2DSKA

Crystal structure of catalytic domain of hyperthermophilic chitinase from pyrococcus furiosus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
300
structure length
300
Chain Sequence
GPNANPIPEHFFAPYIDMSLSVHKPLVEYAKLTGTKYFTLAFILYSSVYNGPAWAGSIPLEKFVDEVRELREIGGEVIIAFGGAVGPYLCQQASTPEQLAEWYIKVIDTYNATYLDFDIEAGIDADKLADALLIVQRERPWVKFSFTLPSDPGIGLAGGYGIIETMAKKGVRVDRVNPMTMDYYWTPSNAENAIKVAENVFRQLKQIYPEKSDEEIWKMIGLTPMIGVNDDKSVFTLEDAQQLVDWAIQHKIGSLAFWSVDRDHPGPTGEVSPLHRGTNDPDWAFSHVFVKFMEAFGYTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords chitinase
publication title Structure of the catalytic domain of the hyperthermophilic chitinase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 114
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2006-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dskA00
3VO0A 4CUCA 2XGBA 4XV0A 3ZO9A 3ZT7A 2OWWA 1UA3A 1KR0A 1E5NA 3II1A 1H0IA 4QCFA 2DIEA 4XX6A 1V0LA 1AQHA 2BXZA 4QCEA 1J0KA 1GZJA 3QGVA 4PMXA 1QI0A 1HJSA 5AC5A 2TAAA 3M6DA 4UOQA 4D6GA 1HJVA 5M5DA 1UR2A 2OWCA 1Q6DA 4J3UA 3AIWA 1K6AA 2Y4SA 3QHNA 3JUGA 3ALGA 4UCFA 3A47A 1OWQA 2DH2A 3BAYA 3GYCA 3MKKA 4PRWA 1V6XA 3NSXA 4ZXOA 1O6IA 4FLQA 2VZTA 5KZ6A 4MB4A 5LA2A 3EMZA 2GJXA 1LF1A 3AIBA 1GOIA 5A8MA 1H4PA 2YBTA 4L4PA 1LLOA 1E1FA 3WBEA 3WNOA 1VRXA 3TONA 2UY5A 2VVSA 4DWSB 4DUXA 4GXPA 4RE2A 1J0ZA 1ITXA 1JDDA 4OIFA 3AS2A 1FHLA 4UQ9A 3AHVA 3T2QA 2VX7A 4MJ2A 3NDZA 1M01A 4W7WA 2CBIA 1XH0A 3N18A 5BWFA 1WB0A 3TOPA 2VX5A 2WC7A 5CGMA 5CSYA 1GOOA 1MQRA 4GI9A 1JNEA 3WNMA 5AC4A 2YJQA 2GK1A 3OIHA 4NI3A 3OZPA 3GTNA 4D71A 3MMUA 1QNRA 1MYRA 4AIUA 4D6HA 3ZJ7A 4P8XA 4V28A 3WELA 3HN3A 5BYWA 5M3WA 1C3FA 2WHLA 3GXIA 4K68A 5A6BA 3VGDA 1ZBVA 2Z1KA 4UFJA 2CPUA 3AI0A 1W1YA 3AXXA 3PZTA 1OGGA 4HOWA 4MB5A 1VEOA 1NWUA 4W8AA 3RM8A 3AJ7A 2PWEA 3MANA 1E5JA 1PZ3A 3WN6A 3M46A 2WLZA 3AS0A 2ZUSA 3W26A 1EO7A 3MMWA 3WUFA 2A3AA 4GO8A 2NW0A 3GXMA 1M7XA 3ZSTA 5GNYA 2QPUA 1KXVA 5AYBA 2WC4A 1KXQA 2FHFA 1Y7VA 3WQWA 4L4OA 1QNSA 3PBGA 1HVXA 3PN8A 3MUZ1 1J01A 4W86A 2GJPA 3EMCA 3PZVA 2VUYA 1CXFA 2DT1A 1I75A 5BXSA 1UWRA 3ARRA 4WJXA 3OG2A 1V3LA 5DF0A 4OOUA 1HIZA 4WSKA 4HOXA 4TX8A 8A3HA 4Z2KA 1QBAA 1D7FA 2CYGA 4HU8A 3WEOA 4PMQA 1WAWA 1N82A 3OZOA 4GZIA 3IJ9A 3GNRA 1RP8A 1CGUA 2J7EA 5CLTA 2W91A 3GZAA 3QOKA 1OBAA 2X09A 2BVDA 1E6PA 1DWAM 2WLYA 4W7VA 3DYPA 4PMRA 3SCVA 3F5LA 3RCNA 1MFUA 1GPFA 3F5JA 3WF1A 3SUSA 2WMIA 1E72M 3UEQA 2OLHA 1MW0A 1CGTA 4J28A 3T2OA 1TVNA 1OT1A 4ZE5A 3WD1A 2YLAA 2A3EA 1WO2A 2EPKX 1WZMA 2V3EA 1J0HA 1HKKA 4AEFA 3L4ZA 5BXRA 2VC9A 5BROA 5A95A 4Z2GA 2BXYA 4YN5A 2C0HA 3ARWA 3OLGA 1XYFA 2VZSA 2ZUWA 3LPOA 2VMFA 3BLPX 4KGLA 4BA0A 5DO8A 1NP2A 5A8NA 4P8WA 3ARPA 3UESA 5BRPA 1B0IA 1XD0A 4JFUA 2BY1A 2PB1A 1JZ2A 3L4TA 4TVUA 1MQPA 2ZX9A 4C7DA 1JZ7A 1QNQA 3CMGA 2VX6A 1E4IA 2VTFA 3AS1A 4OBSA 4QLKA 2W61A 5CQ1A 1KBKA 2J7BA 3PTMA 2D1ZA 5EFFA 3WF2A 1MVYA 3KL0A 1E6ZA 1E1EA 5CPQA 3RIKA 5A1AA 1JAEA 4Z2JA 1WZAA 3LPPA 1ZS2A 1LG1A 4UOJA 2CBUA 2E9BA 2ZICA 3WF3A 1SR0A 2BVYA 3VILA 2O9PA 2CKSA 1E0VA 2Z1SA 2XGIA 1O7AA 1RPKA 2DDXA 2EBNA 3ARUA 1BAGA 1UH4A 1ODUA 1E6SM 1DWGM 1KFWA 1GVIA 2EEXA 4WKAA 1V03A 4AZCB 1L8NA 1HT6A 1NM9A 2X2YA 2G3JA 4JFTA 1PIFA 3AIEA 4MNJA 3WEZA 3BCFA 1B9ZA 2XIIA 4TVCA 2HISA 5E6ZA 2BS9A 2XYLA 1KXTA 2WANA 2G3IA 3M07A 3VIPA 3CZ8A 2J25A 5CSUA 1GOWA 1M04A 1F4HA 1JAKA 3AXIA 4ATDA 1UR8A 4WF7A 4D6EA 3AHTA 4HP5A 5DEZA 2IXUA 1US2A 1Q6CA 3RM4A 2WVSA 3EDFA 1CNVA 5KEZA 3GNPA 2E40A 4AXNA 2D24A 3W38A 2C8NA 2ZOXA 1H41A 5C70A 2ZUTA 2PWHA 4HA3A 4D6DA 2V38A 3GH4A 1A47A 1GQJA 1NP0A 2WVTA 3WKZA 2JIWA 3SUUA 2VI0A 2XTKA 2GUYA 4CN6A 3CZJA 1OSEA 3AQUA 1JXKA 1BVZA 2XVGA 2FGZA 1J11A 1CTNA 1UD8A 3KL5A 2PF0A 2ESCA 2OSYA 1QNOA 3VTRA 1SFSA 2VX4A 1SMDA 1UWTA 1GOMA 3WDPP 2WMKA 2X1IA 3CZEA 3ZJKA 4RE4A 4W8BA 2PC8A 1JF6A 2V5DA 3PZ9A 1KWGA 3UR7A 3N11A 2OYLA 5A6LA 1JI2A 1UQZA 1K9EA 4EKJA 3VINA 2VR4A 4N0RA 3IJ7A 3EBVA 3N17A 4CD7A 4URIA 4WSJA 1JZ6A 1AQMA 2QPSA 3F5KA 4Q7NA 4B3KA 3VGBA 3FN9A 4NRRA 1OM0A 4UR9A 1EDQA 1R86A 3SUWA 2O9TA 2JIEA 3U7VA 3CHEA 1LL7A 1X1NA 2ZX6A 1Q6EA 2XFFA 1V6YA 1DEDA 5D9PA 1UWSA 2NT0A 1OGBA 3MV11 3OLIA 5D4YA 1B3ZA 2CBVA 2CITA 1ITCA 3AHYA 3T09A 3CUGA 2WYSA 4X0VA 4TUFA 4S3KA 1SMAA 2X0HA 5JBFA 2CESA 4BQ5A 3PZUA 3AIQA 1YQ2A 1C90A 1GHSA 3CZLA 2J62A 3ZMRA 1VB9A 1W2VA 4W5ZA 5I78A 3WNPA 4M1RA 4C7GA 5D8ZA 5HOSA 4PTXA 3CUJA 3ZQ9A 4BCEA 5A2AA 1B1YA 4DWSD 2PWDA 5D9NA 3ZSSA 5BCAA 1W1PA 1CGXA 4KWUA 1Q6FA 2XUCA 5FKYA 3NDYA 1E0XA 4ZE4A 3AZTA 1TG7A 1HKIA 3AYRA 4AD0A 1CLVA 2J7HA 1JZ4A 3PZQA 3VDHA 3VMNA 1BFNA 5HXMA 1QW9A 2EQDA 1BYDA 1KR1A 1MQQA 1BHGA 3S6TA 1B3XA 2WWDA 1IV8A 3AMCA 3W0KA 4GQRA 4PMOA 3WY1A 4JL1A 1KQYA 4R27A 5ABFB 2XM2A 3VIHA 3T08A 4TX6A 1U2YA 1US3A 1B3YA 5FCZA 4D72A 3VM5A 3W27A 2YKKA 5IXEA 1H5VA 2XWDA 4PSPA 1VF8A 4X9YA 1E6NA 2ZXBA 2VR5A 4CGTA 5JBDA 4YHGA 1BTCA 2XFYA 3NCOA 1XV8A 4FLRA 3AIVA 1WCGA 5FL0A 2GFTA 3VIOA 1GQLA 4D6JA 2J8GA 3CBWA 3WF0A 3VX0A 4KGJA 4E8DA 1JXJA 1WPCA 4TTUA 3WF4A 1LQ0A 3NJ3A 4QAWA 5I24A 1TE1A 3OLDA 4J3SA 1ZJAA 2XG9A 1V3MA 4NSBA 1B30A 4M82A 1BLIA 1HKJA 2MANA 4R5EA 1UG6A 4AZGA 2CERA 1J10A 2D23A 4XB3A 2D0GA 4CU7A 2VZUA 4P7OA 4JFSA 