7CGTA

Rameb complex of cyclodextrin glycosyltransferase mutant
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
684
structure length
684
Chain Sequence
b'DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 228
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 7cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 7cgtA01
4M8VA 3HNVL 3W0WB 4LLAA 1M6OB 2IPTL 3QFDB 4MXVE 3MSDA 3MO4A 3BLBA 1JPFB 4POZC 1NCTA 3SY0B 1DQTA 3F7QA 1ZA3B 2VLLB 2APVA 3ILPB 4NRXA 5HGDA 2ESVE 3WHXA 1JYXA 3KYKL 1CVSC 3VIGA 1GIGL 5A8NA 5DGQA 2X4TA 2WC3A 4RE3A 1OD8A 43C9B 4H25B 2Y36L 3QXDB 4LCUA 4L9LB 3LKRB 4L1HA 4QOKD 2JK5A 3WMSA 3ZYIA 2Z93A 4PY7A 4PY8I 1M7DA 2IBZX 1DQQB 2R0ZL 1NBVL 1UWXK 3CLFH 5K9OA 2FYYB 3OX8A 4ODWA 1QNPA 1OF2B 2BVYA 1Z5LB 1US2A 4FFYH 1CK0H 3BP7A 2AAAA 1JHLL 1UQSA 2VAAB 1JG9A 4LBEA 2OS7A 5EC2B 1N2RB 1ZEAH 4I3SH 4N9OB 2HJKB 1F97A 3S3JA 3E0GA 3PWUA 3I2CH 4GZEA 5DHVB 3JWDC 3CNKA 4U6YA 5EO1B 4EZMA 1OTUC 2BY1A 4OD1L 1OB0A 1A6UH 5HYEA 5D71L 4NZFA 1EH9A 2CGRL 3WDJA 3KEHA 5C0BA 4JFUA 3BXNB 5FYKD 5I9QB 5C70A 3DVGB 2ZUSA 1MHCA 2OK0H 4UILL 4W5ZA 4GUPB 1AQMA 2PYFB 4GRWH 1NWRA 1MQQA 2VDMH 3FRUB 1CBGA 1P84J 2AS5M 4JGMA 1SYVA 3PGDB 5GGSB 2AK4D 2ZG2A 1IM9B 2BERA 1EPFA 3MO1B 2DTMH 4WU5B 1UM5H 4GI8A 4OI9A 4PJFA 3UROR 3EFFB 2ZICA 2F54E 3HPLB 3ALGA 3P40A 4M02A 3OL2A 4P23C 2A3BA 4XVSH 3BP4A 4JDZB 2X4SA 3I6GA 2F7RA 4RDQG 3LIZL 5ESAA 2QQLL 2XFXA 3VXQB 3BSHA 3ARUA 3BH9A 4DW2L 4P8XA 5IB2B 4K23H 4RWHA 3FFDA 4M6NH 5E8EB 3A21A 3OXSA 3EYUH 2EC9T 3ZR5A 4F80A 5FIPA 5F8QC 1NFDA 5HYJE 2X7LB 3AC0A 3CFCL 3FAXA 5AUMA 1BQHG 4LNVA 3IJYA 2X4NB 5E5MB 3AREB 4ENED 2G4FA 4I13B 2XTJB 1LO3H 1UH3A 1HP5A 5E99L 1NMAL 1OD9A 3CFIC 4P2OC 2VAJA 4S1DC 3M1BA 3GM0A 4FLQA 4APQA 3EAKA 4GXVL 3NDZA 1I3RA 1Q9WA 1QLEH 5EU5A 1ZJAA 4YHZL 1BZ9B 3WJLA 1R3KB 4P2RE 3BQUB 2CHOA 3GJFK 3VD3A 4Y5YB 4QRPE 3QCTL 5KVEL 3ZL4L 1UM4H 4V1DA 1MAML 1V7NH 4AIEA 5EUOA 2NW2A 2V5TA 3RWCB 3MLUL 3PL6A 4UTAH 2R4SH 5GZOD 1XD1A 1L7TH 3NZ8B 1SEQL 4U7KA 4XX6A 2XVPA 3OR7B 4KI5E 3UG3A 2R23A 4OOUA 5ABHA 3EOBA 3EZJB 3O3DB 3SGKA 5I30L 3ULUC 3U7VA 3DI2B 1E6ZA 1I7RA 2DQJL 3NFNB 5ERWB 1Q0YH 5EU6E 1YEFL 4JDVA 4NHCH 1IAOA 3CJJA 5KJRL 2JJWA 4PMXA 1NOFA 4DM2A 2OL3A 1G6RH 3VA2C 4OI7A 3T0ED 4NT6A 5MP6L 4P4KB 1MLBA 1CF8H 4RMUA 3IVKA 2I60L 3L2MA 3K8KA 3KYNA 1FZKB 3RPIB 4U4BA 1WAWA 3DJ9A 3IDYC 4PJAE 4FLSA 3BZFA 3LQZA 3ROLB 5JXEC 4DGVL 3KLAA 4UINH 2GT9A 2D31A 4C54A 1VHPA 4JL2A 2W38A 3SDXA 3TJEL 2YIHA 1ZT4A 4HS6A 4WKAA 5A2JH 3BKYH 3MRIB 4K71B 3H7BA 4BQ8A 5L0QC 3NA9H 2IH3A 4Y19A 2BC4B 2HKHL 4OLZH 4XCFL 4HJGA 4L8CA 1E6PA 3BWAA 4QOKE 3D3VD 1RZKL 3HE7C 3QNZB 3NCJH 3EKCA 1HXMB 2BSSB 3ALWA 1R5WB 5C0FB 4TUJB 3HG2A 3U6RA 3ZJKA 2EDBA 5CPSA 1QFHA 2H45A 2NY3B 1KNOA 1IEAB 3QPXL 4FTVA 1P9MC 4P9HH 1GGCL 1MCCA 1ONQB 1NC2D 3DUUA 1U95A 5DUPH 1A3LL 5FIEA 3BAXA 3W25A 3QI9D 3TVMB 1LK2A 4Z7VB 3QB7C 3LX9A 1RVFH 2W59A 1RZ7L 2OTUB 2HT3D 1JBJA 5D7JC 4M62L 4NN6C 1B3XA 1R47A 3TT3H 1VGKB 4XRCB 3NACL 1WDPA 1XFPA 1B0GA 1PY4A 1XZ0A 4PB0L 3MJ6A 3L1OL 3SKUD 1XIWA 4FXGB 4RGMC 5HPOA 3EYQD 1T21B 3RGVB 3VINA 5H35B 2QKIA 4NKQB 2F53A 2PF0A 2DBLL 2E27H 2K7PA 5AYUH 1MQRA 3T4AA 1MUJA 5FYKE 1EDGA 4Y88A 2VXTL 1DWAM 4PUDA 1JNNH 3EOAB 4J3XA 4RGNB 2QHRH 4OM0H 5DT1L 1FA2A 3D50A 1HHGB 4XP1L 5C08B 1HQRA 2WUCL 3GSNL 3V7AG 1NARA 3W27A 3BX7C 2AK4E 2QV2A 1UD3A 3QEUB 4M6AA 2DLEA 3MRDA 4G80A 2J78A 1F6AB 4HS3B 1CL7L 4O2CB 1XH3B 1ODUA 4CMHB 3V4PL 3U9UB 4NPYB 4F33B 4JFZL 1CICB 5MEQB 1E28A 2B4CC 1QSVA 3EDKA 1RJLA 3W38A 2IH1A 5KSAC 4PJ5B 1T0NA 3MLWH 1L9NA 1SVZA 1Z0MA 2E6PA 5E6IA 4KAQH 4MJ5B 5ANMA 1ROWA 4JCMA 1N8ZA 4RQQA 1BM3H 2NNAB 3GSQB 1YY8A 3PF2A 1TETH 2V17H 1MFDH 2X4PB 3QUML 4U6XA 5C09D 1TZGH 1W9UA 1WBYA 5HDQH 3TWCL 2IFFH 3OAYH 4KUZL 2NY4C 2R0WL 3ZDZE 1BGAA 1S5IH 4DQOH 3OKNA 4NKIL 4KRUA 3DV4B 1EEUA 5DYOA 3ZE2E 1E4XH 2Z31D 4Y8AA 5IVZB 2Z4QB 2Y24A 1CU4H 4PN2A 3HUJB 4P5TD 1R34A 3V6OE 3NPSB 1LWRA 4OQTL 5B8CC 4NFCA 4I2XB 4TVPH 3S3SA 1UD6A 4QXTA 4PRNB 4BH8B 3KYMA 2WCSA 5FCUL 3P0YL 4WSKA 2UVEA 5T33H 4Z95H 3WUWA 1ADQA 5CEYA 3FRPG 3SCMA 5B4MC 1BF2A 2VDLH 2VABA 5LGHH 3AISA 3CXHJ 2XN9B 4OCRL 3IAQA 4IBLT 3K46A 3BISA 2W0KA 1UA3A 2VDPH 5GQBA 3BH8A 3T0EE 5I1GH 4PJGF 4FNLL 3MBXL 2PBGA 1QO3A 4HEPG 3L3GA 3VNYA 2UY7A 1HJXA 4H8HA 3VWKA 3RJQB 5CSYA 1MW1A 5CMAA 1U8PB 2CRYA 2P45B 5J56B 3KLLA 1NUNB 4NQCA 3O3BA 5EC1A 1YMMB 1GSMA 3U46A 3A24A 2OXHA 4LYPA 2P47B 2XWJA 3QFJA 2BNUA 1AD0A 2J6EL 2BRQA 5A94A 5JMOC 1DVFD 4U1MA 1P7QD 5GS0L 3D3VE 2YL5A 1NLBL 1RPKA 4JPVH 1BJ1H 3H42L 5EU3B 4Z2IA 1N4XH 4FHBD 5J06A 4FK9A 1A6ZB 3QP3A 2D3LA 3EZ8A 3ILQC 1HF6A 1BP3B 3KPSD 4N5ED 2WNWA 3QNYB 2V5CA 1QSEB 4DWSC 1Y6NR 5IB4A 5IB5A 1FJ1B 3ALFA 4D1IA 2FGZA 1QKZL 2B5IC 3QEQB 4PR5A 1JYWA 4QGTA 1FDLL 1OM0A 1YN6A 1S46A 1AD9B 3BGAA 5GJSH 1A7OL 3W0WA 3RX5A 4AEFA 2Y2WA 1M6OA 3QFDA 3BPCB 3Q1SL 1NOUA 5F7YC 4FNRA 2PXYD 1EVUA 3SOBL 1KXTB 1JPFA 3V5KB 3SY0A 1KBGH 2DPEA 1G1CA 1AI1H 1ZA3A 2C3WA 2VLLA 3ILPA 5T1MB 3EW3B 1K85A 5IHUL 4YHNB 2BSTB 3O3UN 1UG9A 3VXMD 4GKOA 5C0AE 43C9A 1GCYA 2CK2A 2BFGA 1OWQA 4H25A 5FUCC 2A6JB 3QXDA 