBVA 2PF0A 3ZSTA 4U2YA 3AIUA 1GJWA 1J12A 3K8LA 4UFLA 5LA0A 3ARTA 4F8XA 2WBGA 3PHAA 5CXPA 1NWTA 2AAAA 4W5ZA 2RGMA 2OWXA 1J11A 4AZHA 1NOFA 2J25A 3EDJA 1DWAM 1OT2A 4Q22A 4LYRA 1UWRA 1W9BM 1E4NA 2Y4SA 5CLWA 1HNYA 3CUGA 2UY3A 3G6MA 3NDZA 4XZWA 3AZSA 3WIJA 2EQDA 5DT5A 3W53A 4OBRA 2W92A 1RD6A 2ZXBA 3SCOA 4UFMA 3QHOA 4D6EA 3AS2A 1BVZA 3WL0A 2NT1A 4TVCA 3FN9A 4EE9A 1HF6A 3MS8A 4X0NA 2E8YA 3AZTA 1V3LA 1ISVA 2DPEA 1UH2A 1XH2A 1WCGA 3BAWA 4LQ1A 1KCKA 1GZJA 3IJ7A 2W62A 2FHFA 1BG9A 5JUVA 2D22A 1NQ6A 1OD0A 5A2BA 4PMQA 1UKSA 5A6BA 3WNLA 2DSUA 3W4RA 1GORA 1E0WA 1CENA 1MYRA 5FL1A 2VRJA 5HDRA 1F4HA 2QPUA 2ZX7A 3KEHA 2G41A 3NYDA 2XGBA 4UNIA 1KWKA 1EHAA 5FIPA 3SCSA 2J7FA 3EDKA 4HTYA 4JKKA 2GSJA 1NP2A 1B3XA 3JUGA 2D1ZA 4ATDA 1XD0A 1UYQA 3QHMA 3CHEA 2J79A 4ZE5A 6TAAA 3ZOAA 2VURA 1WZAA 2ZUVA 5IDIA 2Y8VA 5CPTA 4H04A 1Y7VA 1DP0A 2VCAA 1H0GA 5CJ5A 3WQ8A 1VAHA 1V6XA 2ZXDA 2VUYA 2DIEA 1ZJBA 3WF1A 4HMDA 5AC4A 2PBOA 4PMRA 1FFRA 3VD5A 4D72A 1KGWA 4AIEA 2JIEA 3VIGA 2EJ1A 1BYBA 1JD9A 5C8BB 1QNOA 4J3VA 2E9BA 3WNMA 4DUVA 3WKZA 1JFXA 5BROA 4CU8A 1QBAA 5LA2A 3EDDA 5ABFA 1BVNP 3WD3A 1GJUA 1E70M 4B15A 1W3LA 4ZXLA 3WFLA 1E3XA 1RPKA 2E4TA 3SCTA 4XB3A 2J62A 3KL5A 2XVGA 1GUVA 3VNYA 5A2AA 3WSUA 4A3YA 2XVLA 4WJXA 2ZUWA 3PZVA 3IJ8A 2XSBA 2ZUSA 6CGTA 2V5DA 1QI4A 5EB8A 4PMOA 3S6TA 3BC9A 3IAPA 3ZJ6A 2J78A 4S3KA 2VNCA 1IZKA 2BXZA 3MMUA 1H4PA 1ISZA 1O6IA 1OD8A 4D6GA 1E6SM 4S3JA 3EMZA 5HPCA 1TZ7A 2VRQA 3VUPA 3WNPA 3B9AA 2J4GA 4IPNB 3AROA 1U2YA 4NZCA 4QAWA 3WUFA 3MKKA 2ZX6A 1BLIA 1GQJA 5AYIA 3I3DA 1UUQA 4W5UA 3OLIA 1QI5A 4JCLA 5LA1A 1G5AA 2VQTA 2OSXA 1W9UA 4TUFA 1PX8A 1QBBA 2PWGA 1P6WA 4FLQA 4F9DA 1M04A 5D8WA 5C71A 2J75A 1GCYA 2C0HA 5JBFA 2YKKA 5HOSA 1UKQA 4HA4A 3FAWA 4MADA 2OLHA 1ZL1A 2W4XA 1PX4A 1X6NA 3L4UA 2VVNA 3BGAA 3OIHA 3SCRA 1GQIA 3B9EA 4UQBA 2W5FA 1R86A 4JKMA 4D6CA 4UFJA 4L4PA 1J0JA 2GJPA 1U30A 4BS0A 3L2LA 4UQEA 2VZTA 1UR8A 4BCEA 1JI1A 3N18A 1JDAA 4MPKA 4M82A 3W37A 3CUIA 1HL8A 4UQCA 3APGA 2WMHA 1B1YA 3AMCA 5E0CA 4YN5A 3ZR6A 4B3KA 2BS9A 4DWSA 1G1YA 2WSKA 4OIFA 4J3XA 1JZ5A 1HJUA 1BYAA 3U7BA 2ZE0A 3RJXA 2J7DA 4HZ8A 1FA2A 3O9NA 1RP8A 1V6WA 2D0FA 5CG0A 3CMJA 3VD7A 1W3KA 1XV8A 4M24A 5A6LA 3VMPA 1B3WA 1BGGA 3EMQA 1XD1A 3ARQA 1QI2A 2J74A 2WC3A 2VTFA 1XCXA 2CBIA 1UZ4A 3OGVA 2ESCA 4CU6A 3ARXA 3WNKA 1TA3A 4J3UA 1E15A 4AD2A 1UZ1A 1HXJA 2F8QA 4W84A 3GTNA 3MO4A 2WMIB 4P7LA 3W26A 1OGBA 1JZ3A 4U3CA 3BCDA 3TTSA 5GNZA 1JZ2A 4JFTA 2V3FA 2O9TA 1JD7A 3WBAA 1UWQA 3I3BA 4AXNA 2XFFA 3BSHA 3U5UA 4D6DA 1BAGA 2E9MA 2D3LA 4UQDA 2IXVA 3VGGA 1HVXA 5M17A 3VIOA 1OCQA 1E6QM 2FHBA 4UFHA 2DDXA 4UOQA 3HN3A 1I1WA 5D4YA 1J0ZA 2WMGA 1UQYA 4H7VA 2NSXA 1C8YA 1PX3A 2PWFA 2J7BA 2DT2A 3WL1A 2CKSA 5A6BD 3A47A 1L0PA 2A3EA 1HP4A 3M6DA 1UR4A 3NSNA 3CZGA 3FHAA 3F5KA 2VZVA 2TAAA 3GZAA 1HL9A 2AOSA 1GHSA 2DH3A 4AY1A 2GJXB 4GPNA 2WKGA 1R7OA 2WB5A 2XGIA 1KQZA 3AISA 3L2MA 2XUCA 1DWHM 1UWSA 1YQ2A 2CBVA 3BSGA 5E70A 1FFQA 3VGFA 4CVWA 2PI6A 1QI0A 4CD4A 5CPQA 1KXHA 3AHTA 4LX4A 3TTQA 3WH8A 1TMQA 1QHOA 5I78A 4NI3A 1UQZA 1ZJAA 4QDMA 2VZSA 1W1YA 4PBGA 3KZSA 5I3DA 1OGGA 3WUGA 1H1NA 2E8ZA 3VOCA 4NF7A 3GBEA 2VOTA 4CVUA 3OB8A 4J3WA 4PSRA 2VVSA 4EK7A 1W3HA 3WEMA 4P7QA 4ZXOA 4D6JA 2BV9A 4P7RA
chains in the Genus database with same CATH superfamily
4MB3A 3U6WA 3BMXA 3UG8A 3SCWA 4LF2A 3P61A 5FJPA 4CCDA 2WBKA 3IJ6A 3BZJA 1E6XM 3HG5A 5GJMA 2G3JA 2ZRYA 3VVGA 1ZTVA 3CWOX 3WK2A 1B57A 3UF9A 5TBOA 3THCA 3MUY1 1EQCA 4J3SA 3ZQ9A 2WKLA 3EA3A 1OFEA 1J6OA 1X1ZA 3QZEA 1PEZA 1GYLA 4AX7A 1XLKA 4OT7A 4PTXA 1VGAA 2GWNA 3VOFA 2ASHA 2YFOA 3GW0A 1WV2A 2GLKA 4Y2WA 3UR2A 2ZDRA 4IWWA 1H49A 4HT3A 1ONEA 5D2VA 2PUZA 4L1XA 2QGHA 4DJDA 2ZIDA 4HCDA 2E67A 3R0UA 3KCOA 5XIMA 3LNMA 1P6CA 2FH8A 6ALDA 1TR1A 1XIIA 4LYPA 4S2BA 3EDEA 4MJ4A 1NAL1 3AI0A 2PWEA 1UKTA 3U4AA 1AFSA 1QW9A 2IXUA 1NSJA 3MDWA 3VM5A 5I03A 5JMUA 1S5TA 2QUVA 2JE8A 