3I6RA

Plasmodium falciparum dihydroorotate dehydrogenase bound with triazolopyrimidine-based inhibitor dsm74
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
376
structure length
376
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
publication title Structural plasticity of malaria dihydroorotate dehydrogenase allows selective binding of diverse chemical scaffolds.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Oxidoreductase
total genus 149
structure length 376
sequence length 376
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i6rA00
2F84A 1XXXA 2ZRYA 1SW7A 3QRHA 1RPXA 4GUGA 4UTWA 1EB3A 1ZJIA 1PCWA 1SR9A 4H4IA 4LV4A 3I65A 1EIXA 4RR4A 4NJGA 5A8GA 4CNPA 5F2IA 1P5BA 3TSBA 3FJ6A 3BG3A 4LOCA 4GUHA 1WAUA 5LGZA 4XBSA 5L9FA 1OYBA 3GAYA 2NLIA 2OX1A 4UTWC 3QMRA 3EXRA 3A9IA 4ADUA 2VFFA 2RHGA 3PWAA 4GJ1A 1YDVA 5LHEA 3NQ6A 1FQ0A 3P80A 3TNOA 5DCEA 3UWZA 1FCUA 4WD0A 3UY8A 4DF1A 4EVZA 4HN4A 2FQIA 1BTMA 1XUZA 1OHLA 2V5LA 4DQWA 1F76A 2Y61A 3AJXA 2W0UA 1WBJA 2FPTA 2VELA 2FTPA 4X22A 2PRHA 3S5YA 4EF9A 3TV8A 1T0OA 3I7RA 1U5JA 2ZRWA 3S1VA 3OHIA 3Q37A 2TPSA 1THFD 2DJXA 3DFQA 3KVJA 3BO9A 3GR8A 1KW1A 3B8DA 4K8HA 2QUVA 1JRBA 1ZHAA 3TJLA 3W07A 5LGXA 1OG0A 3NQ2A 3B4UA 3TXVA 4A2RA 3BLFA 3W3OA 1TPH1 2BSLA 1GG1A 4A2SA 4XWUA 2BLEA 4ZVJA 1I2RA 3DFPA 3L0NA 4M19A 3LCXA 3W7DA 3P5ZA 1LTDA 3DENA 3C2RA 3N19B 2NV1A 4GNJA 5CPMA 3L68A 1QOPA 3PR2A 2Y7FA 4MPQA 2J9ZA 4OT7A 4D2JA 1PHWA 1SW3A 2CZFA 5FF3A 4M6QA 3L66A 3T40A 3A5FA 4R34A 3TQKA 3TH6A 1Q45A 3N9RA 3SR7A 2FB2A 3GDRA 2I1OA 4XUGA 3S1UA 4FNTA 1SPQA 3SGZA 3W7MA 1W5MA 3KVKA 1QNVA 4UC5A 3DI1A 2TSYA 3P74A 2CFFA 3CIWA 1A5AA 1KFJA 1TQJA 2ZRVA 4NQ1A 4OWGA 4WZHA 3GYEA 4Q32A 5CZJA 4JX5A 1FWTA 2X1SA 1W3TA 4ZQRA 3WJSA 3R12A 2C13A 4O4VA 2QCGA 1ME8A 3EX2A 4I7UA 1XKYA 1ME9A 4WJEA 4NJIA 4U28A 2RDTA 4AHQA 3LI1A 4FXRA 4DO5A 1ML1A 2ATMA 4O17A 4ORIA 4OQVA 1OFDA 1K8YA 4HSNA 5HWJA 1XBYA 3UY7A 1OX4B 1XBVA 3S1XA 4XTDA 1T8XA 1ZNNA 2V30A 5H2ZA 3W2KA 3GNDA 2PRLA 1DBTA 4JX6A 3QW4B 5KINA 1LBFA 1TPVA 2VENA 1GVRA 3DFTA 4DF2A 1KTCA 1QPRA 1KBIA 2HS8A 3CEUA 3MBDA 3G18A 4OE7A 2JK2A 2QCFA 1TTQA 3A24A 3PUOA 2GQ9A 1SZNA 3M44A 4NX5A 1K3UA 2ISSA 1NF7A 1GWJA 1HTIA 1JQVA 1V5XA 4IOTA 1O60A 3RF9A 3GXTA 4CNOA 3R13A 2BTMA 4WY0F 3FEMA 5F2MA 4K7VA 4CQAA 1YADA 3TA6A 4O4WA 1DJQA 1WBHA 3SFKA 1CI1A 1H62A 3MP3A 5AN7A 2YYTA 3S5ZA 3S5OA 1M7OA 2OT1A 4ML9A 1TIMA 4X3ZA 1TTIA 1PVNA 3D0CA 4AHOA 2H6RA 4DXVA 4TX9A 5D04C 2AQWA 3RK8A 3UYCA 1V7YA 4M7TA 2Z6JA 3W6YA 1H60A 4UTLA 1FWWA 2V82A 1KM1A 2WJZA 4JN6A 3E02A 3M43A 2QAPA 3THQA 2ABAA 1DV7A 2J27A 3N2XA 3DAQA 1KM3A 2BX7A 2JGYA 3MBFA 3HOJA 3UD6A 3NDOA 4QM1A 3W73A 1LBLA 1DKWA 2O7QA 1TV7A 5F2LA 1YTEA 1T99A 2J6XA 3BG5A 4WXYA 4PFMA 4EF8A 3W87A 1BKSA 2A6LA 4UFHA 4LUJA 1GOXA 3LCHA 3S8HA 4CNNA 2DZPA 3FKKA 4ZQNA 5AB3A 3QQ0A 4NT0A 4IMDA 3GX9A 3M47A 4A21A 1XI3A 4XKYA 4YWIA 3O15A 3EX4A 4QSHA 2QCCA 5CGQA 1VHCA 1KM5A 2HSAA 1L6SA 4JTFA 4JTTA 3TW7A 3RFAA 4N4QA 3V1PA 4Z1AA 3G3DA 5GVJA 3UXAA 3GXNA 3W1NA 2PRMA 4JIQA 5HINA 3NAVA 2DU2A 1B9BA 1UCWA 2E6YA 4IMGA 4RKAA 4KFOA 3DKLA 3MJYA 3HGSA 2PE4A 3C2EA 1SSGA 2A85A 4FEZA 4AMAA 2NZLA 4BWLA 1U83A 2QCLA 3LCLA 3N14A 5AC7A 4G1KA 1WXJA 2CLKA 1VRDA 1GVQA 4FX8A 3NXFA 3TK7A 2ABBA 1PV8A 4IPIA 4S2BA 5C55A 5IM51 2Y6ZA 1MEIA 1LOQA 2A7RA 4BWLC 4IXHA 1ZENA 2V2DA 5AFDA 5MHBA 3VKJA 4O52A 3NG3A 1H7RA 2GVJA 1FXPA 1EA0A 1ZAHA 2EHHA 3DU0A 2W6RA 3M9YA 2A7PA 1KBJA 1DHPA 2Q8ZA 3L5AA 4PEKA 1PIIA 4UFIA 3LV6A 1K8ZA 1XDLA 3LLDA 4L4MA 4NUWA 3MI6A 4O0ZA 4M6VA 3GDTA 3LXBA 4O1BA 3MW7A 2FIQA 2G5WA 4CCDA 3LERA 5DN1A 4JYFA 3BW4A 1B3OA 5AYZA 4J9JA 3SY5A 3ZWSA 1LM1A 4YCOA 2B7QA 3GKFA 3BGGA 5HQEA 1YTDA 3LRMA 3KAOA 1KFCA 3QSTA 2XN1A 1H50A 1TMHA 5E0KA 1I8JA 5G2IA 1H7XA 4K6AA 2ALDA 1TSIA 6TIMA 5HWMA 4O54A 3S9YA 2V2HA 4EIVA 5ABTA 2BWGA 3TX9A 2WSYA 4LRSA 3MP5A 4FIQA 2WKJA 1X6UA 3TJXA 3IEBA 2AGKA 5KITA 3CPRA 4OGZA 3LHUA 3BG9A 1EWEA 1RVGA 3STFA 2CZ5A 4NZFA 3O05A 2VFEA 2GVLA 3HIJA 2HS6A 3PBWA 1F05A 5A5WA 3PG9A 1UBSA 2YR1A 2DZTA 1B4KA 3ABRA 1P4CA 2RDWA 1C29A 2BZNA 4KFPA 4NJHA 1QR7A 3W71A 1O95A 1Q6OA 3NM1A 1IXPA 5EA9A 4UMBA 1G7VA 1SSDA 4MY1A 3PC0A 5K2ZA 1F73A 4HKPA 4LW7A 4MYAA 4R7JA 5E93A 3W2MA 2QUUA 1ME7A 3DHFA 1J2WA 4ORMA 4MVAA 4O12A 3KX6A 1QAPA 4LS0A 1AK5A 4FX6M 4N6EA 1ICPA 2QR6A 3O6DA 4X2RA 5BNKA 3JS3A 2WOQA 1KFBA 5KZMA 1P0KA 5LNSA 4UTTC 4IQLA 1A5CA 3TC6A 4BI7A 3MUXA 1FCQA 1Z41A 1FDYA 4MY9A 3MP4A 4KFNA 5F1UA 1GJPA 4O16A 1IF2A 3NQFA 1H5YA 4O15A 3CWOX 1F6PA 1JR1A 4E0CA 3VCRA 2TYSA 3R5EA 4O50A 4LNYA 3HPXA 2J88A 2C14A 3FYOA 4UR7A 1VCVA 2WV8A 2YXGA 1G4PA 3GVGA 3WJWA 4PODA 2ZTKA 2QCEA 1PCKA 3QC3A 2O7SA 3KRSA 4DBDA 2B4GA 3GK0A 1FY6A 4HPXA 3W7CA 3U2OA 1SZGA 5D2XA 5BOOA 1SO4A 2DZUA 3PBVA 1J5TA 1K7XA 1ZCOA 5FEWA 4FNUA 4HT3A 1Q6RA 4JYDA 3AO0A 3M5XA 4LVBA 1JULA 4K36A 1Z48A 3CC1A 5K9XA 5AHLA 3NM3A 4P2VA 1LRNA 1BWLA 1YLVA 3GLCA 3CQ0A 2EPHA 3B06A 3OEXA 1TJPA 3NQCA 5HULA 5I3HA 4K7YA 2Q3OA 5LKYA 3DGRA 4H3DA 3GIYA 4KWWA 1KFLA 1F5ZA 1G69A 1WOBA 2Y88A 3W1MA 5LNUA 5G4EA 5J5RA 3W7IA 3VNDA 1QO5A 3RNDA 1CX9A 3CWNA 2CLLA 4NX0A 3EWXA 3W7LA 3W1QA 2A4AA 