3I6RA

Plasmodium falciparum dihydroorotate dehydrogenase bound with triazolopyrimidine-based inhibitor dsm74
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
376
structure length
376
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
publication title Structural plasticity of malaria dihydroorotate dehydrogenase allows selective binding of diverse chemical scaffolds.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Oxidoreductase
total genus 149
structure length 376
sequence length 376
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i6rA00
5DN1A 3CQ0A 3CIWA 1K8XA 4CCCA 1B9BA 2FFCA 4A2RA 3RK8A 2QUVA 3P81A 3TIMA 2E6YA 1TPWA 3W84A 1K3UA 2NX1A 3RU6A 3PB0A 3NPVA 3BK0A 3PG8A 1EP2A 1ME8A 3GDTA 2A2IA 1OVDA 2A7RA 2X1TA 4XKYA 1VHNA 1H51A 3TXZA 4A21A 3C61A 3P74A 2A21A 1R30A 3HF3A 3MI2A 1VZWA 3TQVA 3E49A 3QMSA 1WQ5A 1HFBA 1KM2A 5D02A 4LU0A 1TTQA 4UTUA 2YW3A 1WOBA 1Q6RA 2E5CA 1KFJA 5IBXA 2BSLA 2DZUA 4LVGA 4MYXA 4N6FA 3TA6A 3F03K 1QFEA 6ALDA 1JCMP 5D2TA 5D33A 3R89A 2EF9A 1GOXA 1JRCA 3QPZA 5H91A 2I14A 3IEBA 3HIJA 4LS2A 2V9DA 4WY0B 3IIXA 5CZJA 2DU2A 3N19B 4NXKA 5KZEA 1LM1A 2QJIA 3SGUA 4XBKA 3W1TA 4KFNA 4FXRA 2V0TA 4L4MA 3UXDA 2A7NA 5AN7A 2PRHA 3PM6A 4TIMA 1SFJA 4X9SA 4O1BA 2Y7EA 5AB3A 3O06A 2HTMA 3MYPA 3AJXA 4M6QA 5HUPA 4CCEA 3I7RA 3NQ8A 1YTDA 4UFIA 1QDSA 3GR8A 4JX4A 1AL7A 3EX6A 3BW4A 3TFCA 4YL2A 1VYRA 3HO8A 1TIMA 3H53A 3LM7A 1XUZA 4O18A 3W23A 3NZ1A 4KFPA 1SFLA 1Z41A 5BMXA 2ZTKA 2H3BA 3NO5A 3P5ZA 1D3HA 3IGXA 3FYOA 1VC4A 3HBLA 1ZNNA 3W7NA 1X1OA 1JULA 4OGZA 4AHOA 3TDFA 4R34A 2WSQA 5EKYA 1FXPA 3LXCA 1SUXA 3UWZA 4XWUA 1JUEA 1LLZA 3UY7A 1K7XA 3NQ7A 3SGZA 5G4WA 1WA3A 3P67A 2GQAA 1C29A 4MY8A 1H62A 2VFDA 3DBPA 4PL2A 4UFHA 4JYDA 8TIMA 5BRBA 4YMZA 3G1SA 3UD6A 4NX5A 3EWZA 4KWWA 3FEMA 3GIYA 3L2IA 5HR6A 3PSWA 3LHZA 2QEZA 3W1NA 4P61A 3IGSA 4LT9A 4A22A 2VXNA 2BX7A 3WFAA 4PL1A 4WOQA 1TO3A 4WXZA 4TX9A 1LBLA 1TRIA 3QC3A 3O1NA 3P82A 1IXPA 2JGQA 1QR7A 3LRMA 1U83A 3N2MA 3EWXA 3QF0A 2ISVA 4FNPA 4IMCA 2VFFA 4K7VA 2A7PA 4O11A 1B57A 1LRTA 2ABBA 4NNBA 3DFSA 5DCDA 2F84A 3BG3A 2E6FA 3NQVA 3W2KA 3NPWA 3W75A 1KTBA 3W7PA 2FJKA 4JX5A 5U4NA 1V7YA 2ABAA 2X1RA 1PV8A 3TE9A 4BI6A 3EWUA 1KLZA 3TW6A 1H61A 3WK2A 3OA3A 2QCEA 5DXYA 2E77A 5CPOA 3WJSA 2JKPA 3ZS4A 3W7KA 2C1HA 2Y7FA 3N14A 5G1YA 5EYWA 4UFKA 4S1FA 1PCWA 3L0KA 1KBIA 1Q6QA 1KFLA 3LTPA 4AF0A 1JCNA 1AK5A 5F2LA 4AAJA 1PHQA 1OK4A 2NZLA 4I7VA 2XFWA 2HMCA 1B4EA 4AWUA 2EAWA 3GNNA 4DBEA 2Y88A 2ZZ7A 3M6YA 1VS1A 5D2XA 3TROA 3IGUA 1RD5A 3VNDA 3IIOA 1LOLA 4IMDA 3CT7A 3UYCA 3M5YA 4NT0A 3T7VA 5FI8A 2Y7GA 3HGJA 4BI7A 5DBTA 1HTIA 2CW6A 3M5XA 5AC6A 1OX4B 2DZPA 4KWVA 1O95A 1XC4A 4EWND 1KW1A 4K8EA 2X2GA 1WV2A 5FESA 2GQ8A 2CLMA 3TQ0A 3LLDA 1H7XA 3DAQA 3P60A 4Q33A 5AHFA 1Q3NA 1H60A 3OG3A 1LBFA 2Y63A 3UQNA 2DORA 1N7KA 3A24A 1GYNA 4M7TA 1I2PA 3HMJG 1SO5A 2PRMA 1TQJA 2JBMA 1ICQA 4FB7A 3WJZA 2YYTA 4NNCA 1OYAA 3A9IA 3AO0A 4OE7A 1VPXA 2RHGA 5AOUA 3HG3A 5MHBA 1XI3A 2PCQA 3PBVA 2Q8LA 2B7QA 1ZAIA 4Z08A 1O94A 3W71A 1P0NA 1R46A 2JGYA 4FNQA 4EIVA 2CLFA 3ELFA 2NX3A 3I68A 2ZRWA 4JTTA 2O7QA 3KVKA 1KV8A 4ZQMA 4Y9AA 5K9CA 1AW2A 4CQ8A 4O8RA 1NAL1 3LDVA 3O16A 3BO9A 4OHQA 4PODA 4QM1A 3NQEA 5LNSA 3L9CA 1XBZA 1SW3A 4IXHA 3EWYA 1UASA 4BI5A 3HG2A 3W73A 4NUWA 5IBXC 1VLWA 3V1PA 2E5DA 1MZHA 3BW3A 3L0GA 4TMCA 3NQAA 4BFAA 1OFAA 5FF2A 3EKZA 3F4NA 4XTDA 3K30A 5E1QA 1L2UA 1Z44A 3F4WA 1PE1A 2ZFAA 1LLWA 3W7JA 1FY6A 1WOAA 2Y85A 4JY9A 5F4SA 3JRKA 3Q58A 1ADOA 3G0SA 4ML9A 1UCWA 3THAA 3V75A 1TPH1 4EOUA 3W88A 3ATZA 3H54A 4O53A 1H7NA 2Z0IA 3CC1A 1OG0A 3IVSA 1KLYA 4JXCA 2ZBTA 3CEUA 1FDJA 1FCBA 4IPJA 2QCMA 3WJYA 3W7HA 4TMBA 2ALDA 4MLRA 4ZQRA 1W8SA 3VCRA 5LSMA 3W1RA 1TMHA 1L6SA 5I3IA 1W5MA 1GTEA 3THQA 4LUIA 2W79A 1TREA 2FTPA 3S5YA 4U4MA 2JKAA 1OFQA 2E6AA 2G95A 2J9ZA 1X8FA 5EA9A 4AMAA 4J9JA 4K6AA 2JK2A 1LRQA 1OFRA 3LHTA 2QUTA 3FKRA 4XUGA 3U6WA 1WX0A 4GWEA 1TRDA 1IXOA 1XL9A 1QPNA 1MEWA 2J6XA 4LV9A 3QYQA 1XCFA 3P8IA 3GAYA 3WK3A 3N73A 2GJLA 4JTIA 3W2LA 3NOEA 2XN0A 2VC6A 1OX5A 3C8FA 3W7LA 2C13A 2FLIA 1EWEA 1G7UA 4M6PA 3LGEA 5K9XA 1F74A 1FWRA 4QNEA 2DJLA 1SSGA 3I7SA 2AGKA 3QEZA 3W1LA 1LOQA 1D9EA 4IX0A 2ZRZA 5H2ZA 3CIXA 4HNTA 1W37A 2BXVA 5D38A 1I2OA 4L4LA 2E09A 3G1DA 3NGJA 4O28A 4AHPA 1A50A 3ZFHA 7TIMA 1IF2A 5KTLA 3UWUA 2OT1A 5KSWA 1T8XA 1EUNA 3N9SA 1YXYA 2EGZA 1NF7A 3G18A 2DJXA 4GUIA 4UTMA 1QOQA 1XDMA 4C1KA 3W3OA 5D30A 3KAOA 3G8EA 4ONVA 5I3JA 2NUXA 2ZZ6A 5K9DA 1ML1A 5CPNA 3MP4A 1DORA 3WK1A 2X1SA 1GWJA 5FF4A 4MLJA 1QO2A 1F2JA 2NX9A 2I1OA 3NG3A 3G3MA 4LNYA 1H7WA 3R13A 1H7OA 2Y7DA 5EMUA 3CLMA 3KX6A 5C6MA 5TBOA 5I3GA 4O54A 2X1UA 3W7RA 3C2EA 4M6VA 1VCVA 3KFTA 4A29A 2A6NA 4WQ6A 1U5JA 4N4PA 1RR2A 3S1XA 1KM4A 4RXFA 3WJWA 1H7PA 4C1LA 4PA8A 2A85A 4O1CA 2NUWA 2ISSA 1VYSX 1RQHA 5I3FA 3C2RA 3W7OA 2QUUA 5GVJA 4MY1A 4FNRA 3E96A 5T26A 1LROA 1UJPA 2GVLA 3PF3A 3NQ6A 1W5NA 4FX7A 4UMCA 4NVTA 3W07A 1EP1A 2TPSA 4JYFA 1JVNA 4E38A 3CWOX 4B5NA 1P1XA 3IVUA 3EXRA 3CEPA 2QCDA 2FPYA 3DFNA 2R14A 1QO5A 3QQ0A 3GXPA 1HG3A 3STCA 3KXQA 1FCQA 1DBTA 1O60A 1OFDA 2Y6ZA 3TW7A 4IQLA 5FF0A 2VFEA 4A2SA 3UWWA 5C2XA 3A5FA 