7CGTA

Rameb complex of cyclodextrin glycosyltransferase mutant
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
total genus 228
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 7cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 7cgtA01
4JB9L 1UH2A 2G9HB 5FO8B 3EYVB 4ZOEA 4Y0GA 3EOAB 2XWEA 3QQNA 2VXTL 1P84K 3FRPA 4AMKH 1JPST 2W0KA 4O2CB 2APXA 2CQVA 3NGBB 3D0VB 3EOBB 3AQUA 1JHLL 3NZHH 1N4XL 4LAQH 2O26U 3TH2T 4CCCA 1UZ4A 2QEJA 1TUXA 2IADB 4B9ZA 2VLKA 4MJIE 1HJXA 2PYED 4WI8A 4LQ1A 4PD4K 3QZWA 4DO5A 1DBBL 3TBSB 1DQJA 4EQ2A 4OLXL 1JFXA 2PI6A 3QULB 3R06B 2BC4B 1JZ6A 4ALAL 1NMBL 4U6YA 5I74B 3WJJC 1XGUA 2X4QA 3WS6C 5CBEA 3VWJB 2QLYA 2OR9L 4Z0BL 4C58B 2C5DC 4LSQH 1KENL 3RVVD 4PUDA 3IANA 5HPOA 3HG3A 4RNRB 4XBEH 1I7ZA 2XPGB 3MLSH 1C5BL 5KOMC 4Y19E 2LQRA 4PMXA 4J3TA 1IARB 3O6KL 1ZANL 4WLCA 1YEHL 1J11A 2ED9A 1CGSH 3CCHB 3DMMA 2NTFB 1T4KB 4NNPH 5EBLB 4JQXC 4ELME 5D7SH 1GGUA 2NY5H 5HPMA 3EYSL 3CDCA 2W1NA 4NRXA 3QFJA 4MQTB 5GGUA 3WEXA 2JK5B 2DQEL 3OKMA 2IXVA 3GXPA 1TNNA 4AXNA 4I5BA 1H5BA 4LIQE 5C08D 3KPSA 4D0BA 1S8DA 4Y16A 5D70H 2H9GB 4HBCH 3LKRA 3T3ME 5A6KA 4K3JL 2DMBA 3FO0L 3BSHA 4JG1H 3LCYA 1AXSB 1YPZB 2VTFA 3IAQA 1DUYA 3OGCB 5FA4A 3CZGA 2EBNA 3G6JB 5T1LB 2F54E 5IESH 1B0RA 1UR0A 1ZSDB 4F33A 3GH5A 1DL7H 1XEDA 4OKVA 4KRMB 4OZ4B 5A2JH 4MNQA 4HZ7A 1RZIB 1MI5E 5KSAD 1H15A 2WAHA 3KPLB 4FXGA 3WFCH 3ZKNC 4AG4L 1GOOA 4ZOAA 1WCBB 2WUCH 3BVTA 1P2CA 4PBWD 5LGKA 5ENWB 2ATPB 3CD4A 3H9SE 4MTVA 1CDIA 1S9YA 4JRYA 2WHLA 1J10A 2GSIA 2I9LA 1R24B 1FYTA 3QO1A 3DURB 2VLJB 4X8XA 3MFFA 4WJ5A 5ANMA 4V1DA 1DEDA 4U1MA 5E0FA 1A7BA 5L2KE 4EVNA 3CZEA 4NQEB 2CIIA 3O41A 1T1WB 4KK8C 3T77B 4KZDH 2P8PB 3VJ6A 1TLKA 4OLYL 3HCVB 2YD7A 1FZOA 2F8OA 2QPSA 4P23C 2R29H 3UTTB 3GSWB 2X4NB 2WMKA 3ALFA 4S1DD 3SDDB 1ZHBB 1R3HB 3MMWA 1PVHA 3MUZ1 4UBDC 3HPJB 2UY6A 1ZE3C 5FKAB 4AEEA 4PTVA 2A6KB 3D39D 3KXFD 3M7SA 1MW2A 3AZRA 4ODBD 3BEWA 1B2WL 1DBML 4H0IA 1FZKB 4UNTA 4X83A 4C55A 4APQB 5HVWA 4V2XA 3CUGA 2Y5TB 1YY9D 3B9DA 5LGHL 1UB6A 6FABL 1J01A 3UPCA 3PV6A 2AJ3A 4J8RB 4PY8J 2JIXD 4UOW1 3QI9C 1AO7A 5AAMA 4XWGL 4XAKE 3R8QA 1BD2A 4MB5A 5AG9A 1HI6B 2VZOA 3VXRD 5I16A 2H3NA 1F58L 5E6IC 2J7FA 3BPCB 3H42H 4GH7B 4Z7UB 3L95B 2YD9A 6TAAA 3RBSA 3CUPB 3Q6GH 4ZSOB 3IGAA 1NP0A 2C3GA 1G9NL 5A16A 2YIHA 3PGFL 2SEBA 4HCRL 1E43A 2D03L 2NXYD 1J0JA 4LVOB 4R6UA 2P47B 3AI0A 3NZ8A 2XOTA 4U6XA 3BCDA 4ZXOA 4F2MB 3NCOA 5T1DH 4G9FD 25C8L 3ARGC 4P4KA 1FO0A 2BSTB 5I75B 3H7BB 3EDEA 4FQCL 5D5MA 5KVGL 2QKIA 4CADB 1IGJB 4M7LT 3BPNC 4WU5A 4EE9A 3QXVA 1KEGH 1A9EA 3T2OA 4NT6A 4PJGA 4WHTB 3UTSA 4HT1L 1A1NB 1TQWA 3KR3L 4M1DL 2HFGH 3MROA 2R4RH 4YHKH 1OARH 3FB8A 3FOLA 5CSGA 4JY4B 5GZOD 1AQ0A 3G08B 1Z32X 1OIMA 2A9ML 1AD9B 3CFCL 5EZJA 3TT1L 4DAGL 3NSMA 3WL0A 5JW3L 3SE4A 1K3IA 2FIKA 4XCNA 4ORZC 3OGRA 3GMRB 5GIRB 4EOWH 1K85A 1BMGA 1S9XA 5EOQH 4K3GA 2PETA 3DX1A 2EO9A 1LJYA 3IKCB 2QHLA 2G4FA 2GEEA 1J9CT 2J5LB 4D6FA 2P7TB 3UMTA 3HC0B 1NCNA 1V7ML 4JAWA 2NX5B 1TETH 1SMDA 4OJYA 3QCTH 1JXKA 2D7TL 3N1FC 1MFAH 3HAEA 2VDRL 3MU7A 1ZAGA 3AHYA 3OXRB 3HE6C 3WBEA 3WUFA 1QA9A 1CLYL 1QQDA 4LSSH 3WJLC 4FFWD 1JCKA 3T0XA 3O6LH 1RQ5A 4CDHA 4YIQB 4OD2A 1XCQA 1E55A 3LVEA 2B1AH 3WQ6A 5LG1A 5IFJB 2DQHL 3OKDA 4FFVC 4ZXBA 4LOUD 1WT5C 2GTWB 2XSAA 2W91A 3L5WA 5JIKA 3UTQB 5DHYA 5DD3L 5AD0B 3VRIA 2FJGA 3MRCB 4NJAH 4S1QH 2YA1A 4ONFL 1W72H 3F58L 2VN7A 5EZLB 2BJMH 5IOPB 1TVDA 2D31A 4XPHL 1QI3A 1OGTA 1JPGA 1IC7L 1ZA6A 1A22B 1RZ8A 4DZBA 3NIDF 2GK2A 3HKFA 3TVMB 5J1AA 5IW6B 4JZJC 1FE8H 5AEAA 4W5ZA 2HJKA 1S5IL 4GW1A 2AJYL 1Z6JT 5TF1L 3VNZA 1QFHA 2C3VA 2VLKE 3JV4B 3QUXA 1OGAD 4WF7A 4P7LA 1SJEA 1KNOA 2AK4B 2VX4A 4ZYKA 1KFAL 4KQ4H 3UTZA 3EO9H 2EDOA 5TE7L 4PG2C 1DWHM 2D9CA 4OLUL 5LA1A 4Q9CA 5D8JL 3L4WA 4HKBB 5EU7E 2A0LD 1M1SA 3ZT6A 4DFHA 1TZHB 4C54A 1EIBA 4OT1L 1WNOA 4H20L 2XVKA 4PBVC 4UFMA 4AJ0A 2Y7QB 3BDBA 3WDRA 4HWNA 4GXVL 5D7JB 2A74B 4ZD3H 2AXFA 3TNNA 1MCFA 4AWEA 3P73A 4X5XA 1A6ZB 3W4RA 4OCWL 3PDOA 3L5XL 3VI3E 2PF6A 5DJDA 1N64L 4PRID 4FFYL 3VFOA 2VXVH 4JJ5B 5I1HH 1CL7H 3CSPA 1IGTB 4GS7B 2VUYA 5GJTL 3GTNA 4J2XA 1BPLB 3DETC 1R7OA 1KCUL 2DQDL 5KVMC 3QFJE 4OCSH 1ECEA 3OZ9L 4TVDA 1AHWA 4L29A 2P5ED 3U1SH 5B4MC 3KPSE 4E8DA 1I7UA 2KZWA 3VFPB 2C1OB 2RFXB 3TN0B 3W26A 2OK0H 1M6OA 1YNTB 2OSXA 5C3LD 3UTPD 2VR4A 3I9GH 1WTLA 1T89C 3BO8A 4Z7OF 3GSQA 4IM8A 4Z7WA 3BX7C 1R8LA 4FABL 5I1DB 2DKSA 4B3LA 3H9YA 5DT1H 1A6AA 1JNHA 3GGWA 4ZXLA 4MNQE 5IXEA 2BOCA 2DQTL 2MFNA 1MHEB 5CJ8A 4Y1AB 1MCIA 2ZXDA 3VFTA 2CKBH 3ULUC 1CLZL 2QQNL 3LRKA 3TA3C 3U0WL 3VIGA 4OFPA 1I9RH 2Z8WC 4PJBA 5CD3B 4WW2F 5GSRB 4KUCD 4LSUH 3C5SB 4PREB 1W1PA 2MPAH 4R4FL 4JY5L 2J7EA 1I1RA 4JRYE 3SUUA 3AAZA 3AGVA 4HIHB 3AU1B 4G5ZH 1MUJB 4WU7A 1SM3L 5ANME 5FGBC 3WL9A 5BZDB 1CXKA 1RJYB 2GUOA 1Q72L 1T6WA 3BUQA 1OT2A 4P7OA 3B9KC 5JQ6H 4ZAKA 4WFFE 4CJ1A 4JM4H 2BV9A 5TH2B 3NACL 4LLQB 5JNYA 2X4SA 2NY3C 3JVGA 5F9OL 3BVNA 3BKCH 5A2LH 3VCLB 3GI9H 3MLZL 2DSVA 4X6FA 1C3FA 4GW5B 2HN7A 5DUML 1INEH 3L9RB 1MREL 2HVKA 3NA4A 4OLWL 1JGUH 4RAHA 2EPNA 1CFBA 3P3YA 4TVPD 1F4YL 3QUMH 4OD3L 1I3GH 4HC1A 