1F74A

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL-NEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 125
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f74A00
1J4EA 6TIMA 4FNQA 3W83A 4ZVJA 3S1VA 2C16A 2H8ZA 3I68A 3R89A 1EP2A 1B9BA 1L9WA 2Y7EA 2PURA 4JTFA 2DZPA 5F1VA 3NOEA 2X1RA 1VYRA 5I3GA 1DJNA 1ME9A 4DBDA 3FIGA 3HGOA 1OX4A 4UC5A 2FPTA 4FIRA 2O7QA 3KX6A 4YMZA 3G0XA 1BTMA 2R14A 3FYPA 4X22A 3W85A 4UR7A 2DZUA 3TC7A 4UTWA 1C29A 4X2RA 3LRKA 2Z2UA 3LCIA 4WUIA 1FXPA 2P1FA 2NX3A 3WJXA 2WNNA 5F1UA 1GYLA 5D32A 2CZFA 2ZRXA 3L68A 3UNDA 1SO6A 3BO9A 3Q94A 4WOZA 4OU1A 3F1QA 1H7RA 3EX1A 3S5ZA 1AW5A 3HGJA 1TIMA 2PRHA 1ICPA 4LUIA 3BGJA 1RQHA 1H7XA 1EUNA 3QSRA 3QYQA 4IMEA 3M6YA 1DKWA 5FF4A 1JRCA 2YYUA 4YCPA 3BG9A 5EBUA 1WDWA 3Q58A 4MKNA 4XUGA 2UV8G 2WSQA 4Z08A 3S5YA 4UCGA 1FUYA 3KAOA 3LRLA 4LVFA 3MHFA 1JCYA 6ALDA 4I7WA 1NVMA 1OG0A 3QSTA 3RLUA 3LXAA 1QNVA 1Z44A 3QMSA 4JDBA 3R13A 5FEZA 1OFQA 2NUWA 4FNRA 3W7NA 3S1WA 1ZAJA 1Q6OA 4R34A 4E2BA 2OMAA 4JTGA 1JQXA 1GQNA 4AHPA 4HNTA 3GAYA 4JNMA 2V2CA 5EL1A 1DOSA 2YCEA 2VFGA 1VHCA 1FBAA 4O4WA 1X1OA 5LZLA 3NR0A 3CT7A 5AB3A 2Y7FA 2GVJA 4ML9A 3DFPA 4S2CA 3TMLA 3N14A 1LCOA 4D2JA 2ZZ5A 4DO6A 3CM4A 4BI7A 2W79A 1MEWA 4N4PA 1G4EA 1SSDA 2FDSA 4UMBA 3W7KA 2A0NA 1GEQA 4GC4A 3NQ6A 3STCA 1ML1A 1W54A 2ZRUA 3O6DA 5HUOA 2WO5A 4GWEA 3PWAA 4MZ8A 1EUAA 2A6NA 1XBZA 3NPXA 3EKLA 4H3DA 1KM2A 2NX9A 5DLCA 3ABRA 2X1TA 1EPXA 3MHUA 3TAOA 4IQLA 1F6KA 3W1PA 4IXXA 2E77A 2C0AA 2G97A 3NAVA 4OWGA 3EX4A 2GJNA 4NJIA 4HKPA 4R7JA 3GXPA 4Y90A 3LOTA 3RK8A 5LSMA 1QPNA 1KM0A 3TQVA 3W7EA 1EIXA 1BWKA 1AK5A 2FJKA 3A5VA 4TR9A 4LS2A 2E5BA 2FB2A 3GR8A 4PODA 1QMLA 2ATSA 2W0UA 1I2OA 1KLZA 2QR6A 4HPJA 3G1SA 4UTHA 4UFHA 3TIMA 4TMBA 1RD5A 1P0KA 2DZVA 1ZY9A 2OCZA 2YW3A 3CEUA 2NZLA 1MO0A 1MEHA 1SW0A 1TRIA 2V0TA 4ZQCA 2R91A 1F5ZA 1G7VA 1KBIA 4C1KA 1VYPX 1W5QA 1T0OA 3QW4B 1S5WA 4XKYA 3O6CA 3ABSA 4UTKA 3I7QA 1BWLA 4Y8FA 1WOBA 4Y6GA 3Q37A 2DZTA 3GVGA 3EWXA 2NV2A 3E0IA 3EX6A 5LHEA 4UNLA 4LVAA 3O8AA 4WZHA 4O52A 3NNTA 4NX0A 5F2MA 1HFBA 3MYPA 1G4TA 5G4EA 5AHEA 1KTNA 3USBA 4BI6A 5A8GA 5BMXA 5HWNA 3TSMA 4MZYA 3CTLA 2QDHA 4UTUA 5HR6A 4RV8A 1QR7A 1TMHA 3P81A 2Z0IA 4BWLA 3OIXA 3QRHA 5I3JA 3KRZA 2X1SA 3W2LA 1FDZA 3QPZA 2A4AA 3MI3A 1J5TA 4C1LA 3TU9A 1FQ0A 1TJRA 3W2MA 2E68A 5KMYA 2NLIA 3TK7A 4FEZA 2NXIA 4LUJA 1YDOA 4M5PA 4NJKA 5HQEA 4E2DA 1ZENA 5K3VA 1THFD 3LRMA 1YPFA 1KFLA 4K7YA 1F76A 1G4SA 3W23A 1IXPA 2QJGA 3M7WA 3DFSA 3EX3A 1KM1A 1KFJA 3PUOA 5AYXA 3HGRA 2RH9A 1QO2A 1PCKA 5LNSA 3SIZA 1QAPA 5AN7A 2OT1A 3L9CA 1H60A 3Q2DA 5AFDA 3IEBA 4DXVA 4JTKA 3GKAA 4O1DA 3C2OA 4NU7A 3BW4A 1G69A 1R2SA 2Y62A 3UYCA 3TAKA 3W1XA 5D2VA 2QKFA 1O60A 5LNRA 3W1UA 1SW3A 1L2UA 5LNWA 5K9XA 4OBTA 4TMCA 3S42A 4H6KA 4JS3A 3M41A 4MY8A 3PC0A 4YLWA 2VFHA 1GPWA 1XBXA 5AYYA 2VKZG 1NSJA 3UPBA 1TREA 4LS1A 4RZ5A 4MOZA 3O16A 3GB6A 3P74A 3NM1A 3EKZA 5EPDA 2BLEA 4JYDA 4OV9A 3LCWA 3DU0A 4FHAA 3F03K 3W73A 1VR6A 2CFFA 4BI5A 3NYZA 1V5XA 5E93A 2H90A 3I7SA 5CZTA 3GIYA 4NNAA 4YL2A 2FTPA 3PBUA 2DJXA 3FA5A 3F4WA 3G24A 1JQVA 4B5NA 2ZRVA 4FX8A 3HG4A 3LCHA 1HG3A 5DELA 1OABA 4AHOA 5HWMA 2QUUA 1W1ZA 5AC6A 2A7RA 4M6VA 2QCDA 2WPBA 3TNOA 4MFEA 3W7IA 5CKSA 1T96A 4RJEA 4UTIA 3LXBA 3BW2A 4CNNA 2CU0A 3W7DA 2X16A 3W1LA 1IF2A 3G3DA 1XUUA 4K8HA 2WNQA 3W7HA 1P4CA 2YGYA 4S2BA 5KTLA 4ALDA 2YZRA 1JULA 3PY2A 2A1YA 3STEA 4AB4A 3GLCA 3GR7A 3GDLA 3R12A 1LROA 3MO7A 4KWVA 4FX6M 1VJIA 1KM4A 3FYOA 2J6XA 2Y7DA 1LBLA 1D3GA 3FOKA 2QCCA 3C8FA 3P62A 4XQ6A 2VEKA 3BVJA 5D2TA 4O10A 3S6DA 1GVRA 3MP3A 1DQWA 3IGSA 3NQGA 4O18A 3B06A 4UXDA 4Y9AA 4Q4KA 3W1TA 1G6CA 4LS0A 3PG8A 5F2LA 4DF1A 4FB7A 2J9XA 3ATYA 3HPZA 1YDNA 2HMCA 3W2NA 5L6UA 1LLWA 2ATMA 5AYZA 4GUIA 1SW7A 2V9DA 1VGAA 3JRKA 1P1XA 3VI2A 1IIHA 3B0PA 4JIPA 3M5ZA 4BFAA 3LX9A 4GUHA 3DGRA 2O7SA 4JR5A 3W70A 3OEXA 3CWNA 1TTPA 1FCQA 4JX6A 3LBCA 4Z0SA 3TQ0A 3O6YX 2RKXA 3LLFA 4N9EA 1H5YA 1PS9A 3IVTA 4IMFA 1XBVA 3L5LA 1LBMA 4MVAA 4O1CA 4PEKA 1V7YA 3NL3A 1NF0A 3CIXA 4HNVA 1OF8A 2NUXA 3KVMA 5DN1A 2VXNA 1OFAA 2V5LA 5DCDA 3NL6A 1WA3A 1DV7A 3ZR4A 3HO8A 4K8EA 5D2WA 4RLIA 3B05A 4XZ9A 3OVRA 4PL1A 1FDYA 5C55A 3G0UA 1Z48A 3DFNA 3MP4A 4JTHA 3SFKA 1JR1A 1Q3NA 4KFPA 2E1DA 2OX1A 1WBJA 4M6PA 4QQ3A 1EEPA 3MI2A 1WV2A 1UBSA 2B7OA 2I9EA 4QNEA 4PL2A 3UWUA 4FIQA 2E6FA 4K39A 5BRBA 3L5MA 5FESA 3CEPA 3LI1A 3EB2A 1KA9F 2ZA1A 4AMAA 4NT0A 4O16A 3W1RA 2OJPA 2ZRYA 1OYBA 3SR7A 3UY7A 3S5OA 5AHLA 1JJKA 3C61A 1KW1A 1W56A 3S5NA 5T26A 4DBEA 5G2WA 1B4EA 5FI8A 1JRBA 2RDTA 4NVTA 4A2RA 3EWWA 3HBLA 2E09A 4O0KA 3FJ6A 3N9RA 4PTNA 3G1HA 4UFJA 4ADSA 1EX5A 4LWWA 2ZTJA 1GYNA 5IBXC 3IVUA 4AEOA 1ZHAA 3MBFA 3NEVA 1B4KA 3DFTA 1O95A 3A23A 4ICNA 2GQ8A 4GBUA 3TR2A 1DJQA 4K6AA 5CZ0A 3FLUA 3N2MA 4G1KA 2V5BA 1JCJA 1XDMA 2TPSA 5F4SA 5G2HA 4BR1A 3R5EA 4GUGA 5LGZA 3DAQA 1OFRA 3HOJA 3N73A 3P7YA 3TCEA 3TXZA 1SZEA 1D3HA 4GUFA 2VEIA 5KITA 4UTMA 1QFEA 3LTPA 3T55A 3C4UA 3NQCA 4IXHA 3UWQA 5I3FA 3GK0A 4M7TA 1TV5A 1G7UA 1LOQA 1O5KA 3TX9A 2ZCGA 4WOQA 2H3BA 2GVLA 3QF0A 4RXGA 3UZ5A 3O63A 1ADOA 1SPQA 2Q8ZA 3C2VA 3GAKA 3HMJG 