1F74A

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
293
structure length
293
Chain Sequence
b'MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL-NEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 125
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f74A00
4O4VA 5F2MA 3BW3A 3LTPA 1TYGA 3NL5A 3NQAA 1NSJA 2DZPA 1DKWA 1OFDA 1UASA 1THFD 1XBYA 5I3KA 5AC7A 5FF0A 3B0VC 1XFBA 3L9CA 1J2WA 3TUUA 3ANYA 4ORIA 4CCCA 1GZGA 5DELA 4MZ1A 5A8GA 2RFGA 1F7BA 2TMDA 1H50A 5F4WA 3HPSA 3LLDA 3W73A 1VCGA 3FKRA 2BTMA 1FDJA 2Y7FA 4G1KA 1JRBA 1L6SA 1R30A 1ICPA 1LBFA 3W7LA 1A5SA 3W71A 4MKNA 2YSWA 3DFSA 3KOFA 2RDWA 1MEIA 3L0KA 5BRBA 2J9YA 5U4NA 1KV8A 3G0SA 3O6YX 1QPRA 2FPVA 3BLIA 5KSWA 1QOQA 1KTBA 3EKLA 4Y9AA 4DO6A 5LNUA 1F6KA 1KV5A 3IGUA 3NQGA 5DXYA 3GVGA 1LROA 4HKPA 1B4KA 1XXXA 1P5BA 3NQMA 2EF9A 3ZR4A 3H53A 2WOQA 1H7XA 4IMEA 3O15A 4KFOA 3W7NA 1QAPA 1ZFJA 2ZRWA 5AHEA 4AVFA 1VR6A 2NXHA 2DZVA 3NG3A 1TRIA 3NGJA 4Y8FA 3RNDA 3LCFA 2W6RA 1EX5A 1A5CA 1JCLA 3K30A 3F1QA 3W7CA 1K3UA 4CLMA 4FEZA 4ADUA 1GEQA 3T44A 5HMSA 1VYPX 1LDCA 4O1BA 3TR2A 3SI9A 4UUIA 5FEZA 4NX0A 1XUUA 1SO4A 4WUIA 4FO4A 1M7OA 2X30A 1WOBA 3LXAA 4YLWA 4UTKA 3PULA 4WQ6A 2Y7DA 4AF0B 3DHDA 3W7EA 4Y90A 5HULA 2R8WA 4DEFA 2H8ZA 3LM7A 2Y88A 1AW1A 3QQ0A 1FCUA 4WJEA 4OU1A 1T0OA 1TJPA 1LRQA 3WJYA 5FEPA 1G4TA 2F84A 1KBJA 3IIVA 4HPXA 1DBTA 4WY0A 1H7NA 1G69A 5I3GA 1TPC1 4NJHA 4YMZA 1JUBA 1LBLA 3TSDA 1OX6A 3YPIA 1XBXA 1NEYA 1H61A 3TSBA 1ZENA 3FLUA 3GNNA 1O4UA 5D09A 3C56A 4ZMGA 1O5KA 3A22A 1VLIA 2ZA1A 3STFA 3LLFA 2V2CA 5D2YA 2C1HA 4U28A 5AHFA 1K8XA 1GG0A 4XKYB 4UTMA 1J4EA 2GOUA 4AXKA 3HGSA 4O14A 3MP4A 5AHNA 1NF0A 1UJPA 3TJLA 1VJIA 5T26A 1B57A 4HNVA 1TO3A 3JS3A 5K9DA 1Z42A 2V8ZA 4JX4A 3N2XA 3TU9A 4TO8A 3QM3A 5KTLA 1CX9A 1TPDA 3PB0A 1P1XA 4ADTA 4E0CA 1KW1A 3MJYA 2ZRVA 3BW2A 2JKPA 5EL1A 3O06A 4WX2A 3R2GA 4N4PA 3L0GA 3EX1A 3V1PA 2BZNA 3H55A 4ZQCA 3GKAA 1JCYA 3CEPA 4JS3A 3AJXA 3GLCA 3VKJA 4EWND 3C4UA 3EWBX 4K7YA 3EXSA 3BPWA 5J5DA 4JTGA 1W37A 3M9YA 2XFWA 2QDGA 1D9EA 1OYAA 3RK8A 3B03A 1RVGA 2VENA 1UB3A 4YL2A 3GAYA 3F4WA 4MOZA 2E6AA 1F2JA 4O50A 3C2EA 2WKJA 1GVFA 2A1YA 3EX3A 2E6FA 5E1QA 4QAIA 4IMCA 2AAMA 5K2ZA 4JTSA 2ZZ2A 4N02A 3W7KA 3QEZA 3TC7A 3QQ1A 4FNPA 3BG9A 5HWMA 3PBUA 1XDLA 2GQ9A 2B4GA 2ZZ4A 1M5WA 1WBJA 1LOQA 3B04A 1SZEA 1SU5A 3WJZA 2NUXA 4TX9A 5AHLA 5CGQA 3KAOA 1OVDA 2QCDB 4JX6A 4M19A 4IXXA 1FWSA 5LHEA 1KM1A 2NXGA 4JTTA 5BMXA 4WOQA 3NVTA 1EP1A 2HS6A 3MUXA 2NX9A 4BI7A 3L5AA 3DAQA 3E96A 1YPFA 3W7RA 4NZFA 3I65A 5FEWA 4ML9A 4XBSA 1NFBA 1JCNA 1P0NA 2A7RA 4YXGA 1KFBA 3QW4B 3M43A 4I9AA 3TDFA 3MW7A 5HWJA 2V5LA 2G97A 3DH7A 3W1PA 2O7SA 1G6CA 5KZDA 3RU6A 1P4CA 2WNQA 6TIMA 2Y89A 2YW4A 3LXCA 1OF8A 2ZA2A 2RKXA 4ADSA 2NWSA 1T96A 3IIZA 4S2CA 4I7UA 4EIVA 3HG3A 3GXNA 1H7OA 2WV8A 3TAOA 4LS0A 3ABRA 2ATSA 3GXTA 1PV8A 3TKFA 3FJLA 3N73A 1W3TA 4NXKA 3QSTA 1EP2A 3P8IA 2VFEA 4LVGA 5GVJA 1YTEA 2FQIA 2CZDA 3WFAA 4HSNA 4RK8A 2Y63A 2YYUA 2H3DA 4A2RA 3BGJA 2CLLA 3KRSA 4DPPA 2WQPA 2QEZA 1WX0A 1H5YA 4BWLC 3H54A 4ZQOA 3O07A 4PFMA 1I45A 2QJGA 3W7PA 1W1ZA 2QKFA 4AHOA 3MYPA 3PBWA 1VC4A 3M7WA 2Y70A 1B9BA 4X22A 1BTMA 4JICA 3NEVA 3NQEA 1RQBA 2WNZA 5FF2A 1R2RA 1WV2A 5LHFA 4GUHA 5FF4A 3P82A 1TB3A 4ZQNA 4OWGA 3PY2A 4FF7A 5D2TA 5CSRA 3TXZA 1JCJA 1N7KA 3TW7A 4YCPA 3P7YA 5FI8A 4IPIA 3LHYA 4LV9A 2OJPA 1XBZA 4O1CA 3D0CA 4C1KA 2ZYFA 3OVQA 3MP3A 4AWTA 2Y7GA 1QCWA 5EKYA 3TCEA 1KM2A 5EMUA 2V2HA 2NX3A 4CNNA 4L4MA 5D33A 1KM5A 3CWOX 3W74A 3P62A 2G96A 3VNDA 3CM4A 1MEWA 3W07A 3W1MA 4AWUA 1YTKA 1XKYA 3OEXA 1U5JA 5LNWA 1Q3NA 3NOEA 4BF9A 3VCRA 3LBMA 2A85A 4Z0JA 1YDNA 3TMLA 2A5HA 2QCEA 4QSHA 2ZZ7A 3LHTA 1JQVA 2WNNA 3ZS4A 2VFDA 3B4UA 3NQ8A 1ZNNA 4LC8A 3RMJA 1L9WA 2GVGA 3TK7A 3HO8A 4LC6A 3P5ZA 1TPUA 5CPNA 2W79A 1Z44A 4MYXA 1RR2A 4LNYA 3G1XA 2J27A 1FX6A 4KFNA 3BLEA 3TA6A 4OBTA 2Q3RA 1EPXA 2YCEA 3G1DA 3CTLA 1A50A 3T78A 4Z1CA 3LCWA 2RDTA 3R13A 1YADA 4QJ1A 1PCWA 4IMGA 4KFPA 1TV8A 2J24A 1SFJA 3LRLA 3HOJA 3W7HA 3A5FA 2QDHA 2BSLA 4M7SA 3T40A 4K7VA 3MWAA 5HJLA 5KZEA 1YXCA 2TPSA 1FY6A 2V82A 3IIPA 3TMQA 3G8RA 2X1RA 3KX6A 3DU0A 3B0PA 2B7OA 4NX5A 4ZQRA 4NXSA 3BV4A 2E77A 1G7UA 1G7VA 2VOMA 3NA8A 4LOCA 3OA3A 1HO4A 1UUOA 3E49A 2VEMA 4RZ4A 1FXQA 4RZ6A 4FX6M 1O5XA 5A5WA 4UIOA 4ICNA 4M6QA 4IUOA 1KM4A 4O10A 4TMBA 1GJPA 3UY8A 3W1NA 4NT0A 3G1YA 2CU0A 1IGSA 2FLIA 4TR9A 4BWLA 1W3IA 3L5MA 3S5ZA 1L2UA 3UQNA 3KRZA 1TTIA 3LCGA 4LUJA 3THQA 4S2BA 3SY5A 1YXDA 2QCNA 3SGZA 2JK2A 4OV4A 3S0CA 4O19A 2A6NA 2E6YA 4XZ9A 4H6KA 1IXPA 3G1SA 3KHJA 3GDRA 4JIPA 5LGZA 1NF7A 3R89A 3SECA 1E51A 1RV8A 4KWVA 5AC8A 2Z1BA 1Z41A 5DN1A 5DCEA 5D2WA 3IIXA 1BWKA 2G95A 2CZFA 3PAJA 2BX7A 1QR7A 2B0MA 3TROA 1A53A 1W0MA 3G1VA 3GNDA 1I2QA 1TSIA 3T7VA 2X1TA 4LW7A 2IQTA 2HSAA 1NAL1 2AGKA 1FBAA 3S1VA 3QMSA 3MO7A 5HWNA 4N6FA 3MMTA 5DY3A 2F7FA 4LRSA 4OHQA 3W88A 1VH7A 1OFBA 1TCDA 3CC1A 4O1AA 1QOPA 1TPEA 4EF8A 3ZWTA 3Q37A 3LHWA 5LNSA 3W1RA 3P80A 2ISVA 3C0JA 1GTHA 3PR2A 1BWLA 1LM1A 2WPBA 3S9YA 2VELA 4IX0A 4UFMA 3GIYA 3R12A 3I7RA 3W22A 1TV7A 2ZDRA 5F4SA 2CLIA 3HJZA 2ABBA 4RZ5A 4NVTA 2TRSA 4MPQA 