5HNNA

Crystal structure of the endo-beta-1,4-glucanase (xac0030) from xanthomonas axonopodis pv. citri with the triple mutation his174trp, tyr211ala and lys227arg.
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
MLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAWSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDASGTKPVCTSDSVGQERLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title Crystal structure of the endo-beta-1,4-glucanase (Xac0030) from Xanthomonas axonopodis pv. citri with the triple mutation His174Trp, Tyr211Ala and Lys227Arg.
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 128
structure length 315
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5hnnA00
1EDQA 5A95A 5D9MA 1J12A 4QP0A 3EMZA 3T2PA 3ECQA 3A3HA 2WW5A 4MDOA 3O2LA 2YL5A 5EFFA 3M46A 4A4AA 1ZBWA 5A2CA 5ABEA 2X05A 3SUWA 3WEZA 4F9DA 3ZM8A 1QNSA 3POHA 4GKLA 1DWGM 1Y7VA 3W4RA 1JDCA 3W28A 1CENA 2CITA 2PBOA 4MNKA 2O9RA 3WUEA 4Z2KA 1I1XA 1CXFA 4L4PA 5BXTA 3GXMA 1GJUA 3WNKA 3GH4A 4D6DA 3U5YA 2WYSA 2BHYA 5DF0A 4D6CA 5I5RA 3E1F1 4D1IA 3WNOA 4ZXLA 1CWYA 4FK9A 2EQDA 4PTVA 4WKHA 1OT2A 5AC5A 4KGLA 4XUYA 1HKMA 3SCSA 4UNIA 4X9YA 4P8WA 1LJYA 1UWIA 4EKJA 3OGSA 4UFHA 1US2A 1JZ3A 3BSHA 1JZ7A 4GI6A 2CXGA 4FLOA 3TTOA 4PYSA 2OWCA 4LX4A 2ZUUA 1XSIA 2J8GA 2XWEA 4C7DA 1G01A 3A4XA 2YDRA 4MB3A 2E0PA 4QAWA 3WNNA 1M03A 1GOQA 5AY7A 1C8YA 3SCWA 5E09A 5BCAA 5DO8A 1A47A 4UFLA 1JYXA 2XHYA 2VX5A 2WBGA 5EMYA 2XIIA 4PBGA 1IZKA 1UUQA 1C92A 2XUCA 1DP0A 2MANA 2W67A 1GOOA 3AMGA 4UFMA 1W3HA 1BG4A 3SUTA 3WH5A 2VL4A 1GJWA 3AHXA 3L4ZA 5JIPA 1TZ7A 1Q6DA 3AXIA 2A3AA 1BGGA 1JIBA 2Y8VA 3MV01 1JZ2A 3ZO9A 4P8UA 2GDUA 2JF7A 4B16A 4UOZA 1OIMA 4AIOA 5KEZA 4UOQA 4A3YA 1XYFA 3EDJA 9CGTA 1HVQA 4P8XA 1H49A 5I3DA 4D6GA 1R86A 1UQYA 3T08A 1B9ZA 2E8ZA 1MQPA 4PMZA 1L8NA 1WDPA 1HVXA 3MUZ1 3CHFA 2DT3A 2YA2A 4WKAA 1LL6A 4R5EA 2OYMA 1XD0A 1R7OA 2O9PA 4TX8A 1NP2A 1Z32X 4OBRA 5LA0A 2VZVA 4Z2JA 1V6VA 4MNJA 3VD9A 4MB5A 3RMEA 3VD5A 4AZCA 1WZAA 1XD1A 3VM5A 2J8FA 2GJPA 4HMCA 2QV4A 1NWRA 1V6XA 3VD3A 1UR4A 3VIOA 2WSKA 1AQ0A 2J7HA 2XM1A 3N15A 5LYRA 1EQPA 3NJ3A 4ATDA 3L4XA 4MNMA 3AHZA 1GVYA 3DHPA 2QF8A 3TTYA 4J27A 3AXHA 3ARYA 4AWEA 4JFUA 1V3KA 2UY5A 1E43A 3VM7A 3LPOA 2ESCA 2NW0A 3CIVA 1HP5A 1XGZA 3ARQA 2YA0A 4CCEA 3AROA 2OWWA 3W26A 2DPEA 5A6KA 2EPNA 2WMKA 1E5JA 2JEPA 1MW2A 5FD0A 3BAXA 3ARVA 3ZJ8A 1QBAA 2QPUA 1H09A 2PF0A 4PSRA 2C0HA 3W6LA 4OZOA 4DUVA 2V5CA 3ZSSA 1CEOA 1E72M 2VX4A 3RILA 1VJSA 1GOWA 2DDXA 2FGZA 2CERA 4UR9A 1E0WA 2WC4A 1WZMA 2GSJA 4H41A 4NSBA 4W7UA 4F8XA 2VJXA 1JYVA 4AD4A 3MKKA 1K9TA 1FH9A 1BHGA 2JEQA 4ACYA 4CVWA 3VU2A 2J7EA 5I0DA 7A3HA 1FFRA 1SFSA 3MMUA 4QCEA 2XYLA 3OLDA 1K9EA 1UD3A 1VBUA 3IAQA 4W88A 1H41A 4OOZA 3SURA 2IUZA 2YL9A 1E6QM 4LGXA 3GM8A 5D9NA 1HP4A 5A1AA 4MADA 3L4VA 1V3HA 3WDHA 1XHGA 1Q6GA 1VIWA 3VNZA 4JZ5A 5I2UA 1UH4A 4XZBA 3WMBA 1CXEA 2WLZA 1E3ZA 2J79A 3DYMA 3QOKA 4MTVA 3SCPA 4GQQA 1V3JA 2DT0A 2IXVA 1QHZA 1J0YA 2X8RA 2XFRA 3ALFA 3ARRA 3QOMA 1X1NA 3OZOA 1HJVA 3BLKA 1ITCA 3GNOA 1QW9A 3N11A 4AZCB 4UFKA 1ZBCA 1M53A 1K9DA 5I6SA 1ZL1A 3KL5A 1JAEA 4PMOA 4TTUA 2V3GA 2D22A 1AQHA 2VCCA 3OLEA 3HJEA 1NWSA 3L2MA 3UCQA 3WDIA 4M29A 3DYOA 1W9VA 4U3AA 3PTQA 3WQWA 2CKRA 2BVDA 3L2LA 3VVGA 2YL8A 3L4WA 1V02E 4M82A 3NCOA 2WMIA 2DH3A 2DIJA 2JFEX 2WAGA 2NT1A 3N9KA 2WKGA 4AY1A 1UKPA 4HA4A 4HOWA 4CU8A 3DC0A 4KMQA 2VT0A 3SUSA 3BAKA 3WDRA 1W3JA 3ARXA 3PZQA 1D2KA 3GXIA 3A4AA 4IISA 1D3CA 4PUEA 3VDBA 2X2YA 2PI6A 2CESA 3B9DA 4PMYA 3AS3A 1KXQA 5A94A 5HPCA 1DEDA 1K6AA 4PMDA 1UG6A 1HN1A 2WXDM 3CZLA 4PUDA 4C7GA 4E4PA 1YQ2A 2ZWYA 1JZ5A 2WHMA 4PCTA 2WPGA 5JBEA 4GPNA 1OINA 3WMCA 4HU8A 3ARTA 3VINA 2YJQA 5HXMA 1G9HA 4DWSC 1ZS2A 1ISWA 2IXUA 2BVYA 4W85A 3ARSA 4GZIA 1TUXA 1NOWA 3W27A 1JNEA 4BQ4A 1KBKA 3WH6A 1AVAA 2Y8KA 1ESWA 4JFTA 2WANA 3WEOA 7CGTA 3VIKA 1O6IA 3VOCA 5A69A 3GTNA 1XRVA 3AZRA 1C91A 2J74A 5GQBA 4DWSA 3QHMA 2ZWZA 4E2OA 4HMDA 3PBGA 2WCAA 5TD4A 1BFNA 2WCSA 1QPKA 3KL0A 4HA1A 4AXNA 3CUFA 1NWUA 1GORA 4PSPA 3K8MA 5A6BA 4CGTA 5BXPA 1W1YA 1B31A 4AIUA 4N0RA 1PX3A 3I3EA 1RP9A 3DYPA 7TAAA 3EYPA 1ODUA 2UY4A 2J47A 3NSXA 4HMEA 2J7DA 4AD3A 4NI3A 2ZUTA 4LYRA 3ARZA 2CBUA 2JF6A 4URIA 5JIWA 1V0NA 4P8VA 3ZQ9A 3CH9A 5E0CA 1BAGA 1B90A 3A47A 3IAPA 2G3NA 3EBVA 1FH8A 2RGLA 3ALGA 1V0LA 2JIWA 3WNMA 1CPUA 4U5KA 1OIFA 3HN3A 1W2PA 2G4FA 4ATWA 3FHAA 3G6MA 5IHSA 3AMCA 3T0DA 2V5DA 3UG4A 3VD4A 1N82A 1U30A 2VC9A 3KEHA 2EBNA 2WMIB 2ZUWA 1GUVA 1UZ1A 3EDEA 3GBDA 1GQLA 1OD8A 4W5ZA 3BLPX 2BVTA 2WKLA 4W89A 5CSYA 5IDIA 4Q7NA 1E15A 2NSXA 1GQJA 5GNXA 1OM0A 1W2VA 2XSBA 2WMGA 4CKQA 1JXKA 1W9BM 4J3UA 2YKKA 4CN6A 2WLYA 1UWSA 1XSJA 5D8ZA 4B9YA 1KGUA 2J62A 4JFVA 1UZ4A 1JFHA 2ZE0A 1J0IA 4BZYA 1E56A 4AYSA 2W5FA 3SCUA 2A3HA 1DHKA 3F5LA 4HOZA 2E9LA 1KXHA 1PIFA 3W53A 1VFMA 4QCFA 5KZ6A 4W8LA 4JFWA 2EPOA 3F4VA 1HIZA 4V2XA 2V3FA 2ZUNA 4H7VA 5EBAA 5ABFA 5AYIA 3A4WA 4P7NA 5CG0A 4PTWA 4RL3A 1WP6A 4ML4A 1BYBA 1BYDA 1V0KA 4NF7A 2CCRA 1PAMA 4DWSB 4MJ2A 1F4AA 4EAMA 1V6UA 2J7CA 3VGGA 1C93A 2OSWA 4MNLA 3WSUA 4DM2A 2VO5A 5M3WA 1JDAA 2G3IA 4D6HA 4PRWA 1VB9A 1WE5A 5GPRA 4TX6A 1DWFM 2CBJA 2VVNA 5CQ1A 