1PBGA 4QFUA 3VGGA 3WDHA 4AEEA 1JZ5A 4AYSA 1KQZA 2J77A 3N12A 2VQTA 5CLWA 3ZJ6A 3AROA 1R8LA 4P8UA 2J47A 1EA9C 1W1TA 2J74A 4H7VA 1GONA 4AD5A 3PZIA 3OLEA 3KEHA 2CKRA 1V0MA 1UH2A 3EDKA 4XUYA 2XPKA 1TFVA 1VFOA 4HMDA 4GO9A 1VBRA 4KRUA 2YIHA 1WZKA 4HTYA 3VVGA 2D0FA 3CMJA 3SEPA 1MXGA 3VD7A 1G9HA 1AQ0A 1W9UA 3ECQA 1E71M 1J9YA 3GXDA 2RGMA 1GORA 1BSIA 4EK7A 4PTVA 2WZEA 4CD4A 1ODZA 1GUVA 1UWQA 2WW5A 3B9DA 3ARVA 1OD8A 1E56A 2OSWA 1WDPA 4QLJA 3SCOA 2VCBA 3KWXA 1HF6A 2FHBA 1X6NA 4AY1A 1WZLA 4H41A 2Y5EA 1VEPA 3CUFA 1QVBA 2XSBA 3L2MA 4J3TA 1G0CA 3PZGA 1DWJM 3VD3A 3WUEA 1KGXA 5FL1A 5EBAA 1ZU8A 2VCAA 4J3XA 1V6WA 1VBUA 2DGAA 1GJUA 3DHUA 4M8UA 1E6RA 1OT2A 4QP0A 1CGVA 2WCAA 1E9LA 4PEEA 3ZM8A 1CWYA 1UD3A 1D2KA 3WQ6A 1QI5A 3AMLA 5DFAA 3VIMA 3PTQA 1FH8A 4XZWA 4GPNA 1TVPA 4HZ6A 3GBEA 2XWEA 1GCYA 4PUDA 5IHSA 2YOCA 3DHPA 2W63A 3ZIZA 5JBEA 1VEMA 1JZ8A 2DEPA 1R87A 5TD4A 1UR0A 5I5RA 2IUZA 3VD5A 4GZJA 5D9MA 3I3BA 4UFHA 1BGGA 3VDCA 1LL4A 1A3HA 3FXYA 3AS3A 8CGTA 3ARSA 1XD1A 5M03A 4FK9A 4W93A 1MW3A 4HPGA 1LG2A 5A6MA 2V3FA 5E70A 4CN4A 1B3VA 3VIIA 4E2OA 3WH7A 3WDRA 5I6SA 2BFGA 3SCWA 5A2BA 4MDOA 4UOZA 1C8YA 1CBGA 5HPCA 2E8ZA 3RILA 4AIEA 4F9DA 4CU8A 2J8FA 5HPOA 2WZIA 3A6OA 1QI3A 4PMNA 3VUPA 1K9TA 5M17A 4GQQA 1JL8A 2ZE0A 1J18A 1JF5A 1HL8A 3RPMA 3G6MA 1W3LA 1MW1A 3VGEA 4UQBA 4ACZB 4OOZA 2CCRA 4PUEA 3UG4A 4P7LA 3WMSA 3MSDA 3WNNA 3W24A 1PAMA 5BXTA 2F61A 3DC0A 4OKDA 4J3VA 4JCMA 1G5AA 3MUY1 1W91A 1CXKA 4ZXLA 3WNKA 4BQ4A 3VX1A 3VD4A 2J7FA 4NF7A 1E3XA 2QLYA 3HU7A 3RMEA 2VQUA 2IXVA 3AIRA 1ZBKA 3FHQA 2JALA 1UR4A 4W85A 4F66A 3WD4A 4JHOA 1NWTA 3ARQA 4JIEA 4U2YA 3AMDA 1UD6A 3WSUA 4CVWA 2ZX7A 1B31A 1W9DM 1W32A 3HJEA 3WNLA 2YDQA 2CHOA 2X8RA 3UERA 4AWEA 4CVUA 1XC6A 4U5IA 2VRKA 2W62A 2ZUMA 2VRQA 3AICA 4XZBA 1UWUA 2WSPA 1JIBA 2WMJA 1ZBWA 1D3CA 2GJXB 1FFRA 1H11A 2WHJA 1QOXA 3VMPA 5FOOA 1E3ZA 4HZ8A 1H1NA 1EXPA 1EGZA 4UZSA 4F79A 2JE8A 1VENA 7A3HA 3A3HA 5ABHA 2W4XA 2VT0A 1JNDA 5CGTA 3L4XA 3W25A 4H8HA 3W6LA 3WQVA 3WL0A 5E0FA 3BH4A 3K8MA 2GK1B 3VOCA 3LPGA 4UFMA 4D6CA 3QR3A 4J7RA 3OGVA 3WUBA 1MFVA 2XSAA 4IPLA 1LL6A 5HDRA 4PMUA 4HMCA 1QW8A 2ZXDA 1BYBA 3O6AA 5ABFA 1Q6GA 5E0CA 3CHDA 4GI8A 2XVLA 1HP5A 1FH7A 1C91A 2WCSA 2WWCA 1E6XM 1PJ9A 1BG4A 1V6VA 5GQBA 3F4VA 4P7RA 3UG3A 3SURA 1EDGA 5AYIA 4W5UA 3NYDA 2GSJA 4WIWA 4WKFA 1EDTA 3UCQA 3VPLA 2ZWYA 1B2YA 3T0AA 3ZR5A 4B9ZA 4P7NA 3T0DA 4CN1A 4D6IA 4TVDA 4AZ6A 5A8PA 2FHCA 1ISXA 4AZIA 5A6AA 1AMYA 6CGTA 2E3ZA 4TXEA 2D0HA 2BY0A 2G3MA 4UZUA 2CIPA 4GIAA 4V2XA 4N42A 4X0NA 1IT0A 1V3JA 3UETA 2Y24A 5DMYA 1W2PA 4AZBA 2RGLA 2WVVA 1HJUA 2Y8VA 3ARXA 4PBGA 1KWKA 2X0YA 1CEOA 3APGA 4HMEA 3QOMA 3BAIA 3IANA 3OA5A 3AMKA 4C7FA 2OWXA 3N15A 3VIFA 2UY4A 3WD3A 3SCUA 4EANA 1JD7A 4AZHA 3FAXA 2J7DA 3BMWA 2W66A 1WP6A 3VIGA 2ZUNA 1TZ7A 4PSRA 3VU2A 1B90A 3GDBA 3K1DA 4MB3A 2FGLA 1BYAA 1XGZA 1UKPA 4V27A 3MSGA 3KZSA 1JYWA 4ZFMA 1HJWA 2DIJA 2G8ZA 4PMVA 1CPUA 2OYKA 4AISA 1F4AA 2XVPA 3MU7A 1NWSA 9CGTA 1UZ1A 1FH9A 4RE3A 3VDBA 2A3CA 3K4DA 1TMQA 5EMYA 4P8VA 4U2ZA 1TCMA 3GXFA 3KE0A 1G1YA 1OINA 1XSKA 1ECEA 3IAPA 4RL3A 3ZOAA 4QLLA 1ZBCA 2G41A 2ZX5A 1UH3A 4H2CA 4GI6A 3WD0A 3QHMA 4DWSA 2Y8KA 1JYXA 1CGYA 1DHKA 3AMGA 3AHXA 2EPLX 1V08A 3BGAA 1K9FA 4BS0A 3T0BA 4UQDA 2VOTA 4OJYA 2WZHA 4FLSA 1ESWA 3DYOA 2AOSA 5A6SA 3VGFA 3WH9A 3UG5A 5A8QA 1UQYA 2DSZA 3L4YA 7CGTA 2EJ1A 1R85A 4BQ3A 1PZ2A 5ECUA 3N13A 1W3HA 1ZB5A 2VVNA 3CIVA 3KL3A 5IHRA 1KGWA 3I3EA 3A4AA 2VCCA 3SCTA 4CCEA 2VO5A 5AY7A 3WFLA 4AD2A 4JFWA 2D20A 5JIPA 4DUVA 1H0GA 1LWJA 2BNJA 2E9MA 1V0NA 1WNOA 4OUEA 5FIPA 3WBAA 4IPNB 4A3HA 2J7CA 1KGUA 1UKQA 4PCSA 4AD1A 3U7BA 3LPFA 1I1WA 2VURA 2ZUUA 2XHYA 5CG0A 3RJYA 3SCQA 1FFQA 1QBBA 2ZXQA 3MV01 1JI1A 3FAWA 3VGHA 3CGTA 1PX3A 2ZIDA 1SYTA 3N04A 2WBGA 3ZT6A 3U57A 1JDCA 3WMCA 5D9OA 1EOKA 5LYRA 4AMCA 3POHA 2V3GA 1NH6A 4M80A 4DWSC 4AIOA 3EDDA 2V3DA 1HVQA 4PTWA 1V3HA 4WLCA 2AAAA 4DM2A 3WQ5A 1M53A 4Z2IA 3BSHA 4ACYA 4NRSA 3HMCA 2YA1A 3SUVA 4UFIA 2EXOA 2O9OA 5BRQA 4M56A 4PTMA 1IZKA 4UQCA 2DSUA 4H8UA 3WMBA 1V0KA 4F8XA 1J12A 4PMDA 4CD8A 1W3KA 2EPOA 3VKKA 4UFLA 1CLXA 2VZOA 3D5HA 3THCA 2F8QA 1KBBA 2C7FA 2B31A 1W9XA 2WVUA 3WEMA 3ZJ8A 1E4MM 2D22A 1NWRA 2J4GA 2QMKA 1QNPA 1OD0A 1CIUA 1QHOA 4W8LA 4AD4A 1PX8A 2XIBA 2JF6A 1WE5A 3K8LA 1E0WA 3VMOA 4LYRA 1HX0A 2NT1A 2CEQA 3AZSA 3N1AA 4U33A 3UR8A 1C8XA 4PMZA 4LPCA 1CXHA 1BQCA 2JFEX 1GW1A 1WKYA 5C71A 1BGAA 2WB5A 3B9EA 5ABGA 3MO4A 4MAZA 4Q22A 4CD5A 2ZX8A 2W5FA 3L4VA 1UKSA 1C93A 3RO8A 1HL9A 2CETA 2J79A 1UKOA 1HJQA 4JAWA 1V3IA 3SCPA 2WKGA 1GQKA 2O92A 3T2PA 5E09A 2E8YA 2DT3A 4TOQA 3L4UA 3OBAA 4MNLA 1E70M 3GH5A 1ZJBA 2WMHA 1R7AA 2YL5A 4YHEA 5I79A 2WNWA 3CO4A 1UWIA 2YA0A 4M81A 1XYZA 1BPLB 2GDUA 1KB3A 3NSNA 1U30A 4BZYA 4EAMA 1WDSA 4PN2A 4GINA 1UR9A 4HA4A 4AZCA 1IZJA 5DT7A 1UD5A 2XVNA 4J3WA 1S46A 1VAHA 1TR1A 1JYVA 5GNZA 1G01A 1XCXA 3W82A 4P7QA 2AMGA 4DM1A 1XHGA 3CTTA 4LX4A 1CYGA 2O9RA 1DTUA 3E1F1 2WXDM 5GPRA 3CHCA 5A6BD 3AOFA 1UZ4A 3VD9A 1MXDA 1UKTA 1V6UA 4KMQA 1K9DA 3AYSA 2WPGA 1E55A 3LMYA 1NQ6A 3RM9A 1W1VA 2ZWZA 2DSKA 4FLOA 3AFBA 3ALFA 2XFRA 3CLWA 1XSJA 3AZRA 1AVAA 4JCLA 3CHFA 1E73M 2Y2WA 4PMYA 3W29A 3O2LA 1TA3B 4HZ7A 1PIGA 2WK2A 4ATWA 