1F74A

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords N-ACETYL-NEURAMINATE LYASE
total genus 125
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f74A00
5AB3A 2J9YA 3DI1A 3PR2A 4AF0A 1OFAA 5TBOA 1OABA 1YPIA 4OU1A 4PEKA 2NV1A 3W1UA 2TYSA 1NEYA 3LHUA 3HGSA 3W2JA 3FYOA 5FESA 3DKJA 4FNSA 3O06A 4LS0A 3BGJA 2QCEA 4R7JA 5LHFA 1N55A 3HB9A 1WX0A 4PH6A 3DFTA 3FIGA 2A5HA 4RK8A 4Y8FA 1VLWA 2RKXA 3QPYA 2TRSA 4OGZA 3TQKA 3GXPA 3MW7A 4O17A 4AWSA 2A7PA 1OFPA 4O0KA 1TV5A 1J5TA 1SW3A 3DFOA 3GX9A 3I65A 3O6CA 1Z44A 1JQXA 3W7IA 1MEWA 3E49A 4MKNA 1SZFA 3HO8A 1SW7A 3OG3A 5C54A 1EWEA 3GB6A 4MLRA 1W5PA 4FF7A 2VFGA 3ATZA 5I3KA 1TQJA 1TV7A 1W5OA 3UXAA 3W7KA 1GVQA 3W84A 4EF9A 2ZZ6A 1DVJA 1OX4B 4DBDA 3B03A 1QNVA 3SGZA 1PL9A 5AHEA 3W7MA 2GUUA 1DBTA 4JTGA 2Y63A 3E02A 3STEA 2QCGA 4JGDA 3SECA 2NV2A 3NL6A 4Y6GA 1EA0A 4JD4A 4MFDA 5AYYA 1G69A 1P5BA 4HN4A 2NXGA 1GVSA 3STCA 4LC8A 1Q6RA 1B57A 1K02A 5KMYA 1R46A 4O18A 5DXYA 2A6NA 3P8JA 1FWSA 1LDCA 3PBYA 3W7GA 3W22A 5F2IA 3KRSA 1TPVA 4O13A 3TXVA 5LNWA 2W79A 3TX9A 1JQVA 2J88A 3U8GA 2X16A 3VNDA 1TO3A 5FI8A 2V8ZA 4O10A 2J9ZA 2ZZ1A 4O14A 4OV4A 1XBXA 2C19A 3EWYA 3TDFA 4OHQA 1KM2A 3W1XA 1IGSA 3UQNA 2ATSA 1NFBA 1OF8A 3G1HA 3UWWA 1S5TA 1FWWA 1T0OA 4HKPA 2ZA2A 4GUHA 4WQ6A 3DFSA 1GG0A 2F84A 4NJIA 3LTPA 4GFSA 3LI1A 1IXQA 4FNRA 4NVTA 4EF8A 4IMFA 5CPOA 2WNNA 5CZSA 2B4GA 2ZQ0A 2H8ZA 1YTEA 5CSSA 1MEIA 1TTQA 2H90A 3NQVA 1J4EA 4QAIA 3A5VA 2Z6IA 2A4AA 3W2LA 1H61A 4MY1A 2C0AA 1LBLA 3L68A 5IBXC 3IGXA 2H3BA 4MY8A 3TW7A 2GPTA 3HG2A 4MZYA 5FEZA 3IIZA 3FFSA 1FUYA 4PTNA 1RQBA 3DHDA 3DENA 1W8SA 2EPHA 4Z0JA 4ADSA 3H54A 2R94A 3N9SA 3V1PA 2QCMA 3M7WA 4JTHA 3M5XA 3VE9A 2OMAA 1P0NA 4M7TA 2XFWA 1H7OA 1KFCA 3MHGA 5CKSA 2J27A 2Y70A 2CLMA 4IXXA 1SU5A 4LVFA 4PFMA 3QYQA 5K3VA 4N4PA 3A21A 3TH6A 3NM3A 3HPZA 3N2MA 3GKFA 3QW4B 3ZR4A 3NPWA 2EKCA 3G3DA 2Y7DA 5CPMA 1JRBA 4L4MA 4JY9A 3TW6A 2PRLA 5CG7A 1ZHAA 2CFFA 3G1FA 4RR4A 1Z48A 4CLMA 5FF2A 1VH7A 3QFEA 5U4NA 1JR1A 3LCXA 4CCEA 3TSMA 4ZQPA 1W5MA 4HHPA 4N6EA 3LLDA 3JS3A 3PBWA 3NO5A 3P80A 4UFJA 1FWNA 3BGGA 3GXNA 4A21A 3HBLA 1XKYA 5E0KA 1TCDA 5HWJA 4RXFA 3N9RA 4O8RA 3NYZA 4FIQA 4EWND 4MJMA 4N6FA 4JX5A 1XCFA 4Z1AA 5CGQA 1K7FA 1KLZA 3KFTA 3N19B 1EPXA 5AC7A 2ZRUA 1OFEA 4XKYA 1EWDA 2E68A 2Y88A 2VFDA 1K8YA 1UJPA 3P74A 1FXPA 4LTSA 4AXKA 1LZOA 3A22A 3IVUA 2CU0A 3MI3A 2DZTA 3W7LA 2V82A 2WNZA 5K7JA 4X9SA 1VS1A 3R2GA 1LP6A 2VFFA 3SY5A 3I7QA 2HTMA 3FJ6A 3GLCA 4FB7A 4CQ9A 4HIBA 1OFOA 1TYGA 1R30A 1TRIA 2AAMA 4U28A 3I68A 1DQXA 3LHWA 3CEUA 1ZALA 5HR7A 5AHMA 5KZEA 2BSLA 5CPLA 4MPQA 4WY0B 1VJIA 3BG3A 3UY7A 2X1SA 4S1FA 3MBDA 3MO7A 4NU7A 4RZ5A 1B4KA 3OHIA 4BWLA 3K30A 4XWUA 1O60A 5G4EA 1GOXA 1ICSA 2YW4A 2B7OA 3B06A 3G0UA 1H7NA 1U5JA 4N9DA 1M7PA 3L5AA 1THFD 3HIJA 1TPC1 4Z1BA 5AOUA 5LNVA 1LBMA 2A85A 2CLKA 4A22A 4UTLA 4MYAA 4AAJA 1ONRA 4M7SA 1YXCA 3PAJA 4MZ8A 1RQEA 4FEZA 2DU2A 5F2MA 4Z0SA 2CZ5A 1JUBA 1VCFA 3DFNA 4PODA 4ZL1A 5D05A 2CZFA 2VEMA 2FPVA 1SPQA 1A53A 2QJHA 3BK0A 2BWGA 2YGYA 1G6CA 1L6YA 4CCDA 3TC6A 3W1QA 3W7NA 3GDMA 2V81A 4RX0A 1TQXA 3TROA 1O94A 3G1VA 4AHQA 3HJZA 4NJKA 1SSGA 3RMJA 1YLVA 5L9FA 4R34A 3UPWA 1WOBA 5BRBA 5G2IA 2JGYA 2TSYA 2BXVA 5D2VA 2ZZ5A 3PWAA 4POCA 1GJPA 2QEZA 1QDSA 2ZA3A 1DORA 2V9DA 3W7EA 4Z08A 5MHBA 4N2YA 3L5LA 3STGA 1GTEA 3NEVA 3G1XA 3EXSA 4I7UA 2JKPA 4X2RA 2Z1BA 3QSTA 4A2RA 2X1TA 1OF6A 2YSWA 1O5KA 5C55A 3W07A 4G1KA 5KTLA 4LNYA 1TPDA 4BI7A 3VI2A 4UFIA 1RR2A 5F1UA 2RDUA 5HR6A 1T99A 3LCLA 3L9CA 3P5ZA 2NWRA 1PV8A 4XTIA 4MLJA 2NXIA 3WJYA 3N73A 1FBAA 1H7RA 2RH9A 4A29A 1VYPX 4O19A 1WDWA 3QPZA 3BLFA 3O1NA 1W3NA 3CHVA 1M6JA 3G0XA 1DJNA 3L65A 3FKRA 3PB0A 1MO0A 5D33A 2GQ9A 4O11A 5HJLA 1HTIA 2TPSA 3O6DA 1YDOA 1T96A 3W1NA 3QRHA 5CSRA 3ATYA 2VXNA 2X30A 3G1SA 4JTKA 4O12A 1SZEA 4YXGA 1I2PA 1KBJA 2YR1A 4E38A 3O05A 3NQMA 3TMLA 1PE1A 3B0VC 1VQTA 3USBA 2H8XA 3ANYA 4E2BA 4WD0A 4NX5A 5EBUA 3B0PA 2BTMA 1HUVA 3G18A 4O1AA 3W88A 4ZQMA 4K37A 1RVGA 1TIMA 4TU1A 1QAPA 4CNOA 2OX1A 2JK2A 5FF4A 2DZVA 3DFPA 3GVGA 3EX2A 2C13A 2FPTA 2DZSA 3S5YA 1SFLA 5BW6A 4FO4A 2QCDA 1GWJA 5BOOA 3QSRA 4UFHA 1NF7A 4YLWA 1LLZA 3KX6A 1M7OA 1TPH1 2Z2UA 3NL5A 4NXSA 2JKAA 2B7QA 4AEOA 3W7DA 5EYWA 3WK3A 3HGRA 4YL2A 4HNUA 5K9XA 4JYEA 1W3IA 3W7RA 2ZDRA 4LC6A 4HPXA 3W70A 1K3UA 4BFAA 4MY9A 5IBXA 1C8VA 1W5QA 5C2XA 4O1BA 4TO8A 1LROA 5HULA 2QAPA 5U7SA 8TIMA 2BX7A 3G24A 5G5IA 4LT9A 4WY0F 3PS7A 1RZMA 1VYRA 2DZUA 1KM3A 3FYPA 1ZAHA 4R53A 5K2ZA 2P0OA 5KITA 1DJQA 1SSDA 1AG1O 1YADA 1EX5A 3KRUA 2Q8LA 5DELA 3KVMA 2WO5A 4DO5A 3UWUA 3BG5A 2AGKA 5H91A 2YPIA 4DBEA 1SR9A 4GJ1A 2CLLA 4DF0A 1W0MA 1K8XA 1W37A 4YWIA 1TPB1 1FCUA 1HO1A 1W1ZA 3LV6A 5HINA 1YXYA 2Y89A 3BLIA 1XXXA 3NVTA 2UV8G 3W7PA 4O50A 5HQEA 1KM0A 3LRLA 4LVDA 1XUZA 2VC6A 3O07A 3TKFA 1PVNA 2YX0A 2YYTA 4WJEA 1F7BA 2E5BA 3JR2A 4FNPA 4O16A 3C56A 1SUXA 3CLMA 1L2UA 4UR8A 1GVFA 5KZDA 3LX9A 4EOUA 1TV8A 1FDJA 1FY6A 5G1YA 4UTMA 1NVMA 5FEXA 3DXIA 1MXSA 5D02A 3W7OA 1FCBA 1TPUA 1ME7A 1D9EA 4X3ZA 3NQ8A 5EKYA 1FDYA 1LOSA 1LOLA 4WZHA 3BVJA 3W74A 1TPWA 2QCHA 4UXDA 4YCOA 1GPWA 3I7RA 4N9CA 