1FWNA 1M7PA 3FOKA 2OT0A 3PM6A 1OYAA 1XM3A 3IIZA 5LZLA 1KM4A 3NZ1A 3OG3A 3KFTA 4ICNA 5AC6A 4S1FA 3TIMA 1WA3A 3NNTA 1D3GA 2FFCA 1DJNA 1DORA 2OZ0A 5D09A 5K4ZA 1H7OA 1QWGA 1XFBA 2E5BA 2R14A 5D05A 3LHTA 1F74A 5D2WA 3LGEA 1OF8A 2V5BA 2UV8G 5HNRA 3PG8A 1N8FA 4BFAA 2A7NA 3QMTA 3EB2A 2X30A 2V9DA 4Z1CA 3A5VA 4NJKA 3N34A 3Q58A 1GVSA 3RLUA 4JTIA 3NQ7A 4YLWA 5DY2A 1DVJA 1QFEA 1O5KA 3H55A 3CHVA 1OFPA 4UCGA 1VC4A 2FPYA 1W37A 1L2UA 5G1TA 4YXGA 4CLMA 5DCBA 5F4XA 5G2HA 3W7KA 1G7UA 4GXMA 3PB2A 4C1KA 4JNMA 4UXDA 2F7FA 3NQAA 2YDAA 4FIRA 5U4NA 2X2GA 5KSWA 3QEZA 2YCEA 1TPFA 4JR5A 2QCDA 1JCLA 1WYIA 3IIPA 2DZSA 1JCNA 1X8FA 4L4LA 3IV3A 3FJLA 3PSWA 3W22A 1OK4A 4TR9A 4HHPA 5TIMA 4AF0A 5AOUA 5BW6A 2ZRXA 4JXCA 3CT7A 4FNSA 3NQVA 2Z1BA 2NUWA 3FKRA 4RZ5A 2CLOA 3Q2DA 1EP1A 5AC8A 3ABOA 3UXDA 3G0UA 5F4SA 2R94A 4JTSA 5EL1A 1VQTA 2RH9A 1IXOA 1JRCA 1LLZA 1ICQA 2IQTA 4JYEA 4O11A 3TAOA 5D30A 2NV2A 2ISWA 3LXAA 4QNEA 1KM6A 2CW6A 5KMYA 3L65A 1ADOA 5EKYA 3N9SA 2C18A 2B7NA 3WJZA 1YXYA 4FO4A 2QAFA 3W84A 3F4WA 3E49A 3W72A 3W7EA 3WK0A 1I2QA 1RV8A 3IGUA 4NNBA 4E38A 1NEYA 2JKPA 4GE8A 3ANYA 3HPZA 1QPQA 1W8SA 5HJLA 1OYCA 4DPPA 3CIXA 3NO5A 3G8RA 3ZR4A 3NPVA 3OVPA 5FI8A 5G1YA 5CKSA 2ZZ6A 1I2NA 1HO4A 2TRSA 3M6YA 1GQNA 3TAKA 3B0VC 3G1SA 2WNQA 4XZ9A 1EPXA 1SFLA 1M5WA 3C56A 1TB3A 2WO5A 3VE9A 1WOAA 1VCGA 3ZS4A 1TTJA 1K8XA 5HWNA 1G67A 2ZZ1A 2NUXA 3QPZA 4CQ9A 5F2GA 4AH7A 3KVLA 4FX7A 4N9BA 4LWWA 1OFEA 3CB8A 2YW4A 3DFOA 2NXGA 2B7OA 1GVFA 5F1VA 1VLIA 2C15A 2DP3A 3NYZA 4IMEA 3W1TA 1SZEA 1JJKA 3HGJA 2JKEA 4DF0A 3PUEA 4AWTA 3BARA 4RZ6A 4QITA 3IVSA 3IGXA 1KFKA 3EX1A 5D33A 3UNDA 3W23A 3TR2A 1M6JA 3CEPA 3TC7A 2ZZ7A 2CZDA 3OVRA 1Q6LA 3HQ1A 3HB9A 3H53A 2Y7EA 1R2RA 3PY2A 2Q8LA 2C16A 4O53A 5DY3A 2ZCGA 2QJIA 1L6YA 3Q94A 1UB3A 4I7WA 2YW3A 1I2OA 1OJXA 2G96A 2EGZA 5FESA 2HMCA 5HR6A 5I3GA 3S1WA 1TO3A 3M1ZA 5D32A 3MI3A 4XTIA 2E09A 3HGRA 3L0GA 1K03A 1FUYA 1NAL1 5LSMA 5EPDA 4GWEA 5D02A 5KZEA 3DXIA 3R2GA 1O5XA 1TPB1 1H63A 5EYWA 2V81A 3NVTA 2ZFAA 5IBXC 1GG0A 4I7VA 4UTIA 1XBZA 2E6FA 4AVFA 3VI2A 3I7QA 2B0MA 4XQ6A 1OF6A 2Y70A 1WQ5A 2CU0A 2QKFA 3GDKA 4UMCA 1UASA 3O6YX 4JD4A 2QJHA 3C61A 5H91A 1H1YA 2Z6IA 1SO5A 2OCZA 2ZDRA 4LY8A 3P8IA 2ZZ5A 4FHAA 4IJBA 1OX5A 3A23A 3NGJA 4NXSA 3WK2A 4LC6A 1VCFA 8TIMA 4N4PA 2GQ8A 2A5HA 3O63A 1TYGA 2Y63A 4TO8A 3MHFA 4UR8A 4Z1BA 3LCWA 1YDOA 1TPUA 1VYRA 3TFCA 3FS2A 2CZEA 3WJXA 4LVGA 3BK0A 3JRKA 3CLMA 4NNCA 5C6MA 3L5MA 3L0KA 5CPLA 3W70A 1W3NA 3OVQA 3UWUA 1DQWA 4FNRA 3NPXA 1SQ7A 4JTEA 1WX0A 1XC4A 2Y7DA 3LTPA 1P1XA 4O13A 3O06A 5CSSA 3QMSA 1LRTA 3TQVA 2E5DA 1VH7A 3TE9A 3TUUA 1EP3A 2H8XA 1OFQA 3WFAA 1R2SA 2V0TA 3MI2A 1IXNA 1ICSA 1LDCA 1W0MA 3DKJA 3PS7A 4M5PA 2NWSA 4GC4A 5CPOA 4LV9A 1RQHA 1ZFJA 2QDHA 1OVDA 4Z0JA 1PE1A 1PHQA 3HMJG 2D73A 3L2IA 5AHFA 2YZRA 3W76A 3L9CA 1NVMA 4TMCA 2VKZG 5CZSA 3W1XA 4LRTA 4ADTA 1GTHA 3TSDA 5DLCA 2GQAA 3NL3A 1SZFA 2FDSA 2A1YA 4M6PA 1FBAA 4IX0A 4PH6A 2C0AA 1LROA 3NQEA 1LBMA 1TRIA 5E1QA 4CCEA 1Z42A 1RZMA 4IX2A 4OV9A 4BI5A 2C1HA 3EKZA 4GUIA 4UFJA 3EWUA 4QIUA 2J24A 6ALDA 5EMUA 1QMLA 2DJLA 4TIMA 4O1DA 3CU2A 2VFGA 1HG3A 1JUEA 3UPBA 3FYPA 1HL2A 3G22A 3CM4A 3EXSA 1KLZA 3NL2A 4YL2A 1C8VA 4TMBA 1SFJA 3NQMA 4QNWA 1DQXA 1XDMA 3A22A 3TMLA 3NEVA 3T44A 3OIXA 3EXTA 3K30A 3M41A 4GUJA 4MLRA 5FEPA 2I14A 4JTGA 1X1OA 4QQ3A 4ZQOA 4LVFA 4LTSA 4UTTA 2ZYFA 3B04A 1ONRA 3GDLA 3KRUA 2JGQA 3BW3A 2EKCA 3EX3A 3QYQA 1YDNA 3G0XA 1UUMA 4UIOA 3P62A 1B4EA 4ZQPA 4Z08A 1ALDA 2FPVA 2XN0A 3DH7A 2QUTA 1OFOA 2FB3A 3G1DA 4ALDA 3STEA 2E6AA 2NUYA 2J9YA 5K3VA 3DBPA 4N9DA 3EEGA 4JEQA 2A21A 4MOZA 2VXNA 3B05A 1AW5A 3CTLA 4Y9AA 3G24A 1GYNA 3V75A 2E1DA 5DBUA 1D3HA 3INPA 2GJNA 3HG4A 1QCWA 4Y90A 5DELA 3A21A 2PC4A 1S3HA 3G3MA 1X7FA 2KZHA 3QW3A 5SWUA 3R8RA 1N55A 5D38A 3EWYA 2Y62A 3QF0A 5AHNA 4IGHA 1DL3A 3C2OA 3NOEA 5EY5A 1JCJA 1LORA 4RJEA 3F03K 1P0NA 2C3ZA 4BF9A 2VC6A 2YPIA 3GDMA 4WY0A 2XFWA 3T55A 3WJYA 3M0ZA 3BGJA 1TCDA 3LBCA 1A5SA 1GTEA 4NJJA 3G8EA 3QQ1A 2H3BA 3SI9A 4O19A 1AW2A 3LHWA 3ABQA 4RCXA 1GYLA 1SO3A 1TQXA 1UJPA 3S0CA 2QEZA 3W75A 3W9ZA 3PULA 3TXZA 1F2JA 3DFSA 4FB7A 3T78A 3ATZA 4UNKA 1FCVA 2HTMA 2C6QA 1RR2A 4POCA 1QDSA 2YX0A 1TPWA 4MLJA 1L6WA 1BWKA 4H6KA 1W3IA 3BV4A 1LZOA 1MXSA 1G4SA 1JUKA 3UZJA 3M5YA 2ZTJA 3LB0A 3O8AA 5AHEA 2ZQ0A 3TDFA 3P61A 1QOQA 1ZY9A 3IVTA 1HUVA 3W85A 1ZAIA 1CW2A 2V8ZA 3L21A 1EP2A 1W5PA 3HPSA 4OU1A 3QJAA 1LOLA 2YFOA 1SU5A 3G1HA 1YPFA 5FEXA 1H51A 1RD5A 1FWRA 1H1ZA 2YSWA 4DPQA 3I6RA 4NVTA 1X1ZA 3P84A 4UFKA 4XKYB 3HG5A 3LTSA 2ZRZA 3W2LA 1D9EA 3YPIA 1FXQA 1KV8A 2BXVA 2EF9A 3TROA 3P60A 3GNNA 3W86A 3NL5A 2OJPA 3W1LA 3W2NA 2WSRA 4HSOA 5FF7A 1RQBA 1O94A 1YXDA 1KM0A 2H8ZA 3W88A 1WV2A 1W56A 3DHDA 4R33A 4IMCA 4Z0SA 2RFGA 2G95A 3F4NA 3C2VA 5G2WA 3SGUA 3B0PA 5G4WA 2EAWA 5D37A 4RX0A 3SZ8A 1F7BA 5KTLA 1XUUA 4TU1A 4CQ8A 1N7KA 1QPNA 3NPWA 4ZL1A 1Z44A 3MYOA 3SIZA 1AL7A 3HO8A 2QDGA 2Z2UA 1EEPA 1YYAA 4O28A 1EUNA 4WUIA 3W7NA 2OMAA 1IIHA 1H61A 4HIBA 3KVMA 1KTNA 3C3NA 3KXQA 4AB4A 5TQLA 2VOMA 3IRDA 3ZFHA 2VEPA 2Y7GA 5LNWA 4KKXA 4MUZA 4AHPA 4JTLA 4UTMA 3BPWA 2A6NA 3VE7A 5CZ0A 7TIMA 3GR7A 1LP6A 2NX1A 1L9WA 3FFSA 1R47A 2E77A 