1QDSA 4MVAA 1X7FA 3VFLA 4W9TA 4AF0A 3CIWA 2YPIA 2KZHA 2TYSA 3GDKA 3O6CA 5BOOA 4N9CA 3A9IA 5HUPA 5D37A 3TW6A 1ZCOA 4JIQA 4A2SA 1FCBA 2C3ZA 4ONVA 3BO9A 5TQLA 4JTIA 4O52A 1W8SA 4O53A 3HG2A 4Z1BA 1GT8A 1YLVA 3EB2A 4CNPA 4MZ8A 1JVNA 3MYOA 3UWWA 3GDTA 2J9XA 4O57A 3VI2A 1FCQA 2ZQ0A 2GUUA 3SZ8A 5HR6A 2V5BA 2FPTA 5CZSA 3FA5A 1O60A 5I3IA 2ZRUA 3W70A 1TPWA 2VFHA 4X9SA 3TQVA 3LV5A 3DXIA 4P2VA 3DI0A 1TPH1 4BK9A 1H7WA 1UCWA 3PUOA 4RV8A 1RQHA 2GVLA 1FCVA 3STEA 2C15A 3CQ0A 5TBOA 4GFSA 4XBKA 3W1LA 1I2NA 1SSGA 2CLKA 5G4EA 4ALDA 4EOUA 5CZ0A 2QJHA 4OGZA 3PG8A 4FX7A 5EYWA 3OG3A 2FPYA 1EWDA 4DQWA 2GVJA 3W1TA 3RLUA 4PA8A 4A3UA 4OQVA 3W2NA 3MBDA 5D02A 3BLFA 1ME8A 1S3HA 3TQKA 3NQ7A 2I14A 4M6VA 1I2RA 4MLRA 2PURA 4DXVA 1H63A 4UCGA 3STCA 1KFKA 3RLVA 3CU2A 2J88A 4MZYA 1WBHA 1B4EA 3N34A 3LHUA 3O6DA 3UYCA 1X8FA 3TAKA 4UTHA 4JDYA 2P1FA 3C6CA 3NNTA 4UFIA 3FIGA 4E2BA 1TREA 3C8FA 3S5YA 4UNLA 2Z2UA 1CI1A 1L6YA 1W5OA 1SW0A 4GXMA 4O18A 2C0AA 4IWWA 3B06A 2DZSA 2FFCA 3NL6A 4IJBA 1JUKA 3MHGA 1Q6OA 4PL2A 5SWUA 2ZZ6A 3HPZA 3IV3A 3PC0A 5G2HA 4DBDA 1PHWA 3PS7A 3DFTA 1F6PA 5TIMA 3OHIA 3TX9A 1ALDA 1GWJA 1LBMA 2VEPA 1SW7A 5G2WA 5H2ZA 1WYIA 3LHZA 1LLWA 4O12A 3QF0A 2JKEA 5LNRA 2WJZA 1N8FA 5AB3A 3KXQA 3W7DA 4DO5A 4DF2A 5D03A 1KFJA 5LKYA 4CQ9A 2GPTA 3G0UA 4R7JA 1NVMA 1V5XA 3W7QA 1OJXA 1VS1A 3I6RA 2CLEA 4JGDA 6ALDA 4JR5A 4QM1A 4LS1A 5U7SA 4KKXA 1A5AA 1Q6RA 3NQVA 4WXZA 3ZFHA 3CHVA 2NLIA 3NPWA 4DF0A 3M5VA 2RHGA 3QFEA 4R53A 1VHCA 2WO5A 3O05A 2QUVA 3C52A 1DV7A 2CLHA 4MYAA 1SR9A 4WY0B 2B7PA 2C18A 1A5BA 1IXNA 4AMAA 2I9EA 1ZHAA 1LLZA 3DBPA 2HS8A 4MFDA 3O63A 3T55A 2VFGA 1DJQA 1W5MA 1W5PA 5CZJA 4ORMA 4RCXA 1RD5A 4Z1AA 5G5IA 1W5QA 4TU1A 5I3HA 2A2IA 3EWYA 1Y0EA 2FIQA 3P74A 3UWUA 2FJKA 2OZ0A 3NQCA 5DBTA 2YDAA 3P60A 4XTDA 1SQ7A 3LGEA 5FF7A 4P61A 5LGXA 3EKZA 1YYAA 4UFHA 1ZJIA 3INPA 2R91A 4DBEA 4Q32A 1FWRA 2ISSA 2ZRYA 4BI6A 2H3BA 4ZL1A 4R34A 2VFFA 3GB6A 3T4CA 4NJKA 4A29A 1KA9F 3U2OA 3R8RA 1DJNA 4NUWA 3W72A 4JD4A 3P67A 1TPFA 2QCHA 1YPIA 4QITA 4UC5A 4O13A 2YFNA 4K37A 4JDBA 1SFLA 1H7PA 4MY8A 3W7JA 1XI3A 3STGA 1F74A 1GPWA 4QNWA 5FESA 3DHFA 1WDWA 1OX4A 2ZZ5A 1VCVA 4PL1A 2Z6IA 2JGYA 2ZZ3A 3MHFA 3M5XA 2C13A 1ONRA 5CPLA 1GVOA 2O7QA 1UBSA 4AAJA 5CG7A 4UTWC 3EX2A 1W54A 3GDLA 4M6PA 1F05A 2E1DA 3LERA 5FF3A 2DZUA 4OT7A 4IXHA 1KBIA 4MFEA 3NPXA 3GK0A 2FTPA 4N9EA 1ZAHA 3E9AA 2ZA3A 2EGZA 2YR1A 2Q8ZA 5LZLA 1OG0A 3JRKA 1WQ5A 4NJGA 2CLFA 4UR7A 2NXIA 2VFIA 4LVFA 5F2GA 1FDZA 3BVJA 4Z08A 2RDUA 5ABTA 1XC4A 4E38A 3WJXA 2GQ8A 2XN1A 4K8HA 1YTDA 1W31A 4LVBA 4ZVJA 3W85A 1AL8A 5CSSA 1H51A 4DELA 4X2RA 2J9ZA 1FDYA 1WOAA 3LCLA 2YYTA 4I7VA 2ALDA 3TH6A 1GYNA 1CW2A 3S6DA 2OT1A 3W1XA 3HF3A 1TQJA 3HB9A 3A24A 4RXFA 3W1QA 2QUUA 3EWUA 4GRSA 2Y62A 5DCDA 2EKCA 4WD0A 3M5YA 3B0UX 1TTQA 4JYEA 1IXOA 2C16A 1H60A 2YW3A 3G24A 4UXDA 3QPYA 3M41A 1VQTA 1TJRA 1KLYA 5EBUA 3UWQA 3G1HA 3N14A 1PHQA 4B5NA 3S1WA 1DORA 3PUDA 4RX0A 1UUMA 2P10A 4J9JA 3NPUA 3MP5A 2Y61A 1MO0A 5G4WA 3JR2A 3NXFA 3DFPA 4O8RA 4NNCA 5D38A 4PODA 1OABA 3G3DA 2NX1A 3W75A 4LWWA 4N9DA 1LZOA 1OFAA 3LB0A 3TE9A 2V81A 3GYEA 3O16A 7TIMA 2PRHA 3G1AA 1SZFA 3FEMA 3CEUA 3LI1A 1GVSA 2PC4A 3RFAA 1OFOA 3KVKA 3MI2A 3QYQA 1H1YA 2V0TA 3IIOA 2OCZA 3O1NA 1FQ0A 4GUFA 3TFXA 1VRDA 1D3GA 3BARA 4C1LA 5HR7A 1H7RA 4HIBA 2A6LA 2Y7EA 3BGGA 5DCBA 4A22A 1SO6A 4N2YA 4LY8A 1JCXA 3LRKA 3BG5A 2Q8LA 1IXQA 4MIMA 3LI0A 3L5LA 2D73A 4LU0A 3NQDA 4FNUA 5G1YA 4LRTA 4TIMA 2P0OA 1ZALA 2FDSA 3N2MA 4JYFA 2I1OA 2QR6A 3HGOA 1OFRA 4HNTA 4WXYA 3SFKA 1G4EA 3GKFA 3W6YA 4LUIA 4HSOA 5AN7A 5AHIA 4MUZA 4UTWA 3PSWA 4HT3A 3NQFA 3M1ZA 2GJLA 4EVZA 2WSQA 3F4NA 1HG3A 3TJXA 2X1UA 4QQ3A 2E68A 3SIZA 5AYZA 3LXBA 3KVJA 2ATMA 1LYXA 1XM3A 1Z48A 4IOTA 4JNMA 2C19A 3I7SA 5DLCA 1JR1A 1FXPA 1EEPA 3N9SA 1AG1O 4XQ6A 3LHVA 3IRDA 1Q6QA 3IVSA 4LTSA 3NPVA 5CPOA 3RF9A 1VHNA 1ME9A 4Z0SA 3HGRA 3WJSA 1QNVA 3W7OA 1SUXA 3W3OA 4H4IA 5K4ZA 3NDOA 4QISA 2OX1A 3TV8A 3LOTA 1S5WA 3EEGA 3B05A 2V2DA 5BNKA 1AW2A 1QPQA 2QJIA 4M7TA 4LT9A 3S8HA 3EX6A 4JTUA 1EB3A 3PG9A 1EUAA 2JKAA 1EWEA 4UFLA 5LSMA 3HMJG 3S5NA 4JY9A 1XUZA 3EX4A 4LS2A 1OF6A 3P61A 3UWYA 2VEIA 3PM6A 4JY8A 2NV1A 5IM51 3A23A 3IVTA 1Q6LA 4LVAA 3UNDA 3HBLA 3HIJA 3W7IA 3C2FA 5L6UA 3W2UA 4BFAA 2CWNA 2DP3A 1SO5A 4L4LA 4UR8A 3NM1A 1X1ZA 4UTTC 4GE8A 5D30A 1SO3A 4RJEA 1VPXA 3IGSA 2PRLA 2YZRA 1EIXA 1FWWA 3EXTA 1H62A 1BEUA 4MJMA 3ZWSA 2ZCGA 2B7NA 3VE9A 1QFEA 3A5VA 1O95A 1OFQA 3ABOA 4GUGA 5H91A 3GR7A 4K6AA 4IQLA 3TIMA 3TFCA 3LBCA 3CWNA 3UPWA 3FS2A 4I7WA 3L0NA 1F73A 1VZWA 2QAPA 2XN0A 2Y6ZA 1LORA 1N55A 3E02A 1X1OA 5KINA 2CLOA 1VGAA 3IGXA 5G1TA 2QCCA 3DKLA 4E2DA 3ATYA 3FKKA 3W23A 5LNVA 3W7GA 5CPMA 4GJ1A 2DORA 4WZHA 4HN4A 4UFJA 5K4XA 4M5PA 3N9RA 5AFDA 3I7QA 4GC4A 1L6WA 2NZLA 3Q2DA 2CZEA 1KTNA 1QPNA 3QH2A 1VYRA 4GUIA 4NU7A 4GUJA 4Q33A 1FWTA 4FNTA 2Z6JA 1W3NA 2V30A 2EPHA 4AEOA 2OT0A 4O4WA 4FXRA 4K36A 2TSYA 2WSYA 1Q45A 3DZ1A 1HFBA 1B3OA 1XL9A 2E6DA 4N6EA 4OE7A 1G67A 4UTJA 4LV4A 3SJ3A 4O28A 5C55A 5D04C 1G4PA 1LRTA 1J5TA 4XKYA 1LOLA 3MHUA 3DENA 1R46A 1GQNA 4RR4A 4X3ZA 1EUNA 1OYBA 4K8EA 1T8XA 1JUEA 1T99A 