3MGTB 3IJSA 2W65A 3U0TA 5J4MA 3FO1A 3LV3A 2XTJC 4NXSA 3CUJA 4M3KB 1EBPA 3SOBH 1HILB 3IS1X 5F9WC 2NY0D 1KPUA 5GZND 3PBGA 1E6JH 3UG5A 1MW1A 1AO7E 1TTFA 1FFOB 2FNBA 4F7EB 3CUFA 1BD2E 3ILPB 4C7DA 1UWGL 5F6HI 1JPTL 1ZGLP 2VDQL 1NANH 5E94B 1E3ZA 2EIEA 2F61A 4I4WA 4RMRA 2OSLB 2Y6SD 5CJXC 6A3HA 2ORBL 4P23B 4BSVA 1HXMA 3H8NA 4HX1A 4XBGA 4RAVB 2I07B 4ZS6D 3U46A 4JM2D 4P59H 32C2A 5C0AA 4NSKA 1MCWM 3QISA 4HWUA 3SDXF 5I8CB 3DTXB 4PJDB 1N59A 5HHQA 1BGXH 4G6FB 3VRJB 3UO1H 3QNZA 2XWBA 4ORGA 3PHQB 5GISL 1U93B 3GDBA 1Q9WB 1WUNT 3O2VH 4F9JA 4RFOH 1UM5H 2W92A 3OKOB 4G6AC 4I9WE 3CTTA 4CUCA 5DVMA 1MRCH 4LCWB 2E3ZA 1IGCH 3LAFA 2DJUA 2APFA 1A1MA 3BKYL 4D0DB 5C1MB 5JXED 3ZTJG 1MQKH 4PJGE 2YUWA 3LEXA 2BCKB 2V38A 2CYGA 4UNUA 5E6IB 2H45A 3BUPA 4MYWB 2LU3A 4UQ3B 3SEPA 5C8JA 4XPTH 1YY8B 2OL3L 3NOIA 4X7FC 3TZVD 3WKMH 1PKOA 5GJSH 1OGSA 4P49A 1VHPA 1X44A 1M7DA 5T3XL 4JLRB 3GMLB 3TO4C 2FJHB 4UV7H 4F8XA 1HVXA 4R96B 2FGWH 3QRFM 4P2QB 5FOBA 1IC4H 3PXJA 4GAFB 2WWMD 3MGOB 3PZIA 5DD0H 4MQ7A 3S96B 4AYFA 4DWSA 4O4YH 2EE3A 4Z77B 4PRNA 3W9DA 4XVJH 3NCYS 3WIFA 3QYCA 5IKCA 2BNQE 3HZKB 3IJ9A 4GRMB 3QEHA 4J28A 2OL3B 5EZIH 3EDDA 3THDA 1T2QL 3LN5B 5I1EH 1PLGL 1T66C 5J7CC 5I76A 1BWWA 3PWLA 3WSUA 1G01A 1MJJB 1E5NA 3O6MH 1N7ML 4HQQL 5ACMA 3RU8L 4JO2H 3QIUD 4I2XA 2IJ0C 3O45A 2R0KL 1FSKB 1JZ5A 3MLYL 1EK3A 3E2HC 1WSST 4ZFGL 2FYYB 3FFCD 2WBJD 5HGAB 4KRUA 3X11A 4DW2L 4UTFA 3OV6A 1GOQA 3GMNA 4M00A 1NEUA 1SY6L 4O02L 4GMSH 2VXTH 1PX8A 1XGPA 4JQIH 4UINL 1B3JA 2HVJA 4JFXB 3OWEA 2AJZA 4L3EB 1IV8A 4N90D 5CP7B 3ECBA 4LLDA 3WNLA 1VACB 2YBRA 4E41B 2WUBL 4M8UA 3VGDA 3L6FA 1Q1JH 4XRCB 5ADOL 2MHAA 4MA7L 3N9GL 4D72A 3RDTC 1JGEB 3IDGB 3CIVA 5JA8B 1RUAH 5DJYB 5LKNA 4ALAH 1NMBH 1W1VA 5C0IA 2ZPKL 4AZ7A 1DP0A 3UYRL 1RJZB 4N8VG 4I3RL 2AJSL 2OR9H 1E0VA 4Z0BH 4HKJA 1QYGH 5HYJD 2ICWB 1KENH 5ISZB 4NRSA 5HVHB 1NGQH 2HLFD 5ICYB 2WC7A 2R2EA 4LCIL 2C4FU 5JIPA 1BZ9B 1R3JB 1UGNA 4XHJD 3SGDI 2RB8A 4Q9QL 3E8UL 1Q6EA 2V7HA 3ZDXE 1DQDL 2X1XR 3FT2A 4FQQA 1U92A 1ZANH 3KE0A 1YEHH 5F21B 1PZ3A 4PJ8B 3VH8G 1QPPA 2VRJA 5ID1A 5LXGH 3LHPL 3OB0H 5IT2H 1YZZA 1EEUA 5JOFA 5J6GB 1MAML 1T0NB 3OX8B 1UKOA 1CGWA 4HU8A 1S7WA 3SO3B 3MV9D 2LTQB 4KJWC 5FHBL 5DWUL 2VR9A 5D1QB 4M7LL 3VXUE 3S9DB 3W28A 5D7KE 1W3LA 5EU4B 4JFEA 2QTEA 3G5XB 4JO1L 1GYAA 5ILTL 1OPGL 1K4CA 5BS0D 4AZCA 3SDYH 1QRNB 5E4EC 4PTXA 2QSCL 2XN9D 1VKXA 1IGFL 2Z31C 2P46B 5D1XC 2I24N 1JG9A 2IGTA 4UFIA 3O9WA 4R7DA 1CQKA 2JCCB 4HHAB 1KN4L 1FAIL 4LCYB 1RZKL 4GRLB 4PGDA 5EIVA 2QADC 4P3CL 2PYFB 4NP4L 3IFLL 4PLJC 2DM7A 5T33L 4KXZH 4WO4A 2EDJA 3VO0A 3KYOA 1WWCA 4LLYB 1ZT1A 4YGAB 5C07A 5IIEB 5IBTH 1BIIA 2EC9T 1HXJA 2EDFA 2IFFL 3UAJC 5EDXA 4FS0A 4AG4H 4JHZA 3OPZH 4DZ8A 1MAJA 1V3IA 1DE4B 3DVNB 2BSRB 5BVPH 4PGCA 1YDPB 1KT2B 4IRSB 5HD8C 3KPRA 3V9FA 4ZE5A 4M61B 4XC1L 2EDDA 5DMIH 1UD3A 2YSSB 1OY3B 1BFTA 5MP6L 1KB3A 2H26A 2CETA 4XZBA 3QIBD 4A6YA 1AXTL 1HP4A 3RIFF 1XD0A 3X13A 2P44B 1MRFL 3MCKA 3TTOA 4KRTA 5LCVL 3CMOL 1WP6A 4OLYH 3FT3A 2D73A 4Y2DC 4BQCA 1NMAL 4EIZC 1FL5A 1E0WA 4O2EA 4Z7VA 1JZ3A 1FVEB 3BYTA 4IPNB 4XBPA 2LV4A 4FQXD 4U6VL 2YUZA 3BPLB 2HJLB 3TA3B 1G84A 4U3XA 5E9DD 3AS1A 2PKDA 2EKSA 2WIMA 4D2NA 5HDLA 1B2WH 1DBMH 2RBLA 4QNPE 2YUVA 1VFAB 1KJMA 4BM7A 5F6IB 1XIWA 3C5ZA 1F45A 4LEOA 1CEOA 1CIDA 5FYLE 1NKRA 4NO2A 1PZ5A 5IQ9B 3MV7A 2L7UA 4J6RL 4LHUA 3O2DA 4D6HA 1F58H 1V6VA 1I9IL 2NY3B 3BAIA 3OLGA 4GUPB 1EJOL 4KRPB 1QSFB 4PPTA 4ZFOL 5KAQG 5IB2B 1FZJB 4OIAA 3PGFH 4HCRH 3IDYB 1W72A 4ODVL 1C5DA 1EAJA 5AAWA 2XXMB 5E1HB 1ORQB 4QLRA 4CVUA 3C08L 3ZE1E 5F7MC 3TIEA 25C8H 4GW4A 3SCMC 4UOZA 4GG8A 4FQCH 3STZB 4WKHA 1A3LL 4U2YA 3ARDC 4FQIL 1HTYA 4JN2A 1OSEA 5DMGD 3A6CL 2NZIA 4HH8A 4QRRA 3I6LD 4CMHC 2WKGA 4TN9A 1BQHA 3KR3H 4M1DH 1BYAA 2VERN 1E73M 4XPBL 2B8OT 4ZFOB 1NGPL 4V28A 3CFCH 3TT1H 5K9JL 3W2DH 4DAGH 4XCFL 2GY7B 3GSVB 3BD3A 4N9GA 1CICD 3GZAA 2L4OA 2QSVA 5F93C 3V5KA 2DOCA 3EJJX 4OI7A 1FPTL 1H3GA 2QL1A 3Q0HA 5JTWA 1GVYA 3WQ5A 1IM3A 1ETZB 4W8BA 4HUVA 3BQUA 2EDKA 3B4NA 3GSUA 3MRPB 1AY1L 3MPCA 2EABA 1GJIA 2BVPB 3D2UB 1JFHA 1RI8A 5SWQA 3LPWA 3DV4A 3U30B 3BUYA 3SCPA 3O3AA 3JWOC 5SX5H 4H04A 4K9EH 4DJMA 5MERA 1V7MH 1PKQA 4PJAF 2D7QA 1YMMA 2FX8H 1IKFL 3OAUL 1QI4A 2D7TH 4QOKA 1XR8A 3THCA 1E4JA 3NABL 4WNQA 2QLVB 1D5MA 1AGEA 2XGIA 2Y9RT 1WCQA 1BREA 1NANI 5FV1L 1CLYH 5JHDD 5A94A 1RHFA 1YYMH 2OTPA 5IFHH 1QFWL 2NY1D 2QQLL 3BZ4B 5BRZD 1TG7A 4Z8FH 4NPYA 3RVUC 3IFPB 2DQHH 3TIDB 1I1AD 3FT4A 1U8JA 1JHTA 4CNIB 5DD3H 3AVEA 5AC5A 1IAII 3HG1D 1FN4A 4ONFH 2IGFL 2VDKL 4AIOA 3F58H 2ZOKB 4PIRF 2X6MA 3PHOA 3TO4B 3VD7A 1LEKA 1DFBL 4KTYA 2Q86B 3P0VH 1IC7H 5DC9B 3RTQB 1T03L 1J18A 2F5BL 1JN6A 1O0VA 3MLTB 3PGCB 5SWSB 3WUZA 2VVNA 4LX4A 3LKOA 1S5IH 3R1GL 1NJ9B 5TDNA 4TSBL 3TBVB 2JF6A 2AJYH 2CKBA 5TF1H 2IH3B 1LP9B 5D72L 2CIKB 4K8RC 3PL6D 3OLDA 1DBJL 1KFAH 1KIPB 4LNVA 1KCSH 3UJTL 4ZG1A 3DGCR 2ITCB 2J6EL 4OLUH 1GOKA 2D7PA 3EYQC 2GJPA 3AIWA 3PWUA 5D8JH 3MRKB 2WV3A 3F5WA 3U7WL 3MXVL 4YE4L 2F8VA 3O3EA 1CGUA 4NF7A 4OT1H 4B53A 3QXDA 1B1YA 3D25B 1JAKA 4ETYA 1IAKA 1L6ZA 4XWOC 3ARVA 3P11H 1OD9A 4HU0A 3TFKD 