3W7HA 1P0KA 5D32A 2WSRA 3UZJA 2PC4A 3A9IA 3MP5A 3LHVA 2Q8ZA 4IMEA 1G4TA 4KFOA 3ZFHA 5J5RA 5AHIA 3HOJA 3LXAA 2ZZ7A 3W83A 3C0JA 2E5DA 3ZWSA 1V7YA 3GDRA 4K38A 3S1XA 4AWUA 4IUOA 4M19A 1H51A 1JVNA 4FNTA 1VZWA 3UYCA 2Y7FA 2ZBTA 3S5ZA 4NNAA 4I7VA 3P81A 3C2OA 5AFDA 3TV8A 3VFLA 3FOKA 5FF3A 2B7PA 3QM3A 1J2WA 1WBJA 5D38A 5DN1A 1XBYA 3HPXA 4WY0A 4BI6A 1TTPA 3S1WA 4YMZA 1KM1A 4O28A 5G4WA 4ADUA 1WA3A 3G3MA 4FIRA 3A23A 5L6UA 1P1XA 4H4IA 5D2YA 3R89A 4MYXA 3P7YA 4XUGA 5E93A 1ICQA 4OT7A 3R8RA 4UMCA 3PC0A 4K39A 2GQ8A 2J24A 3VCRA 2J9XA 1OFRA 1PIIA 1AMKA 3PSWA 3W7JA 2QCNA 3LM7A 3EB2A 5E1QA 2ZTKA 3EWWA 4LS2A 4E0CA 2ZRYA 1PCWA 3A5FA 1VC4A 2QUVA 5LSMA 4ZQRA 4ML9A 4O54A 3S9YA 1XBZA 1H62A 1GVRA 3CB8A 3CPRA 4JIQA 1MSSA 3NXFA 4MUZA 4NNBA 1AW2A 2WNQA 4KFPA 1RPXA 3G0SA 3SGUA 4ADTA 3I6RA 5CZ0A 1OG0A 3DFQA 5J5DA 2DJLA 1X6UA 2Y7EA 4MVAA 3LCHA 3NR0A 2V2HA 1HL2A 1SO5A 3NQ6A 5EY5A 3O8AA 2E09A 1ZFJA 1KLYA 4FX8A 3EX4A 3IGSA 1XDMA 4RZ6A 3G8EA 3HGJA 5K9CA 3WJWA 3H53A 4NT0A 1CX9A 3DH7A 4GUFA 1FWTA 4LVBA 1OX5A 3T55A 1X1OA 1KTCA 5F2GA 2WOQA 4AVFA 1TB3A 3P60A 4JXCA 4IWWA 4GNJA 3CM4A 5LNUA 4Q32A 1XFBA 4FXRA 1JCYA 3P67A 3GDLA 2VEKA 1Q45A 1LOQA 5FF0A 4HNVA 4LWWA 1VCGA 2EGZA 5DCEA 3DKLA 4R33A 5K4ZA 3AO0A 3PSVA 2AQWA 1F6KA 1Q6LA 3GAYA 5AHFA 3A24A 3NQ7A 1WQ5A 3TU9A 3PUDA 3UD6A 1OHLA 1EIXA 5FF7A 2V2CA 3CWOX 1UUMA 3GNDA 1OJXA 3BW2A 3DAQA 2D73A 2Z6JA 1PHWA 1KM6A 2YZRA 4Y90A 4X22A 3LRMA 1JCNA 1JJKA 4W9TA 1XC4A 5T26A 5LGZA 3NNTA 4RKAA 3CT7A 3MJYA 4UR7A 3N14A 1BKSA 4UTUA 4ONVA 2OJPA 3MHFA 4QM1A 3TJLA 4D2JA 1YTDA 3QJAA 4E2DA 4FX6M 4ORIA 1EEPA 2ZTJA 3GDTA 4N9EA 3JRKA 4UFMA 3C2RA 2A21A 1KFJA 5LHEA 4OV9A 2A7RA 3W6YA 1VHNA 4DPPA 3W1LA 2DP3A 1AL7A 6ALDA 3NL3A 3TE9A 1WBHA 3TIMA 1IIGA 4IOTA 1P4CA 3OBKA 3DU0A 3BW3A 4EVZA 4JIPA 1OYCA 1JCLA 1Q3NA 1YDNA 1EUAA 1C29A 4HSOA 3UWQA 3DBPA 4C1KA 4Q4KA 3BO9A 2WPBA 3OVQA 3GAKA 4QSHA 4XKYB 1EP1A 3LRKA 3W23A 5AC8A 1ICPA 1H1YA 2CWNA 3NM1A 1XBVA 2QCLA 3E9AA 3SR7A 4MFEA 5HMSA 1G67A 3PUOA 3CWNA 4IJBA 4WXZA 2Y85A 3L0NA 4JTTA 2ZFAA 3RLUA 2Y6ZA 2E6YA 4QQ3A 4P61A 4JEQA 1N7KA 3ELFA 2BZNA 3PG8A 4DO6A 1RV8A 1VCVA 3P5YA 3IIPA 4UIOA 1H60A 3W3OA 1JUKA 3Q2DA 1H1ZA 1A5BA 3TAKA 4LU0A 4YCPA 1MZHA 5AHNA 1VR6A 1FCVA 1AW1A 5F4WA 3CEPA 3NOEA 1A50A 5D2WA 1SW0A 4FNQA 5LKYA 2NLIA 4M6QA 2QR6A 4UTJA 4WOZA 5F4SA 4N02A 2VELA 3B05A 2VFEA 4IX2A 2ABAA 2ALDA 2V0TA 3MYOA 5DLCA 5KINA 4DXVA 4JYFA 3C4UA 2E5CA 1DV7A 1WOAA 4IMDA 2P1FA 3UZ5A 1RQHA 3IVSA 1ZY9A 2YXGA 1OYBA 2RDTA 4AB4A 3NDOA 4UTTA 1UBSA 3ABOA 3BARA 3PY2A 3QMRA 4LV9A 3W1RA 1YYAA 3MMTA 1VHCA 4JX4A 1HFBA 3LOTA 3W7QA 2G5WA 2Q3RA 4UTKA 5G1TA 5FEPA 4LRSA 1VGAA 4UCGA 4LY8A 4XBSA 3FJLA 3E12A 3PM6A 3RFAA 4B5NA 1L9WA 4DQWA 4O1CA 1OK6A 4NUWA 3S1VA 3MUXA 4HNNA 1ZENA 4LV4A 1AK5A 1QPNA 3OVPA 3UWVA 4AHPA 5BMXA 4KKXA 5DXXA 3EWZA 3GXTA 4S2CA 5SWUA 4TMBA 1R47A 3S5NA 4U4MA 3P82A 2DZPA 4H6KA 3W72A 2QCFA 1NF0A 4JY8A 1PS9A 2NWSA 3EWXA 1I8JA 3P8IA 3GIYA 4TIMA 1GZGA 2EAWA 4IMCA 2C15A 3LHTA 1QWGA 3TCEA 4JDBA 4RLIA 4WX2A 5BNKA 3P62A 3CQ0A 3SIZA 4RCXA 3HG3A 2VEPA 3LLFA 4GRSA 2WQPA 3OA3A 3TSBA 2QDGA 1X8FA 3N34A 5AHLA 3O63A 1H7PA 1SZGA 3W1MA 1GTHA 3MYPA 4IPIA 3LCIA 3NPVA 4LUIA 1G7VA 3MI2A 4M6VA 1W5NA 3WJZA 1VRDA 2G95A 3WK1A 2H3DA 3M1ZA 2WSQA 3L66A 3F1QA 3CU2A 3W1PA 3B04A 5I3IA 3B4UA 4Y9AA 1I2NA 3N3MA 3BPWA 3CTLA 1BEUA 5EMUA 4QNWA 3W2MA 1HO4A 1TRDA 2FIQA 4I9AA 2V2DA 1LORA 1NSJA 3IRDA 1VYSX 1KA9F 1F2JA 2GJNA 5K4XA 5D2XA 4ZQNA 4KWWA 5GVJA 3FLUA 4LRTA 4HNTA 4UNLA 2QJGA 4L4LA 3R12A 3KOFA 4DEFA 2O7SA 3T7VA 4NJHA 3ABRA 1OFQA 2C6QA 4K6AA 4DO4A 3UXDA 1PHQA 3IGUA 3W76A 2QCCA 2NUXA 3FEMA 1T8XA 1Q6OA 5I3GA 3P84A 4J9JA 4LOCA 3OEXA 4CQ8A 4HSNA 4ZQOA 1GG1A 4QJ1A 3W9ZA 4GBUA 1QPRA 3KHJA 4GC4A 3LCWA 3LHYA 1D3GA 3TR2A 2HSAA 2R8WA 4UTIA 1FDZA 1K7XA 2ZZ4A 2PE4A 1TSIA 4BK9A 1DL3A 1H5YA 1IF2A 1K03A 2OZ0A 1FCQA 2PURA 3G1YA 3W85A 3RF9A 4JS3A 3DI0A 3G8RA 2NX1A 4OQVA 1QCWA 4KFNA 2V5BA 4P2VA 3NGJA 5IM51 1QOPA 3ABSA 3GKAA 3S0CA 1OK4A 1W3TA 1Y0EA 3LXBA 1KTNA 1S3HA 1S5WA 1QMLA 2W6RA 2YW3A 2ABBA 1IXOA 1B4EA 1EUNA 5DBUA 1UASA 2A1YA 3KXQA 3F4WA 2B7NA 1ME8A 3LDVA 5HWMA 3LCGA 2KZHA 4UTTC 5LZLA 4XBKA 3LTYA 4WUIA 3HMJG 2VEIA 4K8EA 3NQ2A 3W2UA 1W56A 5CZJA 4IMGA 4S2BA 2ISSA 3M41A 3IIXA 1ADOA 3NQDA 1G4PA 5D09A 4IQLA 1XM3A 5H2ZA 4ZQCA 2DZXA 4XTDA 3I7SA 3AJXA 1IIHA 1ML1A 3YPIA 2C16A 4Z1CA 3DGRA 4K36A 3G1DA 1OX4A 4GWEA 5G2HA 1DKWA 2R14A 5AC6A 5HUOA 3W1AA 3TFXA 3E0IA 3NA8A 1EP2A 4NZJA 2F7FA 1D3HA 1TTJA 2E6AA 2PRHA 2WV8A 3QW3A 4UUIA 3LV5A 1X7FA 2ZRVA 3TFCA 3TQ0A 3IV3A 3N2XA 4PL2A 1A5AA 2CZEA 1S5VA 2VFIA 1ZNNA 1U83A 2FJKA 2VFHA 3PG9A 2X1RA 3WFAA 1TMHA 2Y62A 4JTUA 1WAUA 4GUIA 2ISVA 4QITA 3L0KA 3QQ1A 5A8GA 1JCMP 4DELA 1KFBA 3S1UA 4O52A 1I2RA 1I2OA 2OT0A 3PB2A 3Q37A 2A2IA 3C52A 1GQNA 1TJRA 3O15A 2I14A 4JICA 3PF3A 2H6RA 2Z0IA 4TX9A 3LCFA 4UFKA 5C6MA 2WJZA 4M6PA 2YDAA 5HUPA 3PVFA 1DOSA 2BLEA 4JNMA 2FLIA 3S6DA 2FDSA 3IIOA 4PC8A 5F4XA 5C5YA 2CLFA 4LUJA 1FX6A 2DORA 3DZ1A 4AHOA 1O4UA 2ZZ3A 2QUTA 2QF7A 5EL1A 3O16A 2NX3A 3GK0A 3TUUA 2A6LA 4PA8A 4MIMA 1B9BA 1F6PA 2RDWA 