7CGTA

Rameb complex of cyclodextrin glycosyltransferase mutant
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 228
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 7cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 7cgtA01
5E9DD 5TDNA 3HTLX 5INCA 2Y8VA 4WJ5A 5F1IA 4V2BA 1Q1JL 4HPGA 1XH0A 3RJXA 3QEQE 1XYZA 1CK0L 1N0XL 1REIA 1OM3H 2CKBB 3LIZH 4XVJH 3F7VB 3V7AG 3DROA 4JFDA 2JK5A 3FO9A 3W81A 3GMRA 3AM8A 2BNQD 4JFPA 2VLKE 5ICXB 4ZTPL 1U2YA 4N0CD 4XCEB 3MS8A 4F8XA 5EU7C 4JFZL 2AXGA 2OMNA 4ZOBA 5M95B 3CCHB 5E8NA 3S88H 1R0AH 3S7GA 4FLOA 3EO1A 3VINA 3HZKA 4N8VA 4NZRH 2W59A 4X83A 1IMHC 1JPFB 3GSUB 3ZJ7A 3IDGA 5JTWA 5I6XC 1I8KA 1BPLB 2IEPA 5DJDB 4C83B 1SY6A 2HRPH 3HHRB 1Z0MA 3HZYA 1WICA 4JB9H 2VDOH 4KKBC 3ECBB 4D6EA 4HW6A 3M46A 2E9WA 4YHIB 4FQHA 2WHKA 4R4ND 4PRAB 5F1SA 2PYFA 4HKZB 1R6VA 3DJ9A 3RUGB 1GGIH 1JXKA 2IQ9L 4JFYB 2V2WA 5CD5D 3B5GA 4R4FL 1PG7X 3LKOB 4X5XA 1VADB 4X7EC 4OIBA 1YEDA 3BRFA 2ZXQA 2CK0L 1SJVA 2VNCA 3LEXA 5DMIL 4K3JL 4OFVA 2FBJH 1F3RB 4HIHB 3UG3A 3BEWB 2VZVA 1U8OA 2RGMA 4HGWA 1X3DA 2OYKA 3KLHD 5GS2D 3LEVH 3GXTA 1OGAE 5BMFL 3EFFB 4YN5A 4DAGH 2WBKA 2FZ3A 1KN4L 4NWTL 2JIXB 3X13A 1MQPA 5EUOA 1LO5A 1V7NH 5E0QA 5IMMA 4DWSC 4BUGA 2OZ4A 4Y4FA 4OOUA 1MF2H 1JWSA 1N5YL 4G8FA 3CC1A 4MADA 2CUMA 1A6UL 4WKAA 4I18A 3ARPA 4DZ8A 3MRNA 5DF0A 4X7TB 5IHBA 4M93B 3WDRA 1J12A 2Q3AA 2XG9A 2NZIA 3MODL 3RZWA 1JPTH 2DI7A 1IAIH 4MB5A 3SKOA 4BF7A 1P1ZA 1V6YA 5K9OA 2WCAA 4R0LA 2COQA 1JHLH 1KXVC 2JIXD 2EYSA 5HJ3A 1JHTB 5E6IA 4BA0A 5ISZE 4LMQI 3WJLC 5DZNA 4Y5VB 4YHNB 3LQZA 3VFWB 4JM2C 3VGGA 4FFZH 1XR9B 1KBGL 3ALFA 4MQSB 1CBVH 1U8QB 1EFXA 2DLHA 3MJ9L 1DSFL 1ZEAL 1QI3A 2XY1A 3PWNB 4JM2B 3LY6A 5J6GB 1CLZH 4Z76A 4YX2L 1HL8A 1EXUB 1P6FA 4YHPB 3QI9A 3FAWA 4JFEA 1YN6B 4KRLB 5A6KA 3L4XA 4RISL 1EDGA 3RWCB 3OMZA 2JJTA 1BIIB 5I1GL 2IBZY 5EPMA 2C4FT 1HKLL 3WDQA 2I27N 1FL6A 3F58H 4XC3L 1BZ9A 3MOAL 5EU3A 2PXYB 3HI6H 4GMTH 2FO4A 2ZUUA 3I9GH 5DQDL 3WKNA 1CGSL 4R90L 4KRTA 3O9WC 2WUCL 4AZCB 3MJGX 5HYJA 1ULVA 4ENEC 2BV9A 5HGBA 4LGPB 2YFNA 1XT5A 5LQBL 2AJYH 3FMGH 4XMPL 3MLVH 4G9FB 4OLVL 1AR1C 4GS7B 4XMKH 4HJGB 5FO7B 1WAWA 3OTTA 4POZC 3BVUA 2MFNA 4Q22A 5L2KB 1FFNA 1WFNA 4NWUH 5DTFA 3FT2A 3GSNB 5DI8A 3VG9C 2PXYD 3GSRB 5BV7H 1CEOA 5DMKA 5HYJD 4F33B 1YMMB 5IG7A 1PY4A 4IBLT 3AREB 4PB0H 2X4NB 1CFSA 4TUJA 4U1IA 5D70H 4ATLA 4MD4A 1K4DB 3DIFB 4U7MA 3C60C 5BVJB 1PD6A 3N17A 1MCNA 3EMQA 4G9FD 2ZKHL 4LXFA 4PV8A 1QFUH 1ZKAA 5IFHL 4TVPD 5DK3A 4HWEL 1FRGL 5L2KD 1CLYL 4V1DA 4ZEPA 4OFKA 1NEZA 1H9VA 4U1JB 1NDMB 1LP9F 1YMMD 4EBQL 2UYLA 1NCDL 1GOQA 3ARED 4P2QB 1I7ZB 4JZOA 3VXNA 3BUYB 3E6HB 2R8SH 1HIMH 1Z5LB 1G9MC 3F5JA 1R3IH 3FB7B 1WIOA 2Y5TA 2CBUA 5FF6A 1U8IA 3PZMA 3RWDB 1NLDH 3MACL 15C8L 1CGXA 2PO6A 4QLLA 3VM5A 4Z7QF 3GKZA 3KXFE 3QR2A 1IRAY 4EI5A 4S2SB 4LDLB 3U2SA 4DQOL 1KGXA 3PP3H 2HH0L 3LN4A 3SY0B 4EDWH 3VRLE 5AY7A 5E9DE 2OXHA 4P2QD 1UQZA 1RIHH 2XQYG 3O41B 5D2LF 4FLQA 3QULA 3PHAA 1QTYT 3NFSL 2QQLH 5JQ6L 3VVGA 2DSWA 2R15A 3QHFL 4OCMC 1W3JA 2ZUNA 2NW0A 3QO1A 2R0ZL 4J6RL 4M24A 2BRRL 4GI8A 5F8RC 4M43H 2BNQE 1F00I 5H94B 1ZANL 4R27A 3V52L 3HAEB 3DO3A 1RVFL 5DJ8A 3RPIB 2JJUA 2P5WA 5GS0L 5E8OA 3EOBB 1PG7L 4HK3J 3T0VA 2P7TB 1A6WH 3U46A 4U7KA 3BKMH 5TE6H 2YPVL 4OLXL 4JPWL 5B22A 3NZ8B 2XTKA 4XVSL 1INEL 4KVCL 2KZ1B 2OSLB 2VISA 3OAUH 4NCC2 1YC8A 2H3NB 2ICEA 2R23B 3A0OA 3KR3L 4X9BA 1JFXA 1AQ0A 1EBPA 3WDPP 1MVUA 4XPTH 5FYLL 3DHPA 4LRIC 4BQBA 1KB9J 1TVHB 5T3ZH 2GDUA 3VIKA 5IB1A 1ED3B 2F7RA 2P5WD 2DQDL 3TBTB 2BVEA 4ODXA 4QDMA 3LIZL 1RZFH 4F66A 5DHVA 4D6DA 1D5MA 4XVJL 3BZFA 5EU4A 3C6SB 1MHHB 5DUBB 1G5AA 5KANG 3JZ7A 5TQ2H 1PG7W 4FOMA 4PJIB 2DWEA 1FPTL 1NGXA 4HBCH 1BOYA 4TUKH 5GRYA 3G6JB 3HE7B 1FVCA 5HGDA 1H3XA 4H5SA 1SM3H 4PJDA 1FO0L 4NRYB 4X9GA 5I17A 5LYRA 1NUGA 2PYEA 2ZUVA 4M81A 3MLWL 3B9KC 4CVXB 3CH9A 1U8HA 1PZUB 3I02B 4WDIA 2H2PC 5J12B 5D8WA 5C9KA 4PJGE 3BGMA 3ET9F 3U7VA 4MJ4A 2X2YA 2HG5B 3LSOA 4R3SB 2WXDM 4ZG1A 3MO4A 3TBWA 4LCYA 4NQDB 1U8LA 3O6MH 3DSNA 5B39A 3MA9H 1IM9B 1UGNA 1ACYH 4LCCA 2ITDA 1ZBCA 4JY6A 5EZLA 4XNMA 2DQHH 3KPNA 3HE7D 4B50A 2DQCH 2PYED 5HHQA 3L2LA 4WHTA 4Z2GA 1EEYA 4R8WH 5CG0A 4TNWF 4RAUB 1MCLA 4LEOB 4K94H 5EUOE 4FQLL 3HMXH 4NCC1 3VGAC 1RJYB 4R4BA 4XVUC 4DUWA 5JLZA 3QCVH 4J3OC 1W72A 1MUJB 1WITA 5CWSA 1SEQH 3K4ZA 3UCQA 3KGRA 5C70A 3VGAB 5ITFA 5GQBA 4JRXB 2W63A 2HFEB 2VTFA 2ZXBA 3MRBB 3INUH 4NQDD 1E4XI 4Y16C 1GOFA 2D4DA 4W6XB 3WNOA 4M61B 2UY2A 3BXNA 1CICD 5DS8A 2WUBL 3RWHA 5C2BL 3RTQC 4WGVB 3CZKA 3VI4F 1K2DA 4YQXL 1VACA 3QWRA 3OX8B 3OB0K 3I3BA 3IFOA 2C1OA 5A8MA 2DKSA 1DBJH 3DX4A 4PJAF 4NDMA 1B3ZA 4R7NB 5HYSB 1JYXA 4MS8D 4JRXD 1FVEA 3MGTA 4U1MB 1S8DA 4MCZA 4Z7VE 1JHLL 4LYQA 4JJ5A 1SQ2N 5DGRA 3AU1B 4D71A 3HPLA 4XWOD 5GNZA 4JZNA 1CU4L 3QIWA 5IB5A 3WFCL 3RO8A 4NO5A 3NAAH 4QT5B 7FABL 1C16A 1F11A 3IDYC 1BGXH 2F7QA 1OINA 4GAJL 3ZT5A 1OWRM 1N59B 1RP9A 1E55A 2VITA 5B4MC 3ROLA 3K2UL 1FAKT 2A73A 2G2RA 4PBGA 4JDTL 5DT1H 4WI7A 1OF2B 4F7PA 4HA3A 1UT9A 4QO1A 5C6TL 4X6BB 3VXRD 1CLZL 1QBLL 3QUKB 1R5IB 3PZTA 4F7MB 4OF5A 4Z77B 3ZR5A 4JFXB 4DFHA 