7CGTA

Rameb complex of cyclodextrin glycosyltransferase mutant
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 228
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 7cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 7cgtA01
2IBGA 4BFIA 4L9LA 4F79A 1JPGB 2XNAA 5C3TA 3C8DA 2ZOKB 3HZKA 4IOIB 2GJRA 2ICWA 1YMMA 5EB8A 3N1GC 2VB5A 3HC4H 4NRRA 3CIQA 2UVFA 4EOWH 1I1CA 3CH8A 2J88L 4HWBA 4P57A 4OF5A 1SJEB 2FE0A 2F8VA 3PZVA 4P2OD 2Z4QB 3DRTB 1C16A 2RHEA 43C9B 1ZA3B 1MREH 3SDCB 4DW2H 2Y23A 3JUZA 5DLML 4WIQA 1SJEA 1IEHA 2X05A 4HU8A 1BREA 3RIKA 2ED8A 3HE7D 2MQCA 3CFJA 3BGFC 1K4CB 4HWZB 2ZOLB 4DVRL 4X5WA 1DEEB 2CDEB 4QF1A 1M53A 3SCQA 1HTYA 3WNOA 2PUQT 1ZLSH 4G9FD 3L4ZA 3WJJC 4I0KA 2M26A 1C5BH 2B4CL 2NW0A 3W0KA 1GXEA 5CZKA 4X5LA 1V0KA 2V3DA 3ULUD 5IHLB 4IM4A 2Y07H 2EC9U 4DKAA 2CESA 1JPSH 4IIQA 2MANA 3SKUD 2BVQB 3MNWA 1ZGLM 4JFOA 5I1JH 4AMCA 2R0WL 5BXFA 5L2JB 4ZO6A 3EOAA 1U3ZA 1ISZA 3KPSD 4D0DB 2X4TA 2NTFB 2KQMA 4I48A 3B2VL 1TXKA 2E3ZA 1DE4A 1DEDA 1UB6B 2HN7A 2VDPL 5FUCE 1ZVSA 1P6WA 2ZCKL 4NQDB 5FK9A 4CMHC 2EIBA 2OL3A 3UAJD 2A6DA 2H6PA 3GB7B 4LSSL 3WXVH 1A5FL 5GGVY 1T2QH 2X4NB 3MA9L 1EUTA 3HMCA 3MLSL 2BNUA 1MAMH 5IJKA 3WNKA 2BHZA 4ZTPL 1BJMA 1S3KL 5CD3A 1K4DB 4NZJA 5A2LH 1ZE3C 1R5IA 2QPSA 2A6DB 1NGYA 2RFXB 3SDAC 3DDFA 1R5WB 2VXVL 1CFQA 1MPAH 2ICWJ 4AK1A 3VXOB 3GIZL 2WIIB 4HKJB 4TVPE 3SDDD 2ATKB 3ZE0F 3PDDA 3LQMA 3K4AA 3ARSA 3Q48A 3UJJL 5EUOA 1KUMA 3BUYB 5GGRA 5MP6L 1NP2A 1JGUH 5DI8B 5CIPB 1OD7A 5EBGA 1C5CH 4Z7UB 1ES0A 1C7TA 3P4NA 1SHMA 3EDKA 2GFBA 4FP8L 5HGHB 2ZUWA 4ZUWB 1CGYA 3RGHA 1INEH 1CU4L 3NFNA 5ADOH 4D1IA 3LPOA 4XPTH 2ZNXA 5GS2H 4XVSL 5F1IB 3NPSC 3GB7A 5CIPA 5ISZD 2UUDK 1A3LH 3VXRB 4IUGA 2J7EA 1HYSC 4NJ9L 3X14A 1MQKL 4GRWH 2MJWA 4E9LA 5INDB 3QR3A 5HGHA 4WKHA 2LABA 3OKEB 4XNZB 5FOOA 4GXPA 1QFWH 2EE9A 5A2IH 4S1RH 4ISVB 2RFXA 4CMMB 4TX6A 5J89A 3HN3A 4NKDB 5GGVL 1NGQH 2MTPA 2ATKA 4M4PA 1H11A 2VDOL 5E00A 3TPUA 1C7SA 2UWEF 5FD0A 4LDLB 3ZR5A 3DGGA 4GQRA 3QULB 3QUMB 1BM3H 1S7UB 4G8GB 3QHFH 4MJ6A 1ZHNA 1A8JH 3GO1H 3FB6A 1GCYA 3KJ4C 1N6QH 2YLAA 3RM8A 3LKQB 1VJZA 1QI2A 4UIKL 2J8UE 2GDUA 4ZTOL 3ARDA 4M8UA 2ICEA 4W5ZA 2UZYB 4NFCA 3MODL 3SDDB 1MCRA 4HDIA 4G8GA 1UZ1A 1QLEL 4CU6A 3NJ3A 4AT6A 2TAAA 3LPWA 3RY6A 3WXWL 2A1WL 4K7FB 2VLME 3TPKA 5I75B 3MGTA 3WFEH 4OFDA 1KNOB 4JANA 3BDYH 4XB8A 4AG4L 4D0CA 3T0BA 3EW3B 5FO9B 1KBBA 3MMDA 4ZUUB 1XH0A 2BS9A 3NGBC 4ZEPA 4NUJA 4L4VB 4IRZL 3TC9A 2F53B 3STBA 4HA1A 1Q72L 5FUZL 2CKRA 3QP3A 4RBPH 5FGCB 3ZYZA 3N85L 3RWFA 4GRWF 5IIEB 1Q6CA 3DX2A 1UXSA 3ZKND 1EPFA 3CHFA 2NW2B 1LE9A 1NBZA 1T80A 4ZUUA 3WD1A 3WNNA 4JFVA 4ZDHA 1B90A 4MMZC 4ZODA 5C0EA 4QRQB 2GJ6B 4NO0D 4LCWD 4PJ5E 5LGJB 1R75A 1QI5A 4HDIB 3VFTA 3AQUA 4D9QD 2O9RA 1NDMB 3K2UL 3BH9A 4UFMA 3DX6A 1L6ZA 2FEEL 1CICA 4OJFH 4I3SH 1YPZF 3KL5A 5GISH 3E3QC 1JRHI 3IS1X 3BGMB 4G7VH 4PP2B 1DQQA 4LU5H 1TE1A 3RWHA 2ARJA 4KJQC 1YNKH 1BFTA 1AQKH 2XTJE 3UEQA 2XQBL 1IKNC 3W81A 1H5BB 3FY1A 5AEAA 1A9BB 3BGMA 5H37H 1XIWA 3BZEB 2J88H 4I18A 5B38B 2VDML 3R0MA 3GUTB 2EDLA 3QUZB 1QSFB 2J8UB 5HHXL 1XR8A 1DQJB 3VWJD 4G7YL 3S3JA 4NNXB 1JAKA 2IMNA 3LEVH 1JVKA 2XWBB 4JRYD 1AVAA 3WD0A 1B6UA 3CU1A 4WW2C 3RUGA 4P9HC 4HULB 4PUBH 4PJ5B 3QEUB 4ZSOE 3SQOH 4PJBA 5E6IC 2I07B 2JJSA 3ZKMD 2ZP0T 1J1XH 1ZHLB 1PD6A 2AI0L 4YXKH 2HLFD 3CFBA 1S7XB 1FVCB 4M8QA 5JHDE 1QWNA 1KCKA 1YEDB 3C60D 3N0PB 3S3PA 2G3IA 1NFIA 3CBWA 3ZT7A 3O6AA 3MCLL 2W91A 4PTWA 4CW1A 3JV4B 2JELH 2XTJB 5E6ID 5T1MA 1ZKAA 5LXGL 5HHQB 4Y89A 4ODVL 2NY3C 2P49B 1DWFM 2Y36L 4J3WA 1HQ4A 2R2BA 4U1KB 1CFSB 2P5ED 3WL9A 3F65A 2OR7A 4F2MA 4GG8B 5E7FA 3OZOA 4URTB 3EYOB 5IVZA 1EOKA 1J0KA 3P0YH 3H54A 1WQVT 3EGSB 3D87B 2X89A 4OIFA 5EU6E 43CAA 2F58L 5ILTL 3CZFB 1JUFA 2C9AA 2XWJB 1ZJBA 4JFDA 3O3UN 1W3JA 1ADQL 4XNYL 3O4OC 4J3XA 4HOZA 5D1QC 2EDBA 2R2EB 1DUYA 5TD4A 4KVCH 3V5HB 1AFVL 5E08H 3FO1A 1ZS8A 3FQTB 4PRPE 3OKMB 4XNUL 3PL6A 2VNCA 3G08B 3VMNA 1F4YL 2A38A 4M9PA 4OQTL 3UYPA 2JB5H 3CVHB 3OXRA 5DQDL 3VGFA 1LD9B 3KYKH 3D0VB 4PJFA 5T1KA 3QCVH 5MI0C 3VD4A 1RFDL 3HC3H 1KEGL 2EYTA 2V7NB 3MZTA 4LL9A 2XGIA 1FORH 1JNEA 1I9JH 1LEGA 2HFEB 1IBGL 4P2QB 1RZGB 1YNLL 1FNEA 2D0FA 4KKAC 5GZOD 2Y5TB 2A83B 1T7YA 3O6LL 3VH8A 3O3EB 2VITB 4CKQA 4H1LH 4OLUL 1KFWA 5GNYA 1V7NL 1R3HB 5DSCA 1O7DC 1CQKA 4U3HA 5FEBA 1OT1A 3AIEA 1C5DB 4OFYD 4BUGA 2WZEA 2WWDA 1Q9LA 1JWSB 1P5UA 5EO1B 3LRLA 1SBSH 1X5JA 2E9LA 5J7CC 1J1PH 1RUQL 2VXUL 2HJLA 4F33A 2JCCB 2UZIH 4HH8A 5IEKB 1MEXH 1W3LA 5FM8A 1X9QA 5E9AA 2FYVA 1H41A 3ILPA 3PHQA 4QGYA 4NP4H 3UAJC 4LCWE 4PJ5D 4FLOA 1KIRB 2UY3A 1NM9A 4GXVL 1J05B 1YEEL 1ND0B 3MYJA 4OZHF 1OAKH 3QWQB 4PN2A 5DHYB 4J23A 4Z95H 1F11A 1FNHA 1BQHB 4GQ9L 3CIVA 2OWCA 1R5VA 2WQRA 2OTPA 3FHQA 2W65B 2ZUMA 2PXYD 4P5MA 4S3KA 1CFTB 1PQZB 4S1DC 4FNTA 4CVWA 3PP3K 1EEYB 3G9VA 5IG7A 4XTRD 4KTYA 4X9GA 3S8WA 4MA3B 2DQTL 4TVUA 3W28A 1Y6KR 3K2UH 4H88L 5A40E 4O00A 1P4LB 1KXVC 3EZ8A 1UR9A 4U31A 5TJWK 3TT1L 4PSPA 1MCKA 1RUML 1QFWI 4BSJA 4JFDE 3WELA 2OXHA 2Z93B 2Z91B 4CVZB 3ZQ9A 3ZTNH 3UPRA 1AR1C 5DS8A 5EU6A 32C2B 3BKCL 5D5ME 3AXXA 2EXWD 4TN9A 