1VLWA 2ISVA 2ZZ4A 2W79A 3PUDA 4X9SA 3W2UA 5K7JA 3U8GA 1Y0EA 2QCHA 1LYXA 2DZWA 2XN2A 1MO0A 3C8FA 1VGAA 4M7SA 4Y8FA 1H7NA 5I3JA 3I68A 2E6DA 4B5NA 4P61A 5C54A 1KTBA 4GRSA 2CLEA 3ELFA 3W83A 1IGSA 3C2FA 3KOFA 2NXHA 3MMTA 4N9EA 3B03A 3QPYA 4IPJA 1FDJA 3ABSA 4PTNA 3LRKA 5DBTA 4K39A 1S5TA 2X1TA 3NQ8A 5K9DA 1H7PA 1YTKA 2A0NA 3UWVA 2RDUA 5KZDA 2R91A 2E5CA 1A53A 4O57A 2QJGA 2P1FA 5HR7A 4GUFA 4K38A 2QCMA 2YFNA 3HG3A 4LC8A 3C52A 3E0IA 1K02A 4WOQA 3BW2A 1EUAA 4Z1DA 3HJZA 5CZTA 1S5VA 2DZVA 2RKXA 1JCXA 4YCPA 5LNRA 2GVGA 1OX6A 4DBEA 4N02A 3W2JA 4UUIA 2DORA 3PBYA 4UFMA 1O4UA 1KFEA 5FF4A 3PF3A 4BK9A 2WNNA 2CLMA 1LRQA 5DXXA 2PURA 3C0JA 1MSSA 2H90A 4K37A 4MYXA 1PL9A 3DI0A 1IXQA 3OBKA 3S42A 1A5BA 3STCA 2VFHA 3PAJA 1KM2A 2CLIA 2E68A 4HNUA 1VYPX 1RQEA 4DELA 3T4CA 2VFDA 1VJIA 1E51A 1SW0A 1C9DA 2Z0IA 3W1PA 3R89A 3GXPA 2WQPA 3MWAA 3W7GA 2X1RA 2JKAA 3ATYA 4A22A 1G6CA 2CLHA 1JCYA 3P81A 3LTYA 4WXZA 4MZ8A 4NNAA 4MZ1A 4O1CA 2VEKA 3M16A 5I3KA 4FNQA 4GFSA 2A2IA 2DZXA 3UWWA 4MY8A 1BEUA 3N3MA 4N2YA 3SJ3A 3NPUA 1R46A 3MHUA 1GEQA 4FNPA 3TKFA 1JCMP 1TPDA 3LV5A 2CWNA 1TV8A 1I2PA 4MIMA 2V2CA 4WOZA 3PVFA 3TQ0A 3W7HA 3EX6A 1MEHA 4O1AA 1LOSA 4AEOA 5IBXA 4AWSA 1R2TA 1LCOA 1JUBA 3SSJA 3P7YA 3STGA 4UMAA 4ZQMA 5FEZA 2G97A 3USBA 2ZA3A 3KHJA 1PS9A 4MZYA 2QF7A 1DOSA 3QM3A 1VYSX 3W1UA 4ONVA 1J4EA 1W5QA 3IIVA 3IGSA 1G4TA 1SO6A 3LRLA 5HUPA 4QAIA 3M5VA 4FF7A 4WY0B 1GZGA 4RV8A 3E12A 4UTKA 4NU7A 5DXYA 1TV5A 3PB0A 4OBTA 3DZ1A 4EWND 2NX9A 1Q3NA 3NL6A 1W54A 5F4WA 1K7FA 3MHGA 4Q33A 1K7EA 4O14A 4ADSA 4LS2A 1H7WA 3LHYA 3OA3A 3LOTA 2Y89A 1VS1A 4DEFA 3EKLA 3PBUA 4C1LA 3LX9A 2FLIA 3GB6A 3M7WA 3I7SA 2WSQA 2NX3A 2Q3RA 3NZRA 3W7PA 3W7QA 5D03A 2ATSA 3C4UA 4JTJA 4HNNA 2NWRA 3S6DA 3LM7A 4N6FA 2ZZ2A 1UUOA 3TW6A 2GPTA 4PC8A 3MO7A 4XBKA 5FF0A 3VFLA 2VFIA 1KA9F 4PL2A 2WNZA 3MYPA 4WX2A 1XBXA 1I4NA 3LBMA 4ZQCA 3FLUA 3O16A 2H3DA 1TTPA 4FXSA 4O8RA 1TPEA 3QZEA 2VEIA 2YGYA 4RLIA 4PCFA 4RXFA 3QFEA 4OHQA 2ZA1A 2Y85A 1XL9A 4MKNA 2YYUA 4IWWA 4A29A 1NF0A 4NZJA 5U7SA 1W5NA 4MFEA 3EWBX 3LHVA 5LNVA 1JVNA 4JGDA 3NA8A 4PA8A 1F6KA 1G4EA 3P5YA 2I9EA 3W74A 3ZWTA 3O07A 3T7VA 4JDYA 3LCIA 1VHNA 4DO4A 4JTUA 3NQGA 3E9AA 4A3UA 3UQNA 1W31A 3DFNA 3EWWA 1B57A 5AYYA 4E2DA 1QO2A 5TBOA 3IVUA 1OX4A 3RMJA 3PSVA 2WPBA 5DCDA 3SW6A 5G5IA 2ZZ3A 5BMWA 3P67A 3QSRA 4JICA 2J9XA 1IIGA 1NSJA 3E96A 4S2CA 4K8EA 3BVJA 3N73A 3LCFA 1SUXA 3TMQA 4PL1A 5J5DA 4N9CA 3O6CA 4GBUA 1MZHA 3HG2A 4IMFA 1AG1O 1AW1A 2QCDB 3G1FA 1AMKA 1W5OA 1R30A 3THAA 1OFAA 5HMSA 3NR0A 3BLEA 4AF0B 4AWUA 4KWVA 4UTUA 3G1XA 1YXCA 1OFRA 4AXKA 3P8JA 4BI6A 5LHFA 2CLFA 4LT9A 4RZ4A 1HO1A 2TMDA 4JS3A 1GT8A 4IXXA 1ZAJA 2P10A 3BLIA 3RU6A 1VPXA 5I3IA 1I45A 3SECA 2ZA2A 4DO6A 4HNVA 1FWSA 3TCEA 3UPWA 1GVOA 4ZZ9A 3H54A 4RXGA 4WQ6A 1FCBA 1WDWA 3G0SA 3FIGA 5D2VA 4O18A 3TSMA 5CG7A 4EOUA 4LVDA 2GUUA 4UNLA 4UTJA 3WK3A 1FDZA 2X16A 1KLYA 3S5NA 3C6CA 3UWYA 3L67A 4JDBA 1XCFA 4QISA 3W7JA 4O0KA 5BRBA 2NXIA 4ZMGA 4W9TA 5BMXA 2PCQA 1JQXA 2JBMA 3EWZA 3HBLA 4HNTA 3FA5A 4CCCA 1VR6A 1KV5A 1A50A 4U4MA 3UWQA 3O1NA 3HGOA 1S5WA 2P0OA 3QH2A 4MJZA 3W1RA 3L5LA 5L6UA 4YMZA 3NQDA 3UZ5A 5K9CA 2B7PA 4BR1A 3LHZA 1TREA 3B0UX 2C19A 2VEMA 3G1VA 4Y96A 3IIOA 2AAMA 3HF3A 5FF2A 3JR2A 1ZALA 4E2BA 1AL8A 5D2TA 1QPOA 1OK6A 4MFDA 4Q4KA 3WK1A 1LLWA 1YPIA 3TFXA 2ZRUA 1GPWA 5CPNA 4LUIA 3M5ZA 3LLFA 4OV4A 1TJRA 1FX6A 2QCNA 2LLEA 4RK8A 4HPJA 3KRZA 4JX4A 4JY9A 4R53A 5C5YA 5AHMA 4LU0A 4O10A 4JIPA 4QJ1A 3RLVA 3GAKA 4JTHA 2GJLA 4MJMA 5AHIA 1EWDA 2FJKA 5AYXA 3LDVA 2X1UA 4IUOA 4JY8A 5T26A 3N2MA 2ZBTA 3GKAA 4Y6GA 1EX5A 3LXCA 1NFBA 2R8WA 1VZWA 3IIXA 1TPC1 3U6WA 1Q6QA 5EBUA 5K4XA 5HUOA 3LI0A 4LS1A 1HFBA 4NXKA 1OFBA 1TRDA 3F1QA 4JTKA 3P82A 4UTHA 3W7OA 3W7RA 4I9AA 3G1YA 4LVAA 5CSRA 3TU9A 1T96A 5D2YA 1OABA 5C2XA 3GZ3A 1MEWA 3LCGA 1W1ZA 4UFLA 2GOUA 3W1AA 3G1AA 4AAJA 5I3FA
chains in the Genus database with same CATH superfamily
1XXXA 2ZRYA 1RPXA 4GZ7A 1TWZA 4AUBA 2WWCA 3WENA 4UTWA 1EB3A 1EIXA 1ZSXA 3GW3A 4ML4A 4EANA 3FJ6A 1US3A 1WAUA 1XIGA 5LGZA 4YHEA 2OTDA 4XBSA 1F07A 3RX2A 5L9FA 1OYBA 2V5DA 2NLIA 3GAYA 1PKNA 4ADUA 3WQFA 4KIRA 4G2DA 4DF1A 4EVZA 4F2TA 5HPOA 1BTMA 1OHLA 2J8GA 3MUZ1 4G5DA 1WKDA 1F61A 2XFRA 2FTPA 2PRHA 4EF9A 3DIPA 3MVIA 1UOKA 3S1VA 3OHIA 3ZVIA 5DANA 1THFD 3T81A 3BO9A 3GR8A 2YDRA 2OXNA 3W07A 3NQ2A 5I78A 3TXVA 2OLAA 1I2RA 4M19A 3LCXA 4MDOA 2WCAA 4FOJA 3BAJA 4OUIA 3N19B 4GNJA 1QOPA 4XAPA 4Y8EA 3WUEA 3PR2A 1GHSA 3WH8A 2WVVB 3QOMA 4MPQA 2DQXA 3VXGA 2DFAA 2PDLA 4E2OA 4EE9A 2QHAA 4OT7A 2CZFA 4C7FA 4WJXA 2ZVIA 3MV11 5FF3A 3AS0A 2J7DA 4JN7A 3CZEA 4B91A 4HHLA 1WPCA 4XUGA 3KVKA 4JFTA 2VM8A 3I3BA 2TSYA 3P74A 2VR4A 1XLMA 4KETA 1A5AA 1TQJA 1XCXA 4QR6A 4NQ1A 3GYEA 1G01A 5CZJA 5JIPA 1LT8A 3R12A 2C13A 4O4VA 1W91A 4I7UA 1XKYA 4H83A 4WJEA 3MO4A 3TP4A 4U28A 1WKEA 4V2XA 2WMGA 3LI1A 4FXRA 3GTFA 1JCTA 4XZBA 2E8YA 2VX6A 2V5JA 3NO3A 1K8YA 4ACZB 1OX4B 3T0CA 4XTDA 1T8XA 1H4PA 5H2ZA 4TX6A 1WE5A 3QW4B 2O9RA 1LBFA 3K5XA 4I5UA 1GVRA 4DF2A 4H9UA 1X38A 3D47A 1QPRA 4QGCA 4GA8A 4RPQA 3WNOA 1K3UA 1J9YA 1W9BM 2PWGA 2I17A 2O9OA 1V5XA 1O60A 2F8QA 3ITOA 5IOBA 3WLRA 2G3NA 3PZQA 3DYPA 