1J18A 1PX8A 2VRKA 2W61A 4KGJA 1V02A 1CXKA 3MO4A 1WZKA 3VDCA 4H8VA 1JXJA 2XTKA 3N1AA 1UA3A 5BRQA 2BHUA 2V38A 5FCZA 5E9AA 1KGWA 3WBAA 1KWGA 4WJXA 2J7BA 5BROA 2VR5A 2WC7A 1WNOA 2D20A 1CGYA 5CGTA 3AHYA 3VMNA 1HX0A 1WCGA 5A8QA 1JI1A 1Q6CA 3OZPA 1NARA 4AZBA 5D4YA 1R7AA 2ZXBA 1JG9A 1UR1A 1E6ZA 2JE8A 3WUFA 1CYGA 1E6SM 1I75A 3AIBA 4X0NA 1E55A 5CPTA 1KR0A 4YHEA 3WQVA 4GO8A 3UG5A 3F5KA 3SCTA 2E9BA 2YDQA 8A3HA 3S6TA 5E0FA 2FHFA 2D0FA 3WFLA 4GZJA 3OBAA 4OIFA 1HXJA 4BF7A 2RGMA 3SUUA 5JBDA 5BXRA 4HOXA 1EOKA 1XC6A 3AS1A 3TTSA 3ZJ6A 3BMVA 3K4AA 3T2OA 2BY0A 2ZUVA 2BY2A 5BXSA 3LPPA 1CGXA 1EO7A 5CPSA 2VRQA 3CHEA 3VGEA 2E40A 2OWXA 3FHQA 5HPOA 1FA2A 1UHVA 2E8YA 4KH2A 4BA0A 1UR9A 1MW1A 3FNDA 4BCEA 4ACZA 3OA5A 4Y7EA 3AXXA 4AMCA 5ABFB 3NUKA 1BYAA 2VURA 1V08A 3BAIA 1GCYA 2J7FA 1Q6FA 3PZOA 3AIQA 3FN9A 4X0VA 1JI2A 1HT6A 4D72A 3AS0A 4XV0A 1CBGA 4M1RA 5I23A 4Z2GA 4AZ5A 1J0JA 2BY1A 3WF3A 4TVCA 4DM1A 2VCAA 1VFFA 3CMJA 3G6LA 1NWTA 2FH8A 2OYKA 1MWOA 1QNRA 1WAWA 1ZJAA 3CHDA 3N17A 3WF1A 2CIPA 4WLCA 1C7SA 5EB8A 4JAWA 4U2YA 1BG9A 3WMSA 1KXTA 4RE3A 3WENA 1QI5A 1R87A 3I3BA 1TCMA 4HTYA 1UKTA 1QNOA 4U2ZA 2J75A 5HNNA 4BS0A 1Q4NX 1B3VA 3WQ8A 3WEMA 2BXYA 4UQEA 4UZUA 3VGHA 1MQRA 4CD8A 3T09A 3AJ7A 1KQZA 3CBWA 3CZEA 2QHAA 4JL2A 4IPLA 4PMNA 4F79A 1OD0A 1OGBA 3VIHA 2WM0A 5I79A 3N12A 1B2YA 4CU6A 4GIAA 5A2BA 4Q22A 3GDBA 1QHPA 1MFVA 1RH9A 3UR8A 1UQZA 3BMWA 4ZE4A 1E5NA 3MMDA 3VDHA 3VDAA 1EOMA 4MJ4A 2WSPA 3WD3A 3SUVA 1B30A 2E4TA 2ZICA 1R85A 1GOKA 4GINA 3EDFA 2FGLA 3VTRA 1X6NA 2VTFA 3BGAA 3AQUA 3L4YA 5DEZA 2XG9A 4RE4A 2WNWA 1JZ8A 1PZ2A 1JDDA 2XJ7A 4UQCA 4OBSA 3UERA 4K68A 4H8UA 4B15A 1BLIA 1JFXA 1E4IA 2E3ZA 3ARUA 5A8OA 4LQ1A 4D1JA 4CU7A 1NOUA 2VI0A 3AIUA 4W7VA 4EANA 4W86A 4D6FA 1HKKA 3AOFA 4PTMA 3AS2A 2AAAA 3VNYA 2VZUA 1B3ZA 1E4NA 4WIWA 4CD7A 4ACZB 2X1IA 4AZ6A 1EDGA 4D6IA 1KFWA 2YLLA 3N13A 4IPNB 4ZE5A 2W92A 1LL4A 4OKDA 1EHNA 1PEZA 5DFAA 3EDKA 2VQUA 2CHOA 2PWFA 2J78A 2BY3A 3M6DA 4J28A 4E8CA 1TE1A 3RIKA 3VPLA 4U3CA 1AMYA 3T2QA 1TVPA 1CGWA 3AI0A 2AMGA 1US3A 3O9NA 3NSNA 4W93A 1J0HA 1E9LA 1W32A 1PX4A 3EMCA 4TOQA 4XZWA 1CXHA 3L4UA 1ZBKA 3PZTA 2CNCA 4CVUA 2E9MA 3BH4A 2WZIA 4J3SA 2D0HA 2VMFA 3IJ9A 4IUGA 1ITXA 1MXGA 1PJ9A 3GH5A 2DSKA 2Y24A 2YL6A 4CN1A 2ZUMA 2V3DA 4WK9A 1GOIA 4F66A 3IJ8A 4AZGA 4TUFA 1LF1A 4HPHA 2CHNA 3AIWA 1BVZA 3F5JA 8CGTA 3IK2A 1VFOA 3K4DA 5A3HA 4AD2A 2JIEA 3W82A 1KWKA 1GONA 3A6OA 2ZOXA 5JBFA 2CETA 1B1YA 1UWRA 1E6XM 3TOPA 1G94A 1UYQA 2WVVA 3CUGA 3GXFA 3U7BA 2VZSA 5A8PA 1ISZA 1O7AA 2W62A 3VMPA 3KZSA 1G5AA 1KQYA 1LQ0A 5E6ZA 4FLRA 4P7RA 2A3EA 5A6JA 3AHVA 4IM4A 4P7QA 3SCQA 2WMFA 1HJXA 5DMYA 3WF2A 3QGVA 1GOMA 3WNPA 4UZSA 2XVNA 1J10A 1E1FA 3MV11 1UH3A 3FW6A 4PMRA 3ZSTA 2ZIDA 2XM2A 4CN4A 2D3NA 1KCKA 1H1NA 1WZLA 6TAAA 1C8QA 5CPQA 3VIIA 1V3LA 4JKKA 1EO5A 1W9DM 3ZR5A 2FDMA 2J4GA 5E70A 3CPUA 3ZT5A 4W8BA 2CPUA 3VX0A 3UESA 1V6WA 1UD5A 2OSYA 2D2OA 3SIMA 1CTNA 3ZJKA 3WL0A 2GVYA 3GBEA 1HF6A 5IXEA 4AIEA 1KGXA 3CGTA 3WQ4A 2XGIA 1KR1A 4P7OA 1JD7A 3MUIA 3UR7A 2PWDA 6A3HA 1V3MA 4PMVA 4QLLA 3PZUA 1MQQA 1E6PA 2CKSA 3RM4A 2O9OA 1J9YA 2YDSA 3AYSA 3N18A 5A6LA 2GJRA 3WF4A 2WWCA 1E71M 1UWQA 1E4LA 3PTKA 4WKFA 1FH7A 1UWTA 5A6SA 3HMCA 2Z1SA 1TA3A 1JNDA 5HOSA 2D1ZA 3FAXA 5HDRA 3RDKA 1VEOA 2JALA 3BAWA 3MANA 3TONA 3JUGA 4CD4A 4AC1X 2YBTA 3GNPA 3WDQA 2O92A 3U5UA 3T0AA 1M7XA 4M81A 1W9XA 3MUAA 1L0PA 4HZ8A 4D6EA 1GQIA 1TMQA 1JF5A 4XX6A 1U33A 2XVGA 4HZ7A 1VBRA 1QI2A 4C7FA 3GNRA 4Z2HA 1E0XA 1VEPA 2DT1A 2DT2A 2D3LA 4H2CA 3W29A 2WVVB 2XWDA 4J3XA 1CIUA 2D23A 1FOBA 1UD4A 3CMGA 1P6WA 5D9OA 5I77A 4B3KA 4GI9A 1Q6EA 1ISYA 1VF8A 2O9TA 4UOJA 1QOXA 2PB1A 3VILA 1J0ZA 3VGFA 5JUVA 1XCXA 1NP0A 4AEEA 3WIJA 2AOSA 4AD0A 3RM9A 3K46A 1V6YA 2WCGA 3PZ9A 4MDPA 4UQ9A 1HL9A 1EH9A 2C8NA 4R27A 2A3BA 1EGZA 1QI0A 1V0MA 1WDSA 1QI4A 3CTTA 1QNQA 1QBBA 2B31A 4Z2LA 4GO9A 1CLVA 2WZEA 2VVSA 1HJUA 5D9PA 1QI3A 3VIGA 2VR4A 1B0IA 4E8DA 2Y4SA 3MSGA 4MB1A 2A3CA 3PZVA 3NDYA 1LWJA 2GK1A 3LMYA 3CUJA 1DWIM 4EK7A 1HJWA 5IFTA 1OWQA 1E0VA 4ATLA 3AFBA 4AZHA 2DSWA 2F2HA 5DT5A 1BPLB 4AISA 1IT0A 1SR0A 5FKYA 5C71A 4FLSA 2PBGA 2OYLA 3ZMRA 5ECUA 3WBEA 5F7UA 2OLHA 3WD0A 4UTFA 1TR1A 1W3KA 3MMWA 5A6MA 2VX7A 4LXFA 4CCCA 1VJZA 4ZEPA 2EPMX 1C90A 3PTMA 3ZJ7A 5C8BB 2ZX7A 4L4OA 1BF2A 1X6LA 4J7RA 5BYWA 4ZENA 2XFFA 3WD1A 5A8MA 5AYBA 3RJXA 4AZ7A 4JCMA 2Z1KA 1JZ6A 4TTGA 1JYWA 1GVIA 1SYTA 3B8SA 1H11A 1TA3B 1BVNP 1RP8A 3OLIA 1GPFA 1UKSA 1WPCA 5D8WA 2DQXA 4MB4A 4KRTA 1W1VA 3WQ6A 2CYGA 3AICA 3EMQA 4TVDA 4AW7A 3S2CA 3CZKA 3GYCA 1ECEA 2OSXA 2VZTA 4U31A 2ZX8A 1EXPA 1TFVA 3KE0A 3AZSA 1EQCA 3CUHA 3M7SA 4H8HA 3UETA 1DTUA 1E40A 3BAJA 3K8KA 3AIRA 1HJQA 2FHBA 3O6AA 1HKIA 3WUBA 3WY1A 2YOCA 3AMDA 5GNYA 1XV8A 1NQ6A 2XVLA 1PPIA 4YHGA 3VX1A 1KBBA 3M07A 4UFIA 1U2YA 4UQDA 2VNCA 3D3AA 1C3FA 1H0IA 2ZXDA 5M5DA 3FXYA 2ZX9A 4EE9A 2PC8A 3RJYA 1KXVA 2BS9A 3NDZA 2DSZA 3PZGA 4DUXA 3WUGA 1UKQA 4GZEA 1E6RA 2WC3A 3CUIA 4NZCA 5E6YA 4LYPA 3N04A 4M8UA 3U7VA 2ZXAA 1H0GA 1UOKA 4M80A 4P7LA 1DWJM 1XH0A 5M03A 5FOOA 1JZ4A 4MPKA 5FL1A 2GK1B 2X09A 3WD4A 1FHLA 2G8ZA 4JKLA 1RPKA 2F61A 3WL1A 1VRXA 2G3MA 3VO0A 1XSKA 4PN2A 5C70A 1CGUA 3AIEA 1SMAA 