1QBMH 2ZUYA 2DQXA 4FQHA 1BWMA 4LIQH 5EWIH 5DO2D 5A8QA 3RVUD 2F58H 3SE4C 5ILTH 4PRIA 5GGVH 2CNCA 3GXDA 1ITXA 1NC4A 3FXYA 1JCKA 2HKFL 4NC0B 2BMKA 3V4VL 1BGXL 3BWAB 4NHUB 1BYDA 4G43A 1NWTA 3CLFL 1XGPA 4KJPD 3MXVL 3TFKC 4CU8A 1MWOA 2IJ0C 1KLUB 1WNOA 1F00I 3RKPA 4JKKA 2J8GA 2J6EA 2F7RA 2YSSB 1TQUA 4LVHB 4M7KH 3TVMA 3T77A 3GSNL 2QR0A 3U82B 4Y19A 3DV4A 1JPTH 1HNYA 3EMCA 1UZ4A 1KCVL 2HMIC 5CINH 3MRRB 1WP6A 1PEWA 3GSOB 3V6OC 3G5ZA 5GGTH 4JREB 1L6XA 5C2BH 4AY1A 3QDJD 4HKZB 1OIFA 4WU5B 3PWJB 1DBJL 1CF8L 5CWSB 2VL5B 1NLDH 4HSQA 5DUPL 5H35A 4S1QH 2HT4C 4XP5H 3T0XA 4MDOA 1NGQL 2J79A 3NIGE 4EK7A 2J8UF 4M5YH 3STZA 3ZDZE 1T5WB 1GOKA 4QXGH 3AM8A 4JKMA 4XPFH 5GGTA 5TF0A 5BOZG 5CEXA 1I7RB 3MRBA 5KS9E 1RUQH 2VXUH 3DLQR 1HOCA 5IJKC 1EVUA 4DGYL 4HH9A 4R3SB 2L0DA 1V6WA 5LXGH 5B39A 3DPBA 2R8SL 5IJVB 4WO4D 2Q87A 3L7FA 3W11C 3Q6GH 3OL2A 3JV0A 2NY6D 2CLZB 4JHWL 3P77A 5MENA 4QTHB 1SVCP 2I9LB 3MSPA 5C0CD 1BFNA 5HGDA 1MCNA 2ICWB 4Y5XB 1XGUB 3FT2A 3SPVA 4OBSA 4JZJA 5DFWH 2HN7B 2KPNA 2A2QT 1CVRA 1TFVA 1NCWL 4TUKH 1IQWL 5FCSH 1U8MA 5GGUA 4KK9D 5H37G 3KPLA 2AK1H 2UV3A 4XX6A 3IRZA 4RSVA 5FUOL 4AD0A 3HHRB 1AGEA 4WHYH 2J7CA 4EQ3A 1CYGA 2K3TA 5L2JA 5A8PA 2WIIA 4G8GE 3EUUA 2OW6A 3OPZL 4N8PA 1NMCB 3VRIB 4IJ3B 4P8WA 4XPBH 3BISA 4PLNC 1QYGL 1DQLH 2QKIB 2O61A 5E2TL 3C5SB 3OAYK 3QQ9C 4HXAL 3B43A 4EI5C 2VH5H 2X4NA 5A69A 3F7RA 1MWAH 1OCWL 1GPFA 3L3JA 3FT2B 1IEAB 1IBGH 3C60C 3VE0A 4LHUA 3MLWL 3DDGA 5F89B 5JBFA 1MF2L 5ENWA 5TGBB 4W8LA 1DVFB 1ZHKB 1Z0MA 3DURB 4M1CD 1A47A 3S5YA 5I8CB 2C7UA 2CLVB 1BIHA 3GHEL 4PRNB 5BZDA 4FQXD 4GOSA 4LPYA 3UJIL 4J1UA 1WO2A 2A9MH 4NRZB 4NQDA 5FK9B 2CKSA 1INDL 2FWOA 1S7TA 5FYLL 5TGBA 1NEZB 3DVFA 1JGDA 3S88H 3QIUA 4EIZC 3FB7A 4X4MA 5EU3B 1SEQH 1V8HA 1S9KC 3MC0A 1WBZB 3V8OA 5F9OH 3BKJL 3VRIA 3UTTB 4UINL 4GZEA 2RB8A 3LKPA 2BNRE 3OKKA 5FGRA 4QEGA 5E6IB 3CSGA 4PREA 3O8XA 4GRMB 2GJ6E 1IGIH 1KCVH 3OG6B 3VXRA 1T20B 4LSTL 2XXCB 3IJ8A 3CZKA 5CP7A 1YHTA 2C4XA 3A47A 5C08E 2NXYD 3FB6B 1FH9A 2XN9A 4I2XA 5EUOB 4P23A 4PJHA 2FJGA 4NN7C 3MRNB 5F7EH 3P4NB 5BV7C 4YWGH 2ICEB 3R4DA 1PG7L 3NTCH 3WFCH 4F66A 3QUYA 4U1NA 1A1OB 2N7AA 5LGKA 3IVKB 4Y4HA 5L8KB 4Z7WA 4X4ZA 3VWJB 8A3HA 3EJYD 5J8OA 4MA1C 3MOBL 1OP3H 4EIGB 5KVEL 1Z3GH 3PZNA 2D9QB 3AICA 3AS2A 4LLAA 4M7LL 4Z0XA 3PZGA 4FMVA 2X4UA 1GW1A 1FYTB 1UH2A 5FO9A 3PZQA 4F7CB 2W0FB 5HSFA 5KSUB 3F58L 1DBML 3G6JA 1E4XH 4F3FA 2CGRL 2J7DA 5A8MA 1G7IA 2DQFA 1I8LC 1J9YA 5I8KL 1RZIB 1HILB 4H20H 1JNNH 2HAZA 3SJVA 1NMBH 4UOW1 1UXSB 1UACL 5KVFL 4AT6B 4WI3A 2EH8H 5BV7L 1KIQB 1E28A 3I2CL 2AJZA 3PXJA 4NZDA 4TULH 3QULA 2LU7A 1ITBB 1OW0C 1XF5A 3HG1A 1KCSL 3SJVB 5DQ9A 4ZXLA 4C83B 1N64L 1F4WL 6CGTA 4D6DA 1U6AL 5DXWA 1LG1A 2YBUA 3I6GA 1UJ3A 4L3EE 5IFHH 1RMFL 4RE2A 2PTTA 4MQ7A 2GI7A 4AENB 3ALFA 5IKCB 1HIML 5HDLA 3HG1B 4Y4FD 5DQ9B 5IHUH 4EZMA 1VFBB 2D2OA 5AYUL 2GTZB 3S34L 4XI5D 5CSBA 1GAFH 4XBGB 3ESVF 4RE3A 3G6JB 4F3FB 4AC1X 1JHKL 4J4PD 1F4XL 3WMSA 2ENYA 5DJYA 3CV5A 3BD5A 3IU4L 3BIKA 3VFRB 1PY4A 5JUVA 2FSEB 4AEEA 3EJRA 1RY7B 4F8TA 4HLZG 4L8BB 4QO1A 3RDTB 2ATPA 3EFFB 1IILE 5DMIL 1J0IA 4RMWA 3MRHB 2R9HD 4W81A 3VKKA 4HMEA 2GJZA 1ZANL 5D1XD 3KLHC 1A6AB 2X7LA 1FDLH 1HHHB 1YYLH 3LN4A 2XZQH 4FABL 4G6FD 4L3EB 3IFPB 3SUSA 4TVPD 1E5NA 4MD0B 4R96A 2E0PA 2AJXL 5I1JL 1OWRM 3QIWB 5TPWL 5KSBE 3CH1B 4YXLH 3EBVA 2GJ6A 4WFGE 2KKQA 1XR8B 4CW1B 2R8SH 4FQPA 1FVDA 4PMDA 3BH9B 5GS0D 5ABFB 3A6BL 1FCCA 2GK0A 1R3IL 3TBYB 3VFNB 2D03L 4GG8A 4IMKC 3N1QC 4J2XA 3S36L 3GH4A 4YDKL 4OLXH 1KT2B 1E4IA 5FCZA 3S37X 2FSEA 4HKXA 1GHSA 3ZL4H 3HTLX 2PWGA 4FXGA 3S36X 2ADIB 2VQTA 5B38A 3TVMC 3UROR 3D2UD 4NNYA 1L4IA 4RISL 5HHQA 1MQPA 1HCVA 1YPZA 3WF3A 3GM8A 3KL0A 3MV8B 4JKPL 2HT3C 4R2GB 1Z3GL 4HV8A 1QNQA 2A6KA 2KL6A 3O9WB 1CDYA 3G5VB 5CGYD 3BWUC 1U8LB 4S1SL 4U6XB 1A2YB 2DDXA 4BFBD 2DLIA 2IFGA 4YZFF 2VDQL 3EGSA 3PJSB 4Y2DB 1I1FA 4PGCA 2XPGB 3VFNA 4ZO8A 4A4AA 4N8CL 2WVUA 4H0GA 4UTAH 1T22A 1IGIL 1B0GA 4HC1A 3RJDA 3G5VA 3GNRA 3QI9B 4L8SA 1RZGA 1MVFA 1CZ8H 2ADJB 3ARBC 3RUGF 5FKPA 3TH2T 1D5MB 3VDCA 4D8PA 5HNNA 3S96A 5DRNB 3QIBA 5I0ZA 1Q9OA 3VXME 1HKMA 5B8CC 3FO1B 1QYGH 4XNXH 5IVZB 3QWOB 5A43C 5E0CA 1BAGA 3QI9A 1ORSB 2EDFA 3G08A 4PBVC 2VC2H 5HYSG 5L2KD 3NSMA 2L7UA 2ARJQ 1N2RB 1LP9B 1P84J 3GJEA 1TVDA 5DMYA 2EYTB 4F33B 1MF2H 2DWEA 1JI2A 5L9DH 3LV3A 1ORSA 3BUQA 4N0UA 6FABH 3VXUD 1MQRA 3A23A 1UM5L 4DUWA 3KR3L 4NJ9H 4Y16A 1KPRA 5HTSA 5TE7L 4MCZB 5EN2B 4MLSA 1FP9A 2IPTH 5AZ2H 2M8XA 5DD1L 2VRAA 1U3HD 5ESQA 1LO0L 1NBYA 3V7MA 4HIEB 5IFJB 1C3FA 1HKJA 3HG3A 3C5JA 5GZND 2NY1B 4MAUH 3MO1A 5D1QA 4HK0A 3D9AH 3BGFB 2V7NA 3AMDA 5I30L 5GRJL 2XZZA 3ALGA 3A6OA 4KJYB 4X9BA 2VXQH 2OTWA 5CZVL 4YXHL 2V5CA 1CLZH 3ULVD 4RFOH 2CKBL 2EDHA 2E3VA 2YBTA 1T0NB 1EXPA 3QXDA 4PJHE 4JFZL 2E5EA 3WQ5A 4LAQL 5FUZH 4EANA 1V7ML 2VE6A 3BEVB 4PLOB 4WFFE 5H94B 1UG6A 5BV7B 1I7ZA 1MAJA 1D5ZB 2OTWB 5D6DA 5HHOE 2E8YA 3DUUA 1XSIA 4NQVA 4QKXB 2Z91A 1R3JA 1D5IL 4OIBA 5FYJU 3THMH 4LCCB 3VILA 4GRWE 3CMGA 1FJ1A 4XZUA 5B3NA 2HP4A 5C0BE 1LO4H 4TNWK 1OBAA 4XVJH 3RL2A 4F7TA 3HB3C 3E8UH 3LB6C 2WNGA 3LRGA 3TN0D 