3I6RA

Plasmodium falciparum dihydroorotate dehydrogenase bound with triazolopyrimidine-based inhibitor dsm74
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
376
structure length
376
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
publication title Structural plasticity of malaria dihydroorotate dehydrogenase allows selective binding of diverse chemical scaffolds.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
total genus 149
structure length 376
sequence length 376
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i6rA00
1DVJA 4PL2A 3MHUA 1EP1A 5CG7A 4M6VA 1OX4A 1Z41A 2X30A 4FNPA 2WJZA 4UXDA 3LCGA 1KV5A 1KTCA 4HSNA 5G2WA 1HO1A 1EEPA 3W7QA 4JTTA 2A7RA 5C6MA 4CQ8A 4O10A 3CTLA 4OWGA 3CT7A 1DJNA 2D73A 2RDWA 3BARA 3NM3A 3TSDA 1JCJA 1UCWA 3EX4A 1EPXA 4UTKA 4N02A 1TREA 1ZENA 3RFAA 4OBTA 2J9XA 5LNUA 2A0NA 1LZOA 3GX9A 2ZTKA 4MOZA 3N2MA 3NL5A 4R7JA 3PM6A 1C8VA 2NLIA 1TRDA 4LUJA 2FLIA 2VEIA 2KZHA 4N6EA 1L2UA 3QZEA 3L0KA 4UFLA 2ZZ2A 3QC3A 1VYRA 1TPDA 1FUYA 3MI3A 3V1PA 4C1LA 4JTLA 2GUUA 1J2WA 1KFBA 4JDYA 3RF9A 2G97A 3EWBX 4NNAA 4XUGA 3VI2A 1QPOA 5AHEA 5E1QA 1GWJA 3H53A 5D2XA 4NJGA 5D37A 1DL3A 3PULA 2Y63A 2QCFA 1EWEA 2H6RA 4AWSA 4XZ9A 1X1ZA 1ZAHA 3TC7A 1D9EA 4TX9A 1SZEA 2DORA 4X9SA 3LTPA 3IIPA 3S5YA 5HR6A 1OF8A 4NZJA 3A23A 3TA6A 4UTWC 3OG3A 1GVQA 1H7RA 3OVRA 4FX7A 3BW4A 3P5ZA 2VEMA 2E6FA 3O6CA 3TSMA 3FYOA 3NAVA 2ALDA 1GG1A 2P1FA 1U83A 1Z44A 1R46A 3EWUA 1XBYA 3ABRA 3MMTA 3IVTA 1B4EA 1OFPA 3L9CA 1A53A 4O4VA 2QJIA 4X22A 3PSWA 3M5XA 1WQ5A 2HTMA 2RHGA 4LUIA 4XKYB 1SZFA 3GNDA 1IGSA 3BGGA 5DCEA 4YCOA 3LX9A 4NQ1A 5EKYA 2FB3A 4ADUA 5C5YA 1H61A 3TV8A 4O1DA 2NXHA 1AW5A 3FOKA 5EBUA 2DZWA 4LVAA 1KBIA 5AFDA 4N9BA 3W7LA 4R53A 2V2DA 4RZ6A 4WOQA 1OFDA 4L4LA 3NDOA 4QITA 3B06A 5IBXA 4KFOA 1LP6A 2FTPA 1JCNA 3M6YA 1X8FA 1P0KA 2DZVA 2V5LA 3PG9A 4X2RA 1I4NA 1P1XA 2GJNA 4AWTA 1ZHAA 4ORMA 1YLVA 3E12A 3LM7A 2TSYA 4Y90A 3KHJA 6ALDA 3W1MA 1I2OA 1M7OA 3EWWA 3M5ZA 3DGRA 4JYDA 2NX9A 3R2GA 5EY5A 1G69A 1LROA 4FHAA 4EOUA 3CB8A 2PRLA 3S42A 1YXCA 1XFBA 3W1AA 3CLMA 5AHIA 1HUVA 4UCGA 4YLWA 1OX5A 3W70A 1Q3NA 3M41A 2G5WA 3T40A 3W7JA 1X1OA 3O8AA 1FXPA 2JBMA 3LXBA 3FEMA 3W88A 1UUMA 2Y89A 1PCKA 4UTMA 1WV2A 4GFSA 1PVNA 3B04A 1JJKA 5AYZA 5D03A 3C2RA 4UC5A 5CKSA 3W74A 3KVLA 3NR0A 4JTSA 2Y6ZA 4XBKA 4FX6M 1TPH1 4WJEA 3SGZA 4IX0A 4OE7A 4QNEA 3G1FA 3BLFA 1OJXA 1TPUA 2WNNA 1G7VA 1SO6A 1JRBA 2JK2A 4RLIA 3BLEA 3QEZA 1AL8A 1EX5A 2GPTA 2PURA 2C13A 1KLYA 2ZZ7A 1RZMA 1M5WA 1LOQA 5K9XA 1H1YA 2CZDA 3VKJA 3KOFA 2OT1A 1OF6A 1ZNNA 4RX0A 3SIZA 4XQ6A 5BW6A 4NT0A 1VR6A 5C2XA 3HPSA 4GUJA 5HWNA 3AJXA 3P84A 1G67A 3W86A 4UFJA 2H8XA 4P2VA 3B03A 1GVRA 2ZBTA 3LB0A 1UJPA 2R8WA 1C9DA 4OV9A 2DJXA 4JTFA 2A1YA 3EX2A 4JYFA 4MYAA 4EF8A 3VE9A 3K30A 4M19A 4UR7A 5AC8A 2QF7A 4O0KA 3W1TA 1RD5A 3L21A 2DZPA 4XTIA 2UV8G 1VGAA 3IGSA 2X2GA 4NXSA 1WXJA 5KZDA 2ZZ5A 3PC0A 2J9ZA 3A22A 4O14A 1ZJIA 3P74A 2Q3OA 1W5QA 2E6DA 2ZRXA 2V81A 4GBUA 4O16A 4FIQA 3P82A 4CNPA 2A5HA 3PF3A 2QCNA 4DO6A 4KKXA 1W5PA 4K38A 3CWOX 4UUIA 4ORIA 2ZZ6A 3L68A 3GB6A 5LNSA 5KITA 1ADOA 2YDAA 3BVJA 4YCPA 3ELFA 3TROA 4AH7A 1GTHA 3HGRA 2TPSA 4AMAA 1R2SA 3LI1A 4BFAA 4JEQA 1TPC1 3PBVA 1G4SA 4N9CA 5DY2A 1QR7A 3VFLA 4FNQA 2YZRA 3LHVA 5AHLA 4I7UA 5D04C 2VEKA 1PCWA 3IV3A 4OHQA 3SJ3A 2E09A 5EA9A 2RKXA 4DEFA 5DBUA 3NOEA 1W37A 1XKYA 5FEPA 3CWNA 4POCA 3GXPA 1ML1A 5HNRA 2EKCA 4O57A 3I7QA 3DFTA 4Q33A 3HGJA 1GTEA 1Q45A 1LRTA 3P80A 3NQ2A 2H3BA 3GR7A 4C1KA 6TIMA 3AO0A 1WOAA 4UFMA 4P61A 4RXGA 1X7FA 1SW3A 3SZ8A 3NL2A 4JN6A 1V7YA 2RFGA 1VYPX 5I3IA 3S8HA 1BWLA 2FPYA 3DI1A 1N8FA 1KFCA 3PAJA 3W7OA 3GDKA 5L6UA 1NSJA 1B3OA 1VRDA 4UNKA 2FPVA 3R13A 1YDVA 4RJEA 4IPIA 3UWQA 3W72A 1TV7A 1XL9A 3HMJG 2QEZA 5U7SA 3A24A 3TAOA 4UTTC 4FO4A 2ZRZA 3HB9A 4CLMA 5J5RA 5I3KA 1VC4A 4FF7A 3FJ6A 1VCGA 4MZ1A 4EF9A 3LHZA 3CQ0A 5HUPA 3UXDA 3DKJA 1IF2A 2QCCA 4LVBA 3C2OA 1OFAA 4O28A 3W2NA 5KINA 4UTJA 1PHWA 3R5EA 2VFDA 3EX1A 4JDBA 1QPQA 1OYCA 3M16A 3G1HA 4LC8A 4HKPA 3W6YA 1TJRA 4O1BA 4UMBA 4DO4A 2QDHA 2C18A 1F74A 4LT9A 4O15A 3KX6A 3W83A 1FDJA 4KWVA 2Y7EA 2JGYA 2BWGA 1FBAA 2QCLA 1NF0A 1XM3A 2QCDA 4IPJA 1F76A 3E02A 3TH6A 4JTEA 3WK3A 1NEYA 1RQBA 4GNJA 4MUZA 1LBMA 2CLHA 1OG0A 3G1SA 3EKZA 3EXRA 1B9BA 3PB0A 3TXVA 2J27A 4H6KA 1LM1A 1T99A 3LRLA 3CU2A 1V5XA 4Q4KA 2ZA1A 1OYBA 4RKAA 5IM51 1WYIA 4HPJA 1T96A 4LU0A 2GQ8A 1LOLA 2OT0A 2XN1A 3TCEA 1DKWA 4LVFA 1FWNA 3CM4A 3G1YA 1OK4A 3GLCA 2C6QA 3PWAA 3C8FA 2PRHA 3L0NA 3LTYA 5F2LA 5EL1A 3E0IA 2ZA2A 4MY8A 4Z08A 1N7KA 1QO2A 5A8GA 1XC4A 5FI8A 3JR2A 2C14A 1H1ZA 3MHFA 1D3HA 1UUOA 3C52A 2JGQA 3M44A 3LHYA 4M7TA 3E9AA 4QAIA 2CZ5A 2GVGA 3TC6A 1TPWA 4JTGA 1X6UA 3A9IA 4MZ8A 3TK7A 1EWDA 5CZSA 2A21A 4QISA 1DJQA 4GWEA 1TPB1 1YTKA 1QOQA 2ABAA 1NVMA 1SFJA 1PV8A 1OX4B 3BW3A 4I7VA 2W6RA 3B4UA 1K7XA 4DPQA 3O6DA 3LLDA 1F7BA 1GYNA 1VQTA 2A2IA 1CI1A 4ZQNA 2GQAA 1K7EA 3M5VA 5DBTA 3A5VA 3W2UA 1QO5A 5D2WA 4I9AA 4JTIA 1Q6OA 1QDSA 2E68A 4O19A 4ZQPA 3TJLA 3E49A 3NQMA 3Q94A 4RR4A 3DFPA 3OEXA 2B7NA 3N14A 5AC7A 1Y0EA 2Y7GA 2BX7A 3NQVA 4JS3A 3L65A 1KM1A 4JYEA 5U4NA 1I2QA 5AC6A 5F2MA 2NXGA 