4R33A 1ZAJA 3GDMA 4UMAA 5HQEA 3M16A 1K7FA 2YFOA 2ISWA 4XTIA 3FYOA 4O16A 4JTKA 1X6UA 3THAA 1QO2A 3NYZA 1LOSA 1YXYA 5CZTA 1C8VA 1VYSX 4O17A 3UWVA 3P5YA 4KWWA 1ICQA 5MHBA 3W1UA 4NJIA 4JXCA 4DO4A 3LTSA 1TIMA 1MXSA 3NR0A 1I2OA 2VC6A 3UD6A 4CNOA 3PUEA 4JYDA 5F4XA 1TRDA 1TPB1 4IMDA 4IGHA 2C14A 2X1SA 4AHPA 2NWRA 4Y96A 1ZY9A 2YX0A 3CIXA 3OVRA 2A7PA 3UPBA 2C6QA 4FIQA 1LCOA 1YDOA 2ZBTA 1AK5A 4AH7A 5EY5A 1ICSA 1KM3A 3ABQA 1YDVA 1OYCA 3WK2A 4MLJA 3QRHA 1TPVA 3UZ5A 2DJXA 3FFSA 1HTIA 1DHPA 1P0KA 2CFFA 4RXGA 2QCDA 1TTJA 5C2XA 4JEQA 4UTTA 3E0IA 2ZZ1A 3QPZA 1EP3A 2W0UA 2VKZG 3NQ6A 4WOZA 3LX9A 5J5RA 4IPJA 1RPXA 3M44A 3CLMA 3Q58A 3EWZA 4POCA 1LP6A 1GVQA 1TTPA 1XDMA 1KM0A 4JTLA 4FNRA 5E93A 1KM6A 4K39A 3QMTA 2V9DA 3LCIA 1AL7A 1AW5A 3SR7A 5D2VA 5K9CA 4NZJA 3NL3A 2ZRXA 3DKJA 1C9DA 4FX8A 3W7MA 2NUWA 2PRMA 1O94A 5AYYA 1FUYA 2HMCA 4O0ZA 5F1UA 2GQAA 3GX9A 5HUOA 3W87A 4UMCA 3C2VA 3NAVA 5DXXA 4ZQMA 4UNKA 4Z1DA 3W9ZA 3QJAA 3NZ1A 1WAUA 3P84A 3L21A 3C2RA 1KFCA 3NQ2A 4ZQPA 2BWGA 3PBVA 3WK1A 1ZAIA 5KITA 1KFLA 3F03K 1FWNA 4PTNA 3G8EA 2FB2A 3E12A 2VEKA 2A0NA 1PL9A 4QIUA 2QF7A 2ZRZA 4DPQA 4JX5A 1M7PA 1I8JA 1XCFA 1K7XA 3KVLA 3OBKA 4UTLA 4ZZ9A 3OVPA 1XBVA 2BLEA 3W2JA 3HG4A 2G5WA 4EF9A 3PBYA 4FXSA 2J6XA 3KRUA 1JRCA 1F5ZA 2Z0IA 5C54A 4HHPA 5BW6A 5AHMA 3MI3A 1W56A 3GAKA 4MJZA 1I2PA 2WSRA 3BW4A 1I4NA 3C61A 1U83A 3DGRA 4MY1A 4O11A 1OHLA 3G22A 2OMAA 3V75A 3QMRA 2YXGA 1K8ZA 1VLWA 1R2SA 3S5OA 2QCMA 3TXVA 4RKAA 1OX5A 4UTIA 4NNAA 4JTEA 3L65A 5BMWA 3U6WA 3CPRA 1QPOA 5F2IA 4TMCA 2NUYA 2E5BA 3FOKA 1RZMA 3HG5A 2GJNA 5I3JA 5I3FA 3DFQA 3GXPA 2UV8G 2DU2A 3R5EA 3N19B 1JJKA 3FYPA 3LCXA 3MBFA 1WA3A 4AWSA 3DFNA 4UTUA 1JQXA 4O15A 3LTYA 4N4QA 1GTEA 4GWEA 2HTMA 1S5TA 4IX2A 1TMHA 2A4AA 3ELFA 3PWAA 4HNNA 3KVMA 2DZTA 1S5VA 1IIGA 3W2LA 4XWUA 3W83A 2B7QA 1R2TA 1H1ZA 1QWGA 2QCGA 3MI6A 2DJLA 3EXRA 3NL2A 4JN6A 1PS9A 5F1VA 4NJJA 3SSJA 3S42A 1GVRA 1MSSA 4S1FA 4OV9A 2DZXA 5DY2A 1GYLA 1RQEA 4O0KA 1AMKA 1M6JA 3BK0A 3NO5A 3WJWA 1BKSA 4XUGA 2H6RA 1DOSA 4BI5A 3L67A 2X2GA 4H3DA 2E09A 5IBXC 4GBUA 1IF2A 3Q94A 5HINA 1PCKA 4U4MA 3NZRA 4LVDA 1OX4B 1K02A 3M0ZA 3QSRA 4DF1A 3M6YA 4FHAA 3SW6A 3L66A 5K9XA 1F76A 1VCFA 4AHQA 5HNRA 1SW3A 2EHHA 3HPXA 1ADOA 1HO1A 2CLMA 2Q3OA 5AYXA 2NV2A 8TIMA 2A21A 4UMBA 1TQXA 3AO0A 1GOXA 2LLEA 4NQ1A 3GR8A 3QC3A 3L68A 3IEBA 1SSDA 3P8JA 3USBA 1SZNA 4Y6GA 1OFPA 3G0XA 1LTDA 3DFOA 1HL2A 4JTHA 3QW3A 4N9BA 1D3HA 5F2LA 1W5NA 4UFKA 1HUVA 4FB7A 3S1UA 3VE7A 4K38A 4MY9A 1SZGA 3S1XA 1OK4A 3M5ZA 1PIIA 3W2KA 1DQXA 3P81A 5C5YA 3PB2A 3QZEA 2BXVA 4PC8A 2QCFA 4O54A 3W2MA 1KFEA 4O1DA 4WY0F 1WXJA 3I68A 2PCQA 3W84A 3CB8A 2DZWA 4IMFA 5KMYA 1V7YA 2JBMA 4BR1A 3ATZA 4CQ8A 1LRNA 3UXDA 3PSVA 3M47A 2ZFAA 1IIHA 5D2XA 1PE1A 2R94A 4HNUA 4AB4A 3N3MA 1GG1A 1QMLA 4FNSA 5L9FA 3EWWA 2CW6A 3HQ1A 5DBUA 3G3MA 1K7EA 1ME7A 4PH6A 1OK6A 1EA0A 4QNEA 4HPJA 5EA9A 3LRMA 2AQWA 3PF3A 3EWXA 4CCDA 3IVUA 2ZTKA 4PEKA 5CKSA 3C3NA 5G2IA 5FEXA 2QUTA 4JTJA 1JCMP 3TC6A 4RLIA 3GZ3A 3HGJA 4D2JA 1QO5A 1DQWA 1MZHA 3G18A 4JTFA 2PE4A 2QCLA 1K03A 3FJ6A 4YCOA 3PVFA 2ABAA 3ABSA 3LCHA 3BG3A 1MEHA 3TSMA 5K3VA 1TV5A 3NM3A 3UXAA 2ZTJA 1R47A 2E5CA 2A7NA 2JGQA 5KZMA 5K7JA 3KFTA 2E5DA 3W76A 3LV6A 3L2IA 1OFEA 2R14A 3LDVA 3UWZA 2EAWA 4NNBA 2H8XA 3A21A 4CCEA 2X16A 2XN2A 3WK0A 3TQ0A 5D05A 1SPQA 2RH9A 4FIRA 1K8YA 3UZJA 5E0KA 2CZ5A 3UY7A 4PCFA 1DL3A 1JULA 3WK3A 3W1AA 5AOUA 2Y85A 3OIXA 5D32A 3U8GA 5C6MA 2VXNA 1DVJA 5AC6A 4CQAA 1G4SA 1ML1A 5EPDA 3TNOA 3CT7A 4YWIA 5IBXA 3DI1A 3O8AA 2YGYA 3W86A 3G1FA 1PVNA 3SGUA 4FNQA 3C2OA 4GNJA 2QAFA 4Q4KA 1KLZA 3B8DA 2H90A 1C29A 4A21A 2FB3A 1KTCA
chains in the Genus database with same CATH superfamily
1QVBA 4JFWA 3WFLA 3NL5A 4ZE4A 1SGJA 1OFDA 1UASA 4WCJA 1XBYA 2OX4A 3B0VC 5FF0A 1J2WA 1V93A 3UXLA 5ABHA 3LENA 4QG9A 4ORIA 1FA2A 5DELA 3ZO9A 4KWOA 5A8GA 2RFGA 3AROA 4AMCA 1V79A 2INZA 1F7BA 4S3AA 4Y9NA 3L4WA 3FCPA 5D9NA 2V68A 2J7CA 2IKIA 3O2LA 2VGBA 4ERAA 1R30A 1ICPA 1LBFA 3L4YA 4MKNA 2YSWA 1JNEA 1SJDA 3PZVA 4QR6A 3SRHA 3L0KA 5A6LA 2J9YA 8CGTA 2X1IA 3WEMA 2FPVA 1DWGM 1PWMA 5TNVA 1KTBA 4Y9OA 3OGRA 4DO6A 1VP5A 3KOWA 5LNUA 1F6KA 3WDPP 3IGUA 3NQGA 2JEQA 3IUDA 4HKPA 1XXXA 4J2PA 4M82A 3ZR4A 3UJRA 4PCNA 1I1WA 1H7XA 3EDDA 3O15A 3CAWA 4MG4A 2DZAA 2DZVA 2Z25A 3CZLA 3LCFA 4L1WA 3IUIA 3HN3A 1NP0A 1VF8A 3QLLA 4S3DA 3F1QA 1W9VA 4CLMA 3AHYA 3HA1A 3C0QA 4LUSB 4LAOA 1GEQA 3ID7A 4XG1A 3POCA 5I0DA 3T44A 3CJPA 1VYPX 2Y1HA 2EO7A 5I78A 3SI9A 2ASHA 1XUUA 4GKLA 1JZ8A 2RGMA 1E9IA 1UHVA 3ZR6A 2XIOA 2AGTA 3MMDA 2Y7DA 2OQLA 2FZ8A 4DEFA 2H8ZA 2PDIA 5FD0A 3QQ0A 3N2CA 6A3HA 4OU1A 1L8PA 4DWSC 2WZMA 3IV8A 3WUEA 1K1DA 1RJRA 2A3AA 1KBJA 2EXOA 3NOYA 1TKKA 4KRUA 4LPCA 4LF2A 1CYGA 2EPLX 2PAJA 2R1PA 3UGVA 3YPIA 2PDKA 1XBXA 1NEYA 1H61A 2DV0A 1PKNA 6REQA 3FLUA 2CKRA 2PDGA 3CIVA 5ECUA 2D0HA 3BCFA 4F8XA 1BF2A 3E0FA 1U5HA 3STFA 1UZDA 3GXFA 3OZMA 1I9CB 1EJXC 1RLCL 3UW6A 1RALA 5D2YA 2QV4A 4U28A 5AHFA 2YCKX 1GG0A 4XKYB 4U2YA 3TN3A 5DMNA 3ARUA 3HGSA 1JPIA 5AHNA 1NF0A 3TJLA 2Z29A 3CH0A 3JS3A 3RN6A 5REQB 1JG9A 2V8ZA 3NWRA 2C1GA 4WKAA 3M0IA 4J7RA 3TQPA 