3TTYA 3VXQA 2AK1L 3FB6A 4R0LB 1ND0A 5IGXL 3H0TB 1U8NB 3T0EA 4OCWH 5IB4B 3LY6A 1A2YA 2K1MA 5GS0C 2CDGA 2R56L 3CSYB 3L5XH 2J8GA 4KKLD 3TYFB 2DJ4A 1N64H 3OR6B 3E6FA 4FFYH 3QUMA 3KWWB 5JPNB 1D6EA 4KKAD 3PABB 5GGRY 1KULA 1H0IA 2Y06H 2FBJL 1U8OA 5JMOC 4QAWA 4L3CA 1AC0A 5GJTH 1IQWH 5L8JB 4CU7A 3OAYK 2BMKB 2VAJA 4WV1B 3VDHA 1XT5A 1J8HA 4HSQA 2DQDH 4HUUB 1QW8A 3T0VA 4PJ5D 5LWYH 4FNRA 4JFEE 1R86A 5B21A 5A3ID 3TT3L 1G7LA 1MEXH 4ONOA 4PG9A 1JZ4A 1HZHL 2X70B 3QHFL 3MO4A 2JJTC 1O7AA 1S9VB 3MRFA 3DNKA 4Z0XA 2HKHL 1S3KL 1I1FA 4BFEA 5CGMA 5E08L 3HU7A 2ZSVA 3FB7B 1HSAB 4JKPH 2LFGA 4K2UL 4FABH 4NUJA 4BQ6A 2G3JA 3L2LA 5TE6H 1S9WA 4GRWB 5IR1B 2VUOA 1ZHKA 4YZFF 5DRNB 5JLZA 4Y5XA 1FGNL 5C07E 4AEIL 1CLZH 1NAML 2QQNH 1RK0B 3JTTB 5FCUH 3MBXL 4TSAL 1VA9A 3LRGA 2CBVA 3LIZL 3S3PA 5DEZA 1BZ7B 4NUGL 4R4FH 4FTVB 4JY5H 4GKSB 4P0DA 3DBXB 4M6AA 4RDQG 3DC0A 3GSXB 3TLRA 1SHMA 4HWBL 4HTYA 2WLZA 1BG4A 2IAMD 1SM3H 1AGBB 1G7MB 5IVZA 3KLAA 1ZTXL 1NFIB 1Q72H 4Y8AA 5GGSY 2VAAB 3REVB 4HUKB 4OD1L 1OAZH 1DVFC 2BHZA 4IS6A 1S46A 3PZGA 1UM6L 3NACH 3ULVD 5HPCA 1R3KB 4LKXA 5CSZA 4BZ2L 5F9OH 2WZIA 3DVFA 3D18B 3MLZH 5FL0A 4HXBL 4YHLL 2E9BA 4WI6A 3WF3A 2PO6D 1HHKA 5DUMH 1NAMB 4Z7VE 1MREH 3SJVA 4OLWH 2DIAA 5I2IA 5H8DA 5DQ9A 1ED3A 4ZS7L 3WNNA 1F4YH 3MRMA 4P7NA 4RQQA 5KSBA 1JPSH 3FZUD 4U3HA 3F12A 5KVDL 4EN3A 1AVAA 2V5SA 4OUUB 3VD3A 3EYVA 2P4AB 1A64A 3NFPB 4FP8H 4UQCA 2VX6A 1TFHA 2DM3A 4O2CA 3EOBA 5MEND 5CBAB 5D2NC 3ULUF 3LMJH 1T7WA 4J12A 5EH1A 2J7DA 2YWZA 5GNZA 1NFDB 3MV7E 3EOTL 1G6RL 1UWGH 3QHZH 3NCMA 2VLRB 1C1EL 1L7TH 3NIGF 5B8CB 4RWHA 1KIQA 2YPKB 3F5KA 2H2PD 3G6LA 3TTSA 4L8SA 3SCTA 1CF8L 2WZPD 1NAKL 1US3A 5HHOE 2Y8VA 1IGYA 5T1MB 4LU5L 1ES0B 3T0DA 1MCRA 3D87B 5D6DA 2Q87A 1FH5L 3D85D 3HNSL 2YPLB 3PWVB 1NKOA 4OIIL 3RUGB 4NBXB 2W0FB 4D6DA 3F7VB 3WS3A 3WUGA 4YHGA 5K59F 1E56A 5C6PB 5IMMB 4JEGB 3SE8L 3MRBB 5TD4A 1N0LA 5FGCB 4DTGH 4R4BA 4I18A 4X5WA 3IDIB 5I15L 4XP4L 3AC0A 5FFLA 2YPVL 1G6RB 3OJ2C 1NGZB 3DYOA 5JQHC 3SKOB 4Y5VC 1A1OA 1EZVY 2GK0B 3EHBC 3KJ6H 4QRRE 4X6DF 4PRPB 4QXWA 4AEFA 4JRXD 2NTFA 1HNFA 1T4KA 1K4DA 3RVVC 1CQYA 1FFQA 5F97E 4UIMB 3NCBB 2GITB 4X6BB 4H5SB 1UQYA 5JDSB 3LB6D 4DOHB 2GVYA 2OL3H 4KJPD 4U1LB 3SQBA 1PSKL 3V8OA 5MEQA 3KPOA 5IMKB 4Z78B 2V6HA 3ET9F 3WD0A 5T3XH 1XGZA 4LSDA 1KLGB 3AM8C 5C7XL 4Y4FD 1C5CL 4AD5A 2Y07L 1J0HA 1ZEAH 1AXSA 3O8XA 5DK0B 4IMKA 4MHHG 3WNMA 4X7SH 2WP3O 4WW2A 1PKQE 1YMME 2W63A 3WN5B 4QOKE 2UUDK 1V03A 2X4RA 4Y4KB 1F4XL 4N8VB 3RY4A 3VWKB 4ISVA 5C6WH 3VRLF 2YZ1A 1B3YA 1E71M 3MJ9H 2NYYD 3LS5L 1ZWIB 1Z3GL 3ZHLA 1HK6A 1NC4B 4LF3B 4GAJL 4P5MB 3O2WL 4Y5YC 1AE6L 5E7BA 1PLGH 3PDDA 5DJZB 4HQQH 3TJHC 2ATPA 1LK2A 5JA9A 2DYPD 2ZOXA 3KGRA 3OAZH 3MLYH 2VDLL 3VH8B 3L2MA 1RU9H 5KSAC 4ZFGH 1GPFA 2X44D 2ADFL 3F6LA 5DURD 1CXHA 4DW2H 5JW4M 4YAQA 1J86A 4NQEA 5EU6A 4A2MA 4UOJA 4O02H 4PV8B 2V5CA 1LO3L 5DZOA 4E5XB 1HOCB 4PGBB 2VYRE 2W9EL 4UINH 3HCVA 2ZUTA 3GXTA 3N12A 4YEFA 4GBXD 5DD5H 1FJ1B 1FRGL 3MV8B 4M1RA 5C0CE 1V3HA 5IFTA 4TSCL 4I48B 4M9OA 4O00A 3UTTA 1OGBA 5DJCA 5LAXA 1FLTX 3Q6FA 2MQ0A 3SDDA 2Z93B 1HIML 1NGWA 3K4DA 3N9GH 5FKAA 5JBDA 2A6KA 2PXYA 5DD6A 5BCAA 1U2YA 2I25N 5C0ND 4PB0L 4P3DB 4F58L 2AQ3A 5CPTA 2ZPKH 1SQ2N 2JB6B 4N0FB 3UYRH 4PEEA 4I3RH 5IROC 2AJSH 1OAUL 1UJ3B 2Z35A 3WQ8A 5DK3A 5J12C 4S1DC 5GS2H 2A6DA 4XNZC 2Y8KA 4J8RA 1GL4B 2HFFA 3V8CA 5F7DB 3RJDA 4Q9QH 3SDXA 4GIAA 1BGAA 5D7LB 1GJUA 4RBPH 1HI6A 4M8QA 1YEGL 1OM0A 3T0EE 1DQDH 1W2VA 3QNYB 3L1OH 3TEUA 2XVPA 1Q9KB 3ZDYF 1OCWL 3L95A 1T7YA 5E1AA 2YR3A 1ZLSL 1YY9C 3P30H 5C09E 3LHPH 1MXDA 3MUGB 3ZKXC 2WSPA 1EOMA 2WB5A 3BC9A 3BYYA 1CE1H 2E4TA 2YEZB 4ZSOA 4BQ4A 3GH7A 1JFQH 2AVGA 1MAMH 5J0BA 1VIWA 1RJLB 4D1JA 3W6MA 2FYVA 1JYWA 3QEUB 5ABFA 3U4BL 5CINH 3UXFA 1GZJA 1RULL 5FHBH 1J8HE 5GS3A 4P2OB 5DWUH 4U1HA 4D6JA 4M7LH 3G5ZA 4G80B 4MD4B 5D6CB 2VQ1A 4F2MA 2HAZA 3CVIH 1VENA 1A6WL 1OPGH 1QOKA 4D9LL 3H7BA 3INUL 3I85A 3SUSA 4U4BA 4Q6IA 2UWEF 1F3RB 5FOOA 5F7HA 4XCEA 1KGCE 1MQQA 1FAIH 2NXYC 4KQ3H 2DTSA 4RGND 3VGAB 5FUCE 1A1NA 4BQ2A 3BRDA 4O2FB 3IFLH 3QWRD 4HH9A 5LVEA 5T33H 2FATH 3MLRL 4BZYA 3UPRB 4PJEB 1GRWA 3F7YB 5A2FA 2F8QA 3L4XA 1N82A 5FYJU 1H0DB 4OLVL 3FB5B 2IFFH 4NKOB 1X4YA 5CSYA 4LSVL 4HS3B 2BVOB 5I1CH 2VITB 3D3VA 1XYZA 1A4KA 1HHJA 2AOSA 3W9EB 3CSGA 4YHZL 3ULUH 1HDMA 4JPVH 5H37G 1ZHLA 1J5OH 4XC1H 4AEHL 3QR3A 3P9MA 3IKCA 3P4MA 4P2RB 4HPOL 5MP6H 3ARFD 3QIWB 4KVNL 2P8LB 4NDMB 1AXTH 1GIGL 4YHNB 2DL2A 1J1XH 4LBEB 4TNWF 4NQDA 1H3TA 3D51A 2A6IB 2CGRL 4F9DA 4RFEA 3U82B 3VILA 4OGYH 5LCVH 3O4OC 1P53A 3RVXD 3CDYA 2YKLL 1S7TA 4GI6A 1EJ6A 5H2BB 3U4EB 3FRPG 2RGSA 1NMAH 5EA0L 3SGKA 1KF9B 4R8WH 4Y19D 2ZXBA 5JR1L 3GI8L 1K5NA 3SJVE 1RURL 1YYLL 4JDTH 3KS0H 2PTUA 5IV2A 3NIDE 4P46A 4R9HA 2ZP0T 1KWKA 3CXDH 4U6VH 3VIFA 1M05B 5KSBE 4JZNA 3EJYD 1DLFH 3WE6B 5L2JB 1U8PB 2V7NB 3HNTL 3QZWG 5ID0B 4RA3A 1OP5K 4X9BA 5CILL 1KIRB 3UDWC 2XM1A 1TJGL 4MAYD 5J89A 5ADPL 5IVXB 4FFWC 4FFZL 4X80H 4OAWA 5CHNA 4EI5A 1BOGA 1P5VA 3O6FD 1R46A 4LOUC 4F9LC 5FDWB 5IW6A 4H2CA 2IANB 3CC1A 1D5XA 5IJKC 4PRHA 4J6RH 2NY2D 3B8SA 4J3UA 5FV2A 