1F74A

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N-ACETYL-NEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 125
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f74A00
1A50A 1F2JA 1GYNA 1A53A 3QC3A 4UMBA 4QQ3A 2DZVA 2VOMA 4FNPA 2E5BA 3C56A 1SU5A 5HR6A 2B7QA 3LHYA 5F2GA 5FF0A 2H3DA 2Z2UA 2A2IA 3MI6A 3LI1A 4XKYB 3IIVA 3W2MA 3WJXA 1G4PA 2ZA1A 1LRQA 2Q3OA 3BK0A 1VHNA 3S6DA 4HPXA 4O28A 3NL2A 3W7RA 3G8EA 1L9WA 1TV5A 3GDRA 3N2MA 3S5OA 3NM3A 2OT1A 3C8FA 3IEBA 4WXZA 1U83A 2ZZ2A 4RCXA 3SY5A 4UTIA 1AL7A 4XBKA 3RNDA 5I3HA 1DQXA 4HT3A 4MJZA 1MEHA 3PR2A 5H91A 1OK4A 2JKAA 3TC7A 5F2IA 3TK7A 1TPVA 3A21A 4UNLA 4XQ6A 1XBYA 1ZNNA 3IVUA 5AOUA 2RDWA 4XBSA 4MJMA 5DBUA 1NEYA 1G4SA 4CNOA 3I65A 4GUIA 3EX3A 3SGZA 1R47A 3LV6A 1D3GA 4O50A 4Q32A 5C2XA 1G4TA 3OEXA 3W7IA 4UR7A 3W7DA 2CLKA 1HG3A 2QCMA 5G2HA 4QITA 2DJLA 3C61A 1M7OA 5DXXA 4FEZA 1JCXA 3NQFA 4N9EA 1PVNA 1NF0A 4HNNA 2FPVA 1LOQA 2CWNA 1YLVA 2X30A 2VXNA 3U6WA 4CNPA 4AF0B 3NO5A 1OYBA 4AWSA 1Z44A 2QF7A 3PY2A 4CCEA 3TCEA 1TSIA 1KBJA 4UTWC 1H63A 1W37A 1TIMA 4JTLA 3O63A 2QCCA 1JCNA 3I68A 3CC1A 1N55A 1EUNA 4MZ1A 1KM0A 3WJZA 1TTIA 3PUDA 3FYOA 1G67A 2ZA3A 4M6PA 1W31A 2VEIA 5HMSA 4R33A 2RH9A 4ORMA 4DBEA 1ZAHA 1AW2A 1X8FA 3QSTA 3DFNA 1S3HA 3GAYA 4UMCA 1LM1A 1G6CA 1O60A 5CG7A 5KZEA 2ZZ5A 4UC5A 1FCBA 5LNVA 2E5DA 2CLIA 4NXKA 3W1RA 5D2VA 3O6CA 3M43A 3PVFA 4JTIA 3GXNA 2Y62A 4QM1A 3W2JA 2NWRA 4UFLA 3ABOA 1RV8A 3G18A 4XZ9A 3TR2A 2FTPA 1N7KA 2PCQA 3UXAA 1GEQA 3STFA 3UNDA 3MO7A 1I4NA 4LOCA 1VJIA 4G1KA 1X7FA 4LVGA 3KVMA 2BWGA 1QPNA 4O1BA 1UBSA 1H7NA 1WOBA 1RPXA 1OX4B 4LY8A 1ZENA 5FF2A 1QOPA 1TJPA 3W2UA 3M7WA 1QCWA 2CZEA 1I2PA 3L5LA 5CSRA 1GT8A 4MLJA 4POCA 3B05A 1FCUA 3VKJA 3TNOA 3O06A 4JTHA 3BLFA 3PWAA 1YTKA 1YTDA 3LV5A 3P60A 3SR7A 2DZPA 2ABBA 2VEPA 4ML9A 5AHFA 1NF7A 4WOQA 1K03A 1PV8A 1TRIA 3CM4A 3QPYA 4DF2A 3S0CA 3WK0A 3BARA 2NXIA 5K3VA 1TREA 2GQAA 3EX4A 2C1HA 2J88A 3W7LA 4BI6A 1JCLA 5D33A 3B0UX 4UTWA 1QPQA 3HO8A 2ZRUA 4XWUA 1OABA 1IXPA 4O16A 3UWZA 4EF9A 1MO0A 1T99A 1J4EA 1J5TA 1S5TA 2JBMA 3W2LA 3FA5A 4FNUA 1XXXA 3FEMA 3P74A 1OFOA 1YDVA 3LCIA 3PG8A 1W1ZA 4DO4A 5HNRA 2DORA 2B7OA 4IWWA 1WBJA 2CZFA 3PS7A 3UWYA 4O10A 4X22A 3GLCA 2HSAA 3SFKA 3MBFA 4N9CA 1VH7A 3NGJA 2D73A 5KINA 1EEPA 1I2OA 2J9YA 5BMWA 1HTIA 1LBMA 3ZWTA 3B4UA 1DV7A 4A29A 1T0OA 1R2RA 4IPIA 5I3KA 2HS8A 1PCKA 2KZHA 1LYXA 3O6DA 1OFDA 3DU0A 4LRSA 3GZ3A 2J6XA 4JD4A 4FX8A 2Z6IA 5EMUA 1TPWA 4FNSA 3TSDA 3QM3A 4IXHA 4CQAA 4WY0F 1ICPA 3STCA 3WJWA 4S1FA 3W71A 4YWIA 3NQVA 4UIOA 5K4XA 1ZAIA 5L9FA 3PB2A 3FLUA 3LXAA 1QPRA 3QW4B 3W07A 4M6VA 2ZRZA 3C2OA 1P1XA 5FESA 2QCEA 3PSWA 4YXGA 3LTPA 3BGJA 5LNSA 5KMYA 2EF9A 4LS2A 4UTMA 1DHPA 1GJPA 2W0UA 3L66A 3N34A 1M5WA 4JYDA 3BG9A 2NUYA 5J5RA 1MEWA 4Z1CA 3WJYA 5HWJA 3S5YA 3WK1A 2CLEA 3G1VA 5K2ZA 4WX2A 5DBTA 3DBPA 4FO4A 3DHFA 2R8WA 5FEXA 2RKXA 1SZGA 4UTJA 1SO6A 1UASA 3BO9A 1O94A 2VFIA 4LVBA 4YLWA 2QDGA 4LS1A 4E2DA 3AJXA 1KM3A 2P0OA 2C14A 4HNUA 4QAIA 1FX6A 1QFEA 3W1AA 2X1SA 4AHPA 2Y7DA 3L5MA 5F1VA 1TO3A 3SZ8A 4MY8A 3PBYA 3LHWA 4O57A 3TDFA 4NJGA 4MYXA 4HIBA 1ALDA 1W5OA 3TU9A 2UV8G 1P4CA 1SUXA 1KLZA 4XUGA 1TPH1 3LM7A 3QJAA 2WSYA 2NX9A 3NQDA 3IV3A 2G95A 1S5VA 3HB9A 2OJPA 2C3ZA 1F76A 4YL2A 5EKYA 1I45A 3NZRA 2DP3A 4Q4KA 3UWWA 1QO2A 3MJYA 1I2QA 4K39A 5ABTA 3DGRA 1L6YA 4D2JA 4RXGA 4O14A 1ADOA 2Y7GA 1HUVA 1H7RA 1OFPA 1H7OA 3VCRA 4FB7A 2PRLA 3P62A 4H4IA 4A22A 4JEQA 2A5HA 3EEGA 4CQ9A 2YFNA 3KVLA 4TMBA 1TB3A 5D03A 2I9EA 1NFBA 4UTTC 1TTJA 4A3UA 3GK0A 4I7VA 4LVDA 3W85A 2DZSA 4MLRA 4IX0A 2QR6A 4E0CA 4EF8A 4JN6A 3UWUA 1KFKA 3GDTA 2J9ZA 3NL5A 3L2IA 4AXKA 1XBXA 1XUZA 4WY0B 1TPB1 1XDMA 2ZDRA 3STEA 3B0VC 4FHAA 1OK6A 1GPWA 5D04C 5H2ZA 2NWSA 1VCFA 3FYPA 1M6JA 4JGDA 3NZ1A 1H51A 1FWTA 3L0GA 1L6SA 4PFMA 1D9EA 4JYEA 3DAQA 1JULA 1UUMA 3IVSA 1LRNA 4IMCA 5LGZA 6TIMA 3SGUA 1JJKA 3BW2A 1VYPX 1H50A 1WAUA 5A5WA 2EHHA 2V81A 3G1SA 3S1XA 1YTEA 4PCFA 1FWWA 1Q6QA 3TH6A 1SO4A 2RDUA 2V8ZA 3MYOA 4E2BA 1OF8A 1ZAJA 4UTHA 5DCEA 4X3ZA 4EWND 4Q33A 3HGSA 4XKYA 4RR4A 3THAA 4AVFA 4RLIA 1H7XA 4AHOA 1KTBA 5U4NA 3QYQA 5CZTA 2YPIA 3AO0A 5EPDA 1Z48A 4IGHA 1UB3A 1LLWA 2Z1BA 4AH7A 4K6AA 3NOEA 1FBAA 4HNTA 1QDSA 3NDOA 2B0MA 1W5PA 3W1UA 1GYLA 3CIWA 1EWEA 1IGSA 3VNDA 4O15A 1H7WA 5MHBA 3A23A 5DLCA 2G96A 1YXYA 2I1OA 2VFEA 1VRDA 4M7SA 2NUXA 3MHUA 3SIZA 4M19A 3EKZA 3EB2A 2A7NA 2YGYA 2WO5A 6ALDA 1JRCA 3W1PA 4RKAA 4UTLA 1C9DA 1GG1A 3EWBX 1DL3A 2DZTA 4NX0A 2O7QA 2E1DA 5I3IA 1FWSA 4N2YA 4HNVA 4IMDA 2C19A 2Y61A 3FJ6A 5G4WA 3W22A 1KV5A 2DZXA 4NX5A 1EUAA 1OJXA 3EWUA 3CWNA 1BTMA 2P1FA 4UTTA 2FIQA 3W7OA 2FFCA 1SQ7A 3BLIA 4GXMA 3PBUA 3WK2A 1XM3A 2ZRXA 1GVSA 4PA8A 4RZ4A 3DI1A 1KFCA 1ZFJA 4JR5A 3W7PA 3WJSA 2YSWA 1TPFA 3GX9A 3IIOA 1V5XA 5D2XA 2BLEA 1IXQA 3E9AA 1YDOA 3BLEA 2W79A 2C13A 3W87A 1OFAA 3M5XA 4GNJA 1KM4A 4HKPA 2CW6A 3G1YA 2J9XA 1O5KA 2ALDA 3UPWA 1RQHA 3LCXA 4P61A 3KHJA 3L0KA 4BI7A 3QQ1A 4O4VA 2QUVA 1FDZA 4JDYA 4UFKA 5EBUA 2PC4A 1A5AA 3C2RA 2QAFA 1YXDA 3W75A 2VEKA 3F03K 1W56A 3FKRA 1BWKA 1ICSA 4O1CA 5LHFA 2NV2A 2VKZG 2E6DA 4UXDA 3W84A 3QFEA 