4K7VA 1V0KA 4CQAA 1XICA 1YADA 1QASA 4LAUA 4O4WA 3TTEA 1WBHA 1X39A 2VUNA 3N2CA 5AN7A 3S5ZA 5IDZA 1M7OA 2OT1A 1TIMA 5C9WA 4O0QA 1TTIA 1PVNA 3D0CA 4AHOA 4MKVA 4QG6A 1J11A 2WVTA 4TX9A 3OGVA 3FYYA 2AQWA 3SUTA 4YYFA 1J79A 1FWIC 5LA2A 4X60A 4MAZA 2EPKX 7A3HA 1P0DA 4UTLA 3WF3A 5A2CA 1H5VA 3BV7A 4AY7A 5CPTA 1KM1A 3M43A 5IHRA 1V0MA 1R9YA 1IEWA 2JGYA 1E9IA 3VIJA 1KC7A 4QM1A 3TC3A 3WDHA 3PWGA 4RNFA 2BODX 4WXYA 4EF8A 2WB5A 1UWRA 4ZGYA 1ONXA 3S8HA 3GVRA 2DT2A 3FKKA 5T91A 4W8BA 5AB3A 4DNMA 5I02A 4ZE5A 3GNRA 4IMDA 4A21A 1XI3A 4YWIA 2XTKA 5CGQA 2PD5A 2HSAA 3BAWA 4JTFA 4U10A 4N4QA 2VGBA 1BG9A 4REQA 2P0IA 3UXAA 1DE5A 4AZ6A 3GXNA 2PRMA 3T2PA 4JIQA 2D0GA 1U22A 1QK0A 3PHAA 3OGRA 2WHMA 3MJYA 3HGSA 3C2EA 2FMOA 4FEZA 4GX8A 3FXYA 1IV8A 1FWHC 1AVAA 7REQA 2C91A 2CLKA 3EWCA 3NFUA 4O1FA 3DG3A 1GVQA 4FX8A 1J8VA 3S9IA 4S2BA 5C55A 3ZR6A 1E4LA 2EPNA 4GFIA 5H1WA 5AFDA 3MJMA 2X42A 3PZTA 1OADA 3NG3A 2IXVA 2WXDM 1ZAHA 4E8CA 3B9AA 1ZGDA 2W6RA 3RMEA 2OZTA 1PIIA 3N4FA 2MUCA 4W5ZA 2DV0A 1R3VA 4O1BA 4E4UA 3MW7A 2FIQA 3GH4A 1HGWA 2ZUMA 2XU2A 1RJRA 4UB9A 3BJTA 3SY5A 5IXEA 1CPUA 1LM1A 3QPEA 4GI9A 4YCOA 3GKFA 3NQBA 1YTDA 2Z1SA 2XN1A 2PWEA 4BZYA 1UKQA 5G2IA 4GI6A 4AD4A 2UY2A 4Z2JA 4FR6A 1FWBC 5ABTA 2CHNA 3AYRA 4K68A 3VIPA 2WZTA 3IEBA 3UU0A 3OPSA 5C2GA 5A69A 2OX4A 3LHUA 4GQGA 1OIMA 1CGWA 4NRRA 2CZ5A 1ZZMA 3O05A 3HIJA 2D0FA 1NQKA 1G9HA 3PBWA 1F05A 5A5WA 3PG9A 3VTRA 1B3WA 1FHVA 3N18A 3IK4A 3V16A 5I09A 1P1MA 1V6WA 1WNOA 1A4MA 1TVPA 3ABRA 3N3TA 4QQUA 2XH7A 3SAZA 1EZ2A 1IXPA 1G7VA 4Q8UA 4MYAA 2NSXA 3N2OA 3OOQA 1J2WA 4ORMA 4WRHA 4O12A 2RJHA 4EAMA 1W1PA 1XIDA 4LS0A 3PN8A 5LXXA 4FX6M 1P6WA 2HBXA 2XGZA 3OZYA 5BYWA 1YPXA 2ESCA 3LYEA 4C7GA 3NZGA 4IQLA 2PP3A 2OYMA 2YB4A 1FDYA 4KFNA 3BJFA 3NQFA 4H6QA 1H5YA 2E67A 4O15A 2R6OA 5ABFB 3R5EA 4LNYA 3FGCA 2J88A 1H09A 4QRNA 1YHTA 3VGHA 2OR2A 2PTZA 4K2SA 4Y9NA 2WAGA 4DUVA 4W84A 4DBDA 4CU6A 3QTPA 3UCCA 1OSEA 5CPSA 2ZOXA 2WSPA 2PS2A 3NURA 5EFDA 1SZGA 1YW1A 1VAHA 1K7XA 4IFKB 3KE0A 3MCMA 3WD2A 2CBVA 5BZAA 4LVBA 3B8UA 3LA4A 1JPDX 3VZXA 5AHLA 4B90A 4YTUA 3UG5A 3HPAA 4GACA 3GUGA 3VMPA 1J0KA 3J7HA 1BSLA 5LKYA 1XIHA 4JFUA 3S6TA 3THCA 3U57A 4IIGA 1BSIA 1CDGA 2PTXA 3RNDA 4F66A 2IXUA 2J74A 4QDPA 4Z1YA 2HBVA 3PZUA 1M7PA 3FOKA 4GABA 4FOKA 3PM6A 1OYAA 2QPXA 3VFCA 1KR1A 1KM4A 1BKHA 4ICNA 1XHGA 1W9XA 2PSNA 3B0XA 4IH3A 3OYXA 3VNMA 1DJNA 1GEHA 2OZ0A 3BOFA 3CGTA 1C3FA 2R14A 4ATDA 4JFWA 5D2WA 4C60A 2ZDSA 2UV8G 4AZHA 2HVNA 4JTQA 3EB2A 2X30A 4H8UA 1G0CA 3A5VA 3S83A 4REQB 2QVHA 1R3YA 3RLUA 4YLWA 5DY2A 2BASA 4ZO8A 3XIMA 3I10A 3AMCA 3CHVA 1TV3A 3ZYZA 4UCGA 1IEQA 4PUDA 4CLMA 5DCBA 3NSNA 1AODA 3OW1A 3LMYA 4GXMA 1NQ6A 1W3KA 1AD1A 1YNPA 4E6MA 4PRRA 1EL3A 2XVGA 2JEQA 2YXXA 2OO0A 2YJQA 2YDAA 1TPFA 1CXIA 4E8GA 4HP5A 1E0VA 1JCNA 2XG9A 4PTXA 3IV3A 4WSKA 3FJLA 3W22A 1OK4A 2Z1VA 2V69A 3EOEA 4V15A 3LBOA 2C7FA 4AF0A 5BW6A 3NQVA 2Z1BA 2NUWA 4RZ5A 5KZ6A 1EP1A 4G8TA 1GVEA 3UXDA 3G0UA 2Z7GA 4C6CA 2RH9A 1ICQA 4O11A 2Q01A 3TOYA 5D30A 4QNEA 2CW6A 3N9SA 5JUVA 2B7NA 5E5CA 3A3XA 3PUGA 4QLKA 3E49A 3WK0A 5AZ0A 1DWIM 3H2FA 4HA4A 2WMFA 3QV8A 4GE8A 6ENLA 1QPQA 3NOYA 1UZ4A 1WZAA 1E6ZA 1GVYA 4NL1A 5FI8A 4J35A 2X7WA 3ARSA 4M82A 3VDCA 4XZ9A 4FLQA 4IJRA 1EPXA 3CYJA 2G41A 2WO5A 3VE9A 3E0VA 1VCGA 4DZAA 3UVAA 1K8XA 3POHA 1LWJA 4G1NA 2TAAA 3QR0A 2NUXA 3QPZA 2XFFA 2XVLA 1XS2A 2ZUVA 2B7OA 2C15A 4UZUA 2QMJA 1KQYA 4DXXA 2ZUSA 1A49A 5TF0A 3L4ZA 3VX0A 4D6IA 2YCJA 3CQKA 1GK8A 1NDVA 3IK2A 3PUEA 5FL1A 2VT0A 4AWTA 4F0HA 3BMXA 4R9XA 2PC8A 1GPFA 3L2LA 3W23A 1BXBA 3TR2A 1LF1A 3B8VA 3AHXA 3HQ1A 3W27A 2XUCA 3UR2A 4C6LA 4QE4A 2Z1KA 3KWSA 2QJIA 2XIIA 1UB3A 3VGEA 4HZ7A 3SCPA 4DI8A 2BY3A 2F6KA 1SFSA 3S1WA 4Q8TA 5D32A 3SGGA 3MI3A 3HGRA 3TYZA 5LSMA 5EPDA 3QLDA 2Y0FA 5CSUA 2VQTA 3R2GA 4XO6A 3SEPA 2ZUTA 3V1HA 2Z7KA 1MW0A 1O12A 4LAOA 4CN4A 3MPGA 4UTIA 2E6FA 3ZM8A 5EMYA 4R3UA 5H6HA 2JE8A 3VI2A 1EYEA 3IJLA 3MVTA 4CN6A 4F2BA 2Y70A 2CU0A 1M9HA 3GG7A 4WK9A 4UMCA 5AVHA 1EJSC 3LPOA 4MWAE 3GHRA 3C61A 3ABZA 1H1YA 3DDMA 4NZ4A 4ICCX 2OCZA 3P8IA 2ZZ5A 3P93A 3A23A 3WK2A 3EPNA 1VCFA 8TIMA 3O63A 1E4MM 3CWHA 5AY7A 1TG7A 2Z26A 2UZ9A 3R58A 3S3GA 1RK5A 2OPJA 4NAFB 3TYBA 1VYRA 5C9XA 2L5HA 5C70A 3LGDA 4JCLA 5CC6A 3BLKA 4XG1A 4FK9A 2FJUB 2DSUA 3JRKA 3CLMA 2VMFA 1WAWA 5CPLA 3VKCA 1W3NA 1EEXA 3M0JA 5DMNA 4JTEA 1WX0A 1N8IA 5CSSA 3MDWA 1BAGA 1MW2A 3PBGA 3TE9A 1X6LA 3TUUA 3CNYA 1NP2A 3BQ5A 1OFQA 3CH9A 1BQGA 1R2SA 2V0TA 3EA3A 1W0MA 3PS7A 5JIWA 4GC4A 1ZFJA 3M0IA 1PHQA 3DHPA 2P50A 3D3FA 3SY1A 1FOBA 1UP0A 4Q7IA 1GTHA 3TSDA 3WIJA 2PDWA 2VCBA 5DLCA 3ITVA 2BY1A 1DTNA 1SZFA 2P8CA 2FDSA 2W4XA 1B54A 4OZOA 2A1YA 4YTTA 3MKVA 1YDYA 1OCJA 4PH6A 1F3WA 4HCLA 4CCEA 1PZ2A 1Z42A 3F7JA 1RZMA 4IX2A 3ITCA 2VR5A 3GW0A 5BXPA 5T9BG 1K9FA 3WQWA 3PTKA 6ALDA 5EMUA 4MM1A 3BMVA 4C6KA 3T2OA 2VFGA 1HG3A 1CIUA 5JU6A 7PTDA 1E5NA 4C5ZA 1HL2A 3WLHA 3TTOA 4NF7A 2PWDA 1X96A 2CBUA 3NL2A 4PMYA 3TQPA 2RJGA 9XIMA 1KCLA 1SFJA 4FI4A 1XDMA 3TMLA 4PSRA 2WBKA 3FVMA 3I3EA 4GUJA 4MLRA 4QQ3A 1A47A 1E1EA 5FSEC 4ZOAA 4ZQOA 4UTTA 3B04A 3PTDA 4I5RA 1JIBA 4LUTA 1B2YA 4JTAA 3B9EA 3QYQA 3H8AA 1UUMA 1RCOB 3P62A 1R86A 