1F74A

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords N-ACETYL-NEURAMINATE LYASE
total genus 125
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f74A00
1B4KA 4WXZA 3QSRA 3NQMA 2ZA3A 3MHFA 3BV4A 1GVRA 2H90A 2DORA 5DCDA 1Q6OA 3P61A 3USBA 3TAKA 3RK8A 2QAPA 2TYSA 1VCFA 4ML9A 3LHVA 3OEXA 5CKSA 3EX3A 3C2RA 4RZ4A 1H5YA 3R12A 3S1XA 5EMUA 4OHQA 1O5KA 5F2IA 2EHHA 2TMDA 4LC6A 2X1SA 1GJPA 3SIZA 3IIXA 3NPWA 4OBTA 3LHWA 2WOQA 2YZRA 1ZNNA 5CG7A 7TIMA 1G4SA 3BG5A 3JRKA 1G4TA 1VLWA 3O06A 2LLEA 1W5NA 3HG2A 3W7JA 1SPQA 1EA0A 3STEA 4U28A 3CEUA 1JUBA 3NOEA 4NZFA 5F2GA 4I9AA 2OX1A 1MSSA 5FEPA 3M5VA 1X8FA 4LRTA 4NJKA 1YYAA 1SO5A 1X7FA 3L67A 1GPWA 3W9ZA 3MP4A 4TO8A 4LVAA 3KAOA 1HO4A 2BTMA 3W84A 1QDSA 3MHGA 3N2MA 5G4WA 4LVDA 4HNVA 2QCFA 4OWGA 3CIWA 3GK0A 5AC8A 1S3HA 3ABQA 1IXOA 3TSMA 4XKYA 2NX3A 1WOBA 3LRLA 3W1RA 2JKPA 4R33A 1RVGA 4R53A 4LY8A 1W8SA 5AFDA 1M6JA 2Y88A 5LNWA 5LNRA 4O52A 5CGQA 4UR8A 3LLFA 1GVSA 3T78A 3BG9A 3G1FA 2WKJA 3LTSA 5DN1A 4NZJA 2ZZ2A 3WK2A 3G0SA 3NPXA 3C3NA 3HF3A 4M5PA 4YL2A 4AB4A 1TV8A 4Q4KA 1KLYA 3U6WA 2ISSA 5EA9A 3BGGA 3GZ3A 3W7IA 4DEFA 1JULA 3GR7A 3LI1A 4OQVA 4UC5A 3S6DA 3WJYA 3C56A 2ZTKA 2KZHA 2A4AA 1TPWA 3M0ZA 4UMAA 1A5CA 5TBOA 4RXFA 2F7FA 4CCEA 3LBMA 2C14A 3E02A 4M6QA 3GAYA 4MYXA 3EWXA 2GOUA 2CWNA 5K9XA 3EWZA 4HNUA 5C2XA 3DFSA 5F2MA 4EVZA 3GDRA 1KM1A 1LOSA 4NNAA 1DQXA 1FXPA 3E12A 4BWLC 4FHAA 2RH9A 3NQFA 3GDMA 2CLOA 3O15A 2YPIA 4FO4A 4N2YA 1UUMA 3KVKA 1I2NA 1W3TA 3TUUA 5L6UA 1S5WA 3G22A 4OE7A 2QEZA 3C4UA 3P62A 1B57A 5CPLA 4A21A 1LRNA 5I3KA 2WPBA 4RLIA 2Y7EA 1ZAIA 2A85A 2CLLA 3GXTA 3UXAA 1XBYA 4K7YA 1WQ5A 2CZEA 1I45A 5MHBA 3HG4A 3P74A 3ATZA 4FX7A 3DFPA 3NQEA 4QJ1A 1XI3A 1PL9A 3B0VC 2CLIA 1XCFA 3A9IA 3W7LA 4YLWA 3O8AA 1FDZA 1HTIA 4UFLA 5HNRA 2GVGA 1SU5A 1LRQA 2QUUA 1A53A 1MEWA 1A5BA 1OABA 5AYXA 3W7HA 3IGXA 4OGZA 3S5ZA 1W3IA 1LOQA 3S8HA 1DHPA 1SFJA 1H7PA 3NVTA 1TYGA 4PTNA 3QEZA 4UFJA 1YXYA 4JTJA 1FDYA 5CZJA 3GIYA 5I3HA 2GQ8A 2IQTA 5AHMA 5KTLA 3W7EA 1UCWA 3HMJG 3MUXA 3TFCA 1TTIA 4GJ1A 5HUPA 4AAJA 4JYEA 3LXCA 4JX4A 2A6LA 1ZHAA 4LT9A 2HS6A 5LSMA 2ZA2A 4RK8A 1NF7A 4ZQRA 3BW4A 4Z1DA 3LHYA 4GFSA 2EPHA 4JYDA 1SSGA 3OIXA 3GB6A 4NU7A 3HBLA 3O07A 3RFAA 5I3JA 3GAKA 3SI9A 1IIHA 1FCVA 4UFIA 3W74A 4FX8A 4GUFA 4JTKA 4LUJA 1GVFA 1LTDA 1F6KA 1QPRA 1K3UA 4EF8A 2ZCGA 4UUIA 1XL9A 1O95A 5C54A 2H3BA 3NNTA 3HGJA 1XXXA 2JGYA 3M5XA 5G1YA 2TRSA 4WQ6A 5G5IA 5DELA 4M6VA 5F4WA 2DP3A 3W1XA 1TPUA 5K4XA 2I1OA 3A5FA 4LVBA 4M7SA 4D2JA 5EBUA 4K8HA 3TW7A 2V9DA 3W87A 5FF3A 2QCGA 1C9DA 4Y6GA 5BW6A 2WNNA 3W2MA 3M5YA 2ZTJA 2Q8ZA 3SR7A 2HSAA 3S1VA 1PCKA 4MJMA 1Z42A 1PHQA 3W07A 1T0OA 3G3DA 3W88A 5CZSA 2YX0A 3G18A 1HG3A 2F84A 4I7VA 4XTIA 1WOAA 2E77A 1MO0A 2FPTA 2ATMA 1W3NA 2Q3OA 1HFBA 3F4NA 2VOMA 3DAQA 1LRTA 5K2ZA 4O50A 2ZQ0A 1MXSA 1J4EA 2QAFA 2X1TA 2G95A 3UWQA 3W1NA 4DBDA 1XBZA 2R14A 3TJLA 1TRIA 5AYYA 1KFEA 4FNPA 1UB3A 1N55A 3U8GA 4NX0A 3C8FA 2B4GA 3TC7A 2OJPA 3V75A 1NAL1 4DBEA 1X1OA 5D37A 1EX5A 4E2BA 1ICPA 1I4NA 3M6YA 3LHZA 1OF6A 3P5ZA 3GXPA 2X1UA 1S5TA 3OHIA 1TO3A 3LCLA 5HINA 4QISA 3CT7A 3AJXA 2TPSA 3PUEA 4DPQA 3MBDA 4DO4A 3OBKA 4BI6A 3B04A 3WJSA 1VS1A 1JUKA 3DFNA 3UXDA 3SGUA 3A23A 1YXCA 2YXGA 2VEMA 3ABSA 2NXHA 3UWUA 1RR2A 4N9DA 4O13A 2BXVA 5FEZA 1XFBA 3LCIA 1FUYA 3DHDA 4GUIA 3NR0A 1LDCA 5H2ZA 1FDJA 1H1ZA 1VR6A 5AHNA 4DELA 4MZ8A 1L6YA 5IBXA 1GG1A 3HGRA 1QCWA 4Y8FA 2OCZA 2GUUA 4K8EA 1W54A 2AGKA 3M41A 4AH7A 1HO1A 4ZVJA 4GE8A 4IMFA 1PV8A 4X3ZA 1WYIA 4UFKA 3P7YA 3B05A 1TTJA 1IXPA 1FWNA 1EEPA 2WSRA 4IMEA 2A5HA 4NQ1A 5D38A 2CLFA 4QITA 3L66A 1KTNA 3B06A 3GDKA 3DFOA 1DV7A 1GZGA 3B0UX 3SY5A 2TSYA 4O54A 3NPVA 3MO7A 2VEKA 1VYPX 3OVRA 1OYAA 3N19B 4UMBA 5BMXA 1LLZA 3NYZA 2PURA 1O4UA 1DORA 2WV8A 1SW0A 5DBUA 1LBLA 1WAUA 2H8ZA 4MY9A 4O53A 2XN1A 4Y96A 4TR9A 3EX2A 1VPXA 1SO6A 3LRMA 1T96A 4GUGA 3M43A 3FIGA 3F03K 3FLUA 2OMAA 3FOKA 2RKXA 5D03A 1PIIA 1VJIA 1OJXA 3Q37A 4IQLA 3W1PA 4ADTA 1ME7A 4XWUA 1SUXA 3UQNA 3SGZA 2WQPA 1BTMA 4Y90A 3KVMA 2NUXA 4JTHA 4X2RA 1KM4A 2VFDA 4XQ6A 2VEIA 2HS8A 2FPVA 4AEOA 1I2PA 2H8XA 2PE4A 2QCEA 5U4NA 4JGDA 3R2GA 4BFAA 3P84A 2PCQA 4O17A 4NUWA 3I7SA 1AK5A 1N8FA 3N3MA 1H1YA 2BX7A 2JK2A 2QJGA 3DFTA 3W2KA 2Z2UA 1FBAA 3R89A 2WSQA 3W22A 2XFWA 1GVQA 1H62A 1SW3A 4NJJA 1Z48A 4E0CA 1F76A 2A1YA 5HWNA 1DL3A 1ME8A 5J5DA 5CPNA 3QMTA 4C1LA 2D73A 2FDSA 3QMRA 5ABTA 1RQHA 3STFA 3W7QA 1XC4A 2FTPA 1HUVA 5HQEA 1KV8A 1VYRA 3W71A 3NZ1A 4A2SA 3P81A 4ZQOA 3ABRA 3B4UA 2V5BA 2ZRVA 4O57A 3FKRA 1I2QA 5CPMA 1ME9A 3UPWA 3KOFA 1Y0EA 3W1TA 1OYBA 3PB0A 3HQ1A 4O1BA 1P5BA 3STGA 1Q3NA 4TX9A 4MOZA 2FB2A 1GTHA 3Q58A 4MVAA 4FX6M 4JN6A 1AW5A 1H50A 4UFHA 3JR2A 5FF2A 2DU2A 2QCHA 2GVJA 4FB7A 3PBVA 4CQAA 4JS3A 4FXSA 1TMHA 2E5DA 3W7OA 3T44A 3M44A 4XUGA 3GNDA 1XDMA 1WV2A 5AHFA 1XBXA 2GVLA 1LP6A 4MZ1A 3EKZA 1K02A 3UWZA 4O14A 4K39A 1H7NA 4QNEA 4JIQA 3LHTA 5CSRA 1JCMP 2QR6A 1TPH1 4WX2A 3L5AA 1IXNA 1FCUA 2J27A 1P4CA 1K7FA 2Y63A 4EF9A 3BK0A 4JTLA 4O4VA 1VQTA 5DXXA 5FESA 4U4MA 3TDFA 3TR2A 4AWUA 3MMTA 2AQWA 3PY2A 4UNKA 1YDVA 3PM6A 1F05A 3MI3A 4NVTA 1RPXA 