5A2AA 1E4MM 5BWFA 3AMKA 4W8AA 2VRJA 1BQCA 2EPLX 3VUPA 5A6AA 1EIBA 3W38A 2CBIA 4PMXA 1E73M 1H4PA 1H5VA 1B3YA 3DHUA 5FL0A 1VEMA 5FIPA 2ZUSA 1R8LA 1CECA 2WWDA 1GZJA 5LA2A 4CUCA 1C8XA 4Z2IA 1EHAA 3ARWA 3DECA 4OJYA 1J01A 2GDVA 4OUEA 2DSVA 1UA7A 4AEFA 3TTQA 4AZIA 3NIYA 1W9UA 1W9PA 1E3XA 5BRPA 3WFZA 1XH2A 1IV8A 3VGDA 1K9FA 1W91A 1VENA 3WH8A 1EDTA 2GJXA 3IANA 4OOUA 3WDJA 3BXWA 3VIPA 1CGTA 4J3WA 3WELA 1V3IA 3KWXA 4W7WA 3MS8A 3RPMA 3WD2A 2XFYA 3U57A 1GNXA 3OGRA 1FP8A 1UD8A 2V3EA 3BAYA 4HPGA 1J0KA 4CCDA 5M17A 4M24A 3W25A 4NRSA 3AZTA 3CZJA 4U33A 4JKMA 4MAVA 3OIHA 4W87A 4RE2A 3ZT7A 1JGIA 2VUYA 3ZR6A 4WSKA 4FLQA 2QMJA 2Y2WA 2YA1A 4JIEA 1D7FA 2DH2A 1FP9A 2EJ1A 2WHKA 4WSJA 4F9JA 4JHZA 3MUY1 2WVSA 1CDGA 3CZ8A 2WVTA 3GZAA 4BQ2A 3WH7A 4A3HA 1MW3A 1E70M 1F4HA 1LG1A 1G1YA 1WB0A 4PMUA 3WQ5A 4J3TA 1B3XA 3RM8A 2BHZA 3WF0A 3II1A 2Y5EA 4B3LA 2DSUA 4N42A 1UD6A 3SCNA 4NRRA 1CZ1A 3AISA 2BXZA 4W84A 1CXIA 4GI8A 4TXEA 1NH6A 3FAWA 2XPKA 1M04A 4B9ZA 1E6NA 4MAZA 4PEEA 1ZB5A 1BTCA 4YPJA 2HISA 3QHOA 1CXLA 1OCQA 1CNVA 1S46A 5CLTA 3VKKA 1UWUA 2X0HA 5HBFA 2UY3A 3LPFA 3IJ7A 3BCDA 3PZIA 1LLOA 2GUYA 2D0GA 1MW0A 4BQ5A 2ZX5A 2UY2A 2XSAA 3APGA 3ZT6A 3SEPA 1RD6A 1WKYA 2TAAA 3WH9A 2XVPA 2YIHA 4ZXOA 3PN8A 1WDQA 1SMDA 4JCLA 1KB3A 1GW1A 3SCVA 4ZFMA 1MFUA 2XIBA 3W81A 1UR8A 3ARPA 1ZBVA 2PWHA 3THDA 3WDPP 1ZJBA 1BYCA 4UQBA 1OT1A 3MSDA 2WB5A 3CO4A 4QFUA 2WBKA 1TVNA 3B9EA 3POCA 1VAHA 1PIGA 2C7FA 1AQMA 2DGAA 1DWAM 2GJXB 5DT7A 2UWFA 4M56A 1QW8A 2WHJA 3UG3A 1CGVA 2YLAA 4DWSD 1CLXA 1WO2A 3TP4A 3SCOA 1G0CA 1OB0A 1OSEA 1V03A 2CEQA 3PZNA 1GHSA 5A6BD 1MVYA 3CZGA 2W4XA 2F8QA 2J7GA 2VZOA 1ZU8A 3KL3A 4HP5A 3W6MA 3AIVA 3VIMA 2WMJA 2G3JA 3K1DA 2QMKA 3UEQA 2PWGA 2WK2A 1C7TA 4H04A 3NYDA 4GQRA 3VIJA 1PZ3A 4KRUA 1HL8A 3CLWA 3WKZA 4D71A 2WZHA 2EO7A 5EFDA 1IZJA 2G41A 4HU0A 4DUWA 1HJSA 2ZX6A 3MU7A 3BSGA 4PTXA 1W1TA 3VD7A 4BQ3A 1JL8A 3PHAA 2QLYA 3WN6A 5GNZA 1OGGA 3EDDA 1JAKA 4FMVA 2J77A 1FHDA 2NT0A 4HZ6A 4D6JA 1LWHA 3RCNA 2HVMA 4W5UA 3T0BA 2EEXA 1UR0A 4S3KA 4UQAA 4JL1A 2XGBA 1EA9C 1XH1A 3GXDA 2QPSA 1W1PA 4YN5A 4XB3A 3AYRA 1MXDA 1WDRA 4GXPA 3QR3A 3ZOAA 4QLKA 1H3GA 3VGBA 1JD9A 3AHTA 1UD2A 4FF5A 3HU7A 2VOTA 2FH6A 2J25A 1M01A 1BGAA 3K8LA 3THCA 4V28A 3LPGA 3CHCA 1JYNA 4HA3A 2EPKX 2BV9A 3VMOA 3BC9A 5I78A 1MYRA 2ZXQA 1I1WA 5I24A 2WMHA 3VIFA 2DEPA 4J3VA 4JFSA 1GHRA 4AD5A 5ABHA 5CZKA 4QDMA 2WVUA 4KWUA 2CBVA 1NM9A 4JHOA 3W0KA 4V27A 1H2JA 3OLGA 1HNYA 3WNLA 5A8NA 3ZIZA 1ODZA 1KCLA 1J11A 5CSUA 5CJ5A 3NSMA 4S3JA 1QNPA 1UR2A 1GQKA 1LG2A 3W24A 3SCRA 2XVKA 1QVBA 5IHRA 1OBAA 5AC4A 1UH2A 3GH7A 3AMLA 2EXOA 2FHCA 2D24A 4PMQA 3OG2A 2VQTA 5IFPA 4AD1A 2YBUA 4WF7A 1VFUA 2VX6A 3D5HA 4LPCA 4CD6A 1JF6A 1NOFA 2Q8XA 3OGVA 2W66A 1A3HA 1BSIA 1OGSA 1PBGA 4TVUA 1B3WA 1LL7A 2W63A 1W3LA 4PCSA 4U5IA 1UKOA 5CXPA 5LA1A 2VCBA 3PZMA 3BCFA 2WHLA 4CD5A 3OB8A 3W37A 2GFTA 4UFJA 5CGMA 1YHTA 1QHOA 5CLWA 3RO8A 3FY1A 5ABGA 3J7HA 4UCFA 2W91A 3L4TA 4LYQA 1ISVA 2BNJA 1E1EA 1FFQA 3TA9A 1ISXA 2PWEA 2BFGA 1HKJA 3I3DA 6CGTA 4QLJA 3B9AA 1XYZA 2DIEA 1TG7A 1XCWA 2X0YA 1DWHM 3QHNA
chains in the Genus database with same CATH superfamily
3DOPA 5A95A 4C6QA 3TNBA 3T2PA 2EAWA 3O1NA 3M46A 4I3GA 4XO6A 5A2CA 5ABEA 3ZM8A 5DCEA 5H91A 1Y7VA 4ZQPA 1JDCA 4IIBA 2CITA 2PBOA 1QR7A 4JY8A 4C6NA 4JIQA 1S2WA 3GXMA 4NYUA 5C9UA 5DF0A 1VQTA 3UJSA 4ZXLA 4FK9A 3LLFA 3U8GA 4L65A 1THFD 1HKMA 4PTDA 4P8WA 1F76A 1UWIA 4LCQA 4EKJA 1FWRA 5DMNA 3LYEA 4UFHA 1US2A 5FF7A 2O56A 1L6SA 3BSHA 1YTDA 1JZ7A 1WXYA 3UR2A 3B97A 3PY2A 2VKZG 3DX5A 4AIBA 5FEWA 4JTRA 4PYSA 2YCJA 2ZUUA 5JVLA 3H4XA 3ITCA 5EYWA 3A4XA 4MB3A 2OKTA 3N6JA 3WNNA 6PTDA 4WDUA 5E09A 3R89A 5BCAA 2DZPA 3EEGA 4UFLA 5EMYA 2Z6IA 4PL2A 3CTLA 3EAUA 2OO6A 3KUMA 2XIIA 2I17A 1IZKA 1UUQA 5IBXC 2P3ZA 1XG4A 4LUYA 3AMGA 4NXKA 4JEJA 3IJDA 4IMAA 1BG4A 3NGJA 1WAUA 3WH5A 3K13A 5JIPA 1GJWA 1TZ7A 3C3NA 2A3AA 5HQEA 2GDUA 3JRKA 3IJIA 4M7SA 3AJXA 4DBWA 1DKWA 2TRSA 4EXAA 4QQUA 1H49A 4Q8VA 4GUHA 1XP3A 4IX0A 5I3DA 4D6GA 4J35A 1UQYA 2E6AA 4W9TA 1AFSA 5C9XA 2E8ZA 1MQPA 3QBUA 3LERA 1UC5A 2P3EA 1JPHA 3MUZ1 3S4TA 4R5EA 3L0KA 5D32A 2DZTA 3W6YA 2GWNA 4B4FA 4O1EA 1XD0A 3T8LA 2V2HA 3N2TA 4QDPA 3G0UA 1YTKA 1E9ZB 1ZFJA 3PSVA 4DI8A 4I8DA 4Z2JA 4LAOA 4MNJA 3VD9A 3ES7A 2G5WA 1Q7QA 3SDOA 2ISFA 2QJJA 1XD1A 3VM5A 2QCNA 4Q32A 3T9PA 1UPPA 3DFTA 2QV4A 1UR4A 3VIOA 1T6MA 1WX0A 1AQ0A 2J7HA 5U7SA 3P5ZA 3MA8A 1EQPA 1CI1A 3AHZA 3DHPA 3S2MA 1YX1A 4J27A 3ARYA 1DIEA 1V3KA 3O0FA 1E43A 1KFCA 3VM7A 3QZ6A 2ESCA 2NW0A 3CIVA 1WYIA 4KCTA 1R3YA 3AROA 2OWWA 5A6KA 1V77A 2WMKA 3MY9A 2JKEA 3UPMA 2QW5A 2VGBA 3NPWA 2QUNA 3M43A 1DJNA 1H7RA 4WVXA 1NJJA 3I6TA 4LY8A 2NLYA 3RLVA 4OZOA 2V5CA 1U1HA 1RK6A 5D2TA 3LLDA 2FZ9A 3U2OA 3RILA 2DDXA 4UR9A 1OCNA 3OVRA 5AFDA 1OFDA 4H41A 3C2YA 3CM4A 4F8XA 4N6EA 5D2WA 4Z1YA 3O6YX 1AW2A 1PKMA 4CVWA 5I0DA 7A3HA 5AHFA 3W2NA 2PDNA 3V3WA 2PU0A 2YPIA 4GX8A 4K6AA 4UWMA 3ME3A 2YYUA 5F1VA 4LGXA 5HWNA 1T40A 4KW2A 1Q6GA 3RRXA 3TCEA 1CXEA 5L6UA 3W00A 2WLZA 4YXGA 3E2VA 3GSMA 1W1A1 4Q8TA 5C9WA 3SCPA 3GU9A 4GQQA 4WX2A 4DF2A 2DT0A 3OZOA 3VFCA 2HBVA 3AC0A 4JYDA 4UFKA 3UW6A 3LSCA 1FCUA 1ZNNA 1ZL1A 3KL5A 1JAEA 1AQHA 