4LYQA 4WW1B 1H2JA 1I9IH 5BOPA 4DGIL 2AK4A 5TF0A 1TXKA 4WI7A 3RJQB 3RPKA 4BK5A 1EJOH 3BRGC 2F54D 1MCNA 4JFZH 4OUOA 5GGVL 5BYWA 3HUJB 4RE3A 3MSPA 5DO2D 1FQ9C 2VLME 3KZSA 4M6ML 4B0MM 4W88A 5ESQB 2LU7A 2B2XL 4ODVH 1GHFL 1KXVA 4R7NA 1MI5D 1U8LA 2HJFA 4LGSB 3SE3C 3C08H 3WEOA 4ZQKB 2DQCH 3ZO9A 2MKWA 4U1JB 2EIZB 2FD6L 4L4OA 2V9QA 3HI6L 4NQCB 1E4XH 5BW7C 5E8EA 2CLVB 4FQIH 3RNQB 2EEBA 5D2NB 5GRUL 3A6CH 1DN0A 1FNEA 5SX4I 1MJ8H 2RJMA 3CPLA 4FXKA 2ZX9A 5L2KD 2D4FA 5GRWA 4JFWA 5E9AA 4GPNA 5ICZB 3SDCD 1TCRB 2QPUA 1NGPH 4CW1B 5ICXA 3WHE0 3G5YB 5K9JH 4PN2A 3UG3A 3GO1H 1MRDH 4PLKD 4IHOA 2ATKA 3WJJA 4NYLB 3WS6A 2PTTB 2MNUA 5CEZL 2ZUMA 1FPTH 1Z0NA 3GSOA 3VFPA 4PUBH 1US2A 2RFXA 5DFAA 2JB5L 4YHIB 4PLNC 1S7XB 1AY1H 2EH7L 4GXUN 1I85C 1YNTA 1YPZE 2NY4D 4RISL 5GGRA 4O51B 1UCBL 4L4VD 3OAUH 4KUZH 1KEML 4RMVA 4Y5VB 3GJFB 1MLBB 2VH5H 2E40A 3RL1B 4MVBD 2AERT 1MHEA 2I9TB 4JQXA 3WQWA 4Y1AA 2DQFB 1OWRM 3CLFL 1F4WL 2JF7A 3WKZA 3AXLB 4XAKD 5JORA 1QFWH 5FM5M 2QQLH 3WENA 3G5VB 3HS0A 1L0YA 4G43B 1XF4B 1JXJA 1T2XA 1H3PL 3FQTB 4OZHB 1RZ7H 3Q2CA 3HZVA 3BH8A 3KPNB 2VLJE 4R90H 1RD6A 4TRPL 3AU1A 1H9VA 1NLBL 2G5BB 3AREC 3VFVB 4A2LA 4AD2A 5SV4A 2IGFH 4URIA 2ESVA 2W62A 1RIHL 1RJYA 4NQEE 4TUOB 5EU6E 3WNKA 1O6IA 4MAUH 1CT8B 3LKNB 5D2LF 1FHGA 5M94B 4HS8L 1CWVA 1E28B 1WZLA 4NKQB 1T03H 1BF8A 4G9DB 4NO3A 1Z9SA 1EEYA 4JREC 2CUHA 1D5IL 3VCLA 1VAHA 3DOSA 5HXMA 3W29A 2Z4QA 4TSBH 4GW5A 3LMYA 3UTTE 5IVNA 1ZT7A 2OYPA 4FMKA 5KJRL 5D72H 4DVBA 4CD7A 1RIVL 2G75B 5I8OL 4D1IA 1BJ8A 3UJTH 1FZMB 3F62A 1NCDH 4HLZG 4X7DC 2J6EH 1FGVL 3ZJ8A 5GGSA 2FR4B 1CPUA 1U8KA 4TTUA 3GMOB 3GH4A 3MXVH 4PJFF 2VKWA 5JPMA 1VEOA 4YE4H 2AJUL 3UC0L 5GGQL 2OQJA 4IRJD 4Z2JA 3V0VA 4PJ9D 1KTKE 4Q2ZB 1FFOA 2K7PA 4JKLA 4HUNB 3SDXE 3UJJL 3ILPA 4ATDA 4J27A 2AK1H 4C59B 5DO8A 2AGJL 2J8UB 1LDPL 4QLLA 4Z7UE 1U6AL 2EEXA 2R56H 1VRXA 4P23A 5KANG 2NY0C 2XKNA 1NCAH 4UFHA 4UTAL 3O3BB 4ZSOE 5GZNC 2WCAA 4NSBA 2NQCA 5C0DA 2R0ZH 3BLPX 5T5NG 4MD5B 2ADGA 2CDFB 5CJBA 2ARJA 5A6JA 2H32B 1PEZA 1C8XA 4NO0B 1WBXB 5T1KD 1XH2A 4ZEPA 3VRJA 2F53A 2Y6SC 5HHNB 3PHQA 3QUZC 3X14B 3SUWA 4HP5A 3TT3H 1Q9WA 3MNZB 2JJUA 1HZHH 4ZS6C 2UY2A 3QHFH 4FOMA 2BSSA 1CD1B 1VPOL 4XNZB 4D6EA 2ICWI 3QI9A 2NLJB 5KEZA 2I60L 4YDJA 5E08H 5IJVB 3MRRA 3QHTC 1UZ6E 4MJIB 1WAWA 4X9HA 5E6IA 1YQVL 4LLWA 4LMQI 5C92A 5A6MA 3S3SA 4BF7A 4OTXL 1YY8A 2X4PB 4X7TB 3U6RA 4FQJL 1FGNH 4Q22A 3MBEB 1UXWA 5CUSL 5DTFA 1Z0MA 4PJAA 4WTXA 2XZAH 4RGOL 2MQCA 4TSAH 4J1UA 2CXGA 3D3VE 4JKKA 1B0GA 1XCWA 4LIQL 2N4IA 3DHPA 4URTB 4NUGH 1SYTA 1UD6A 1NCCL 2TAAA 3ZTJH 4HWBH 1QI5A 2CLZA 3ARGA 4OUEA 3GSRB 4W7VA 1OB1B 2P8MA 5I9QC 4CU8A 1VGEL 1UACL 5CWSB 1E1FA 2CO6B 3TZVC 3N11A 1SJXA 2JJSC 4WUUD 2HFEB 1JWSB 2WW8A 4GKNB 1VBRA 1XCXA 1UM6H 4FQHB 3A67H 4XUYA 4ELMB 4BZ2H 3QDMD 1U8QB 3NSNA 4JPIA 2EADA 5TFSL 3MLPA 2OL3A 4Q9RH 2EECA 4HXBH 4YHLH 3LN5A 3BMVA 1DR9A 1IEBA 4KK9D 2DQGL 4ZS7H 1V02E 5C0JA 1KCRH 5F3BA 1T1ZB 2WWMC 4MLSA 1V0NA 4HKXB 3BSGA 4U1GB 3DMMD 1UQSB 4D9QE 4YHYC 3RIFK 3SQOL 3LDBC 5HI5D 4LSPH 1Q94A 5BMFL 5F1IB 3IJYA 4DGVL 1NCTA 4G6JL 4QRUA 1F97A 4C4KT 5KSVA 3W27A 1CFSA 3QFJD 4LCCB 43C9B 4XTRD 3QIUC 4OGXH 3MJ9A 1OD7A 4PRHE 2W07A 1G6RH 4E41A 5HI4D 2ADIB 2IF7A 2OYKA 2WBJC 4N0UA 5KBNC 1C1EH 1UH4A 4XB3A 4GKLA 2BVYA 2KQNA 2AK4E 4FK9A 4XRCA 3HE6A 2NZ9D 1XRVA 4BKLA 4TNVF 4G3YH 3WJLA 1UD2A 4WUKL 4YHEA 3BMWA 3H9SB 1KPRB 5D1ZD 3BGFB 3JV6B 1IL1A 3Q5YA 1FH5H 5D9PA 3HNSH 3VXTB 5K9OB 3MLXL 5C8BB 3AYSA 1WT5A 2QSQA 4KHXL 4NHCL 1AGDA 2FO4A 4MNQD 2X4OA 1JGDB 3BWUC 4AYSA 5SWZA 5ISZA 4ZUTA 5LGJB 2X09A 3CZSA 2D1ZA 4QF1B 5KN5A 5F71A 3T3PF 4PRAB 4QXUH 5ACLA 1AKJA 2RCSL 5JUEH 5I15H 3AFLA 2LE9A 2YPVH 3D69B 3FQRA 4G8GD 5FDYA 4ZFFB 2AEQL 3T0WA 4GZJA 3I75B 4JZJA 3O3UN 3LEYL 2OCFD 4M7ZC 1WFNA 3GIVA 1K8DB 3FQXA 4R97C 5HDRA 2K9UA 1QI0A 1F8TL 1XGQA 1D3CA 4DUWA 5DRXB 2R2HA 4XHJC 1I8MA 4WFFD 1FCGA 5DUBB 3F5JA 3A24A 5DK2B 5A6BA 3BJLA 1NUFA 3AUVA 2F74A 2CNCA 1A14H 4PG2A 4V27A 1OSPL 1GGIL 5D7IF 1JDAA 3G5XA 1PSKH 3VMPA 1E6XM 3T2PA 5E99L 1P6FA 5E0QA 3TM6A 2E27L 2XYLA 2DLFL 4GQPH 3N18A 1T1YA 5C7XH 5D8ZA 3GSNL 4Q58C 2X7LB 4HHAA 4LCYA 3MRDA 2EYTB 4OZOA 4OM0H 4UT7L 4ACYA 1A3HA 4NKDB 1NWTA 2CLRB 1E6SM 4QLJA 4FN0A 1IM9A 2C3XA 2UZIH 1F4XH 3MJ8B 2BFVL 3OBAA 1ACYL 4PJCF 1Z3GH 3RWFB 2A6JA 4HLJA 4Y1AE 3WQVA 4Z7NE 1UKSA 4JFUA 1MWAA 4GAJH 3U2SA 1I8KA 3O2WH 1AE6H 4HIIA 3MYJB 4F37F 4P8XA 3H9HB 4HXAL 3IF1B 1GGBH 1VB9A 4XP9L 2FSEB 3MLWL 3VDCA 4YBHA 4KK6D 1IGMH 4IRSA 3RAJH 2H1PL 4FF5A 1JWMA 2E7CA 1NDMB 2VDLH 3BP6B 3U0PB 5INCA 5HDQL 1N5AA 4NN6B 1UYWL 1U42A 2ADFH 3GSNB 5DJAA 2ESVE 1BM3L 3VSVA 1LO2L 3BD5A 5DJ6A 3VSTA 4JFFA 1LO3H 3O4LA 4OJFL 1BVLB 1LWHA 2W9EH 4WK9A 1LO4L 2XQBL 1VFBA 3PTQA 4KK5D 2ZKHL 1T89A 5GRJL 3MKKA 4R5EA 1MIEL 3JXAA 1S7UB 3QPXH 5E8PA 4EBQL 5IB5B 5FYKH 1BBJA 3T4AB 1Y7VA 4I9WD 2NW2B 4IRJB 3ZKSD 2DF3A 1MFNA 4PMNA 4AT6B 2HJLA 3TA3A 1P4LB 3QR2A 4GLRH 4HOZA 3CC5B 2EDQA 4BJLA 4K8RH 4PB0H 4F58H 3ARTA 4ZO9A 4J23A 4JFDD 1UXSA 4UV4H 4W93A 3BP5A 4CAGA 1PQZA 1KTLA 3OJVC 3AREB 2IQ9L 4ODTH 5FGBA 5HYIA 3L5IA 5IQ9A 3CH1B 1BYBA 