2D2JA 5KTLA 2X0SA 2XIIA 1VFHA 4KEMA 2NSOA 1WAWA 4QXIA 3V16A 2AQVA 3IRSA 4Q4OA 3VMPA 3TN5A 3GLCA 4TUFA 4OUIA 3WO8A 2ACQA 4K7YA 1X1NA 1E5JA 3EXSA 5J5DA 1W37A 1WDSA 2C91A 1VFOA 1YRRA 1XYAA 1BYDA 4YL2A 3F4WA 4MOZA 1RPKA 3C2EA 3OLIA 2PWHA 3EX3A 1JXJA 2E6FA 6PTDA 3WMSA 3MUCA 5K2ZA 3ITCA 4HU4A 3QQ1A 5FJOA 4FNPA 2PTYA 2GQ9A 5D8WA 5GPRA 1GZ1A 3PK7A 1QATA 3B04A 4YS1A 3WJZA 3KE0A 4TX9A 1KNWA 3RHGA 2QV5A 2WQDA 3FN9A 3UZWA 2QCDB 4CNUA 4JX6A 1FWSA 4TVCA 1ZZMA 2FZ9A 2NXGA 5BMXA 4WOQA 1S2TA 4EXQA 1EP1A 2EQDA 3MUXA 2NX9A 1XLIA 4NZFA 1FP8A 7CGTA 3I65A 2G3FA 1EDQA 1O5QA 3BSHA 2G37A 4IF2A 4ATLA 3E0VA 4OZOA 4ML9A 2WBKA 1D7KA 1V3HA 3BQ5A 5FJPA 1NFBA 2X41A 2XVLA 1JCNA 2VTFA 4YXGA 1GOMA 3L2MA 3MSYA 3GH5A 3TDFA 1TVPA 1DXFA 5HWJA 2PBGA 1LL7A 2C0HA 1E0TA 1EDGA 1FWHC 1QT1A 3GC2A 6TIMA 3RX2A 1O1ZA 4I6VA 2A3BA 1F4AA 2Z1WA 3MU7A 3QV8A 3S2MA 4ADSA 1T96A 4S2CA 4I7UA 3BMWA 4LAUA 5F7UA 2WV8A 5D9PA 3VZYA 3FJLA 3N73A 1EP2A 3P8IA 5CG0A 2FQIA 4LXFA 3ZJKA 3V0TA 2YYUA 4HTYA 2H3DA 4M1BA 4A2RA 2G0WA 3N9KA 4W4QA 4IFRA 2CLLA 5HDRA 4MF4A 2J25A 3VOFA 4M1RA 1H5YA 3H54A 3ZR5A 2ZUSA 4GY1A 1J0HA 1DWFM 3W7PA 3ONBA 1E71M 3PBWA 3KEHA 3RITA 3M7WA 1O5RA 1BTMA 1VFUA 3RRXA 2BV9A 3NQEA 4NYUA 2Y8VA 5FF2A 3OJGA 2W66A 3H21A 3OLGA 3P82A 4PUUA 1HJWA 4ZQNA 1DYSA 3H24A 3PY2A 3LS9A 5CSRA 1UR4A 4YNGA 3SCQA 2VC7A 4IFOA 4YCPA 1M68A 3A3HA 1GVIA 2OJPA 4C6FA 2V5CA 1XBZA 2ZXAA 1Q7QA 1E9ZB 1QXLA 4ZA0A 1S3TC 2Y7GA 4LUTA 1QCWA 1EO7A 1FH9A 1KM2A 5EMUA 2W5FA 3FDKA 4KW2A 5LXEA 1E56A 4K8GA 1POJA 4CNSA 4CNNA 4L4MA 5D33A 3CWOX 4HYWA 1IZJA 4QEHA 3W74A 4HZMA 4IG2A 3UXKA 3VNDA 1IEQA 3CM4A 4UQDA 5LNWA 1JZ2A 4IPNB 4BF9A 4Z0JA 1YDNA 3TMLA 2CNCA 4I9MA 2WKGA 3SM0A 4CD7A 5A8PA 2O56A 2WNNA 2BHZA 3NQ8A 4LC8A 2A3CA 1L9WA 1U2YA 4XZMX 4LC6A 1CZ1A 4GYFA 5CBBA 4EK7A 2XM1A 2YCLB 3N25A 1TPUA 4BA0A 1JCTA 1E73M 3CV1A 3BLEA 4X2PA 4ASTA 2VDHA 3URNA 2YCEA 2XIJA 1A50A 2W4XA 4XKMA 3T78A 4PZVA 2RDTA 2XZ9A 4UQCA 4QJ1A 4L64A 1NWRA 1R0MA 4KFPA 1RP8A 2W92A 3ZVHA 3ZOAA 2QDHA 2DW6A 2GUBA 4M7SA 3WLJA 3T40A 1H3GA 3VXGA 3BTNA 4QS6A 3LEPA 2PLCA 2IQ0A 3ARVA 5HJLA 2YB4A 3VMOA 3TMQA 1EL3A 1R3VA 4Y9PA 3AXMA 1RBLA 2B7OA 7ENLA 2DVXA 3DGBA 4HNLA 1X96A 1G7VA 2VOMA 4LOCA 4NZ4A 4RZ6A 4FX6M 3K4DA 1OC6A 4UIOA 1JF6A 5A5WA 4K3ZA 4M6QA 1KM4A 2CC0A 1Q66A 4XD4A 2PDUA 3G1YA 4FXJA 1IGSA 4R27A 3LY0A 5CPQA 1ZJHA 4LUJA 4ZSUA 1LWIA 2PBOA 5AYBA 1NQKA 4S2BA 4HTBA 2JK2A 4OV4A 1GVYA 1LUCA 3CMFA 1R3WA 4JIPA 4EX4A 1JEZA 4Q6JA 4JTQA 4GQRA 5AC8A 2OSWA 2BVTA 2G95A 4BQ4A 4MDOA 2BX7A 1KXHA 1QR7A 4YIWA 3SUTA 1A53A 3AICA 2PPGA 1R3YA 1BGAA 3GNDA 4H01A 4C7FA 3WL0A 3SDOA 3S1VA 3OODA 3MO7A 1XH0A 4N6FA 1EJSC 1IZCA 4RNFA 2VDIA 4OHQA 1UR9A 5HQLA 4AIOA 1TPEA 1VEMA 4ZOEA 3W1RA 3PZUA 2DIKA 3OG2A 3W6MA 2ISVA 3SUSA 3WNNA 4EE9A 1R3TA 1V02E 3PR2A 4CUCA 1FHVA 2VELA 5F4SA 1KRAC 2ZE3A 4NVTA 3KOZA 3VTRA 4MPQA 4OBSA 1S2VA 1LWHA 3LPFA 2J6VA 1N8IA 2GUYA 1RJPA 4AF0A 2KZHA 3GDKA 1TWSA 1FOBA 3WD3A 5BOOA 3M0YA 2HCVA 2POZA 2ZUUA 3A9IA 5HUPA 3UT0A 4DJDD 3TW6A 4IZGA 4KEVA 2HXUA 4JIQA 3WENA 4A2SA 1FCBA 1NWTA 4JTIA 1F07A 3TNBA 3HG2A 4CNPA 1XDJA 5DQPA 3MCNA 4PYSA 3CBWA 3ARZA 2J9XA 1V6UA 4NL1A 1BYBA 2FPTA 1O60A 2DIJA 4X9SA 1UCWA 4KERA 4RV8A 4XBKA 3GG1A 5G4EA 4J3ZA 4EOUA 1KRMA 2QJHA 1E1CB 3DC8A 2FZNA 1EWDA 2GVJA 3W1TA 3RLUA 4PA8A 3W2NA 5D02A 3FAWA 1I2RA 5J04A 4DXVA 4EKJA 2DT0A 2WBGA 1AQFA 3GTIA 4C91A 4D6CA 4E6MA 2J88A 3GTNA 3AMDA 1B4EA 4ZODA 2Z7KA 3ZYZA 1WXZA 2GJXA 2HJPA 1XISA 1V3IA 2UZ9A 4HHLA 4UFIA 4E2BA 4CQCA 3MV01 2Z2UA 1KQYA 4GXMA 3G6LA 1C93A 1HL8A 2C0AA 3UG3A 2HVMA 2VUYA 3WDQA 4ZB2A 3B06A 6ENLA 5IOBA 2FFCA 3NL6A 4NAFA 4GMEA 4IJBA 5E9AA 4GACA 2WHKA 1JUKA 1XRTA 3B8IA 3FVDA 4PL2A 4GOAA 2ZZ6A 3PC0A 4DBDA 3MVTA 1X38A 1T40A 2X05A 3PZTA 5TIMA 1JD7A 3OHIA 3TX9A 1ALDA 1LBMA 3Q67A 3B3DA 2O9OA 5I77A 4O12A 3QF0A 1QW8A 2JKEA 1OC7A 3WLMA 4MNLA 4TOQA 4CKQA 2PD5A 1EC7A 3W7DA 1NIUA 3ALGA 4BY3A 4DF2A 2JEPA 5HJYA 6TAAA 4CQ9A 3F2DA 3GM8A 2NVAA 3VDGA 3SRKA 4LCRA 3QZAA 3TEVA 3NQVA 4WRHA 4WXZA 2FH8A 3REQA 2VC9A 2E7FA 5M2FX 4R7OA 1CCWB 1KO0A 2V69A 2NLIA 1Q7ZA 3C52A 1DV7A 1EEXA 4QS5A 2BXZA 3ITVA 1IXNA 4DXKA 3U0HA 1VFTA 1X6LA 2PTDA 5CZJA 1O7AA 3QY8A 2NQ5A 1EC8A 5G5IA 4JKLA 1CXIA 1FWEC 2A2IA 1NH6A 4XB3A 5AKQA 3H7VA 1PBGA 3FAXA 3LGGA 2X7VA 1IYXA 3P74A 3SO7A 1UR3M 3FHAA 2OZ0A 4L61A 3TONA 2EBNA 3P6LA 5DBTA 3AMKA 3G5EA 8RUCA 5LGXA 4BEUA 3EKZA 4UFHA 4ZO8A 1Q65A 3CGTA 3K4AA 4JCMA 5GJNA 1TWDA 3UEQA 3WBYA 4QSFA 5I03A 1KA9F 1A4MA 1PYMA 3DG7A 3M0JA 4MNMA 1DIKA 1V0KA 4GO8A 5EFFA 3QHMA 1TA3B 4QITA 4UC5A 4O13A 3W01A 4A8RA 1GQJA 2C8NA 3K5XA 4JDBA 1H7PA 3KP1A 5BROA 4DBSA 4L4PA 3STGA 2DW7A 1GPWA 1WDWA 5DMMA 3SCVA 3DG3A 1WXYA 2Z6IA 2JGYA 2X0HA 4V28A 3S3GA 5CPLA 3EX2A 3GDLA 4JTRA 4S3JA 4C6CA 3LERA 4GQQA 3EPNA 2DZUA 1E0UA 1KBIA 3NPXA 3LSBA 1Y65A 3PP7A 3E9AA 1NOWA 2Q8ZA 1P0DA 1EBGA 4WKFA 4ACYA 4D71A 1X7IA 4NJGA 4G7FA 3WNLA 5F2GA 2FZDA 1R7OA 4D9PA 1XC4A 3WX7A 3EA2A 4INFA 3WZ0E 1W31A 1TJ1A 4ZVJA 2GK1A 1H51A 4MHBA 1WOAA 1L2QA 2OZ3A 4FOUA 3U4AA 4H9YA 1JGMA 3W1QA 3EWUA 2BXYA 2Z1KA 4D6EA 2EKCA 4GXPA 4JYEA 4HZ7A 3M41A 9RUBA 