5HPOA 1J2WA 4GI9A 1G9HA 4FMVA 3EOLA 1EDTA 4AD4A 5RUBA 1QOXA 2OZ0A 3C2RA 4BQ4A 1VFFA 3GDMA 1EIBA 5D02A 4PL1A 1UD4A 5CAHA 1PIFA 1ZP4A 1XH1A 5H6HA 3C4UA 1XBXA 3WLHA 3A24A 3GNRA 1R9ZA 1AH3A 2A2IA 4AZCB 3L4WA 1BG4A 1NARA 3SIZA 2PAJA 2XG9A 1RLCL 2EPMX 1UWTA 3W1AA 1LRQA 5I02A 2ZWYA 5CPOA 3BAKA 3AMKA 3OA5A 2NQ5A 1UASA 4O13A 3G1AA 1V08A 4PTMA 1SZGA 1W37A 4JDYA 1EJ7L 2EO7A 3RHGA 3TN6A 1XBZA 4PRTA 4NZFA 4BI6A 2DJLA 1E6ZA 5JH1A 4R85A 2NLIA 1WDSA 5AHNA 1TRDA 4N6EA 4A29A 3OQ8A 3O8AA 4NX0A 5E93A 4IQLA 3SUUA 3R0KA 3RUBL 4PH6A 5HBFA 5FJUA 2YL6A 5EPDA 4JTSA 7ODCA 1PPIA 1DQWA 3O05A 3BAIA 1OINA 1J96A 3M0YA 4LBRA 3T0DA 2OQYA 4C65A 3W02A 1JIBA 4O54A 3W7PA 4OUIA 1W5QA 4GYJA 3BAYA 3K13A 4IMAA 4KEZA 1G94A 1MUWA 4ZEPA 3ZYZA 2FMNA 3UYIA 4B16A 2PB1A 3HV9A 4NJIA 1W17A 1KM3A 3TSDA 2I57A 5LHFA 3NPXA 5I3JA 5FCZA 4I90A 1ZSXA 2OWWA 1WO2A 1TMHA 1SVDA 2PGEA 2VXNA 4YS1A 2YLLA 5AC6A 5FI8A 4AH7A 3WLSA 3C2EA 3KOWA 4MB4A 1CBGA 3DFPA 4E3VA 2XVKA 2IPGA 1FP8A 1C90A 1XJBA 4IM4A 3R7MA 3G24A 5EU9A 1BHGA 3GG7A 1KB3A 4AY8A 2VGBA 1ML1A 3EA2A 9CGTA 2O9OA 4ECLA 4GWEA 4MKSA 5LGZA 3SB0A 3WN6A 1IF2A 3CZJA 4Q8PA 4XKYB 3WMCA 2A6LA 5EA9A 3W23A 3M5VA 3S1VA 3W1RA 3W6YA 3QR1A 2PCQA 1FRBA 1IZCA 1S5WA 3POCA 2CEQA 1JVNA 4PEKA 2OEKA 3WQOA 2C15A 4E8DA 2PURA 5A6TC 5DFAA 1VBRA 4V2XA 5LXEA 4XWUA 3SJNA 1S46A 2ZZ2A 3GIQA 2VHLA 3KHDA 2UWFA 3MUZ1 4H19A 2VEPA 4NG3A 1AMKA 2WMFA 2WVVB 2J13A 4HYWA 4IGSA 2PC8A 3IIZA 4CLMA 3VOJA 1WUEA 3VMOA 2P0OA 2CLOA 1LCOA 4JHOA 4O53A 4GLEA 3L65A 2X2YA 4JTCA 4M6PA 5D9NA 4EOUA 3CNYA 3W7QA 3A4AA 1L9WA 3PZGA 1OCJA 4ES4A 2J8GA 4IFOA 1VZWA 4O50A 1NTHA 3OJGA 2AQOA 3JZEA 2XM2A 1SO3A 2D69A 3K4AA 1LLOA 4O1AA 4EXAA 4XZIA 4I5UA 3VKJA 4GQQA 5ABFB 4KCWA 2QAPA 3AAMA 4WZHA 1K8CA 1ISYA 1TQJA 3VNMA 4MNJA 4UNLA 4PTDA 4RW5A 3FJ4A 2OU4A 1HJVA 2QNEA 2G4FA 2Y63A 3W7JA 2YW3A 1SM9A 1I2OA 2BVWA 3PK7A 1GNXA 4ZQNA 3JVAA 4M1BA 3BWWA 4WY0F 5HUOA 4HSOA 1XRFA 2VFGA 4CQ9A 4XD5A 3P6LA 1Q6RA 3O07A 4MB1A 1UC5A 3GHTA 2ACSA 2W61A 1WZMA 5CJNA 3WBEA 3HOJA 2ON3A 2VI0A 2PDLA 3FCPA 3GX9A 2XYLA 1QHPA 2J7GA 1PZ3A 2RH9A 3A3HA 3UWYA 2FZNA 3AYSA 4XO6A 4DJFC 3EOUA 3TXZA 5DCEA 1DE6A 1XIEA 2YX0A 4DM2A 1PZ2A 4GHRA 1JAEA 4LS0A 5AECA 2CKRA 3MSYA 3PZOA 1KTCA 2GYIA 5BZAA 4GUGA 1B9BA 4OZOA 1H11A 2IKGA 3VK5A 1ZJHA 3UNTA 4IL2A 1EO7A 3E0WA 3BCFA 3QM3A 1V3MA 3V4BA 5HINA 1NWSA 2YCEA 4KBXA 4AYSA 1Z9AA 5A8OA 2YBUA 1DL3A 2Z1SA 1XIJA 3VDHA 1Z8AA 1XSKA 1DJQA 1A0CA 1R8LA 2FQIA 4A22A 2VC5A 3N73A 3E0VA 3PWGA 2XGZA 1UPPA 3BXWA 1RAKA 5XINA 3VFCA 5C0QA 4GUFA 1C3FA 2Z24A 1F6KA 4LT9A 4E2OA 5IFTA 3PPCA 1V0KA 3T4CA 2CBJA 3NURA 1Q8AA 1Z41A 1JEZA 3W2JA 1O1ZA 1E6PA 1W3NA 4S3EA 4HMNA 1H2JA 5D2TA 5KSWA 3TYUA 2BXYA 4GXWA 1XIMA 4DZAA 2NQ9A 4R53A 1PJ9A 3GVGA 1CXLA 1H7OA 4JTFA 2WZMA 4GXMA 4AD0A 1EBGA 3L4TA 1TA3B 2I5GA 1Q13A 3M64A 3QOMA 4PB4A 4AW7A 3C6CA 5HA7A 2GFTA 4XAPA 3HPAA 2YDQA 3RK8A 2A3BA 5D38A 4JX5A 2PSNA 4QE1A 4JTUA 2PE4A 2GQ8A 3S47A 1RQEA 6A3HA 4ZO9A 3HFYA 4RXGA 4I7UA 1BYCA 3DGBA 3AQUA 5A2CA 3U57A 3LG3A 2QCMA 2VX4A 3R58A 3IJQA 3OG2A 3W00A 1TG7A 2PLJA 1EYWA 3E12A 1X38A 4QP0A 1F8MA 3GXPA 1ENUA 3ANVA 4M80A 4CQDA 4NZ3A 3PZIA 4KWSA 1XCWA 3UERA 1KBKA 4ATLA 2BY1A 4KWUA 2D73A 1CGUA 3T07A 3WMLA 4ENLA 3IGUA 2VR2A 3WBYA 1O5QA 4JX6A 2FPTA 5LIUX 3UETA 2QYGA 2Y70A 4H83A 1L2QA 5G4HC 4C6CA 4ZL1A 3V0TA 5A6JA 3SY8A 4PRRA 2BNJA 2A6NA 5I79A 4NAEB 2G8ZA 5HJLA 4AZCA 3Q4DA 1W1PA 1Y65A 4AWEA 1FXQA 2V3EA 3AXHA 1DWGM 4J3ZA 3RILA 1D3HA 3DFYA 4KQNA 3K5XA 3V7PA 2O4QA 4QITA 1A5SA 3ARRA 4OOZA 1NFPA 3TTOA 3ZFHA 3U2OA 2GOUA 1R3QA 5E6ZA 3O6AA 3UZYA 2DY3A 3HB9A 4YJ5A 4C7GA 3SN4A 2YLAA 1J4EA 1Q7ZA 4X9YA 4OHQA 2TSYA 1EL3A 3U48A 3AHXA 3KUMA 2Y1HA 3P0WA 3WNOA 3W1PA 4PULA 4JZ5A 3LQLA 4IMGA 3GG1A 2DQXA 1NH6A 3M7SA 2ISFA 1BTCA 3ALGA 1R3RA 1RY8A 1V0MA 1KCLA 2Z7GA 1LWHA 4TOQA 3ZJKA 1W2PA 1GOIA 3BMVA 4GOAA 3LMYA 3WLQA 1YYAA 3P0XA 1VC4A 