1FWWA 4FNSA 4EIVA 4FXRA 3L9CA 2QF7A 4AMAA 4N6EA 3QF0A 1Q45A 5LNUA 2FIQA 4GUHA 4JTGA 2E5BA 2Y85A 3CWOX 4FNUA 2ZBTA 4EWND 3L0KA 1FCBA 3W72A 5BRBA 4GXMA 4K7VA 3M47A 3TSDA 3R8RA 4UCGA 1G7VA 1KW1A 1YTKA 3GLCA 3HPXA 3IVUA 3MYOA 4DF1A 4DF0A 4PCFA 5AHIA 2NV2A 1D9EA 3V1PA 3RLUA 5AYZA 2NX9A 3S5YA 4UTHA 4Q33A 4H4IA 5KINA 3UWVA 1TQJA 3MW7A 4PH6A 4KKXA 2DZUA 4ZQMA 1KM6A 1LLWA 2CLHA 5J5RA 1XM3A 4UTWC 3PBYA 2DZWA 2B0MA 3FFSA 2DJLA 1GT8A 2YR1A 3HGOA 5E93A 3WJXA 2ZZ1A 1WX0A 2E6YA 2QUVA 3Q94A 3NL5A 3NXFA 4M19A 1F5ZA 1W5MA 3LRKA 3TC6A 4DPPA 1DJQA 1QAPA 2BSLA 2NLIA 1JVNA 3GYEA 3I7QA 5HR6A 5K9DA 2A7NA 3W2JA 4YWIA 3RNDA 2H3DA 1KM5A 1P0NA 3LTYA 4HT3A 1G6CA 5EPDA 3PBWA 3FJLA 3SW6A 1O5XA 3E49A 3DGRA 3D0CA 4MLRA 4ORIA 4HSNA 2C3ZA 2AAMA 4M6PA 1QR7A 2J9YA 3ZR4A 1EP3A 3NO5A 4RZ6A 1THFD 1QFEA 3S0CA 1OX4A 1KBIA 3A24A 1T8XA 4WJEA 2JBMA 3T7VA 6TIMA 3MP5A 3CEPA 2E5CA 1W56A 2Z0IA 1KFLA 3LCFA 1DVJA 5FI8A 1W5PA 3CWNA 1D3GA 8TIMA 3TU9A 4IX0A 3W6YA 1DQWA 3N34A 1YADA 5KSWA 1FX6A 1YDNA 3GDLA 5CPOA 1OF8A 1XDLA 3G1DA 1QMLA 3CM4A 4MKNA 2V81A 1RQBA 3UZJA 1ADOA 1L6SA 1SSDA 3W7NA 4W9TA 4AF0B 3IIZA 3FEMA 3BLEA 5KZDA 3A21A 4AHPA 1QO2A 1G7UA 2ISVA 4HPXA 2JKAA 3HGSA 4Z0SA 2Y7FA 5K9CA 4TMCA 2J9ZA 3GKAA 1AL7A 1OX4B 2EGZA 1BEUA 3HB9A 2WSYA 3RMJA 1H7XA 1IF2A 5KZMA 2A7PA 1BWKA 5C6MA 4O16A 2R91A 3N14A 4LS0A 5GVJA 1LBFA 3LXAA 1NF0A 4Z1AA 1OK6A 3FKKA 3DI1A 4FIQA 3S1UA 1EWDA 4YMZA 5CZ0A 4WD0A 4AHOA 3BLFA 3PUOA 4UXDA 3WK1A 1WDWA 2O7QA 3N73A 3EEGA 4ZQNA 3NM3A 2I14A 1EPXA 1GQNA 3EXSA 3W2UA 2V2DA 1KFJA 3A22A 3GR8A 1B4EA 4PEKA 4BF9A 5DLCA 3HPSA 1LBMA 3TH6A 4QIUA 3NL3A 4N02A 2E6DA 5KITA 2V82A 3NPUA 1OFEA 1LCOA 4PFMA 3TJXA 1JCXA 3RF9A 4IMCA 1M7OA 3TQ0A 2X30A 3STCA 5AB3A 2Y70A 1OX6A 3CPRA 4CNPA 3DKLA 4AVFA 3S5NA 1ZAHA 1UJPA 3LX9A 1G69A 1LROA 2Z6JA 4WOZA 5FF7A 4Z08A 1DKWA 2FQIA 2R8WA 2NXIA 3SZ8A 2ZDRA 1UUOA 2RDUA 2FLIA 1SZNA 3A5VA 4A29A 1F2JA 3L0GA 2GQ9A 4FNTA 1KM3A 3EKLA 4IUOA 1QOQA 1CI1A 5HMSA 3RLVA 4IGHA 3W83A 4Z1BA 3LCHA 5I3GA 1ZY9A 2BLEA 3INPA 4MY8A 2Y6ZA 4LV4A 1TTQA 3GX9A 2Y62A 2O7SA 3PUDA 4ALDA 4JX5A 3O05A 3FYPA 4PL2A 4POCA 2VKZG 5HR7A 4X9SA 1MZHA 1VC4A 4S2BA 2B7NA 4O8RA 4JTEA 4BWLA 1V5XA 4A22A 4UTUA 1W0MA 1VCVA 4HNTA 3NZRA 1OHLA 3LCGA 4LU0A 1PVNA 3EB2A 4FEZA 1F6PA 4JXCA 4LRSA 3TQVA 4O1CA 3O1NA 4KWWA 4CNOA 3DENA 2CLMA 4M7TA 3IGSA 4JTUA 1TREA 2VFFA 1OFPA 4H3DA 4X22A 1QNVA 1OFAA 1TPC1 2J6XA 3BLIA 2C15A 3TW6A 3DKJA 3HJZA 4IOTA 5HWMA 3EXTA 1P0KA 5D05A 3W1QA 5LGZA 3NL6A 3G8RA 3DH7A 2C1HA 5G2HA 3GXNA 1ZAJA 3MHUA 3UPBA 5IBXC 3E9AA 5AHEA 1OG0A 4TU1A 1GVOA 3O6CA 2ZRZA 1D3HA 4A2RA 3UNDA 1CX9A 5F4SA 4N9EA 4NJIA 4DO6A 2PRMA 5LGXA 3NM1A 4IXXA 3L5LA 2FJKA 3W7PA 1DOSA 2QCCA 3G1SA 1IIGA 4Z1CA 1L6WA 5K3VA 2QJHA 1Z41A 3KFTA 2C6QA 5HJLA 4CNNA 3TXVA 2A0NA 5LNVA 2VEPA 2QUTA 3VNDA 4JTTA 3KX6A 1FY6A 5KMYA 2VENA 4AXKA 5LHFA 4O1AA 2VFEA 3NQCA 3W7CA 3NG3A 2CLKA 4WOQA 4MFDA 2WNZA 3TMLA 4PL1A 1SZFA 3C0JA 1H7WA 4UTLA 2P1FA 5I3FA 2GQAA 4WXYA 1H51A 4FNRA 1JUEA 1OX5A 3TV8A 4O0ZA 4ZMGA 1VHCA 5D33A 1ZALA 4QAIA 3MWAA 4MY1A 2VELA 1K8XA 3EWBX 1R46A 3TFXA 3EXRA 4ICNA 3ZFHA 4QSHA 1G4EA 3W7RA 3B0PA 1W37A 3F4WA 4LOCA 4IWWA 4KFOA 3UYCA 3S1WA 4NT0A 4RJEA 3KVLA 5DY2A 3TROA 1RV8A 2NX1A 3CLMA 1ML1A 4NJHA 5D32A 4DXVA 4WY0A 2E09A 5IM51 2E6AA 2E6FA 2ATSA 4I7WA 4LC8A 4YXGA 1TPVA 3L68A 3HPZA 2Q8LA 3W70A 1TCDA 3LERA 1WBJA 3LV6A 3P8IA 5HWJA 3BARA 5LHEA 3PS7A 3T55A 2ABBA 3UY7A 1OVDA 4YCOA 2EAWA 5T26A 3W1MA 4AWTA 1EWEA 1M7PA 1KM0A 3H54A 4PA8A 2W79A 1QPNA 2V5LA 5FF4A 3IVTA 1KTCA 5E0KA 1SW7A 1KA9F 3TKFA 2ZRUA 1KM2A 2Y89A 1VCGA 1YPFA 3LV5A 4FNQA 1I8JA 3GKFA 1SZGA 3IGUA 2CZ5A 5DCBA 1FWTA 3PBUA 2JGQA 2RDTA 3TNOA 3LGEA 3RU6A 5BOOA 1JR1A 1TSIA 4IPJA 3H55A 5EY5A 1J5TA 1TPDA 3W76A 2V30A 4O0KA 2BWGA 5DCEA 1AW2A 3WFAA 1NSJA 3BG3A 3LDVA 4GNJA 4LVFA 5D04C 1F7BA 4O15A 3I65A 1EB3A 3EX6A 5A5WA 1RZMA 3CIXA 1HL2A 4ZZ9A 1FCQA 2NUYA 1Q6QA 1R2SA 5AC7A 1B3OA 3QZEA 1SO3A 4A3UA 2YYTA 2UV8G 1KFKA 3QJAA 5DY3A 3C2EA 3QFEA 2FPYA 3QH2A 1OK4A 2YFOA 2J24A 4O1DA 1XBVA 3THQA 3W86A 4RCXA 2NWRA 2QJIA 3TQKA 3SECA 3TXZA 1B9BA 1OFRA 2QCDB 1EUAA 3BGJA 3PSWA 3DXIA 4UR7A 3W7MA 3BVJA 1SFLA 3B8DA 5LZLA 1SO4A 1GTEA 3G1VA 2CFFA 4XZ9A 1G4PA 3B03A 1EIXA 2HTMA 1AMKA 5FEWA 3NGJA 4HIBA 3TSBA 3O6DA 5D2TA 2YDAA 3LLDA 2PRHA 4Y9AA 3ZWSA 1TV5A 2RDWA 3ELFA 4L4LA 4XBSA 1LORA 3UWWA 3G1XA 4UNLA 2ZZ3A 3LHUA 5C5YA 1V7YA 3LXBA 2QCDA 2OT0A 3NQVA 4XBKA 3C2FA 2EKCA 4GUJA 3WK0A 4JICA 4QM1A 1EUNA 3C61A 1EP1A 4UTWA 2RHGA 1X1ZA 1GYLA 1TQXA 3O16A 1QPOA 3S9YA 1ICQA 1JCNA 4P61A 2ABAA 2P0OA 1SQ7A 3T4CA 4P2VA 4GC4A 2Z6IA 1O60A 3H53A 4LS1A 2NWSA 1AL8A 2A7RA 3W7KA 3P60A 2P10A 2A21A 3G0XA 3NA8A 1ICSA 1FQ0A 5TQLA 3W2NA 3R13A 3WJWA 3E0IA 3TIMA 4QQ3A 1K8YA 1K7EA 4IMGA 2X2GA 2ALDA 5EKYA 3FA5A 3UD6A 3I7RA 1WBHA 3OG3A 3THAA 4MJZA 3W7GA 3PAJA 3QMSA 4R34A 3VCRA 3ANYA 3EWYA 3L5MA 4LV9A 5DXYA 1K8ZA 4YCPA 1Q6RA 5EL1A 1O94A 4N4QA 1S5VA 4PODA 3SFKA 1IGSA 3I6RA 4Z0JA 3PVFA 3N9RA 5D2WA 4K38A 3MI2A 2C18A 4ZQCA 3SSJA 4ADSA 2YFNA 3NQDA 3TX9A 3ATYA 5LKYA 4RV8A 3CB8A 3QQ1A 1H60A 1K7XA 4WY0F 