3FXYA 1UH2A 5IHRA 3G1HA 3QOKA 1PHQA 4IPPA 1TMQA 2Z2BA 4HJFA 4US5D 4GFIA 1W1YA 5C9UA 2WZTA 3B8WA 1XRSA 4PMYA 1UUMA 2P10A 4J9JA 4JHZA 2CETA 3OLDA 4PCSA 3J7HA 2Y61A 5A6KA 1DWAM 4JPGA 4WGHA 5G4WA 1HNYA 2WMIA 3VIFA 2NX1A 2P88A 2XVKA 3W75A 1HQTA 5G4HC 4E3TA 1QK0A 5KETA 1V02A 3TE9A 3O16A 2PRHA 3FEMA 3KVKA 2XWEA 3IIOA 4PRWA 2OCZA 4V1YA 4NZ5A 2CESA 4C1LA 4HIBA 5DCBA 4A22A 3WELA 1SO6A 3LRKA 3VNZA 3T0DA 2OLAA 3CV6A 4MIMA 4DJFC 2OSYA 2QPUA 3L4ZA 1HT6A 4LU0A 3KS6A 3NQDA 3OYZA 1UR2A 3IJ8A 4J27A 1V6YA 2PF0A 2EPNA 4LRTA 4KF1A 3AZTA 4JYFA 2I1OA 4HHMA 3NUKA 4MWAE 4B5SA 1OBAA 4LUTB 1G4EA 3GKFA 3W6YA 1IT0A 3QR1A 3NQFA 3M1ZA 1F3EA 3LQLA 3UBPC 4EVZA 3F4NA 4MJ2A 2X1UA 3MUIA 3GBDA 4C65A 3LXBA 3KVJA 4M51A 1XYLA 2BBFA 2PMQA 4I5RA 3RILA 1CT5A 2C19A 2FMNA 3I7SA 5DLCA 1EEPA 2PZNA 4XQ6A 4DNMA 2OOFA 2QJJA 4PBFA 1J9YA 5CPOA 3R7MA 3E2RA 5A2BA 1A0EA 1BF6A 4ZOCA 3WJSA 1QNVA 1JDAA 4XD3A 4DM1A 4ML4A 3BCDA 4EPKA 3W3OA 4H4IA 4LYKA 1VBGA 4C6EA 1GKRA 4GVFA 2Q6ZA 1DIDA 3LOTA 3NDYA 3EEGA 3B05A 4HOWA 5CSUA 4IIFA 5A6BA 1AW2A 1ECQA 4IIHA 1P6BA 3V4BA 1ECEA 4M7TA 3NJ3A 4H04A 4M81A 1MXDA 3G2GA 3ZVHB 1DWIM 4GNKB 1LT8A 4JY8A 3A23A 1XG4A 4ECLA 4H19A 3HIJA 4F2UA 3GNOA 3W7IA 3C2FA 4CD5A 3R1ZA 3FGCA 2W67A 3TYBA 2G8ZA 3HTWA 3EA3A 1KCLA 4UTTC 5A6MA 5D30A 1SO3A 3GNRA 3CO8A 4MJMA 4D8AA 2B7NA 2VR4A 1P43A 1QFEA 1O95A 4H8VA 3FY1A 4GUGA 4PSRA 3GR7A 4K6AA 4IQLA 3TIMA 1AODA 1BG4A 3L0NA 4DI8A 3VGBA 2QAPA 4BQ5A 3CNYA 4RDVA 4QG6A 4ZGYA 1N55A 5D8ZA 2AQOA 2V5JA 3JVAA 2ZXQA 4PTVA 1XX1A 4K1WA 2DORA 4UFJA 3V5CA 1MXGA 3NSMA 3M6DA 1LUCB 2NZLA 3GO2A 3EMZA 4AC1X 2CZEA 1W3JA 1XIIA 4Q6XA 4NU7A 4GUJA 2WLZA 1FWTA 1W3NA 2EPHA 4ERGA 2PDHA 3RCYA 1Q45A 1XL9A 1XQKA 3ZJ8A 3VCNA 4YTTA 5EMYA 4LV4A 3ARSA 1G4PA 3T1GA 4HU3A 3WNOA 1LOLA 3MHUA 3DENA 1R46A 1WKEA 1EUNA 2P5NA 4K8EA 3WBAA 1T99A 4R33A 1J8VA 3V5OA 3DFYA 3GDMA 1AD4A 4FS9A 2J47A 4FK9A 3ZLFA 1VKFA 5HQEA 3C8NA 4R9OA 1XRVA 4PUWA 1K7FA 4K2SA 2YFOA 3RYSA 1FWJC 4JTKA 1QO2A 3NYZA 5G1MA 5CZTA 1UH3A 5MHBA 4C7DA 1TIMA 1MXSA 3NR0A 2VC6A 2YA0A 5ABGA 3N4FA 5F4XA 2FGBA 1EF3A 5LIWX 4D6JA 5ABEA 1VBUA 2D2HA 1AQ0A 1C91A 4Y96A 1CECA 1YW1A 3OVRA 4QTGA 1LCOA 1YDOA 3ITYA 2GSJA 1KM3A 5IFTA 2PDJA 3QRHA 3CAQA 1UW9A 3WYZA 1YNQA 5AZ0A 3U48A 1XIDA 2CPUA 4PUKA 2DQWA 4TV5A 5JIWA 3E6EA 4RXGA 3F4VA 4AY7A 3ANVA 1FRBA 3GSMA 3E0IA 3QPZA 3FX4A 3R94A 4WOZA 4JHOA 6XIMA 4F79A 4QQUA 4JQ3A 1B5TA 4ICMA 1LP6A 1TTPA 1XDMA 2P0IA 3WQCA 2ZXBA 1YHTA 4P8UA 1EZWA 3WQ8A 3UCDA 3PFRA 1NELA 2ZX5A 2IKHA 5K9CA 2HISA 1OT1A 1E6NA 4QE5A 3W7MA 4MNKA 4Q8TA 3MPGA 1SJAA 3N2OA 3CZJA 5CGTA 4O0ZA 3N29A 2VZSA 4FI4A 5HUOA 3W87A 4UMCA 3FHQA 2BB0A 4I8YA 1UOKA 2D3NA 4LH8A 3QYSA 4YVXA 1FKWA 2GJXB 3B9DA 4RPQA 3M0XA 4Z1DA 3W9ZA 4Q4RA 3QJAA 1XYZA 4R88A 3MT1A 3L21A 3PZIA 5KITA 2VJXA 4NAFB 4YTUA 4ZO9A 3L4XA 3G8EA 3WDIA 1K77A 2FB2A 1QK2A 2FTWA 4J1OA 1V0LA 2ZRZA 4XUYA 2OGJA 2XJ7A 2YXXA 1PUDA 4QAWA 3KVLA 3DDMA 3HM7A 5CXPA 2XM2A 3SSZA 1R86A 3PBYA 4FXSA 1QTWA 4X9YA 3BOFA 3SY8A 5BW6A 1W56A 1Q6FA 4M24A 3VZXA 4MJZA 3EGJA 2MANA 1EXBA 4AZIA 1I4NA 3AAMA 1U83A 1UROA 4A8LA 4C6BA 3G22A 1VLWA 4AD1A 1R2SA 2OWWA 1ZP3A 2QQ6A 1J11A 4FP1A 4JTEA 2FHCA 3L65A 5A6AA 1YNYA 1QPOA 2NUYA 2PEVA 2PLMA 3DFQA 3GXPA 3R5EA 3ZQ9A 3LCXA 4M3PA 2J8FA 1B31A 1Q6CA 1V3MA 5HXMA 3KBVA 1XP3A 4N4QA 2QMKA 2HTMA 1E55A 1TMHA 4RDYA 3N12A 4PTWA 3WG6A 4XWUA 1H1ZA 3R43A 1UC5A 3PTKA 2QCGA 3VMNA 3NL2A 1PS9A 2HK0A 4KGJA 1QUMA 4S1FA 4OV9A 3CV7A 1JYNA 2DZXA 1U22A 4UR9A 1GYLA 4O0KA 3TW9A 1M6JA 1W17A 5LA2A 3A6OA 4DJED 1BKSA 1W1TA 1DOSA 2CXEA 3VDAA 5XIAA 4HQVA 3L67A 3VX0A 4ENLA 1R8LA 3GU1A 2E09A 1JDEA 2VMFA 3VDCA 5IBXC 4GBUA 5HQMA 1XSJA 3HV9A 4A05A 1VFLA 3R58A 5HINA 1DXIA 1PCKA 4Z2LA 3I6TA 3QSRA 2FVLA 1DWHM 3SW6A 3L66A 3UNTA 3U5UA 4N0RA 5DT7A 3WNPA 4AHQA 1SW3A 1WCGA 2X7WA 3IGHX 4UMBA 3QOMA 4FA3A 1TQXA 3VZZA 4ZCWA 1BD0A 3IEBA 1SSDA 3QR0A 1KGXA 1LTDA 3G0XA 3RIKA 3VOJA 3OHMB 1XLFA 3WL1A 4UFKA 1UMLA 3UJFA 4PUDA 3UG4A 3HQNA 3N15A 1E15A 1WKDA 2F61A 2XFFA 2EG8A 1ISZA 2GK1B 1OK4A 3P81A 3UWEA 2QVHA 3QZEA 2BXVA 3WLLA 2QCFA 4OKDA 3USZA 1RA5A 1KFEA 4O1DA 4C5YA 3NXLA 3VO0A 2G41A 1WXJA 3I68A 4HSHA 3CB8A 2DZWA 2W3ZA 2GGEA 2JBMA 3RX3A 4CQ8A 3PPHA 1NJJA 1IIHA 3LZ5A 4MM1A 1PE1A 4KEZA 4AB4A 3N3MA 1GG1A 1QMLA 3EPMA 4FNSA 2XINA 4HN8A 4ILSA 2B31A 1DP0A 3I3EA 1EA0A 1UZHA 4E8GA 3PF3A 3EWXA 3DOPA 3W82A 4I5XA 5A8QA 4U5IA 3H2AA 2PDYA 3AZSA 4JTJA 3TC6A 4ZOAA 3GZ3A 4JTFA 2QCLA 5D9MA 1K03A 4LANA 2YCJA 4CU6A 3MKCA 2WMIB 2VCAA 3AHZA 3BAYA 3TSMA 3NM3A 2ZTJA 3TN6A 2E5CA 5KZMA 3GE7A 3W76A 3VNYA 3LV6A 5HAOA 2JIEA 3LMYA 3OZOA 5I06A 2VP8A 1XG3A 2R14A 3LDVA 2PWUA 3WQOA 2EAWA 5DMYA 2Z1SA 3CUHA 4FIRA 1W1IE 3UZJA 5E0KA 2XSBA 3UY7A 3W1AA 1KR1A 3EB3A 5BYWA 1XIHA 3OIXA 2OO6A 3VNKA 4E8DA 5AC6A 2XZ7A 3WQ6A 1ML1A 3GBEA 3DI1A 3O8AA 1ITQA 3F4DA 2VWTA 1PVNA 3IJIA 3XINA 4GNJA 3GH7A 5E09A 3CLWA 2H90A 1C29A 4A21A 4GIAA 4GVGA 1KTCA 5IFPA 4O4VA 4M56A 1MYRA 1P6CA 3LTPA 2WHJA 2DZPA 2D0GA 3GNXA 1THFD 4GD0A 5I3KA 3AXIA 1A5LC 1XFBA 3U2EA 3ANYA 4I5UA 1QPKA 3GQYA 4CN1A 3WQGA 3ZVIA 2ADAA 2TMDA 3MCMA 3LLDA 4KCTA 1WDRA 3VM7A 3CUIA 