2QMJA 3S2CA 3FNDA 1L0PA 4AZ5A 1TUXA 2JEPA 2V5CA 1UYQA 3MUIA 3THDA 3FW6A 1OIFA 3BC9A 1DWHM 1H09A 4QDMA 2QF8A 2DH3A 2BV9A 4HOZA 1MWOA 3L4WA 4MTVA 1LWHA 3WH8A 1GVYA 1PPIA 3CH9A 1XCWA 3GH7A 1FOBA 1JG9A 2WMGA 4J27A 3ARYA 4UQEA 4OZOA 1W9PA 3CPUA 4TTGA 3BCDA 1NOUA 2J75A 1CZ1A 1JD9A 2D3LA 4HPHA 1XRVA 4B3LA 2VJXA 1UD2A 1BYCA 3BAJA 5CPSA 3VDAA 2BY3A 4U3AA 4CU6A 3AXHA 3PZNA 1BF2A 1BG9A 5CJ5A 5I77A 3W4RA 4UQAA 1FHDA 2FDMA 5I23A 1HXJA 1C7SA 2YL9A 3ZT5A 1WDQA 1CENA 3BSGA 1GHRA 1VIWA 1E15A 1DWIM 1VJZA 2BHUA 2E0PA 4Z2HA 4FMVA 2A3HA 1CXLA 2ZUVA 1HJXA 2VZVA 3D3AA 3OGSA 1RH9A 3IAQA 1B3WA 1E4NA 3SCSA 4FF5A 3AHZA 3PZOA 2GJRA 2G3NA 2OSXA 2PWGA 3WIJA 3RDKA 1GQIA 1V02E 1FP9A 3VNZA 3BAWA 5E9AA 5E6YA 2YDRA 2WHKA 3OGRA 4JKKA 3WUGA 4DUWA 3ZR6A 5CXPA 5EFDA 2WBKA 1VFMA 4W89A 5I2UA 1C92A 3FHAA 1W9VA 3VIKA 3MUAA 1HKMA 6TAAA 4M29A 5ABEA 1UD4A 5A6JA 4PCTA 3WD2A 2YA2A 3WDIA 4MDPA 1ISWA 4JKMA 1DWFM 1JFHA 4MAVA 5EB8A 3B8SA 3TTQA 1YHTA 1JGIA 4D6FA 2UY3A 3K46A 3M7SA 2E9LA 1V02A 1E6QM 2PBGA 5IFTA 2D2OA 2BHZA 4E8CA 4IISA 1UA7A 3MS8A 3WL1A 2WKLA 1Q4NX 1OB0A 1QHZA 1NARA 3QHOA 4U3CA 1U33A 5IFPA 2W67A 3SIMA 1CXIA 1GJWA 4NZCA 3CUIA 2EPMX 1UR1A 4AZ7A 1OCQA 2BY2A 4JHZA 3U5UA 1QI2A 3B9AA 3W53A 5BXPA 3PZMA 4E4PA 4ATLA 3DECA 3TA9A 2DT2A 1RD6A 1ISYA 1HNYA 1PX4A 4Y7EA 4UFKA 4MB1A 1E40A 5FD0A 4W88A 5A8OA 5DT5A 3WH6A 4AD3A 3A4XA 4JL2A 3U5YA 3K8KA 4OBRA 2EO7A 5D8WA 3WFZA 1WDRA 3ARZA 4KRTA 4CCCA 3BMVA 4S3JA 2YL8A 3RJXA 2YLLA 4B9YA 1M03A 3BAKA 3IK2A 4HU0A 3POCA 2D3NA 3WDQA 1C8QA 3SCRA 3MMDA 6A3HA 1JDAA 1EHNA 5A3HA 4LYQA 3ARTA 1P6WA 2FH6A 4UTFA 1GOKA 4EE9A 1ISVA 1V3KA 2YDSA 1CDGA 1J0JA 3W81A 4ZENA 3EDJA 3O9NA 2GVYA 4A3YA 3TTSA 2JF7A 4U5KA 2NSXA 3IJ8A 2QV4A 2WMIB 1HP4A 3WH5A 1EIBA 3EYPA 4IUGA 4W7UA 1MW2A 5A2CA 2XM1A 3BAXA 3GM8A 1OIMA 4M24A 3J7HA 4MPKA 2YL6A 2DSVA 2E4TA 4W87A 5I3DA 2DQXA 2WAGA 4B15A 2WCGA 3W6MA 1J0IA 3SCNA 1I1XA 4A4AA 1CXEA 1VJSA 1NOWA 4CCDA 4H04A 1H49A 2CBJA 2VNCA 3GNOA 1LJYA 2CNCA 2Q8XA 3TTOA 2VRJA 1EO5A 3BLKA 5IDIA 1W3JA 1GOQA 3PHAA 1CGWA 5HBFA 3TP4A 1PEZA 3WENA 4D1JA 2FH8A 2PBOA 4D1IA 2QHAA 5A94A 4LXFA 4WKHA 1E43A 1BVNP 4H8VA 4WK9A 2DT0A 3VIJA 4AW7A 2BVTA 3WQ4A 4MJ4A 5CPTA 4MNMA 1G94A 3N9KA 2OYMA 3AIUA 1XH2A 1EH9A 2GDVA 1VFUA 3L2LA 3TTYA 1FP8A 4ML4A 3DYMA 2X05A 7TAAA 2WMFA 3K4AA 2JEQA 3NSMA 3W28A 2WSKA 3VNYA 3NIYA 2YBUA 3CZGA 4CD6A 1R7OA 3EMQA 1FA2A 4AC1X 1NOFA 2G4FA 4GZEA 5I0DA 3AISA 1J0YA 4CKQA 2DSWA 5A6KA 4Z2LA 1XH1A 2XVKA 4MADA 1EQPA 4JKLA 2A3BA 4B16A 1KCKA 1UHVA 2UWFA 2CXGA 1GNXA 3CUHA 2W92A 1UOKA 4KH2A 5CZKA 3GBDA 1OGSA 3WQ8A 1DP0A 5JUVA 2EPNA 4F9JA 1Z32X 3FY1A 2WM0A 2J78A 1H2JA 1QPKA 3I3DA 2HVMA 4U31A 5C8BB 2WHMA 1C7TA 1H3GA 3CZKA 2F2HA 5JIWA 1QI4A 4UNIA 3WDJA 3SUTA 4BQ2A 1EOMA 4PYSA 5LA0A 2UY2A 3G6LA 2BHYA 1EQCA 2ZXAA 3PTKA 2XJ7A 1EHAA 1UUQA 1ZL1A 4HA1A 4GKLA 1W9BM 2PI6A 1CECA 2DPEA 1VFFA 1E4LA 4JFVA 1TA3A 4W84A 4YPJA 4ZEPA 3OB8A 2CHNA 2PWFA 1QHPA 1RP9A 3EDEA 4LQ1A 3NUKA 4IM4A 1JFXA 1KXHA 1ISZA 4MNKA 3VM7A 2J7GA 1KCLA 1JZ3A 3W37A 5F7UA 5HNNA 5LA1A 4LGXA 4BF7A 1XSIA 2VL4A 4ACZA 2WC3A 1JYNA 1X6LA 5GNXA 5A69A 3A4WA 2WVVB 4LYPA 3BXWA 1HN1A 4JZ5A
chains in the Genus database with same CATH superfamily
3VO0A 2DORA 3AXKA 3E0LA 2BX7A 2CZDA 2OWWA 2A21A 4FF7A 1FXPA 4XUGA 4QCFA 2V5KA 4NX5A 1RLDA 1J0KA 1GZJA 3URAA 1QI0A 4Z17A 1HJSA 4MUZA 3M0LA 2PD5A 1S2AA 3TCEA 4D6GA 1HJVA 3PBWA 2ISSA 1AJ0A 1K6AA 2V67A 4IIEA 2ABBA 1VPQA 2PTXA 3ALGA 3V1HA 1F3XA 1OWQA 3GTHA 4HNUA 3GYCA 3DHFA 4H9MA 4KCWA 1RZMA 3CB3A 4QISA 5EYWA 1MRQA 3H2AA 3L65A 1QW7A 4JTJA 2Z1BA 3XIMA 4BF5A 4PGLA 4MB4A 3F4WA 3IVTA 1F8MA 1AL7A 1H4PA 4GY1A 2QZRA 4V33A 3FGCB 3TONA 3EXTA 3UZJA 1SJAA 4DWSB 1ITXA 1JDDA 2BB0A 2VFGA 1FHLA 3AHVA 3KRZA 4W7WA 3N18A 5BWFA 4HJWA 3RR1A 3TA6A 1GOOA 3WNMA 1DXIA 1ENUA 2YJQA 4K8HA 3FJ4A 3OIHA 4NI3A 2QCDA 3BDKA 3T0CA 4D71A 3MMUA 1GOXA 1MYRA 4D6HA 3WELA 3GHUA 2F38A 4LRSA 1VLIA 1DVJA 5M3WA 4HK5A 2WHLA 3UR5A 3GXIA 1P0EA 2Z1KA 5AECA 2ISWA 4JTQA 4V1XA 5CC7A 4MIMA 1W1ZA 4MB5A 2ISVA 3H2NA 4LAZA 3RM8A 4GVFA 4EXQA 3MPGA 1HQTA 4PUNA 3WN6A 3M46A 1QCWA 4DJED 3WUFA 3L12A 1X8CA 1JPDX 4GYPA 3GVGA 1KXVA 1KXQA 1Y7VA 4L4OA 1QNSA 3PN8A 4LAOA 3T8LA 1J01A 3HZ3A 4W86A 3RRXA 3PZVA 4AWUA 2DT1A 5BXSA 1UWRA 4WJXA 1V3LA 3GU1A 5EL1A 1HIZA 4WSKA 1QBAA 3EKZA 3M6YA 2HWGA 1TIMA 1LWIA 4XAYA 2KZHA 3GKAA 4PMQA 3QLDA 4GIYA 2INEA 3E0WA 1XYBA 3GNRA 1CGUA 2J7EA 5CLTA 3W1XA 1OZQA 1OBAA 4YL2A 2X09A 3NPVA 4QJ5B 5I7GA 3UWWA 4PMRA 3SCVA 3TR9A 2GQ8A 1R3WA 3M0IA 1GPFA 3F5JA 4TV6A 5AC6A 3O63A 3UEQA 3XISA 3B8WA 3T2OA 4O1DA 1TVNA 3WLPA 2VC7A 3H8AA 1WO2A 4AMAA 4IJBA 3UY7A 2V3EA 3NQCA 1J0HA 3HPFA 2XISA 4AEFA 5HQLA 3PR2A 1DKWA 2ZRUA 4DI8A 2VZSA 3DFHA 2VMFA 2Q09A 1XDJA 3S2JA 2PSNA 4BA0A 4O1EA 3N2TA 5DO8A 1NP2A 5A8NA 5D02A 4V15A 5J5DA 1XD0A 4MOZA 3TNBA 2PLCA 4ES4A 3GTIA 4Q6JA 2VX6A 3BARA 2W61A 4K8EA 4IQDA 2VDIA 4M51A 3I6EA 4HYRA 5EFFA 3SGUA 4IP7A 4KFPA 4IPIA 3LLFA 1S1RA 4NZ1A 3GD6A 4Z2JA 3VOJA 1WZAA 3BV4A 4JDYA 3U2ZA 1I6NA 5EMMA 1VKFA 3OTRA 4UOJA 2E9BA 2UZ9A 3B04A 4UTKA 1CI1A 1SR0A 4FPSA 4Q8TA 2O9PA 3EWZA 3V0SA 4QTGA 1X1OA 3R8HA 2Z1SA 1BXBA 4R53A 1O7AA 3MT1A 1F8IA 1TJ1A 4DYJA 3OW1A 3ARUA 3W1MA 