5CZTA 3MBFA 3QW4B 4IX2A 3MYPA 3M7WA 4MFEA 1KV5A 1ZENA 2DZSA 4K6AA 2YYUA 5FF0A 4BK9A 3QSTA 3NL2A 1WA3A 1SR9A 4JIPA 3K30A 1A50A 5EYWA 1EP2A 1Z44A 1WXJA 1VRDA 1XUUA 4KWVA 4L4MA 3VKJA 1F73A 1ALDA 3QC3A 3ZS4A 4NNBA 3P5YA 1T99A 4RZ5A 4XTDA 1QO5A 4FIRA 3HIJA 2CZDA 3VE9A 1XUZA 4O4WA 4Q32A 4DO5A 3CU2A 4HHPA 4J9JA 4MLJA 1C29A 1VLIA 4TMBA 5I3IA 4JD4A 1I2OA 1DJNA 3U2OA 3G0UA 2W6RA 3CTLA 3W3OA 3E96A 4MPQA 2OZ0A 3NAVA 5LNSA 1PCWA 4UMCA 1LYXA 3TE9A 4NXSA 3EWWA 5AHLA 3M16A 3WK3A 5SWUA 3NQ6A 4HKPA 3VI2A 3W73A 3LCXA 4ZL1A 1TPB1 1BKSA 3OVPA 5HULA 4MYAA 3CHVA 1TV7A 4KFNA 4RX0A 3BO9A 4JNMA 4LS2A 1GWJA 3DHFA 3L2IA 4CCDA 3PF3A 1G67A 1U83A 3IIPA 4LW7A 2PC4A 4O18A 2NUWA 3JS3A 1IXQA 1YTEA 4RXGA 3NQAA 4DF2A 3O63A 4NJGA 3W2LA 1YXDA 4HN4A 3W75A 3IV3A 5D2VA 3WJZA 4NXKA 2ZRXA 1VGAA 3PC0A 2B7PA 2W0UA 3MI6A 3DI0A 2YCEA 4O12A 3G24A 4H6KA 3L0NA 1KFBA 3QW3A 1TRDA 2HMCA 3KRUA 5TIMA 2Y61A 3MP3A 1TB3A 3IVSA 5BNKA 3DU0A 4N9CA 3VFLA 1QPQA 3P82A 4ORMA 3P80A 2JKEA 1C8VA 2ISWA 4CLMA 1W31A 1TPEA 2DZTA 1OFBA 1OYCA 3HO8A 3P67A 4MZYA 4AF0A 2QDGA 1VH7A 3LB0A 1ZFJA 3C52A 1W5QA 2X16A 1XKYA 3QPYA 3G1AA 1RQEA 2VXNA 2DJXA 3KVJA 1OFDA 4O10A 2FFCA 1MEIA 4FF7A 1F74A 2ZZ6A 4OU1A 4JEQA 2YSWA 3KRSA 4PC8A 4CQ9A 3MJYA 1Q6LA 2NXGA 1YDOA 4UFMA 1W5OA 3W1AA 1TJRA 3N2XA 4IMDA 4MUZA 2ZZ7A 3TMQA 1P1XA 4ONVA 2WNQA 2XN2A 4NX5A 3LCWA 5F1UA 3TK7A 4AWSA 4C1KA 6ALDA 3LOTA 1OFOA 5A8GA 2CU0A 2A6NA 2BZNA 3HG5A 2ZRYA 1YPIA 4JDYA 3QRHA 4IXHA 3UZ5A 1VHNA 2C19A 3TA6A 4UTKA 3NQ2A 1H61A 2WJZA 1GG0A 4XKYB 3W85A 5H91A 3BPWA 3M1ZA 1NVMA 3C6CA 1SZEA 4N6FA 3OVQA 3OA3A 4LTSA 3LTPA 1GEQA 2DZPA 2B7QA 3KRZA 2J9XA 2ZA1A 1LM1A 1I2RA 3ABOA 4WZHA 2RFGA 3LBCA 3EX4A 1LOLA 4HPJA 4K37A 2E1DA 4LNYA 5D30A 1JRCA 2YW4A 1JJKA 2H6RA 1TPFA 1JCLA 1UASA 5F2LA 4EOUA 4UIOA 2G96A 3KHJA 4UTTC 2QDHA 3P8JA 3IRDA 2V8ZA 4JX6A 3C2VA 5HUOA 1J2WA 3PULA 1H7RA 2ZRWA 2WO5A 1PHWA 2A2IA 2QKFA 1R2RA 5F1VA 5DBTA 1K03A 5F4XA 4I7UA 2EF9A 3DBPA 1KFCA 2VFHA 3W1LA 1NEYA 3QPZA 5CSSA 1KTBA 3QYQA 5AOUA 4BI7A 2QCNA 1AG1O 4BI5A 1GOXA 1LZOA 2DZVA 3GVGA 2C0AA 3NQGA 1A5SA 3O6YX 1TIMA 2CLEA 4TIMA 2VC6A 1PS9A 2B7OA 5G2IA 1MEHA 2V0TA 3M5ZA 1UBSA 4R7JA 2FB3A 5G2WA 3NDOA 3NQ7A 2Y7GA 1QOPA 1BWLA 1ZCOA 4UTIA 1NFBA 3HOJA 4LWWA 3YPIA 4E2DA 1N7KA 3QM3A 3PR2A 3UY8A 1JQXA 1L2UA 1X6UA 3FS2A 4S1FA 2X1RA 4KFPA 3N9SA 4N9BA 1E51A 5L9FA 1FWRA 5AC6A 2PRLA 3DFQA 4RKAA 2V2CA 4LUIA 1M5WA 3QQ0A 3W23A 4JY8A 2GJNA 3LI0A 5G4EA 4ZQPA 3FYOA 2VFIA 1PE1A 1KLZA 1KBJA 4MIMA 2YW3A 2J88A 3PSVA 1TJPA 2QCMA 3GDTA 4HNNA 4E38A 5E1QA 3NQ8A 2XN0A 1FWSA 4JDBA 4RR4A 3SJ3A 1R30A 4IJBA 2OT1A 2C13A 3HG3A 1JQVA 1CW2A 4N4PA 2V2HA 3PB2A 3UWYA 3TAOA 4ADUA 1ONRA 5AN7A 1JRBA 5G1TA 1DBTA 4OV4A 3CQ0A 5FEXA 2ZZ5A 3PWAA 1VYSX 2Q3RA 3EWUA 3S42A 4B5NA 1R47A 5C55A 5D02A 5D09A 4AHQA 5KZEA 2GPTA 5D2XA 2YGYA 3G8EA 2NV1A 3NEVA 2Y7DA 4WUIA 4OV9A 3L65A 4GBUA 4K36A 4JTFA 4IPIA 2R94A 1GYNA 5K4ZA 3IIVA 2NZLA 4OT7A 3Q2DA 4O11A 3VE7A 1TTPA 5BMWA 1JCJA 4JTIA 2CW6A 2QCLA 3BW3A 1H63A 3KXQA 2G5WA 3EX1A 1FXQA 1YLVA 3PG9A 4BR1A 4O28A 3G1YA 2ZFAA 4JTSA 4HSOA 1R2TA 5K7JA 3BW2A 3L21A 4GRSA 2C16A 1AW1A 3CC1A 4JYFA 1OFQA 4LVGA 4UTTA 4NNCA 2DZXA 3GNNA 4GWEA 1U5JA 3M9YA 4UTMA 3G3MA 1ZJIA 3I68A 3IIOA 3F1QA 2Z1BA 3T40A 3S5OA 2ZZ4A 1QWGA 3C2OA 1A5AA 1YTDA 1L9WA 2CZFA 2E68A 4CCCA 3PG8A 1W1ZA 3W7DA 3DZ1A 1RD5A 1H7OA 3FJ6A 4CQ8A 2G97A 4JR5A 3TCEA 4O19A 2ZYFA 1VZWA 2VFGA 3IEBA 4JY9A 3G1HA 4DQWA 2GJLA 3R5EA 2I9EA 4UTJA 3ZWTA 3LM7A 3AO0A 4G1KA 1JCYA 5U7SA 5D2YA 4QNWA 4WY0B 4S2CA 3W1UA
chains in the Genus database with same CATH superfamily
2HROA 1JYXA 1DE5A 4RPPA 3QLDA 1GVRA 2G50A 5DCDA 4LEFA 1Q6OA 3P61A 3USBA 3TAKA 1VBHA 5LXXA 4P8XA 4XZNX 1E6XM 1VCFA 3G5EA 5AZ1A 4ML9A 1UD3A 3PPCA 1Q66A 3OEXA 2PWHA 4QDMA 4LB3A 4V28A 2EHHA 2OPJA 3BC9A 4OZOA 3WQVA 3RITA 1GJPA 4DJDC 1DXFA 4CVUA 4EWJA 1KFWA 3LHWA 4AEEA 2YZRA 2WK2A 1HNYA 1CXHA 2LLEA 3HG2A 3EA3A 3W7JA 4GA8A 3STEA 1F3EA 3THDA 1TWWA 3F2BA 2J8FA 3AIUA 4I9AA 3R58A 2G3MA 2OX1A 3PK7A 4FLQA 5FEPA 5A2BA 3AYSA 4LRTA 1QNPA 3MWCA 3OLEA 2PP1A 3MHGA 2YXXA 3VDAA 5G4WA 2RJHA 3B8TA 3VZXA 3SCPA 3CIWA 4H7ZA 3VA8A 3ABQA 4XKYA 3H12A 1R0MA 2FHCA 3OJGA 1WOBA 2ZADA 2XWEA 2OZ3A 5IXEA 1MNZA 1TWIA 2WVSA 1YE4A 4ZEPA 1FWDC 4MADA 4C6FA 5LNWA 5EB8A 5JH2A 4UOQA 3ARYA 4GPNA 4Q4OA 3T78A 2EPNA 2TODA 1U5HA 1DIEA 3G1FA 3W0KA 3WDHA 2WKJA 2Z27A 3GU2A 4JNYA 3G6MA 1Z32X 2IPJA 1M41A 3G0SA 4M5PA 4XB3A 4Q4KA 2PTWA 5LIUX 3WD1A 1HKVA 1TV3A 4GOAA 2ISSA 5EA9A 6ENLA 1UZHA 4ZOAA 3QHOA 2VX4A 1MXDA 2PZ0A 3LI1A 2ZX6A 4OQVA 1IR2A 3RO6A 2Q01A 2KZHA 2A4AA 4UQDA 1TPWA 2PP3A 3M0ZA 1VBRA 2E28A 7CGTA 4M6QA 3GAYA 1A47A 2CWNA 1K1DA 3DFSA 1KM1A 4UBPC 1ZZMA 3EKGA 4BWLC 4TXEA 4WKAA 2RH9A 5AYIA 3GDMA 1A4MA 3T05A 2NVDA 3DCPA 1I2NA 1W3TA 2P3ZA 3RLGA 1S5WA 5FAGA 2QEZA 2Z2AA 3P62A 2QULA 3M0KA 4RLIA 2VZUA 2Y7EA 5LIWX 1ZAIA 2VC9A 3S1GA 4J5NA 4K7YA 4DBSA 1ITUA 1PZ1A 1CENA 5MHBA 3ATZA 3WO8A 3NQEA 1EBHA 4YTSA 1YPXA 2QUNA 1LWHA 3UNTA 4AYSA 3E0LA 4P7LA 1XCFA 1QNSA 3HPFA 2ZUTA 2NV9A 3USZA 3WEOA 1FDZA 1OY0A 1GVYA 4BQ3A 4MMWA 5I00A 1LRQA 