2F84A 3ABSA 3P8JA 5AYYA 4XTDA 3NR0A 1F05A 2ZFAA 5E0KA 3TA6A 1DKWA 2VEMA 4N4QA 3SJ3A 3B8DA 4QISA 3W73A 2ATSA 2IQTA 3I7SA 2R91A 1V7YA 3LHUA 4M7TA 3EWXA 3VI2A 1EX5A 3H54A 2JK2A 1ME8A 1VCGA 4H6KA 5DCDA 5EA9A 2B7NA 4ZQPA 4FF7A 4UUIA 2QAPA 3BW3A 3MWAA 3FJLA 3TROA 3HG3A 1EP1A 4JTSA 3LGEA 3N73A 2H3BA 4KFPA 4WJEA 5FF3A 1IIGA 3P80A 5AYXA 2ZZ1A 5FEZA 3U8GA 3C6CA 3CLMA 5F4XA 3MHFA 1VYRA 3T7VA 1VHCA 1LCOA 3EX6A 2Z0IA 3GDMA 4WZHA 4LW7A 1K8XA 1R46A 4WQ6A 4Y9AA 2A1YA 3QEZA 3Q37A 8TIMA 1F5ZA 3QPZA 4MFEA 1SZFA 4U28A 4S2CA 3W70A 5C6MA 4GC4A 5G1TA 4DQWA 3TV8A 2ZQ0A 2Y89A 3PM6A 4N4PA 2NLIA 1RQEA 1VPXA 3B03A 4KFOA 3T44A 3TKFA 2C16A 2B4GA 4RZ5A 5AN7A 5IM51 3W1LA 3G0XA 2VFFA 1OFRA 3G22A 1O5XA 4MZYA 3L21A 3W2KA 3CWOX 3EKLA 2NX3A 3NAVA 4IPJA 1SFJA 3RU6A 1EIXA 3M0ZA 2X16A 3E12A 3I7RA 3LLFA 4GWEA 1ONRA 1SW3A 5TQLA 3INPA 3M44A 3M5YA 4ZQRA 1LRTA 1LLZA 3E49A 3H55A 4M6QA 2C0AA 3M1ZA 1SO5A 3NEVA 2QJGA 3EXSA 3TE9A 4LU0A 4NUWA 3G24A 1EP2A 2CZDA 5FF4A 3R2GA 2WSQA 3RLVA 4ADSA 1GVQA 2V9DA 1YDNA 4RK8A 2DZUA 4GUHA 3UD6A 4O54A 3C2FA 3NVTA 4HHPA 4ZQMA 1KFEA 4ZQOA 1SW0A 2LLEA 4ZQNA 1GTHA 5A8GA 1MXSA 1HFBA 1OVDA 1WDWA 3EX1A 1FCQA 3I6RA 3HQ1A 3LBCA 3HGOA 1KM2A 3G1HA 5DY2A 4HSOA 2Q8ZA 2EPHA 3JR2A 1KFLA 2FLIA 2GUUA 4X2RA 1ZJIA 3USBA 4Y90A 3NYZA 3A5FA 4JTKA 1D3HA 1TCDA 1LOSA 3R8RA 3IGSA 1H60A 4Z1AA 2A7PA 3TAKA 1L6WA 1TPC1 3KOFA 2Y6ZA 3PSVA 2VFGA 3L5AA 4Y8FA 4FIRA 4WUIA 1KBIA 4FXSA 2YW3A 3SI9A 5I3JA 3GYEA 4PTNA 3FOKA 3P84A 5CZSA 1FDJA 4UCGA 1JQVA 3DZ1A 3W83A 3W1TA 2CLLA 4W9TA 2WNQA 4ZQCA 1Q3NA 2ZTKA 2E68A 3M47A 3GVGA 2CLMA 2X1TA 5HQEA 2O7SA 4CLMA 1W3TA 3FS2A 4CCDA 4MFDA 1DJNA 1LOLA 4KKXA 4GRSA 3W3OA 3Q58A 2ZYFA 2YDAA 1PL9A 5D32A 3CEPA 3ELFA 3RLUA 4LUJA 3QMTA 3GKAA 4PL1A 2ZRVA 2QCDA 4O13A 1H61A 3G1XA 1R2SA 1DORA 1VYSX 3NPUA 4GE8A 1JQXA 2NUWA 4PEKA 3N14A 3V75A 3GDLA 3OVRA 1PCWA 4JTFA 1GOXA 2Y70A 4NZFA 4H3DA 5D02A 3DXIA 2G97A 2JKPA 2Q3RA 1PE1A 1TPDA 2QKFA 4AEOA 3HGRA 2V2DA 3LTSA 1OX5A 3LHZA 3W1XA 2QUTA 3PUEA 2A85A 1FY6A 2HMCA 2C15A 5AB3A 4TU1A 3V1PA 1CX9A 3GDKA 4GUGA 3ATZA 4MPQA 3BG3A 2FQIA 3RFAA 1TPUA 3W76A 3UXDA 3LI0A 4UFHA 3PUOA 4ADTA 3R13A 5CPOA 5CGQA 3O05A 5FEWA 3VE7A 3KRSA 3NPVA 3O8AA 1K8ZA 2E77A 1IXNA 4FX6M 5AHNA 4WY0A 5FEPA 4X9SA 3EX2A 3F4WA 4DF0A 3MP4A 1ZY9A 1PS9A 3EWYA 2QCHA 2A6NA 4CCCA 2V2CA 1X1OA 4Z0SA 4JTGA 2Z6JA 3NQ6A 3LCWA 4S2BA 3UY7A 1S5WA 3N9SA 1A5CA 1MSSA 2EGZA 1YADA 5D30A 4O53A 3MHGA 4MUZA 1SSGA 2QCNA 3LXBA 1R2TA 3P8IA 3M6YA 3IIPA 4JIQA 1QOQA 4RXFA 4B5NA 3MP3A 2I14A 3A9IA 5SWUA 4NJJA 3E96A 3DFOA 3QF0A 3W9ZA 2V82A 3BPWA 1A5SA 2OCZA 3R89A 3TMQA 2H6RA 1KM6A 3NQCA 4LUIA 2GQ9A 3UZJA 4C1KA 4K38A 3IIZA 3DFTA 3SSJA 4JNMA 3GKFA 4J9JA 4LVAA 3KRZA 4IMGA 3MI3A 1JUBA 1W5NA 5CPMA 3LRKA 2NXGA 4CNNA 3GXPA 1SO3A 5C54A 1ICQA 3S1UA 3P5ZA 5DELA 2H8XA 1VQTA 1B3OA 4LT9A 1OG0A 5LSMA 4KFNA 2RFGA 1A5BA 5BW6A 5L6UA 3LXCA 2P10A 3IGUA 2NV1A 3Q2DA 1JCYA 1LROA 3YPIA 1OFBA 3TFCA 3WFAA 3N3MA 3A5VA 1DVJA 3NG3A 1PIIA 1WA3A 3M5VA 1F6PA 1ML1A 5E1QA 1Q45A 4LC6A 4MIMA 3LRMA 2Y63A 4IJBA 5IBXC 4IMEA 2A4AA 1TYGA 3ABRA 1SPQA 3IGXA 4TIMA 2WPBA 1FXQA 2J24A 1VCVA 1RD5A 2Y7EA 1E51A 4NNAA 2A7RA 2XN2A 3M5ZA 5AYZA 3K30A 2VFDA 5KTLA 4LV4A 1X6UA 2W6RA 4A21A 1M7PA 1QO5A 3NM1A 3MI2A 3PULA 5K9XA 5KZDA 4MYAA 3W7GA 2WKJA 1GWJA 4R34A 2H90A 1KTCA 3S1VA 3TJXA 3O16A 4O19A 1RQBA 1JCMP 1RZMA 1QNVA 3VE9A 3GXTA 2CZ5A 3MP5A 1W0MA 4OWGA 3M41A 2QJIA 3W23A 2A21A 3HGJA 1ZHAA 4R53A 2YZRA 5F4SA 3C0JA 3L0NA 1LORA 1TTQA 4JIPA 3ZR4A 1Q6LA 4DBDA 3PC0A 4NXSA 5LKYA 1W3IA 3P5YA 1G4EA 3E02A 1L2UA 3H53A 4WD0A 2ZA2A 2WJZA 5AHEA 3TXZA 3F4NA 3KAOA 3ATYA 1XCFA 2WOQA 2ZRYA 3C52A 4LTSA 4ALDA 1FWRA 3TW6A 2Q8LA 3P82A 1C29A 1Q6OA 2X1UA 4Z08A 3VFLA 2J27A 5K4ZA 5LZLA 4LWWA 3CT7A 4MZ8A 4L4LA 1FDYA 4TMCA 1R30A 4K36A 5HJLA 3EWWA 1TRDA 4OV9A 1LBFA 2GJNA 3CHVA 3RK8A 2V5BA 4LVFA 3LHVA 4DEFA 3HPSA 3R12A 5BNKA 4QNWA 3BW4A 4AF0A 3O6YX 3UWQA 5C5YA 1QR7A 5AHLA 3DHDA 4QJ1A 2JGQA 2WNZA 1GG0A 1IF2A 1OYAA 3DI0A 4UNKA 3UY8A 4DPQA 5KITA 5KSWA 3MMTA 3NQGA 4JTJA 2ISWA 4UFMA 4FXRA 3L9CA 3OA3A 1IIHA 2CFFA 4GBUA 5HINA 4O8RA 3TSBA 5FI8A 1K7XA 4ZVJA 4OV4A 5J5DA 4ZZ9A 1FCVA 1THFD 1TQJA 1H1YA 3C2EA 3OBKA 2ISVA 4MY1A 3GAKA 5D09A 3L65A 5F2LA 1O4UA 1VR6A 2A0NA 5G1YA 2BX7A 2CLFA 1W5QA 2R14A 5EYWA 3W86A 2DJXA 1WXJA 4BWLC 3NQ2A 3QMRA 2PRMA 3M16A 4K8EA 4RZ6A 3S9YA 3UQNA 1AG1O 3W7CA 1TMHA 2X1RA 1TV7A 4N02A 1C8VA 4HSNA 2VELA 2E6YA 4I9AA 5DY3A 3JS3A 3CPRA 3W7NA 4NJHA 3C4UA 2TRSA 2ABAA 2FPYA 3TQ0A 3OVQA 3HPXA 4TR9A 4E38A 2WV8A 1EB3A 3W88A 1W5MA 1YXCA 4TX9A 5AC8A 1FXPA 3N2XA 3P81A 4OT7A 3HF3A 2ZBTA 5CSSA 3B0PA 1EA0A 2H8ZA 4UMAA 4XTIA 5U7SA 5HWMA 2FDSA 1GVRA 5G4EA 1OX4A 1RR2A 3HPZA 4LV9A 1JCJA 5HULA 1JR1A 2B7PA 4P2VA 3HIJA 3MUXA 3LRLA 1PHQA 3QZEA 4FNQA 4JYFA 1Y0EA 4IXXA 3N9RA 2GPTA 3NA8A 3W7QA 1XBVA 3PG9A 4FNTA 5AHMA 4BR1A 5C55A 1QAPA 4IMFA 3IVTA 1TJRA 2GJLA 2WSRA 1AW5A 3R5EA 3F1QA 2YX0A 3W1QA 5CPLA 2OZ0A 3U2OA 4JY8A 1B4EA 1XKYA 4AWUA 4UTKA 4NZJA 2V0TA 2NXHA 2OMAA 4YCOA 4NJIA 2GOUA 2BXVA 2YYUA 3G1AA 3HJZA 4EOUA 3JRKA 2QEZA 3G1DA 3BGGA 4K7YA 