5CSSA 1G4SA 1EGMA 3L2MA 5RUBA 2FDSA 1F6PA 2BVDA 4ZOCA 2F9RA 5HMFA 4HNVA 4ECLA 3L4WA 1V02E 4M82A 3NCOA 3PPGA 2JFEX 2WKGA 2ZZ2A 3NPUA 4HA4A 4HOWA 4CU8A 3PUGA 3OZYA 2QJGA 1PTDA 3S6OA 2O4MA 3A4AA 1K4GA 1D3CA 4IISA 4RV3A 3B9DA 2PI6A 4PMYA 1EP2A 3QY8A 5JMUA 1M65A 4POCA 1Z44A 1M68A 3TYAA 1OEPA 3LDVA 3M5VA 3I6EA 1DEDA 3STFA 3PUDA 4PMJA 4C60A 4PMDA 3M47A 4RE0A 1PHWA 3WJSA 4IL0A 3P80A 4C7GA 2ZWYA 2WHMA 1OINA 3WMCA 3KDNA 2PDHA 5D37A 4HU8A 4LUJA 3ARTA 4HSOA 4QSHA 1GG1A 3VINA 5LXEA 3WYZA 3M0XA 3ARSA 3DH7A 1F3WA 3O8AA 1EPXA 4YWSA 5J5DA 1T5AA 5AHNA 3EX1A 4C6MA 4A05A 4JFTA 1P43A 3WK0A 3BLLA 3VOCA 3TWBA 2GVEA 5LKYA 1T8XA 4QM1A 5GQBA 1FQ0A 5HUOA 5G1TA 5KZEA 4ZO6A 4DWSA 2FZDA 2ZWZA 4KEMA 2NQ9A 1A50A 5BOOA 2WCSA 2I1OA 4EPKA 2X1TA 2ADAA 3CUFA 3QRHA 4PSPA 1K77A 3K8MA 5A6BA 3S0CA 4CGTA 1W1YA 4KWOA 4GG9A 1TYGA 2GPTA 3TWAA 3H2AA 4I5RA 1Q13A 1I9CB 3OJGA 4HYRA 4JTSA 3WX7A 4AD3A 1S2CA 2ZUTA 1TPC1 4LYRA 4URIA 5JIWA 4P8VA 3L68A 3ZQ9A 3G3DA 1B90A 3A47A 1PXGA 4R7JA 1FKWA 3TU9A 1FH8A 3ALGA 1XBZA 1D7KA 3A23A 1UBSA 4FA3A 2G4FA 3FHAA 1R38A 3W01A 3VD4A 1N82A 1U30A 2ZUWA 5AVNA 2BVTA 1IHIA 3R1ZA 5IDIA 3HPAA 1E15A 2NSXA 4L80A 1QOPA 2IPFA 3L23A 4Q7BA 2WMGA 3B8WA 4CKQA 2B81A 3VXGA 1LRNA 1S2VA 1ZCCA 5HWMA 1UWSA 1S39A 3M41A 3XIMA 1KGUA 1EYWA 1UZ4A 4IMEA 1NTHA 2ZE0A 2FB2A 3TK7A 5BZAA 1XLAA 3FVDA 3QPZA 4AYSA 3VOFA 1BD0A 2W5FA 4FHAA 2A3HA 2IPWA 1SM9A 4RNHA 2E9LA 3W53A 1VFMA 4JIPA 3HGOA 1VPYA 5KZ6A 2YXOA 4JYFA 4JFWA 3RAOA 3F4VA 3QTGA 1HIZA 4V2XA 3LHZA 2ZUNA 4H7VA 5EBAA 4LAUA 1IF2A 3NNTA 4Q8NA 4NZ5A 5E1QA 3OPSA 1YDVA 5CG0A 3RPTA 4TIMA 4RL3A 5DCDA 1WP6A 4ML4A 1KM0A 1OC6A 1BYDA 1FY6A 3IRDA 3TH6A 3MI2A 4DWSB 4JTJA 1F4AA 4MJ2A 1V6UA 2J7CA 1KV5A 2J27A 4MNLA 3WSUA 3WLRA 3PR2A 2VO5A 1GOXA 3MJYA 1GW9A 1JDAA 3HG2A 1FWHC 1PX8A 3MW7A 4KGJA 3H2OA 1CXKA 2W0UA 3VDCA 1JCJA 4NZ3A 5BMXA 2V0TA 2G50A 3N1AA 3NQAA 3TQKA 4GGHA 3HV9A 2PDXA 3U48A 1NF0A 4ZO7A 2HTMA 3QY6A 2DORA 3P93A 4K3ZA 1DJQA 1F6YA 4LC8A 1P1XA 4L4MA 1CGYA 6ENLA 3AHYA 1KCZA 3VMNA 3KX6A 1R9YA 4UTWA 1NARA 1V5XA 5FJJA 4XWUA 2A4AA 2PSNA 4R34A 4EXBA 1E6ZA 1LRQA 3N9SA 2ZE3A 1I75A 1X1ZA 3LXBA 3M5YA 1KR0A 4YHEA 3RU8X 2Z25A 3WQVA 4GO8A 2VEPA 3SCTA 2E9BA 4FIQA 1B5TA 3S8HA 1OK4A 3BCJA 3VUSA 2C79A 2D0FA 3WFLA 3LTSA 2W79A 4OIFA 3P14A 4S1FA 4L56A 2RGMA 2CZ5A 4EPDC 3CASA 2VYOA 5LHEA 3CYVA 3AS1A 5FACA 2ZUVA 4JQ3A 3C5QA 4LFYA 3S42A 1VBGA 1EO7A 1UHVA 5A5WA 4BA0A 1UR9A 5ECVA 1MW1A 2Y5JA 3HZ3A 3A13A 3OA5A 3M5XA 4BKNA 4XG1A 1ZAHA 2VURA 2PDKA 1AW5A 4DBDA 1JI2A 3AS0A 2QT3A 1ELSA 5L9FA 4AZ5A 4AF0A 4TVCA 2VCAA 4REQA 5AC8A 3G6LA 2OYKA 3NR0A 4C6KA 2POTA 3WF1A 4WLCA 3UP8A 5AC6A 3EPNA 3GU2A 4WDWA 3E0VA 1BG9A 5DRCA 3AXMA 2EG7A 3N25A 3GR8A 1X1OA 3CUXA 4IWWA 5HNNA 3MPGA 4XZMX 1UJPA 1ENUA 1H62A 3TQPA 2BXYA 1LZOA 3T09A 1HZYA 3W07A 3WLTA 4I5XA 3CZEA 4JX6A 4XBJA 4JL2A 1TWZA 5FF2A 3CV1A 2XIJA 4GI4A 2WM0A 4JTGA 3N12A 5I79A 1IE7C 2QULA 3HOJA 3DG6A 5A2BA 1H1YA 1TREA 3GDBA 1W3NA 1VLIA 1KFEA 1OX4B 2HMCA 1RH9A 2OGYA 3CPRA 3UR8A 4O18A 3VE7A 2OT0A 2VHLA 3TYDA 3VDAA 5BU6A 3A64A 3V1HA 1SSGA 1HFBA 2A5HA 4MJ4A 1XBVA 4JEQA 1OCJA 5BMWA 4RDZA 1NFPA 4IZGA 1XIGA 5F4XA 2OZ0A 1KCXA 3EDFA 3WCZA 3BGAA 1YXCA 1EKOA 1JZ8A 2G0WA 3W7LA 3GUWA 3FOKA 3IEBA 3P61A 2OEJA 4K68A 1WXZA 4JTTA 5CC5A 3GIYA 5CGQA 1OF6A 2E3ZA 4A2SA 1SW3A 4LQ1A 5K9DA 1XFBA 1UWAA 3H2FA 4RNJA 3RR1A 3AS2A 3VNYA 4XAYA 4WIWA 1BTMA 2X1IA 4O57A 2Q02A 1EDGA 1Q45A 1H7PA 3FKKA 3ZXWA 1LL4A 5TBOA 3C2VA 3W7QA 1PEZA 3URQA 1QDSA 2E1DA 4AF0B 4REQB 3LRMA 3P60A 1GKRA 4US5D 2R82A 4E8CA 2X7WA 4DJDA 2OQLA 3VPLA 3MJMA 1AMYA 1CGWA 2EG8A 3QPYA 1US3A 3I4KA 1E9LA 2R9RA 4JNZA 1PX4A 1L6FA 1CXHA 1ZBKA 3PZTA 4CVUA 3D3FA 2E9MA 4Q8QA 1WKFA 3BH4A 3W7OA 4XSMA 4K1WA 2V5BA 5E5CA 4NX0A 1Y8BA 7PTDA 1MXGA 2YL6A 1R3QA 2A79A 2B0MA 4MJMA 1LF1A 2OO0A 3AIWA 3H7UA 2WJEA 2PTZA 4PUJA 3CV2A 2ZDSA 4NYYA 2X1RA 3W82A 4LAKA 5JBFA 1UWRA 2PP1A 3FCPA 1GVRA 4A22A 1F2JA 4GQBA 4V1YA 3U7BA 2OX1A 4R33A 4O12A 4L7ZA 2TMDA 1G5AA 2H8XA 4P7RA 5LIWX 3M9YA 1M7OA 1GOMA 4LVFA 3MUXA 4M7TA 3W1LA 4WGHA 2XVNA 3S1WA 4TMBA 2D3NA 1KCKA 4GYKA 1WZLA 5CPQA 3VIIA 1SQ7A 1TPUA 1V3LA 5G5IA 2PRHA 4JKKA 2ATMA 1VBJA 2W9MA 2A1YA 4DX3A 3ZT5A 1O4UA 2GGJA 5CPMA 2CPUA 3T42A 3T0CA 1F3TA 5H8UA 4NHVA 2D2OA 2NVCA 4IGMA 2JK2A 1I0BA 3G5EA 3WQ4A 1H60A 1QJWA 2IPJA 1KR1A 3UR7A 1KBLA 3PUEA 4GUIA 2PWDA 4O10A 4LOCA 2CKSA 3B0UX 3IS4A 3NZPA 2GJRA 1E71M 1QMLA 4GH3A 1BWVA 1SFJA 1JDEA 1VPQA 3B8DA 1E4LA 3TC7A 3BURA 4M6QA 1SR9A 3V5CA 3HMCA 1P48A 2A3LA 1TA3A 3MP5A 2D1ZA 7REQA 5HDRA 2JALA 1DE5A 3MANA 1QPNA 3SFWA 1HW6A 4Q8MA 4AX7A 4UTJA 2XIOA 5CBBA 4IICA 1W9XA 4D6EA 1GQIA 4QIUA 2ON3A 2BOEX 4E6MA 4HK5A 4OU1A 1JRBA 3GNRA 1OFRA 4KWVA 1E0XA 3BLDA 4H2CA 1VEPA 1XYLA 2OQYA 2XWDA 4RK8A 3S46A 1SGJA 3H70A 2D23A 1P6WA 1EJ7L 4GI9A 3GTFA 1ISYA 4S3FA 1QOXA 5AVHA 1JPDX 1BVWA 2PB1A 3DDMA 5I3JA 3SGZA 2P53A 3K30A 3TYUA 3WIJA 4AD0A 3RM9A 3TR9A 1JCNA 1JQVA 2WCGA 2OZ3A 2Y1HA 4ZGYA 3TUUA 3Q67A 5BNKA 1L6YA 1C9DA 1S5VA 4DLFA 3ABQA 1QI4A 1CB7B 2Z00A 4GIEA 1QNQA 3W83A 4LS0A 1P4CA 1RCQA 1YDNA 3CQJA 4E8DA 3AYVA 3LEPA 3BG5A 1J96A 3NDYA 3MKCA 4GE8A 3ZVIA 4HJWA 3TN5A 4EK7A 3CV7A 4Q7IA 1OWQA 