1EYEA

1.7 angstrom resolution crystal structure of 6-hydroxymethyl-7,8-dihydropteroate synthase (dhps) from mycobacterium tuberculosis in complex with 6-hydroxymethylpterin monophosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
256
Chain Sequence
PVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGETSRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLASVADAVAAGVDPARLVLDPGLGFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVISALAALHGAWGVRVHDVRASVDAIKVVEAWMGAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DIHYDROPTEROATE SYNTHASE I
publication title Crystal structure of Mycobacterium tuberculosis 7,8-dihydropteroate synthase in complex with pterin monophosphate: new insight into the enzymatic mechanism and sulfa-drug action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 88
structure length 256
sequence length 270
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1eyeA00
3H2FA 4NHVA 4C1NA 3TYEA 2Y0FA 3TYAA 4DJFA 4O0QA 3H2MA 2YCIX 2H9AB 4DJED 3H23A 4D8ZA 1TX0A 3MCNA 4DAIA 3TYZA 2VEFA 3H24A 4S38A 3H2OA 5JQ9A 4DAFA 1TWZA 1Q7ZA 3BOLA 3MCMA 1EYEA 2DZAA 4NL1A 4DJDA 3TYDA 4S3CA 1Q8JA 4S3EA 3TYUA 2Y5JA 1AJ0A 3TR9A 4DJEA 1Q8AA 2H9AA 4NILA 3TYBA 4DJFD 2DZBA 4MWAC 1TX2A 1AJZA 4HB7A 4S39A 4D9PA 4D8AA 4DJFC 3K13A 4O1EA 2YCLB 3NOYA 2Y5SA 1AD1A 4MWAD 4C1NB 4MWAE 3V5OA 1TWSA 4O1FA 1AD4A 3BOFA 3H2CA 4S23A 1Q7MA 3TZFA 1AJ2A 2YCJA 4S3BA 2YCKX 3TYCA 2VP8A 1TWWA 2DQWA 4DJDC 4CCZA 4S3AA 4G9PA 4NIRA 2E7FA 4S3FA 1F6YA 4DJEC 1Q7QA 4MWAB 3H2EA 3MCOA 3TZNA 2OGYA 3H2AA 3H2NA 3H22A 4PZVA 2BMBA 3H26A 2YCLA 1Q85A 4DB7A 4S3DA 2VEGA 3H21A 4MWAA 4DJDD
chains in the Genus database with same CATH superfamily
4YNGA 3SCQA 4NQ1A 4L64A 4IXXA 1GVSA 1O1ZA 5EY5A 1PV8A 1H7PA 4J3WA 4TMCA 1AZ1A 1B0IA 3F4NA 3PPCA 1AW5A 5ABHA 2V3GA 4I7UA 3MUAA 3D3AA 1TJ2A 1VRXA 1UUQA 5FJOA 3PNZA 1RQBA 1FWTA 3OEXA 1W3JA 3WLLA 3OBAA 5D33A 3CIWA 3B4YA 4QQ3A 2V0TA 1WKYA 4AUBA 4WVXA 4P5UA 4C5YA 1R3TA 3UNDA 2PODA 3M47A 2X1SA 1J93A 5AVHA 3QKZA 3HA1A 1K9FA 5AKQA 4F8XA 4FALA 1UKPA 4R5EA 4MNJA 3SR7A 4FF7A 4EOUA 2Q8XA 4GD0A 3VDGA 1PZ2A 2DU2A 1PTDA 1YBQA 3ITLA 4GO8A 3A23A 3CMJA 2PC8A 1V6VA 3A5FA 4FX8A 3XINA 4CQAA 5I3GA 2A2IA 4Q22A 1TA3B 1EP1A 4XWUA 2XN0A 1K7XA 4AIUA 3MUY1 3FNDA 1E0XA 1F6KA 6XIMA 3BCFA 4XG1A 2GLKA 1QVBA 5DMYA 3I7QA 5LNWA 3S9YA 1Z89A 3LCLA 2ZX8A 2ZUWA 3GNNA 5FEXA 5IBXA 1RD5A 4N4PA 5HDRA 2WZIA 1AQMA 4Q4KA 4H7VA 1SZFA 3MMWA 3ZR4A 2FPTA 1UP2A 3KZPA 4MGGA 3W2JA 2GVYA 3C0SA 4GE8A 3GXDA 4RW5A 2UY4A 2XHYA 4MNMA 3SUSA 3W2UA 1UA3A 5AYBA 1UUMA 3B8IA 1UPMB 1TV2A 5H91A 4Z2LA 1HKIA 3MUCA 4CGTA 4MDOA 7ODCA 3IAPA 1FTXA 4HSNA 3QGVA 2O4QA 3P80A 2E67A 2ZRWA 2YYUA 3D0CA 2PLKA 4PUKA 1CLVA 3GG7A 1OQFA 1OYCA 3FEQA 3NZRA 4E4UA 5I3JA 2GJLA 1ZTVA 3GR4A 2PTWA 4BQ2A 4EPEC 3MBFA 5A1AA 3LHZA 1UH2A 3AIVA 1XRVA 4B2DD 3LI0A 3G1XA 1PYMA 3AIWA 3ARXA 1H7OA 1XJBA 1TUXA 3SSZA 2AAMA 3VO0A 1PVNA 4JIIX 3DUGA 4ERIA 1TWWA 1I2PA 1QT1A 2HVNA 5G4EA 5DQPA 2QCDA 4XSMA 1QOXA 4TOQA 1SFJA 1ITUA 3VNIA 3B9AA 2F6KA 3BSHA 1UR4A 3RMJA 1BPLB 4NZ3A 2ICSA 2X8RA 1BQGA 1QTWA 1DXIA 2CBJA 4DJED 1C8VA 4ICNA 5AHFA 1EFZA 1Y8BA 1FCVA 1AZ2A 3SI9A 3P0XA 3N25A 3WD0A 4XO6A 5K4XA 1I0DA 2MNRA 1RVGA 3FXYA 3W1RA 2INZA 4O57A 3WMBA 3MQTA 1XFBA 3KTXA 1A0DA 1VKFA 3TKFA 1P1MA 4CNPA 3VIIA 2PLCA 3SN0A 1B5TA 3CMFA 3KBWA 4IQDA 1N8WA 2FFCA 3R10A 3AUJA 1V3LA 4FP1A 2QF7A 1ONXA 4AY1A 2A7RA 1QW9A 1J18A 2ODOA 1EA9C 2QDDA 3CPUA 1MI3A 2QCFA 1HVQA 1W1VA 3MV11 2GDVA 3M5ZA 1KM3A 2CESA 3KBSA 4DHGA 4BQ5A 3W7KA 1U1UA 5DT5A 1N82A 1Z32X 3GDKA 2FMNA 3UF9A 2TAAA 1AUSL 1IWPA 3WBYA 2CKSA 3QV9A 1JI1A 2PD9A 3EOEA 3QOMA 4PUEA 3SIMA 2DZXA 4PFMA 4ALDA 2DZPA 1XYAA 1TPH1 1XYMA 1OGSA 3EX1A 5DO8A 3DFQA 4JFTA 2C3ZA 4G2DA 1EBGA 4Q4MA 3C3UA 2BOFX 1D8CA 2D3LA 1U22A 1ZCOA 1NU5A 1W3NA 3T6CA 1US3A 4WKAA 1KBBA 3VGFA 3CHVA 4JN6A 1SO4A 1O60A 4LVAA 1IR2A 4OBRA 3GXFA 4S38A 5HR6A 4NT0A 3IJIA 3D3FA 2R14A 4IG2B 3W7DA 4Q8MA 2FHCA 3SCUA 2VFDA 4P8WA 3WK1A 4HSHA 4KH2A 1B3VA 2B81A 3DDMA 3UY7A 4UQAA 1CDGA 2HNHA 5L6UA 8XIMA 3VZXA 1HIZA 3LV5A 4DPPA 5KEZA 4GG9A 5B80A 4PBEA 4NILA 4DZHA 1LOQA 1ZQ5A 5XINA 3DBPA 4N42A 3WQ6A 2PGEA 2V3FA 4GQ0A 1B2YA 5CC7A 4RZ6A 1PYFA 3LGGA 2YSWA 4JIPA 4AYSA 2E09A 5G1TA 2P8CA 1W3LA 3LRKA 3T0DA 1QJWA 4IT1A 1CIUA 3KOFA 5DANA 1EHAA 4FOKA 3SB0A 2XN2A 3QW4B 2YB1A 3RLUA 4W4QA 4HSOA 4UTTC 1XH1A 3E0IA 3HBLA 3PM6A 1K1DA 3CZEA 3BAYA 4WSKA 1XYZA 2IKJA 2YFOA 2P3EA 1BXCA 4H2HA 5A5WA 3HGOA 3G5EA 3T44A 3UG8A 3R6IA 5A6JA 1JYVA 3COTA 1UD8A 5JH2A 5AC5A 3ZLFA 5TBOA 3FX4A 3QTGA 1W9XA 1PJ9A 1ZS2A 1SMDA 1OK4A 1W3KA 4R27A 3C0QA 1J0HA 3SDOA 3GW0A 1T6MA 3C4UA 1E3XA 4GC3A 3CEUA 2NSXA 1FP9A 4ZL1A 1EJSC 4K8EA 2JGQA 3WJYA 2BHYA 3AXHA 3PJWA 2C1GA 3ITOA 5LYRA 3QC3A 5E9XA 2VO5A 4O8AA 5G2HA 4E3TA 4IMFA 2OLSA 3UXDA 3HGRA 4UOZA 4C6OA 3H55A 3VK5A 3OQ8A 2OEMA 3WQ4A 1FHUA 4PYSA 3VPLA 5D37A 4QJ3B 3HN3A 4RL3A 1B30A 3JZEA 1XLKA 3GX9A 3LK6A 3IK2A 3AXKA 3E6EA 2Y5SA 4H9ZA 3W1UA 4NSBA 3RO6A 3I7RA 1HW6A 3M0XA 4YLWA 1YNPA 5C7VA 4HPHA 2F2HA 4LVBA 3KFTA 3PTDA 5A69A 2XSXA 3SCWA 4US5A 3S5NA 3SM0A 1AMYA 4E2BA 1B54A 1XYLA 3PF3A 1C92A 1F6YA 1S1PA 1XLCA 1GG1A 4YL2A 