5MENB 3OGOE 1CFVH 4P46A 1KEGL 1GXEA 3IXAB 3PZQA 1FBIH 3IXTB 4QHUA 2Z8SA 3RHWF 2OJZL 3SGEI 5HYJE 3P0VH 3DMMC 3GXIA 3LN5B 2F9BT 4XCYA 1XGRB 1JNLH 4KRNA 1JGUL 2X1XR 3WHXB 4AD2A 3DX9A 2XG4A 4ELKA 5LGJB 3W5NA 4WW1A 4WNQB 4FP8L 1LK3H 2A3AA 1W0WB 3T8XA 4GMTL 4XRCA 1KXTA 1X1NA 1X5XA 3I9GL 3SGEH 3DMMB 4L9LA 1N6QL 2UVEA 2OBGA 3GMOB 4G9FE 4K3EH 3FQUB 4D0BA 3JUZA 1CENA 1DWIM 4TVPE 3ALXA 1MJUH 1Q9LA 1RJCA 3O45B 1A0QL 5F7HA 5L2KE 3SE3A 1F8TH 5MEND 2Q7YA 3N1GC 2AJYL 3BSHA 3FMGL 4HS3A 4KKCC 2AW2A 2LAGB 4QRQB 4W4OA 1IQWH 4XP1L 1UENA 3MLVL 1O0VA 4NKOA 5C8JA 3UJJH 5C0DB 1WFTA 1HEZA 5GGVY 5JPMA 1AGCA 4N9GB 3T0EB 3DX8B 4L1DA 3ZTJH 5HI5D 1YMME 1B90A 2V3DA 4LPCA 1AXTL 4TSAL 4Z6AT 1NH6A 2YJQA 2XHYA 4QRPA 4NWUL 4LVNC 4O51B 1ISYA 1JPGB 1H3WM 1R87A 3SDYL 5J13C 4UOJA 1KACB 4DKFH 4OCNC 5L9DH 4XXCC 4S1SH 1B3XA 3TT1L 3L1OH 4S0SD 1L6XA 2HFGH 3V5DB 4RAVB 3MRLA 1NOWA 4AIZA 1SEBA 1J5OH 5B3NA 1NPUA 5F1OB 4HG4J 5A2JH 3CZNA 2BZDA 1F3JB 1QEWB 5IROC 1KCKA 3OWEA 3H3BC 1GZPA 3DTXA 3T0ED 3A47A 3MRDB 4QRPD 1UG9A 2OSXA 4NC0B 4QEGA 4WKHA 4EQ3A 2W0FA 4P2QE 4PLKD 4PYHA 3QHNA 1HL9A 3UG4A 5I24A 1UD8A 4OLYH 5D1ZA 3PUCA 4UT7H 5BXSA 3IFPA 4AD4A 5EBLB 2GIYA 4HIEA 2OJEB 2WW8A 5FK9A 1TZHA 2GJZB 3QO0B 3V6FA 5DMGC 2VRJA 4P3WA 2R8SL 1HIML 3EKCA 4JIEA 5INDA 1FG2B 1S9XA 2R0LL 2YD1A 1INQA 3P9MA 4HHAA 4BM7A 4D6FA 1ZSDA 1KV3A 5JW5A 3TC9A 5TDOB 3SPVB 4XVTH 3QH3A 4Y5YB 1NLDL 5CPSA 4EKJA 5F89B 1KB5A 2NQCA 4XWGL 3QUML 4NM4H 3ALWA 5GISL 2AJSH 4YXKH 2XVPA 4XNYH 5EU5A 1IM3A 3RVVD 1CXHA 1T3FA 2W66A 1DBKH 4MMZC 5TGBA 3L4VA 1KN2H 3RIAF 3UTZB 4IRJA 4KUCD 1PJ9A 4MDIB 2HMIC 4BZ2L 2GJPA 1ZGLB 3MCLL 2R4RH 2HKFH 5JW4M 2P49B 1H5BC 4PGEB 2OR9L 2B2XH 5FYKL 3V6ZB 2DLEA 2P5WE 1WC7B 2LQRA 4HXAL 4PRBB 2XN2A 1J10A 4KK9C 1MLBB 4NZFA 4U1SB 2OP4H 3PXHA 5ILTL 1JWMB 4IRJD 1MQ8A 1P2CA 4OM0H 1RZKL 3FRUB 3TGXA 1QPXA 2H9GB 5I16A 5ID0B 1VGEH 3D25B 4IJ3C 1KCLA 3UCRA 4QLKA 3JTSB 5KSVA 4MDOA 3OAUL 3T1WA 5BS0B 3GJEB 3OZOA 2V9QA 3I85A 4LHUA 4XPTL 1R5VA 4P3CL 3L6FA 5C0FA 1W9XA 3VXMB 2E3ZA 4LSSH 1DVFB 3HNTL 1X9QA 4JGJA 2MQ0A 4PJCF 5SWSA 1A14L 1KJ2A 1Q0YH 1YUHB 4U33A 4GAYB 2CBIA 4OLEA 4H8WC 5E5MA 4NJAH 2HTLC 5BROA 4V27A 4P5MB 3FQWB 1MH5A 4MX7B 1OGBA 4L3CB 1ZHLB 1MHEB 2F53A 1CZ8H 2PYEE 4MXWH 4ZAKC 5TQ2L 1UWEH 4WY7L 1IAKA 3VFNA 1QG3A 4LHUD 5E00A 3VWKC 5BS0D 4E5XB 1A02N 3OGCB 5J1AB 1JZ5A 4AZ8A 5A16A 3B2UC 1NWRA 1MCFA 3VXMD 1DVFD 1ZT7B 4PJEF 3TOPA 3WD3A 3GBNH 5ABEA 2X10A 1QKZL 1J1OL 3BPCA 4LF3B 4PP2B 1OCWH 4NUJA 4YE4H 4FZEL 4NQDE 1E6ZA 1J11A 3GRWH 3B9EA 3CZFB 4OV5B 2QV4A 4E4PA 4M6MH 2XIIA 4WU5A 4KK8C 3ARDC 2EO1A 4PRHA 3VG0H 5I19L 1XF5B 4UAOC 3QNZA 1FZMB 4OJYA 4CD5A 2DQHL 2DQCL 1KFAL 5GS0D 3WKMH 4WKFA 4K94L 2A6KA 4JRXE 5AD0B 3RWGB 2JALA 1A5FH 4KRPD 4UAOB 4KZEL 1C93A 4PGJA 3HC0B 4FNRA 3MQIA 3RA7H 1JGEB 1SEQL 3GZAA 5T1MA 2Z8RA 4E8CA 2WMJA 3VNZA 4UNUA 4G9DB 3MRJB 5FYLD 2AKRA 3NGBB 4PRHD 1BECA 3PWLB 4I48A 1AIFB 3HAEG 5E5UB 2H26B 3WY1A 5HHOA 1I75A 3OKMA 4LARH 1KULA 3ARUA 1CGVA 1FO0A 3ZO0A 1RJZA 1URLA 4JVPA 3VXRE 2WVVA 1B3WA 1U42A 1RUKL 3C6LB 2GTZB 4WEBH 1E4XL 3P2TA 3S5ZA 2Z92A 4HKXB 2E8YA 4X6CF 4HT1H 3U4BH 1C08A 5J3HC 3VCLB 5D6CB 3CSBA 6TAAA 1UWSA 1R3KB 3D18A 3C5ZA 4D0DB 3GHEH 2ATKB 1KLFA 3DSFL 3WIFB 4EOWH 3PHSA 4CW1B 7CGTA 1LL4A 2OL3A 2DBLL 5HYEA 1NFDF 3C6LD 4WEMB 3F65A 1FCCA 4Q9CA 1FGVH 2FGZA 5DC9B 1JZ7A 5DT1L 3BEVA 5MENE 4J1UB 4ODBD 4NN6B 1BFSA 1SYVA 1XCQB 3MREB 2DH2A 1G6VK 1KYOJ 1GHRA 4YZFE 4I0PC 4P5TC 4PD4J 4OGYH 1YEKL 1K9TA 4HMCA 3F7YB 5A94A 2R9HC 1RUPH 1AD0B 3UYOD 5IFJA 4EZMA 1MHCB 3OAYK 1OM0A 2WINB 3BWAA 1DTUA 4ATWA 3KEHA 2ZE0A 1LEGA 2A6JB 1V3JA 5ABHA 4MDJA 2DMCA 5KOVC 1T4KB 1YN7B 1OAZL 2IWGA 5SX4H 5FEBA 2VX6A 1M53A 1QVOA 3BPOC 5K59E 1OSZA 1FGNH 3GBLA 4MSWA 2CH8A 3WIHH 1OY3B 1N4XH 3HMWH 3E6FA 1DWJM 4PRDA 4ONFH 1YQ2A 1JWUA 1H15B 3T0EE 3FN3A 3I6GA 3PJSB 4QRPE 1LNUA 5IWLA 2XWTA 3ARQA 2OWXA 1F8TL 2EIDA 3U9UB 3U9PL 4KV5F 4MWFB 1E4WL 1IQWL 4WU7B 5FGSA 3UJJL 2XN0A 3PZUA 2ZCLL 4YBQC 2B5IC 3G5XB 4BFBD 2OMBA 5FCUH 5JW3H 2DN7A 3W0WB 3RWEA 4UT9H 1CCZA 4RE3A 2VWEE 2FECI 1EVUA 2WSPA 4DKEL 2CHNA 3L3DB 2IFFL 3S96B 4JQXA 5EIIA 4TRPH 3L1OL 2HFGL 2X4QB 4PJBF 4TOYH 1GHFH 4JDVA 4X0KB 1CD1A 3FT3A 1C5BH 3TH2T 3REWA 1F3DJ 1J5OL 3BO8B 2UWFA 3RP1A 4EUPA 5HYSG 2Y7QA 2BHYA 4G8EA 3F4VA 3GMMB 4G42B 5L2JA 1BBJA 4AENA 3W0WD 4AC1X 3NCCB 4X7DC 4IMKA 3S6CA 5CAYB 1BWWA 4XB3A 3BQUC 5DJZB 4QF1A 4IPLA 5EFFA 3ZJ8A 3PZGA 1L0YA 1DQDH 2E9BA 1LQSR 5JXED 3X3FH 1LWJA 2FJFB 3L95B 1J88A 4YXHL 5MEOB 5BV7C 2GDVA 4K9EH 3C08L 1RPQA 3FAXA 4P2CG 3O2VL 4L1HA 5SWZA 3WSUA 4LNRA 2VQ1B 3L3KA 3MBXL 2BMKA 5D4QA 4UILH 1U6AH 1DQQB 1NMBL 2AJSL 4YXKL 4L4VB 4XNYL 1P69B 3O3BA 5F6HI 3VSTA 3GSWB 5KW9L 3BVTA 1KN2L 5SX5K 2NLJA 1T2JA 1TPXB 3DRQA 3U7YL 1EGJA 5DK0A 5TQ0H 3ZHDA 1ZA6B 4G7YH 3BAEH 5BO1H 2LU4A 2B2XL 3VI3F 1AVAA 3L5HA 4JQIL 1IGIH 3P4OA 3QHZH 2AK4B 4TSCH 5I74B 3JUGA 4Z7NE 3DDFA 3BPLB 2XRAL 1CIUA 4IDLA 3EAKA 1RHHA 2G5BB 3WN5B 1H3UA 4NOBA 4PY7A 5IVXF 4ZTOL 3N50A 1B0RB 3PL6C 4GBXC 3C9NB 2CGRL 3S3SA 4C58B 1TENA 5CS7A 4YPJA 3KPMB 5BS0E 2VDLL 3QP3A 3LMJH 