6TAAA 2OVLA 3A47A 3PFMA 4DAIA 3TTSA 1AQFA 2XN0A 3DH7A 2QUTA 2IKGA 3STEA 2E6AA 4MWAB 1BWVA 2J9YA 3TNBA 4JEQA 4US5A 3M0XA 4JKLA 3ES8A 2PB1A 3WUGA 5JVLA 4TQTA 5LIYX 3HG4A 4QDMA 2PDKA 4B5WA 4HNCA 1S3HA 1YQ2A 5FJTA 4BEUA 4FLOA 1J01A 4HYRA 3Q45A 1XH0A 1LL4A 3BJSA 3R8RA 4HCHA 1ZB5A 1LUCA 3GSMA 4PMVA 1XH2A 3GIPA 2PDPA 5AHNA 4IGHA 5EY5A 1JCJA 2E1WA 5ABEA 1LORA 2R82A 4BF9A 2YPIA 2EBNA 3BGJA 1TCDA 4H9ZA 1XSIA 2ACSA 1RBOB 3VO0A 3CZLA 2H3BA 1QI3A 1HJUA 4O19A 1GYLA 3H2EA 1UJPA 3S0CA 4QEEA 2E9MA 5FA5A 4NRSA 4NKCA 3QY7A 3DEQA 2BGQA 5D8WA 5LA1A 2HTMA 2XZ7A 4HYWA 4H6KA 1LZOA 3R43A 1G4SA 1JUKA 1WZMA 2ZTJA 3WCZA 3TDFA 4H6RA 1QOQA 1B5TA 3PZGA 4MG4A 3TN4A 2ACQA 3WBAA 5D9NA 3OQEA 1LOLA 1DWJM 1D8WA 1YMYA 3AIQA 3DFYA 3ARPA 4PBGA 1YPFA 1FWRA 3GFYA 2GUBA 3RCMA 3RRXA 4UFKA 4XKYB 4QHRA 1D9EA 1D3CA 1MRQA 4QCEA 3WFZA 1EYWA 4OECA 3GNNA 3W86A 3NL5A 2R1PA 4F0MA 1V3KA 4XZIA 3W1LA 3W2NA 3ZQ9A 2ZADA 3HV9A 1RQBA 2WC3A 2DVXA 1KM0A 1V4YA 1JPHA 4ZEPA 5D4YA 3AYTA 4JN8A 2GGGA 3OTRA 1S39A 2J79A 2G95A 2RFGA 5G2WA 1PKLA 1HIZA 4DYKA 2EAWA 5D37A 1XUUA 2BVWA 4ATWA 1Z44A 3K4WA 3EMZA 3MYOA 3SIZA 1AL7A 1T5AA 4ROPA 1FA2A 3WL0A 1GJUA 2OMAA 3FSTA 1FWCC 1JDCA 1H61A 2CITA 1QNOA 3KVMA 1Q6CA 3KXQA 3UZYA 2D1ZA 3EPOA 4Y9PA 1ADSA 2FVLA 1AQ0A 1DIKA 1BVNP 2Y8UA 4AZCA 7TIMA 3GR7A 2OG9A 1L9WA 2TODA 2QYGA 4BY3A 5M1TA 2QV4A 3MKCA 2E77A 2IKIA 2ZZ4A 1RSCA 2INFA 3U8GA 1Y0EA 3IJ8A 1OBAA 1MO0A 3C8FA 1PTAA 4M7SA 2PGRA 1QHZA 2DDXA 2CNCA 2QZRA 1E43A 4P61A 5C54A 1IZJA 5HANA 2XH2A 2GSJA 3VNJA 1UQZA 4Z17A 1IGSA 3MMTA 4A6GA 3QPYA 4NG3A 4IPJA 3ABSA 5DBTA 3QV6A 4RE2A 2A0NA 1AJ2A 2R91A 4ZO7A 1UW9A 4CN1A 5HR7A 3GM8A 4LBUA 5LIWX 1IEIA 4WVXA 1R7OA 2YFNA 4LC8A 4A05A 3TJ4A 2HEJA 1UPMB 2Y5EA 3ZVHA 1W1YA 3CUGA 4FOUA 4PUUA 4KWUA 4CD4A 4BQ5A 5CZTA 1S5VA 1OX6A 3K4DA 3W2JA 3FJ4A 6PTDA 4PYSA 1KFEA 4CCZA 4R7OA 2NQ5A 1EOKA 1LRQA 4P7RA 5DXXA 4G7FA 1MSSA 2NVAA 3C8NA 4K37A 4YU1A 3S42A 1JZ6A 4X63A 4UQBA 3BWWA 4HNUA 4DELA 2VFDA 4ZA0A 2Z0IA 3FDGA 3W1PA 2RDXA 3GXPA 2Y1HA 2PMQA 2WQPA 3IUHA 3W6LA 2JKAA 1O68A 2BS9A 3BC9A 1G6CA 2CLHA 1TMQA 4F4RA 4WXZA 3KCLA 4FNQA 2O4QA 3RO8A 1R46A 4YTRA 1GEQA 3U4FA 3GFXA 3UJSA 2VVNA 4WOZA 3BGAA 3TQ0A 1OWQA 4O1AA 1LOSA 5IBXA 1YX1A 2PF0A 3SSJA 3SCWA 1DYSA 2KX9A 3STGA 3USBA 2VD9A 2R9RA 4GIRA 2QF7A 4GNKB 1M1BA 3QM3A 3QGVA 4ONVA 1J4EA 4I8DA 5B80A 1SO6A 1QTWA 3CUFA 4D6FA 1KBLA 3E12A 4UTKA 4TTGA 5DXYA 2VC5A 4DWSA 4OBTA 4BCEA 3WH9A 4CD5A 3R10A 1EC7A 1Q3NA 4Q3MA 2PODA 4FXJA 4XSMA 2IPJA 1VBJA 3IS4A 4O14A 1A80A 1H7WA 3VU2A 4MMWA 5CAHA 3H26A 1VS1A 4DEFA 4Q8WA 3CUJA 4HPGA 3KRBA 3NZRA 3W7PA 4XD6A 5D03A 2OLSA 3S6DA 4HTYA 4N6FA 3UBPC 4CQDA 1UUOA 3TW6A 2XVPA 5E9AA 1H0IA 1VEMA 1VFUA 3OLDA 3A12A 3SCUA 3MA8A 4AD1A 5A95A 1AZ2A 1DJHA 1AH3A 3GUWA 3FLUA 4LYKA 5B7ZA 3AYVA 1TTPA 3CV1A 1RLDA 1LQ2A 5HAOA 3USZA 2VEIA 2XH0A 4RXFA 4OHQA 2EKGA 4A29A 4XD4A 1EXBA 1UMLA 1BGGA 5LNVA 3WQPA 4I90A 3UEQA 3VK5A 1RH9A 3ZWTA 3F4CA 3C86A 3E9AA 1MRAA 4AC7C 3NJ3A 4YHGA 2BVTA 3DFNA 5AYYA 4E2DA 1QO2A 3WMCA 3IVUA 5FKYA 1TMLA 4PMOA 2C71A 1JI2A 3VDBA 5DCDA 1PBGA 2XM1A 3XINA 4C6IA 2PWFA 2J66A 2NLYA 4JICA 2J9XA 2Q71A 1IIGA 4S2CA 3E96A 1PIGA 3RGTA 3VD3A 3WLKX 3BVJA 5HNNA 3S2LA 4H2HA 2JIEA 1MZHA 4GBUA 2E3ZA 3TWAA 3SCRA 2C1IA 2QCDB 3G1FA 2VNCA 3U2ZA 4MKSA 1R30A 4W86A 5HMSA 2PUZA 3K8KA 3B97A 4JKMA 3GR4A 4MUPA 1C9WA 3G1XA 1E0TA 4BA0A 3P8JA 4AZIA 2JQXA 1XD0A 2CIPA 1HO1A 4EXQA 2P10A 3RU6A 5CPQA 3R11A 4HNVA 3R94A 3UPWA 1HKIA 4ZZ9A 4U3AA 3GYCA 4AQLA 3G0SA 4O18A 3TSMA 5CG7A 1I0DA 4JFSA 3L7RA 1UKSA 1KLYA 5BRQA 3UWYA 4KW2A 4JDBA 4ZMGA 4A4AA 5BMXA 3VKAA 2PCQA 1JQXA 2JBMA 3FA5A 1T41A 1KV5A 4JIHA 2ANUA 3O1NA 2FZDA 2D20A 3VGFA 3MV01 1DWGM 5K9CA 3UZ5A 4IGSA 4S39A 3HF3A 2I57A 3FCPA 1YBQB 4P8VA 4PMQA 1ZALA 1OK6A 4TUFA 3WK1A 5FJUA 3TFXA 4AIBA 3SM0A 3BLDA 5CPNA 4DUWA 2NV9A 3M5ZA 1HKJA 2QIWA 1TJRA 4PE8A 2ZX5A 4HPJA 2FZ8A 1KXVA 1P43A 1QI2A 3EYPA 4DB7A 2YBUA 2BGSA 2GJLA 3IGHX 3TYUA 2X1UA 4JY8A 3GKAA 3TLLA 1Q8JA 1VZWA 1ITUA 3GO2A 1ISYA 1HJWA 2XSAA 3W00A 1UD8A 4JTKA 2X7VA 9RUBA 2G4JA 3KW3A 2R24A 3W82A 4L6OA 3G1YA 1VB9A 1JZ5A 1IT0A 1LQ0A 1MEWA 3H22A 3LCGA 2XSXA 3VPLA 4AAJA 2J8FA 4IQDA 4YYCA 5BOFA 4GJIA 4GUGA 4M3PA 5LYRA 4DZHA 1ZJIA 3VGBA 4XB3A 4IQJA 3BG3A 4AEFA 1QNSA 2A3CA 4EXBA 5CC5A 1MYRA 3WF1A 1BYCA 1MFUA 3WDJA 4UTWC 3BOXA 3A9IA 4CEXC 4DIAA 2QDDA 1FQ0A 2Z25A 3TNOA 3UY8A 6REQA 4WD0A 3F2CA 4HN4A 4H8NA 1R0MA 3FHAA 5H8UA 2WJDA 4P8WA 5E0FA 3CQJA 3P0XA 4DJDA 4X22A 4DWSB 5DMMA 1T0OA 1U5JA 4GBDA 3Q37A 1T7LA 3DFQA 1KW1A 4JHZA 1JRBA 1ZHAA 5CBIA 1QJWA 2G0WA 5LGXA 2PAJA 4A2RA 2BSLA 1GG1A 4A3QA 4KESA 3OO2A 1SGJA 4NAEA 3TN6A 3E0WA 3L0NA 3LM3A 3MMUA 3SQLA 1LTDA 3OZMA 3C2RA 3WLTA 5CPMA 3L68A 4YPJA 1UQYA 4ZTYA 2JFEX 3LPGA 2ZXQA 5ECVA 1QXLA 4PUKA 4M6QA 3A5FA 4C90A 4ZB2A 3TQKA 3N9RA 1FFQA 1EPVA 4FNTA 1SPQA 3SGZA 3W7MA 1Z7AA 1VRXA 4UC5A 1X6NA 3DI1A 2CFFA 3LLXA 5I06A 4WZHA 3JW7A 5AECA 1KWKA 2X1SA 1W3TA 4KEMA 3M64A 4QCFA 2E4TA 1KBBA 4QSFA 2RDTA 5G1MA 2GVEA 3SCNA 1ML1A 3RRAA 2QUNA 4WR3A 4HSNA 3WL1A 3VGGA 3VIFA 5HWJA 3EWDA 4EP8C 1XGEA 4CNSA 2V30A 2PI6A 3RXZA 3W2KA 4BQ2A 3GNDA 4GYPC 8XIAA 1XQLA 2VENA 