5D2YA 3OG3A 4BK9A 4ZL1A 4R7JA 3TAOA 4O11A 4A2SA 5LNRA 3W7JA 2GVLA 1YYAA 4JTEA 4MY9A 3TSMA 3TW7A 1NVMA 4I7UA 5K9CA 3S8HA 2XFWA 5BMXA 1UJPA 3NL3A 5D38A 1QMLA 4OHQA 2BSLA 3W7EA 3PBWA 3TJLA 3GB6A 3ZWSA 4Y6GA 1O95A 3B04A 5LHEA 4O1DA 4BWLA 1FWNA 5AC7A 1WBHA 1OFQA 3HOJA 1VZWA 1EP3A 3KFTA 1KTNA 1W3NA 1JUKA 3G8RA 5KZMA 2OX1A 2EAWA 5F1UA 2AGKA 2FB3A 5DN1A 2AQWA 4FX7A 2G5WA 1N8FA 5G5IA 5G2WA 5TIMA 2E6AA 1Q6RA 3NQ8A 3Q94A 4TO8A 4ADUA 1DQWA 1J2WA 3PAJA 3NNTA 4O18A 5LGXA 4O1AA 1Z42A 4WOZA 1DJQA 3TFXA 1CI1A 3LDVA 3DFSA 2BTMA 3TQKA 3L67A 2EKCA 4BF9A 5LNUA 1ZCOA 3T78A 3DFPA 1W54A 3W1NA 3TQVA 4NVTA 1SZEA 2YCEA 2ZZ6A 1I2NA 4AMAA 5I3GA 1YPIA 1OFEA 1XI3A 4O0ZA 3NXFA 2V5LA 1PHWA 4K8HA 4ORIA 2TPSA 1I8JA 2GQ8A 2QCFA 4K37A 3P67A 3DKLA 1SZNA 4MVAA 4NNCA 4EVZA 1EPXA 1G7VA 5TBOA 4AAJA 1LP6A 4O52A 1YPFA 1RVGA 1JRBA 4ZMGA 4LNYA 2WQPA 3DH7A 1DBTA 4I7WA 4GJ1A 3EWZA 2FPTA 2WNNA 4ICNA 3FFSA 3OHIA 2CU0A 4L4MA 3CTLA 2YR1A 1OX6A 4DF1A 4WXYA 4DO6A 3O07A 4GUJA 2QDHA 5HUOA 3T55A 1K3UA 1BKSA 1HO1A 3FKKA 4ONVA 5K7JA 3LHTA 2QCLA 4K7VA 4UFIA 3RF9A 2ZRWA 4Z1DA 3TIMA 3TXVA 3ANYA 1WQ5A 3NQ7A 1KW1A 3L68A 1FUYA 1I2RA 4LRTA 3PB0A 4UTUA 1XFBA 3OVPA 2JKEA 1IXOA 4YMZA 3NL6A 3G3MA 2HTMA 5CPNA 1OYCA 1BWLA 3HMJG 1H5YA 3ABQA 2DU2A 4A2RA 4AWTA 2C6QA 3W74A 4JX4A 1B4KA 1OHLA 2TSYA 3CU2A 3G1FA 2ZCGA 5DXYA 4KWWA 3C2VA 4N9BA 3S1WA 3BV4A 3GR7A 1VLWA 1XL9A 2GVJA 1F73A 3PBVA 2PE4A 2XN0A 1EWDA 4NNBA 5CZ0A 2C18A 3LBMA 4DPPA 3HG5A 3CEUA 1QPOA 3OIXA 2RDTA 4QIUA 1KFBA 5HUPA 1LTDA 4MOZA 1Z41A 4UR8A 2JGYA 1TQXA 5D2WA 3S5ZA 4C1LA 4JTTA 2QCGA 1SFLA 2ISSA 3HBLA 3GR8A 3W72A 3MBDA 2YFOA 1G7UA 5HR7A 1SSDA 2E6FA 2RHGA 1VLIA 2QJHA 3EXTA 5F4WA 5E93A 3G0UA 1F74A 2Y7FA 2PURA 2CLOA 4OGZA 4GFSA 1KM5A 1OF6A 2E09A 2FJKA 3I7QA 3KRUA 4DELA 3SECA 1GVFA 4JXCA 1P5BA 3MYPA 3N19B 3P7YA 2ZTJA 3PF3A 4QSHA 3NPXA 3T4CA 4FIQA 4O17A 2NX1A 1AK5A 3W7KA 3CIXA 2GVGA 5I3FA 2R94A 4JICA 1P0NA 4O12A 5EL1A 1FQ0A 1VGAA 5F2MA 4HN4A 3ZFHA 4IUOA 1TPEA 3DENA 1ZALA 4RX0A 1ME9A 4U4MA 4AHQA 5K9DA 4PODA 4BI5A 2YYTA 5AC6A 3STGA 3DFQA 2QCDB 3GNNA 5CZJA 3W7MA 4OU1A 1AW1A 3UPBA 2A6LA 1SR9A 2XN1A 1F7BA 2V2HA 3UWVA 3NQEA 4FNRA 1AL8A 2TMDA 1VS1A 1F6KA 1H1ZA 4JX5A 1UCWA 4Z1BA 3THQA 2X2GA 3HG2A 5FF7A 3A22A 4OE7A 2HS6A 3TC6A 3IRDA 1H62A 3WK3A 2Y88A 4RJEA 3DKJA 3QSRA 3W2NA 3ZS4A 4CQ8A 4IX2A 5D37A 2VC6A 5DCBA 5T26A 3QW3A 4AB4A 4LS0A 4PC8A 3CB8A 3TMLA 3IIXA 3B06A 1HO4A 2VENA 1TV8A 2YW4A 4NQ1A 1TTPA 2E5CA 2V30A 4DXVA 3E0IA 3A24A 3KVKA 1XBZA 3W1MA 4YCPA 4BFAA 3LLDA 1LZOA 1H7PA 3NQAA 5GVJA 3M9YA 3LX9A 2Y85A 1NSJA 3T40A 4PL2A 3C3NA 3LOTA 4DO5A 1XUUA 3GIYA 4O0KA 3NQMA 1T8XA 2NZLA 2DZWA 4N6FA 4GUFA 1GQNA 3LCHA 4N9DA 1WYIA 3MW7A 3BG5A 1KM1A 1KLYA 1LBLA 3KXQA 4NJKA 3O15A 3S5NA 1T96A 3G3DA 1WX0A 4NU7A 4JTUA 5AFDA 4IQLA 3KVJA 1WOAA 2YXGA 1LDCA 4EIVA 1JUEA 3TUUA 1JVNA 3LCGA 5AHIA 1KV8A 1QWGA 1KA9F 4KWVA 5G2IA 3QQ0A 3W6YA 3FIGA 4QNEA 1NAL1 1U5JA 2AAMA 2QUUA 2ZZ7A 4JS3A 1SW7A 5LNWA 1MZHA 5HWNA 2CLHA 1XDLA 1DOSA 5D05A 4JDBA 1XC4A 1HL2A 1K02A 1ME7A 3CQ0A 1GZGA 4IOTA 1KFJA 3UZ5A 3W7HA 1BEUA 1X1ZA 4JY9A 4Y96A 5BRBA 2BZNA 1W8SA 3SW6A 3LB0A 5CKSA 2ATMA 2ZZ3A 2F7FA 4LC8A 1GVOA 3LCFA 3UYCA 1CW2A 4N6EA 3LERA 1B9BA 3QMSA 4HPJA 2VFHA 3S42A 4NT0A 1VC4A 3G0SA 1K7FA 4JX6A 3P61A 3QH2A 5D2TA 1AMKA 4RV8A 3O1NA 3HG4A 3BVJA 4OBTA 3GNDA 1UUOA 4Z0JA 5BOOA 7TIMA 3D0CA 3EXRA 3RMJA 2OT0A 4M5PA 3TX9A 5EY5A 1GTEA 4OQVA 1K7EA 1K8YA 4O4WA 4PH6A 3NPWA 1WV2A 5IBXA 3QRHA 4MKNA 2ZZ4A 1G69A 3LTYA 3KX6A 1P0KA 2FB2A 2TYSA 2PRHA 1B57A 3LCLA 4UFJA 1MEIA
chains in the Genus database with same CATH superfamily
1JXJA 1FWFC 3VZXA 3S47A 4UMBA 4NHVA 2VOMA 4KMQA 2B7QA 3LHYA 3GVVA 3UR5A 1M9HA 1TWIA 4DI9A 2MANA 5A2AA 3IIVA 1Q8JA 1AD1A 1JFXA 1G4PA 4XSMA 1LRQA 2Q3OA 3B9NA 1QRQA 4O28A 2D2JA 3LG3A 1US2A 1CXIA 2WVVB 1XSIA 4AZIA 3S5OA 3NM3A 2OT1A 3IEBA 4WXZA 3EOEA 4HK5A 1AL7A 1GEHA 1DQXA 3W00A 2EXOA 2INFA 3OBEA 4MJZA 4FAMA 3VM7A 3PR2A 1UR2A 3VINA 5MKGB 1OK4A 1E0WA 2OYMA 3G6MA 4UNLA 4XQ6A 1XBYA 1ZNNA 5LIXX 3K8LA 4D71A 1NEYA 3QY6A 2J77A 1EJVC 4HMNA 4KGLA 2I5QA 2VQUA 5LIYX 4Q32A 5C2XA 1G4TA 3OEXA 5FJTA 4TTGA 4UR7A 2GK1B 5G2HA 1M7OA 1CGTA 3L4UA 4FEZA 1NQKA 4N9EA 1PVNA 4RE4A 4HNNA 1LOQA 2X30A 5JBFA 2VXNA 4CNPA 4RW3A 3FGCB 3WUGA 4JKLA 1RVKA 4CCEA 4IIBA 3URNA 1KKOA 3PZVA 1GJUA 1JCNA 3F4CA 2O0TA 3CC1A 1EUNA 1ISWA 1DWJM 4CUCA 2I57A 5EGRA 3CWHA 4L61A 3ARSA 4LPCA 3VIKA 4M24A 2VHLA 3G6LA 1NJJA 7XIMA 4XD5A 4YVXA 1DJGA 4ZO8A 3DOPA 1JEZA 4DLFA 3MMDA 4YIWA 5KZEA 4Q6JA 2ZZ5A 1QWKA 1MUMA 2CHOA 1YNYA 3FSUA 3W1RA 2IUZA 5D2VA 3BCDA 1J18A 3O6CA 5I3DA 4PCSA 3N6HA 1RV8A 5CPSA 1VBHA 4AIEA 4NI3A 4TOQA 2DVTA 2XSXA 1GEQA 3UNDA 3UZXA 2G50A 5A6BA 1I4NA 3HN3A 3W02A 4LOCA 1VJIA 1X7FA 4YYFA 4I5XA 3D5HA 4JHMA 3WBWA 2XTKA 3DBNA 1OX4B 3VDHA 3SCTA 2J7GA 2PP0A 3E1F1 3M7WA 1QCWA 3SB0A 3GRIA 3L5LA 4DWDA 2QULA 4D8AA 3W29A 3L4VA 5FAJA 1AD4A 3O06A 5BXSA 5HNUA 3BLFA 1YTDA 2ZXDA 3P60A 1VFMA 2GDVA 3SR7A 5H1WA 1E0VA 2DZPA 3C3UA 2ABBA 2VEPA 2YB4A 3PTMA 1K03A 4LYKA 1CGVA 3CM4A 3QPYA 4DF2A 1YKWA 1GVEA 3RX4A 3WK0A 3BARA 5K3VA 