4JD4A 1BEUA 3WK0A 1SO5A 3C3NA 5IBXC 3HG3A 3KRUA 3GKFA 4R34A 1BKSA 2NXIA 2A6NA 4EVZA 1A5CA 3DZ1A 1H60A 1R2RA 1JCLA 3WJXA 2E77A 4E2DA 3KAOA 5E93A 2B7OA 2H90A 4JIPA 1RQHA 3W1UA 3W23A 1TV5A 5HWMA 5D09A 4ALDA 5BRBA 1KFLA 5TBOA 1SO4A 1YDNA 1R47A 1DQWA 3GDRA 2V2CA 4FNSA 2I9EA 4NJKA 1P0NA 1AW1A 1NAL1 5CPOA 2F7FA 1GZGA 2YGYA 2C0AA 1TJPA 1TPEA 3O07A 3B05A 4O0ZA 1L6SA 4ZZ9A 3STFA 3SR7A 3S1VA 3WJSA 1FWTA 1YPIA 1W56A 2PRMA 2ZDRA 3CPRA 3F1QA 3W7NA 4AEOA 4LS1A 1TPFA 2IQTA 1RPXA 5DLCA 2QUVA 3STEA 4CCEA 4PH6A 3W7EA 2O7QA 3NPWA 1M6JA 2WNZA 3C2EA 1ZCOA 1FCBA 2ZZ4A 3INPA 1KFJA 1VCFA 2DZXA 1OFRA 3LGEA 4JX5A 1HL2A 1H50A 3N73A 1EA0A 1GVFA 3JS3A 1YXDA 2ZZ3A 1KM4A 1ALDA 1TTPA 3GIYA 3HPXA 3W1XA 2HMCA 2ZRYA 1LYXA 3B0UX 4BWLA 1FDZA 3IIZA 3Q58A 4LV9A 2DU2A 4OU1A 2X1RA 3R89A 1THFD 1W3TA 3HGOA 4O8RA 3G8EA 4LRSA 4FEZA 4DQWA 5CZ0A 2R91A 2VC6A 1KTBA 2A7PA 1AG1O 2AQWA 4QNWA 1KTNA 2ZYFA 3O1NA 5CPLA 1PE1A 5ABTA 4LS0A 1W0MA 3BG9A 3TFXA 3DHFA 4Q32A 5FF2A 4JTUA 1SW0A 1F6PA 3QJAA 1KLZA 1YXYA 2X1SA 1W3NA 3ATZA 4NX0A 3GDTA 3UWWA 1DBTA 4S1FA 3EKLA 5CGQA 4Z0SA 3G1AA 1QFEA 1Z42A 3DFNA 1KA9F 3BPWA 2Z2UA 4LTSA 5F1UA 3NL6A 2X1TA 1Q6RA 1SZNA 3O63A 1XDMA 1P4CA 3P62A 4ZL1A 1LLZA 1VZWA 2X1UA 1KW1A 4Y96A 3M0ZA 1LDCA 2QCGA 2P0OA 3HQ1A 4D2JA 2CZEA 1YYAA 1EUNA 3FKKA 4YL2A 2NUXA 1I8JA 1TB3A 2A7NA 4UTUA 3DXIA 1O5KA 4W9TA 4XWUA 3LHUA 3PUOA 4HSOA 4A22A 3FKRA 4IXHA 3NO5A 3DFSA 3A21A 3W71A 3F4WA 1O95A 2GOUA 3MI2A 1K8YA 5AB3A 3MYOA 2Q3RA 3HGSA 1HG3A 3W76A 1DORA 3NXFA 1A5AA 5G2IA 3W2JA 5TIMA 1G4PA 4BI5A 3W75A 8TIMA 4A3UA 4MLRA 2PE4A 3C6CA 4NNCA 3NQAA 4O1CA 3CC1A 3BGJA 1H7XA 3IIVA 3M1ZA 5CPNA 4JX6A 3NM1A 4LS2A 2CLFA 1OFEA 2NX1A 5HMSA 2DZUA 1SUXA 4G1KA 2VELA 3S1UA 5D2TA 2VEPA 5I3JA 3G1VA 3RLVA 2HS6A 4BI7A 3M43A 2CLLA 1TTJA 3GXTA 3W1QA 4GUFA 4AVFA 1VHNA 1IXPA 4MFEA 1JUEA 3I6RA 3TJXA 4DO5A 4M7SA 4QM1A 1JQXA 4DBEA 1FWSA 2RDTA 4N2YA 1QPNA 3I68A 4S2BA 1OFQA 1SO3A 4M6QA 4Y9AA 3R8RA 4CCDA 1TYGA 3I7SA 3LV6A 1KM0A 4A29A 3S6DA 5AYXA 5LZLA 3W2MA 3NZRA 1IXNA 3DHDA 3QQ0A 1E51A 2VFHA 4I7WA 5AN7A 5BMWA 3W22A 1S3HA 4N4PA 3U6WA 2DZSA 3N19B 2YCEA 1KM6A 4NJIA 3MHGA 4MVAA 2CZFA 3DI0A 3SI9A 3FLUA 1LRQA 4IMGA 3ZFHA 3LCHA 2E5CA 3U8GA 3GR8A 3W3OA 3N3MA 1SR9A 3U2OA 1QMLA 5DCBA 3W7IA 1F73A 4PODA 4AHOA 1W1ZA 4DXVA 2WNQA 3CHVA 1JCMP 3L5AA 1IXOA 1H63A 1OFOA 1VYSX 5CZJA 3PBYA 1I2PA 2Y70A 3G0XA 3GAKA 1YADA 3KFTA 3KRZA 3ABQA 3N34A 4CQ9A 3TXZA 3NPVA 1O60A 7TIMA 3VNDA 5C54A 4O54A 1MEWA 3EWZA 5H91A 3UXAA 4A2RA 3W7RA 1FDYA 1OFBA 3HO8A 4BK9A 1OYAA 5G1YA 2X16A 4U4MA 3BK0A 5G4EA 1QPRA 3Q37A 3UYCA 2Y85A 1FXQA 2DJLA 3R12A 4O53A 5DCDA 3PY2A 3UZJA 3DBPA 1TRIA 3LHTA 3LRMA 4PEKA 2I14A 2WSYA 1N55A 4UFKA 1SSGA 1VCVA 2G95A 2QCHA 1F6KA 2Q8LA 4RCXA 5LSMA 1H7OA 1H62A 1I2RA 1O4UA 3LDVA 3OA3A 1GEQA 5D2YA 1J4EA 4XTDA 1B4KA 2Y7FA 3P5YA 3KRSA 3W73A 1DV7A 5AHNA 3TSBA 4PA8A 3W7DA 1SU5A 2ZRVA 3NQEA 4FNUA 3NQ7A 3P8JA 5T26A 5EYWA 2V5BA 5KZMA 1S5TA 3QW4B 2C16A 1EP3A 2VFIA 1G4EA 3PS7A 1WX0A 2G96A 3TKFA 4WY0A 1RV8A 2ZRUA 4TO8A 2V0TA 4AHQA 2VFFA 2E5BA 3F03K 1PS9A 5LHFA 5KTLA 2V2HA 4M6PA 4QIUA 5AYYA 1TO3A 1JVNA 1TCDA 1LBLA 3L66A 2QCDB 4IMCA 1ONRA 4N9DA 3HPZA 2H3DA 1J5TA 4Y6GA 3B0PA 1KFKA 1MEIA 5F2IA 3UWVA 3G18A 5HULA 3O16A 5FEZA 3NQ8A 2Y61A 2JKAA 3TQVA 3M5YA 3EX3A 3G1XA 5J5DA 3QFEA 3UQNA 5DY3A 2QCEA 5HWJA 4PCFA 4ZQMA 1GQNA 3BG5A 3QMTA 2LLEA 3NZ1A 1ICPA 4ZMGA 3FIGA 3T78A 2WSQA 4O52A 4HN4A 2O7SA 3FS2A 3A5FA 1LTDA 4TIMA 5F4WA 1M7PA 3LCWA 4YWIA 4Z1CA 1S5WA 2YR1A 2QAFA 3SY5A 3PVFA 3UPWA 5SWUA 3SW6A 3W7HA 2NV2A 3JRKA 1ZY9A 3PUDA 1C29A 4JX4A 3P81A 1H5YA 4IJBA 2I1OA 5BNKA 3DU0A 2FB2A 4GC4A 3HOJA 1KM2A 1W5NA 3M7WA 1LOSA 3TIMA 1ICSA 1FQ0A 2XFWA 4MZYA 5AHFA 5F2GA 5F1VA 2B7PA 3S5NA 1W3IA 2QJGA 3G1DA 3QMSA 1R2TA 3NQ6A 4MFDA 1P5BA 2J88A 4HNTA 4KWWA 4GUHA 1LCOA 4JTJA 5LNRA 3UWUA 3IIXA 1OABA 4Z1DA 4O50A 3PUEA 1TQXA 1JUKA 3DFQA 4FXRA 1U5JA 3B8DA 4JICA 4UTIA 4ADSA 3MUXA 1TV8A 4K37A 3IVUA 1EUAA 2BXVA 3DAQA 1PHQA 1PL9A 2ZCGA 4WOZA 4OV4A 3O15A 1RQEA 2CLKA 2WO5A 4LV4A 4FNRA 4RK8A 1W54A 1G6CA 3TUUA 2ATMA 4JNMA 3DH7A 1AL7A 3W2LA 1TMHA 3M9YA 1HFBA 5K3VA 1K03A 4AHPA 1OK6A 4GE8A 4O4WA 5DXXA 4BWLC 3L5MA 5A5WA 2YX0A 2JKPA 2CWNA 2XN2A 4TMBA 4MKNA 5D02A 1G4TA 2YYUA 3EXTA 3TDFA 5EMUA 1EB3A 3W7GA 1I45A 3W9ZA 1K02A 5LGZA 3H54A 3MP4A 2PC4A 1KM5A 2W79A 1UB3A 1LRNA 3UWYA 5BMXA 3TE9A 3PG8A 3TU9A 3G3MA 1GJPA 4N9EA 1RVGA 5D38A 1WAUA 4Z1AA 4PTNA 1NF7A 1XXXA 2ISWA 3G3DA 4GXMA 1GOXA 3MBFA 3EXSA 5LKYA 2OZ0A 2FDSA 3ABSA 2C1HA 3TX9A 3LCFA 4PFMA 3OBKA 5HINA 4Z0JA 1FCVA 3FJLA 4IOTA 5DELA 4AF0A 4MJMA 1KV8A 2YW3A 2ZTJA 2FJKA 3P60A 5K4XA 3EX6A 2VFEA 3OVPA 3WJYA 1Z48A 3L0GA 4UMCA 5FF3A 3SFKA 4N4QA 3NA8A 3L67A 1VH7A 3YPIA 1H7WA 4GUGA 3RU6A 1PIIA 3O06A 4ZQOA 2TMDA 1OHLA 3GAYA 1UASA 4O12A 1WOBA 1ME7A 3MI6A 1ZFJA 4BF9A 3KVKA 3QSTA 3UY8A 4H3DA 3TW6A 3KVJA 4FXSA 4LVDA 3C4UA 2WQPA 1OX6A 4K7VA 1BWKA 1B57A 1JR1A 3TMQA 1VLIA 5FF0A 1F5ZA 1VJIA 4HT3A 5K4ZA 3T44A 1IIGA 3I7RA 4OGZA 4RXFA 2QAPA 5C55A 4WXZA 1T8XA 2QJHA 3TW7A 4S2CA 4A21A 4HNUA 2Y7DA 1XCFA 2B0MA 2YXGA 4CCCA 3GK0A 4HNNA 3GXNA 2V8ZA 1ZALA 4TU1A 3WK2A 5K9CA 1Q6LA 