3INPA 4ZQPA 1GZGA 3DI0A 1K02A 3CU2A 2CLMA 4RX0A 1DVJA 3ZFHA 5FF7A 5FEWA 3DKJA 1W3TA 3G1DA 3ZWSA 3NQ2A 3S0CA 1K7EA 2PRMA 5LHFA 4OE7A 1LOLA 1IXNA 5EKYA 1JUEA 1IIGA 1A50A 3P5ZA 3V75A 2BSLA 4UFMA 4ZL1A 1WXJA 1OJXA 1OFEA 3S1UA 5BNKA 1U5JA 3SY5A 1GG1A 5BOOA 3BLFA 2D73A 3DFOA 3UWVA 3G0SA 3GNDA 4W9TA 3DENA 4O13A 3R8RA 2X2GA 4RXFA 5DY2A 4NXSA 5F2IA 3TFXA 4XTIA 1AL7A 1YYAA 2ISWA 2F84A 2Y7GA 5DXXA 5KSWA 3GXNA 2EPHA 2E5DA 4RZ4A 3W88A 2ABAA 1RR2A 2EF9A 4IMGA 2Y88A 2WJZA 1L6SA 3W3OA 1JCMP 4J9JA 2AGKA 4PA8A 2Z6IA 3LCFA 3O15A 1Q6LA 2QEZA 5EMUA 3W84A 3IIVA 4ZMGA 4TIMA 1RVGA 1I2NA 4MYXA 2VFDA 2TSYA 3DI1A 3M9YA 3SZ8A 5G2IA 2X30A 4I7VA 4JTJA 2HTMA 3BV4A 2FQIA 4JGDA 1Q45A 3P82A 1OK6A 4CQAA 5D02A 1ZCOA 3NPVA 3C2RA 3LHUA 3RF9A 3VCRA 1EP3A 4LU0A 4UMAA 5BMWA 3W7PA 2ZRWA 4AF0B 3P67A 2ZYFA 3BG3A 2RDUA 3E02A 3HG3A 2P0OA 4FNUA 3W2KA 1FCUA 5BW6A 3BLEA 3BGGA 3N3MA 1C8VA 4LRSA 2ZZ7A 1W5MA 1H63A 3M5YA 3G1VA 4N9CA 3KHJA 1WX0A 1WAUA 2DORA 4L4LA 1SZFA 4MZ1A 2V30A 4RCXA 2YX0A 3GDRA 3U2OA 4WQ6A 3LGEA 3DZ1A 5D30A 2JGQA 1YADA 3CPRA 4JYEA 3SGZA 2YFNA 1RQBA 4Q32A 3W7JA 3C2EA 2QCNA 1OYAA 4MPQA 2QF7A 1R46A 1U83A 3IV3A 2ZBTA 1EB3A 4QAIA 3WK2A 4MY1A 2NXHA 4JN6A 1ONRA 2Z6JA 3PM6A 3PUDA 1CW2A 4E0CA 3RMJA 1TPWA 1KFBA 2ZTKA 1AL8A 3B4UA 3M43A 4OT7A 4HNNA 3NA8A 5G5IA 2FLIA 4OV4A 4NX5A 5AHIA 2CLHA 3LTSA 3LCXA 4JTUA 3EXRA 4O1AA 4EF9A 2Q3RA 1NFBA 4NJJA 4WXZA 2B0MA 4UIOA 3QM3A 1NF7A 5DBUA 5EY5A 3WJWA 1X7FA 3PAJA 2B7NA 3NQ7A 1XCFA 1W0MA 4XWUA 1PHWA 1W3IA 4ADUA 1TV7A 1F05A 4WY0A 1XL9A 4IMCA 1KBJA 3SSJA 2E6YA 4KWWA 5HR7A 4UFIA 3DH7A 3WJZA 1B3OA 2G5WA 3ZWTA 1QO5A 3S1XA 4A3UA 1GVOA 3C2FA 1FX6A 1R2RA 3EWZA 5CPMA 1DBTA 3LERA 4E38A 2QCFA 4Z1AA 2FIQA 2A21A 1O5XA 3OHIA 2CZ5A 1GWJA 2PC4A 5D2XA 1OX4B 2H6RA 3PVFA 5K4XA 5E1QA 3W87A 3NZ1A 1HUVA 2OT0A 3TW7A 1XUZA 2ZA3A 1AW2A 3LHYA 4NNBA 4AWUA 1XI3A 2BXVA 3G22A 3TXVA 4Y96A 2EKCA 2Q3OA 4JTLA 1F7BA 3WK3A 3M5VA 1GTEA 4RKAA 1XBYA 5AHMA 5LNVA 1KFKA 2VEMA 1OFOA 3ABQA 3IIPA 4ZQNA 2H3DA 1L6WA 2HSAA 1ZNNA 1VC4A 3NPUA 3B0VC 3T78A 2FFCA 2QUTA 1YXYA 3PR2A 5HJLA 1F6PA 3TV8A 1MXSA 3W1AA 3T44A 3W7RA 1CI1A 4BWLC 2XN1A 4EWND 2C18A 2VELA 1VHNA 2J88A 3KOFA 2NXGA 1X8FA 2WV8A 3L0GA 3QMRA 3YPIA 5KZEA 2F7FA 4X3ZA 3IIOA 4M6QA 4GRSA 3TFCA 3CC1A 1ZALA 1PVNA 4N02A 3NQDA 1KM5A 1VLIA 2YPIA 4I7UA 1I2QA 3TDFA 3TSBA 2C6QA 5I3HA 3SGUA 3MWAA 3QMTA 3T40A 3VNDA 3ATZA 4XBSA 3UXDA 1EP1A 3P80A 3H54A 3PBVA 1I2RA 1JCNA 3PG9A 1TTIA 2ZRZA 4IMDA 3EXSA 1OFDA 1VCGA 1TQJA 1H1ZA 3TQKA 5C2XA 1GT8A 4H4IA 1LLZA 1LP6A 3R2GA 4RR4A 3WK1A 3P84A 3TC6A 4EF8A 1PHQA 3H53A 4MUZA 3TKFA 2Y63A 1LDCA 4FXRA 3EXTA 3LV5A 2Q8LA 4LT9A 2VFIA 1H7WA 1TSIA 3DHDA 1E51A 1FXQA 4LVGA 2QUVA 4MJZA 4LNYA 2EAWA 5U7SA 1UUOA 1Z41A 1F2JA 2QCEA 2CLLA 1HL2A 4CQ9A 2FPYA 4O1BA 4P2VA 1P5BA 4HNUA 3PULA 4AAJA 4UUIA 1KM3A 1DORA 1I4NA 3QW3A 3NL5A 1OFPA 1YDVA 3EWYA 3W9ZA 4XBKA 1X1ZA 5H2ZA 5FEPA 1PE1A 1TO3A 1K3UA 3EWBX 4NUWA 1K7FA 5A5WA 3W1MA 3A21A 2VENA 3NL2A 2C15A 3MP5A 4K7VA 2Y85A 3L5AA 1I45A 2EHHA 3NG3A 2QCLA 4ZQMA 3HB9A 4O11A 4ZZ9A 1DHPA 4IPJA 3MI6A 1GJPA 3PS7A 4A2SA 1K8ZA 4CNOA 3RU6A 1B57A 1IXOA 1SZGA 2V82A 1I8JA 1Y0EA 4A21A 3PB0A 3W86A 3FJLA 3L66A 1QOPA 5DY3A 2AAMA 1VCVA 5GVJA 4NQ1A 2DU2A 4XKYB 4Q33A 5F4XA 3HG5A 4A22A 3HF3A 1M5WA 4NJHA 2CLOA 2GUUA 2G95A 1CX9A 4O0ZA 1TB3A 5CGQA 3PSVA 3T4CA 4GXMA 4KFOA 3KXQA 3TE9A 4GE8A 2V81A 3DHFA 4AWTA 1TYGA 1Q6RA 4O12A 3C0JA 4JX5A 2BTMA 3LTYA 2YXGA 1SO5A 1FCVA 2A5HA 1M6JA 5G1YA 1H62A 5HMSA 3P61A 5CPOA 4AXKA 4JY8A 2IQTA 1N55A 4QITA 3THQA 3G18A 3PBWA 1TPDA 3TUUA 5FF3A 5EA9A 2QDGA 3GDMA 3ANYA 1ICQA 3M44A 1DL3A 3NO5A 2C19A 3W76A 5IBXA 3GKFA 3NZRA 4LVDA 1JCXA 1YLVA 4DELA 3C52A 3UZJA 3LB0A 4M19A 4YXGA 1JCLA 1VS1A 1W37A 2CW6A 1LRNA 1QPRA 3P8IA 4TX9A 3WFAA 1K03A 2VEPA 5D37A 1OHLA 1VCFA 3P8JA 1A5AA 4YCOA 3W22A 1OK4A 1XFBA 2CLFA 1TTJA 2CZEA 3L0NA 5C5YA 3FEMA 4XTDA 5G4WA 5LNUA 2JKAA 4OGZA 3NM3A 3QH2A 2ZA2A 3LI0A 4ZQRA 2J9YA 4FX7A 3QFEA 4DO5A 3NQAA 1XDLA 2JBMA 4UTJA 1W5PA 1G4PA 1GVQA 2C13A 5LKYA 4NZFA 4AHQA 1PL9A 4L4MA 1KV8A 3UXAA 4QSHA 3L67A 4EIVA 5CSSA 1H7OA 1Q6QA 3BW3A 1S3HA 1H7PA 4NNCA 2V2DA 1SR9A 4HSOA 3MJYA 3W07A 2GVGA 1ICSA 2JKEA 1JUBA 3NDOA 1W5OA 5DCEA 4O54A 2XN0A 4FF7A 1LM1A 2BWGA 3EEGA 2WOQA 2DZWA 4TU1A 3FKKA 4QJ1A 5C54A 4ADTA 5HINA 4U28A 2A7NA 4JD4A 1ZAIA 4IUOA 1QPQA 2A2IA 3B03A 4UTTC 1AMKA 2JKPA 1PCWA 1N8FA 5D2YA 5TQLA 3W7QA 4PCFA 2ALDA 3O07A 4FXSA 5AHNA 5KINA 5HWJA 2Y61A 4N9BA 1TPFA 4POCA 1LOSA 3L0KA 1I2PA 3NXFA 2QCDB 4ONVA 3VE7A 2VFFA 3NQVA 1A5BA 3THAA 1TJPA 3HIJA 3RLVA 4QNWA 2GJLA 4EVZA 3HG2A 4LV4A 4UNKA 3TW6A 3OVQA 1W3NA 4UTLA 4X9SA 3W72A 1D9EA 1UJPA 4JICA 2H8XA 5J5RA 4UMCA 1FCBA 1VRDA 3C3NA 1J2WA 5I3IA 3A5FA 4N6FA 3WK0A 4NXKA 2YFOA 1UUMA 5D09A 2CLIA 1UB3A 3W2UA 3LBMA 5K7JA 1EWDA 5HULA 4DPQA 4HIBA 3HJZA 3GDTA 3W1QA 1ME7A 1TPH1 1KTBA 3RFAA 1ZAHA 1FWTA 3QPYA 4FNTA 2TRSA 1IXQA 4JXCA 1WQ5A 1GOXA 3U6WA 1DQXA 2ABBA 4KKXA 3O06A 3KVLA 3DFQA 1SQ7A 3HPXA 4UTWC 1KM6A 1LORA 3N2XA 2CZDA 3UQNA 1L6YA 3QEZA 1YXDA 2AQWA 2J24A 5C6MA 1XKYA 3A22A 3CB8A 1H50A 1YTDA 5CPLA 