4O1DA 2VENA 4DF1A 2R91A 3MBFA 2FB3A 1W54A 3OVRA 3LHZA 5D03A 3NQFA 3L2IA 3TSDA 4LW7A 4KWVA 1QFEA 2ISWA 2VOMA 1HG3A 2YFNA 5DCDA 1L6WA 5DY3A 3KVJA 3M5ZA 3M0ZA 3T4CA 3D0CA 4K8HA 4JTLA 3FA5A 2CLIA 3HG4A 4DPQA 3SSJA 4BI5A 1YDVA 3S8HA 4XQ6A 2ZRZA 4NXKA 1QR7A 3MHUA 1O5XA 3S5OA 1O95A 1YPFA 4MOZA 3WJSA 3E96A 1TPFA 2CLOA 4AF0B 4NNCA 3R13A 4FXSA 1GYLA 3CIXA 3FS2A 1JUEA 3SI9A 3B0UX 3PUEA 3TAOA 3L5MA 1QOQA 2GJLA 1YXDA 4NQ1A 5F1VA 1AL8A 1XUUA 3UWZA 2QKFA 1I45A 3V75A 1OVDA 2CLHA 1VLIA 4LVGA 5KSWA 1GT8A 4K7VA 4A2SA 1ZAJA 1KFEA 3HG5A 3NG3A 1DQWA 4GUJA 7TIMA 3TC7A 2HS6A 2JKEA 1SQ7A 4OBTA 3SZ8A 5HNRA 2EHHA 1LM1A 2QDHA 5D04C 1FXQA 3BG9A 3C61A 3O6YX 3KAOA 4OE7A 5EA9A 1TTIA 1XI3A 3EX3A 4AWTA 3MP4A 1QO2A 4UTWA 1K8ZA 1I4NA 4JTIA 1KV5A 2ZRWA 5AYXA 4NJGA 3W87A 3EXRA 3T44A 2DZWA 2ZA1A 4UNKA 3C2FA 1TREA 3TK7A 1XL9A 4O4WA 4ALDA 3KVLA 4GUGA 5I3JA 3QH2A 4O57A 5LNRA 3LXCA 2GOUA 1H63A 2V30A 2Y7GA 3PBVA 3IEBA 4K7YA 1B3OA 1F05A 2NZLA 1EB3A 2GVLA 2RHGA 3VKJA 1ZJIA 1X1ZA 4O0ZA 3UWYA 4Q33A 3M47A 1KFKA 3L67A 5DY2A 2I9EA 2FB2A 1OX6A 1SFJA 5DBTA 3NQEA 5KZMA 1LCOA 1WXJA 3U6WA 1R2SA 1KBIA 1BWKA 3LBMA 4ORMA 4WXYA 2GQAA 4NZFA 5BMWA 5HWNA 1OYAA 3IVTA 4H3DA 4LVAA 1PCKA 3GNNA 3UNDA 1QPQA 3QF0A 2ZZ2A 2YFOA 4IPJA 3ZS4A 1KM5A 4C1LA 3P61A 4IGHA 4RXGA 3LBCA 3Q94A 1ZCOA 4UTHA 1FQ0A 3QEZA 1LLWA 2TMDA 2WKJA 3L21A 4N4QA 3SJ3A 3CIWA 1GEQA 3NAVA 3GR8A 1SO3A 3MP3A 3TQVA 2E1DA 4Z1DA 4QIUA 1V5XA 3UPBA 3C6CA 1XDLA 3MI6A 4RJEA 4ZZ9A 4AMAA 5LGXA 4ICNA 4FX7A 4LS1A 5ABTA 1EP3A 1FWRA 4GE8A 2NXHA 1LRNA 4M5PA 2V5LA 3QMSA 4JTEA 5DCBA 2J6XA 3NPXA 1TJPA 3HQ1A 4JTJA 4OWGA 2CLEA 4HPJA 4NJJA 1KFLA 3MWAA 1A5SA 1Z41A 3SW6A 3IIVA 3M44A 1CW2A 2GVJA 2ZCGA 3EKZA 3HF3A 1ALDA 1ZAIA 2OT1A 4ZVJA 1LYXA 1NAL1 4QNEA 3B8DA 3LTSA 2PRMA 4PCFA 3T78A 2WSYA 2NUYA 3RK8A 4CNPA 1LRQA 2C18A 5G2WA 3NZ1A 2FPYA 3OIXA 1KTBA 5D2TA 1H7XA 3BLEA 3WK2A 3TXZA 2Q3OA 3W2KA 3M5VA 4TR9A 2P10A 3EEGA 4HT3A 4JYDA 3S42A 2A7NA 4BR1A 1LRTA 2CZDA 2YCEA 3THAA 4JR5A 3LGEA 3TA6A 1G4SA 3G22A 3W86A 3NZRA 1AW5A 1UB3A 2RFGA 3NQCA 3FKKA 1Q6QA 2QJIA 3BW4A 4MJZA 1F5ZA 1W31A 1CI1A 5AYZA 1SO4A 1Z42A 4DF2A 1LTDA 5CZTA 2HMCA 1G4EA 1YTKA 5D37A 3GDKA 3WJXA 3C2EA 3NQGA 3W2NA 3QMTA 4A3UA 3THQA 4CCCA 3LERA 4JX6A 3VE7A 2NX9A 5F2LA 6TIMA 4BWLC 4CNNA 1LBFA 3M5YA 4UTWC 1IXNA 3QZEA 2XN2A 3EWUA 2JGQA 2FFCA 3ZWTA 3EX6A 5I3FA 3M6YA 5A5WA 4UC5A 2QCDB 2GVGA 4ZMGA 3EXTA 5EPDA 2I1OA 4JTFA 1H50A 1ME9A 2JBMA 2XN0A 3W1TA 3F03K 4I7WA 1F76A 4TMCA 2VKZG 3HPSA 3NQAA 4EIVA 1E51A 3T40A 2ZYFA 4UMBA 2NUWA 3C3NA 5K9DA 4CQAA 4UMAA 3EWBX 1JCJA 1RD5A 1JCXA 3WK0A 2IQTA 3KRZA 1N8FA 2OCZA 3H55A 5LNSA 1SZNA 4O15A 2CW6A 4IX0A 4O4VA 1A5CA 2B0MA 4JTSA 4XZ9A 1I2QA 5TQLA 4QISA 4FHAA 2ZRXA 1F73A 3HGOA 4JDYA 1VPXA 2YYUA 1M5WA 2G97A 5I3HA 1G7UA 4NX0A 1L6SA 2C1HA 4FNUA 1DHPA 2DJXA 1F74A 3L0GA 1C9DA 3SFKA 3UY8A 1TPEA 2FTPA 1KW1A 4UFLA 3EX1A 3Q58A 3M16A 3GZ3A 1K7EA 2ATMA 2E77A 1OFBA 1OFDA 2G96A 3LI0A 5CPNA 3STFA 3GR7A 3LB0A 2QAFA 5TIMA 4BF9A 1QPOA 3EKLA 1BWLA 4PL1A 3M9YA 2O7QA 2W0UA 3ABQA 4Y96A 1BTMA 3NL2A 1R2TA 3BV4A 1QO5A 2EF9A 4N9BA 3C2VA 5FEWA 1KV8A 2E6FA 3W7CA 4AH7A 3QQ0A 3R5EA 3W71A 2XN1A 3CC1A 3M43A 4GXMA 3TMQA 3NPUA 4RV8A 3F4NA 3W75A 1UUOA 2PCQA 3C8FA 3RU6A 1SO6A 1IXPA 1MEHA 3RNDA 3G1AA 1GVOA 3U2OA 1H7WA 2FQIA 2QUUA 3TJXA 3INPA 1WV2A 1R2RA 1UCWA 4JN6A 3KVKA 3PULA 2LLEA 4O53A 2HS8A 2X1UA 3GYEA 4MZ1A 3TNOA 3DHFA 5AN7A 2A0NA 2C14A 1GYNA 5D30A 4WOQA 1WYIA 1JULA 3QC3A 4RZ4A 2E6DA 3RLVA 1JRCA 3W73A 2X2GA 2C3ZA 1KM4A 4IXHA 3PBUA 2Y61A
chains in the Genus database with same CATH superfamily
1S2VA 4LALA 3PR2A 5TBOA 3TNBA 2NQ5A 5M3WA 4OU1A 3ZLHA 2NV1A 3RCYA 4H6EA 1GOKA 3TC3A 1CGTA 2BS9A 3HGSA 4HCHA 3RJXA 1XIHA 3JZUA 1R6WA 3O06A 3E0VA 4GZJA 2F6XA 1V0KA 4LS0A 4MADA 5LHFA 1N55A 4J3WA 4DZIA 3ZJ8A 3FIGA 3GYCA 4RK8A 4Y8FA 2QVHA 3M0VA 2RKXA 4L9YA 4JQ4A 5AC5A 2WVTA 5EMKA 3MW7A 3UJFA 2J75A 4AWSA 2VC9A 3XISA 1J5TA 5C2GA 3DFOA 1RSCA 4DJEA 1IYXA 1WPCA 6PTDA 3O6CA 2XM2A 1Z44A 3W7IA 1UIOA 3EBVA 3OG3A 4L1XA 4MLRA 1P0BA 4AEEA 4F66A 5HOSA 1TQJA 2ZVRA 3W84A 4EF9A 4UQEA 5AHEA 2GUUA 2NSXA 1EEXA 1PTDA 3STEA 3QY7A 4JGDA 4H9XA 4MNJA 1EA0A 3IJ7A 2WLZA 3LPOA 3CH0A 3E2VA 1BD0A 3STCA 3VD5A 3V0TA 1EQPA 3WQWA 4JQ1A 5DXYA 1NWSA 4FS9A 3P8JA 1QTWA 2GDVA 3W7GA 5FL1A 4AC7C 3PWGA 3N6HA 3TXVA 2W79A 3BL3A 3U8GA 2X16A 1FWFC 5FI8A 2JF6A 3H4GA 1Z8AA 2ZZ1A 3ARUA 4OHQA 3W1XA 1IGSA 2YOCA 1V3MA 3S2CA 2W92A 2J74A 1MDRA 1FWWA 1T0OA 3EKGA 4DB7A 4DJFC 2EPNA 4O8AA 4WQ6A 3DFSA 1GG0A 3LTPA 3LA4A 3LI1A 4FNRA 4NVTA 1EF2A 1RK6A 4IMFA 2WNNA 5CZSA 1D7FA 3R8GA 1R7OA 1AQHA 2H90A 3QN3A 2R24A 1J4EA 4QAIA 2Z6IA 1F6YA 4GA8A 3W2LA 5I24A 4AVOA 3L68A 5IBXC 4G6CA 3TW7A 2TAAA 3ARQA 1TUFA 2Q01A 3VK5A 3FFSA 3ITCA 2ICSA 3WIJA 1E5JA 1R9ZA 2FYMA 3N29A 4UB9A 4ADSA 4URIA 4B5SA 3V1PA 5FJTA 4B90A 5DT7A 3TLLA 4ZGYA 4PFMA 2GSHA 4IXXA 1SU5A 1VKFA 3VGDA 3KDNA 4RDYA 3HPZA 4ATDA 4GKLA 3NPWA 2EKCA 2VL4A 3G3DA 4JTRA 2OYKA 5I6SA 4QLKA 2XFFA 1ZHAA 1PZ1A 1J0HA 4KS0A 3LPFA 3G1FA 1M7XA 5A6TC 4ATLA 3BANA 1Z48A 2VQUA 1UQYA 3QFEA 5U4NA 1NH6A 4CCEA 