2EPHA 3G0UA 4XBSA 3IRDA 3IVSA 3RMJA 5TQLA 4WXYA 3ZWTA 5LHEA 4YXGA 1FY6A 2BSLA 4WX2A 4HIBA 3CEUA 1JCYA 1KFEA 3QPZA 1F05A 4ICNA 2ATSA 3GZ3A 2NV1A 3IEBA 2RDUA 2WV8A 4IX2A 1LLWA 2ZA3A 4MY9A 1MEHA 4IMFA 4MLJA 4UIOA 3NQFA 4NU7A 3LRKA 2CW6A 4MYXA 5DN1A 2Z0IA 3MP3A 3QSRA 1FX6A 1L6WA 3NL3A 4UFIA 4QSHA 1K8ZA 1WBHA 2YFNA 3LBCA 5LNVA 1HTIA 2VENA 5KSWA 3EWYA 4WQ6A 1QOPA 3LOTA 3E96A 1MSSA 4LOCA 4ADTA 1YTEA 2TRSA 4N6FA 3LV5A 1H51A 3QMRA 3TQKA 3STCA 5D2VA 5F4SA 3LBMA 3P61A 5DXYA 4LNYA 5F4XA 3UWZA 2HS8A 4MY1A 2BLEA 4K8EA 3UPBA 4FB7A 2F84A 4GJ1A 1FCUA 1T0OA 2EAWA 3IGXA 1YTDA 2A4AA 3FA5A 1GPWA 2FPTA 1MO0A 1MXSA 2OJPA 3GDMA 2PCQA 4XKYA 3SECA 1MZHA 3NVTA 2Z1BA 3HG5A 4AXKA 3TR2A 3LERA 1EIXA 4E2BA 1W31A 2FIQA 3NQCA 1ICQA 1XUUA 1QWGA 4ONVA 3S1XA 2A6LA 2YW4A 4LWWA 4IUOA 2CU0A 4WY0F 3G0SA 4MIMA 2OMAA 4NXKA 2ZFAA 1ME9A 3PBUA 5FF4A 3LXAA 4LRTA 3W85A 3P8IA 4ZQCA 5D05A 3PB2A 3BLIA 3W7MA 2ABBA 3F4NA 1SZGA 4BR1A 3FFSA 3OVQA 1G7UA 1IXQA 2NUWA 4OQVA 3UY7A 5KZEA 1K8XA 3MWAA 3MYPA 3OIXA 4JXCA 4NJHA 3P7YA 2DP3A 3EWXA 4NX5A 4X3ZA 1FWWA 2C15A 5D32A 4R33A 5I3HA 3RNDA 1ZAIA 1QNVA 4UR8A 2QUUA 3W84A 4RZ4A 3RK8A 5FEWA 3H55A 2ISSA 3I65A 3N9SA 2R14A 2Z6IA 1XBZA 4UTWA 4CNOA 4CNNA 1D3GA 4JY9A 3TQ0A 3TFCA 3W1NA 2WPBA 5K2ZA 3QM3A 3N2XA 1TSIA 2WSRA 2W0UA 4KFNA 4UTLA 1H7NA 1TPVA 5HUOA 3W7PA 4AWUA 2C3ZA 2TYSA 3MBDA 2ISVA 1Q6QA 1SQ7A 3HG2A 5I3FA 3LI0A 2YYTA 1DOSA 4FIRA 4OT7A 3STGA 1XI3A 3WK1A 3LCIA 3BG3A 3HIJA 1TQJA 3GDLA 1LBFA 2C19A 1XUZA 3OHIA 4A2SA 2CLIA 3T7VA 4WZHA 3WJZA 3D0CA 2Z6JA 1WBJA 4IMEA 5LGXA 2VFGA 3LCLA 4MJZA 2VXNA 5FESA 4O13A 3ZS4A 4K8HA 5H2ZA 3O05A 5D30A 3CEPA 4L4MA 4LVGA 1W8SA 2Q8ZA 3TMLA 3G24A 4JTHA 4B5NA 3ZWSA 3EEGA 3LXCA 3NPUA 4DF0A 1A5SA 3L5LA 1YDOA 3ANYA 3HBLA 2GQ9A 5L9FA 2GJLA 2Y62A 4EWND 5K7JA 1NFBA 3M47A 3NQGA 1ZAJA 4HHPA 3W1RA 3IGUA 4O17A 4E0CA 4TR9A 3ATYA 1FWRA 3GYEA 3TAKA 5LNWA 2Y88A 3LLFA 4QJ1A 2NWRA 2YSWA 1K3UA 2VKZG 4PL1A 4AAJA 3V75A 5G1TA 2E6AA 1WDWA 2QDGA 4WY0B 4YMZA 2WKJA 2HSAA 4Z1BA 2E5DA 3S9YA 1S5VA 3HF3A 2FQIA 3VE7A 4IXXA 3NQDA 2YPIA 1VHCA 3VCRA 2OCZA 4FNTA 2EHHA 5G5IA 3USBA 1A5BA 1FCQA 4ZVJA 2GVLA 2AAMA 1K7FA 1JCXA 4IQLA 3BW2A 4IMDA 1KM3A 2CLOA 2H8ZA 2FFCA 4JGDA 3PSVA 3B0VC 3BV4A 3S1WA 4WUIA 3W7KA 4RZ5A 5CZTA 3HG4A 5AHMA 3UD6A 4HNVA 3SGUA 1TIMA 5I3GA 1HO4A 3L2IA 2ZRWA 3T55A 4LC6A 4LW7A 4QQ3A 4UNLA 1F2JA 1L9WA 5FEXA 3W7CA 5HR7A 1XDLA 3PBWA 2QUTA 2ZZ1A 5HQEA 3C2FA 1O94A 3NGJA 4E38A 1TTQA 1AW2A 4GRSA 4O18A 4UFHA 1KBJA 3W1PA 3CIXA 4LY8A 3THQA 1ME8A 3PR2A 1DHPA 1JULA 1R30A 1SSDA 3EB2A 1H7PA 2VOMA 3W07A 4O11A 5AOUA 2CLMA 1CX9A 2GVJA 5EPDA 3LCXA 1JUBA 2NUYA 3S0CA 1JRCA 2B4GA 4JR5A 3ZR4A 4JTKA 3W87A 5CSRA 5KMYA 2J6XA 3T4CA 2RH9A 4DELA 3G8RA 2QCMA 3IIOA 3C61A 4GUIA 5D33A 2YFOA 1TTIA 1XBVA 3O6YX 1GYLA 3WJWA 5CSSA 3C2VA 1I2NA 2EGZA 2NX3A 3DFOA 3ABOA 1VLWA 3MP5A 4K36A 1AMKA 5E0KA 2V9DA 1IIHA 3W2KA 3LTSA 3QQ1A 1A50A 2WOQA 3MO7A 3NNTA 5K9DA 3N9RA 2QKFA 4H4IA 2CLEA 5FF7A 1QAPA 1EP2A 2E1DA 3HJZA 3QPYA 4ZQRA 1JQVA 2E6YA 3CIWA 3LHWA 4NVTA 2B7QA 2R94A 4DPPA 4NJJA 5HJLA 3GKAA 4CQAA 3UNDA 3G22A 5MHBA 3W1LA 4IGHA 4K6AA 3KXQA 4EIVA 2EF9A 3S5OA 4U28A 1SFLA 4K7YA 3NG3A 3S5ZA 1XBXA 4HPXA 3THAA 1VPXA 4NUWA 2QR6A 3GVGA 4PC8A 1W5OA 4KFPA 5BOOA 4AB4A 2BTMA 4NZFA 4WD0A 4IWWA 3C56A 3MW7A 5GVJA 5CPMA 1AK5A 5G4WA 1WA3A 2V82A 3Q2DA 3QW3A 1O5XA 4DF2A 3DENA 1SPQA 1YPFA 3QRHA 2P10A 2JKEA 3MJYA 3QF0A 2CFFA 2V30A 4UTHA 4DF1A 4NNBA 3SSJA 3NPXA 1LORA 3GNNA 4DBDA 3NEVA 2NWSA 4K39A 2OX1A 2J9YA 3QYQA 3P67A 4UMAA 1UBSA 1GVOA 1CW2A 2ZQ0A 1GT8A 4J9JA 4RV8A 1GVSA 2A85A 3C0JA 3UZ5A 4M5PA 4BI6A 1GG0A 1L6YA 1SW7A 3DKLA 4AF0B 4JY8A 4Y8FA 2NZLA 2BZNA 4ML9A 1QCWA 1RR2A 3QH2A 2DZTA 2J24A 3NYZA 4TMCA 3KVMA 1W5MA 4UTTA 4FX8A 1OVDA 4JIQA 4MPQA 4O1AA 3FYPA 3RLUA 2AGKA 3BO9A 1VS1A 3WFAA 1DQXA 2XN0A 5G2HA 1BTMA 3TNOA
chains in the Genus database with same CATH superfamily
3SJNA 3ARSA 5CG7A 4GJIA 3WBYA 4FNPA 1W3LA 3B8WA 3OBAA 4D1IA 4TTGA 3LCGA 2X09A 5G2WA 1OCQA 2ONEA 4M8UA 3W7QA 1U2YA 4JTTA 2IMRA 3S2LA 5C6MA 4D6CA 4O10A 3CTLA 4OWGA 3CT7A 3BARA 3NM3A 5DO8A 3TSDA 4KW2A 1IT7A 3EX4A 1KGUA 5LNUA 3GX9A 4QTGA 4HCDA 3NL5A 3C3UA 1F3XA 4R7JA 1F4AA 1BXCA 4XZMX 4A8LA 1TRDA 2OYLA 1AZ2A 4JFSA 3WF4A 3V4BA 2QDEA 3QZEA 3KRBA 3LBOA 4UFLA 3QC3A 1T40A 1VD6A 2JFEX 3MI3A 2XUCA 2OODA 3RF9A 4U5IA 3B9DA 1GWJA 5D2XA 4XAZA 5D37A 2BV9A 3ITGA 3UWEA 1V3HA 4B5UA 3CO8A 4LYRA 4XZ9A 4GCXA 1SZEA 4UOQA 1TFVA 4X9SA 3S5YA 3A23A 3MANA 3TA6A 2OGJA 2Z00A 2E6FA 3GU2A 1XLAA 1TJ0A 4M51A 2P1FA 2P88A 1PO9A 4AD4A 3SY1A 2AKMA 3EWUA 1HJSA 4B9ZA 1B4EA 3V1HA 1OFPA 4DHGA 2GDQA 4KT2A 2QJIA 4X22A 4LUIA 4OUIA 3GNDA 1XC6A 3MB9A 1EO7A 1PYMA 1I60A 1E1CA 2PDJA 3WH9A 4N7QA 5JU6A 3BAJA 3NO1A 4ADUA 1EYWA 3CNYA 1LF1A 4S3AA 2SFPA 4R5EA 4X60A 1KBIA 5AFDA 4B5WA 5FACA 4WOQA 4L4LA 3NDOA 2DZVA 3TYAA 1CYGA 1QRQA 4X2RA 1N2VA 4XSMA 4DUWA 5C2GA 2WWCA 4ORMA 2TSYA 4OVXA 3KHJA 6ALDA 3W1MA 1PUDA 1M7OA 4XIAA 3BCDA 1US2A 4JYDA 2NX9A 3T42A 2Q6ZA 1LROA 4FHAA 5A6MA 4A8NA 1UD6A 2WM0A 3CB8A 4FPSA 1YXCA 4C6OA 4ROQA 1J11A 2G5WA 1VENA 4DJFC 4REQB 1HKJA 2ZADA 4TX6A 1UUMA 5DT7A 1XLLA 1CECA 4GIAA 