1E6SM 4DYKA 1VR6A 3R7MA 1GVIA 2EEXA 4GJJA 1V03A 4AZCB 1YRRA 4HNNA 3HMJG 2FPVA 3IK4A 1B9ZA 5PTDA 5E6ZA 3F1QA 5AHEA 1P7TB 2YXXA 4C6FA 3N2BA 1VCGA 2QCMA 2WANA 2G3IA 3M07A 3VIPA 3CZ8A 3R13A 1GOWA 1M04A 5K9DA 4JBRA 5G4WA 4D6EA 3QGKC 3C4UA 1RHCA 1ELSA 4OE7A 5CCZA 4GKTA 1EBHA 1FKWA 3CU2A 5CZJA 4AXNA 3W38A 3CAQA 3NM1A 4GNKB 2C8NA 2ZOXA 4TX9A 1Z7AA 2ZUTA 3DAQA 1A47A 1NP0A 1Y5WA 1G4TA 3H2CA 2R14A 2XINA 3AQUA 3FA5A 1BVZA 4ZR8A 1UD8A 3FDGA 4KCVA 3NZPA 4GUGA 3NO5A 3H4GA 3W88A 4LJ3A 2XIOA 3UNDA 1XIFA 2GGGA 3CZEA 4YU1A 4RE4A 1P0NA 3USBA 5ECVA 1S2CA 1PTGA 3UR7A 5A6LA 5G1YA 2OU4A 1UQZA 1O94A 3VINA 1MRAA 4Q4SA 4XTDA 3N17A 2V30A 4ZVJA 4QG6A 2QPSA 3F5KA 4O1FA 1UBPC 1TJ0A 2VFEA 7PTDA 1OM0A 4X22A 3A5FA 3SUWA 2O9TA 1POJA 2L5HA 4LWWA 4M7TA 3C61A 4QEEA 2ZX6A 4KRZA 1GYMA 1FKXA 4LEFA 1H60A 3MV11 4NQ1A 2CITA 3CUGA 3GVQA 4X0VA 4XSMA 3Q58A 4R88A 3RU6A 3PZUA 1RJQA 1QO5A 2J62A 4N6FA 1W2VA 1ADOA 5HOSA 4PTXA 3CUJA 5E93A 2VUNA 5A2AA 3VOFA 3G3MA 3ZSSA 1TPUA 1W1PA 2OEMA 3CO8A 5FKYA 2IKHA 4IWWA 4XTIA 4ZE4A 3HGSA 3JVAA 5AOUA 3PZQA 3QMTA 1EJVC 1RCOB 4AFYA 1BFNA 2EQDA 1BYDA 3R2GA 4Q4PA 1MQQA 1B3XA 1FHUA 1NEYA 3GDLA 5HA7A 1PL9A 4G1NA 2A6NA 4ZODA 5FJUA 3GC5A 1B3YA 1O5KA 1EJTC 3LI1A 3VM5A 3C2EA 2ISFA 3HPAA 1NDWA 1W3TA 1VF8A 5D2VA 4H9XA 3IIXA 3MY9A 5JBDA 4YHGA 3RF9A 1EC7A 1XV8A 4FLRA 1Q8AA 3HFTA 1WXJA 5EMUA 4C60A 3VIOA 3NPWA 3TOYA 3WCZA 4D6JA 2J13A 4E8DA 4R7OA 3NJ3A 4HU3A 2J8TA 1TE1A 2EG6A 1VBGA 4P5UA 1B30A 1AD4A 1R3YA 2PCEA 1GKQA 2MANA 2E7FA 4B4FA 3F2BA 1J10A 3RLHA 4P7OA 4JFSA 4QFUA 1ZP4A 1ONEA 4PUUA 1QUMA 3PY2A 1GT8A 3TN6A 5CLWA 2EGZA 3QYQA 5FJRA 3OVGA 2E6AA 2ATSA 3S1VA 3T05A 2AKZA 3SM0A 4AD5A 3PZIA 3MVIA 3OLEA 4OVXA 2GJNA 3EDKA 3W00A 3W85A 3LCWA 5CC3A 1X6UA 2XPKA 1GZGA 5AYYA 3M43A 3DG6A 3S9IA 2BP1A 4HTYA 3Q37A 4HCLA 1T96A 1VBHA 3EWBX 1MXGA 1TV7A 1TQJA 4QGCA 1FBAA 1ZLPA 1DJQA 4O1CA 1E71M 2PDNA 1J9YA 3GXDA 2RGMA 1UW9A 4EK7A 4PTVA 4CD4A 1TV3A 3VKCA 3ARVA 2Y5SA 3FA4A 3P93A 1K70A 3A22A 2EPHA 3VNIA 2ZADA 3SFKA 2Z6IA 4D8ZA 4H41A 4CQ8A 5MKGB 1TRDA 4LOCA 1YIXA 4M6PA 5BMWA 1QVBA 1SR9A 4QJ3B 4AYGA 4FEZA 3SR7A 1EP2A 1XLCA 5EBAA 2VCAA 4LUSA 3GVRA 3NA8A 4M8UA 1E6RA 1OT2A 1F6KA 3DFNA 1E9LA 4K6AA 5IBXC 3LM3A 4ZQPA 2OGJA 1C29A 6ALDA 1AH4A 3W1PA 4GPNA 3C6CA 3W74A 2CLKA 1GCYA 3U8GA 3TMQA 3TC3A 4CNUA 2C19A 5IHSA 4E2BA 2W63A 3ZIZA 3MP4A 2ZA1A 4R9OA 1JZ8A 3R79A 3W7OA 3WFAA 5TD4A 3CQ0A 3LERA 1XLFA 4LANA 4PRRA 5DXYA 1LOQA 1BGGA 2HE8A 2FLIA 2B81A 3PP7A 3ARSA 2QR6A 3O15A 3MSYA 1XD1A 1ZPTA 4YTRA 1LG2A 2V3FA 2XZ9A 5FF3A 4D2JA 5HWNA 2XU2A 4JTTA 3WH7A 4DY1A 4A29A 2R6OA 5JH1A 1M7OA 3UT0A 4B91A 3RLUA 3H26A 1HKVA 4MDOA 2ZYFA 3KBJA 4UOZA 1QO2A 3PUDA 4GG9A 2B7OA 5H8MA 2PCQA 4DELA 4CQDA 3EWXA 4CU8A 3ELFA 3LQGA 4Y8FA 1QTWA 1RAKA 3F4CA 5LNWA 3VUPA 4IJRA 1O68A 1XW8A 5M17A 4GFIA 1JL8A 3NL6A 3CWOX 5LZLA 1MW1A 3W2LA 2I5IA 2ODOA 3I65A 4OOZA 3WMSA 3WNNA 3CYVA 2F61A 5CG7A 1H63A 5DMLA 3G22A 1XBVA 4ZXLA 1GWJA 3VD4A 2ACRA 4DZAA 4PMJA 3CPRA 2QLYA 4GJIA 3HU7A 3RMEA 4DNMA 2QQ6A 4Q4OA 1ZBKA 2E28A 4LH8A 3CV2A 4F66A 3W1TA 3E0FA 1NWTA 4JIEA 4S3BA 3QPZA 2OQYA 3W7RA 4AF0A 4K1GA 3HURA 2OVLA 3VNJA 2YDQA 2Z26A 4AWEA 4CVUA 1CLKA 1LUCB 2NWRA 2W6RA 3WJZA 1PTDA 1MUWA 3NL3A 4O14A 1ZJIA 4JX4A 2V68A 3SBFA 3TLLA 2WHJA 1QOXA 5FOOA 3R94A 4HZ8A 4TU1A 1IR1A 2JE8A 3KP0A 4X9SA 3UR2A 4F79A 3PUOA 7A3HA 1UCWA 2GGJA 4JXCA 5REQA 2J66A 5ABHA 2W4XA 4WDUA 1YPXA 1KNWA 1P48A 2P10A 1DQXA 4IL2A 1X39A 1JDEA 3GVVA 3L4XA 4H8HA 1D8WA 3WLSA 4HYWA 3W6LA 2PDPA 3WQVA 2J9YA 3TJXA 6REQB 5E0FA 2GK1B 1QRQA 3QR3A 4J7RA 3M0XA 2XSAA 1JPHA 1TPB1 1VYSX 3EOUA 2AL2A 1QW8A 4KT2A 1BYBA 3O6AA 4RPQA 5E0CA 2HSAA 4GI8A 1D3GA 1JVNA 1O1HA 1C91A 4DN1A 2WWCA 1A5OC 1TWDA 2C71A 4L6HA 2DVXA 5GQBA 2Z4GA 3N14A 3F4VA 1GVSA 2IQ0A 4P7RA 1QPQA 4ENLA 1YDOA 3UCQA 3TYCA 1EP3A 4B5SA 5T9CE 4A6GA 3PUEA 3ANUA 6ENLA 1AW2A 1TYGA 2ZQ0A 3NGJA 4HN4A 5A8PA 1AMYA 1RCXB 2BY0A 4UZUA 4KIRA 4GIAA 4N42A 1IT0A 2PFHA 4E3TA 3MP3A 4GYKA 3GG1A 2WVVA 4LNYA 2Y8VA 4PBEA 3R43A 1R3SA 4KCTA 5DX7A 3REQB 4JGDA 4CNPA 3W75A 3BAIA 1DXFA 3IANA 3ZVIA 1GVQA 1U1HA 1K4GA 3OA5A 4C7FA 3VIFA 3SCUA 1BD0A 1KM2A 4H9ZA 3FAXA 2W66A 2ZUNA 2Y8UA 3VU2A 4LB3A 1B90A 3GDBA 1V77A 3C2RA 1UKPA 4J4KA 1EWDA 3PNUA 1MMFA 1QFEA 5JQ9A 4C6LA 3GWQA 3SW6A 4AISA 1F4AA 2PWVA 5D37A 1H50A 3S42A 4HU4A 1HZYA 4PUWA 3E3HA 4H7ZA 1NJJA 5LIYX 1XF0A 2PAJA 4U2ZA 2YZ5A 3GXFA 4NG3A 5DRIA 1FTXA 1XSKA 1C8VA 3BGJA 3FGCA 4H2CA 2QCLA 4DWSA 4Z1YA 3ATZA 2NX3A 4BS0A 1NSJA 4UQDA 4OJYA 5A6SA 1YE6A 3W2JA 4BQ3A 4L80A 5ECUA 4CLMA 3GYEA 4AY7A 3W01A 2VEIA 2VVNA 3LTYA 3AWNA 3KL3A 3A4AA 1TPEA 4CCEA 2VO5A 3WLRA 1KM0A 4A05A 4JFWA 3C3NA 1H0GA 4E38A 1LWJA 1Q6QA 2BNJA 4XAFA 5FIPA 4A3HA 4ZO7A 2YZRA 2EG7A 1N8FA 4J35A 1KA9F 3RU8X 3HOJA 2ZUUA 1EB3A 1PKLA 1OFBA 4MF4A 5CG0A 3UCCA 1FDYA 3BJTA 3HPXA 4LEQA 4H00A 1VHCA 3LGEA 4EPEC 3CK5A 3ZLFA 1BXCA 2A4AA 1E51A 2Y70A 3UZZA 4LUIA 5K4XA 3O07A 1NVMA 3VGHA 4YYFA 4RKAA 1AH3A 1ITUA 4UMBA 8RUCA 1TMHA 3N04A 3R8RA 3M64A 3ZT6A 3QQWA 1JDCA 1IGSA 4XBSA 3OA3A 5LYRA 4AMCA 1IQ8A 4M80A 4PCNA 4AIOA 3SADA 4PTWA 4DBWA 2AAAA 3WO8A 4BF9A 4UNLA 5D30A 1EEPA 4FXFA 4NRSA 3NQEA 4RR4A 3SUVA 3W70A 2REQB 3FCPA 1AA1B 2RJHA 1F3WA 