1K8XA 4R33A 3QQ1A 4S1FA 3UWYA 3C6CA 4UFLA 3IIXA 2XN2A 4DPPA 2VC6A 2WNZA 2B7QA 3STGA 3W7MA 2J9ZA 4GJ1A 1T99A 4JTTA 2XFWA 1S5TA 3O05A 1H51A 3CQ0A 4K37A 1TPVA 1EWEA 3PF3A 4WY0F 1HO1A 3QQ0A 3IGUA 1SFJA 3F4NA 1LYXA 2JK2A 4AVFA 3NQMA 3PBYA 4MIMA 1VYSX 2ISSA 4JX4A 5DCBA 1F73A 3QJAA 5KZMA 1KLYA 2ZZ1A 1QDSA 3KRUA 3LV6A 3M0ZA 1H1YA 1PIIA 1SZNA 2FB3A 4WXYA 3L21A 4CCEA 3AO0A 4WD0A 1XM3A 3VKJA 2E6AA 1XXXA 4O50A 3W74A 5F2GA 3G1YA 1H61A 1P0NA 3NQEA 4U4MA 3W7OA 4PC8A 3NQ8A 4AWSA 3MUXA 3HPSA 3BK0A 1KFCA 4LC6A 4GNJA 3L65A 2I14A 3I65A 2A6LA 1X6UA 2BZNA 4O14A 5K2ZA 3O1NA 3DXIA 1BKSA 5FEXA 5K9DA 4CCDA 2NX1A 1ZFJA 3M5XA 4MJMA 1ALDA 4O53A 3MW7A 4O28A 2C14A 5CG7A 3TJXA 5G1TA 4KFNA 4QIUA 2HS8A 2TMDA 1GTHA 4JTEA 4LC8A 3BPWA 1LRQA 4JYFA 1SU5A 1VZWA 2YDAA 4LRTA 4MFDA 4O4VA 3DBPA 3I7RA 1FWNA 4PFMA 1FWWA 4CQ8A 1O4UA 4K38A 3GNNA 1W8SA 5FF2A 4O17A 5I3KA 4IOTA 4MYAA 3PUEA 1HTIA 1OX6A 1YTEA 2DP3A 3B8DA 3BLIA 7TIMA 4UR8A 1TPEA 1QOQA 2DZSA 4ORMA 1OFBA 1UCWA 3DKLA 1TCDA 4MLRA 3B04A 2PE4A 3GX9A 1TTQA 1SSGA 3E49A 1VPXA 1RPXA 2NV1A 1WBHA 1TV8A 1Z42A 1MSSA 3UWWA 3IIZA 4CNPA 4HPXA 4IX2A 2OZ0A 3IRDA 5MHBA 3K30A 4LV9A 4RZ6A 3W71A 3SW6A 3CLMA 2PCQA 2HS6A 1ZJIA 3FFSA 1KTCA 3LHWA 3W7LA 3NPWA 3KVJA 2KZHA 5DBTA 5LGXA 3H55A 2QCHA 3C56A 2ZZ6A 2YYTA 1OYCA 1SO3A 1IGSA 3UY8A 3OBKA 3S8HA 1EA0A 1BEUA 1NEYA 5D04C 1R2TA 1T8XA 3MMTA 5AOUA 4A29A 4LW7A 1VH7A 4O19A 3KVKA 5TBOA 2ZZ4A 1OX5A 4FNSA 3W2JA 2JGYA 5AC7A 1XC4A 3CHVA 4JDYA 4JY9A 2GPTA 3E9AA 1LBFA 3FKRA 3KRSA 3GZ3A 2NUYA 4AH7A 3I6RA 3N19B 3VE9A 1AW1A 1RZMA 1JUKA 2R8WA 4O8RA 2NWRA 5D05A 3PB2A 3SJ3A 1FWRA 5D33A 2RFGA 1RQEA 1FWSA 4LTSA 3SI9A 1GVSA 4M7SA 3TJLA 3M16A 4JIQA 3VFLA 3IGXA 3W7CA 2LLEA 2A85A 3WJSA 2B7PA 2QAPA 8TIMA 2QAFA 2QCGA 2C3ZA 3NVTA 1W5NA 2I1OA 3IVSA 3QC3A 2WKJA 2V2HA 1OVDA 2FPVA 4DO4A 2Y89A 1FY6A 3OA3A 3LHZA 4EOUA 1H7NA 2ISVA 4UFKA 1TRDA 3QZEA 3SECA 4R53A 5D38A 1TPB1 4IJBA 3G8EA 4O57A 5K9CA 5L9FA 2P10A 5FF0A 1KV5A 1R30A 4WX2A 2WQPA 3G3MA 2QCMA 3NQFA 3TSDA 3M47A 1K7XA 4OQVA 5TIMA 5EYWA 3HQ1A 1VLWA 3UPWA 1GG0A 4Z1CA 3LM7A 5AHFA 3BG5A 1TPUA 3W1NA 4PH6A 3G1AA 3T7VA 3E12A 1SFLA 1F74A 3G1FA 3LLDA 4IPIA 3A9IA 5ABTA 1GVFA 3G8RA 4HT3A 2V8ZA 1W31A 4GFSA 5E0KA 3UWZA 3CWOX 4ZQOA 2VFEA 3P5YA 2W6RA 1S5VA 2BX7A 1WYIA 4O15A 4Z0JA 4RK8A 5HNRA 1KFEA 4ORIA 2C1HA 2R94A 3L2IA 4Z1BA 3TROA 3LCLA 2B4GA 1QPOA 4QM1A 1JVNA 5AC8A 2X1UA 3ABOA 1TPC1 3LCGA 3U8GA 4DQWA 1MZHA 5IM51 4CCCA 3FS2A 2YSWA 1YTKA 2PRLA 2ZZ3A 1O94A 4FNPA 4QISA 1LZOA 3GDKA 4NZJA 4DF2A 3KFTA 4OHQA 2NWSA 1A53A 3MBDA 3N34A 4YWIA 4WY0B 3JR2A 3UD6A 1QWGA 2ZFAA 5CSRA 2QJHA 3S9YA 3BARA 4DEFA 3AJXA 1C9DA 1ME8A 4N6EA 5F4WA 3G1XA 2TYSA 1M7OA 3MHGA 4K36A 4CLMA 2WSRA 2QJIA 4I9AA 3GYEA 4N4QA 4TO8A 1SUXA 2J27A 1G67A 2A7PA 2ZDRA 3W6YA 1MEIA 1LRTA 4Z1DA 1PV8A 2E5CA 4AF0A 4N2YA 4FO4A 3HGSA 5K4ZA 1HO4A 1NAL1 3LXCA 5CZJA 2WSYA 4BF9A 2Z1BA 4MLJA 3V1PA 3ZS4A 2DJLA 1N7KA 4LY8A 1OF6A 4IX0A 3TMQA 2Y70A 3STFA 2GQ9A 3P60A 1QCWA 3LDVA 3LHVA 2GQAA 1WOAA 4NJGA 2YR1A 1M7PA 1LTDA 3WJYA 4IWWA 1VQTA 2VOMA 2RDWA 3A24A 1K8YA 2CWNA 2ZZ2A 1YXCA 2E6DA 3ELFA 3CIWA 4LOCA 3M1ZA 2GOUA 4BK9A 4JTIA 5CZSA 1SO4A 5U4NA 5CPNA 3EX2A 3N9SA 4WJEA 4P61A 1YPIA 5HUPA 3W75A 3PSWA 3E96A 4IGHA 2RHGA 1UASA 4MY9A 4N9DA 2Y6ZA 3EWUA 4HN4A 3W7GA 4HSNA 3OG3A 1TQXA 1R47A 3JS3A 5KZDA 4UTTA 2G96A 3LHTA 3TH6A 1FDJA 5D03A 3MYOA 2DZXA 3RNDA 3NGJA 3OVPA 2ZQ0A 4GUJA 4HHPA 3B0UX 3D0CA 5J5DA 1RV8A 2CLEA 5DXYA 2CLKA 2YW4A 1A5SA 5SWUA 3GXTA 1AG1O 5H91A 2EGZA 3TA6A 4DF0A 4JTSA 1A5CA 4JEQA 4LVBA
chains in the Genus database with same CATH superfamily
1J4EA 5GPRA 3ZVHA 4JN8A 3S2LA 3VABA 2C16A 4L65A 2CWXA 3HM7A 2QQ6A 3AXMA 1L9WA 4GGHA 2V38A 3FEQA 4HGXA 4W7WA 1O6IA 4JTFA 1YKWA 4F2UA 2BVDA 2WXDM 4EAYA 1DJNA 4HA3A 4DBDA 2VMFA 3HGOA 1MUWA 3UETA 2VM8A 4WSKA 4YMZA 4UNIA 3W85A 1T7LA 4UR7A 1F6YA 1C29A 1DIDA 1UR0A 1CNVA 4KRZA 3CMFA 2P1FA 3MVTA 3WJXA 3UYIA 1J9YA 3AIEA 3VIOA 2WNNA 3QQWA 4YWSA 1TVLA 5D32A 2O55A 1VBUA 3GD6A 4WOZA 5LXXA 4OU1A 1BFNA 3F1QA 2ZICA 1AW5A 3HGJA 1TIMA 1XKJA 4LUIA 4XAPA 5LA2A 2J7CA 5I77A 3APTA 3F5KA 4QGCA 3VUPA 2QVNA 1EUNA 4IMEA 3UW6A 1KCZA 2Z27A 1PKNA 4HPNA 4LANA 1JRCA 3BJSA 4YCPA 1RAKA 3KP1A 3LMYA 2UV8G 4ACZB 3S5YA 2HROA 4UCGA 3LRLA 2XSAA 1LQ0A 4ZA0A 1OG0A 3RLUA 1HKMA 5FEZA 2NUWA 4JQ3A 4M80A 1OINA 1Q6OA 4R34A 4L1XA 5HNTA 4JTGA 2Q8XA 1ZJAA 2V2CA 5EL1A 2YCEA 2VFGA 4O4WA 1YQ2A 3KS5A 3CT7A 3GUGA 4HVXA 5LIYX 3VIHA 7TAAA 3WF1A 4DUWA 2VZOA 4N4PA 3UJFA 1G4EA 3KDNA 1SSDA 4UMBA 4GC4A 3N18A 1CWYA 2WWDA 5HUOA 2WO5A 4GWEA 1GVIA 3S3GA 4CKQA 4AC1X 4DM2A 1EPXA 3UFYA 3MHUA 3TAOA 3MDWA 1F6KA 2Y4SA 4J2MA 3H2CA 4RPPA 4TX6A 4Q3MA 4NJIA 1AH3A 4HKPA 2HXTA 4C5YA 3LOTA 2PUZA 3RK8A 1NWSA 2E8YA 1AK5A 1LL6A 3KS6A 4J2PA 3OG2A 2NVDA 2WWCA 2FB2A 1PWMA 2G41A 2W61A 1FWDC 2W0UA 1I2OA 3BZGA 5I09A 4S3DA 3WUBA 5LIUX 1ZY9A 4NI8A 4DN1A 3CO8A 4HBKA 2GUYA 3CEUA 4K1GA 1TRIA 4BQ2A 2ZADA 1G7VA 1VYPX 1T0OA 3TLQA 4RZBA 1AJ2A 1BXBA 3I7QA 4F0HA 3UG4A 4Y8FA 2DZTA 2H9AB 2V3DA 1R3RA 1OD8A 4WZHA 3P0XA 5PTDA 5IFTA 5F2MA 1G4TA 5G4EA 2I9UA 4GI8A 3USBA 