2QYGA 1OM0A 3VDBA 3DECA 2UZ9A 4KRZA 3CUIA 3H24A 1SFJA 1ZRQA 2FGLA 4L4PA 4PTNA 3QEZA 1GOMA 4JTJA 5CZJA 4EPBC 2CIPA 5DFAA 1X98A 5KTLA 2DH3A 1AQ0A 5IHSA 3V36A 1EYEA 1UCWA 3HMJG 4HTYA 1R3VA 3MUXA 5DEZA 3TFCA 2W61A 4JX4A 1AD4A 2A6LA 1T6MA 4I5RA 1KCKA 3MTWA 5LSMA 2ZA2A 4RK8A 4A8IA 1NF7A 4ZQRA 3BW4A 4NU7A 3VFCA 3LUTA 3RFAA 2PU1A 5FA5A 3SI9A 1IIHA 3PAOA 3REQA 4UFIA 1OG6A 2BGNE 3IJ8A 1WP6A 4R9OA 1LTDA 5M2FX 4I6VA 1VJSA 5A94A 2ZCGA 3GIPA 4WLCA 4IIHA 4K1WA 3U9IA 3IRSA 2H3BA 3NNTA 1IHIA 4W8BA 3VDGA 3M5XA 1MQRA 5G5IA 3R7MA 3U48A 1BXBA 2HDJA 1QBBA 3LPOA 2OB3A 2MNRA 3CZLA 4B15A 4F0HA 3Q4DA 4IIDA 4K8HA 3TW7A 3W87A 4C60A 3PZNA 4Y6GA 5BW6A 3NWRA 4WF7A 4YTQA 3TN6A 3W07A 2AL2B 4L61A 4GGHA 4D6JA 3EOLA 3C86A 5AZ0A 4I7VA 1CGVA 4AZIA 1BSLA 2ATMA 4Z2LA 2Q3OA 5K2ZA 3CIVA 4GO8A 4AD0A 1MXSA 1DIKA 4RDWA 4CU6A 2QAFA 2G95A 3WNOA 5I07A 4IPNB 1P0BA 4YN5A 1J0JA 3OZOA 1TRIA 2VDIA 3AICA 1OCBA 3U8GA 1NAL1 1L6GA 1V6UA 4LAOA 4DBEA 5D37A 4E2BA 3DX5A 1JDDA 1I4NA 3M6YA 3UXIA 2IQDA 1OF6A 3P5ZA 1JNDA 2V3DA 1TO3A 1TE6A 5HINA 3O6AA 4D9PA 1BYDA 5A2AA 3OA5A 4R3UA 4JFSA 4DPQA 1GQIA 2VM8A 4DO4A 3ITCA 3B04A 3ZJKA 1PDYA 3UG8A 1VS1A 2O56A 3DHUA 2VP8A 2I9UA 3DFNA 3FW6A 1IWBA 4FOUA 1PKMA 1RR2A 4DVOA 5C70A 5A6JA 4O13A 1EGZA 2PI6A 3RX3A 3DHDA 3M64A 3N29A 4GUIA 1LDCA 1FDJA 1RJQA 1H1ZA 5CJ5A 4DN1A 5JBEA 3N12A 2SFPA 4C6QA 2WC4A 5IBXA 1QCWA 2OCZA 2GUUA 2PLKA 3FJNA 2AGKA 3W29A 1HO1A 3E5BA 3S2MA 4GE8A 5I0DA 4QFUA 4X3ZA 2JEPA 3TJIA 5BRPA 2CLFA 5C2CA 1KTNA 1NOFA 3B8SA 1JDEA 3B0UX 4O54A 3EDFA 4HOWA 4NY2A 1JGIA 1UWAA 1JPMA 2RDXA 3OVRA 5BMXA 1Z8AA 4IF2A 4XAYA 1SW0A 3B0YA 2ICSA 4TV5A 2XN1A 4TVUA 1D8WA 5HJYA 2E8YA 3KBVA 1V79A 4GUGA 3M43A 1M1BA 4TVCA 4F2BA 2RKXA 4ICMA 3ARPA 3PTMA 1PIIA 1VJIA 5IFPA 3W1PA 4MWAB 4TX6A 1H41A 1I0DA 3HMCA 1BTMA 4AIOA 2VFDA 5A3HA 4WR3A 4UB9A 2H8XA 3MKVA 1IGWA 2QCEA 3KBMA 3R2GA 4AWEA 4BFAA 3R0KA 5I02A 1ZGDA 3P84A 6XIMA 2BX7A 3VGDA 2QJGA 3LBOA 1AJ0A 4W5ZA 2WANA 4AC1X 2G3FA 1XIBA 1S1PA 1F76A 5HWNA 2BBFA 2FGBA 5CPNA 2DDXA 5EMLA 3ZO9A 2D73A 2C79A 4OECA 3VIFA 5GNZA 3STFA 1XC4A 3SN0A 4YWSA 2FTPA 1HUVA 2QV4A 1XLMA 2E8ZA 4X63A 1V3MA 5CC7A 4A4AA 1OT1A 1XFCA 1XH1A 4TQTA 4O57A 3WH9A 4MNMA 1I2QA 1RH9A 5C9ZA 1ME9A 3W1TA 3HQ1A 1O1ZA 1RD6A 3AUOA 2ZXAA 3SCNA 4TX9A 2O4MA 4HA0A 1GTHA 3TC3A 4FX6M 4JN6A 5FF2A 2X1IA 4FXJA 3ITXA 4LUSB 4DWSB 3F2CA 4WJ8A 1TMHA 2E5DA 4WHBA 1L2QA 3GNDA 3ID7A 1WV2A 5AHFA 1GHSA 4KWSA 5JBFA 1W9VA 1Q13A 1E55A 1SGJA 2V68A 3UWZA 4QJ5B 4WSKA 1KNWA 2AKMA 1BFNA 5JIPA 4C6IA 1EQPA 1P4CA 1K7FA 2VD9A 2PGEA 1X96A 4P7QA 4FALA 4EX4A 3OZPA 2UY2A 4DZAA 3ZJ7A 3B97A 1F05A 4NVTA 1UD6A 3STPA 1FWWA 1W3KA 4E3TA 2J6VA 3BZJA 2QF7A 3L9CA 4ZOBA 4N6EA 4AMAA 3POCA 4D6CA 5LNUA 2FIQA 1XRVA 2G0WA 4M1RA 4GUHA 2E5BA 1W3LA 1R87A 4EWND 3L0KA 5DMLA 4EXBA 3W72A 4YPJA 4RE2A 4J3TA 1EJUC 4WK9A 1G7VA 1KW1A 1YTKA 2PF8A 3HPXA 3IVUA 4RUBA 3S46A 4DF1A 3SUTA 4KH2A 3S5YA 2Y5JA 3WDQA 4H4IA 3UWVA 1G9HA 4PH6A 3UJRA 3GWQA 1KM6A 3WNLA 3SB0A 1LLWA 2X09A 4UTWC 1EGVA 2DZWA 4HZ8A 3ECQA 3WJXA 4B3LA 2E6YA 4R7OA 2E0PA 3NXFA 3PJWA 3ZLGA 2DUXA 3VIJA 2NLIA 3MCOA 4E4PA 3WQ8A 2BASA 3RNDA 3VNZA 1G6CA 1UPMB 4I90A 1M53A 3FJLA 2VO5A 4RDZA 4CN6A 1O5XA 2BB0A 2OQHA 2WHMA 4MLRA 3B0XA 4Y9PA 3VKKA 4CU7A 4QE4A 1O12A 4ZTXA 2C3ZA 4ZSTA 1UQZA 4OBSA 1EP3A 3NO5A 4E8GA 1AQMA 4QE5A 3K8MA 3A24A 3CZGA 3BLPX 1V4YA 2EG7A 2VDGA 4Y2WA 2FVKA 4EACA 4L7ZA 4GHRA 4Q8VA 1W5PA 1FHVA 5ENLA 8TIMA 3ZYZA 2Z00A 4DM2A 1X8CA 9CGTA 3N34A 1YADA 5KSWA 4Y9NA 3CO4A 4GVGA 1XH0A 2HCVA 5CPOA 1W1IE 3CM4A 1UD5A 3UZJA 3SY1A 5AC4A 3W7NA 5GJNA 2AMXA 1L6FA 5KZDA 3A21A 1QO2A 1G7UA 3KP1A 3LYEA 3EMQA 5A6BD 5JVLA 2JKAA 1PX8A 3A6OA 1VFTA 3II1A 5K9CA 1PTDA 4TMCA 3ITOA 2EGZA 3BWWA 5LA0A 3RMJA 3KLLA 5A6MA 4QHRA 3WBAA 1FWBC 1BWKA 2J77A 4O16A 2R91A 3N14A 4GCXA 4L56A 4LS0A 5GVJA 2X05A 1W3HA 1NF0A 2DSKA 4E6MA 4XD3A 3FKKA 1XICA 1IWPA 1WKFA 5AC5A 2YCLA 4AHOA 3WK1A 2O7QA 1D2KA 5ABHA 1EPXA 1HJUA 3EXSA 1QOXA 1V08A 2HVMA 2IPWA 2Z25A 2VYOA 2PZNA 3GHTA 4QIUA 4N02A 2X7WA 3V3WA 1WZLA 3TJXA 4FLRA 3WMCA 2JEQA 3TQ0A 3STCA 3U4AA 1OX6A 3GTIA 1FFRA 1NELA 2VQUA 3DKLA 3LPFA 1ZAHA 3QV9A 4ZOCA 2Y8UA 1G69A 2XIMA 5XIMA 1TE1A 2PTYA 2NXIA 1QK0A 3SZ8A 2ZDRA 1UUOA 2FLIA 3GYCA 1TVPA 3I3DA 2W63A 4AC7C 3R8GA 1W1VA 1A0EA 3EKLA 2ZWYA 5HMSA 3RLVA 4IGHA 3QZ6A 3WQOA 3L7RA 1UQYA 3LCHA 2BHUA 3HN3A 4MY8A 2JIWA 2ZXQA 3KE0A 1RY8A 3PUDA 4ALDA 5BOFA 5HR7A 1EF2A 3D5HA 2VKZG 1VC4A 4KT2A 4LYRA 4BWLA 1R38A 1V5XA 3SADA 1W0MA 4PMNA 1BVNP 4HNTA 2ZXDA 1PAMA 1RA0A 2PDIA 2AL2A 4H41A 2DT3A 3WUEA 3GW3A 2CKRA 3FSTA 2VOTA 1TPC1 1F8IA 1MQQA 4UQEA 3MB9A 1ZLPA 3A9BA 3S2NA 1P0KA 1OIFA 4HYRA 2CLPA 4G5DA 1IEWA 2OKOA 5M1TA 3DH7A 3K1GA 2C1HA 1ZAJA 4DZHA 5AHEA 1SFSA 4A2RA 3NOYA 3R25A 5F4SA 4N9EA 4QBXA 5C9XA 1MXGA 4IXXA 3WD0A 4HTBA 2P53A 3NEHA 3IJQA 4JFVA 1IIGA 4A8RA 1NWSA 4BCEA 1W1YA 1Z41A 7PTDA 2C6QA 4GX8A 4CNNA 3TXVA 2EPLX 4HA4A 2VEPA 2QUTA 2GGGA 4JTTA 1FY6A 5KMYA 2VENA 4AX7A 3W7CA 2CLKA 3UA4A 2H9AA 4DNMA 3R79A 4IIFA 1JD7A 1SZFA 3FYYA 2DSUA 3D3FA 3KOZA 2GQAA 2WNWA 4LAKA 3TV8A 3WDRA 3PN8A 3MWAA 2VELA 3ZLFA 