1IE7C 3B04A 2EPOA 2BVDA 1Q6CA 3FVDA 1XS2A 3NR0A 5J04A 4XBKA 3VIKA 4BA0A 4IX0A 4QNEA 3G1FA 4FLQA 1JRBA 5DMYA 4G2DA 1EX5A 2GPTA 2PURA 1FTXA 1S38A 5LA0A 3BTNA 5K9XA 3SUTA 2PBGA 5A8NA 4QHRA 2WHJA 4U2ZA 2OT1A 1OF6A 4RX0A 3SIZA 3HPSA 3FVMA 1F3WA 1M03A 8XIAA 3AJXA 5A6LA 3P84A 4YNGA 1GVRA 1UJPA 4F2UA 1C9DA 4EF8A 4MYAA 3EDDA 3VUSA 1RD5A 3XIMA 3IGSA 3GXIA 2X2GA 1VRXA 2QS8A 4L4PA 4QE5A 4CVWA 1E9LA 5H6HA 4GH3A 1V6YA 5KZDA 2J9ZA 2QHAA 3HV8A 4NRRA 2E6DA 2ZRXA 4C7GA 2F9RA 3TR9A 3P82A 4NASA 4CNPA 3PF3A 3ITOA 1D7KA 3HN3A 2PFHA 2NQ9A 4ZSTA 5MKGB 1GUVA 1V6WA 1K70A 1F3TA 5XINA 5LNSA 4YCPA 3TROA 5I5RA 3EPNA 1BQGA 2TPSA 3M0MA 1M9HA 3KWXA 1R2SA 1NU5A 1TPC1 4N9CA 3V36A 3VFLA 4KIEA 2BFGA 3LHVA 2VEKA 2E09A 5B7YA 4HCHA 5EA9A 2RKXA 4EK7A 1ZQ5A 1XKYA 2O9RA 3A12A 1AQHA 4MSSA 3GXPA 2J62A 3GHUA 4V1YA 4I5RA 4HNOA 4MDOA 3I7QA 3DFTA 1XRVA 5GJNA 1R3WA 1GTEA 4ZODA 1HGWA 4XBJA 3PK7A 4LYQA 1SJAA 1R3YA 2OQLA 3RJYA 4C1KA 1WOAA 3L4UA 4PRWA 4GIRA 3SZ8A 3UEQA 3ZLHA 2HQAA 1R9XA 4JTDA 1E6ZA 3UCQA 3DESA 5REQB 1NSJA 3AIRA 4UNKA 3SCTA 3SCRA 4S3JA 4GQBA 4LB3A 1TV7A 3HMJG 1SYTA 4UTTC 3HB9A 2ZUMA 3R43A 4I3GA 1ZP3A 1DYSA 2WKGA 4HCLA 4ZXOA 1E73M 4EF9A 2DIKA 5HUPA 1KCKA 3TQPA 3EX1A 3AROA 4LC8A 4Q4PA 1PIGA 4HKPA 2PTDA 4G6CA 3OBEA 3KX6A 3W83A 3T6CA 2DSWA 2Y7EA 3CMJA 1E5JA 3L7RA 2QCLA 2XTKA 2VJXA 4ATWA 1IZCA 4IPJA 1F76A 4FR1A 1NEYA 4MUZA 1IEIA 3VNIA 2CLHA 1OG0A 5FOOA 1MUMA 1GKPA 4D8AA 1J2BA 2BODX 5D9OA 5IM51 1SFTA 5A8PA 1WYIA 4HPJA 4ERIA 1SJCA 4YTTA 2VWSA 1LOLA 2DFAA 2GGGA 2XN1A 2I7GA 3TCEA 1GQKA 4LVFA 1V8EA 3CV7A 2JALA 4IICA 2I5QA 4Y9NA 1B3YA 1XLBA 3PWAA 3P0XA 4IG2A 3N2OA 3LTYA 3UR7A 3CK5A 3WLTA 1AVAA 4ZE4A 5A8GA 5FI8A 3JR2A 4U3CA 4YU1A 2CBIA 4LYKA 5G1MA 1UUOA 3C52A 3UG8A 4QAIA 3NQBA 3GTNA 3WLMA 1BD0A 1X6UA 3R11A 3AZSA 3TK7A 5CZSA 5M3WA 2A21A 1XYZA 4QISA 1JXKA 2ABAA 1SFJA 1XIHA 3LLDA 1DIKA 3OGRA 1UG6A 1GYNA 4JCLA 1Q5MA 3SM0A 2GQAA 3A5VA 3W2UA 2W62A 4O0QA 1JPKA 3TJLA 3KCJA 4Q4RA 3CIVA 3WDQA 2B7NA 2HROA 2E3ZA 1Y0EA 2BX7A 1MDRA 4FF5A 4JYEA 3KTXA 2PTWA 5F2MA 3GS6A 4BF7A 4JD4A 1EYEA 1FKWA 3C3NA 3EA2A 4ZCWA 3HG3A 3N2TA 4PULA 4EP8C 4TUFA 3VNMA 1A5CA 3OU8A 3DZ1A 3QQWA 3WJXA 2E77A 3KAOA 5E93A 1E15A 1CPUA 3K8KA 1WB0A 4D9PA 1J79A 1RQHA 4DNHA 3AJ7A 4FALA 5IXEA 1QI2A 2DVUA 3C86A 3PFMA 3ITTA 3WNOA 1EQPA 5BRBA 1KFLA 2DZBA 4QFUA 4G1NA 1LG1A 9XIMA 3QV7A 4MGGA 3U57A 1AW1A 3L4WA 1IWPA 2F7FA 4KWSA 4LBUA 2YGYA 3GUGA 1TJPA 4YVVA 1K9TA 1TPEA 2JF6A 3G6LA 3KLKA 4Q7NA 1HJXA 3H4WA 2NLYA 3STFA 3UA4A 4C6JA 5KETA 4XO6A 1YPIA 2ACRA 2ZDRA 3CPRA 4FS9A 4PTDA 4LS1A 5DLCA 5CXPA 1J0ZA 1DIDA 1S2UA 3C2EA 2WNZA 1ZCOA 5AZ1A 4DLFA 3N6HA 2YL8A 2DZXA 4AY8A 1WKDA 4YN5A 1NFPA 3JS3A 4EAYA 1YXDA 4BKNA 4C6PA 4MADA 1KM4A 3JZEA 1P6CA 1SJBA 3GIYA 1UR0A 3BE7A 5DANA 3H4GA 2PWGA 3A3WA 3OHMB 3B0UX 2OZ8A 1PSCA 4C1NB 4BWLA 5GPRA 3IIZA 1MW3A 1K6WA 3QTPA 3FHAA 3HGOA 3BLLA 4O8RA 2XIJA 4LRSA 3F2DA 3BOXA 2A7PA 1KTNA 3POCA 2DSUA 3LEPA 4AWEA 2PWEA 4C6LA 1S1RA 3NSXA 2PDGA 4NSBA 1XLKA 5LXXA 3ATZA 4S1FA 2Y8KA 3SIMA 4Z0SA 2WMJA 3DFNA 5CC6A 1Q6RA 3UG3A 4BHYA 1SZNA 1XDMA 3KDNA 1P4CA 3O63A 3TN6A 4ZL1A 4DAFA 1VZWA 4C6IA 3XISA 1KW1A 3GNPA 3ORWA 4J3TA 3CGTA 2P0OA 2F6KA 1YYAA 3EOSA 3FKKA 4ERAA 2A7NA 4P7NA 4GA8A 2WHLA 2QXWA 2I16A 3RXZA 5E5CA 3AS0A 3F4WA 1O95A 4W88A 5AB3A 4DY1A 3W76A 2Q71A 2NT1A 3IACA 4KWOA 1KGWA 3NXFA 3VOCA 1BSIA 3LPFA 4R7OA 4RNFA 1F8IA 3JZUA 3H2CA 1XWYA 4L1XA 3BGJA 5A1AA 2QZRA 3B8UA 3M1ZA 5CPNA 4YVXA 2PWUA 2OQHA 2GK1A 4LS2A 3K8LA 1R3VA 2WVTA 3VDHA 3W38A 4FOJA 2CXGA 3WLKX 3VGEA 1C9WA 4W7WA 1V08A 5I3JA 1XIIA 4G8TA 2FZBA 4KH2A 3KBSA 3M43A 5EU9A 2YLLA 1Y8BA 1X8CA 3QTGA 7TAAA 2ZX5A 5DX7A 1Q7ZA 1OGSA 2XIMA 1JUEA 3BWWA 1UIOA 1XG3A 4DO5A 2VDGA 4W7UA 1JQXA 4DBEA 5IHSA 4S3FA 1QPNA 1OFQA 1SO3A 3WKZA 1MDLA 4KRUA 2YBVA 3R8RA 1ENUA 2FDMA 4DUOA 3WNNA 1KM0A 2IKIA 3NO3A 5AYXA 5A8OA 3DHDA 3QQ0A 2GJPA 3D6NA 2FYMA 1G5AA 4GXWA 1HNYA 1CLVA 3WH7A 3H23A 4N4PA 2DZSA 4IGMA 1IEXA 1AJZA 2Z1XA 1Y5VA 2A3EA 3UJ2A 2FH8A 1D7FA 3MHGA 3EGJA 4YJ5A 3SCVA 2CZFA 1WXZA 2IPWA 4EKJA 4GI8A 3ABZA 1KNWA 1PYFA 2INEA 1ZS2A 3E0LA 2A3AA 5DCBA 1CGXA 3W7IA 3W53A 4UOZA 2XVKA 1OIMA 1IXOA 1H63A 4G9PA 5CZJA 1I2PA 3NSNA 2Y70A 1E6SM 3ABQA 5BU9A 3STPA 3NPVA 5A2AA 1VKFA 7TIMA 1AMYA 3I6TA 4DBWA 3CAQA 1ECEA 4XVEA 2AQVA 4XSLA 3VKAA 4F0RA 2Y5EA 3RU8X 1AQ0A 3M0HA 4MB4A 4BK9A 3T2QA 5I77A 3BK0A 1JF5A 3W28A 1CDGA 4MUPA 3VYLA 3GXMA 3UZJA 1XLFA 3FK4A 2I14A 1DTNA 4CCZA 1N55A 2F2KA 2Q8LA 1DJHA 5LSMA 1H7OA 2XH7A 1GEQA 4XTDA 1TWSA 1W1PA 4AU0A 1BKHA 4RUBA 3DG7A 2X0HA 2RDXA 3GXFA 1EX1A 1P0EA 4PA8A 1SU5A 1CXLA 3M46A 3QVQA 4A3YA 1CTNA 4LY4A 2C16A 2YOCA 4WR3A 1EPVA 3K2GA 2XDFA 4AHQA 3N15A 2FFIA 3F03K 1PS9A 4K2SA 3PP7A 5LHFA 2V2HA 3NXLA 3WD3A 1JVNA 1Q7QA 2MANA 2XGBA 2PDLA 2QCDB 2H3DA 1J5TA 3T09A 1G1YA 1EA9C 4PSRA 4M80A 4CN6A 1IWBA 1MEIA 2PZ0A 5F2IA 3UWVA 3G18A 3I4EA 1TKKA 2PU0A 2Y61A 3P2VA 3S83A 4V27A 1BGGA 3M5YA 3EX3A 1TA3A 3UQNA 5DMNA 1DWJM 3N2BA 1BXNA 1PB0A 4PCFA 4LUYA 3QMTA 1RCXB 3PZUA 1C8YA 4U33A 1UBPC 2PDKA 3M0LA 2Y8UA 3BSMA 4HGXA 2QW5A 3WD4A 4TIMA 3LCWA 1V0MA 1D3CA 2YR1A 2QAFA 1DJWA 3UPWA 1GYMA 3SW6A 5CAKA 2NV2A 