5A8GA 5HWNA 3FA4A 3TSMA 3GO2A 3CTLA 4UTUA 1HP5A 4JQAA 4H6EA 4HB7A 2Z0IA 4HZ6A 4BWLA 3W2LA 1BD0A 3LMZA 3MI3A 3MKCA 1DWAM 3W2MA 4QDMA 3SN4A 2ZWYA 2NLIA 1FWAC 3CQIA 4EK7A 3AS3A 3QGVA 3CHDA 1EBGA 4E2DA 4CQCA 1QNOA 3EOEA 1Y5XA 1YPFA 4RL3A 3PANA 1J11A 1G4SA 1AJ0A 2QJGA 5EFDA 1MUCA 5LXEA 1QAPA 3L9CA 1L6FA 3RITA 3Q45A 4Q8TA 4DXVA 4O1DA 4NU7A 2DZBA 4A8NA 2Y62A 1JDEA 1C3FA 3N9KA 5D2VA 4A3QA 1XFCA 2J7FA 1T40A 1ISVA 2OEMA 2PP3A 5LNWA 4PUMA 4OBTA 5MKGA 4EE9A 3OLIA 1UWAA 4H6KA 4JS3A 2Y1HA 4YLWA 2BVWA 3W82A 4LAUA 3OU8A 2VKZG 5G4HC 3UPBA 5ABFA 4RZ5A 3O16A 2OXNA 3P74A 4IF2A 1XD1A 1XSJA 1PB0A 4XD6A 3NSXA 1KBKA 2WMJA 4OV9A 1V3KA 1VF8A 3OZPA 1JIBA 2AMXA 1BYAA 4PMNA 3F03K 1NM9A 2FHFA 5FAJA 2PTDA 4S23A 2Q02A 4RDWA 3LSBA 1TIWA 4ZXLA 4YL2A 1BXNA 2VDGA 3H22A 1UH3A 3F4WA 2O9OA 4C6BA 1JQVA 4B5NA 4MWAA 3HG4A 3UZXA 1G0CA 2AQVA 2DW7A 4GYPC 5AZ0A 3W28A 3R4IA 3LQGA 2WPBA 3TNOA 3T08A 1FP8A 2Q71A 1MFVA 4HNLA 1DQUA 3LXBA 3HV9A 4Q4SA 3W7DA 4I5UA 2V3GA 1CXKA 2QW5A 3W1LA 3G3DA 1XLKA 4TTUA 4XIMA 1XSKA 3CUGA 2WNQA 4HYWA 3W7HA 2YL5A 1FTXA 2I17A 3CUXA 2YZRA 3WD0A 4K1WA 4YTTA 3OYXA 9CGTA 1KKRA 2F38A 4KCUA 3GDLA 3UZZA 3R94A 4FX6M 2WYSA 3M7SA 4JQ2A 2O4QA 3FDGA 2HJPA 3P62A 3WG6A 4R88A 3WL0A 2Z25A 3U4AA 1A5NC 1PPIA 3NQGA 4EWJA 1M7JA 2VRKA 4MJ4A 2FGBA 2WSPA 2OVLA 1JZ7A 1KFWA 2RGMA 2R1KA 5L6UA 1L2QA 1SW7A 2V9DA 3JRKA 1P1XA 2RJHA 4FMVA 3S1GA 1IIHA 1UP3A 1SZRA 4E8CA 2D69A 1WZLA 2O7SA 3CMJA 3CWNA 1FCQA 4JX6A 1PXGA 4N9EA 4YYFA 1PS9A 5XIMA 1EO5A 3IVTA 1KC7A 1B3WA 3L5LA 4MVAA 1LBMA 1UQYA 5CAHA 1V7YA 3NL3A 3PTQA 2VXNA 3GFYA 5DCDA 4K8EA 5D2WA 4RLIA 3B05A 2QV5A 1E9YB 1KBLA 4PL1A 6A3HA 3MP4A 2GGIA 1EEPA 1XCWA 3NYDA 3BJTA 1EXPA 3DG3A 3RG6A 4J3TA 4JIIX 3MDUA 3T0BA 5ECUA 3LNMA 3EB2A 2Y2WA 3QVQA 4D9PA 2YCJA 4AMAA 4O16A 1IWBA 1BF6A 1FH8A 1OYBA 2GSHA 2UY3A 3ZM8A 2WZHA 3SCNA 1ENUA 1VFMA 4AD4A 2RDTA 3GVRA 3KRBA 4NVTA 2E09A 1B90A 2I5GA 4LWWA 3N2TA 2ZTJA 1AJZA 3GTFA 2WQDA 3IVUA 4D6JA 4AEOA 1ZHAA 3MBFA 1FKWA 1B4KA 4FXJA 3N4AA 1GUVA 3DFTA 3A23A 4GBUA 3TR2A 1DJQA 4K6AA 5CZ0A 3FLUA 2BOEX 4G1KA 3EB4A 1JCJA 3IUDA 2HVMA 3EZ4A 2XVLA 1XDMA 4L1GA 5G2HA 3FYYA 2W27A 3RO8A 2VZTA 4MWAE 4E4UA 3TWBA 1F07A 3P7YA 1D3HA 3AHTA 2Z28A 3LTPA 3T55A 2QMKA 3C4UA 4IXHA 3UWQA 5I3FA 1TV5A 1LOQA 2WNWA 2ZCGA 3I3BA 3ECQA 3UZ5A 1DYSA 1SPQA 5A2AA 2PDFA 3ITTA 1R5YA 3CU2A 4C6DA 5FF7A 4QQUA 1L8NA 3CV7A 4WDTA 2PRMA 4M51A 3CAKA 1IXNA 3LZ3A 1IIGA 1UD8A 2DPEA 3P5ZA 2ASHA 4ZL1A 1OFEA 4UCFA 4JIEA 3S1UA 5BNKA 3SY5A 3F7JA 4KS0A 5BOOA 4RPQA 2WCAA 3G0SA 5CLTA 4O13A 3R8RA 4N0RA 4MG4A 3OODA 3CTTA 3AFBA 4HMCA 5DXXA 3RX2A 1KD0A 3GXNA 3CT2A 4IP4A 2EPHA 2GJXA 4DZ5A 3MSDA 1CXHA 3PZTA 1U30A 2ABAA 1FHVA 3W3OA 2AGKA 3PJXA 3UJ2A 1Q6LA 3S4TA 3PZOA 4PMVA 1IYXA 2C7FA 1I2NA 2R6OA 3M64A 2VFDA 9XIMA 3QY6A 2HNHA 3RCNA 4OECA 1US2A 4CN1A 4XO7A 4LUSB 1HX0A 5C71A 5HMDA 1Q45A 4L64A 4O0QA 3P82A 5HNUA 3TCSA 3F2CA 1W3KA 3M0MA 5C9XA 1B5TA 4J35A 3SQSA 4LF1A 2A3LA 2ZX8A 4NY2A 3NPVA 4AIUA 3WQGA 2PP0A 1RXOB 3ES7A 3A4XA 2BV9A 2BBFA 4GBDA 2RDUA 3HQNA 2WVUA 5BW6A 5E0CA 4W4QA 3R7MA 3E2SA 4LYPA 3G1VA 2YLLA 3H7VA 2DORA 3LS9A 1SZFA 2VQTA 1E55A 4RCXA 3U2OA 3P6LA 4C6JA 3DZ1A 5CSYA 1YADA 3CPRA 4NZ5A 2WVVA 5CC7A 1RQBA 4IH3A 1V08A 1OYAA 1XIHA 3IV3A 4PCSA 1W3JA 1X1NA 3GE7A 1E6ZA 4GQQA 2Z6JA 1JPDX 3W37A 4TVCA 1CW2A 4E0CA 2EG7A 3RMJA 3WX7A 1KFBA 3H2AA 1I6NA 2ZTKA 1H09A 5BU9A 1EX1A 4FLQA 1C9WA 3B4UA 3M43A 1E3ZA 4GGBA 1QHOA 2FLIA 4ZFMA 4NASA 1AH0A 3LTSA 3LCXA 4ZO9A 1OG6A 4EF9A 5LA1A 4Q7BA 4UIOA 3SDOA 1NF7A 3D3FA 1L0PA 2B7NA 4HU8A 1XCFA 3GBEA 3QV6A 3WBWA 1W3IA 1PKLA 4WY0A 3ZVHB 1B3YA 3D6NA 1UP2A 2QPUA 1UC5A 3WJZA 3S1XA 3SAZA 3ARWA 2IS7A 1J0JA 1FX6A 1MXDA 1UC4A 1DBTA 3LERA 3CBWA 2QCFA 1V6UA 5GJNA 4E38A 3SM0A 1CGTA 4HK7A 2FIQA 3PBMA 4A3RA 4IJRA 1O5XA 3VMNA 1FWJC 3DUGA 4GQGA 2H6RA 3PVFA 4FP1A 1U22A 3VINA 1EDGA 2JEPA 3CPUA 3LPPA 3BMVA 3LZ5A 4ZR8A 1WPCA 1S2UA 1XUZA 3ISIX 1F7BA 3WK3A 5HATA 3NEHA 1CGVA 3E2RA 4MGGA 4RNHA 1NH6A 1V51A 2GOKA 2O92A 3H26A 3GH4A 1BLIA 1J18A 1H49A 1L6WA 3EBVA 3EEZA 4Z2KA 3QKZA 1VC4A 1R87A 2NQHA 4R5EA 2WC3A 1PYFA 2E67A 4DWSC 1O1HA 3TV8A 3W1AA 3V35A 3WELA 1NP0A 3W7RA 4RE2A 3A64A 3PZGA 3CH0A 1TJ1A 3KOFA 3RMEA 1X8FA 3L0GA 1H4PA 5E0FA 4P8UA 1AODA 1BSIA 4X3ZA 3IIOA 1C7TA 2OKTA 4M6QA 3TFCA 3CC1A 4GYPA 2CLPA 1KM5A 1I2QA 1YEYA 5EB8A 3F2DA 2OYKA 4AW7A 5C9UA 3MWAA 3TZFA 3VNDA 1PYMA 3CUIA 2OWCA 1TMLA 1PEZA 3UXDA 1CGUA 1EP1A 1I2RA 1JPMA 1JYNA 3PG9A 3MC5A 4XB3A 2JF7A 3EXSA 4ZB0A 1TQJA 1XLAA 3ZSSA 2NT0A 3TC6A 4EF8A 2VDHA 2Q8LA 2QMJA 1H7WA 1TSIA 3GFXA 3KCJA 1FXQA 4GINA 1X97A 4LVGA 2QUVA 4FLSA 4MJZA 3AC0A 1BAGA 4C1NA 4S3FA 5U7SA 1LG1A 4BCEA 4B15A 4O1BA 3ITGA 1VBRA 3PULA 4AQLA 1ISZA 4D1IA 2V3FA 1DORA 3UXKA 3QW3A 1KGUA 3W6MA 5H2ZA 5FEPA 1PE1A 1K7FA 2QJJA 3VZYA 1GJWA 3KUMA 4XAYA 2XM2A 3NL2A 2C15A 4QLJA 3HN3A 3LEPA 1U1HA 3FN9A 1BG4A 2WCSA 1KNWA 3Q65A 3SSZA 5AC5A 3H21A 1GJPA 2Y8KA 4A2SA 1OIFA 4CNOA 3RU6A 2V82A 1I8JA 1RUSA 1Y0EA 4MPKA 3PBGA 4MDPA 4PMUA 4WVXA 5DY3A 2AAMA 4IT1A 3HURA 2OWWA 1SFTA 2CLOA 2GUUA 3T4CA 3SCRA 4GXMA 4KFOA 3ZJ6A 4AWEA 2J74A 