2YYTA 4AZHA 2DSWA 1OFQA 4F2UA 4CQBA 4AISA 1KM6A 1IT0A 1SR0A 1LLZA 2PBGA 2OYLA 1W5NA 2OLHA 4UTFA 1W3KA 4PB4A 4UBPC 2VX7A 4CCCA 1VJZA 4Y90A 2Q3OA 2DJXA 2DZVA 3ZJ7A 3IV8A 4NU7A 4H9UA 1OVDA 2UV8G 1H7XA 2XH2A 4J40A 5EPDA 3EWWA 2OG9A 1TRIA 2R94A 3NOYA 4Q4SA 3JVAA 4JCMA 5K3VA 1SYTA 2V69A 1TA3B 3OLIA 7REQB 3M0IA 1W1VA 3ORWA 5EY5A 3TXVA 4E4UA 4H7ZA 4CLMA 4AW7A 3S2CA 2DJLA 1O5RA 2OSXA 1DV7A 2QCDA 3AZSA 3CUHA 4ZO9A 3BAJA 4N9BA 3IV3A 1QRQA 4AQLA 4XK2A 1HJQA 2FHBA 3WUBA 1HKIA 2E7FA 1U5JA 5D2YA 3WY1A 2Z7GA 6TIMA 3B8VA 3UNTA 3VX1A 1KBBA 4LSBA 2QJHA 2E5BA 1U2YA 1XLFA 2Q8LA 2GGGA 1WDDA 2VNCA 1KFJA 1FHUA 5M5DA 4ZMGA 2PC8A 3N2OA 1Y5VA 3RJYA 2R24A 4O19A 5AHLA 4ZTXA 3CNYA 3OBKA 4DUXA 4GZEA 4QTGA 1TV5A 2ALRA 4BF9A 3W02A 1P6CA 1XPYA 3CUIA 3BK0A 3A22A 4M80A 2QZRA 3H21A 5FOOA 4MFEA 4MPKA 1AD1A 2PDWA 4BF5A 4K8GA 2G8ZA 1FWTA 4QS6A 2F61A 1F5ZA 3WL1A 5H6HA 1XSKA 3R5EA 2FQIA 1SZRA 3UFYA 1W5QA 2XDFA 1SMAA 1KC7A 5IBXA 3GVWA 2EPLX 3VUPA 1I2QA 5CJNA 2WSYA 3W38A 3WJYA 3XINA 4PMXA 1E73M 4A2RA 1VEMA 2ZUSA 1XLBA 3P62A 1GZJA 4G6CA 1ITQA 3N6HA 1IXQA 1XLIA 4OUEA 4QRNA 1UA7A 3HPXA 4BWLC 4WR3A 4AEFA 4AZIA 1GVSA 3NIYA 4DXKA 1W9PA 1E3XA 5BRPA 3WFZA 3GLCA 3WH8A 1DXIA 3WK1A 1LTDA 1YEYA 3BXWA 3VIPA 1CGTA 1I0DA 2DZSA 4AUBA 3LCHA 2E28A 2QCDB 4NX5A 4UTUA 2FZ8A 4W7WA 3PF3A 1J8VA 1RV8A 5KSWA 4HBKA 2BASA 5BW6A 3TYBA 2INZA 4HPGA 2QUVA 4M24A 4GUJA 5HR7A 3AZTA 3CZJA 4UTLA 3OIHA 4PB5A 4W87A 1IZCA 2JGYA 4MPQA 3ZR6A 1RHCA 4WSKA 4FLQA 1KRAC 5HJYA 3PUOA 4JIEA 4LAMA 1D7FA 2DH2A 2WHKA 4NJKA 4NZ1A 4DZIA 4GVIA 2INFA 3MUY1 5FEZA 3WH7A 2NV9A 3AXKA 1D3HA 3O0KA 1LT7A 4PMUA 3WFAA 1ALDA 1B3XA 3P7YA 4R88A 4B3LA 3UQNA 1VR6A 4NRRA 1CZ1A 3PK7A 3AISA 2BXZA 2VP8A 2PDQA 2CW6A 3ITLA 2F38A 1KFLA 1WUFA 3B03A 2X40A 1K70A 3E96A 3VOIA 2HISA 3QHOA 4LCSA 1CXLA 2D73A 1M6JA 3RU6A 5CLTA 3REQA 1UWUA 2PLCA 5HBFA 2UY3A 1ECQA 1LOQA 4ZR8A 2GUYA 2ZX5A 2XSAA 4GK8A 3N73A 5IOBA 3HF3A 3APYA 4BI5A 1VPXA 1RD6A 1WKYA 2TAAA 2DY3A 2YIHA 1KB3A 2G37A 5CPNA 4YVVA 3PBWA 3KHJA 3PWAA 1UR8A 1ZBVA 4C5YA 2CZFA 1ZJBA 1BYCA 3W2UA 3TYEA 1F07A 2WB5A 3MSDA 1QT1A 2WOQA 4QFUA 1VAHA 3KS6A 1PIGA 1TELA 3S2JA 4O0QA 3UVAA 1BKHA 3R43A 3HQOA 3N6QA 3CMFA 4ZOBA 3W84A 4C1KA 3STCA 1OF8A 3T40A 1NY1A 1QW8A 2WHJA 5DELA 2ACSA 3UVIA 1CLXA 2DVUA 3SCOA 1A5CA 1KD0A 3PZNA 4UIOA 3GDMA 2PZ0A 4IQDA 2IKIA 1MVYA 3CZGA 2J7GA 2VZOA 1ZU8A 4P5UA 3RGTA 3SRDA 1RAKA 3FJLA 2G3JA 1KM2A 4C6EA 1HGWA 1PZ3A 3VIJA 4KRUA 1GTEA 2CLMA 4IFRA 3RX3A 5CCZA 3GG8A 3LCXA 2RAGA 3VNJA 1ONRA 4V15A 2RHGA 3VA8A 4F0RA 2G41A 2ZX6A 3UXKA 1SZFA 1X7IA 4HTBA 5F4SA 1I2NA 4XIAA 1H61A 4XKYA 3KS5A 3MWAA 4XISA 4H1ZA 3SM0A 1GEHA 1IEXA 5GNZA 3B0PA 2C91A 1Z41A 2J77A 1FHDA 4DPQA 4HZ6A 1A0CA 4OUIA 3VYLA 4B5SA 4IQEA 5HJXA 1IXPA 2WQDA 1QW7A 2L5HA 3S2NA 1W1PA 3MZ2A 2Y5SA 4GXPA 4NNCA 3MI6A 4F0LA 3W85A 4QLKA 3VGBA 1JD9A 2Q8ZA 1A4MA 2VOTA 2J25A 1DVJA 1EC8A 1BGAA 3CAQA 1OYBA 5U4NA 4V28A 3PBUA 3UU0A 3GXPA 3UPWA 4HA3A 2A7PA 3H12A 1Q85A 2ZXQA 1M7PA 2G96A 3UZJA 3GZ3A 4AD5A 3OO2A 5ABHA 3KBNA 2CLPA 1H2JA 1I45A 1VP5A 1EJVC 3OLGA 1HNYA 4H9VA 1OYAA 4BJHA 5T9BG 1NDYA 2DZXA 3NDOA 3IIPA 2SFPA 1J11A 4TMCA 5CJ5A 4MSSA 1QNPA 3MQTA 4IIHA 2V68A 4WY0F 3T7VA 1TMHA 3C2RA 2I16A 1Z7AA 2DUAA 2POZA 4B5UA 4LTSA 3AMLA 3UWUA 4I6KA 4R7OA 2YBUA 3BW3A 3EOOA 1XLGA 2E1WA 3H24A 3W2MA 1LBMA 3AYTA 4LPCA 3COTA 3KAOA 4PCPA 3KOFA 4ICMA 5E0KA 1JF6A 4CQ8A 2ACQA 2C0AA 2F7FA 3RLGA 1K1DA 3TQ0A 2YSWA 3GG1A 3H22A 1A3HA 1BSIA 3MWCA 3LENA 4TVUA 1Z69A 3E5PA 1W3LA 4PCSA 4PR4A 1S5WA 4WRHA 4XKYB 2ZADA 3I7SA 3HM7A 5LA1A 4CD5A 1A5LC 3OB8A 3ZVHA 3GB6A 1LOSA 4DJED 2IW0A 1YHTA 1QHOA 5CLWA 3UJ2A 1M5WA 2DZUA 3UF9A 2GSHA 5C9RA 2X0SA 5IM51 3Q94A 1K3UA 2BNJA 3QEZA 1ISXA 1FWJC 3TC6A 3EZ4A 4PUWA 3E49A 4JN6A 5LZLA 1ZRQA 3PWGA 4M51A 3T0TA 3LM3A 4O1BA 3C2EA 4G9PA 1XCWA 4KERA 3L9CA 1DWHM 3QHNA 1J12A 5FA5A 3O2LA 1E0TA 2YL5A 5EFFA 3IVTA 4MYXA 4Z1AA 4A4AA 4EP8C 3SUWA 4ORIA 1EUNA 4XZ9A 2P0IA 3S3GA 3O05A 4MVAA 3TX9A 2NX1A 3WUEA 1I1XA 5FJRA 5BXTA 3WNKA 4ZFCA 5DLCA 4D6DA 2BHYA 3M5ZA 4D6CA 5I5RA 1EJUC 1QPQA 2EQDA 1RK5A 1QTWA 2QEZA 1OT2A 1DQXA 1EF3A 1KRCC 5AC5A 1WV2A 4KGLA 4H3DA 4UNIA 4X9YA 2CLFA 4H9MA 4K39A 5LNSA 3FA4A 3WLQA 2DQWA 1UC4A 2ALDA 3P74A 2CXGA 3TTOA 1A0DA 2PU1A 2OWCA 1O5KA 4MWAA 5C6MA 4I9JA 2YDRA 4IF2A 1R3VA 2E0PA 4QAWA 3W86A 1GOQA 1C8YA 3SCWA 2E6FA 1JYXA 2X1UA 4RDVA 2WBGA 1ZZMA 4OV4A 4PBGA 3ZVHB 3EWUA 2PP0A 3R11A 3KBJA 1DP0A 4C6DA 2W67A 3E2RA 2QV5A 1JPIA 2FLIA 4A8NA 5EKYA 5EBUA 3L4ZA 3LV6A 5C54A 3MV01 1BGGA 2QKFA 1AJ0A 2JF7A 1OIMA 4AIOA 4LF2A 4A3YA 1XYFA 3EDJA 3A12A 3L21A 2R91A 1ONXA 4P8XA 4XBKA 1V8EA 1TPH1 1PCWA 1R86A 2VEFA 3T08A 2VOMA 4DO7A 2PRMA 1L8NA 1WDPA 1HVXA 4M6UA 4EF9A 4GYPA 2PEVA 4OECA 2DZAA 3ITOA 4GC4A 1JCTA 1LL6A 2ZCGA 3GS6A 5T26A 2OYMA 1OG0A 1V7AA 3B8TA 2W27A 4TX8A 4EAYA 3KBMA 3OG3A 4PFMA 4HPXA 4OBRA 5LA0A 2GL5A 2VZVA 1V6VA 2IQTA 5D03A 4MB5A 3VD5A 2NXGA 4I7VA 1IWPA 1YPIA 3HO8A 1NWRA 1V6XA 3VD3A 3NQ7A 3R25A 2HCVA 2OODA 3TAKA 1DE6A 5TF0A 1TJ1A 4AY8A 2XM1A 3N15A 4PGLA 1X7FA 3NJ3A 2QF8A 4AWEA 4DXXA 4JFUA 2GWGA 3BV4A 1U5VA 2HEJA 1XIMA 1XGZA 3ARQA 3UYCA 4CCEA 3W26A 2EPNA 2X1SA 4N4QA 2P50A 1PTGA 