1FBAA 3LBMA 3HPZA 5A5WA 3MHUA 4FX6M 2RDWA 4JTUA 3M1ZA 4R33A 5KMYA 1GVQA 2JKEA 4MJMA 4JTSA 3KRSA 3QPYA 1KM0A 5LKYA 4UC5A 4X2RA 3TR2A 2A1YA 2VEMA 3G1AA 1SO6A 3QW3A 4QIUA 4K39A 1MO0A 1Z42A 4UTWA 3M47A 2A5HA 4LVFA 1P0KA 1A5BA 1JJKA 3L21A 4DXVA 2WPBA 1QCWA 2BZNA 2C16A 2WSYA 3HG4A 4JDBA 2GQ9A 3GAKA 1X1ZA 3C2VA 4UTIA 3MP5A 3LHYA 3CU2A 2AQWA 4LC8A 1MEIA 5G1TA 2X16A 2H8XA 1VRDA 1HO4A 3NNTA 1SZNA 3PB2A 4OV4A 4QITA 3QMTA 3A23A 1TPDA 1R2TA 2WV8A 3BLFA 1OFOA 4NJGA 3IVTA 5D32A 1TTIA 2C19A 3W86A 1NFBA 1VR6A 1K7FA 3P62A 3TV8A 3QM3A 3LCIA 4DO4A 3ZR4A 1OK6A 1G4SA 1J2WA 3L65A 3ABSA 1MXSA 1R47A 1F73A 3S42A 5LNWA 4DQWA 2QCCA 4X3ZA 1VHCA 3G1FA 5DCEA 4Z0JA 3O6CA 2O7SA 3IIPA 2CLEA 4I9AA 5CG7A 3W22A 2OX1A 3FJ6A 1J4EA 3C56A 3GVGA 3TH6A 4HNVA 3W7MA 1Q45A 1TPFA 1YDNA 3BV4A 4JTGA 2YSWA 3ATYA 4JTJA 5A8GA 1IXQA 3G1VA 2J27A 3QSTA 5HWMA 3LHWA 4ZQNA 5CGQA 4UFJA 3U2OA 1Z48A 4UFMA 5J5RA 4JTHA 2YFOA 4FO4A 1QPRA 4LC6A 3DFOA 4HN4A 1SQ7A 3ABOA 4WJEA 4G1KA 1H63A 3M44A 1GG0A 4MY9A 3F1QA 4MFEA 4UR7A 4LTSA 4UTJA 3E12A 3O07A 4NJKA 3B05A 2QCHA 2G96A 5DELA 2GPTA 2PE4A 3ABRA 5F2MA 1EA0A 1W56A 2ZRXA 5AHNA 1ZALA 4HHPA 2G97A 1OABA 2EPHA 5AHMA 1ZENA 1QWGA 5D2VA 4LVDA 1ZAHA 3LXAA 3W2MA 1G69A 1H1YA 2ZZ1A 4NNAA 2P0OA 2DZSA 3C52A 3QSRA 2CZDA 2TSYA 3KHJA 3NM3A 5I3KA 5G2WA 1JQXA 1T99A 1AMKA 1G67A 4RCXA 1XUUA 3EXSA 3SJ3A 3BGGA 1F6KA 3RFAA 5E0KA 4MVAA 1DVJA 2DZVA 3CHVA 4Z1AA 4OV9A 2GVJA 3LCFA 3W87A 1TV8A 1H1ZA 2QCNA 1NSJA 4WY0A 4CNPA 4A3UA 4NU7A 2WNNA 4GBUA 2J9YA 1W3TA 1K7EA 3TNOA 5LHFA 1ZY9A 4CLMA 3W2NA 2NV2A 2VFIA 5K4ZA 4N9BA 3SY5A 3W2JA 1YPFA 3MI6A 4AB4A 4N6EA 3QZEA 4YCPA 1PCKA 5IM51 3GXTA 1H50A 4RR4A 3C4UA 3G22A 4K38A 3M0ZA 4HT3A 4UNKA 1KA9F 2ZDRA 2FB3A 2WNZA 4WX2A 1G4EA 4LVBA 4NXSA 4CNOA 2CLIA 3LOTA 3LHUA 1FWSA 1FXQA 4WZHA 5I3HA 6TIMA 1GZGA 1W31A 5HQEA 1XBVA 4N02A 2DP3A 1YXCA 3GK0A 2RH9A 3LBCA 4N4QA 2FDSA 4MZ8A 3W7DA 5K7JA 1QMLA 5D04C 1WYIA 4LY8A 3BLEA 3A5VA 4DF2A 3KVMA 2H6RA 1SPQA 3W7QA 1VCFA 4IWWA 4H3DA 3L68A 1H5YA 3MUXA 2ZRVA 3O8AA 2QAPA 4OQVA 2NXGA 3IV3A 2VKZG 2H90A 1VYPX 4IUOA 3FA5A 3PVFA 2VEPA 1TPVA 2CLHA 3P5YA 4H4IA 1M6JA 2PURA 3VFLA 3B03A 5F1VA 3PBYA 1YYAA 2V5LA 3PG9A 4ORIA 2R8WA 3W1XA 5U7SA 3MMTA 2V8ZA 1VCGA 3FIGA 1VGAA 5CSSA 5HWJA 2ZA2A 4BWLA 3KVJA 1TYGA 2ZZ3A 4IX2A 4AH7A 1LZOA 2ZRUA 3GNDA 3DU0A 4ZVJA 3QJAA 1VJIA 1ZJIA 2QDGA 1AG1O 1SZEA 1KFEA 1W5OA 2CU0A 4H6KA 5LHEA 4PFMA 3MHGA 1QNVA 3UNDA 4CNNA 3TMLA 2E1DA 4UTLA 1SSDA 2YZRA 1I2QA 3W72A 3EX2A 3PBWA 1P5BA 3W2UA 5FF3A 3LTSA 1XM3A 2B7PA 5CZSA 3ZWSA 4AVFA 4UTWC 3CWNA 2YXGA 3T78A 1JQVA 1O4UA 2ZRYA 3TJXA 2CFFA 4RZ6A 5C5YA 4O4VA 2VEKA 3R2GA 4HPXA 3BG9A 3TC6A 3W7EA 4Z0SA 3RF9A 3FJLA 3LI0A 3HPSA 4E0CA 4DEFA 4K37A 4IJBA 4JTEA 2C3ZA 2ZTJA 3H55A 2TMDA 4I7UA 1GG1A 4MIMA 4BF9A 5F2IA 4JYEA 3O05A 1UUMA 2DZXA 3M43A 4ICNA 1KFBA 2C14A 2Z2UA 1ME9A 5HWNA 1BWLA 2YW4A 3STGA 3DENA 3L5MA 1YLVA 4HSOA 1P4CA 1D3GA 3I7QA 4TO8A 2HS8A 5K3VA 2V2DA 3KOFA 4GNJA 5DY2A 2QJGA 4Z1CA 3GR7A 1YADA 4JIQA 1I4NA 3FS2A 4JR5A 2A4AA 4PTNA 1THFD 3M41A 3PUDA 3UZ5A 1FWTA 1OFEA 4GFSA 4RLIA 1YXDA 1F6PA 5HULA 1OX4A 3B04A 3BLIA 5CPMA 1I8JA 3W83A 1O5KA 1SZGA 1TJPA 2NXHA 1I2RA 1IIHA 4ADTA 3TFXA 3HQ1A 1FWNA 5HMSA 3N9RA 3RMJA 2CWNA 4LWWA 3E02A 3VE7A 4NJJA 1KV5A 2TRSA 2H8ZA 5HUOA 2RKXA 4ZL1A 1R2SA 5CSRA 4MFDA 3S1WA 5HJLA 3W9ZA 3KVLA 3LHVA 5CPLA 3HJZA 4CQAA 4M7SA 3LCXA 3S0CA 2Q3RA 4O14A 4IGHA 3Q37A 3JS3A 3TX9A 1JCXA 1W54A 4UXDA 2PC4A 3LCWA 3R12A 1LRNA 1PVNA 3EWBX 3PSVA 3W1AA 3NM1A 1S5WA 4JX6A 3LERA 4O12A 3DXIA 5G4EA 3G0XA 3TKFA 2J9XA 4MKNA 1EUAA 3PR2A 3TXVA 1OX6A 1FQ0A 1RZMA 3HGOA 3S9YA 2QR6A 4JEQA 4M5PA 1OF8A 3LXBA 3O6DA 2NWRA 4LRSA 4XZ9A 2BWGA 3QW4B 3TCEA 5AHEA 2CLOA 3W7CA 1NEYA 1FWWA 1WXJA 1K8ZA 2V81A 1TPUA 1YTKA 1TPEA 3O63A 4OU1A 3TU9A 2A6LA 3TQKA 2RDUA 3UZJA 3LV6A 3KRZA 3FKKA 3DI0A 3L5AA 3EB2A 3EWWA 4PH6A 1TB3A 2FPTA 3VKJA 2C15A 4OWGA 5AHLA 1DQWA 5AYXA 4KFOA 4UMAA 3NR0A 3ANYA 2NWSA 3WJXA 4RKAA 4O4WA 3G1HA 5HINA 2ISWA 3EXTA 1I2NA 4O57A 3TK7A 5LZLA 3OBKA 4LS0A 1GJPA 3S5OA 5DLCA 2QKFA 4Q4KA 4XBSA 4U28A 4ZMGA 1RQEA 2ATMA 1DHPA 3GXNA 3QH2A 2R94A 3P61A 3EX1A 2Z1BA 3OEXA 1VQTA 2OCZA 4OBTA 3T40A 4QAIA 3GDKA 3CPRA 3TAKA 4GRSA 4XKYB 1W1ZA 2ZQ0A 3S6DA 4QISA 2WSRA 3HGSA 3N2XA 3GDRA 4CCDA 1L9WA 2RFGA 3GDMA 1MSSA 5E93A 4E2DA 3B06A 3BARA 5CZ0A 3TSMA 2XN2A 3NXFA 3PUOA 5D05A 1GT8A 1JCYA 1QPOA 4I7WA 1T0OA 1DJNA 4HIBA 4MYAA 4JICA 3QRHA 1M5WA 4N9EA 4AWSA 4BWLC 1KM1A 2OMAA 3W85A 1A53A 4NZJA 4WXYA 1XBXA 1BEUA 3KRUA 1GVOA 1T96A 4MOZA 4M19A 4IMFA 1OYCA 2W6RA 3M16A 1QOPA 4JTKA 3W1MA 4IPIA 3PC0A 1KFCA 3FFSA 3GKFA 3PUEA 4N2YA 5SWUA 4MZ1A 3B0PA 1GQNA 1AW5A 3UXAA 1LTDA 3G3DA 3NQ2A 1A5SA 5G2HA 5TIMA 4JIPA 3I6RA 4FF7A 1CW2A 1YPIA 5K4XA 2H3DA 5FEPA 1G4PA 1ZFJA 1TJRA 2C6QA 4TR9A 4OT7A 4RXGA 1JUKA 3MP3A 4DO5A 1DL3A 1W3NA 3BG5A 3NL5A 1QPQA 4IMEA 4QJ1A 1TV7A 3T55A 1N55A 2FB2A 2FQIA 3Q94A 2UV8G 4CQ9A 3NL6A 3STFA 4BR1A 1ZCOA 2E5BA 1UB3A 2PRLA 3B0VC 4AWTA 1GVRA 1SW7A 3L66A 4R7JA 1PS9A 3NQGA 3L67A 1LOSA 5EL1A 5AC7A 4S2CA 1FDYA 1FCUA 2Y62A 2EKCA 4IMGA 4O13A 4PC8A 1A5CA 4O0ZA 1TCDA 5D03A 1BWKA 2WOQA 3YPIA 1YTEA 1ZAJA 1AW1A 