4F7CB 4J2XA 5IR1B 4E0RA 1MVFA 2VKXA 3DUSA 3PGFH 4GW1B 5A6SA 4OOZA 3L9RB 2RGSA 1LP9B 4HPOH 3VXME 4LKCA 4LLQB 4G8IA 4XP5H 4KUZH 3QUMB 4PJHA 4U1LA 5C08B 4H7VA 3WMCA 5F72S 1Y7VA 1UCTA 2AK4D 2V5DA 1X5HA 2XXCB 1OAYH 2PWFA 3T65B 3DUHA 3I75B 2I60L 4CVZB 1HXYA 3HS0A 3MRPB 3BP5A 4JPVH 1E4IA 4Y5XB 4TQEL 2X9XA 4J23A 1II4E 3FO0L 3U7BA 2CMRH 2GITB 4NJAL 1QX1A 5DSCA 2P8PB 3MROA 3CTTA 3NH7H 1UVQB 2VDML 4XAKE 3AOFA 2WHJA 1CZ8L 2EC9T 3HNVL 3QXVA 2F19L 3WEMA 1E56A 1MLCB 5IBUB 5A6MA 1W1VA 2E0PA 1ITCA 1S9YB 4QY8A 5C08D 3ULUD 5D2LB 2HTKD 5DFVC 1Y0LB 4NNYA 1CI5A 3BHBA 2Z1KA 3WF0A 5EBWB 3SDXB 1QR1A 2APXA 5FDWA 3TFKD 4PY8I 1W1PA 5FYLE 1N0LA 2BOCB 3VXTA 4OI7A 4PRHE 3MNWB 4NBZB 4MD5A 5DZOA 2BSSA 3V9FA 3WBAA 3A6CH 5F7MC 1DN0A 5FYKD 1FYTA 3KJ6H 5GJTH 3HE6A 4NBXB 3VILA 3AICA 4G6AD 1IILE 4MVBD 1DHKA 4U0RB 1GQIA 1MREH 3U1SL 2AJ3B 3E8UL 5IHLB 1NGZA 1RZGA 3HZMA 4JO4L 5D93C 2CO7B 2QPSA 4HDIB 3O8XB 3VG0L 1NANI 1NMAH 4WV1A 4OQTL 4E41B 3DX7A 4HX1B 4U6VH 4AWEA 5D93B 1NAML 5A8PA 1CXFA 1MJ8L 2H2SC 3WKML 3MJ7A 3GUTA 2JEPA 5DO2C 5D9OA 2VMFA 1NKOA 3G5ZB 2EEBA 4Z8FL 5IOPB 2OTUB 2QQKH 3RAJL 1PS3A 4PMNA 5BW7C 4RGMB 1I9JL 5I1KH 2YS4A 4PGCA 3VFOA 3MNZA 1A6TA 4HUMB 3SCTA 2G3MA 5D96B 2EYTA 2NY5L 5F6IC 4YDVB 4DGIH 1QVBA 5J6HA 2XWEA 4CN6A 2ADGA 3GSOB 2EIZB 5E4EC 5HD8C 3LOWA 2QLYA 3H42H 2YUVA 4PJ9C 4L8SA 3VGBA 3CDCA 1UM4L 2ZUSA 3HC3L 5DRXB 2XM1A 4IDJH 4XNZC 1PKQA 2FHBA 1MRCH 2QEJA 4F7EA 1PLGH 4HUUB 4AZ6A 4EIZC 3LZFH 4OZ4A 5GRWA 3E0GA 3AXLB 4YDJA 1B4RA 3EGSB 1RAMA 4ODWB 2G3IA 4D8PA 2WIIB 4XNZB 5I8CA 3ARYA 2YL9A 1S3KL 2HFFB 3MOQA 3WQVA 2DIAA 1G6RL 1F4YH 3CMJA 1NFIB 4G5ZL 4W85A 3R0NA 3QPQD 1E28B 43C9A 4Y4HA 3AS0A 1VRXA 3GIVA 3QXDB 4TNWK 2WWKT 5DQJA 5FUCE 5DMYA 3ELAT 3EYUL 2Y07H 1A3LH 1XYFA 2PETA 2QHRH 3EYSH 3VFSB 3IDIB 1I7UB 4P57B 1YEJL 4OGYL 4MQXD 3THMH 2WBJD 2GJ6A 2NXZB 2F8QA 2WHMA 4GRWF 2GVYA 4FNLH 2WPGA 1OP3K 3QISA 3GH5A 3CZSA 2VXVH 4OIAA 1T1ZA 3MV8A 2C3VA 4MHHI 4Y2DC 3DV4A 5JIKA 4Q6YA 4MAZA 1D2KA 2IUZA 4D0CA 1ZWIA 3HA0A 4KMQA 3O6LH 3DOSA 3SDDB 4GRWH 1Z32X 5A2BA 3C2AH 4XZUA 4B3LA 2NY7L 4ONFL 4LMQE 3QNXA 4PJAB 1FA2A 4JREC 3W0WE 1W2PA 4X8JB 1HJVA 2NXZD 5F96L 3BPNC 2XG5A 2D0FA 4O5LH 4JHWH 2QF8A 4CADA 4JREB 2GEEA 4UTBH 5F3HB 5FCUL 5JW3L 2J78A 1JP5A 4YBHA 5K9JL 3HRZA 1A7OH 4A6YA 2PWHA 2DT3A 4O4YH 3K80A 5B21A 4J8RA 4FFVD 2A6DB 4XPAL 1P7QA 2YRPA 4KDTC 1JGLH 3SCMA 3MGAA 3SDDD 5CGTA 2YUWA 1S7QA 1U41A 2BDNL 3G6DL 2AXFB 3GSVB 1HXMB 2FECL 2YA1A 1OD0A 2A6IA 1UUQA 3JV4A 2N4IA 4Z78A 1D5XB 5A2KH 3O2DL 4H26B 1K6QL 4GOSA 4J3XA 4QRUA 5A2FA 2Y5EA 3L3HB 1A6AB 1FNFA 3OLDA 3UETA 3N85L 2ORBH 1P7QD 1IC4L 4L3EA 3SCMD 1A3QA 5FKPA 1S7VB 1QNRA 5IHUH 5SWZE 2OX5A 3D50A 3HJEA 5JOEA 2F54A 1DZBA 1DQDL 2F8VA 5KVGL 5CP7B 4YNYA 5I79A 5GRXG 2J47A 2GFTA 3ZM8A 2W38A 4GKZA 2V5CA 2XSBA 2A9ML 4DO4A 1EOMA 1I8LC 3LKOA 4DN4H 1HQ4A 1BYBA 3BAJA 2MNUA 4XX1E 4RMSA 3O81A 3WXWH 4MZ3A 5F88B 2DJ4A 4UILL 2ZG3A 3LRMA 1G01A 1U6AL 1R3LB 3EFFA 1PDKA 2HRLA 4NRRA 4UZGA 4BQ9A 1L4IA 3LV3A 3IVKB 3JWOL 4Z7UF 5A2LH 2O61A 4DKDC 3DHJA 4QHNB 1FFOA 4OZHF 4ZFZB 5HDQH 1CT8A 2AK4E 5TQ0L 5EIQA 4N8PA 4G7YL 4J4PD 5J11C 5BO1L 4XXDB 4MD0A 4PTTB 5E1QA 4P3DA 4BQ8A 1M6OB 4DWSA 3BP7B 3VGEA 1QBMH 1W8OA 3T09A 1HOCA 3N9KA 3PNWA 1A6PA 5ESVB 3AIWA 3OIHA 4H1LH 4JO2L 4M48H 2AEQH 4X7SL 1FSKC 2AJUH 2HAZA 2BJMH 3LS4L 5DA0B 3ULUE 2X70B 1OBAA 5CUSL 4EVNA 5HI4C 3PGFL 3RI5F 3VMNA 3GMNA 3JV5A 2X4PA 4FQ1H 4W70A 3RRQA 4EDXB 2D73A 2YIHA 1SYTA 1KXVA 5TD4A 4XP5L 4BSWB 2D0HA 1XZ0A 4NT6A 1WZLA 3RMEA 4UR9A 1MQQA 3WJLA 1A1NB 3KVQA 4JM2A 3KPSA 2E27L 5FYKE 1OAYL 2VT0A 4WI9A 5IHSA 5DYOB 1AY1L 2DIBA 2QSCL 1B3JA 1ZT4B 1DQLH 1EXUA 4XP6H 2F58H 1L0XA 1YNKL 4KAQH 2IPTH 4DO5A 1MWAL 3QRGL 1EHAA 5JORA 3HN3A 3D39A 3UAJC 3KYKL 5DD6B 3NH7L 3RWCA 4RWYL 3P0YL 3GMLA 4LRNL 5ABFA 4C4KT 3SDXE 1G7HB 3F12B 2C4FU 2J6EH 2Y9RT 5I23A 1YEEL 3U36A 3KPSD 4OUUA 4XPFL 1BQCA 1Q6CA 3PP4H 3QWQB 3B6SA 3CJJA 1JV5B 5FYJL 4D9RD 1TVBA 4FNPA 3T0DA 4P4KA 3CXHJ 5KTEL 2YD5A 1ROWA 3TNMB 2VUYA 1M7IB 2G75B 3H3PH 5AUMB 3VFMB 3AJ7A 4AEFA 1L7IH 2HWZL 2BFVH 1CD9B 3MOBH 1NGYA 4DOHB 1TJGL 1TMQA 4JY5L 3O9WA 1RUQH 4U2YA 1NC2A 4WTZA 5EWIH 5I76B 5FO7A 4ESKA 2EDLA 1WAAA 3QIBC 4P2OC 3T2OA 1MI5A 2A9NH 3ISWA 5DRWA 1AR2A 5ANMB 3UPRB 1F97A 2C9AA 4G43A 4P4KD 1HH9B 3LAFA 4DCQA 2FATH 4OF6A 1HVQA 3QIBB 3MLRH 3E2HC 3QWOA 4XPHL 3UTTA 2XVNA 4GZIA 2IQAB 4H0IA 3ZIZA 3L4UA 3O9WD 3KNBA 4ZFGH 3H8NA 3QGVA 2CIIA 3H3KA 2AEWA 1HJQA 4PJCB 2SEBB 5EFDA 2JF7A 5ICZA 1G0DA 4RRPA 4IOSD 4RBPK 3K4DA 3B8SA 1AH1A 2Y8KA 3C60A 5I66A 3ULVF 1KCVH 5EORH 3WXVL 3VFPA 4UNVA 4UU9B 1YJDL 4UV7H 4DGIL 3SQBA 1HZHH 2VCBA 2XYCA 4M3JA 3FB5A 3H9SA 4GW4A 5TPWL 3GMPA 4PTUB 2R1WB 2RFXB 2VDRH 2X4OB 7TAAA 4OCWL 5F71A 4FABH 2MANA 3ULVH 4KKAC 1YECL 4PJEB 5IB4A 5BRZB 2DMBA 2PW1B 3A6BH 2HT2D 2IPUG 5HPMB 2FDMA 1PZ2A 1FZKA 2W60A 4LLAA 1GZQB 4BYHA 4WI8A 4A3YA 3RGVC 2NY4C 4KFZC 4YH6A 1Q6GA 1NAMB 2IAMC 3S5LA 1KBBA 3O6FB 3F7QA 2CBJA 3RGVB 3V5HA 3SCRA 3PGDB 3SY0A 1OTTD 4NP4H 5TE4H 1WCQA 3SUTA 1HHIB 1BLNB 3P30H 2J75A 5HDBF 1CFNA 3GJFH 1CFQA 5KSAC 5IBUG 1TFHA 