1CLKA 3LNPA 1EEXA 3R0KA 3EKLA 5BXSA 1O95A 3I3BA 1C90A 2H3DA 1NF7A 2CHNA 3TQPA 4HHHA 1Q6QA 1OADA 1YIXA 1X8FA 1NM9A 2DZSA 5CPMA 1TX0A 1OJXA 3B9DA 3O6AA 2WOQA 1JDDA 4A29A 4AHOA 3FAWA 4H41A 4PUDA 1HL8A 1UH4A 1TKKA 4JTRA 1OT2A 3AFBA 1OX4B 1R3QA 4XIAA 3MSYA 4DRSA 1NTHA 3QGKC 4BF7A 4JIEA 3TAOA 4D1JA 3N18A 3UETA 1XIFA 2H9AA 4K8GA 4ADSA 3IEBA 4LTSA 3O9NA 2FMOA 4RV8A 2ZXAA 2HK0A 3GNOA 4ATDA 4HMDA 3NURA 3CAKA 3W84A 7XIMA 3AMGA 5E6YA 4IM4A 5KZMA 3IJ7A 4WJ8A 3WH6A 1BG9A 4JX4A 2IKGA 3QZAA 1YTKA 3VA8A 1HKKA 1UKOA 3WQDA 3WDJA 3RRXA 1V93A 1VFLA 3W28A 4RZ4A 4LAMA 4TVCA 3SGZA 2CLKA 3KBMA 4UQCA 4PUWA 3BQ6A 2A3CA 3SRKA 3B0UX 5AVNA 3CUHA 4HK7A 4J2PA 4HOXA 3RX4A 5A6AA 4ECLA 1OFRA 3HG4A 3HPZA 3MBDA 1IQ8A 2Q8ZA 2QEZA 2AKMA 4IUOA 4M6QA 3LHYA 1WUFA 4IFRA 4ICCX 1FCUA 1HKVA 4JIHA 1IYXA 1ZLPA 3BMXA 2A3AA 3ZJ7A 1PE1A 1R47A 1BHGA 1ITXA 1U5VA 4E8DA 1XSKA 2XUCA 4HNVA 2CFFA 4NAFA 2QJJA 4FAMA 4B5SA 2WNQA 2Y5JA 2ZXQA 4GACA 3PB0A 2BWGA 4Z08A 2CNCA 1JDFA 3SJNA 3TYBA 1KA9F 1MYRA 1UR8A 5AHLA 4GQBA 4Y9NA 3HG2A 2I5GA 4EIVA 2CLIA 1KRBC 3NZ1A 1NWSA 1U33A 3HG3A 3IWPA 5FI8A 1H0IA 2QCEA 4GYJA 2OSXA 3GUWA 2H90A 5CGQA 1ZJIA 3EB3A 4L9XA 2FJUB 1V02A 2WVVA 4A3QA 3P93A 4HNTA 1TV3A 1D3CA 4GUJA 2NLIA 1XUUA 3XISA 2ZX6A 3K4AA 4MF4A 1XF0A 4EPDC 3LMZA 4N9DA 3K8LA 3IJLA 2Z1KA 1RXOB 3UZZA 4H04A 3VIJA 3OA5A 4PBGA 4O4WA 1B3YA 3OU8A 2J7EA 4GXWA 3O6CA 3E0LA 3BAJA 1XQLA 1GT8A 1FOBA 1UWTA 1TJ1A 3N2CA 2FQIA 5M5DA 3RM9A 2R1LA 3HQNA 1BWLA 1GGOA 1KRMA 3EKGA 1H1NA 5EMYA 4CQ8A 1HG3A 3I6RA 2DDXA 1J0JA 1Z48A 1EDGA 3KS6A 4Q7IA 2HZGA 3TSDA 3TMQA 5FSDC 3WY1A 3CK5A 4C6BA 2D0HA 1ZFJA 1S1RA 4PL2A 2X05A 2YL5A 4LX4A 3WK3A 3VNDA 4LU0A 1H7NA 5DEZA 1EJTC 2PAJA 4M56A 1A5UA 1W5MA 3F03K 4C6MA 4KW2A 3EA3A 1XCFA 3BVJA 4JX5A 4QG8A 4WRHA 1GQJA 2W63A 4K2SA 3QJAA 2A21A 3OVRA 3VILA 2QJGA 3GHRA 4BI7A 1ISVA 1V3IA 2C13A 5C8BB 1B9BA 2GJPA 5FJIA 3N34A 3B0VC 1MXGA 2QCNA 1GQLA 1OD8A 4YJ5A 4X2RA 3TMLA 2WHJA 1T8XA 1TMHA 1OGBA 1ITQA 5D30A 4XBKA 1OC6A 6REQB 3BG5A 4QS5A 4L6OA 5KMYA 5HMFA 2WNWA 4FOUA 5ABGA 5HOSA 1H3GA 3TCEA 2INEA 4C6KA 4PMRA 4AAJA 4GY0A 2CZFA 4UQBA 2R94A 3IUDA 3FOKA 4EK7A 1ONEA 2INFA 3GG8A 4IISA 4PMZA 3R8HA 1IHIA 1VHNA 3FN9A 1DPMA 3SFKA 1K8YA 1TRDA 2AMGA 1V03A 2CZEA 3M41A 5C54A 3SN1A 4P8XA 1P0EA 4F40A 4CD8A 1CENA 5TIMA 3W85A 5LXXA 2WMGA 4DJFC 3JVAA 3HQPA 3CB8A 4DO5A 3EA1A 2C14A 2KAUC 1VEPA 1HJUA 1M41A 5E5CA 5M17A 2BGQA 2OT0A 4Y90A 5LSMA 1MMFA 1ZALA 3VDHA 1MW3A 3S5SA 4H6EA 3DIPA 1L9WA 4JDBA 4HK5A 3AIBA 3ZT6A 4I6KA 3SFWA 1W9UA 1BAGA 3QF0A 3ES7A 3VNZA 1PIFA 4EWND 3MO7A 3JUGA 4UNIA 2V5KA 3HO8A 2YL8A 1OD0A 3W7PA 3M0MA 4N7QA 1Z41A 2CWXA 4HOWA 3T0AA 3H23A 5XIMA 2EGZA 3BGGA 5C9UA 1NVMA 3W2NA 5CPNA 5D9OA 1DXFA 4NZJA 4LF1A 3BPWA 3AS0A 3CPGA 3CHCA 2GVLA 4OOUA 3SUWA 3W70A 3UZWA 5A95A 2D20A 4KCVA 4YN5A 4KWUA 3S6OA 4JEQA 2WZMA 2R24A 2HPMA 4JHZA 4UTFA 1WXYA 3W00A 1KGUA 2NV2A 4U3CA 3DERA 2G97A 1VZWA 1TMQA 3R8GA 3NUKA 4OGZA 4P8UA 1UW9A 4WXYA 4JFUA 5FD0A 2CLEA 2E5BA 5CAKA 1GORA 3B8VA 5CG0A 5AZ0A 1SJBA 3E2QA 4UTHA 5HUOA 3MY9A 3M0ZA 1H09A 1CB7B 2DIJA 5I3HA 3QZEA 1IZKA 3ABXA 3NQDA 3EYPA 1OG0A 4O16A 3NQ2A 4XKYA 5HATA 1CZ1A 2Z7GA 4G1KA 3WF0A 2EBNA 2XTKA 3FA4A 2A7NA 1VS1A 3GLCA 2VOMA 2V2HA 3TROA 5EB8A 2XM1A 2OYLA 2FJKA 3QN3A 3SEPA 4CNSA 2YZ5A 1GVIA 2C18A 3GR7A 2YW4A 4AZGA 4GINA 3W53A 1DL3A 2EG7A 4GQRA 1TCMA 3WBEA 3URNA 1VYPX 3POCA 1EJXC 5K7JA 4MZ8A 2DV0A 4LBSA 1XC6A 3NDZA 2RFGA 3CM4A 4W7WA 1R9XA 3FK4A 2B7PA 4FLOA 1VFHA 4BK9A 3UR7A 4UNLA 2J47A 4MOZA 1K9DA 4JTSA 4HU4A 1BRLB 4DZAA 1TR9A 2DZWA 1G67A 3ZJKA 2BX7A 2OYKA 2HJPA 2OYMA 4O0ZA 1GG0A 2CBUA 3QMTA 3AUOA 4QJ1A 4BFAA 3AO0A 2PZ0A 5CKSA 2V5LA 3WLIA 3HB9A 3CL7A 3P61A 5LIWX 3QY7A 3LCIA 2ALDA 3NGFA 4WDUA 3OLGA 5EMMA 1VFOA 4EPKA 4ZSUA 3B9NA 2GOKA 4NUWA 4A8IA 5CZSA 4B9YA 3LCXA 3H4XA 3NM3A 2J9XA 3MMDA 5F2GA 3HF3A 4Q8UA 4WOZA 4M6PA 2C1IA 4GPNA 5HK4A 4O50A 4H6QA 4LAKA 3V1HA 3ZIZA 3WQFA 3Q67A 1W31A 3V4BA 1IXQA 1XS2A 4HTYA 5AECA 5BZAA 3IARA 4NHVA 2DSVA 4NASA 3U48A 3CTTA 1KWKA 2VDHA 1N2VA 3EGJA 2WB5A 1E1CA 4V15A 1FWIC 3SCPA 2W27A 1VPYA 4LCRA 3CGTA 2VFGA 4UMAA 4K38A 1ME8A 2OU4A 5FF3A 4JL1A 2XG9A 4E4FA 3IS4A 5IFTA 1V0NA 4IMEA 1EYEA 3AI0A 2GL5A 1Q13A 4GQQA 2I17A 3HIJA 1JNEA 3U2OA 1UOKA 2OTDA 3A9BA 3VOGA 3CBWA 4HZ7A 2X7WA 1NOWA 2EQDA 2PDYA 3NG3A 1UWAA 3T78A 4XAGA 1LM1A 3CQHA 3VD4A 5DCBA 4D9PA 4LAUA 4OVXA 1GEHA 3S1WA 5T26A 4I9AA 1BGGA 3BSGA 3GXIA 6A3HA 1S38A 5KITA 3LZ5A 1R3WA 1UH3A 2QDGA 5F4XA 1U1HA 2VENA 4E3VA 3EPOA 1W1A1 2Y7DA 4V28A 5HJYA 3V5OA 4GZJA 4XZBA 3N2MA 2PDUA 3RILA 5IFPA 3H2CA 5FF0A 3W7NA 4Y96A 2GSEA 2WC4A 5IDIA 1BXBA 4LYRA 1WB0A 3E5PA 4PA8A 1XDLA 3KW3A 1NFBA 3GD6A 1MUMA 3ALFA 2AL2A 4KCWA 2QJIA 3LI1A 2BTMA 5IHRA 3BJFA 4DNMA 4DB7A 1X7FA 1KRAC 1SFSA 5U4NA 3JRKA 4CD6A 1KFBA 1TELA 1PDYA 2NX3A 4YVXA 1VF8A 1C29A 3RCMA 5F2MA 4GIYA 2HBXA 4XX6A 5K2ZA 3L0KA 4IX2A 2XWDA 4NAEA 3EWZA 4HIBA 3GWQA 4TU1A 2Y7GA 1IGSA 1ESWA 3I6EA 3STEA 3OP2A 3DBNA 1L8PA 3GAKA 1RLDA 4QS6A 4R53A 1HO4A 1X38A 1PZ1A 2VKZG 1EJVC 3QY8A 4PSPA 1X8CA 3RLGA 4D72A 4JTAA 4ZE4A 4MIMA 3DU0A 2D73A 1QHZA 4HA3A 3P8JA 3UQNA 5DX7A 5F1VA 7CGTA 3M16A 4C7FA 5CZKA 3I68A 2OVLA 1HUVA 1C7SA 2VR4A 5FEZA 