4UOZA 4TTUA 2W9MA 2I17A 1ZBCA 4YN5A 4WDTA 3KOFA 4IJRA 2V6AA 3MO4A 5BRBA 1IHIA 2X42A 4Q8UA 5U4NA 1ZJAA 1QWKA 2ZIDA 3O6YX 4J5NA 4W89A 4K1GA 1UWIA 4D72A 5DXYA 4NY2A 4HP5A 4RDZA 1B4KA 1QHPA 3NQMA 1ODUA 1UD8A 2WOQA 4IMEA 5HANA 5CH9A 2GWGA 3BAIA 1ZFJA 4HHHA 3FGCB 3NG3A 1TRIA 3TLQA 2RGLA 4Y8FA 3S2NA 3LN3A 3K30A 1HF6A 4WR3A 3W7CA 4PR4A 3URAA 2J7EA 4MWAD 1YMYA 1MRAA 3T9PA 2AKZA 4UUIA 4JTCA 2VQUA 4WUIA 4FO4A 1M7OA 4YLWA 4EANA 3PTMA 1ONXA 4J3TA 3QVQA 3DUGA 3W7EA 4D1IA 4Y90A 4RE4A 1AW1A 1E4MM 2J7GA 2PFHA 3WJYA 5FEPA 1YEYA 3IIVA 2VZTA 1S46A 3UYIA 1J01A 1C90A 2HXTA 5BRPA 5CJ5A 1G69A 1Q6DA 4YMZA 5JBEA 1JUBA 3GUWA 4RZBA 4KWUA 3TSDA 3TSBA 3GNNA 5E6YA 3C56A 4W84A 1O5KA 4GX8A 3A22A 2DPEA 3VABA 2V2CA 2WHLA 1E0WA 4B2DD 2JFEX 4HPGA 3N2TA 1R7AA 2A3EA 4AXKA 3KL0A 2VI0A 2Z4GA 2Z26A 2PB1A 3E0LA 3MKVA 1VJIA 1N2VA 2JQXA 1WDDA 4GYPA 3N2XA 2D20A 2DUAA 3SN0A 3SCRA 2QZRA 3N6HA 1QJWA 1US2A 1TV2A 4DAIA 1P1XA 1R9ZA 1W1A1 1LQAA 3VIGA 4ADTA 4E0CA 3MJYA 2ZRVA 2R6OA 1UMYA 2JKPA 5C71A 3O06A 3R2GA 3L0GA 1OCQA 3V1PA 4JN8A 1JCYA 3CEPA 4H6EA 4JS3A 3VKJA 2WHMA 3EWBX 1PKMA 3WH6A 3BPWA 1RD6A 2MNRA 3GVWA 2XFWA 1NOUA 3ANUA 1D9EA 3RK8A 5T9CE 3B03A 5C7VA 1XLDA 5LIKX 3AIBA 1EQPA 3H2CA 4O50A 3APYA 2WKJA 1GVFA 2A1YA 2E9BA 4QAIA 4IISA 2AAMA 5TD4A 2ZZ2A 2V3EA 3W7KA 4FAMA 1JZ7A 4JNZA 4PUJA 3O3RA 3OO2A 2BGQA 2GOKA 1M1BA 2ZZ4A 1M5WA 1SU5A 1E3XA 3ES8A 2NUXA 1AZ2A 5AHLA 1OGBA 2QJNA 3KAOA 1OVDA 1ISXA 4M19A 5LHEA 4FR1A 4JTTA 1HJQA 3NVTA 4AD3A 1U1UA 2HS6A 3CS2A 3L5AA 2QPXA 3E96A 4H8HA 1DJIA 4JFTA 3W7RA 1P6WA 1GGOA 1W3HA 3VD4A 3Q4DA 1UQYA 3BZGA 1V4YA 2X8RA 1P0NA 1GOOA 1VPYA 1OT2A 1KFBA 3QW4B 2V5LA 3JUGA 2QIIA 2G97A 4CU7A 4CEUC 1G6CA 1P4CA 4LB3A 1O66A 1N82A 2BY0A 2WNQA 3T0BA 4DWSA 3BAXA 2Y89A 4BF5A 2ZX8A 3EDJA 2PLJA 1CGUA 3LXCA 4PMNA 2ZVIA 2RKXA 3WDRA 1MNSA 4EIVA 3UZZA 4NSBA 1FWFC 1XLKA 4H9MA 1PV8A 3TKFA 5I5RA 1NP2A 3R79A 4NXKA 1W9UA 4LVGA 5GVJA 1A5NC 2CZDA 3WFAA 2QULA 4HSNA 4RK8A 4DYKA 2BOEX 2Y63A 1R9YA 5PTDA 2EG6A 1UPPA 4DPPA 2QEZA 2AL1A 4BWLC 4UZSA 4ZQOA 4B9ZA 4ZXOA 2XTKA 1LJYA 4ZR8A 4HVXA 4F9DA 4LYQA 5AZ1A 4W88A 4PMXA 2W63A 5ECVA 1RQBA 2VQTA 2WNZA 4B3KA 3DBNA 3QFWA 4A3QA 4GUHA 4XZIA 2HE8A 3C0SA 1XLMA 1XH2A 1JXKA 3T8LA 1JCJA 1N7KA 2O55A 1BAGA 2QVNA 3A4JA 1EOMA 3BLPX 2VC5A 4F2BA 3PWGA 2ZYFA 3MP3A 4AWTA 5LA1A 4GLEA 1JAEA 4MUPA 2OQHA 3EZ4A 2PTXA 1BHGA 4WGXA 3W1MA 4AWUA 1YTKA 3W25A 1XKYA 2D24A 4G7EA 1Q3NA 2OODA 2OZ8A 2PGRA 4NYYA 2PWVA 1TJ0A 2A5HA 4QSHA 3LHTA 1H1NA 1V08A 1JQVA 3E2VA 4IMAA 4H7VA 3HO8A 3UERA 4AISA 3RMEA 3WLSA 4RNIA 3CHDA 4HPHA 1UKQA 1EO5A 2W79A 1Z44A 1EPVA 4LNYA 3TA9A 1ADDA 3NYDA 3F4CA 1P7TA 2HDJA 1AQMA 4MB1A 3CTLA 3VPLA 3R13A 3B97A 3GU2A 2P53A 4GK8A 1SR0A 1SFJA 3RLGA 2IPFA 4W93A 3W7HA 3E2QA 3P0WA 1MUCA 5TF0A 3LYEA 4K7VA 3B9AA 3CHEA 4H8NA 1E72M 1YXCA 4AY8A 1FY6A 2V82A 3G77A 3IIPA 2XGZA 3EDFA 3OVGA 1PAMA 2X1RA 3KX6A 3RPTA 3S5SA 3DU0A 4WVXA 1K4GA 2JIWA 4OOZA 4WEVX 3LZ3A 2E77A 1G7UA 1BGGA 3MUY1 3RG6A 1UUOA 2VEMA 4RZ4A 3T81A 4A3RA 1XLHA 4MMWA 3GW3A 1GW1A 1UUQA 3IJLA 4LGXA 1CGYA 3PZQA 4O10A 4TMBA 4ERIA 3A4XA 4NILA 1K6WA 3ITGA 4LB4A 2YL5A 4E2VA 4P8VA 2CU0A 5FAJA 1W91A 4LFYA 4TR9A 5ABFA 4B91A 1W3IA 3L5MA 3UQNA 3IANA 3KRZA 4HBKA 3RPDA 4L6HA 3VOGA 2R24A 3THQA 5KZ6A 1VJZA 3OW1A 1J0YA 3PZGA 3SY5A 1OM0A 1AJ0A 4M0XA 5A6TC 1X6NA 3HZ3A 2A6NA 3OPSA 3KLLA 4U3AA 4XZ9A 4H6KA 1P1MA 3G1SA 3WEZA 3XISA 1HN1A 4BF7A 4KWVA 4PE8A 1Z41A 3KTXA 5D2WA 3IIXA 2CZFA 3WLQA 2XU2A 1D7FA 2X40A 3K8KA 1TSIA 4ZXLA 1NAL1 3IS4A 3EEZA 3DYPA 5C7HA 3MMTA 1DIOA 4EF8A 3C86A 4AZGA 4LUSA 2DEPA 1IV8A 1GTHA 1BWLA 2WPBA 1F61A 3GIYA 4FOJA 4YWSA 1OIFA 2OSXA 3I7RA 3AS2A 2CLIA 3SAZA 1EBHA 4Z2GA 3PJWA 2YCIX 4MVAA 3UGRA 2R1KA 3CIWA 2TYSA 2F8QA 1IWPA 3O6CA 5A8MA 2PDXA 3W38A 4N9CA 5HNNA 3HPAA 2OLSA 4PTMA 4Q8WA 5TQLA 1EF2A 1W8SA 3TOPA 4PB5A 1T8QA 1YLVA 3EB2A 4U10A 4GH1A 2WW5A 2GSEA 1WDQA 3MYOA 2ANUA 3N6QA 3UWWA 3GDTA 2PA6A 4O57A 4DJDC 1Q7MA 1ISYA 3AU2A 3VM5A 4J3UA 1QI5A 2ZQ0A 1NU5A 5HR6A 1LF1A 2V5BA 4ROPA 4LCQA 4JTDA 5CZSA 5I3IA 1KRCC 4PN2A 2VFHA 4C6MA 5CCZA 3MKKA 1TPH1 3CUGA 1RQHA 1PDZA 1XGDA 3CQ0A 5TBOA 4GFSA 3B8UA 4GZJA 3VKKA 1KBLA 3W1LA 3EOOA 1I2NA 3A3XA 4I90A 4TX6A 2CLKA 3FJ4A 1W9BM 4ZO7A 2QF8A 4FX7A 3VVGA 2CBIA 1HKVA 3GG8A 4DZIA 3MUAA 4DQWA 4UQBA 4A3UA 1W3KA 4FOKA 1XRFA 2OWXA 1NM9A 2PDFA 3BLFA 1S3HA 1CIUA 3AYVA 4U33A 4M6VA 2QGYA 2NQLA 4XIMA 4UCGA 3IJ6A 3RLVA 3SIMA 3UR5A 3B9NA 3GTFA 2JF7A 1WBHA 1IEXA 1XIGA 3EAUA 3BLKA 3TAKA 3AHVA 4PBGA 3C8FA 1W5OA 5FOOA 1SW0A 1S5NA 3C3UA 4AZHA 2WZEA 4DI9A 2DGAA 2FZMA 5FL0A 4Q8QA 2WMHA 3HPZA 4H2CA 3M0HA 3DFTA 3MV11 2V3GA 4B4HA 4JQ1A 3ZJ6A 4Y7EA 1V51A 2VEPA 3Q65A 5G2WA 3DIPA 3KBWA 5H2ZA 1WYIA 1TX0A 5DANA 4NG3A 1Q4WA 5AB3A 1J96A 1PSCA 4DO5A 3L4VA 2GJRA 1OD8A 3GHSA 1KFJA 2FHBA 4R7JA 2QDDA 1NVMA 4BZYA 2YA1A 1E9YB 4LNCA 1OJXA 3VGEA 3WH9A 4JGDA 2C1IA 3ARRA 4KKXA 1A5AA 1Q6RA 3U2ZA 4GI4A 1DJWA 1RCXB 4IQEA 4DRSA 1MI3A 4HYVA 3LMZA 5HK4A 3CHVA 2NV9A 4DF0A 3M5VA 1FWBC 2VNCA 4MYAA 5E6ZA 3MS8A 3CMJA 2C18A 4M6UA 5HMFA 4IT1A 2I9EA 4KQNA 1E4NA 1LLZA 3DBPA 3O63A 1G01A 5HATA 4ORMA 4RCXA 