4ADUA 3EPOA 2QR6A 3WEOA 3SUWA 1E5JA 1LZOA 4ZMGA 4DNHA 2PMQA 2QHAA 1CGTA 1VF8A 3GWQA 3OVRA 1VB9A 2X40A 3FEQA 1A5AA 4DBSA 1PIGA 5ABEA 1SW0A 1VIWA 5HAOA 3QBUA 3W81A 3GNDA 3ECQA 3TFCA 4IX0A 1QI3A 1XLHA 2CETA 4Q4MA 3PBYA 2JIWA 3H7RA 4H6EA 3JZUA 1AZ1A 5C6MA 5FESA 1JDEA 1DEDA 3DFOA 2AL2A 1RV8A 3GVVA 5GQBA 1E43A 1HO1A 4GX8A 4PTWA 3N9SA 1DIDA 1OIMA 3W84A 2NX3A 2BVYA 4Z08A 2P76A 1QK0A 1WOBA 4B4HA 4RV3A 1Y5VA 1Y5WA 4GQBA 4XKYA 2J27A 1ISXA 1UPMB 3H53A 1V0NA 1B31A 3BANA 3IIOA 4OGZA 2GSHA 3C56A 4XQ6A 4XZBA 2F61A 2FHCA 5JVLA 3PJTA 3EZ4A 4TU1A 4Q8UA 3GXDA 4QR6A 3QPZA 3CWHA 3SIMA 4P7OA 3LXBA 4KH2A 3A6OA 1DWFM 4WOQA 2A85A 1XICA 2WVVA 1FBAA 4A3HA 3H54A 4GVFA 4EX4A 4CGTA 5H91A 4JN8A 1RCXB 3H2MA 2WHKA 3LPFA 2FB2A 2P5NA 5TF0A 3OVPA 3VX0A 3F2DA 3PWAA 1XC4A 4XISA 5EMJA 3RMEA 4E38A 1JF6A 4RNIA 3AXMA 3LI0A 1QNSA 1QTWA 1FOBA 3L5AA 4GBUA 3G8RA 3KBNA 3WD0A 1IXNA 1P1MA 1UJPA 1A5NC 1Q6DA 1A49A 1TV3A 4ZSUA 3GDBA 5I3GA 4X63A 1XYZA 1TELA 1K03A 3UYCA 3W29A 1QASA 2Q3RA 1W5NA 4RE2A 3ANUA 3PB2A 3V5OA 2HPIA 3V5CA 5KZ6A 2FFCA 1W5PA 2L5HA 3UCQA 3EWCA 3MTWA 3UXLA 3MZ2A 4JHMA 1TO3A 3CHFA 5HJYA 3AXXA 1K9FA 4ZTYA 1CZ1A 4U28A 5MHBA 2RJGA 5BMXA 1QOPA 1R5YA 3WLTA 1W9PA 1VPQA 3FXYA 2I5QA 1W0MA 5BW6A 3HM7A 3WD4A 1JGIA 1AQHA 1TPUA 1TX0A 2FTWA 4X61A 4F0MA 1YHTA 5JH2A 4W8LA 5BMWA 3VKAA 1EH9A 3SGGA 1Z42A 3BLKA 1Q7QA 5IHRA 1J9YA 3T05A 4HHMA 3WDIA 5GJPA 3VINA 3LLDA 2NQJA 3UVIA 1FY6A 4H8NA 4EANA 2HK0A 3CPUA 2PCEA 2CFFA 3TQVA 3LV5A 3CYJA 2CCRA 3N9RA 3ITLA 3SUSA 3PVFA 1MXDA 5D8ZA 3P14A 4AHOA 1W1B1 1PTGA 4P5UA 3FGCB 4ERIA 1LLZA 3MY9A 1T5AA 3GNOA 2OLSA 2Y6ZA 4CQBA 2P10A 1YBQB 4GUJA 2FZBA 1UJQA 1LOLA 3QHNA 1XIDA 2SFPA 2Z1BA 1DE5A 2Z29A 3P5ZA 1NDYA 3DHPA 2OZ3A 4UZSA 4Q8VA 4GI4A 3QQ1A 3VFLA 3GXNA 4DYJA 3L23A 1WDQA 3EOEA 3B8DA 2PDBA 4QCEA 3HU7A 3CZLA 2W91A 4FLSA 3NXLA 2QCDA 4WRHA 3CT2A 1RALA 2ACUA 4UIOA 3O06A 3AIEA 1FCVA 1XQLA 4W8AA 3R5EA 3S83A 3LBOA 3WDHA 3BGJA 1V79A 2ZRZA 4PUNA 1KRAC 4V27A 1OYBA 5HQMA 1TVLA 1VFOA 2Y61A 5IFPA 4ZSTA 3LCWA 4QM1A 5IHSA 4Z2LA 5A8QA 2V2DA 2ZX5A 1XX1A 2ATMA 1P1XA 3ABQA 2O56A 4AWTA 3GG8A 3MV11 1R30A 4E2BA 1MQRA 3I68A 3GDLA 1N82A 3AYVA 1OX5A 1B30A 2ZUMA 1ME7A 4JOMA 3A4WA 2BY0A 2VT0A 4YXGA 3W1TA 4C6MA 1M03A 1WAWA 4XBKA 3ITXA 5D05A 3ABRA 1TE6A 3WFZA 4L4OA 2XU2A 1HN1A 5D03A 3OGRA 3WEZA 4Q8QA 2J7CA 1XP3A 1XH0A 4ROPA 3WY1A 4O17A 1EJVC 2Y89A 4X9SA 3WK3A 3U5YA 3L4ZA 2DSKA 3TYDA 1L6YA 4PFHA 1N8IA 3ZJ8A 3CUZA 4F2BA 3UGRA 1UD2A 3S0CA 3GKAA 3ICJA 3ZJ7A 1MFUA 1VFLA 1FWIC 3CV6A 3GE7A 5LXXA 3WJYA 1P7TA 1TREA 1ZB5A 3F5LA 2DH2A 3KOZA 3EYPA 1H50A 5IOBA 1ZBWA 2J88A 3E5PA 3SCPA 2VELA 1HKKA 5DCDA 1Z48A 5BU9A 1OY0A 1M7PA 3V35A 1FTXA 1EC7A 3UXDA 4DBWA 4HYRA 1LL7A 1UP2A 1ZLPA 1ONWA 5BXPA 3GDKA 3LCGA 2E1WA 3NQ6A 2HROA 3W7LA 2C18A 4LGXA 1ZGDA 4AYGA 1Q8JA 2AMXA 2NXHA 3TA9A 5EKYA 3FNDA 1ODZA 3S42A 4MNMA 4ADTA 3AWOA 4TTGA 3CBWA 2OZTA 3EB3A 3BAXA 3AJ7A 3BH4A 5JIWA 4JNYA 3O0FA 4H8VA 1PTDA 3TIMA 3L5MA 3PZQA 3MVTA 3O16A 3C2YA 3RGTA 4S3DA 4LUSB 3SM0A 3LZ3A 2A0NA 2E5CA 3ZLGA 1QNVA 2YCIX 3DIPA 4FA3A 3L0KA 4H8UA 3LQGA 1PTAA 1D3GA 1UR3M 2RFGA 1JYXA 3A64A 4UTLA 1TWSA 4Z2JA 3NO5A 2Q01A 3K4WA 3WUBA 3KOYA 2P50A 3WLJA 4Z2HA 3UZZA 5FF3A 2WANA 2BODX 1UUOA 4A3UA 5HWMA 2W27A 3LA4A 3APTA 4ACZB 2VP8A 3V0SA 4JGDA 3Q37A 3E0IA 1TKKA 3HA1A 1F07A 3WLOA 4HMEA 2VL4A 1V6UA 4UNKA 1OFDA 2YW4A 4CKQA 2ABAA 3GIPA 3DHFA 4G8TA 3U8GA 3EXTA 4YTSA 1ITUA 4H9VA 2ZFAA 3MMDA 4O16A 1KBBA 5G2HA 4AQLA 1KV8A 4NSBA 1K4GA 2CU0A 3AIUA 3K8LA 4JN6A 4H9UA 4F8XA 4IJCA 3PHAA 2AAAA 3LCFA 4MF4A 4W5ZA 3IIPA 1P43A 3CHVA 3EDJA 4HTBA 1UWAA 3L0NA 5D04C 5CLWA 2UY3A 3XIMA 1K1DA 3NDZA 2QJNA 3V16A 4US5D 4ASTA 2EQDA 1C29A 4YTQA 3L7RA 5D09A 3FA5A 3CV2A 2Y5SA 1RQHA 2ZXBA 3QHOA 1BVZA 2A7PA 1EEPA 2NSOA 4TVCA 4FX6M 2BLEA 2PGRA 3IARA 4Q4PA 1EKOA 1SZNA 2E8YA 4B5WA 1DIEA 1S2TA 1RJPA 1ISVA 1IEQA 1UH2A 1H5YA 1XLLA 3MJMA 