1TREA 1XS2A 4GVHA 1M7XA 3T1GA 5D33A 1XF0A 3WQ5A 4DZAA 1QPQA 4XWUA 2ZRUA 3K13A 3MB9A 2ALRA 1IXPA 4EF9A 4YPJA 3WUEA 1T99A 5LXEA 3ABZA 1J4EA 4X63A 1Q8AA 1J5TA 1S5TA 1RLDA 1M68A 4FPSA 3TC3A 4FNUA 1M04A 2ONEA 4LQ1A 1J93A 1XXXA 2Y5EA 4U10A 1V0KA 1OFOA 4AZHA 5M3WA 3LCIA 2R82A 4DO4A 2B7OA 4JBRA 4UB9A 1YE6A 1X97A 3PS7A 3UWYA 3GH4A 4CQDA 3VNMA 3AXHA 1KD0A 1S46A 3K4AA 4N9CA 1VH7A 1I2OA 2J9YA 4WSKA 4KRUA 3V5OA 1NFGA 3MCOA 3WBEA 4P7NA 1R2RA 4KEUA 1XRFA 3L4XA 1DJZA 3DU0A 4CNTA 3SFWA 4GO8A 5EMUA 1TPWA 4Q4PA 2ISFA 1ZBCA 4CQAA 4WY0F 4S1FA 4YWIA 4MMWA 4HK7A 4JTAA 4L7ZA 2NQ9A 2G4JA 5L9FA 5AZ1A 3FLUA 3LLXA 3W07A 1DE6A 5JU6A 1P1XA 3IAPA 3LTPA 2F2KA 3OLGA 5LNSA 2EF9A 2CEQA 4HOXA 1GJPA 4JIIX 4PYSA 5GQBA 4IZGA 4XK2A 4PB5A 3N34A 1EXPA 3BG9A 4PSRA 4CVWA 4GJIA 1TZZA 3WK1A 1FFRA 4GVGA 1WCGA 2WXDM 5E0CA 5CPQA 4WRHA 1UD2A 5IHRA 4FO4A 2I7GA 3I3EA 1PBGA 2XYLA 2RKXA 2WSKA 3L2LA 2QDGA 1HJUA 5BOEA 4E2DA 3AJXA 4XBJA 4HNUA 1FX6A 4F4RA 1XYZA 3W1AA 1X6NA 5F1VA 1XW8A 4B5XA 3LHWA 4O57A 1Q6FA 3VU2A 4KH2A 3WDPP 3LZ5A 2V69A 4IP4A 1P4CA 4QE1A 1YQ2A 1TPH1 3LM7A 1H3GA 3EKGA 3HB9A 3UJSA 1XLGA 3I6EA 5EKYA 3UWWA 1VBUA 1OZMA 2DP3A 1XGDA 3MJYA 2EBNA 4FOJA 1I2QA 5HJXA 4ZENA 5ABTA 2CBUA 1R87A 1JF5A 1ADOA 3UT0A 3EA2A 1G0CA 3FXYA 1HUVA 2Y8KA 2ZUNA 4JEJA 2CZVA 2GVYA 3GZAA 1H7OA 4FB7A 4GI6A 1XHGA 2NQJA 2A3AA 2YCLB 1DJXA 4TMBA 3SN1A 1NFBA 3O3RA 4I6KA 4I7VA 1FH9A 1JYNA 3W85A 4MLRA 2QR6A 1N8IA 4EF8A 3M0HA 1ISYA 3H6OA 2J9ZA 3NL5A 1XBXA 1TPB1 2D1ZA 4DWSB 2ZDRA 3GHRA 1GPWA 3SCPA 2OKOA 3MUCA 1V7AA 3FYPA 3PJWA 4HJFA 3L0GA 4ZA0A 4PTVA 4JYEA 1UUMA 4IMCA 2VX4A 2PDPA 4H9UA 1H50A 4BHYA 2EHHA 3QR3A 3IJLA 2GUBA 3S3GA 4QROA 1D8CA 3OZOA 1KFWA 5JMUA 2W66A 5DCEA 4X3ZA 2YBVA 4Q33A 4G56A 1FKWA 4XKYA 1KR1A 2DVUA 3TLLA 1H7XA 1EOKA 3QYQA 3UG8A 2HVMA 2YPIA 4DUWA 5ECUA 1Z69A 1Z48A 2FKPA 1DEDA 1LLWA 4AH7A 2GFTA 1OT1A 3WX7A 1XIIA 2O92A 4J2PA 1QDSA 3NDOA 1W5PA 4U5IA 3W1UA 2W3ZA 4J4KA 4AVNA 1EJTC 1ISXA 4O15A 4LSBA 5I02A 1SR0A 1YXYA 2VFEA 1EPVA 2W91A 4DUOA 1OCQA 2WO5A 1IHIA 3AHYA 1JRCA 2PMQA 3WQPA 1GG1A 1DL3A 3BAYA 3OW1A 4NX0A 2O7QA 5E5CA 4Q4SA 1OWQA 2VRJA 2J7BA 4YTQA 3KCJA 1KV5A 2Z1KA 5CC6A 2O9OA 2FIQA 4H9YA 4AY1A 3QHNA 4E3VA 4JOMA 1VJZA 4HHHA 5REQA 2IS7A 4GXMA 3PBUA 1KQZA 3WK2A 4B5TA 5BXPA 2MUCA 1ZFJA 3PFRA 3WQ6A 3WJSA 1IEXA 5D2XA 1MMFA 1V02A 3AS2A 1IXQA 1BVWA 2WZEA 1RD6A 1IWPA 1WUEA 4FXFA 4GNJA 4GQBA 2GQ3A 3WMCA 3G1YA 2ALDA 1FFQA 3PPHA 4HZ6A 3NSNA 3KLKA 2UY2A 2BHZA 3KHJA 1KQYA 1OC6A 2TAAA 3C2RA 2UY4A 3W75A 2VEKA 3F03K 3FKRA 3QYSA 1BWKA 2HDJA 1OD0A 2NV2A 2VL4A 1PZ2A 3HURA 3H2MA 3WQ8A 4WK9A 4PE8A 3TTSA 5EMYA 3P8JA 3CUGA 3AIWA 3NR0A 3GTFA 3EMZA 3GW3A 5E0KA 4N4QA 3VD7A 2ATSA 2R91A 5JBEA 1NOUA 3EWXA 3VI2A 3GBEA 2C71A 2JK2A 4H6KA 2WJFA 3QKEA 2QV5A 2PD5A 3MWAA 1I0DA 1EP1A 1DJYA 3B97A 2YKKA 2EG7A 4JTSA 3T09A 1BF2A 2XPKA 1X1NA 4D6IA 4JN7A 5FF3A 1IIGA 1NELA 2E40A 2GJXB 2WM0A 4QHRA 2CNCA 2PTXA 1FHDA 1G1YA 3M0IA 4C7GA 1BTCA 1UD8A 3HV8A 1K8XA 1VKFA 2A1YA 1VENA 4L4PA 5DX7A 2Z28A 4S2CA 5C6MA 4GC4A 4DQWA 4N4PA 4DUXA 1KCLA 3B03A 3BICA 4GY7A 3T44A 2C16A 2B4GA 5AN7A 3W1LA 4HZ8A 1OFRA 3W2KA 3K2GA 3L21A 3R10A 4IPJA 1SFJA 2X16A 3LLFA 3GU9A 1OT2A 1ONRA 3M5YA 5A6SA 2ZUSA 3URBA 4M6QA 1IEWA 2C0AA 3WUBA 2QJGA 3EXSA 4AZ5A 2WC7A 2CXEA 4ZOCA 3IARA 1GVQA 8CGTA 4RK8A 2DZUA 3HU7A 4GUHA 1MUCA 3NVTA 2VCBA 5B7ZA 3C86A 2WZHA 3TTYA 2LLEA 4A6GA 2JIEA 1WDWA 3I6RA 4Y9OA 1F3XA 2XIMA 3HQ1A 1DIEA 2OU4A 3EEZA 3G1HA 4LEFA 3AMCA 2HBVA 4HSOA 3KOWA 4WR3A 5CQ1A 2EPHA 2P0IA 3NIYA 3CAVA 1KO0A 2FLIA 2GUUA 5CC3A 2EPKX 3VPLA 3A5FA 1HZYA 4K3ZA 4BY3A 2R24A 4L1XA 3IGSA 3FHQA 1BXCA 1UWIA 1TWSA 2A7PA 1UA3A 3WYZA 4Z1AA 3KOFA 3AXXA 3PSVA 3L5AA 3N4EA 1KBIA 1C7TA 2YW3A 3ECQA 2O9RA 1UZ1A 2AAAA 4U33A 4PRWA 2WMJA 4DUVA 4R9OA 3L2MA 4RV3A 3GYEA 5A6KA 3LS9A 4LNCA 1XWYA 1NARA 3RO6A 2V3GA 3W83A 3BWWA 2CLLA 1QW9A 2XWEA 4GJJA 4AX7A 2WNQA 4ZQCA 3U2ZA 1Z32X 2QYGA 2ZTKA 1CT5A 3GVGA 4UQ9A 4ZR8A 2CLMA 3H2OA 5HQEA 4NYYA 3LK6A 5JVLA 1VFHA 3FS2A 4WKFA 1DJNA 1LOLA 4KKXA 4OOZA 3CGTA 4PMUA 2ACRA 3LPGA 4GRSA 2YDAA 3W81A 2GJPA 3RLUA 3MUY1 4LUJA 3QMTA 2DIJA 3UF9A 4MNMA 4D6HA 3ORWA 4O13A 4R5EA 1R2SA 3AXIA 4C6QA 4PEKA 1HJSA 4Q8TA 3N14A 4ERAA 3GDLA 3OVRA 1PCWA 1WE5A 1KXTA 2Y70A 4NZFA 1OQFA 1PE1A 3S2NA 1TPDA 4ZOBA 2A3BA 2V2DA 3TYBA 3LHZA 2QUTA 3LY0A 3M07A 5CGTA 2V68A 5BWFA 1KXQA 3AZTA 5JBDA 1J79A 4MB3A 3RX3A 1TPUA 3EOUA 3W76A 5CLWA 1CXKA 4J2MA 3R13A 1X39A 3BJTA 3OZYA 5CPOA 3O05A 5FEWA 1AUSL 1V6XA 2WC3A 3VE7A 4IL0A 4QXIA 3AS0A 4GINA 3NCOA 4P5UA 2E77A 4UQBA 4FX6M 5AHNA 5FEPA 4DF0A 2ZADA 2W4XA 1PS9A 2YA0A 4HOWA 3M0VA 1DXEA 1X1OA 3QC0A 3IJQA 4JTGA 4Z0SA 4GY0A 2Z6JA 3NQ6A 1EHAA 1UW9A 5I07A 5CGMA 4G1NA 2QCNA 4Z2HA 1R2TA 4HCHA 1E4MM 4JIQA 3JVAA 4HU4A 4I5RA 3A9IA 4IP7A 5SWUA 1K9TA 1B3YA 1AFSA 3W9ZA 3BPWA 1IEQA 1X96A 4XUYA 1P48A 1EA9C 2A3LA 3MTWA 1QNQA 4C1KA 1T41A 4B90A 3IIZA 3F5LA 3P93A 3UESA 1GOIA 3VDCA 4JNMA 4P8XA 1JAEA 3C0SA 1W5NA 1CYGA 3FV9A 1SO3A 2X8RA 3S1UA 1QBAA 2H8XA 7REQB 1N2VA 3VKKA 3ARWA 3H21A 1XLMA 3DESA 4IMAA 1B3OA 5LSMA 1LT7A 1VBGA 5BW6A 1UKPA 4L65A 