3MFFA 2ADFL 4QTIL 1MFBH 1ACYH 4Y4KA 3TNNB 4LKXA 4U1SA 4JFWA 3TYFB 1UACH 4CD7A 3VM7A 4ONOA 3P73B 3GI8H 1OAZH 1R46A 3PZ9A 5IVXA 4A6YB 5DJAA 1CS6A 3VFPA 1E6JL 4K23H 5E09A 5LCVL 1D5BA 4HWEH 3UBXG 3VWKA 1QRNB 1Y7VA 1KXQE 4YGAB 5HYEA 1OB0A 2DM4A 3WD5H 1P4LA 4PMUA 4YXKL 4LCCA 4A6YA 3O2WL 1XH1A 4S2SA 2M2DA 3SE3A 4WTXA 3I3DA 4NWTL 1G5AA 4MJ5B 4NCC1 5GS3A 3O6FD 4HFUL 1EHNA 3L5XH 4OZHB 5LA0A 2UWEE 4U3XA 1BVKA 5I15H 2HWZL 2NX5B 2XKNA 5F1OB 2OLHA 3GSVA 3E2HB 1S7QA 4M1GL 4Z7NF 4UDTB 1F2QA 5I18L 1HXYB 2OYMA 4WFHE 5B39G 1NUDA 4JPVL 3BP7B 4KI5F 5JIKA 4JKPH 1IGML 1HKLH 3TYGH 1OAXL 2P1YA 3W39A 2R1XA 2V17L 1HT6A 3G5ZB 4X7EC 3FT4B 2Q8BL 1EAPA 3O0RH 3V6FA 4JEGB 3JWOC 2HFFB 4C7FA 2NY7L 1QBAA 1DBKH 2IPTL 1XGTA 2ZSWA 3B9KD 1A22B 3LIZL 4WV1A 3L95A 3WYRA 3NZ8A 4U2YA 1CE6B 3KYOA 2BSRB 5J11C 4XCYA 1G6RA 4PLJC 1EZVX 4PMZA 1MIEL 4LCIL 3D39E 4QRRB 3OGVA 2ZICA 1KN2H 2BNQD 4JZNA 3NA9L 4JAMA 5EC2A 1YMHA 2MPAH 3K2MC 4HKBA 3EDFA 4LEXL 1VGEH 1Q0XH 3F7YA 4TSCL 3RZCB 5GGUB 4F9LC 4ODSH 4ZOCA 5IB3A 1SMDA 4QLLA 3GXFA 3FOMB 1G7JB 3MV01 2YOCA 5MENB 2YUZA 3IDJB 2Y2WA 1BX2B 2FZ3B 1HL8A 4NRYB 1OWQA 2VO5A 4ZUTA 3TTOA 3FOLB 4EI6B 4X6EB 2EDRA 3KLDA 2XZQL 5IB3B 1PSKL 4P2YA 3WFLA 1JF1B 2DKUA 2BJMH 3WLBA 3IJ9A 1I7RA 5IFHL 3RZCC 1PG7W 4UB0L 1N64H 2QADC 3N18A 3AMKA 4X6DB 3CSPA 4JJHA 4RZCA 1CE1L 5C0JA 1BWWA 1J8HE 5CUSL 2X4TB 4PB0L 3BFOA 2A6JA 4UT6L 1VADB 3WIHL 3ULVF 2ALWA 5JW4Q 3VIIA 4M1RA 1E40A 1KR1A 2AEQH 5AYUH 1J18A 2R39A 4AD1A 5CCKH 3NIFE 3DO3A 5EZIH 2VXQL 4POYA 2PCPA 2QBWA 1PBGA 5I8OH 3WIFB 2W5FA 2D3NA 4LVNB 1TMCB 4LLDA 1NOWA 2R2HB 2FZ3A 1OLZA 4XC1L 3UP1A 1EEZB 4Q0XH 2XQBH 2VKWA 4DAGL 4O2CA 4OQTA 1NEUA 2PTUA 5E1AA 1U2YA 5CBEA 2AJVH 3C6LB 4MB5A 1QKZL 3GMPA 4NBXB 5F7LB 4F58L 4BQ6A 4PJ9C 2VN4A 3VG0L 4EXPX 4ZE4A 1GGCH 3OGOE 4TOQA 5AZ2L 4HUNB 3SCMB 1P7QA 4OCLC 5TE7H 1WZMA 1U8KB 5EO9A 3RU8H 3IFNL 2DLEA 4PG2A 3RNKB 3KYNA 1BOGB 4I0PB 3TTSA 4KH2A 1EV2E 5HHOA 4NT6A 3PWNA 5FDWA 1C8QA 1EJ6A 3LHPL 1AXTL 1T1WA 4DEPC 1JAEA 3VSVA 2MKWA 2R1WB 3NAAH 2I24N 1LO2H 5INDA 4CADB 2PCPB 1BOGA 1J1XL 2VSDA 3LS5L 2DN7A 1MJ7H 2AGJH 3LKPB 4Y4HB 3GRWL 5CGMA 4CCEA 4OD1H 2R2HA 1EEZA 4E0RA 1CFNA 2NY3B 1HJXA 4NWUH 3PG2A 4LOUC 3K4DA 4PJIE 4YC2C 2GFBB 4G8EA 3KYAA 5KANI 1J8HB 4HWEL 2NPLX 1RIHH 3L1OH 2Q6WA 3D3VE 4DQOL 2ESCA 4RQQA 5F6IB 3SGDI 4QY8B 3OR6A 5J4MA 1K3ZA 5KOMC 4JFED 3KXFE 5D1XB 2IBBA 4B15A 1XD0A 3MLRL 5JORA 4GG6B 4P8UA 3QO1A 1D6VL 5EUOF 4YHEA 3CUPB 1XCTA 4NI3A 4Y2DD 1A1NB 4PLKC 5KZCD 5I76A 2DQHH 5CHNB 4Y5VA 1EHLL 4HTYA 2MOVA 4ISVA 4LNVA 3BP5A 2YA1A 4QOKD 4UUJA 4NKDA 4OCNC 1WDPA 5E9DE 4CADA 2X4PA 3L3GA 1Q1JH 2FGWL 3LKOA 2P8LA 1ZT7A 4FFYL 1MRDH 3QRFM 4PMYA 5IB4B 5EBAA 1E5JA 3EOYG 3P40A 4AZBA 1AGBA 1JYWA 1U3HC 3FRUB 5E4IA 1RZIA 3D2UB 3HMXH 5JUEH 1CDHA 4Z7UE 5GGSY 5JXEA 3QHOA 4Z2GA 4X80L 4G8EB 5I1EL 5L6YH 2PTVA 3MACL 5HJ3B 4ESKA 2MWCA 4DKFL 3PV7A 4MNQE 4LKCB 1QFUH 3LD8C 5SX4I 3TJHD 5D2LE 5K93A 2J6EL 3DECA 3BT2H 2OYPA 4IS6A 3M8OH 3RY5A 1BSIA 2ZUVA 4U6HB 4OLYL 4OUOA 3GSNA 4GW5B 3V0WL 2GUOA 3QUKB 2CRYA 1NCAH 2H32H 2R1YA 3I6GB 1QHPA 2EEBA 4G9FB 4WO4A 5FO7A 3ZT5A 2BNRB 2G2RA 4RA3A 1TCRB 2GJZB 1ZGLA 4NN7B 1YDPB 4ZNCD 5CSGA 4YO0B 4LGPB 2DT2A 2F5BL 5TFSH 4GW5A 4JFQA 4BELD 4TQEL 4U0RB 2DIJA 4ZPVA 2CR3A 5GJSH 1U58A 3CDGA 3R1GL 5K9OB 1XIWC 1AGBB 4R2GD 5FHAH 2XVNA 1UADC 2NYYC 3BIKB 3FKUS 3QEGL 4XWOC 1OF2B 2DQGH 3H9HB 4ZXBB 3WDJA 3GJFH 1UUQA 2NNAB 2K7PA 4HFWB 1OY3B 1CGWA 4GKZB 4S3JA 3TBYA 1WBYA 1ZVYA 2HFGH 4LKCA 5D6CA 1MH5A 5JIIA 3MLUL 2DQCL 4XWGL 4F57L 4PJEE 3TM6A 1DQJA 4OGXH 7FABH 5CUSH 2W9DH 3O4LD 3VIKA 2PYFA 3WD2A 4Y88A 1DP0A 4HFWA 4XPAH 5C0BA 2QL1A 4JL2A 1XCXA 1UD4A 2G2RB 5BOPA 4XXCA 5DJYB 1PZ3A 4XP9H 1K5NB 3ARBA 4Y4HC 1ETZA 5JHDA 5IESH 3EJYC 4D6HA 2QSTA 3ULVC 2DTMH 4KV5F 3ZDXE 5CILH 3HLAB 4OF0A 4U6YB 1U58B 4QOKE 2X1PA 2AAAA 4FQ1H 4LCCC 4MPKA 2UY7A 5BJTB 4M8QB 5IW3A 1UVQB 3GM0A 4EI5B 1GQJA 2VCAA 3RRQA 4NWTH 2Z8VC 5H8DA 5DJCA 5JXAL 1HIZA 5CP3H 1TQWA 1SYSB 2ZG3A 3QXAB 4Y2DA 4CN6A 5A6KA 2X4SB 2VCBA 4YN5A 3CH1A 2CLRA 2D31B 1U30A 3RWDA 4LIQL 5FOBB 4HZ8A 1UD6A 4D94A 4FP8H 4ZUVA 4YK4C 3MQIA 3SGJA 1BG9A 2X4SA 1PBYA 4GXUN 1MI5B 1C08B 5FYLD 3RVTC 4L8SC 1K8DB 3OR7A 1R3LA 2A6IB 1JMXA 3F5LA 3V7AG 2VLKA 3EJZD 4X6CB 1LVEA 3EO0B 5KANG 3VIOA 3HRPA 2FBJL 1I1FB 3BN9C 4PGCB 4D2NA 3GZKA 4U1JA 4YEEA 3ILQD 5GRUL 1YN6B 2FDMA 4YR6B 1KJ3L 2XN9D 1RD6A 4AD4A 3TA3D 2G3JA 1PKOA 3PL6B 4DN3H 1N26A 5CBAB 4L3CB 5I18H 1QI4A 1IGJA 1DBBL 3ARFA 5IV2A 3DMMC 3TIDA 3K3QA 4W89A 1TA3A 5C71A 3D0VA 4PJFB 1AR1D 3QZWB 5EBMA 1GJUA 4O02L 2A6KB 4D9QE 3ZKXB 5C0AE 3BEWB 4X6FB 2W92A 2XTJC 4ZSOB 2EEDA 3VRLE 1EMTL 3OKYA 2IH3A 3W2DL 4GBXD 5BVJB 4HIEA 3ARTA 1CDBA 4JGUA 1SEQL 2V3GA 1T4KB 4H7VA 1ZV5A 5C0ND 1E6OL 4GJTB 5BXRA 4I9WD 4NZTL 1LWJA 1LK2A 1NCDH 3DMMB 2HVKB 1SMAA 4X6FA 4UQCA 1WF5A 4FNLH 3ZOAA 5FO8A 4U5IA 4U3AA 2CGRH 2GKIA 3O6FA 1S9YB 2NW3A 4ALAL 1MIEH 1S7WA 3MNVA 3HMWH 4LCIH 4U1HA 1MI5D 4D8PB 3VXMB 4PGJA 3CVHA 4KJWC 2CRIA 5EB9A 1GL4B 5ICXA 3IXTB 3SGKA 3NFSL 1WT5A 4M8VA 4FQIL 3LPPA 3FTGB 4OV6F 5FO8B 2X4RA 4JFUA 2B8OT 1HH6A 