4QHLB 3LQAL 3RZCC 2D31B 1I8MA 3PDOB 1EX0A 1LDSA 3KE0A 1G7IB 4N68A 3RX8A 5GNYA 1L9MA 1UM5H 2Y07L 2YK1L 3WFEH 2R69H 3EOYG 2XGIA 1DWHM 1KPUA 2AERT 3W2DL 2JB5L 3TIDB 5EUKA 2ENYA 5I1IH 5BOZG 1WO2A 3TYFB 1V03A 5D8JL 3WQ6A 5AG9A 2IC2A 3O6FD 2VAJA 4YUEL 4FNLL 1C1EH 5J1TC 1YPZA 4ZFFB 3OZPA 5JHLL 2BNRB 1U8PA 3BVWA 3KLSA 3EOBA 3U5UA 3RWJA 2X4UA 3OA5A 4PJAE 4NPYB 1GGTA 5D7IF 2DQTH 1GSMA 1CDHA 4D9LH 3AROA 4ZYKB 3WFZA 5BJTA 3NBNA 4JN1L 5DLMH 4F9PC 3O6LL 4IOIA 4N0RA 3C2AL 4L8DA 4MNMA 5L7XH 4MB3A 1I3GL 2EXYC 4X6CB 4DVBA 2X4TB 5EOTA 4OZFH 5F70A 3EYPA 5C0JA 4PMUA 3DV6A 3EYVA 3WO3B 2V3GA 4LRIA 4O5LL 3HU7A 4JJHA 1FZOA 2DQIH 5A3IC 2GW5A 3QJHB 3IT8D 1KGCD 3WFBH 3KLAA 4Z0BH 3UO1L 5IBTH 4XBPB 1NFDB 1W2KT 5EO9A 2MHAB 1JGLL 1IEAA 3W0KA 2EDFA 2P8LB 4LFHG 4NCDA 1AKJB 4G6ML 3G6JA 4L3EE 4RNRA 5I71B 4A3HA 5AYUH 1VEOA 5FFLA 1KTLB 4NJ9H 2ZNWA 1S9WA 4K7PH 2HVKA 1HJUA 5AZ2L 2FIKA 4PS4L 5I1JL 3WS3A 1G84A 3U0WH 5A6JA 1A4KA 2FR4B 1PX4A 4JHBA 1U36A 4XV0A 3CUHA 1G7QB 5ACLA 2BXZA 1ZHBB 5IP4A 2Z9TA 3MX0A 4PUDA 3B9KA 4QKXB 5IHUL 3UJTH 3QFJA 3HUJF 4TN9A 4TVSa 5F7KC 3CU7A 3CUPB 4ACPA 1X44A 3EFDH 1INDL 1IM9A 3FFDB 1EEZB 1IC7H 4ZDHB 1P4BH 2ESVA 3LDBC 4Z7WF 1NFKA 2XJ7A 2WMKA 4PRIA 2QR0B 4L4TB 5I1LB 1RJYA 3MA7B 4U3XA 2OM5A 3B9VA 4N0YH 5JIWA 1MUJA 2VX5A 2F15A 3BZEA 1T1YB 2WMHA 2XZQL 4DZBA 5JNYB 3EHBC 1KJMB 4KK6C 2AEPH 3UBXA 1X7QA 1BQHA 5HY9B 1F6AA 1DE4B 4M61A 5T33H 1TA3B 2BS9A 5HDQL 2GJJA 4ONHB 1RZ8B 2VDPL 3V0VA 2O5XH 4N5ED 5GS1B 5JIHA 3CGTA 3O3EA 1XCTB 4Y16A 2LVCA 3BVNA 4LAQH 4PJBB 2WZEA 4L4TD 5F7WC 1QBML 1XH1A 3RTQA 3BH8A 1C7TA 4K9EC 3QQ3B 2EDOA 2WWCA 2W1NA 3KYNA 1NCNA 4KI5F 1VERA 2X89D 5TF0A 2AJUL 4XX6A 2GY5A 2R4SH 4P23A 3KPSE 3ESVF 1UADC 3ARRA 4OD3L 3TH3T 4D9RE 2L7JA 4KJQC 4JAWA 2VXQH 3V0AC 2YBTA 1I3UA 3O3AA 3MYJA 3BW9A 4LAJH 1R3JB 4CMMA 3RTQD 1NGWA 3W24A 1PPIA 3A4WA 5JR1H 5HGHB 3EJUA 5DWUL 3V6BR 2AAAA 4HOZA 4TTDD 3WFDL 1EDTA 2V7NB 1AHWC 1QNPA 1UWGL 3T2NH 4AH2B 1DQLL 4F7MA 4P23D 4XP6L 2F58L 5F8QC 4X80L 4NSKA 3SURA 4HS8L 3ES6B 4KAQL 4YBLB 3HZ3A 4K71B 4UB0H 1MJJB 1CN4A 2DSZA 2GUOA 2JB6A 4UQ3A 2IG2L 1GGCL 4BQ3A 3ARBB 5ADPH 2A1WH 1H0IA 1UQSA 1DUZA 3IU3B 3UX9B 5IESH 1FV1B 4M1GH 4DOHE 1RZJL 3DMMA 3KL3A 3SDAB 3VXQA 3CFJA 5IW1B 2FGWH 1K4CB 3IDJB 5F9OL 3FQUA 3ZTJG 2R2EA 3RL1A 3FZUC 1WT5C 3C8DA 3VUPA 3G5YA 4HWBH 3MOBL 1BFVL 5ANME 2IBBA 3T0BA 3BSZH 3NVQA 2V5TA 1JXJA 5IVXB 4WUUB 4JRYA 5C0DA 5DEFA 1QHZA 5HHNB 3DX8A 3CLEL 3U30C 5I8EB 2OWWA 4ETQB 4F7TB 1B0GB 3EJTA 3ARBD 2J4GA 3MRQA 1YEGL 2G9HA 1UG6A 2FATL 3QEHA 3NCOA 1JNNH 1NJ9B 1G7MB 3MLRL 3UP1A 3SDAD 1G7LB 1MWAB 1WBYB 5EBGA 5KJRL 3MYZA 3BZDA 5JDJA 3NTCH 3QJFA 1NBZB 2NMSA 1FH5L 4RAVA 4M7KL 1QYGH 3IETA 4E2OA 1HILB 2Y6SC 3LKSB 3CK0L 1GH7A 4XXCA 2HT4D 2WWMD 3L3GB 5F7DB 5KVMC 3H9SE 3KZSA 2DAVA 2EO7A 2LTQB 2VB5A 5DJ6B 5E99H 2H8PB 3MR9A 4Z9KB 4UBDD 3P4LA 1KB9K 3D9AH 5IROA 2BVQB 5DQ9B 1ZVSB 1BOGB 3SDCC 1OPGH 5LJYH 2X5PA 2Z4QB 3ILQD 2VZOA 2X4RB 4W8AA 4UTAH 2QKIB 3GKWL 3KLKA 2FLBT 5FECA 2VDRL 4OV6F 1ITBB 3U7WH 1H0DA 3ULVL 4CKVX 3A6BL 3S4SA 4NRXA 4P59L 1T1WB 3RNKA 2EECA 4MNQA 2NY1C 5FYJD 3CPLB 1TCMA 5MEQA 4ODUB 1HX0A 1R7OA 5IW6B 4Z7OF 1KQYA 4JZ5A 3LH2H 1UH3A 4PG2C 5L8JB 3WFLA 2VXSH 2EDEA 3BKCH 4HIJB 3VA6A 1ECEA 5CLTA 5MERB 2ZICA 3P30L 4JY4B 4M7ZC 3V4PH 3VH8B 3L5XH 5HYFA 3ARFB 3BMWA 5FM4A 2WP3O 1CBGA 4H41A 1UM5L 4K55A 3ZDYF 2BNJA 3WFEL 1BQLL 2DLFL 1MCWM 5CGMA 3CHCA 2MWCA 1H5BA 4AK1A 1VIWA 5C0RH 1HHKA 5AWNL 2WZIA 2J8GA 3N04A 2IMNA 5KG9B 5AC4A 1D6EB 1KGCE 4TVCA 3EOTH 5LA2A 3CIVA 1EO8H 3OJ2C 3OHXB 1W3KA 3FRUA 1TR1A 4MAYA 3S37H 3QRFM 1VFBB 4RA0C 4LSUH 2J7CA 2YL6A 3ARFD 3JTSA 1T0MA 1JTOA 5KVFL 3PWJA 3GIZL 2CPCA 4L8CB 1G7PA 1Z0NA 3H7LA 1YNTA 1JMXA 1OGSA 3QDHA 2DI9A 3IF1B 2MOVA 3W9EB 1PQZA 3VTRA 1EHNA 1X5GA 4K7FA 1DJSA 2YD4A 3WUEA 5I3DA 4OJFL 3FTGA 2C7UA 2J7LA 3ALGA 4MAYD 4DN3H 1O7SA 4GW5B 4FQQB 1NFDE 3IDXL 1MRDH 4QNPE 4ZD3H 2ED9A 3WF1A 4P5MA 4YAQB 2F5BL 1F6FB 4F3FB 2P5EB 1JJUA 4Z0BL 5IBTL 3PIQB 5IT2L 3D0LA 2J79A 4YC2C 2YDSA 4YDKH 2Q1EA 1GPFA 3GSXB 4U31A 4WI2A 4CJ1A 3CHEA 4NQCA 4ZAKA 3UMTA 5CPQA 4AMKH 3VWKA 2QMKA 5JIPA 2IGFH 3TCLA 3PHOA 3BH9B 1TZIA 2OR8A 3FQNB 4G6KH 3LXBA 1VFUA 1G9NH 2A74B 3EDDA 4GRWB 4RFEA 2CDEA 3HNSH 2P5ED 4OGAC 5EULV 5ITBL 3F62A 5L0QB 4UIKH 5JHDB 3CC5A 1LO4L 4P4RA 1KUMA 3MLZL 3PN8A 4L4TE 4ZAKD 3EFDL 4V2CB 5I8OH 1BYCA 4AY1A 1NL0H 1P4BL 3ARDA 2XTJC 1HWWA 1R3HA 4NSBA 1UB5A 5HHPB 3S8WA 3Q3GB 3MUGA 5IEKB 3WY2A 3ZSSA 3NN8B 4FQIH 4N0YL 1XF4B 2XTJB 2IBGA 3V5KB 1DBAL 3FY1A 3OKOA 2DLIA 1QNZL 4NO2B 2EADA 1FL3A 3ARXA 3MRJA 1TMCB 1AO7B 3KYAA 3IDNB 4UFMA 4HV8B 3BKYH 4PJBE 4PTVA 4NNXB 1UEYA 3FQTB 1H3TA 4YHKH 2ZNXA 3QCUL 5I1AA 5E4IA 4L3AA 2BVOB 4U3HA 4JO3L 3HLAA 5F93C 3A22A 1MFCH 1H49A 3BP6B 4QCIA 4PJ7A 5C0NC 2OTWA 5EC2B 1M01A 1MPAL 4J3SA 4XMLL 4GI9A 4KHTH 1NCCH 1OP5K 3RNQA 2VXTL 1W9DM 3TEUA 1TTGA 5JBFA 5EOCJ 1IGML 2OSWA 1QW9A 4ONOA 4HG4K 4CW1A 1ADQL 3TA3B 3OJVC 2J8FA 2R56H 4I4WB 5TF1L 4JFQB 3GTNA 1F4XL 1UASA 1OW0C 3WNNA 2NYYD 1A3RH 1FNSH 1QPKA 3PHQB 3WD5H 4AG4L 4PV9B 1RJLB 4LLYB 5JR1L 3RM4A 2DQGH 5HYQA 