1QUMA 2I1OA 5BNKA 2VQUA 3DU0A 2Y0FA 3SURA 4NAFA 3HOJA 1KM2A 3WH5A 1WZLA 5I2UA 3IK4A 1B54A 1FQ0A 2B7PA 1QW9A 1BSLA 2VGGA 1W3IA 3QMSA 1R2TA 4MFDA 1RAKA 2PSNA 4S3DA 3TP4A 4B2DD 4KWWA 5LNRA 3IIXA 3DFQA 4UTIA 5HXMA 3MVIA 1NWRA 4K37A 1U22A 3BCFA 3GIPA 2BXVA 1D8WA 3F4CA 3DAQA 4IJRA 3ARXA 1L0PA 4WOZA 1V03A 3CAWA 1RQEA 2Q8XA 4D72A 2WM1A 1H3GA 2WO5A 3B0YA 4FNRA 3VM7A 3WFZA 4RK8A 5I03A 5LA1A 1W54A 7REQB 1WDDA 4YTSA 4ES4A 3M7SA 1OK6A 5DXXA 4BWLC 1QJWA 3B9AA 5A5WA 1BYDA 3OZPA 1OCBA 2Z2BA 5D02A 1G4TA 3TDFA 4AZHA 3HU7A 1I45A 5JMUA 3W9ZA 1K02A 5LGZA 4C6EA 3H54A 2FGZA 4HOZA 1H09A 1UB3A 2W79A 4MB1A 3EWDA 3PG8A 1HKWA 3CAVA 3VFCA 1GJPA 1NF7A 1XXXA 1HJWA 3U7VA 2ISWA 2OQYA 1GOXA 3DN5A 4Q22A 1LWIA 5LKYA 1N8IA 2BDQA 4HVXA 5EMKA 2DW7A 3V35A 1S46A 1FCVA 3LY0A 2CESA 3UESA 4IOTA 2WCGA 4AYGA 1UOZA 2PPGA 4J4KA 2VR5A 1JAEA 1J0IA 4UQEA 3LM3A 2YW3A 3ZVHB 5CG0A 2ZTJA 1Y5WA 3P60A 5K4XA 2VFEA 3WJYA 5FF3A 1HIZA 2QMKA 1E5NA 1H7WA 3O06A 3VIHA 2F38A 4HHLA 1UASA 4O12A 6A3HA 1ZFJA 4BF9A 4Q4SA 2CYGA 3QSTA 1RBAA 4BJHA 2QUMA 4UQAA 1Z9AA 3TW6A 1H2JA 3CQJA 2O92A 1GEHA 3C4UA 1LT7A 3EDJA 2XIIA 1CT5A 3TMQA 1F5ZA 4GJJA 1D8CA 1FWFC 4HT3A 4L1WA 3T1GA 3T44A 4RXFA 4L56A 4WXZA 1S3TC 4G56A 3WQCA 4HNUA 1W1YA 4I90A 3PWGA 1E43A 4YIWA 1V6TA 4HNNA 3GXNA 4WJ8A 1K77A 1KRCC 3WK2A 1XLIA 4XZBA 5K9CA 4NZ3A 3TEVA 3RMJA 3APYA 5TQLA 2YLAA 3GR4A 4CNUA 4YYFA 3ZWTA 1FY6A 3WLHA 1C93A 4HHHA 3CEUA 2ZE0A 4PCNA 1E4LA 3MC5A 1XLJA 2J7HA 3BZGA 2NV1A 3QR1A 4QG6A 5ABHA 4IX2A 1LLWA 4GQQA 1MEHA 3NDYA 3LRKA 2CW6A 3EOOA 4Z17A 3ALGA 1L6WA 4JFUA 2IQDA 4QSHA 5KSWA 3EWYA 4B92A 2B81A 3E96A 1NP2A 4WKAA 1O66A 1IQ8A 2IXVA 5DQPA 5CBJA 3F2CA 5HMDA 2PTXA 3QMRA 1DXFA 3TQKA 1NM9A 4AD1A 5D2VA 2J13A 2WVVB 5CBIA 1QNQA 1DWIM 4GK8A 4GJ1A 1T0OA 2WANA 2XM2A 2A4AA 3FA5A 1GPWA 3AIBA 1MXSA 4IUGA 4PTVA 1P6WA 2ADAA 1LWJA 1MRQA 1MZHA 1EBGA 4H7VA 4D6DA 1FWGC 2A6LA 4LWWA 3G0SA 3GH7A 2OMAA 2ZFAA 1ME9A 3PBUA 3BJSA 3LXAA 4HU4A 4CNSA 4LRTA 3W85A 4Y2WA 4ZQCA 4GXPA 3QYSA 1K9DA 1PZ3A 1XCWA 2VVNA 2GWNA 3PZVA 3UY7A 2DSVA 2CZVA 1XKJA 1R9ZA 3F5JA 3K4WA 4Z2GA 4V1XA 1EJVC 5LIXX 4JQ1A 4KCTA 1FWWA 2FZ8A 2VEFA 3ERPA 4YWSA 3RX2A 4J40A 3RNDA 3KBWA 3V5FA 5I79A 3W84A 4Q8QA 2CBVA 3RK8A 1C91A 4REQA 4L9YA 4PRTA 2R14A 4PTXA 3KBNA 1XBZA 1ITXA 1EC7A 1PIFA 4CNOA 2BOFX 4XZWA 1NQKA 5K2ZA 2DH2A 2W0UA 4UTLA 3W82A 3CPUA 4OIFA 2TYSA 2ZXBA 1E9ZB 4FIRA 3OQ8A 1XI3A 4A6GA 1KGXA 1V3IA 4RE3A 1TQJA 4UQDA 4Q3MA 1A4LA 3OHIA 4A2SA 2CLIA 3VOHA 3T7VA 3H8AA 3QR0A 4WZHA 2Z6JA 3OZMA 3REQB 4OFCA 5LGXA 5BXRA 1HVQA 3LCLA 5CLWA 4GOAA 3V0UA 1DE5A 2QNEA 5A6BA 1XG4A 2Q8ZA 1CBGA 1ZBVA 3TMLA 3HV9A 4HU8A 3EEGA 3O3RA 1B90A 4XV0A 3L5LA 5CAHA 1RXOB 2PDPA 3MMUA 4HMNA 2OVLA 3VKBA 4F9DA 3ZJKA 3BICA 3M47A 4HHPA 1AJ0A 4O17A 4E0CA 3GW3A 3F4VA 3GVWA 3ATYA 3GYEA 5LNWA 1GW1A 3MQTA 4PBFA 2YSWA 3ID7A 2ZUVA 3CASA 3UCDA 2XSXA 4NYUA 4PBGA 2YDSA 2I17A 3S9YA 5MKGA 1NDVA 3NQDA 2V3EA 4E8CA 2YA2A 4AW7A 2NSOA 1XPGA 5G5IA 3ARYA 3SQMA 4ZVJA 2J66A 1O7AA 5C70A 3L4ZA 1OZQA 2H8ZA 2FFCA 3PSVA 1ITUA 4MMWA 3N4AA 1OGGA 4OBRA 3BUVA 4RZ5A 1TELA 5AHMA 3UD6A 1Q63A 2HBXA 3L2IA 3O0KA 4LC6A 1IYXA 1XYFA 2PF0A 3W7CA 5BWAA 5HR7A 3CH0A 4FI4A 4GRSA 4PCTA 1RP8A 5AC5A 1RHCA 3EB2A 4FXFA 4HBKA 4PUNA 1DWFM 4FLSA 1QHPA 2CLMA 1CX9A 3LCXA 2NUYA 1GQIA 1JRCA 2B4GA 4JR5A 3B8TA 1ADSA 4DWSB 3ZR4A 4JTKA 1TX2A 4HMEA 5CSRA 1S5MA 2R1KA 5REQA 2J6XA 3T4CA 3TTOA 3UXKA 1VJZA 3QHMA 4DELA 1UD5A 4H9XA 2CHRA 2YFOA 1EL3A 1EJTC 1TTIA 1XBVA 4AY7A 4IIFA 3WJWA 1S39A 3CUFA 1VLWA 1BVWA 1RY0A 2V9DA 1US3A 4B15A 1GVEA 3U2CA 3NNTA 1IHIA 4ZBCA 2PU1A 1WZMA 4ZE5A 1WKEA 5EMJA 2GSHA 1OT1A 3QPYA 4PCPA 5GNXA 1NWSA 3LHWA 4A3QA 2FKPA 2PS2A 1AQFA 4IQDA 3VNZA 3LPGA 1YNQA 1IGWA 5MHBA 4QSFA 3VIJA 4IGHA 3NURA 3VMOA 1E1EA 3KXQA 3AYVA 3S5OA 3LQGA 1SFLA 3TYZA 1XBXA 4HPXA 3RR4A 1XFCA 1DWHM 3THAA 3SCQA 5BOOA 4FP1A 3NEHA 2BTMA 2DEPA 3MW7A 5CPMA 5G4WA 1M53A 2CIPA 2V3FA 1PTAA 3DENA 1HX0A 2OG9A 2MUCA 4O8AA 3WMBA 5CZKA 3O6AA 3CTTA 3GTXA 3HPFA 3SSJA 1U5HA 4I5UA 2J9YA 4UMAA 2DY3A 4L7ZA 4LBSA 1GVOA 1GVSA 5IRPA 3C0JA 1L6YA 4AF0B 4Y8FA 2NZLA 2J24A 3BLDA 3H2NA 4GVHA 1DJIA 3AIUA 1XYCA 3RJXA 3FAXA 2EBNA 4JFTA 4XZIA 2C8NA 1NH6A 3RLUA 1SGJA 3WF2A 4GIEA 3L4XA 5G2HA 4A35A 3KOYA 2UBPC 4HMCA 1EP1A 3IJQA 1V02A 3TN3A 1RBOB 3ZMRA 1JFHA 4XD3A 2J77A 1KV5A 1M65A 4PUWA 1HO1A 1EEPA 2VI0A 2PDCA 1C3FA 1F3EA 4CQ8A 1TJ2A 1FVPA 1X38A 1BPLB 3N18A 1Z89A 2G50A 4PUKA 3MUCA 2WMIB 4N02A 1ZENA 4OBTA 3RILA 2J9XA 1GHRA 2I57A 2A3LA 1MFVA 3H2EA 3HA1A 3M0KA 4Q8OA 4LUJA 4QBXA 3H24A 2FLIA 2KZHA 5HOSA 2VGFA 4GHRA 3DX5A 3L0KA 6REQB 2ZZ2A 4KCVA 4F66A 1VYRA 3W6MA 1TPDA 3HFYA 3V1PA 3T81A 1J2WA 1KFBA 3VKCA 2CNCA 3EWBX 1QPOA 5AHEA 5E1QA 1TZ9A 3ARUA 3FDKA 2Y63A 4RE2A 3OQEA 1Q8JA 1ZAHA 1GJWA 1WPCA 3MJMA 4I6VA 1UC4A 3TC7A 1D9EA 5LYRA 3W0KA 1UD4A 1ADDA 2PDXA 1UH4A 3VIFA 1LL6A 1OF8A 4JQAA 1J96A 4H9YA 1GVQA 3OVRA 4FX7A 3VGGA 3VD3A 3P5ZA 3GQYA 2YZ5A 3TSMA 3FYOA 4DJFD 3MDUA 4PMRA 4IP4A 1GG1A 3B4YA 1ELSA 1IT8A 2HZGA 3KUMA 1Z44A 1XBYA 1A3HA 1KKRA 3MMTA 1TWIA 3IVTA 3L9CA 4O4VA 3M5XA 1WQ5A 2J47A 2WZMA 1OD8A 4H7ZA 4XKYB 1A5OC 1XH2A 1L2QA 3O7UA 5EKYA 4XKMA 1H61A 