3DFTA 1KTCA 2D23A 4OE7A 1OZMA 9CGTA 3PUOA 2I7GA 2V68A 2GQ9A 3AXKA 4NX5A 2B81A 1E40A 4PCPA 2VWTA 4YTSA 5BU6A 1GWJA 1Z3NA 4IOTA 4HMDA 3VOJA 4PGLA 3RF9A 4RE4A 1EKOA 3GC2A 1RAKA 3R13A 2BTMA 3FEMA 3WQEA 3MSGA 4QTGA 2X0HA 1NDYA 3EBVA 3TA6A 4CGTA 5CGMA 3SFKA 1CI1A 3MP3A 3H2CA 1AH4A 3ARRA 4ML9A 3LS9A 1REQA 4X3ZA 1JDDA 3ZR5A 1TZZA 4DXVA 1NFGA 4IM4A 4B9YA 4IL2A 3RK8A 1V7YA 3UYCA 2MANA 3A13A 1H60A 3WX7A 4A3YA 3HFYA 1U1UA 2WJZA 4JN6A 4D6CA 3UFYA 1E6XM 2HE5A 2QAPA 4NIRA 2ABAA 1VFSA 2CXEA 4J1OA 3ZO9A 2BX7A 1A3WA 2PGFA 1DKWA 1YTEA 1RY8A 1KB3A 1T99A 4QX4A 4PFMA 5GPRA 3WLMA 4GKTA 1NARA 4UFHA 1GOXA 3LCHA 5DRCA 4WHBA 4NT0A 5FIPA 4FS9A 3M47A 3KTCA 1OCNA 3F4DA 4QSHA 2RGLA 3KOXA 2NW0A 3GZAA 3W1NA 2WJEA 5HINA 3NAVA 2DU2A 1B9BA 1PEZA 2XVNA 1G1YA 2BBFA 3BUVA 3T1GA 4IMGA 3GE7A 4KFOA 2FTYA 3UXLA 3GG0A 1SSGA 4L9ZA 1Y65A 1XJBA 4GVFA 3LCLA 3N14A 5AC7A 3TK7A 2ABBA 4IPIA 1DIDA 1JFXA 2Y6ZA 1MEIA 4AD0A 1JF6A 1JXJA 3FAXA 1VJSA 5JBFA 1UHVA 1GOQA 1IWAA 4O52A 2HDJA 1QU4A 3A64A 6A3HA 2GVJA 2WYSA 4S3DA 3H4WA 1KBJA 2Z24A 1EHNA 4OVXA 3OG2A 4LANA 3AAMA 4NUWA 3CZJA 1XINA 3MI6A 4CQCA 3GDTA 4H7ZA 3HFTA 1S2VA 3ARZA 4QDWA 4CCDA 5FAGA 3F5KA 1F3TA 3A3WA 4JYFA 3LD5A 4RZBA 2PLCA 1B3OA 3BW4A 4J9JA 1V93A 3WNKA 2HRWA 1C90A 2OGYA 3S9ZA 3NWRA 4NZ5A 1S2UA 3PPGA 4JEJA 1B1YA 1H50A 5E0KA 4H6EA 2W62A 1H7XA 3BICA 1ZBVA 4O54A 4FR1A 2V2HA 4EIVA 4MSSA 2EQDA 2XVKA 2FKPA 4LRSA 1Z69A 1X6UA 4GMEA 1Q7MA 2RAGA 2AGKA 4S23A 3T09A 2X41A 3UJ2A 3CPRA 3WF4A 4GO9A 4QEHA 5XIMA 4AIOA 3U4AA 4Q8OA 5HJYA 5D9OA 2GVLA 3ES7A 2HS6A 4IGMA 3GC5A 3W38A 1GOMA 1JAKA 1FVPA 4J3WA 1W3HA 5BOEA 3I6TA 4KERA 1DE6A 3S4TA 1UD2A 1K6WA 2BZNA 3PJXA 4KFPA 4NJHA 1QR7A 5GJPA 4F2UA 1E0XA 5B7YA 3HN3A 1W2VA 4B92A 1SSDA 1VP5A 4MY1A 1BHGA 3TTYA 2QV5A 1ME7A 1ENUA 1V3MA 3M0KA 3DHFA 1IHIA 3E0LA 4H8VA 3SFWA 4DUOA 1QAPA 3CL7A 3SJNA 1HQTA 1ZP4A 1ICPA 4GI8A 2WVSA 3NZPA 1KKOA 3O6DA 1EJXC 2WHLA 5BNKA 1OCQA 1P0KA 4F9JA 2QDEA 3CZ8A 3TC6A 1R5YA 1Z41A 2NT1A 4HGXA 4ZSUA 1DHKA 1GJPA 3UYIA 4PZVA 1KWGA 3CWOX 1JR1A 3ARWA 3VCRA 2A79A 3WYZA 1UMYA 2C14A 2YCLA 3FYOA 3T05A 1G4PA 3WJWA 4PODA 1XIEA 2O7SA 2DT3A 3VINA 1NP0A 4DBUA 2WM1A 1SO4A 3GC4A 2VGIA 4L65A 4ROQA 3BSGA 1J5TA 3PBVA 4ILSA 1ZCOA 4PMZA 4GQ0A 4FNUA 4YVVA 1OGSA 3M5XA 3T07A 1JULA 1V0NA 4Q6XA 3CC1A 3E38A 2VC9A 3AU6A 2R1NA 2EG7A 1XIBA 1TJPA 2Z4GA 3L4UA 5I3HA 1XLAA 3GIYA 1A5MC 1CLKA 1KFLA 4M0XA 3G2GA 5G4EA 1Q63A 3SQMA 4GXPA 1TJ2A 1L2QA 3CWNA 4NX0A 1XYCA 3EWXA 4W7WA 3CV6A 3BAKA 5MKGA 4CD7A 2OT0A 4D6DA 3IAQA 1PJ9A 2VX5A 2X40A 3V18A 1W2PA 4IPNB 4S1FA 4ZB5A 1MMFA 2PDHA 2GK1A 2FHCA 4ATLA 1D3GA 4KCUA 3HU7A 1FH9A 4Z2LA 2J78A 2E5BA 2ON3A 5FOOA 1XLDA 3LHTA 3LGEA 1FKWA 2WK2A 3A6OA 4F0SA 1GKPA 3QMTA 3U5YA 5C8BB 3KBVA 1RJQA 3N34A 1GVSA 3M0VA 3MUCA 3NQ7A 2W61A 5I03A 3ZT5A 1MDRA 1FTXA 3H55A 1NOWA 3KS6A 1W37A 1L2UA 1WZKA 5F4XA 5G2HA 1CYGA 1VKFA 3AXIA 4C6BA 1BVZA 4E5TA 1BRLA 2G3FA 1XFCA 4JNMA 1HP4A 3WDIA 1TUXA 2DEPA 1S38A 3CXOA 4LUYA 2Q02A 1CZ1A 2X2GA 3QEZA 2YCEA 4UQ9A 2G3MA 4JR5A 2DZSA 4L4LA 3DN5A 3W53A 3MT1A 5C9RA 3FKRA 1VENA 3L23A 1HJSA 5LIKX 5F4SA 1QHOA 2CEQA 3GTIA 1MUMA 3GTNA 4DLFA 7ENLA 4JYEA 3TAOA 4BJHA 4AIUA 3AXHA 3L65A 1JDAA 4LUSA 1YXYA 2QAFA 3MMDA 3W72A 4KRTA 5ABGA 4HTBA 2YDQA 1RV8A 2IKHA 4E38A 2JKPA 3REQB 4GOAA 2WWDA 3URQA 4LF1A 4QJ5B 1OYCA 4J5NA 1IR2A 4JIEA 3AIUA 3VC6A 3WQ6A 4HK5A 1GYMA 1S2CA 3WD1A 1OT2A 3G8RA 3NPVA 2PA6A 3B9DA 2ZZ6A 1UJQA 1XYLA 3M6YA 3B0VC 3G1SA 2PWUA 1YIXA 1HVXA 3SUSA 1EBHA 3W6MA 1LG2A 5BXSA 4IHCA 2D2JA 3B8WA 2BY2A 4CQ9A 5F2GA 2NQLA 4AH7A 1GHRA 4FX7A 4N9BA 2HVOA 4LWWA 1OFEA 3CAQA 3DHUA 2YW4A 5F1VA 3S6OA 1VLIA 5A6KA 2DP3A 4HVXA 3WN6A 4IMEA 1SZEA 2BXYA 1JJKA 3EOLA 2UY4A 4ZFCA 4F48A 1I60A 1TWWA 1KFKA 3EX1A 1M6JA 3CEPA 3TC7A 1NH6A 3H53A 3E2VA 2C16A 4LBSA 4O53A 4MHBA 1L6YA 1E6NA 2VEGA 3MKKA 2YW3A 2HK1A 1E71M 1I2OA 1OJXA 3LK6A 2DUAA 2EGZA 5HR6A 2WSKA 3M1ZA 2R1MA 3AU2A 1EJ7L 4XTIA 1EC9A 2WZIA 4H7VA 2Y5SA 2DT0A 2GJXB 3L0GA 4R7WA 1NAL1 4IP4A 4GWEA 2BHZA 3DXIA 4LEQA 3A4XA 1J93A 1KO0A 3WQVA 1TPB1 1RLCL 1GKRA 2KAUC 3VILA 4GI4A 3IJ6A 3IACA 3NVTA 3KCJA 1UD6A 4B2DD 3HV8A 3OA5A 3I7QA 4XQ6A 1OF6A 2OOFA 3AS1A 5A1AA 1FHLA 3GDKA 1UASA 3M0MA 3O6YX 1GQKA 2QJHA 5D8ZA 1SO5A 2ZDRA 4LY8A 4FHAA 4JFVA 1OX5A 3HM7A 4NXSA 4LC6A 5CG0A 2A5HA 1TV4A 4A8LA 2Y63A 4TO8A 4HYVA 4Z1BA 4CQBA 3U5UA 3FSUA 4PB4A 1MDLA 1TR1A 3HQNA 3FS2A 2D2HA 2QT3A 3GIQA 3WJXA 3BK0A 5C6MA 3EOUA 1GORA 4KEZA 3T2QA 1MQRA 3H24A 4FNRA 1VD6A 1SQ7A 1XC4A 4TOQA 5I2UA 1P1XA 3KM8A 3WQOA 3TN3A 2WC7A 4XVEA 1TWSA 3BH4A 5AZ1A 2H8XA 1KXHA 2WMHA 4R9OA 3WFAA 3T08A 4HBKA 1YNQA 1IXNA 1ICSA 5J04A 3FEQA 2NWSA 5CPOA 3OLIA 1LWHA 3ARVA 1OVDA 4CD6A 1XDJA 3WQ5A 4CNTA 5AHFA 2YZRA 3UXIA 2FGLA 3AMKA 3L4WA 5D9MA 1NVMA 1CXFA 4DUXA 4XAYA 1GKQA 1WUEA 2PTWA 5FJRA 3NYDA 3WQDA 3NSMA 5FJPA 4P7OA 4ACZA 1GQIA 3K1GA 1XV8A 4M6PA 4IX0A 5FD0A 1LROA 6XIMA 2X0YA 1LBMA 1TRIA 3AC0A 4XZWA 1RPKA 3QC0A 3EKZA 3VDGA 3S2CA 3PZMA 2J24A 2NQZA 3KWXA 1QMLA 2RGMA 1TKKA 4TIMA 5ECUA 1L0PA 3EZ4A 4M24A 4KBXA 2VX7A 3RHGA 1CCWB 4B5XA 3EXSA 5I6SA 4EK7A 4Q6JA 2BHYA 4YL2A 1QUMA 1C8VA 4TMBA 2HPMA 2OYLA 2XISA 2PDBA 1KGXA 