1RK0B 3BMVA 4LGSB 1FH8A 3I50H 3MREA 2P43B 4BZ1H 2E4TA 4HCRA 3IKCA 8CGTA 5HVWA 2J8UB 5CXPA 3VFUB 4L8BA 4NGHH 3H7BA 2YD6A 3T1FA 3SQOL 3TN0B 5ACMA 1KPRA 3MRRA 1UKSA 2WMPA 1V0KA 3VXSD 3TP4A 4QRSB 4I0PA 4P5TA 1KCRH 2DQFA 1GONA 3TBVB 3SEPA 4KDWA 1Q72H 3C8KB 4Z7UB 2APVA 4UFIA 1AXIB 4OZHB 5D9SB 4NQVA 4O2FB 1GL4B 5FA3A 2YXFA 3EMZA 2D3LA 1W91A 4Y4KB 4IS6B 5MP6L 4JRYE 4PLJC 3QXAA 5IESL 1Q9KB 4Q6IC 2YPLA 1EUTA 5IVXE 2XTLA 1VEPA 1BVZA 1DBBH 3OAZH 4Z2JA 1FC2D 3K2MC 25C8L 3IB4A 4GQQA 3TN0D 4IISA 5BXRA 3BSZL 4Q6IB 4CDGC 2UY5A 5D71H 3AIRA 1IGTA 4OFYD 3DX0A 3D0VB 3OXRB 1T5WB 2AGJL 1X5AA 1KF9B 3RI5K 3CSYB 1WV7T 5T1DL 5F7FA 4KTEL 2YD3A 1QSEA 4OF7A 5AG8A 5BVPH 5A43C 4GKLA 5IB3B 3B3IB 1JNNL 1JAEA 1I9IL 1G94A 2D22A 2WVUA 3EO0B 3CVHL 5JZ7C 3G04A 4PMXA 5FYJE 5ERWA 2BY2A 3SBWC 4WHYH 3TIEB 3CZLA 3P4NA 4GT7A 1BVLB 4Q9QH 1A9BA 2B7DT 3CLFH 1DLHA 5C09B 3FN9A 4OLZL 3FQRB 4P2RB 3JSSA 4YBQD 1U92A 4S1RH 4LSQL 5IK3A 2Q76B 2EH7H 4AJ0A 1EUUA 4DGVH 3KJ4B 1D5IH 1NSNL 1C5DB 4MNQE 5CEYA 4AMCA 2ZOKB 5FKYA 5FL0A 5DDHA 4JKPL 5IFAH 4PIRF 3L95A 4JFVA 1QHPA 5I1DA 3BQUA 1BSIA 4M4PA 3O3DB 3MUAA 3LEYH 5CZXC 1XF3B 4N0UB 1HNFA 1WCBB 5AZEL 1TVPA 6A3HA 5BZWB 5C09D 4I2XA 4DTGH 3L4TA 4ISVB 5EOQH 4XCCH 4W88A 2VQ1A 4P2RD 4MA3A 1XGTB 4RMUA 3OKNA 4CMHC 1P7KA 2BVYA 1FORL 5J57B 4HEPG 1H1NA 5DJ0B 1IZJA 2NTSP 4K07A 3LH2L 4Y19B 1JCKA 3GSWA 3WIJA 1NBYB 4CMHB 1WZ1L 2BSRA 4JANB 4HUKB 3JWNC 1D9KB 4CCDA 4X9FA 2FJHB 2J7EA 1S7WA 1MCOH 4UDUB 3EYQD 1ZLWK 1ZLVK 1ES0B 1B31A 3W27A 4JLRA 2Q8AL 4HAGA 5IF0A 4G7VL 2FX7H 3GO1H 4QHKJ 5HGAA 4NXKA 1S9VB 4YPGA 4HWNA 4DJMA 2DKMA 4B16A 4N5UA 4LQ1A 1OGTB 5GGUB 5C0GB 2ZX6A 5C0RL 4Q9RH 1KC5L 4HKBB 1UXSA 2G5BA 2ZWZA 1DR9A 2X7LB 2DWDB 2FWOB 4OLWH 3EOTL 4LLDB 2AK1H 2CD0A 1B0RA 2YMXL 1J86A 3EBVA 3QQ4A 1SVCP 1LG2A 1D9KD 4WI5A 3MV7B 4FXGB 1C91A 1OB1B 2KKQA 3PL6A 4GBXA 3JWDC 1XSIA 2X2IA 4U05A 3OKKB 3RIFK 4LLQA 1LE9B 3AAZB 1HT6A 3QQ9D 2EQDA 3ARSA 2X41A 3HFML 3LB6D 1QLFA 1E6OH 4MLIA 2G5RA 2ED8A 2CUIA 2WMIB 2Q86A 2P5EE 5E8DL 5GGSY 4OIFA 3GJFB 4DN3L 4XPBH 3MRFB 3WUBA 3F7PC 2VN7A 3ULVD 3X11A 3RDTC 4NZUH 2EC9U 1FNGB 4YR6A 1Z3GL 5I0DA 2BVPA 4NM8H 1ZHNA 4YDKL 4ELMA 1EZVX 4DEPB 2R0WL 3G6AB 1S9YA 4NOFA 1UD4A 1BAFH 4HUXA 4ZE4A 4O2CA 2W0KA 4MXQD 3VRLF 3HPJA 1ZLUK 5EBWA 2BP3A 4WFHD 2HVMA 4U3AA 3MRIA 3R06B 4LOUC 2C1PB 1V0NA 5D2NC 5CHNA 3RL2A 4CN4A 4OI8A 4F37K 1U8KB 3UERA 2GT9B 2FEEI 3QUXA 2DM3A 3ZKMD 2WBGA 1FVDA 4TOQA 4LK4A 3CDYA 3GBDA 5DVKA 1CE1L 4QAWA 2FEDD 3JUYA 4U6XA 3NFPB 1KYOK 1XSJA 4PJ8C 5GRUL 1M7DB 3WCYA 2CJUL 4PD4K 1QRNB 2HT3D 3EYFA 5JPNB 2XFXB 5C0IB 4KGJA 2BC4B 2ZUQC 4I8DA 4FQCH 4OZFB 3DGGB 3MRMA 5I0ZA 2H6PB 1HSAA 2WM0A 4U1HB 1E0WA 1XFPA 1NL0L 3U4EA 4PJ8B 4LKXA 3VH8G 4D6JA 1RIVH 1WISA 4MJ5B 1SFSA 3QUXD 4K3DL 1BM3H 1H3PL 3BDYH 5L8LB 4FQXA 3WSQL 1VGKB 1MCIA 1I7TA 2VLMD 3SJVA 1ZLSH 1LO2H 3TZVC 5C0CA 1JN6A 3IJSA 1A7RH 4MA8L 1SZNA 3RKDC 4TUFA 3OKEA 5HHVH 2D7PA 5A6LA 1DQJA 1UM6H 1E4LA 3P4MB 1QRND 5KN5B 4GFTB 5FA4A 4DVRL 3BKYL 5CSUA 2NR6D 5BW7A 1BAGA 2XN9B 1CDUA 3HR5A 4NZJA 5C0AB 3WD2A 2ICWJ 2IPKB 2EDJA 4FQXD 2QMJA 5DR5L 2XA3A 2CKBH 1KCSL 3NIFE 1LEIA 5GHWL 4NO0A 4B5EA 1IKNC 1YYLH 5C0CD 5IV2A 5I1EH 1IFHL 1W0VB 5DRXA 5JA8B 2VE6B 1UEMA 1V7ML 1AXSA 4LCUA 3VXSE 4MDPA 3FB6B 1U8MB 1QI5A 2I07B 4PJ9A 1YEHL 3TJHD 1TUXA 2DT2A 3BUQA 4MJ6A 3H54A 4HH9A 4JDZB 2XN9D 2YA2A 3HMXA 4QLJA 1S7XB 4GRLB 5E2VH 1TG7A 4LDEB 3RY4A 2FJGB 1XIWB 4PJGF 1SY6H 4PJ5A 4YDLC 1UXWB 1UKPA 3MLXL 3L2MA 4HC1A 5ID1A 1NGQL 4GG6A 2J4WH 3ZSTA 1QNSA 1A9EA 2GFBB 2J8UE 4LGXA 4HKJB 4Z7WB 5AAMA 2KQNA 3FOLA 4U1NA 5CZKA 5GS2H 3HZVB 3GH4A 4QP0A 3G08A 3VPLA 4PUBH 4KXZH 5IHZB 4PJ9D 3HRPA 3I50L 3CFDA 1EEQA 4Z7UE 4KJYB 1VPOH 2X4SB 4NGHL 3VM7A 5B8CB 5KBNC 4OZHE 4IRSC 3SUSA 5CINL 5EUOF 4LEXH 1FN4B 2Y06H 3SGJC 3OJMB 3EOAA 5C0EA 5CBAA 1IAOB 4GRLD 1KCRL 4IHOB 5DK2A 1DUYB 1XIWD 3OR6B 5DO8A 2UZIL 3SGDI 3QDJA 3TPKA 4IRSB 4MHHG 3MRHB 3FXYA 4WTWA 1TCRB 5BQ7B 4K7PY 1BZ7A 1XRVA 4OTXL 2PC8A 1MQKL 1YYML 2OZ4H 4ODHH 5D9NA 4Y2DA 2R2HA 3AIVA 2BSED 4NO3B 4JG0H 2XWDA 3W25A 1NC4A 1F2QA 4IIQA 3OB8A 3PWVB 2MKLC 3BE1H 4D94A 2YN5A 4TULL 3QDJD 3P11H 2C3WA 3KDMA 5DJYA 4XBGA 4JR9L 4FXKB 5HDLA 5FKAB 3ME0A 1GAFL 3I6KB 1KG0B 1FC1A 4XAWH 4PTMA 3DVNA 3REVB 4Z7VF 4FTVB 2A6DA 3IFLH 4AM0B 1T6WA 1C12B 3UJIH 4AIEA 1U93A 5C09E 5BXFA 5DD0L 4P2RE 1JFQH 3MFFA 1XHGA 1UR8A 3BZ4B 4WCYL 5H8DA 4KDTA 1WBZB 2CSPA 3O2WH 4K2UL 8A3HA 4KI5D 3CLFL 4Z95H 2V2TB 2O92A 4ZQKB 3L3HA 4PB9H 1I1AC 3EDEA 1E6RA 2DYPB 4MQ7B 4S1QH 4U5IA 1IC1A 2O5YL 5T1LA 4JZJC 4X0NA 1GC1C 12E8L 5D1QD 4FTVD 1FNEB 1YEFH 3TT3L 5IFAL 3WF4A 5EDXA 4BK4A 4XNXH 2XVLA 1XGZA 4N8CH 3RQ3A 4Q9BA 3KYMA 4F9DA 3NPZB 4U6YB 1J0JA 3L3IA 3LEYL 3L5WA 3WEXB 3AC0A 4KH2A 4DTGL 3L5IA 2Y23A 2YWZA 5EU6B 1NWTA 5JOPD 1ZOXA 2DYPD 3OR7A 4F15C 1CDGA 1OAXL 3CVHB 1QLRA 3PV6A 4ZSOB 2CLRB 3WUWB 1W1TA 1I4FB 5H2BA 3S36L 2V5RA 1DEEB 5DJAA 1X5YA 4M62H 4YWGH 4EEEA 4GUPB 1HKFA 3DURB 3RVXD 5M03A 32C2B 4ZFZA 2BNUB 4MCYB 3EJJX 4JG1H 1AD9A 3LKNB 5IGXL 3RDKA 3WL9A 4CGTA 2WNWA 4QGYA 4TVPH 3MRGA 3V8OA 4C56B 4AY0A 1CFTA 1JI2A 1Q0XH 