3LSCA 4Q7BA 1V51A 3VD3A 4KT2A 4GK8A 3MHUA 3DOPA 5FCZA 2EJAA 4J3XA 3GXNA 3EOOA 4PMYA 5BOOA 4ZB0A 4KEUA 4ZBCA 1YW1A 5EFFA 5F2LA 1EC9A 3ZO9A 4B5XA 1UG6A 4CNOA 1K02A 2WM1A 3LHVA 3FA5A 1GWJA 1RCQA 2ABBA 1OYAA 1F8MA 2DUXA 2FZMA 3DFSA 3C6CA 5EU9A 3GK0A 3S2LA 4D6GA 1JULA 2Y85A 8XIAA 4AX6A 2VFFA 3R58A 4F79A 4MM1A 3WQ8A 2ZQ0A 4WY0A 1UD6A 3QSTA 2GQAA 2XH2A 1XIGA 3L2IA 3PBYA 1I60A 4AZIA 1SZRA 1MZHA 5RUBA 4JTEA 3IK4A 3W83A 3G1YA 3NYZA 2YXOA 3CIVA 1PX3A 1YKWA 3S3GA 1GOKA 1FHVA 4YVPA 1ELSA 1D7KA 3V1PA 2I14A 1IZCA 2ZZ2A 1E51A 5CPLA 1YDYA 4F3HA 3P81A 3I4KA 4U2ZA 3OJGA 2VT0A 3P74A 1O7AA 5JH1A 2B7QA 1S2UA 5MKGB 1J9YA 2PRHA 4O1EA 4GJIA 4MJZA 4X2PA 4O1CA 3R43A 5HINA 2XH4A 3VKBA 4CVWA 4GYFA 1ZBWA 4N6EA 1LROA 1F61A 2O9OA 3WNMA 2QUNA 4JQ1A 4DYJA 3QV7A 5IM51 3I6TA 3EPNA 1UROA 1EC8A 3WQCA 3M5YA 1FQ0A 4ML4A 3RN6A 3EWDA 2BV9A 1EIBA 1EC7A 1XLIA 1E1EA 4PTVA 4BKNA 2XGBA 3GNXA 3KL0A 2NWSA 1MRAA 1FWBC 3UWEA 3NQVA 1M6JA 1E6SM 4CKQA 3LM7A 2YDSA 3EWWA 1B9ZA 4RE0A 1CGXA 3HZ3A 1FWRA 4AF0A 3N2OA 4IQEA 3IVSA 1OFDA 2J8FA 4GX9A 2HXTA 1O94A 2QUMA 3P2VA 4RNJA 1ECQA 3BLOA 2POZA 4WD0A 4FMVA 4YMZA 2OR2A 2VGIA 3AMLA 1DJQA 1NJJA 3KS5A 1V6YA 1XLGA 4GH1A 3ZZ1A 4DWSA 4JQ4A 4RLIA 4RE2A 3PVFA 4P7OA 5CH9A 1Q2SA 3ZJ6A 3GU2A 5BROA 2CBVA 5DFAA 4O11A 1EUNA 5HWJA 2O7QA 3C8NA 2EPHA 4LJ3A 4B5UA 2PGRA 4A8RA 3AICA 4J2MA 1OEPA 1HJSA 1M04A 3NPUA 5A8MA 2DT2A 1RK5A 4R7JA 3CV1A 1PUDA 1TPC1 2WVSA 4FIRA 4XZ9A 1VBUA 4DUVA 3QFEA 3DYPA 4LRSA 2Z25A 3OW1A 2QKFA 2PMQA 3BCJA 2O56A 3V7PA 3EPMA 5ENLA 3EXTA 2I56A 1XBVA 3ALGA 3QFWA 1UZ4A 2V3EA 4CN1A 4CN6A 4GO9A 3UWUA 2NT0A 1S2CA 1FHDA 3AWOA 3F5KA 4XZWA 1J0KA 1XL9A 4WXZA 4JY9A 3K8MA 4ADUA 4M5PA 1MXSA 3W7RA 3ZJ8A 2Z6IA 3PPGA 3EOSA 4C6JA 5A6KA 1E1FA 1FXQA 1K6WA 3BV7A 2GYIA 1F4HA 3GVQA 3N6HA 3KOXA 4IPIA 1A47A 2IQDA 4RW3A 1E9ZB 4KFPA 1QI5A 4QDWA 1LTDA 1KC7A 3WIJA 1AVAA 4BA0A 2JKAA 3VX1A 2WANA 4MJMA 4REQB 3RCYA 3SN4A 2BY2A 5I07A 2GWGA 3M0KA 4ML9A 3GXTA 1HT6A 3NQ8A 1KQZA 3LCGA 2ZUMA 1Q4WA 1TPEA 5LHFA 1PAMA 3W22A 3OBKA 2QS8A 1Q6DA 4AMAA 1V7YA 3BTNA 4W8AA 3R2GA 1CGYA 1KFLA 1EO5A 3TONA 1LUCB 4JICA 5CGMA 2GOUA 1NFGA 4M0XA 2Q09A 1OFOA 4DJDC 3LY0A 2Y2WA 1G5AA 1K70A 4JYEA 3NXFA 3O8AA 4WGXA 1S5MA 4Y6GA 1WDRA 1EZWA 1XGDA 3FFSA 3LLXA 1I45A 3IPWA 1JGMA 1QOPA 3T4CA 4OE7A 4WOQA 5JVLA 3EDJA 1G4SA 1W8GA 2W91A 4JTIA 5CZ0A 1GVYA 2OLAA 3RU6A 3DXIA 2I57A 3E2RA 3DYOA 3BARA 3NPVA 4QNWA 5AB3A 2NQJA 3SJ3A 5I02A 1YNYA 3RPTA 3GVWA 1Q66A 5AHMA 2PU1A 4UBPC 2GDUA 4L4MA 3WLJA 2REQB 3FJNA 1Y65A 3BAWA 5CAHA 4W5ZA 2QVHA 4LXFA 4RNHA 3UFYA 2J7GA 4GIEA 3C2YA 3KP1A 4FNUA 3A6OA 2X0SA 5CSSA 3W29A 3W2MA 2C0HA 3ELFA 1ISXA 1YDNA 3UWWA 3K2GA 2P10A 5FSEC 4MJ4A 2NUXA 1HQTA 1J0ZA 5CG7A 4HPNA 4AXNA 2DIEA 3C0JA 1G7VA 1M7XA 4XKMA 1QPRA 3GRIA 1UD3A 1WUEA 5JMUA 3Q65A 4BQ3A 4P7QA 4IP4A 1L6GA 4GFIA 1G6CA 3E12A 3UA4A 1VBGA 4WDWA 3ANUA 2CCRA 1THFD 2ZBTA 1ECEA 3N3TA 2WO5A 4W87A 3SCNA 3H2OA 1VYSX 2QAPA 2OEJA 5A8GA 4A05A 1GVRA 3K4WA 5GJNA 4HVXA 3UXKA 3USBA 1OB0A 1OZMA 2PF8A 3GDTA 5I06A 3W74A 4POCA 3L12A 2YDRA 4HHMA 4UQDA 1TVPA 1W3HA 3M0JA 2V30A 1SW0A 5C2XA 2IPFA 4BR1A 7REQB 4HNUA 2X7VA 4GGBA 3U4FA 5IBXC 5BYWA 2WHKA 3VINA 4GI4A 5LA1A 3S0CA 3OZOA 3K46A 3ZVHA 4JTHA 3V0UA 4UOJA 1QI4A 3IV8A 4AWTA 2W67A 3G1HA 5FAJA 3DFNA 2QYGA 4UMCA 4FXJA 1GKQA 5D04C 1SQ7A 2OFJA 2WMJA 1V3JA 4CCCA 1E6ZA 3PZ9A 1KR0A 4LANA 4GMEA 3VKKA 3GVRA 2ISSA 3UNTA 4OU1A 4BWLA 1QPQA 2ZICA 3F4VA 5LNRA 2UBPC 4ERAA 3PFMA 2X2GA 3AIUA 1EF2A 1VP5A 2JALA 3ZM8A 4H01A 3VMNA 4DJDD 3LXAA 1FRBA 2AGTA 2A3LA 3G0SA 3RGTA 3AHZA 2YCIX 5LA0A 2QJMA 1XDJA 4FPSA 2VGGA 2EXOA 4AD1A 2OQYA 3GAYA 1KW1A 1POJA 2ATSA 3APTA 2ZA1A 4CN4A 1XIMA 1QMLA 2DH2A 2PPGA 4MKVA 3BGJA 4S3JA 3HG5A 1PZ3A 4NJGA 1VH7A 3UY8A 1REQA 6TAAA 1GOIA 1JPDX 3WJXA 5G4WA 2QHAA 3GSMA 2CZDA 3TQVA 5A2CA 2NQZA 3LG3A 2W92A 5ABFA 2XGZA 5BWFA 3WNLA 2WCSA 1QATA 4JZ5A 4KWWA 3CWNA 3U8GA 1UKTA 2ZZ4A 2OLHA 2Q02A 3WLRA 4QEHA 1EXBA 1ADDA 1M68A 2CITA 4M19A 2Y5EA 3N3MA 4J35A 1PKMA 2YCJA 3VM5A 3BLDA 3N13A 3O06A 2H8ZA 4Q3MA 4WDXA 1AW1A 2FB3A 1W1PA 1AQHA 3C8FA 4H4IA 2X42A 4PRWA 4G7FA 4LC6A 3HPFA 1XIBA 4P7LA 3P3BA 1ONRA 5BMXA 3WO8A 4PB5A 3SECA 3V18A 2YBVA 2RDUA 1OCQA 2C71A 3PSVA 1TA3A 3TJLA 3VNMA 5AHNA 4FA3A 2OQHA 3LCFA 5C2CA 1E6PA 2X0HA 3NQFA 2J77A 5EMKA 2QF8A 2WQPA 1HXJA 1LBLA 3KCLA 4HJWA 4DBUA 4YYFA 2X1UA 3NZPA 1I0BA 5M2FX 4DXVA 2WMFA 2ISDA 4RDZA 1GVFA 3TYDA 1DEDA 2A79A 3CLMA 5HANA 3UWVA 4ONVA 3BANA 5TNVA 4DF0A 2CXEA 2JF6A 2E8YA 2R6OA 1UB3A 4D8AA 1G69A 3SGGA 3TU9A 4KRZA 1LG1A 3DHUA 2XVKA 1VR6A 4PEKA 1UWRA 1SO3A 2QVNA 1JL8A 7A3HA 4TUFA 4UTUA 4O53A 4Y9OA 4LEQA 3AS1A 4GVFA 1EPVA 3MJMA 3GTXA 1LLOA 2DQWA 4JD4A 1MQPA 3KX6A 4CQCA 5H8MA 4U5IA 2OO0A 3O16A 3PZVA 1D7FA 3K1DA 2A3EA 1JAEA 4ASTA 4K1GA 1WZLA 1F7BA 1BXNA 2GVEA 4H9UA 3F1QA 2I9EA 1YX1A 2E5CA 4L9YA 1E71M 3VIFA 1DKWA 4J3UA 1US0A 1S5NA 3TCSA 1M7PA 5BNKA 3RAOA 1V3KA 3DESA 3OTRA 4PMUA 4LPCA 3VCNA 2QGYA 1IIGA 1W1TA 1V3HA 1NQKA 1H4PA 4U4MA 2ZXBA 5E6ZA 3O07A 1PPIA 2GQ3A 3VCCA 2VZUA 3MMUA 5I3FA 1QNRA 3GBDA 2WVUA 4ZE5A 4KEMA 4WX2A 1RA5A 4DO6A 5K4ZA 2D69A 1XGEA 3V0TA 3ID7A 3PBUA 5HNTA 4K37A 2DZBA 1XG3A 4HB7A 3BC9A 3EA2A 3FYPA 3MC5A 3MI2A 4DO7A 