5KITA 2CLKA 4O15A 1LDCA 3EEGA 4ZZ9A 3S5NA 4DF1A 2QCGA 1I45A 1GEQA 1DQXA 3EKLA 3UPBA 4O52A 1F7BA 4UTTA 4N9DA 4RK8A 1DJQA 1ZHAA 3PWAA 3LLFA 4DELA 3TSDA 1S5VA 1F05A 4FIRA 5LGZA 2GJNA 2RDTA 1L6YA 3M7WA 4EVZA 1V5XA 2X30A 3P84A 3DFQA 5C54A 3P80A 1ICSA 3A21A 4LS1A 4P2VA 3C2FA 3MYOA 4JN6A 1CI1A 1XFBA 3W1UA 4HPJA 4N9CA 3HOJA 1HO1A 4AF0B 4ORMA 1FDZA 4UR8A 3SIZA 3CM4A 3GX9A 1J5TA 4NZFA 3LCHA 3STEA 4BK9A 1JRBA 1LYXA 3BVJA 4GUJA 1S5TA 5AYZA 4O1DA 4LV4A 5EBUA 4Y8FA 3EX3A 1KTNA 3OVPA 2QF7A 2ZZ5A 4FEZA 2YFNA 4YXGA 5L9FA 3DFTA 1SR9A 1IIGA 1RVGA 3DGRA 5AFDA 5J5DA 3MWAA 5D09A 1XDLA 1KBJA 1OFPA 3LB0A 4LRTA 3USBA 3DHFA 5EY5A 4MZYA 2P10A 1XKYA 2Y61A 1L6WA 5DCBA 1DOSA 3SW6A 4GUFA 3ABQA 5D2YA 1RV8A 3M5VA 2HSAA 3DFPA 4WD0A 3W76A 4EF9A 4HNNA 3W7IA 2I9EA 1PIIA 1VH7A 2YCEA 5FEZA 4RJEA 1O5XA 4ALDA 1ALDA 2NLIA 3NDOA 4NX0A 4TU1A 3GZ3A 3TUUA 4AHQA 4MJZA 3GLCA 4UCGA 3SSJA 4FNUA 4UNLA 3A22A 2Q8ZA 2W0UA 5AYYA 2DZTA 2QDHA 3GKAA 1S3HA 2D73A 1AL8A 3W1QA 4O1AA 4GUHA 4JTFA 4DO6A 2ZA3A 1ME7A 3NPXA 4MUZA 2R91A 3U8GA 2LLEA 3NQCA 3RLUA 3G0UA 2VEIA 3B0UX 2B0MA 5KZMA 3UWQA 3W7GA 3NZRA 1MEHA 4FIQA 4XTIA 3GDLA 5G2IA 5AC8A 4GXMA 3HB9A 1GTHA 3NPUA 3P8JA 1RQBA 2WJZA 4RZ5A 5BNKA 2WKJA 1OHLA 3E0IA 1OFBA 4QQ3A 4JGDA 3R8RA 2VFGA 3IRDA 1F5ZA 2NV1A 1G4TA 2VFHA 2ZZ4A 4D2JA 2YPIA 1EP3A 1JCLA 1QAPA 5BW6A 1XXXA 2BTMA 3L5LA 2YR1A 5TQLA 2P1FA 3B8DA 1TSIA 3DH7A 3NEVA 4Y90A 1NF0A 4GUGA 3NVTA 4HSNA 1F76A 3C3NA 5BMWA 4POCA 1Y0EA 2YX0A 3W70A 4DPPA 5F1UA 4MPQA 1Q6OA 3LV5A 3OIXA 1Q6LA 4RV8A 3NA8A 4O19A 3CTLA 2CLLA 3MO7A 4O16A 3ZWTA 2A0NA 2F7FA 2Y70A 2OZ0A 3SZ8A 1TPB1 1K03A 1HL2A 4O0KA 4O17A 4GC4A 3RNDA 1B4KA 3FLUA 1LP6A 3DZ1A 1C9DA 2QAFA 5KZDA 5C55A 3QQ1A 1C8VA 2WO5A 1YDVA 2GUUA 3NYZA 2GOUA 1HUVA 3CB8A 3DKJA 5F4WA 1IXNA 2ZA1A 2OT0A 3O6YX 5AHIA 3NL3A 4W9TA 1VLIA 4RZ4A 3LRLA 3LI1A 2KZHA 2QJHA 1KM6A 1X6UA 3MHFA 3VI2A 4K36A 3NAVA 3W74A 1G7VA 4O10A 3DHDA 2IQTA 1E51A 2AAMA 2Z6JA 4K8HA 2CZ5A 1KFKA 5LGXA 5HR7A 3O15A 1CX9A 3P7YA 1KM3A 4Y96A 4YLWA 1R2RA 4JD4A 1K02A 5F2GA 5BOOA 4LVAA 1PHWA 5HNRA 5DBUA 4UMBA 2VELA 1B3OA 4QNWA 2QCLA 3E9AA 3LRKA 3QMRA 3RLVA 2HS6A 1KTCA 3W1PA 3R5EA 2BLEA 4WOZA 4JY8A 2XN1A 1N8FA 2V5BA 2YDAA 1M7PA 5D2WA 4JTLA 2B4GA 3NQDA 4YWIA 3HPXA 1WBJA 1UUOA 1LBMA 3UWVA 3PAJA 4UTTC 3FYPA 1WAUA 1EEPA 4ZQOA 4UUIA 1YDOA 3EX4A 4JDYA 4UIOA 3C6CA 1WDWA 3OVQA 1SW0A 2DZWA 2FPVA 3HG5A 5F4XA 1PL9A 1BKSA 3DI1A 4UTKA 4R53A 2Y89A 5FEWA 3SI9A 3T44A 3DKLA 4IXXA 1DKWA 4FX8A 1JUBA 4JS3A 3S1UA 3MW7A 3N3MA 3S5ZA 4AEOA 3SFKA 1LCOA 3T4CA 1W5PA 1RPXA 1FCVA 1TTPA 3UPWA 2V82A 1EX5A 1W3IA 4LUJA 5LNRA 4JNMA 1TQXA 4E2BA 1ONRA 3OHIA 3TJLA 1LORA 2NUYA 3PY2A 3TC7A 1KM5A 4Z1DA 3VE9A 4DF0A 4NJHA 3L0NA 1A5AA 1GVFA 1FUYA 4Y6GA 5D37A 1SZFA 3GYEA 2ZCGA 3M9YA 2TYSA 3LCGA 5ABTA 1SU5A 3NQMA 3LX9A 2QCDB 4S2BA 5CKSA 2EHHA 3C0JA 4X22A 1TV5A 3IIVA 4K7YA 2OJPA 1XBYA 3PULA 5L6UA 3M5ZA 1GYLA 3UY8A 4ADSA 2ZYFA 4WUIA 4KKXA 5G5IA 4DBDA 2NXIA 3UWYA 4GJ1A 5KINA 1K8YA 5DXXA 4HNUA 1SO4A 3C2OA 5CZTA 4FNSA 4PCFA 1BTMA 4UFLA 1JCJA 3PS7A 4UTHA 3GB6A 2J88A 3SR7A 2Z6IA 1EIXA 3QFEA 5EPDA 4LW7A 5FF7A 3N34A 2YGYA 4AXKA 4ZQPA 3I65A 1EB3A 2WQPA 1JR1A 1H7RA 3W6YA 4ADUA 4Z1BA 4ZQCA 3LTYA 2J24A 3B4UA 1UBSA 4Q32A 3NL2A 5DY3A 1G6CA 3MI3A 2G5WA 1IGSA 4IOTA 2WNQA 1ICPA 3MJYA 1GPWA 3BW2A 3INPA 2V2HA 4XQ6A 3IIZA 2C0AA 3PBUA 3TAOA 5LNUA 3HGRA 4LOCA 5FEXA 4EF8A 4FHAA 3JR2A 4NJIA 3BPWA 2E68A 1GVSA 1TTJA 3BGJA 1FX6A 1OYBA 2ZZ2A 2B7NA 1X7FA 3NQFA 2CZEA 2VENA 1EPXA 3G24A 3S1VA 4O50A 1W0MA 4RX0A 1DV7A 4HKPA 1OJXA 3MBFA 5K2ZA 4FXSA 2FIQA 3G8RA 2YYUA 2VOMA 2GVGA 4GE8A 2ATSA 1NVMA 3SECA 2E6DA 4NQ1A 1M7OA 1SO3A 3FOKA 3TSBA 3D0CA 2CZFA 4QSHA 5LNVA 3S8HA 4YCOA 1EWDA 2B7OA 2V2CA 3OVRA 2V30A 1W5QA 2Q3OA 3MBDA 3WK0A 3Q2DA 4WY0F 4PEKA 1TPC1 3G1YA 2C18A 1WBHA 4DPQA 3LCLA 3G1XA 2QCFA 3TMQA 4FNTA 1OF6A
chains in the Genus database with same CATH superfamily
4D6FA 4WF7A 4B5WA 1K8XA 2PCEA 4GKTA 2FFCA 3RK8A 3TIMA 1KNWA 2E6YA 3W84A 1JF6A 4ATDA 1KBLA 1UIPA 1ME8A 3GDTA 4XAFA 2A7RA 1FFRA 2HPIA 2X1TA 2UY3A 4LPCA 4DXXA 3C61A 2DGAA 3C0LA 1VPYA 1K8CA 3AXMA 2VEGA 1VZWA 3OLIA 4Z2HA 3E49A 3HMCA 1HFBA 1KM2A 5D02A 4LU0A 4W87A 4UTUA 1Q6RA 1C92A 8CGTA 2BSLA 3LN3A 4MYXA 3TA6A 1XLJA 4JHOA 3EA3A 1J01A 6ALDA 3SRHA 3R89A 1GOXA 4WKFA 5BU6A 4WDXA 3IEBA 3HIJA 3A47A 7PTDA 4P8XA 1LM1A 4XBKA 3W1TA 4LXFA 2A7NA 4YTRA 5ABFB 2F61A 5CC6A 2Q6ZA 3H2CA 2ZOXA 3OLDA 5HDRA 2Y7EA 2CC0A 3O06A 1BG9A 3AJXA 4D8AA 2ZIDA 4M6QA 5HUPA 3CYJA 3T6CA 4CU8A 1QPKA 3UJEA 4JX4A 1AL7A 3BW4A 3SUWA 4YL2A 3HO8A 3LM7A 1RCOB 1GKQA 1SFLA 5BMXA 1E43A 3JZUA 3P5ZA 4UZSA 4NI3A 1K4HA 2BHYA 4Q4OA 1X1OA 4AHOA 1YDYA 4OZOA 3D3AA 3LMZA 2PDJA 4R34A 3TDFA 3TYDA 1FXPA 3LXCA 1A49A 4B9ZA 6CGTA 2WC7A 3EPNA 3NQ7A 3SGZA 3CHFA 2GQAA 3SB0A 2VFDA 1XYZA 8TIMA 5BRBA 3CLWA 3SQMA 1FWEC 1VBRA 4BHYA 4YMZA 4YVVA 4NX5A 5A6TC 1KWKA 3UG4A 1EGVA 3M07A 4BQ3A 1ZJAA 4LT9A 2ZX9A 3RN6A 3ARQA 3H23A 4TX9A 1TRIA 3QC3A 4ZO8A 3O1NA 2QZRA 3VIIA 2EPLX 1U83A 4PYSA 3EWXA 1X97A 3QF0A 2ISVA 1YPXA 4D6CA 2ZX5A 4K7VA 5EB8A 2R1NA 3DFSA 3UW6A 4UZUA 2F84A 1YE4A 2VVSA 3GXDA 2XH0A 4E2OA 3NQVA 3NPWA 3BJSA 