1GZ1A 3TSMA 1V0NA 1W5MA 2DUAA 3JS3A 3NFUA 5IFPA 3BGGA 1JD7A 1SJCA 5E0KA 1OM0A 4GPNA 5HWJA 4ICMA 4NIRA 1E4MM 1ADSA 3G6MA 3SDOA 4EWND 1MMFA 1DWGM 2E9BA 1G5AA 4NAEB 4JX5A 1XR2A 3N19B 1EPXA 1XCXA 5DMYA 2VFDA 4DZAA 3ARZA 1EQCA 1LZOA 3MI3A 2CU0A 2V82A 4LY4A 3VDBA 5K7JA 4X9SA 3R2GA 2VFFA 1HN1A 3GWQA 3I7QA 4U31A 1UPMB 4DAIA 1OINA 2Y0FA 2PC8A 4GJIA 2NQLA 3CEUA 1E5NA 2VC5A 4K1WA 1ZALA 4A3RA 4I90A 1E9LA 3LUTA 5CPLA 4WY0B 4R7OA 1X98A 2X1SA 3U0HA 4NU7A 2Z2BA 4BQ4A 1XD1A 1UOKA 3B06A 4G56A 2WHKA 1R3YA 1U5JA 3L5AA 1THFD 3GH7A 4XAFA 1TPC1 1X1NA 4Z2HA 4PMOA 4M7SA 3E2SA 2P8CA 3PAJA 1F8MA 3TYUA 3IAPA 4FEZA 1RY0A 1JUBA 3ZT7A 1BRLB 4WJXA 3DFNA 3T0BA 3VZYA 2FPVA 3A3WA 2WCSA 2RAGA 3M4HA 4QLLA 2YLLA 2BWGA 3DECA 3W7NA 2X09A 1YKWA 4H9YA 3SY8A 4X0NA 3TOPA 2CPUA 2IKHA 1XLEA 3TEVA 2SFPA 3QY8A 5G2IA 1CPUA 4IIHA 1BVWA 2E4TA 2V9DA 1BRLA 2ZVIA 4AG0A 3L5LA 5ABGA 3KE0A 3NEVA 3G1XA 4J27A 3EXSA 2PI6A 4DJEC 3QSTA 1ECEA 3AHYA 2ZUWA 1YRRA 4PMJA 9RUBA 5C9RA 5C55A 3W07A 1A0CA 1UWTA 1HKIA 4G1KA 5KTLA 4AISA 1J0IA 2Z29A 2VX5A 3NURA 2UY3A 3OYZA 2XDFA 3ZQ9A 1D2KA 1Z3NA 3N73A 1AH0A 1QBBA 2PBOA 2RH9A 1FP8A 3K46A 4AY1A 4HGXA 1FH7A 3O1NA 3TN3A 4W88A 1WZMA 3OGVA 3LM3A 4LCRA 3ZLFA 3FKRA 2VVSA 1W3LA 5HJLA 1R3SA 2VQTA 4AW7A 4F0SA 1YDOA 2C91A 4ENLA 2X30A 4JKKA 4Q8PA 4O12A 1A80A 4WEVX 1KBJA 2YR1A 3WLSA 3FK4A 5CBBA 1VQTA 3TN4A 3B0PA 1ZSXA 1HUVA 2VEGA 3W88A 2WVSA 1FP9A 4J3UA 3QBUA 2PEVA 8CGTA 3IJIA 2OX1A 3P0WA 5FF4A 1XRTA 3GVGA 4QXIA 2DZSA 1Q63A 3S5YA 3VD9A 5BW6A 4F0KA 5C9XA 5D9MA 4V27A 1ITCA 4U33A 2HDJA 3FAWA 2ISFA 3ARXA 4C6MA 1ZLPA 4UFHA 5CC6A 1DTUA 1TPH1 3B9AA 2JKAA 4AEOA 3W7DA 1ISYA 1Q7ZA 4ZFCA 2VZTA 1NM9A 3HU7A 4F0LA 3W70A 1K3UA 4BFAA 2WB5A 4PUEA 3UXLA 2PF8A 2QV4A 2VO5A 3K4AA 4EE9A 5FOOA 3MDWA 3UJRA 1W8GA 4DAFA 4O1BA 2NV9A 2F2KA 4PBFA 3GRIA 1MRQA 4PEEA 3OGSA 4LUYA 1MW0A 4JCMA 1W9UA 3MT1A 1W1VA 4R53A 4MB4A 5CQ1A 2BB0A 1SSDA 3ZVHB 3BE7A 2P50A 5DELA 2WCGA 2OSXA 5EB8A 3TYZA 1R3VA 1JZ4A 3BG5A 5GJNA 5H91A 2GDUA 1F3WA 4DF0A 1K8XA 1W37A 2A79A 2VDHA 3WFZA 2WK2A 5A8QA 3LV6A 5HINA 1TR1A 3NVTA 5EFFA 3W7PA 1UWRA 4HVXA 1EXBA 1KNWA 4LVDA 1PVNA 5JUVA 3FJNA 5JMUA 4R85A 3JR2A 3QHMA 1SUXA 1WKYA 2ANUA 1K70A 4UR8A 3D3AA 1J6PA 3LX9A 2FH8A 5G1YA 1JDFA 1BPLB 3EA2A 1UZ4A 1GOIA 1U2YA 1TPUA 1ME7A 4X3ZA 3MB9A 4C1NA 1UKSA 4L6DA 1LOLA 3IANA 5MKGA 1GQKA 1XC6A 4YCOA 4KH2A 2OFJA 1RUSA 1LQAA 2WSRA 1SR0A 4D8ZA 3IARA 4G2DA 3LMZA 1EFZA 3K4DA 3VFCA 1NP2A 2V5CA 3VABA 2G3NA 2ZZ7A 1V0LA 3C0JA 3M0YA 3BXWA 1A5NC 3ZWSA 3AJ7A 4K38A 3S1XA 4GOAA 5BYWA 3QLDA 4M19A 1EX1A 4FNTA 1V3LA 1VZWA 2Y7FA 3KBNA 3S5ZA 4FF5A 2VZOA 3W53A 4PB3A 3VFLA 1J2WA 2PGFA 3WQGA 5DN1A 4XD6A 3UERA 2OWXA 4BI6A 3DDMA 5G1MA 1KM1A 4O28A 3MANA 3MCNA 3G3MA 3OBEA 3A23A 4H4IA 5D2YA 2GGJA 3IGHX 4H9TA 3EPOA 1VJZA 4UMCA 3PC0A 2J24A 3VCRA 1L6FA 3HV8A 3W7JA 1F9CA 3PZOA 2ZTKA 3EWWA 4E8CA 7ENLA 4ACZA 4ATWA 5A8MA 1XSKA 3B8SA 4ZQRA 4ML9A 1JEZA 2IXUA 3CPRA 1MSSA 3SEPA 4EKJA 5JBEA 1BYBA 3G0SA 4P5UA 1HT6A 5CZ0A 3AMDA 1OG0A 4J3XA 5J5DA 2DJLA 4XZNX 4MVAA 1QI3A 3N4FA 1XLIA 4A3HA 3CQHA 4HHLA 4RUBA 1KLYA 4R9XA 3EX4A 3ARSA 1XDMA 4NT0A 4GUFA 4MTVA 1FWTA 4LVBA 5ECVA 3AHVA 1ADDA 4NP7A 1OX5A 3BCJA 3T55A 5F2GA 3P60A 1QI2A 1K8CA 4FXRA 4R5EA 3H70A 3WH6A 4ZOAA 1AUSL 2BVDA 5CLWA 2EGZA 3WLIA 5K4ZA 3JZEA 3PSVA 1A0EA 2AQWA 3H22A 1O1HA 1Q6LA 1JDDA 1YDYA 4CEXC 3O9NA 4Q8NA 3TU9A 5AVHA 3V5OA 5T8GA 1E6ZA 3ZJ7A 4CNUA 2Y2WA 3EEZA 3WO8A 5LXXA 4XAPA 3H4WA 3GNDA 1OJXA 2Z6JA 1PHWA 1KM6A 4HK5A 5LIXX 1KRMA 4PTDA 3W01A 3VGGA 2ON3A 3CT7A 3MJYA 1BKSA 2XIJA 2NQ9A 2OYMA 3WLNA 4PYSA 3EPMA 1HKWA 1YBQB 4H19A 4ORIA 4J1OA 2ZTJA 2A21A 4HCLA 3R10A 3WH7A 2A7RA 3W6YA 1VHNA 4PUDA 4HYRA 4L65A 6ALDA 3LZ5A 4GI8A 4WVXA 1O6IA 4QE1A 3DU0A 3OBKA 3ISIX 1MW3A 1IEQA 1A3HA 1JCLA 4NL1A 3S5SA 3WD1A 3UWQA 2WBGA 3DBPA 5A8OA 2HE8A 3BO9A 5DMMA 3W29A 3C0LA 4RNIA 3W0KA 1IEWA 1EP1A 3KW3A 3W23A 3UA3A 1ICPA 2E9LA 5CSYA 3SCVA 2FVMA 3BOFA 2PU1A 3E9AA 3EAUA 4C6CA 3TR9A 3AHXA 5CAKA 1TJ1A 5I77A 2E6YA 4P61A 2D3NA 4PMNA 3PZVA 2DIKA 1Q8JA 5LIKX 3P5YA 4RE0A 5LA1A 1OIMA 1YW1A 2WZHA 3AAMA 3RILA 1EJSC 2DSKA 4FOUA 3W3OA 1R3QA 3U7VA 2XIBA 1H1ZA 1KWGA 1A5BA 3TAKA 1MZHA 3UWEA 4JNZA 2IMRA 4F3HA 3CEPA 5D2WA 1FWGC 2GVEA 2OZTA 4WOZA 4F9JA 3B05A 3KL0A 4IX2A 2ABAA 3L4YA 3ZVHA 4DXVA 1UR3M 2GUYA 1DV7A 3C8NA 3UZ5A 1XKJA 4V15A 1ZY9A 4MWAA 4W7WA 4GI6A 3DHUA 1OYBA 3UJEA 4MWAC 3ABOA 4DZ5A 1CCWB 3K2GA 1RP8A 2O4MA 5CPSA 3PN8A 4QSFA 4DY1A 4JX4A 1HFBA 4TV6A 3L2MA 2G5WA 2QVNA 2Q3RA 2POTA 5FEPA 4LRSA 1EC7A 1VGAA 4C7FA 1RP9A 4UCFA 1GPFA 4ERAA 3E12A 3PM6A 3RFAA 1IZKA 2PD9A 3IJLA 1OK6A 3NXLA 4NUWA 4E6MA 3SCRA 3W6LA 1AK5A 1MUWA 1UC4A 3VNIA 4HN8A 4H8HA 1W91A 3UWVA 2GGIA 2XH0A 1IT0A 3LNPA 4XO6A 4KKXA 3EWZA 3GXTA 4S2CA 1XLMA 4F48A 4NG3A 3T05A 3AMKA 3QV9A 4QG8A 1W9DM 4U4MA 3WY1A 4M0XA 1NF0A 1HIZA 1NIUA 2J7HA 3H6OA 3EWXA 1V93A 2QNEA 1TWWA 2WHMA 3GIYA 3WMCA 4DBWA 1XSIA 4WF7A 4TIMA 1QWGA 4X63A 1AJZA 4B5WA 3H2AA 3P62A 3HG3A 2VEPA 3LLFA 4DBUA 4GRSA 3MKKA 3TSBA 1Q2RA 3AZSA 2QDGA 4ZSTA 3QKZA 3O63A 8RUCA 4AY8A 5CJNA 3WENA 3RDKA 4F2UA 3LCIA 3NPVA 