2JKPA 2VC6A 4IOTA 4R9XA 4LYPA 3A4AA 3SUUA 5GQBA 4LT9A 2GQ9A 1PB0A 1XKJA 3HFTA 4AD3A 4C90A 1P6WA 3EMCA 5BRPA 3KRSA 4MWAE 1I2RA 4P2VA 4GY7A 3JS3A 2OZ0A 4HPGA 5CSRA 3PFRA 1TVLA 2QCDB 2VQTA 1FFRA 2V38A 3I7SA 5I79A 2Q3RA 1M03A 3ARZA 3SQLA 2YA0A 3W6YA 3TXVA 3V36A 2VFIA 4H8UA 4KCUA 2ZKMX 1TPDA 5HMSA 2OT1A 3R0UA 2A3BA 1HTIA 1TB3A 2A6LA 1JNDA 5I77A 1XP3A 1U5JA 1HX0A 2WKJA 2BXVA 1F76A 2YX0A 4P7NA 3I4EA 1OF6A 4MZYA 4Q4PA 4TV5A 4GHRA 3WJWA 4QQUA 2G37A 3OG3A 4X60A 3CUZA 4U5KA 1XBYA 4LV9A 1JGIA 3F4WA 2Y70A 1O4UA 3BW3A 1FWSA 1BG4A 4ILSA 2P8BA 3TTYA 2Z27A 3L4WA 4NZ1A 5GNYA 3TJXA 1H63A 2V67A 3PPHA 4KWOA 2I7GA 3UT0A 5FEWA 1FX6A 3ES8A 5DXXA 3D47A 3P6LA 3VAVA 4K36A 4KIEA 3P5YA 1TWIA 3GZAA 4C6DA 1HL2A 3EB4A 4E5TA 2R1PA 4IG2A 2PTZA 1GZ1A 1CLXA 1ZL1A 3L4VA 4C6NA 2GGEA 3PNUA 3B9EA 1XPYA 1TREA 3GNDA 1XLLA 5D9PA 1RPKA 3VZZA 4X63A 1R6WA 2BOEX 4UFJA 1CBGA 4W84A 5A6LA 1JZ4A 3B97A 4I9JA 2HS8A 4JTTA 1RPXA 3NL3A 3CHFA 1XIJA 2VD9A 2OGYA 3NQGA 4RKAA 7TAAA 5EGRA 3WENA 1Q85A 3TW6A 3G1AA 3WNKA 3B40A 1YQ2A 3MI6A 3VXGA 4AIBA 5FJUA 4PMJA 2WCGA 1SJAA 1UWQA 2X09A 3HQ1A 1NDYA 4U33A 4P8VA 1BVNP 1IWAA 1QFEA 3VMPA 4KRTA 2BY3A 5BXTA 5BRQA 3CASA 2WSRA 2CKRA 4PTWA 3PZQA 3O1NA 2HE8A 3BAIA 1OSEA 4LBUA 1F2JA 3IIXA 1GZJA 2Z2BA 3A13A 2V69A 1KBIA 3W6MA 2IQ0A 3L4TA 5LIXX 4UNKA 4WHBA 3N12A 4MY8A 1DYSA 1JIBA 4J3ZA 4RPPA 4RDWA 1QR7A 1XLJA 4MDPA 1MWOA 4LALA 4DVOA 2DORA 2Z7KA 4HU3A 4RJEA 3WH9A 1WNOA 3IJDA 3GY1A 4HCDA 3SY8A 3LLFA 2FKPA 3EEZA 1RALA 3PANA 1KKRA 2ABAA 1E9LA 1VIZA 3PJXA 1AMKA 2WNZA 3GG1A 1ZJBA 3BMWA 3P14A 1FY6A 3U4AA 4MKNA 2V5DA 5JBEA 2HQAA 5DMMA 3OGVA 4HA1A 4OZOA 4IP7A 5B7YA 4H9XA 3R1ZA 1H2JA 5ECVA 3PBMA 3KRUA 1A5BA 4JN8A 1JCLA 1OZQA 4GC4A 5BW6A 3MW7A 3IGHX 1QNSA 2QNEA 1GONA 3Q4DA 3HV9A 4KMQA 4FB7A 1P0DA 1S3TC 4AB4A 3N14A 4KCTA 3R79A 5L9FA 3AQUA 4AZ5A 3BG3A 4ROPA 4LCQA 1KTNA 3NEVA 5F4WA 1TZ7A 1K8CA 1V4YA 3SY5A 3HJEA 2BB0A 4HHPA 3BURA 4JX6A 2HVMA 2F2KA 1V6UA 4QSFA 1Z7AA 4ZB2A 4GBDA 1IIHA 3E2SA 4A21A 3W7EA 1QBAA 3N6JA 4QBXA 2J74A 3W1QA 3ITYA 1F8IA 4UTKA 3I3EA 3TDFA 3U57A 5I24A 5D2YA 4DF1A 5AFDA 1GOMA 1WA3A 2A85A 4US5D 3RFAA 4XUGA 4ZQOA 4PMNA 4AWSA 4LYQA 4K39A 1W5NA 1AQFA 1YE6A 1XLDA 4GA8A 4EX4A 4WF7A 1BTMA 3UR8A 1V0MA 1AD1A 1JI2A 4C6QA 1ZJAA 4O54A 3N4AA 1CNVA 2DSKA 4UZSA 4KEVA 4J4KA 4KWSA 4K1WA 3JW7A 3ONCA 3LENA 4GYPA 1H5VA 2C19A 2E1WA 4L61A 4GGHA 3WBWA 3W7GA 1XYBA 3C5QA 2FTWA 4V2XA 1JRCA 1K9EA 4O52A 4DBSA 4IQLA 4F48A 3H21A 4JNZA 4FF5A 7PTDA 4AW7A 2OELA 3TSBA 1LOSA 1LLZA 3LQLA 1L6FA 4PMDA 3UESA 2QJHA 4QLKA 2IMRA 4RZBA 1ISYA 4Y7EA 1A5OC 2Y24A 3Q58A 1TTIA 4DAFA 2D24A 1PDZA 1SR9A 4YCOA 3CV2A 5BWAA 3EX4A 1SUXA 1VQTA 1OC5A 1DIKA 2AQVA 3KUMA 4BF5A 3G8RA 1FP8A 4HGXA 2WKLA 1R8LA 1Q8JA 5CC5A 2OXNA 5EMLA 3TR9A 3PWIA 4N0RA 3A47A 3CTLA 1ADOA 4B4HA 4HYWA 1UPPA 3TN3A 1XI3A 4DIAA 1H0GA 2PGWA 4UTJA 3VGGA 1VD6A 4NNBA 5D8ZA 2HTMA 3HMJG 1UP3A 4W7UA 4AX7A 2XIJA 4LUSB 5F7UA 4GUHA 3LPPA 3VD5A 4EWJA 1VC4A 2QIIA 3PWGA 3USZA 1U1JA 5H8UA 3PZTA 3LBMA 1LYXA 4QFUA 5A3HA 1R3RA 3SGUA 1KM5A 1UUOA 4UCGA 1Y5XA 3BLIA 4PTNA 1RP9A 4JAWA 4XISA 1UWUA 3WBXA 3CYJA 3LM3A 4IMDA 4RPQA 4HU0A 4UR7A 3WN6A 1KTBA 1CECA 2EKCA 5HQLA 4JKMA 1KFEA 1KGXA 1RCXB 1KCZA 2XINA 1G4EA 5T9CE 4PUJA 4ZOCA 4Y9AA 3OO2A 3GTIA 3GYCA 4DBWA 5JBDA 4KPLA 4NJIA 3O6DA 1NQ6A 3IGSA 1TCDA 2BODX 3QYQA 1J2BA 3TTQA 5FESA 4CU8A 5DRCA 2AL1A 2DPEA 2GUBA 5TAOA 2PDFA 1E9YB 5FIPA 5JQ9A 1TWZA 2VL4A 1SFLA 3PZOA 2HK1A 3VGHA 1E6NA 3NVDA 2OX1A 4GVHA 3AISA 2ZE3A 1G01A 2QT3A 3E96A 3GVVA 2YCEA 1EP2A 1QASA 3G3DA 4IFKB 1CGVA 1AJZA 8A3HA 1C8XA 2TPSA 1JQXA 1TVNA 4IMAA 4Z2JA 4S3GA 1P7TA 4JNMA 3RO8A 3CXOA 1LL4A 4AWUA 5D2TA 5LIUX 2ZDRA 4DI8A 4AWEA 3P0WA 1OCJA 3UJ2A 3GU1A 1LT8A 3VMOA 3R0DA 3WF2A 3W7CA 3YPIA 3Q2DA 1ZSXA 4V27A 1KTCA 1DTUA 3EMQA 3W1XA 3URBA 4IP5A 3WL1A 4LUTA 2J7CA 2VM8A 2CLMA 3K4DA 2DSZA 3FJLA 2V5CA 1V6WA 1NWUA 4R85A 3TWBA 1O5XA 3UCDA 1R46A 1E0VA 3IVUA 2HROA 2C91A 1Y0EA 2VGBA 1TZZA 4MB4A 5MHBA 2CLHA 5HBFA 1A5LC 4RUBA 2GSHA 4F0SA 1E4MM 4HQVA 4FEZA 3O05A 1B3OA 3PBGA 1MUWA 4N2YA 5TD4A 5A6SA 3GG0A 2NQ5A 6REQA 3ARRA 1ZP4A 3OB8A 2CIPA 2J8GA 3APYA 1O1HA 2HEJA 3Q45A 1YADA 1EXPA 3CAVA 3O15A 1VYRA 3KVKA 1MW0A 5LA2A 3DGBA 4ZTXA 2XIMA 4EVZA 4D6EA 1KXVA 4YHEA 1EDQA 4X3ZA 4I90A 4GNJA 3MDUA 4KIRA 2G4FA 3GM8A 3G22A 4EF9A 4Q32A 3AJ7A 1EJRC 4MAVA 2ZUNA 4X61A 4UFLA 2XH7A 3FVMA 3R12A 4CCZA 2IUZA 1R3SA 2PTXA 4ZENA 4UTWA 3N15A 3VNKA 1PWMA 3QY6A 1I2OA 5FF2A 3LB0A 2E6FA 4LWWA 5GJPA 5HUPA 3ABRA 4EE9A 4WEVX 4IH3A 3KL3A 2O4MA 1KQYA 3R8RA 4LNCA 3GFYA 3H6OA 2GGGA 4QISA 4LAOA 3L4ZA 4EF8A 2E3ZA 2BASA 5A6TC 3II1A 3QSRA 3TV8A 1GTEA 4L1GA 3HPXA 4NKCA 4WY0F 2WWCA 3TC7A 2X0YA 5U7SA 3V5FA 1B3ZA 1UQYA 1XKYA 5G4HC 3WNPA 5D05A 3OZYA 5HWNA 4A3YA 4F0RA 1L6WA 3P82A 3S9IA 3PJTA 1H60A 1JR1A 1NP2A 3MV01 1VFFA 1BF6A 1PKLA 3MVIA 3R89A 2WZTA 2WM0A 5EMUA 2PDGA 2WLYA 4K7VA 2GDQA 4O1DA 3RXZA 3WKZA 4B15A 5EBAA 3QLDA 2PZNA 3WUGA 1A50A 2VELA 2PWVA 3DFTA 1PBGA 4E2OA 4QSHA 4L9ZA 3BW2A 3ZLHA 1W32A 2FB2A 1FA2A 1J12A 1DJXA 1IV8A 2CPUA 3C61A 1X6NA 3MHGA 1MDRA 3FSTA 4QE1A 1NP0A 3IIPA 3AXIA 2EPNA 3QR3A 3GH4A 4O15A 2QJNA 2QW5A 1OY0A 1Q4NX 2JE8A 3SRHA 4Y2WA 1UZDA 4DO4A 