3EWBX 2GGEA 1CGUA 3EXRA 2DVTA 2HK0A 3W7RA 1PB0A 4B91A 1W37A 3GC2A 3F4WA 1DYSA 1Z69A 4LOCA 4PUEA 2OGYA 4GJIA 4NT0A 2CEQA 4RJEA 1RV8A 2GVYA 4DXVA 5BWAA 1K9TA 1P1MA 4WY0A 1S2WA 3QR0A 5IM51 2E6FA 2QVHA 3GFZA 4Q7NA 4I7WA 4Y9MA 4H1ZA 3L68A 3MA8A 1WBJA 3CL6A 1ZBCA 5LHEA 3UY7A 1R3TA 1J10A 1UIPA 5T26A 1RK5A 1E0VA 3HJEA 4S39A 4NP7A 2ON3A 5LA1A 2V5LA 3F2DA 1HW6A 5FF4A 2B81A 2P50A 4OOUA 3DEQA 1KM2A 3EWDA 4J27A 3LV5A 1WCGA 3O2LA 1I8JA 3OG2A 5I5RA 2CZ5A 2D24A 1BXCA 1FWHC 7ENLA 4JAWA 4XK2A 3TNOA 1TSIA 4IPJA 3H55A 4I3GA 5E9AA 2RUSA 4H8NA 2RGLA 4C90A 2VMFA 3LDVA 4LVFA 1P6WA 5D04C 3CIXA 1A5KC 3H2CA 2FYMA 4ZZ9A 5HMDA 1FCQA 2NUYA 1EF3A 1R2SA 4WCJA 1KWKA 5AC7A 2RGMA 2XSBA 3QZEA 4A3UA 4P8WA 3L23A 3ZVHA 3CZJA 1OK4A 2YFOA 2J24A 1A5NC 2WLZA 3MS8A 2NWRA 2NSXA 2BY2A 3M0LA 1OFRA 2QCDB 3BH4A 3PSWA 3LD5A 1N82A 4UR7A 3W7MA 3VABA 5LZLA 1KO0A 2CFFA 2YKKA 1VF8A 4NIRA 3KEHA 1US3A 1C7TA 3GVRA 3BMWA 4B2DD 4PN2A 2HTMA 1AMKA 3CK5A 4DAFA 3NGJA 2OQYA 3TSBA 2J62A 1XISA 4HNLA 2PRHA 4Y9AA 3ZWSA 3NO3A 3ELFA 3E38A 4UQCA 1LORA 5FJTA 4YTUA 3G1XA 2H9AB 2XZ7A 2BVTA 4KESA 5C5YA 1HVQA 3F5JA 4GXPA 2OT0A 2ZUNA 1UWUA 4A3RA 2EKCA 4GUJA 4IG2A 3QPEA 2XUCA 1TQXA 1B3ZA 3S9YA 4P61A 2E3ZA 2GUBA 2P0OA 2A3LA 3T4CA 4B16A 4HP5A 1P6BA 1O60A 3H53A 1ZB5A 3BAWA 1TELA 4Y7EA 3SEPA 3GVWA 1FQ0A 3TIMA 2EO7A 3T0CA 1K7EA 3HZ3A 4IMGA 5EKYA 1MW3A 2QIWA 2OELA 1U30A 3FA5A 1SJCA 2BP1A 5EMJA 4NKCA 1GPFA 3W37A 3BTNA 4R34A 3DFHA 3VCRA 3BLLA 4CQCA 2WC7A 4HA3A 1K8ZA 4P8UA 4B9ZA 4PODA 3SFKA 4RV3A 2F6XA 3IWPA 3N9RA 3UGVA 2O9PA 3I10A 7A3HA 3CQIA 4W5UA 1UMYA 4I5XA 2X7VA 3NQDA 3U0HA 5D8WA 3CB8A 5CZTA 3MBFA 4IX2A 1KB3A 1W9BM 3M7WA 4JN7A 1ZENA 1W3JA 1XLCA 2Z7GA 4K6AA 1VFMA 3WLRA 4XZWA 2YYUA 3HURA 1W1A1 4BK9A 4PMRA 3NL2A 4JIPA 2VCAA 1EIBA 3KL3A 3AS0A 3COTA 4AZHA 1XUUA 3JUGA 4KWVA 2HBVA 1F73A 4B5XA 5CC3A 3ZS4A 1UOKA 4JTDA 4NNBA 1T99A 5CGTA 1V0NA 1TG7A 3HIJA 3U3HA 2DIKA 1X97A 3CU2A 1TZ9A 4OOZA 4J9JA 4J3WA 3DBNA 4JD4A 4HPNA 3CAWA 4C6LA 3NAVA 4ACZA 1H5VA 4UMCA 4NXSA 1VIWA 3WK3A 2P5NA 2XZ9A 3VDHA 3VI2A 1HF6A 1CXKA 3LCXA 1TPB1 1BKSA 4AZGA 4DZ5A 2G41A 4G2DA 3CHVA 4KFNA 4RX0A 2QMJA 4V33A 4Q7IA 4H2HA 4JNMA 3UP8A 3FNDA 4JQAA 2X42A 2YXOA 1G67A 2QPUA 3CQJA 3GW0A 1PJ9A 4B90A 4B92A 4O18A 3JS3A 3W28A 4IQJA 1ZP4A 1EDQA 3UCDA 3W2LA 1A80A 2PGRA 1YXDA 1GQKA 3OB8A 2PTXA 3PC0A 2WLYA 2YCEA 3TA9A 1PUDA 1NH6A 1QATA 3KRUA 2HMCA 5TIMA 3VNYA 2Y61A 3MP3A 4UZUA 5BNKA 3DU0A 4PFHA 1FP9A 1BQCA 4ORMA 2JKEA 1UP3A 1TPEA 3RJYA 2GDQA 3LGDA 1W5QA 1PWMA 5T91A 2X16A 2GJXB 1LQ0A 1A0CA 2ZUWA 5C7VA 2O0TA 2Z1VA 1OFDA 2ZZ6A 4JEQA 4A8LA 1Q6LA 3W1AA 2OLAA 4IMDA 2QLYA 2ZZ7A 3TMQA 3AU6A 4PRRA 3ZT6A 2FZDA 2A3BA 3LCWA 5F1UA 3TK7A 3CUJA 1QI2A 2NSOA 3LOTA 2A6NA 5H8UA 4XAZA 4LCRA 4F79A 3QRHA 3UZ5A 1E70M 2DSZA 1KWGA 4AD5A 2BOEX 4XZIA 4UTKA 1RAKA 3NQ2A 2WJZA 1GG0A 2V67A 3M1ZA 4F40A 3C2YA 3C6CA 1SJDA 1BTCA 4LTSA 4AZBA 2CERA 2B7QA 3KRZA 4J2PA 3TYZA 1UBPC 3ABOA 1E0XA 4HSHA 3EPMA 3FAWA 4LNYA 5D30A 2CITA 4GI8A 4Q6JA 5DO8A 1RUSA 3S6TA 1YNYA 4DX3A 2Q71A 2QDHA 1KGUA 4JX6A 4W93A 2XGZA 1BYBA 5F4XA 1OCQA 3DBPA 3W1LA 1KKRA 3AMGA 1NEYA 1L8NA 4Q6XA 2GQ3A 1VENA 4QSFA 3QYQA 3PZVA 2QCNA 1AG1O 3WLIA 2A3AA 1TR9A 2QGYA 3GVGA 3NQGA 4AG0A 1TIMA 4DUXA 4S3FA 1DXEA 3UVIA 3EOOA 4CD6A 3PZOA 3M5ZA 1UBSA 3AWOA 4R7JA 3N4FA 3ZIZA 5G2WA 4MJ4A 3NDOA 4CN4A 5C9WA 3VNKA 3ZLHA 2Y7GA 3OOQA 2FMNA 1ZCOA 2E9BA 2FVMA 4YHGA 3HOJA 4LWWA 4E2DA 4KPLA 3UY8A 1JQXA 1LJYA 3UJFA 1E51A 2OYLA 2QIIA 1UA7A 3N6JA 1KXQA 1GHRA 4J35A 3WEMA 4HNNA 4E38A 4NI8A 3N2OA 2QJNA 5E1QA 4NHVA 2XN0A 4JDBA 4YVVA 2J4GA 1ONXA 1R30A 2OT1A 2C13A 3CV6A 1K6WA 3I6EA 3B8UA 1CW2A 3POHA 4O1EA 3TAOA 1XIHA 1TMLA 3EA2A 4S3JA 1RBLA 1V6XA 1AFSA 1R47A 5KZEA 4DJFD 2ISDA 4H2CA 3URQA 1UHVA 4I6KA 4DNHA 9RUBA 3GDBA 4UQBA 3VD3A 1S38A 3OLDA 1W17A 4AXNA 4YHEA 2Y1HA 1JFXA 1KKOA 3WLSA 2YA0A 4US6A 3AZTA 3LZ5A 4HHLA 3R43A 3Q2DA 1UH2A 4DXXA 3WF4A 2J8TA 4BEQA 3KDOA 4MNKA 3BW3A 3MUCA 4YVXA 2GK1B 3KXQA 3GFYA 1F61A 3EDKA 3QXBA 4EE9A 3WH7A 1GYMA 4HSOA 3PBMA 3K4DA 5K7JA 2INEA 2WBGA 1EC8A 4GRSA 4DI8A 4JYFA 3P0WA 3PZ9A 2OLSA 4MNLA 4HMEA 4NNCA 3LSBA 1XLBA 1J18A 3ES7A 4RE0A 1LLOA 1V77A 4R9XA 3I68A 3QKEA 3F1QA 3T40A 4G56A 4HCHA 2E68A 3NCOA 3PG8A 1W1ZA 1IT7A 1HGYA 2VGFA 4CD4A 3AU2A 2BV9A 3FJ6A 5CZKA 3UR5A 3H6OA 1VZWA 1DJXA 3IEBA 1VFHA 3LU2A 1X38A 1JDAA 3TYAA 3LM7A 1EDGA 3AO0A 4WY0B 1LUCA 3VOHA 2D2HA 3QSRA 4KCUA 1Q6GA 5BXPA 4W7WA 3WNKA 2JF7A 2DT1A 2F6UA 1QW8A 2ACRA 2OLHA 3KL0A 1DJIA 4ZBCA 5CKSA 3T8QA 2DV0A 4F9JA 3S1XA 3E5PA 1FH8A 2ZE0A 1O5KA 1XLHA 3C8NA 2NQZA 3UZWA 4LC6A 4FI4A 3SIZA 1OSEA 3NPWA 2CCRA 5CG7A 3T9PA 4QEHA 5I78A 2CESA 1YNQA 3OYZA 1VLWA 4I8DA 3ARZA 4DZIA 1EA0A 3KWSA 1P7TB 3NOEA 4FPSA 2R1PA 5F2GA 3R94A 4E2VA 3H7UA 1MSSA 2I5GA 3M5VA 3UJSA 1X8FA 1YYAA 1E40A 3UT0A 1SO5A 4FOJA 1R9YA 1B30A 1BVZA 4G1NA 3MP4A 4TO8A 1DTNA 3KAOA 1HO4A 2EJAA 5A69A 1H4PA 2BTMA 5I7GA 1QDSA 4EPEC 3L2MA 4UZSA 4OWGA 2WB5A 5AC8A 2NT1A 4EAMA 4Q8OA 2NX3A 1QXLA 3W1RA 2D0HA 3CHDA 3ABZA 2PWDA 1AODA 1M6JA 3RX4A 5LNRA 5CGQA 3BG9A 3WQ4A 4NZJA 4GVFA 3NPXA 1UP0A 4AB4A 3SUSA 