2V68A 2YIHA 4GE8A 4XKMA 3WQFA 3CXOA 3DHFA 1JYXA 3RM8A 3C0JA 3LTYA 1SO5A 4QHRA 1UA7A 1M6JA 5G1YA 3P61A 5CPOA 3DGBA 4H9XA 3TTQA 4F48A 3SCUA 1XRVA 2VYOA 2QDGA 3ANYA 1XRFA 2DGAA 1PX4A 2WKGA 1RK5A 3NZRA 2ISFA 1TCMA 1VPYA 2CXGA 4G9PA 3ITXA 4QE5A 4GNKB 4H7VA 4YNGA 5GNXA 4PMJA 4M19A 3CLWA 1VS1A 3UGRA 1WUEA 4H6QA 2AKMA 4CU8A 4E4PA 2CKRA 4JTDA 1A5AA 1OSEA 1XFBA 4GZ7A 3Q67A 3N12A 4W84A 1ZBKA 1JPHA 5GNZA 3WQDA 3IJ6A 5G4WA 3LBOA 3QH2A 4X61A 2J9YA 3N11A 1AQFA 5JXQA 1X7IA 5B80A 3ZIZA 1GVQA 2C13A 4Q8QA 3QTPA 1US0A 3WLRA 5MKGB 2J7BA 5XINA 3L67A 4EIVA 4GI9A 1PJ9A 2XJ7A 1H7OA 2BVYA 1UROA 3CWHA 1Q6QA 4PB5A 5ABFB 1Z69A 2XFRA 2D24A 4G5DA 4DXKA 2CHRA 3B9AA 1SR9A 4K8GA 3E0FA 4B5VA 2YLAA 4KWSA 5C8BB 3FXYA 3W07A 4GY0A 4ZFCA 4H00A 4MM1A 1XV8A 2YJQA 3NDOA 3LN3A 1W5OA 3VNYA 5DCEA 4O54A 4GVFA 1EOMA 2WOQA 3ABXA 4W85A 4QJ1A 3CZKA 4HCHA 3WDRA 1C93A 2A7NA 2BY0A 2Z24A 2PDJA 3B03A 1XWYA 1AMKA 3IARA 1PCWA 3H2OA 4U5IA 5TQLA 3W7QA 5FL0A 1V6XA 4MWAB 5AHNA 1ITCA 4OVXA 4F0RA 3E0WA 4N9BA 1QWKA 1NWUA 3UXLA 3VFCA 3OBEA 4B3LA 1LOSA 3NXFA 3MO4A 2RJGA 2VFFA 2FZ8A 3JZUA 2BXYA 3VKDA 3GSMA 1TJPA 2GJLA 1P0EA 5CC5A 4AY8A 3TW6A 2ZUVA 2VURA 4ZO7A 4I5XA 1Q7ZA 1VRDA 2R1PA 2YCLA 5D9OA 3U2ZA 1DJHA 1UB3A 1J2BA 4IFOA 1QNPA 2JALA 3URQA 4GQ0A 1TPH1 3OHMB 1KTBA 3RFAA 3HA1A 3QPYA 1DQXA 2ABBA 5BZAA 1G5AA 3S2MA 3O06A 3ARPA 3HPXA 4UTWC 2AMGA 4INFA 2RUSA 4Q4MA 4IP7A 1XIEA 1L6YA 2PLKA 1J0YA 1YXDA 4PTXA 5HMEA 2GL5A 1CBGA 3CB8A 3BSMA 4L80A 1YTDA 5CPLA 5ECVA 3ITOA 4UFLA 3IIXA 3SCTA 1L6GA 1S5TA 4KRTA 1H51A 4K37A 5RUBA 3PF3A 3UR2A 1E1FA 3QQ0A 2GDVA 1JDCA 3EOOA 1UHVA 4J28A 1ZCCA 2XVNA 1F8IA 3PTKA 2VVSA 5HNNA 4AVFA 3H24A 1VYSX 4Z2JA 1SJDA 3QJAA 3KRUA 3LV6A 4RDYA 5EMKA 4EANA 3UR7A 4WXYA 4L56A 4CCEA 2WSKA 4D6HA 2VGFA 4IIGA 4OUEA 3VKJA 4JKMA 1KXVA 4LSBA 3T4WA 1ZBVA 1XLGA 2VVNA 1H61A 4U4MA 4PC8A 3MUXA 2Z1SA 4ML4A 5JMUA 4QFUA 5BU6A 1IGWA 3VDCA 3GS6A 2CZVA 3GC2A 3AALA 3DIPA 3I3DA 2A3CA 1U5HA 2QDEA 5A2BA 4MJ2A 4EP8C 2TMDA 4JYFA 3E1F1 4IG2A 1RP9A 4MFDA 1C7SA 3UJEA 5CH9A 5A8QA 4MAVA 3E74A 3BLKA 1OY0A 4K38A 2ZUSA 2KAUC 5FF2A 3MY9A 4IOTA 2ZX7A 3PUEA 1HTIA 1CCWB 3NGFA 3AUOA 3B8DA 3BLIA 1EFZA 1KRAC 5I79A 3W25A 1PKMA 2CNCA 1QOQA 1MXGA 5MF5A 3DKLA 1TCDA 3B04A 3GX9A 3CJPA 3H7UA 4S3BA 1MSSA 3EOUA 4MAZA 3TN3A 4HPXA 3DECA 3IRDA 5MHBA 2DUAA 2ZX6A 3DYOA 5DMLA 3SW6A 3VKAA 2IXUA 2HS6A 1ZJIA 4DWSA 3W7LA 3AYTA 2VHLA 4C6LA 5DBTA 2QULA 4EXAA 1SO3A 1IGSA 3KBMA 1EA0A 3V0TA 5D04C 1R2TA 3KE0A 4CEUC 4LW7A 3RLHA 3C2YA 5FKYA 1OX5A 4DBSA 3CHVA 2PDMA 3OGRA 2GPTA 3PZUA 3KRSA 4U33A 2GJXB 4IJCA 2FH8A 3DCPA 3VE9A 4HCDA 1Z32X 3L23A 1AW1A 2G4FA 3RX3A 2HV5A 3MV11 3VMPA 5D05A 2BASA 1E72M 2FYMA 1FWRA 1RQEA 4LTSA 4JFWA 1M03A 1GVSA 1UKQA 4NAEA 1VFLA 4OJYA 1EYWA 2REQA 4L9ZA 3W7CA 1JF5A 2A85A 3B40A 3REQA 3WJSA 4UB9A 1V93A 2QCGA 4FXFA 3NVTA 1W5NA 3TP4A 2OQHA 4ZEPA 4PSRA 1W6TA 2V2HA 4DO4A 2Y89A 4QCEA 4D1JA 3LHZA 3OO2A 2UY4A 4UFKA 3QZEA 3WLTA 1E0TA 1TVPA 3EDJA 4GI6A 4YVVA 4R53A 4PMQA 1TPB1 4O57A 5HANA 4PSPA 4GC3A 4WX2A 5F7UA 2R1NA 3AMKA 1K7XA 1NU5A 2WMGA 5XIAA 2GQ3A 1V6YA 2BY3A 3U7VA 5I23A 4GY7A 1FWIC 3BG5A 2WVVB 3W1NA 4PH6A 4XZWA 1A0DA 5GNYA 1S2CA 1SFLA 4QE1A 3MU7A 3CZJA 1W91A 4LBUA 2VD9A 2PDGA 1AD4A 5TAOA 2DIJA 4C6MA 2ZIDA 2V8ZA 4C6QA 2D3NA 1UOKA 2VFEA 2W6RA 1S5VA 1WYIA 4Z0JA 5HNRA 2CKSA 3TROA 3R0KA 8XIAA 4Q6JA 4ZTYA 3U8GA 1TZ9A 2YSWA 1GQKA 2Z2AA 3NDYA 5FJJA 1TWIA 4H8NA 2A3BA 4FNPA 4PFHA 4QISA 1JZ4A 2F6XA 3TYDA 4HNCA 3KFTA 1A53A 3IS4A 3MBDA 5A6BD 3QY8A 4WY0B 2CBIA 3JR2A 3UD6A 2ZFAA 5I78A 3VOJA 2YZ5A 3FXGA 1ME8A 5FIPA 4BQ3A 3RX4A 4AIBA 1JYVA 1M7OA 2W9MA 4DYKA 2Q6ZA 2XIIA 3POHA 4H2CA 1XLEA 4TO8A 2DT1A 1PDZA 4AZ6A 2W62A 3BMXA 4AMCA 1EL3A 4HK5A 4HTYA 1RVKA 5CJNA 3T2QA 3GIQA 4AF0A 4N2YA 5DT5A 1OWQA 5K4ZA 3BANA 5BOFA 4MLJA 3ZS4A 1KO0A 1MRAA 1OF6A 2QJNA 1WZKA 4I8DA 3TMQA 1R7OA 3GVWA 3LDVA 4PMXA 4NJGA 2YR1A 2IKJA 1M7PA 1LTDA 2WANA 2GSJA 3SCOA 3WJYA 4ZGYA 5A6SA 1YXCA 1JXKA 1RA0A 3ELFA 3CIWA 1K4HA 3T1GA 5CAKA 5FSEC 1SO4A 5CPNA 3N9SA 4P61A 3NDZA 3WMSA 1V3LA 4IGHA 4F4RA 2RDXA 2W92A 4PRTA 3EWUA 1OC7A 3W7GA 5ABEA 4HSNA 2PDQA 1VBHA 1ZSXA 3N25A 5KZDA 2G96A 1W9UA 5D03A 2OKOA 1NOWA 3RNDA 3WL1A 1XIGA 3AS2A 3NGJA 2EPLX 1C92A 4ZXOA 1ONEA 1E70M 4GO9A 2EG8A 3IK4A 1A5SA 1W1B1 1WXZA 2F2HA 1YIXA 1EGMA 5H91A 1E6PA 4LVBA 4EPBC 5CGMA 2YA0A 5EMJA 1RHCA 4ZVJA 3AIBA 3WDQA 1B9BA 3QFWA 2X2YA 4PCNA 3VC6A 3GXIA 3DBNA 1UKOA 4Z2GA 1C8YA 1UWTA 3ARVA 1RPKA 2E4TA 3UA3A 5BCAA 1WP6A 1VYRA 4C90A 5I3GA 3IJLA 1OX4A 4UC5A 2FPTA 1H0GA 4C1NB 1E6NA 3ZJ8A 2O7QA 5IDZA 3HQPA 4X22A 3M0YA 1J6PA 4HYVA 1W8GA 2AAAA 2DZUA 4EAMA 3TC7A 3MUAA 3GHRA 4UTWA 4X2RA 3LCIA 4W8LA 1B2YA 1FXPA 3EB3A 4DBWA 3LM3A 5BRQA 3WEZA 2P0IA 5F1UA 3TQPA 3RPTA 2CZFA 1F4HA 3S6TA 2ZRXA 1IEWA 1VAHA 1HKIA 3BO9A 3Q94A 4OBRA 1AMYA 3AU2A 1A3WA 3EKGA 1ICPA 2WZMA 4F79A 3CH9A 3QYQA 1DKWA 2VQUA 3B8UA 3GW3A 2F6UA 4UQEA 5EBUA 3RXZA 1VJZA 3TN4A 2WSQA 4Z08A 3KAOA 4EX4A 1A5MC 3QSTA 1BQGA 2VCCA 3LXAA 1QNVA 4QLLA 4HYRA 4AD0A 3ZJ7A 1R38A 3W7NA 3S1WA 1HVQA 1QNSA 2OMAA 4JNMA 1DOSA 1T5AA 1VHCA 2HBVA 3PZMA 4BF5A 