5FD0A 3ARVA 4MWAB 4ZA0A 2PF0A 3W6LA 2C0HA 2QCLA 4S2CA 4DUVA 4FNQA 3DIPA 1E72M 2OVLA 2VX4A 3PBYA 3B3DA 1GOWA 2CERA 4BK9A 2D2HA 1GKPA 4NSBA 1KRMA 4ZSUA 2VJXA 3N3MA 3ISIX 4ZODA 3EB2A 2VEKA 4NZFA 2JEQA 4ACYA 4IG2A 2J7EA 2R6OA 5ENLA 1FFRA 3RUBL 2XYLA 5AZ1A 2HXUA 4FNUA 1QFEA 1VBUA 4I5UA 4Q4RA 1XICA 2J9YA 3NQ8A 3SURA 4UMAA 2YL9A 3LA4A 5D9NA 5A1AA 5I3FA 1GVEA 1MI3A 1ADSA 3OODA 3WDHA 3BGJA 1E1CA 1VIWA 4Q8UA 1ZP4A 4HIBA 3WLMA 4XZBA 3WLSA 3WMBA 5FEPA 1F9CA 4IGHA 3QOKA 3DYMA 1F3EA 2Y61A 5HNUA 4ZQOA 3W22A 5C0QA 2PDIA 4AXKA 2JQXA 1DJGA 4DY1A 4DWDA 2GVGA 3QOMA 1X1NA 3VKDA 1Z9AA 1EWDA 3LG3A 3W7HA 3KBSA 3GWQA 3GNOA 1OJXA 3ZLHA 5I3GA 2RDWA 5F2GA 4JYEA 4IMGA 2V3GA 3EKGA 2V5LA 2VCCA 3OLEA 3DYOA 4PFHA 1RQEA 1XFCA 4U3AA 1SJCA 4QNEA 5M2FX 2WAGA 5LIKX 4MFDA 3DENA 3GNNA 3HQNA 4XAPA 5CZ0A 5C7HA 4B4HA 4JTIA 1SO4A 3SUSA 1C9WA 3H2EA 3GXIA 2ZC8A 3B4UA 3NXFA 4PUEA 4JXCA 2X2YA 2CESA 4R3UA 3WMLA 4GKTA 3F4CA 3WQOA 5HPCA 1ME7A 4FPSA 2QXWA 1OZQA 3VNDA 3L2IA 4LALA 4HVXA 4PUDA 5LNVA 3CWHA 1O12A 3O06A 1VFHA 4O8RA 1JZ5A 4PCTA 3GY1A 3KWSA 3L5AA 4O4WA 3PM6A 1MRAA 2QVNA 1ICPA 3WQPA 1AQFA 3LX9A 1FX6A 4DWSC 1ZS2A 2IXUA 1XJBA 3M16A 4GQ0A 4W85A 1EXBA 3TA6A 3IARA 1S3HA 3H53A 1TV8A 4GZIA 4IG2B 3C52A 3W27A 1Z89A 1KBKA 2BBFA 4EXQA 4PL1A 4AWTA 3TJ4A 4FOKA 3LNPA 3L5LA 4MIMA 1O6IA 1Z8AA 3QKEA 3S47A 1XRVA 1ONEA 2J74A 3FYOA 4HMDA 5JQ9A 3PBGA 5TD4A 1GORA 1RVKA 4DRSA 1E1CB 5BXPA 3R58A 3W7KA 1IYXA 2FYMA 2I56A 3F4DA 2VD9A 3UA4A 4YYCA 1RQBA 4HU4A 2NWRA 3EYPA 1ODUA 2UY4A 3NSXA 3NQ6A 4HMEA 4L1WA 3ARZA 1V0NA 1W5OA 4BEUA 1XCFA 5CAKA 1BAGA 2QDGA 4GQGA 2Z24A 2XFWA 1R9XA 3EBVA 4MZYA 4F2BA 2E68A 1D3GA 1TUFA 1V0LA 3N4FA 3AWOA 3A5FA 1RA5A 1RLCL 3BL3A 4ATWA 3T0DA 3AMCA 1TV3A 2V5DA 5C2GA 1KFBA 2ACRA 2HK1A 2VC9A 4ERIA 3KEHA 2OJPA 2HQAA 4WD0A 1R5YA 4FR1A 5I03A 1UZ1A 3EDEA 4US6A 3GBDA 1OD8A 2XN2A 2WKLA 3Q65A 1A5SA 4Q7NA 4FNPA 4Y9OA 3ONBA 3B8IA 5GNXA 1W2VA 1VFLA 5CC3A 2Y7EA 1JXKA 1W9BM 3IRSA 3NAVA 4J3UA 4PE8A 2YKKA 4LUTA 3BLFA 5D8ZA 4G1KA 3FYPA 3UBPC 3GTXA 3CQHA 1J0IA 1E56A 4L6DA 4RKAA 3SCUA 1RVGA 5I07A 1PIFA 1VS1A 3URNA 2INEA 4GHRA 4QCFA 4O11A 2O0TA 4W8LA 2RFGA 2EPOA 3P6LA 2V3FA 2ICSA 3UY7A 1F74A 5ABFA 3KFTA 4BR1A 4PB3A 4KT2A 3EX3A 3O7UA 4NF7A 2VEIA 4GFSA 4Z1DA 4EAMA 3WJXA 1DJIA 1C93A 1EWEA 3PANA 1K8ZA 4JICA 2G3IA 4HYWA 4PA8A 1VB9A 1WE5A 3FDKA 4TX6A 1DJZA 1DWFM 2GUBA 5G4WA 1Q66A 5CQ1A 1J18A 5DRIA 4GISA 1S3TC 1K8CA 3MO4A 3LXCA 1JXJA 5FESA 2Y88A 4UTWC 3W71A 3W1NA 3BOLA 5FCZA 5E9AA 1KGWA 3GC2A 1DIKA 3QZEA 1KWGA 1MNZA 4WJXA 3QR0A 5T91A 4M1BA 2J7BA 1AA1B 4RDWA 1YDYA 3H6OA 3LZ5A 2WC7A 2ZA3A 3WQCA 5CGTA 4J4KA 1Q6CA 3FK4A 2AQVA 3TR2A 4ADTA 1R7AA 2QDEA 2YX0A 3WUFA 3T4CA 3HURA 1E6SM 3HA1A 1NU5A 4UTTC 1T8QA 1OABA 3BJFA 1XXXA 5TAOA 2PPGA 4DUOA 5FSDC 1CLKA 3GTHA 3TLQA 4DEFA 8A3HA 2FHFA 4LUTB 3GHUA 1JJKA 3OBAA 2V6AA 4GCXA 3PPHA 4HOXA 2BWGA 3ITVA 4LYKA 3TTSA 4ADSA 5BXSA 3LPPA 1TJ2A 5BOFA 3TEVA 2VRQA 2OWXA 5HPOA 3G1HA 4S3BA 3R0UA 3FNDA 1VBHA 1SO6A 3IIZA 5ABFB 2WZTA 3NUKA 1FWEC 3LCWA 2BOGX 3BAIA 2J7FA 1Q6FA 3AIQA 4B90A 3FN9A 3DFPA 4GNKB 4D72A 4H7CA 1CBGA 5LNUA 3BG3A 3U2CA 4AEOA 3PNZA 2BY1A 3WF3A 1NF7A 1XLHA 1TCDA 1VFFA 3I68A 1QNRA 1ZJAA 3CHDA 3RX2A 3LS9A 4NNBA 2GUUA 2WJFA 5A8GA 1KXTA 3DGBA 4CEXC 2PDGA 3GDTA 4HTYA 4U2ZA 4Y96A 1MZHA 1A3WA 2OFJA 4MGGA 4TQTA 2JBMA 4QG9A 4UQEA 2PDFA 2C71A 1XKJA 4CD8A 3UA3A 3AJ7A 3QSTA 1LWIA 1LUCA 1O1HA 2QHAA 2QVHA 3SRFA 1V6TA 3QV7A 4JQ4A 1NFGA 2Q09A 1EYEA 2CLIA 1DIDA 5GJNA 3IGXA 4Q22A 2P10A 8TIMA 3IUDA 3BMWA 3CAWA 3MMDA 3VDHA 1ZJIA 2PDUA 3W2JA 3C61A 5MF5A 3NFUA 3KRUA 4HD5A 3LU2A 5F4WA 3DN5A 2E4TA 2QCFA 4I7WA 4INFA 2HDJA 4YVPA 3G77A 4L1XA 3VTRA 4O0ZA 2VTFA 1EZ2A 2Y6ZA 3L4YA 5DEZA 3R0DA 3PULA 1GTHA 2IKHA 1GEQA 4Q4MA 1PZ2A 4ZVJA 4JQ2A 1JDDA 2XJ7A 3FEMA 1DXFA 4OBSA 2DVTA 3UERA 2GGHA 1W1IE 2J88A 3ARUA 1D8WA 4QHRA 3ABRA 4W7VA 1XX1A 4D6FA 1Y65A 1BSLA 4PTMA 5LIYX 1JDFA 2HROA 5D38A 2VZUA 4CNOA 4CD7A 4X3ZA 1X8CA 3FJNA 4HHHA 4A8LA 4AZ6A 4DJDC 4K1GA 3I4EA 4HK6A 4Z1BA 1MSSA 3N13A 4IPNB 4ZE5A 3HMJG 2VGFA 2XZ9A 4OKDA 5DFAA 2VEMA 1YNYA 4LRSA 1TVLA 3MVTA 2VQUA 1MEWA 1Z48A 1TR9A 2BY3A 1P1MA 1AMKA 3DFQA 1FHVA 1TE1A 3RIKA 3PB2A 1TO3A 4XQ6A 4FX6M 2V2CA 1TVPA 4JS3A 3T2QA 3AI0A 4HMNA 4W93A 3NSNA 3TC3A 1QO5A 3G18A 1EC9A 5HAOA 2ZRUA 2YFOA 2C13A 4AYGA 5AECA 2DVXA 1VH7A 2D0HA 3Q37A 3MBFA 4KFNA 1XISA 4M0XA 3GH5A 4WCJA 2DSKA 4H9ZA 2ZUMA 2V3DA 4WK9A 3RN6A 3IJ8A 4TUFA 2X7VA 4NL1A 4Z0JA 1LUCB 3GR4A 8CGTA 3BARA 1VFOA 1UZDA 4Q8WA 5DCBA 4IH3A 5A3HA 2JIEA 4OHQA 3MB9A 3M0VA 5FF3A 1KV8A 3M0HA 1E6XM 1NSJA 3CUGA 1KA9F 5A8PA 5HUPA 1O7AA 4S3AA 6XIAA 3VMPA 1OZMA 3BW2A 3KZSA 5E6ZA 4GIYA 5D30A 1XQKA 1KLZA 4QE4A 3TN3A 4K7YA 3EKLA 4P7QA 2KX9A 1WOAA 3WF2A 3QGVA 3MI3A 3EKZA 4C6OA 1J10A 3SN1A 2XH0A 3FW6A 3ZSTA 2ZIDA 4CN4A 3O63A 2GGEA 3SN4A 3T07A 3ICJA 2GQ3A 3PAJA 1EO5A 1C29A 3I65A 3GXTA 5E70A 4W8BA 3OVQA 2KZHA 4MKNA 4D8LA 1OQFA 3M4HA 4Y9MA 2Y7GA 4X9SA 1FWIC 2GVYA 2OQHA 3QQWA 4RNFA 3NVTA 4JTUA 3E74A 4I7UA 4AIEA 1KGXA 1W5PA 2PE4A 2IS7A 3OBEA 2Y70A 6A3HA 1E6PA 2Y85A 2YDSA 3NQEA 3CIXA 4FP1A 3D47A 3GVQA 4IQLA 2EGZA 3MCNA 1UWQA 4HPJA 4WKFA 3R10A 1UWTA 4B5VA 4XAGA 1R3TA 