4JBRA 3UR7A 3ANVA 5M03A 1KLYA 2VGBA 4D6FA 4IUGA 3WD2A 1KRMA 4DEFA 4HJFA 4GZ7A 3NO1A 3IAQA 3C56A 5LYRA 1I75A 2DFAA 4TV6A 1A5CA 2F7FA 2C14A 3H21A 4L64A 1LQAA 2PS2A 4MYXA 1X6NA 1GGOA 1S2UA 3FVDA 2EPMX 5F7UA 1ZPTA 1WKDA 1VFFA 1HKJA 2XISA 4EVZA 2ZDSA 4IIBA 3DIPA 1FXPA 1R8LA 3DG7A 4FHAA 3NQFA 4FO4A 2YPIA 3WMSA 2IKGA 3THCA 3WQFA 4EKJA 3CGTA 3E0FA 5L6UA 4L6HA 2R6OA 4OE7A 3WQDA 4Q7BA 2X0SA 3C4UA 3PBGA 3IV8A 1B57A 5CPLA 1LRNA 3GC4A 4I8YA 3UG3A 3GXTA 3UXAA 1WQ5A 3BDKA 3E0VA 1I45A 4Q8PA 1ODZA 3SCTA 3DFPA 4QJ1A 4IT1A 4I9JA 4JTCA 2Y8KA 2CLIA 4D6EA 3IARA 3A9IA 5AYBA 3W7LA 2Y5EA 2DVXA 2C7FA 1RVKA 2QUUA 1I0BA 4C7DA 1A5BA 1OABA 3W7HA 3FAXA 3MZNA 2PMQA 3ME3A 2B31A 3T07A 3S8HA 4LJ3A 3PPHA 4JQ1A 5ABGA 5E6ZA 1XIFA 4UFJA 4QS5A 1G94A 1FDYA 3UCCA 3NXLA 4AZ6A 3GIYA 3VGEA 2GQ8A 4KWUA 3VMPA 2DSWA 1PWLA 1E6QM 4B4FA 5J8LA 4IIGA 3E74A 4JN8A 4GJ1A 1UWQA 1ZBVA 3LM3A 4DYJA 1OZMA 2HS6A 2E9LA 1Q6CA 1E1EA 2P8CA 4GINA 2EPHA 4JYDA 1H0GA 3OIXA 2WMHA 3W4RA 3O07A 4AVNA 5BXSA 1FCVA 2GWGA 2VX7A 4P7OA 4J3SA 4LUJA 1JG9A 4JKMA 1F6KA 1QPRA 3PJUA 4UUIA 1LG2A 4LBSA 3K5XA 5C54A 4D8AA 3WLNA 2JGYA 1G1YA 4IHCA 4IP7A 4LAMA 3ZSSA 3DERA 3WZ0E 2DP3A 5C71A 1KBLA 3WQPA 1KXVA 2I1OA 4LVBA 3ZMRA 4D2JA 2BVDA 2VGGA 1JPIA 3NQBA 3WMBA 2QCGA 1PDZA 2WNNA 3W2MA 2ZTJA 1KCLA 4IICA 5FJPA 2J66A 3S2JA 1T0OA 5BZAA 1Q2SA 4S23A 4GNVA 1WOAA 3AS1A 3DN5A 2E77A 4KRUA 4S3KA 2FPTA 4J2MA 2Z1KA 5ECUA 1D7FA 5CLTA 2VOMA 1K9FA 2HPMA 2PDUA 2ZQ0A 3QGVA 3MVIA 3S9ZA 2QGHA 3W1NA 2J7FA 1XBZA 2R14A 2P0IA 1MZRA 3GIQA 4FNPA 3SRKA 1UB3A 1XH2A 1N55A 2Q09A 4DUOA 4M0XA 3TC7A 3P14A 3V75A 5G4HC 2ALRA 4LF1A 1E1CB 1OEPA 1QBAA 3GVVA 1XLFA 4GACA 5EFFA 1XYCA 3RM8A 1U1JA 3CB3A 2ZC1A 2X1UA 1S5TA 2J25A 2AQOA 2XIIA 2J79A 3BE7A 3MBDA 3WLJA 3OBKA 3H2AA 1E1CA 3U2EA 1R7OA 4RW3A 4GY0A 3R11A 1JUKA 2PBGA 4B9YA 2WZMA 2VEMA 4N9DA 3AHZA 4TVDA 4GQRA 5FEZA 4CEXC 3NR0A 1VR6A 4MZ8A 3ZR6A 1I1XA 4L1WA 1M9HA 3HGRA 4JZ5A 1JEZA 3GH5A 1C9WA 2DUAA 4S3CA 4UFKA 2OYKA 4E5TA 4D6GA 1DP0A 3B05A 1TTJA 1IXPA 3RR4A 2PA6A 1CCWB 2A5HA 3HA1A 4GO9A 4NQ1A 5D38A 1J9YA 3L66A 1NQ6A 3QR3A 3GDKA 4WGXA 1CIUA 2W4XA 1GZGA 2W27A 3AUJA 3N6QA 2HPIA 3NPVA 5GPRA 5HAOA 5C7HA 4J1OA 3N19B 1S39A 2QDEA 1XRSA 2PURA 5DBUA 1LBLA 4GVIA 3T8LA 4OUIA 2H8ZA 2DQWA 4TR9A 2W91A 4YU1A 1J5SA 1SO6A 3AS2A 1ZQ5A 3HPAA 4ZXOA 6TAAA 4BS0A 3EYPA 4HOZA 3MUZ1 1WUFA 4XWUA 1SUXA 2WQPA 2WMJA 1QW7A 1N2VA 2HWGA 3KVMA 4X2RA 2HS8A 5I09A 2W9MA 2WMKA 4J3UA 5U4NA 3EOEA 1GOIA 1J6OA 3AXKA 1OC6A 2PCQA 4MB5A 1MYRA 1G01A 1XC6A 3N3MA 1H1YA 5LXEA 3DFTA 3W2KA 2Z2UA 1B31A 3GNXA 1EJRC 3W22A 2UY5A 3LNMA 1XF0A 8A3HA 1W32A 4E0CA 1ISVA 4C6MA 1BXNA 1UR1A 2DUZA 5JIWA 2A1YA 2J7GA 3QMTA 4CQDA 3DDMA 3CMGA 1UH4A 1B1YA 3PTKA 4R88A 2FDSA 3QMRA 3AXIA 3UG5A 5ABTA 1XD0A 1RQHA 2AOSA 3W7QA 2WWCA 5HQEA 4GCAA 4H8HA 3XIMA 3CZKA 3W71A 1Q7QA 4MWAA 1CLXA 3ZVHB 1DJYA 4QDPA 3WD4A 3V5OA 1E6SM 4LAZA 1OYBA 1P5BA 2X2YA 1REQA 1Q3NA 3TTSA 3BLKA 3IGHX 1TWDA 5FJJA 4MOZA 1FTXA 3RILA 1IZJA 4MVAA 1AW5A 1XSIA 3RRXA 4Q22A 4E3VA 4JS3A 3BJSA 4FXSA 4HQVA 4IPLA 1FVPA 2V5KA 1XLIA 4JOMA 3M44A 4XUGA 1XDMA 1W8GA 2O9TA 1XBXA 2GVLA 1LP6A 3E2QA 3LPGA 1YEYA 1TJ0A 4GX9A 5BWFA 1ISZA 1VBJA 4WGHA 2YIHA 4QNEA 1N8IA 1PZ0A 2QR6A 1KRAC 2J27A 5FL0A 2WSKA 2W67A 3T0BA 4EF9A 4JTLA 2GGHA 3KL5A 5FESA 3TR2A 2XM2A 3PY2A 3W6LA 3MI3A 1X7IA 1Y7VA 4FNSA 5FIPA 4RNHA 1U33A 3UXKA 5CAKA 2TAAA 4PE8A 3A3WA 3ORWA 2Y85A 1R9ZA 2AGTA 4NZCA 3ZSTA 5FACA 1FCBA 2V5JA 2Q6ZA 3L4WA 3N3TA 4UCGA 3MYOA 1R9XA 4DF0A 3QHNA 2DEPA 4ZODA 4AVOA 3UF9A 5I03A 2OWWA 3KM8A 3N4AA 4KKXA 1Q8JA 2CLHA 2WZHA 5J5RA 1XM3A 3PBYA 3KOWA 3FFSA 5E93A 4WJXA 2QUVA 3Q94A 1FWGC 3WDJA 1MW1A 1W5MA 3LRKA 1QAPA 1XRFA 2BSLA 2IXVA 3BSMA 1JVNA 3HV8A 5K9DA 3RIKA 4YWIA 1HJSA 3CQKA 3GD6A 2BHYA 2H3DA 1CTNA 4ZE5A 3P3BA 5REQB 3TOPA 3IAPA 3LTYA 4HT3A 1UKOA 1CYGA 3H22A 5EPDA 4DLMA 3SW6A 4QEEA 1OT2A 3WH5A 4ORIA 4AZ5A 2AAMA 4M6PA 3PZUA 3AIRA 3CAKA 1QR7A 2J9YA 1IWAA 1B3WA 4H9VA 4MDOA 3S0CA 1NM9A 1OX4A 5HNTA 4WJEA 2JBMA 3KS5A 3GH4A 3VNIA 4L9ZA 3N9KA 2E5CA 3LENA 4XZHA 3GG1A 1KFLA 2WMIA 1DVJA 4PTMA 2Q02A 2FZBA 4ES4A 3F4VA 1DQWA 4QAWA 1IEVA 2CPUA 3AIEA 1YDNA 1UD8A 1OF8A 5FJUA 5A8NA 4XAGA 1QMLA 2QF8A 3FEQA 4KBXA 2V81A 3A3HA 1ADOA 1L6SA 3VM5A 2EG6A 1SSDA 4W9TA 3BLEA 5EU9A 4AHPA 3GO2A 1DJZA 2WMFA 3IJDA 5HMFA 2Y7FA 2YLAA 3H2EA 1UC4A 2J9ZA 9XIMA 3GVQA 2FVLA 3GKAA 1AL7A 5C0QA 1PKNA 1BEUA 2OXNA 3BAIA 3WF2A 2ACSA 1POJA 1OK6A 4FIQA 3W53A 3CH9A 1EWDA 5CZ0A 1GZJA 3ITLA 4WD0A 4UXDA 3H2OA 3GC5A 4Q8WA 1XW8A 5GNYA 1GQNA 4IPPA 4RNIA 3AIQA 1E3ZA 4C91A 3TH6A 3NSMA 2CXGA 5KITA 4KEVA 4YJ5A 3NPUA 1LCOA 3NFUA 1JCXA 3BL3A 4W87A 3RF9A 2XG9A 4KCTA 4LYQA 1EBGA 2Y70A 3CPRA 4RDYA 3SUWA 3CASA 4HK5A 5A6BA 4IZGA 5JQ9A 2OFJA 1LROA 4WOZA 5FF7A 1DWAM 1DKWA 1M7JA 2FZNA 3ARRA 2FQIA 1J01A 4KGLA 2E7FA 2XGBA 3VIPA 1SZNA 1BRLA 3VDCA 3E2RA 1F2JA 3L0GA 3TTYA 3G1RA 1XP3A 4FNTA 2VNCA 1HZYA 3RCNA 3W83A 1DIDA 1E3XA 1HKIA 3CNYA 1HX0A 2CBJA 3WIJA 4HK6A 1XINA 4LV4A 5CGMA 3PTDA 4PGLA 2O7SA 4KS0A 4JX5A 1ECEA 2WSPA 3FYPA 1MZHA 4S2BA 4O8RA 4WDXA 1IT0A 3K2GA 4B5VA 1JXJA 