1XRSA 4XSLA 3GNXA 1U2YA 2X0SA 4JX5A 1XIFA 5U4NA 3UZZA 3CL6A 3KDOA 4W5UA 1E4NA 1KGWA 3FHQA 1MW1A 3H2NA 1FWAC 3EWUA 4Z2JA 1H61A 3WK2A 4L6DA 2J62A 3GH4A 3LGDA 3T42A 3W7KA 1HKKA 4QE5A 3PWIA 3RO6A 4B90A 1NTHA 4I9TA 1PCWA 1Q6QA 5C7VA 3LTPA 1N82A 1AK5A 5F2LA 2YCLB 1PHQA 2HEJA 2NZLA 1LWHA 1M3UA 4QJ3B 4ZCWA 1A80A 2XFWA 4GQ0A 3GHUA 1B4EA 3DFYA 3EGJA 4AWUA 3GNNA 2VRQA 2Y88A 3M6YA 2ZWYA 4EAMA 3UG5A 3VNDA 3LPOA 4J3TA 4C6OA 4LF2A 3T7VA 8A3HA 3HGJA 4BI7A 3UPMA 3MV01 2PTDA 4A3RA 2PD5A 2GOKA 2WSKA 1OX4B 2DZPA 2NVDA 4PR4A 1O95A 1XC4A 1KW1A 4K8EA 5T9BG 5FESA 1UZ1A 2CLMA 1UH2A 1ZBCA 3TWAA 1Q3NA 1H60A 2R9RA 3OG3A 2PDMA 5GJNA 3MB9A 2W92A 1I2PA 4QDPA 3HMJG 2BGQA 2RUSA 5CSUA 2MUCA 3WJZA 4NNCA 2PGEA 4QGCA 4OE7A 1MQQA 4IT1A 1VF8A 5CJMA 4JFWA 1I1WA 1NM9A 3HG3A 5JVLA 5FJUA 2G50A 2PCQA 3PBVA 3ZVHB 1ZAIA 1UPMB 3W71A 1WZAA 4INFA 1R46A 1ZQ5A 3WBEA 1AQ0A 3MCMA 3F5LA 4R7WA 2NX3A 2ZRWA 3RDKA 1EOKA 4Y9AA 5AZ1A 1SFSA 1HKJA 4B3ZA 4OHQA 4PODA 2Z2BA 1XBZA 4R9OA 1UD5A 4IXHA 3EWYA 5HMDA 1O1HA 4W4QA 1UWUA 3CZGA 4IP7A 3QBUA 1VLWA 1LT7A 2E5DA 4JKKA 3L0GA 3SCVA 4L7ZA 4OECA 3F4NA 3CASA 4AW7A 4XTDA 3K30A 3GHTA 2FHFA 4HB7A 5E1QA 3W7JA 1FY6A 4JY9A 5F4SA 3JRKA 3Q58A 3CO8A 4H6RA 4L61A 3AWNA 4J5NA 2WKLA 2R24A 1RBAA 2WQDA 3ATZA 1H7NA 2FYMA 1OG0A 4JXCA 1FCBA 3W7HA 3WQ8A 3SM0A 2YOCA 1LG1A 1W8SA 4J27A 2XGBA 2QNEA 1R5YA 1W5MA 4F48A 3THQA 2FH8A 2PMQA 2FTPA 1SJBA 2F2HA 3S5YA 3E0VA 2JKAA 4OKDA 2NQZA 2J9ZA 3CUHA 4MPKA 4TVCA 4AMAA 1JZ6A 4YN5A 1OFRA 1G01A 5EMLA 4QCFA 3U6WA 1WX0A 1TRDA 1IXOA 4NILA 5JH1A 3P8IA 4JTIA 5RUBA 1RCQA 2XN0A 2XG9A 3W7LA 2FLIA 4M6PA 1XLDA 4GH1A 1SSGA 2AAAA 2AGKA 3GNOA 3QEZA 5CPQA 2ALRA 1LOQA 5I07A 4ML4A 3EDFA 3OQ8A 5D38A 3SCPA 1I2OA 1TKKA 4L4LA 3SDOA 3FA3A 1S2WA 2V38A 1A50A 4YNGA 3ZFHA 7TIMA 1UIOA 1IF2A 1XLFA 2POZA 2POTA 3WF4A 3DIPA 5KSWA 2WW5A 4XAPA 2Z26A 1QBBA 3AU2A 1XDMA 3BH4A 4C1KA 3EPMA 3IAQA 1AVAA 4I5UA 3ZT6A 1JPKA 2GGEA 5D30A 4LCRA 3UERA 3GBDA 3FNDA 3MUY1 3OZYA 4FLOA 4H2HA 3FW6A 2WHMA 1US2A 2VZVA 3EPOA 3G3MA 1US0A 3NG3A 4LNYA 1H7WA 1BVNP 3R13A 1EJTC 2PTXA 4B5VA 4NP7A 1ADSA 5I3GA 2YBVA 3VDAA 3KFTA 2FHBA 1MUWA 4WQ6A 3E2RA 5C9WA 2HROA 1H4PA 3S1XA 1KM4A 4EAYA 4UQBA 3VNMA 3MSDA 1JZ8A 4C1LA 4PA8A 2DFAA 4DWDA 3C2RA 3CL8A 4MY1A 4AEFA 3B9AA 5CQ1A 3PF3A 1WZKA 1W5NA 1G94A 5J8LA 3H70A 4CVUA 2F6XA 4B5NA 1GQKA 1OC7A 4XVEA 1CGXA 2ZADA 3NIYA 3GXPA 2A3CA 1J6PA 3KXQA 3XIMA 1DBTA 1B3ZA 4IQLA 2XSAA 3QLLA 2XJ7A 5C2XA 1GOIA 1NDZA 3B40A 4KWUA 2ESCA 3IJ6A 4FX6M 4GGBA 4H9XA 4F8XA 4L9ZA 1GVQA 4JTSA 1E1FA 1KM0A 1NARA 1H09A 4X2RA 3TR2A 2XFFA 2B81A 1DIEA 2INEA 3QW3A 2AKMA 4BA0A 2VRJA 2D0HA 1Z42A 4UTWA 2BP1A 1YX1A 4LVFA 4G9PA 1P0KA 1A5BA 4QCEA 1A5NC 2WPBA 3U48A 3R58A 3EOSA 3N4EA 4OJYA 1H41A 1PX3A 4R7OA 3AIUA 3GAKA 1NOFA 2F38A 4LCSA 3LHYA 1CNVA 2AQWA 1MEIA 3K13A 3ZR5A 4DWSB 4F9JA 1CIUA 1VRDA 3ALFA 1M65A 2D2GA 3CZLA 1IZJA 2V3GA 5D8ZA 5I03A 5D32A 4HNOA 1BQGA 3NTYA 1AQHA 3NSMA 4IFRA 4LY4A 1WKDA 2WKGA 2ZUNA 1PKNA 3TYEA 3GG7A 5LNWA 2QHAA 3WLPA 1DWJM 3AS0A 4X3ZA 1IT7A 1HVXA 1VAHA 3O6CA 1O66A 1S46A 3D5HA 2F9RA 3W22A 1QT1A 4KEUA 2ZICA 3PJWA 3OZOA 3GVGA 3N18A 4HNVA 3W7MA 1EHNA 1XIHA 4JTJA 3OBAA 1RPKA 5HWMA 2Y5JA 3LHWA 1FWFC 4UFJA 1W3JA 2NV9A 2HXTA 3WF2A 1C90A 4B5SA 4WDTA 1JYNA 2YFOA 4Z2LA 3CWHA 1QPRA 4YTTA 2WWCA 4HN4A 2D2HA 1VFOA 4LEQA 4G1KA 1VEOA 1GG0A 4MY9A 3F1QA 1M9HA 4GY1A 3O3RA 2DSWA 3B05A 2GK1A 3THCA 5DELA 3T8QA 3N25A 3RPMA 4NZ3A 3UJFA 2G97A 1QWGA 5D2VA 5HJXA 4FP1A 3LXAA 3W2MA 3D3FA 5HNUA 2TSYA 2C79A 3KHJA 3TZNA 3NM3A 4S3GA 5I3KA 4B3LA 4W8BA 2IKIA 1AMKA 1XUUA 3WD2A 1VENA 4F0KA 1GKPA 2ADAA 2DZVA 3THUA 3LCFA 4FOUA 3VIHA 3KM8A 1NSJA 1P6WA 2BOGX 2INFA 2PDYA 3U5YA 2OTDA 1RP9A 4CLMA 3W2NA 2C71A 4L6HA 3W2JA 3BV7A 1ZLPA 4D6GA 1RY0A 2UY4A 4N6EA 3GXIA 4YCPA 3GXTA 1O6IA 3C4UA 3LZ3A 4US5A 3BZJA 4JCLA 1KA9F 2ZDRA 2WNZA 4LVBA 4NXSA 4CNOA 1TWWA 3LOTA 1V6WA 4WZHA 3UR8A 1GZGA 1FKXA 3N6QA 1J0JA 3LU2A 3B8TA 4N02A 2RH9A 4RE3A 3LBCA 1TMQA 2CLPA 3SCWA 1WYIA 4DF2A 3UXIA 3GR4A 1HKVA 4UCFA 1F8MA 3L68A 3HTWA 1E0WA 2QAPA 2ZUUA 3HZ3A 2VKZG 4GNVA 4R85A 1VYPX 4OVXA 3FA5A 3WH6A 1HW6A 2PURA 3B03A 3PBYA 3D6NA 2V5LA 3MMTA 1XLEA 1VCGA 1V0MA 2ZA2A 1ONXA 4BWLA 1ZBVA 4RNJA 3VYLA 3DGBA 3GNDA 3DU0A 1VJIA 2XHYA 1AG1O 4PFMA 2PLMA 1B3VA 1QNVA 3UNDA 4CNNA 3MC5A 2E1DA 3RITA 1SSDA 4NYYA 1I2QA 2YZRA 3W72A 3PBWA 3W2UA 3A9BA 3BOFA 4Q8TA 4H2CA 1DJXA 2B7PA 1PWLA 3WLKX 3TLLA 4XKMA 1IV8A 1UBPC 3WMLA 3CT2A 4E5TA 4LX4A 4YU1A 3ONBA 3TC6A 4P7OA 3DX5A 4DYEA 1BTCA 2WNWA 4E0CA 4K37A 4IJBA 3ORWA 3GU2A 1GOQA 4JTEA 4PTDA 2C3ZA 4I9MA 3H55A 1XGZA 3TYAA 2AQOA 4KWOA 3SURA 4M56A 1UUMA 3MUCA 3M43A 1BVWA 1ME9A 1W9BM 1BWLA 4U2YA 4FS9A 4J1OA 4HSOA 3WNLA 3KBMA 5K3VA 2NLYA 2V2DA 4PRRA 3HFTA 3S6OA 1QRQA 4PTNA 1THFD 1J0HA 3M41A 3PJTA 1P6CA 3UZ5A 1FWTA 1OFEA 3CZ8A 4XZLX 1I6NA 1FVPA 1YXDA 4RLIA 4BY3A 3IANA 5HULA 3B04A 5CPMA 4KIRA 1I8JA 1IWBA 1O5KA 4ADTA 2NXHA 1IIHA 1KR0A 4XZIA 3IJ8A 2IQDA 2J75A 2CWNA 4FMVA 3E02A 4NJJA 2FTYA 4JTAA 4MFDA 5HJLA 1R7AA 3W9ZA 3LHVA 5CPLA 4CQAA 4WKAA 1W8GA 1GJWA 2D3LA 3TP4A 2CESA 2Q3RA 3WUFA 1PIGA 4V28A 3JS3A 1JCXA 2PC4A 2Q71A 3R12A 3NYDA 3W1AA 