4QNEA 1GZJA 4MIMA 3IGSA 2V69A 4IL0A 3CYVA 4AHQA 1EP1A 1OD0A 1S2WA 5A2BA 4PMQA 1UKSA 5A6BA 2E1DA 5CC6A 1A80A 4PFMA 2VRJA 5HDRA 1XYLA 4NZ4A 4G5DA 5C2GA 3K1GA 4RCXA 4K3ZA 3NYDA 5HANA 3BQ6A 1TIMA 4KEMA 3R94A 4UNIA 1TPDA 5FIPA 4YMZA 1B3XA 4ATDA 5J5DA 4IP5A 2CWNA 4ZE5A 3B8WA 2PDIA 2IPFA 2VURA 4JDBA 4UTTA 2ZUVA 4NXSA 3MJYA 3FDKA 4PUKA 3WQ8A 1YW1A 2VUYA 2DIEA 4WJEA 3KAOA 2BOEX 1NDWA 2XFWA 4HMDA 1BQGA 2IQ0A 5AC4A 2FVKA 4PMRA 1FFRA 3NQCA 3SQLA 4D72A 4AIEA 2JIEA 3ITTA 3T55A 4GC4A 4ORMA 1XYMA 2E9BA 2PZNA 3VYLA 3UJRA 3WNMA 3BW4A 2GQ9A 4LOCA 3WKZA 1UBPC 1JFXA 4DXKA 5HQLA 3PJWA 1J5SA 4NJGA 1TWDA 2YR1A 4X3ZA 4AF0A 1EP3A 5LA2A 4D8LA 1GVQA 1GJUA 4L4MA 3LHTA 1RJQA 4LSBA 3W2UA 4WY0A 5LNUA 3QV6A 3SCTA 5C7VA 3CAQA 5A2AA 3WSUA 3UY7A 4B3ZA 2C6QA 5C7HA 3M0XA 3PZVA 3SRDA 1P0NA 1CI1A 2ZUSA 3I7SA 4RX0A 2G3FA 4NAFB 2CZDA 2GOKA 1QI4A 5EB8A 1FDZA 4PMOA 3IAPA 3I7QA 2Z0IA 3C61A 3MUXA 3MMUA 1ISZA 1O6IA 1OD8A 1L6WA 4UR7A 4V33A 1YBQA 3VUPA 4GC3A 3B9AA 1S38A 1T7LA 4S39A 3LXAA 3DDMA 4UTHA 5KITA 2QS8A 3M1ZA 3FYYA 4NZCA 1Q7MA 1GQJA 3I3DA 3LN3A 4BF5A 3TK7A 4PCNA 1PYFA 6REQB 5C55A 1Q6OA 1P6WA 2ATSA 1S2CA 5C71A 2J75A 2TRSA 2C0HA 3M0ZA 5K4ZA 1SUXA 1SJDA 2R24A 5KZDA 4QE5A 4LUIA 1R47A 4YTUA 3FDGA 3DBNA 4DN1A 2OLHA 4ZOAA 1PX4A 1VFSA 2CZEA 4BWLA 3W9ZA 1VCFA 4WGHA 4D6CA 1U1HA 1J0JA 3FX4A 4O4VA 2GJPA 2O4MA 3H23A 4F2TA 3LSCA 2VZTA 1MI3A 4D9PA 2X1RA 3N18A 3GSMA 4OWGA 2Y7EA 5CGQA 3W37A 1I4NA 1NEYA 5HR7A 1TIWA 1ZAHA 3ZR6A 1R6WA 1VPXA 2NVCA 1XCFA 4DELA 1F8IA 2OT1A 4JNMA 1JZ5A 1Q85A 1I60A 5HMDA 2WO5A 1LRTA 5CG0A 3VD7A 4M24A 4WXZA 4L56A 1YTKA 3PUOA 1PVNA 2ZKMX 3O1NA 1S3HA 2W0UA 3VCRA 4JTTA 2J74A 2VTFA 3WYZA 5KMYA 3OGVA 4JIRA 5E5CA 2ESCA 4CU6A 3ARXA 5ENLA 3WNKA 4J3UA 1OC6A 1UZ1A 1HXJA 2F8QA 2FFIA 3GTNA 1VYPX 2WMIB 4U3CA 3TTSA 3NNTA 5GNZA 1H7XA 3F4WA 4OTKA 2H90A 4JFTA 3WBAA 3ZS4A 3I3BA 4AXNA 3CUXA 2E9MA 3IRSA 2IXVA 4YLWA 1KV5A 3O0KA 1R46A 5CBBA 3C3NA 3MI3A 4IG2A 4UOQA 3QEZA 4DNMA 3LLFA 3MP5A 1UQYA 1J5TA 5AZ1A 2J7BA 1ZJIA 2A5HA 3WL1A 2A3EA 3LV6A 1H61A 3S2NA 3TWBA 4M7SA 1PL9A 3FHAA 2VZVA 2FVLA 1ONXA 3M0IA 2WQPA 2WJZA 3VABA 2GJXB 3BGGA 4L4LA 2C1IA 4GPNA 2XGIA 1KQZA 1H7PA 4JYDA 2WZTA 3OW1A 2ODOA 1YQ2A 2FTPA 3OEXA 4CQAA 2HMCA 2Q6ZA 3NZQA 2UBPC 1M41A 3NQVA 4GUIA 1FWAC 5F2LA 1JCNA 3QGAC 5I3DA 1W1IE 4EIVA 4MZ1A 3B0YA 4FEZA 1H1NA 4MLJA 2E8ZA 5BOFA 3GBEA 3S5NA 4CVUA 4XBJA 4J3WA 4HPJA 4EVZA 2H6RA 2BG5A 2VVSA 3M4HA 4OVXA 1ZP3A 4IGNA 1W3HA 3WEMA 2XSXA 1O12A 2ISVA 5G1TA 2DZPA 5AHIA 3UT0A 3QV8A 2BV9A 4P7RA 2ZDSA 1SFTA 4A2RA 3D5HA 1ECEA 3P62A 1NM9A 3SY5A 2PDJA 4QGCA 1J10A 5C9WA 3UA4A 4IUGA 2V9DA 3KS6A 4GJ1A 3EWBX 4BWLC 3P80A 3VIJA 4ACZA 5H2ZA 5U4NA 5T91A 4P8XA 3VXGA 4F66A 2NXIA 4PUWA 3SO7A 1C8QA 2V2HA 4ERAA 4MOZA 4DYKA 3FXGA 3Q65A 5E9AA 3AOFA 1AL7A 1LROA 2Q02A 4U31A 1YPFA 3B03A 2IQTA 3LCHA 4MNKA 3SGZA 2CIPA 4J27A 2PDYA 4HJWA 2BHZA 3FKRA 4NUWA 3UZWA 3W86A 1LLWA 1O5XA 5A8PA 3VUSA 3W1MA 3QH2A 5D30A 4HK6A 3TW7A 3C5QA 1R0MA 3C3UA 2VRKA 1LG2A 1MZHA 1TUXA 2G3IA 1F6YA 1HP5A 3TWAA 3AS1A 3T0CA 5A8NA 3BO9A 4HSHA 4AZBA 2V82A 4RDVA 1V02A 4RDYA 9XIAA 3W22A 4PMJA 4O19A 1UWIA 2GGIA 1R9YA 4NNCA 4DZIA 5BOEA 1AA1B 3V1HA 1EXBA 1WE5A 3NTYA 1OGSA 3PBUA 2WLZA 1K9DA 1QNPA 1WPCA 3MO7A 5D33A 3RM9A 1KBLA 3ATZA 2GL5A 3NJ3A 2ZA2A 3UJEA 3ZVHA 3VIMA 4WSKA 3WH9A 3A3WA 4WLCA 3B0XA 3LXCA 5AZ0A 3TCSA 3GLCA 3NQEA 5DY3A 1XDLA 1GKQA 3S1UA 1O7AA 3JR2A 4J3TA 4MSSA 4BF7A 1KWGA 1M1BA 4LS2A 4XZ9A 3OBKA 3UG5A 5F1UA 4Y7EA 2X30A 4AVFA 3IGHX 4CN6A 4S3CA 4WKHA 1H51A 4BF9A 3DG7A 2D3NA 2QCHA 4JS3A 3GU2A 2GGGA 3EPNA 4Y6GA 5E09A 1CXFA 1JUBA 3R8RA 2J66A 5FSDC 1K9TA 3TV8A 5LYRA 1PV8A 1KCXA 3G1YA 3GTXA 3INPA 3STCA 4PMUA 4PMDA 3T2QA 2Z00A 4K36A 1K6WA 1TPVA 4LY4A 2PTDA 1HUVA 3PUDA 4G6CA 3IS4A 3GFZA 1T96A 3CZEA 2XFRA 3GAKA 5A8MA 4C6DA 3BVJA 5D9MA 1WOAA 1CGWA 1SR0A 3RITA 4ZB5A 3GTHA 4C1NA 1AD1A 1JRBA 1XDMA 4ZQCA 