4AY7A 1G7VA 1P7TB 3P3BA 3WJZA 3NZPA 5T91A 4AD3A 3L66A 4JIHA 3K1GA 3F1QA 2OGYA 3CU2A 2F6UA 3CZGA 3B4UA 1CNVA 4HD5A 3AYVA 3BPWA 3CTLA 4PUWA 5EMUA 4QNWA 4ERGA 3AU2A 5EMLA 3ES7A 2AMGA 2AOSA 4HMDA 3S6OA 3IRDA 2E28A 2HNHA 1KA9F 4ZOCA 5D2XA 3DIPA 3WQOA 3LPPA 1BF2A 4LRTA 2CWXA 1EH9A 3LQLA 4L4LA 2AL2A 1O5RA 2D20A 1J79A 3T7VA 3TTSA 3RHGA 2YB1A 3P14A 3N12A 3VOGA 1ZJAA 4K6AA 1PDYA 4JL1A 1UD2A 2GWNA 3IGUA 4P8WA 4IZGA 2POZA 1JAEA 3RR1A 4GBUA 3R11A 1S1PA 2J7GA 4L6HA 3LCWA 3TR2A 2HSAA 3M0XA 1XV8A 2G4FA 2PUZA 4K68A 1XRFA 3OZOA 1H5VA 1DL3A 3G1YA 3RF9A 1P43A 2DT3A 3G8RA 3R6IA 2NX1A 5EU9A 1QCWA 4KFNA 1XWYA 3OTRA 2D0FA 2VD8A 1QOPA 1FKXA 4HYVA 5MF5A 1S3HA 3GO2A 3F4DA 4XAGA 3SCWA 2FHBA 3UXIA 3SCTA 3HURA 4DUVA 1POKA 2A1YA 3E5PA 1M3UA 4HOWA 3O3RA 4RDVA 4V2XA 3WMSA 3CQIA 3LDVA 2IKGA 5LZLA 2OELA 4QAWA 2CERA 4KW2A 2PTDA 3CYJA 4XO7A 2VEIA 4K8EA 5CAHA 3W2UA 3URQA 3QTGA 1PZ3A 2FTYA 1JNDA 3ES8A 2VZVA 4LCSA 3PZNA 4GZIA 3KCJA 4GMEA 3OLIA 1ML1A 1RAKA 3YPIA 3BQ5A 3L4WA 3G1DA 4GWEA 3W1AA 1RCXB 5IHSA 3WF3A 1TJ2A 1ZZMA 1QT1A 4UUIA 2J62A 5FJJA 1X7FA 2ZRVA 1W1B1 3JW7A 3TQ0A 3IV3A 1MUMA 5T9CE 4GIYA 1E6RA 1S5VA 2EBNA 2Z00A 1HJXA 1GYMA 2VFIA 4EK7A 3QQWA 3AMLA 2VFHA 5FKYA 3I3BA 4HHMA 1TE6A 1HGWA 1R7AA 2X7WA 2PDUA 5CJ5A 4O52A 3COTA 2OT0A 3PB2A 2WMIB 3C52A 4GYPA 2I14A 2G41A 1AA1B 5AVNA 4OUEA 3MWCA 2Y5SA 3WD0A 2PBGA 2WMKA 5XINA 4M24A 7ODCA 3E1F1 2FDSA 1G01A 4KGLA 1HKKA 2V69A 4QGCA 3AWOA 4AHOA 2ZZ3A 2WKLA 5I2UA 2XVNA 5EL1A 1M53A 4ZODA 2A6LA 5DMLA 1F6PA 2RDWA 4JKMA 5DANA 3RX4A 3KCOA 2PDBA 2FB3A 5D03A 4C6FA 3TSDA 4KWVA 1QFEA 3QV8A 4BEQA 1HG3A 2QHAA 4HPNA 1L6WA 3E3HA 4R3UA 1W2PA 5HQMA 1F8IA 4YTSA 1UZDA 2XZ9A 3PFRA 1EZWA 4JTLA 3UZXA 3SSJA 3NCOA 4C7DA 2WZIA 4XQ6A 1JPIA 1QR7A 1O5XA 4PULA 4LFYA 3N4EA 3ZYZA 3AIWA 5JVLA 4R27A 2DQWA 1E73M 3WD2A 2ZC8A 4GK8A 2CLOA 3MC5A 4I5XA 3CIXA 4NRSA 3SI9A 3PUEA 3WNPA 1HKMA 3V75A 1OVDA 1E9YB 1VLIA 5KSWA 2HE5A 4HZMA 3T2PA 4A2SA 3FNDA 2ZOXA 4U10A 2YDSA 3BLPX 3HG5A 1NDZA 3T4WA 3TC7A 2HS6A 4G5DA 4RNHA 4WIWA 5CBIA 5D04C 1FXQA 4NAEA 3C61A 3EWCA 2INFA 1CGWA 3KAOA 1BQCA 4ES4A 1MXGA 3ITTA 3HFYA 3H21A 1Q7MA 4D6JA 2J7CA 1RJQA 5CXPA 4HMCA 1KV5A 2ZRWA 5AYXA 1XH0A 3W87A 3BDKA 2FDMA 4UNKA 3C2FA 2VI0A 3KVLA 3F5LA 5LNRA 3AWNA 2WAGA 4ZO6A 1F05A 4KRZA 2RHGA 2GVLA 4C91A 4O0ZA 3UWYA 3M47A 1F3XA 3L67A 1QI5A 2YBVA 3AZRA 5C7HA 2FB2A 3NQEA 4EPEC 2WANA 1WXZA 8XIAA 1VBJA 5J04A 3AUJA 1R2SA 3KBJA 4IL0A 3GU2A 5A6BA 1BWKA 1PTGA 2EG7A 3S46A 4GX9A 5E70A 3IVTA 4H3DA 4LVAA 2DFAA 3GNNA 4H9MA 3QF0A 4OBSA 3UBPC 1IHIA 4NYYA 4C1LA 4E8GA 1WZLA 2P3EA 3REQA 4LF2A 2TMDA 1PYFA 3FJ4A 4UNIA 2D2HA 3NAVA 3GR8A 4KT2A 2O55A 4Q6JA 5HATA 3NQBA 3UPBA 1QNPA 4AMAA 1HXJA 3DG3A 4ICNA 1MQQA 1EP3A 5ABTA 4GE8A 2ALRA 2HVNA 2NXHA 4M5PA 5GNZA 2V5LA 3S2LA 4XIMA 4J35A 5DCBA 3HQ1A 3CMFA 1QRQA 4HBKA 2CETA 4HPJA 3VUPA 4NJJA 1A5SA 1E40A 1TFVA 3HF3A 5CC3A 4HZ7A 1ZAIA 3VDAA 2H9AB 3WQFA 5HPCA 3B8DA 3LTSA 3UCQA 2WHJA 2WSYA 2NUYA 3RK8A 1E9IA 3NZ1A 3B40A 3BLEA 2XGBA 2YLAA 2E25A 2UY2A 5FJOA 3WF4A 4TR9A 4MWAB 1IZCA 2WJEA 4LAOA 1PZ2A 1XQLA 4KRTA 1VRXA 4JKLA 2CZDA 2YCEA 4JR5A 3A3XA 4V28A 4KWOA 4GVFA 3HPFA 2BFGA 4WGHA 1UB3A 3M0IA 3UT0A 1Q6QA 5CGMA 3TZFA 1F5ZA 1W31A 4YTRA 3AXHA 4BS0A 1G4EA 1YTKA 5D37A 3WJXA 1IGWA 4YTQA 3THQA 2Y5EA 4JX6A 1XDJA 6ENLA 3VE7A 2NX9A 5CZKA 2C0HA 3MU7A 2XN2A 4D8LA 3VCNA 4CVWA 3M6YA 2XFYA 4UC5A 4OECA 3IPWA 4Q7IA 2QCDB 4GG9A 1U30A 3LK6A 2I1OA 4TX6A 4D6EA 4GCXA 3W1TA 1HL8A 1F76A 3PJWA 2ZICA 3NQAA 4A3YA 1P1MA 2YCIX 2HRWA 3FVMA 3VIMA 3C3NA 5K9DA 3W38A 4UMAA 4IG2B 1JCJA 1XS2A 1JCXA 3WK0A 2IQTA 4WCJA 1N8FA 1H0IA 1QATA 4O4VA 4QISA 2ZRXA 3HGOA 1VPXA 3MPGA 1M5WA 4PMDA 1G7UA 4NX0A 5C0QA 2NVAA 4KQNA 2VRQA 4DX3A 4FNUA 2PTYA 1F74A 2FZ8A 3SFKA 1MNZA 1TPEA 3QLLA 5B7YA 5MKGB 1TX2A 1NFGA 3H2FA 4B2DA 1DWHM 3CHEA 1ELSA 3M16A 2ATMA 2E77A 1OFBA 3T0TA 5AZ0A 1OFDA 3MCOA 3STFA 3LB0A 2EO7A 1E0VA 3APGA 1OCNA 4IG2A 4J7RA 4OZOA 3ABQA 2PGEA 1BTMA 2AAAA 1OCQA 1QO5A 2O9OA 4AH7A 3QQ0A 1EJWC 3GG7A 2AL1A 4HNLA 4WLCA 2XN1A 3M43A 3MO4A 3NPUA 4RV8A 4S3BA 3GC4A 3W75A 1UUOA 1GVOA 1OT2A 5AYIA 3KL5A 3B8VA 1BVNP 3TJXA 1WV2A 3INPA 1CXFA 1R2RA 4FPSA 1UCWA 2GL5A 3PZUA 4KERA 4IQEA 1HKJA 4IPNB 1RD6A 1A3XA 4RNFA 3QC3A 4J3TA 3UGVA 4YJ5A 2R1KA 2X2GA 3MV01 4IXHA 5HA7A 2Y61A 2Z28A 5AB3A 4AF0A 2J25A 1OABA 4GY7A 4LYQA 3U4AA 1GORA 2HV5A 1UKQA 1YMYA 1Q13A 5FESA 2CNCA 1V3JA 2QCEA 4R7JA 3RRAA 3MMUA 1WX0A 1HVXA 3W24A 1VLWA 3MUIA 3QPYA 2FZNA 4OGZA 3KL3A 3P6LA 1X8CA 4NRRA 4O0KA 2BGQA 3GX9A 3HMCA 3PAOA 1I9CB 3E49A 3GVQA 1SZFA 1SW7A 5C54A 4DXKA 3GB6A 5XIMA 4FF7A 2VCBA 4BQ2A 1JZ3A 3ATZA 5I3KA 4IISA 1TV7A 1W5OA 3PZGA 3W7KA 1FH9A 2C71A 2CBIA 1MXDA 3W81A 3B03A 1AH4A 3SGZA 3ZT6A 1PL9A 3W7MA 1DBTA 2Y63A 3VOHA 1S38A 4I8YA 4M8UA 2ODOA 2QCGA 3ZIZA 2G4JA 3DEQA 4Y6GA 2QJJA 1E1CB 5TD4A 4MFDA 2NVCA 1XGZA 1PO9A 1G69A 1A4MA 3CASA 2NXGA 1X7IA 4LC8A 2VGBA 4XKMA 3H7VA 1K02A 5KMYA 4QX4A 1J0YA 1R46A 1Y8BA 1CDGA 2FKPA 1US3A 2PPGA 4NZ4A 1IT8A 1NQKA 4MHBA 4QJ3B 1XGDA 1XH2A 4O13A 5LNWA 3OA5A 3TX9A 3NZQA 2X05A 1TO3A 1V3KA 3IV8A 1RJRA 1PIFA 4IP5A 