4L9LA 2EEXA 4X6CB 3N1FC 1GQJA 4YBHA 3HN3A 3TTSA 3VFSB 4AISA 3H54A 1DQQA 3L95B 3N1QC 2C4FT 4PJIE 2AXFB 2FYYA 1RZFH 1CLYH 1NLDH 5E24E 1A7RL 2PF6A 2X41A 1Z5LA 4NZCA 4YGAB 4OZIF 1FIEA 5GISH 4G8GD 5LBSH 1BG9A 1H3TA 1LEGB 1OM3L 5JUEH 2GIYA 4UR9A 2VAAA 5A2FA 2ATPB 4X7SH 3CAFA 3CMOH 1N2RA 5FKAA 1FH5L 4X98A 2HJKA 3HRZA 4JO3H 3KJ4C 3TA3D 4KDWA 4G6AC 3BW9B 4Z7OF 5DHVA 5FHBH 4F3FB 4R5EA 2MPAH 4GAJL 5EO1A 4G7YH 3WL1A 2PWFA 4HD9A 2ED9A 1F42A 3QUKB 1UYWH 4J3UA 4WWKD 2YL8A 1NMCB 2I9TB 2W60B 2EEAA 3BXNA 3M8OL 1JTPA 2BCKB 4JR9L 5HSFA 3DVGA 1RFDL 1C7TA 2AJXH 2FX9L 5C09E 4GUPA 2BXZA 2OWCA 4Y4FB 3FRUA 4MAYB 5DK0B 3LKNB 3PGDA 4XNZC 5JHLH 1QHOA 5F6IC 1IM9A 1KG0B 4DVRH 4WU5A 3TGXA 4LCYB 3EFFA 2DKMA 1AR2A 3HPLA 3IFPB 3ARGC 5CFHA 5KVDH 4HX1B 2P5WB 3NCOA 2J8HA 1JWSB 4ACPA 4P59L 4JDZA 3WFHB 4MAUH 3UTTA 5BCAA 1BLNB 5DQ9B 3HMXA 4ODXA 3DDFA 3MLVH 1EHLL 3VXQA 3PZGA 3QUYD 2DWEB 3HZKB 5IB2A 4KUCD 2YD3A 5E8EA 1VFFA 4JQIH 1GHFH 2XUCA 3C5ZD 4KV5F 5IW6B 4JHOA 3WDPP 4FABL 2BHZA 5GGTH 1QW9A 4QXUL 4WNQB 2X7LA 4Z0BH 1I7ZB 3HG5A 5E5MA 1FFRA 2IQAB 2X4NA 3TN0A 3RMEA 4GRWE 1UGNA 3IFOB 4ZO8A 2ITDA 4C4KO 4E41D 3QT2A 2MOVA 4LKCB 3FB6B 3PHOB 2Z8SA 1E6JL 2WMHA 4CCEA 1S9KC 1AKJD 2Y7QA 2ICEB 1GOGA 4JPWL 1BZ9A 3HS0B 2G60L 3BQUA 3OZOA 1PIGA 2G41A 4IRJC 1KPRB 1CGWA 5I2IB 3OGVA 4Y5YA 3UDWC 3VMPA 3U7BA 4X6DB 3C5JA 4ZFOL 1OTUD 3LS5L 3RWCA 3DXAB 3NCEB 4RAVB 1UWGL 3NZ8A 4D9LH 3OKOB 4JZ5A 5HVFB 4LSTL 3OR7A 2PO6C 3O3DA 4OJFH 1NCAH 1QNZH 5LXGL 1F90L 4CU7A 3NFNA 4RBPH 3O6ML 5ERWA 5IMMB 3HC0B 4WHDA 3AIUA 1OAYH 3P4NB 5F7WC 3KPSE 3MRFB 3THDA 5DFVD 2WBWB 3FFCB 4WEBL 1WWWX 3MOAL 4NNYB 4JG1H 2PI6A 4WSJA 3SE4C 4C59B 3EJTA 1R5IB 4KK8C 1FZKA 4KXZI 2FB4H 3U2SB 4P23D 3RPIA 2F2HA 4N8VB 5GRUH 1Q6EA 4MADA 3TTQA 5IBUG 4HIHB 4QCFA 3ROLA 3TCLB 4E0RB 1MJJB 5D9MA 1AY1L 3OJDB 4WF7A 1E6XM 3SCNA 5IGXH 4TVPD 4CADB 5FM4A 2ZJSH 1UKSA 5IKCB 3AIWA 3MRIA 1M1SA 2CKNA 3KXFA 2V5RA 1B9ZA 2YKLL 3G08B 2BC4A 4EN3A 2ZCLH 3QQ3B 3ZTJG 1DBJH 3TBVB 1MFAH 1T0OA 4WUKH 3VMNA 1RK1B 3QNZA 1NM9A 2BSSA 1TVDA 1R5WA 5C0FA 1G01A 3TC9A 3AXIA 4AYFA 2GJPA 1ZS2A 4S1DD 4K2UH 4K94C 3S96B 1IEAA 3BAIA 1ONQA 5EORL 4WI6A 3TVMA 5M95B 2WBJC 4XPFH 2R9HD 4G8GE 4CN6A 1AQKL 2IMMA 5I19L 3VW3H 2CHNA 2VX6A 1Q0XH 2OTUA 4PRHE 3HNSL 1NCBH 2XG9A 3LB6D 2OM5A 1Q72L 3LSOB 3ARDC 4HKXB 3WFZA 1FFNB 4XRCA 2FE0A 3I3BA 4JM2B 4FXGA 4H8VA 4W89A 5D8ZA 3VFVB 1T21A 1QA9B 2PYED 3RGVA 3BUPA 1MWAB 4HGMA 5H35A 1RJYB 3E6FA 3VXTB 1CXEA 4YHKL 5C0CD 3SDAB 3SDCC 3QDGB 4W86A 2DM7A 1OAUH 5I6SA 3MYJB 3EOAA 4K7PL 1EFQA 1KEML 2W9LA 4NNPL 5J0BA 2JKXA 1I8LC 1HHGA 4O5LL 4LQFL 5C08A 2AJYH 2VQTA 3VJ6B 1MFBH 5D1XD 2DICA 4IS6B 1GGUA 2LVEA 1F6AA 1HIZA 5FKPB 1HIML 4O2CA 1V8HA 1XH3A 2JCCB 3VRIA 1W3HA 5F1OB 5AZ2L 4OD3H 3UTSD 3U9UA 4NPYA 3FMGH 3WSQH 4F33A 5F89B 2R8SH 1YQ2A 1PPIA 5D1QD 1CICA 3MGTB 4OSUL 5MEQA 3F5WB 3A4AA 3D85D 5A16B 2D3NA 3QULB 4HCRH 4UFKA 2HAZA 1AP2B 4ONHB 4Y4HB 5F9DC 1Y6KR 3D52A 2ZX6A 2RCSL 4BSJA 1MRDH 2FSEB 4A3HA 3T2OA 2P5ED 2XIIA 4MJ5A 1ZJBA 4WENB 3P30L 4D94A 1VJSA 3VCLB 1L0XA 4DO4A 2NNAA 3GSQA 3IGUA 1EUUA 4M3KB 5L2JB 1UJ3B 2PNDA 2X4PA 1XGZA 4E41E 4UQDA 4HW6A 4KC3B 4EUPH 1O6IA 3ALXA 4N8PA 3VDHA 1H5BC 1OAXH 2OJZH 3RVVD 4PJCF 3DV4A 2QEJA 5IVZA 5BZDB 1CGTA 2Z4QA 4PTTB 3HUJA 3OV6A 4YC2C 5FOOA 5DT7A 1QSZA 4I2XA 4MLIA 2AI0H 1O7DC 1U3HB 3G6LA 4ZD3H 4R7DB 5BXTA 4BH8A 4G7VH 2QQQA 5B39A 2FD6L 5FUOL 2IQ9L 4TSCH 3N1PC 3V0WH 1T5XB 3PWPE 4JAWA 4O51B 2XN9A 4J3WA 1BWMA 1H0IA 4JRXD 3EO0B 4J3VA 5KVFL 1UZ6F 1CD1B 3UTPD 2ZOLB 3DMMB 3SHSA 4IDJH 5BV7H 5F9OL 1JTOA 2J7FA 1L8NA 1H8NA 1Y7VA 2NQCA 4M24A 5E8DL 1YEKL 3N17A 5FYJL 1JDAA 5I1DB 5MEND 1TCRB 4Z7WE 3WHE0 2R1XB 3WFEH 4D3CH 2J7BA 1J0ZA 5IMKA 1YMMA 4G5ZL 4TVPE 5KSAD 3EYSH 3D0LB 3QCVH 1SJEB 2PW1B 4V2CB 3O9NA 5JBFA 4Z78B 4XP9H 1KIQB 1TPXB 4F9LC 1IGTB 4LK4A 4AQOA 5MHSD 4I0PB 4XNYL 5D7IB 1C92A 2CDGB 4PRWA 4P7OA 1F00I 1A6ZA 5JTWA 1KN2H 2NY4D 4M82A 4G6KL 4KVCH 3SUWA 3QNYA 1OT1A 1HEZB 1QSEA 2HLAB 4OKDA 1D3CA 3F4VA 2YK1H 1TQBC 2YRLA 1FJ1A 4PCTA 2MCPL 3BD5A 4ZSOB 1P53A 3QEQA 3EJZC 1ACYH 4LARL 4CCCA 3O2WL 1AD9A 1BYDA 1BQHB 3VSVA 4M5YL 3WF4A 3D48R 3LN9A 4YFEA 1OQOA 1V6XA 1MCDA 5IUSA 3BPCA 4DUVA 1Q9KB 3G6JE 2PYEE 4UDTA 3V5KA 2IPUG 3RVWC 1GPOH 4UCFA 2W5FA 5T1MA 4XPTL 2FHBA 2B1HL 1UEMA 1B3ZA 5A2BA 5C0CE 4YHNA 2BSTA 4MAZA 3N04A 4BCEA 2QV4A 2P46B 5I16A 2ZSVB 2QJDA 4UMGA 4F8TA 2J7LA 4Y89A 1PG7L 4Z5RB 2A6JA 1ZS8A 5CQ1A 2JFEX 3NMEA 4X6CA 3LXBA 1NCDL 2CIIB 5BMFL 1UWSA 4OLXH 2WKGA 3WUGA 1H49A 1DBAL 3CXDH 3VFSA 3L95A 1U8MB 2YSSB 2AXFA 5EU7E 2ICWI 3BPLB 3DETC 5D9SB 3UTSE 2WSKA 4UTBH 1I1AB 1ND0B 4Y2DC 5HHVL 4HBQA 3M07A 1RUKL 4HBCL 1A1MB 4HXAL 4JZJC 3MOBL 4YO0B 4HWZB 2DQDH 3MV7E 3AYRA 1E0OB 1P6WA 2DQXA 2VDNL 3BW9A 3GHEH 4P3DA 1T7VA 4YDVA 4F3FA 5T1LD 4MAVA 2DT3A 1CPUA 5L2KD 2P5EE 1FRGH 3QUKA 3EYPA 5ACZB 1EA9C 3KVQA 2I9TA 3BUTA 3ZDXE 5CEZL 1WCBB 2W60A 1KFAL 3B8SA 5I24A 4FP8L 3N9GL 3IRPX 2R69L 1IKNA 2BCKA 4ONFL 3LZFL 1MFCL 2IPKA 5IOPB 1R8LA 1T2QL 1W3JA 1IC4H 1IC7L 4Y4FA 5JXEA 4MAYA 4S0TD 5T3ZH 5DK0A 3LKNA 4WWID 2BVDA 5T3XE 3UJJL 7TAAA 1KG0A 3WDRA 