2ACUA 1S5WA 5G4EA 4O12A 3TKFA 3S2MA 4QG8A 3AIEA 1J93A 3B9NA 5FOOA 5AZ0A 1EH9A 1RZMA 4QG6A 4HMCA 4DN1A 1OF8A 3LXBA 4LRSA 2PPGA 3K5XA 3QW4B 4M1BA 4REQA 1JD7A 3G1RA 1JAKA 5AHEA 2CLOA 1FWWA 3BURA 4D6JA 2OGJA 1K8ZA 3CV6A 3AYSA 5BXTA 1TPUA 1QWKA 1BLIA 3O63A 3TU9A 1NDYA 4AD5A 4Q22A 3M0LA 4AZ6A 3FKKA 3SFWA 3DI0A 3L5AA 1TB3A 2FPTA 3ZT5A 1OT1A 2C15A 5AHLA 1DQWA 2JQXA 3VIFA 3NR0A 1UJQA 2VJXA 1M7JA 2IKHA 3QV6A 3KLLA 1PB0A 2PTYA 1I2NA 2ONEA 4D8ZA 4EWJA 1OCQA 4XBSA 4JHMA 4Q4KA 4ZMGA 3RILA 4LUYA 3TCSA 2IXVA 1H3GA 3VGBA 2BFGA 4C5ZA 3FXGA 4J3XA 2OCZA 4EANA 6REQA 8RUCA 3CPRA 2GSEA 4GRSA 4XKYB 1W1ZA 4ZSTA 4QISA 3HGSA 4Q4PA 1MNZA 1L9WA 1EPVA 3R10A 1UHVA 3U7VA 3I10A 3B06A 4N42A 1TWIA 2XN2A 1VFHA 4AU0A 1T0OA 1UD6A 4CN4A 1DTUA 3WQ5A 1UR2A 1V02E 3WNOA 4NY2A 5LXEA 3IK4A 2OX4A 2PGRA 3NJ3A 2PF8A 1YE6A 4WXYA 2XH2A 3SY8A 2NSOA 4YYCA 4DBSA 4M82A 1C8XA 5BRQA 2XIIA 4DHGA 3M16A 1WXYA 4JTKA 4AC7C 3DYPA 1KFCA 1UD3A 4OBSA 2PODA 1ITXA 3FFSA 3GKFA 4F2BA 2QVHA 3PUEA 4N2YA 3WCZA 3B0PA 4GX9A 3VMNA 4AG0A 1ESWA 1PYFA 5TAOA 4TVDA 3QR3A 3VIMA 2Y2WA 3B4YA 3SQSA 1GZ1A 4FF7A 2H3DA 1TJRA 5GJMA 9XIMA 1RALA 5A6JA 4J2PA 4IIEA 4LB3A 3B8VA 3VDCA 3F4DA 5EFDA 5GJPA 1TV7A 3E0WA 1XIEA 4ERAA 1MW0A 1JPMA 3GNRA 3N4AA 4HPNA 3GFZA 3E3HA 4XZNX 4GISA 2OSWA 2VQTA 2PA6A 1ZCOA 1WAWA 2E5BA 1OGSA 3R8HA 3B0VC 2G3FA 1GVRA 5FACA 3MVTA 2Y1HA 1PS9A 3WBWA 3I6TA 1E3XA 1YRRA 4E8DA 5BCAA 5AC7A 1LQ0A 3UP8A 5KEZA 3CPUA 4S2CA 5DT7A 4UQCA 4I5XA 2EKCA 3CQKA 4IMGA 4PC8A 3CV2A 1T8QA 2XGIA 2GYIA 4TXEA 4DZ5A 1BWKA 2DIEA 1AW1A 5KITA 5JH2A 1WDPA 3S4TA 3RUBL 4QBXA 1HN1A 2Y5EA 3EKLA 4KCWA 1DJQA 3LLFA 2YA2A 3ITGA 1S5VA 3DECA 4J2MA 1BRLB 3M7WA 3NZGA 2O92A 1RP8A 3RM8A 3SEPA 3P84A 3OIHA 4O1FA 1U5HA 3CXOA 4I6VA 4UOJA 4CEUC 3A21A 3C2FA 4HPJA 1N2VA 5CPTA 1Q6GA 3HOJA 1R9XA 3OGSA 3GTNA 3URAA 1JYXA 2PDGA 3N9KA 1LYXA 3WF0A 3HQPA 3BVJA 3PZIA 4PMQA 5EBUA 1NIUA 3TN4A 3QHOA 2DZBA 1UQYA 3AXKA 4HPHA 3WLIA 3VABA 1X39A 2V63A 3DFTA 1M53A 7ODCA 3M64A 1IIGA 1Z6KA 1DJWA 1XICA 3NUKA 1YIXA 3ES7A 1KBJA 1JPHA 3USBA 2PF0A 3OA5A 5E6YA 1JI2A 1XKYA 2OSYA 5AYBA 1KKRA 3WFLA 5D4YA 2ZE3A 5I02A 5D2YA 3BC9A 3HA1A 1RV8A 2VC9A 7XIMA 3WD1A 2I9EA 1PIIA 2XSBA 2CCRA 5FEZA 4ALDA 3PZOA 3VOHA 2IPJA 4BZYA 4TU1A 3BAWA 4AHQA 4RDWA 4B2DA 4UCGA 4FNUA 5EU9A 3ZLGA 2R1PA 3W29A 5I6SA 4CD5A 2WZTA 1JXKA 3GKAA 1US3A 1VEMA 1A3WA 1L0PA 3COTA 4W5ZA 3CHEA 2X0YA 3U8GA 3APYA 1U33A 3RLUA 3B0UX 1PZ1A 3F2CA 2PDQA 2BY1A 1GJUA 4MWAA 3NZRA 2WVTA 3JUGA 4XTIA 5G2IA 3T1GA 3WQDA 1BFNA 3OVGA 4GXMA 3NPUA 4RZ5A 1JPDX 4DRSA 1OFBA 2HBXA 5FCZA 4H9TA 1XWYA 4IFKA 5D9MA 2OKOA 1EC8A 2QULA 1JZ5A 5BW6A 1XXXA 3FA4A 4MAVA 5TQLA 3WQGA 3B8DA 3AS2A 1TSIA 3SN1A 2XPKA 1RK5A 1M03A 2BGSA 3DH7A 4PMXA 4HSNA 5BMWA 4RDZA 1XIIA 1Y0EA 3M0YA 3SCOA 4U3AA 4MPQA 3M6DA 3VUSA 4LB4A 3DG3A 3VDHA 2QYGA 2REQA 4RV8A 1ODZA 2BGNE 3MO7A 3VVGA 4O16A 3EA1A 4O0KA 1T7LA 4GC4A 1UOKA 4H04A 5BWFA 1LP6A 1C9DA 2QAFA 5KZDA 5C55A 4C6KA 3WDPP 2ZXBA 3PAOA 4G56A 1CZ1A 3L4XA 1IXNA 1UKQA 3K8KA 2OT0A 2W5FA 4W9TA 3IAPA 3ICJA 3LI1A 1X7IA 4CD4A 3HN3A 3VI2A 1EGZA 2WMIB 3T0BA 1G7VA 3G6LA 2VOTA 2E1WA 4KETA 1MRQA 2Z6JA 2PWUA 3R43A 1X98A 1CX9A 3GVVA 3UU0A 1UR9A 1R2RA 1P0EA 5BOOA 5CCZA 1PHWA 4LAZA 5HNRA 2VELA 1HJUA 4JQ3A 1XPGA 4B16A 4LBSA 2YDSA 3AYRA 3QMRA 3RLVA 2HS6A 5C9XA 4MNLA 4S38A 4JY8A 3TQPA 3L4ZA 3GY1A 1DJZA 1KRBC 3LD5A 4LUSB 2X41A 5BWAA 1WBJA 2BODX 1LBMA 3UWVA 4E6MA 3PAJA 1EEPA 4JDYA 4UIOA 2DW7A 3WLLA 3D46A 1SW0A 2WHLA 4G7FA 3RCNA 3WQFA 2VGGA 1HIZA 5M3WA 1UOZA 1EJVC 3MW7A 3N3MA 1QATA 3T4CA 1ZP4A 1XYAA 3S83A 3UPWA 1EX5A 4LUJA 1TX0A 2XZ9A 1HF6A 3OHIA 1NFGA 3MMWA 3TJLA 5H8PA 1ISXA 3OHMB 1DEDA 2VX4A 3TC7A 4Z1DA 3SN4A 3VE9A 5CC7A 2NQ9A 4DBWA 4HNCA 2DSKA 3W82A 5BXPA 4Y6GA 3N6JA 3ANUA 4HBKA 3UZWA 2TYSA 2TODA 4Q7NA 3NQMA 3LENA 5B80A 3CUZA 3UGVA 5CKSA 2H9AA 3FN9A 4DLFA 3TYBA 1XBYA 1KRMA 3AS1A 1TZ7A 5L6UA 5E9XA 3UY8A 4UNIA 4ADSA 1PO9A 1GVEA 4WLCA 5KINA 5AY7A 2NW0A 4FNSA 1UP0A 1ZBKA 1BXNA 1FRBA 1JCJA 5I24A 5A6BA 1RY8A 2Z6IA 4PBEA 4DO7A 5GQBA 1UW9A 1H2JA 1FWJC 5ECVA 4ZQPA 3W6YA 4H7CA 1RSCA 2ZC8A 3I3DA 3LTYA 2J24A 3B4UA 1E1EA 1Q6EA 1UBSA 1CXKA 1G6CA 3MI3A 1IGSA 5C9RA 2WNQA 4ZENA 2GGJA 1GPWA 4C7DA 3BW2A 3INPA 2Z29A 1IEVA 3IIZA 1S39A 3VGHA 1HP5A 4LOCA 4O0QA 4ZB5A 3EMQA 3R11A 1DJIA 2E68A 4PBFA 1TV2A 4E4PA 1OYBA 2B7NA 2CZEA 2VENA 4GKLA 3AMCA 3S1VA 4LJ3A 1KD0A 4HKPA 1OJXA 2D0FA 2JEPA 4GE8A 2ATSA 1NVMA 1BVZA 3SECA 4C1NA 4XV0A 2E6DA 1M7OA 4B3KA 3FOKA 1XIJA 3D0CA 2CZFA 3AUOA 2E3ZA 4YCOA 4FLRA 3UR2A 4D1IA 4HOXA 1OSEA 4HTYA 4XZBA 4QTGA 1HVQA 1E1CA 3ECQA 1A5UA 3BAKA 2C18A 2X0HA 3LCLA 2QCFA 1CWYA 1XLMA 3RM9A 1UKOA 3GU9A 3CQ0A 2R1MA 4CCCA 1O1ZA 4GMEA 2CETA 2XVLA 4PMDA 3APGA 1HT6A 3PB0A 2W62A 3BK0A 2NQHA 3EDEA 3S2LA 2NQJA 4JPGA 3F7JA 4AD4A 3VKDA 1VIWA 3TXZA 4A21A 2YL9A 2VC7A 3RJXA 1SYTA 1R30A 4PFHA 3A13A 3VNJA 3K4DA 1VFUA 1TTQA 4K8GA 4YIWA 1B0IA 1KFJA 1Q7QA 3GXFA 4GI6A 4WCJA 4JN7A 4LVGA 4BEUA 3N11A 5A95A 2IQ0A 3D47A 5D33A 3WX7A 4RV3A 3WSUA 3PTQA 5A3HA 2VUYA 4LS2A 4NYUA 2DU2A 5KZEA 3SGUA 4NZCA 4L4MA 3GXMA 5AN7A 3QY6A 2PDFA 2PRHA 3PM6A 3WQEA 5KZ6A 4TIMA 1SFJA 2PDBA 3T0CA 3WELA 