4JCLA 2P10A 4XZLX 2L5HA 2OOFA 2PB1A 3KL0A 3YPIA 3T0AA 3G1RA 2BGNE 3C0QA 3N3MA 6PTDA 1DVJA 1PXGA 2XIJA 3M5VA 1ML1A 1W3KA 4PBFA 5E1QA 2DT2A 3SRKA 5FKYA 4ZOAA 2Y63A 4LAZA 1CB2A 4YNGA 3AMLA 4H6EA 3BDKA 4IMEA 1TYGA 1SPQA 2OVLA 4TIMA 2WZTA 3SIMA 1JPDX 3VUSA 3N2TA 1FXQA 1JZ7A 4J3UA 1RD5A 2D22A 2G3MA 2R9RA 2A7RA 3CQJA 5AYZA 2VFDA 4S3JA 2PU0A 4LV4A 2W6RA 3RCYA 4RNHA 4A21A 3BCFA 2XSBA 3RITA 2ZUMA 4LYPA 1R3YA 1J0YA 4PMYA 4PUDA 1GKPA 5IDIA 1TWWA 3QTPA 3TJXA 1QNVA 3UEQA 1QK0A 3AYTA 4FLQA 3B40A 5C8BB 1VPYA 2VEFA 4E8GA 1ZHAA 4R53A 1XG3A 2YZRA 3LD5A 1QI2A 1LORA 5LKYA 1UKQA 3P5YA 4A3QA 2O4QA 3UR7A 4JKKA 2PDCA 3H53A 3PANA 4LEQA 3UA4A 1UH3A 1UR1A 3KAOA 2RJGA 2ZRYA 1FWRA 1Q6OA 2VP8A 2X1UA 1BYDA 2J27A 1EO7A 4KERA 4RDZA 2XVNA 3M0YA 4L4LA 1FDYA 1R30A 3BH4A 2XIQA 2BP1A 3EWWA 1UC5A 3GHUA 1TRDA 4WVXA 3CHVA 4J3ZA 4QCEA 3LHVA 3JU2A 2Z7KA 3ICJA 3BW4A 1ONEA 4NYUA 5C5YA 1QR7A 6XIAA 3VD5A 3DHDA 2JGQA 2WNZA 3CZJA 2A3CA 3ARTA 5DMLA 1J5SA 1C90A 1MZRA 5KITA 4LYQA 3WLMA 5D9PA 2ISWA 4A8LA 3OA3A 5HINA 3TSBA 5I78A 5J5DA 2FMNA 4OV4A 4ZZ9A 1FCVA 3C2EA 3C0LA 5FD0A 3G2GA 3WG6A 1VBJA 1A0CA 1VR6A 1O5QA 3SM0A 1GNXA 5B80A 1J0ZA 3W86A 4AZCB 1TX0A 4US5A 4JQ3A 3V3WA 2DJXA 4BWLC 2ZC1A 3QMRA 5EFFA 4DM1A 1SM9A 3CBWA 2PSNA 3S9YA 4FK9A 1XGZA 2YLLA 2X1RA 1J2BA 2E6YA 4I9AA 3PZQA 4KIEA 5HANA 2PWUA 2J74A 2REQA 2Z1XA 4W4QA 3PJXA 3ARXA 3GTIA 3HPXA 4TR9A 4P7QA 4RE3A 3TJIA 4H2HA 4BEQA 3LENA 3RM9A 4TX9A 1FWBC 3HF3A 1ESWA 3B0PA 5CSSA 1ITXA 1DQUA 4XTIA 4UQEA 2FDSA 3R94A 2D2OA 1HVQA 3BANA 2DT0A 3FCPA 4WDXA 3HPZA 1ZB5A 1UPMB 3HIJA 1QVBA 1PHQA 3QZEA 2PLMA 1PEZA 1Y0EA 4ZTYA 2P3ZA 3GR4A 1DE5A 4HU3A 2WANA 3W7QA 2ZE0A 4AWEA 1V6TA 3A4XA 1V77A 5C55A 4G5DA 3IVTA 3SCSA 2CHRA 2GJLA 1C8QA 4M29A 4AD1A 4ZCWA 4UOZA 5CBJA 1TJ2A 1ZP4A 3FY1A 3GNPA 4H7VA 1CTNA 4V27A 1JGMA 5D8ZA 4NZCA 4UTKA 2J7FA 2NXHA 2OMAA 3IJ8A 3FYYA 2BXVA 1EGMA 2I5GA 4NG3A 4ILSA 4EOUA 4H8UA 3G1DA 4NRSA 3BGGA 4QEHA 1S2AA 4BK9A 4R7JA 1PZ3A 4QSFA 2PTZA 5AC4A 5LNRA 2PZNA 4MY9A 4PEEA 1TELA 2C0HA 3TSMA 2QV4A 1H1NA 4XD6A 4HOZA 4Y9NA 5D38A 1Q6CA 5LHEA 1I9CB 1QI4A 4O1DA 3RM4A 4BWLA 4WEVX 3CMGA 1WBHA 1REQA 3OLIA 2DDXA 3VOCA 3TQPA 1NP0A 1W3NA 2WNWA 4MAVA 4H7ZA 5HPOA 1GVYA 5F1UA 4JFSA 2FB3A 1M03A 2AQWA 4FX7A 3SY8A 1HIZA 1U1HA 5HA7A 1E9LA 2E6AA 3NQ8A 5T91A 1NH6A 1MYRA 3SUSA 5LGXA 1OGSA 2FGZA 2J66A 1CI1A 3DFSA 4I3GA 3L67A 2EKCA 4UQCA 4LCRA 3T78A 3DFPA 4C6LA 4D8LA 5HATA 4NVTA 2YCEA 4I9MA 4AMAA 1YPIA 4MWAB 3CHEA 3QVQA 3VGFA 4L64A 3ITYA 2VM8A 2V5LA 3NQBA 4ORIA 2XVPA 4CD5A 1I1WA 2GQ8A 2QCFA 3VIGA 4J3TA 5I6SA 1RK6A 2VUNA 4MVAA 4MG4A 1LP6A 1IR2A 3ME3A 1RVGA 3V7PA 4ZMGA 2WQPA 1PWLA 3KBMA 3EWZA 2FPTA 5D9NA 2VMFA 1X38A 3F4DA 1QATA 3M0KA 1S2TA 2CU0A 4L4MA 3DC8A 4OECA 1E5NA 4WXYA 2V63A 1EDGA 5M03A 5A69A 3FSTA 4W93A 5I24A 1BG9A 2QDHA 3SN0A 1BKSA 3N11A 4ONVA 4DZIA 3LHTA 2CKRA 2ZRWA 2Y8UA 4J3VA 3THDA 3PTDA 4S3EA 3L68A 1FUYA 1I2RA 4GZ7A 1E3ZA 4Q4OA 4JTCA 3OVPA 2JKEA 3QTGA 2IPFA 3KBVA 4CNSA 2PDLA 1HT6A 4PMVA 2F6KA 1VD6A 1B4KA 3FA3A 1OHLA 1HKWA 3CU2A 1ZJAA 1P43A 2INZA 2ZCGA 4KWWA 2WMIB 2YDQA 3S1WA 1XL9A 4MSSA 1F73A 4NNBA 2DSVA 3K46A 3HG5A 3CEUA 4ICCX 1KFBA 4MOZA 4B3ZA 4UR8A 1TQXA 3S5ZA 4C1LA 2PWFA 3QHOA 5DMMA 4HU0A 1E6XM 3HBLA 3W72A 3MBDA 1TZ9A 1G7UA 1HN1A 3SDOA 5HR7A 2E6FA 2RHGA 1HJQA 3CNYA 4E4FA 3EXTA 5F4WA 1XIEA 5E0FA 2ESCA 3G0UA 4B4HA 4W8AA 2CLOA 1XKJA 4XZWA 1MQRA 3KRUA 5PTDA 3QOKA 2B31A 4HVXA 3CH0A 3MYPA 5CAKA 1GKQA 3PF3A 2YDSA 4AEEA 3MUAA 5I00A 3RU8X 2NX1A 1SZRA 2CITA 4JPGA 3Q45A 4BKNA 1HGWA 5I3FA 2Y5SA 1M7JA 5EL1A 2DT3A 1UD5A 1RA5A 1TPEA 2Z1VA 3VAVA 4RX0A 5JUVA 4AHQA 5K9DA 3HQNA 1Q2SA 4ZB5A 2QCDB 1E40A 3W7MA 3TONA 4OU1A 4RDYA 1AW1A 2UY5A 3UPBA 2A6LA 1SR9A 3LPPA 3N4FA 3CLWA 3KL3A 1F6KA 1E6PA 4JX5A 1UCWA 4Z1BA 1RCXB 4F66A 4GIEA 4F79A 4EAMA 4CEXC 1YW1A 2D0HA 1EXBA 1JF6A 1H62A 3UFYA 3WK3A 4C5ZA 2GWNA 2IKGA 3UERA 2NQZA 5D37A 2VC6A 1EH9A 4E3TA 1EDTA 1BXBA 1H11A 1NIUA 4F0SA 3IIXA 4IISA 3B4YA 4KBXA 4YWSA 1TV8A 3CHFA 2YW4A 2Q09A 4DXVA 1OCJA 3CV6A 3VKCA 4H8HA 3KEHA 1LZOA 1H7PA 3NQAA 3BLDA 1W6TA 1H41A 1VBRA 4GZIA 5CSUA 4HA3A 3LOTA 2RAGA 3RR4A 4O0KA 2DW6A 4MJ2A 3NQMA 4Q4QA 3R7MA 2VURA 3LCHA 3BG5A 3EB4A 4BQ5A 4FLOA 3KTXA 4JTUA 5AFDA 3AHTA 3L4WA 3L4TA 4W89A 1SJAA 2F61A 4GGHA 4EIVA 3BCJA 3LCGA 1QWGA 1LG1A 1XJBA 4KWVA 5G2IA 4L9ZA 4JS3A 1JAKA 1SW7A 2Q8XA 1H2JA 1UC4A 1XC4A 4XO6A 2VRQA 1HL2A 3VMPA 1K02A 3CQ0A 1KFJA 3UZ5A 2OZ8A 3CXOA 3N18A 3RRXA 2BNJA 3PTQA 4JY9A 3GM8A 5BRBA 4W7VA 1LT8A 3GO2A 3VC6A 1W8SA 5EU9A 3L23A 3LB0A 2ATMA 2F7FA 2P8CA 1RA0A 2VEGA 1OD8A 2QW5A 3R1ZA 3WLJA 5BWAA 1CW2A 3CZKA 1JGIA 3SUTA 2ZDSA 3FVDA 2CERA 4NT0A 1H4PA 1VC4A 1JDEA 3G0SA 2DIKA 1PPIA 5HMFA 2V5CA 3O1NA 2HXTA 5BU6A 3MKVA 1A5KC 1LL7A 7TIMA 3EXRA 1K7EA 4L80A 1E1FA 1K8YA 2D24A 3V16A 3RMEA 3MY9A 3OODA 3KX6A 2V5JA 4JCMA 2FB2A 2TYSA 2PRHA 1US3A 3LCLA 4UFJA 4QQUA 4Q8OA 2ZE3A 1F2JA 3MMWA 3PZIA 4DBWA 1JFHA 3TEVA 1FWDC 3QC3A 3BOFA 3AWOA 3JZUA 3NO3A 4MHBA 1QHZA 3DCPA 4GPNA 3C56A 5HR6A 1Q13A 1FA2A 1XGEA 3SUWA 5CJMA 3FAXA 3MS8A 3W25A 2DUAA 4B4FA 1AQ0A 2A2IA 3MI6A 1I1XA 2QGHA 