2XN1A 3MW7A 3QC3A 3DHDA 4F0HA 1ZCCA 2EPOA 4L5ZA 1TX0A 4N4QA 2VZOA 4H19A 3P67A 3THCA 2F8QA 5AVHA 1N8WA 1KLZA 1T6MA 4IPJA 2J4GA 1VFSA 4MJMA 3IJQA 1X97A 1IWBA 4W8LA 1PX8A 2XIBA 3VMOA 3GG7A 2NT1A 3PWGA 1C8XA 4PMZA 4LPCA 2JFEX 1ADDA 2Z0IA 3JZEA 2WSRA 1GPWA 1IEIA 3B9EA 3UBPC 4RCXA 1Q7MA 2XN0A 4C6QA 3HG4A 1EPXA 2J79A 3NNTA 1YPIA 2OO0A 3EPMA 1V3IA 2QUTA 4IXXA 2DZWA 5EY5A 1DJNA 1YEYA 3LBCA 3H54A 3NQBA 1M7JA 1IF2A 1R47A 5G2WA 5E09A 3NPXA 2DT3A 3GKFA 3SJNA 3OBAA 4MNLA 3MCMA 3GH5A 2NXIA 3DIPA 1ZJBA 1R7AA 3LNPA 4F0LA 1YPFA 1W17A 2PDXA 1UWIA 4M81A 5C9UA 1Y5XA 2OMAA 4G5DA 4PCPA 1LDCA 4AZCA 5BMXA 1IZJA 1UD5A 5DCBA 3GIQA 1DOSA 2VENA 4C1NB 1PWMA 4KS0A 4XO6A 1VAHA 2GVGA 3TH6A 4XKYA 5GNZA 4NJHA 1G01A 1WDDA 3WBYA 1P7TA 3W76A 1CYGA 3WLNA 5GPRA 1EF2A 5A6BD 2Q3RA 2XIJA 1UZ4A 4DJDD 1OCBA 1ZUAX 3M0JA 2ZWZA 1LTDA 3M0YA 3VABA 1MEHA 2R1KA 4DBEA 4Y90A 3T40A 3ALFA 2XFRA 5DXXA 3KDNA 3BLFA 1VH7A 3DFSA 1E73M 2Y2WA 1LOSA 3O2LA 1J96A 1PIGA 2QMJA 5AFDA 4AZ5A 3R89A 3W7CA 2PZ0A 2FDSA 1K7FA 1UYQA 3MUIA 3THDA 2WZMA 3FW6A 1YDNA 1OIFA 4QDMA 2QF8A 1WQ5A 2D69A 1B5TA 3H70A 4IIHA 1MWOA 1KRAC 1T5AA 1PZ0A 3L4WA 4GFSA 5C9WA 2F6KA 5F4SA 1I60A 1SO3A 1PPIA 4NYUA 4AVFA 4AU0A 3GH7A 1FOBA 1TJRA 4J27A 1ZALA 3WQGA 4Y9PA 4DJFA 1Z8AA 2D3LA 1MI3A 3H55A 5LNRA 4HPHA 2Z28A 1XRVA 4XG1A 2VJXA 4B3LA 1UD2A 3IIVA 5CPSA 4CQ9A 2PRHA 2B7QA 5CJ5A 1W0MA 1HXJA 2FMOA 1S2TA 4KQNA 2R94A 3ZT5A 1CENA 2YCLB 3HJZA 2BHUA 2A3HA 1NIUA 4IFKB 5K7JA 4PA8A 2FPTA 2ZFAA 4CEXC 5C9RA 2BGNE 2DZXA 3AHZA 5LGXA 1ZFJA 3B9OA 1GQIA 1UUOA 5E9AA 3W2MA 3V0TA 1F61A 3FXGA 2YDRA 1ECQA 3UXIA 3LK6A 3E9AA 3CASA 3V75A 1VFMA 2QULA 5AZ0A 3VIKA 3MUAA 4CEUC 1EKOA 1UD4A 4RXFA 3OZMA 4JTEA 3WD2A 3WDIA 4AWTA 5AHLA 4FX8A 3UZ5A 1LLWA 4LF1A 1EGVA 5EB8A 3TTQA 1JGIA 3AO0A 3WLMA 4D6FA 5LIXX 3DG3A 5DANA 3H12A 1V02A 2PBGA 1PDZA 4QITA 2D2OA 2YDAA 3CWHA 1UA7A 3WL1A 2DVUA 1NARA 3TEVA 1GKRA 4Q8PA 2WNNA 4IGNA 2W67A 3W7KA 4NZCA 1FWFC 2EPMX 3G0XA 5BU6A 1MO0A 3U9IA 1OCQA 2A85A 3GSMA 3TV8A 2Z2BA 1QI2A 5BXPA 3PZMA 4E4PA 2A7PA 3TA9A 2DT2A 1PX4A 4Y7EA 1E40A 3BMXA 4FNPA 5A8OA 4R9XA 4JL2A 3U5YA 3IWPA 5D8WA 3ORWA 1DJHA 3W86A 3BMVA 4FNRA 1W37A 4MHBA 1F7BA 1M03A 3BAKA 3G2GA 3POCA 4F3HA 4HVXA 3VFCA 1C8QA 5DQPA 2V63A 1LQAA 6A3HA 3W72A 5A3HA 1YTEA 2QCHA 4MLRA 1P6WA 2FH6A 4EE9A 1ISVA 2POTA 2NQHA 3H7VA 2A0NA 2YDSA 1CDGA 3BW4A 4ICNA 2GVYA 4A3YA 2JF7A 3S3GA 4U5KA 4CQBA 4EPKA 3WH5A 3IUIA 1XIHA 1R2RA 1J5TA 1IEXA 1MW2A 4M6QA 5A2CA 4M24A 4HB7A 2YL6A 3N2MA 2QDGA 5I3DA 1VIZA 2DQXA 3UWQA 2WCGA 5D38A 2C15A 2NX1A 2QCGA 2VYOA 4GXWA 4JTIA 4ADTA 1VJSA 1S38A 4CCDA 2ISDA 3E96A 5MKGA 5I3KA 2CBJA 4ZQCA 1LJYA 4WXZA 3KAOA 3BLKA 5IDIA 1W3JA 4I6KA 4YVXA 1CGWA 4IX0A 1V8EA 4XIAA 3H23A 2BOFX 2QHAA 3GDKA 4CNTA 1W3NA 4HSOA 4JNYA 2V69A 1PTAA 4QDPA 2DT0A 3AUOA 5CPTA 4LTSA 4G2DA 3TTYA 4IQJA 3COTA 3NVDA 5LKYA 3W28A 3VNYA 2WO5A 2PDHA 4LCQA 5LIUX 4DBDA 3GC2A 3SZ8A 4O1AA 4A3RA 2OZ3A 4CKQA 2KAUC 4NAEB 1SSGA 3A64A 4N9EA 2Z1VA 4Z2LA 2XVKA 4B2DD 3ZWSA 2I16A 2VD8A 1EQPA 2A3BA 4NJKA 1XWYA 5I00A 4KH2A 3OZYA 3QW3A 4LV9A 3WQ8A 4RW5A 3N6JA 4F9JA 3FY1A 3W73A 1XIBA 4HCDA 4ERAA 1H2JA 4FSAA 1UROA 4GISA 1C7TA 1NFBA 1FCBA 3H2EA 2Z27A 4LFYA 3CZKA 3EB4A 3LHVA 1G6CA 5C9XA 4U10A 5I03A 3N29A 3BG3A 2XJ7A 1XPYA 1EHAA 3M0ZA 4HA1A 3C2VA 1CECA 2PTYA 1LCOA 1RR2A 2GDQA 4YPJA 4ZEPA 3BOLA 1QHPA 5DN1A 4IM4A 2X42A 1THFD 1JFXA 2WZTA 4X2RA 1CB2A 5F7UA 4BK9A 4XISA 3C2OA 1XSIA 3LXBA 3B4YA 3KOWA 2D2HA 1HG3A 1UP3A 1L9WA 1FWJC 1HN1A 4F0RA 2GOKA 4JZ5A 1XIDA 3ISIX 3QLLA 1ZRQA 4JQ2A 3ZO9A 3ZT7A 3WLTA 4Z1BA 2XH4A 1Q65A 1KR0A 1E5NA 3EOOA 1J8VA 4OWGA 4Y9MA 4ZQMA 3NYZA 3P61A 1V0LA 2BXZA 2PLJA 1SJBA 2A7NA 3W83A 4L6DA 4PMXA 3MC5A 4D8AA 3LXAA 5HULA 3I68A 3W22A 3P8JA 5M5DA 2V2DA 1UR2A 3NM3A 2PU0A 1Q6DA 4J3UA 3WQPA 3AIWA 3EAUA 4W4QA 3JS3A 2Y4SA 3QHNA 3C2FA 1YXDA 5C2XA 4NI8A 2A7RA 4F0KA 3GR4A 4PRWA 3NSXA 4ZXOA 1O6IA 3SN0A 2Z6JA 5LA2A 3TW7A 2WJDA 1GOIA 4O11A 5A8MA 2PDQA 1E1FA 4PL1A 4DF1A 1OHLA 1TSIA 1LRTA 2YYTA 5EBUA 4FS9A 1JPIA 1GVEA 5DBUA 4REQB 3MYPA 3DC8A 4J3ZA 4RE2A 1ZAJA 4OIFA 3AS2A 4UQ9A 3T2QA 1XCFA 4Q4MA 2VFFA 3M0MA 4MJ2A 1M01A 2CBIA 1XH0A 1A0CA 2PP1A 2WC7A 5CGMA 5CSYA 5FJIA 1MQRA 5AC4A 2ZZ2A 1Q45A 1T8QA 2GK1A 3IGXA 3OZPA 3GTNA 1A49A 2R1NA 4O50A 3ZWTA 3VKJA 4EXBA 4AIUA 1P6CA 2G37A 3B8IA 1IWPA 4ZQOA 1JUBA 4JY8A 5BYWA 3AYTA 1L6GA 3DH7A 3UWUA 2VEGA 1ZBVA 1QPNA 3ABOA 4UFJA 1XI3A 3UGRA 1B57A 1FWRA 1XM3A 1H7XA 1W1YA 2PP3A 2O4MA 2QEZA 1PCWA 2YX0A 3GDTA 1IXPA 3AYVA 4ICMA 2H8ZA 3AJ7A 3IGSA 2PWEA 3KVJA 2NVDA 3N4AA 2WLZA 3S5OA 3H22A 5MHBA 5DY2A 4R3UA 2NW0A 3GXMA 1M7XA 3CHVA 2TODA 3UXAA 5GNYA 3GR7A 2QPUA 4G56A 5AYBA 3WQWA 3QF0A 3PBGA 1QJWA 4RE0A 1JEZA 2QKFA 1UMYA 4XIMA 3L0NA 4FZIA 1V7YA 3WQEA 2PODA 5DF0A 3UG8A 4OOUA 3TROA 8A3HA 1FWHC 4TX8A 3EEZA 4ZOEA 4HOXA 3NURA 1R9ZA 3QKEA 1Z48A 2D2GA 2ZVIA 3A3XA 2CYGA 3G18A 1EC9A 4HU8A 3WEOA 1BXNA 3PFMA 2WPBA 3DBNA 3REQA 3KS5A 1WAWA 3WQFA 3OZOA 1TX2A 4GZIA 3IJ9A 1RP8A 3W1QA 2W91A 3GZAA 1G4SA 3UWZA 1ONXA 1E6PA 4LBRA 3KLKA 1SZNA 3M47A 4DQWA 3B40A 3LS9A 1JCJA 1UC5A 2WMIA 1E72M 2OLHA 4ZE5A 4A8NA 5EU9A 3LUTA 2GL5A 1XGEA 3FYOA 1WKFA 3L4ZA 1A80A 4H9UA 5BROA 5A95A 4Z2GA 3IJIA 