1XBXA 2C19A 4PTXA 4AIUA 4AX6A 2BHYA 1I6NA 1KM2A 2ZIDA 5IXEA 3G1HA 4XZBA 1S5TA 4WDUA 3SQSA 3WCZA 3PWIA 1VFLA 1GKPA 3DESA 1ZS2A 3H2EA 3I3EA 2GDQA 5GNYA 5CPOA 4LAZA 2ZQ0A 3EOSA 3B9OA 3EMCA 1FRBA 4LJ3A 2V63A 3ITYA 3EMQA 1VD6A 1UR1A 3WG6A 2BY1A 3NQVA 3CPGA 4M29A 3CV1A 4HJFA 4NHVA 4LNCA 3S1GA 1E6XM 3ITLA 3L4TA 3IGXA 3HM7A 3HG2A 4MZYA 3EDJA 1E56A 1MFVA 3IIZA 1EOKA 1FFQA 3HN3A 4D72A 1RQBA 3R7MA 3DENA 4C90A 1FFRA 4W8BA 2NQZA 3MDUA 1W8SA 5A6LA 5LA2A 4B4FA 1DIDA 3N9SA 4D9PA 2QCMA 3M7WA 2OMAA 3DN5A 1P0NA 4M7TA 2XFWA 3BLDA 1KFCA 1OC7A 5K3VA 4GO8A 3GW0A 3WNLA 4B9ZA 3U5UA 1T8QA 3ZR4A 1X97A 2Q02A 3PJXA 4X61A 4V1YA 2NVDA 3APTA 4JY9A 1BQGA 2PRLA 1KCKA 4YTUA 3HA1A 1R3TA 4RR4A 4KPLA 3LMYA 4GISA 1GOMA 3HV9A 2Y5JA 3CL6A 1JR1A 1P0EA 3LCXA 3EB3A 3A64A 4D6GA 4F79A 2HXUA 1DTNA 3PBWA 1SMDA 3FA4A 3P80A 4UFJA 3MMDA 1QNRA 3N15A 4MAVA 4PUNA 3LY0A 2VGFA 2E40A 4O8RA 3NYZA 4PMRA 4N6FA 3ITXA 2CKSA 4ZOEA 1K7FA 4A8NA 3KFTA 1NU5A 1B3VA 3S6TA 1NJJA 4F4RA 2X0HA 1EWDA 2E68A 2Y88A 5AY7A 1K8YA 4RV3A 2IS7A 3IVUA 5E6ZA 3W7LA 2DZTA 2CIPA 2WNZA 1PB0A 1LP6A 3ALFA 2HTMA 3FJ6A 2ZWZA 3QYSA 1R30A 2AAMA 3AMCA 4U28A 4NZ1A 2Q6ZA 1DQXA 2EQDA 5HR7A 2HWGA 3NDYA 1Q66A 4MPQA 1VJIA 3F5KA 3UY7A 3MBDA 4RZ5A 3LENA 4GO9A 3OHIA 3CIVA 4BWLA 5G4EA 1O60A 1GOXA 1ICSA 2YW4A 3UR8A 3SM0A 6REQA 4N9DA 1M7PA 3HIJA 4Z1BA 5AOUA 5LNVA 1LBMA 3WUFA 2WM1A 3CUHA 4FR6A 2CLKA 2Q09A 4Q4QA 4AAJA 1YX1A 1KRBC 1RQEA 2DU2A 4Z0SA 2BOGX 2DT1A 1VCFA 3KDOA 3CV7A 3I4EA 5D05A 4DRSA 2CZFA 4F9DA 1SPQA 1A53A 1XHGA 2VP8A 3BK0A 4DJFA 3VAVA 1G6CA 3OG2A 2PDYA 1T5AA 3CMGA 4CU6A 1Z9AA 1O94A 3G1VA 4AHQA 1GOQA 4DJED 4NJKA 1SSGA 1CENA 2HBXA 1NY1A 1WOBA 5BRBA 1ZU8A 1RBOB 4L7ZA 1SVDA 3PWAA 1H09A 2ISDA 2YJQA 1DORA 3W7EA 4Z08A 4N2YA 3S2NA 2IPFA 3EZ4A 4I7UA 2D2GA 2Z1BA 4A2RA 3OZYA 3QZ6A 2X1TA 1Y65A 2YSWA 4X0VA 1FWBC 5HNNA 4Y9OA 1GONA 2FH6A 2E67A 3K8KA 5A2AA 4ICCX 4LAMA 1ZL1A 4L6OA 3RX2A 4DHGA 1TPDA 4H04A 1W9BM 1RR2A 2RDUA 5CLTA 4YHGA 1JZ6A 2DSZA 2H9AA 2NXIA 4ZE5A 1FBAA 1NARA 3GXDA 3U3HA 4A29A 3WDRA 4PSPA 3QPZA 3A6OA 3VX0A 3CHVA 3CTTA 1OGGA 2YXOA 5D33A 3UG3A 3SCQA 2GQ9A 2TPSA 1QHPA 2X40A 4A6GA 1T96A 3W1NA 3QRHA 3ATYA 3K5XA 4Y2WA 2VXNA 3IJ8A 1CGUA 4W89A 4JBRA 1YBQA 4YXGA 1I2PA 5KEZA 3NQMA 2O9RA 1PE1A 3B0VC 3ANYA 3EPNA 4E2BA 4WD0A 2RGMA 4NX5A 1EHNA 4LBSA 2CHOA 4YWSA 2BY3A 4XG1A 1W1TA 3QGAC 4ZA0A 1RVGA 1UBPC 3U2ZA 3UR5A 4R7WA 1W17A 4CNOA 2JK2A 3VDHA 3N2OA 4A3QA 4KIRA 1NWUA 2PZ0A 2WM0A 3QVQA 2FPTA 2XWEA 5D8WA 3T2OA 2AL2B 3ICJA 1E0TA 4KEMA 4Q8WA 2JE8A 4NAFB 4FO4A 2E1WA 1R9YA 4AVNA 2CESA 1NF7A 1FVPA 1JPHA 2YBTA 2Y4SA 1TV2A 3GNRA 1LLZA 3KX6A 1M7OA 4O1EA 3DG7A 1BXNA 2B7QA 2DT0A 5DX7A 5EYWA 3WK3A 4YL2A 2PTXA 5K9XA 2ZDRA 3AIVA 3XINA 3CPUA 4H7CA 3NGFA 4F8XA 1HF6A 1A3WA 5IBXA 4F0MA 2WMJA 1W5QA 1YIXA 5C2XA 1LROA 5U7SA 3VNMA 8TIMA 2BX7A 3G24A 3LQGA 5G5IA 5JBFA 4LT9A 4LX4A 4WY0F 3PS7A 1KM3A 3QPEA 3RMEA 1DYSA 1BKHA 3A4AA 1WDQA 2Q8LA 3KVMA 3RLGA 1XLJA 1DE6A 2J7BA 2Z27A 1SR9A 8XIMA 1O1ZA 2CLLA 5DFAA 5FSDC 1W0MA 4MB5A 1FCUA 3R8HA 1XLLA 1CIUA 1YXYA 2OB3A 3BLIA 4NSBA 4IGSA 4U2ZA 1E72M 1KM0A 2ZX5A 4NYUA 3CZLA 2VEFA 4JFUA 1F7BA 4LB3A 2BY0A 2W9MA 3PTDA 2WPGA 1VFTA 2WC7A 3CLMA 1L2UA 2QJMA 3O0FA 3UA4A 1TV8A 2VX7A 1J0JA 4WHBA 2P5NA 3M7SA 5FEXA 5LIYX 4XBJA 3DXIA 3WBEA 3K8LA 1FCBA 2XFRA 3TJIA 1D9EA 1LOSA 4F0RA 5A6SA 4FXJA 1XIBA 2V5JA 3W74A 3SADA 4CGTA 1GPWA 3I7RA 2GJPA 3T0AA 3VKDA 2GWGA 5D32A 1PKYA 3UZJA 1JDCA 2PC4A 2D2JA 1W1PA 4ACYA 4DNMA 2XM1A 5LYRA 3BMXA 1MI3A 1REQA 4JHMA 5REQB 2HISA 3OO2A 3RAOA 4GIAA 5J5RA 4PR4A 3W83A 1MUCA 1JYNA 3GDRA 3MA8A 4AWUA 4PCSA 1NQ6A 4C1NB 1H51A 1FWEC 3SUUA 4KCTA 1JVNA 1M68A 3FHAA 4MNLA 2PTWA 3B9EA 3AXMA 1E4NA 4PTMA 1FTXA 2E0PA 3GBEA 4NNAA 4I7VA 3P81A 3C2OA 3VIGA 1QHOA 3U5YA 5AFDA 3TV8A 1Z32X 3FOKA 2B7PA 2VCCA 1XBYA 5JXQA 3HPXA 2WQDA 2WVVA 4LEFA 4YMZA 3UGRA 4CN1A 1E1CA 5G4WA 4HA0A 3KUMA 1WA3A 5DO8A 4FIRA 5JH2A 3KBVA 4HA4A 5L6UA 2X8RA 3R89A 1OB0A 1W3JA 2TODA 4UQAA 1UWAA 2PLMA 1V6WA 5HNUA 3RCNA 5E93A 4LPCA 3EDDA 4YHEA 3WX7A 9CGTA 2OWCA 5I23A 1WKEA 4F0HA 3VINA 2JQXA 4DJDD 3WUEA 2J9XA 1PIIA 3CGTA 4P8UA 3B8IA 3TTOA 5FJPA 4FMVA 2EPOA 3GFXA 3EB2A 3LM7A 5E1QA 1AQFA 3MMWA 2VRKA 2RJHA 2Z1VA 4FP1A 2WVVB 2ZRYA 1U1JA 2E9MA 3A5FA 5LSMA 3WQDA 3S9YA 1ITXA 1GVRA 3CB8A 3O2LA 5FJRA 4JIQA 5CH9A 1FHUA 4NNBA 1V3HA 1XFCA 4KFPA 4GYFA 2ZWYA 1VFFA 3SGUA 3DFQA 1J8VA 1QWKA 2FZ9A 2V2HA 1UROA 1HL2A 4LUTA 3GVWA 2E09A 1W32A 4FX8A 1XG3A 1AZ2A 1PXGA 1H2JA 3HGJA 3VM5A 1X1OA 4LBRA 1KTCA 2WOQA 4AVFA 2C8NA 4IWWA 4JXCA 4ZFMA 1XFBA 1JCYA 3P67A 3KTCA 3WEMA 1BVZA 2VEKA 1B9ZA 4HNVA 1JD9A 3DKLA 4R33A 2J8GA 4Q4OA 3AO0A 3WKZA 4C6DA 3FHQA 3GAYA 1EL3A 4AWEA 4HMNA 1PKMA 3A13A 2KX9A 3PUDA 3MY9A 3UD6A 1EIXA 2GK1A 4RZBA 2P76A 3BOXA 1UD3A 2CBVA 3RJYA 3BW2A 3DAQA 2YZRA 3BAJA 3PK7A 5A6MA 2DUXA 3LPGA 1UH3A 5T26A 2F38A 1B30A 3N14A 1GK8A 3DGBA 2PTZA 3RXZA 1IEXA 2O92A 3QOKA 4QM1A 3UR2A 2IKJA 3CK5A 4W93A 3VO0A 1R87A 2WVUA 3XIMA 4HPGA 4FX6M 1EEPA 3ZOAA 4N9EA 2PDQA 3JRKA 3R43A 4UFMA 3C2RA 3CL8A 4QDWA 4AD4A 4GIEA 3AROA 3BLKA 3CHCA 3AYTA 1AL7A 2F6KA 