1W6TA 4JIPA 4EPDC 4Z1AA 2DIJA 3E74A 1FX6A 1QDSA 3S2LA 4J9JA 3VE9A 1EF2A 1G7UA 1VEPA 3G1SA 1S2VA 2DZBA 1NF7A 3CV1A 2E9LA 4WKAA 3USZA 4FNSA 4IXHA 2DT3A 4GD0A 2GUYA 3MUAA 3T2OA 1JPIA 4C6BA 1MSSA 1F4AA 3C2OA 4UUIA 4Y90A 3LM7A 3ZLHA 3GYEA 3WQ6A 1VEMA 4LANA 1UW9A 3GHRA 1BGAA 2ISSA 4JPGA 1R3SA 1C8XA 4ILSA 1ECQA 3GNXA 4LB3A 1V0LA 4R3UA 3SRHA 3QXBA 2Y8KA 4RPQA 3SURA 3W6LA 2HE5A 1E4MM 5M2FX 4RE3A 5KETA 2NX1A 4N42A 3EA1A 1K77A 3LTPA 3OO2A 1K6AA 3DFQA 1GVSA 2F6KA 3MB9A 5F4SA 2C1HA 2PGWA 4DJED 5CAKA 1EC9A 1F76A 3ARVA 5G1YA 4U5IA 3GHSA 1V3IA 3E0FA 2WHMA 5C9XA 5DEZA 1W31A 3KLLA 1XYBA 2JEPA 4N9CA 1G4EA 1A5LC 2G37A 1X7FA 3TJIA 2DFAA 1MW0A 4AVNA 3BG3A 5A6MA 1POKA 2PLKA 1G6CA 1KM4A 4QJ1A 1J79A 3FYPA 4GJJA 4OUEA 5HXMA 3LNPA 4CQ8A 3URBA 1E1EA 4DVOA 3BJTA 4AMCA 1CTNA 4LB4A 2X1SA 3WLMA 4XG1A 4KCVA 1N55A 3UVAA 4GBDA 4W88A 1DJGA 4AUBA 3WX7A 4ML4A 1VP5A 1OVDA 4XO7A 2VDIA 2EPKX 5CPNA 2EPHA 4GFSA 3NPWA 1GTHA 1Q63A 1ZAIA 4IIBA 2WMIA 2R8WA 3A12A 4KFNA 3VILA 1Q6LA 1V5XA 4U4MA 5DCBA 1Z44A 1NOUA 3G6LA 5D37A 1H1YA 5HQEA 4GMEA 4H6QA 2VC6A 4OE7A 2CLLA 2RDWA 3M5XA 4YHEA 4K38A 1JDFA 1GQNA 4FF5A 2NV9A 4XD3A 2ZUNA 1E56A 4KRTA 4ONVA 5FAJA 1KTBA 1T99A 4B5VA 1V6YA 2I9UA 1RPXA 3NYZA 2QVNA 1WXJA 3B4YA 1UP0A 1B5TA 3DYMA 4K7YA 2VO5A 4UTIA 2WNZA 1YDYA 4KGLA 1NVMA 1NIUA 3RU6A 4ZFMA 1RD5A 4YYFA 1GQLA 2NT0A 3GM8A 3IV3A 1CGYA 2Z1KA 3KBMA 1DOSA 4WSHA 2WV8A 5J8LA 2EKCA 3EGJA 3WDPP 3AHYA 3ONBA 3W27A 1MZRA 1OBAA 3H4XA 2WC7A 1LOQA 4LAMA 1Q6CA 1PKLA 5DF0A 1ZENA 1EUNA 1YE4A 5G1MA 4BI5A 2FLIA 1QPNA 4I8YA 3DENA 4BK9A 3E2VA 1XUUA 2NWSA 3WDRA 1PKNA 3WBWA 1PCWA 1M9HA 2Y0FA 3J7HA 3CPGA 4DF2A 4IPIA 3W1LA 2DVUA 3PG8A 3B0UX 2H9AA 1BTMA 2EGZA 3HBLA 5LGXA 2A1YA 5HWNA 2WQDA 3VNKA 3STPA 3G1HA 1MDRA 1X8FA 4QQUA 2Y8UA 3BE7A 1R85A 4YL2A 2ZA3A 4FNRA 2REQA 3PZ9A 4LUJA 4C5ZA 1JI2A 1JF5A 4O28A 2X1UA 5F4WA 1NY1A 3EOSA 2QDHA 2QUMA 4AZ6A 2DVXA 1YKWA 3NZPA 3VNDA 1EA9C 3WQGA 4FSAA 1B2YA 2Q3OA 1LBLA 4JIQA 3SI9A 2EG7A 4O10A 1KTNA 5A3HA 5F4XA 5HR6A 5REQB 3TQPA 2PS2A 4NJJA 1TPWA 3MV01 1UWUA 4REQB 2AMGA 4MZ8A 2GK1A 4KF1A 1IWPA 2R91A 5E9XA 4TX6A 2F7FA 3U2CA 5I3HA 1EDGA 3W74A 5DT7A 2YXXA 3LBMA 1ITXA 1GVFA 3T78A 3O15A 4GYPC 3BMWA 3AHZA 3T8QA 3SUVA 1LOSA 2OWCA 4UFIA 4LW7A 2GQ3A 2I5IA 3WUEA 4N9EA 4TIMA 2VR4A 4KT2A 2ZRWA 3K46A 2ISDA 1RBAA 1SPQA 3DFSA 4HK7A 2CYGA 3RIKA 3K30A 3T08A 2YDRA 2V0TA 3KRZA 2YL5A 3LUTA 2JBMA 5HNNA 1A3HA 4WEVX 3TVAA 3VU2A 2RGLA 3V1PA 3CV7A 5AC5A 1MDLA 1LJYA 3IVTA 4DQWA 4ZQMA 2QLYA 3CUJA 4QCFA 1IQ8A 1NJJA 2OKTA 2XVPA 3MT1A 1HX0A 1J0KA 1HTIA 2G5WA 2PDHA 3EX1A 5CSUA 1IV8A 2J9ZA 3EXSA 1WDRA 4J1OA 3USBA 4AZIA 1E0UA 2WPGA 1FWGC 2VD9A 5IRPA 3H21A 1WKYA 1UOKA 4MGGA 4CNPA 3AMGA 1YDNA 3ZXWA 3DHDA 1XYCA 1R3TA 1UIPA 5CC3A 1DJHA 4O52A 4O0QA 4AD3A 1TE1A 2AKZA 1TPH1 3B05A 4G2DA 1Z32X 2A3AA 3DH7A 4WSJA 2ALRA 1L6FA 4ZO8A 3CUFA 3MVIA 3H4WA 3N17A 1GPFA 4GCXA 4A8LA 1TCMA 1H1ZA 4DPQA 5C9RA 2I7GA 4L80A 1OM0A 1FUYA 4PC8A 1TYGA 1MXSA 3L0GA 3IJLA 3VGEA 5C5YA 4FIRA 1QK2A 3LX9A 3W2NA 3ZWSA 1FWRA 4LUTA 3T7VA 4CCCA 4I6VA 3HJZA 5BRQA 1T8XA 3FSUA 2C91A 4JIEA 4W7UA 1H7NA 3CT7A 1ZAJA 3HFTA 4F0RA 3LY0A 4V15A 2HBVA 3DFNA 2DZVA 2ZBTA 1IHIA 1H7RA 2D2HA 4LY8A 3KWXA 4H8HA 2EF9A 2ZZ7A 1IIHA 4Z1YA 1W32A 3KXQA 5FF7A 5M03A 2JF7A 2PFHA 2H8XA 2BMBA 2HVMA 2FVMA 5L9FA 1XLMA 3VM7A 4K8HA 5HWJA 3G0XA 2P3EA 1B9ZA 2QGYA 3VIFA 2YB1A 4HK5A 3CAVA 2NLYA 3E2QA 3U9IA 4HNCA 1UA3A 4AY7A 1K9EA 3H7VA 4DRSA 5LKYA 2OR2A 1AH4A 2JQXA 3A4XA 3N2TA 1PAMA 3LCXA 3VGDA 5A95A 2X0YA 4D2JA 1A3XA 2HQAA 4PBEA 1QNRA 1YNPA 4KERA 4V28A 3B9OA 2B7PA 3ARWA 2X2GA 3P7YA 3UWUA 2PGFA 8CGTA 4E0CA 2V8ZA 3SN0A 3SSJA 2B81A 2Y2WA 3H12A 3DERA 3MI2A 1RCOB 3RU8X 1JG9A 3U2ZA 1JYWA 3WK0A 1PHQA 3GTIA 1XQKA 4B3LA 1VRXA 1P48A 2X7VA 4XAYA 1DQXA 3WELA 3GDTA 3AIWA 4CUCA 5ABTA 1UR9A 2H3DA 1EHNA 2ADAA 4ZCWA 4JY9A 4LXFA 2FGZA 3W25A 4Q7IA 4WDTA 1BWLA 2Y7GA 