1AFVL 3ULVE 5EU6D 1KLUB 4Y8DC 2H45A 5LA1A 2GK0A 4PRPA 4Q9RL 1TJIL 4GKNB 3NA4A 5EBMA 1IV8A 2IH1B 3WDIA 1MCWW 2AK1L 3BDXA 3D3VA 3FOMB 1U58B 3B5TA 4IEFB 4KY1L 2X70A 1T0OA 2HJFB 5E8EA 3ZTNH 1Z9OA 2ZWLT 4O02L 3K0WA 4Y2OA 2EACA 5F1NA 1F42A 3JBG7 5SV3A 1T22B 4Z5RB 5KSUB 4KPHH 1M4KA 2P44B 2VQUA 1AGFB 4M5YH 4WFHE 3MO1B 5D6DC 5JW4N 4KZDH 4C56D 4JPIA 3K81A 4LLMA 1UFUA 3KS0J 1JD7A 1FFPB 1ZU8A 4M8QA 3UTQB 4BKLA 4I5BB 5EA0H 4F2MA 1HINL 2VLLB 3D3VD 2EKSA 3PZNA 5DD1H 2X9WA 4LPYA 1G9HA 1ETZA 1QSFB 3O11A 3MBEC 4ELME 5FCSH 4NQSB 5TFSH 4I77L 5FO8A 2A0LC 2YDQA 1HH6B 1VKXB 1MXGA 1CXLA 1A7PH 1TQTA 3ARGB 3KPOB 5DA4A 3QUZC 2I26N 5DD6A 3VXPA 4URTB 1UC6A 2HJKA 1RURL 2GQHA 1DDHA 2V7HB 2CDGA 2V3EA 1JK8A 2EAEA 1L7TH 5EC1A 1BG9A 2VLME 1WPCA 4MJIA 4HGKC 4D2NA 4M7LH 2IJ0C 2AXHA 2VRQA 4JGUA 3AS1A 2XWJA 3DVGB 1K8IA 3EYOB 3GI8H 2FX9H 2OK0L 1X5LA 4XBEL 1QSFD 4KKLC 2CIPA 1OARH 1T21B 4MA1C 3VX1A 1QRNE 1Q9OA 5A6AA 4RGOL 2J88H 2VDQL 3U0PA 3ARGD 4BH7B 2ADIA 5HI3C 5F7YC 1CG9B 4MA1B 1XGPB 4OZIA 1XGYH 5DUPH 4QCFA 2FEEL 3ZE1F 1I9EA 1NDGB 1UZ6F 2XACC 5I1HH 3CFKA 1NAKL 2RHEA 5C0CE 3AB0B 4FQCL 2IANB 1MJ7H 1BEYH 2OW7A 4P2OA 4EN3C 4LCWA 1UJ3B 4UV4H 2AABL 1RIVL 3D85A 4OF3A 1Q8MA 5ABDE 3QIUB 4NHUA 1QHOA 1PKOA 4RFNB 5I15L 4L29B 1VA9A 2Y24A 3BGAA 3Q2CA 2WC7A 1K9EA 1A7RL 3FRPG 4WVRA 2XN9E 4PJCA 1TQSA 1DEDA 3P3YA 3L4YA 3NSMA 2A2QT 1F4HA 1UM6L 3O4LA 3AI0A 1NCBL 5IVZB 5HHMB 2XQBH 1P4LA 4WW2C 1IKFL 1CDCA 1G9NC 4HA1A 1BREA 4QWWD 4U4BA 5FB8A 4N90D 1NEUA 1U95A 5FD0A 4FG6D 3GRWA 2VLRA 2Q20A 4OD1H 1ERNA 1HHGB 3D2UB 4PJDF 3UC0H 2AV1B 2NW3B 3MANA 3QIUD 3QAZC 5FHAH 2FSEA 4GAGH 1JE6A 2RFXA 5I1EL 1WEJL 2AJZB 3VIIA 3DO7B 1TQBC 2IADB 3OV6A 1X4ZA 5BRZA 2PW1A 2ZCHH 4ZUVA 4HZ8A 3S35H 1IT9H 4A4AA 2WMFA 2NW2B 1OTSC 1M05B 3H2WA 5ETUA 4GG6E 1KXQA 2OXGA 5E8PB 4QOKB 1ND0B 3RVTC 1XMWA 4HOWA 3PQYB 3ZE2F 1MFBL 1TQBB 2A77H 2W9EH 3TBSA 4Q2ZA 5GGTH 1CGYA 2KH2B 4Z7WE 1MCPL 2HLFC 2YEZB 4HPYH 5F3BB 1SY6L 2VN4A 1UZ1A 3BKJH 1OAUH 4YHZH 4M3KB 4Y1AB 2J4WL 2IAMA 5ACZB 3CFEA 1RD6A 2O9RA 3SCWA 3PDOA 1D5ZA 1HJXA 3AFLA 4PUBL 3LKQB 3SGKC 4F58H 2PI6A 5AYBA 3QDJE 5CSZB 1CWYA 1SJEA 3FONB 1Q1JH 1HKIA 4AD1A 3VWJB 5KSAA 2EJ1A 1VBRA 4Q7NA 4PYGA 3RZCA 2VAAA 4QOKD 3PQYD 3QHTC 5DHYB 1CK0H 1AQDA 3K3QA 4QRTB 4ZUSB 1KPVB 3BUPA 3VD4A 4XH2A 2BNRA 4YHMH 4QYOB 4ZTPH 3MV01 3NDZA 4X6EB 4POYA 4JFZH 4OZFG 1RZIB 2WCGA 1J05A 5I73C 4KI5E 1ISXA 2VLKB 1LHZA 2WCSA 3OKLA 4E8DA 2OZ4L 4ODHL 3JV0A 5SWQA 3VWJD 4GO8A 1YY8B 3N13A 1LWRA 3K8MA 3KPPB 5F9WC 5TDPA 5I73B 3D5OF 2F8XC 3WUZA 4OAWA 4NFBA 5I75B 4FTVE 3T3MF 5E03A 1V02A 2ZCKL 5IMOA 5IEHB 4PTXA 1RUML 1U8JB 2YWYA 3OB0H 3MUZ1 4Z2LA 2B8OT 1NMCB 5KZ6A 5CFHA 1UR1A 1WK0A 2XPGA 4PP1D 2GAZA 3S5YA 2IQ9H 4I1NB 1R24B 1MFDH 3CXDL 4NRZB 5JMRA 2YUXA 4P0DA 4R4FH 1T7YA 3QUYA 1MW2A 5EN2B 4PRNA 2DM4A 1HXJA 4HFUL 5DMIH 5JOPE 4K3JH 1KTLA 4M5ZL 5DGQA 2A3BA 4UQDA 4Q58C 3DXAB 3BN9C 2D03L 5B38A 1J9YA 3C09C 3X12A 4AT6B 4X6FA 3DETD 2H32A 1ACZA 2WMGA 4H04A 5T3XH 3DX6B 4YZFF 3TO2B 4NWTH 4APQB 2AV7B 4WO4B 3LPGA 1ISWA 1PVHA 1QW8A 2CRMA 3QUYD 3TF7C 3LPOA 2VLJD 5F9JB 2DT0A 2HFTA 1EEZA 1TFVA 2QADC 1N5YH 5EU6E 4Z2IA 1A6UH 1U8NB 4XNQA 3P77B 1T0PB 1YEIH 2NY2D 4NQEB 4ZSOE 5CJQL 5K59F 1B2WL 4HULB 1BIHA 3DXAD 2R0KL 1KENH 1N5AB 2ATPB 3O6KH 3VFGL 3MODH 4BH8B 3DRTA 3CXHK 4KROB 5I1CL 3T4AB 4APQD 3LRSB 3PZIA 4D1IA 5CGYD 4R96B 4WO4D 3AS2A 4LBEA 1UZ8A 3E3QE 1EGZA 1V0MA 4C56E 1Y18B 3EJZC 4PRPE 3RWFA 1UCBL 2B1HL 2EZ0D 1KBGH 3M1BB 4A2MA 3MV9D 4F8TA 4JG1L 3A23A 1BJ1H 1UACH 4R2GD 1T2QH 3D3VE 4YIQB 3EDFA 3MJ9H 3DX3A 1ZEAH 4NQED 1Q94B 2ICES 4YX2H 3A3HA 5LGHL 5IKCA 3TO4B 4UT6L 3W11D 5J9PA 5J0BA 2FX8H 1KTCA 3AIQA 1F90H 1S7TB 4KROD 1H3VA 2O5ZH 2ITCB 3THDA 3WUGA 3IGAA 2VC2H 4JKMA 2DD8H 1ORSB 2BFGA 5FHBL 3GXFA 1YMHA 4XNUL 5EZJA 5I1GH 2FYYB 3KYOA 2B0SH 43CAB 4UQBA 3GGWB 3ZTNL 1OSPL 5D7SH 3SKNA 2P24A 3M17B 4XC3H 4KUCF 4D6IA 4P49A 1K5NA 1V3MA 5E0CA 5DQDH 1QSFE 1WGOA 4R90H 1W0YT 1XGQA 1M04A 2WUCH 3X14A 1MHPL 2YA0A 3TO4D 3WFHB 1Q9WB 1I8IB 1JD9A 1GGBL 2EXOA 2VQTA 2BOBB 3KPRD 3DC0A 1X4YA 4XMPH 2VUOA 2NNAA 3MLTB 1G7JB 3KWWB 3SOBL 2N56A 3WMSA 4MJIE 1M7XA 1V05A 3U6RA 1QSZA 2XZAL 2FB4L 1KJVA 3BXWA 1AHWA 5TH2B 2ZJSH 4P9HC 4HUVA 4X5WB 1Q6FA 4I9WD 3RM8A 4OF0A 2EO9A 2JJVA 3L7EA 4P5KB 3TBYA 2D24A 3ZDYE 5L88L 2Z35B 4PGDA 4UDTA 1OP9A 1L7TL 5F7EL 2R1YA 4M7LL 4J3VA 5CEXB 3GI8L 1A1MB 3OKDA 1JTPA 2O9TA 3TPUA 5A6BA 2CK2A 2ZKHH 1GPOH 1ZT1A 5JW4Q 1D5BA 2X2HA 5IFHH 2Z91B 1TETL 3PABA 4HWEH 2ADFH 2CR6A 5EO1B 3QNYB 2PWEA 1DCLA 1KFWA 4EANA 1CLYH 4N90E 4WUUA 4XI5C 1WT5A 1AC6A 4LL9A 1FIGL 5SV4A 1EAPA 4I3RL 3WUWG 1LE5B 3L3OB 4ZXBA 2MSPA 2X40A 2BVDA 4EBQH 1FHDA 3LPFA 3T3PE 5CMAB 1BEYL 2Z31B 2VVSA 3QFDB 1AJ7L 1GQJA 4NRSA 3O4LE 2D9QB 3STZB 5D7JD 1B3YA 1FL5A 1V08A 1NCAL 2Q3ZA 5DEGA 1JNDA 4YFLF 4J3WA 3W9DB 2PW2A 5ESAA 2VL4A 3MACH 15C8H 2GSGB 2VERN 4NNPL 4X99B 3FB8B 4MNGE 4YFLI 4MJ2A 4ZXBD 4ZODA 2WKGA 2H8PA 1LO3L 2APBA 1E27A 4G6FB 2B4CH 2FL5B 1T03L 4FHBD 3C5SB 5GSRB 3ORJA 3BVVA 3STLA 2EYRA 3MNVB 5C07A 1HHHB 1UWXK 1V8HA 2ZUWA 5FGRA 2E9MA 2Z31D 3HC4H 4ACZA 