5ESQB 5D1QD 1I7ZB 3VGAB 3BSZL 2Z1SA 1QG3A 4LLQA 3RJXA 3N9GH 2UWEB 3HC0B 1U8NB 3DI3B 3JWDH 2GDVA 3A3HA 5L8LB 5IMOA 1UZ6E 1JNLH 1IGCL 4YWGL 4CAGA 2BRQA 1KGCD 4KAQL 2P42B 3VINA 4OM0H 2B31A 1F02I 1QSVA 1AGCA 3L5WB 4AZ7A 4WSKA 3B4NA 1NP0A 1KB5B 1FZMB 1T0NA 5D7LD 1Q6GA 4JY5H 3PUCA 4WI5A 4K9EH 5E5UB 1TJIL 5IEKA 3IJSA 3TP4A 5I1AB 4W93A 3MFFB 4MD5B 2VAAB 2BNQA 3MCKB 1I1WA 4H0IA 5FYKL 1DUZA 5D93C 2VISA 5ITBH 3RY6C 4OCXH 1WBXA 3MRQB 4HF5L 3P73A 3MRJA 3UESA 3FQXA 1T89A 1CIUA 3NN8B 5IB5A 4M6NL 1HWWA 3VXTB 2ZNWA 3VFPB 5DVLA 5E2UL 3OAYH 5BS0D 4ONGH 2P5WA 3TFKD 1MJ7L 3UTPE 1F6AA 2DQCH 1FFNB 3WFEL 5K59E 2QV4A 4ZO9A 3G6AA 4ML4A 2WVSA 5K9QG 2MCG1 2VLKD 1QTYT 2E8ZA 4M6MH 2NZIA 1B9ZA 3T8XA 1FL5B 3NN8A 5IB5B 2HVJB 4CDGC 1L7IL 3PTKA 3BE1H 3T0EB 3VFVB 1MHEA 2IGFH 3V8CA 2X1IA 4KKNA 5BRZA 1NARA 1YY8A 3WJJA 4X5XA 4JDVB 5T3XH 2EABA 2GJJA 4OZHA 1KLFA 1UWXK 1QSEA 4M7JH 4U2ZA 5T3XE 1H9VA 3WF4A 3BUDA 1A7BA 3QA3A 4GRLB 5JQ6L 2BK8A 3TBTB 4PGZA 4XBEH 1OAQH 2I9TA 4X5XB 3AMLA 2NY4D 2OX5A 4XVUC 5I1CL 3SDYH 4BQ3A 5ANMB 4CNIA 5AZEL 3F12A 5DK3A 3MROB 2OR9H 3KNBB 3H0TA 3CFDB 4Y4KB 5DJXB 4LSRL 2GEEA 1C8PA 3ZHDA 1JGLH 2GTWA 1F6AB 5DMIH 4N9GB 1GGUA 4BQCA 4JQXC 2FEDC 4KK8C 4U7KA 2GK2A 1K9EA 4LSQL 1BVKB 3FJTA 3O8XD 3FCTA 1FL5A 1X5LA 2WMIB 4YHOH 1URLA 1CE6A 2X2HA 3VX0A 4GG6F 2J1KA 2QPUA 1U8QB 2DQGL 1Q8MA 4H1LG 5HHXH 1CG9B 3OHXA 3RVVC 5BW7A 2BV9A 3RUGE 2QHAA 2AXHA 1NSNH 2IBZX 5BVPL 1F3RB 3M45A 4O51B 5C0CB 4Z2IA 1ZS2A 4W4OC 4S2SB 4CUCA 3CUFA 3BVXA 3WN5C 3VFOA 3QPXL 1HIMH 1BOYA 5F7DA 1INEL 1CU4H 3SKNB 3U4BL 1MLCA 3VXSB 1J0ZA 3MGAA 3K7UA 4GAYB 4U1MB 4Y5XC 5CLTA 1RZKH 4KZEH 4FQIH 4Q9CA 1U42A 3KYOB 3SURA 4MAZA 3BESR 4M5ZH 3W82A 5IJVA 3MLYL 4RISH 4F8QA 1LQ0A 4DN3L 5I1HH 5I71C 1KJMA 3CXHK 1RFDH 5LQBL 3GBML 2J8OA 2QMKA 4F8XA 2Y25A 1A6UH 4CJ1A 2YL9A 5E8NA 2WBJB 4LRNH 4M02A 4EDWL 1FFOB 1YUHA 2OJEA 3F7YB 4OZ4B 1C16B 4PYGA 4N8VB 5HYJE 2MHAA 1MWAA 1BP3B 2H3NB 3OHXB 5FHAL 1VADA 4MXWL 3P9WB 3WUGA 4MQXD 4OZGB 3FOLA 4PJGA 3VDBA 1G6RB 1E3ZA 1ODUA 3WHE1 4B5EA 3KPLB 3DX1A 1R87A 3NBNA 2YPVH 1CT8B 3QHTC 4GRLD 1UH4A 1LO5A 2IWGA 1RMFH 4LLDB 5DA4A 1UWUA 5M95B 2J4GA 4P8VA 2EDXA 4OZGA 1VKXA 1KN4L 5KSAD 3QFJD 4HUMB 4MGXA 3ZKNC 1GSMA 4O2CB 3VOCA 4JGMA 1JP5A 3F7PC 2V3EA 3QDMD 4W88A 3QI9C 3CUHA 5IGXL 3RO8A 3P4MB 2V9QA 3D85D 1E4XL 3HMXA 2RGMA 3IGAA 1U8MB 2OBGA 3QNZB 2Y7QA 1U8KA 1CICC 4PJDE 5BS0B 5FYKE 2FDBP 1R86A 2VXTL 3CVIH 2WLYA 1FH8A 1ZU8A 5D8JL 2B1HH 1IC5L 4Q9QH 2EYRB 1ZHKA 1XZ0A 5LWYL 3CFEB 4FTVA 3BUTA 4HXBH 5LVEA 4RGMB 1FPTH 5IWLA 2XVPA 4PRNA 3LB6D 4HGMA 1T1YA 3TO4B 1P7QD 3QQNA 4OGXL 4AIUA 4QRRE 4KY1H 4GO6B 3BAXA 1QVBA 1S9WB 2DQDH 2JIXB 5JO5B 3WHXA 3C5SA 4AMKL 2X10A 4S0TD 4L29B 4I1NB 4I4WA 4RFNB 4UV7L 5IMMA 4WHCA 4X0KA 4KKBC 2JIXA 1I9RL 4I3RH 5ECJE 2DGAA 3SUVA 3O2DL 4ZPTA 4XP1L 1MHCA 1MOEA 5FYJD 2NSXA 1JNLL 3T0DA 3RGVB 5BZDB 4IRJD 4JRYB 1H2JA 1XCTB 2AV7A 4JB9H 1KFAH 1KTCA 2FWOB 4YHMH 5DUML 3KS0H 2X44D 4OF3A 5IEHA 3X11B 3SKJH 2WZIA 4X6DE 4U33A 4UILL 4P46C 3WUWG 2B7DT 3B2UD 1QSZA 4JFSA 4BZ2L 4Z2LA 2AAVA 2HTKD 3VWJA 3PWLA 3ABZA 1JFXA 5MEPB 2VX5A 5C0DB 1MEXL 4OZIF 3OGCB 1IC7L 4ZD3H 1TJIH 1DLFL 5ICZA 3A6BH 3RVWC 1QNPA 4OCSH 1G9ML 4D0BA 2ERJB 3AS1A 4J3OC 2CO6B 5KSUA 2PW1A 2JJSC 4L4TE 4RNRA 2DWDB 5C6TH 3KLHD 1NH6A 2WSKA 1NQ6A 2FECL 2J4WH 5ICZB 1V3LA 1KCRH 3SUWA 2P8LB 3GBDA 3PE9A 4R7NA 3KXFB 5A16B 4MXWH 4IEFB 4WNQA 3TTQA 2FD6H 3AXIA 1UEYA 2JCCF 1TG7A 4LQFH 4XVTH 5AUMA 5DFTA 5FKAA 3MLXL 2I5YH 5F3HB 1KACB 4TVPH 4KROD 4ZPVB 1A1NA 1UZ8A 1WVZA 1N0XH 1QEWA 4PJ9D 1KB5L 2PTTB 4MQ7B 1B31A 3F7QA 2WMGA 4FZEL 4Z7VA 4U6HA 2YPKB 4M5ZL 4LLYA 3AI0A 1M4KA 1E6OH 1JZ2A 4OT1H 4Z7WF 3MV9D 4FQQA 5M03A 5C9JB 4GT7A 4NX0A 2F5AH 2HH0L 1RZFH 3OXSB 1X5IA 4X6CE 1T0MA 4ONHB 1QSFD 5FYJH 2E27H 3H9SB 4MNQB 4JRXD 2NW2A 1NWRA 1SJHB 1DCLA 4MXQC 4HIJA 1HKLL 1EUUA 2JF6A 4B16A 1IGYA 3B5GA 5ABHA 5GGQL 1RJYA 1SJXA 2EIZB 4U5KA 4CD4A 4JRWA 3D5OF 3FFDB 3H9SA 3MOAH 4MJ2A 4K68A 4L3EA 5EIVA 5B3JE 3OKNA 4M5YL 5GXBB 5C0IB 1A7PH 3ZT6A 1T83A 4MD0A 4R96B 4W87A 4G80B 5T3XL 2GSJA 4K2UH 3VDHA 3TH3T 1XGYH 2OJZL 4RGNB 1KN2L 3X13B 1DSFH 2ZUXA 4L4TB 2YN5A 3MLVH 1TVHA 5DO8A 5A6BD 2ZSVB 4MD4A 3ZDYE 5IVOA 1SYSA 1KTKE 2HRPL 3RDTA 3AREA 5DLMH 5I75C 1QSFA 2VJXA 4PLKD 1UWEH 4OLWH 3QHMA 4C7GA 2NXZD 3HRZB 4PTXA 5E08L 4MNQA 1NMAL 1U8JB 1C12A 4I18C 3LPGA 5GJTH 1A7OH 4U6YA 5TH2A 3MJ9H 1RZJC 2WMJA 4R0LB 1QSEE 4RMSA 5ALBL 5EU5A 4FLRA 3BAEH 1QBBA 4PJEA 1FZOA 1XGZA 5GRJH 4G8FA 5DK2A 1QA9B 2ADFH 4QRSA 3A22A 3EMZA 3A0OA 1K85A 5IT2L 1BIIB 5T1LD 3CSBA 1P4BL 2H1PH 1LQSR 2V2WA 2ZPKL 3D48R 2YL5A 2H45A 4BA8A 5EU5B 1YEDA 2HT3D 2EPNA 1U8PA 1KYOJ 2C3XA 4W7VA 1W9XA 1KT2A 4KY1L 2ADGA 2X89D 5E56A 4CVUA 4G8FB 5DK2B 2UY4A 5BW7C 3FQRA 3QO0A 3ARFB 5IV2B 3RI5F 4PBWD 3ZLQC 4XCNB 3JVGA 3U9PL 3VWKD 4PUDA 5E2TH 3BIAX 3CSYB 2AEQL 5B4MD 1NDGB 4K3GA 4XPBL 3FQNB 1G7HA 1CD1B 1MLBB 3WLWC 4L8SB 1IEBB 1TCMA 3V4PL 2F9BT 2D20A 3LS5H 4XGZB 4PRHA 3SE3C 3VFWB 2WMPA 1KLGA 1IQWH 4NKMA 3WH8A 3C9NA 2EIEA 4PJEB 1ZLWK 3WE6A 1UWSA 2DMKA 2F54A 3LEYL 3DTXA 5HDBF 1MCDA 3SY0A 1W2VA 