2EPMX 1XF0A 3TV8A 2HXUA 4M6UA 4RPQA 2DZWA 1PKMA 4C1NA 4GY7A 4N9BA 2PAJA 1EDQA 3R79A 3B06A 5IBXA 1LP6A 1X8FA 1CNVA 3PG9A 3WD1A 4XK2A 1P1XA 2GJNA 1XRSA 1JPMA 1J10A 3E12A 3LM7A 4XVDA 4Y90A 3EWWA 1OC7A 1G69A 3MA8A 3R8GA 2OWCA 3TWAA 1ZRQA 4KS0A 5LIUX 4US6A 4Y7EA 5FJRA 1XFBA 4RE4A 4WGHA 3CLMA 1HUVA 4YLWA 2CC0A 1Q3NA 3W7JA 1X1OA 3O8AA 3AMKA 3LXBA 1OD0A 4B9YA 2Q02A 3W88A 1S5NA 1PCKA 2ZX8A 1WV2A 1SVDA 4AG0A 1V4YA 1H41A 1ONXA 5CEWA 1WDSA 4UQBA 4JTSA 4FX6M 1UP2A 2W91A 1TPH1 3S5SA 2IQ0A 4OE7A 2CKSA 2OSYA 1FHDA 2PP3A 4J2PA 4DZAA 1SO6A 2JK2A 3QEZA 1Q4NX 2C13A 1E72M 2G8ZA 3THUA 2WJFA 1MXDA 5CQ1A 1RZMA 1X1NA 5T9CE 4W93A 3CYVA 2P0IA 3KOFA 1ZNNA 4M56A 1A80A 3TC3A 5BW6A 1V6VA 2FZDA 4UBPC 3SCSA 5HWNA 3WQEA 4PUEA 3XINA 5DEZA 3IUDA 4OV9A 3UW6A 2DJXA 4DIAA 2A1YA 3EX2A 2IW0A 4M19A 3W81A 4KERA 2J74A 4GMEA 2DZPA 1JPHA 3L23A 2UV8G 1CB2A 4RDVA 5C7VA 2G4FA 6XIMA 4HNCA 1ZPTA 2ZZ5A 1KQZA 4O14A 1ZJIA 3P74A 1W5QA 1ISZA 4GBUA 4E8DA 1QBBA 4BQ5A 2A5HA 4AVNA 4DM2A 1W5PA 4K38A 3CWOX 3SRFA 3L68A 3GB6A 4ASTA 1ADOA 1UZDA 2YDAA 3BVJA 3ELFA 4AH7A 1GTHA 4AMAA 1US0A 4BFAA 1A47A 4R9XA 2YCLB 3MKCA 2YZRA 4F48A 1PCWA 1H4PA 4OHQA 3ZJ8A 5EMYA 5DBUA 2HK0A 3NOEA 1J6OA 4Q8WA 5FEPA 3GNOA 4POCA 1NJJA 5FSDC 1ISVA 4Q33A 2FGBA 4DUXA 4ERGA 1Q45A 4F9JA 4W4QA 3P80A 4AX7A 1VEMA 3NQ2A 3GR7A 6TIMA 2PDBA 4Q7BA 4UFMA 4JHMA 4P61A 1ISWA 1X7FA 4WCJA 1FWHC 4ZOCA 3VIGA 2RFGA 5I3IA 3S8HA 1BWLA 4E5TA 1UPPA 1KFCA 2DUXA 3PAJA 4DRSA 3W7OA 1SFSA 1XV8A 1VRDA 5CCZA 2FPVA 5FJPA 3IJ7A 4GKLA 4RJEA 4IPIA 1N8WA 4AYSA 4HYRA 1YEYA 3W27A 1E71M 3FXGA 5IDIA 2ZRZA 4CLMA 1Q85A 1EC9A 4YTRA 1VC4A 3AMDA 2AAAA 4MZ1A 3VCCA 5GNYA 1EJXC 3EZ4A 3ECQA 2DDXA 4XD4A 2WXDM 3A64A 5BWFA 4B4FA 3H12A 4LVBA 3D47A 1OFAA 4O28A 4UTJA 3RX3A 1XINA 3T0CA 1V0LA 4LFYA 3RPTA 3G1HA 1O12A 3ARPA 4HK5A 3W6YA 4O1BA 4UMBA 4DO4A 1F74A 4LT9A 3CUZA 4F3HA 8RUCA 1ODUA 1R8LA 3SUUA 4B5TA 2HXTA 3K5XA 5M17A 1I9CB 1V3JA 3M4HA 4HYWA 2BY1A 3ZSSA 2QCDA 3VOFA 2CWXA 4JTEA 1Y7VA 1RQBA 1LBMA 1GK8A 4L6DA 1VAHA 4S3GA 3EKZA 3AIVA 2XFRA 3EXRA 3TTQA 1MUCA 2J27A 2ZC8A 4ZO6A 2Z24A 3EMZA 3IJ8A 3CU2A 4XUYA 4IFKB 4QG9A 4RKAA 3PN8A 3VD7A 2XGIA 4CQBA 2CHOA 2GQ8A 2XSBA 1RK5A 1FWNA 3W00A 2ZIDA 2G3IA 2V38A 4UWMA 2C6QA 4W85A 3C8FA 3L2LA 4XAYA 3L0NA 4IIHA 1QK0A 1B30A 1V0KA 4E8GA 1V0NA 1A0DA 4A05A 3PTMA 2J8GA 3B8VA 1BYAA 1UC5A 3MHFA 1H1ZA 3N4EA 2Z1WA 3URAA 3UYIA 5CSUA 1PTDA 2FZNA 3LHYA 4M7TA 2GVGA 3TC6A 1UR8A 1RJRA 4MKVA 1YW1A 4L80A 4OZOA 3WQOA 1TE6A 5TAOA 1TPB1 2Y5JA 3ZXWA 1PV8A 2CPUA 3KOXA 4DPQA 2OKOA 3D46A 3T2OA 1VQTA 2A2IA 2DT1A 3C5QA 3EBVA 4ZQNA 1A5KC 5DBTA 2WBKA 1PKLA 3UBPC 1QO5A 4JTIA 1Q6OA 4JEJA 4O19A 3NQMA 1HGYA 3DFPA 3OEXA 4UOJA 3N14A 3RYSA 7REQA 1F07A 3NQVA 3ONBA 4GH1A 3FCPA 4JKMA 2NXGA 3WK0A 4KF1A 5IBXC 3KRUA 5JVLA 3GKFA 1BKSA 2A6NA 4L61A 4EVZA 3UZXA 5FJOA 2RGLA 2GVYA 2J4GA 1M04A 3GH5A 2B7OA 2OSWA 5HBFA 3BURA 2W5FA 1DJGA 2VURA 4PMYA 1JG9A 4JIPA 3QGAC 4GPNA 1J18A 3PZTA 4DI8A 3W23A 1TV5A 2YB1A 1XYAA 5T91A 3VZXA 4R7WA 2QVHA 4J3WA 5E9AA 2V2CA 4FNSA 3KP0A 3U3HA 2I9EA 1E3XA 3BANA 4QXIA 1GZGA 3L4YA 2C0AA 1MQQA 1VFFA 3ARQA 4U31A 3O07A 4O0ZA 1L6SA 3ZVHA 4WSKA 4ZZ9A 5IFPA 3CZEA 6CGTA 3WJSA 1J9YA 1WDPA 3R58A 1W56A 2PRMA 3MTWA 2G3FA 1TPFA 3VILA 2ZXQA 4W5ZA 1RJPA 3WCZA 3GXDA 3C8NA 3NPWA 1M6JA 3CZ8A 1UR3M 4W84A 3PZQA 1VCFA 4QDMA 1HL2A 1H50A 1QTWA 3N73A 2DSZA 2QIIA 1J12A 5AYIA 4UNIA 1YDYA 4TV5A 2VZVA 2X42A 3SSZA 4EPBC 3WEOA 3HPXA 2ZRYA 1LYXA 4WKFA 3W25A 2X8RA 3QKZA 1B3ZA 2DU2A 3R89A 1THFD 1W3TA 2R6OA 2ZX6A 5CJ5A 1ZZMA 4DQWA 1O5RA 3TJIA 2ZYFA 3UT0A 4EE9A 5I06A 2OZ3A 1DEDA 1Q13A 1HKMA 3DHFA 4Q32A 5FF2A 4NF7A 1RK6A 4JTUA 3QJAA 1KLZA 3VXGA 2WSPA 1W3NA 4NX0A 3GDTA 1DBTA 3EKLA 1Z69A 4LAZA 3G1AA 1QFEA 1Z42A 3AAMA 3BPWA 4JFWA 2X1TA 1JPDX 3P62A 1J01A 1LLZA 3IK2A 4HZ8A 4E4FA 4CU7A 3CUXA 4O1FA 1UD3A 1REQB 4D2JA 1RSCA 5CC5A 2CZEA 4LEFA 1EUNA 1NDWA 1QW8A 4UTUA 4B3KA 1O5KA 4W9TA 2BHUA 4XWUA 4HSOA 4A22A 3FKRA 3P3BA 2PDUA 3DFSA 3A21A 1GORA 1PDYA 3MI2A 1K8YA 3MYOA 2WBGA 4HSHA 4PGLA 3WX7A 4Z2LA 2WVVA 1VIZA 4JTQA 5G2IA 3W2JA 5TIMA 1M41A 4BI5A 3SEPA 3W75A 3A13A 2ZOXA 3ZSTA 3C6CA 2Y2WA 3NQAA 1DWAM 1GZ1A 4QS6A 3WLRA 1NOWA 4IF2A 4U3AA 1EJ7L 3PFRA 2WC4A 2WMKA 1FWJC 3VGDA 3UVAA 1N82A 1GKQA 4LSBA 4MDPA 3S9IA 1JDAA 3EWCA 1OFEA 3WQWA 5HMSA 3WZ0E 2DZUA 1SUXA 3QGKC 3QZ6A 3RPMA 4K1GA 4D6HA 5D2TA 3NDZA 3RX4A 3G1VA 4C7FA 4CUCA 2FHBA 2CLLA 3CUIA 3WLPA 1Q66A 4GUFA 5A2CA 4QJ4B 3NYDA 2VOTA 2G3MA 3I6RA 2PI6A 3TJXA 2J7FA 4TV6A 4QM1A 1GW9A 3QV6A 4N2YA 4S2BA 4GD0A 4M6QA 4OECA 3SCWA 3W2MA 2WK2A 6PTDA 2YCJA 3WQ4A 3VD9A 3U6WA 5A69A 1S2TA 1X6NA 3MPGA 4KCUA 3LNPA 3M64A 4MVAA 2Z1KA 4BZYA 5A94A 4ZFCA 2E5CA 3U8GA 3F7JA 5HNNA 4PODA 4AHOA 2G0WA 1JCMP 3G2GA 3GAKA 1YADA 1ZGDA 2WMHA 4WKHA 2F8QA 3DYOA 3ZQ9A 1KRAC 4O54A 1MEWA 1F6YA 3AXXA 4KEMA 4A2RA 3W7RA 1UKQA 3REQA 4GC3A 4I9TA 2X16A 1E55A 2OLHA 2CETA 3R10A 3UYCA 2DJLA 4O53A 3UJEA 2XPKA 4LEQA 3PY2A 1RLCL 4K3ZA 5BCAA 3WLJA 1BAGA 3LHTA 3LRMA 3HQNA 3R0UA 4JL1A 4UFKA 1SSGA 5CPTA 2G95A 2QCHA 3QY6A 1F6KA 1JD9A 1PX8A 1QT1A 7A3HA 2NVCA 2BVTA 3OA3A 3T4WA 1J4EA 3TA9A 1B4KA 5B7ZA 2HPIA 1OC6A 3GVVA 3KRSA 