5AB3A 1EQCA 4HCLA 3S2NA 2HE8A 4CCEA 3ZR6A 4JQ4A 3I7RA 3NQ8A 3BQ6A 1YTDA 3SCTA 1GGOA 4F66A 3WLOA 3BZGA 3TFCA 2PSNA 4O18A 3W23A 3NZ1A 4HGXA 1Z41A 4C65A 1OB0A 2QMJA 2VDGA 1D3HA 3UEQA 1PYMA 3GUWA 3BTNA 4W7VA 3HBLA 4OGZA 1DIKA 3NDZA 1PX8A 3FV9A 1PSCA 3ARSA 2XIOA 4P7RA 3OPSA 2PI6A 3UWZA 1HL9A 2BVDA 3QTGA 1JUEA 3N17A 1K7XA 1CXEA 2Y5SA 4RNHA 1C29A 1H62A 2HVNA 2Q09A 1Z69A 2X8RA 4JYDA 1Q2RA 3B0YA 2QJNA 3S9ZA 3G1SA 3HJEA 2D2OA 3EWZA 3H2FA 4KWWA 4U33A 1CB2A 3FEMA 2GWNA 3E1F1 2QEZA 3VDGA 3W1NA 2VXNA 2KAUC 1NDWA 1TO3A 4WXZA 3PJXA 2CKSA 3P82A 1IXPA 1DWAM 2JGQA 4HN8A 3LRMA 3L2MA 1QUMA 4O11A 4NNBA 5DCDA 5I79A 3QGVA 2C7FA 4Y9PA 3WY1A 4Y7EA 3BG3A 6A3HA 3AIVA 3KP0A 3FVMA 1G5AA 3BL3A 4GI8A 4WDUA 1QNPA 1F9CA 1J0ZA 2WB5A 3HV9A 4P7NA 1HGWA 4BI6A 3LEPA 1KLZA 1UR8A 5JIPA 3ZS4A 1GW9A 2FGZA 4M24A 4WJXA 2VGBA 4AX7A 3UXKA 4AF0A 2MNRA 2EPKX 2VGIA 3UNTA 3MKKA 1SVDA 1C7TA 2WHJA 2VZUA 2EAWA 2F2KA 3SY1A 5FJOA 5D2XA 3TROA 3N04A 1Z32X 3UYCA 3M5YA 5BXSA 4HYWA 4JNYA 5FI8A 2PUZA 4ZGYA 3WLNA 1H49A 5AC6A 2E9MA 4KWVA 2PP0A 4XISA 3DG6A 1KC7A 4IM4A 3LLDA 3NFUA 3OZPA 1H7XA 2BOFX 3DAQA 3P60A 4HJWA 4Q33A 2BBFA 5AHFA 3UQNA 1LBFA 2Z7GA 4M7TA 3BLKA 1V93A 2JBMA 4FB7A 3V0SA 1CENA 3CHCA 3WMSA 1TELA 4XIAA 1H0GA 5TF0A 4AZ5A 4PEEA 4HCDA 5MHBA 1XI3A 4DJEC 4Z08A 1O94A 3BAIA 4WGXA 5FL0A 5EMJA 2G3IA 3ELFA 3I68A 4C6IA 2O7QA 3KVKA 4BJHA 3BSHA 3TWBA 4O8RA 1VEPA 3SUVA 4ECLA 3OYZA 1V6VA 1Q65A 3CQIA 3HG2A 3PPHA 4FR1A 3V1PA 4BEQA 3BW3A 3PPCA 1W1A1 4TMCA 1VP5A 5FAJA 4PUDA 5HMEA 3GHSA 3EKZA 2W67A 4NG3A 1Q5MA 2BY2A 1EO7A 3UVIA 3URQA 1Z44A 4U3CA 3T4WA 3UCQA 1Z89A 1W3HA 3R0UA 4DWSD 4ML9A 1F4AA 1QASA 1GOOA 3H54A 4DAFA 3CC1A 2ZBTA 1FDJA 2D23A 4IPJA 4IP5A 2QCMA 4TMBA 1V6YA 4MLRA 2OELA 3VCRA 5I3IA 3K8MA 4LUIA 4I8DA 3M0XA 2W79A 2ZE0A 3ISIX 4U4MA 4ACZB 2DH3A 1OFQA 1D7KA 5H8UA 1UKPA 4DUWA 4LAUA 2G95A 3KZPA 4J9JA 2JK2A 1C8QA 2PDHA 2QUTA 4L80A 3CAKA 1HJVA 1AUSL 1OD0A 2HVMA 1XL9A 1GPFA 1AQFA 1QPNA 4FZIA 2ACQA 3QZAA 3GAYA 4FXFA 1AH0A 1R85A 4HU3A 3T08A 4FSAA 4HJFA 2VC6A 5A8NA 4FOKA 2C13A 2Z2AA 1SMAA 1EWEA 4LAMA 1XISA 4WSKA 5K9XA 1F74A 2DJLA 2RAGA 4WDWA 4RL3A 1W91A 1TWDA 1CGTA 2O9PA 3W1LA 3PTKA 2OEMA 4HHHA 3CIXA 3JU2A 4DUOA 4EXQA 7REQA 2J13A 3G1DA 4GYFA 5KTLA 3UWUA 2PEVA 2EGZA 2HDJA 2DJXA 2OR2A 4GUIA 2ZUVA 1TVNA 2XIMA 5CZKA 3W3OA 3G8EA 4ONVA 1R8LA 5M2FX 3QFWA 4CUCA 5K9DA 1ML1A 1EOMA 1PZ3A 3MP4A 3WK1A 5HPOA 2X1SA 1GWJA 4MLJA 3T0DA 5LYRA 4XO6A 3AYVA 5EMUA 1OBAA 5C6MA 5TBOA 1XR2A 1MFUA 4O54A 4DAIA 3URBA 1KRAC 4M6VA 1VCVA 2W27A 1W2VA 2G37A 3USZA 3AXXA 1B54A 1RR2A 3H2AA 1KXVA 5FD0A 3WJWA 1IEIA 2NUWA 8XIMA 1VYSX 4JKLA 1PX4A 5I3FA 2XM2A 2QUUA 1OGBA 3ZMRA 1GCYA 1A3XA 4FNRA 5T9CE 2GVLA 1EC9A 2QJJA 3CHDA 1EP1A 3CNYA 4JYFA 3E0LA 3CWOX 5LIXX 1GUVA 3H21A 3IVUA 4NAFA 3EXRA 3R25A 2FPYA 4B5TA 1QO5A 2ODOA 1A0EA 1HG3A 3STCA 1S2TA 4EK7A 5JMUA 3RR1A 2Y6ZA 3WDHA 5CG0A 1GOMA 2V3EA 2C8NA 3TOPA 2HK1A 3PK7A 4M81A 3DFHA 3KBNA 4L9XA 3VGFA 3AZSA 4JTUA 4IUGA 3M1ZA 3VFCA 1XSKA 3C5QA 2YL6A 3WLMA 4IIGA 2VEMA 3G1AA 1SO6A 4GIRA 2YA1A 4K39A 1K9DA 1Q85A 5A2BA 4Q8PA 2NQLA 3M47A 1E6SM 1JJKA 3HU7A 1A5MC 1F6YA 2C16A 2O9TA 5XIMA 1X1ZA 3CQHA 5LIKX 1ONWA 3LPPA 3CU2A 1RJRA 2WBKA 4LC8A 5BROA 3SRKA 1GVYA 3AMGA 1KRCC 4OV4A 4JNZA 3A23A 1TPDA 1EBHA 1SR0A 5G4HC 2XWDA 4AD1A 1TTIA 3WBXA 3PJUA 2C19A 4S3CA 2BVYA 3VMOA 3W00A 1G4SA 1J2WA 3DOPA 3PANA 1MXSA 4EE9A 3PTMA 3MQTA 6XIMA 1VHCA 2HNEA 2VUNA 4GOAA 4Y8EA 3S3GA 4R9XA 2O7SA 4KF1A 2OX1A 3G77A 4DJFD 2EXOA 5HMFA 1V02A 1PTGA 1XD0A 5JU6A 4P8UA 2YSWA 3ATYA 3G1VA 2J27A 3WUBA 4IISA 2FZBA 4ZQNA 2VCCA 1GKRA 1YNPA 4XB3A 1B5TA 4UFMA 4KESA 1MVYA 4JTHA 4IIFA 1XLHA 5DRIA 4FO4A 2VL4A 4LC6A 3ABOA 1F3XA 2PP1A 1H63A 3M44A 2YLAA 1JDCA 4UR7A 3ALGA 4Q8VA 5CH9A 2QCHA 2G96A 1PJ9A 2BB0A 3WNKA 2ZRXA 1QNOA 2WLZA 3FJ4A 5AHNA 1ZALA 4HHPA 2EPHA 1ZENA 3JZEA 4LVDA 1XGDA 1G69A 2ZZ1A 4HA3A 3C52A 2CZDA 4GY7A 4AX6A 3BJFA 3UA4A 1AJZA 1T99A 4OFCA 2DSUA 3ZT7A 4JBRA 5HNNA 4QFUA 1B30A 3W38A 1GYMA 1F6KA 3CGTA 5E0KA 4Z1AA 3AFBA 1KO0A 2GVJA 3W87A 5I0DA 1GORA 3JW7A 3FSUA 3NGFA 4NU7A 4MNMA 3TNOA 4FR6A 1DWFM 5LHFA 4V15A 8XIAA 5K4ZA 4ZSUA 3NO3A 4N9BA 5ABFA 2HRWA 2P88A 1YPFA 3QKEA 3WZ0E 1HP4A 3WNMA 1Q4NX 3QZEA 4F2TA 2GSHA 5FSDC 4GYPC 3G22A 1CT5A 1EL3A 3NO1A 4ZXLA 3BUVA 4B15A 3E5PA 1FXQA 3V5CA 1FKWA 3CPGA 3IPWA 5HQEA 5CJ5A 2DP3A 1QK2A 4ROQA 1YXCA 3GK0A 3W6MA 2VCAA 1BKHA 2JF6A 4PRWA 2G4FA 3ZJKA 1BWVA 3SCNA 1QMLA 3TTSA 4AYGA 1EXPA 1S2UA 1P0BA 2VEFA 3KVMA 1JDEA 1XRTA 1FWCC 1IQ8A 1E0TA 4W86A 3IWPA 3N1AA 5IHSA 1JDDA 1H5YA 2ZRVA 4E3VA 3FEQA 2Z00A 4IUOA 2VEPA 1DXIA 2CLHA 2CIPA 4IGSA 1M6JA 3VFLA 1YYAA 3PG9A 4ZTYA 2V8ZA 3FIGA 1VPQA 5HWJA 1LL4A 4JFTA 2D22A 3KVJA 1XW8A 3AU6A 4M6UA 4B4HA 3VNKA 1LZOA 2P3ZA 3EOEA 5REQB 3QJAA 1ZJIA 2WCGA 3IUHA 1ODUA 3W4RA 1KFEA 3VGEA 4OIFA 3O7UA 1BHGA 3W6LA 3IJLA 1O5RA 5DO8A 1Z3NA 1E6PA 3WG6A 2J6VA 4X61A 3LTSA 3VIKA 4EACA 2FZDA 3ZWSA 4AVFA 3BLDA 4F0RA 1XLAA 1JQVA 2ZRYA 1V0LA 2CFFA 5C5YA 3R2GA 4URIA 3M0VA 2CBUA 2ZC1A 3BG9A 4DM2A 3MCOA 4TX6A 3FJLA 4DEFA 2FFIA 4Y9OA 1W1B1 2TMDA 1GG1A 4A6GA 5F2IA 4W7WA 2VP8A 2VT0A 3B9DA 3VPLA 3U2ZA 2YCLA 3RXZA 3WL1A 