2OZ3A 2FH6A 3M46A 4GZIA 3TN5A 2VX5A 1BFNA 1DE5A 4UTLA 2JQXA 1TZ9A 9XIMA 1CWYA 1XIEA 5LNUA 5LXEA 3IJQA 3QTPA 5C9XA 3PS7A 1K3UA 3IUIA 2CHRA 4MADA 3T08A 1T7LA 4MFEA 4WJXA 1OVDA 3GH7A 1DWAM 3PTKA 1AL7A 1RY8A 3VX0A 1EA0A 1DQWA 3ABZA 4WLCA 4HNLA 1IEQA 1J0IA 3AALA 3W6LA 1PX4A 1EBHA 4WKHA 4K8HA 1QW7A 2W3ZA 4DZ5A 4HU8A 2UV8G 4Q33A 4DLMA 1MDLA 1VEMA 5C0QA 2HVOA 3KOZA 3QQWA 1HO1A 2ON3A 3PHAA 4DYEA 1ZBCA 3B0XA 3W25A 1TV5A 1GQIA 3GZ3A 1MXDA 5T8GA 3KBVA 1AD4A 3SW6A 1Q7MA 3H7RA 4QNEA 1MO0A 1YPXA 1C91A 2YB4A 1NY1A 2XN1A 3MB9A 4XKYB 1XIDA 3RJYA 5C5YA 2WXDM 3O2LA 3UXLA 5AHEA 3W1NA 4ACZB 4UXDA 1HGWA 1AH3A 3A3WA 4ROQA 4BHYA 1MNSA 3FDKA 4MWAA 3ERPA 5EYWA 4IIDA 3RPDA 4D6HA 2YGYA 4QHRA 3B8SA 3WYZA 1GHSA 4H9YA 3APGA 2FHBA 4HK6A 4MPQA 2C8NA 3PZMA 4CNNA 3KXQA 2YDQA 4E4PA 2HS6A 1Q3NA 4O1AA 1GPWA 1L6SA 3EZ4A 4KEZA 2ZRYA 1FFQA 5HXMA 2GJNA 3D5HA 3M64A 3UPBA 4LS0A 2XPKA 3WLNA 3RITA 2JFEX 1AFSA 2DJXA 1L6YA 5EBUA 1X1OA 2QULA 2CLFA 4GY1A 1D9EA 3CWOX 1IR1A 5GPRA 4ZO9A 3PSWA 4YIWA 2V68A 4GIRA 3VNYA 2Y88A 3VD9A 1QNOA 3VD7A 2WSPA 4XBJA 1XINA 4HD5A 4UUIA 4IJBA 4NJHA 2FGBA 1XH2A 4N9CA 3UERA 3G3MA 1R2SA 3AZSA 2G3NA 2NX1A 4IQJA 1RD6A 2W4XA 4W5UA 4LVDA 3QPEA 1M5WA 5PTDA 1TTPA 4Y8EA 1IT8A 1NIUA 4FR6A 3T9PA 2OZ8A 1QXLA 1ZP3A 4O1BA 4QJ5B 4OKDA 2GQ8A 1XSIA 1R86A 4YWIA 3CWHA 2GUUA 1OF8A 4N9EA 4X22A 3VIGA 1D3GA 1JYWA 3QXBA 3K30A 3W38A 4PB3A 2PF0A 3TW7A 3GHUA 3GO2A 4JFVA 4JEJA 4JQ3A 1RAKA 3FEMA 3A4WA 4Q8NA 3RG6A 1WOBA 4OT7A 4DUOA 2IXUA 5D38A 2PE4A 4G56A 4UOQA 3UD6A 1R9ZA 4N6FA 1KFCA 3TK7A 1LL7A 1R2RA 5AYIA 4Z2KA 5G1MA 2ZIDA 4MMWA 1EP3A 2NUYA 1M53A 3EB2A 4UIOA 3F4CA 3NQEA 3TOPA 2VR5A 5DCEA 4EKJA 2PDMA 4L6DA 3H53A 3LBCA 2ZUVA 1GYNA 4ICMA 2F9RA 1NAL1 4QAWA 2I1OA 4PUNA 3T0CA 4DWSC 2W0UA 3E38A 2AL2B 1B90A 3H4WA 3CUXA 4CNTA 3TTSA 2NV9A 4JKKA 1DJNA 4Q6JA 2R1KA 1TWDA 3MP5A 3VTRA 2JBMA 3LPOA 3HURA 4IIEA 1TV4A 1H51A 3OIHA 5HPOA 3S1GA 1XHGA 4JQAA 3FAXA 2ZA3A 3L7RA 4PUUA 2ACSA 4LY8A 1YTEA 1JYXA 4HPXA 4B5TA 3NR0A 2W9MA 1FWNA 2OQLA 4AY8A 2E77A 3SY1A 2DH3A 1CI1A 2RJGA 3CNYA 1K7FA 2ZC1A 2IS7A 1PKYA 2QUVA 4PCFA 4H3DA 1X97A 3NJ3A 1O5QA 1E0TA 3A9IA 3RLHA 3NIYA 2ZUSA 2PDBA 1ZY9A 4OECA 3WQ5A 2G0WA 5CC6A 1HKWA 3N9SA 4IICA 3N2XA 3AIRA 1C3FA 3RX3A 5TF0A 4ATLA 2MUCA 3L0GA 1AJ2A 1BWKA 1PIIA 2YCKX 1H50A 4FNQA 1DJYA 2GSJA 1QDSA 1DWHM 1ZAJA 3O3RA 3CO8A 3BICA 4AIEA 4PBFA 5MKGA 2NXIA 2O9RA 1KXQA 1I1WA 4KETA 2JIWA 3TZNA 8RUCA 2V9DA 1S39A 4LRTA 2C15A 2YLAA 2JK2A 1W6TA 4AD0A 3TYEA 1DBTA 4WY0B 4CUCA 3VDCA 3C2RA 3RRAA 5KZEA 4L4PA 2ZFAA 4ZO7A 1P48A 3VIKA 3NQ7A 5E0FA 3GKFA 2E40A 3CO4A 3ITGA 4RE3A 3KTCA 3W7OA 1WDWA 2E6AA 2GFTA 4B3KA 3PZNA 1QNPA 5K9DA 3ARPA 3MCMA 2C79A 1S5WA 3QPZA 1G4PA 3KE0A 3N9RA 4S3CA 3VIPA 1A49A 1Y7VA 3AIEA 4ZR8A 1K4HA 2VEKA 5JUVA 4D6DA 2KZHA 3AZRA 2B31A 3K13A 3KVLA 1E72M 3STPA 3L4UA 5G1YA 4J3VA 2ZUUA 2XH0A 4UR8A 4Q4SA 1CGUA 3AS3A 4O12A 2LLEA 2XSBA 2DSWA 5JXQA 1ZAIA 3DI0A 2VZVA 4PL1A 3V0SA 2ZZ3A 3VDBA 1M3UA 2Q01A 3KRZA 4KGJA 1W3IA 1EDTA 1POKA 3S5ZA 4FSAA 3NQCA 4HCLA 4CD7A 5CLWA 4QX4A 3U2ZA 1E0WA 3QC0A 4TMBA 3VI2A 4DWSD 2QMJA 1HN1A 1H1YA 3AYTA 3NVTA 1JDEA 4Z1YA 4XZNX 2QCGA 2IKIA 2V5BA 5XIAA 1NDZA 4JXCA 1AH0A 1JJKA 3EWYA 3TA9A 3LXBA 4GUFA 3CLWA 3N04A 4AEOA 1RQHA 4PMVA 3AU6A 3LCWA 2NQHA 2VNCA 2PDKA 3EWCA 4LBRA 4NXKA 1VENA 3GE7A 5E0CA 2VXNA 1DQUA 4NX5A 4LUIA 1JPKA 2DZUA 3EX2A 3U2EA 5H6HA 3B8UA 2HBVA 2XIIA 4PCTA 3O6YX 4MUPA 2VMFA 3FA3A 2A4AA 3WUFA 4HMEA 4B90A 2DJLA 1LWIA 3JZUA 4ZOEA 2PDIA 2ASHA 4AC7C 3MYOA 4P7RA 1CGTA 1WBHA 2NV1A 3CV7A 3UJEA 2GUYA 3MUXA 1WOAA 3RF9A 4RNFA 1P5BA 1YE4A 2WMIB 4O10A 1GK8A 1E4IA 3UYIA 2GGJA 4M8UA 1ENUA 1JDCA 4REQA 5CPQA 3EEGA 3FCPA 2YIHA 1P0KA 4U10A 1JUEA 3ICJA 4GCXA 4C1LA 1JCXA 1UR2A 4GCAA 2Z28A 1LT7A 4QDPA 3O0FA 3ZMRA 1KBLA 4HT3A 2PWFA 5LHEA 3CHEA 1PXGA 1XWYA 4FI4A 4ORMA 3KWXA 4E2DA 4JTKA 1CW2A 4L4OA 4NJJA 3MWAA 1DIDA 4AZCB 2Y89A 2DVXA 1YXYA 4NI8A 4UFKA 1W1B1 2VVSA 2I5IA 1ML1A 3EOUA 1NF0A 4BWLC 5C55A 4JTDA 4INFA 4LS1A 3FJ6A 1E56A 2ZWYA 3KRBA 5T9BG 3O63A 3WCZA 3TJIA 3PZIA 3QHMA 1R7OA 1WDSA 2CBIA 4DF2A 3GW3A 5J8LA 3T40A 2QPSA 2Z1BA 3GC4A 1Q63A 4QCEA 4YTSA 3G1VA 1TE6A 2OODA 3TIMA 3UGRA 3BLPX 4MY1A 1F4AA 3ZWSA 3LSBA 4NZCA 3CQIA 4YYCA 3W2LA 3RR1A 2REQA 4AIOA 1L2QA 3IIOA 3SQSA 4HNNA 5I3DA 1WDDA 2E68A 2H8XA 5DN1A 4D8LA 3W86A 1EJ7L 5FL0A 1G7UA 3RU8X 3H2NA 3IVTA 3B0YA 1P0BA 2EHHA 3PP7A 5LNVA 5IOBA 2TYSA 3BQ5A 4L1WA 3F2DA 2RUSA 3AIQA 1AQ0A 1FHLA 4KWVA 1KXTA 3LGDA 1P6CA 2J7DA 2QDHA 4XD4A 3WMSA 4MTVA 2GJXB 1PTGA 4GZ7A 1HJVA 3BOLA 1K6AA 3GU9A 2O55A 4FLQA 5D02A 5K3VA 2CLLA 3RIKA 4YTQA 1X1ZA 2CZ5A 3ITTA 1Q5MA 3LPGA 2VR2A 4BF9A 1BSIA 3W88A 1MQRA 2E5DA 1G94A 2QCCA 1GZGA 2Z2AA 3WQVA 4ZSTA 3S83A 2CXGA 2WMHA 1NDWA 3WLHA 3T2QA 1PEZA 1B4KA 1R38A 1XW8A 2VCAA 1CYGA 1MFVA 4R34A 3W73A 4XTIA 1QHOA 1MW2A 4QROA 4LVFA 1KM0A 2EAWA 1Q2RA 4G7EB 4U31A 4QG6A 2I16A 4JTQA 3ZOAA 5GNZA 4GIAA 4XD5A 5HULA 5HMDA 2V6AA 1UMLA 7ENLA 1V0LA 1NARA 4R7OA 3T8QA 4C6PA 1JCMP 1BD0A 1VGAA 4L7ZA 5CBIA 1TR1A 3CUGA 1ZB5A 3GDMA 4I7WA 1I6NA 2VVNA 4AVNA 4C6LA 3LEPA 4QG9A 3M6DA 1OM0A 4M1BA 1XFCA 4M51A 2WMKA 3KM8A 2Y4SA 3WG6A 1JZ7A 3UR5A 1E4NA 2BNJA 2VDGA 4G1NA 3WNNA 4DWDA 5A8OA 