5EC1B 4Y7EA 3ILQD 3B9KA 5FD0A 1UWXH 5T3ZH 1QPKA 4MQSB 4I0KA 5BVJA 2ICES 1UQZA 2WWKT 1TMCB 2WBKA 1OCWH 4F8QA 3WIJA 1ZLSH 5GQBA 3C6SA 1TVPA 4JFOB 3VIIA 1FIEA 3REWA 1NM9A 4HW6A 1QHPA 5GS0H 4N0RA 1VFUA 2VVSA 2X5PA 1QFWI 3L3KB 5F1NB 1W9VA 4AENB 1FP9A 3RWEA 1RULH 4XMLL 1LG1A 1JMZA 3H7LA 2BNQD 4JO4L 5MI0B 4M62L 1A6WH 3JV0A 3ARQA 4D9LH 3H54A 3INUH 5LA2A 4DKEL 4LCWE 1YECL 1YEEL 5GRXG 4PJIF 5HBFA 5HHXL 3MX0A 1YN6A 3ALGA 1QR1A 3FTGA 2VLKB 2XIDA 2RIKA 3QZWB 1I8IA 5DGQA 4CDGC 2WMJA 1DQJB 4F57L 4BFIB 1FHLA 3MLRH 2BP3A 4ZFOA 2CPUA 1BTCA 1EERB 4OQTH 5CJXA 1OINA 4U6YB 3FQUA 4YWGL 4OBRA 1QOXA 1RHHB 1XGUB 4OLVH 2V5TA 5E2UL 5C0BD 4PJAE 2XRAL 4L4TB 3WFBH 5DMGC 2D3NA 1DANU 4LSVH 1HKIA 3QOMA 4XXCC 4J3VA 2VSDA 3ROLB 1NOWA 1UWSA 3QUXD 3PZOA 1ETZA 5D93C 5A8OA 1I7ZB 3MCG1 5JIWA 4AEHH 1TVHA 3QUZB 2GFBA 4HPOH 4UAOB 1GIGH 2XN1A 4KHTL 2EO1A 4K7PY 4LPVA 3KG5A 2CGRH 4ZNCD 1EFXD 1F3DH 2BY0A 1QLEL 4XH2A 1MCPL 4RBPK 2YKLH 3MRGA 3LH2H 3DX4A 5HPMB 5K33A 4NC2B 5EZOL 5D8WA 3P4LA 4W85A 5EA0H 1OGGA 3QQ3B 3BZ4A 2FRGP 5JR1H 3GI8H 4BCEA 1RURH 1YYLH 4NRXB 3ZT5A 3WEXB 3M46A 3TIDA 2X9XA 5T3XE 4I5BB 1H5BB 4N9OB 4PFEA 3KPSB 3NH7L 1S8DB 4Y16B 3LKRB 3HNTH 3O11A 5CILH 2Z91A 4WI5A 3P0GB 4ACPA 1TJGH 4AY0A 3TO4A 1QI2A 4XC3L 5FA4B 4L8CA 2NY1C 4FFZH 5HNNA 2M2DA 1W0VB 4YK4B 1B0RB 4PTTB 3IDJA 1NSNL 3FFDA 3MLTA 3EJRA 1ZS2A 3VXUD 4XP5L 4F33B 4IISA 4PP2B 5D7KD 4XAWL 2GCYA 4OKVB 4HIJA 5FO7A 4I0PC 2CHOA 2OI9C 3TBVA 4NN5B 4E41E 5BJTB 4OF6A 1H15B 4N0UE 2BRRL 2IH3A 2J8HA 3OL2A 1ZJAA 4M7KL 4DGIH 1ZB5A 1IGIL 1KIPA 1RP8A 3KLHD 1P2CB 2PR4H 4KGLA 5GGVH 3V0WL 2BERA 2P1YA 1S9YB 4JRYB 4LRIC 1HWWA 4PUEA 2GSIB 3QSKB 4G7VL 3VMOA 3QO1B 1FYTB 1Q6CA 5AWNL 4M6MH 1JDDA 5LYRA 2B2XH 3BDYL 3BIAX 1GHFH 3MFFB 4WJ5B 2CCRA 5ANMB 4V1DB 4U1MB 5I8EB 1TQCB 5ISZE 3O41B 4KMTL 3PL6C 4P9ML 5CSBA 4JPKL 2IPTL 2FD6H 3VJ6B 3WBDA 3HI6H 1MQ8A 3H0TA 1U8NA 3IK2A 3VI4F 4MB3A 2YDSA 5GRUH 1V7NL 1IEHA 2PC8A 4NC1C 4QO1A 2HRPL 2EXYD 3WD3A 5JPNA 3D0LA 3BUIA 1TJHL 2UWEA 4IM4A 2J6EA 4KROD 1RUPL 2A3EA 4ZAKD 3TFKC 4X4MA 2PW1A 3BEWB 3RDTA 5DFWH 5F9AC 1MFUA 3VXMD 3LXBA 2A2QT 1LVEA 4KKLC 1UB6B 4P48A 1Q0XL 5CEZH 3PQYA 3PV6B 1QRNE 2AJ3B 4YZFE 1FO0L 1AO7B 2JB5H 4MMZC 3BN9D 1QNZL 3LRHA 3WDQA 1BD2B 5EU5A 4RISH 1D2KA 2D9QB 2H3NB 1NWRA 5DVOA 3PGDA 1NFKA 1CFQA 2DTML 1HSAA 4W5UA 1KBGL 4P2CG 2D7NA 1KEMH 3HFMH 4ZUSA 5A3IC 2ZIDA 1HSBA 4M7ZB 1N2RB 2BNRB 5A16B 5IFPA 3U36A 3CLFH 1FOBA 1AQHA 2DSZA 2SEBB 1F4WH 1RK0A 3PWPB 5DQJA 2IC2A 1MWOA 1B6DA 3QUYB 1SYVA 2XZQL 4PJHF 3NZ8B 2ZWYA 4NZFA 4FTVA 1UR9A 5E24E 4P4KB 3O0RL 2WMIA 1FO0B 3GSXA 2EDWA 3EFDL 3L3OA 1G9EA 1HKJA 4TRPH 5D5MB 1NLBH 2QKIB 4UIKL 1HH6A 3B2UD 4WU5B 4LPCA 4CVXA 5KOVC 2DL9A 2Z31A 1A9EB 5D1XA 3BXNB 4JFFE 3O4LE 4NT6B 1DSFL 4PJGB 4HS8H 5FHAL 3K81A 3UTSB 1HJQA 2GJ6A 3MROB 2VZVA 4QCIA 3FB8B 3FOLB 4M4PA 2IG2L 3WH6A 1JUFA 2XY2A 4D6GA 1KB5L 1KOAA 2ICEA 2JELH 4TOYL 2IAMC 5EZJB 3SKMA 5MHSE 5KJRH 1A6VH 2Q1EA 3VXSA 2Y5EA 2FIKB 1RIVH 4XCNB 4LHUG 5I8OH 1A6PA 5F1SA 3ULUE 3AICA 4GT7A 1AXIB 2WINA 2WNWA 1S9XB 3ULVC 2GT9A 1J88A 2IPUG 1T2JA 4HWBA 4W89A 4OUUA 4PSRA 1LL6A 4D6CA 2PO6C 5I1JL 3QPQD 4NM4L 2AJUH 3EBAA 5FB8A 1PG7L 2FLBT 1V3LA 2C4FT 1NFDA 1A02N 1NC2A 3FZUC 3GHEL 4J4PD 4XMKL 4MDPA 2AGJH 2IMNA 1QA9B 5J9PA 1KB5B 5KS9F 1LDPH 1QQDB 3BAWA 1GC1C 4Y2DA 4MQXD 5EO9A 1NCWL 3BZDA 3HRZB 4OD2B 4MCYA 5T1MA 1ES0A 4UTAH 3OKDB 4ZXBB 1JMXA 3SCRA 2Q7YA 2J77A 1X5LA 4NWUL 3L5WB 3F7VA 5DHYB 3OG2A 1RIUH 1BQHG 3PP3K 4KUCF 1H3VA 2B5IB 4NCC1 4UUJA 4U1SA 5IHZA 1ZGLM 1H11A 2H2PC 2XTJE 3CJJA 4AZBA 1OGTB 1JPGB 1ZA6B 4MJ6A 4DZBB 3CDGA 2CKSA 5J1AB 4D9RD 2HJKB 1G6RA 4KKNA 1E4NA 1VPOH 5I18L 3W25A 3ALXA 3GM8A 2Y23A 1MHCA 4YXLH 2C3VB 5J13B 3T09A 1KNOB 5GS1C 5CZVL 4OLZL 5ALCH 4HD9A 3ARWA 5FYKU 2F7OA 2VABB 5L0QB 1HVQA 3L3GA 2CUIA 1GQIA 4FQJH 1QWNA 1TZGH 4ZTOL 4X0KA 3MOQA 5F1OB 1U30A 5F7LB 2DPEA 1UCTA 1WKYA 3BWAB 3GB7B 4RX4D 2AXFB 3LB6C 3GXFA 3HR6A 4RRPG 4IOSD 4N1HB 3SCMA 3CZFA 1VGEH 1UACH 2VIRA 1MHHB 1HCVA 1UD8A 3PDOB 3ARDA 5DVNA 4U1IB 2NSXA 5JXAH 3VFOB 4FQ2H 3IS0X 2HT4C 4OZIF 1KIUA 7FABL 4Y4FC 2ERJB 5TFSH 1HKMA 1PDKA 1NC4A 1VERA 1MW0A 3RVTC 3UYPA 1R85A 5D2LA 4QRPA 5F96H 2R0LL 1M71A 2DQGH 1YNLL 1QSED 4JM2F 4AZHA 1FAKT 1RK1A 3LRSA 1AHWB 4ERSL 4KAQL 1I7UB 1GSMA 2AXGA 2Y4SA 1E6OL 3GBEA 4TNWK 1L4IA 1NBYA 1M6OB 4DGVH 1W9DM 3MUAA 2VNCA 3LPFA 3RO8A 1JHKL 3BO8B 2WM0A 4Z7WB 5SWSE 4F7TA 5DD1H 1OP3K 2WVVA 1AD0A 3RM9A 4JFED 1NGXA 1A6AB 1JNHB 5L8KB 2AJXL 4I48A 1KGUA 2BOCB 1P7KA 4PJFA 4K68A 4U7SA 4WI2A 1IJ9A 3WMBA 3VFTB 1LP9E 3MRQA 1PX4A 4ESKA 1WC7A 3FMGL 4PJBB 4CU6A 3WY4A 4WUKH 4RZCA 4HC1L 1QBMH 4P3DA 1VEMA 4GBXC 1WAAE 3V6ZA 3MLXH 3AAZB 4YHML 4KHXH 4LSTL 3SKJH 4NHCH 5ECJE 4M5YH 1UJ3A 4WU7B 4K94C 3WL9B 4JO3L 4EUPG 1OLZA 2GUOB 3THMH 4IDJH 4ODWA 5C07D 4OFVA 4E2OA 3OR7A 4ZAKB 5FOJA 5FYLL 3MOAL 1MJUL 1V6WA 1C8PA 2X4SB 4M6OL 2BOBA 1QNRA 3BVNB 1JRHI 4QRQA 3NMEA 2DIBA 3NBNA 4X6FB 2AEQH 4FLQA 3V4UL 4M82A 1MJ7L 4I0PB 5DDHA 2ZJSL 4TX6A 2HVKB 4WCYL 3SKNA 4XI5D 2EDLA 1G7JA 2BZDA 4R27A 3L5JA 5ETUA 2UWEE 1L6XA 1RJLA 4X6EA 4EJ1C 2XA3A 5DA4A 