5D1ZB 4F7MA 1FOBA 3VWJC 3QG7H 1G9NH 5T5NF 3ECBA 3IFNH 3Q1SH 4I0PD 1CLYH 1NANH 3OR7B 1T3FB 2EXYC 4LPCA 2FX9L 4GQ9H 4IPLA 1EGZA 3UDWA 4A3YA 5CJOL 3B6SA 1UJTA 1IC4H 4OQ1A 4LRIA 4S0SD 2WCSA 3O0RL 2VR9A 3DX7B 1D7FA 3D18A 5LJYH 1WIPA 5D96C 2NY2D 1FP5A 4Q9BA 3WFZA 5GSVA 4WEBH 3TO4C 1CECA 2Z31A 1WUNT 3X17A 1MFAL 4IHOA 3UPAA 3H9SD 1OGSA 1J87A 1SMOA 2IPUG 4KTEL 2DIBA 4ENED 1QSED 1X5FA 3PXHA 5CMAB 1JGIA 3VXPB 1MFDH 1Q0XL 3RPIA 4XNQA 1I1AB 5ANME 5DSCB 4EDXA 2H8PB 3X3FH 2X40A 1NAKH 2LVEA 2R0KL 3L3DA 4QRTA 3FO9B 3CLEL 4IOIA 3TCLA 2I27N 3NH7L 4N0UB 3BW9A 3NIFF 1MHPH 4YHML 3VFUB 3MCKA 3WJLC 2IH3B 4KHTL 1NQBA 4FMFA 4NZRL 4Y16B 2D7PA 5IB1A 4ETYA 4UILH 1WBXB 4XB7A 4BQ8A 4TVPL 3GMOB 3S35L 4QCIA 1GOQA 4LX4A 3RL1A 1WFNA 5DF0A 3GH5A 2X0HA 1KIPB 3POHA 3ZO9A 4X6BB 3SCWA 4B7LA 4HOWA 1AO7D 1KJVA 5C0CE 5JIHA 3EDJA 4KMTH 2WWKO 5KSBF 1I8KB 1EJOH 3SJVD 1AC0A 1IM9D 3QUML 1WZKA 4QRPE 3O9WC 1F11B 1HZHL 3D69B 1W0YT 1NMBL 1G7MB 3QR2A 2X6MA 4NXSA 1SY6H 1GGIH 4Z7QF 3C5ZA 5I1DA 1P69B 3P0VL 4FABH 1ZHBB 4ODWA 2YC1B 4EQ2A 1CN4A 4FFZH 4OFVA 3D3VA 4NQXB 3E6FB 4OGZA 2WXDM 3G6AB 3GMRB 5LWYH 3MNZA 1B3JA 1O5DT 3C60A 3GBNL 3PN8A 2VX4A 4MX7A 1O7VA 1JGVH 1KEMH 3IKCB 1JHKH 3M1BA 1OCQA 1QFPA 3HNSH 2GQHA 4GIAA 5GNXA 1JF5A 3WDQA 3S34H 4HX1A 4G9DB 1KWKA 1RSFA 3DXAE 2YWYA 5EBWA 2VRQA 2KBGA 4N0UE 3KYMA 4XVSH 3CXDH 3KLLA 4Q22A 3QPQC 3R1GH 1W9PA 2HG5A 3WBEA 1J12A 4HCRH 1QQDB 4N0YH 5E6YA 3OLGA 3BWAA 4NHUA 5EZOH 3W37A 4HPOL 1DQLL 2J8HA 5F72S 4HKJA 1FDLL 2EQDA 1FH5H 4HZLB 5D2NC 2EKSB 2DJSA 2FGZA 4GAYA 5C9KA 1LG2A 2GJXA 4R27A 1JHLH 4K3DL 5EUKB 5A2CA 1YEHH 3RAJH 4OI7A 4MX7B 1BVLA 1MELA 3UYOD 4RE4A 1W9VA 3U7WH 3G6LA 2MFNA 1HDMB 1KB3A 5DRZB 3GHEH 1IFHL 3K4ZA 3MLZH 4MADA 3L95B 3STLB 1AD9B 3QCTH 4HUWA 3ET9F 1E6QM 3DHJA 3VD3A 3U83A 3CK0H 2O9TA 3BP7A 4JZNB 4GMSH 1MLCB 1RQ5A 3DYMA 4BZYA 1AY1H 1D5XB 1VEMA 1X5ZA 5C6WH 3LMJH 4LSVL 5EBLA 2R1XB 1KWGA 3JV5A 5E24E 3STZB 1OGAD 2RGSA 5I77A 5HDBE 5I0DA 5EU7C 1Z9OA 3EFDL 3PHSA 3V6FB 5D7KD 2HJKB 3ULUC 4Z78A 2HFFA 4HWUA 4AW7A 2EDNA 5HYJD 4KK5D 3LSOA 4HS3B 1KBGH 4O02H 1N7MH 3QUXC 4WV1B 5CEZD 1AQMA 1X6NA 4KROB 3ULSA 4URIA 4DKFH 4PJIA 3SCRA 2F15A 5GIRA 2VUYA 1H5BC 2YD7A 2VDQH 4N8VA 4X80H 5L6YL 5JZ7D 1S5HA 4MJ6B 1ZLVH 4GI9A 1WCQA 1QFUL 1N0XL 2E7BA 1ZLVK 3C5ZD 3QUXD 4IRJA 3LCYA 4OM1H 4RA0C 3IXAA 1S9XA 4P3CH 2OSYA 1MW2A 3S88L 2CSPA 1CT8A 3QFJA 1HYRC 3PWVB 4H26A 1AHWA 1OAYL 1AI1H 3IF1B 4HWBL 2BXZA 4N5UA 1F8TL 2G60H 5DK0A 4AQOA 5B8CB 1GJWA 4JFPB 4P5KB 3S5LB 3BCDA 1R24A 3V4UH 3PIQA 3AIUA 3MUAA 2AK4E 3EYVA 3UBXA 4YBLB 1I85A 4J8RA 3TZVC 4BSVB 3HNVL 2W60B 5HI4C 4U7MA 2Y7QB 1QVOB 1MCSA 2XZAL 3DRQB 3BVTA 1Z6JT 3P11L 3RWFB 4TNVK 5BQ7A 5MHSE 3VUPA 1QHOA 2IQAB 1LO5B 2ZCLH 1MNUH 2Y8VA 1IM3B 1FLRL 3S37L 1LL6A 1QFWM 3QUXA 4LARL 1ZLUH 4UNVA 4YXLL 3KHQA 1AFVH 4K71C 5D9MA 2CDGA 3N85H 2APWA 1JWUA 4LMQI 3MV7D 4LLUB 1FL6A 3VE0B 2AV7B 5C0BD 3MREB 2AXFA 3WN5A 1FFQA 3IF1A 3P0VH 3QDJB 2IH1A 2VI0A 3TJEH 3CZNA 3C6LA 4IDLA 1JWUB 2XIDA 1CGSH 3W0WB 1CLZL 2YS4A 1A7RL 3EYUL 5KVDH 4RAVB 2W63A 5FL0A 5F1KC 4TTGA 1XIWB 3BZEA 1BFVH 1KJ2H 3QIUB 3EBAA 1MQQA 3LMYA 5IVXE 2ESVB 4JY5L 5C0RH 3LS4L 3I02A 4X98B 5H2BA 3T2OA 4YAQB 1NC2D 6A3HA 1NANI 3V7AE 2ARWA 3W26A 2NXZC 2ZKHH 1EFQA 1WEJH 4QY8A 3E6HA 4WW1B 3Q0HA 2XVLA 2CYGA 1ACZA 4M82A 3KDMB 5DR5L 2BOCB 2BVDA 5KSAA 1CLYL 3BPCB 5GQBA 2YD2A 3OJVC 1GOIA 2GCYB 2XZCH 4C55A 2PWHA 3L4XA 2OZ4A 2AK4A 4OD2B 1FNSH 4I3SL 5DQJA 1M05A 4HC1L 3HE6A 4PS4H 4PMRA 5KSAB 1S46A 1J8HA 3WH9A 3RPKA 2D3LA 2W62A 4Z7WB 3FB5A 1CZ1A 1MFVA 3L7EB 2VCCA 1JN6A 1FVEB 4JN2A 3ULUH 5JOPE 4Z6AT 4FQ2L 3UPCA 3CVHL 5JR1L 3I02B 1VPOL 2HFTA 3O4LA 2DI8A 3QOMA 4JG1H 1S8DB 3O6KL 2EDKA 2G5RA 3IDIA 1EMTH 4FQXC 1J5OL 2DLFH 1OAQL 3L3KA 2H2SC 3L4YA 5HYIA 3SDXB 3VXNB 4D9RE 1F90H 3DIFB 5EH1A 4AZ8A 4BKLA 1KXVA 4QHNA 4NO3A 2VOTA 3RDTC 1ORQB 3BO8A 1PZUB 4OLUH 1HL9A 4X4ME 1P2CA 4JCMA 3U5UA 3KR3H 1UKOA 4HCRL 1DUYB 4KQ4H 9CGTA 1CBGA 2F53E 2X9XA 3QEHB 5HD8C 2XRAH 1DZBA 2C1PB 4NRXA 2AJUL 2IANA 1F3DJ 4APQB 2EIZA 4C56E 4TSCH 1RUKL 1XH3B 2ESVE 1KPVB 1QBLL 3VI4F 1JZ6A 1SR0A 3BQUD 4Z7OF 1L9NA 3KLKA 1AD0B 3FN9A 3AY4A 1S7RA 4ONHA 4WWKB 3NFPA 4XWOD 4I77L 5FA3A 1HF6A 2VDLL 5FF6B 4P2QA 4HPOH 2X9WA 5A2KH 3DMMD 4LBEB 2IALB 4AZCB 5I6SA 1TFHA 4UU9B 1MH5B 4ELMA 4DGVL 4YBHA 4ACYA 4YQXL 1PZ5A 3OX8A 2PYFB 1V7NH 4KMQA 5I1GH 3GDBA 3KLSA 4ATDA 2VLMD 5BXSA 4MAYD 2BSSA 3NCCB 5DYOA 5I15L 1E3XA 3WH5A 2HT2C 3QEHA 1TJGH 1WKYA 1MJJA 2OI9C 2Y6SC 4TOYH 2VL4A 4GINA 2B5IC 2F2HA 4PY7B 2OSWA 5HDQL 1HHHA 1X5YA 3QUMH 1FP8A 1VEPA 5JTWA 5K9KA 2BVUA 2P8MB 4XAKD 1CGSL 1CXHA 3AU1A 3HAEG 1OD0A 1U8OB 3MLTB 1LO4L 4TNVF 3IAGC 4UOQA 5DUPH 4RWHA 1NEZG 4XRCA 4XNUH 1VFUA 1FSKC 3CH9A 1ZWIB 1MIMH 1TQCC 4HK3N 1UH3A 4GKLA 4OJYA 1E0XA 2VXTH 1A21A 3CUGA 1AKJB 4PRDB 4P48A 1OSPH 4GMTH 4NO2B 3GYCA 3TV8A 2XICA 4RGMC 2NY0B 5FOBA 1TVBA 3S35X 3CPUA 3CDCA 2IQ9L 1S7SB 2VDRH 1CE1H 1MI5A 5BXTA 1GVYA 1OPGL 3L3OA 3LEXA 4U49A 2LU3A 5DJ6A 4XI5C 4ONFL 3MJGX 3ZJ6A 5DJCB 1IRAY 1MCLA 4OCRH 4NDMA 1VENA 5IGXH 3CDFA 3V4UL 2DPEA 2WAGA 4L5FL 2CK2A 3TT3H 5KG9A 