4DX3A 4GQ0A 1W5QA 4TU1A 4IICA 1Z7AA 3SCUA 3D47A 3EWYA 3O0FA 1Y0EA 1S1PA 5JQ9A 2EEXA 2YBTA 3E5BA 4XTDA 3R8GA 1SQ7A 3SADA 1EQCA 2WNWA 3LGEA 4P61A 2OLHA 5FF7A 3QKEA 2OKOA 1ZJIA 1LL6A 4DBEA 1R87A 3R11A 4BI6A 4ZE5A 4ZL1A 2VFFA 3GB6A 2SFPA 3T4CA 3NVDA 2NLYA 4TVUA 2HWGA 3R8RA 4IP5A 3WLOA 4GZ7A 1DJNA 3CMGA 3P67A 1YPIA 2YFNA 1UD3A 3V0SA 1AJ2A 1B54A 4MY8A 3THDA 3W02A 3FVMA 2WMFA 3AWNA 4QNWA 1CTNA 2XH4A 2ZZ5A 1VCVA 2PU1A 2Y24A 1QNQA 4PL1A 3MHFA 3M5XA 2GDUA 5CSYA 2C13A 1GVOA 4UTWC 3SGGA 3K1GA 4IP4A 2Q02A 4OT7A 4MFEA 1Q6GA 3GK0A 3L2LA 5AVNA 4FMVA 4N9EA 1ZAHA 1T5AA 2EGZA 2YR1A 4XZHA 4EACA 3VX1A 4CU8A 1Y7VA 3I3BA 3JRKA 1WQ5A 3PJUA 3VNIA 1TVNA 1O6IA 2WWCA 2CLFA 4WSJA 1NDZA 5GNXA 2NXIA 2VFIA 4LVFA 1FDZA 3WJXA 2GQ8A 2YCLA 4K8HA 4LVBA 3W85A 1EKOA 1RUSA 1AL8A 1REQA 3QGVA 4DELA 1A5KC 2J9ZA 1FDYA 1XSKA 3LCLA 2ALDA 3CHFA 3OZPA 4AU0A 3S6DA 2E1WA 1B3ZA 4QX4A 3RDKA 3PJTA 3HF3A 3HB9A 4GRSA 4WKHA 5DCDA 1QNOA 4WD0A 1X8CA 1LQ2A 4F0SA 3RM9A 1H60A 2YW3A 2WSKA 1JFHA 3AYSA 1TJRA 1KLYA 3KCOA 4DWSB 3N14A 3PN8A 3KZSA 4L9YA 1DORA 4DN1A 3WQWA 3OGVA 3AI0A 3MY9A 1S5MA 2WB5A 3NPUA 1WNOA 3WF0A 3NQBA 1J6OA 3LNMA 5I2UA 3GFZA 3SCSA 5AY7A 4QDWA 4O8AA 3SFWA 1LZOA 2ZX9A 1F3TA 3RGTA 1OG6A 1X39A 2V81A 3PZ9A 1ZU8A 1QASA 3LI1A 4MAVA 3QYQA 1H1YA 1XLEA 3WLNA 4RW5A 1WUEA 3TYDA 1YX1A 3BARA 1A5OC 1CB7B 3QLDA 3SJNA 5HR7A 3KP0A 3NTYA 1H7RA 2J7BA 2OXNA 3VD5A 1W1B1 1UR8A 2WC3A 4LY8A 1JCXA 1O12A 2Q8LA 2BY1A 5D4YA 4JNYA 1IXQA 3TTSA 2DH3A 4IUGA 4P7LA 2D73A 3CO4A 4RE3A 4GPNA 4FNUA 4PMUA 1ZALA 1HJSA 4B3LA 3VA8A 3NZGA 3HGOA 4JL2A 2G50A 3SFKA 3OQ8A 1MNZA 4U31A 4E4FA 3OA5A 4L9ZA 3WFZA 4U5KA 1HG3A 5AYZA 4G7EB 4HMCA 4GI9A 2EG7A 4AD5A 3ZM8A 1Q2SA 1UG6A 4GIYA 4JEJA 1Z32X 4JNMA 1JR1A 2WVTA 1GQLA 4S3KA 4Q7IA 2WJEA 3AMCA 1GPFA 3SCOA 2NVCA 3WQ4A 3H2MA 3VIOA 1ME9A 1J18A 1VFFA 3W7OA 1BVZA 5CLTA 3NDOA 4M80A 1A0DA 2J7HA 1CNVA 3WUFA 1PWLA 5IDIA 1PXGA 3LLXA 4WK9A 3VIMA 4DXXA 4LT9A 1WDPA 3EX6A 3S8HA 1J6PA 1TR9A 1EUAA 4OBRA 4UFLA 1CGVA 3S5NA 3TYZA 4JY9A 2ODOA 1XUZA 3EX4A 1NDYA 3P61A 1XH1A 1A5UA 5C9RA 2YDSA 1A3HA 1FFQA 3UNDA 2NSXA 3EB4A 4BFAA 2CWNA 1UWAA 3T08A 3NM1A 3VGDA 4NZ3A 1H41A 4I8DA 4H9TA 3PTQA 2ACSA 4RJEA 3IGSA 3BAWA 2YZRA 1EIXA 3CB3A 1BEUA 3GHTA 1NDWA 1BYAA 5H91A 4BEQA 4IGMA 3T07A 1ZPTA 3W81A 1TV4A 1JDCA 4IM4A 3TFCA 2BGNE 3CWNA 4W86A 3FS2A 1XR2A 1E1CA 3UVAA 3WKZA 5ABFB 4EPBC 2P3EA 2Y6ZA 4G56A 1TZ9A 1LORA 3E02A 3RR1A 1X1OA 2CLOA 2NT1A 5G1TA 4E2DA 3DKLA 3ATYA 5LNVA 5CPMA 4XVEA 3VOIA 1Z8AA 2AOSA 3TYUA 2FFIA 2VZUA 1KTNA 4J35A 4GUIA 1VYRA 4FALA 4DJFA 5IDZA 3ERPA 2ZX6A 1HFBA 1JYVA 1EYWA 3QGKC 1XPYA 4N42A 4UTJA 4YPJA 3SJ3A 1LRTA 1J5TA 4YTQA 2YLAA 3KUMA 5FJJA 3DECA 2R1LA 5CJNA 1OYBA 1JUEA 4JIIX 1EHNA 2ZX7A 3CHCA 3H26A 1VD6A 3BC9A 3H8AA 4UMAA 1H09A 1PO9A 3V0UA 2R1NA 1S1RA 3UP8A 1NDVA 1ZB5A 3FYOA 1GKPA 3THAA 1YXYA 1VYSX 4O17A 1ZJBA 1U1HA 5HOSA 3PZMA 4AVNA 1OCNA 3UD6A 1ZBWA 4GVHA 3BURA 3MQTA 4IGHA 2HK1A 1K9TA 2NWRA 1C92A 2A7PA 3DYMA 4FIQA 2DQXA 1AK5A 2Y5EA 4AH7A 1ICSA 5A8OA 1YDVA 3WK2A 3TCSA 3MANA 1B90A 2PWFA 2F6KA 2REQA 3IK4A 4J3XA 4P7QA 1DHPA 1Z3NA 4D6GA 1D8WA 4HA3A 2CFFA 4KIEA 2WC7A 4J40A 2O4MA 3N17A 2WKLA 1CXFA 5C2XA 4JEQA 4UTTA 2ZZ1A 4H6RA 2F2KA 2GFTA 4GO9A 1HKIA 1UIOA 4IGNA 4WSHA 1JYWA 1UKPA 2Y2WA 1B30A 2GGJA 2QIWA 3EWZA 2GGGA 5HPOA 3VNLA 1GVQA 3T8QA 3QHNA 5E93A 2NVDA 1C8QA 4AQLA 3RO6A 3QMTA 2V9DA 4C7GA 4DBUA 5D2VA 1MRQA 4NZJA 3NL3A 2ZRXA 3DKJA 3GZAA 3A47A 1GORA 1TA3A 4FX8A 4BJHA 5HNTA 2WVUA 5AYYA 3WD4A 1FUYA 1HKKA 1V0NA 4XX6A 2GQAA 3LD5A 3GDBA 3C2VA 3URBA 3TOYA 4ZQMA 3P84A 4LAKA 4CN4A 1KFCA 1R3QA 1V3KA 2BWGA 5FSDC 1ZAIA 4NP7A 1KFLA 3NZQA 1BXBA 1UP2A 1FWNA 4Q4QA 3IJQA 3AXHA 3CXOA 1SM9A 3E12A 2VEKA 4TQTA 4MB5A 4TTGA 4H9ZA 1XIBA 4IFKA 4JX5A 3CQKA 1M7PA 1O1HA 1T6MA 3GR4A 1XIMA 4UTLA 5CLWA 3OVPA 3HQOA 1XLBA 2F9RA 1XBVA 2BLEA 1OEPA 3W2JA 1GOKA 2G5WA 4P7OA 1GZJA 1BRLA 4B3ZA 3TTYA 2J6XA 4D8LA 3ARWA 3OTRA 3N2BA 4HHPA 5AHMA 1VBHA 1OY0A 3BW4A 5LIUX 1S2CA 2DY3A 2YDQA 2ZDSA 1SMDA 3TJIA 4W8LA 4O11A 1OHLA 3V75A 3T0TA 3QMRA 2W61A 2QGHA 2YXGA 3SUWA 1K8ZA 2XFRA 4JL1A 4AD0A 3RCNA 3E74A 5BMWA 5H1WA 3CPRA 1A5MC 1QNRA 1D3CA 3N11A 2E5BA 3FOKA 1RZMA 4F0RA 2D3LA 2PZ0A 2PTWA 5EB8A 3WH7A 2UV8G 1EJWC 2DU2A 3N19B 3FYPA 5C9WA 3M07A 1XLGA 3CWHA 3CZ8A 4O15A 5CC7A 4Q22A 4GWEA 1JF5A 1S5TA 2EJAA 3ELFA 3PWAA 4HNNA 3QTPA 1S5VA 2E4TA 2B7QA 3BGAA 2J13A 4AZBA 2DJLA 3EXRA 4JN6A 4RNJA 4PUMA 5BCAA 1ONEA 1Q2RA 1AMKA 4JOMA 3GTHA 4J3SA 1YNPA 1C7SA 3RPMA 4L5ZA 2H6RA 2FMOA 3II1A 4MWAB 3E5PA 4BI5A 4S3BA 3BE7A 4JFVA 1LG2A 3Q94A 4U4MA 3V5FA 3FW6A 3T09A 2WMJA 3M6YA 4DJEC 5DT5A 3UESA 5CQ1A 5JH1A 1F76A 2CXGA 4AXNA 5CZKA 2BOFX 5HNRA 2EHHA 1VEOA 4H2HA 2Q3OA 2NV2A 3TYCA 1NQ6A 1GOXA 1XSIA 3QC3A 2PGFA 3L68A 3PANA 1SZNA 1OFPA 1HL2A 1TWWA 1YBQA 4JTHA 4N9BA 3DC0A 2CERA 3VKAA 3AQUA 3GYCA 5GQBA 1SZGA 1EA9C 3FA3A 4C6KA 1DEDA 1REQB 2WMGA 3ZLHA 1H2JA 2DSUA 4E4PA 4PC8A 3ITLA 4O54A 3T4WA 1E4IA 4W5UA 5LYRA 1SJCA 3N4EA 4WY0F 3KTCA 4JHMA 1GQKA 4IMFA 1V7YA 5B80A 3ATZA 1T7LA 2ZFAA 7TAAA 1XICA 3W27A 1POKA 5L9FA 2D2GA 1DXEA 3G3MA 2WXDM 3R8HA 1AH4A 