1VLIA 1TPB1 1J6PA 4OTKA 1KM2A 3OGRA 5AY7A 5IHSA 2BOGX 1A3WA 2E9BA 1VBHA 2Z4GA 2WJEA 1E6QM 1U30A 2TODA 3UG5A 1WP6A 1B3WA 1AODA 2QCLA 3VIMA 4OV9A 3UJSA 3PUDA 4ERGA 1CT5A 2HE5A 3P7YA 4HYRA 4K6AA 3NA8A 1ZCCA 2QZRA 3B0PA 4UR9A 4XD6A 3BXWA 2Y7EA 1WX0A 3AHXA 4Q4QA 1KO0A 2HSAA 3VFLA 1SZEA 2D0GA 2E28A 3LTSA 2QV4A 1HGYA 3AU2A 1ZAHA 3P84A 4QP0A 3S5YA 1KLZA 4PTMA 5A6BA 1CEOA 1VJIA 5HNUA 4NIRA 1WXJA 3L5MA 2GVGA 3E49A 4GKTA 3MU7A 5D09A 4XO7A 3LTPA 2EKGA 4UQ9A 2NT1A 5AC8A 3CS2A 3H2EA 2OMAA 2PTYA 5EL1A 3FKRA 2VEGA 3QW3A 2V2CA 3CT2A 4FXFA 2ZVIA 1ICPA 4Q6XA 1JF6A 2HV5A 3XIMA 3CH0A 2ZRUA 3G0UA 1I8JA 1M7JA 1FCQA 1NWRA 1RVKA 2L5HA 1REQB 1VBJA 1NSJA 2VFEA 2ZZ1A 1E73M 1JZ8A 1UA7A 3QVQA 5E9AA 2O7SA 4M6UA 1TG7A 3LCHA 4FNRA 1JZ3A 1NELA 1ZPTA 5ABFB 5DMLA 3C3NA 1AJ0A 4LQ1A 3WNOA 5JIPA 4DJFD 2ONEA 4GNKB 3W07A 1W17A 3E3HA 1XXXA 3LA4A 5FF4A 3S2JA 3CZGA 4AD5A 2WJDA 2JEQA 4LUJA 5KZ6A 3MP4A 2NWRA 2WSQA 3WFAA 4WR3A 3S2CA 4C1NB 4R3UA 3WQGA 3QYSA 5CJ5A 1HZYA 2NVCA 2FIQA 2O92A 2WVTA 4I3GA 2WZEA 2UY3A 3FHAA 2ZCGA 2H6RA 5FAGA 4UCFA 3LS9A 4GJ1A 3SURA 4EP8C 1I9CB 1HKMA 4J27A 1F3XA 3OLEA 4UFHA 1KBJA 4V1XA 1TQJA 3R13A 1Z42A 3IV3A 3LHTA 4H2CA 2J66A 4FX6M 2D2GA 3ZT7A 2AAAA 1Q6LA 3LD5A 2P0IA 3E0WA 4DN1A 1ME7A 1XISA 3LLDA 1JYNA 4FNPA 4ORIA 4WZHA 5C70A 1E43A 3PK7A 5BOFA 1A5MC 3BZJA 2A3HA 1K8XA 4LVGA 5BCAA 5ABTA 2OZTA 3EKZA 1EB3A 4HZMA 4AVOA 3P60A 1MRQA 2FZBA 4W93A 3SAZA 1KCKA 5D32A 3VNLA 2B4GA 1FXPA 1DTNA 5CJMA 4TVDA 4XTDA 5E1QA 1OX6A 1WO2A 3LNMA 1TIWA 3PN8A 2GK1B 2PDJA 3SRDA 4NNAA 3NO5A 1IE7C 4RR4A 1WYIA 1OGGA 1W0MA 1U5HA 4IIFA 3MP3A 2PA6A 4ZMGA 1NEYA 1XBZA 4C7DA 2FDSA 2P5NA 4MB3A 3L4XA 4S3BA 3WUBA 2JIEA 3M5XA 1Z6KA 1GCYA 2OGJA 1EX5A 4E8GA 1EF3A 1RV8A 4WDTA 5J5DA 4YPJA 3IJ9A 2J6XA 3TP4A 3F2CA 3VKDA 1OFQA 3MCOA 4KFNA 9XIAA 4IIGA 4DBDA 3TC3A 1MZRA 2I9UA 1ODZA 3REQB 2EG6A 3GFXA 3QZ6A 3K1GA 3R5EA 1QU4A 4X0NA 3QHOA 2FGLA 1RJPA 5I3KA 4ES4A 1XV8A 4WSJA 2VWSA 2ZDSA 4JTCA 3QOKA 6ENLA 2XZ9A 3QPYA 2YYTA 1XYCA 5D8WA 5HA7A 3NQ6A 3UJFA 4HHLA 4HYVA 4ZEPA 4Z17A 3MHFA 4JIQA 4B4FA 4OIFA 5A8NA 3B04A 3QLLA 2PDNA 3QMRA 1TFVA 4XZLX 5H2ZA 1WAUA 5BXRA 3M44A 3BGAA 3PC0A 2A1YA 2UZ9A 3NPWA 4QE5A 3O0KA 3BLLA 2YCLB 2F8QA 1J5TA 3DCPA 3BLKA 3KBJA 9RUBA 1XPGA 3RM4A 1EJUC 4MVAA 1OYBA 3ZR5A 1GJUA 4F66A 4C65A 1DXEA 1RCOB 1HL9A 4LAZA 4IMGA 5DMNA 2PP1A 2YBUA 3NXLA 2W6RA 1U2YA 2BSLA 1SFTA 3G6LA 4DYKA 1FWCC 2YW3A 1DP0A 4FIQA 2HISA 4H83A 1EYWA 4NZ5A 1RUSA 1VB9A 4UTMA 3T7VA 4F2TA 3B3DA 4ZOAA 4D8ZA 2ZYFA 1HP4A 3FGCB 2WPGA 1B57A 2OJPA 3TN6A 2ZRZA 4PRTA 1KBKA 1WE5A 4J7RA 3UYCA 4H9VA 3GNRA 5IRPA 4YXGA 1RSCA 4FOJA 1M65A 2WV8A 3M0YA 4RV3A 3UXIA 3EOLA 1DWIM 4GYPC 3W1TA 2DZAA 2Z1VA 1PHWA 3N2BA 4OHQA 2P1FA 1DHPA 3BV4A 4CQ9A 1OFPA 4B16A 2PTDA 5BU6A 4DELA 3C2VA 3VKCA 5REQB 1XC4A 3TTEA 1PS9A 2Q71A 3VUPA 2BXYA 5I78A 2WLZA 1KRCC 3NOYA 1UD2A 1CXEA 2XYLA 3CL6A 3R25A 3B8DA 3F5LA 2CW6A 3E2VA 2Y61A 1GYMA 1D2KA 2RDXA 3UR2A 2WHLA 1E3ZA 1J01A 3UWYA 4A2SA 2OG9A 1RA0A 4PTXA 1QNQA 3VZYA 5FOOA 3CUIA 2OKTA 3OQEA 2VZOA 2VI0A 1S5VA 2QMKA 4AMCA 1JCTA 2PD5A 3GNPA 4IPJA 3HTWA 1HJQA 1DJIA 2BGSA 1H62A 3ATZA 2CLPA 3KBNA 1JUBA 3ZT5A 3BMVA 4JHOA 2J6VA 1L8NA 2EEXA 4MY9A 4F0MA 3SIZA 1IEVA 4UFIA 4YTRA 3SRFA 2QLYA 3NO3A 5A6MA 3S4TA 4NY2A 1W1ZA 4NXSA 1RBOB 3ARTA 4WJEA 1TUFA 1QCWA 4QXIA 2D22A 2WAGA 4TIMA 1M1BA 4ENLA 3M0LA 3TVAA 3TNBA 5DBUA 2ATMA 1XH0A 4JR5A 1QK0A 4OJYA 2EJ1A 2PWGA 3OPSA 1OCBA 1O68A 3W2KA 2NVAA 4PMQA 4TQTA 1ALDA 5KSWA 4H9TA 1EL3A 2Z26A 1YMYA 3LX9A 4ZQRA 1JPHA 4BEUA 3K8KA 3BW4A 3W1PA 3PTMA 3S5OA 4PSRA 4AD2A 1UHVA 3UEQA 1NOUA 2HWGA 3OZPA 2VP8A 2Y62A 2J62A 1UIOA 3NYDA 2PFHA 1XD1A 1XLFA 2VHLA 1I1XA 3PUEA 2WHMA 2YL9A 2RKXA 3ABSA 1HFBA 3UCCA 1EGMA 3FSUA 2Z1SA 4B3ZA 1BLIA 1PKNA 1MEIA 1A3XA 1Q7ZA 5FJRA 2OPJA 9CGTA 3ARVA 5CPSA 3KDOA 3WDPP 3DKLA 3IUHA 2SFPA 4AQLA 3QM3A 3W7QA 1E40A 5CQ1A 2ALRA 3MCNA 1XLAA 1DWJM 3ONBA 1FBAA 4RXFA 4ZO8A 3AXMA 1UD4A 3P67A 1Y5WA 3WLKX 1XLHA 3I65A 3K5XA 4JS3A 4A6GA 2WC3A 1A0CA 3MYPA 3ZLGA 4DY1A 3NTYA 5D2WA 3NSXA 3CV6A 4J28A 4S2BA 3SCSA 3WSUA 1T0OA 4WCJA 2PBGA 2V63A 2VRQA 2J78A 2PP0A 2FVMA 5HNNA 3ABQA 5ECUA 2XVPA 4X0VA 4NRSA 3PAJA 3WLQA 3W7IA 5AC7A 4PH6A 4AVFA 2CERA 1HP5A 3M0VA 2POTA 2ZX9A 1UP0A 3NL6A 1ZNNA 3WQWA 2CYGA 5CXPA 1Q6GA 1KD0A 3QEZA 2CLOA 2FHFA 1L0PA 2DT1A 1O12A 3VOFA 2FLIA 4HPJA 4U28A 3DC0A 4DQWA 3CQJA 1Z8AA 4FZIA 3LDVA 2E9MA 1ZBKA 1T40A 4QGCA 3CZLA 1TJRA 2YFNA 1N7KA 3TWAA 3VE7A 4W86A 3G1FA 4S3FA 2V8ZA 1FKXA 2FH8A 4RNIA 1UCWA 1EJWC 4QJ4B 2DSUA 5A8PA 4IL0A 3AROA 3BAXA 3KP0A 2QQ6A 4LUSA 1MNZA 3GUGA 2O9TA 3SBFA 5J5RA 3M6YA 3P62A 4A8NA 4BZYA 2VX7A 4LS2A 2YA2A 4MB1A 4KQNA 5SWUA 2PBOA 4ZCWA 2VEFA 1W5QA 1F74A 2DEPA 3PULA 2G8ZA 3W02A 3DI1A 1OABA 2HRWA 4UFMA 2F7FA 3G8EA 4I9TA 1OK6A 4HN8A 3UA3A 3THUA 1TE1A 2CWNA 1VBRA 1C93A 3EDKA 2ZOXA 4UTWC 1GQNA 3T8LA 3T2PA 4C6IA 4E2VA 3I3DA 3M7WA 2ZZ5A 4JQ2A 3OA3A 2C6QA 4CEXC 5K9XA 3UZJA 3W71A 4Z1AA 1A53A 4ZFMA 3VC6A 3AMDA 4A3RA 3GFZA 4PEEA 3GXPA 2GGHA 3W7MA 2HXUA 3SCTA 1UZ1A 1S2AA 4IIHA 4J1OA 4IFOA 3N73A 5G5IA 1AH4A 2IPGA 3MANA 5C9WA 1E6RA 4IFKA 1OBAA 3QKEA 3TAKA 2DW6A 3TTOA 2BY1A 3A4XA 3S47A 2PP3A 3ARQA 4YTTA 4OV4A 3L67A 4MYAA 4ZQNA 