3NEVA 3OLEA 4UQDA 3OIXA 3K30A 4FXFA 1J0ZA 2I14A 1W9DM 4QG9A 4J27A 4WDWA 1JNEA 2ZYFA 1ONRA 3KRUA 3QHNA 4LUSB 3V4BA 2VC7A 1U30A 3BW3A 4GVGA 2EKCA 3EDDA 2FMNA 4BKNA 3EX3A 3HPFA 3NEHA 2PDMA 3G0XA 4ZQPA 4Z08A 1V3HA 1ALDA 3V3WA 3WDRA 4ERIA 2IQDA 3GXFA 1N2VA 3WQCA 3DBPA 2NVCA 1OD8A 2A21A 1MUWA 3CTLA 1UH2A 1UIPA 4Y9AA 2IPWA 1LQAA 1QATA 2J7CA 2VQUA 2AL2B 3MUAA 4ZXOA 3VIIA 1QCWA 4Y90A 4AD2A 4AMCA 2KZHA 1Q5MA 3SUWA 2JEPA 4HU4A 4PB5A 1N55A 1PX8A 5D38A 3WLOA 1G5AA 3EWYA 2V3GA 5A6LA 4RJEA 1XLLA 2FGZA 3B4YA 3P2VA 1J0HA 3T9PA 3UGRA 2VC6A 3GDMA 1JYNA 3LBCA 5HMEA 1A5SA 1GTEA 1AQHA 2QUMA 3TVAA 3LHWA 5JBEA 4U2ZA 3HURA 1M7JA 4IG2B 3KLLA 3W75A 1RA0A 1QHPA 1ZL1A 3TXZA 1F2JA 3DFSA 2ZX8A 4HK6A 5T9CE 1RCQA 1JPKA 1RR2A 2YX0A 4MLJA 1TPWA 4GNVA 1BWKA 4GPNA 3FJNA 4RUBA 2DZBA 5I00A 4B5VA 1MXSA 1Q85A 3UZJA 4M1BA 3THDA 3GBDA 3O8AA 4DNHA 5AHEA 1IZKA 4ZOEA 2AOSA 3WLNA 1T6MA 1W8GA 1ZY9A 1HUVA 1XISA 3W85A 3K8LA 1W5PA 3QJAA 1SU5A 5ABHA 2BY0A 3VOCA 3G1HA 4WIWA 1H1ZA 3G77A 4DPQA 4PBFA 4NVTA 3LTSA 1H11A 4GINA 4P8UA 3YPIA 3BSHA 2EF9A 2PDYA 4HSOA 2YZ5A 3DCPA 5CXPA 4Q4OA 1B3XA 4LCQA 3WLQA 3S2NA 1WV2A 2QVNA 3ARQA 3FDKA 3EB4A 1BLIA 4IMCA 1GOKA 3BMWA 3F4NA 3TYAA 4AVNA 3B0PA 4RX0A 3SZ8A 1F7BA 1N7KA 4H41A 1QPNA 3NPWA 4JAWA 4ZL1A 2F38A 3BURA 2QDGA 4AX7A 3P14A 2Z2UA 4PEEA 4O28A 5CGTA 4GK8A 1Q7ZA 2PTDA 4WUIA 3VM5A 1KCKA 3HA1A 4E3TA 4H9XA 3W7NA 2DGAA 2AMXA 3AHVA 4AFYA 1XYMA 1EC8A 5TQLA 2VOMA 1HKMA 3IRDA 3ZFHA 2VEPA 2Y7GA 4KKXA 4AHPA 4YN5A 3WO8A 4E2VA 4X2PA 4HA3A 3C5QA 3VE7A 3HQPA 2ASHA 2FHBA 1C92A 4GY1A 3DGBA 4Z42C 1Q2SA 1XR2A 1EGZA 2ISVA 5EMMA 4LAKA 3ME3A 3PUDA 5I3DA 4X9SA 3HQOA 3W2UA 3TW9A 2QGYA 4KF1A 2DZWA 3OJGA 2XN2A 3WF2A 5A3HA 4PUJA 2E6DA 1KTBA 2JF7A 1Z6KA 1Q6GA 4Y9MA 2Y8KA 4N9EA 3B03A 4QJ4B 1WDSA 3ISIX 3ORWA 1L8NA 2HK0A 2ZKMX 3V35A 4PTNA 3TYCA 5K9DA 1H7PA 3UWVA 1I9CB 2E5CA 3GH7A 2P1FA 1NWSA 2EEXA 1CGTA 7XIMA 4FLRA 1WXYA 2YDSA 2YBTA 3C52A 1BYBA 3E0IA 3TA9A 1K02A 3W0KA 1EQCA 1I1XA 1ITXA 3T0DA 2VGFA 1EUAA 1I1WA 5ABFA 3HJZA 4XZNX 1EA9C 2INZA 3ID7A 3TTQA 2DZVA 1POKA 3T8QA 2EPLX 1ZJHA 1L6GA 4N02A 4UFMA 1O4UA 5REQA 3MSYA 1F6YA 4PN2A 2YL6A 2ZUNA 4MNKA 1OG6A 2Z27A 1V79A 3C0JA 1EDQA 4IFKA 5RUBA 3CO8A 4PUMA 4L6DA 1PL9A 4US5D 2VFHA 2CLIA 1V7AA 2PZNA 3KEHA 1IR1A 3OYZA 1QBBA 2BP1A 3W7GA 1PPIA 2YKKA 1C93A 3GHUA 3R0DA 5PTDA 2A3AA 3W81A 5CC7A 2BOGX 2E0PA 4Q8QA 4GFSA 3PZ9A 1A0DA 3SUVA 4N2YA 3NPUA 3GVWA 1S5NA 3WDPP 1AFSA 1JCMP 5DEZA 2EJAA 4FPSA 2ONEA 4AZGA 3QGKC 3MUY1 3EX6A 1MEHA 3KOZA 1R2TA 1LCOA 4RNJA 1JUBA 3U7BA 3V0TA 2E40A 2WZEA 3OP2A 1EJRC 4ZQMA 5FEZA 2DQWA 4UR9A 4H7CA 2G97A 1PUDA 4BHYA 5FAJA 1JFHA 1PS9A 2V6AA 2BV9A 1JNDA 1V6VA 1VYSX 1NWRA 1OGBA 3IIVA 1G4TA 3VCNA 1PKYA 3OQ8A 4IIEA 5HUPA 3E0FA 4QAIA 4G9PA 2OWCA 1GOOA 3MU7A 2WQDA 3PAOA 2DIKA 4NU7A 1TV5A 3NGFA 1R9XA 2ISDA 1N8WA 3ZSTA 1UZHA 5F4WA 2IS7A 2VO5A 4IP5A 1K7FA 2HJPA 3MHGA 4Q33A 4ADSA 4P7NA 3LHYA 3SCSA 1E55A 2GVYA 1PYFA 3PBUA 4C1LA 1S2AA 3FX4A 3LX9A 3GB6A 3HMCA 2NX3A 4IIFA 2ATSA 4HNNA 2NWRA 1X97A 1BYDA 3R8GA 4XBKA 4INFA 5FF0A 3VFLA 1E70M 4PL2A 3MYPA 2ZXAA 1I4NA 1WKYA 4ZQCA 1SMDA 3N11A 3ZJKA 3B9OA 4DLMA 2H3DA 1A4LA 3QZEA 1W9PA 1OD0A 5HXMA 3IUIA 1J5SA 3AOFA 1IE7C 3TYDA 4DJEC 2ZA1A 1XL9A 4MKNA 4IWWA 1NF0A 5U7SA 3KBMA 4MFEA 3EWBX 3LHVA 1V77A 1Q7QA 4JGDA 2P3EA 4XIMA 3VABA 3W74A 4FMVA 1OCBA 1DWFM 3T7VA 4JDYA 3LCIA 1VHNA 4NZCA 3ARYA 1W31A 3CK5A 1P6BA 1WO2A 2ZICA 1B57A 3UZZA 1B3YA 3N6HA 3ITYA 4D9PA 2DIJA 1BXNA 2WPBA 3AZRA 3ZT6A 3LU2A 5BMWA 2I16A 3QSRA 4FZIA 4GG9A 3N73A 1GVIA 4N9CA 3O6CA 4D72A 4IMFA 1AG1O 5T8GA 1AMKA 1GOWA 1W5OA 2ZWYA 1EZWA 3THAA 5A8PA 1Z32X 2FYMA 4Q8VA 7TAAA 4AWUA 4DX3A 1YKWA 1AD4A 4C5YA 5BWFA 5JBDA 2OZ3A 2CLFA 2HNEA 3H21A 4RZ4A 3AJ7A 4JS3A 4IXXA 3BLIA 2GUYA 1I45A 2ZA2A 4DO6A 1GVOA 3AALA 3DESA 5JMUA 1ZCCA 4RXGA 3V0SA 4S3CA 1UD5A 4W85A 4EPEC 2EO7A 4LVDA 4US6A 3K2GA 4UTJA 3WK3A 3APGA 1M3UA 1U1JA 1PB0A 2FTWA 4QISA 5BRBA 1SJCA 4YNGA 3NTYA 4H04A 3IJ7A 1CT5A 1E56A 3CH0A 3V0UA 4CCCA 4U4MA 3BL3A 4LFYA 4ERGA 4MJZA 3SY8A 4PBEA 1XRFA 3UCQA 4YMZA 1P0EA 3APYA 4BR1A 3LHZA 1TREA 3ANVA 1R6WA 4Y96A 9XIAA 3GHSA 1MQQA 5F7UA 4P7QA 2WLYA 4EPKA 5D2TA 2IPGA 1O5QA 1PZ0A 1W6TA 1YPIA 2YXOA 3MANA 4J3ZA 3LZ3A 1UOZA 1FH8A 3H2MA 5REQB 2MNRA 3LLFA 4OV4A 3QR3A 2QCNA 2LLEA 3H4XA 3VM7A 3KRZA 3RITA 1Q13A 4HU8A 1V6UA 4L6HA 4H9YA 1E6QM 5AHMA 1VBUA 4LU0A 2VZTA 4WDUA 4JIPA 4J2MA 4QJ1A 4HK7A 4JTHA 5AHIA 1EWDA 2FJKA 1DJIA 2BVDA 4IUOA 2GWGA 2R8WA 3IIXA 1TPC1 4HZ6A 5HOSA 1W1A1 4LX4A 3W28A 3LI0A 5KETA 4LS1A 2J62A 2AGTA 1ISVA 2WMJA 4UTHA 3W7OA 2PP1A 3W7RA 2IMRA 5CSRA 3TU9A 4NAFA 1T96A 4DM2A 4JHOA 3O9NA 4ZR8A 1S3TC 4WF7A 4B3KA 4UFLA 4X9YA 2DH2A 1F3XA 2F84A 2OOGA 1SW7A 3URNA 3QRHA 4N7QA 4KCVA 1E1CB 1SR9A 3I65A 4D71A 2PDUA 1J2BA 4CNPA 1P5BA 3TSBA 3QKZA 2GWNA 2PBGA 3RU8X 3R25A 3QQWA 4WLCA 4MNJA 4C7DA 1IWBA 3EXRA 1XLCA 2RHGA 1SMAA 2PDXA 1UR9A 3NQ6A 3P80A 5DCEA 4PULA 2F2KA 1H41A 2Y61A 3AJXA 2W0UA 4DJED 3B8SA 2VELA 2ZRWA 2HQAA 3GU1A 2DJXA 3LUTA 1WB0A 3GU9A 2QUVA 1OG0A 3BLFA 4DJDC 4HOZA 4XWUA 2GJRA 4MB5A 2ZWZA 3MQTA 1D8CA 3D3AA 3DFPA 1NU5A 1HZYA 3P5ZA 2VRKA 5A6SA 4C6PA 3DENA 3EDJA 