1OC6A 5A6KA 4BHYA 5AB3A 2Y7FA 2FZMA 5B7ZA 1UR2A 1M41A 3TMLA 2BNJA 2ZZ5A 3MUZ1 3CM4A 3WBXA 2W79A 1A5LC 4MUPA 2PTYA 4CD8A 3VOIA 3VTRA 1FWEC 4S3JA 2PEVA 1GEQA 3NQ6A 4QDWA 4I8YA 1W54A 2ZRUA 1HGWA 5IDIA 2R9RA 4HZ8A 3VM7A 1XLFA 1L8PA 1NWTA 4GH3A 1MZRA 3EKLA 4H3DA 5DLCA 2IKIA 4GQBA 3ABRA 4JZ5A 3W1PA 4IXXA 1XRTA 4L6DA 4XAGA 1Q7MA 4OWGA 3S5SA 2PDHA 3VIPA 2Z2BA 1IEQA 1A5OC 4R7JA 4Y90A 3GNPA 3VK5A 3D46A 4E6MA 1GW9A 5I03A 2FJKA 4TR9A 4M24A 3RGTA 1R85A 4HPJA 1ZB5A 4UTHA 3G2GA 4Z2HA 3WNLA 3NIYA 1P0KA 2WPGA 1OADA 2YW3A 2NZLA 4ZQCA 4DAFA 1F5ZA 4ATLA 4IHCA 4QP0A 1A47A 4WGHA 2GYIA 3UZWA 3QW4B 3ABSA 4UTKA 3W26A 3SQLA 3U5YA 1WOBA 2PDKA 3Q37A 4Y6GA 3GVGA 2NV2A 2PDYA 1UIOA 3HPAA 1GKQA 2PP1A 4KT2A 2E28A 4KGLA 3GWQA 2XZ9A 1UPPA 3GG0A 3DN5A 3UPMA 1S39A 5BMXA 5AKQA 2J8TA 4LNCA 5E9AA 1QI5A 1TMHA 2VL4A 1XG4A 3B9NA 4MF4A 3U9IA 3QRHA 3V0UA 2X1SA 3TVAA 2A4AA 3TYEA 1J5TA 1VENA 4C1LA 1TJRA 4ZODA 4F2TA 2NXIA 3RHGA 4AD3A 3PTMA 1IR2A 1U2YA 1Z3NA 4UQ9A 4V2XA 5DMYA 4Y9OA 2YCLB 1ZENA 5K3VA 1THFD 4PYSA 3LRMA 4C6PA 1RD6A 4TVUA 4K7YA 2QNEA 2XISA 1F76A 4AEFA 3KWXA 3W23A 3M0IA 3DFSA 5M03A 1KM1A 2X7VA 3QC0A 1E0XA 3CO4A 5AYXA 1E3XA 4XD3A 3UG8A 2RH9A 5LNSA 2ZUUA 3TTSA 3WLJA 1RA5A 3SCSA 5AFDA 4GPNA 3C2OA 1R2SA 3UYCA 4KIEA 3W1XA 4N7QA 4WJXA 2PGWA 4ZTXA 5LNRA 1L2UA 2PDXA 1M7XA 3M41A 3OA5A 3N29A 5AYYA 1NSJA 4LS1A 4Q6XA 1RCXB 4NILA 4WKHA 2E8ZA 3GHTA 4JN7A 4PRRA 1V4YA 4JYDA 2Z1KA 3LCWA 4JIRA 1Y7VA 4LCRA 1UD2A 3QTGA 4DJDA 4KIRA 2R82A 2EPMX 3NYZA 5E93A 3RUBL 1HP4A 3BLDA 2WMFA 4GI4A 2YB4A 1Q2SA 3G24A 2NQ5A 2J8GA 1OZQA 3LCHA 1HG3A 5DELA 4AHOA 3B97A 3KDOA 2ZOXA 1W1ZA 3DEQA 2A7RA 2QCDA 1X38A 1WDDA 4LYKA 3PFRA 3NQBA 4MFEA 4E5TA 4RJEA 4UTIA 3COTA 3IWPA 3ZYZA 1EXBA 1UWIA 4LY4A 3T0TA 2E9LA 4LB4A 2X05A 2EPNA 2FHBA 3WMCA 4S2BA 3SB0A 2QF8A 2IQDA 4C6CA 3VNKA 1JULA 1Q85A 3R12A 1O66A 3FYOA 4FLRA 1FFRA 1LBLA 3FOKA 2NQ9A 4M1RA 1S2WA 1I1WA 4XQ6A 4IG2B 4AVNA 1UJQA 5D2TA 4Y9NA 2ZXAA 1OT1A 4O18A 4UXDA 2Y5SA 4Q4KA 3W1TA 4LS0A 4DF1A 2J9XA 3B8TA 3W2NA 1LLWA 5AYZA 4R3UA 4XZNX 3XISA 1Y5VA 3VI2A 3B0PA 2E40A 4JIPA 4N42A 3M5ZA 2I5IA 2HNEA 3DGRA 4JR5A 2YL9A 3LBCA 3PUGA 2VC9A 3O6YX 3UJRA 4JL2A 4QR6A 3TLLA 1ZQ5A 5FAGA 5CBBA 4PEKA 3ZT7A 2PZ0A 1JAEA 4HNVA 1OFAA 4IPNB 3H4XA 1CZ1A 1DV7A 3HO8A 3FVDA 4XZ9A 4DWSB 2PLCA 3OVRA 5C55A 1Z48A 3T05A 4QS5A 1JR1A 4KFPA 2E1DA 2OX1A 4WRHA 3L4VA 4M6PA 4QQ3A 4AYSA 3WF0A 3MI2A 1WV2A 2B7OA 2I9EA 3UWUA 2ACSA 3UNTA 1A0EA 1FWFC 3VKBA 2IPFA 1MFUA 1KQYA 2NQJA 3I6TA 2E6FA 4K39A 1X96A 4JAWA 3L5MA 3CEPA 3S9IA 1Q7QA 1NFGA 5BWFA 2BY2A 2ZA1A 3VILA 2VCAA 5JH1A 1J12A 1ADDA 4I6KA 5AHLA 1U33A 1KW1A 3SUWA 2VO5A 5DANA 3V18A 3GTIA 6XIMA 4ADSA 1EX5A 3AS1A 4GIRA 1GYNA 5IBXC 4WF7A 1ZPTA 1G1YA 3M46A 1XICA 4NAEB 3ARYA 5FD0A 2REQB 4O1EA 2XH7A 2DUXA 3UEQA 2JFEX 4XSMA 4GCAA 3REQB 4TVDA 3UU0A 3GTNA 2ANUA 3KBSA 1G94A 3MPGA 3QHOA 3R5EA 3CZ8A 4GUGA 1P6WA 2BVTA 1YW1A 1OFRA 3WIJA 3ZOAA 3WD1A 5M2FX 3HOJA 1KGWA 1HQTA 3URBA 4WDWA 5E70A 5IHSA 4GUFA 4UTMA 3DESA 5JQ9A 3IANA 3NQCA 2FGLA 3TX9A 4A4AA 1UW9A 4WOQA 1K70A 5A69A 4JTQA 4RXGA 3O63A 2J79A 2Q8ZA 3HMJG 1Q8AA 4CN4A 3INPA 2QHAA 3ZR5A 1K02A 2W67A 4ATDA 1ITQA 1DVJA 3OGVA 2G0WA 3FX4A 3AYRA 3DKJA 2OLAA 4L4PA 4IIEA 4PBEA 1QJWA 3BCFA 3RIKA 3KCOA 5HJXA 4Q8PA 3AS0A 3S6OA 1DJYA 1GOKA 2I7GA 3ARRA 3SRHA 3N2BA 1XX1A 4FOJA 1EJRC 4GZJA 3UWVA 3W01A 3WQOA 4A05A 4EXBA 4NXSA 1PAMA 2F84A 2Y7GA 5KSWA 3ZXWA 3VIGA 1TR1A 2EBNA 2PTXA 2XIOA 4MNJA 2I56A 3W88A 4IMGA 2OLHA 4F9JA 2Y88A 2QUMA 4J3SA 4ZSUA 4PA8A 2Z6IA 3LCFA 3O15A 6XIAA 3K4DA 3IIVA 5A95A 4ZMGA 1RVGA 2WMHA 4B4FA 2TSYA 3MSRA 4TOQA 3QBUA 3DI1A 5G2IA 3ITYA 4I7VA 3NURA 3WEOA 1DJIA 3BL3A 4PMRA 4FPSA 4BEUA 1I9CB 1OK6A 3PPHA 4CD5A 3CHFA 1JPKA 1SGJA 2FTWA 1J6OA 3O9NA 1A4MA 1EP3A 5BMWA 2HVOA 4LAKA 3W7PA 2ZRWA 3NO3A 3L4TA 4AF0B 4ZSTA 1F9CA 3E02A 4YIWA 1J96A 1HNYA 3VOFA 2CESA 4LBSA 1FFQA 1GVYA 1JDFA 3AISA 1IQ8A 3M5YA 4GNVA 2XPKA 3KHJA 1XLIA 3WQCA 4MZ1A 3WF3A 2A3EA 3LGEA 3SRDA 1KR1A 4LGXA 2BP1A 1S5MA 3POCA 3BWWA 4GIAA 3GFZA 4MPQA 1E6RA 4DHGA 2VOTA 1G01A 1KRCC 2Y24A 1YX1A 1VP5A 4IFRA 1EO7A 3UBPC 2G8ZA 4ICMA 1QPKA 5TF0A 2NXHA 3FJ4A 1ONRA 1NIUA 3PM6A 5A8MA 3PUDA 1I60A 1J01A 1P6CA 1AL8A 4OT7A 5EGRA 4HNNA 4LAZA 4H2HA 1PKYA 1PTAA 2CLHA 3N1AA 3EXRA 4O1AA 3QM3A 1BYBA 1X7FA 4XWUA 2FTYA 3NZQA 1PHWA 4ADUA 1TV7A 4IQEA 2OSWA 1HGYA 1XL9A 1KBJA 3L2LA 4KWWA 2CIPA 4UFIA 4JQ1A 2V6AA 1B3OA 1QO5A 4A3UA 1MQQA 3WQEA 3EWZA 5CPMA 1EQPA 3OTRA 4Z1AA 1Q66A 2A21A 3ICJA 3OHIA 3VNMA 5C7VA 3VIFA 1V02A 1OX4B 1EF3A 3C0SA 5E1QA 3W87A 2P8BA 3NZ1A 1UMLA 3LK6A 1HUVA 2OT0A 3N3TA 1JXJA 3AMGA 3TW7A 2VZUA 3LHYA 4AWUA 4ZB2A 4AD5A 4CNSA 3NZGA 3SRKA 2Q3OA 5I00A 4HD5A 3A13A 3TEVA 1GONA 3V7PA 1KFKA 1OFOA 2QPSA 3EDFA 3ABQA 4GLEA 4FLOA 3CZEA 4ZQNA 4HA0A 3GH7A 3EYPA 3NPUA 3B0VC 2FFCA 3AJ7A 2OB3A 3PR2A 4BA0A 1J0HA 5HJLA 1FHLA 1F6PA 1UD4A 3QR1A 5IXEA 3T44A 4PULA 4BWLC 1E1EA 3P14A 3MT1A 3BICA 3WQWA 3VGFA 2WV8A 1GHRA 4QEEA 4GIYA 3QMRA 1JZ5A 3SUTA 3W53A 3LPOA 4F8XA 3WNNA 4H41A 3H4GA 4S3AA 1ZALA 1PVNA 4QLKA 4N02A 3BTNA 3TYCA 2YPIA 4V15A 3WENA 5I3HA 3GC5A 