1XKJA 5BXRA 1MUWA 1FH7A 3DG6A 1UWQA 4CCDA 3C3NA 3SBFA 1J0JA 1L0PA 3HGJA 4D2JA 4UNIA 1DQWA 4XV0A 3G18A 1QI0A 3ABSA 3GG0A 1MEHA 5FL1A 2BG5A 4ZTYA 2GDQA 1R47A 1OCJA 3GVRA 2E5DA 2ZXDA 1VAHA 2Z1VA 3GXMA 3DESA 3UWZA 1C8XA 2YL6A 4HK7A 2XN2A 4NI8A 3VOCA 3ITTA 3C5QA 3TQ0A 2RH9A 4P8XA 1V6WA 3AS1A 4QLLA 5JH2A 1XIEA 1MZRA 4LX4A 4PCFA 1ZLPA 3WK3A 3AS0A 2Y85A 3R25A 4UOQA 5D32A 3U8GA 1DVJA 2J7FA 4HA1A 4CQAA 2BVYA 2D2OA 5EPDA 4YWIA 5IBXA 3W86A 3G1FA 2YL8A 3SGUA 4FNQA 4HMEA 2IPWA 1Q4NX 3B8DA 4XISA 4G9PA 1CENA 1TYGA 3WCZA 2XSXA 1J12A 1DKWA 4HMDA 4LQ1A 1UIPA 4REQA 3L9CA 5DF0A 2YA2A 3TUUA 3GRIA 3V7PA 3BZJA 4JQ4A 4W8BA 1H50A 2BMBA 2AMXA 3E3HA 1VCGA 4FSAA 1UD5A 3FKRA 4AX7A 3AC0A 1V0MA 1FDJA 4G1KA 3D3AA 5C9ZA 3VDHA 1ODZA 3BV7A 3W71A 3DFSA 4KMQA 1MEIA 4PMRA 1UR1A 4Y8EA 4GY0A 5I3DA 1AFSA 1XC6A 2D23A 3BLIA 5KSWA 3E1F1 3EKLA 2ZC8A 3TYEA 5DO8A 4GISA 3GVGA 3WN6A 5I07A 4YHGA 1F8MA 1F3WA 2I5QA 4F3HA 4JFUA 3W7NA 5AHEA 4AVFA 4P7NA 3E2SA 3VD9A 3IJ9A 4HYRA 3GD6A 3PJXA 3KTSA 2NQZA 2YBVA 3T2OA 5FACA 1E3ZA 3EMQA 1K3UA 5H8UA 4ADUA 3P3BA 4YYFA 2W62A 4C1NB 5EMKA 3UG8A 4R7WA 3KCLA 3N13A 1PPIA 5FEZA 1SO4A 1BSIA 3WNMA 2GYIA 2X30A 1WOBA 3LXAA 3S9IA 3PFMA 4WQ6A 4UTKA 2Q09A 2RAGA 1MFVA 3DHDA 5DEZA 4MWAC 4QJ4B 3ISIX 5HULA 1E5NA 4CQBA 3LM7A 2O9TA 1FCUA 2GDVA 4WJEA 1TJPA 3T42A 3B8SA 4AZCA 2F84A 2ON3A 4HPXA 3AYTA 4UQ9A 3H4GA 3KDOA 3VKBA 3SN4A 2UY2A 3BH4A 3URQA 3WD0A 4ZOBA 5I09A 1XYMA 1ISVA 1O4UA 3M7SA 4JQAA 1EJVC 2XH2A 3R10A 3GFXA 3A12A 2ZA1A 2HPMA 3RU8X 3LLFA 1GCYA 3EOUA 1K8XA 1KKRA 3H70A 2P76A 1EOKA 1J4EA 2GOUA 3P93A 1KKOA 3MP4A 4O14A 4ICCX 4OOUA 3TTQA 3FSTA 1B57A 3VC6A 3VIPA 1BXCA 2J79A 3CT2A 4TO8A 3TJ4A 3W53A 1CX9A 1TPDA 2Z28A 3PB0A 1LG1A 4YU1A 2C79A 2XFYA 4LAMA 5BRQA 3BW2A 5EL1A 3M0KA 3EX1A 4ZQCA 3AJXA 4EWND 3VKCA 4Q4MA 1E6PA 1PTGA 3M9YA 3VILA 3UA3A 5FAGA 1EZ2A 4IIGA 9CGTA 1UB3A 2OOGA 2E6AA 3AMGA 3OQEA 5E1QA 3VAVA 4JTSA 2REQB 3QEZA 3TC7A 1B1YA 4Z2HA 3H7UA 3BG9A 2WJFA 4QG8A 5HWMA 1DWJM 3PBUA 1ITXA 1JZ6A 5M1TA 2B4GA 3EDKA 1KCZA 3GXIA 2EPKX 2XVPA 3JW7A 5CGQA 1CBGA 2HEJA 1VIZA 2E3ZA 4PEEA 1L6GA 5IXEA 1GK8A 1YDYA 5MKGB 1HJUA 1KM1A 3AMLA 2WANA 2FYMA 4NKCA 2WWDA 3FJNA 2Y0FA 3QC0A 1I1XA 3IUHA 4BI7A 2YZ5A 1Q13A 5T8GA 3I6EA 3UU0A 4Q7BA 3E38A 3CQIA 2E28A 1GUVA 2A7RA 1XPGA 1UBPC 1UWSA 3M43A 4I9AA 4GBDA 3MW7A 3F5KA 1UWRA 3AFBA 5KZDA 3RU6A 3PBMA 1OF8A 4FLOA 2QMJA 2ZA2A 3B8TA 3MCOA 3N1AA 1UZ4A 4C6NA 2NWSA 4JIRA 3IIZA 3RXZA 3FEQA 1J0ZA 2WC4A 3GXNA 1QI4A 4LBSA 4ZBCA 3ABRA 2ATSA 2CKSA 3G6MA 3QSTA 4IJCA 4DBWA 4PMZA 3VDBA 3BXWA 1RHCA 1BXNA 2VGIA 3BSMA 4JAWA 1WX0A 4AW7A 3O07A 5M17A 2QJGA 4IFKB 4YTSA 2VO5A 1M7JA 1W1ZA 2QKFA 4RUBA 4AHOA 3MYPA 1VC4A 4X22A 4FLQA 3NEVA 1OINA 4HZ8A 5T9BG 1BRLB 1WV2A 3BDKA 1RK6A 2AL2A 3QV9A 1TB3A 4XZNX 2ISFA 3TXZA 4J3VA 3TW7A 1NFGA 4E3VA 4IPIA 4LV9A 1EGZA 3RCMA 4C1KA 3OVQA 3PPCA 4KH2A 2YOCA 4AZ7A 4MDPA 3KZPA 3UETA 1LQ0A 2BHYA 3F7JA 1MEWA 3W07A 1ZBVA 4V33A 3OEXA 1U5JA 2D22A 4WLCA 1RH9A 2E25A 3LBMA 2QCEA 5HBFA 2ZZ7A 4QP0A 3WIJA 4B90A 1ZNNA 2OYLA 3RMJA 2GVGA 1MW3A 2UWFA 3P5ZA 2E9LA 3A4AA 5B7ZA 1KGWA 2WYSA 3U2CA 3SUVA 3G1XA 4KFNA 3TA6A 2Q3RA 1EPXA 3G1DA 1IR2A 3LCWA 5JIPA 2CLPA 1EJUC 1HP4A 1K6AA 3ITXA 4Z2JA 1TV8A 2J24A 3LRLA 3SCTA 4E4UA 1EX1A 5JU6A 3QXBA 2BSLA 4XBJA 1MW1A 3MWAA 5KZEA 3BJTA 1LT7A 4C6OA 3G8RA 3CL8A 3B0PA 1XCXA 2PP1A 4Z42C 4S3EA 4ATWA 4EXAA 3WBEA 1RBAA 5FSEC 3S83A 4L56A 3E49A 1FXQA 1CGXA 3IAPA 4LEQA 4CGTA 3UPMA 3FDGA 2GVEA 3B4YA 4M8UA 4JFSA 4ICNA 5AVHA 3BMVA 4IUOA 1EH9A 2PDQA 4S23A 1GJPA 3W1NA 1DJGA 1YBQB 5A6SA 1VBRA 1TMLA 3WLKX 4H7CA 4BWLA 3S5ZA 2X2YA 1TTIA 1VBJA 3LCGA 1DPMA 4LSBA 4KS0A 5FJUA 2VYOA 8XIMA 1YXDA 3SGZA 1UJQA 3S0CA 4O19A 1GW9A 3O6AA 1IXPA 3KHJA 1DIEA 5LGZA 3R89A 3SECA 1E51A 1RV8A 3CQJA 2PDMA 4X60A 5CC6A 3VINA 1TX2A 3KOYA 5DN1A 2O4QA 3WMBA 5DCEA 2OWCA 1TUXA 1HVQA 2OELA 2RDXA 3PAJA 1PZ2A 3TROA 3LPPA 3G1VA 5FKYA 4J4KA 3V1HA 1JPDX 2OEMA 3T7VA 2X1TA 2HSAA 4E2OA 3NCOA 5HWNA 1GJWA 7PTDA 5DY3A 3LBOA 4GYPC 1VH7A 2CITA 1OFBA 4GIRA 1TCDA 3CC1A 1QOPA 3ZWTA 3LHWA 5LNSA 1IEIA 1DTUA 4CQDA 3P80A 2ZUMA 4RDWA 3C0JA 3IJ7A 3A13A 2FGLA 3W22A 1TV7A 3HJZA 2ABBA 4RZ5A 4AUBA 1H0IA 1QI2A 2ZWZA 1QDSA 3C2YA 1X7FA 1XLAA 1GEHA 3K8MA 2L5HA 3VIIA 2J66A 3IAQA 2XIMA 2VM8A 3EOLA 5D37A 1FH8A 1Q6EA 4PB4A 3VCCA 5TAOA 3OU8A 2PD9A 4O53A 4PUNA 4IIEA 1GT8A 4Z1BA 4OJYA 5I00A 4MZ8A 2PDWA 1I6NA 1UC4A 1EXPA 3VI2A 3NFUA 3SZ8A 1GJUA 3ZMRA 4B15A 1M03A 2ZRUA 3W70A 4KESA 3TQVA 1D2KA 5HNUA 1FHDA 3LV5A 3DI0A 3GS6A 4BK9A 1H7WA 3PUOA 2YL9A 4REQB 3AIQA 2GVLA 1FCVA 3BWWA 5AC5A 3STEA 3MSGA 1EJTC 4Q8PA 1A3XA 1SSGA 1M41A 1U5VA 5EU9A 4OGZA 1X97A 2IKJA 2JE8A 3I3DA 1UD6A 1IGWA 3OG3A 1T41A 7A3HA 4OQVA 5RUBA 3MBDA 3R6IA 3K1DA 2PURA 1H63A 2H9AA 4L1XA 4DHGA 2DSZA 3N34A 3O6DA 3LHUA 4HCHA 4ATDA 4OFCA 4JDYA 2P1FA 3CUFA 3WQFA 3NNTA 3FIGA 4NAEA 3S5YA 1YKWA 1CI1A 1L6YA 4HPNA 5C0QA 1Z6KA 1HXJA 3SCWA 4CVUA 1IT7A 2VD8A 4G2DA 3S46A 2DZSA 3OIHA 1A4LA 3MHGA 3ORWA 1Q6OA 5SWUA 4KBXA 3IV3A 2V63A 4IPLA 5FCZA 1WP6A 2IW0A 1XCWA 5E0CA 2DSKA 4OUEA 2VZVA 1GWJA 2PU0A 3NZPA 1LLWA 4A35A 1PX4A 5LNRA