5MKGA 3LNPA 4GISA 4NF7A 1ZBWA 1R85A 3MO4A 1PVNA 3K13A 3ARVA 4JXCA 3TQVA 3N15A 3BOLA 4O1CA 3TTQA 1QHZA 4CNOA 4GMEA 3QY7A 4MWAD 4M7TA 4JL1A 4JTUA 1ZJBA 5E0FA 4F48A 2DSVA 4H3DA 4N7QA 1DPMA 2ACUA 1XCWA 2F2KA 3BLIA 4QR6A 5HNUA 4F0SA 4TX8A 4CD5A 3EDEA 4GG9A 4AY7A 3N17A 1YDYA 3W1QA 4ZCWA 5LGZA 2I16A 2EXOA 3G8RA 5G2HA 2QQ6A 3WUFA 3UPBA 1P48A 5REQA 2ZRZA 5HPCA 3M0XA 3ALGA 4NJIA 2GOKA 2PRMA 5LGXA 2R1LA 1HXJA 3GTNA 2XINA 3M6DA 3G1SA 3M0IA 4PRWA 1HVXA 3T1GA 3REQB 3VD4A 1XG3A 4W8LA 1YE6A 1UA3A 2QJHA 4GQ0A 3KFTA 1GONA 5HJLA 1XV8A 4XX6A 3VNDA 4PTXA 1KR1A 4JHOA 3SQSA 4GGBA 1VFLA 3H70A 4BZYA 3NQCA 1PIFA 3NG3A 2GUYA 4PL1A 1H7WA 2HZGA 2P1FA 2ZXBA 3TN4A 5I3FA 5TAOA 3VKBA 1O5RA 4JIRA 4PUJA 4ZMGA 4LUTA 1ELSA 4QAIA 3RM9A 2VCBA 9XIAA 2FTYA 5FJOA 1FHDA 1EA9C 4PMUA 1OD0A 2Z24A 1GVEA 4KFOA 3WH8A 3S1WA 3MVTA 4F9DA 1E9ZB 5D32A 1XSKA 1EOMA 2E09A 1V6WA 2Y24A 1XKJA 2ATSA 4LC8A 4OIFA 1IEQA 2W5FA 3HPZA 2Q8LA 5HWJA 3A13A 1XIJA 2GDUA 3KZPA 3AYVA 3QOKA 4AWTA 3OTRA 3OO2A 1M7PA 1KM0A 1B2YA 1E0WA 2W79A 1QPNA 2YL8A 2J7HA 3KBJA 1C90A 3NSNA 1JZ3A 3W27A 1R3RA 4HHHA 1SJBA 3CZ8A 1E6RA 1KTCA 5EMYA 1RA5A 2VUYA 4V15A 3TKFA 3WF1A 2Y89A 2R1KA 4QG9A 5J04A 3IGUA 5DCBA 4AY8A 5A6SA 1EX1A 1IV8A 3RU6A 4KW2A 2E9MA 5GNXA 3MSGA 5JXQA 1CXEA 3M46A 2V30A 3W76A 4D1JA 2BWGA 5DCEA 1AW2A 1NSJA 3BG3A 4XD5A 2A3HA 2IQ0A 4O15A 3I65A 5A5WA 1RZMA 1HL2A 1Q7ZA 4LCSA 4IJRA 4XSLA 3S83A 4DJFC 3TWAA 2YYTA 2PP0A 2FHBA 2UV8G 3QJAA 5DY3A 3QFEA 2BNJA 4K68A 1SJAA 3URBA 4RCXA 3TOYA 4RE4A 1KGXA 2GL5A 3OLIA 3SECA 8RUCA 3BGJA 2D23A 5KEZA 1SO4A 1BD0A 3K8KA 2IW0A 1HP4A 3ES8A 1G4PA 1AQFA 2GZXA 4E2OA 1EIXA 1EJSC 2DW7A 5FEWA 3ZT7A 2YDAA 3LLDA 4IFKB 4BJHA 4OVXA 5HPOA 1UR2A 3WDIA 1VFOA 4UNLA 2ZZ3A 3LHUA 3IJLA 4IL0A 4JTQA 3IUIA 2FMOA 4GIAA 4QM1A 3C0LA 1EP1A 4UTWA 4WKFA 2IPGA 1GYLA 3HM7A 2Z4GA 2XFFA 4OUEA 1XLDA 1ICQA 3WQCA 3CMFA 4AD2A 2ABAA 3QLLA 4NAFB 1H3GA 2Z6IA 3CUHA 3W7KA 1UROA 4PYSA 2J7EA 1WKYA 1W9DM 1XIIA 2VR2A 2EEXA 3RG6A 1DJGA 4M1BA 2RAGA 2E67A 3UD6A 4C6OA 2OEKA 4D8LA 3THAA 3T0TA 4QJ4B 1LUCB 4U2ZA 5ABFA 1Q6RA 4N4QA 1UKPA 3RDKA 4Z0JA 5BXRA 5HNNA 4Q8UA 1CXIA 1IZKA 1V93A 3MI2A 4GYJA 3ARWA 3DYOA 3SSJA 4MUPA 2O9RA 2YFNA 3TX9A 1OWQA 5LKYA 3NZPA 1UKTA 1H60A 3WMLA 4WY0F 3QOMA 1JF5A 2A79A 2DIEA 4MFEA 1KV5A 4IGSA 3GU9A 4GZIA 1Y65A 1TA3B 4G8TA 2QJMA 2GYIA 1WA3A 1SR9A 1KBBA 3KTSA 4HPHA 1A50A 1EP2A 3NSXA 1FH9A 1ZBKA 2VRQA 8XIMA 1ALDA 5A95A 1EC7A 4XTDA 3KBNA 4IFKA 2CZDA 3XISA 4BQ5A 1WO2A 4I9TA 4HHPA 4MLJA 4TMBA 5I3IA 4FOKA 1VB9A 2QS8A 1BF2A 5E6YA 4ATDA 1A5MC 4DJDD 3CTLA 3FVMA 4MPQA 1WB0A 1XYBA 4O1FA 1PCWA 3L2LA 2VRKA 1BHGA 5D8ZA 1XRTA 3EWWA 4K2SA 2XHYA 4AZCA 4HKPA 3PFMA 3BJTA 5CSYA 4DLFA 3BCFA 1YNPA 1E6PA 3W73A 4ZL1A 4R27A 2BFGA 4ZB5A 4MYAA 2AKZA 1V3JA 3VX0A 1GWJA 2QMKA 2V3FA 4CCDA 1MDLA 3RX2A 2CYGA 3IIPA 4GFIA 4F0MA 1EJWC 4D6IA 4LW7A 4MB3A 3BURA 3NQAA 3ALFA 1WPCA 3L4TA 4F2TA 2XVGA 3QTGA 1R3WA 2WJFA 1F4HA 1VGAA 4X2PA 2W0UA 3GG8A 1XJBA 2DVUA 3A47A 3DI0A 4H6KA 1BG9A 3L0NA 1KFBA 1PZ2A 1V6VA 1TRDA 3IVSA 1ZTVA 1KQYA 3TEVA 3RYSA 3P82A 3L4UA 3P80A 4XAFA 3ZZ1A 2OVLA 1C8VA 3ZXWA 2ISWA 4CLMA 1DHKA 2G8ZA 3P67A 4MZYA 1F6YA 2QDGA 2WPGA 1ZFJA 3QGAC 5FD0A 1JPHA 2YCIX 3LS9A 3HV9A 3QPYA 5DQPA 3SRDA 5DRIA 2VXNA 2XVKA 2DJXA 4O10A 4OU1A 3MKCA 2QVNA 3CS2A 2NXGA 1W5OA 3LEPA 1TJRA 3WLTA 3N2XA 3GXMA 1ECQA 1EO5A 4MUZA 3E2VA 2XN2A 1BF6A 3FDGA 4HU4A 4DJFA 2QPSA 5HA7A 2ZX7A 6ALDA 2Z1SA 1BVWA 5A6KA 3FDKA 2ZRYA 1IEIA 3VIGA 3T81A 5FAJA 3UERA 1FWCC 2I5QA 1GVIA 1YBQA 3CLWA 1JPDX 3TA6A 4XKYB 3W85A 2VWSA 3LTPA 1GEQA 3F5LA 3HFYA 7XIMA 2ZUUA 2C1IA 2ZA1A 2ZC8A 1LM1A 2CXEA 1BSIA 4WZHA 4Y8EA 4GYFA 4HCLA 4OKDA 4Z2IA 1LWJA 2VCCA 3KCJA 3VAVA 2E1DA 1SMDA 2F9RA 1JRCA 1EO7A 2Z1XA 3RUBL 3PZGA 1MW0A 5I24A 1MFVA 2BDQA 2I5IA 3KHJA 4UTTC 3VIMA 3WFZA 5FCZA 3N6HA 3P8JA 2V8ZA 3AOFA 3K4AA 3PULA 1H7RA 2ZRWA 4FSAA 3OHMB 1XSJA 2A2IA 1EJVC 1UD4A 5DBTA 4C65A 1K03A 2Z7KA 3B3DA 4AIBA 4L65A 2VFHA 3W38A 3VVGA 5A6LA 3RPTA 1B3XA 4K1GA 1GOXA 1LZOA 4DWDA 2O55A 1R86A 2WMGA 1A5SA 1EH9A 5GJMA 5KZ6A 4R85A 1AH0A 1PS9A 3GHSA 5G2IA 1TX2A 3SQLA 3SY8A 4Q4PA 3OVGA 1TFVA 4XO7A 1W1TA 3H2MA 4YVPA 3KHDA 4KMQA 1OB0A 1QOPA 3RGTA 4C6EA 4O8AA 1NFBA 3QBUA 3YPIA 3PR2A 3R10A 1L2UA 4S1FA 1X6UA 3FS2A 2X1RA 3MJMA 5L9FA 4PB3A 5H8PA 1FWRA 3MV01 5AC6A 2PRLA 2NT0A 3UVAA 3QQ0A 1XIGA 4JY8A 3W23A 2DIJA 2GJNA 5G4EA 5FSDC 1KLZA 3TCSA 1TJPA 5AY7A 4FZIA 4N0RA 3SJ3A 1CEOA 3HG3A 3IUHA 2OYMA 4ADUA 5AN7A 1TCMA 3L12A 2ZZ5A 3EWUA 3OGSA 2HJPA 4B5NA 3FXYA 4S3GA 2PLCA 5D02A 1NWTA 1H2JA 5D09A 3DGBA 5D2XA 2FZMA 1YX1A 3U7VA 4NASA 2XH7A 2L5HA 1PZ3A 5XIAA 1FHLA 4AD4A 3VIOA 3BAXA 4F0KA 3ARQA 3AJ7A 1MFUA 2OOGA 4K36A 4IPIA 2R94A 1SZRA 4IQEA 2INFA 5K4ZA 4GK8A 3HQNA 1TTPA 1GW1A 5TNVA 3QY8A 5FKYA 3T2OA 3WQ5A 4DJEC 2QCLA 4TUFA 1H63A 5HDRA 4PUMA 1U1UA 2OODA 1W9PA 4UCFA 3JVAA 5E9XA 4O28A 1AVAA 3G1YA 1XLLA 2XJ7A 2PDJA 3VZZA 3OGRA 2VZTA 4UTTA 1RPKA 4PCTA 4AFYA 3BQ6A 2PWEA 3WLHA 1QNOA 3G3MA 4C5ZA 2P76A 3S5OA 3C2OA 1YTDA 2D3LA 2CZFA 3TYUA 3GG7A 3VILA 4PUKA 3DZ1A 2G97A 4JR5A 2ZKMX 1BWVA 1WNOA 2ZYFA 1ZJHA 3G1HA 