3U0TB 3EZ8A 3AMCA 1AQKH 3FO1B 3LV3B 3HE7D 2OWWA 1L0QA 2D7OA 4G80A 1B0WA 3E6HA 3RGVC 4EXKA 1ZBCA 4H8UA 2X41A 3VFRA 3DDFA 5E99H 4M8VA 1KPUB 1VCAA 4Q9BA 2DLFH 1KELL 3WUBA 5HHPA 4IOFD 4LAQL 3DXAD 3T1WA 2YL6A 4JZOA 3RZCC 4LFHD 5GPRA 1NEZG 3ZR5A 4ZODA 2X2JA 3K8LA 4M7JH 4UT7H 4I4WB 4BSVB 1IZKA 1HXMB 3HNVL 4HX1B 3BVWA 3UPRA 4PJEA 4XBGB 2BFVH 3F7YA 2GJJA 1ACYH 3U7YL 3I3DA 3ARBD 4XVUC 32C2B 4UT6H 4M93B 5C0AB 4NSKB 1FDLL 1H0DA 4POUB 4WHDA 1ZBKA 2CITA 5HHQB 3U9UB 4RGNC 4LSQL 4XP9H 1ZVHA 3MLWH 4XBEL 4QT5B 4FTVE 4ORGB 5D9OA 2IMMA 5HDQH 4P2RA 5HHOD 1UYWH 4CCEA 3T4YA 1XFPA 2P8LA 4NDMA 4HEME 4YHNA 1R5WA 1BM3H 2NMSA 1A1MB 2JJTA 1A5FH 1N6UA 3AS2A 4KRLB 4NNPL 4HDIA 7TAAA 4LLAA 2XQBH 3LN4A 3ME0A 2ZKHH 5GRJH 1PGRB 4OQTA 4X4YA 5I1IL 4EANA 1MIEH 4L8DA 3U4EA 1ISXA 5FIPA 4BS0A 4FG6C 5C8JB 3WFEL 3QEQB 3ARFC 4JE4B 5I71B 3GK8H 4F7PA 4WFHD 1P1ZA 3OF6A 4BFBD 3KYMA 3DROB 4PLOB 1MY5A 4JFVA 1M05A 4BFGA 5CJOH 2O9TA 3UERA 4MNJA 2R69L 4WWKD 1FORL 5ID0A 4QGYA 5I73C 3BH9B 1MCBA 3KAAA 3KYKH 3N50A 5CQ1A 2QR0A 2XNAB 4POZC 2OBGA 4HIEB 4MMXC 2J7LA 5IESL 5F7KC 5AYUH 5C9KA 2IQ9H 4PB9H 1J0IA 1MFDL 5FDWA 4MQ7B 2BHUA 4DWSB 3GXMA 1NFDE 4PRNB 3EJYC 4YFEA 4TVPH 1P7QD 2ZG2A 5IKCB 5DEGA 1E5JA 4MAYC 2CSPA 3BQUD 1H3UA 3ZKQD 4ZOCA 1QNQA 2HFTA 3WUEA 2F9BT 4Y89A 4DCQA 2OJEA 1BF2A 3O6FC 3L4YA 1TPXB 1FV1A 1GC1L 2YPLE 4I2XB 2HP4A 2DIJA 3O45B 3PTKA 4QOKD 5J06A 1KACB 4X6CF 3HI5L 2NY2C 3BISA 3OHXA 1GW1A 1JZ7A 5DS8B 2DT0A 3X11B 1A6UH 4XMLH 2V5YA 4WDIA 4JO4H 5FGCE 4M62H 2OLHA 5I0DA 1XGPB 4U1JA 2EIZA 4KZDL 2YBTA 4LAJH 2HVJB 2AJZB 4NQCA 4DKEH 1U3HD 1GZPA 5DO2C 5IW1A 1YECH 3ECBB 1YEEH 2CLVA 3EJUA 4U33A 2W60A 5HHXH 2R29L 4LLDB 5D7IA 5D2NA 4CVWA 2F1BA 1CDUA 3CK0H 4LXFA 5DR5L 2FL5A 3L3HB 2Y2WA 3VPLA 3L6FB 2MHAB 3B5TA 4F57H 1UKQA 3WY1A 2A3BA 5ITFA 4Y2OA 4XZUA 3IKKA 1TFVA 1UEYA 4DOHE 3DX7A 4CW1A 2XZCH 1HYSD 2C7FA 4YWGH 2EYRB 4E0RB 4H8VA 5A8MA 5F1KC 3SDAD 5C0CD 4HMEA 5EO1A 2AKRA 3KLKA 4LLUB 2KKQA 3MRLB 4PJCA 4RMTA 1T5WA 2R2EB 4WFGE 1UZ8A 3SDCC 1F3DJ 2PYEA 3RY6C 2VRKA 1OAQH 4DM1A 2V7HB 3DI2B 4GG6F 2C1PA 3FT2B 1U92B 4FQQB 4O51A 4KY1L 2F7QA 5E00A 4UDUA 4QXTA 4PLKC 4HWZA 5ID1B 3B3IA 3QQ9D 3DUUA 4Y5VA 4CBPA 5J11B 2QHAA 3Q6GL 5TGBA 4XGZA 1MCPH 3FCTA 2VL5B 2BHYA 2DQFA 3Q5TA 2OSYA 1ODZA 2NY4C 3I84A 1NL0L 1S7WB 3T0ED 3BLKA 1CLCA 3FQTA 3VD5A 5I79A 5T1DL 1K4CB 1OIFA 4PSPA 4AZCB 1H3XA 3NH7H 5C09D 4PMUA 4MVBC 1CENA 3B8YA 4JR9L 2MANA 3M17A 2XKUA 2WKLA 4Y4HD 4PGEB 3VXPB 3O9WB 4Q7DA 4R7DB 4LCUA 3AM8A 4TUOA 4A6YL 4XC3H 1XH3A 3HMXA 1YQ2A 3LKNA 2Y24A 2Y25A 1GOHA 4PGDB 1NSNH 2VL4A 4XP5H 2CMRL 1JNEA 5CIPH 4XAWH 1IQDA 3AZSA 4WO4B 3RL2A 2B4CC 5E4IA 3K2MC 2EDBA 3P9LA 1ZT1B 5C08A 2BRRH 4GMTH 1BIIB 1C8YA 2G5RA 4M7KH 2WK2A 4CN6A 3WY2A 2XACC 3EIFA 3LD8C 3SCNA 4JRWA 4WEUD 2FR4A 5EOQL 4IIQC 3KPRB 4G7VH 5AWNH 3GMOA 1R47A 4X9GA 3BDYH 4QRSB 2H26B 4MS8D 4NHUA 4WJXA 4A6YB 5EIQA 5KSAA 3X13B 1CXLA 3GRWA 4OZFA 5IG7A 3MCKB 3QCTL 2R0WL 2APBA 4TUKH 1TITA 4Q2ZA 2IPTH 2F5AH 2E8YA 3ZSSA 3FT3B 1W9UA 4KC3B 4S1SH 5FYKE 3F6IA 2GW5A 2WBWB 3VW3H 4LSSL 3O2DL 5I6SA 3O6LL 1FL5B 4TNVK 2IBZX 3PP4L 4HLZH 3NDYA 4OZGF 1TQBC 2V17L 3D6GA 2EPMX 4XBPB 2W0LA 2JEQA 1TJHH 1YEKH 4M43H 4FQ1L 1RUPH 1CXIA 3ARSA 2CRZA 2V2WA 1W72L 1KTCA 2AEWA 3EO1A 1XIWB 4WRLA 3C5ZB 1GONA 4LEOB 4MHHI 5IROA 1MF2L 3C09B 1EV2E 4PR5A 3SJVD 4W86A 1D5BB 5C6TH 1FE8L 4NO2B 2AABL 4XPFH 3VFWA 5T3ZE 1PZ5B 3FRUA 1QNZH 3VFUA 3MV7B 2YRZA 3A4XA 3LQZA 4LHUB 4FLOA 2NW0A 3D39A 3KXFA 4J3WA 4ODSL 4P8WA 3CXHJ 2DTMH 3CHEA 4OI8A 1I1YB 1KBGH 4N0YH 4ATWA 2AV1A 4PJEE 4HGKC 2EZ0D 1X5ZA 4BZ1L 1S7QA 2JIXA 4FNLL 1RUQH 1W72B 3IDUA 1C5DB 1UKPA 2BNUA 1JWUA 4UQAA 2XZQH 3VXRA 1YEIL 5AY7A 3TIEB 2WC3A 1NGYA 3BUDA 3RGVB 3O0RH 3EFDH 4GG8B 1S7VB 1INQA 1IAIM 4P2RE 1WIPA 1V3JA 1WK0A 1OB1A 1ZL1A 4UIKH 3RNKA 1NMCC 4JN2B 1GGCL 5KZCB 1KXTA 4WI4A 2HFEA 1JWSA 4QRRB 1X7QA 4GO9A 5FHAH 3VWJD 3N9KA 3KJ4C 4W6YB 5CGYD 3RZCB 4Y8DC 1BQHB 4KKCC 1PG7X 1U8QA 3ZO0A 4PJ7F 4F37K 5B39G 4G6KH 4QHKI 3WFLA 1F2QA 4G9FA 1UWEH 4Z7QF 4YC2B 1KB5H 2W66A 4TOYH 4HOWA 3CSBA 1KSRA 1M04A 1TENA 2GAZB 1SVZA 1P4IL 1FBIL 4N9GB 5EU7C 3U1SL 1EO5A 1P4BL 4H26A 1IM3B 1UQSA 1NH6A 4HUVB 1WIUA 1S7SA 3NFNA 5SWQB 3B6SA 3DV4B 2EEDA 3O3AB 4F66A 3I9GL 2CKNA 2AXHA 1C8QA 4QGTA 5MERB 4F7CA 4HPHA 1YMMB 3WKNA 1DWFM 3K3QA 1PG7H 4WNQB 1D5MB 1AGEB 3FQWB 3GHEH 3DMMC 3ZJ7A 2WMPA 1LEGB 4XMKH 2FE0A 1OOAA 4U7MA 1UEMA 2WHKA 1I9RL 3LQMA 1BFOA 1NCWH 3T3PE 5EB8A 4NPYB 5T1LD 2MPAL 3JV6A 3VD4A 1WJ3A 3FT4B 1U8JB 4XTRC 1BAGA 3VXTA 1MCQA 4NWUH 3CXHK 5K9OA 1R5IA 3L4TA 1XF3B 1FN4B 4NCDA 3PHOB 3UDWA 2NZ9C 4QF1A 2XV6B 4JM4L 3V0AC 3S7GA 1AMYA 1JN6B 1PW3A 1UM4H 2EDEA 1H5VA 4NQCE 4JGMA 4NZUH 5D1ZC 1R75A 1BFNA 5HHMB 2E6PA 5EUKA 3I75A 5TDNB 4F9LA 5HGGS 5D7IE 5D2NE 5I18H 4KZEL 5IJKA 2VLJD 1JGUL 4GQRA 1DTUA 3ULVF 2Q8XA 2WZEA 3IU4H 3S5ZA 2UVFA 5CZVH 4NKIL 4NQED 3FY1A 3QUML 3ZSTA 1E6PA 5DRXA 3DUHA 3QJFA 3PNWA 2WQRA 5DFTA 5HDBF 4AM0B 3PWUB 3F5WB 2CO7B 3SOBL 5D4QA 3JZ7A 3UTTD 3O3EB 3QXDB 3PZNA 1E6JL 3TV3H 3SDDD 4NRZA 1IAKB 3SE3A 2PYEE 1K8IA 5A43C 4NFDA 4N5EC 5C9JA 5GRYA 