4AZIA 5D7KD 3SE3C 1AQ0A 3MXWH 4LCYA 3WEXB 4EBQH 4EDWL 3IFPA 3T0AA 4HX1A 2P5WA 1JWSA 1BLNA 3SN6N 5E2JA 5DQ9A 5IVXE 3R06B 3G5YB 2DWEA 3HZKA 3B83A 1C8QA 4KZEH 5DC4B 4Q74A 2F7QA 3L9RB 2VVNA 1BQSA 5IW6A 3H7LA 4YK4C 2K7QA 2D9QB 4JRXE 4OQ1A 4WNQA 1DANT 1NGWB 1I7ZA 3Q5TA 3QGVA 1NBQA 2IQAA 3VG0H 2EAEA 3UTPE 1K6QH 1YHTA 4JQXA 1V08A 1U3ZA 5JPNB 5D9OA 1RZKC 4JHAL 1DWGM 3IFOA 1UA6H 1OAKL 1FQ9C 3FO0H 4N0FB 3ARDB 1NJ9B 3L3OB 1QFUH 4LKCA 3BZDA 3PHOA 4QFUA 3C8HA 3T65B 5MENE 1H3WM 3A0OA 4DKEL 2WK2A 5ADPL 4I8DA 3ZTNH 3HS0A 4DGIL 5L88H 3B4NA 2MSPA 4G6AD 1KPRA 5I2IA 3P2TA 4FQJH 4X8JB 5F1SA 4X6DA 1VAHA 2Y6SD 4S0SD 3MOQA 1I1YB 1T1YB 3DXAA 1WB0A 4M03A 3UERA 2Y06L 3OKOA 4ZAKC 5MHSE 4RFNC 1BG4A 1OLLA 4JFQB 4ISVA 1P69B 4NJAL 5IMMA 2GSJA 1BGXL 3HC0A 2EEDA 1AJ7H 3BSZL 3RRQA 1KJ3L 1A7PH 1SM3L 3P4NA 4BQ6A 1E15A 3MRFA 4L3ED 4WTXA 1KULA 3FFCA 2X1OA 4L5FH 4NNYA 2XQBL 1N5AA 5FGSA 1CIUA 3TV3L 1A14H 4YBLC 5E9DB 4W93A 1R5IA 1LE5B 4L3AA 4PEEA 1H41A 3ARGD 3DYOA 3FQNB 3BSGA 4JQVC 2WAGA 2BK8A 3U2SA 2CMRL 4N8VA 4DKFL 1IM3B 4HIHA 3CZNA 3TCLA 2XIDA 1MJJA 1R24B 4E0RA 3OJDA 5I1IL 2P8MB 2XQYK 4HK3N 4CADA 4LVOC 2V7HB 3HC3L 1LP9E 1SBSH 3VI4E 4EAMA 4PJ8B 1HKLH 4PJHB 3G08A 1OINA 3QQ3A 1KJ2H 1F2XK 3TBVA 2PC8A 2VDRL 3OJ2C 1RK1A 4BZ2L 3BMWA 4M7ZB 1OD7A 5KANI 5BWFA 1XGTA 3S96A 5HI4C 4P2CG 4XB3A 1V6WA 1AGCB 2CK0L 1Z0NA 1YPZB 2K9UA 2CBVA 2RB8A 4KKLD 2XICA 1DBBL 4IRJD 4TQEH 5CBEB 2HVKB 1FFPB 5SWQB 5DRXB 3LSOA 1J1PL 4XWOD 5FFLA 2XGIA 1FFNA 3WH6A 4V1DD 4DAGL 5L2KE 2WINB 4PREB 5DO2C 3VFVA 3PL6D 1QA9A 5HNNA 1MWAA 1RJYA 1KJVB 3WMBA 2FWOB 3VXTA 1CL7I 4WIWA 4XMPH 4MNQD 3SDAA 1EAPB 3QDGA 4YHLL 2IGFH 1WCQA 2ILLA 1LDPL 3MYJA 3QIUD 3GHBH 5MERB 4F7MB 5K59F 3U57A 4DM1A 3AIRA 1HYSC 2OW7A 3OR6B 3U4BH 1V3JA 2I07B 5I18H 1RV6X 3RQ3A 3VJ6A 4GOSA 4X7TB 5GRZA 1J8KA 1F6LL 4UOZA 4IS6A 3VI3E 2JB5L 5D7KE 2DT2A 1M7XA 3W53A 1REIA 2JCCA 5JR1H 5FCZA 4ZG1A 3C87A 4P5MB 1E6RA 2V38A 5F7UA 5F89A 4URTB 2DQTL 5B21A 1JGUL 3MGTA 3OF6D 5LAXB 3IK2A 4N0YH 3KR3H 3F5WA 5A16A 3SGJA 5IR1B 5DHVH 2XZCL 3Q6FB 4ONHA 4Y4HA 3WD0A 1U93B 4YXLH 3OGCB 1IV8A 3DLQR 4YDLB 2FSEA 1KGXA 4CD7A 5DD1H 3FOMB 1EK3A 2E8YA 3BDBA 2O9PA 3JV0A 5IXEA 3SCWA 3H9YA 2YXMA 1ZWIB 5L2JA 1UJ3A 4ZPVB 2WC4A 3D51A 3F65A 2HMID 3SDDC 2VLJB 4NZUL 3O6FC 3TZVB 2NR6D 1MWOA 2EIBA 2OQJB 3F5JA 1TMCB 3W37A 5BRZD 5BZDA 4BQ4A 4PTTA 3HMWL 5DC0A 1A0QH 2AJUH 3ECQA 1FV1B 2A73B 2BNRB 2LU3A 5L6YL 1QW8A 2NY6D 2VRAA 1U3HA 4PV8B 4PYSA 3HMXH 4R7DA 1XIWD 1N3NB 5EWIL 3TPKA 3WFBH 4OIBA 1F2QA 4LPXA 4AG4L 4HPHA 4LLWB 1EOMA 3ALPA 4QLKA 4OV6F 1T5XA 1T83C 5E70A 5SX4H 1IARB 1OSZB 3K4DA 4O51A 3POCA 5CGTA 5TE7L 3O9WB 4L3EE 1YQVL 3EO0A 4DGYH 1CD1A 2ZOLA 3DMMA 4JFPB 3ARTA 4CW1B 5CZKA 1OGGA 3C08L 1CDGA 1A6VH 2DTSA 5T3ZD 4NI3A 3UYOD 2VLRB 4HZAA 2XZAH 4U3CA 2Q7NA 5I1DA 1U8HA 1TCRA 2NY2C 3NVQA 2JELH 4JRYD 2R1XA 5LA1A 5I74B 1DEDA 1GOHA 1G0CA 4TRPH 3L7FB 2VLKD 1NGXB 3ZKMC 1X5YA 1Q1JL 5CSUA 2YFNA 1OARL 2QBWA 1DFBL 3D0LA 5CJ5A 1G7PB 1SJEA 2PW1A 4NJ9H 3B43A 2H6PB 3BPNC 1KIQA 4GQ9L 5I1KL 1EIBA 1FIGH 1MQKH 4GXPA 1V6UA 1IGTA 4B7LA 4S3JA 4GI9A 4I0PA 3SBWC 1NFDE 2FECL 4NKOB 3BRGC 5D7IA 2CO6B 5L7XH 2CDGA 4LU5L 1E4IA 4LEXL 1W0VB 5CXPA 3IDIB 4KHXL 1HVXA 2FEEL 3W28A 1MJUH 3UZVB 2HLAA 4J2XA 4EJ1C 4ZFMA 2G2RB 1GC1C 3MGOB 3QDMB 3OAYK 3NAAH 4ZSOA 1Z6JT 2DMKA 4DKDC 3V5HB 1AGDB 2NXYC 1JNHB 5HYQA 4X5WB 2XVGA 1CDJA 4MVBC 2BNJA 1A6TB 2OLHA 4V1DE 1BREA 1BVZA 5EUOE 1Q9KA 5F6HJ 1R6VA 3MRHB 4MNQE 5GGVH 1DWHM 2CR3A 1IILE 4EQ3A 3MODL 5CJQL 4WO4B 2FR4B 2ZSVA 1IQDB 1GGBH 4UT7L 1GHRA 3PQYB 4WKHA 1OSPL 4WI3A 1Y6MR 2VRQA 1MPAL 3ABZA 4HPOH 2CIIA 3PWJA 4XCNA 3KPRD 3HC4L 3HB3D 1N7MH 3K2MC 1KTLB 4XVTL 4HFUH 4WI5A 5FF6B 1U8MA 1NCWL 2YSSA 3MLYH 4LFHD 3QAZC 4M3JA 2QTEA 5F7KC 4X9IA 5D9SA 1B6DA 5BS0B 1I1AA 2Q8BH 5DHYB 2PO6A 4I48B 3ZYZA 2JF6A 1BAFL 4WIQA 1UHVA 1A1MA 4NQCD 2H9GB 4YO0A 4HWZA 5CILH 2X6MA 1KTKE 3SDXE 3KJ6H 1T1WB 1PDKA 2W9DH 3QEHA 3C9NB 5DJZB 5M03A 5IJKC 1BVLB 3P77B 4FQCL 3CH1B 1MCWW 1EQCA 4X0VA 5ACZA 2YRPA 5IG7B 2VUYA 3SE4A 1WCBA 5IBUB 4FZEL 1LL7A 5ABEA 1F4XL 2KDGA 5IOPA 1V3MA 3ISWA 5JW4R 5LKNA 2VXUL 4LSPL 4D6DA 2KBGA 3MUHL 2EE6A 5A8MA 3DSFL 2WIIB 5GGRB 3WMCA 2HA1A 3LRLA 1R33A 3L5JA 4YE4H 1OW0C 1I9EA 1I7TB 3MNVB 3WEXA 1ZVHA 3MC0A 5FYJU 4F7CB 3W0WD 5FUZL 2WZPD 5JW4N 2H1PL 1CGSL 5ISZA 3PP4L 3ULVL 4TNWK 5D6CB 4NZTH 3R06A 3BCDA 1B0WA 3O2VL 3O6KL 1QBLH 1A3RH 2J4WH 2Z8VC 3G5YA 3LOWA 3WY3A 5A69A 2ZPKH 3WXWH 5DMIL 3AI0A 4LSDA 4O00A 3L9RA 3S4SA 4ELMF 1CG9B 3QUMB 1R85A 3INUL 5C7XL 2APWA 1NGWA 4O58H 4AEHL 3K81A 3BVWA 5JPNA 2CLVB 4QNPF 1LK3H 1LO0L 4F7EB 4MLSA 3V0AC 5T3ZE 4N0FA 3T3PF 3ARDA 1I9IH 5FGCE 1UASA 1NJ9A 3AMGA 4LSQL 1JZ5A 1XT5A 1ETZB 1FPTH 5B38G 1JXJA 3T65A 2A2QT 1N6VA 4QEGA 4JRYE 4XP4L 2AKRB 3DX7B 1ISWA 4FFZH 2VLKE 3IDNB 4JFYB 1MCHA 4N0UE 4ODHL 5I15L 2EIZB 4KQ4L 1R7AA 5I73B 5TDNB 3AZRA 1K4CB 1NDGB 4G6MH 3L4UA 5E2VH 1I1YA 4FOMA 1T1YA 3REVB 5HJ3B 1F4YL 4YH6A 5EIIB 3MRGB 1E27B 4NWTL 4JFQA 4HJJH 5ANME 4CJ0A 1B1YA 2RAMA 1FGNL 4P4RB 2EDWA 5E08H 3GO1H 5AY7A 5DGRA 2UY4A 2PBOA 2O26U 4E9LA 2RJMA 1QFWI 3AAZB 1YYLL 