2IKGA 3KDNA 5C7HA 1NH6A 5HWNA 3L5MA 1P4CA 4GC3A 4PTXA 4HMEA 1JZ2A 3RRXA 4KERA 5DY2A 4MB3A 2IPFA 1OIFA 3GR7A 3LYEA 3T2QA 1BF6A 2FHCA 1BXCA 2A4AA 1B90A 1E55A 4GFSA 1Q63A 3CMJA 1L6FA 2BDQA 2I56A 4H8NA 1F6PA 4QLKA 1OX4A 2QQ6A 4ZFCA 3IRSA 1T40A 4UBPC 1V6TA 3TFXA 3HQ1A 4HZ6A 4QRNA 5HMSA 4PUEA 5G1MA 1WZLA 1MRAA 2TRSA 2RKXA 5CSRA 3SCSA 3K4WA 3S1WA 1XG4A 4M8UA 4KH2A 3QY7A 1JPIA 1ZJBA 4IPNB 4O14A 3ZVHA 1W3LA 3Q37A 3QC0A 3TX9A 2WBGA 1W54A 4UXDA 3LCWA 1LRNA 3EWBX 3NM1A 1QW8A 3GH5A 4RE4A 1REQB 2J9XA 1EUAA 4M80A 5M1TA 1XF0A 1FQ0A 3ME3A 5FJRA 3HGOA 4UB9A 3O6DA 2P53A 5HOSA 4XZ9A 2VTFA 5M5DA 4BQ5A 2V81A 3K1GA 1AJ0A 1RHCA 4PUKA 4G2DA 3DERA 2GJXB 1E6QM 2ACSA 1V3IA 1R9ZA 1YTKA 1TPEA 4FALA 3TQKA 2RDUA 3LV6A 4AWEA 1EFZA 2XYLA 3OO2A 1ISWA 4AC1X 3U3HA 3EB2A 3VKJA 4DJDA 2P50A 4KFOA 3CMGA 2VGFA 3ANYA 2NWSA 1Q7MA 3PZUA 2W4XA 5HQLA 1TR9A 2NT0A 3O2LA 1A0CA 4HTBA 4A8IA 1FHUA 4A4AA 3V16A 1GJPA 5DLCA 2QKFA 4U28A 3ARUA 3MKCA 3C3UA 1RQEA 2ATMA 3GXNA 1CGVA 1NWTA 3EX1A 4ZO7A 1VQTA 5H1WA 3IACA 4JIIX 1MI3A 5KETA 3PBMA 3TAKA 3QTPA 2ZQ0A 4FXJA 3S6DA 2WSRA 4RDVA 3R4IA 5CC5A 4CCDA 3B0XA 2RFGA 1I0DA 4C6QA 2PFHA 2CBVA 3SIMA 5CZ0A 2O55A 1UZHA 3EAUA 3PUOA 2FZNA 2D1ZA 3WQOA 1GT8A 1JCYA 1PDZA 1QPOA 3VKBA 1CLVA 3H2MA 4L1GA 1RCXB 2Z27A 1M5WA 3E74A 2E28A 1KM1A 1NY1A 9XIAA 4AVNA 1ZSXA 1DHKA 3W85A 1A53A 5E0FA 1XIMA 3BE7A 3KRUA 2IPGA 4IG2B 2PDKA 1GVOA 1T96A 1VFSA 3E0FA 2EPOA 1ZB5A 4IMFA 2W6RA 5CLTA 1ECQA 1UD2A 2C1GA 4W8LA 4IPIA 3PC0A 4JKMA 4PUMA 5TD4A 3U57A 2AOSA 3I6EA 1UKTA 4HZ8A 3AICA 3UXAA 3UR7A 3G3DA 1UROA 3PP7A 4GZ7A 3RO8A 5G2HA 3H4GA 4LANA 3VUPA 1AMYA 1XRVA 4MM1A 1CW2A 1XYBA 1YEYA 1YPIA 1IT8A 2JIEA 5K4XA 2BVWA 1LUCB 2VR4A 4ZE5A 4TR9A 3UG3A 3MP3A 4PZVA 4CQCA 1EF3A 3R79A 4MGGA 3BG5A 4QJ1A 4GZEA 3T55A 3AIQA 3VZZA 1IWAA 4KEZA 2FB2A 2FQIA 2IXUA 4DI8A 5DMYA 4YWSA 3STFA 2GLKA 3NEHA 2FKPA 1UB3A 2XISA 3VM5A 3ENLA 4B5XA 4GIEA 1B31A 1SW7A 3ITXA 3C0SA 4A35A 2WK2A 4LUTB 3T9PA 1XSIA 3NZPA 3ZZ1A 1E9YB 1FDYA 1DE6A 4IIDA 2WOQA 3P3BA 2CLKA 4O15A 3HFYA 2CYGA 4Z2GA 1B2YA 5LIUX 2IS7A 1I45A 1GEQA 1ZUAX 1DQXA 4XD3A 3UPBA 1UR4A 3ZLFA 2DUAA 4DJDD 1ZHAA 3PWAA 4GPNA 4NI8A 3TVAA 4PE8A 5LGZA 2RDTA 1JAEA 5CXPA 4YTUA 4PMJA 1EJUC 3LLXA 4U5KA 3S9IA 2QDEA 1ICSA 4MWAE 3OZMA 1Q6CA 2AL2B 1TG7A 2F6UA 3WQWA 4LS1A 4P2VA 4QQUA 4PUWA 3MYOA 3U4AA 3W1UA 1BD0A 1WO2A 3LM3A 4D9PA 4UTFA 5MKGB 3TJIA 1HZYA 1QHZA 5HPCA 2DQXA 4ORMA 4UR8A 3SIZA 4AZCB 1J5TA 3STEA 4BK9A 3H24A 4O1DA 4GX8A 3FAXA 2OZ8A 3WIJA 2SFPA 1I60A 1KTNA 4AISA 3A4JA 1JZ7A 3VZXA 4KCTA 2ZZ5A 3B97A 4FEZA 3PNUA 4PMVA 4JQ1A 4WK9A 3VCNA 3II1A 1RVGA 4IQJA 5D09A 1JGMA 1XDLA 1OFPA 4PSPA 2VZSA 2X40A 4O1EA 1ISVA 3OYXA 4D8LA 1CXHA 4QHRA 2DVXA 1DOSA 4GUFA 4J3ZA 3UCDA 3BLOA 3M5VA 3DFPA 4WD0A 3POCA 1VH7A 2YCEA 4AQLA 3AHTA 4X0NA 3LK6A 1K6AA 2QPSA 4RJEA 1O5XA 1ALDA 2NLIA 1XLIA 3NDOA 1EIBA 4NX0A 3ZJ8A 4IFOA 3TUUA 3THDA 1PXGA 4MJZA 3STPA 4AZBA 3A22A 3WDIA 4YTQA 4QAWA 2DZTA 3EBVA 3W1QA 4O1AA 3PZ9A 4GUHA 4JTFA 3AHVA 3C2YA 4MUZA 2R91A 2W3ZA 2LLEA 3L7RA 2VEIA 2G8ZA 4QS6A 1KCXA 3MZNA 1JCTA 1A4LA 3FJNA 1E0XA 4G7EB 1K9EA 1CXLA 1XYLA 3UWQA 3W7GA 5I09A 3L12A 3T2PA 3MDUA 4EPBC 1E9IA 3HB9A 1GTHA 3P8JA 2WJZA 5EGRA 1OHLA 4MB4A 4AVOA 3R8RA 3IRDA 2NV1A 2VFHA 2DVTA 2YPIA 1EP3A 3VK5A 4CGTA 3L5LA 2QGYA 3CH0A 2JALA 4W85A 2UBPC 3FHAA 1RK6A 4XAGA 2ISFA 2PU0A 3NEVA 4Y90A 1NF0A 4GUGA 2ZKMX 1E56A 4X2PA 5D9NA 3VMPA 3E6EA 1W9DM 2PWHA 3SJNA 4F0MA 3W70A 4DPPA 5C2GA 3MZ2A 2ZUWA 3LV5A 2GZXA 3N2CA 3H2EA 1Q6LA 4O19A 3CTLA 2CLLA 1E6ZA 1UD8A 3ZXWA 3WFZA 4R27A 1PPIA 2F7FA 4GK8A 1HL2A 4DVOA 4O17A 3EYPA 1B4KA 2Z1KA 3NCOA 2ZUTA 1C8VA 3EWCA 3NYZA 3U4FA 2EQDA 4RE0A 2ZA1A 3KLKA 1DPMA 1S5NA 2FZ8A 4ZEPA 3BCJA 2OQYA 2YJQA 2YB1A 4WKHA 3EA2A 3W74A 4O10A 5DMNA 1SFTA 3G2GA 3WUEA 2PZNA 1E51A 2CZ5A 1J0KA 2E67A 4ZOBA 2QJMA 2WM1A 1KM3A 1NWRA 2OODA 4YTSA 4Y96A 4JD4A 4MUPA 1K02A 5F2GA 4LVAA 1MUCA 4UMBA 1DYSA 4QNWA 1B3OA 2AMGA 1XJBA 3AQUA 2W63A 3ERPA 4DI9A 1RA0A 3W1PA 1TWSA 3R5EA 2BLEA 4J35A 1N8FA 4GO9A 1M7PA 4P7LA 4AEEA 4NHVA 1OQFA 5CBJA 1NDVA 3F5KA 5D9PA 2W91A 3CH9A 3WLRA 4UTTC 3BCDA 3FYPA 2NT1A 1JDFA 3PZTA 3OVQA 1SJAA 3W27A 2DZWA 3O0FA 3IUIA 4UTKA 4F9DA 3OB8A 3BSGA 1XFCA 3DKLA 1IZKA 1DKWA 2JFEX 4JS3A 3S1UA 1MQRA 2PWDA 4AEOA 3H26A 1TTPA 1R3SA 2V82A 4UQDA 5BYWA 3ARVA 4Z2KA 2D0GA 3DC0A 3BMWA 4L4PA 4C6BA 4C91A 2NUYA 1KM5A 1OWQA 3B8SA 2ACRA 1FUYA 1AZ1A 4LH8A 5D37A 3ES8A 2ZCGA 5C70A 3M9YA 5ABTA 2OXNA 5XIAA 3VINA 2UZ9A 2QCDB 4S2BA 3WEOA 2DIJA 2EHHA 1IR2A 3OW1A 1G0CA 3IIVA 4K7YA 1MYRA 5GNZA 3M5ZA 4DM1A 3PPFA 3H7UA 5CC3A 4WUIA 4DBDA 2PDUA 3A3HA 4C6EA 2NXIA 2V3DA 1E1CB 1K8YA 1SO4A 1UR3M 4IGMA 3GW0A 3C2OA 3SUTA 3T2OA 1FWDC 3RX3A 1BTMA 3UBPC 1L8PA 4ILSA 3ITOA 4HSHA 3SR7A 1E6NA 1EIXA 1UR1A 3QFEA 2CBJA 1RJQA 4LW7A 1XLGA 1EB3A 1EO5A 2WQPA 4IIHA 1JR1A 1H7RA 3W81A 1E70M 3AHYA 1V8EA 4NZ1A 1HGYA 4GG9A 4UQ9A 1RJPA 2EG8A 1E9ZB 4ZXOA 3PBUA 4G1NA 3TAOA 2J8TA 4H6EA 3WF1A 1ZPTA 2G3NA 5FEXA 3V4BA 4EF8A 3GD6A 4FHAA 3M7SA 4Z2IA 2IPWA 4NJIA 3BPWA 2OU4A 3SUUA 1GVSA 3WLSA 3BGJA 1FX6A 1YNYA 3NQFA 3B8WA 3Q65A 4HA1A 1EPXA 2VI0A 1W0MA 1GHRA 4XD5A 1QI0A 4NZ4A 2GVGA 4S3DA 