3BSHA 3HPAA 3W73A 1DV7A 7XIMA 4AMCA 4CN4A 2F61A 3NUKA 4JIHA 3NQ7A 5EMLA 3WQDA 5T26A 5EYWA 1DQUA 2V5BA 3PZNA 1S5TA 4Q4OA 1WX0A 2G96A 1TZZA 3PANA 1RV8A 1HQTA 4KEZA 3NWRA 4GX9A 4GNKB 3IJ6A 3SRDA 2AOSA 2E5BA 3K1GA 4NAEB 2PC8A 1JCTA 3JW7A 4TVCA 4M6PA 5AYYA 5KTLA 2BY3A 3OB8A 4MHBA 3QFWA 4PUMA 1RY8A 2OR2A 4N9DA 3HPZA 3B0PA 1NOFA 3URBA 5CSYA 4LNCA 3EEZA 1VBJA 2P50A 1JEZA 3VKDA 3NQ8A 1DXIA 2PLMA 3QFEA 3OG2A 4ECLA 5HWJA 5XIMA 2PZNA 2DH3A 3K8MA 4ZQMA 1GQNA 4ZMGA 3U2ZA 5JBEA 4H00A 1JI2A 4U5KA 4HN4A 2O7SA 3FS2A 3AFBA 1LTDA 3T0AA 3IUIA 3FSUA 2WPGA 4XAFA 1ZY9A 1C29A 5ABGA 4JX4A 2VC5A 4W86A 3ZM8A 5FJUA 1K8CA 2FB2A 4DBSA 3DFHA 3PJTA 4OKDA 1W5NA 3M7WA 4QR6A 4C6BA 1ICSA 5AHFA 4FR6A 5F2GA 3KHDA 4DWSA 2QJGA 2HVMA 4JTCA 2WW5A 3FGCB 3OZOA 2J88A 4HNTA 4GUHA 1OABA 3CZJA 3VDGA 1JUKA 4FXRA 4JICA 3IJDA 2EEXA 1WP6A 3GD6A 1EZWA 1TWWA 4RDWA 1PHQA 1PL9A 4LAMA 2ZCGA 3WQ5A 3WQGA 3MSRA 4AY1A 2CLKA 1NWUA 3GG8A 2PGRA 3OLEA 2VZUA 4DI9A 3B0XA 3S47A 4JQ3A 3TUUA 3FXYA 1AL7A 3VGHA 2DW6A 3ARVA 1TMHA 1NY1A 3M9YA 5K3VA 1SZRA 4F0KA 1K03A 1ONWA 4GE8A 5DT5A 4ZB0A 3L5MA 3PZ9A 3EKGA 2A79A 4YHGA 5LA2A 4MKNA 2GGJA 1ITCA 3RM4A 4J5NA 2E25A 4H9VA 3W7GA 1XRFA 3KS6A 3MP4A 3OJGA 1LRNA 3SADA 3G3MA 4C6MA 2D0HA 1XGZA 1RVGA 5D38A 1U33A 2Y5SA 2HCVA 4GXMA 2GLKA 1SM9A 2D0GA 3TX9A 1A5NC 1W9XA 1DJXA 3FJLA 3KWSA 3N6JA 1G94A 4HA4A 4LJ3A 4AF0A 4F0SA 1JNEA 3ZR5A 4XIMA 3GH4A 4J3UA 2E40A 3SFKA 2PWHA 4TTUA 4N4QA 3NA8A 1KRMA 3V5OA 2PDMA 5AVNA 4WDTA 2DUZA 3A47A 2TMDA 3IPWA 3GAYA 2VD8A 5M03A 1WOBA 1MVYA 1IR2A 3SB0A 1R3RA 3IJ9A 3KVKA 3NOYA 3UY8A 3T0DA 2FTYA 2WQPA 1FWAC 1B57A 1JR1A 1L6FA 3ME3A 5K4ZA 4Z2JA 3I7RA 3LPPA 3V5CA 2WMIA 2XH2A 2OSXA 2QJHA 3UFYA 3TW7A 4S2CA 4A21A 2PB1A 2CERA 1UKSA 2ACQA 3WDJA 2V8ZA 1GONA 1Q6LA 2EPHA 4XBSA 1QPKA 2GSJA 3IRDA 4CU8A 3WEMA 1NELA 4D8LA 3TWBA 3UA3A 1JCYA 1K4HA 1OINA 4P8UA 6REQA 1CXEA 1KFEA 2EPNA 6TAAA 2ATSA 4QLKA 2D0FA 3IEBA 2RDUA 2O56A 3AC0A 4UIOA 1KCLA 1QHOA 4ZR8A 2PLKA 3NQFA 4NU7A 5DN1A 2Z0IA 1XD1A 1ZUAX 3WLNA 3QSRA 4Q8UA 4FOKA 1RALA 5FSEC 1XW8A 4UFIA 2YFNA 5LNVA 3LBCA 4IIBA 5TF0A 3VX0A 1EF2A 2WWDA 3LOTA 1IV8A 1TV3A 4LOCA 4ADTA 1YTEA 1JYVA 5DRIA 4HTYA 1RA0A 4UZSA 2Y4SA 3BV7A 3THDA 1W1VA 1F4HA 3MKVA 1QATA 1FCUA 3TTSA 1YTDA 2FPTA 1MO0A 3GDMA 2Q09A 2PCQA 3EDFA 1GPFA 4MB3A 3CZLA 4XKYA 1WZKA 2GGHA 3N12A 2OTDA 1BVZA 1CGYA 4MG4A 4AXKA 1GVIA 1EIXA 1T8QA 2R9RA 2FIQA 1ICQA 2UY3A 3QR3A 4ONVA 4NIRA 2CU0A 4WY0F 3TYEA 1V93A 4MIMA 1KCZA 3WDHA 5FF4A 4MKSA 3P8IA 3BLIA 2ZUNA 2ABBA 3F4NA 1MW0A 4BR1A 3EOUA 1G7UA 2NUWA 4HYVA 1K8XA 3VCNA 2FGLA 3L2MA 4NJHA 2DP3A 3EWXA 4NX5A 3CAKA 3VC6A 3K4AA 2C15A 4CN1A 5I3HA 2I56A 4UB9A 1QNVA 2O9OA 4UR8A 4ZO9A 2QUUA 4RZ4A 9CGTA 2P8BA 2ISSA 4B16A 4FAMA 3S6OA 4D71A 1BWVA 1QI0A 1VFOA 4ZFMA 4UTWA 4WSJA 1WE5A 4CNNA 4JY9A 2JEQA 3DBNA 1TSIA 4KFNA 1WUEA 5HUOA 3PNUA 3TCSA 3IWPA 1SQ7A 1DOSA 1UA3A 3AHYA 1Z32X 3T08A 4DNMA 5FCZA 3BG3A 3HIJA 1V02E 4IL0A 3GDLA 5A3HA 2FVMA 3APTA 3VDBA 3VU2A 3WJZA 4IPPA 1YRRA 1XJBA 2BBFA 3CMGA 3GO2A 3U48A 5A6AA 4IMEA 2F2HA 2EXOA 2RUSA 1RLDA 3NJ3A 3GRIA 3KBVA 1OG6A 3S9ZA 3ZS4A 3ISIX 3CEPA 1XICA 1KXTA 4KRTA 4X0VA 2PBOA 2INZA 3GSMA 5JIPA 4AIBA 3S2MA 4MTVA 4DWSC 2KX9A 3ANYA 4V28A 2ODOA 1V3LA 2GQ9A 5K7JA 4L6OA 3RG6A 3SFWA 4PMXA 3NQGA 3P93A 1ZAJA 2WC3A 2ZVRA 4ROPA 3W1RA 4AIOA 5I00A 3QHNA 4TR9A 2BXYA 2VHLA 3CL7A 3TAKA 1J0KA 3RLGA 3LLFA 1RP9A 4OBSA 1E0WA 1E4NA 3RCMA 3F4DA 3V75A 5G1TA 2E6AA 2QDGA 1Q6EA 4DAIA 1XPYA 2WKJA 3VNKA 3BGAA 2HSAA 5FKYA 1S5VA 1YE6A 5BXSA 2FQIA 3S2NA 4IXXA 4IHCA 1VHCA 4EXBA 2OCZA 2PTZA 3BQ5A 5C9RA 2PMQA 1JCXA 4IQLA 1T41A 2YCLA 4IMDA 5DMMA 3QY7A 3L4TA 1KM3A 3H4XA 3S1WA 4JKLA 4WUIA 3HG4A 4MNKA 3OLDA 3SGUA 1TIMA 3VAVA 1HO4A 2ZRWA 5ABFB 1UA7A 3T55A 3H26A 1PZ2A 1F2JA 1R0MA 4ML4A 1HL9A 3VGFA 1JDEA 2ZICA 3PBWA 4ZENA 5HQEA 3C2FA 1O94A 4XB3A 4CQDA 4O18A 4R3UA 2G3JA 1E6PA 1KBJA 3MUIA 4LY8A 4TOQA 3THQA 3PR2A 1DHPA 1SSDA 2DQXA 3AYSA 3O0FA 4O11A 2VM8A 1F8MA 5AOUA 5HQMA 2GVJA 5IDZA 2VR2A 3DG3A 4PB3A 3W87A 2ZDSA 3DUGA 1RJQA 1E56A 3C61A 5D33A 4DVOA 3CWHA 1YBQB 1VFMA 3UXIA 1ZCCA 1UROA 2ZE3A 4H8NA 5CSSA 3DFOA 2EGZA 3ABOA 4HHMA 4GYPA 5E0KA 1EF3A 1QXLA 3A4WA 3E0VA 4RNHA 3LMZA 2WOQA 3I3BA 3MO7A 3SN1A 3N9RA 2QKFA 3K46A 3UXLA 2CLEA 3W26A 4IGNA 5FF7A 4M24A 4KWUA 4ZQRA 4Z2IA 2OOFA 4AIEA 3CIWA 3D3AA 1DTUA 2R94A 3E2VA 1QU4A 4DPPA 5HJLA 2VNCA 3GKAA 4CQAA 4HPNA 4J1OA 3CHDA 3ZO9A 3GVQA 1OGBA 1KBBA 3G22A 2L5HA 2VC9A 1J8VA 4K6AA 1NIUA 4LX4A 4EIVA 4Q8TA 4E6MA 3AIWA 1FHUA 4L1GA 3N3TA 4NUWA 2QR6A 4IFKA 4CD7A 2AMXA 4KFPA 1HJUA 4LANA 2V82A 1PEZA 3RITA 1SPQA 4WLCA 4WEVX 2JKEA 1ZLPA 3QF0A 2PDFA 4ZB5A 1GGOA 2YKKA 4X0NA 2CFFA 1QW7A 1NDZA 4S3EA 3NPXA 1XYLA 4PRRA 1YIXA 3LGGA 1AD1A 2P8CA 4K39A 2ZQ0A 4J9JA 5AC4A 3GHRA 2A85A 3ABXA 1GG0A 3LNMA 1SW7A 2O4QA 2NQHA 2BZNA 4ML9A 1QCWA 3QH2A 3N04A 4TMCA 2QUNA 3H2AA 3DYMA 3KVMA 4R88A 3CUGA 1LL4A 4HA0A 3VIMA 3GTIA 3GC4A 4W5UA 3WN6A 4AEEA 4O1AA 1ZBKA 3BO9A 3WFAA 1RD6A 5A8MA 1BTMA 3TNOA 4I5XA 4PL2A 3MHUA 4M6VA 4KCWA 2WJZA 4UXDA 4DJEA 2GVEA 5E9XA 2J78A 1KTCA 3LMYA 4C6QA 3TZFA 3HFTA 4Y9PA 4F8XA 5ECVA 1DJNA 1ZJAA 1UWAA 2RDWA 4ZTYA 1P48A 