1E70M 2XWBA 5K9QI 4KMTL 4OD1L 5JBEA 5JQ6H 2QKIA 5DJ2B 2HLAB 2ZSVB 3LRLA 3QHFH 1OAQL 2ARJB 5DJCB 3KL5A 3PQYE 2W65B 1AGDB 3AVEA 3SDCA 3TVMB 2RBLA 5IQ9A 4J6RH 1K3IA 2UWEA 1LEKA 1JPSL 2BRRH 1ZJBA 2ZCHL 1T5XB 1T1WA 3NFNA 4G80B 3SE8L 1U91A 1TQCC 3U82B 1B1YA 5CKGA 5DRNB 1ZANH 4ZFOB 5C07D 3V52H 1RVFH 3T2PA 4N0CC 3TLRA 1BD2B 5ELIA 2AOSA 2J7FA 2WQRA 4M03A 1PG7H 1UWTA 2I5YL 3E1F1 4H0GA 1TQCB 2PTTA 1XF2B 4OLXH 2BNQB 4UUJA 4ZNEA 4W6WB 4HIJA 4R9HA 3D4YA 1INEH 4KVCH 3BKJL 1OAUL 1S7RA 2EIBA 3D69A 5EO0A 4YHZL 2KL6A 3MRCA 5TDNB 1E3ZA 1E4NA 1BVKB 5INCB 2HP4A 4WJ5B 1E1FA 3KR3H 3QA3A 2NZ9D 3TVMD 4PG2A 5F1IB 4LLWA 1Z9SA 1C5CH 5FYLH 4F58L 1ZHKA 5I18L 2QTEA 1BYAA 1EO5A 4OF8A 4N42A 3SCPA 2GCYA 5JBDA 4LIQL 3VE0A 5BZDA 2DQDH 1N8ZA 3DROB 4JFDB 1TQVA 1LD9A 1NBQA 3NABL 2JK5B 3FO9B 4NKIL 3GMRB 4LPUA 3L3JA 1BD2D 4JFPB 3DDGA 1T0NA 4R4NC 2GSIA 3ZHLA 5T5NF 1W72L 3DHUA 1CQYA 2Q8XA 1HJSA 4YHML 3QSKB 2AXGB 5CD5C 4XCNA 5EFIB 1CFBA 5E8NB 1FPTH 2BX5A 2IH3A 1IGYA 3EO1B 4M7LT 3HZKB 4P8WA 4N8VB 2X09A 3G6LA 1A22B 1SYSA 1VFAA 1FO0H 3KLHC 2W61A 3MLWH 5T1KA 4F80A 4X6DE 3HZYB 4JFDD 1IC5L 3ZKND 4U6TA 3ZO9A 3H9HA 1MWOA 4ML4A 1RY7B 1U3JA 2VLJE 1F2XK 3RVUD 4YDIL 4KK5D 3AY4C 2PYFB 2P42B 4KVNL 3Q5OA 1CE6A 4PJGB 2V2WB 1HQRA 3DXAE 1IBGL 1YEDB 1KELL 1MFDL 3LEXB 5T1KD 3IJHA 2VIRA 4FQLH 1I85C 4TYUA 4RL3A 1U8OB 4HGWB 5IIEB 1OQOA 3LRKA 3Q6FA 4MNHA 1JYWA 3MZTA 1IVLA 3RGHA 1W3HA 3FHAA 2FZ3B 4G8GA 4FQ2L 3X13B 4HWZA 5EUOB 1LO5B 1VJSA 1I9RL 5T3XL 2A74A 2EXWD 2NPLX 5IMMB 3MV9E 2X1QA 4Y4FB 3RKPA 5LGKA 4PN2A 2OQJA 5JHDA 2NT1A 4NQEE 3HG3A 1JWSB 1CIDA 3DWTA 2WUBH 2XT1B 5C2BH 4G8FB 4TTUA 1A1OA 4M93C 1KR0A 4I18B 4YQXH 2DSUA 3OAYH 1MAML 3MRNB 1IE5A 1YEIL 1C90A 3SKOB 1N3NA 5MEPA 1KENL 3O6KL 3CSPA 4R0LB 4FMKA 4PGBA 4HK0A 3UYRL 2EYSB 3V5KA 5HJ3B 4Y5VC 1ZXQA 2K9UA 4XGZA 5E6IB 5C0BA 4Y4FD 3GXMA 1CQKA 3LQZB 1CU4H 5GZNC 4AD5A 3WFCH 4HV8A 3JTTA 5ESQA 4RZCA 4K68A 1GQLA 7FABH 2J7HA 4IUGA 2BHUA 4GAJH 4Z7VB 1EFXB 2BVUA 3MTRA 3BAXA 3PBGA 4UFJA 1CXEA 1UACL 1ZA3A 4K8RH 3K2UH 4HZ7A 1T2QL 1PSKH 4JDTH 4WUKH 3KPRE 5DVOA 4Z76B 2BVOA 4HSQA 4YK4B 1HK6A 3LRHA 1N2RA 2DGAA 3BP6A 5C6TH 3QI9B 4XTRD 2DJSA 1QBLH 2JJTC 3BAYA 4JFEB 1S46A 3C5JA 2FX8L 1F90L 5E6ID 3QOKA 2O5ZL 2D2OA 1U2CA 4I9WE 1KEGH 4NN5C 3CFCL 2VC2L 2PXYC 2DD8L 5EPMB 2OJZH 2CNCA 1FL6B 1BZ9B 4HGMA 2A3CA 2B0SL 1JGUH 4HQQL 1EFXD 5D7SL 4NN5B 4FP8H 4JFQA 1ISVA 1WDRA 1N6QH 5HYJB 1HYSD 5A2IH 5HGBB 3QI9D 1RJLA 4LLYA 4JFED 4GS7C 2F2HA 2ZG1A 1A0QH 3LKRA 1OW0A 3FQXA 5CD3A 1V3IA 1CF8H 4XP1H 3BGFB 4FFWD 3RU8H 1E4KA 4NX0A 1FFNB 4RGNB 1XCXA 1A6ZA 1AXTH 3FT2B 5DI8B 1CDJA 5DTFB 4TSAH 2ZJSL 4QRSA 3F6LA 3AREC 3IJYA 4PJXA 2E7MA 3ZDXF 3C8KA 5DMKB 3OJDA 1KB5L 5IG7B 4PMZA 3SDYH 3N12A 4XHJD 1H8SA 1RULL 1KIQA 1CFSB 4H1LA 4O2FA 4TUJB 3TT1H 3W39A 4U1IB 4MD4B 4GRMA 5D1XA 4CN1A 4J28A 4JFWA 2H1PL 3V95A 1WBXA 2XA8L 4PV8B 2J5LB 4YEFA 1GPOL 3BWUC 5SX5H 4V1DB 3ULSA 2HISA 2JE8A 4RGND 3AMCA 1NEZB 2ADFL 4R97B 2DF3A 4X98A 3D0VA 1MW3A 1WB0A 2UYLB 1JHKH 3F5LA 4WHYG 4XZWA 4HJ0D 5D1XD 4JZOB 3VXNB 3MLUH 2D7NA 2VH5H 1NBVL 4AEHH 1ZK9A 4ORZC 4E42A 3ULUF 3WENA 3FCTA 4QTHA 2Y5TB 5FF6B 2R0LH 1TNMA 3QG6A 2ZPKH 5D7LA 1T66D 1G9EA 2E9IA 2Z1SA 3NIDE 4JKWA 1BVLA 5C07E 2YPKA 1IGJA 2ADJA 2PO6B 4V1DD 5CCKH 5FV2A 4ODSL 4GQ9L 2J6EA 1VESA 2O9PA 4EI5B 4XWGH 4OSUL 3QUMH 3U2SB 4AXNA 5GISH 2ENSA 3IU4H 3ULUH 2NXYB 3LN4B 1S5HA 2B4CL 4LVOC 4P2YA 3TV3L 1CLCA 3N15A 1B3VA 1KJ2L 2D0GA 3T0AA 3QULB 4BZ2H 2CRZA 3HC4L 4UTFA 3MCLH 4LVOB 5D7LD 1LGVA 1Y6MR 2OR9H 5FAAA 3QO1B 5FYKH 3SDXF 5JUVA 3QXWA 2ZX9A 4HXAH 2PO6D 1XF3A 5GGSA 3VRJA 1FFQA 1BD2E 4ZNEE 2O9OA 4EI5D 2PNDA 3BDBA 4WEUD 3KWXA 5DJ8B 2NXYD 4ODTL 5ILTH 2P5WB 5E8OB 2Q6WA 1RZKH 3U46B 3RJYA 1QFPA 1ONQA 5A40E 4ZXLA 3X17A 3NZHL 4P9ML 1OT1A 2VISB 2NY6B 3L7FA 5E1AA 2ICEB 1JDAA 1LL7A 4EKXA 2Y36H 4JFSA 1MEXH 1MVUB 3MJ8B 4UDUA 5C92A 4QRRA 2BVTA 4JFDE 1C5CL 4P3CH 5IB1B 1ESWA 1MIML 3HNTH 1J8HA 3QPXH 4ODXB 5GGUA 5DHVB 1A14H 3BZFB 5EU4B 4UQAA 1V5JA 2Z8WC 2DWDA 3IAQA 1BWMA 4UQ9A 2XNAA 1XD1A 5L8KB 2NY6D 1LILA 2DWEB 1NGXB 2BCKA 3HE7C 3PG2A 4WY7H 3BLPX 3GNMH 5IFPA 3MV7A 1HJWA 2CIKA 1FVCB 2X1OA 4UFHA 5HGDB 1JNHA 4NKQB 4H5SB 1J8HD 4PJDB 5I17B 4U7SA 2PYEB 5J12C 4ZENA 1DLFL 5FO9A 1XR8A 2XYLA 3HKFA 3N18A 1U8HB 4WDIB 1QKZH 1J1OH 3CU1A 3BGMB 3WEZA 5DC0A 4FZEH 1C8QA 3BD3A 3CFIC 3RVWD 1QD0A 3TBWB 4LCYB 3ECQA 1YHTA 3U7AA 3AIBA 2RQ8A 3EJSA 1CICC 5B39B 5FL1A 3NIGF 4LCCB 2ITDB 4JY6B 5EZLB 3DARA 4XNMB 3KPNB 2VURA 5HHQB 4XPGL 4WHTB 5I19H 1EEYB 1AI1L 4MTVA 1CICB 3FFCA 3NA9L 5K33A 1KFAH 3RDTA 4R4BB 5JLZB 1YDPA 1J1PL 2L0DA 1UZ4A 4X8XA 2OL3L 4MS8C 1W72B 2CESA 5CWSB 2D9CA 3HG1A 4KZEH 4ORGB 4G6JH 5GRZA 2CETA 4HZAA 4LPXA 4XWOC 1U8KA 2NTFA 3GM8A 3V2AR 1KTDA 2I24N 5CJOL 3SKJL 5E2UL 3STBA 3BRGC 3NCBB 3S2CA 4JVUA 5D2NA 2B1AL 3W5MA 5DS8B 3FFCD 3RWHB 1WZAA 1BJ8A 3N1PC 4BQ2A 5FXCH 4C7DA 1K2DB 5JPNA 4GKSA 4JCMA 1QQDA 2C1OB 1RUKH 5D7IA 4U1HA 3AIEA 3BD5A 1E4XH 4PJ8A 4HU8A 4NDMB 1KBKA 5GIRA 1ODUA 4YFDB 2UY3A 2XPKA 2DM2A 4OI9A 3QEUA 1OP3H 4ZPTA 1BJMA 2QQNL 1FVEB 3MGTB 3VXRB 4BFIA 1S8DB 2AVGA 