1YRRA 3FAXA 4WJ8A 3TONA 3JUGA 1X38A 3LD5A 5EMMA 1XIJA 2O92A 1OX6A 2PLJA 1OFPA 1L0PA 4HZ8A 2VFHA 1TMQA 1CX9A 1LBLA 3PP7A 2C6QA 3CAVA 2CZEA 1QI2A 4HYVA 2DT1A 2RDTA 4ZOAA 3CIWA 1TSIA 4J3XA 1CIUA 3VKAA 1XIBA 3CMGA 3LCFA 5I77A 4B3KA 1EP1A 1Q6EA 2PFHA 2FFIA 2O9TA 3N2CA 3VILA 1NP0A 3K46A 4JIRA 2CU0A 1BEUA 3PZ9A 1N55A 1LLWA 5D09A 4R27A 2PTYA 3O16A 3V5FA 4NI8A 2ZRYA 1WDSA 3VNMA 2JKPA 4J3ZA 2TPSA 2QJMA 3VNLA 4Z2LA 2B31A 4GO9A 2PDCA 4DYJA 1F8IA 5D9PA 1B0IA 1F8MA 3B0XA 2DUXA 4MLJA 1F6KA 3PZVA 9XIMA 5KETA 4GXMA 3T78A 3K4WA 4QS5A 5AOUA 3KHDA 1R47A 1E0VA 1LRTA 2I9UA 4BI7A 3Q45A 1QXLA 2FZNA 4A8IA 1H1ZA 3GHRA 2KAUC 2ZBTA 4FLSA 1H5YA 1LORA 3E3HA 4B92A 4GBDA 5A6MA 2ZYFA 4ZEPA 1PE1A 4QE5A 5C8BB 1R3RA 2HVNA 1FUYA 4L4OA 1B54A 1BF2A 5BYWA 1EEPA 3MSRA 1T7LA 2TODA 4ZENA 3A21A 4UMBA 2HE8A 4KCUA 1Q5MA 1FDJA 5A8MA 3RJXA 4DJEC 4JY9A 2Z1KA 1JYWA 4FXFA 1J5TA 3B8SA 5D8WA 4X63A 4MB4A 3UD6A 3EX6A 3AICA 4Z1CA 2WJDA 3CQKA 3GVVA 3GYCA 1PDYA 2HJPA 2CXEA 2VZTA 4U31A 3W1AA 2ZX8A 5LNWA 1TFVA 2ISSA 4RPQA 1EQCA 4H8HA 3MHGA 2G4JA 3K8KA 4ZQNA 3B8UA 4J5NA 5HR6A 4KEVA 5DXXA 2OOFA 1PPIA 3ZR4A 3V4BA 1AD4A 2J24A 3VFLA 3OQEA 1FVPA 4UQDA 3TMLA 1Q6OA 3D3AA 3EPMA 1H0IA 2ZX9A 5DMLA 3ABSA 1HQTA 2BS9A 4XD4A 3PZGA 3DU0A 3WUGA 1E6RA 4FNRA 4B5NA 3B0YA 2PZNA 4O8AA 1FWAC 4DF1A 4HHMA 5EMJA 2WC3A 5E6YA 2ZZ3A 4LYPA 2OZTA 3H55A 4PULA 4XAFA 2ZXAA 4FALA 4QE1A 3MDUA 1IT8A 2QPXA 4C6CA 3IPWA 1SJBA 1JZ4A 3IGUA 4JTQA 4NQ1A 2E6YA 3L0GA 3U2ZA 2E25A 2G3MA 5G2WA 2C14A 1YLVA 4PN2A 3URBA 4DN1A 1VFTA 1KO0A 4AU0A 1Q8AA 5A2AA 1AH4A 2QGHA 1BQCA 4LNCA 2HZGA 4L6HA 3SSJA 1O68A 2CBIA 1H4PA 1NFBA 1H5VA 1B3YA 3NL2A 3JU2A 3L66A 3KVJA 4CUCA 3JW7A 1C8XA 2P0OA 1EHAA 3ARWA 3DECA 2BOFX 3UZ5A 1YMYA 3LM7A 4O1CA 5CH9A 1W9UA 4O13A 1JCMP 3UXLA 3SBFA 1XH2A 1BWKA 3WLHA 3KCOA 1K9FA 1KW1A 2J6VA 1EDTA 1SUXA 4GMEA 3DZ1A 3EPOA 3SECA 3IGSA 4ENLA 1H7NA 4OT7A 3TJIA 4HNCA 3VAVA 1P0BA 1WKEA 1UMYA 3WELA 2GSEA 4UMCA 3RPMA 2PD9A 3WD2A 1TZZA 3QVQA 3U57A 5D2VA 1T99A 3QKZA 1FP8A 1UD8A 2CWXA 3PSWA 3ABZA 5DANA 3CO8A 1U83A 4U33A 4RE2A 3ZT7A 2Y0FA 5FJPA 1J79A 2Y2WA 2YA1A 1W3IA 2C1HA 4NZ4A 4F0HA 4IP5A 3A4JA 3CZ8A 4LBRA 3V35A 5FJIA 3GZAA 3VOHA 2HBXA 4A3HA 1AODA 1NDZA 3SQLA 1F4HA 1RR2A 2A6NA 3WQ5A 2FJKA 3S6DA 4J3TA 5I3IA 1T96A 4IUOA 3LTYA 2YFNA 1XRSA 2DSUA 4N42A 2QCMA 3GUGA 4IFKA 2GYIA 2PODA 5C2CA 3LBOA 4W84A 4ES4A 1M9HA 3NEHA 2W3ZA 2XPKA 2Z28A 2IMRA 1ZB5A 3QMRA 1N7KA 3TZNA 1BTCA 2NUXA 4YPJA 3C0LA 1VZWA 3QM3A 3WLNA 1CNVA 1S46A 4Q4OA 3VKKA 2X0HA 3LPFA 2FIQA 5HK4A 3IJ7A 2FVKA 3LI0A 1H7WA 3KM8A 1MEHA 1MW0A 2UY2A 3JS3A 1XW8A 3ZT6A 4K8EA 1I4NA 3SEPA 4PZVA 2FGBA 2XVPA 3ZLFA 3U0HA 3PN8A 3WBWA 3B04A 1SMDA 3QTPA 4JCLA 2A0NA 4ZFMA 3RHGA 3STGA 5G2IA 3IIOA 3THDA 2HPMA 3GFYA 1OT1A 3CO4A 4AVOA 5HULA 4C1LA 1W0MA 1DWAM 3KP0A 2PDPA 4X22A 3MZNA 2VR2A 2XN0A 3BQ5A 3PWIA 1WO2A 3TP4A 3F2BA 1OB0A 2NUYA 3KOXA 5AHEA 1X96A 2FTYA 4G7FA 3KL3A 4HP5A 3W6MA 3FA3A 4XZIA 2ZDRA 4H04A 3NYDA 4GQRA 3R4IA 2GQAA 1V51A 4N7QA 3RX4A 3OIXA 1HL8A 3WKZA 1O95A 2QR6A 1W54A 1ME9A 4A3RA 1HJSA 3VNKA 3T1GA 3BSGA 3LGGA 4NG3A 4BQ3A 1JL8A 2DV0A 2QLYA 3ITTA 3Q4DA 1R2TA 3H23A 3EDDA 4FMVA 2NT0A 4IFKB 1MNSA 4MKSA 2HVMA 3T0BA 2EEXA 4IIFA 2ZRVA 1UR0A 4S3KA 1B4KA 2ZC1A 2XGBA 3GXDA 4GYFA 4YN5A 4WDTA 3SO7A 3GDRA 4XB3A 1MXDA 1WDRA 3QR3A 3LRKA 3ZOAA 2WSRA 2JGQA 3EWZA 1RCOB 4QEHA 2VDIA 3KXQA 4PRTA 3E0FA 2FH6A 2HXTA 3W74A 3K8LA 3LPGA 2A7NA 3N2XA 4NT0A 2BV9A 2QCHA 5I78A 2WMHA 2Z0IA 3VIFA 1VFSA 5HJLA 2DEPA 3E2QA 4JFSA 4WEVX 4QDMA 2CBVA 1NM9A 2QJNA 4RPPA 2OU4A 3TOYA 3WNLA 5A8NA 4HNUA 3TE9A 2PLMA 4JIHA 5CSUA 3NSMA 1UR2A 1GQKA 3C0JA 1LG2A 3SCRA 3EWYA 1JR1A 3WLLA 5AC4A 3GH7A 1K03A 2GQ9A 1LROA 3V36A 1IQ8A 3UJFA 2BG5A 2VQTA 2A21A 5IFPA 2PTWA 4WF7A 4NAEA 1VFUA 2VX6A 4H00A 3W7RA 3D5HA 3RRAA 3MP3A 4E5TA 3G8RA 2YBVA 1TTIA 5D04C 3T8QA 2Q8XA 3ELFA 2W66A 3KOYA 5ABTA 9XIAA 2P8CA 1OGSA 2NV2A 2QUUA 4L1GA 5CZJA 3SY1A 1LL7A 4L6OA 4IT1A 4RDYA 1UKOA 5T9CE 1MDRA 4XBSA 3BPWA 2GFTA 4UFJA 5CGMA 2J9ZA 3T6CA 4O17A 2PGRA 1YPFA 1LQAA 1S2TA 3AWNA 2W91A 3MYPA 4LYQA 1M41A 1ISVA 4DZAA 1E1EA 4FXSA 1FDYA 2PWEA 3S5NA 1JCLA 4FIRA 3AU2A 2DU2A 4QLJA 3P67A 1JEZA 2F84A 3NQBA 2DIEA 5HWJA 3VNIA 3NVDA 4E3TA 4ZQRA 4AMAA 1EDQA 4QNWA 5D9MA 3CV6A 1P0NA 3EMZA 3ECQA 4MDOA 1RY0A 4Z17A 4CNNA 5B80A 1MEIA 1ZBWA 2X05A 3DG7A 4RX0A 3WEZA 4F9DA 1A5OC 1QNSA 3M0ZA 3CU2A 3POHA 4LH8A 4GKLA 1DWGM 1GT8A 1RCXB 4G2DA 3W4RA 5C2XA 5FSEC 1NIUA 2JKAA 4MNKA 1PO9A 4EACA 2O9RA 4Z2KA 1CXFA 3FFSA 5HQMA 1GJUA 1E51A 2WYSA 1XG3A 1VD6A 4D1IA 3DKJA 2PDBA 2FPTA 1CWYA 1VCGA 4PTVA 4F3HA 3GAYA 4YLWA 2VGGA 4H2HA 3CEUA 4XUYA 4MWAC 4B2DD 2DW7A 1OX4A 5FEXA 1LJYA 3NZQA 3TROA 3UT0A 3G1VA 4P61A 1JZ3A 2PGEA 4NAEB 4C91A 4GI6A 4R9OA 5D33A 1W37A 4H19A 1TPFA 2WM1A 1DJWA 4KRZA 3DGRA 4XD5A 1XSIA 5AHMA 2J8GA 3MBDA 2RDXA 4DJFD 4C7DA 2WKJA 3FVMA 1CT5A 2XISA 1VC4A 3BWWA 3IJ6A 4UTTA 4EX4A 2FVMA 1A47A 2XHYA 2VX5A 4QSFA 1G6CA 1LT8A 4QG6A 3W9ZA 1TTPA 4UR7A 1UIPA 4MYAA 4UB9A 3RLHA 3DUGA 4C6LA 1W3HA 2R8WA 1TPDA 3SUTA 2VL4A 3AHXA 1G69A 1Q6DA 3HIJA 2Y8VA 1JIBA 1JZ2A 3ZO9A 1UUOA 1EPVA 4GYPC 4KFPA 4FZIA 5G2HA 4UOQA 3TN6A 3BTNA 4MMWA 3LHTA 5FF4A 