5DANA 3L4YA 1UR2A 4G1NA 3AXKA 1RBOB 4H00A 3GC5A 5FF0A 3GXFA 3I7RA 4R34A 4RNJA 3SGUA 3LRKA 1CW2A 4BQ5A 2BOGX 4JR5A 3SRKA 3B04A 3ATYA 2CITA 1XGDA 2PDMA 3R6IA 2TODA 2BOFX 2XWEA 4HNUA 4LCQA 1P6BA 1MW1A 1Q45A 3MP3A 3VDAA 2BBFA 4IX2A 3ABXA 3SSZA 3T4WA 2YGYA 3WF0A 1JGMA 2J24A 4IMDA 2X8RA 1GVOA 2P53A 3VDCA 5D32A 3EXRA 3GYCA 1JL8A 1VFHA 4C6KA 2VGGA 4Q6JA 3N6JA 1KW1A 1A47A 5D2WA 1FHLA 1F6PA 2FDSA 3SFWA 4HNNA 2HDJA 3WJXA 4L65A 3S5SA 2QAFA 3EEGA 4LCRA 5LZLA 3S5YA 1V8EA 2PDNA 1PKMA 3MUCA 3PFMA 4WDXA 4NX5A 1UD6A 2YCKX 2BHYA 3GXTA 2CNCA 1FCUA 1VRDA 2QMKA 3GC4A 2YJQA 2PP3A 4ZTXA 3C2FA 1US0A 4UB9A 4RZ4A 1XISA 1M6JA 2OELA 3IWPA 2RJHA 4PUDA 1GOXA 1FHDA 3AS3A 3B9NA 1Q6QA 1VFUA 1XINA 2P0IA 2X1IA 1DVJA 3BW2A 1VKFA 4FOJA 1E4LA 5D2YA 1LDCA 1YLVA 1HKVA 3VOHA 3RM4A 4PEEA 4DPPA 3R8HA 2DEPA 3N2OA 1QVBA 5F7UA 3N6HA 2OLAA 5CLTA 4IF2A 3IIXA 6PTDA 4DBEA 3MMWA 3WD1A 5EMKA 1CDGA 4DY1A 2HCVA 2V2CA 4MB5A 2X05A 4LC6A 4M81A 1XLEA 2VCCA 3NGJA 4DO4A 1KQYA 4ZO6A 5M5DA 1Y8BA 4IIDA 4IOTA 4GGHA 4D8ZA 3FYOA 4LVGA 1MEWA 2OYMA 2B31A 3GIYA 2G4JA 3QZAA 5G2WA 2Y7DA 3B8SA 3VNZA 1UBSA 4YU1A 1XI3A 3QFEA 3R11A 1ZBKA 4RUBA 3CEPA 3CZ8A 1NDZA 3K2GA 4AB4A 1CXIA 4JTAA 4GACA 1UROA 4PMNA 1TTJA 3NXFA 1J0IA 3KL3A 1KD0A 3PANA 1V93A 2QJHA 4P8UA 4R27A 3WG6A 2YCLA 2IS7A 3E49A 1LT7A 2E40A 3NUKA 3PZUA 1WX0A 3NQMA 2HXUA 2XTKA 1JDCA 1H0IA 2HPMA 3PTMA 4GINA 2CZFA 3ARZA 4M6VA 1FWCC 1GYMA 4JYFA 4F79A 4K8GA 1EZWA 1BYDA 1O95A 3KZPA 3W7RA 1O5RA 1KGXA 4E5TA 4WVXA 5G2IA 1UR0A 1WB0A 4H3DA 3Q58A 5BWFA 2PWVA 1JDDA 4PMZA 3HO8A 4GZ7A 3NSMA 2ZCGA 3QW3A 2CC0A 1EGVA 1NF0A 5H8UA 1EJWC 1LQ0A 5FEPA 3WLRA 4LC8A 5G4WA 3LSBA 3WH6A 1DV7A 1VD6A 4CCEA 2WSYA 3F2CA 3WNNA 1SO5A 2NZLA 3G3DA 1XXXA 2WWCA 1GW1A 1E6NA 5DMYA 1YTDA 3VNIA 1O4UA 3LMZA 4IIEA 2KAUC 2CHOA 2LLEA 2IMRA 3MQTA 4FAMA 2YDAA 4E6MA 4KEUA 5I23A 3HQPA 3GR7A 4ICCX 4RZBA 2XIJA 2A3HA 3II1A 4Q4QA 4M5PA 3QV7A 2XZ9A 5AVHA 2PDKA 4QROA 4FB7A 2PDUA 4JICA 4QDPA 1AQMA 4AEEA 2PTZA 2Z26A 4LEFA 2OKOA 4A3QA 5JQ9A 4R33A 3N2CA 4NT0A 4XZHA 3K4DA 3WF4A 1XLAA 1FHUA 4Q8TA 4HN8A 1VH7A 4M51A 4ZENA 4Q4KA 3S8HA 3JS3A 4KEVA 2V3DA 3GG0A 4QXIA 4XV0A 1X97A 4K6AA 3UFYA 2NQLA 4WJ8A 4KWOA 1XLJA 3VCCA 1MUMA 5IBXC 1KNWA 4Y8EA 2OCZA 1XBYA 2B7QA 2Z6JA 3AUJA 3W38A 3E1F1 4BI7A 3BOLA 1TUFA 4O1CA 4QE4A 1JQVA 2CLIA 3STEA 1LG1A 3PC0A 4RDZA 4FHAA 3HURA 4DO6A 1OK6A 3GXIA 4Z2KA 4LWWA 3BOXA 1XUZA 3AIRA 2AGTA 3N13A 4UOZA 1KR0A 2RHGA 3XINA 4IHCA 3DC0A 1SZRA 4H2CA 3THDA 1NP0A 4I8DA 4XK2A 2JKEA 1RSCA 9XIMA 5ABGA 4Z1BA 1HO4A 2D0GA 4C6OA 3THQA 2O92A 4KCTA 3I3EA 4HNTA 3AWNA 2QF8A 1LWIA 3MCOA 4LALA 1LL6A 3CIVA 3D3AA 1US3A 4UR8A 5SWUA 3AC0A 2W3ZA 2G96A 5E6YA 3P82A 4WIWA 3FAXA 1PE1A 3VZXA 3BARA 1JCYA 1K4HA 1J2BA 4DO7A 4EF9A 5LA0A 3ARTA 2R1LA 5CXPA 3TZFA 2OWXA 1ICPA 2J25A 1DWAM 3HF3A 4NNAA 3EKZA 3APYA 3CASA 4Q8NA 3YPIA 1ZCOA 3TUUA 3R25A 3WIJA 1H62A 3V3WA 3ITCA 3CL6A 2W92A 1YRRA 1OEPA 2X0SA 3DX5A 3ID7A 3SCOA 5HATA 2X1TA 3BLIA 1GVRA 3VNJA 4B5UA 2W9MA 2PD5A 4LVDA 1GKPA 2I16A 4U10A 4HVXA 3VE7A 4IJRA 1XH2A 3B8TA 1WCGA 2R1NA 1V7AA 2DUAA 3I6RA 3IJ7A 3NEVA 1ADSA 1HGWA 3S2JA 1VBHA 2W62A 4POCA 2D22A 3MP4A 1NQ6A 1KLZA 3N14A 3TAKA 1GORA 1E0WA 1CENA 5FL1A 4LF1A 4PB3A 2CWXA 2JKAA 2ZX7A 1DXIA 4DJEC 1EHAA 3VDGA 3SCSA 1GPWA 2OO6A 3KOXA 2EAWA 3EDKA 2DORA 2GSJA 2P3ZA 3JUGA 1XD0A 3CHEA 4N4PA 3QY8A 1WBJA 6TAAA 3BW3A 3IUDA 2PEVA 3W7DA 3TTEA 3TE9A 4TQTA 4H04A 1Y7VA 1DP0A 5CC7A 1H0GA 3V75A 3G0SA 3BLFA 1MNSA 5C9ZA 3PNUA 2VFFA 4ZQOA 2ICSA 3GVWA 1S1RA 5A8GA 3TW9A 3WF1A 3A22A 4DXVA 4O1BA 5HNUA 1KKOA 2AL2B 1KGWA 4KIEA 1XPGA 2EJ1A 5FEWA 3AALA 3UWVA 3G1DA 4F40A 4FF7A 1XLBA 4AAJA 4GG9A 2VUNA 4DUVA 1B4KA 1FKXA 2E6YA 4DJDC 4FI4A 1ME8A 1W3LA 2XN1A 4ZXLA 4C6LA 5E1QA 1E3XA 4QQ3A 2H8ZA 4JQ4A 2E4TA 3TMQA 3CTLA 5EMLA 3VNYA 2XVLA 4WJXA 2ZUWA 2QKFA 1BRLA 1K7EA 1SSDA 4WCJA 1DJWA 4H9MA 2OEJA 3BLEA 3EWYA 3IJ8A 