3URAA 4DQWA 2GJLA 2V38A 3J7HA 2I9EA 3R5EA 1IT8A 4G1KA 5D2YA 1XCXA 4QNWA 3AS3A 4S2CA 4WXZA 1M7XA 2ZA3A 3MHFA 4YIWA 5BYWA 2DORA 4H7VA 3B4YA 2QAPA 2CBIA 2TYSA 4ZB0A 3WG6A 1S2AA 3LHVA 5BU9A 4URIA 4EP8C 4UR9A 3EX3A 1H5YA 4ENLA 4OHQA 1JF6A 5F2IA 4BEUA 4BY3A 2OWCA 2MANA 3AXMA 4F66A 1PYFA 3TJ4A 2WOQA 1ZNNA 1SFTA 2VTFA 3BUVA 6REQA 1Q6EA 2P3EA 1TV2A 3CEUA 4L4OA 3UW6A 3FGCB 1UYQA 2YLLA 4NZFA 2PAJA 1TKKA 3APYA 1NQKA 4KCVA 4PMZA 4H01A 4NJKA 4PSRA 4S38A 3VYLA 1PX3A 1OCJA 3MT1A 3W9ZA 2XIJA 1MQPA 3OGVA 3W84A 1PKYA 1WZAA 4J3ZA 4GC3A 2DH2A 4HNVA 2QCFA 3GK0A 5DT7A 3M0VA 2GJRA 3TSMA 2UY4A 3LRLA 2JKPA 4NILA 1RVGA 3UZYA 3ARTA 3SCVA 4LY8A 5AFDA 1UG6A 1R7AA 2Y88A 4AD1A 4O52A 2PCEA 3LLFA 3WL0A 1GVSA 4R7WA 1H1NA 5DN1A 4MG4A 4CEUC 2ZZ2A 4MHBA 3WK2A 2DZBA 3HF3A 4YL2A 2JIEA 3CAVA 1TV8A 1X6LA 4QG6A 1DEDA 1QRQA 3SUVA 1O66A 4ACYA 1HJVA 3GZ3A 4A8NA 1WZMA 1CBGA 4UC5A 2ZTKA 4ML4A 1FA2A 3VOGA 4A05A 4RXFA 4CCEA 3LBMA 3E02A 3RO8A 3UZXA 4WSHA 3EWXA 4PB5A 3FCPA 4HNUA 1TVLA 2VC5A 5C2XA 3BOFA 5F2MA 4HMNA 3LLXA 3UETA 3N18A 1S5NA 3GDRA 4NNAA 2ZVRA 4DBUA 1ZCCA 4HVXA 3E12A 3APGA 3O15A 1EC9A 4U3CA 3V1HA 1GQJA 1UUMA 3VKDA 2XH2A 3TUUA 1YRRA 3G22A 4EXAA 4LUSA 1B5TA 1WDPA 4JCLA 3F4CA 5I3KA 4AZ7A 1JYWA 2G4FA 1AD1A 2A85A 5BROA 4X60A 3PPFA 2CLLA 1XR2A 5IOBA 1XBYA 2OZ8A 2CZEA 1B9ZA 3P74A 3CYJA 4EPDC 1PL9A 3PNUA 5A8OA 3B0VC 5TD4A 4F3HA 4US5D 2ZUSA 3MMUA 1B54A 4PMQA 3GRIA 2GVGA 1LL4A 2Z26A 2FKPA 4JNZA 1MEWA 5AYXA 4NZ4A 4OGZA 1LT8A 2QNEA 2PGFA 3FX4A 1DHPA 3NVTA 1A4LA 1YXYA 4ZE4A 1RJPA 2YZ5A 3RAOA 3A4WA 5I3HA 3RMEA 3KCOA 2IQTA 5AHMA 1J0KA 2HBXA 2YBUA 4NAEB 1VEMA 3KRBA 1C92A 3TZNA 1NOUA 1TTIA 5HUPA 4H7CA 4AAJA 4JYEA 4JIEA 4LT9A 3AMLA 4Z1DA 1S5MA 1SSGA 2XYLA 4PTDA 3HBLA 1JZ7A 1RCOB 2VQTA 3GAKA 1CXLA 4FX8A 4GUFA 2XFYA 4JTKA 3GXIA 1GVFA 1GCYA 5HANA 3HQPA 2BY3A 1TUFA 1UD2A 4LSBA 3W24A 1E73M 5G1YA 4WQ6A 4F0LA 4L80A 2JFEX 5DELA 2C8NA 2D1ZA 4HPGA 5EMKA 3AQUA 1JL8A 3W1XA 4GI4A 5ABFB 2BOGX 4L1GA 3A5FA 3V4BA 4M7SA 5G1MA 5EBUA 5A6AA 2GVEA 2V9DA 5FF3A 1C9DA 2V63A 5HQMA 4ZTYA 1F3XA 3SN4A 3M5YA 2OO0A 2Q8ZA 3SR7A 2HSAA 1T40A 4IGMA 4MJMA 3RN6A 4QROA 3G3DA 3W88A 1J8VA 4XZMX 1IYXA 1ZP3A 2D2GA 2OKTA 5CZSA 1CNVA 3G18A 4ZO7A 2F84A 4XTIA 3Q67A 4FP1A 3R0DA 2QW5A 1MO0A 3HFTA 3F4NA 4WEVX 3DAQA 1H0IA 3OIHA 4LYKA 1H09A 3H4GA 3EZ4A 1J4EA 4DWSD 5CLWA 2WYSA 3U4FA 5CBBA 5D4YA 3TJLA 4QDWA 4IG2B 4NX0A 5FJIA 3WQ6A 1X1OA 1QPKA 1J12A 1ICPA 1XYLA 3GXPA 4H00A 1JD9A 3KDNA 2WCSA 3Q45A 4QISA 1JI2A 3OZMA 4J40A 3CT7A 3AJXA 1FFQA 2Z1WA 3PANA 2YA2A 4BI6A 3EB4A 3GBEA 1OD8A 2Y2WA 3BV7A 3SGUA 5M17A 3A23A 3SCOA 1YXCA 2PDWA 3ABSA 3UWUA 4JEJA 4WIWA 4CU8A 4PMYA 1FUYA 3LCIA 5H2ZA 4XUYA 4C6CA 1L6YA 1W6TA 3CUFA 4HU3A 3AMKA 1SYTA 4XVEA 3M41A 4IMFA 4C6KA 1PV8A 2XVLA 5HQLA 3QQWA 1FWNA 1EEPA 1R3YA 2WSRA 4PBFA 4JQ4A 2IXUA 4QITA 4MWAC 3P2VA 3B06A 4X0NA 2HK1A 1DV7A 3FA4A 1QI3A 2QZRA 4HOXA 4YTTA 5I3DA 1EZWA 2VJXA 2TSYA 4ZO6A 2P8BA 2VEKA 1QHPA 1E4NA 3S47A 2WKGA 4HD5A 3TW9A 1VYPX 1OYAA 4X9YA 1LLZA 2WV8A 5D9MA 4GH3A 1WAUA 2PWVA 1RJRA 3N4EA 4O53A 4Y96A 1NFGA 1VPXA 1TMQA 1LG1A 3PFRA 1T96A 7TAAA 3FIGA 4XKMA 3F03K 2IUZA 2OMAA 3FLUA 3SRFA 4ERIA 1OJXA 2J7BA 4IQLA 1Y5VA 1UWSA 3VXGA 5I2UA 5DT5A 1HT6A 3SGZA 3BQ5A 1NFPA 4Y90A 4AZCB 2NUXA 2VEIA 5CC6A 5BOEA 2VR5A 1I2PA 3L4VA 2PE4A 1K6AA 1V51A 4B4HA 4YTRA 3SDOA 3SAZA 1XD1A 1VKFA 1AK5A 1N8FA 2JK2A 3QC0A 2PWGA 2WSQA 3NDZA 3WSUA 1GVQA 4NJJA 2ODOA 3CV2A 1Z48A 3QV6A 4TTGA 1DL3A 2I56A 5J5DA 3SM0A 1I60A 3PP7A 4C1LA 2PDQA 2EBNA 1UKQA 3RM4A 2D0GA 2UBPC 3MANA 1BQGA 3ZOAA 3QVQA 1VYRA 1UC5A 3VO0A 4WVXA 3NZ1A 3P81A 3ABRA 3B4UA 3T0AA 4Q8TA 2OU4A 1TIWA 4NRRA 2ZRVA 2HNEA 5CPMA 4I5UA 3UPWA 2MUCA 3KOFA 1Y0EA 4O1BA 3PB0A 3WD3A 3STGA 3QKZA 2FB2A 3Q58A 1M03A 2WM1A 1H50A 4UFHA 3DYMA 2DU2A 2PDBA 2GVJA 2ACQA 1JPKA 4LALA 4XG1A 4FB7A 3QV8A 4CQAA 3CPUA 3V35A 4FAMA 4XAPA 3LSCA 3W7OA 3T44A 3MZ2A 2PDGA 2ZUMA 1E4IA 4IM4A 4MZ1A 3NZGA 3EKZA 1MRQA 4CNTA 3LQGA 4O14A 4K39A 3LHTA 3GQYA 2WVVB 4WX2A 3L5AA 2HXUA 2Y63A 2XIQA 2PDYA 2OX4A 4O4VA 4V1YA 1VQTA 5DXXA 3RHGA 4V27A 4U4MA 4H6EA 1QNQA 4AWUA 1KGWA 2PC8A 5E70A 4LUYA 3MSYA 1YDVA 3TYCA 1NDYA 4C1NB 4FXRA 3VC6A 3QF0A 2RJGA 1Q45A 3OQEA 3SRHA 1C8QA 4R5EA 1XPGA 4JTGA 3CWOX 2O4QA 2OZTA 1V3HA 2ZBTA 7ODCA 5I6SA 4NL1A 2DY3A 1DWIM 1V02A 1F8MA 4AIEA 4B5UA 5BRBA 1JYNA 5A2CA 4J7RA 2GK1A 4G9PA 3QTPA 3UJ2A 2QXWA 3R8RA 1ONEA 3GLCA 4LAUA 3KCLA 3ZJ6A 4UWMA 1UZ4A 3LG3A 3V1PA 2CC0A 4NZ5A 1W1B1 2NX9A 1LL7A 4UTHA 1KXTA 3NTYA 2GJPA 3RJXA 3GXFA 3VOFA 2V69A 4ZQMA 1XLJA 1EJ7L 5CXPA 1AUSL 3DC0A 1XX1A 1ISYA 2B0MA 2YR1A 2WJDA 3AIBA 4I9MA 4DM1A 2PPGA 1F5ZA 2FHFA 3TC6A 4DPPA 3H8AA 1DJQA 1O68A 1FHUA 3GYEA 3I7QA 5FJRA 4GIRA 1U2YA 5HR6A 1CT5A 2A7NA 1EOKA 5HMEA 1KM5A 1P0NA 2VX5A 4AIUA 1HL9A 3RXZA 1E56A 1KCZA 3EPNA 4MNJA 4HSNA 2YOCA 3MC5A 4LGXA 3ZR4A 3E6EA 1QFEA 1JZ8A 1T8XA 2JF6A 3T7VA 1H11A 3MP5A 1DWJM 2CHNA 4H9TA 2CBUA 4DBWA 5M3WA 1W56A 4K3ZA 1EJTC 2XFRA 4M29A 3LCFA 5FI8A 3WQWA 3RLHA 2D2OA 1D3GA 1VPYA 1ONWA 3W6YA 1ISWA 4Z2HA 4JTAA 2X8RA 2IKHA 4YYCA 2HISA 1FX6A 5I23A 1XDLA 3G1DA 4DUVA 1RBAA