3N04A 1ZCCA 3TIMA 2PDWA 4P8VA 1IIGA 4BF7A 3V16A 3VD4A 4IOTA 2V5KA 1PX8A 2BVWA 1R8LA 1TR9A 3IAQA 4GD0A 2VJXA 5LIWX 1C29A 5DRCA 4Q4KA 3RGTA 1FHVA 2PDMA 3CHFA 3PFMA 1H1YA 4M3PA 1XBVA 3ZM8A 1U33A 3SR7A 5FAGA 1Q5MA 2Y8VA 3CWNA 4XISA 4IJBA 1QI4A 4GQRA 4XAZA 2ZFAA 1F07A 2Y6ZA 1YNPA 3QHNA 4QQ3A 2IQDA 4AYGA 4KEZA 1I75A 4TOQA 1EZ2A 2G3JA 2BZNA 3PG8A 1VFMA 4V33A 1RV8A 1VCVA 4L1WA 3IIPA 3LN3A 3N13A 4FR1A 4XZWA 3PPFA 1JF6A 3VYLA 4UQDA 1IWPA 1JUKA 3PZQA 3QHOA 1VR6A 1FCVA 1M65A 4HSHA 1KCXA 3NOEA 2VWSA 1SW0A 2VZUA 2E8YA 1QW8A 1UH4A 2QR6A 4OUIA 5F4SA 1S46A 3SY1A 4QJ5B 3F2CA 4GVIA 3EB4A 3EOOA 3SCUA 5KINA 4DYEA 4JYFA 3T42A 3BLOA 3C4UA 4IMDA 2P1FA 1RQHA 1Z6KA 1ZQ5A 4AZCB 5C9WA 2I16A 3NDOA 4UTTA 3BARA 4PUJA 3SBFA 1BFNA 1JXKA 3W1RA 1EJ7L 1YYAA 2VWTA 3DFYA 1VHCA 2WMHA 3K4WA 2KAUC 5G4HC 3CZKA 1PSCA 3ECQA 2XSBA 1BTCA 2PLJA 4LY8A 4XBSA 2ZKMX 4B5NA 3ZVIA 2J6VA 1VEOA 4C6QA 3GY1A 2XUCA 4HNNA 4LV4A 5A6JA 3NDZA 1K1DA 1QPNA 2QDDA 5BMXA 3ZLGA 5DXXA 1VEMA 2GSJA 1FA2A 1ZBCA 1R47A 3KRBA 4PGLA 1SM9A 4JPGA 3P82A 2J77A 3WD4A 2DZAA 3G1RA 4Q7BA 1LF1A 3GNOA 1I8JA 3C5QA 1EXPA 2OX4A 2HJPA 3TYDA 1GZGA 4IMCA 1GW9A 2YDQA 1DEDA 3EMZA 3GVVA 3E74A 2NSOA 3BAXA 3G2GA 1AZ1A 3OA3A 3TJ4A 4L80A 4OJYA 4KCUA 4HK6A 1SJAA 3LSBA 1GTHA 3B0XA 4LUIA 3VIHA 3MI2A 3OODA 3WK1A 2ZUTA 3R0KA 4LBUA 3ZO9A 1PX4A 1C8YA 3GBDA 4HCDA 2QUNA 3B04A 5I3IA 1I2NA 2XZ7A 3K13A 4QR6A 1SZRA 3EYPA 2X42A 2C79A 4I9AA 4EWJA 3FN9A 2I9UA 1NSJA 1H4PA 1VYSX 1QXLA 5ABHA 4Z17A 1F2JA 5GVJA 2QJGA 2Z1XA 3RO8A 3UPMA 3R12A 1J11A 4DEFA 2O7SA 1LLOA 2Z25A 4LUSA 3N3TA 3H7RA 5DF0A 4GYKA 4AD1A 3IUDA 3BAIA 3S9IA 3BSMA 5I3GA 1BLIA 4J9JA 4QDMA 3OEXA 3G6LA 4HSNA 4QJ1A 5JU6A 1QPRA 4GC4A 2OZ3A 4H2CA 2QUMA 2ZZ4A 2XISA 1H5YA 1OT1A 1K03A 3W85A 1WUEA 4JS3A 4XD3A 3W37A 1OZMA 4IL2A 1A5KC 4UBPC 1UPPA 4Y9PA 2VHLA 1OCBA 4MWAD 1V03A 3WLMA 3S0CA 3LXBA 1W3TA 3FGCB 5H8PA 1S5WA 3S47A 3ZJKA 2W6RA 2YW3A 1GHSA 4IFKB 5GPRA 1IXOA 5AC4A 1SYTA 1UASA 1F61A 2B7NA 3LG3A 1ME8A 1DWJM 2KZHA 3BUVA 3AOFA 1AD1A 4HU3A 1VB9A 3OP2A 2GGGA 3HMJG 1JYVA 3NQ2A 5JBDA 4IP7A 5FJIA 2O9PA 1Y5WA 2G3IA 4K3ZA 4IGMA 4QG6A 3WQ4A 2JIWA 2W66A 1ADOA 2ZXAA 3NQDA 3IRSA 4NAFA 3WUGA 1GW1A 2PP0A 5D8ZA 3V3WA 5LA0A 2ZC1A 2WC3A 1XM3A 4OBRA 4ZQCA 4PCNA 4XTDA 3AJXA 3KOXA 1B3WA 4PMYA 4Z1CA 2W27A 5G2HA 3ZXWA 4QEHA 1DE5A 1DKWA 1TWSA 4PBGA 5AC6A 5HUOA 1JFXA 3TFXA 3D6NA 1PBGA 2PRHA 5ABFA 2WV8A 4YS1A 2HVMA 3AXKA 3TFCA 2C1IA 1B54A 2J8FA 2CZEA 2HK0A 2PWEA 5I78A 2YCKX 1U83A 2FJKA 2VR4A 3D47A 1TMHA 4QDPA 2EPKX 1DJHA 2BODX 1M04A 3QQ1A 3CMJA 1JCMP 1LL4A 5GQBA 1KFBA 3PZMA 4S23A 3WLQA 1ISWA 1ONEA 1OWQA 1UQZA 1GQNA 3O15A 1REQB 5REQA 3UJSA 4B15A 3ITGA 2H6RA 1ZJBA 3LCFA 3HJEA 2YDAA 5C7VA 2BLEA 2A3LA 3S6DA 3IIOA 4AD2A 2Y8KA 1PUDA 4XZIA 2PU0A 1JNEA 4D6CA 5E5CA 4IF2A 1EOMA 3DZ1A 1O4UA 3TZNA 3L23A 4R9OA 1WKDA 4DWSB 4HMEA 2JIEA 3TUUA 4MIMA 3MCMA 1U22A 3WQPA 4GZ7A 1UWUA 4JFWA 3OVRA 3LHZA 3GD6A 2XGIA 2I5GA 2XINA 2WMFA 1E6QM 3GTFA 3N17A 4ZO8A 3AS2A 4TXEA 1XLBA 1R0MA 2BG5A 4E2VA 5DCDA 3KVJA 1HJVA 5IDZA 2VCAA 2P53A 4HTBA 3CXOA 4LF1A 4KBXA 4DI9A 4YU1A 3CJPA 4ZBCA 3FA5A 2CLIA 4DWSA 4DPQA 1YDVA 3S8HA 4H6RA 3T8LA 3MHUA 4HA1A 4TTGA 1UW9A 2DW7A 3UYIA 4CD5A 3QR1A 3VILA 3CV6A 4MGGA 4LYPA 3OHMB 4MOZA 5DMNA 4XSMA 3E96A 3TYCA 3WZ0E 1VPYA 2D0HA 4D1IA 2AQVA 1JUEA 1JL8A 4PSRA 3SRFA 3LBOA 3POCA 3TAOA 4NQ1A 2ZX6A 1AJ2A 5BXRA 3WLRA 2QDEA 2CLHA 4LVGA 4QEEA 1HQTA 5JH1A 4LSBA 4LUTB 1ZAJA 3VIJA 5I3DA 3NG3A 4CQCA 7TIMA 3ERPA 1LG2A 1RA5A 1SQ7A 4P7QA 5HNRA 4QE4A 2VZSA 5HANA 1V02E 4OE7A 1TTIA 1QASA 2AMXA 1PKLA 4H41A 2GJXA 3RX3A 4UTWA 1K8ZA 1I4NA 4WK9A 3EXRA 3T44A 2F9RA 2ZA1A 3PTMA 1W9XA 2DVXA 3A4JA 2VUYA 3I10A 3VIPA 3QGKC 4O57A 1H63A 2V30A 2Y7GA 3VOJA 2G3MA 2NZLA 2B81A 1EB3A 1KCLA 3ZT5A 4QQUA 1X1ZA 4Q33A 1FWJC 4P7NA 1JZ2A 2I9EA 1CB2A 4ZXLA 1SFJA 4I9MA 5DBTA 4HZ8A 3BCFA 3PNZA 1LCOA 4DO7A 4E8DA 4GVGA 2WSPA 4FLSA 3U6WA 2WKGA 5A6BD 1I1XA 3SN1A 3LBMA 3QXBA 2GQAA 2Z7KA 4XD5A 3M0HA 3LLXA 3KBMA 5HWNA 3F7JA 3UP8A 3E6EA 5AECA 2DPEA 1JXJA 1OSEA 3P61A 3W26A 4Q4SA 1E15A 5D9NA 4FLOA 4YN5A 3N2BA 3BURA 1TE1A 3N4AA 4N4QA 1OG6A 7XIMA 4AZGA 1OQFA 1SO3A 1JGMA 5FACA 3FV9A 4P8XA 3TQVA 2E1DA 1IR2A 4BHYA 4LB4A 5EMMA 3VPLA 4FLQA 3MI6A 3ONCA 4RJEA 2G8ZA 1CBGA 2DH2A 4LS1A 1LRNA 5E09A 3QMSA 4GI4A 4JTEA 2WWCA 3IK2A 3ONBA 1TJPA 4A05A 2CHNA 1QK2A 1KFLA 1UKTA 2CXGA 3MWAA 1Z41A 1ZJHA 3FDKA 5IDIA 4PMUA 4NZ5A 1CW2A 3M0KA 4HOZA 1IR1A 1DJYA 4MDOA 4ZVJA 1LYXA 4QNEA 2UBPC 4PCFA 3T78A 1ZB5A 4ZE4A 1LRQA 1TMLA 1F4HA 3N18A 1H7XA 3TXZA 3VNYA 1MWOA 4PRWA 1WZKA 5A3HA 3EEGA 1OC5A 4OOUA 2BDQA 1U5VA 2A7NA 3ANVA 2WLYA 2OXNA 4ZENA 3W86A 4EXAA 3NZRA 1Q65A 3FKKA 2FJUB 1XLFA 3W4RA 3V18A 2PWHA 4MJZA 3TWBA 1SO4A 3UG8A 3GDKA 5ABEA 3C2EA 3TWAA 1XIJA 3DBNA 1Y5VA 4ZXOA 1R85A 4CCCA 3LERA 5F2LA 3BOLA 5CJMA 4WDXA 3EWUA 4XZHA 3RPTA 3EX6A 3WYZA 1BYAA 2GVGA 3EXTA 2BNJA 1CEOA 1ME9A 3LGDA 2PDJA 4XZLX 2PWFA 4TMCA 2VKZG 3CYVA 4S3DA 2AKMA 2AQOA 3T40A 1ESWA 1GVIA 2NUWA 4UMBA 1WDRA 1TVLA 3OPSA 4CQAA 3EWBX 4MUPA 3KRZA 3GIPA 3OQEA 1YE6A 2J78A 1A5CA 4M1RA 1F73A 4JDYA 2YYUA 3WF1A 