1H0GA 2X4OB 4GKNA 3AYSA 3BKYL 2O5YH 3LMJL 2BVOA 2OLDA 5HGAA 1FL3A 4QFUA 5HHNB 3WKZA 1XGRA 1T7WA 4X7TB 2EYSB 1IAOB 3TBWA 1BZ9B 1XR9A 5IBLC 4UOJA 3WDIA 3FFCE 5FFLA 3KWXA 1K8DA 4EDWH 5GRZA 1E1EA 5F6HJ 3T08A 1Y0LA 2QSCL 2Z35B 3B9AA 1E15A 3N9KA 4XPFL 2Y06L 5E99H 3N1PC 3C08L 3F5KA 1IKFL 3K8KA 3NABH 4OV5A 4LAQH 1RPQA 2J7LA 4K07A 3GTNA 5F44A 3U2SA 1PZ2A 4PJEF 1PYWA 3MV8E 4EDXB 1WT5C 3LIZH 1RUAL 1VCAA 4XMLH 3K1KC 4RMUA 4EAMA 5J3HD 2EPKX 4YBQD 2VDNH 4J3SA 3V5KB 1YEGL 3FRPG 4PRHB 3D18B 4RMQA 4WCYL 1OCWH 1NOFA 4YHLL 1YNTA 4P7NA 3BXNB 4HXAH 3C9NB 1N4XH 4ZFOB 2WM0A 5E8DH 1TMQA 4LASH 4OF6A 4ZFGL 1XGRB 2W9EH 3RPMA 3MRRA 1V6XA 1YEKH 2WC7A 5C2UB 4JFFA 1FBIL 1EK3A 1TITA 2EDJA 5BRQA 4ZOEA 2N56A 1YNTB 1RHHB 3JTTA 4M1GH 1T4KA 1U8NA 5IM7B 2DAVA 3RPIB 2FEDD 1FV1A 4XP6L 3VA6A 4JGJA 4ZFOL 2O5XH 3HJEA 4S1QL 3QNXB 1AE6H 2QEJA 5ALCL 3T09A 2Z4QA 3DRTA 2GIYA 1DR9A 3NCJL 5ICXB 2IUZA 1JPGA 2B2XH 3SDCA 1HJSA 2A3EA 3I6LE 3NAAL 4M7LH 4EVNA 3HNTL 4FK9A 1YMMB 1NBVL 3L2MA 4PUEA 4KJYA 3SGJC 4PGEA 5A6LA 5F3BB 3GRWH 4LLQB 3ZJ8A 2Q20A 3I50L 3BP4B 3AY4C 3O2DA 3T2PA 3QYCA 1CLXA 4M6OH 3DI2B 1YJDC 3MUY1 5HGDB 3Q5TA 4JHWH 4R7DA 2FECI 2P45B 3HR5B 3N1FC 3PGDB 3APGA 3OJDB 4XH2A 2R4RL 1HINH 2X4QA 3QDGD 4LVHC 5KSBB 1E4NA 5FCUL 1AP2B 3VI4E 1DUZB 1QI0A 4POZC 1W0VA 1N6QL 2QQKL 4XXDA 3QJHB 3RIFF 3T4AB 1B2YA 3GO1L 3NACH 1Q4NX 2GK1B 2AJVL 1QOKA 4TX8A 4BM7A 4GXUM 2R56L 3TV3L 1ZA6B 1L7TH 3ZDZF 5SX5K 3MRPA 4R8WH 2LTQB 2UY5A 1IARB 2VZSA 1UWEL 4BYHA 4WI6A 3WIHH 4WHDA 5SWZB 2F5AL 2HH0H 3AUVA 1CDIA 1G7MA 2X41A 5GRVK 2D24A 3REWB 1R5IB 2YKLH 2F74B 4O2FA 5T5NG 5CCKL 5IUSA 3ARZA 5EU7E 5TDOB 3NCMA 3W38A 3EYQC 3IDMB 3IETB 1R3KB 3CFKB 4PS4L 1WAAE 2YC1A 3P4OB 1FNSL 1YY8B 2GTWB 4LGRB 1BBJB 1PPIA 4F15C 4Z9KB 3E6FA 2OSXA 4LVNC 5F89A 2PBGA 3LKNB 3PV6A 1AP2A 3BRGC 2JJTA 4PGDB 5E8EB 4Z7UA 1E0VA 1AD9A 4MAVA 3II1A 5DD6B 1OQOA 4WDIB 3W24A 1RJLB 4YH6A 2FD6L 1N8ZB 4LHUG 4XAWL 3NFNB 3U1SH 2KUTA 3CC5A 1QKZH 4HD9A 4PMXA 3KJ6L 4FTVE 4I8DA 1KELH 4HUXB 4UDTA 4OT1L 1V0LA 3MLRH 5FKYA 3ISWA 1JHTA 5LKNA 4GKSB 5ICYB 4PGBA 5DJZA 2IXVA 1YEGH 2NCMA 4JFFE 5FUOH 4E5XA 2MCPL 2HG5B 5DT1H 1IT0A 5TDPA 1RI8A 4X7SL 2E7CA 3W25A 1CK0H 4PMQA 2NY5H 4X83A 2AV1B 1BFOB 5HHOD 1KULA 4FNUA 1P5VA 1DLFH 2XFXA 1R34A 3QEQE 5GJTL 1QHZA 2UVEA 2Y24A 5A2BA 2X5PA 1BPVA 1GHFL 1MIML 4P2OA 3VXUA 4NN5C 3PNWA 2Q3AA 4Z76B 4QWWC 2NYYD 1D5XA 4R90L 2PKDA 2BFGA 1BJ1H 1OTSD 5A3IC 2KZ1B 2Z92A 5FGBA 2V3FA 4WHTB 1H15A 1C90A 4YJZL 1WGOA 4AIEA 2B0SH 4G8IB 4PJGE 3VFOB 3PP4H 1RJLA 4K55A 3QUYB 4U1NB 4AZHA 1CLOL 5ID1B 2P43B 5CD5C 1B3YA 2FX9H 4MQXC 4X8XA 1FCGA 4K7PH 1OTSC 5A3ID 5EOCH 4XPGH 1KV3A 4HUWB 2R0WH 2Z31D 2VLLB 3GGWB 4WIWA 1UKTA 1FYTA 5D7KE 5C0GB 5T33L 1FNFA 5DD5L 2WMKA 4NQCD 2QSVA 1KJ3H 4TRPL 1MW3A 5CD5D 4TOYL 2OP4L 2BRRL 1D9KB 2ICCA 5I9QC 3K46A 5JPNB 4YGVA 1QNZH 2H3NA 2P8PB 1RVFL 2LAGB 3FMGL 5JPMA 3F58H 1L0PA 1AHWB 1KIQA 4R5EA 5D7IF 5HVHC 4XNXL 4Z7QE 1FE8H 4GUPB 1UR4A 3HPLB 1JXKA 1JYXA 4JFPA 3ZR6A 2WP3T 2WVTA 3RBSA 1EDTA 3WCYA 4V2XA 3WSUA 2VXVH 1O0VA 4JFEB 4P2OC 3SUUA 1UXWB 2FATH 3HZMA 1BFSA 3D39A 3VJ6B 4W6XB 1ADQH 1KQYA 1J8HD 4PBGA 1UASA 5C0AA 4YIQB 3ARQA 5BRZD 4MHHG 1WAWA 4HA3A 1PEZA 5IBTL 3GGWA 4YDJB 2NTSP 25C8L 5JOPD 3WFDL 1W8NA 2IQAA 5D7JD 2VURA 3F6IA 3HE6C 4HQQL 3IDNA 3EYPA 1DBAH 3M46A 4WHYG 1JL8A 2PR4H 1Z0NA 2I60L 3LN9A 5DFVD 1UWGH 4JZOA 1J0YA 2GITA 3HI1A 3W53A 1NFDA 4L4TD 2WINB 4WCYH 3N17A 3J7HA 3KVQA 4HS8L 2VLJE 4GUPA 3RVXD 5AYIA 2VLKE 1U8HA 3QUZA 3QDJA 4OJFL 4APQC 1G84A 4R26L 4S10A 1N6VA 1V5JA 4XT1C 2O5ZL 3VVGA 5LGHH 3NCJH 4RFOL 2AJYH 3PWNB 5FDWB 1YN7A 4P59L 2Q7NA 4RAVA 3LXAA 2YPLB 4OD2A 4AIZA 4FNLL 1B0IA 2IF7A 2X0YA 3RWHB 5E7BA 1KTDB 3VRJA 2R1WA 3RTQD 3OIHA 3ROLA 1JK8A 1RU9H 2B39A 1XF2A 3GH7A 2QADD 1IAIL 1MJUH 1NAMB 3TO2A 3U79A 4GQPH 1FL6B 3DX4A 1KG0B 4N0FB 1JXJA 5T1LA 2A77H 3FB5B 3MREA 4NZUL 4YBLC 4GW4A 3PWLB 2AXJA 2BVEA 1MXGA 4G6KL 3G6DL 2X1OA 2XFRA 1NFIB 4UTFA 2IH1B 2CBIA 3MRMB 2ZWLT 3RGVA 3WO4B 1NAMA 1WTGT 2Y5EA 1ZEAL 3JWDL 5MERA 2X70A 3O6ML 2CIKB 3VCLB 3FQUA 3RA7H 4AEIH 5LG1A 3BSZH 1CL7L 2DQUL 4R90H 4PJ9B 2VDNL 4U0RC 3NIDE 4WENB 4JHAL 4D6JA 2F54E 4R4FL 3AXHA 4LSUH 1WAAA 4XP4H 5GSRB 1RK1A 2AQ3A 4R97B 1W72H 5TE4H 2H26B 3FQUB 4KUZH 4W8AA 4ZAKC 1GGYA 3JSSA 4ODHL 2ZWYA 3IFOA 4JE4B 3WUZA 1UD8A 4AY0A 5T3XD 3HZYB 1BAFL 1M6OB 1UC6A 4HMDA 3OLEA 1A14H 1UZ8B 2RCSH 4L4VE 3SDYL 4C59B 2J74A 4A6YL 3EOBB 4LPVA 3ARPA 3RZCD 3EYOA 5DJ0A 5ID0B 4LLYB 4UQ3A 1L7TL 4OUUB 1P9MA 1U0QA 1V3IA 1A6WH 3FN0H 4AD2A 2IALA 1FZKA 4AZCA 1XMWA 1EFXB 1UG9A 2WANA 4O9HH 5A16A 1AY1L 1CFVH 2HTKC 1CWVA 4WNQB 1LO0H 4AZ5A 2DDQH 4JPVH 5C0AD 5IFAH 2CETA 4YLQT 4UFKA 1ACYL 2P5EB 3V0AC 3WDRA 3VW3H 1Z5LA 2XQYK 3BPNC 4CU7A 2YFNA 1GOGA 1KPVA 4H1LA 3CPLB 3QUKA 2EDEA 4YHOL 4LHUD 5IQ7L 5DQDH 3SDDC 4Z7OE 3GJEB 1ZGLB 1ZS8B 2RAMA 4BK5A 4GO9A 1K8IB 3GSXA 5HYSA 3RAJL 2HKFH 3AU1B 2CIIA 3ARBD 1EZVY 5IMKA 4JN1L 2JTDA 4GZJA 5EO0B 4BH8B 1UWIA 3B9DA 3NACL 3CHEA 4DUVA 3KEHA 2YL8A 1EVTC 5T3ZD 4ELKB 2RR3A 1K8IA 3PGCB 4XAKE 1WC7B 4AM0B 2H2PC 4KV5E 1U91A 1I1AD 1R6VA 4UV4L 