1KM4A 1VFSA 3HMCA 3CQKA 3P8IA 4JBRA 2Y0FA 3AOFA 2ZE0A 1FKWA 2ZTJA 4ZZ9A 2ZRXA 5E0KA 1J96A 1SO5A 1FCBA 1W8SA 3UG4A 1YYAA 3CB3A 3TQKA 1BKHA 4GLEA 2RH9A 3VOIA 1LOLA 1FDJA 5AC6A 3BO9A 2YBTA 4QTGA 2DT3A 3C86A 4IX0A 4IGNA 4PGLA 1J79A 1T96A 4JL2A 1DORA 1W5OA 1WBJA 2WK2A 4IHCA 1EWEA 5CBBA 2WQDA 3S2NA 4LC8A 1XLEA 4M7TA 3ZWTA 1EGVA 3G1DA 1P7TB 2WYSA 1VFUA 3B8WA 3W26A 3VKJA 5H8PA 4Q8VA 1W9BM 3V75A 1EO7A 1KNWA 3STGA 1OFAA 1UMYA 2AOSA 2BVTA 5AYYA 1P1XA 4A35A 3PY2A 2DY3A 4GRSA 4XIMA 3RNDA 4S23A 3RK8A 1N8IA 1DOSA 3UCQA 2B7NA 1HKJA 3ARYA 1ISZA 2PDXA 4NRRA 4DLFA 3SSJA 2XJ7A 1H49A 1JZ5A 4HTBA 4LUTB 2GJRA 4PR4A 3CC1A 2E1DA 7TIMA 5HWMA 3KDNA 3W4RA 4L6HA 2DW7A 3ZVIA 4QITA 3U3HA 2W62A 3CH9A 2J75A 5DT7A 1MFUA 2IQTA 3T42A 3R94A 4YS1A 3URQA 3VABA 2VRKA 4US6A 5C6MA 3TJ4A 3DG7A 4NX0A 2ZWZA 4DAIA 1SM9A 4EAYA 3KAOA 3DX5A 4AH7A 3S1UA 2PEVA 3THCA 1X6UA 2OOFA 2P88A 1DJGA 2J8TA 1LLWA 4NP7A 4JFWA 3T09A 3ENLA 4IJRA 1YDVA 2WJZA 4DM1A 4N9BA 1I75A 2QV5A 3A3XA 4Z1BA 3QGAC 1CCWB 3IGXA 3WX7A 2FDMA 4JTLA 1VLWA 3LHUA 3MSDA 3AYVA 4TV6A 1QI3A 5D2VA 2V5JA 3E0FA 1O66A 3GTFA 2VC9A 1US2A 1JCYA 4MWAC 2D2JA 3W1LA 1PL9A 1T8QA 3HGSA 1VJZA 2CHOA 4H1ZA 5DF0A 3WDIA 1FWGC 4LW7A 1XUZA 1N8FA 2DIKA 3TR2A 5I00A 3OVQA 2X1RA 3ZFHA 2HDJA 1V77A 2VZSA 5HJXA 3GB6A 4HMNA 3T81A 5JBFA 1B31A 4D6IA 5FJJA 1UJPA 3EWBX 2YOCA 4BI6A 5T91A 4I8DA 1OCNA 1PO9A 3U0HA 1P0NA 2VC5A 4DUXA 2DUZA 4I8YA 1Q6FA 2VYOA 4M29A 3WLOA 5BOEA 3CZJA 6XIAA 3NAVA 2Y8VA 3NWRA 1LBMA 1GJWA 1DJWA 3IGUA 1GTHA 4WSHA 1QPNA 1E6XM 1EOKA 4OWGA 1WKEA 3GH5A 4XB3A 1F3EA 5CC3A 1JPIA 3DC8A 2FZ8A 1A0EA 5HQEA 4A22A 3VOJA 3W81A 1QI0A 3W1MA 2PCEA 4H8VA 3R4IA 4MG4A 2EG8A 3KTSA 2J13A 3EBVA 1WCGA 4BI5A 1IEIA 3M1ZA 5C2GA 4LUYA 4B3LA 2OO6A 3BOXA 4F9DA 5DY3A 1LCOA 2WSKA 1YBQB 1QPKA 2FTPA 1TQXA 2CU0A 1YDOA 2DZTA 1RZMA 4DI9A 4B5NA 1LJYA 4H6KA 4UTIA 2Q6ZA 3VC5A 4IGHA 1XLBA 1R0MA 1TYGA 2QAFA 3NCOA 3N4EA 1JZ6A 1B4EA 5CEWA 2UY2A 1LWHA 4B9ZA 3KCJA 4FXSA 1W54A 4Y9MA 1V08A 2BVYA 2G5WA 4Z2GA 3G2GA 5DLCA 3HM7A 3ZSSA 5KINA 4F0KA 1DIEA 1GHRA 2Y1HA 4F0LA 1GQKA 3VGDA 1UR0A 1PCKA 2Z00A 1XR2A 1KFWA 3UJRA 2RDWA 1B1YA 6CGTA 4O18A 1LZOA 1RK6A 1V0KA 5GJMA 3T07A 4ZGYA 4M81A 2NSOA 2R91A 3GDLA 2X1TA 4G9PA 4J3TA 3L2MA 4H8NA 1DE6A 2ZADA 5HMEA 1BYAA 4GVIA 3DH7A 4QE4A 3VM7A 4PZVA 4NZFA 1K03A 2WBGA 3B06A 4B2DA 3W27A 2BGNE 3V35A 3WMCA 4QLJA 2X1IA 2XISA 5DRIA 1Q6RA 1V6TA 4R88A 4UWMA 1Z44A 3MZ2A 4PRRA 2DZVA 3QHNA 2CC0A 4WIWA 4ZTYA 4TX9A 2FTYA 1A5SA 1W91A 1XLMA 2G3IA 3DHPA 1W9PA 3LQGA 4G8TA 3T0BA 2YJQA 3U7VA 4ACZA 1E70M 1HNYA 1KR1A 2BS9A 5EMJA 2E0PA 2P50A 4YHGA 1W1YA 3FW6A 1RJQA 1QI2A 3RLVA 2TRSA 5LNSA 3C2OA 4DM2A 4LCSA 4S3EA 4GUIA 1MSSA 3KWSA 1FDYA 4DJEA 3L0NA 3URAA 1JVNA 3RX2A 1A5KC 2EO7A 1YXCA 3FV9A 4RCXA 2GGIA 3WQOA 1TJPA 3IAQA 5JIWA 4FR1A 1XYFA 3LYEA 4L1XA 4IF2A 3MT1A 3M0HA 4MWAD 2ZRVA 4GH3A 1R7AA 3W72A 1LP6A 2Z0IA 2R82A 1EH9A 3L5LA 2WZHA 3W7HA 3QV6A 5CBJA 5E70A 2Q8LA 4PCPA 1PTAA 1ICSA 5LIKX 2B0MA 3THDA 3F2BA 4MWAB 4HOZA 1H1ZA 2W5FA 4JIRA 4O28A 1X96A 2XFRA 1OFEA 4S2CA 1QWKA 2A5HA 1UJQA 3LMYA 4NYUA 1KWGA 3L21A 4LB4A 2XDFA 4R33A 4KFOA 3W1AA 2IPWA 3W37A 3KCOA 1NOFA 3STCA 1XRSA 3OLIA 1PHQA 1CXLA 2XZ7A 2PURA 4H19A 5E93A 1OIFA 3NEHA 1OIMA 2VC7A 1W2PA 2C16A 4MHBA 1N55A 1WDQA 1UD5A 4X9SA 4CQDA 1M01A 1JQVA 3W7LA 2VQUA 1J4EA 1JG9A 4A8LA 3WEMA 3DYMA 4KESA 2XIQA 3WF3A 3ZS4A 1Q8AA 1PIGA 2D2OA 3W23A 2FZ9A 3W9ZA 3EX6A 4O8RA 1YTDA 3DHDA 3UZ5A 4EXQA 4DPQA 2ZTKA 5A8QA 4M1RA 4MYXA 3MVTA 5KTLA 1MUCA 2BG5A 3NL2A 1HJWA 2I5QA 3HV8A 3RPMA 4FS9A 4I5RA 3WJZA 3A3HA 1KKOA 2PU0A 3SZ8A 1FWAC 1DJHA 1OG6A 1EZ2A 2YKKA 5CCZA 3WLTA 4RDYA 1AW2A 3MKKA 2NVDA 1AL8A 4U2YA 1H41A 3BUVA 3T4WA 1DVJA 5C71A 4S3AA 5A2AA 1IGWA 1DWGM 3MUZ1 1KM1A 2G96A 3E0VA 3SCVA 4ZOBA 4JYFA 3AYRA 4XBSA 4FK9A 4Z1DA 3CZKA 2ZZ7A 3WD1A 3QRHA 2AKZA 3NOEA 3GQYA 3H2FA 1BSLA 1GVQA 4TVUA 1VPQA 2OX4A 1TV8A 5IDZA 1ZZMA 2VX4A 3WJSA 1LDCA 1UYQA 1V6XA 4DNHA 2G50A 4TXEA 1KFKA 2YLLA 2HNEA 1LF1A 1EQCA 1IXPA 4HZ8A 1BGAA 4DXXA 2QR6A 2GWNA 1P6BA 3G18A 4MNKA 2NX9A 4NJKA 4HZ6A 2VFHA 2UY5A 4CLMA 5D4YA 3QV8A 4D1IA 1SYTA 4NL1A 3F7JA 5CJNA 2C0AA 2QPUA 4B5WA 1LBFA 3WDRA 3WMLA 6PTDA 3THQA 2EPOA 2W61A 2PI6A 3QR0A 4IPNB 6ALDA 4TTUA 3C52A 3QBUA 1XBXA 2NZLA 2G3MA 1ZHAA 5FJTA 1PSCA 1NDVA 3AS2A 1W1IE 2J88A 3EDEA 3NFUA 1WXZA 3RCNA 1A5AA 1FVPA 2WSYA 1LQ2A 2XFWA 4O0KA 4J9JA 5CPTA 3KEHA 4GI8A 2ISWA 3SADA 1YNQA 2PLMA 2R1MA 4GI6A 3OYXA 1CXKA 3TW9A 4C91A 5LZLA 3JU2A 3BWWA 5AN7A 3TC6A 2OSWA 1MVYA 1J6OA 1GKRA 4KGLA 2B7OA 3LGEA 4D6CA 3N4FA 3BJSA 4ZQMA 2GVJA 3LXCA 3BDKA 1JDAA 1RHCA 4DBEA 3DN5A 2BVDA 1UC4A 4RK8A 4Q8TA 3C56A 5EKYA 3MJYA 3PZGA 2QXWA 1GOOA 3PWAA 4FNTA 1S3HA 1X39A 1E9IA 4V33A 3E9AA 1QO2A 3BCDA 2D23A 4ZQCA 8CGTA 1R85A 1UWIA 2GPTA 2PRMA 4AZ6A 1OX4A 4M82A 1G4TA 4E38A 1C9WA 1UKSA 3DG3A 3GIQA 1MQQA 1SSDA 1V79A 4IPLA 3NGJA 4F2UA 4UQEA 4BQ4A 1SO6A 1UBPC 2ZX7A 3PPFA 3VNJA 2PLJA 1IEXA 1QRQA 4XAZA 3T05A 3WL0A 4ZO6A 3H7UA 5LIYX 3MDWA 3BAKA 2EPMX 4WQ6A 2J7FA 1WQ5A 2A0NA 3PBWA 2QPXA 4DXKA 2NLYA 3V3WA 2QCHA 1EOMA 3RJXA 1IT7A 2PWUA 1ZENA 2IKHA 1SZNA 2J9YA 1BYCA 3A4JA 5TQLA 3S1XA 1RR2A 1KCLA 1ZU8A 1GOQA 4LF2A 4ZVJA 5J04A 3C2EA 3L2LA 