2DOCA 1KC5H 1GOWA 2XACC 5E9DA 3WQ4A 5D2NE 1LE5A 4C7DA 1FVCB 3FQNA 3GK8H 4G6JL 1I9RL 3BCFA 3CZKA 4RA3A 1P6AB 4PJFF 1IM3A 3LVEA 1FSKC 1R24A 1IAII 4M1DL 5HHPB 1MIML 4X80H 1O0VA 5J12C 3MROB 1DLHB 1OGAB 2A1WL 2V7HA 1OT2A 1MFVA 5C9KA 1MQ8A 3ARBC 4PJ8A 2V2XB 5D2LF 1C1EL 2EXWD 5JO5A 2O5YH 4LLVB 3WJJA 2K3TA 1IT9L 4GG6E 4J12A 4M8UA 3KPRE 3SUUA 3VUPA 4S1SH 3ULSB 1RIUL 1FNFA 2IEPA 5J1TC 3ARED 2XTJD 4JN1L 4UUJB 2YL6A 1AGCA 4PRBB 1VFAB 2X1QA 3BRFA 3UO1H 1YPZA 5KG9B 1X4XA 3FRPA 4NQCE 5CBEA 4PGCA 1D7FA 2Y07L 1A4JB 2HVKA 1FFPA 5SWQA 5DRXA 3RNKB 4AD1A 3KWWB 4LMQE 4AEIH 1V0LA 4ZAKD 2WINA 3UYRH 3MFFB 4Z9KB 2WW8A 3VH8G 2QQKH 1KJVA 5CP3H 1HWGB 2FWOA 5GGRY 3QHNA 3O3AB 1CLOH 8A3HA 3BVUA 1RZJH 1EAPA 4P7QA 3JV4B 4U1LB 4WFFE 1V0NA 1IJ9A 4WW2C 3SCOA 4F7MA 5MERA 4RBPK 1MF2H 4PLNC 1BEYH 4PJGB 3CBWA 2I07A 1G7HB 4KDTA 1VGEH 4X7TA 5AWNH 2DQEH 4P4KD 1SJVA 2FCBA 3WL9B 4W7UA 4NSBA 1R0AH 1JJUA 3OIHA 4EVNA 1TQUA 1JNEA 3W0WE 3DURB 2YOCA 4GW4A 2NXZC 2XA3A 5LAXA 5IB3B 2QHLA 1N64H 4DTGL 3NCYP 4HJ0C 1DQML 5IR1A 3Q6FA 1JCKA 3WXVL 1U93A 1N5YH 1MREH 3B3IB 4AH2B 5ABDE 3OGCA 1P7KB 3EDJA 4TOYL 1NQBA 3UAJC 1YEHH 1MJ8H 4NC0B 3GMRB 4DN3H 5TH2B 5C0IB 2NYYC 4Z18A 4PUBL 3FOMA 1IL1B 4B53A 4PJDB 5HI4D 3HRPA 2EPLX 1AE6L 3NA4A 1ZWIA 1QVBA 3DUSB 3MLSL 4ZPVA 4L4TB 2NY3D 2E6QA 2E6JA 4KMLB 3ZMRA 2VLJA 1BLIA 2P48B 3RPKA 4F37F 3TZVA 1B4RA 1UCBL 4R97B 5DVMA 2NY1B 2OQJA 3LPWA 4K9EH 1KBBA 3IDMB 3IDXL 3IAPA 2AABH 3RBSA 1HOCB 4YUEH 3LQAH 4LLYA 2QHAA 2DIJA 4ZS7H 4TTUA 1XRVA 2VCBA 4N90D 1FV1A 2A73A 5DO2D 4AIZB 5KZCD 4PV8A 2OI9C 1G0YR 4ZS6D 5ID0B 2WVSA 4OCYH 2RQ8A 4FQXB 4HK0B 1N3NA 1QFWH 2FJFB 4UIKH 1S3KL 2ZCKL 4P8WA 3VSUA 2ZNWA 2MWCA 4LLWA 4RAUB 2IANB 2J88L 2P44B 3OAUH 1OSZA 2WPGA 3WNPA 2X40A 5IQ7L 2NY7H 3O9WA 2W9EH 1IGJB 4ZQKB 1WZ1H 3RWJB 3BKMH 1RURL 2NSXA 5GRWA 5J11C 3OKMB 4JFPA 3CHDA 3O2DH 4FQ1L 4JZJA 4LYQA 4OZHB 5C08D 1VBRA 3UBXG 2HTLC 1H09A 1D5IH 4OB5H 2ZCHH 4ACZB 4KY1L 4OZIB 1YEIH 1QX1A 1UKPA 1CYGA 3MACH 3MJ7B 1RU9H 4ZFOB 2X10A 4LGPB 2AEQL 5ETUA 4JVWA 3L7FA 4UOW0 4DK6A 1CICD 1PSKL 4IIQC 1I85C 2FO4B 4HT1H 1ITXA 1G7PA 3GM8A 1CBVL 2H6PA 4PJ5D 3AFLA 1JK8B 3O4OC 4GKSA 4B7IA 4KQ3H 3H3KA 1IBGH 1TJIH 5D7SL 1A1OB 5C8BB 1URLA 2DQGL 4NKOA 3CUGA 1J86A 4GO6B 3BUQA 4PD4J 3WKML 1RAMA 2H2PC 2HLFC 3AS0A 3SDDD 2XTJE 1W0VA 4G3YL 3IDIA 4K7FB 4UV7H 3BVTA 1RJZB 5ALCH 1K9FA 1CFQB 4ZMAT 3D5HA 1G9NH 3U4AA 1YJDH 3MBEB 5CLWA 4PP2B 2G2RA 3MGOA 3QDMA 4YNYB 3R8BB 2XZZA 1LEKB 1N59B 4RMVA 3V5HA 1AGDA 1JNHA 3KPQB 1QRKA 3CGTA 1MXGA 4X5WA 4PS4L 4R0LC 4XB8A 5INCA 1A6TA 1FGVH 1I3UA 4KZDL 1LO4H 3WE6B 2OW6A 3PHQB 3NCMA 4JFVA 5J4MA 2IXUA 4WV1B 4KWUA 4EXKA 1MCSA 1QYGL 4Q58C 5KSUA 1I8MB 4U0RC 3MRHA 4PTMA 3MJ9L 4JKPH 5D96C 5TPWL 4U1JB 4WO4A 2FR4A 2V2WB 5INDB 3WBAA 3PQYA 1AFVH 2Y5TB 2VITB 4K8RH 4M5ZL 5ITFB 4Q9QH 1KTLA 1OCWH 2IUZA 3R0NA 1MNUL 5FF6A 5K9JH 4XAWL 4NOFA 4YDKH 4OUEA 3N12A 1LO5B 1F3RB 1MCOH 1X5LA 5DUML 2NY2D 1IGIL 1X3DA 4HEME 2YLLA 5BS0A 1UWEL 3NCFB 5DHYA 3AIEA 4Z7QE 1HDMB 1A7NL 2H9GA 1N6QH 3A6CH 4LEOB 4MNHB 4Y7EA 5HDLA 3GH5A 3N06B 2DDQL 1Q4NX 4DO6A 2EE2A 2BRRH 1T1WA 5D8JL 4HC1H 4X7EC 5DJZA 4K3EH 3WF3A 5CUSH 1BVLA 1RUQH 2YMXL 3P77A 4FQIH 4FZ8H 3I6LD 5ICXB 3SIMA 3CH1A 2OP4H 3GIZH 3KLDA 5IG7A 1DWFM 4LCCB 3KDMA 4RX4D 4WFHD 2VDQL 5FYKL 3FTGB 1I1CA 5CIPH 1F3DJ 3GSNA 2YA1A 1R3LB 3B5GA 1E0XA 2R0LL 1ODZA 2E9LA 4R90H 4LVHC 2H8PB 4XXDB 4LF3B 4XMKH 3NCBB 2CUHA 2CLZB 2A77L 3F6LA 4Z7VE 4XBEH 5MEPB 1EMTH 2WIIA 3PE9A 5GGRA 3A47A 2BHYA 3AXLB 5HHOD 4U7SA 4XCEB 5BZWB 3QEQD 3U0PB 4QWWC 4RMRA 2F19H 2UVFA 3MNVA 4IMKA 3JVGC 5E1QA 4N90E 1B88A 2YD7A 2D9CA 3F7VB 4WVRA 3QBTB 5BXSA 4F7CA 1KN4L 1JYVA 6A3HA 3MZTA 5GRJL 2DQUL 4MQ7B 4JCLA 3VFWA 3CIVA 5D6CA 4I3RH 5H37G 4NC2B 2CERA 2GTZB 5M5DA 1CG9A 3QUMA 3ARFC 4H2CA 4FN0A 4GAGL 3QEGL 2PN5A 1T2XA 5CD5C 2ZXQA 5EZIL 5F7NC 2CLVA 5C08E 4F7EA 4WJXA 3GI8L 4YHOL 2XM2A 3WELA 4AMCA 5T1DL 5DWUL 3S5LG 3UJTH 5HYFA 5KW9L 3F58H 4OQTA 1KPVB 2AKRA 3DX7A 3HR5B 4NN5C 2EZ0D 3IDNA 4JFYA 4A4AA 2WHJA 1EZVX 2EIZA 3IJHB 4M93C 5TDNA 1K4CA 4QRUB 3EFDL 1YEEH 3REVA 1EXUB 4PJ5E 1L0QA 4JHWL 2C1PB 4GI6A 3V6ZB 3MGAA 3MRGA 1X5HA 1FH8A 4TSAH 5EPMB 4Z8FL 3JV5A 4OD2B 1OHQA 4P4RA 3O4LB 1CDUA 3QXAB 2OJEB 3NABL 1A3HA 3EJYC 3CPLB 5EU4B 4B16A 1JGVL 1EUTA 1PLGL 3AAZA 4MAYD 4ALAH 1CWVA 4O02L 5TJWK 4Q2ZA 3WIIH 3TESA 1HJUA 4U2YA 3HUJE 4KROB 3RIFK 1R7OA 1IVLA 4J4PD 2J6EA 5HPMB 3GBML 2DSUA 4I2XE 4UQ3A 3G9AB 4QTIL 2P5WD 1KTBA 5HHPA 5D72L 3MROA 4YXKL 1DLHA 1OGAA 5C1MB 3NIFE 1CZ8H 1JPGB 4MNGB 5D7LD 3T0XA 4FXKB 2V2XA 1S9XB 4JY5H 5H8DA 2J7DA 4LLVA 2R29L 3FO1B 2XN9E 3BXWA 5DK2B 1FFOB 5SV3A 3I9GH 5DRWB 3ULSA 3T3ME 4CGTA 1MFUA 4KTDL 4GMTL 4UUJA 1MY7A 4GS7B 4PRBA 1VFAA 1NMBH 4K7PY 5KG9A 3L3IB 4PJCB 4R4FL 3O3EB 5A6SA 5I17B 4OI8A 4A6YL 25C8H 1JRHL 3UCQA 1IRAY 2VR9A 1A4JA 4K3JL 4AZGA 1T83A 3WDQA 3RNKA 3OSKA 3KWWA 2Z8RA 4ZXLA 4NGHH 3M6DA 2JEQA 3I6LE 3MFFA 2WVVB 3DXAD 3CUJA 4KJWD 1W0WB 3V6FB 5J11B 3GXPA 1OBAA 3RWIB 4BJLA 2XIBA 2BVQB 2J8FA 3FB7A 3VFRB 1MCBA 3G6AA 3O3AA 4WFHE 4BFGA 4XVJH 4HIEB 3JV4A 4OV5B 1U6AH 4R2GB 4WDIB 1HH9B 5IVNA 