2EYTA 3GUTA 4PJHA 2APTA 4NKDA 1A2YB 5BW7A 4APQD 4YJZL 5HY9A 3AB0C 1KJ3L 3U57A 5E5RB 3QUMB 4YBQD 1D6EB 4P59L 3ABZA 1U8OB 4EUPB 1I8LA 4L3CB 7FABH 2IALA 35C8H 1LE5B 4RFNB 3C6LC 5CAYB 3UR7A 1J8HB 3RJXA 2R0LH 1V5JA 1HQ4A 1YNLH 1TVBA 3AS0A 4M4RA 5CEZE 1E3XA 5INDA 3DX6A 4HJ0D 5DUPH 4PRBB 4TVCA 1G7LB 3NA9H 4PG9B 3RWGB 1UM5L 2NXZC 5FL1A 4PRIA 1MRCL 3G9VA 1E6OH 2Q6WA 1E4LA 1IGCL 1QLFB 3U83A 4YFLF 3WIHA 4JKMA 1GCYA 4Z0XB 1I1FB 2E9MA 2XYCA 1I85A 1BVLA 2ZSVB 1JHKH 3WMCA 1XMWA 5JIIA 4NUJB 1JNNH 4KK6C 2O9PA 1S9WB 1UB5A 2AJXH 3JWDL 5IB5A 4XPTL 5JLZB 3IDMA 4Y5XB 4L9LC 2CRMA 2JKXA 1CE6A 1AGFA 5AG8A 4H25A 3WKML 5IHSA 3EDJA 4NFCA 1RZJC 3S5YA 3RBGA 4KK5C 1NEZB 3RPMA 5KS9A 4RE4A 4LVHC 4YHMH 2X2HA 4LSTH 3IXTB 4CD8A 3D1MC 3DYPA 3VUPA 1DQTA 2XXCB 4JO3H 1CD0A 2ZX7A 5IVZB 3KLAB 3AREA 5DD0L 1NUGA 5F7WC 4IS6B 4O4YL 3CH1A 3MOAH 1MJUH 2OTWB 1N5YL 3MUHL 4LKXB 1FL3A 5CSZB 4JY6A 4G8EB 4R2GB 5EZIL 2J8UE 4PY8I 5KVFH 1SR0A 5JBFA 3V4UH 1MJ7H 5IQ7L 4UOQA 1HHKB 4W68A 2ZJSH 3H3PH 4OFYD 4ONHA 4WCYH 5DEFA 5DMJB 4JFOA 1AFVL 5DQ9B 1DJSA 4KH2A 1EUUA 4L9DA 4RQQB 2NX5D 4JO2L 5B22A 3TCXA 1M4KA 3ILQC 5HGBA 2YJQA 2WVTA 1E4KC 4EN3B 3WBAA 4AENA 3PWNA 3JUGA 1JJUA 2A38A 3EMQA 5IB3A 2DLTA 2XA8H 4LLMA 3MMDA 4GAYA 4BYHA 1IAMA 4GMSL 3V52L 1C93A 4JQIL 3NFSL 3OZOA 2VWEC 1HEZA 2FECL 2LAGB 3BJ91 1KELH 3SUVA 4B3KA 1CR9L 1KCLA 1ESWA 4K71B 4KI5D 3GIZL 1I75A 3MMUA 4JPWH 1MCSA 3A6BL 5I1GH 4YPGB 3D39E 1AR1D 1CN4A 4S0SD 1KIQB 1Q1JL 4JQVC 2G3IA 4L8SB 4RA0C 4BFIA 4OLEA 1EEQA 3HNVH 1IGYB 1RUAL 1BPVA 3U7YH 3N1AA 5AUMA 1TE1A 3TVMD 1RHHA 1CBGA 1FDLH 3WS3B 2VDOL 4AD3A 1OTUD 4L4TA 2JFEX 4XPGL 3LKPA 4OB5H 1QYGL 2HLAA 3C60C 5J3HD 4NM8L 1J1PL 1UVQB 5EOCH 3ROLA 3M8OL 3VA6A 3VXRE 4OZIA 1NGQL 2AK4D 3CLEL 3SY0A 3BD4A 4R4BB 4I18B 4X5WB 3G04A 3QUZA 5FK9A 5TPWL 1A1OB 2X2IA 4NQTA 2O9OA 3BPOC 5LXGL 1A7QL 4GZEA 1K4DB 5IT2L 2Q7NA 1Y6MR 2ZNWA 1G9MC 1XSIA 5HOSA 2BVQA 2WIIB 5I1IH 1A7NL 4QRTA 2OW7A 4G9FE 3WSQL 3WFEH 1A7RH 5D7JD 2WNGA 3QQ3A 4BUHA 2H41A 5A8NA 3BW9A 1E4WL 4N42A 5MEQB 3KPOB 4XNUH 4P4RA 4XHQA 2X9YA 3SDYL 4LNRB 2R69H 1UD4A 1FORH 3OGOE 2XZZA 4HIXL 3APGA 2Z1SA 4IEFB 4WKFA 3O8XB 3VDBA 1B2YA 3ULVH 1U3YA 1W0VA 3HTLX 4H0GA 4WW2B 4PTTA 3AIQA 2FDMA 4X4ZA 2EACA 4LDOB 4PP2A 1MFDH 1GQKA 2G2RA 3TZVA 2X4RB 2EXWD 5KANI 2HYMA 2JJSA 1BAFL 4ISVB 2GJXA 5BJTA 3CIQA 3WH5A 3QHMA 5IBTL 3FAWA 3KPQB 3TN0D 4OFDA 2D22A 2A9NL 4U0RB 3OPZL 5BVPL 2YN3A 1PEWA 1W3HA 3T8XB 1LK2B 1GC1H 1HXYB 4HPYL 3VI4E 4Q0XH 1HIZA 2UWFA 2R1YA 4D71A 5IHBA 5DMIL 3QNXA 2UZYB 3HI5H 5FF6A 3F7PC 1Q4NX 3KWXA 3LSOA 5I8EA 5FIEA 4UQ2A 4YAQB 5EU6B 3AJ7A 1WFTA 4Y1AD 5HGHB 3LQAC 1NCBH 4RAUA 3VGHA 4NNYA 1R3IH 4IBLT 5CIPA 3KLHC 1SJHA 5EMYA 4OCXL 5GNYA 1K6AA 3VIPA 4PMZA 5EO0B 4GZIA 1OSZB 3QIUA 4N8PA 5DJCB 2VZTA 5LAXB 1H8OA 8FABA 5DR5H 3Q6FB 3WLBB 4ZPVA 3FFCA 1NGWB 4W7WA 2PXYB 5DD6B 5ESAA 3SBWC 1BVNP 3LPPA 3G6MA 3WMSA 2XFYA 1X5XA 2YD1A 2Z35B 1X5YA 4GAGH 2EXYC 2CBIA 2A6DB 3D9AL 5E2VL 3UTOA 5CZXC 5CMAB 2HFFB 4KROC 3S4SA 4AMXA 3SDXB 3WNOA 2YHGA 1B3XA 4M8QB 1WPCA 2J2ZA 3MNWA 4KY1H 4PJHE 2D2OA 5E1AB 3VFNA 3CU1A 3WF2A 3V6FA 2DSKA 5E2WL 1N2RA 2BNRA 3T3MF 5HYJA 3BN9C 4DUXA 4P5TC 3WO3B 3PWPA 3STLA 5DGRA 2OX5A 1NL0H 5ABFB 1MH5A 2X8RA 3QUYA 3TBWA 4U1HB 1R33A 3G5ZB 3NCFB 2BVEA 2VQ1B 1R0AH 2YD6A 3CGTA 5DA0B 1QSVA 4P23D 4Q6IB 5TE4H 3OIHA 4PRIE 4JR9H 3VGBA 3KPPA 5A95A 5BO1L 4A6YH 4XCEB 3BXNA 3OGVA 5ERWA 2V3EA 2HWZL 2W5FA 1WE5A 4CD5A 4G6FD 4ELKB 2CMRH 5GXBB 4HH9B 1J9YA 4CL7A 3QOKA 4PCSA 5BS0A 3PXHA 3W2DL 4Z2GA 3B43A 2DT2A 4LCWD 2XN9A 3HG4A 4U5KA 4LLVA 1ISZA 1W9XA 5FKPA 2CJUH 3TCLB 3D3VB 3HB3D 1A4KB 1HHJB 3ZE0E 1MCWW 3C6LB 4U49A 3QRGH 1CTNA 4C57C 1T7ZA 1HDMB 5HSFA 4WI3A 4JG0L 1ZHLB 5E6ID 1QBBA 3P9MB 4MXQD 3P4MB 4PY7A 4F7MA 1UASA 4K9EL 1PX3A 2NXZB 4XXDA 1MCLA 2PWEA 4NQDB 2FX8L 2R0WH 4FNSA 4RFEB 4OF7A 3T2NL 3SE9L 3VIJA 4K94H 5EBMA 3DSFH 4X6CA 2GDVA 1S7TB 3F65A 5F9JA 1KB5A 4FA8A 3SIMA 3O2DH 4YBLC 3OAYH 3R0MA 1YYML 4G7YL 5IFHL 4IRZL 4JIEA 3PP4H 3BGMA 1K5NB 3HRZA 3QPQC 4Z8FL 2DWEA 2V17H 5IV2B 5E03A 4L9LB 4P46B 4P2QD 1S7RB 1YA5A 1WVZA 4OBSA 1PY4A 4JVWA 4GKZB 1NOFA 4FQ1H 1N6QH 4JZNB 4J4PC 4LKCB 1TTUA 4Z76B 3W0WB 2EXOA 4JAMA 1XH1A 4DN3L 4BQ5A 4MQXC 1W9BM 4OAWB 5CHNB 3P0VL 3IETA 5B39B 1MPAH 1MF2H 1BOGB 4EI5B 2AABH 4TVPE 1D5XB 4P5KA 5T3XD 4PRHB 5CKGA 3NDZA 4LGPB 5H35A 3K1KC 3EFFA 4Z2HA 3ESVF 5E9DA 4ODSH 4GQQA 3STBA 1AQMA 5FYJL 1CECA 4JFQA 1KCSL 8CGTA 2VABA 2X2YA 3VG0H 2UZXB 3ZDZE 4GG6A 4BZ1H 3W11C 4L3ED 1J05A 1WIOA 4FNLH 3IU3A 4L4TE 1MFBL 4R7NB 4E41D 5KZ6A 1U8LB 1JV5A 2HJFB 1HH9B 1YEIH 4OZIE 3D5OF 1HT6A 2DM4A 4ZO8A 3P11L 3NPSC 2VZ3A 3BWAA 3L7EA 3GB7A 3S97C 5EFIA 5J57B 5E8EB 2NPLX 3DECA 1MHHA 1GGCH 4HFWB 4CN1A 1W8OA 1DN0B 1FNEB 4U1IA 1C08A 1T1XA 2D0HA 4PP1C 4U1KA 4ODUA 3CPLB 4FXKB 3IXAA 1XGRA 5ISZD 2Y06L 2WHMA 2R9HD 1IQWL 3K46A 5ICXB 1EH9A 2Q20A 1P4IH 1HE7A 5LWYL 2X1OA 1FBIH 4IHOB 2ATKB 4PJ8D 1B4RA 2WHJA 1MEXL 2FJFA 5EG6C 3GSOB 1P4BH 4TQEL 3C60B 4UOW0 4XXCA 4ZUVA 4N1CA 5DYOB 5GGRB 2WANA 3P4OA 3SGEH 4JKPL 5D1QD 1EHXA 3U9PL 5TE6L 3NPZB 3W81A 3LZFL 5GS2D 5DZLA 