2XSBA 3TU9A 1DXEA 4W9TA 3QPEA 3GRIA 5GJNA 5LNVA 3S6TA 3MW7A 1RY0A 4S3KA 2VNCA 1IZKA 3LHUA 2OZ8A 1E6SM 3EMZA 5HPCA 4HNVA 1V4YA 2VRQA 1PYMA 4L64A 4OQVA 4FXFA 4MM1A 1SR9A 2CLMA 3R1ZA 4H9TA 1JQXA 3WQFA 4OBTA 4DF1A 3QY7A 3WUFA 3IUHA 2ZX6A 1I2PA 1X1OA 2EJAA 1TR9A 4O11A 4ZO7A 4X22A 1G5AA 1W9UA 2HVNA 4AG0A 4FNTA 1JPMA 3D6NA 3DI1A 4F9DA 3WFAA 4C6FA 3DN5A 1DHPA 2VEFA 4BR1A 5EBUA 4IPJA 2QDGA 4HA4A 4HHLA 4ZQRA 1XFBA 1ZL1A 2Q09A 2D2JA 3W2LA 3L4UA 4L5ZA 4N9DA 2W5FA 1R86A 3GTFA 4MMWA 1U30A 3MDUA 4UBPC 3TC6A 2RDTA 2G95A 5FA5A 4TX9A 4UMAA 4O1DA 3UPWA 5K9CA 3BJSA 4BCEA 4O1FA 1F74A 3CL7A 1JDAA 3LHYA 4MFDA 3CUIA 1CX9A 1HL8A 2WMHA 1XF0A 1B1YA 3ABZA 3BL3A 2VGIA 1M3UA 2NV1A 5CPLA 4DWSA 1G1YA 2BDQA 4G7FA 1BYAA 2ZE0A 3Q94A 1FA2A 4H1ZA 3HV8A 1RP8A 3S9IA 2D0FA 2C3ZA 3CMJA 1QT1A 2Y85A 1XV8A 4K1WA 1K3UA 5A6LA 1MRQA 1BGGA 4H6RA 4JN7A 2HSAA 2AQWA 3KDOA 1EB3A 1PWMA 1RA5A 1UZ4A 1IXOA 3L67A 3QMSA 4HD5A 1DQUA 4W84A 1EFZA 1JZ3A 2AL1A 3BCDA 1WA3A 3DG6A 2C14A 2XFFA 3R79A 1BAGA 1XLIA 4JX4A 3KM8A 2Y5JA 2FGBA 1OG6A 4UTWA 3W2KA 1PKYA 4ZR8A 1E6QM 4QG8A 3A23A 4LTSA 4ZGYA 2DDXA 1TCDA 3LS9A 5FF4A 1DTNA 1I1WA 3KTXA 4HU4A 3W1NA 3KOFA 4G56A 3NM3A 1SW3A 5EY5A 5JU6A 3PUEA 5F2GA 1EPXA 4GNJA 3W85A 3H70A 1IEIA 2CKSA 4LVFA 5A6BD 3A47A 1Q4WA 1XM3A 1L0PA 4ZODA 3TYCA 1HP4A 4EP8C 5FAGA 3BUVA 3QR0A 1LBMA 3DI0A 4MG4A 3RCMA 4DJFD 2TAAA 5F2MA 2DW6A 2AOSA 1GHSA 1YDVA 2INEA 5CKSA 2WKGA 1RZMA 3BZGA 2R6OA 2FPVA 1XPYA 2XUCA 4EPKA 2ANUA 1UWSA 3SJ3A 2CBVA 4L1WA 3BSGA 5E70A 1FFQA 1T0OA 3VGFA 3SQSA 2QCDB 2D2GA 4CD4A 2JK2A 3TNOA 3R13A 3SZ8A 3AHTA 1QHOA 1MEIA 1S5NA 3R12A 3A9IA 3STFA 2VZSA 1W1YA 4PBGA 2BGNE 1OADA 1F3WA 4X60A 5MF5A 4UTMA 4QJ5B 1XLDA 2VOTA 4UWMA 1L6GA 1TWWA 1WDDA 1WXZA 5TQLA 1EX5A 4D6JA 4S3GA 3S6DA 1KM5A 1WZKA 2FH6A 4LAOA 2QZRA 3BV7A 4UCGA 4MKNA 3CWNA 4HHHA 1YXDA 3V5FA 4OV9A 2QUTA 4MAVA 5BRBA 2E0PA 4DM1A 3ABSA 1Q4NX 2WC4A 4MFEA 3S2CA 3W71A 3G22A 3TC7A 4KIRA 5AYBA 3B0PA 1W56A 4HOWA 3N9KA 1EP2A 3OLDA 3GVRA 5BU6A 3QR3A 1EOMA 3BSMA 4XAZA 5CBIA 5DBTA 3GW3A 4NY2A 3M47A 9RUBA 3L2IA 3MUIA 1BF6A 1MQPA 1XSIA 3KP1A 3L68A 1BKSA 4N2YA 2YXGA 2WSRA 1OYCA 1XW8A 1LF1A 1B4EA 4V1YA 4U2ZA 2BASA 4CN1A 1CYGA 1PZ1A 3Q2DA 3QTPA 2NX9A 1P7TB 3LCIA 1KM1A 1QW7A 1TJ0A 1QPKA 3OBAA 1JUKA 4GH1A 3UESA 3BLPX 4B92A 3PZTA 1J93A 5GPRA 3QLDA 3L21A 1LP6A 2XIOA 1OFBA 4Q3MA 1ONRA 2WVUA 4N7QA 2Z1WA 1QXLA 2YYUA 4ADSA 4F4RA 1H09A 3BCJA 4PCTA 1UG6A 2A79A 4L6OA 4NILA 2BVTA 5BXTA 2GVYA 2QIWA 4EAMA 3M44A 5I6SA 4I7VA 2XJ7A 1R2SA 1AQFA 3AIBA 3LTYA 4Q8WA 3S9ZA 4JIHA 3FV9A 1H60A 2DSZA 3VCNA 1CB2A 5JBEA 4I5XA 1F3XA 1CPUA 4XTIA 3VIIA 3TN5A 3OP2A 1HT6A 2J9YA 3P3BA 5BRPA 1IE7C 3HPFA 1CGXA 3LHZA 1QPQA 5KZMA 3E9AA 3TROA 1JRCA 4MJZA 3SUTA 2WVSA 3OGSA 3CQKA 3QFWA 4S23A 1JZ7A 4EWND 2JF6A 5AYZA 1OF6A 4PODA 1G01A 3VDBA 1UD8A 4BQ3A 3WQWA 4DIAA 1F05A 3FW6A 2PODA 1GVYA 5TD4A 4MY9A 1KM0A 1SMAA 3D3FA 2CZVA 4MPQA 3MWCA 3W0KA 2E7FA 2QCNA 3N19B 3WQ5A 2MUCA 4DZ5A 4KMQA 4IUOA 3PNZA 3OLEA 3I6TA 3R4IA 1MUCA 1PDZA 4DHGA 3GNPA 1TV2A 4P8WA 4AHPA 2ZZ5A 3URAA 1RA0A 4PMXA 2WXDM 3VAVA 1ZY9A 2YZ5A 1C7TA 1XGEA 2F9RA 2WZEA 4JFVA 4NYUA 3KE0A 1KXQA 1DBTA 1X6LA 4PA8A 3FHQA 2OMAA 1IWBA 3H2NA 4L9YA 2BSLA 3DHUA 1RLDA 3REQB 1VCVA 2Y5EA 3I4KA 3RCYA 4C91A 2RAGA 3PR2A 4JEQA 1GG1A 2J6XA 1GKRA 1MFVA 2I14A 1F73A 2PLMA 3UXAA 3IAQA 2WM0A 4EACA 3NA8A 5C2CA 4CCZA 4AIBA 4R88A 1AW1A 2PTYA 4RNHA 5D9OA 3GFXA 4M8UA 2GWGA 4JTLA 3TYEA 1KGUA 5K7JA 3W82A 5LNRA 4US6A 4P8VA 3WQEA 2VFIA 3WQCA 1WDWA 1S39A 4NP7A 1B3YA 5AFDA 5T8GA 1OX4A 5XIAA 4GVIA 1A53A 1EJXC 3HMCA 1Q6GA 1TPB1 3EWXA 3GBDA 3HGJA 5H1WA 4GCAA 2Y7FA 2ZUUA 1SFLA 2EPNA 2D2OA 4JTEA 1JXJA 2B7NA 1C91A 3NDOA 3QSTA 1DKWA 4Q4RA 2PDPA 2IKHA 5LIYX 1YADA 4L9ZA 3OBEA 1K8YA 1KFEA 3NZ1A 2C79A 2XFYA 1HKIA 5A69A 5HULA 3QTGA 4WXYA 1SJCA 1JUEA 4JTDA 4XIAA 2BGSA 2D23A 4IFKA 3QGKC 3IANA 2FGLA 3TR9A 2X0HA 4ZFCA 