3V4UL 3RY4A 4M7LH 4PJGA 1G7HA 1QSEE 3HI5H 3FFCD 4QRQB 2D7TL 1F5WA 4ODSL 3QO1B 4HKBB 1WIUA 2NZIA 3QEQE 2ENSA 3WL9A 3O0RL 3V8OA 3T2NH 4W81A 4YEFA 3CHEA 3ZJ7A 3DURA 4XPGH 5IB3A 1ZU8A 1YMHA 3RM4A 4GKNB 3FQTB 5C0RH 1UKTA 3B3IA 1P7KA 3V8CA 4JGUA 4J23A 2YN5A 1E6QM 5I71B 1TTGA 3GMRA 2WWMD 5TH2A 2VC9A 5C0IA 2WCAA 1ZGLB 4F9PC 1E6SM 4M9PA 4L29B 1IL1A 3K80A 2XPGB 4PJDA 4X6CE 2QADB 1S78C 3HE6C 5JA8B 1XF1A 4KKBD 4FF5A 4L4TA 4K8RD 4MA8H 2CO7B 2FH8A 2X4QB 1RZ8B 2MQ0A 1BFTA 2W0LA 5IBLC 4GINA 3MV11 5HI5C 4FFWC 3SCRA 5J57B 3VFPB 1MVYA 3IDMA 4FFYL 1HOCA 4J28A 3G6DH 3ES6B 5JA9A 1X6LA 4IISA 4ZNEA 1HP4A 1S7SB 4I3SL 4P49A 3G5VA 2ARJB 3TTYA 2AQ2A 4XB7A 3NSMA 3I2CL 4JM2D 5ID0A 2F5BH 1Z3GH 4FQXA 4HK0A 1G5AA 3MLZH 4TX6A 5DI8B 2FJFA 3VGEA 1LHZA 3BEVB 4QXGH 4EANA 4RAUA 2WM0A 2IANA 1A6UL 2J8UB 3SDAD 4EE9A 5MI0C 3TFKC 1IGJA 4ZQKA 3R0MA 3RWJA 5A6BA 3KL0A 2OK0L 2VZOA 2D0GA 3OKMA 3PGCB 1K3ZA 3C60C 2OYKA 2VDML 4OZHA 3BYTA 2VWEC 2DT0A 1T6WA 4ACZA 1HJWA 4OZIA 1VRXA 2FECI 2NXZD 4HGKC 2DTML 1UM5L 2E9BA 1P4BH 3MJ7A 4X6EB 4ZFOA 1W9DM 2R2CA 3MUY1 2P5WE 2AMGA 3LKPB 4JFFD 4UT6H 2KZWA 3IU3B 1ZE3C 4XVSL 2EKSB 1XF2B 3QCUH 1BVNP 4HFWA 2AOSA 4JJHA 1F02I 5GRVK 4OZFG 2Y25A 3O8XB 1F3JA 1W2KT 1JK8A 4K23L 4XV0A 4I77L 2R15A 1A1OA 3KL3A 4PMZA 4JZNA 1E40A 3D87B 3CZGA 3F12B 3QYCA 2JIEA 4JFEA 4K7FA 4DUXA 4F7TA 1LO3L 1RJZA 3MCLL 3CZSA 2E7HA 3P9LB 4ZUSB 1GVIA 3MBEA 4MXWH 4AZ5A 2ZKHH 1BECA 5LVEA 4YNYA 3GMPB 2JJSC 1NSNH 3H6JA 1QLEL 3AHVA 3KPQA 1H9VA 4LCWB 1VADB 5D1ZB 1WZLA 2GSGB 1JWUA 4XWGH 2V2TB 3WE6A 3JWOH 3PHQA 3C09C 2DJ4A 4WV1A 1UM4L 3ZKXB 2ORBH 1V7NL 2Q1EA 3DXAE 3GBNH 1U3HD 1JNJA 3L4WA 1I8MA 4UTAL 4FA8A 1G1YA 3S5ZA 5GXBB 5B38B 3PZTA 3JTSB 2J1KA 5IW1B 2VURA 4HPYH 3MV9B 3QUZC 4U1JA 4OZGF 4XNQB 4O9HL 4QRSB 2V2WA 5INDA 1E4MM 3SCVA 1Q0YL 4DEPC 4I5BA 4HMEA 4MYWB 4NHCL 2Y5TA 5E03A 5B3NA 4NN5B 5CCKH 5ITFA 3FFCE 2HTLD 1G6RL 4H20L 4B5EA 3DMMD 1X44A 5CZVH 2FX8H 1FYTB 2APTA 1LO5A 5D5ME 4EI5C 3HNVH 5AG8A 3RJDA 4UQ9A 1V3IA 5HI3D 4PGDB 3F5LA 2XV6B 1F4WH 3LKQB 2D4FA 4MNHA 4LEOA 1CE1H 4BZ1H 4UINL 4PJ7E 1T03L 4P5KB 5D70H 2EACA 1T66C 4P48A 1WBXA 4O4YH 4U1HB 3TH3T 5C3TA 3BKYL 5ICXA 3F8UB 1R46A 2WHMA 5HVGB 3NA9L 4MNLA 4CD6A 3VDAA 5DFAA 4OLZL 1NBYB 2AJVL 4I0PD 4LCCA 3FTGA 4I18C 3NUKA 3NCJL 4JFWA 1JTTA 1R3LA 1XEDA 1HHJB 4CMMB 2EC9U 4HA1A 2BV9A 2H8PA 4XXDA 4LF3A 4P9HL 2CLZA 5E6ZA 4PGZA 3ARVA 3KWXA 3QNXB 4PGBB 3A4WA 2WLZA 1WVZA 3D25B 1RVFL 3TO2A 3KYAA 4XCEA 5BZWA 3U0PA 3CFDB 5E5UB 5K9QG 4WHTB 3PZIA 3F7VA 4WCYL 1QNOA 1PZ5B 3M17B 1A2YA 5EH1A 2EJ1A 4ONGH 3S5YA 1YNTB 5DJXB 4MQ7A 2YPKB 5I66B 5D71H 4D6IA 4IJ3B 1ERNA 2GK1B 4Y0GA 2GTZA 5IFTA 4XZWA 4UILH 5AYUL 4Q9CA 3QDGE 4XI5D 2UV3A 1JZ3A 2E9JA 1YUHB 1JNNL 1QUNA 4QF1B 2QHRL 3MV8B 4R27A 5GHWH 1LDSA 3S34H 3RL1B 3KLSA 3TO4B 1XGYH 1PQZA 3VH8B 3L5WB 4HP5A 5GS2H 2J79A 3GJFB 1EEYB 4JGJA 3N85H 1HI6B 3OMZA 4AD5A 1QNQA 2JCCE 3VFUA 5DMKB 4TVDA 1FNEB 1KPVA 3HR5A 2OYPA 1YN7B 3HG4A 3QIWB 2R2EB 3Q6GH 1YYMH 1GGYA 3IJHA 4CRPA 4NBXB 3ULUF 2VXVH 4QRUA 4X6FB 3B9EA 5IFPA 4PUEA 4PJEF 1EXUA 1U3YA 2WWKO 1U8KB 2C1PA 1C8YA 3MLWL 3V6ZA 1H11A 2NX5D 1IKFH 3NN8B 1AGFB 4KAQL 3RTQC 4FNUA 1UCTA 1KIRB 4OD2A 1MCFA 1NMAH 1MRFH 3O4LA 2OZ4H 4QXWA 3QXAA 4ZXBB 1AO7B 1TVBB 1TETL 1FC2D 5CD3B 5IESL 2V17L 5EOQH 1MFDL 4MA7H 3K2UH 3CPLA 5EU4A 3AMLA 1TZGL 4YHZH 5HDQL 5I3DA 5HGBA 3ME0A 3EDDA 3VDCA 2EDYA 3QCTH 5KVEH 2V7NB 4RAHA 1KENH 3ZL4H 1UWIA 5TFSH 4TNWF 2LABA 1CU4L 2AJSL 2OSYA 3BFOA 5HPMA 1PZ2A 4X7FC 3FT4B 5F1NB 3W24A 1EGJA 5CZXD 2GK2A 2DQJH 1JPGA 4MNGA 4FXKA 3ARFD 4OT1L 1S9XA 2BVOA 3IKCB 5M7QA 4Z95L 3RKPA 1ZSDB 3PABB 3LXCA 5KVMC 3FO1A 2VDLL 5DK2A 1E4KA 1YDPB 2EBNA 5FYKU 4LKXB 2AK1H 5H2BB 1EAJA 4XNMB 3OLDA 3VGDA 4BUHA 2MJWA 5C07B 3IFLH 1U8LB 5IROA 3WUBA 3L3IA 5I17A 4TVCA 1NAMB 4XPAH 1ITCA 3TJEH 5DZLA 4OF5A 4NO2B 1IC1A 5MI0B 4X6DF 3C2SA 1T89A 5TF0A 5EFIB 4XCFH 2WVVA 2YD1A 4E5XB 1W0WA 5A8OA 3RWIA 4KRNA 1Q38A 4GO8A 2BVQA 5F7MC 2CESA 1QBAA 3S97C 3VFRA 3ZIZA 4P46B 3DROB 3VWJC 3X3FL 5D7IE 5EOCJ 1NCUA 3RZCC 1CQYA 4HIEA 4OV5A 4JPVL 3NIGE 1A3LH 1N4XL 1XH2A 2O92A 1HH9A 1PY9A 1WBZB 4UU9B 4GQRA 3PDGA 1C90A 2EIDA 1QBBA 4L8BB 4QRQA 4PBGA 1J8HD 1IGYB 1NGPL 2JIXB 3K4ZA 4M62H 4TUKL 4HKBA 4QHLB 2JIWA 2H2SC 1I85A 4TYUA 4ZSOE 1BTCA 5E9DD 1ZAGA 4HUUB 3BRDA 5IFAL 4M6OL 4XZUB 3L1OH 4OGYL 3DYMA 3HZYB 3MRLB 2DQIH 1MLCB 1NKOA 4IRSC 4MA1C 4Z7NE 3X14A 3FQTA 1AI1L 3OG4B 4KH2A 1JL8A 4OUUB 4PPTA 4PJ8D 1S9YA 2ED8A 1XD0A 4XTRC 3RVXD 1ZGLA 1EX0A 4OIIH 5JIKA 1FC1A 2WUCH 4L29A 2FJHB 2XPGA 4KI5C 4M7LT 4AZ6A 2AGJL 3J7HA 3WY1A 4IUGA 5J13B 1WDRA 4R0LA 4WHYH 4FMKA 2X4QA 1RZ8A 1FVDB 1X4YA 1BD2D 2XN1A 4Q6IB 3C09B 3ZM8A 1RUML 1RZFL 1SQ2N 3QH3B 3VFPA 3JUZA 4X4YB 5GISL 5LBSL 5I8KH 3ES6A 5JUEL 1RUAL 4KJQD 4JKWA 2OBGA 5IBTL 4CD4A 4LPYA 1XR9B 3IRZA 1S7SA 4X7SL 3AXHA 1GOFA 3CMOL 4JO3L 1TA3B 5MEOB 1ZA6B 4DEPB 2X4UA 5FHBL 2NX5E 5DI8A 4G7YL 4UOJA 3BEVA 4M43H 1UYWL 1CLXA 1NCCL 4ODBD 1LWJA 3QUMH 2J8UA 3WQVA 1HNYA 1JV5A 5HYSG 4MQXD 2P7TB 2EO7A 4KUZH 5I2UA 3PGCA 1NP2A 1IEHA 3IJSB 2X70B 5IFJB 5DURB 4QRTB 5HDBE 5JHLL 1WF5A 4OQTH 3FQWB 