4ZPVA 3QEGH 3HPLB 3CAFA 3IJ7A 4GO9A 3AYRA 4JQVA 4JZNB 4YHOL 3QIWB 5IB5B 2OCFD 1T04A 1IEBA 4QXTB 3DSFH 2ERJB 4OLUL 1C16B 1H0GA 3MUHL 5IMLA 3TZVA 1NOUA 3QWRD 1AGBA 2DBLH 2VITB 4LDOB 3ROLB 1HWGB 2UUDK 1B9ZA 1T2XA 2A73B 2G2RB 5J89A 4AD3A 4JFEE 5GGQH 1TIUA 3ZLQC 1NQBA 4F7PB 3WQWA 4K8RL 1PSKL 3G5VA 4WUKL 4LQFL 4LU5L 4A6YH 4N8VG 2ZX5A 1UH4A 2X9YA 5ICYA 1W0VA 2PCPA 1FOBA 5GGRA 3MMEA 1YEKH 1FH9A 5GJSL 5HI5C 1OTUD 3QIWD 1IKNA 4QHUB 5JOFA 4BQ6A 4UI2A 4XCYB 1OGGA 4M00A 4JDZA 3DX9B 4ELKB 4WW1B 1OAZH 5I5RA 5IJVA 3T8XB 1QFWM 4XRCB 4AYSA 1KXTB 1S7XA 1P4IH 3HUJA 2FJGA 4L9LB 1MELA 4YO0A 2NY3B 5T3XD 4D0BB 3B43A 3MCKA 1Q9LB 1HE7A 3HB3D 4TX6A 5LWYH 4NKDA 2Q7YB 4RGNE 4HIIA 4P46D 4PJXE 3T0EC 1F4WH 1HEZB 1PZ5A 1CF8L 1AGCB 1E4WH 4PLKC 3U9PH 5JPMB 4KJYA 3H53A 3RU8L 4K3HA 4CU6A 4X4YA 6FABL 2ZCLH 3TCXA 4S10A 2BY3A 4QRPB 3VD3A 1P84J 5LVEA 2VXUL 1S7UA 1AGEB 4DKEH 1TJHL 2IFFH 2NY3D 3MRLB 3SGJA 4FRWA 5E08L 4AIZB 1I3RA 4BSVA 4P8UA 4V1DE 2DB8A 2OW6A 3PF2A 4B9ZA 5E1HB 4X0VA 1EGJL 5TJWK 1GZPB 3CDGA 3DTXB 3QHMA 4Y89A 1QI0A 3RVVC 3PGCB 2W0FB 5KS9A 2JCCA 2NX5A 3Q6GL 4JM4L 4P8XA 3D52A 2XICA 5KVDH 5D1ZB 4J12A 3IFPB 4HIEB 5D7LE 1TZHB 4OCXL 1JHKL 4P7OA 3PXJA 1KT2A 1FG9C 3V6FB 4NHCL 3WN6A 3MLUL 2VH5L 3ABZA 4AEHL 5DVNA 4PG9A 1S9XB 2W0LA 4QGTA 4AM0A 1HSBA 1INQB 3P9MB 3EJPA 4YXHH 5HBFA 4HHAB 4Y5YC 3C08H 5JW5B 2ZPKL 2QHAA 1O5DT 3QH3B 2KQMA 3O2VH 2NX5D 1EV2E 1KB5B 1BBDL 4IRJC 5CCKL 4MLSA 3MBXH 3GSQA 2HN7A 2GHWB 5EU5B 1IM3B 5D1ZD 2WYSA 1OLLA 1UR4A 5TGBB 1NMBH 1U2HA 4WFGD 3IU4L 3ULUL 4UQ2B 2Q8BL 1CR9L 1UB6A 4OKVA 1EJOL 4IRJB 4H25A 5DJXA 3WLBA 5KW9H 3AXHA 2A83A 3QCTL 5TE7L 4HWBA 2VR4A 3U7YH 1FNEA 3J8F7 1I1AA 2AP2A 3SCUA 3VFVA 1MCQA 1K8DA 3ZE0E 1FP9A 1F45A 4JZJA 1A4JA 1QFHA 2GJXA 4S1DD 4LLVB 4JQIH 1R75A 2Z93A 5BYWA 1JF6A 3O3UN 2XRAH 3PWPA 1O7AA 4X7FC 3ZE1E 1P2CB 1UZ6E 4S3KA 4ZTOH 1JGDA 2CKNA 5FIPA 3ZKQD 5I16B 1W9PA 2CGRH 4UQCA 1KTBA 2CLRA 2VDLH 3WUWA 4HZ6A 3CFBA 5KSVB 1I4FA 3IJ9A 1J8HE 4P7QA 1S5IL 3DURA 4DUVA 1OWWA 3N0PB 1DVFC 4LHUB 2Y36L 1MEXL 1R5VB 3AS3A 1I7RA 5I2IA 3CUGA 3L6FB 4NKMA 5C0FB 4P7RA 1RFDL 5SWSB 1KJ2B 2AI0L 3T4YA 4MA7H 3NCEB 3QPXL 4NC1E 2I60H 4U1KA 1KIRA 3H6JA 1CGTA 5E5MB 2IXUA 1KLUA 2W0PA 4PJFA 1XH3A 4TQEH 3FO0H 4ATDA 2BHZA 4O2EA 1NEZG 5E2TL 1IAKB 2VDMH 3VFNB 4LPVA 4PJDE 1U9KA 4FNQA 3PV7A 5E00B 3HNVH 2F19H 3GNML 3SCVA 1TLKA 4X4MA 5GS0C 1H3GA 5A16B 5IBLD 1NUDA 1HKJA 4U6HA 4HOXA 2GK1B 4G3YL 5ECUA 4Z18A 5SWSD 1FFRA 3BPCB 4RBPH 5D72L 4NUJB 3ZE2E 1GCYA 4JFOA 1MFAL 2F74A 4KRPB 2VLLA 5D6DA 4X4XA 2XGBA 4PMYA 3FFCE 2F53D 4N0FA 3SKMA 1T80A 1UD3A 4CL7A 1JGVL 4LIQE 4WU5B 4MAUH 4K23L 2E6PA 2ICWA 3U1SH 1HH6A 4KQ4H 4U1GB 4PRHB 3E8UH 1T1XA 3KPOA 2QPUA 4JO4H 2DDQL 1YQVL 3MBEA 4NYLA 3QNZB 3TJEH 1YY9D 2HVJA 2BSTA 5E5RB 5F44A 3WQ5A 4PMRA 1O7VA 4OQTH 2WAGA 1G1YA 2P8MA 5D5MA 4XAKD 1RZ7L 2A6KB 1T7XA 3QUZA 2CYGA 5CIPH 3KG5A 5GZOD 1NAMH 1FH7A 2W62A 1MJ8H 4OD2B 3GB7A 35C8L 1JTTA 1B0IA 3R1GL 4G6JL 3NGBC 4Z8FH 1FLRL 3RAJH 1JNJA 3F6IA 1T21A 1I9JH 2AKRB 1YPZF 4I48B 1BFOA 5HHOB 3MRKA 1KTRL 3OKMB 1BG4A 2C4XA 3C6LC 2NY5H 1FO0B 1RJZB 3QR3A 3CSGA 4RIRA 4X9HA 1A6VL 4UMGA 3V0WH 2GUYA 5FUZH 4JAMA 2WP3T 2Z92B 3VXUA 1GGYA 1C08B 5BCAA 3NCJL 1KIPB 3T3ME 1UM4H 3HC3H 3UTSA 4L29A 4EN3A 3EUUA 4OGXL 3N06B 5CLWA 4AISA 5HHOD 4J3UA 3QEGL 3GI9H 2VABA 4Z2KA 1QFWI 3LPPA 1S3KH 2ZP0T 1G6RH 4G5ZH 5T3XE 4ALAH 4NN6C 3VGHA 5DUMH 3AHZA 1WKYA 4QNPF 2FYVA 1F58L 5GGQL 5EMYA 2QL1A 3BEVB 1QFWH 3GXNA 2VZ3A 3OF6A 1SYVB 3M6DA 4WW2A 4A6YL 4EN3D 3EYUH 5FUCC 3U57A 1TTFA 4WLCA 4JFFA 4OZGA 5C1MB 5IFJB 1OD8A 3C5ZD 4HUWA 3BWAB 1YEJH 2RCSL 1OCQA 4N1CA 1PEWA 1LEGB 4MDJB 3W6MA 1UWQA 4CCCA 5D9MA 3IDMA 2X8RA 4QTIL 1F4AA 1QVOB 4OCSH 5DRZA 1CD8A 5B39G 4AQOA 4ZUTA 1P4IL 1QI4A 4MSWB 3D3AA 4PR5A 4ZUUA 3CHFA 3E6FB 5CBEA 4CVUA 4FF5A 1CTNA 4PRDB 3CX5K 3QDMA 3TNNA 1JWUB 3I6GB 1HDMA 1LNUB 3DBXA 2NY7H 4FLSA 2XWTB 5LWYL 4CNIB 1T20A 5E94B 1F4WL 2YSSA 5F96H 4W4NA 3IS0X 3RWEB 3SGKA 2DQEL 3ILPA 5BXPA 3DYMA 5ALBL 3TWCL 1J8KA 5K9JH 3HG4A 4Z0XA 4PREA 5EH1A 5JXEC 3QDMD 3BP4A 3UBXI 5EIIB 3QEQA 1OVZA 2YC1A 1VEMA 4XPAH 3HCVB 3V4VH 4P99A 5FV1L 4JDVB 3DI3B 2JCCE 1CD1B 2NX5E 4B0MM 2CDFA 3FT3B 4NXSA 1RZIA 2AQ3A 2BDNH 3G6DH 3REWB 4BJLA 2DJUA 1WIPA 2VLKA 4EUPB 4IMKC 3GNPA 4D9QD 2Y7QB 4G8EB 1NKRA 3O2DH 4WFGE 1TTUA 3U0TB 4M8UA 5IMKA 1K6QH 5L2JB 1BBJB 4AENB 4K8RD 3ZDZF 5IJKC 2ZG2A 2CKSA 3N85H 3SE9L 5KVDL 3THCA 4QF1B 3VJ6A 1IC4H 3UXFA 2FDBP 3OGVA 3P73A 3KLLA 3CH1A 5JW4R 3VDCA 5KVGH 4HZLA 2X1IA 2FHCA 3UROR 4M29A 3BRDA 1V6UA 3N1FC 1GZJA 5J7CC 2I9LA 4OM1H 5SWZB 2A9MH 4F57L 3CZEA 2V5YA 4LNRB 3L3KB 4JKKA 2BMKB 4ZS6D 4OGZA 2PF6A 2XZCH 1RK1A 1UYQA 3O3BB 3GFUA 4AIXA 3CVIH 3F5KA 1EJ6A 1TPXC 1C92A 4KJWD 3K8LA 5DVLA 2X6MA 3FKUS 2NLJB 3DRQB 5FOJA 5H35B 4HUNB 3JWOH 5DK0B 1VFFA 5HPCA 2VZTA 4GXVL 2I9TA 5IM7A 2VL5B 4IMLB 4OBRA 1OGAA 5I74C 5D9PA 4H88L 5SWZD 3BPLC 1IL1A 3P4OB 4OB5H 3WN5C 1U8NA 2YFOA 3P77A 4ZMAT 1RHHB 2P1YA 3OG4B 4P48A 4HTYA 1IQDA 2ATPA 4JO2H 4HIXL 4ZOCA 1PEZA 1TDQA 1T89C 4X7SH 5FOBA 3TESA 1ORQA 4XP9L 4E0RB 3DUSB 3LS4H 3VRIA 1U3HA