4Z2GA 2RDXA 2P8BA 2OYKA 1FH7A 3NZGA 2OGJA 1JZ8A 1GJPA 2FZMA 5LHEA 1QHZA 4QLJA 4RW3A 4GI6A 1D7KA 4P2VA 2VEGA 4HBKA 1D7FA 3MZNA 2J8TA 3ZT5A 1UHVA 3OQEA 3ME3A 2CHRA 4G7EB 1JCTA 1HW6A 3BK0A 1AMYA 2G3MA 2XH2A 1QO5A 5K4XA 1UMLA 3H8AA 5BNKA 3AIQA 4PMYA 4AF0B 3SCVA 2J47A 1AG1O 4LRSA 4FK9A 2PWUA 1WDPA 4WY0B 2PRMA 3UA3A 4OECA 4TMCA 4Q4SA 1CLXA 2YA0A 3W73A 1LORA 2DT1A 4XVDA 1VHCA 3LI1A 3TZNA 2YFNA 4IH3A 4FPSA 1LRNA 1FDJA 3GS6A 1K70A 3N3MA 3C0JA 3UJ2A 3UW6A 4H7CA 1PDYA 5EL1A 1VS1A 3VZYA 1I8JA 3NIYA 3RPDA 1IEWA 3T44A 1AODA 3TQ0A 2E3ZA 5CZKA 3B0VC 3S1WA 1EX1A 5EFFA 3D46A 2ZADA 3PS7A 4D1IA 3E02A 1V3KA 3ABOA 2G0WA 1VJZA 4BJHA 4OBSA 5ABHA 3ITYA 2WSPA 4ZOBA 3B8VA 4IQEA 2HE8A 1W1TA 2GUUA 3IPWA 5C2XA 1X1NA 3W01A 4KWVA 1BXNA 3O3RA 2GJRA 4DUXA 1XYFA 3CGTA 5AHEA 3MMTA 2WHJA 4OJYA 2AQVA 3CHDA 2ABBA 3KTSA 4AWUA 2P88A 3AZRA 1CLKA 4GZJA 4S2CA 3GZ3A 2IKJA 4GY7A 1BXCA 2OPJA 4DI8A 1IGSA 2RUSA 4DXXA 4AZGA 1JYVA 3B97A 1VEOA 1QCWA 2BVDA 4GKTA 2ZQ0A 3GHUA 4PCPA 2R1PA 3CH0A 3CIXA 3QVQA 3T81A 4JL1A 4DX3A 1GOQA 2V5JA 4JFWA 1CIUA 1XR2A 3R89A 5JXQA 1GOMA 2I9EA 1OF8A 4KETA 3FS2A 5I77A 4XAGA 1OWQA 4A8IA 1KFWA 3GK0A 3MBFA 4BKNA 3THAA 4GRSA 5K2ZA 2GJLA 4YTTA 3F7JA 1HQTA 1GK8A 3CLMA 2I17A 4HZ6A 1F3EA 3SCQA 3LTSA 5E0FA 4AIOA 3U2EA 1L6SA 4R5EA 4HMCA 2CERA 3T1GA 2W67A 3W24A 1SZEA 3PZNA 2W66A 1PS9A 3VD9A 1DORA 4M56A 2JGYA 3WF3A 2INFA 4TVUA 1GWJA 4FOUA 1W54A 1FHVA 2PD9A 4M7TA 3VIKA 1QNQA 1TRIA 1UB3A 4K68A 4GIYA 4IG2B 2XN2A 3NQ7A 3ES8A 1GG0A 1KR1A 2ZRUA 3M41A 3HQ1A 3V0UA 2GGJA 1WYIA 3BICA 1W8GA 2NW0A 1TWZA 1P4CA 2ZVRA 2ZOXA 4PUEA 3RLGA 4QJ3B 4QFUA 4F48A 1A4MA 4KGJA 4E3TA 2GVJA 3C8NA 2C19A 3M0LA 1FWJC 2P1FA 3AIVA 4I7WA 1W1VA 3GB6A 1Q6EA 4YCOA 4NZ5A 2HTMA 2A21A 4WUIA 3PULA 1DPMA 3A5VA 3VC5A 5LIWX 2D0HA 4EXBA 1ADDA 4BZYA 3RPTA 4QBXA 2IW0A 3U4FA 2A3CA 3SDOA 5FEZA 3MI6A 2VDHA 4LYKA 1PBGA 1WZLA 3TTYA 3H55A 2DGAA 1JNEA 2PDWA 4MUZA 2XIIA 4IICA 3T8LA 2GDQA 3HGRA 4PRWA 1O68A 3L5LA 3R2GA 1XRVA 3O2LA 5FKYA 5TNVA 3H2OA 1EOKA 3UWWA 1VR6A 4IP4A 2O55A 4HYVA 4JXCA 4LPCA 2QUUA 2WOQA 1J0HA 4UMBA 1SYTA 1ZNNA 2J7EA 2E5BA 3FK4A 3RX4A 1SSGA 1OG0A 4RNFA 1PZ0A 3ZM8A 5A5WA 2ZRXA 2F38A 5DY2A 1CEOA 4IPLA 1Q3NA 2EXOA 1F61A 3ZO9A 3TOYA 1OB0A 3EEZA 1Q2SA 4JYEA 3REQA 7REQB 3CO8A 4WR3A 2NXGA 2QV5A 3N04A 1FWHC 1EO5A 3QC0A 3G1RA 3LM3A 3WLPA 3T2PA 1QRQA 5I5RA 4TX8A 2CLHA 2WCSA 5CZ0A 1W91A 4XD6A 2HBXA 2GPTA 2V81A 4XZLX 2WKJA 3CS2A 3ORWA 5I7GA 4AZ5A 4ICNA 3T09A 1B54A 1OABA 1SFJA 1UD5A 2OO0A 4D6HA 4ICMA 2CXEA 2W6RA 3VIHA 4I9JA 3EWZA 1W9VA 3SY1A 2Q71A 4H41A 3N4AA 4J7RA 3CXOA 4GY1A 3WH7A 4W87A 1P0BA 2NQZA 2VR5A 4CEXC 3ZVHB 1BKHA 1I6NA 3NO1A 2XIBA 4B4FA 4Q4OA 4GE8A 1CXEA 5FF2A 3IK2A 4XUYA 4A8NA 1AK5A 5B7ZA 2Z2BA 1GGOA 3CB3A 2FJUB 1IR1A 1LUCA 4DJFA 3DG3A 4J2PA 2D24A 3LPOA 2P8CA 4XVEA 5CQ1A 4I6KA 3PAJA 1WKDA 2DUZA 2V5KA 4PUJA 1E0XA 4AC1X 1LYXA 2FPYA 4K37A 2F6UA 5BCAA 4L7ZA 1E4IA 2ZTKA 4N02A 1XC6A 3DYPA 1QWGA 3LERA 4GI8A 4Q8OA 4W85A 1IT0A 4MWAE 1VPYA 4M1RA 2QXWA 2ZC8A 3B9DA 1UH3A 3KW3A 3QQ0A 4ORIA 1MW3A 2E09A 3CM4A 2NVAA 4XTDA 5I3FA 1FDYA 1GOKA 3W7MA 3EB2A 4JHZA 5AHFA 1U5VA 2Z1VA 3ZR5A 1NQKA 1NELA 4RL3A 2QF7A 5K3VA 3HPZA 3F1QA 5GNXA 4DAFA 1O94A 2W79A 2YCJA 4G7EA 2F6XA 3WF2A 3WDQA 4C1NB 3OOQA 2FKPA 4NU7A 1GT8A 2QQ6A 4H4IA 2GUBA 1WQ5A 3T0AA 1M7XA 2C8NA 3AUOA 1E1CA 3N29A 4A4AA 3ZT7A 3N6QA 2XH7A 1YX1A 1EWDA 1NFGA 3CC1A 3M0VA 1TJ1A 2QT3A 4WK9A 4ZBCA 4HPHA 3BAJA 3UZXA 3A3XA 3EX4A 3M46A 3TJ4A 3KVMA 3ONCA 4HCLA 5A6SA 2WW5A 2VZOA 5PTDA 3AMLA 6XIAA 1QW8A 3C86A 1R2RA 1YEYA 4JQ2A 2BP1A 4NRSA 4H2HA 1UP3A 3DZ1A 2IPJA 2C7FA 2VGFA 1EXPA 1WAUA 1EJTC 3K1DA 3DEQA 5EMMA 1G4TA 1A5CA 1IXQA 2PF8A 4HOZA 4CD6A 5FJIA 3H2AA 2Z25A 1WP6A 1D9EA 2GZXA 1AVAA 3S1XA 3TN3A 4FX7A 2QCEA 1UOZA 1A3WA 2WYSA 4R9OA 1HVQA 3NOEA 3ES7A 3VPLA 3W6MA 3TONA 4HB7A 1CECA 1BEUA 3PWIA 1YMYA 2MNRA 1E9YB 3P93A 3C0QA 1U5HA 3IJDA