4D6GA 3LI1A 4XKYB 2GL5A 3REQA 2ZA1A 3CH9A 1VHNA 1UKTA 3H7UA 2NQ5A 2BMBA 3G8EA 1XYFA 3EZ4A 1JDAA 3N2MA 1WAWA 4Q4RA 1WXZA 3C8FA 3CHCA 3H2NA 4LUTA 1PO9A 3WLSA 2ZUTA 3ERPA 3PTKA 2VX6A 1MEHA 3FA4A 2CBJA 5FJPA 3SCUA 2DZAA 3E2QA 4LAKA 1GPFA 3BURA 3IVUA 4JTQA 4R88A 2RDWA 2Z7GA 4XBSA 4EPEC 4MJMA 3NFUA 3VGDA 2PBGA 4CNOA 3I65A 3ZSSA 3TTQA 4ZXLA 1D3GA 2BOGX 3GG7A 4XZMX 3W7DA 4JTRA 2PTDA 3TYUA 2QCMA 2NVAA 2DJLA 3C61A 1JCXA 1UPPA 1B2YA 2FPVA 1AA1B 2W63A 4IG2A 2GGHA 3U6WA 1F9CA 4AWSA 3PY2A 2GDUA 3LBOA 2OB3A 3JUGA 4IF2A 4JIEA 1TIMA 4JTLA 5REQB 5TD4A 3WSUA 2QCCA 3I68A 5BYWA 4MZ1A 1WZAA 1TTIA 3WH9A 3FYOA 3IUDA 4DJFD 5JXQA 1G67A 4XVDA 1BKHA 1W31A 2VEIA 4C6PA 4GYFA 2RH9A 1Y65A 3DFNA 2XHYA 4LX4A 2Y4SA 3IJ7A 1BWVA 5CC5A 1F4AA 4GIRA 1YNPA 2PEVA 1QUMA 3AYVA 3B8IA 2OO0A 1O60A 1XYCA 3PJTA 4WGXA 3VIMA 3COTA 1FCBA 2X1IA 3WNKA 2E5DA 1XLJA 3AWNA 1OZQA 3PVFA 3GXNA 3ID7A 1E6QM 2Y62A 4QM1A 3RHGA 4JIRA 4UFLA 3W26A 4UQDA 1NU5A 4XZ9A 3TR2A 2FTPA 2WJDA 5M1TA 2PDUA 1WDRA 2J78A 4PSPA 5DT5A 3EAUA 4LAOA 4FOUA 1S38A 2VI0A 1UBSA 1R9XA 3EPOA 3A12A 2OZ3A 1MDLA 1B3VA 3VOGA 1QOPA 2CZEA 1GT8A 4POCA 4C6JA 3VKJA 3TNOA 2I9UA 3B9OA 4B9YA 4JTHA 5FL1A 4W85A 2VX7A 4H04A 3GVWA 4L4OA 2Y24A 5A6AA 1HKIA 3S0CA 2PDJA 3HFYA 2GQAA 2WKLA 1XIBA 3EOSA 3G5EA 3W7LA 4BI6A 1JCLA 4Z2GA 3F2DA 4Q8VA 2JEPA 2XH2A 1BRLA 1OABA 3TWAA 4MKVA 2HBXA 3DEQA 4IUGA 3PAOA 4IJCA 3FK4A 3KS5A 1RBOB 1QW8A 2CPUA 3P74A 1QASA 1YDVA 3OOQA 5HNRA 3WCZA 2XJ7A 3U5UA 2HSAA 3ARQA 3ZWTA 4HNCA 4LAUA 4FR6A 4IPIA 1PCKA 2KZHA 2GGJA 1B3XA 1J11A 4E4PA 3WLIA 3AHZA 3CMFA 3N6QA 3WJWA 1MUWA 4UIOA 4QCFA 3BUVA 3WD0A 1ZAIA 5I7GA 3UPMA 2WCGA 4C1NB 5RUBA 1QPRA 3QW4B 2E3ZA 4M6VA 2ZRZA 4N0RA 3C2OA 1DYSA 4LS2A 1XV8A 1GQIA 2W0UA 1RY0A 1ZP3A 2PTYA 2WVSA 1JI2A 2Z2BA 1M5WA 4MM1A 1MFVA 3K1GA 5JH1A 1MEWA 4Z1CA 5HWJA 3PP7A 2CLEA 3HA1A 2BVWA 3W4RA 5D9MA 5K2ZA 4OBRA 5DBTA 3DBPA 1EJWC 3DN5A 1QI0A 3CL8A 4B92A 4UTJA 4XAYA 3AU2A 4C6CA 3AALA 1O94A 3FJNA 3IRSA 3BC9A 4LS1A 3K5XA 4GMEA 1KM3A 2RUSA 5J8LA 4ML4A 1QFEA 3KL5A 4ICMA 2Y7DA 1IR1A 4XAPA 2VRKA 3W37A 1VB9A 1HX0A 1TO3A 1VPQA 2C91A 3OHMB 4MYXA 4HIBA 1ALDA 2EKGA 2NSOA 2F2HA 1MRAA 5HMEA 1YHTA 4DAFA 1A49A 2P3EA 3M6DA 1ZU8A 1F76A 2C3ZA 3IGHX 2BDQA 1DJWA 1Y5VA 3ZJKA 1QO2A 1UH4A 2VR4A 4CU7A 1L6YA 1CGYA 5FL0A 1H7RA 5EMLA 1OFPA 4P8VA 4A22A 3QFWA 2A5HA 2JFEX 3KVLA 5D03A 3ARVA 4S3BA 2I9EA 4GG9A 4PTWA 2W27A 4A3UA 3BTNA 3AXMA 3THUA 2J47A 5LA1A 1AH4A 1KFKA 1S1RA 3BL3A 2BVTA 4A3RA 3B0VC 4FHAA 4I6VA 4PZVA 4F0KA 3PPFA 3UCQA 4AYGA 4B2DA 3DAQA 3E6EA 3IVSA 1LRNA 3A4JA 3SGUA 1VYPX 2CBIA 4DAIA 1XFCA 1YTEA 4PCFA 1FWWA 1PB0A 1Y5XA 3WD3A 3S9IA 2RDUA 4E2BA 3MYOA 1OF8A 1ZAJA 1GOOA 1R0MA 4JQ4A 2BGSA 5FIPA 1UH2A 5H8PA 1OSEA 4OFCA 1XISA 2FHCA 4RR4A 1O6IA 1R3SA 3EA3A 4L56A 3SURA 3THAA 1RBAA 2Z26A 4MUPA 1Y5WA 1KTBA 5U4NA 3IS4A 4HMEA 5CZTA 3ZJ7A 3LQGA 1JCTA 4IGHA 3WBAA 4K6AA 1UP3A 1E4LA 2J8TA 1G94A 2QIWA 4ZFCA 3MSRA 3CIWA 2HPIA 1EWEA 1IGSA 1TFVA 3VNDA 4ZE5A 1A5UA 1H7WA 3DX5A 4MB5A 5MHBA 4DXXA 1ZL1A 2G96A 5I23A 3KTSA 1VRDA 4M7SA 2XZ7A 1EC9A 4M19A 3NZPA 4XO7A 4MNKA 4ASTA 3UWEA 3W1PA 4RKAA 4UTLA 4KESA 4FOKA 2E1DA 3CZ8A 4N2YA 2HISA 4HNVA 4Z2JA 5KEZA 3WDQA 3ITCA 2C19A 4LFYA 3FNDA 4TVUA 1EUAA 3EWUA 3CWNA 4RL3A 2FFIA 4G7FA 3W6MA 3W7OA 4L9YA 2ACQA 4QJ5B 1DWFM 3GU1A 2ACSA 2XUCA 5HQLA 4Q4MA 4NI8A 4RZ4A 3B9EA 4JR5A 3V1HA 4PULA 3TNBA 2VJXA 1NWUA 3LNPA 4HP5A 3QKZA 3E9AA 1YDOA 1XC6A 3CT2A 4YJ5A 3I3DA 1KM4A 4HKPA 3R79A 1MW1A 2C79A 1RQHA 3LCXA 4NIRA 4BI7A 3QQ1A 3VIHA 4PUKA 4O8AA 2I16A 2PC4A 4PB3A 3Q65A 1XLBA 1YXDA 3NYDA 3SQLA 1ICSA 4O1CA 1EZ2A 1A3XA 2VC7A 3QFEA 4CU8A 2F84A 1TWZA 2PP1A 3RCNA 3ABSA 4DVOA 2FZDA 1EQPA 3PZMA 1X6LA 2ZFAA 4LBSA 2ZXAA 3RJXA 2ACUA 3B8DA 4JN8A 3IV8A 4QISA 3DG7A 5I2UA 1KNWA 1E6SM 1QNOA 3ARPA 2IPGA 1V3KA 3H54A 1L8NA 2OPJA 5DCDA 5C9UA 2BY0A 5EA9A 3BW3A 3D3AA 3RUBL 1HKJA 3ONBA 3BMVA 3LGEA 5DEZA 1W9UA 2H3BA 3VX0A 2VD8A 5AYXA 2OELA 2ZZ1A 1XIHA 5FEZA 4ZFMA 3U8GA 3MHFA 1CXEA 1DIDA 4RZBA 2VNCA 2QJNA 4O0QA 2Z0IA 2BASA 3GDMA 5CH9A 4LW7A 4WQ6A 4Y9AA 1J6PA 1BYCA 4Y8EA 8TIMA 3Q37A 2ZKMX 2GYIA 2DPEA 1FHVA 5B7YA 4XZHA 3JZEA 3TV8A 2Y89A 2NLIA 3VNJA 1VPXA 2AKZA 4RZ5A 4AY7A 5IM51 4AD0A 3G0XA 1O5XA 3EKLA 2NX3A 5A8PA 3RU6A 1BSIA 2OSYA 3OG2A 4GWEA 1SW3A 4DYKA 4IQJA 5TQLA 3P14A 3F5JA 1LRTA 2WPGA 3H55A 5IFTA 3M1ZA 4TVDA 4ERGA 1CWYA 1IGWA 3TE9A 4CNUA 4C6FA 5FF4A 4GXPA 2WSQA 3CZEA 3PZNA 7PTDA 3EPNA 1UMYA 3C2FA 3ARRA 2REQB 1E1CB 5T8GA 4BCEA 4O1FA 1KFEA 4ZQOA 4BQ3A 1GTHA 2QT3A 4JIHA 5E70A 1JDCA 2R1MA 1W9XA 3HGOA 2G8ZA 1KM2A 2Q8ZA 3JR2A 3B8TA 4QG8A 3QY8A 4X2RA 2D20A 3USBA 1IEIA 1A0DA 3NYZA 3QGKC 3H8AA 1L6WA 4ZO7A 1CLXA 3F5KA 3VX1A 2ZVIA 4WUIA 3UJ2A 4FXSA 1QBBA 4XV0A 2VDIA 3USZA 3VM5A 5I3JA 2BOEX 1K6AA 4MWAE 1C92A 1XG4A 3N04A 1PAMA 3FOKA 3GWQA 3P84A 1U5HA 3R0KA 5CZSA 4XD3A 4FA3A 1JQVA 3W1TA 2PC8A 3AROA 1E6NA 4KEZA 2PS2A 1B1YA 2E68A 1SFSA 2WVTA 1D7KA 2X1TA 2AL1A 2O7SA 3T8LA 4CLMA 3MPGA 4PUWA 2PDYA 2BVDA 3WF1A 3Q58A 2ZYFA 1BHGA 1WZKA 5D32A 2R1NA 3B3DA 1E9IA 2P76A 1IYXA 4PL1A 1SJBA 5HDRA 1VYSX 4YHEA 4GE8A 1XLAA 4OTKA 