4GD0A 3VIIA 3N6QA 2VP8A 4XBJA 2Z1VA 2GVYA 4MKVA 3H54A 1JCNA 1VFOA 8CGTA 1Q5MA 4IMDA 4ZOEA 1TWZA 5AC4A 1TZZA 1H1ZA 5C2XA 3GDBA 3JVAA 1TUXA 1LP6A 4WLCA 4RR4A 3R11A 3WK1A 3P84A 3DYPA 2AQOA 3H53A 3TKFA 2OG9A 1LDCA 3LV5A 2VFIA 1E40A 3KL0A 3MCNA 5EU9A 2HCVA 4LCSA 4GH1A 4LNYA 2EAWA 1XQLA 1VEPA 1Z41A 4LH8A 2QCEA 1LL7A 3NTYA 1P5BA 4HNUA 4AAJA 1H0IA 1KM3A 4AUBA 3GU2A 1I4NA 4D6FA 1OFPA 3ARZA 3EWYA 3NL5A 3S2CA 3AHVA 1ZLPA 1B0IA 1TO3A 1P0BA 1K3UA 3AXIA 4P7NA 4NUWA 3C86A 4MTVA 5A5WA 3VD4A 2OTDA 3A21A 4C91A 3MP5A 3H6OA 1PUDA 2PF0A 3VZZA 2QCLA 1M04A 3BLPX 1DHPA 2XIQA 4US5D 3U48A 3PS7A 3VD9A 2BOGX 2R1LA 1B57A 1IXOA 3A4AA 4A21A 3AMCA 3W86A 3L66A 1JEZA 5FJTA 2CBVA 1VCVA 2NSOA 3V5OA 4TXEA 5CGQA 4V1XA 2EQDA 2J78A 1RY8A 2J77A 3KXQA 3TE9A 5I3DA 4C6EA 3B8WA 4DRSA 2V81A 3WD4A 3KZSA 4M8UA 4GYJA 1TV3A 4QJ3B 2YBVA 2BTMA 1V3JA 7ODCA 1H62A 4ZOCA 1Z9AA 1N55A 3ONCA 2QT3A 1S46A 1V0KA 3PBWA 2UY5A 3WLQA 3VDHA 4R9XA 1XISA 3M44A 1DL3A 3NO5A 2OO6A 2I16A 1XDJA 1Q6CA 3I10A 3W76A 1IWAA 5IBXA 4LVDA 1WKDA 3C52A 3UZJA 5AYBA 4IIBA 3RM4A 1JCLA 3GYCA 5A6AA 3BXWA 3WUFA 4TX9A 3UA4A 1VCFA 3P8JA 1NQKA 2NSXA 3W22A 4JHMA 4JTCA 5C5YA 3L0NA 4CVUA 3OLGA 1V0LA 4OGZA 2DEPA 3LI0A 4ZQRA 3GUWA 2ZUNA 2AOSA 4W86A 4DO5A 2HE8A 4UTJA 1HKVA 1G4PA 2IXVA 3CZGA 5LKYA 4NZFA 4L4MA 1KV8A 9XIAA 3XINA 1ESWA 1X98A 4KEUA 4QSHA 2V69A 1H3GA 1QBBA 2PD9A 3APGA 1FP9A 2V2DA 4HSOA 2GVGA 1JUBA 3ARQA 1W1YA 2EG6A 1PX8A 4JOMA 4YTSA 1K1DA 3E2VA 1N2VA 3L4UA 1Z89A 2PTZA 2J4GA 2BWGA 2FMOA 2DZWA 3FKKA 3PZQA 4ADTA 5HINA 1KWGA 1ZAIA 3W4RA 3GR4A 2FHCA 2J47A 1J79A 2PGEA 3LUTA 4HPGA 1DE6A 4IQJA 2A2IA 1JI1A 2DH2A 3O07A 3RU8X 4DZHA 2ZDSA 5KINA 4XIAA 2DH3A 5AZ1A 1TFVA 2Y61A 1TPFA 2D23A 1I2PA 2QCDB 4ONVA 1ITXA 3NQVA 3LU2A 3QY7A 3R1ZA 3THAA 2YKKA 4EVZA 3SFWA 3HG2A 4LV4A 3OVQA 1W3NA 2NQLA 4KCWA 2OYMA 4X9SA 1DHKA 3WDIA 5J5RA 1EZWA 1J2WA 1W2VA 4R7OA 4N6FA 5I7GA 4C60A 5D09A 2CLIA 1P1MA 3TNBA 3LBMA 1EWDA 5HULA 3GQYA 4DPQA 4HIBA 1GOIA 3HJZA 4M3PA 3SRFA 5BXPA 1K9EA 3W1QA 1WAWA 4YTUA 3OQ8A 6ENLA 2W91A 3L7RA 3QLLA 8RUCA 4PUNA 4WJ8A 2PDLA 3KVLA 2OSXA 4S3EA 1JDDA 2FZ9A 1ZJBA 4KWOA 1XGEA 5E5CA 5FCZA 2CZDA 1UD6A 1CGWA 2DSVA 3QEZA 2AQWA 1XKYA 3A22A 2FVMA 1JI2A 1H50A 1K8XA 3AWNA 3TTYA 4H7CA 4S1FA 2NQZA 1MYRA 1XH1A 1ZP4A 2XN2A 4DPPA 2VC6A 2WNZA 3STGA 4WDXA 2PGFA 1TPVA 2DVTA 3IGUA 1ODUA 1R3TA 2VNCA 4UQBA 3MWCA 1W9PA 1LYXA 4O1FA 5KZ6A 5E6YA 1R9YA 4JX4A 1PX3A 1F73A 5DCBA 1Q4WA 2PB1A 1KLYA 7PTDA 1H1YA 1PIIA 1XP3A 1CIUA 1OCNA 4QBXA 3PTDA 2VX5A 3QGKC 3BQ6A 3VGGA 3UCQA 1XXXA 4CN6A 4HTBA 2BOFX 3W74A 4C6FA 4WEVX 3AUJA 1KRMA 2W3ZA 3PP7A 4P7QA 2VTFA 2VJXA 1VD6A 1KFCA 4GNJA 3STPA 2I14A 4Q22A 3T8QA 3BE7A 2A6LA 2V5CA 2J66A 2BZNA 1JNEA 1FWGC 3OP2A 3LENA 1BKSA 5K9DA 4CCDA 2IPWA 1MW0A 4UWMA 1MW3A 4ZENA 1ZL1A 5ABGA 4HA1A 2BGNE 2NV9A 2ISDA 3MW7A 1P0DA 1PWLA 5CG7A 3TJXA 5G1TA 1J0KA 2C79A 5D8ZA 1XIJA 4JTEA 3BPWA 4LRTA 3I7RA 3E2QA 3CQHA 4PFMA 4CQ8A 3CMGA 3CUHA 1O4UA 1GGOA 4G56A 4E8DA 4X0NA 3EA2A 3HPFA 5DMNA 2OYLA 3BH4A 4MYAA 4PCTA 1EC9A 1WZAA 5M17A 2DP3A 4ORMA 1OFBA 1UCWA 1QW7A 2C1GA 3QV8A 4AZ5A 2X8RA 3IAPA 1RCQA 1RPXA 2WVSA 1WBHA 3IIZA 3QV7A 4CNPA 4QXIA 2OZ0A 1VIZA 1UH4A 3QR0A 3W00A 1LG2A 4LV9A 4F2BA 5A8OA 1YBQA 3UR8A 1V3IA 1YHTA 1J0ZA 3PK7A 1XHGA 5EBAA 1W9VA 1UZHA 4DO7A 3QHNA 2DW6A 1CLVA 3ERPA 3OBKA 3FY1A 3THDA 1WE5A 1SMDA 2WBGA 1T8XA 3MMTA 1KRBC 5TBOA 2ZZ4A 1P48A 1QK2A 4Q8MA 1XC4A 4JDYA 4JY9A 1QT1A 4AH7A 4JFSA 2PTWA 3WEMA 4DJEC 3C0QA 3O3RA 3TN5A 3N19B 4LPCA 3QXBA 1JUKA 3TA9A 5JVLA 3PB2A 3DFYA 5D33A 2RFGA 1XIIA 1OBAA 3SI9A 4IICA 4M7SA 3CUFA 3M16A 3VFLA 4KETA 1IEXA 2B7PA 4DWSD 4KCTA 1GOWA 2XVGA 1H2JA 1W32A 3ID7A 1XSIA 2C3ZA 4RDVA 4RNJA 2D2JA 5CBIA 1R9XA 2I1OA 3AIRA 4QE4A 3EWDA 4Z17A 3IVSA 3QKEA 5I06A 3QC3A 3VGHA 3PAOA 1JL8A 2FPVA 5A8NA 3OA3A 3ARSA 1W1VA 2HDJA 1S1RA 3PWIA 3VKKA 4HZ7A 3SECA 2WZEA 5D38A 4WR3A 4CCZA 2Z29A 1P43A 5L9FA 3BAWA 5FF0A 3V36A 2WQPA 1RCOB 1K9DA 3K8KA 4PEEA 4HMDA 1Q6EA 2R24A 2GWGA 4QEHA 1V6VA 2J7GA 3MJMA 1PIFA 2Q09A 4KPLA 4V1YA 1VLWA 1GG0A 2FVKA 4CQDA 3M6DA 2OU4A 1TE1A 3T7VA 3B0YA 1BKHA 3G1FA 1DEDA 2D0HA 3AMLA 1XW8A 1QVBA 1GVFA 4B5UA 5E0KA 4LYQA 3CWOX 4CGTA 4DLMA 3O6AA 3FNDA 4LFYA 4KESA 4C6IA 4RW3A 2DT2A 5DFAA 1CT5A 3BDKA 4D6CA 1QBAA 4RK8A 1RH9A 1TV2A 2B4GA 1I0BA 1QPOA 1JVNA 5FJOA 2X1UA 2PDNA 4DQWA 4AZIA 3FS2A 1YTKA 2ZZ3A 3W24A 5I5RA 3BZJA 5G1MA 2D20A 3FV9A 3UVAA 3VNJA 4FR1A 3GU1A 1A3HA 1GNXA 3GDKA 4ZO8A 4OHQA 2NWSA 1QNQA 3RRXA 1QWGA 3EAUA 1GQIA 3AJXA 4FAMA 1C9DA 1QHPA 3ANVA 4E8GA 3MB9A 5F4WA 3H2NA 2TYSA 4K68A 3A4JA 3BQ5A 1POJA 2QJIA 4H9ZA 3GYEA 4N4QA 3DG7A 1SUXA 2WLYA 2A7PA 4A35A 3DDMA 1UZ1A 1LRTA 4Z1DA 2E5CA 1B1YA 3U4FA 1HO4A 2WSYA 3AZRA 3F5LA 4LY8A 2Y70A 1US3A 5CCZA 1DP0A 3ARTA 1WOAA 2Y8VA 3C5QA 3LPFA 2VOMA 3FW6A 2RDWA 1XIMA 4QCFA 3FVMA 2VRJA 1EBHA 3CB3A 1JZ3A 4JTIA 4CD7A 1VPQA 4PUUA 5C9ZA 3E96A 3QR3A 3S9ZA 2RHGA 1UASA 1RALA 5EFFA 2PWDA 2Y6ZA 3MA8A 1R47A 1VBJA 1O7AA 1RK6A 3PZNA 4GZIA 4IPLA 2OQYA 2YXOA 1N8IA 4HA4A 1NARA 3QOMA 2EKGA 3OVPA 4MNMA 4LX4A 5BXSA 3B9OA 2ZQ0A 4GUJA 1HJUA 5LIWX 4HHPA 3B0UX 