1QUMA 4PFHA 1V6VA 1M41A 4QROA 3B8UA 4D6DA 3GC2A 5BU9A 3GZ3A 1K7EA 4JQAA 1PX3A 3RM9A 1RVKA 5CPNA 2QAFA 3DFHA 2ZUUA 4BF9A 3BJFA 3N2TA 2O7QA 2W0UA 2YA2A 3NL2A 2EF9A 4JHOA 1KV8A 1BF6A 3R5EA 3W71A 1J5SA 3VNJA 3M0MA 4GXMA 3E0LA 1JPKA 2BBFA 3C8FA 2OWWA 3A4XA 1BWVA 1H7WA 4IPPA 4B5VA 1K77A 4QCFA 1VPQA 4BJHA 3PULA 2HS8A 2ZE3A 1UZ1A 3TNOA 1XLAA 2A0NA 2ZX9A 3T0CA 5D30A 4WOQA 1WYIA 1JULA 3RLVA 1JRCA 4JTQA 4N42A 1K9EA 3WUBA 1MYRA 1OFAA 3KCLA 3SUWA 1CLXA 2XH7A 2BHZA 3M46A 3W1UA 3LHUA 3W2JA 4JTDA 3FYOA 4UQBA 2HK1A 4C6NA 7A3HA 1KR1A 4PH6A 3DFTA 3R25A 2A5HA 4WR3A 4DWSD 4IFKA 3TQKA 1JAKA 1UHVA 3I4KA 1XICA 2PDXA 1MW2A 1W9PA 2O4QA 4BCEA 5I0DA 3I65A 3PPGA 1D7KA 3DYPA 4XK2A 3VM7A 3OLDA 5EMJA 2REQB 4MKNA 4UZSA 1F3EA 1W5PA 1KR0A 2VDGA 4Q8VA 1S2UA 2ZZ6A 1DVJA 1OX4B 3AI0A 3NJ3A 3WDHA 2ESCA 4WDTA 1QNVA 3AIUA 4JTGA 2CBJA 3E02A 4QLJA 4CD8A 4B3LA 1VFUA 4W86A 5I00A 1K6AA 1PIGA 3G77A 4JD4A 3FCPA 5AYYA 1P5BA 4HN4A 3LSCA 1GVSA 2I56A 3HQOA 1Q6RA 1OD8A 1XIGA 1B57A 2XSAA 4GQ0A 1POJA 3BJTA 5TNVA 5C71A 1DIEA 4IPLA 2A6NA 1LDCA 2DEPA 1TPVA 3R4IA 5M2FX 2QGYA 1JQVA 4EXBA 3VNDA 4XB3A 3K1DA 4AMCA 2FMNA 4O14A 1O7AA 4C5ZA 3TDFA 1UMLA 2X1IA 1U5HA 2ATSA 1NFBA 3FX4A 2HZGA 4HKPA 3ME3A 2QGHA 4V1XA 4GUHA 2PGWA 2F84A 1YE4A 4EF8A 2B4GA 3VNZA 3PPCA 5CC5A 5CSSA 1MEIA 1TTQA 2IXVA 7REQB 5ABFB 3A5VA 1H61A 2PCEA 3FVDA 2H3BA 4MY8A 1GHRA 2GPTA 5E0FA 2D2OA 4D8AA 5FEZA 1L2QA 4GYJA 1FUYA 4PTNA 3CO4A 2PP3A 3KOYA 1KO0A 4PB5A 4MG4A 3H54A 3WLJA 3SUVA 3CUZA 3VE9A 1H7OA 3DHPA 2J27A 2CLMA 4TX8A 4LVFA 4ROQA 4L4PA 3TH6A 3N2MA 6XIAA 2D1ZA 3QW4B 1NDYA 1WB0A 2Y7DA 3RN6A 2WHLA 3NEHA 4L4MA 1FWAC 5CG7A 1E0UA 4ASTA 3HQPA 1RA0A 4RW5A 2VR2A 1M03A 5FF2A 3VNKA 3OZPA 4ZQPA 5FAJA 3LLDA 2JFEX 4P7LA 1FWNA 4A21A 3HBLA 1XLHA 4Q22A 3UR7A 2VOTA 4GBDA 2JEQA 2YCJA 4RXFA 3V0UA 1G9HA 4FIQA 4MJMA 4GQGA 5EGRA 1XCFA 4Z1AA 5CGQA 4AZHA 1KLZA 4IJCA 4ECLA 2HXTA 5AC7A 3WQEA 2ZRUA 3Q45A 4XKYA 1UJPA 1W1YA 4K8GA 3P74A 1FXPA 4LTSA 4JCLA 3WMLA 1TWIA 1SFSA 2GGHA 4X2PA 4NZCA 3GLCA 1EDTA 4FB7A 4CQ9A 1OFOA 2IQ0A 3L4UA 4XD4A 1WNOA 1BYCA 2EJAA 3LHWA 1L6GA 4W4QA 3OQ8A 4S3EA 2BSLA 3VGEA 3EOEA 5B7ZA 1Q4NX 2BGNE 3BG3A 3AFBA 3WSUA 3MO7A 1JYXA 1X96A 1O68A 1B4KA 2GLKA 3CUGA 1NELA 1T40A 3AMGA 3V7PA 2V3GA 3VIFA 1F4AA 3H2CA 5C9UA 1DPMA 4US5A 4OIFA 4Y9MA 4QP0A 3DG6A 1E71M 1CXLA 4M1BA 4A22A 4UTLA 3EDKA 4MZ8A 3V5FA 2YKKA 4LGXA 5F2MA 2XJ7A 4PODA 4REQA 4ZL1A 4PBEA 5KETA 3C0QA 3AALA 3VKKA 3UZYA 3OIHA 3OGRA 2QJHA 2YGYA 3TC6A 4CD6A 2HNEA 3GDMA 4KETA 2V81A 4RX0A 1TQXA 5BROA 1XLCA 1KD0A 5L9FA 3VIIA 4C6EA 2CXEA 2JGYA 3WEOA 2TSYA 4D71A 2BXVA 5FJUA 2ACUA 2ZZ5A 3BC9A 4POCA 2OR2A 2QEZA 1QDSA 3GH5A 4G1NA 4JIIX 1EDQA 4HYWA 2NT0A 1V4YA 3MZ2A 5C70A 5MHBA 4Y9NA 3SFWA 1N8WA 4IH3A 1O5KA 4AC1X 4J28A 2GQ3A 3L4XA 4S39A 4S3CA 3VOIA 3S9ZA 4LNYA 3AYRA 2QPXA 4Q3MA 3VI2A 1B2YA 5F1UA 3LCLA 3PUGA 3L9CA 1XLDA 3P5ZA 2NWRA 1PV8A 4XTIA 4MLJA 3TOYA 1Q6DA 3CUXA 1MRAA 2DT2A 3WJYA 4Q4RA 1PYMA 1C3FA 1VYPX 4QE5A 1WDWA 5JQ9A 3BLFA 3AIBA 1W3NA 3WDIA 3SUTA 1JCTA 3EOLA 1M6JA 3G0XA 3PB0A 1MO0A 5IHRA 4G8TA 4O11A 4U3AA 1HTIA 3UNTA 3B3DA 4IFOA 5CSRA 4YVVA 3FDGA 4CQDA 5CPQA 4HP5A 3VIKA 3O05A 3TMLA 2WXDM 2H8XA 5EBUA 3FGCA 3C86A 1XPGA 2OQYA 3V35A 4O1AA 1CWYA 5HMFA 1EO7A 2W61A 4K37A 1CXHA 3ARWA 1TIMA 1QAPA 2ZX7A 2DZVA 4Q8TA 3GXMA 2C13A 3OOQA 4J2PA 1WCGA 1TELA 2MNRA 5CG0A 2PWVA 3GE7A 3AS3A 3OW1A 3MSRA 5HPOA 2QCDA 4D6IA 1GWJA 5BOOA 5CPTA 3QSRA 4MF4A 2VR5A 4AQLA 4AYSA 3U4FA 2Z2UA 3NL5A 4NXSA 2P0IA 3HGRA 3CZJA 4HNUA 1FWIC 4JYEA 3GHSA 4LH8A 3GQYA 1H0GA 4LC6A 4MWAE 4JFSA 4ZSUA 3HZ3A 4EPBC 4BF5A 3FXYA 1B1YA 3PBMA 4MY9A 1JPMA 1C8VA 4DIAA 4TO8A 2XH4A 4GX8A 3WDQA 1CLVA 1RZMA 2BP1A 3FY1A 3UF9A 3FYPA 3AU6A 3WLTA 5K2ZA 5E9AA 5KITA 1DJQA 1YADA 1AG1O 5EFDA 1IE7C 3SQMA 1EX5A 2D23A 4ZCWA 2WO5A 2OLSA 2PLKA 4DO5A 3UWUA 3AQUA 4DBEA 1GGOA 4AZCA 4CNTA 3ZR6A 3EA1A 4YWIA 3EGJA 4QJ4B 1QHZA 1HO1A 3I6EA 3AIEA 1U1UA 1XXXA 3PTKA 3V0SA 2ZDSA 4O50A 5HQEA 4BQ3A 2VC6A 3O07A 3TKFA 3RO6A 4NZ3A 1ZUAX 4N0RA 4B3KA 2PDKA 2ACSA 1H11A 4OOZA 2CC0A 2VX6A 1UMYA 3MV11 3RRXA 3TN6A 1O66A 1GVFA 2Y24A 4EOUA 4W85A 4RDZA 1FY6A 1VFOA 3A9BA 3CAKA 1MXSA 2XIOA 3DYMA 3W7OA 4B3ZA 3NQ8A 5EKYA 1FDYA 3N1AA 4WZHA 1VFSA 3BVJA 3BZJA 3CHDA 3R58A 3MTWA 3TQPA 4N9CA 3E0FA 1P0KA 2EEXA 3DCPA 1HZYA 3A9IA 2XVPA 4AZIA 2WMIA 4B5TA 1FWCC 4HQVA 2JEPA 3WMBA 4IMEA 3STPA 4L64A 4M6UA 3ZFHA 2FGBA 5AHIA 3LXAA 4H9VA 1TWDA 4F40A 1OEPA 1EGMA 3RYSA 1X38A 3HPAA 3UYCA 1G1YA 6XIMA 4MB1A 3ARYA 5TAOA 3CUJA 1H3GA 2QLYA 3MUCA 5FF3A 5D38A 3N9KA 4WY0A 6CGTA 1TTPA 3S1WA 1GVEA 2GZXA 3URBA 1P1XA 4JL2A 1BGAA 3AZTA 1WZAA 2NQJA 4XUGA 1ICQA 3O6AA 4MMWA 4OT7A 8A3HA 1ZRQA 1FOBA 2OG9A 4RW3A 4HU4A 2R82A 1AMKA 1S3TC 2QCNA 1XYCA 4I5RA 1OY0A 1YHTA 4E0CA 1PCWA 1VC4A 2QUVA 3UVAA 1XBZA 1B90A 3E2QA 3AC0A 1AVAA 1BSIA 5EMYA 1RLDA 5I03A 3OB8A 4S38A 1RPXA 1ZBWA 1XRSA 3L4VA 1VJSA 2Y7EA 4W84A 4JNYA 3CLWA 3O8AA 4GGHA 3AHTA 3IGSA 3GM8A 4RZ6A 3G8EA 3CNYA 3MQTA 3H53A 4AZ7A 4PCPA 2WCAA 5LNUA 5A8NA 1TMQA 1ODZA 2FHCA 3TCSA 1KB3A 2HEJA 1Q45A 5FF0A 2QS8A 1AMYA 1A5MC 3GH4A 1F6KA 1KCZA