5CINH 4DVRL 2DD8H 2A6KA 1JUFB 4X6EA 4NQDB 4PLJC 4TPRH 1FG2B 4Z2GA 3SDYH 3LKPA 3B9DA 4KRPC 3IU3A 2F8QA 3QIBB 1XF2A 2EKSA 4MAUL 2VX7A 1AR1D 4U6TA 4OGXH 3MLVL 2DJSA 4YPGB 3O8XA 3GNML 1G9MC 2HT2C 4JQIL 1GHFL 3OGSA 3HE6D 4FNLH 2H26B 4Z0BL 3O81A 5C6WH 4LRNL 2P24B 5IBLD 1AHWC 1F58H 4LSSH 1Q6FA 1QLFB 1F45A 2P8PB 3P9LA 4ZUSA 4P3CH 4Q6YA 4L9DA 4NO0B 5GS2D 3RUGA 5FO9B 5A3ID 3GMPA 2Q6WA 4LCWA 1VADA 2C4FU 2DI9A 5D1ZA 3RKDC 1TNMA 2GSGA 2V2TA 5I5RA 3ZKNC 3AS3A 4K3DH 2HN7B 3V7AE 2BNRD 5JHDD 5GS0H 2R0KL 1B31A 4X4MA 4HUXB 1N82A 3IDUA 4NRXB 3S5LB 5B38A 3JTSA 5IW1A 4PMYA 3H42H 1OGSA 3MV9A 3TFKD 2LU4A 1MI5A 3BE1H 4PMRA 4ELMB 2HYMA 1WUNT 4OJFL 5KBNC 4XNQA 1QNZL 4QRSA 5JORB 4M1CC 4LPCA 2F1BA 1IGMH 2WZEA 5LJYH 3MRRB 4XPHH 5FDYA 3O9WD 3RO8A 1HWHB 1NEUA 4P9MH 3UC0H 2CEQA 1NANH 1QKZH 4AZBA 2CJUH 2GEEA 3MA9L 2APXA 1KTDA 4ENEC 1C5BL 5E9DE 1TQCB 4JG1L 2YUWA 1XF3B 2VLRD 2NMSA 1J87A 1HCVA 3SGDH 5B39G 3DDGA 4PGDA 4CUCA 5GRUL 3LKQA 3GBLA 1KB3A 2EXOA 2VDOH 1P4IH 2ESVB 3QWQB 5T5FH 5C0DB 4P5KA 2LU7A 3QUXB 2ZJSL 4U1HA 5B22A 3S35X 2JJTA 4PJHE 3V6OC 4Y2OA 3PTQA 1T22A 1QP1A 1A5FH 1CFSB 1E6OL 4BKLB 3STZB 1NBYA 1DBJL 1ZHNB 3UJIL 1EDQA 1MFAL 2FEDD 1TUXA 2X9WA 5C0BB 4WUKL 2J5LC 1A7RH 2N7AA 4K2UL 4CMMA 2J12B 3LH2H 4X7DC 2DRUA 3WQ5A 4QDMA 2F8XC 1OM3H 4KRMB 1UYQA 3S6CA 4PGBA 1YPZE 4Y16D 1OAQL 5FO8B 3WD2A 1T2JA 3T0EC 3QDMD 3D25A 1E43A 1CDHA 5TE6H 5FYLH 3VW3L 3NGBC 1Q0XL 3CFDA 3EYOB 1T3FB 3BPOB 4WHTA 1NCBL 3V0VB 1CCZA 3L4VA 2D2OA 5HBFA 1PZ5A 3M17A 4LSVL 5ICYB 5DJXA 2YPKA 5I66A 2QSTA 3QUZD 5ESAB 2F8OA 4QP0A 3K4AA 2BY0A 3MXVH 2GK1A 3M8OH 3FN9A 5D2LB 2Q86A 3REWA 1RFDH 2FX9H 4XXCC 1IZKA 5KSBE 3IU4H 4WO4D 1YUHA 1OAUL 3P0VH 5C0EA 1JZ8A 3PQYD 4QF1A 3MV8A 3THMH 1UUQA 3RL1A 1WQVT 3TO4A 1W32A 3VH8A 3L5WA 4FG6C 2AJYL 1HINH 4OKVA 3RPMA 3GJFA 1EEYA 1MFBL 5E0QA 2I9LB 1HI6A 1YY9D 2R56L 2XNAB 4ZTOH 3BAKA 2Z1SA 1XHGA 3OA5A 4TNVK 1DQLH 1FNEA 4FQQB 4JFDB 5BS0D 1YN7A 1U2HA 4OD3L 3QIWA 5DVOA 2O61A 2R2EA 3FMGL 3WSQL 5HGHB 5LWYL 2R8SL 4PJ9B 2HT3C 5JW4M 1E4LA 2YN3A 3RDTC 3VRLE 4JFOB 4HCRL 1YC8A 3AB0C 4FABH 1U8KA 3WUZA 2E7LC 4OTXH 4QXUH 4Z0XB 1S7UA 1WCGA 2DWDB 3LAFA 3NN8A 1TQTA 2BNQB 1AGFA 4DFIA 2X2IA 3PNWB 4YR6B 2F5AH 1UB6A 1KIRA 1U8NB 5BXPA 5AYBA 4W4NA 3BAJA 4I9WD 1AO7A 1TVBA 1E6JH 1NKRA 2OL3B 3TYGH 1UR1A 3HA0A 5FHAL 1EVTC 2ZXBA 4MJID 2G60H 3HMCA 1QTYT 3QDAA 3IVKB 1SR0A 1OAXL 4HDIB 3L5IA 5FA3B 2V7NA 3MLXH 2YD8A 2QR0B 4I4WB 1V0MA 3O2LA 3EOYG 3ZSTA 1KCVL 1H2JA 3RIAK 2BNRE 2VSCA 1JZ7A 4LSTH 3FT4A 5JQHC 5F1NA 1CGUA 2AI0L 3S98A 4ZD3L 1F90H 4HWUA 3O6MH 4S1QL 2WV3A 5EU6B 3IKCA 2VN4A 4Y19B 1FO0B 4JY4A 4RMSA 4TSCL 3V0WL 3PABA 4Z2JA 4H1LA 4NKDB 5DQJA 2FNBA 3T1WA 5F7EH 5JZ7D 3MOAH 2XSAA 3MMUA 4XC1H 1YDPA 4LKXA 2GITA 3BVVA 5H2BA 4XNMA 1CWYA 1KEGH 3CDGB 4HV8B 4FTVB 1U95B 1B30A 3R1GH 5C07A 5BV7L 1U8LA 1LK2B 2VLRE 3PP3H 2H41A 1AY1H 2P49B 2XZQH 4NUGH 1NAMA 1GOQA 2IXVA 4NQUA 3WFEL 4D3CL 4NO2A 4URIA 4PIRF 1DQJA 1P2CB 2Z31C 2CH8A 1HYRC 4KKCD 3E3QC 2XY1A 4AEEA 3D18B 3EYSL 4P5TC 2ENYA 3ZKQD 2MKWA 3AMCA 3QCVL 5EFIA 5EULV 2YPVL 3GNOA 3GSOA 3U30C 4E5XA 3RTQD 2QKIB 2F53B 1AXIB 4QOKB 4G9FB 3PTKA 3DROA 4F7PB 5A3HA 3FO9B 2IALB 4IOFD 1U33A 3CZFA 2BP3A 4MSWB 5GSRB 2PETA 1KN2L 2OTWB 1IAIM 2V9RA 4M4RA 5BRPA 4OZFB 4JDTH 4L8BA 1HQRB 4LLQB 5A8QA 3RIFF 4HWEH 2JIXA 3QDME 1RUPH 4QHLA 2YK1L 2G9HB 2XTKA 4V2XA 4G80B 5I1JH 4HUUA 5KS9F 4Y4KB 4HA3A 1Q72H 3QHFH 4XNUH 4X9YA 1UKOA 4XZUA 1UA7A 4GQPH 3HZYA 1HK6A 4H26B 1MLCA 5JIHA 1E28B 3SCSA 5GS0D 4LVNC 4JKMA 5KTEH 1OGAD 1GPOL 4NCC2 4U5IA 2BVPB 2YD9A 4OUUA 2B7DT 3AYSA 1DEEB 3BGFC 1DVFC 3OWEA 3PQYE 2IBZY 4HZ8A 4LQFH 2FJHA 4LHQB 4RQQB 3MRMB 1L0YA 3VTRA 4OLXL 4U3XA 4TSBH 3WN5B 3QDHA 4Y7MA 1FVDA 4BFBD 4Q6IA 3VGAC 3U4EB 3OKNB 5EG6C 1QBMH 4N5EC 3DX3A 2DYPD 3QH3A 5EO0B 3W39B 2VCCA 3MREA 4JO1L 4X4YA 5BS0E 1XCTB 3OHXB 3EJQA 3AICA 1XR9A 1FNSL 4U6HA 4GW5B 4HMCA 4MA3B 4MXQC 2RCSH 4P99A 2DQDL 3BAWA 5MEOA 4QXTB 1AC6A 1ZA6A 4GLRH 3V52L 3GHEL 4AIOA 1AQDB 4PTWA 1MY5A 2EPMX 2PXYC 1H8SA 5DFWH 1FRGL 2WP3T 3ZE0F 4QTHB 1G7QB 4RFOH 3SKNB 4WU7B 1ES0B 2WMGA 3W5MA 2D0HA 2P7TA 5LCVH 4ZFGH 1KGWA 2OTPA 3ORJA 5HYJD 3G5XB 2H2SD 1QHPA 2Y9RT 1AXTH 3IJSA 2X70A 2JB6B 5IFJA 5T3ZL 2DAVA 2FH6A 4QRTA 1IAMA 1P6FA 3QPQD 3V4VH 1UQYA 2FATH 5DJCB 3FQWA 1OD0A 1IFHH 1IEBB 4NFDA 5FYLD 3E6HB 3GB7B 3MXWL 3HJEA 2NTFA 1S7QB 5EC1B 4NQDA 1B0IA 4IRSD 1WFNA 1UJTA 5C8JA 1EFXA 3DV6B 1V02A 2LVCA 2ZG1A 4XGZB 3QFJB 4QRPD 5FUOH 2IQ9H 5F1KC 1NGYB 1TVHA 3TA3C 2JEPA 1EO8H 4CKQA 4YPGA 4V2BA 4U1MB 4UQ2B 1EOKA 5TF1H 3P11L 1WAAA 1FFQA 5CJXA 3TCXA 3QQ9C 4WWKC 2PTUA 4OCNC 2H26A 5JDSB 5HVHC 2I27N 5F7HA 1KXQA 1YEKH 4E2OA 1UA6L 5FYJH 2P8PA 1SZNA 3I84A 4RA0C 4F58H 3D1MC 4OCSH 3OLEA 2BDNH 2X2HA 5FO9A 4OF3A 3VG9B 2NY1D 3ZTNL 3QG7H 3ARYA 5JIPA 1BFSA 3ET9F 1OP5H 5L88L 4OFYD 3HAEG 3IJ8A 1DQDH 2HN7A 1EGJH 2GFBB 4K3HA 3DVNB 3ZYJA 5FXCH 4HUXA 4J3TA 5SV4A 3S5LA 3VKKA 1M05B 3MPCA 1E70M 4XUYA 4ELMA 3QUYC 2HISA 4G6KH 4S3KA 5JORA 4NXSA 2UY6A 2NZ9C 3C5ZC 3MRRA 3QI9B 4NO5B 4OCXH 1E9LA 3MLPA 3W2DH 5A6BD 5BW7A 4Y5VB 1LE9A 4J3OC 3OXRA 4A6YB 4L5FL 4DVBB 3O2WH 