1UCWA 3KM8A 1EPXA 1A5MC 1TREA 3I3EA 4H9ZA 4S3BA 4P7QA 2VZOA 4W8BA 4GIYA 3PM6A 1GOQA 1C8VA 2NLIA 1G01A 1Q6FA 2GJXB 2XIQA 4AEFA 2R1NA 4WDUA 3WMLA 2PP0A 5A6BD 3MCMA 3OW1A 4GI6A 1XIMA 4HPHA 4C1LA 2VGBA 4JTLA 1R5YA 4JDYA 1OC5A 1LQAA 2G97A 4XUGA 2PP1A 3VI2A 1PWMA 3GG1A 4NJGA 3H7UA 2Y1HA 4WRHA 2QCFA 4EACA 4Q8PA 4AWSA 4CEUC 1X1ZA 3O9NA 4TX9A 4MWAB 2DORA 5D4YA 3WQVA 4QLLA 3II1A 4NZJA 4UTWC 3TONA 1PTGA 1BLIA 2DT2A 3BW4A 1PAMA 2IXUA 2VEMA 1E0TA 1NARA 1EHNA 1JZ4A 4BY3A 2ALDA 1JI1A 2XINA 3QKEA 1U83A 3MDWA 2BG5A 2V67A 1R46A 1IEWA 1EIBA 1C8QA 3ABRA 5G4HC 3PSWA 4DYEA 2HTMA 2RHGA 2WZEA 2VEGA 1SZFA 2E8ZA 3ITXA 1M7JA 3BGGA 4GQ0A 3HMCA 2DIJA 3VZZA 4YCOA 4PEEA 1VFSA 1IEQA 1O68A 2VRQA 2FB3A 1WZAA 5C5YA 3EPMA 2QVNA 2O9PA 1Q4WA 2IS7A 2E67A 4O1DA 2NXHA 1AW5A 5EBUA 1IZKA 3U4FA 4IZGA 1GNXA 4DJDA 3W7LA 4RZ6A 1OFDA 4QITA 2XM1A 1CWYA 2PGEA 4MAZA 3EPOA 4KFOA 4QRNA 1CXFA 3M6YA 1AH4A 3H2MA 2J7GA 4WJXA 4AWTA 1ZHAA 5JXQA 4H6RA 4TQTA 4A8RA 3RUBL 4AZCB 3DGRA 3R2GA 5EY5A 1VPYA 1WXYA 2QYGA 4RDZA 3SCPA 5LIYX 1B3VA 2V5DA 4F0HA 2PRLA 3WDIA 4YYCA 1M3UA 2E7FA 3AI0A 4C91A 3W1AA 4NILA 1UZ1A 3KZSA 2D1ZA 3HQOA 3VINA 3ARRA 3W70A 4CQCA 3M41A 4QJ5B 3T40A 1VFHA 1XSJA 4KGLA 2QJJA 2JBMA 4GKTA 3QPEA 3FEMA 1REQA 4Q6JA 1UMYA 1JDCA 2Y89A 4P5UA 4GBDA 3DEQA 2X0SA 4GFSA 1XRTA 3CB3A 3LG3A 3LENA 3QY8A 3VIOA 1JJKA 3EMCA 1B5TA 5D03A 4UC5A 5CKSA 1VEPA 5F7UA 1YE4A 2JE8A 2Y6ZA 3GC2A 3WMCA 4E2VA 1UH3A 1FWCC 4WJEA 3A4XA 2WNNA 4AX6A 1G7VA 3SQSA 3FY1A 3BLEA 3PTQA 1RBLA 3FW6A 1UIPA 4K8GA 2ZZ7A 2NVAA 4LF2A 4QEHA 4ZGYA 1LOQA 3RRAA 2CZDA 4TX8A 1W3JA 2NT0A 1UD2A 5ENLA 1MWOA 1K9FA 2FZ9A 4XQ6A 4DZ5A 1VR6A 3KBMA 3KP1A 1O1ZA 2BY0A 3W86A 2QV5A 2H8XA 1MI3A 2D3LA 3B03A 3LB0A 1W1IE 1PKYA 3P14A 2XVGA 3QLLA 4JTFA 4JYFA 2J8FA 3K30A 4UR7A 3ES7A 4D6GA 5AC8A 2QF7A 4IIDA 4O0KA 1FWDC 2BXZA 3L21A 5JUVA 4NXSA 4PZVA 3OGSA 4O1EA 1P43A 4FXJA 2WMGA 4IP5A 1UD8A 1CGVA 2Q3OA 2V81A 4MNMA 4GYPC 2NQJA 4O16A 1R7AA 4FIQA 1VJSA 4KESA 2XZ7A 3OLIA 3TZNA 3GVRA 2QCNA 4MM1A 1XX1A 4UUIA 1E6NA 3E2SA 3VNLA 4QROA 2J6VA 2FH6A 3HJEA 2V6AA 1XIGA 1Q6GA 3HGRA 1R3SA 1PX4A 4EPKA 4J3VA 1L6GA 3LI1A 3PBVA 3LSBA 5DY2A 1LQ0A 2HNEA 4FNQA 3CV6A 4Q8VA 5AHLA 5D04C 3WBAA 2YA1A 3GG7A 3SJ3A 4WK9A 4B3LA 1Z6KA 4EPEC 3G77A 3RCYA 4ATDA 3CWNA 5HNRA 2BY2A 4O57A 3PJUA 4GY1A 4EXQA 2OKTA 1FP8A 3HGJA 1S2AA 1LRTA 2ZWYA 2H3BA 2YB4A 2AKZA 1SW3A 3NL2A 1WAWA 1V7YA 3TNBA 2PUZA 1EBHA 2R82A 2FPYA 1N8FA 1QNSA 3GW0A 5L6UA 1AODA 1B3OA 1EEXA 1YDVA 3UWQA 3N9KA 3W72A 2QEZA 5U7SA 3A24A 3TAOA 3MU7A 4DM1A 4J3SA 1V6UA 4AD2A 3FJ6A 2DVXA 2OGYA 1Z3NA 3NZPA 4HJWA 3CQ0A 3DKJA 4WF7A 3HURA 4JN8A 1W9PA 5KINA 3W2NA 4JDBA 1QPQA 1KCXA 4DJEC 3M16A 1XHGA 1CB7B 2QDHA 2C18A 3R8HA 2JF7A 4O15A 4NAEA 3QXBA 3EOEA 1P0BA 1FDJA 3VK5A 1UH2A 2V3GA 1NF0A 1HJVA 1XM3A 3WK3A 2GDVA 3FV9A 1HJQA 5JBDA 1E0XA 3KL5A 4H9UA 1XIBA 4MJ4A 1JGMA 2VZTA 1T99A 1FWIC 4NKCA 3AWOA 1V5XA 2J79A 2ZA1A 4PB4A 3BH4A 3WENA 4EX4A 2FTWA 4LU0A 1POKA 2OT0A 1C90A 4Y9MA 2OPJA 1V51A 1BHGA 2PGFA 4E3TA 1K6AA 1XLDA 2DPEA 2IUZA 2XU2A 4YTUA 1OK4A 1JF6A 4IJCA 4ZTXA 5F2LA 3U4AA 5EL1A 4J3XA 5D9NA 2C71A 4MY8A 2Z4GA 4Z08A 1N7KA 1QO2A 4LB4A 1CXHA 3OA5A 3R0KA 4RW3A 2C14A 2NW0A 2Z27A 2WLYA 1WDQA 3AISA 3W29A 3VD4A 2JGQA 1NDYA 3FGCA 1S1PA 3ZR6A 4I9JA 1JDDA 4GWEA 1GCYA 1YTKA 2GGIA 1OX4B 3CS2A 4I7VA 2W6RA 3B4UA 4M1BA 1K7XA 1LUCB 2DSKA 3GYCA 1F7BA 1CI1A 3V18A 2VO5A 3MUAA 2D22A 4C90A 4XISA 3VMNA 1V77A 5CGMA 3DCPA 4I9AA 1QDSA 2E68A 5FL0A 4RR4A 1GVYA 4W89A 3AHVA 1NTHA 4H19A 3OYXA 5CGTA 1I0DA 2VTFA 2Y7GA 3UJFA 3UZZA 4JS3A 3L65A 3WL1A 4MJ2A 4RV3A 2D2JA 2H9AB 2QLYA 4DJDC 3RO8A 4H2HA 2IKGA 3MZ2A 1SO5A 5T8GA 1XIFA 3WLOA 2NXIA 5E0CA 2V5KA 3USZA 3ZJ6A 3ANUA 1H60A 1JCLA 1CGTA 5M5DA 2CEQA 4ICMA 1KKOA 3H22A 4ZO7A 4NI8A 4S23A 4QCEA 2W9MA 2H90A 4NZ1A 3W1UA 1YHTA 1DHKA 3AZTA 4NI3A 1XDJA 3N4FA 1MZRA 4N0RA 5TBOA 1YDNA 4AQLA 1R47A 2XHYA 1DQWA 4LAKA 5J8LA 4NJKA 3A3XA 2Z26A 1NAL1 4FK9A 3ZLGA 1UR2A 4Y9OA 5BU6A 4XZNX 4LH8A 4LAUA 1KR0A 3CV2A 3WNLA 3B05A 1DP0A 4C60A 2WJDA 2WYSA 2VVSA 4LCSA 3SR7A 1X6LA 3S1VA 3BDKA 1FWTA 1OCJA 4H6QA 1Q2SA 4DO7A 1JPIA 4H9TA 2DGAA 1SR0A 3W7NA 4AEOA 1M7XA 2IQTA 2QUVA 2J8TA 4CCEA 4PH6A 3W7EA 4H8HA 2ZC1A 3B8SA 1KFJA 1JXJA 1W9BM 4JX5A 3LLXA 3ZT5A 1EA0A 4FLOA 4RE0A 4UCFA 3WQ6A 1KRBC 2ZZ3A 2EO7A 3W1XA 2HMCA 2ISDA 4UTFA 5H8MA 4GYKA 4HD5A 4V33A 3Q58A 4OU1A 2X1RA 1U1JA 1MYRA 4AZGA 3G8EA 4FEZA 3EDEA 4F40A 3B9OA 1OCNA 4ZOAA 2R91A 2VC6A 1BF2A 1KTBA 1AG1O 1ESWA 2ZX7A 1XH0A 2ACSA 3O1NA 5CPLA 1W0MA 3BG9A 3W4RA 2VDIA 2ICSA 1SW0A 2YCKX 1YXYA 3IJIA 4Q4MA 1FH9A 3E2QA 5I23A 5CGQA 2QPUA 2VWTA 1BTCA 1LWHA 4G5DA 4LTSA 3NL6A 4MB5A 3VA8A 1E0VA 4S38A 2X1UA 1DIEA 1POJA 3TLQA 3VTRA 3AWNA 4Y96A 2QCGA 3BQ6A 3HQ1A 3OPSA 1EOKA 2NUXA 1I8JA 1TB3A 3DXIA 4KEVA 3LHUA 1CEOA 3PUOA 1E9IA 1M01A 2ALRA 2HV5A 1QI4A 3CO4A 1EZ2A 3GHTA 3HGSA 1HG3A 3H2FA 1R6WA 3FA3A 1DWGM 4C7DA 2FVLA 1G4PA 4M29A 1V79A 8TIMA 4A3UA 4MLRA 2P53A 4NNCA 4B4HA 2BVYA 4O1CA 1W1A1 3OLGA 3CC1A 4EWJA 4NP7A 1BG9A 1XGEA 1H7XA 3BLKA 3B3DA 1UWRA 1V7AA 2PD5A 3KL0A 2QT3A 3RLHA 3NM1A 3ZIZA 2YIHA 1C92A 4K68A 4P7RA 3QBUA 3H70A 3W01A 2JQXA 4G1KA