1JQXA 4GHRA 4L9XA 3OGSA 1GOXA 1TVPA 1KB3A 4V1YA 1REQB 3II1A 1U22A 3DXIA 2G97A 2JKPA 2Q3RA 4CN6A 2OZTA 3R6IA 1YMYA 4Q8UA 4UOJA 3LTSA 3UYIA 3W1XA 4X0NA 3QLDA 2A85A 3UZYA 1A80A 4ZXOA 2YXXA 3KM8A 2C15A 1V4YA 3GDKA 4EAYA 2PDWA 2PD9A 4P8WA 2ZVRA 3IAQA 2FQIA 2Z1WA 2D0FA 2V3EA 5CAHA 3LI0A 1GQJA 4UFHA 5CLTA 4L1WA 4HU8A 1EC7A 2QMKA 1CB7B 5CGQA 4LGXA 4LCQA 4R7WA 3KRSA 3CZGA 1UMLA 3O8AA 3AXKA 1F4HA 3PZTA 4W87A 2QGYA 2Z1SA 4F2TA 4OUIA 2Z00A 3EWYA 4CCCA 2V2CA 4C6NA 3R0DA 1E9ZB 2DH3A 3LCWA 4AQLA 1S5WA 2EGZA 1YADA 3NOYA 5D30A 3MHGA 4HSHA 1NWTA 4CQBA 4M0XA 3CV7A 1C7SA 2QMJA 3P8IA 2PDHA 1XD1A 5DQPA 1A3HA 4RXFA 1HJXA 3UG5A 3U57A 4QDMA 3VNZA 1L6GA 1PTGA 3QF0A 3VABA 5T9BG 1RP8A 3N2BA 2ZWZA 4K8GA 4DYJA 1ZJBA 1JG9A 3R8GA 1KM6A 4LUIA 3MT1A 2GQ9A 3LSCA 3MDUA 4K38A 3AOFA 3SSJA 3GKFA 4J9JA 3KRZA 1XLFA 4CN4A 5A6MA 4CCZA 5FACA 4B5VA 4H2CA 3GXPA 4YU1A 1ICQA 4MDOA 4N42A 3SQSA 1XR2A 5LA0A 1OG0A 1Q7ZA 1A5BA 5L6UA 3LXCA 3IGUA 1AJZA 1JCYA 1K1DA 4HK6A 4QDPA 3VUPA 2QPXA 3XIMA 1GOQA 2EPOA 1PIIA 1RCOB 1WA3A 2PI6A 1F6PA 3E0WA 4AD4A 1CZ1A 1LWIA 4LC6A 2J13A 4MIMA 3IUHA 1WZLA 3LEPA 1PKLA 1TVLA 3RDKA 2WMHA 4IJBA 2NSXA 3IGXA 4KEMA 1GJWA 4C5YA 4CGTA 3GQYA 2Y7EA 1E51A 1DWHM 1J6OA 2TODA 3T0TA 5H8MA 5KTLA 5CEWA 1C91A 1M7PA 2HCVA 4GD0A 5M17A 3NM1A 4US6A 3EDEA 5C70A 3KBJA 1K8CA 5KZDA 3ZYZA 1AJ2A 4MYAA 2CKSA 3W7GA 4R34A 2E9LA 4E8CA 5A94A 1KTCA 4O19A 2FZBA 4P7RA 1JCMP 3VE9A 1JI1A 1W0MA 3FJ4A 3WFZA 2VZVA 3M41A 3W23A 3L4YA 3GNXA 1EJUC 5FA5A 3WQWA 5AECA 3SCQA 3C0JA 3L0NA 3LYEA 4FMVA 2OX4A 4DBDA 3K1DA 3PC0A 4NXSA 3AIUA 4QG6A 5AKQA 1O12A 3O2LA 5FJRA 1L2UA 4WD0A 4FALA 1UJQA 2HRWA 2QJJA 2J8GA 1L8PA 2CYGA 4EANA 3F4NA 2J7HA 2WOQA 1E70M 2Q8LA 3UVAA 1SMAA 1CIUA 5BCAA 4DJED 5LZLA 4JNYA 3VMOA 3CT7A 4MZ8A 2PWVA 5HJLA 1Z3NA 4OV9A 4F8XA 4PTXA 4LYRA 2JQXA 2DSZA 4LVFA 4DEFA 3HPSA 3R12A 1UUQA 5BNKA 1SJCA 1AQMA 3O6YX 5C71A 4Z42C 3FGCA 4DZHA 1OYAA 3DI0A 1WPCA 3NQGA 3DG3A 2DZBA 2CFFA 4GBUA 4ZO6A 1AZ1A 4CN1A 4ZVJA 9RUBA 1THFD 1H1YA 3GAKA 1KGXA 3S6TA 3KBSA 2QUMA 4JQAA 4XVEA 1BG4A 4W84A 2OQHA 1MQPA 4FLRA 5G1YA 2R14A 3UG3A 1NM9A 5EYWA 4BF5A 2RDXA 4WSJA 1UZ4A 3H2AA 1YNQA 3HPAA 1XRTA 3UQNA 3S2LA 1AG1O 1QT1A 1TV7A 2HEJA 1J12A 3CPRA 5LIUX 1B54A 3ZO9A 3W7NA 3C4UA 2TRSA 1XH1A 3ENLA 2DH2A 2DQWA 4E38A 2WV8A 5LIKX 3W88A 2HXUA 4DJFC 4D6JA 5DRIA 4OT7A 3D3FA 2H8ZA 3OVGA 5I5RA 4UMAA 1LQ0A 2AGTA 1EO5A 1Y7VA 5HWMA 2UZ9A 1OX4A 4HHMA 2JF7A 4LV9A 1JCJA 1V3LA 1JR1A 2B7PA 3GXMA 3MUXA 3QV9A 4KCWA 5C7HA 4JYFA 3HQOA 1AQFA 2NQHA 2GPTA 5DO8A 3ITLA 1XBVA 2D2GA 2W61A 4FNTA 5AHMA 3WFLA 4FZIA 1J0IA 1P7TB 3R5EA 3E38A 4ACZA 1B4EA 1XKYA 3H4GA 1UOKA 4AWUA 4MADA 4IPLA 3Q4DA 4C7DA 1JD7A 2V3DA 4D8ZA 2YYUA 3G1AA 4DY1A 5D2YA 3CB3A 1E6RA 4JHOA 4DX3A 3TAOA 4ZL1A 1W1TA 3ZR6A 4IJRA 3W7JA 1YYAA 3N29A 3N2OA 1DTNA 4G6CA 2G4FA 3TW7A 1RH9A 3MSYA 4I7UA 3S8HA 4H41A 5BMXA 3NL3A 4OHQA 1R3TA 2G0WA 3W7EA 1V02E 3PBWA 1TZ7A 1O95A 3GW0A 1V6VA 1E43A 1OFQA 5F7UA 3REQB 1W1YA 3KFTA 3KP0A 1M3UA 1JUKA 3G8RA 3EBVA 5KZMA 4XG1A 2EAWA 5HQMA 2GGIA 4Q6XA 3D6NA 5DN1A 3WNMA 1Z6KA 5HBFA 1NQ6A 1NWSA 1N8FA 1OY0A 4GNKB 1Q6RA 3SCOA 4TO8A 3NXLA 4DJFA 4ADUA 1OCBA 1E72M 3NNTA 4O18A 3RGTA 1GHSA 1MXDA 3QN3A 3S6OA 3TR9A 1TJ0A 3TFXA 2UY3A 4NZ5A 4WIWA 2XIOA 1U33A 1ZCOA 3FXGA 1SZEA 1JIBA 2PDQA 2PF8A 1OFEA 1XI3A 4O0ZA 2O55A 3PWGA 2VWSA 2JEQA 1PHWA 1RXOB 1TCMA 2ISDA 1FOBA 3P67A 3DKLA 1AVAA 1C8YA 4EVZA 1G7VA 5TBOA 4DO7A 1Z9AA 4O52A 4LNYA 3DH7A 1JXKA 4I7WA 1ZCCA 4F9JA 4K2SA 1M65A 2WNNA 1I6NA 4CD4A 1OX6A 2PODA 2XFRA 3W24A 3O07A 3GNOA 3WLKX 6TAAA 4LH8A 4GUJA 2FMOA 3RLGA 4DI8A 1MNZA 5C2CA 1K3UA 3AHXA 1OINA 1XCXA 2JE8A 3FKKA 3KCLA 3MUIA 2E67A 3RF9A 4UFIA 3ITXA 1AODA 4Z1DA 3ANYA 4D9PA 4Q7NA 2BXZA 4KRZA 3NQ7A 5A95A 1KW1A 4A3YA 3MV01 4UTUA 3LA4A 1AH0A 3AC0A 1F61A 1OYCA 4B9ZA 3HMJG 2DU2A 3WQDA 4A2RA 4ENLA 3MA8A 4QLKA 5HNTA 4JX4A 1DTUA 3BV7A 1D2KA 2DEPA 4NSBA 1VLWA 2XN0A 1EWDA 2C18A 4QTGA 1SVDA 4XB3A 1UYQA 3LBMA 4DPPA 2AKMA 1G5AA 4ATWA 5AYBA 3EMCA 4QIUA 3CUXA 2FTYA 2JGYA 5XIAA 4HHLA 4NAFA 4OBSA 2AMXA 3BSMA 4H8NA 3DDMA 2DSWA 2YFOA 2VQTA 3B9AA 1SSDA 1VLIA 2WZMA 1FWEC 5HNNA 4TUFA 1F74A 2PURA 4I90A 4LBUA 4OGZA 1KM5A 4PMZA 1OF6A 2DQXA 4Q8PA 2FHBA 1V51A 2PP3A 1W1B1 5IOBA 4JXCA 1P0BA 2WKGA 3WNNA 1GOMA 4FIQA 4O17A 5BXRA 3CIXA 1R7AA 1P0NA 5FSDC 3APGA 4HN4A 3RPTA 3M0JA 3ZFHA 4IUOA 3WDHA 4QE4A 2WBKA 4HNLA 4U4MA 1YIXA 1T5AA 3SCVA 2HK0A 3DG6A 4JQ1A 3K4WA 2Z24A 2ICSA 1DHKA 4UZUA 2X7WA 1H1ZA 3THQA 4E4UA 3HG2A 4OE7A 3XISA 3IRDA 4IPNB 4GZJA 3DKJA 3QSRA 4CQ8A 4IX2A 3PBGA 4ZODA 3R8HA 3QV6A 2CBVA 4AB4A 3L12A 4PC8A 3CB8A 2BY3A 5E9XA 3TMLA 1Z7AA 1XDJA 4NQ1A 1TTPA 2D3LA 1XQKA 3E0IA 3KVKA 3P0WA 1UD4A 4BFAA 3TYEA 3LLDA 4HJWA 2WK2A 4GA8A 5J04A 3M9YA 1NSJA 3BQ6A 4DO5A 2P88A 2QIIA 1K9FA 7ENLA 4I5UA 2WCAA 4N6FA 1KC7A 1GQNA 4YHGA 3KXQA 1S2UA 1JZ3A 1WX0A 3K8KA 3AICA 4GIYA 2YXGA 4PTDA 1LDCA 4QS5A 5CBBA 3H2CA 3N2CA 2PDFA 2DY3A 5AHIA 5LA2A 3QQ0A 3ZIZA 4GBDA 3FIGA 1DP0A 1EL3A 2AAMA 4IH3A 1C93A 4EACA 1QW7A 1MZHA 2OYLA 5HWNA 1WDDA 4TV5A 1DOSA 2D2HA 1YBQA 1GZGA 4IOTA 3W7HA 3P6LA 4A05A 1KRAC 2PWEA 