1SO3A 3KCLA 3UZYA 1YTEA 3TV8A 5HNRA 3CHFA 4EF8A 3GIQA 2DT3A 2YA2A 4MF4A 3CL7A 1VKFA 4GVFA 4GFIA 4J2PA 1R7OA 2O9PA 1AZ2A 2BODX 1NP2A 3TW9A 3CYJA 1XLKA 1XLMA 3QY7A 4RR4A 4B5XA 1WZAA 4XSLA 2J8FA 3GKAA 4HMCA 3USBA 4GGBA 2WQPA 4HPNA 2VFFA 4AX6A 1YYAA 3H54A 5LYRA 2FB3A 1F61A 3L4XA 4MNMA 3NO1A 4XZLX 4JX4A 3MO7A 3AXHA 3ABOA 3GX9A 2UY5A 1O5XA 3N3TA 5AHIA 1G4EA 3LPOA 1SZNA 4RZ5A 2CLEA 4NNAA 4XKMA 1VJIA 2UZ9A 2YA0A 2YR1A 2Q6ZA 1LOLA 4LB4A 3HBLA 4IGNA 1VYSX 1XR2A 3BAXA 8XIMA 3IIVA 4HJFA 2QPUA 1H09A 1HO1A 2GLKA 3C0SA 2OB3A 5DN1A 1G67A 2W6RA 1VJSA 1CW2A 2FGZA 2ZVRA 1WZMA 3NL5A 4Q8PA 2GSJA 4W7UA 5H8MA 4AHOA 1XLJA 1ITUA 4R7WA 4XVEA 1BHGA 1XYBA 1XS2A 3VU2A 1X39A 4YTSA 3NL6A 3I7QA 4K38A 3MMUA 1LM1A 4JNMA 2Z1VA 1SZGA 1W17A 4FNTA 1W1ZA 1YNQA 4QCEA 3UWEA 1K9EA 3DAQA 1ZLPA 3IAQA 4W88A 4RZBA 1HG3A 1H41A 4OOZA 3THAA 4DYEA 3GM8A 2Z7KA 3H7VA 3L4VA 1AH3A 1JGMA 3PPCA 1XHGA 2VC7A 1RBAA 3UWVA 6REQA 3VNZA 4IJCA 5I2UA 3LY0A 2GJNA 2ODOA 1Q6RA 4ROQA 3LGDA 3CL6A 4MTVA 4JTAA 3KRBA 4FF7A 1QHZA 2X8RA 2XFRA 3ALFA 3ARRA 1ITCA 1QW9A 1ZBCA 1M53A 3CQ0A 4YIWA 5BRBA 3KTSA 4PMOA 4TTUA 2D22A 1S1PA 1U5HA 3H4WA 3LUTA 2NLIA 2REQA 3HJEA 2PCEA 1KM3A 1W9VA 2EKGA 3PTQA 3WQWA 3L2LA 4YWIA 3VVGA 3CQIA 2WMIA 2DH3A 4H8NA 3LHUA 4DYKA 4HKPA 3N9KA 4EVZA 4NKCA 1UKPA 3B0VC 3DC0A 1GVOA 1QPOA 3SGUA 2VT0A 2XH7A 3BAKA 2ZZ6A 3UJRA 3WDRA 1Q7MA 4BEQA 1D2KA 4S3EA 4M19A 2DIKA 5K4ZA 4TU1A 4FX8A 1KXQA 3OVPA 4CEUC 1EEXA 1XLLA 4E0CA 5A94A 1K6AA 3UXDA 3UXIA 4QISA 1UG6A 2HS8A 2ACUA 5I02A 1YQ2A 3LRLA 3W1PA 3F2DA 2RJGA 1QK2A 4LVGA 4JTLA 2IKGA 3CL8A 2YJQA 3SJNA 3G24A 4WXYA 5HXMA 1G9HA 3T55A 1ISWA 4NILA 3QFWA 4C6IA 1TUXA 1NOWA 3FSUA 3GG0A 4FR6A 3WH6A 1PL9A 2Y8KA 4ICCX 3D46A 1ESWA 2PDYA 4LEQA 3WEOA 4M3PA 7CGTA 3VIKA 1KKOA 5A69A 3GTNA 3LXAA 1C91A 4LVDA 3DHDA 2FZBA 2YZ5A 2Z1XA 1BFNA 1LP6A 1ZY9A 3KL0A 3HFYA 5XIAA 1R46A 4ICNA 1AJ2A 1GJPA 6REQB 2VDGA 3NYZA 4AIUA 4R85A 3ATYA 4N0RA 1PX3A 4LS1A 1BRLA 3DYPA 4IL2A 7TAAA 1QAPA 2VFGA 2J47A 5TNVA 2J7DA 1OHLA 2RUSA 4HB7A 1EL3A 2CBUA 2JF6A 1US0A 3H8AA 1IT7A 4GCAA 3TCSA 4ONVA 3CH9A 5E0CA 3M0YA 4O1DA 1PKYA 3SN0A 4F40A 3CAKA 3IAPA 3GQYA 3LBMA 1J5SA 3WNMA 2NQLA 4D8ZA 1CPUA 1LYXA 2REQB 1OIFA 4U5KA 4C6BA 5D05A 4YTQA 1W2PA 3GDKA 5LHFA 3PC0A 4MY8A 2EBNA 2WMIB 4HGXA 4HSNA 1GQLA 3BLPX 1PHQA 4W89A 4N02A 3K1GA 5FI8A 2OLAA 4AG0A 3TVAA 4JNYA 2WNNA 4CN6A 1DYSA 4B9YA 4JFVA 3EEZA 1JFHA 3LCGA 3KTXA 4LY4A 2R1KA 3LI1A 3TW7A 2OKOA 2I5QA 2QIWA 4A3QA 5HMSA 4H9TA 1YXDA 3A4WA 4I90A 3RITA 3H26A 4U4MA 4UNLA 3O3RA 3H7RA 3G22A 3P8JA 4DXVA 1GYNA 4YS1A 1EUAA 1XLCA 1V0KA 1GYMA 4RCXA 2CCRA 3FLUA 1PAMA 4JTEA 3TSMA 4EOUA 1FWFC 2OSWA 1R0MA 1WKDA 4DM2A 4YTRA 5M3WA 2O7QA 2C16A 4PRWA 4MLRA 4S3DA 5J04A 5GPRA 4DQWA 2VVNA 1J4EA 3NO3A 2W61A 1BRLB 1V02A 3EB4A 3S1VA 4GX9A 1WZKA 4PUUA 2XTKA 1JCXA 1MUMA 4ROPA 1UA3A 2FFCA 3NEVA 4ADUA 5BRQA 1OFBA 5FAGA 3FDGA 2V38A 1IWAA 5FJUA 1ZGDA 3ONCA 2PS2A 2VR5A 2F6UA 5CC6A 2Z2BA 1WCGA 3EX4A 1EC7A 3QMTA 4NJJA 5A8QA 4DJEA 3PB0A 2PC4A 3BZJA 1JG9A 1UR1A 2JE8A 4Q4PA 1CYGA 1FWGC 1TJPA 1CB2A 4H6QA 5CPTA 4YTTA 4GXWA 4PBFA 3UG5A 4FSAA 2YDQA 2EJAA 3T05A 2R1MA 3ABXA 3S6TA 5E0FA 2VELA 4IHCA 3GHSA 1GQNA 1L2QA 3N2BA 1EA0A 1HXJA 5CKSA 1W3TA 1DL3A 3SUUA 5JBDA 1KNWA 5BXRA 1EOKA 5C55A 5JU6A 1YE4A 1OY0A 3KZPA 3T2OA 4UCGA 4QBXA 1RZMA 3DI0A 1TV4A 3L7RA 3GKFA 2A85A 3CHEA 1FA2A 4OVXA 3CB8A 3S5ZA 3NQCA 2E67A 1EF2A 3OA3A 4Y7EA 2XIMA 3SFKA 1V08A 3MTWA 1GCYA 4FS9A 2I57A 3PZOA 4X0VA 2QF7A 1HT6A 2WJZA 5CAHA 3RCMA 4FOJA 3LBCA 3QV6A 1TWSA 3CMJA 3W2KA 2FH8A 3PJTA 2NX9A 1MWOA 4HN4A 3N17A 4IJBA 5EB8A 1K8YA 4JTFA 3LGEA 3WMSA 3VC5A 5BOEA 4RE3A 1TPVA 1R87A 3M7WA 3I3BA 1TCMA 1TPWA 1UKTA 1QNOA 4DF0A 5FJOA 2J75A 3DC8A 4BS0A 4J1OA 4ZBCA 4MOZA 1I8JA 1Q4NX 2VFIA 1NDVA 4Y9AA 3DFNA 3QPEA 1E9YB 1RUSA 1KQZA 1PSCA 4IOTA 4IPLA 4PMNA 4F79A 1OGBA 3VIHA 1N8IA 4CU6A 1R3SA 3U2EA 3BICA 4N6FA 3IUIA 5CPLA 2Z27A 1QHPA 1HTIA 1UW9A 4CQ9A 4ZE4A 3NQDA 2FMNA 1E5NA 3T44A 3PJUA 1EOMA 3E02A 3WD3A 2QYGA 1XRFA 3SUVA 1SW0A 1KM4A 2ZICA 3VABA 3W1TA 4EIVA 1PWLA 1D8CA 4GINA 3TW6A 1X6NA 3E9AA 5C9ZA 4IX2A 3AQUA 3OEXA 3V5OA 2ZFAA 4RE4A 2BMBA 4XVDA 2GZXA 1TX2A 2CWNA 2Q01A 3B9NA 4MZ8A 4IXHA 4Q6JA 1E4IA 4D1JA 4CU7A 4FI4A 3NTYA 3ANVA 1B3ZA 1E4NA 4JN8A 5DQPA 1GKQA 4DB7A 1EP3A 1TPEA 1KFWA 1QUMA 2ASHA 3QR1A 1EHNA 2BTMA 4K8HA 2B7PA 3W76A 4HNTA 3WLIA 3TMQA 2CHOA 2PWFA 2J78A 4MM1A 2BLEA 3M6DA 4J28A 3T4WA 4AY7A 1O66A 1ML1A 1JCYA 3GYEA 4U3CA 3P3BA 3PJXA 3O9NA 1J0HA 4GOAA 2AAMA 8XIAA 1W32A 4XZWA 4TOQA 3ANYA 2YCIX 3L4UA 2CNCA 5C7VA 4E2DA 5H2ZA 3GDLA 3L12A 3C6CA 1XIDA 1UOZA 4J3SA 3IJ9A 4F2TA 5CEWA 1UR3M 4PRRA 4J9JA 4IPJA 1FWCC 1SFTA 2J8TA 2Y24A 4CN1A 3P0XA 1GOIA 3UY8A 4AZGA 3GO2A 1Z3NA 4FX7A 1IGWA 1BVZA 1TTQA 1XC4A 3F5JA 4C6PA 3L67A 3SQSA 3TAOA 2V5KA 1W1B1 3MCMA 3G3MA 2OEKA 3BVJA 3A6OA 4JD4A 2ZOXA 2CETA 2PDMA 1ZHAA 1B1YA 3JZEA 4DNHA 2VENA 1XLEA 4UUIA 1UYQA 1RSCA 1K7FA 3I6RA 1VIZA 3GXFA 1EB3A 1K7XA 1ISZA 2HS6A 1LQ0A 1YBQA 4S39A 2A3EA 1RPXA 1XYCA 3G1RA 4IM4A 2WMFA 1HJXA 5DMYA 2I9EA 1NAL1 1Y0EA 3SRHA 1E1FA 3MV11 1UH3A 2PGFA 5BWAA 4YU1A 1C8QA 3QYSA 2CLOA 1P0KA 3R0KA 2CFFA 1XIFA 4PUNA 3W73A 3ZR5A 1AH0A