4XX1G 5C3LD 2GJZB 4M5YH 1A14L 1XF3A 3LD8B 2ZUQC 4JKLA 3GH7A 4PLJD 2WQ8A 4OOZA 4KRPD 3LMJL 1DR9A 3PZUA 5FKAB 2AJZA 1GZPA 4X98B 4WHCA 1Y18B 2E5EA 2N7BA 1MAJA 3HRZB 3PWVB 2ESVA 5C0DA 1JXKA 1OGAE 1M03A 1QEWB 4M56A 3QUXA 2HT2D 1PFCA 1SBSL 2EYRB 4DZ8B 4KKNA 1HKLL 1Z9SA 2RFXB 1HXKA 1CFSA 1ITBB 2VTFA 4O2FB 2OR7A 4C57C 5BMFH 1OB1B 4BKLA 3STZA 1KJ2L 3QWOB 1LO2H 1ZHNA 1XC6A 5A40E 3QDJB 3PXJA 4MDIB 2UY3A 4H8WH 2RGMA 5CLTA 2BS9A 2EDFA 4IRZH 4PG2C 2IAMB 1VFBB 1RMFL 4NDMB 3VGGA 1DANU 3WLBB 4KMTL 3MBED 3EO1B 3JTTB 5DFVC 5F6HI 4HBCH 5FO8A 3RKDD 4AQ1B 1HNGA 1KV3A 4AL8L 5IWLA 2HTKC 3EYOA 3ZKND 1T3FA 2VDNH 3BN3B 4TQEL 5A6AA 5DLMH 3V0VA 5ITBH 3ARPA 1G7JA 4EUPG 3MCKB 2A3EA 2EH8H 1TNNA 5ICYA 3UTTB 3BKJH 4ODXB 5CEZH 2IADB 4LPVA 3N9GH 4M1CD 5D2LA 5I75B 1K9DA 5BO1H 3VILA 3AMKA 3VXSB 1T2QH 2JALA 5C09B 2IGFL 4A2LA 4NZRL 5E94B 3DX0A 3TN0B 4PJGE 2EKJA 5BROA 4AY1A 2ZZUT 2ITDB 3UJJH 5KAQF 3LRHA 1JVKA 1DZBA 1ZGLM 1DWJM 5JXAH 5I18L 2AEIT 2PR4H 1HHKB 3FN0L 4EDXB 2I9LA 3MSPA 4PB9H 2WKLA 2XNAA 5CSZB 5FYLE 2Y7QB 5KZ6A 1TFHA 1XV8A 1D9KC 5JR1L 4FQQA 4JFDA 2XN0A 2WZHA 3MSGA 2R9HC 2ZUWA 3AY4A 5HGHA 4PJ9A 4X9HA 5LQBH 3SUTA 2WNGA 4UFHA 4N0YL 3C5JB 3KR3L 1GZJA 2X1XR 4JFOA 3LB6C 1B6UA 4MTVA 5TDPB 5B3JF 5CEXB 2ITCB 1U91B 4Z0XA 3X12B 1W2PA 3RVTD 2DWDA 2BNQA 1E4NA 3PNWA 4YR6A 5EBLA 1E4XI 5DD1L 5A6JA 3CU1A 3FN3A 1U8NA 3MA7B 4YDIH 4Q9RL 3HI6L 4DKEH 3QOMA 1CXIA 4YFLI 4YHYC 2IG2L 1D5BB 2ADIB 2A3AA 3D2UA 4HDIA 5FA3A 4OZOA 5D1XC 3PIQB 5CBAB 4I4WA 2QR0A 3S88L 4P7RA 4UZGA 5EU7C 4KK6D 4KI1A 1A0QL 2AJUL 3EUUA 3TYFB 1KPUB 3IETB 4YJZL 5D1QC 2Q3AA 3WFBL 3KXFB 1BGXH 1XGRB 5EU6A 1KJ3H 4N0CD 1SM3H 1FO0A 4EN3B 1UG6A 1FLRL 4XCCH 5CS7A 3EMZA 4NKDA 1Q9LB 1LL4A 3WYRA 4AT6B 4U1GB 2XQBH 2A9MH 4ETQB 4GBXC 4FG6D 4MNMA 4DGYL 3NPZB 3CDGA 2VR5A 1FN4B 4HV8A 2XM1A 3C6LC 3X17A 3BMVA 2Z91B 7FABL 3GJEB 1JNLL 4UQBA 4MHHI 4EI6B 3RP1A 4OZIE 1EEQA 1OVZA 3OJMB 1Z32X 5HYSB 1NWTA 3S4SG 3WIJA 3RVVC 2JELL 3RDTD 2W65B 1P2CA 3MJ9A 4JREC 4Z7OE 3AS1A 2UY2A 3VXMB 3D18A 2AV1A 2ZOKA 4NJ9L 4R4BB 4JG0H 1SJHB 1YEGH 2AERT 5BJTB 3E6FB 4QOKA 2A6DB 3H3PH 3RHWF 3SGEH 1FIGL 1MQKL 4G9FA 5C2UB 4HH9B 5DJ8B 2DLTA 2DM3A 4F7PA 5I1EH 4PCSA 3FO9A 2IALA 1G6RB 4MSWA 2FDBP 5L7XL 5GSRA 5E9AA 4JO2H 5E4EC 5C0AD 1LD9B 2B1AH 3O4LD 4YPJA 4W4OA 2CK0H 1HVQA 2OTWA 4HIXH 1EO7A 3IT8D 4U05A 2Q7YB 3RI5F 4BSVB 1DBBH 4OZFA 2ZUVA 4LLQA 5FYJD 1MJUL 3CXHK 4P7NA 4RIRB 2G9HA 3SKJH 1J9YA 4Y4KA 3NAAL 2L4OA 1CR9H 3VRIB 2ERJC 5I0DA 3LY6A 2FX7H 4WTZG 3ZE1F 4DAGH 4PFEA 3CK0L 4IDLA 4F15B 3D9AH 4KROD 4Y5XB 4H26A 3FJTA 4HWBL 4L8SB 3FO2B 3HPJB 4V28A 3QQ4B 4GRLB 4AIXA 2C26A 2Q8XA 5DEFB 4PYGA 1FZOB 2BVPA 1JIBA 3LXAA 5GGVL 4KV5E 4BQ9A 3ZDYF 2E7MA 4NFBA 1DEEA 3N15A 4QY8B 1BBDH 1GGBL 4WUUB 1HWWA 2DKSA 4BSWA 2OX5A 2GW5A 3MRMA 3GSRA 1IGFH 2RGLA 1N7ML 1CE6B 1HHHB 2X0HA 4HFUL 2XG5A 3WN5A 5LGJB 3UBXI 3CLEH 1D5MB 3MR9B 5AYIA 4OLYH 3RDKA 3MLYL 4LRIC 3U4EA 2W67A 2XSBA 3VIFA 2AXHA 2E7BA 3STBA 5EO0A 1U8JA 3W39A 2E8ZA 1VJZA 1KB5L 2EO9A 3GEWB 3U0TB 1VPOL 2Q8BL 1XCTA 4DN4H 3MUZ1 1FNAA 3OHXA 4W8AA 5DFTA 2HKFH 1FNGB 4GW5A 4LLDB 4MA3A 1RHHB 1JPST 5CILL 3BJLA 3THCA 2E9WA 2YC1A 3KJ6L 4CN4A 3TNMB 1AQDA 3KLHD 2D7NA 1PX4A 2O5XH 2EDJA 5B39B 4QTHA 3EHBD 4OZGB 1G7QA 1FH9A 3SKNA 4WU7A 3UTQA 1ES0A 1MSPA 3LRSB 1N0XH 3EJPA 4JPIA 4E41B 3K8LA 5ID1B 4U3HA 3VXOB 1QPKA 1BZQK 1ZL1A 4XP6L 3G5XA 1G84A 5E7BA 4M7JH 1GOMA 2JB6A 1A7QH 2Y23A 1KOAA 5EO9B 5CKGA 3S3PA 35C8H 4NQXB 5DJCA 3CFEB 3V6OA 5L6YH 1IEBA 1L7IH 1X4ZA 5ICZB 1HT6A 4YE4L 4YZFF 3E6HA 3GB7A 1S7QA 5IHBA 1B2YA 1R86A 5D6DA 5IMKB 2VZTA 5EWIH 2BFVH 3DV6A 1BFNA 2YEZA 4N42A 1S5HB 4XGZA 2HP4A 4B41A 2YDRA 1JF6A 1NGYA 5F9JB 1OCQA 1CEOA 4NZTL 2UWEF 1QBLL 2J4WL 2P8LB 3SO3C 4UQ2A 2ZPKL 1DJSA 5DS8B 4MB3A 3T0EA 2DSKA 2X05A 3WQ6A 3VXPA 3DRTB 4HULB 1U0QA 4PJDF 3C08H 1GOIA 2QADD 5JDSA 5DR5H 4IM8A 3NTCH 3WEOA 1LK3L 4YN5A 4P23B 4B50A 4HK3J 1I9IL 2A6IB 3MLTB 1R87A 2JE8A 4WGVB 5DA0B 1FPTL 1CDCA 2ZUUA 3QG6B 2AP2A 4FQ2H 5D93C 1Q1JH 1OARH 4MXQD 4HKZB 3O6LH 4OFDA 1U42A 3QZWG 4FFZL 2AXJA 1UD4A 1KLUB 3B9KC 2PWDA 5F88B 1HKKA 2DGAA 4GJTB 1D2KA 4G6ML 2GFBA 5IDIA 3CUPB 3DVNA 4UDTB 5E2VL 3BD3A 1R5VA 2FL5B 3D3VA 1M05A 4LU5H 3GMMB 4P2OB 1E4WH 5DJYB 4HJJL 5I16B 3O4LE 1QI5A 1NC2A 5I6XC 4M1RA 4L4VD 3QI9A 1BFVL 4NO5A 1ZS8B 5E08L 1CGYA 4R4ND 4Y5VA 5E2TL 2NY0C 2VZSA 3GO1L 2A3HA 5FYJE 3O41B 3CV5A 4A6YA 4DVBA 4OZHF 1GAFH 4D6HA 3KS0J 2GJZA 5T3XH 4MX7A 2E7LA 2V6HA 3EJSA 1R3JB 1NAMH 2YA0A 4NQVB 3A67H 5EIQA 3RA7H 4LIQL 4PRHD 5DD3L 4M1GH 4OLUH 3U82B 3VX1A 4L4OA 1KCRH 1Y18A 4HPGA 1KXVA 3PWVA 2DI7A 4OLWH 3TBSB 3MODH 1QEWA 5AEAA 3WNOA 1ZLSH 4PJEB 4P3DB 3HNTH 4MNGE 4YDVB 5IW3A 4UT7H 2EYRA 4DZ8A 2Y6SC 5ALBH 2RFXA 3O8XD 3QQ9D 4G8FB 4O2FA 5IMOB 1SY6H 1OB1A 1WO2A 2DH3A 1ZVSB 2O5YL 3QWOA 4PMVA 4XVTH 2Y1VA 3QDJA 4MDIA 2ZUMA 4Q7NA 5BQ7A 1XGPB 5HHXL 2IGTA 5AC4A 2IPKB 1GC1L 1QOKA 2LFGA 3IDYB 3TEUA 2IAMA 1VFBA 5GJTL 3WD5H 3MV01 4NDMA 4NXKA 2HH0L 3P0GB 3WLBA 3FB8B 3EO1A 3EDFA 3JTTA 4PJCE 3UO1L 3RFZC 3WF0A 4HUNB 5D1QB 3D85B 3E3QE 3JUYA 3H55A 3NOIA 4HZ6A 5L0QB 3LMYA 4X5XB 2CRIA 3MCKA 