4EUPB 1RHFA 4QRUA 4PJ8B 3L3HB 5GNZA 1WWBX 3AREB 2VDKL 4WFED 1DVFC 1F4AA 1FN4A 5I1KH 1NCCH 4OTXH 4PRAA 3PGCA 4OCMC 3K8MA 1EX0A 4NKQB 4LBEA 1VF8A 1FAIL 5A2JH 2JEQA 4NQTA 2OSLA 4H5SA 4WI8A 4G3YH 3IJYA 2BXYA 1FO0H 3MTRA 1OAUL 3FONB 4WV1C 3GSXB 5IW1A 3I9GL 5ETUA 4OM0L 3BEVA 4P3WA 4FNPA 4MD4B 2Y9RT 1FA2A 5A6AA 2WCGA 4MCYA 2BSSB 4LOUD 4M81A 1UYQA 1LDPH 1P1ZB 4X4YB 4AL8L 4PY7A 3QH3B 1UM5H 1AGFA 4LLWB 2BVOB 2Z9TA 5HGAB 4KPHH 5LCVH 5JOEA 4C58B 5AAMA 5IHRA 1IAOA 1CBVL 1D6EA 5IF0B 4PP1D 4HEPG 4P9HL 4H25A 1P4IL 4H88H 1VGEL 5L2KB 5DJ6B 2FL5B 1WIOA 4R4FH 3UTSA 3UETA 1IEBA 2J47A 1DBJH 1D9KC 1UEMA 1LLOA 5D7SH 4ZUVB 4LCUA 3A67L 3JUGA 4LKXB 1LF1A 3TA3A 4QOKB 5DURB 4PJ7F 3KHOA 1RZ7H 1X44A 4A2LA 5KSVA 1AC6A 5ISZB 5T1DH 2OK0H 3S97C 3TBWB 1RV6X 3EIFA 1NCUA 1I1AC 2YPVL 3WS6C 1DWIM 1VACA 1TTFA 5HGGS 4FN0A 1MJUL 4OZIE 1WIUA 4WUKH 2CBVA 1KSRA 3FO2B 4JM2D 4Y2OA 2PYEB 3O11A 3CMOL 4GRLC 1X5KA 4K94H 3T77B 4OV5B 1PX4A 3NZHH 3VFWA 4G8GD 2PWFA 4NPYB 2NY3D 1NUGA 2Q86B 4QHUA 4X7SH 5HI5D 5DD3L 3FO0L 4UNTA 1FG2A 4WEMB 2N4IA 3BXWA 4FQLH 1XR9B 1JGLL 3QWRD 4PJCE 3V5KA 3WEOA 4RAUA 2DQEL 3S3SA 1UQSB 3KPRD 3HUJF 1EDQA 3RBGA 3S98A 1SYTA 5C09E 1H3VA 4P8XA 3UTZA 1C92A 1WFUA 3BW9B 4RGND 1G1CA 4IISA 5I17B 3ZE1E 1MNUL 1I7TA 3CD4A 3GIVA 5C8JA 1KBKA 4TTDD 2NY1C 5EZJB 3IXTA 3OG4B 3BP4A 4Z8FL 1JGEA 2MSPA 5EFFA 4PJFE 5M5DA 3WNLA 2ZOKA 5INCB 3MMEB 3WIIL 4V1DA 1OGTB 5B39B 3PGDA 4Y4KD 3L6FB 3FN3A 5DTFA 1CIDA 2Q76B 4MNLA 1EFXD 4X5WB 1ZJAA 3WFDH 4QRRA 3O2WH 1FNAA 5H35B 4DN4H 4B7IA 4QRTB 3GSUB 3INUH 3AIRA 1JRHH 1KENH 3HI6L 4KRUA 1BQHG 3MMUA 4JFFB 1OAYH 5JOFB 1AGCB 3L5WA 4Y5XA 3QDAA 3WL0A 3U30B 1TENA 3GHBH 1YEFL 5DVMA 1XV8A 3GKWL 3C5ZB 3RMEA 3U7YH 5DURD 3MRPB 4YHGA 3DUSB 1SYVA 2PYEE 3ZYOA 1DEEA 4JFHE 1FHGA 1KGXA 2D4DA 1O7AA 4K2UL 1RJZA 1E71M 4QTHA 3REWA 3RU8L 2H6PB 2ENSA 2QF8A 2C26A 4NJAL 2IADA 3ARDD 4OCWL 2Q76A 2VR4A 4JZJB 5D1XC 2ZUSA 5D9OA 5FDYA 2UYLA 1TUXA 4DCQB 4WTZG 4G9DA 5BO1H 4Y19D 4N0CD 1KCRL 2HJFA 4WJ5A 3T0EA 1WWWX 5C0FB 2PI6A 2LAAA 2DT0A 4QRPA 3POCA 4Q74A 5EZIL 5KSBA 5DI8A 4K3JL 3DYOA 5HPMB 1NC2B 3TCXA 3MACH 4NO0A 5I8CA 5CEZL 3T4YA 4RX4A 3SBWC 1HP5A 4JHAH 4E5XB 3T4AA 4F57H 1WV7T 3AS0A 3O45A 3GSQB 1UD3A 3VGEA 3BKMH 3CFCH 5BXFB 1VFOA 3SDCD 2PETA 2YFOA 1MUJA 3CFDA 5DJXA 2XACC 5A95A 1ZB5A 5KEZA 2XFYA 1LJYA 4BQ4A 4I0PA 1J11A 4P2OB 2V2TA 1EXUA 4N5ED 4NRSA 3CC5B 5IWLC 1OARL 2OL3B 4X9FA 5B38G 5CEYA 4B9ZA 1T1WB 4E41E 3QXTA 1R3KA 3BI9X 3CFKA 5DR5H 1DFBH 4BSWA 1JZ5A 4Z2JA 4TUFA 3A67H 5BWFA 4DWSD 5CZXC 3VG9C 1H0IA 2A3AA 5ID1A 1Q9KB 1OAUH 5DJDA 5CQ1A 2VYRE 5I1KL 1LNUA 2D0HA 2OWWA 4WTWA 2LVCA 3IDYC 4GBXB 1M03A 3EJPA 5EU3A 3J8F7 2V2XB 3MZGB 4EE9A 4FRWA 4FXKB 2BY3A 2J6EH 4XHQA 1WZ1H 1MCJA 2B4CC 4U1MA 1TQTA 1G01A 4MYWB 3K0WA 1UYWH 3IRPX 3BVVA 1NCWH 4OF7A 4TUKL 4GKSA 4PRID 4XPAL 5ICYA 3SDDA 1NUFA 3JVGC 5JHLH 4LQFL 1A3RH 1KF9B 5EULV 5ABDE 2XN9B 4I2XB 2LE9A 1E6PA 1WEJL 1HJVA 3SQOL 3RNQB 4UQBA 2J7GA 5CEYB 2FEEI 3UJIH 3BP5B 4JCLA 4WFHD 3MRNA 3AZSA 1IGFL 3EOTL 3AIQA 4OKVB 2X4PB 5GS0H 1YEJL 4Z78B 5K9JL 3D39B 3VJ6A 4D3CH 3QJFB 5IDIA 2AP2A 2PO6B 2XRAL 2D7TL 1NCNA 4PJGB 2W9EL 4MJ4A 1ISVA 4YIQA 1MQKH 4MDIA 2G9HA 4MWFA 1UOKA 3SCUA 4AZ6A 1S5HB 1T89C 3SE9H 1KYOK 2W61A 1GZQA 1NGPH 1NGXB 5KTEH 3LKSB 1QFHA 1RIVH 4KRLB 1UD2A 4J8RB 3QDGE 2XA8H 3T1FA 4IRJB 3BPNB 3S4SG 4BQ9A 3H9ZA 2APVA 2VLLA 2DIAA 4XC3H 2XSBA 1WWAX 4P4KD 4GS7C 3A4AA 3MGTB 1NDMA 3REVA 4AMWA 3PHAA 5M7QA 2XN1A 3MOBH 4G9FA 5FO7B 3GSWB 4FZEH 1T21B 3RJYA 5D7LA 1JRHL 5A3HA 2YMXH 4QNPE 5HPOA 4NXKA 3ZL4L 1GOWA 5F88A 2D9CA 2YD1A 1CDCA 2JIXD 4XNMB 1MFDL 3IDUA 4Y1AE 3Q2CA 1P7HL 1MCOL 5JPMB 3E1F1 3MLVL 3AAZB 1EERB 4JY6B 3WN5B 3BSGA 4WKAA 4POZD 3JTSA 4ZDHB 4NQDE 3MRKB 5EU6D 2L4OA 3WJLA 5D5MB 1JNDA 2VLJD 4OZOA 2D7OA 4NNXA 1U3HB 5MI0B 1J0HA 1YNKL 2WUCL 1KXQA 2R0LH 4RMRA 1FC2D 5GGQH 2H2PD 3JWOL 5CJOH 2J12B 5B22A 2VX6A 1UA3A 3CHCA 5DMGC 3VFRA 3ULUE 3GMNA 5C08B 4NJAH 2NT1A 3BVNA 4W6WB 2E7MA 1D3CA 3A6CL 5ELIA 1UQZA 4AZGA 1OTUC 4P7LA 3WBAA 3MPCA 4U1GC 4XUYA 3HMWL 3GSWA 1OQXA 1P9MC 3C08H 1FO0B 5CSZB 2D1ZA 1OP5H 1CXKA 2AMGA 5I66B 1MHCB 4JQVC 3JV4A 5C1MB 4NFBA 5D7IB 2WINA 4P9HH 3FB8B 3SO5A 1B4RA 5F6IC 2AK4B 5F7UA 3QUYD 3U0TB 1GHRA 2ADIA 1CL7I 1DN0B 2YZ8A 2VLJA 4NNYB 3ZYJA 2CXGA 3GXNA 2I07A 1DJSA 4L4JA 1W72A 3JBG7 4YDLC 4MNGB 3BKYH 4P4KC 1W9DM 1U36A 3R06A 5EFDA 4BF7A 1YPZB 3VCLA 1CICD 1DWHM 3B83A 3TT3L 5CFHA 3LZFL 4R2GC 3UR8A 3SCPA 3FAWA 1YEIH 4OCWH 2BOCA 4YHPB 3U57A 2BVPB 2PN5A 5F9DC 4DM2A 1A7QH 4GAGH 4UQ2A 5HYJA 3B9VA 3QUZC 4M93B 3GSRB 3PDOA 3IDIB 4N1EA 2Y8KA 1QR4A 4W7UA 1M7IA 4I0CC 3QEUA 5KS9B 1T66D 1KEML 1XF4B 5D7JA 1J0JA 1ORQA 1OGAE 1UKQA 1VA9A 4HLJA 1DLHA 2HYMA 2G5BA 1ED3B 2CIKA 2VDRL 3QFDB 1G6RL 2NXZB 3WKML 5JW3L 1OP3K 4NQCE 2IC2A 1M7IB 5KS9A 2WBJC 3FQWA 2GHWB 4TPRH 3U4AA 3GZAA 2B20A 3S2CA 4W7WA 4MA1B 3EYSL 1LEGB 2HFEA 2SEBB 2DRUA 5HVGB 3V95A 3FO0H 3EO9L 1FNLA 5ADPH 2PNDA 2LU4A 2VITA 1OAXH 5EC1B 4R4ND 3QB7C 3U6RB 2DBJA 4XAWH 3V2AR 4O4YL 2R4RH 4F37F 3BO8B 4PSRA 3OAZH 4IDJH 1JYVA 4BQ5A 2HRLA 3WEXB 3PQYE 3F5WB 4K8RH 1M6OA 