2NUWA 1EWDA 2PDLA 4EACA 5I0DA 3M7SA 4AY7A 1BYDA 2H9AB 1X7IA 1TPUA 2PC4A 4TO8A 4BJHA 3WD3A 5ABEA 4WGHA 3ATYA 5LKYA 1R3VA 1WZAA 3UBPC 3FVDA 2O9PA 4MKSA 1C8QA 3OHMB 3VGBA 3KHDA 4CNUA 5MF5A 1F73A 3OYZA 3PJUA 3TSMA 5C9ZA 2PDPA 4RXGA 3O7UA 3KOYA 1EIXA 1XCWA 1P43A 5B7ZA 3W87A 4UTTA 4C6CA 3LV6A 1Q45A 1O6IA 4W8LA 4GABA 3WD4A 3KVJA 3UZXA 1H7XA 2FPYA 4HP5A 3N19B 1AA1B 4JTGA 1QNVA 4Q4OA 4AC1X 4Y8FA 1K9TA 1FWHC 4CVUA 3KHJA 1TV7A 4QCFA 3J7HA 2R8WA 1F3TA 2FGZA 3BOFA 1ODUA 4OBSA 1VCVA 2XM2A 2ZZ6A 3CYVA 5EFDA 3STFA 1F9CA 1FDZA 3NQAA 1LRQA 1XIIA 5C9RA 2J7BA 1DHKA 1H7WA 3LTYA 3H26A 2DGAA 3ZQ9A 1W5PA 1DQXA 3PZUA 4JPGA 5DXYA 4X9YA 3WF1A 1JD9A 4NAFB 5HJLA 4XZMX 3ZYZA 3H2MA 4HJFA 2DVUA 5DBTA 2FZNA 4TTGA 2HCVA 2WMIA 5A94A 3LOTA 3W75A 2Q3OA 1D3HA 3MKCA 1PCWA 1G0CA 2Z29A 1VIWA 1WDPA 2FPVA 1UIPA 3BLEA 1W37A 3ANYA 1QOQA 3LBOA 5LGXA 3F5JA 3DAQA 1PWLA 5GNXA 1F05A 2G3JA 4RZ5A 4GXPA 2Y6ZA 3TXZA 2P3ZA 3HPSA 3ISIX 1JPMA 2WVVB 4LY4A 3MUIA 4WUIA 5I09A 3OBEA 4XQ6A 3EXRA 1X1NA 4JFSA 1Q6EA 3W0KA 1T41A 1EQPA 2VCCA 4EPBC 4W89A 1C7TA 2CETA 4AZCA 4H6RA 3AHTA 2O0TA 1S2TA 2DQXA 1WPCA 1I2QA 1S2VA 3H7VA 4URIA 3DHFA 2ZC8A 4XK2A 1M9HA 4Z42C 2CEQA 4JKLA 4MAZA 4GISA 3L65A 4RDVA 3PR2A 4W88A 1V3MA 3SQMA 2R9RA 3LN3A 3DEQA 1R87A 2VEIA 3SCOA 2OCZA 3AXXA 3AZTA 5CSYA 1Q7QA 4PTDA 3ZXWA 1DV7A 1JXJA 1TPFA 4XZIA 2NXGA 3M43A 5AYZA 1FH9A 1IF2A 1FUYA 4Z1CA 1R3YA 2DFAA 1TPVA 5FEPA 3GIYA 5AHIA 4GJJA 2V3DA 1X98A 3RDKA 1SSGA 4BY3A 1KV8A 1QUMA 5M1TA 4IZGA 4O17A 2E6YA 4D6FA 3CIXA 4HN4A 3BL3A 1OX5A 3OGSA 2C1HA 3V5CA 2E6DA 4XZHA 3PG9A 5HNRA 2XGIA 1UR9A 4M6VA 2RJHA 2YDAA 3EAUA 3SUTA 4LB3A 3JR2A 4L5ZA 4G6CA 2OEKA 4AEFA 3W3OA 3FS2A 3RR4A 4AD4A 1KCXA 3MZNA 1W9DM 5DY2A 3W76A 3VU2A 3CQ0A 3KLKA 2VDIA 4LV4A 3NPXA 3WUEA 3EDFA 1WKFA 2GJXA 3WELA 3A12A 3NO1A 5GVJA 4GNVA 4DUWA 4JCMA 3WDQA 1LRTA 1P4CA 3AHVA 3LZ3A 1QWGA 1VCFA 3CL8A 3PG8A 5E09A 1OFBA 1K77A 4XAYA 2EF9A 4ZODA 4PMOA 3BZGA 1J5SA 1XD0A 3VVGA 3S6DA 5FF7A 4AHQA 3RHGA 4AYGA 5BU9A 5M03A 2FVLA 3W7JA 5DELA 4C60A 3CT7A 1JZ2A 2Y8KA 5AC4A 5HAOA 1VEOA 4AISA 4QR6A 1J10A 1Z69A 4LEFA 3E02A 3IJ6A 4GKLA 4UC5A 3CJPA 2NXHA 3GR8A 3M0IA 4G7EA 1BKSA 4U3AA 1SPQA 3Q94A 4AFYA 1H11A 4I5UA 4UMBA 4MUZA 4HMCA 1V7AA 3IIVA 2WWDA 4Q8OA 2JF7A 3M5VA 3G24A 1TIMA 4Q8PA 4HA4A 1GJPA 3KOWA 3C0LA 3HQOA 4GWEA 2JGYA 1UBSA 4GFSA 3T55A 1GW1A 4LYKA 5HQMA 4MJ2A 1G9HA 4B91A 2VURA 3AMKA 4BEQA 4D71A 1XX1A 4PE8A 1PZ0A 3MWCA 2RAGA 1GW9A 4Q8QA 4E6MA 1SMAA 2VX6A 4XD3A 1XM3A 3LUTA 4WKFA 4KS0A 3TX9A 5DCDA 3PB2A 4UZUA 4EXAA 1IZJA 3OZMA 4Z2IA 3MA8A 1A80A 3WDHA 2V2DA 3AJXA 3LHWA 4MNLA 4HCHA 1UASA 3P5ZA 3TNOA 4HNOA 2G41A 3EX3A 2QIWA 4QLLA 1PX8A 2A6NA 5KETA 2VGFA 3UPMA 2XIBA 1RBLA 1ZBVA 1V8EA 3R7MA 1OWQA 4EAMA 4GI9A 3OVGA 4CD4A 3TA6A 3UWZA 1EEPA 2PDHA 4AZ7A 3L4YA 1SVDA 1K7EA 4MB5A 3DENA 2Z2UA 1W2VA 2BFGA 3NZQA 3L5AA 2VCBA 4K7YA 3B9OA 1W9VA 1EUAA 1LRNA 4JGDA 5CPOA 1RLCL 4BS0A 3B05A 1CXFA 3VOHA 2YPIA 2XSAA 5KZDA 4CD5A 4E0CA 4QDMA 5CSUA 3ITCA 1F5ZA 1H61A 1SR0A 4JYDA 2YR1A 1ISWA 1UKQA 2HPIA 3MKVA 3G1SA 1BTCA 3VYLA 1GUVA 2DT0A 2G95A 2ACRA 4L65A 5A6BD 3VIOA 3TOYA 3F4DA 1BRLA 1UWSA 3VGEA 2YXGA 1EGZA 2DP3A 3UW6A 4FO4A 4JNYA 3OLDA 4FX7A 1WZMA 3GC5A 1IEWA 1XDMA 3LRLA 4C6EA 3WK0A 1K8ZA 1E15A 4A2RA 4HBKA 1XRFA 4K3ZA 4GBUA 3TZFA 4C7GA 1E0UA 3H12A 1RQEA 3TH6A 2VRJA 2P0OA 4JTUA 1EHNA 1JF5A 1JCNA 1HJXA 1JD7A 3U2CA 2Z1XA 1J0YA 4L56A 2BMBA 1T99A 1QBBA 4JCLA 3W24A 1MEWA 4C1NA 1YHTA 3ANVA 1ME9A 2ADAA 2ESCA 4DJFA 4H9MA 2GZXA 1EKOA 1GVEA 2F61A 3SUVA 3PTQA 2J27A 3GBEA 1R5YA 3GVGA 4IPPA 3UWQA 3W01A 3WK2A 2PS2A 1FH8A 1WV2A 4D2JA 5D9MA 2TSYA 3WEOA 1UZHA 2VD8A 4MZ1A 1X6LA 2OB3A 3HFYA 3N6QA 4KERA 3WQPA 2VTFA 1TTQA 3WBAA 3CUJA 1IT0A 5FJPA 4B92A 3N17A 4XVDA 1E4LA 4JHMA 3FXGA 4OOZA 3A64A 1XIHA 1S5TA 4ZXLA 3HJZA 1TRIA 4R9OA 2IPJA 3WFZA 4FNSA 1BVWA 2V82A 3AYSA 3FLUA 2ZUTA 3OG2A 2DVTA 4PODA 4R7WA 5K9CA 3G1RA 1E1CB 2VUNA 3PUOA 1TSIA 1OINA 4IGMA 4H7CA 3BE7A 3OIXA 2QUTA 1FWWA 4MPKA 2GK1A 3U9IA 2KX9A 4JTFA 2E7FA 3NSNA 5CLTA 4GXMA 2BVWA 1DWFM 3IRSA 4JN7A 4FLRA 3FKKA 3AMCA 1ONWA 3UXAA 1HVXA 1H7RA 1VHCA 4CCDA 2XVGA 1JCJA 4O0QA 4AU0A 1FWDC 3AWNA 3A5VA 4G5DA 3IJ8A 2WCAA 2P53A 1TMLA 3I10A 5AYXA 2QGHA 3S6TA 4IJCA 2PRLA 3LERA 3NNTA 5EPDA 1YPFA 3RYSA 1GEQA 3S46A 2E9LA 1MW1A 2MANA 2OWXA 3GDBA 2VUYA 3G6MA 4GZEA 4PB4A 4B5VA 4DZIA 1VCGA 2FFIA 1VFMA 4LH8A 2BBFA 1UOZA 3REQA 4DEFA 1KXHA 4C6FA 3NQBA 3NDOA 5F2IA 3EXSA 4S1FA 1QPOA 1RP8A 1R30A 2PUZA 3WFLA 2EPLX 3WEZA 3G77A 1XGZA 4IXHA 3FIGA 4A4AA 3IRDA 1SW7A 4AXKA 1G1YA 1RH9A 4ZXOA 4OFCA 3DZ1A 3AHYA 2E4TA 1JXKA 5I5RA 4EXBA 1CX9A 1S2WA 4Y9PA 3ORWA 4OBTA 2WJFA 1KM6A 3FYOA 4PCNA 3KLLA 4NAEB 3C2FA 5D9NA 3WLMA 1R9YA 1CXIA 3D6NA 3PAOA 1E5JA 1UR3M 1M7OA 3L23A 2JKEA 3CHDA 4CU6A 2PWEA 2H3BA 3N9KA 3H70A 2OWCA 4DX3A 1I2NA 2YCLA 4XUYA 2ACUA 4D6JA 1K4GA 3UP8A 3M07A 2W66A 2F84A 1JUKA 5G2WA 1LQ0A 5EA9A 4WK9A 3S42A 1F3WA 2F38A 5I7GA 4Q8WA 3CAWA 3PBVA 4I6VA 5HR7A 4GOAA 5A2BA 3H4GA 2E25A 4NU7A 2JEPA 3S1VA 1OT1A 3ITVA 3UG3A 5BRBA 4KRUA 5I6SA 3EMZA 1C9DA 1B3XA 2PWHA 3UZYA 5H1WA 1QW8A 4ADTA 1CXHA 1GKPA 3HPAA 1GNXA 4NVTA 4MFDA 1ZJHA 3FJ4A 4Z2HA 4W9TA 3VUSA 1ICQA 3TYUA 1O5RA 5LGZA 3QQ0A