4LCRA 5FEPA 2RJGA 5SWUA 1H1ZA 4AIBA 2CFFA 3LHZA 3W7HA 5BRPA 2HPMA 2PB1A 3ABRA 1XLHA 4K36A 4C7DA 1JZ7A 1OC7A 3KTCA 1E4IA 3ID7A 2OZTA 4OBSA 4RPPA 2NLIA 3GU2A 3L66A 1E1EA 4IMEA 1JAEA 3HGOA 4HK6A 3TQVA 2CBUA 4UCGA 4XVEA 1FXQA 4F0SA 2PF8A 3EA2A 1OFDA 3E6EA 2J88A 3BJFA 2EBNA 1BAGA 1KFWA 5I3JA 1L8NA 3NZGA 1NM9A 3H4XA 4LVDA 4JFTA 2VDHA 1X8FA 4AUBA 3AIEA 3WEZA 3BCFA 1RQBA 4TVCA 3WYZA 2HISA 5BNKA 4ASTA 1KXTA 2WJFA 1S2WA 5C5YA 1OZMA 1QAPA 2PGWA 5CSUA 1SJDA 1F4HA 4QS5A 4ADUA 4ATDA 1UR8A 1TWWA 1EJWC 4C65A 3Q45A 5DEZA 2IXUA 4FA3A 1Q6CA 3EDFA 5CZ0A 3WQDA 1IEVA 4E2VA 2PRLA 2ONEA 2QJNA 4J40A 4HA3A 1DE6A 2JIWA 3SUUA 1LT8A 2XSXA 2VI0A 4EIVA 1A5AA 1FCUA 4KETA 5BOFA 3KUMA 3N4EA 3TFCA 2G97A 1YXCA 4JTAA 2AGTA 3W7MA 4I9TA 2XVGA 3T42A 2FGZA 4ZO8A 2ZZ6A 2PF0A 3F2DA 4M3PA 3WLKX 4FOKA 2REQA 1SFSA 2QVNA 2NQ9A 1UWTA 3PC0A 4PE8A 1GOMA 3WDPP 5AC8A 2WMKA 2X1IA 2V5DA 4H4IA 1FUYA 3FYYA 3L0GA 3RG6A 4O19A 3GX9A 3HQNA 3MHUA 3P5ZA 1TKKA 5DRCA 4R85A 3THUA 1K9EA 4X3ZA 1W5QA 3EBVA 4URIA 4DUOA 4RZ4A 1AQMA 3TC6A 4S3FA 1DQWA 3NFUA 3ES7A 3S6OA 4ICCX 2R1MA 4XKMA 4UR9A 1EDQA 3HF3A 4TR9A 3DKLA 3H6OA 5A8GA 3H7RA 4JICA 1LL7A 1MZHA 4XQ6A 4ZB2A 3S6DA 1R3QA 1UWSA 1OGBA 4LW7A 3OLIA 1B3ZA 5FJOA 2XZ7A 4FXRA 3AHYA 2X0HA 3LRMA 2OEJA 1YQ2A 4NIRA 5G1MA 2V5LA 1VB9A 2X30A 5I78A 5FF0A 4M1RA 1SM9A 2FIQA 4BCEA 4E4UA 4XSLA 4A21A 2DUZA 2PTZA 1Q6FA 3VC6A 2UV8G 1HW6A 1GTEA 3NDYA 3VFLA 7TIMA 3GR8A 4RX0A 1TG7A 5CGQA 1HKIA 1G7VA 3GZ3A 2AGKA 3AYRA 1CLVA 2OLSA 3VDHA 4C1NA 3VMNA 5CAHA 1XIMA 3RGTA 4MVAA 4XBJA 1KR1A 3S6TA 1XG4A 4YVPA 2NUYA 3MDWA 1EX1A 3P0XA 1KQYA 5ABFB 4UTIA 2XM2A 3T08A 4NL1A 1WBJA 4EPBC 2QUNA 3RLGA 1P0BA 2YKKA 3IRSA 1H5VA 2XWDA 4ZQNA 4WDWA 4N6EA 2ZXBA 3PUGA 3V0UA 1QT1A 1YNQA 2H9AA 1WOBA 1E9ZB 3KFTA 4TQTA 3NTYA 1RBLA 3MDUA 3K1GA 1GQLA 1WOAA 3FX4A 1QMLA 3EX2A 1F5ZA 3CEPA 4KGJA 2A2IA 4TTUA 3WF4A 1LQ0A 4NJGA 3NZ1A 3UJFA 3OLDA 3N9RA 3G77A 3N6HA 1BSLA 4QQUA 4NSBA 1HKJA 2CERA 2D23A 4IQEA 4KEVA 4WRHA 3N3MA 2D0GA 3B4UA 4MZYA 3PULA 4AEOA 1UR3M 3MVTA 3OIXA 1JZ5A 4AYSA 3SN1A 1KQZA 2VQTA 1CB7B 4C6IA 1GYNA 3IS4A 2TMDA 3C5QA 3BE7A 1GONA 1R3RA 1WUFA 3BL3A 4NY2A 3QV7A 1UH2A 3TNOA 5AHNA 1TFVA 4B5NA 3RCMA 5AN7A 4KRUA 2H6RA 3MHFA 1ZQ5A 1WZKA 3VVGA 4IH3A 4C90A 3CMJA 3VD7A 1VPXA 3ECQA 4S39A 2BOGX 3LSBA 5ABTA 2R9RA 1WYIA 3H2OA 2WZEA 1OD8A 1E56A 2OSWA 1RPXA 4FR6A 3MWAA 3SCOA 4EVZA 3S9YA 2FTYA 3KWXA 1HF6A 2FHBA 1SO5A 1WZLA 3BSMA 2Y5EA 1SVDA 1KFBA 3RX2A 3L2MA 4HCHA 4J3TA 2ACQA 3NVTA 3TMLA 4HPXA 4PC8A 3VD3A 2GJLA 4RUBA 3WUEA 4EWND 3MI2A 3A3WA 5FL1A 5I07A 1ZU8A 5RUBA 2HRWA 2AQWA 2DIKA 3M0VA 2AQOA 1GJUA 2R8WA 1S3TC 3GFXA 3ZM8A 1H7WA 1VZWA 2QUUA 2ZZ4A 2V81A 3WQ6A 1QI5A 3AMLA 3VIMA 3QH2A 3U0HA 5TBOA 2J24A 1X1ZA 4JIRA 2XWEA 1DORA 4PUDA 1O12A 2YOCA 3DHPA 2NVCA 1EX5A 3NDOA 5JBEA 1VEMA 1JRCA 1XC4A 3CQHA 2XFWA 3GHRA 2IUZA 1LRNA 3I3BA 1PO9A 3BW3A 5A6TC 2IKGA 3FXYA 1KFJA 3VDGA 4GE8A 1KFEA 4DJEA 3GVWA 5MF5A 4IMGA 3K4WA 5E70A 1B3VA 4O53A 4GVGA 4E2OA 1NELA 2BFGA 1Z6KA 4RK8A 2GPTA 2C3ZA 1BWLA 4UTMA 1TB3A 3NQ6A 1S2VA 1CBGA 4N02A 5KMYA 5HR6A 4IZGA 2Q6ZA 4KIEA 2J8FA 4KPLA 3RN6A 4LVAA 4IP4A 3NOYA 3TWBA 2QJHA 2PA6A 1K9TA 4FR1A 1QWGA 1P1XA 4GQQA 1Z41A 2ZE0A 1J18A 3P84A 3RPMA 1BKHA 4X63A 2PMQA 3G6MA 3NQMA 1I4NA 2OELA 3P74A 3GIPA 5HNUA 4HSNA 2HV5A 4O10A 3PJUA 5BXTA 3DI0A 4GX8A 4H6EA 1IWAA 4J3VA 4UC5A 3B8VA 1G5AA 4TMCA 4AQLA 1DXEA 3P6LA 1CXKA 3EWDA 4K2SA 2PRMA 1YX1A 3FEQA 4ZCWA 1NF7A 4NF7A 1E3XA 4L6OA 1PHWA 3B0PA 1L6FA 2IXVA 2OODA 3HG3A 2ON3A 3V7PA 4R7JA 4W85A 3NQAA 3PFRA 2BASA 4KBXA 3ARQA 4U2YA 1QU4A 1Q5MA 3AMDA 1UD6A 3WSUA 4O8RA 3K13A 2ZX7A 4DO4A 2CLPA 3NL5A 1W8SA 3HJEA 1PWLA 4L9ZA 4HHLA 4LVFA 2X8RA 5LIKX 1XC6A 4MWAD 1Z69A 4S2CA 3SI9A 3GAYA 4XZBA 1UWUA 3AWOA 1ZBWA 1D3CA 1X7FA 2GJXB 3CJPA 4Y2WA 2E6FA 2Z2AA 3STFA 3VMPA 5KETA 1G7UA 4UZSA 1VENA 4OHQA 1IT7A 1R2TA 5CC6A 1D8CA 2YFOA 4RZBA 2FQIA 1PHQA 3A21A 4NAEA 2OXNA 3WL0A 4K39A 3BH4A 3K8MA 3VOCA 3SAZA 3LPGA 1K8XA 3OGVA 3WUBA 2ASHA 4IPLA 1LL6A 1LZOA 4HMCA 3NXFA 3NQ8A 4HNCA 1HP5A 3S1XA 3KZPA 5LXXA 4INFA 1E6XM 1PJ9A 3H24A 4JX6A 1V6VA 3AJXA 2IPJA 1MUCA 3CV1A 1Q8JA 2OX1A 1NU5A 4WX2A 2J6VA 4HBKA 5AYIA 1XRTA 2JKPA 4WIWA 1KKRA 1KV5A 1TUFA 3GLCA 5HNRA 1B2YA 1DIKA 4YIWA 4B9ZA 4P7NA 3T0DA 4CN1A 5GJNA 4UXDA 3P2VA 1VCFA 1UP2A 3KS6A 4KEMA 4AZ6A 3QR0A 1N7KA 4AZIA 1T40A 3O1NA 1FWSA 6CGTA 2HNHA 1J5SA 1RBOB 4TXEA 2D0HA 2G3MA 1LBLA 4V2XA 3S0CA 1V3JA 4GK8A 2Y24A 4O13A 4AZBA 4J9JA 2GWNA 2IKJA 2X0YA 4A35A 3GE7A 1K02A 3RK8A 2ADAA 2Z1WA 3QOMA 4HMEA 3V16A 4YNGA 1E1CB 5IDZA 1M9HA 3B0VC 3C52A 1XRSA 3DFQA 1LORA 4YVVA 3AMKA 4IMDA 3N15A 5D04C 2UY4A 5DCEA 4L1WA 3AAMA 1EZ2A 4AZHA 2J7DA 4Z1CA 3TXVA 1YADA 4S3DA 3R8GA 3VIGA 3GTFA 4I7VA 3GY1A 4PSRA 3S5NA 4AVNA 5HMDA 3YPIA 3K1DA 2FGLA 1JDFA 3R4IA 1BYAA 3LENA 1PXGA 4H8NA 1JYWA 1HJWA 2DIJA 2X0SA 3I7RA 1SFTA 2GGHA 1Q13A 4O52A 1QR7A 2VGIA 3MKVA 1FH9A 3K4DA 1TMQA 1KRMA 1VC4A 1YYAA 3P3BA 2Q8ZA 4IXHA 4HZMA 5LXEA 4FIRA 3KE0A 4ZZ9A 2PGRA 3HA1A 1OINA 5FSDC 1YTKA 1A5BA 4BI5A 3IAPA 4RL3A 4DRSA 3ZOAA 3KTSA 1DYSA 3GNDA 2FZNA 3G1YA 4YJ5A 4GI6A 1UP0A 3UFYA 1JYXA 2Y8KA 4NZFA 3AMGA 3AHXA 1SFJA 2VOTA 3HFYA 4O0ZA 4FLSA 3PJXA 2EG8A 1Q4WA 2AOSA 