2DQJH 4U1IB 5KAQG 3KPOA 3SIMA 3PDOB 3OXRB 5C7XL 4ELMB 5BVPH 1QI3A 4XP6H 3SDAB 3CZFA 4AD3A 1CGUA 4NC1E 2WBKA 4S1SH 3D5HA 1ZBCA 1AQDA 3W4RA 4P4KB 3N13A 2VMFA 1QUNA 5IFJA 3SKMA 2COQA 3QZWG 1IGFH 3PWUB 3VXMA 2RJMA 1V08A 2B2XL 5D1QB 4LRIC 1MFCL 4CN1A 4KVNL 3VSUA 1JZ8A 1XCQB 3OKMA 4PJAF 5E2UH 3OB0K 4UFJA 3RDTD 5IMLB 2X4RB 2YUWA 4EUPA 3S7GA 1YEEH 5SWSE 3PWUA 1BQHA 2UWEA 1EO8L 5EN2A 2J3SA 4X4YA 1A6UL 2XWTA 3GNPA 4X8JA 3SDXE 1ERNA 5D71L 1ZWIA 3FRPA 5DVKA 2ZOXA 4ELME 2W07A 5ACZA 5CEZH 5I73B 4MNHB 4HZAA 2ED7A 3HG1D 4Y7MA 4RBPK 1KIRA 4HK0B 1OB1A 3WV0A 2O9OA 1XT5A 3H7LA 2D4FA 4JZ5A 1DBKL 4RFEA 1HHGA 4TTUA 4U05A 2ZX7A 2NR6D 1U8JA 4YHKL 5K9JH 4JFXB 1MCHA 2CQVA 2A3BA 4QOKA 1FN4B 2ZZUT 2DLTA 2YJQA 3AYRA 2W65A 3TA3C 4ZYKB 1Q6EA 1AO7A 1D5ZA 2DKMA 4PRDA 5I2IA 2P5WB 2H32B 1CD0A 1QWUA 4HF5H 2D7NA 4GAJH 3I75A 4NP4L 3IANA 4UOZA 3JWNC 4LIQE 3THCA 4DWSC 2HVJA 3CXHJ 4BK4A 4QP0A 2JB6A 1GC1C 2Z93A 1P1ZA 2JF1A 3VMPA 1WWCA 5A94A 1ZT1B 4WI9A 5CZVH 5KVMC 1FG9C 1Y0LB 1PIGA 4E8DA 2CD0A 1CFTA 1PQZA 1H49A 3U1SL 2Y1VA 2JLLA 4QT5A 4K23L 4XTRC 4JY4A 3DETD 3NCYS 4RAUB 4WWKC 2JB6B 5KG9B 2D22A 2YEZA 2NY5C 1UWGL 5L2KA 3HE7A 1U3JA 4NBZB 2IPKA 4DW2L 3SKOA 1CTNA 3VX1A 2EYSA 4J4PC 1E4XI 1ZT4B 4QRPD 4P3DB 1I9RH 4I3RL 1FHLA 4Z77A 3SY0B 1AXSB 5DD1H 1NPUA 3CK0L 4WU5A 4KGJA 2VL5A 3BXNA 1VFAB 2CUHA 3DVNA 2HWZH 4UBDC 4XCCH 3FCTB 4JPIA 1OVZA 4PJDF 4U4BA 3GBEA 3IJHB 1K6QH 4IRSB 3DX7A 3TIEB 5I2UA 4R4BA 3L6FA 3HC4L 3HS0B 1CG9A 1BF2A 5C2BL 3H2WA 4LGSB 5IM7A 4X9YA 4JREC 3MRLB 1EAJA 2JJVA 4WVRA 4UFLA 1JHLL 5A8OA 1AH1A 1I3RB 4HXBL 5GRXG 4JPIB 1B4JL 1UYWL 3UC0H 3HG1E 5E4EC 1WDRA 3CFJB 2VQ1B 1DL7H 1W9UA 3P9LB 2BNJA 3PWJA 1KGWA 3TONA 3BGAA 2YEZB 3WNPA 2C3HA 5A6MA 3RCNA 5EA0H 5J13C 1BLIA 4W4NA 5JXED 4WGVB 3U30C 3EAKA 4LF3B 4ZXBC 2CJUL 4PJ7E 1RUKH 1AXTH 1EAPB 2QR0B 1ODZA 3ZSTA 4PJCA 1ZA3A 1ONQA 5C3LD 5DO2C 1TZGH 1IGTB 2V5YA 4E41B 5IQ7H 1MYRA 1NWUA 2HISA 3MKKA 2W66A 2G60L 3L5XL 4ORGA 4IIQC 1GQKA 2BSRA 5ABEA 4Q0XL 2D73A 5E5MB 5C92A 4HWZA 3IDXH 2DM2A 4V27A 4LCYB 4P57B 3WH6A 5MEQA 1BVNP 1JGEB 1VB9A 3DX9A 3MUJA 2ZUUA 2PC8A 3LY6A 4BFGA 2GJ6D 1VDGA 5DJ2B 1YY9D 3DUSA 4Q9QL 2VZ3A 1XGUA 4JM2A 3RM9A 5CEXB 3WF0A 4IIQB 4OGAD 4A6YH 5CD3B 1RJZB 3H55A 5TDNA 2OM5A 2BVQA 3MNWB 4MAYB 3DX9B 3MLSH 4UBDD 3EJSA 4JKLA 1VKXB 1GONA 1SQ2N 2F53D 1C8YA 4L4VD 3MGOB 4LSSH 1ZHBA 4ODWB 4PJ8C 1QRNE 1E4KC 3L3JB 4PJCB 2XN9E 4I2XE 3P4LA 4WGWB 2ZE0A 3VFGH 4YX2L 3GMRA 4NZCA 1QO3A 2PXYA 1MWAL 1UCBL 1LEIA 4HT1H 4PJBF 2W1NA 3VXSD 3VPLA 3BIBX 5E70A 4U3CA 2CRZA 4FQ2H 2DL9A 4ZUWA 1LK3L 4NM4H 1EXUB 3RWJB 3R0NA 3S6CA 2V5TA 4W86A 1LEIB 4ZXBD 4HPGA 1BAFH 1MCCA 3DNKA 4JM2B 2JF7A 4Q6IC 4U6VL 2ZJSL 4QF1B 3GJFA 3WIFA 4NT6B 1F13A 4QXGL 4DK6A 5FXCH 3O8XB 4GRMA 2X2JA 3WHXB 5JO5A 3MRCB 4HGWA 4PRPB 4DEPB 3S6TA 5IHUL 2ERJC 4CMHB 1XAUA 3BPLC 3PTMA 1IAKA 5J06A 2W59A 5C09D 2FH8A 3BD3A 1W3KA 1MREL 2VZUA 5IMMB 3FL7A 3KPSE 4PTUA 3ETBF 3TBVB 3MV9E 5GJSL 4M4RA 5KSAC 3MRCA 3C09B 4HGWB 1JGDB 4NOBA 1P7QB 4XX1E 3VXOA 1MHHB 3O9NA 1LO2L 4NO0B 3WXWH 3DBXB 1FAIH 3WL1A 4XP1H 4OZFH 2XIBA 4KKLD 2V5DA 4O2EA 4TULL 4YFLI 4MB1A 3OZPA 3DVGA 5GHWL 3ZKMC 4LNRA 1A7RH 3EYUH 1X5AA 1EHXA 5J6GB 3SGEH 2C7UB 3QDMA 1TJHH 5IT2H 2XWEA 4GAGL 3QXUA 4WFGD 4RDQG 5E00B 3TPUB 5L0QC 3OF6A 2ICES 1S7TB 4K8RC 1ZLWH 3VG0H 2WC3A 4ZXOA 4PRPA 4BSWB 3ARFD 1WZLA 3ESUF 2XWDA 2GSIA 4AEFA 3GNOA 4HUUA 4JIEA 3LRSA 1QLFB 3VFMB 4X7FC 4CBPA 3LSOB 1INDH 4LP4A 4HCRA 1E4JA 2I26N 4WHTA 2YD6A 5CKAA 4JJ5A 3PWPD 4OSUH 1XF5B 3EJTA 2AXGB 2GSIB 2A1WH 1XIWD 4M9OA 4B53A 4F80A 4KQ3L 3LX9A 5F9AC 3O9WD 3WENA 4Z2KA 3KXFA 3WMCA 2C7FA 1H3UA 1S3KH 3DVGB 3KG5A 4PJHB 3MLUH 5D7LB 1GIGH 4QRQA 2CERA 1S7UA 2N1KA 1DQTA 1GVIA 4K8RL 4G7YH 4G5ZL 2FHCA 2I5YL 4IDJL 5IB4A 3KPSB 1OD8A 4GI8A 2CKBB 2IFFL 4C4KO 15C8H 4NKIH 3ZHLA 4PR5B 2YPKA 8FABB 4P46D 2YDSA 2C3GA 3PIQB 1DWGM 3ZKSD 3PGFL 1X1NA 3EYVB 4OLYH 3O2LA 4X0VA 5FYLH 4OAWB 3VFGL 2ATPB 3EFFA 5LAXA 1WICA 4GH7B 4AENA 4I18B 4F9PA 4W70A 2G9HB 4MWFB 4YE4H 3C8KA 2OMNA 3N04A 3X3FL 4GKZA 2Y6SD 3LKSA 4NUGH 3BSHA 3QG6B 1QFWL 4W6YB 1DQQB 4D1JA 2XG4A 1QNSA 3ZYIA 5CJQH 3U9UA 4DO5A 1MAKA 4JRXB 2A9NH 4RFNC 2Q7YB 1U3HA 5D7IA 4LSPH 2VN7A 4G80A 3D3VD 1WB0A 4M48H 2BSTB 5EORH 4R97C 2Y4SA 3V6BR 5LGJA 3VIHA 8FABA 3RGVC 4KROC 1KB9J 3KS0J 3V0VB 4HIHB 1EOMA 1TQBB 2Q7YA 3AOFA 3LDBC 4PLJD 4QHLA 4JY6A 3C6LC 1JF6A 1RK0B 4YX2H 3PWPE 3MRKA 3VD9A 2YDQA 5D5MA 1E0OB 4PJBB 4G6JH 3HRZA 1G6VK 3D1MC 1QLEH 3BUPA 1XSKA 3G6MA 3AREC 3HE6D 4ETQA 3ARUA 5E2VH 1KCUH 3MRHA 4UNIA 3R8QA 3QCUL 3EO1B 3QDGB 3MJ8B 4GSDH 4P2RA 5C0EB 4DUXA 1H3WM 1T03H 1GQLA 3KDMA 4M93C 4OF8A 2H9GA 2QSQA 2XUCA 4U6XA 1XF2B 3R8BB 3BDYL 1XFPA 2Z8WC 4AG4H 5SWSB 3AB0B 3BUBA 2NY4C 2XWBA 3TA9A 2ITDA 3K80A 1MCWW 1WDQA 2HMID 4CVXB 3N12A 5I66A 2ARJB 4YPJA 1HXKA 1LL4A 3EDDA 4YPGA 1WFOA 1U2HA 2OJZH 1YJDL 1FVDB 5FM4A 3TV3H 4MJIA 5BO1L 5C0NC 2AEPH 2F7QA 1X5HA 2OZ4L 4KDTA 5DRNA 3O8XC 2E6PA 4FQCH 2HTLD 4DGIH 1IT9H 2VLJB 2J8UA 1G7HB 1KPUB 4UQ3B 4YHIA 2A73A 4PRWA 3LN5B 1V02A 3F5WA 1FNEB 4LCWA 3MODH 4U1KA 2XPGA 4P49A 4UDUA 4ETQB 2E9JA