4PGJA 3BPOB 1JD9A 3VX0A 3MA7A 5F9DC 1FYHB 4L8BB 4CGTA 1QRND 1TIUA 1I4FB 5FCUL 2IQAB 1NOUA 5JORB 5EOTA 1VFFA 2B7DT 3HS0B 3OA5A 4NOBA 5FKYA 3IFOA 1F2XK 1YUHA 4GRLD 1GXEA 4BA0A 3HZVB 1FYTE 2GTZB 3BH8B 2GJZA 5I19H 1PIGA 4V1DE 4LASL 4OZGA 2ESVB 1EHNA 2E7BA 4B41A 3CV5A 2E9IA 3S34H 1OAZL 4TXEA 4Y7MA 2AS5M 1EXUA 4NO3B 1EEYB 5BRZA 3LQAL 3OG6B 2DMKA 2G60L 1VGKA 2DI7A 1G0DA 5HJ3A 4IRSD 3RWDA 3V4PH 2Z4QB 2Z8RA 4KZEH 5IBUG 3KLLA 1E1EA 2GK1A 2QQQA 5A3HA 1ZT7B 4I0PA 4AIZA 2W4XA 2C7UA 4LQFL 3G9AB 5B4MD 1FFNA 2YA0A 4CN4A 4DVBB 1MIMH 3HG1A 3EJZD 4NKIH 1ZA3A 2FBOJ 1JPSL 3BKMH 5D96C 4EUPH 5GGSB 1U8KB 2G3NA 2E5EA 2HA1A 4W87A 3A5VA 3M1BA 3MODH 4LRIA 4FP8L 4LYRA 1DANT 5H94A 5JPMB 1HKKA 4C4KO 3EOYG 2OQJB 5EU3A 3IYLW 3V0VB 1K6QL 2UUDH 4YDLC 3AHXA 3LMJL 5A8PA 5DMKA 3PL6A 3TA3D 3QHZL 4EQ3A 1FH8A 3KVQA 2HT2D 4QTIH 5E2TL 3O2LA 1AGCA 1L7TL 3HE7C 2Z8VC 3ZHKA 2VB5A 3CZKA 1U8IA 4U5IA 4XNXL 3WV0A 2XKNB 1KJ3H 3DHJA 3DO7A 2PCPA 5B3JE 1K3ZA 2BNRE 5HYJE 5C0DB 1EAPA 4M03A 4IOFC 2E9WA 3CH8A 2ADGB 4X9FA 3PWPE 2ARJB 3KYNB 3U9UA 1MCDA 4KTDH 4IOIB 2F53B 1AH1A 4QT5A 4ZENA 2NY3D 3EZJB 4PJ7A 2BNJA 4DTGL 2CR3A 2HT3D 3OB8A 2VC9A 4MA1C 4KRPD 3ARBC 5D5ME 3CO4A 4WIWA 1TA3A 1QSFD 2BSSB 1UENA 5IW3A 3QI9B 3KJ6L 4YDJB 1NPUA 2DLHA 4U0QB 3MRRB 3UTSE 1WDQA 1EBAA 2VOTA 5DVKA 1PZ2A 3K4AA 1T0PB 4U6HA 4LLWB 4PJ5A 3CFIC 1JL8A 3JWDH 4AMCA 3QEQA 3RILA 4ZDHA 5BS0E 3U6RB 5HHVH 1UXWB 1A9BA 5DTFB 2XN9E 2PUQT 4PJAB 3P40A 2B4CH 4J1UB 4LP4A 3DROA 4KV5F 3D4YA 4P5TB 1B0GB 3WNPA 3M45A 4KKBD 2YWYA 3MREA 2CK0L 3BH9A 4ZTPH 2O9RA 1TZIA 4XP6H 1ZEAL 2XNAA 3N85H 2CLZB 5L9DH 3ARGB 4HIEA 2P8MB 2FHFA 4X7SL 1W1TA 1LWRA 2QSTA 3LX9A 3BPNB 4LVNC 1U2HA 3VU2A 2C26A 1EO8L 3NAAL 1VADA 5T5FL 4X6CE 4PTUA 4WWKC 3CZJA 3T0AA 1N5YH 3MJ9L 1LL4A 3ZJKA 3GMMA 2YOCA 4JPIB 2QBWA 3RWCA 1PG7W 2DBLL 5IQ7H 2WP3T 1IEBB 2KDGA 3D2UD 1AFVH 1BP3B 5C0JB 2IAMA 4G6AD 4D3CH 5F3BB 5DFVC 1AP2A 4OQ1A 4OFIA 2FB4H 1RU9L 4JHWH 4R26L 5DS8A 1Q94B 2XM2A 3IJYB 4TTDD 3AIRA 1V8HA 3V52H 4CMMA 2J7CA 5CCKL 3NFSH 2E6JA 4QRUB 5KSVB 1CFSB 3ZIZA 2YS4A 2MJWA 4WY7L 5DD5L 1CR9H 2NY6C 3WO4C 4PS4H 3GIZH 3A6BH 4B16A 4N0UB 1CZ8H 4XNMB 5E9DE 5I8KL 3L3HA 3WH7A 1NDGA 1EO7A 3HE6B 4BKLB 3TO4D 1U91A 3EJQA 1F11A 2YC1A 3NIFE 4ZPTA 5EOCJ 2FH8A 3RTQD 3PZUA 1IL1B 1U3HC 3GBML 4HKZA 4GG6E 2EYRA 2VXUH 5DRZA 5SWSD 4E0RA 2VDOH 1LO0H 5MENA 3QH3B 3HPLA 2X1PA 4XNQA 4XPGH 1AGDB 4PJXF 2FO4B 2X4OB 5J8OA 2ZG3A 4LLUA 3EKCA 4NM8H 1J1PH 5SWZB 5L7XL 3MRLA 4ZUTB 3M8OH 4X0VA 3ES6A 1ZOXA 2O5XH 5KN5B 2DM2A 3CLEH 2WWDA 5ECUA 1AKJB 2X89A 3TGXA 3FO9A 2J7GA 1T66D 2WWKO 3FQRB 3L1OL 2E6QA 3PIQA 5TPWH 4JZJB 3G6DL 3D85A 4GJTB 5E0CA 1JNJA 3MYZA 3SDAC 1MYRA 3P30L 1A7QH 2E8ZA 3GIVB 3FQXB 2B1HH 1CE1L 2ESCA 1U41A 3O3DA 2VL5A 1XGQB 2G41A 1JFQL 2R2HB 1A7NH 1I8MB 1K9DA 3I6GA 3WSQH 1OP5H 3C9NA 5CINL 1MWAL 2F74B 3K8MA 1E4WH 1CFTA 5DJXB 3JBG7 4UQEA 3LXAA 3CVIL 1WICA 5JW4N 3X3GL 1WISA 4NN7C 3PZTA 2VISA 4HIXH 4JRXA 5J1TC 1T1YB 1C16A 4NKMB 5C70A 3GYCA 3V5HB 3VXPA 4PGEA 1KGXA 1P5UA 4KQ3L 3VOCA 3MRDB 3B2VL 4GQ9L 4Z7WE 3QXWA 4QHLB 1Y6NR 2CBUA 3ESUF 1G7HA 4FNTA 2FATL 1IM9B 1V0LA 4RIRA 2N1KA 2OTUA 1PZUB 1K9TA 1BAFH 1B31A 5L88H 3P4NA 2A6JB 1KTBA 5BV7C 2HH0H 2E7HA 2HTKD 4Y4HC 1MWAB 3U2SB 2A9NH 4UR9A 1I8KB 3QP3A 4HIIB 4Y4FA 1FP8A 5I1CL 4PJBE 3DHMA 4M1CD 3ULUL 3HZMA 4JPVL 1RVFL 2KL6A 4HPYH 1LHZA 1J5OL 3FOMB 4AISA 1JWMB 5INCB 1N5AB 1I3RB 4QRSA 3FAXA 1LG2A 5DJAB 1J1XL 1EHAA 1SEBA 3KPTA 3MOBH 4XVSL 2XN2A 2XGBA 5DJ6B 1O7SA 2D0FA 4JFFB 4OGYL 3O4LB 5FM8A 1VFBB 1D9KC 1GGYA 2CIPA 4OCXH 4I3GA 5BRZE 4HJGA 3MA9H 1GOGA 5E8PB 4FTVD 5BZWB 1SYSB 2R15A 4UT9H 5CJQL 4R8WL 1BBJB 1GAFL 2DYPA 4L3AA 4MS8C 4Q74A 3BHBA 4JDTL 3ARPA 4AW7A 1CL7I 3HG1E 1S9KC 3CXDL 3LKSB 4M48H 2AAVA 1ZT4A 4UFLA 5IK3A 1DLFL 5DJ8A 5AYIA 4G8IA 4KJYA 4UZSA 3ZYOA 2ZWZA 1ITBB 1G0CA 1X6LA 3QWQB 1U95A 2EE9A 1QHOA 1UXSB 4GBXA 4X80L 4AL8L 3BP5B 1PQZB 1JVKA 1KTLB 3QDGB 4FRWA 5JW4R 3LN9A 3S37L 3GKWL 5CG0A 4Z2IA 2JIEA 4XMPL 1D5BA 3D9AH 5E2VH 4M1GH 5ESVA 4N68A 3CZNA 1E27A 1LF1A 3B9KB 3EYFB 3IJHA 1R5VA 3X17A 4MCZB 3SGEI 2WXDM 3AYRA 2FH6A 5BVJB 4HOXA 1HF6A 1I1YA 1G9HA 3C6SB 5HD8D 4HFUL 2F2HA 1IILE 4P2YA 1N0XL 5EUOF 4OGAD 2ZOLA 4JFZL 5E2WH 1OM3H 3REWB 4X99A 1DWGM 3BZEA 1WO2A 1WZMA 5C0AE 4Q97A 3IJ8A 1BFVL 4X6DB 2W9DH 5GHWL 4DGYL 3RWEB 3D50A 1DWAM 2VLRD 2J1KA 2ZUNA 2XTJB 3QUKA 2DQCL 1OAKH 4PJ7E 3RGVA 1CDBA 2EZ0C 1WBYB 1S7VA 5F9WB 1E4XL 4Z7QE 1RY7B 5BOZG 3NGBC 3OTTA 3OKKA 2YPLD 3W5MA 5BO1H 3EBVA 3S3JA 3NCYP 4RMWA 1YN6B 1L0XA 1QR1B 1MJ8L 3FTGB 1CD9B 3RZCA 5A2KH 2HWZH 1IFHH 3CFDB 1I8IB 5DC4B 1P6WA 1W3KA 4E9LA 4Q6YA 3WFHA 4Z95H 3QEQE 1LDSA 2HKFH 3FQUB 3GO1L 2GAZA 4NZCA 1MRDL 5I74C 2FCBA 3TONA 1OD8A 4HZ6A 1JGIA 2X4UA 3SHSA 3VWJC 2J8FA 5CGYC 4PRPD 3MNVA 4PUBL 3UCRA 4NFBA 2ED7A 4JG0H 2VX7A 4LHJB 1LQ0A 2DB8A 1AQDB 1RZJH 1TVHB 3QWRA 2GFBB 3CZLA 3RVWC 3TF7C 4MA1B 4JN1L 2DT1A 1XF5A 4YGVA 4KUZL 3T2NH 3SE9H 1FNHA 4WWID 1AIFB 3ULSA 1CS6A 1GOWA 2VH5L 4XH2B 3FQWA 1JK8B 1LEGA 3MRGB 2DD8L 3VXOB 4QNPF 4NZJA 4G7YH 1FA2A 4IRZH 1BIHA 4QEGA 3QQ4A 4EDWH 3CFJA 3ARFA 3IDXL 5LQBH