4I90A 3GHSA 2Z4GA 5DXYA 3CK5A 2O9PA 1OZMA 7CGTA 4IQDA 2X41A 4H83A 3TA6A 4DF0A 5CGTA 3N2CA 3O0KA 6TIMA 3W83A 3KHDA 5HPOA 3R89A 1XLCA 3AZSA 1EP2A 3N15A 4Q8NA 4Q8OA 3N4FA 1JFHA 4LXFA 1OGBA 3WY1A 3K2GA 2DZPA 3NOEA 4G8TA 2R1MA 2X1RA 4ZCWA 5CPSA 4YHEA 3FIGA 4H7ZA 2CCRA 1GZ1A 3KX6A 1BTMA 2R14A 3TYBA 1CPUA 5EMYA 2TAAA 3GNXA 4WUIA 4OBSA 5CPQA 3NSMA 2AL2A 4OZOA 4D8AA 1JGMA 2ZE0A 2GGHA 1GYLA 2OOFA 3RRAA 4D71A 2X40A 3IJIA 3ALGA 1AH4A 1XCXA 3VU2A 1XPGA 3EX1A 3BGJA 1RQHA 3EPOA 4WCJA 1H7XA 3QSRA 2GZXA 3M6YA 5FF4A 2YYUA 1BGGA 3F5JA 2A3HA 1WDWA 3Q58A 4MKNA 4XUGA 3WLNA 1FUYA 1KXHA 4LVFA 4B90A 6ALDA 4I7WA 4OUIA 3QMSA 1S2TA 3R13A 5HOSA 1ZAJA 1E0WA 4LALA 1JQXA 4HNTA 3ENLA 1CLKA 3M4HA 1X1OA 2OQLA 5LZLA 3PNZA 3NR0A 1NELA 3U5UA 3THUA 5A3HA 3GBDA 4S2CA 4Q4RA 3N14A 1LCOA 1TWWA 4BI7A 4B92A 1MEWA 1WDSA 4DX3A 1EHNA 2VEFA 4F3HA 2FDSA 1BYDA 2A0NA 3STCA 4B5WA 2PI6A 3OIHA 2EXOA 1CB7B 3T0AA 4MZ8A 1EUAA 2A6NA 1XBZA 4LYRA 3NPXA 1D7KA 5GJMA 3AYSA 3RJXA 2X1TA 4J7RA 4DNMA 2E77A 1W9XA 5ENLA 3T8LA 3G6MA 3GXPA 5E6ZA 4O8AA 4FS9A 1KM0A 3TQVA 4NYUA 2CYGA 1BWKA 3K46A 3A5VA 9RUBA 4NAFA 4LS2A 4R85A 2E5BA 3GR8A 5D4YA 2ATSA 1KLZA 1VRXA 3N4EA 1VBGA 2VX7A 1KQZA 2ZC8A 1UQZA 1RD5A 4CQBA 2XIJA 2OCZA 1DXIA 1MEHA 3OZOA 2V0TA 1V8EA 2OEKA 4C1KA 2YDQA 3AQUA 1B9ZA 2VUYA 1VEMA 8A3HA 3O6CA 1OCJA 1Q6GA 2FZDA 1N82A 3OVGA 2VEGA 4Q7NA 5LHEA 4GKLA 1ADSA 2XH2A 2GGGA 4UTFA 1HFBA 3MYPA 3S2JA 2GJPA 1LUCA 5AHEA 2J7HA 4M29A 2ZXBA 4BI6A 1F4AA 3SN0A 4DJEA 1CDGA 4RV8A 1JD7A 3P81A 1J5SA 3BAXA 5C2GA 3OIXA 1C8QA 1VJSA 3KRZA 2PS2A 4NZ1A 3ITLA 3NJ3A 3TU9A 1FQ0A 5CLWA 3O0FA 2E68A 3GU9A 4ASTA 4GA8A 2POZA 3KW3A 4LUJA 4LB3A 4NJKA 1FRBA 5A6MA 4M0XA 3LYEA 4QG9A 2CEQA 2PDWA 1IHIA 1SM9A 5FACA 1IXPA 2XGIA 1IT7A 3EX3A 4KEVA 1PDYA 3KLKA 1QO2A 1PCKA 3VO0A 4Q4OA 4J27A 2OT1A 1H60A 4DUOA 4F0KA 3IEBA 4RE3A 4XO6A 1XIFA 3GKAA 2Y0FA 3BW4A 3CPGA 5M5DA 1M1BA 3TAKA 3U7BA 1O60A 4ZO6A 3W1UA 1SW3A 1LQ2A 3S42A 3VDBA 1XH0A 5H8PA 1GPWA 1XBXA 3LGGA 4PE8A 4MOZA 1ISWA 3GB6A 4DXXA 2PFHA 3OOQA 4Q7IA 4DLFA 5EPDA 2BHZA 1XPYA 4L61A 3RR4A 4GX9A 4C6NA 1BRLA 3I6EA 5A1AA 4CNUA 2XH0A 4FHAA 4XVDA 3VZXA 2D3LA 3V5FA 2H90A 2PZNA 6REQA 4NKCA 1R3SA 5CZTA 2FTPA 5T9BG 2HK0A 1IR1A 3FA5A 5HAOA 4US5A 2ZRVA 4FX8A 5BXRA 3AYVA 5HWMA 1Q8JA 2GDUA 5AC6A 1GK8A 4M6VA 4F0LA 5HPCA 3W7IA 1HL9A 2FH6A 1AQHA 2XGZA 1DWGM 5C2CA 4CNNA 2CU0A 1EHAA 3FAXA 1UR8A 2X16A 1F3TA 1HJSA 1IF2A 2QXWA 4AZBA 3IJ8A 1XUUA 4K8HA 1P4CA 1V3MA 4HCLA 4ALDA 4GO8A 5EMLA 1T8QA 1QRQA 3PY2A 2E1WA 1W1A1 3GLCA 3GR7A 1LROA 3MO7A 4KWVA 1VJIA 1KM4A 1E4NA 2Y7DA 4DJDD 2QCCA 3C8FA 4L6HA 2VEKA 3S6DA 2G37A 1DQWA 3VXGA 4YYCA 3B06A 4JEJA 4ZE5A 4FB7A 5F2LA 3RILA 3U2CA 2JIEA 1YDNA 3HPZA 4JQ4A 2HISA 5EMMA 2HMCA 2DZAA 2P8CA 4GUIA 1VGAA 4Q4QA 1E0VA 3ALFA 4UQCA 4JFUA 2ZUMA 4HU4A 3LX9A 1SMAA 3W70A 1M68A 2ZWZA 2Z26A 1TTPA 3GNRA 2PLMA 2RKXA 2QGHA 4JCMA 4IMFA 3CL6A 1XBVA 3H2EA 4O1CA 1NF0A 5J04A 1OF8A 3KVMA 1CXFA 5I02A 1YBQB 5DN1A 2VX4A 2V5LA 4MNLA 1WA3A 3ZR4A 2ZKMX 4GFIA 1K9TA 1XYCA 1IV8A 3WDJA 3MMUA 5I0DA 1FDYA 3G0UA 3DFNA 4JTHA 4MHBA 3TN6A 3II1A 4V33A 3VCCA 4DBUA 4RE0A 3THCA 2DQXA 1XLHA 2QZRA 3R43A 4QNEA 1V03A 4PL2A 4A3HA 3VOCA 2CHNA 4EPEC 3R8GA 3E5PA 1CXLA 3MUY1 3ME3A 1D3CA 1KA9F 4NYYA 4NT0A 4G7EA 3ZQ9A 1EJVC 3CS2A 2OJPA 2WHLA 3SR7A 1Q6FA 4XAFA 3UY7A 3S5OA 3PPFA 5G2WA 5FI8A 1JRBA 4A2RA 5FOOA 3EWWA 3HBLA 3FJ6A 1BPLB 1GVEA 4PTNA 3G1HA 4UFJA 1AZ2A 4S38A 1XYBA 1ZS2A 5CJ5A 3AHXA 1XD0A 1XGZA 4S3KA 3NEVA 3TJ4A 3NXLA 4ICNA 1W9DM 1MNZA 4R9OA 3FK4A 5F4SA 1W9BM 4MMWA 4BR1A 1M01A 4I5RA 3VVGA 2PWUA 4PUWA 2HBXA 3TCEA 1SZEA 5KITA 2VEIA 3IUHA 3LD5A 3SADA 4PB3A 1HIZA 2WM0A 4Y9MA 2DIKA 1WUFA 3NUKA 4H8HA 5DT7A 1BXCA 3LY0A 3QF0A 1ADOA 4W7VA 2XUCA 3DG6A 4ZQPA 4UOJA 4RX0A 5A6TC 4M6UA 1A0CA 2XSBA 1K7EA 1RJPA 1LOLA 3EWCA 2DDXA 5TNVA 1A50A 3JU2A 2BSLA 2FKPA 1WXJA 5AVHA 4QAWA 1NTHA 1U5JA 1Q13A 4AX6A 2C1IA 5DRIA 3BLFA 2D73A 1E6XM 1DWIM 4HP5A 3GNDA 2VC5A 2X2GA 4RXFA 5DY2A 5F2IA 4B3KA 3MMWA 1YYAA 2ISWA 4JPGA 3WF2A 2PA6A 3UG5A 1EJXC 3K1DA 2E5DA 5M1TA 2HWGA 4RZ4A 3KL3A 2PWFA 1MDRA 2X0HA 4NSBA 2EF9A 3SY8A 2WJZA 1L6SA 1HJQA 1DXEA 1S2AA 2GLKA 2QEZA 2DSZA 5REQA 4DZIA 4GABA 5CXPA 2A3AA 1FWHC 5A2CA 4MYXA 3QZAA 4W93A 1MQRA 3M9YA 4IUGA 4JTJA 2YDSA 4QRNA 2HTMA 4JGDA 3RCYA 2AKZA 4KQNA 1JZ8A 2FZBA 1BTCA 4QTGA 1ZCOA 1EDTA 3C2RA 1CB2A 4LUTA 3LHUA 3VDGA 5H6HA 3VCRA 2WK2A 4XZBA 1WZMA 4UMAA 1I0DA 5JU6A 3BGAA 4FR6A 2PSNA 4TUFA 3P67A 2ZYFA 2BHYA 4LCQA 3HG3A 3W2KA 1FCUA 1EYEA 3BLEA 3BGGA 1UWUA 3N3MA 1VFHA 1QASA 2XINA 1C8VA 2ZZ7A 1W5MA 1H63A 3UWEA 4MB1A 4YVXA 4N9CA 1WX0A 1WAUA 3PZVA 3LG3A 1R0MA 2YX0A 3GDRA 4PB4A 4FF5A 4G2DA 5D30A 2JGQA 3VNIA 4AZCA 4JYEA 2PDCA 3SGZA 4D8LA 4TV6A 2QCNA 4U31A 3DX5A 2O0TA 5TD4A 2QF7A 1U83A 1GHSA 2ZBTA 2D2GA 4GKTA 4XISA 4JN6A 3BCDA 1C91A 4DJFA 4AXNA 3H2MA 1DJXA 1EA9C 3BOLA 2VCBA 3PJWA 4PUKA 2DFAA 4DZAA 2BFGA 2V5JA 3MKKA 3NA8A 5G5IA 2CXEA 2WKLA 1QI2A 3DOPA 3NO1A 1UKPA 2YA1A 3D5HA 5J8LA 2Q3RA 2D1ZA 4NJJA 4WXZA 2B0MA 3OYZA 1V6TA 1TJ0A 2I5QA 3WMBA 5DBUA 5EY5A 4DWDA 1UZ4A 3ZR6A 1W0MA 3PZ9A 3SGGA 4CUCA