2CZEA 5A8QA 3TU9A 3QN3A 4WY0F 2DSZA 3L4YA 7CGTA 1R85A 3NGFA 3QZAA 2INZA 1ZB5A 4ZB0A 2JK2A 1FWDC 4RDVA 5TNVA 1ZGDA 3R6IA 3GTXA 3TN3A 3I3EA 3C3UA 2DZPA 3BURA 5AY7A 3WFLA 4A2SA 4AD2A 2RKXA 3GHTA 3MCOA 3S5ZA 4NZ4A 1PS9A 3IRDA 2D20A 2VP8A 1S5TA 1V0NA 1Z89A 5FESA 1KGUA 2IPFA 4PCSA 3T7VA 3W3OA 3U7BA 8TIMA 3CS2A 2VURA 1GW9A 2BVWA 1TV4A 3L5AA 3RJYA 1Q6RA 1FFQA 4ADSA 3MV01 1SQ7A 2V9DA 2QJGA 4ILSA 3EX1A 3DU0A 3EOEA 2ZIDA 5C7HA 4H7CA 2PGFA 3FDKA 1EA0A 1BQGA 3U57A 3WMCA 5D9OA 1EOKA 1SZRA 4YCOA 1NH6A 2CLLA 4DWSC 3N2OA 2V3DA 4IGHA 3WQ5A 4Z2IA 2W9MA 4ACYA 4Q4RA 5KZEA 2YR1A 4UFIA 1B54A 1ZENA 2EXOA 2O9OA 2W0UA 4JIPA 3S1GA 1IZKA 3MJYA 1W1IE 1IEQA 5AYZA 4H8UA 4F8XA 1NDZA 4ZFCA 3RAOA 2Y61A 3EPNA 2C7FA 1KFCA 2B31A 3CMFA 2WVUA 1V6TA 3ZJ8A 3VZXA 1M41A 3CNYA 5G2IA 1NWRA 3O0KA 3RMJA 2V0TA 3CTLA 3MJMA 2V2CA 2JF6A 1E0WA 1K3UA 1XLEA 1RVKA 1EP1A 3N1AA 4L4MA 1KBLA 1K1DA 3SGZA 1R46A 4BKNA 1GEHA 1T0OA 5LNSA 3WJSA 4A8IA 2WB5A 3NOEA 4KESA 1ZSXA 3LDVA 3DERA 3LLXA 4WJ8A 4NNAA 1C93A 3MQTA 3E2QA 1VYRA 4F2UA 2ZZ3A 1HJQA 4JAWA 4FOUA 1K8CA 3LZ3A 4Q4QA 3R0UA 1TTJA 4TOQA 4O54A 3L4UA 3VAVA 4IMFA 1YXYA 2HK0A 2WMHA 4HN8A 3NR0A 3ZFHA 3RXZA 5H6HA 5I3GA 5FI8A 2WNWA 3TQPA 2O4QA 1KB3A 3NSNA 3LY0A 1JRBA 3VXGA 3PSVA 5LNVA 4S2BA 4WOQA 3ZLHA 4LU0A 1XDMA 1WDSA 4HA4A 1KM3A 1ZJHA 4WJEA 2C1IA 4YMZA 3KXQA 4MKSA 3W82A 1GJPA 4I5XA 2AMGA 2BWGA 1BKSA 4EAYA 3FFSA 3ABQA 3USZA 1RVGA 1DTUA 1TELA 4LSBA 3M0HA 3VNMA 2EKCA 3AOFA 4MY8A 4MLJA 1MXDA 1V6UA 5GJMA 3AYSA 4I8YA 4Q4KA 4K38A 4G6CA 3TFXA 4FLOA 3AFBA 4E8GA 3GXPA 3CL7A 2C13A 3OBKA 3RHGA 3CEUA 1AVAA 3CHFA 1KLYA 4PMYA 3W1NA 2PDBA 1ICSA 1GVOA 4ATWA 1HFBA 4Z0SA 2JEPA 3V5FA 2ZE3A 2V5CA 4GVHA 3KRUA 3GUWA 4FIQA 1DWHM 3EEGA 4DZ5A 1H09A 2OFJA 4JR5A 2WNQA 3QV9A 1GKPA 4MTVA 1I0DA 1VP5A 3ITXA 3WH8A 2OJPA 3SSZA 1JG9A 4UQEA 4OZOA 1W9PA 3CPUA 1XIGA 3TYEA 3P81A 2BGQA 3QQ1A 3UVIA 1XQKA 3S83A 3PS7A 3NWRA 4H2HA 1BYCA 3XINA 2BY3A 3BCJA 5AVNA 1IIGA 4OUIA 4CU6A 5DMNA 1BG9A 3CLMA 5I77A 5C2GA 3S9ZA 2Y7FA 1EBGA 1H1YA 5H91A 1AZ2A 4LV4A 2DFAA 2HCVA 5I23A 1L6SA 2F84A 4HTBA 3ITYA 1XLKA 1WDQA 4IIGA 3BSGA 1A3XA 1DWIM 3PF3A 4DXVA 2E0PA 4AVOA 2YXOA 4IMAA 4H01A 2EJAA 1Y8BA 4H1ZA 1EPVA 3D3AA 1WXZA 2ZRVA 3OGSA 3T0TA 3CM4A 3CUZA 4FF5A 2FMNA 3PZOA 3S47A 4ROPA 4ZSTA 4FXJA 2G3NA 4R33A 3RDKA 3W2KA 1V02E 3VNZA 5AHMA 1X98A 2WHKA 1RUSA 4WDTA 3ZR6A 2OT1A 1EYEA 1TRIA 1FWTA 2WBKA 4W89A 3CQIA 1C92A 3P14A 1W9VA 4NHVA 3SY8A 4IP5A 4K1WA 1KM6A 4XZ9A 4PCTA 2YA2A 2P0IA 2OGYA 1ISWA 3OVPA 4DJFC 4TO8A 4MAVA 2FVKA 1TJPA 1OEPA 3IV8A 5G2HA 5JXQA 3KHJA 4XZLX 3BOFA 2E9LA 1E6QM 3T07A 2VELA 4IISA 3MS8A 1XPGA 4IFRA 4Q8MA 4GLEA 1OB0A 1CW2A 1QHZA 3TJIA 2X2GA 2OO6A 3DGRA 3SIMA 1UJPA 4Y9OA 2FVMA 3CUIA 4QQ3A 5BW6A 5TIMA 1UR1A 4L4LA 5HQMA 3U5UA 1D3HA 2QYGA 1XLBA 1ZHAA 2G50A 2PURA 1FRBA 3NQ7A 4ATLA 4YS1A 1WKEA 3CB8A 3STEA 4MB1A 3WBXA 3F4NA 5FD0A 4QG8A 1ICQA 4W88A 1XISA 2R82A 3K8KA 3EA3A 1LLZA 2PEVA 2H3BA 3W7NA 3RFAA 4IIBA 3B8DA 4S3JA 1PE1A 1NTHA 2YL8A 4O0KA 4FNUA 4HU0A 3DENA 1SUXA 6XIAA 1QK2A 3G1RA 1H61A 2Y5JA 3SCRA 3LOTA 1OF6A 4QDWA 1EHNA 4ERIA 3ARTA 1JPMA 5LSMA 1W5OA 1GOKA 1MEIA 2PWUA 3UWVA 1TWIA 4UTWC 3HBLA 3WK2A 1CX9A 3O9NA 1PUDA 3GK0A 2ZRWA 4Z42C 3HGJA 4FI4A 3STCA 1EIBA 3G5EA 4OTKA 2XM1A 4MG4A 5F2MA 3P8IA 3RLVA 3LBOA 3J7HA 3U4AA 2DSVA 2E4TA 3QR1A 3SCNA 3S4TA 3QSTA 2C0AA 4KFNA 2PDUA 1LYXA 1CXEA 4QBXA 1NOWA 3G0SA 1KRCC 2DUXA 2VNCA 3GNOA 3DDMA 3SY5A 4LVBA 3TTOA 1BEUA 1U22A 1Y5VA 1EO5A 3I6TA 3PHAA 4BY3A 1UZDA 3L23A 5HBFA 1NDYA 2PBOA 4FX6M 1JPKA 3QGAC 1BVNP 4WK9A 3F2CA 3FKRA 1I2PA 2FTWA 4MJ4A 4ZOBA 3JW7A 3AIUA 3S8HA 1VFUA 3DYMA 1K77A 7TAAA 3K4AA 2JEQA 3NSMA 2GLKA 3NIYA 4O1BA 3CZGA 1B4KA 3LM7A 3OHIA 1R7OA 1FA2A 1NOFA 1VBJA 2G4FA 3AISA 1WV2A 3STPA 3QMRA 4I5RA 4YCPA 4B16A 2H8XA 3UWYA 2W92A 5CZKA 3W6YA 1ME8A 2ZZ1A 2YCKX 5DCDA 1Z32X 4ROQA 2WM0A 3I3DA 4U31A 4F48A 5C8BB 1NFGA 4BR1A 4DO5A 2QS8A 3G1SA 5JIWA 3FLUA 4MY9A 3QYSA 2GVJA 1E0TA 5CBBA 2CZ5A 2W27A 3E0IA 1UUQA 4WGHA 1EJXC 1E4LA 2Z25A 2Z7GA 1TA3A 4W84A 4GGBA 5C7VA 4WSHA 3WQOA 3H4WA 4MZ8A 1W1B1 1Q6LA 1KCLA 3V4BA 1JZ3A 3Q67A 4FNQA 5TF0A 5HK4A 1LM1A 4LGXA 5EMJA 4BF7A 2WC3A 1JYNA 1X6LA 3C0QA 4YTUA 2H3DA 3BK0A 1DL3A 2CZFA 3BXWA 3PTDA 4QJ1A 4CNOA 4JN6A 3OJGA 1F6YA 4LRTA 3QV8A 3G1VA 4AX6A 2EHHA 5FEXA 2XDFA 3II1A 5D2YA 1AQHA 3HG2A 2AKMA 3TVAA 2FVLA 2FB2A 4I3GA 5AC5A 1OK6A 3M6DA 4UOQA 4IL0A 2QVHA 2OWCA 3E5BA 3G1XA 3KVLA 3JUGA 1XKYA 3CC1A 4XK2A 4E5TA 4DEFA 3BAYA 3MKKA 4FLQA 2VZTA 5KZ6A 2XH0A 3NZQA 3D3FA 3RX4A 2GJXA 1LF1A 5CPOA 1AFSA 3AIBA 1UBSA 4EF8A 4B5VA 2YBTA 4L4PA 1LLOA 3BJSA 2IS7A 3WBEA 3WNOA 1VRXA 4Q8VA 1WAUA 3H2FA 2VVSA 2G95A 1QPOA 4DUXA 4GXPA 4GBDA 2INFA 5A5WA 1V7AA 4LUTA 4HHHA 1O5RA 3NDZA 3WLIA 1WB0A 2VX5A 2X7WA 3RITA 3KBWA 3R11A 4GI9A 3TIMA 5F2IA 4M19A 1U5HA 1I2OA 3SRDA 1QNRA 3C0JA 3ZJ7A 3IACA 4V28A 3HN3A 1DJGA 1C3FA 3WX7A 3LN3A 5A6BA 3VGDA 4EXAA 3TCSA 4JTHA 2CPUA 3LD5A 4DJDA 3AXXA 3QTGA 4RXGA 4HOWA 1VEOA 1NWUA 6XIMA 4W8AA 4L65A 2G5WA 3MANA 3MO7A 1PZ3A 5EA9A 2ZUSA 2D73A 3MWCA 3W26A 1EO7A 2FFCA 3MMWA 2A3AA 1JCTA 4GO8A 1A5KC 4C6DA 4AC7C 5CKSA 2FHFA 4FX7A 1PCKA 9XIAA 2I14A 1EJUC 1CCWB 2VUYA 2E67A 1CXFA 2GSHA 1E9YB 2RAGA 