4HMDA 5F97E 3RU8H 3HE7B 1I3GL 4YQXH 4AEIL 1JPTH 1AGBB 2CSPA 2IADA 2QQKL 2XWTA 2ZX5A 2HRPH 1H0DB 2NZ9D 1GVYA 3W6LA 3MV9D 4FQLH 1KIPB 4B15A 1CLOL 1OPGH 3VXSA 1RZJL 3CC5B 5C09A 3WNNA 4RRPG 1T0MB 5E94A 2M2DA 4AYSA 1UZ6E 5D7JB 1MF2L 5EIVA 1KR1A 1BEYL 1KBKA 1B4JL 2CCRA 4NN6B 1KJMB 5DMJB 1VGEL 2YBRB 4XHJC 4EDXA 5FV1L 1HHKA 5AWNL 1FYTD 3BAYA 4RGMB 1KFWA 5CSZA 4RMWA 3H9SB 1R0AL 5BV7C 4WY7L 1EJOL 4YHGA 2A9NL 4APQC 2C7FA 3IDJB 2KZ1B 3PP4H 1QG3A 4KKLC 4PLKD 2XRAH 3P3YA 1WEJL 3O6KH 4JHBA 5IVXB 3WJLC 5DMIH 2YKKA 4KJPD 3AM8A 4H8UA 1N64L 5CEZE 5TDPA 1CDYA 5KAQG 4M6MH 2EH7H 4XWOC 5CEXA 1BOGB 1U91A 2ITCA 2LTQC 3VXRB 3BP5B 2RHEA 5E7FA 2ZWLT 3TIDB 3X12A 4TXEA 4LHJB 4JRXB 4AEHH 3PL6C 1MJ8L 4ISVB 4PRDB 5KANG 3PWPD 3TTOA 3CFKB 3SGKC 4BK5A 3MA7A 3BO8A 2L0DA 2FYVA 3EO9L 1I8IB 4LSQH 3QIUC 2X89D 15C8L 2ID5A 3DHJA 1XSJA 1D5BA 2ADIA 3RJYA 5EBAA 4YWGH 1SBBA 1NGQL 5DD0L 4J3SA 3MUAA 1N5AB 8FABB 2HTKD 1A7BA 3VIOA 3WHE1 4K9EL 1EDTA 5KSAB 3PIQA 5CBAA 3WKZA 2J7CA 1FP8A 3LQAL 1QWNA 2O9TA 1G9HA 1WGOA 1F4YH 2ZUXA 1P7QA 3TYFA 1KPUA 3IETA 4NM4L 2MMXA 1FL6B 3RBGA 4BQBA 2KUTA 4GAYB 5K33A 3S37L 4EOWH 3AOFA 2C3VB 3TBTB 1QFWL 2COQA 5C92A 1XGRA 1TJHH 4RMTA 3CFJB 2NY4B 2CLRB 1C3FA 4L4VE 5EZJB 1JGLH 4PJBF 1Q9LA 2YD6A 4AT6A 1ZBVA 2W9EL 1UXSB 3W11C 4ETQA 1E55A 1XGTB 1IAIL 3BKML 1FN4A 3FZUC 2J62A 5BRQA 3TO4D 3O2DL 5GRXG 3CHCA 2IPUK 5B8CB 1U8IB 1D9KD 3QWRA 2Z91A 4XH2B 3GJEA 4H88H 1OGTB 3PBGA 2BY3A 2HMIC 1D5IL 4OB5L 1UWUA 4EI6A 3WH8A 2UZIH 3AIVA 2P42B 3E2HC 5HYSA 1MIMH 1MVUB 2NR6C 3CSPA 1H1NA 1WFUA 2FBOJ 3UTZB 3FXYA 3MACL 4GIAA 5EMYA 1DCLA 1RU9L 3QIWD 2W65A 2DLIA 5E95B 4NN7C 3LDBC 1E73M 1C1EH 4TULL 3VXMA 1K2DB 2C3HA 4HT1L 4WW2F 4R4BA 1HKIA 3WIHL 1IT9H 1SJHA 2NY6C 5BJTA 3IYLW 2VC2H 3VFGH 2A6DA 1XIWC 4KQ3L 1E3XA 4HH9A 5DJ8A 1IBGL 1TJIL 2AW2A 3AJ7A 4JN1H 1G6RA 3EIFA 3BDYL 3FONB 1A6WH 1LD9A 2J75A 4ZXBD 1AO7D 3B2UD 3BUDA 4UV7L 1OY3B 4X8XA 4BSVA 2CPUA 2Q7YA 1FYHB 1G9NL 1YJDL 1OIFA 1MCRA 4RIRA 1CS6A 4LCWE 5CJ8A 3BEWB 4MS8D 3SO3B 3IB4A 3S36H 3MRPB 6FABH 5T1LB 5DMGD 3WO3B 1FGVL 5C71A 4Y5XA 1LO4L 4PMUA 4L8SA 3FO2A 1I75A 1BJ8A 3HFML 3HPJA 1WT5C 3MV7D 5H94B 4PMOA 3QQ4A 4GRLA 4JVUA 3UESA 4GO9A 3WCYA 2GTWB 5DEFA 4CJ1A 1FZOA 1VEPA 3MV9E 3I50H 4DWSB 3JXAA 4FNQA 4CKVX 3GZKA 4QY8A 4TN9A 4GBXD 4W88A 2F1AA 1N0LA 4WUUA 2B5IB 3WH5A 3HAEB 5E6IC 5EOTB 5AYQA 1AFVL 3C6LD 1F3DH 2YUXA 4Q9QL 1CE6A 1HHHA 3GUTB 4Q0XH 1U58A 5EZOH 5LGJA 5TQ0L 2R4RH 1S7VB 4YDKL 1D5MA 1FYTE 3MR9A 3WIFB 1MCOL 1PKQE 3WO4C 2D7QA 5T3XD 3PP3K 3GXFA 3U0TA 1HCFX 3WXVH 1FNGA 4NBYB 3H0TB 1X5GA 4LLDA 1BIHA 5D2NC 5E8PB 1RHHA 1N6QL 3K8MA 3BAEL 3TNMA 4HC1L 4K3EL 4U49A 3VFTB 4FZ8L 3QJHB 1AE6H 4ZO9A 4OZGA 2OYLA 1R3HB 3NBNA 3MLSH 4P46D 4BF7A 3MLRH 3LRSA 1FAIH 4KJYB 4RGOH 5J3HC 4E41A 4DK3A 2YZ8A 4CU6A 5ID1A 4ZE5A 3SCMC 2PTTB 2NW3B 5E56A 3VE0B 3VXOA 1UCBH 1MHEB 1KCUH 4R90L 3NDYA 2BZDA 2DL9A 4ACYA 1WDQA 4XMKL 1UOKA 1E72M 3IDXH 2AEPH 1CFNB 3HB3C 3KJ4B 5EO9A 5JMRA 3A6OA 3OGRA 1IGCL 1A9EB 4U6VH 4NQXA 2D22A 3CFEA 1P4LB 1U8HB 5HHQB 5ICZA 4X6BB 1HH6A 2F19L 3IJ9A 3DSNA 2PWHA 2VSDA 3VWKC 4BK4A 1CLCA 5F1IA 3SJVD 4O2EA 1J10A 1NEZG 1WK0A 1S3KH 1S5HA 2IBGA 4HXBH 4P8UA 5FECA 4JANB 5F9JA 4E42B 3S9DB 2P8LA 3AHZA 1KQYA 3DYPA 4I3RL 1HZHH 1RULH 1I1XA 3U9PH 1RURH 1WIPA 4L3EB 1XCWA 2VKWA 5DS8A 2A3CA 4ODTH 4XNZB 5F9WC 4FQ1H 4Q7DA 3DIFB 5F6IB 1JNDA 3FT2A 3DRTA 3VDBA 4EUPB 2NY5C 5HY9B 3A23A 1VEMA 4PLOB 2QLYA 1HL8A 5IEKB 3POHA 2OL3H 2PUQT 3ARGB 3WQ8A 1CNVA 4P23A 3GSWB 2A6IA 3MLTA 2EDDA 1HSAB 4HKJB 2WUBH 3QG6A 3F62A 3T8XB 3F58L 4AY0A 2VISB 4HKZA 4LASL 3WFDL 1KTCA 5HYQB 1NAKL 3MI6A 3HHRB 1J01A 1KLUA 5F88A 6TAAA 1J05B 2QMJA 2DQHH 1YEEL 1JD9A 3CUPA 4G6FD 2C9AA 2FL5A 5CGYD 2J3SA 3GMMA 4MCZA 1FO0H 2GYSA 4P2OA 1W1PA 5DJYA 3JZ7A 4TSAL 2J8UF 1OP9A 2J2ZA 4RFEA 5K59E 2ZSWB 1AO7E 4UNVA 1BZ7B 3PWJB 4U5KA 4XCNB 1J1OH 1T6VN 4HSQA 3KZSA 3O41A 2VH5H 4LMQI 4IRJB 4L9LC 3FHQA 1RIHH 4ALAL 4DO5A 2F7OA 2XKNB 5DURD 1ZXQA 3LN4B 1G7MB 4WGWB 2HJFA 5DJ0B 1GJUA 3V7MA 1SMDA 3EMCA 1TLKA 1R3JA 3T0DA 2VUOA 4H7VA 2XI9A 4NQVA 2PO6B 5IT2H 5ENWB 2PYEA 1JF5A 3LEYH 4NQDD 4LSRL 4PTUB 4F57H 1ZGLP 3WFLA 4J8RB 3TBSA 1CFVH 3QIBD 3CU7A 4NQEB 3SE9L 4PJEA 3QEHB 1OTTD 3VMOA 1CZ8L 1GCFA 1U8QB 4OGAD 1CENA 3QIUB 4NWUL 4G8FA 1OIMA 5IMOA 4M5ZH 1ZVSA 1CFTB 3IXAB 5IFHL 4CD5A 2EXYD 2CKRA 2VZUA 3VRJB 4G43B 2WB5A 3ZR6A 2JTDA 2ARWA 3FB5A 3Q48A 1XGPA 3I9GL 2EO1A 6CGTA 5DUMH 3FNDA 5I9QC 2W63A 1O5DT 4OZFH 1R3IH 3MMDA 2GDUA 1UWEH 4OF7A 3WEZA 1YNLH 1NMBL 3FB8A 2GJJA 1AXSB 4NO0D 3RUGF 1C93A 1UWQA 5D1QA 4N9GB 3RWHB 1JI2A 3B9KD 3D85A 2DDQH 3DUHA 25C8L 1W9BM 5EA0H 4UNIA 4XNXH 1G94A 1FP5A 4X5XA 5HYIA 2VRKA 1YC7A 5D4QA 1OP5K 5I23A 3UETA 1GQIA 2P5EA 3HE7A 3NSXA 3BLPX 5ISZB 1F8TH 1AGBA 2X2YA 4PGEB 4KK9D 3SCQA 2VDQH 2P43B 1P9MA 43CAB 3CHFA 3NFSH 1H0DA 4J1UB 5TQ2H 2R0LH 2YZ1A 3S4SB 1KIPA 4MDPA 1EHAA 4HOXA 2WBJB 4WI4A 3CC5A 3B9VA 1UH4A 4ORGB 4XVJL 2ZOXA 1T0MA 2NY0D 1KCSL 2EXWC 1U6AL 4LNRB 4JZOB 5D7JA 2ZX8A 3WL0A 4M7LL 1KJMA 4IHOB 5F96H 2YBRA 5BRZB 3TONA 3AREC 5EB9A 1J5OL 2XTJC 3WBEA 5CPQA 5I1HL 4HLJA 2VR4A 4JJ5B