3AYTA 1J18A 1ZJHA 4GNKB 3CV7A 4MJ2A 4BCEA 1SO3A 4KRTA 3M0HA 4QSHA 4H83A 1KGXA 4CN1A 2V30A 1W5QA 2Q3OA 3MBDA 3WK0A 4XVDA 4FAMA 4IIBA 5DRCA 4W89A 1WBHA 3S5SA 3AIWA 4Y9NA 5ECUA 3OLGA 5DN1A 2OEJA 1B9BA 1B3YA 4PMRA 2CZVA 4XG1A 4KS0A 4NASA 2OLAA 1LQAA 1TPWA 4DJEA 1K3UA 3IJDA 2NX1A 3RU6A 3PG8A 3CUIA 3AAMA 2A2IA 4XKYA 3J7HA 4AZIA 3P74A 4PB5A 1F3WA 3MI2A 3EB3A 2RGLA 3TQVA 1B3XA 1EYWA 2WC4A 3XINA 4V33A 4QX4A 1QTWA 3S2CA 3IS4A 4G8TA 1P6BA 5HNTA 4TOQA 4N6FA 2QW5A 3KOWA 5IRPA 1QFEA 1JCMP 4J28A 3UVAA 2EF9A 3DHUA 5H91A 2I14A 4UQAA 2V9DA 3P14A 1DJGA 4GCAA 4WY0B 5CZJA 3N19B 9CGTA 5CEWA 3RMEA 3UXDA 1V6XA 2ZX8A 3FDGA 5AVHA 2EO7A 3CAQA 4O1BA 3EEZA 3L4UA 4H9VA 4ZB0A 3N15A 5C9UA 1RD6A 2XH4A 2VR2A 4UFIA 1QDSA 3EX6A 2EJ1A 3AROA 5DEZA 4N7QA 2ZUMA 3OOQA 1S1RA 1VYRA 1DIDA 1TIMA 1CGYA 4H6QA 4RW3A 4KFPA 2ZTKA 2H3BA 4KW2A 3IGXA 1VC4A 1JULA 4MSSA 5EKYA 2E9BA 3GTXA 4DB7A 3WMCA 3UY7A 1GOKA 1W17A 1W2PA 3KUMA 3GDBA 4MY8A 3DBPA 3ZYZA 3PTDA 4UFHA 1VBUA 4MB1A 1R3YA 3IJQA 3VC5A 1BYBA 1V3MA 3SUSA 3GIYA 1GK8A 4DZHA 2WSPA 5HR6A 3CMFA 3LHZA 2EPMX 3GC2A 4P61A 3IGSA 2BX7A 3WFAA 4LALA 1ZTVA 1LBLA 3CAVA 1QR7A 3ZSTA 5I06A 4CQDA 1BF2A 3N2MA 5CPSA 1PKMA 4FNPA 1UWTA 1B57A 1LRTA 2ABBA 2C0HA 4QJ4B 1I9CB 2I5IA 2OYLA 2E6FA 3M0KA 3W2KA 4C6LA 1MXGA 1TR1A 1UR0A 2EG7A 1ECEA 2ZX6A 3AUJA 1JDAA 1HL8A 2D24A 3W7PA 4K68A 1QW7A 4D6HA 2OQLA 2ABAA 1Y5WA 2X1RA 5HAOA 4US6A 3TE9A 3OA3A 5DXYA 2E77A 5A8MA 1NWUA 5CPOA 2C1HA 3ITCA 2D20A 2CXGA 4JTDA 3CS2A 5EYWA 4ATWA 4S1FA 4PTWA 2V5KA 3OODA 4CD8A 4AAJA 3QV9A 1D2KA 1A5KC 3NXLA 4I7VA 4RW5A 2E7FA 2HZGA 5IOBA 3NOYA 1C93A 5FKYA 4DBEA 1XDJA 2ZZ7A 3RJYA 4HOWA 3IGUA 4LNCA 4PB3A 1XHGA 3N2OA 4NT0A 3ARWA 4PRTA 2Y7GA 2XSXA 4IL0A 5DBTA 4FF5A 4H9MA 1YBQB 4LYRA 2X2GA 1WV2A 2GQ8A 3TQ0A 1EHAA 2OLSA 3LGGA 2DORA 1N7KA 3A24A 5E0CA 3M0MA 1SO5A 2HVOA 2PRMA 4Q4SA 4UOZA 1ICQA 2J7CA 3DN5A 3PPGA 1MW3A 3V7PA 3A9IA 5A94A 2RHGA 5AOUA 3WEMA 1IHIA 2WVVB 4GBDA 1W1TA 5ENLA 1E0VA 4KRZA 2Z7KA 2Q8LA 4ZO6A 4MNJA 3WLTA 1A4MA 2CWXA 2I7GA 4FNQA 4Q8QA 4H1ZA 2CLFA 1WKFA 2EEXA 4JTTA 1KV8A 5IFPA 1AW2A 4AXNA 4D1JA 4QEEA 4QM1A 1XYCA 3NQEA 3H22A 1M01A 3L9CA 1SW3A 4Z17A 1V77A 3H7RA 5IBXC 1MZHA 4DZIA 2VWTA 4JFUA 1GOWA 3NQAA 1OFAA 5FF2A 3CV1A 3CB3A 4BF5A 1L2UA 3AWOA 1PE1A 2PWFA 1BYAA 1XKJA 2PTZA 5C9ZA 3UG8A 1WOAA 2Y85A 3H4WA 2P5NA 2E8ZA 1XQKA 4IICA 3V75A 1E40A 2QXWA 1ITQA 3W88A 4O53A 2Z0IA 3RLHA 2YIHA 3VC6A 4C6PA 1KLYA 1SM9A 3N2TA 4GH3A 4E4FA 4PBGA 5A1AA 2ALDA 4ZQRA 2I5GA 1NJJA 5LSMA 1TMHA 1GTEA 3MA8A 2BS9A 3IGHX 1TREA 2PDIA 1Z8AA 1W9VA 2E6AA 3WQCA 3SRDA 3ITLA 1X8FA 5EA9A 2I5QA 3ZOAA 1QK0A 4K6AA 1LRQA 3FKRA 1V3LA 4GWEA 1TVPA 4D72A 1AQMA 5CLWA 1TUFA 3CYVA 4LV9A 1PKYA 5A6MA 4B9YA 4US5D 2PDXA 1XCFA 3WK3A 3N73A 1ZBWA 2WMIA 4XUYA 4S23A 1G7UA 3LGEA 5CAKA 4A3QA 3I7SA 5HANA 1DXEA 4J7RA 4ZBCA 4Y9MA 1D9EA 5PTDA 4IX0A 3LQGA 1V3KA 2BXVA 4O28A 4AHPA 3NGJA 3ZQ9A 2QUMA 3AMKA 3AXIA 4EXBA 1S3TC 2OT1A 1BAGA 3DBNA 4J3VA 3N9SA 1YXYA 4C6NA 3G18A 4UTMA 1CEOA 2ZXQA 4NF7A 2WJFA 4U10A 5I3JA 2NUXA 4LUSA 5E6ZA 2ON3A 5CPNA 1XG3A 4MMWA 3WN6A 1DORA 3NWRA 1QO2A 4EKJA 1F2JA 1TA3B 1V0NA 2I1OA 2UY5A 1WB0A 1RAKA 2DY3A 2HE5A 4GYPA 3CLMA 1E72M 2VZOA 3KX6A 4X60A 1V79A 3C2EA 4M1RA 3S6TA 3XISA 4AY7A 5DFAA 2A6NA 1U5JA 2J8GA 6XIAA 2VMFA 2J8FA 2VQUA 3A3XA 1NOUA 2FMOA 4ZO9A 3S1GA 1QNRA 2A85A 5DMLA 2ISSA 3KOZA 1RQHA 3TTQA 1UWAA 2WVSA 1R3QA 5GVJA 5DT5A 4C6DA 5T26A 1UJPA 4U2ZA 4GCXA 4V2XA 3NQ6A 1XRFA 2QGHA 1TV4A 3EMCA 1MDRA 4UMCA 4NVTA 4FI4A 4WIWA 3W07A 3TTEA 1V3HA 4W7UA 4E38A 3UJ2A 2V67A 2FDMA 4NSBA 2YKKA 4WJ8A 2EKGA 3DEQA 4HU8A 4S3FA 3DFNA 2R14A 4L1WA 2DSVA 1BG4A 1WP6A 1GNXA 4EPEC 3GG1A 1O60A 3IJIA 4OUEA 1A3HA 1OFDA 2E9LA 2VFEA 3FAWA 2FMNA 3UWWA 3L4YA 1FBAA 1LF1A 4XZWA 4AIBA 5I5RA 3LBMA 5A5WA 3MHUA 1MMFA 4PUJA 1KWGA 2OYKA 3EOOA 1U1HA 4C6FA 1PTAA 3TNBA 3OJGA 2JKEA 1CPUA 3QPYA 4XZHA 1R3RA 5LKYA 4UC5A 3GIQA 2A1YA 3AZRA 5DX7A 3GS6A 4QIUA 3KBWA 2DSZA 1NELA 2WMKA 2A5HA 4B5UA 3LSCA 3VU2A 3QY8A 3L21A 4DXVA 4AFYA 1QCWA 3L23A 2BZNA 3VTRA 1Q6FA 5EMMA 4GYKA 4IJCA 4KQNA 1VD6A 2HBVA 3AS3A 4JDBA 2GQ9A 3C2VA 2QV4A 4UTIA 1MW2A 4X9YA 4E8GA 1RLCL 2H8XA 3PHAA 3WD0A 2E25A 3NNTA 3PB2A 4QITA 4ICCX 4KWSA 1XIGA 1R2TA 2WV8A 3BLFA 1WDQA 3IVTA 3QXBA 3W86A 1H1NA 1NFBA 1VR6A 1K7FA 2AL1A 1IYXA 3TV8A 3QM3A 3LCIA 4DO4A 2D3NA 1OK6A 2ZX7A 3ABSA 2HWGA 3S42A 3WD3A 2QCCA 3G1FA 5DCEA 3PN8A 2CLEA 4I9AA 5CG7A 1WZMA 3I4KA 4H9YA 4XD4A 4NAEB 3TH6A 3BV4A 1YDNA 4JTGA 5A8GA 2VD9A 3EKGA 5CGQA 2Y24A 4MDPA 3U2OA 2QIIA 1KCLA 2EJAA 3MUIA 2VO5A 3RRAA 1WDRA 2OGYA 1Q66A 4HD5A 3DFOA 3MU7A 4S3AA 4WJEA 2PBOA 3SCRA 4AY8A 1YMYA 4MFEA 4LTSA 4UTJA 3O07A 4NJKA 3N29A 3KE0A 4AIEA 2PE4A 4HP5A 4QE1A 2BASA 4LGXA 5AHMA 4NRSA 1V0KA 3VX1A 2P0OA 3K4AA 2DZSA 4L5ZA 3QSRA 4ZR8A 2PLJA 1G67A 1MWOA 1ZP3A 4RCXA 4HOZA 3BGGA 3GNPA 3S2JA 3VOCA 4Q4MA 3RFAA 1DVJA 3CHVA 4OV9A 4F0HA 3T09A 1P48A 1U5VA 4CNPA 1P1MA 2FGLA 1ZGDA 4Q4QA 2WNNA 4GBUA 2J9YA 1W3TA 1K7EA 2NV2A 3B9OA 3SY5A 1EZ2A 3VZYA 3WMBA 3CZKA 3VX0A 1K6WA 4RPQA 3MI6A 5FJPA 4AB4A 4X0VA 3UGRA 2HJPA 1PCKA 5IM51 4QLJA 3M0JA 1J5SA 3M0ZA 4JQ2A 7A3HA 4HT3A 3VIPA 4CQBA 1EXBA 4DLMA