1EJXC 5FCZA 2ZX6A 2V38A 1H49A 3I4KA 2DGAA 3LPFA 3BJFA 3F7JA 4RPPA 1GVOA 3TTOA 3WLRA 3LERA 3ITTA 3KCOA 3QMSA 3T0BA 4HPJA 4QRNA 4O1EA 2VFHA 2VZSA 1K7FA 3RM8A 4LF2A 1AMKA 1O66A 2PDNA 1KWGA 3RPDA 4CKQA 3BVJA 2HE8A 4QLJA 5CSYA 4JL2A 4Z0JA 5BOOA 3MC5A 2YL8A 4OVXA 4XISA 3RMJA 2O9PA 1GTEA 5EY5A 3TYCA 4O4WA 4PH6A 5IBXA 2DSKA 2ZZ4A 1G69A 2ASHA 3HMCA 1EOMA 1XIGA 1P0KA 1B57A 1X7IA 1MEIA 5C9WA 1A50A 4EE9A 1PX8A 4KEVA 3WD4A 1NDYA 4QQ3A 1VAHA 4FNPA 5I03A 4HZ7A 2VVNA 4TXEA 5A8QA 1ZJHA 1SU5A 2GUYA 2H9AB 2H3DA 2WWCA 3TN4A 2Z2UA 1UIPA 3W2MA 3WJXA 3BK0A 1Q63A 4W86A 4C6DA 4HPXA 3NL2A 4UTFA 3GDRA 5AYIA 3APYA 5AY7A 5EMMA 1VEPA 1U83A 2ZZ2A 4RCXA 1JZ8A 3H4XA 2PWDA 3MDWA 4UTIA 3SY5A 3RNDA 4QS6A 5I3HA 1UWQA 4XD4A 1J96A 5H91A 3VKDA 1E5JA 4JTDA 3VIJA 5DBUA 3TN6A 2J62A 1QTWA 1XIMA 1NP2A 1SJDA 2AL2A 2EPNA 3WLOA 3V36A 4GUIA 3EX3A 1CENA 3LV6A 1GHRA 3AI0A 3W7IA 2EQDA 1HG3A 3NVDA 3NQFA 3L7RA 3E2RA 3FVMA 4HA4A 1YLVA 1HP5A 4AF0B 3NO5A 1Z44A 1MNSA 1W9VA 2Y5JA 1KBJA 4UTWC 1H63A 4LCSA 1W37A 4Z2KA 5CG0A 1T40A 3O63A 3CO4A 3KRBA 1R5YA 1VFLA 3E0FA 2KX9A 1XYMA 4W8LA 1ECEA 2G3IA 3WMLA 5TF0A 3OGRA 1YRRA 1ZAHA 1UR0A 1X8FA 4S3FA 4OZOA 1S3HA 2NQLA 4OKDA 1M01A 3GAYA 3TOPA 4UMCA 3T6CA 1LM1A 4JHZA 1G6CA 5CG7A 4GQGA 1EJSC 2HNEA 3LGGA 2OOGA 1CLKA 4NXKA 3POHA 2PDGA 4JTIA 2JALA 4F0RA 2NWRA 3SBFA 2W67A 3ABOA 3ZT6A 1N7KA 2YCIX 1CGXA 3A6OA 3IJ6A 2WBGA 4QDWA 2HZGA 3KVMA 4RUBA 2CESA 4QEEA 1TWDA 4O1BA 3RPMA 3EA1A 4HN8A 2QPUA 4LY8A 4NZ3A 4HA1A 5FF2A 2VCCA 3N1AA 1TJPA 3DGBA 1IZKA 1I2PA 3MWCA 4UCFA 5CSRA 4MLJA 1CPUA 3B05A 3VDGA 2GZXA 1VEOA 3R0UA 2E1WA 4X60A 2EO7A 5EMJA 3PWAA 1YTKA 2PDIA 2CC0A 4GVFA 4GCAA 1H0IA 1QXLA 4GNVA 5AHFA 2OR2A 4WOQA 1PV8A 1TRIA 1UZHA 5CJ5A 2YCKX 2A3HA 3RCMA 3RYSA 3EX4A 3SRDA 3WDRA 1S2WA 2C1HA 1OGGA 2XH0A 4Q8MA 1HKKA 2F38A 4UTWA 4ROQA 2W9MA 4BQ2A 3QGAC 3O6AA 4O16A 3WD2A 1UOZA 4IQEA 1GQLA 3SADA 1MO0A 3QR0A 4PBGA 2JBMA 2VZTA 3FEMA 3AYRA 3CIVA 4XZNX 3PG8A 1W1ZA 2DORA 4IWWA 1WBJA 4ZO9A 1XYLA 4PCPA 1W32A 4X22A 3GLCA 3OYXA 3WBYA 3SFKA 4CD8A 2KAUC 3DHUA 2D73A 1HVXA 3M0LA 3NGJA 5KINA 1WNOA 5BMWA 1LBMA 3VGGA 3WUFA 5HOSA 4EPBC 4GC3A 5I3KA 2VTFA 4R7OA 3O6DA 4LRSA 3GZ3A 1O5RA 5H6HA 3ANVA 4FNSA 2X7VA 3QM3A 4IXHA 4B16A 3WQGA 1ICPA 3STCA 3W71A 2FTWA 4NF7A 3VGBA 1V3JA 2UWFA 2HK1A 4PRTA 3RN6A 3LXAA 3KDOA 4KT2A 3MANA 3WH5A 5FESA 2QCEA 3PSWA 4NP7A 4U2YA 1F3WA 1DHPA 6CGTA 5DT7A 4DN1A 4JYDA 5DFAA 3WJYA 4C60A 2XDFA 3G1VA 4M80A 4WX2A 3NWRA 3WNLA 2R8WA 4ZB2A 5FEXA 1SO6A 5XIMA 3FX4A 1UASA 1IT8A 2VFIA 3SGGA 4LVBA 3TOYA 3POCA 3WNOA 6REQA 2P0OA 2XGBA 4QAIA 4AC7C 4AHPA 1IWBA 1VEMA 3A3XA 3WO8A 3IPWA 3L5MA 4GI9A 2ZXQA 3PN8A 3SZ8A 3UA3A 3PBYA 2YL5A 2P8BA 5EFDA 4EP8C 5A2CA 3TU9A 2UV8G 4XUGA 4OUEA 3QJAA 2WSYA 2NX9A 3NQDA 4L6DA 3IV3A 2WLZA 1QHPA 1S5VA 2AOSA 2G95A 4DNMA 1PTAA 2Y2WA 4LB3A 1BD0A 3J7HA 3NZRA 4Q4KA 4K39A 4YVVA 4V28A 4E8DA 3DGRA 3U4FA 2D3NA 1NWRA 2VDHA 4RXGA 1GK8A 3QZ6A 4O14A 4L6HA 2Y7GA 3OIHA 4PMDA 3VCRA 4H4IA 1GONA 4B2DD 4JEQA 1N8WA 3EEGA 4HPGA 4CQ9A 2YFNA 1TV3A 1TB3A 3BLKA 4UTTC 1TTJA 5CZKA 4LVDA 3UNTA 2E28A 2DZSA 4AFYA 4HQVA 3OB8A 1RJPA 1ZS2A 3GDTA 3STPA 4HB7A 4AXKA 3WQ4A 1XUZA 3STEA 4DJEC 1IE7C 1OK6A 3OBAA 5D04C 3TJ4A 5H2ZA 2NWSA 1ISZA 2OXNA 3T4WA 1M6JA 4ECLA 4JGDA 3VD4A 1H51A 1L6SA 2WW5A 4PFMA 1JULA 5LGZA 1W9DM 2FZNA 2QPSA 2V81A 3S1XA 2XG9A 4BJHA 1FVPA 1SO4A 3TYZA 3VZYA 3SO7A 3I6TA 4UTHA 3CJPA 4R27A 1E71M 3HGSA 4H9XA 3V5CA 8XIAA 4ACYA 4B3LA 4JFTA 1ZSXA 3KE0A 4RLIA 1N82A 3T81A 2YA1A 3ZT7A 5C7VA 5AC5A 1MWOA 1R9YA 3QPEA 4W5ZA 4TV6A 5EPDA 4C6BA 1UB3A 1TV2A 1H09A 4AZ7A 4H1ZA 1AMYA 4HNTA 2B0MA 3OU8A 5CPTA 1JDFA 1GYLA 1K6WA 5A1AA 9XIMA 3OJGA 5A8NA 2YB1A 3MSGA 5DLCA 1J01A 2I1OA 1WZMA 3WF0A 2NUXA 3WLPA 3SIZA 1W2PA 3EKZA 2A7NA 3OGVA 2YGYA 3H7RA 5LIWX 6ALDA 2OQYA 2OWCA 4PUEA 4KWUA 4YS1A 2DZTA 4U2ZA 2DIEA 5I3IA 3WIJA 1FWSA 1TR9A 3WH7A 1US0A 4IMDA 1AZ2A 2Y61A 3A4AA 3FJ6A 2E0PA 4NX5A 1Q4NX 4WCJA 1BTMA 2PWHA 1W9BM 3M0XA 3CUIA 4KPLA 4Y7EA 4UTTA 3KWXA 3MU7A 4UWMA 5BROA 4Q7BA 4DHGA 4LANA 3PPCA 1KXHA 1LUCB 2GSHA 3P0XA 4S23A 3B9DA 1FHUA 3ZT5A 1JL8A 1U1UA 4LY4A 1KFCA 4WDWA 4DJEA 3W7PA 4MNJA 3GX9A 3IIOA 2PA6A 3PPGA 3R4IA 3UETA 3BLEA 3WLNA 2C13A 3W87A 2R1LA 1OFAA 3M5XA 3WEOA 2CW6A 2J9XA 1O5KA 4K1GA 1CXFA 3BZJA 3S2JA 3W82A 4V2XA 4P61A 3L0KA 1U30A 1J0HA 2QUVA 1FDZA 4JDYA 4M1BA 2IQDA 2QAFA 5LHFA 4NY2A 4UXDA 3W84A 3EMQA 3GY1A 4LXFA 3SY1A 3UG4A 3U7VA 1GUVA 5AYYA 1F05A 4ROPA 5E09A 1NDZA 3TA6A 1DKWA 2CHNA 2VEMA 3GVRA 2VGGA 8RUCA 3W73A 2HROA 3KS6A 2IQTA 3N15A 1Z89A 3AFBA 4M7TA 1VCGA 4QE5A 3T05A 3O0FA 4B5SA 2WHJA 3H12A 2B7NA 4ZQPA 4UUIA 4MWAA 3VD9A 3FJLA 4J40A 3TROA 3BQ5A 1UZDA 3AZSA 2DFAA 2XU2A 4KFPA 1HP4A 2ZUVA 1A3WA 4PMOA 3C6CA 5F4XA 1HKVA 1VYRA 4GX9A 1JPHA 1VHCA 1LCOA 4GVIA 1YDYA 1E73M 4HGXA 4XZBA 3QEZA 1LLOA 3QPZA 4J27A 1PIFA 2XIBA 4MFEA 4U28A 3V18A 3V5FA 5A6LA 3GU2A 5G1TA 2ZQ0A 3O0KA 1ONWA 2FH6A 1RQEA 3DYPA 4KFOA 1UD6A 4F3HA 4MZYA 3UR8A 3CWOX 4Q8QA 4F40A 1EIXA 3M0ZA 1ITQA 3I7RA 1OADA 2IKIA 3VIOA 4RE0A 3INPA 4ZQRA 2I56A 3E49A 1PJ9A 1SO5A 3UXKA 1S5MA 2WMGA 4LU0A 4NUWA