2FGBA 3PPHA 3AHZA 2Y7FA 2WVUA 4KMQA 3BSMA 1BXCA 2YA2A 4DHGA 5FJIA 2YA1A 3TLQA 3S1GA 4R88A 3T40A 3TEVA 3VZZA 1XX1A 4R34A 3RCYA 3TH6A 3KOYA 3U0HA 1RALA 3SR7A 4NP7A 2D2GA 2FB2A 3S1UA 4Q7NA 1J0IA 4HQVA 1W5MA 4OUEA 1QNVA 4FP1A 4IJCA 2FZ9A 1HGYA 3CIWA 4OWGA 3CAKA 4Q32A 1FWTA 3WJSA 4ECLA 2QCGA 1ME8A 4OOZA 1ME9A 4IL0A 4NJIA 1ITCA 3AIVA 2OODA 3E3HA 3CUHA 3OBAA 4ORIA 4OQVA 4F8XA 4MWAA 4UNIA 3LN3A 3JVAA 1XBYA 3S1XA 1XBVA 3WMBA 3PNZA 1ZNNA 1YNYA 2NSOA 2VP8A 1FRBA 2REQB 4R5EA 1J0YA 2HXUA 2PRLA 1XGDA 1UWTA 1DBTA 1W1IE 3NO1A 4D1IA 4JX6A 2E28A 4GYKA 1TPVA 2HWGA 3WKZA 1XLJA 2X05A 1DWHM 4U2YA 3CEUA 3UNTA 1UA3A 3G18A 1ZJBA 1SFTA 3A24A 3NDYA 2JIWA 1SZNA 3M44A 4OKDA 3GG8A 3N4AA 3ONCA 1HKWA 1NF7A 4D6EA 1JQVA 1HTIA 4GLEA 2VI0A 4CNOA 2IUZA 1Q6FA 5F2MA 5HDRA 2DT1A 4CU7A 1UWIA 2QLYA 1J12A 1H62A 1MXDA 2YYTA 4D8AA 2QS8A 1DXFA 1JGIA 4B16A 4PCSA 2H6RA 5DX7A 3VOFA 1CGVA 1TZ7A 4UOZA 1DJWA 1UR3M 2Z6JA 3W6YA 2NQJA 3QYSA 4NI3A 1K9EA 1B90A 3ZOAA 2ZVRA 3M46A 5TD4A 3EB3A 2J27A 3N2XA 3DAQA 1KM3A 3HOJA 5A8QA 3W73A 2XHYA 3NVDA 4B3ZA 2O7QA 1TV7A 5F2LA 5A6JA 3CASA 2XIQA 4RDZA 4DAFA 2J6XA 1XWYA 3BG5A 4H9MA 3W87A 4X61A 2A6LA 4LUJA 1CGXA 5KEZA 1A0CA 4CNNA 2DZPA 1TUFA 3H4GA 4PTMA 4RNHA 3GX9A 4UQEA 4XKYA 3O15A 3EX4A 1IEXA 2ALRA 3KBSA 2QCCA 1VHCA 1KM5A 1L6SA 2DW6A 4JTTA 3RFAA 2WCGA 3V1PA 3JUGA 3G3DA 4Z1AA 4QLJA 4S3EA 2J75A 4B3LA 1P7TB 4RKAA 1KXTA 3T0TA 3H2AA 3H6OA 1KRCC 4GH1A 1PTGA 4J3UA 1RHCA 3BANA 4AMAA 3L4TA 4BWLA 1EHAA 1U83A 2QCLA 4JKKA 5CZKA 3PZNA 1WXJA 4C65A 1VRDA 4HSHA 4MPKA 1PV8A 1F3EA 2PWHA 3TZFA 5LA0A 2XGBA 2VWSA 1IEVA 3MCOA 1GJWA 2Y4SA 5MHBA 3VKJA 1E6SM 1H7RA 1FXPA 4F3HA 1D7FA 4AU0A 1K8CA 2Q8ZA 2WC4A 4CVWA 3L5AA 2QPSA 4DJDD 1K8ZA 1XDLA 3LLDA 4O0ZA 1UD3A 3LXBA 1MWOA 4KWSA 4ZCWA 1XPYA 2DVTA 3LERA 5DN1A 4AISA 2Z29A 5AYZA 4KRUA 1M04A 5M2FX 3WQ8A 3QTGA 3VGDA 2OSYA 3LRMA 4XZMX 3FA3A 1KFCA 3KAOA 2D2OA 4QLLA 3QSTA 2OQLA 4RDVA 3U9IA 1I8JA 2ALDA 6TIMA 3VDAA 3EDFA 2BWGA 3IJDA 3SIMA 5BXRA 5DO8A 4FIQA 2WKJA 5A94A 4F0LA 4H2CA 5A6TC 3W37A 1MW1A 1Q6EA 3PJTA 4OIFA 4OGZA 3VNKA 3STPA 1Y5WA 4OFCA 1RVGA 2VFEA 2JALA 2VL4A 1XW8A 4PSPA 4JOMA 4E8DA 4LCSA 4QG8A 5EMLA 1B4KA 4XSLA 3CHEA 4B15A 3IARA 2WNWA 4JTDA 1P4CA 3U2CA 2RDWA 3UA3A 3QKEA 4YJ5A 4KCTA 1P6CA 3VOHA 4HPHA 4S3FA 1Q6OA 5EA9A 3WEZA 1RP8A 5K2ZA 4HKPA 3RIKA 2GZXA 4J3SA 1BYAA 5E93A 2QUUA 1XLKA 1ESWA 1J96A 1V02E 4MVAA 5LIUX 1ONWA 3B8TA 3KX6A 2A3BA 3RCNA 3ITLA 2G37A 2CBJA 1U5HA 1AK5A 4N6EA 1XYAA 2QR6A 4X2RA 5CBJA 8XIMA 2WOQA 2YL5A 1KFBA 1VPYA 2CXGA 4XKMA 5KZMA 5LNSA 2HXTA 1UPPA 3AIEA 3JZUA 4GYFA 4BI7A 1FCQA 4HMEA 3MP4A 4O16A 1TA3B 2POZA 4KEUA 5E09A 1YRRA 4HZ8A 2O55A 3ICJA 5M03A 1CXLA 1F6PA 4E0CA 2TYSA 1PYMA 4WSHA 4O50A 3HPXA 3DC0A 2R1LA 2XM2A 2VEFA 3WBXA 4UR7A 3AXXA 2YXGA 2WV8A 2BB0A 4P8XA 1LT7A 3K8MA 2ZTKA 2QCEA 1PCKA 3QC3A 3UG4A 3KRSA 2B4GA 4XBJA 4HPXA 3VIMA 3WBEA 4AC1X 2DSVA 3U2OA 4C6EA 5D2XA 5BOOA 2DZUA 5FEWA 1V8EA 2IKJA 1EOMA 4B4HA 2GDUA 1Q6RA 1B31A 3I4KA 1H2JA 5C71A 3AO0A 3H12A 1I0BA 1CB7B 4K36A 5K9XA 4P2VA 4L64A 1NIUA 4JL1A 1YLVA 2VUYA 3B06A 2V3DA 3DOPA 3L4VA 5HULA 4K7YA 2Q3OA 2EG8A 1XG3A 1O66A 1F5ZA 1WOBA 2Y88A 2WHJA 3CMFA 3W1MA 5LNUA 5J5RA 4NI8A 3II1A 5I07A 3W7IA 3ITXA 3UCDA 4LBRA 1QO5A 2CLLA 2P53A 3W1QA 1A5LC 4UBPC 1XYBA 2A4AA 5DRIA 2YA0A 4HMCA 2J6VA 1J18A 1XM3A 1PIFA 4JTRA 2WMKA 3TCSA 3N13A 3EKGA 1CEOA 1O1ZA 3OG3A 5DF0A 2B31A 4PCTA 3TIMA 1WA3A 3CUZA 3NNTA 5HJXA 1XYFA 3VMNA 5A8OA 5K4ZA 3SBFA 1H7OA 4GYJA 1K77A 1M03A 1QWGA 1UR0A 1UZ1A 3ZLGA 3WFLA 1VFHA 1EF3A 2HVMA 4PMNA 1F74A 1OF8A 5HNRA 2HV5A 3C0LA 1NJJA 1E72M 4BFAA 2A7NA 4PTWA 4MJ2A 3ECQA 3PTMA 2V9DA 3NXLA 1R38A 4Z1CA 1ZBCA 3Q58A 4DJFA 4H1ZA 4EACA 4MTVA 2PDIA 1O5KA 4W5UA 4B9ZA 1RXOB 4L56A 1OFPA 1VC4A 3VD5A 1QRQA 4YXGA 2PEVA 4A8NA 3GVVA 1MI3A 1K9TA 3QVQA 3W7KA 1G7UA 3WSUA 1WDQA 3BCFA 2F7FA 1IGWA 2DPEA 1KKRA 4IP7A 1FHUA 1PZ3A 2QW5A 3SCVA 4Q4PA 5U4NA 4E4PA 5KSWA 1KGUA 1KRMA 1FHDA 1MFVA 2QCDA 1WYIA 2GDQA 3IIPA 3AIWA 1O5RA 3PSWA 3KS5A 4HHPA 5TIMA 1UYQA 2YL9A 5AOUA 3BE7A 4JXCA 1WDRA 1JYVA 1C8QA 3ANUA 2CKSA 2CLOA 3Q2DA 2J7HA 4GIEA 3ABOA 2QPUA 4X0VA 5CLWA 5EL1A 1VQTA 1IXOA 1VFLA 1JRCA 1LLZA 3LQGA 2IQTA 1ZBWA 2ISWA 1KM6A 5KMYA 3WQ4A 2ISFA 4M80A 5EKYA 2C18A 3VNLA 5DFAA 4PB3A 4IIBA 4JQ1A 2O4MA 4FO4A 3F4WA 2GDVA 4QAWA 2BOFX 2XIBA 4MDPA 2GGJA 4GYPA 4NNBA 1NEYA 3B9NA 4L1WA 1HVQA 3RR4A 5HBFA 1CWYA 4A3HA 3EA2A 4W93A 3AI0A 1FP9A 3P6LA 4DPPA 3SQSA 4P5UA 4X0NA 1EDTA 4AEEA 3CIXA 1AZ1A 2BNJA 1E73M 1QPKA 3NO5A 4C6OA 4GXWA 5HQLA 5G1YA 1HXJA 5CKSA 3WLIA 1XC6A 5FL0A 1HO4A 1B3ZA 3TAKA 4JBRA 4KWOA 3ARXA 1YBQA 1SFLA 1QNRA 1M5WA 1XLEA 2J7EA 4YTQA 1QI4A 3CQIA 4QP0A 4I8YA 1WOAA 2BDQA 3SCTA 3VDHA 5CCZA 4IIDA 1EIBA 3LNMA 1W1TA 5M17A 2WJFA 1MVYA 2ZX7A 4ZSTA 4AYSA 2RUSA 1XF0A 3KVLA 3NCOA 3QXBA 2QQ6A 3CB8A 3KTSA 4I3GA 1X1NA 3KDNA 4EX4A 1Q66A 3VKBA 3NYZA 3W1TA 2VR2A 3HGJA 3N6QA 4DF0A 1OM0A 3UJRA 5IRPA 4RZ6A 4QITA 3IVSA 2SFPA 3AICA 1VBGA 3UNDA 1ELSA 1IWPA 3MB9A 2CZDA 1Q6LA 3FV9A 4PRWA 1R2RA 1GOIA 2DZAA 1O1HA 5DY3A 2VX4A 2Q6ZA 1JDEA 4K1GA 3GNPA 4TVUA 4BQ3A 3CPGA 4M6UA 1KNWA 2G96A 3FW6A 1NTHA 5JQ9A 2C8NA 4EWJA 2HMCA