1VFHA 4JDBA 2VGBA 3OG2A 3N2XA 2Q3OA 4BEUA 3R0DA 4WEVX 4QX4A 3K30A 3C8FA 5LIWX 3N4FA 5AB3A 2EKGA 1HO4A 1N82A 3ZXWA 1KW1A 1REQB 2FFIA 3DX5A 4IF2A 4LYKA 2XGZA 4W7VA 5J04A 1RY0A 3EXRA 3RCNA 2ZTJA 3GU9A 2E6YA 1MFUA 2IMRA 2DP3A 3SUSA 4ZL1A 4QHRA 2YCEA 3O6YX 2CHRA 4DVOA 1CGTA 3PPHA 3WD1A 2A3EA 3UA3A 3VCCA 1WZMA 5BXRA 2VC9A 5JMUA 2NUXA 4YN5A 3OO2A 1OF8A 4ZTXA 2O55A 4JIHA 4WCJA 1XYFA 4KGLA 3BLPX 5AKQA 4IGSA 2BTMA 3LXCA 1B0IA 4JFUA 1L2QA 3N6QA 3DZ1A 5TAOA 3L4TA 4TVUA 5M1TA 2HZGA 2XIMA 3DI1A 3L0KA 3IV3A 2VTFA 2HXUA 2J7BA 2D1ZA 4HIBA 1A5SA 3AC0A 4BI6A 2E5DA 5CPQA 4LUSB 4XAPA 3RIKA 1M6JA 1FX6A 5A1AA 4HQVA 4C6OA 3CWNA 4EPDC 4JTLA 3LPPA 1SGJA 4WVXA 3EPOA 1LG1A 3SFWA 3ZS4A 3VKAA 2DUAA 2ZICA 3TSBA 3WF3A 3TDFA 2BVYA 3IVUA 1E0VA 2GUBA 4DZHA 2XGIA 3WK3A 4I9MA 2CLEA 3W1LA 1ODUA 3KVKA 1DWGM 2EAWA 3CV6A 3AUJA 2ALRA 3G1AA 2X2YA 2G3JA 5ENLA 3VKBA 4MNJA 3E0VA 2CLHA 1IE7C 1YW1A 2XYLA 1SSDA 3I4EA 5C0QA 3TKFA 3AXIA 2CW6A 2BMBA 4WF7A 4HP5A 1QXLA 2ZBTA 1US2A 1YNPA 1OCJA 4GXMA 2WVSA 1LT7A 2GQ3A 1CNVA 5KEZA 3GNPA 1EC8A 4NILA 4C6NA 2ZVRA 3LGGA 1H41A 3TUUA 2PWHA 4D6DA 2V38A 3GH4A 2JGQA 1GQJA 5XIAA 1VYPX 2WVTA 3WKZA 1OC6A 1TREA 1JCNA 2XTKA 2GUYA 2GVEA 3SRFA 3W7DA 3CZJA 3ZYZA 3TK7A 4JTDA 1JXKA 1GZ1A 1UPMB 1J11A 1CTNA 3KL5A 2E1DA 4ZB5A 1A0EA 2MUCA 1TPH1 3VTRA 3SQLA 1VCVA 1OYAA 1DJYA 3LB0A 5D2TA 3UVAA 4W8BA 1JF6A 4MGGA 3GC4A 3FVDA 3VC5A 2PLMA 1RA0A 3TJLA 4XO7A 3M7WA 2OYLA 3SRHA 1JI2A 2VR4A 4N0RA 2UBPC 2NQ5A 4CD7A 1JZ6A 4WSJA 3F7JA 3PB2A 3CIXA 4DO6A 5FEWA 3LLDA 2PDIA 4NRRA 1DJIA 2GYIA 4KWWA 1N55A 1R86A 4A3UA 5KTLA 3ZZ1A 2JIEA 4TMBA 1HO1A 2O7QA 5I06A 4XD3A 1M68A 3WJYA 1Q6EA 3P5YA 1V6YA 2NT0A 1AQFA 5D32A 2E68A 2OEKA 1ITCA 4S3KA 4JTSA 4ZA0A 1SMAA 4GUHA 4MWAB 2X40A 2CESA 3BGGA 4PUJA 3VCNA 1GHSA 3CZLA 3JR2A 1XLMA 5EGRA 2WKJA 3WNPA 3OOQA 1KTBA 3QY7A 3BTNA 2DZVA 3ZR4A 1LP6A 1OFOA 2XIQA 4KWUA 2XUCA 2KX9A 3N73A 2FYMA 1TTPA 3NAVA 1UOZA 3L21A 2J7HA 1JZ4A 1KM5A 1U1UA 3UJ2A 1YBQB 2A79A 3STGA 5HXMA 4UR7A 1QW9A 2ZRYA 1GVRA 4B2DA 1BHGA 1OFEA 2WWDA 1IV8A 3AMCA 3ITCA 4WOZA 3UXKA 2PGEA 1KBJA 4GQRA 4JL1A 4R27A 3GDRA 4GCAA 4IMCA 3VIHA 4L9XA 3MUXA 1C9WA 5FCZA 1K4HA 3D46A 5IXEA 1RY8A 2WSQA 2VWTA 3LV5A 5BOOA 2Y89A 1T7LA 4CGTA 3K5XA 3TQKA 3DFYA 1HGWA 4H6KA 2XFYA 3NCOA 4K37A 3IIZA 3QFEA 1WCGA 1I2NA 1FWWA 5FL0A 2GFTA 1I2RA 6TIMA 2O56A 2J8GA 3WF0A 1TR9A 2QGYA 3SGGA 3TYZA 4NT0A 1LBFA 1WPCA 4DBSA 1L8PA 3MI3A 4IICA 3T44A 1ZJAA 2XG9A 4FO4A 4S1FA 1SW7A 4M82A 1VGAA 4R5EA 1UG6A 4AZGA 5HWJA 2R1PA 4CU7A 2VZUA 3WDHA 1PBGA 1RV8A 4RNHA 3FK4A 4B5UA 2J77A 1DV7A 3ZJ6A 4P8UA 2J47A 3NG3A 3IJDA 1EA9C 1KV8A 2J74A 3OYXA 2PD9A 1V0MA 4XUYA 2HNEA 3MTWA 2YYUA 1VFOA 4GO9A 2YIHA 4HA0A 3VZZA 2VGGA 4YXGA 1G9HA 1AQ0A 1H7PA 1W9UA 2X41A 3WQCA 3TJ4A 4C6CA 5FSEC 3DUGA 3THAA 1TPFA 4BHYA 1ODZA 1GUVA 3G1HA 1UWQA 2WW5A 2PDGA 1WDPA 1OJXA 4QLJA 4TV5A 3UXDA 2VCBA 1AK5A 2I5QA 3LEPA 1KC7A 2F6UA 4I8DA 1KBIA 4KEUA 2PZNA 1VEPA 1S5MA 2NZLA 3CUFA 5IRPA 1UB3A 2XSBA 1G0CA 3PZGA 2E5CA 3L67A 1DWJM 3EWUA 3W1UA 3H2MA 3TR2A 1KGXA 3RPTA 3UD6A 4ZOAA 4J3XA 4O57A 4RJEA 3DHUA 2Y7GA 1TWZA 1CGVA 2YFNA 4PEEA 3D6NA 3VOIA 3TYBA 2OB3A 1QWKA 1PYFA 1FH8A 1O66A 4XZWA 1S39A 2DW6A 3UW6A 1TVPA 4HZ6A 2GVLA 3N2CA 1IYXA 4C6PA 3FSTA 4IG2B 1BVWA 3V3WA 1ZP3A 4RDZA 1JULA 1UR0A 4PULA 3APYA 1J4EA 1SU5A 3BLEA 3VD5A 5D9MA 1EL3A 4O17A 4B92A 3G1FA 1LL4A 1A3HA 2NV2A 3B06A 1TO3A 1Q85A 2QCEA 4LF2A 1WXYA 3O16A 4NUWA 3RPDA 4W93A 4HPGA 4NNCA 1DHPA 3DFOA 3KOYA 3HO8A 1QPRA 4UTUA 1X7IA 3RNDA 3G3DA 3QFWA 3VIIA 4K8GA 2I9UA 1H7NA 3SCWA 4N4PA 1P5BA 1UUMA 4GQBA 3ZVHB 4ORMA 3EX4A 3W7IA 2BDQA 2PLKA 1C8YA 1JGMA 5HPCA 3RILA 5JU6A 4F9DA 2TPSA 1NAL1 3A6OA 3CT2A 1QI3A 3T9PA 3NQDA 5T9BG 2C1HA 1OFPA 3WBWA 3MB9A 5B7ZA 1JF5A 2QW5A 3Q94A 1K8ZA 1HL8A 3N34A 3VGEA 1WUEA 2ZA3A 3S2NA 4UQBA 1XLIA 1RQHA 2POZA 5HAOA 1AODA 5L9FA 3DC0A 1Z3NA 3G8EA 3PPGA 4JCMA 2ACUA 4UIOA 1LBMA 4BQ4A 3VX1A 4F2TA 2J7FA 4ML9A 2W79A 3UPWA 1RCQA 3UNTA 3RO6A 1R9YA 1MZRA 2VQUA 3HGRA 3AIRA 3R58A 1M3UA 4LBSA 2JALA 2QIWA 4DJEC 1TIWA 3WLOA 3WD4A 4L1GA 5BRBA 4JHOA 4XZMX 2VXNA 2F6XA 4QE1A 1EIXA 4NP7A 1QATA 2VEPA 3ABZA 3IUDA 4UTHA 2G4JA 1W32A 4K3ZA 4V1YA 3OQ8A 3LHUA 1EJRC 3IVSA 4U5IA 4WY0B 2VRKA 4B5XA 3PAJA 2W62A 3GAKA 2ZUMA 3ITOA 4IPPA 4AG0A 3G8RA 1AH0A 1JIBA 3PNZA 3O6CA 3MMTA 1FFRA 2GOUA 2HDJA 1JUKA 4MUPA 1O1ZA 1ICPA 3ABXA 1H1NA 1EXPA 2HQAA 5LHEA 1F3EA 1SFLA 3A3HA 4UWMA 2EF9A 1OFAA 2YW3A 4GYJA 1JNDA 3P60A 2VD9A 3VI2A 4JIQA 3UZXA 3ZLGA 2ZKMX 2CWXA 4D6CA 3GG8A 4XKYB 4JYFA 4PMUA 4LVGA 1OG0A 2FKPA 4KERA 3WLLA 1Q6GA 4H9TA 2XVLA 4JYDA 3B9NA 5AYXA 4DNHA 4Z0JA 2RHGA 1IXNA 4RNFA 4UTJA 2HROA 2P3ZA 4HPNA 5KZDA 1F6PA 4G1KA 3UG3A 3SURA 3NO1A 3F03K 1EDGA 1MSSA 4W5UA 3NYDA 1EDTA 1DPMA 3ANVA 3ZR5A 3AU2A 3PSWA 3DOPA 4G7FA 4DYEA 5A6AA 4A2RA 4XBKA 2CIPA 4X0NA 1XG3A 5DMYA 1TZZA 2OCZA 5AC7A 1HJUA 3ARXA 4E3VA 1KWKA 1N2VA 3GUGA 4H6RA 1W8GA 5FF4A 2B7PA 4EF9A 4JTKA 1QK0A 2OWXA 4L56A 1ZAIA 3WD3A 1A4LA 4EANA 3M41A 1W1A1 4LALA 1BRLB 1TZ7A 2PP0A 4XAGA 5BOEA 3MSGA 2VFHA 4ZFMA 4Q7IA 2E25A 5BWAA 4PMVA 2OYKA 4YTQA 1RXOB 3MU7A 1U1JA 1NWSA 1P43A 3U48A 4NU7A 1NY1A 3BQ6A 4RE3A 3QVQA 3UYCA 3VDBA 2A3CA 4DWDA 5K9XA 3KCOA 4JN7A