7CGTA

Rameb complex of cyclodextrin glycosyltransferase mutant
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 228
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 7cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 7cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 7cgtA01
2FB4L 1KXTB 4XCYB 4P3CH 2J25A 1L7IH 1HI6B 5C0CE 1XH3A 1AD0A 4J3UA 5ABDE 5M95B 2JJTA 5C09B 1MCRA 4RFEA 4MMZC 3QDHA 4M48H 1XSKA 2VN4A 1NGXA 3QNYA 2YL6A 4M93B 5JXAL 2JEQA 4FZ8L 5F97E 1FNAA 1MPAH 2UWEB 1NCWH 3MRJA 2AQ2A 5DFVD 1JPST 4XRCA 4JO2H 2BVPA 3L1OL 3CC5B 1TTGA 1VRXA 4HZ8A 4L4OA 4IDLA 2K3TA 2VVSA 3TN0B 2CO7B 3EOYG 4YHLH 3VWJB 1N2RA 1C12B 5E6YA 3RJQB 2ZUXA 2D4DA 4F9JA 1Q8MA 2P43B 1OM3L 2Y4SA 3GXDA 4W68A 4MWFB 4NT6A 1KFWA 4POYA 3P9LA 3NIDE 4QLLA 3HC4L 2HKFH 5BMFH 5CGMA 4NRXA 5D1XB 3TFKC 4JFYB 2B5IB 2WUCL 2YBRB 3CMJA 1VB9A 1OP5H 1W8OA 4GQQA 1DQMH 1INEL 5IV2B 1VENA 3PQYA 1BQLH 1JG9A 1FGNL 3F6IA 4LHJB 3L4ZA 3F7PC 4XNUH 3CUIA 1CFQB 4MXQD 4JGMA 2EXWC 4IHOA 4MNGB 4DUXA 5DRWB 5DFAA 5TQ0H 2C9AA 4GMSH 3VUPA 3BEVB 4NZTH 2LABA 3AS3A 4HBCL 4IMLB 3QEQA 1EUUA 3DROB 2FJGB 3U6RB 4LLMB 3QT2A 5AUMB 1OM0A 3EJTA 3RTQB 2UY4A 1DBJH 4RIRB 4TVCA 4RRPA 4HIJB 1PDKA 2GTWB 4NJAL 1HILA 3DX6A 1J8KA 4MS8D 5LGHL 1V05A 4Z7NF 2E7HA 4JB9H 3V5KA 3L3HA 2DI7A 3MV8D 1B3XA 1KIQA 3MBEB 2VZOA 3Q2CA 4PY7A 2Y1VA 1REIA 4U0RB 2H26A 3TPUB 5KS9E 3E8UL 3HG1A 2NLJB 2Q87A 1PBGA 5ACMA 4M61B 1CBVL 1MIMH 1MLCB 1KIRA 2XZCH 1EJOH 4BK4A 4RE2A 5DUBA 3K46A 1OLZA 1J9CT 4LARH 2IBZX 3B2VH 4L8DB 5ENWB 3TN0C 4GBXA 1PFCA 3KL5A 5BZWB 4UQEA 2CK0L 4EUPG 3TBVB 2XGIA 2VKWA 1W9DM 4M6AA 2DTMH 3D0VA 1NBZA 5GISH 3H3KA 1AQDA 4KMLB 1CDYA 3MROB 1DE4A 4QCFA 3NABH 1R3HA 2GITB 3OAZK 5D1XC 1U3HC 3ZJ7A 2QHRH 4KV5F 4C4KT 3IXAA 5J1AB 2HKHH 3L5XL 3LEVH 2YD6A 4OQTH 4CAGA 4Y4HD 3ARDA 4U3XA 1V3KA 1UCBL 4E42A 5KZCD 5D7LB 5IGXH 4NQUA 4YHPB 5AWNH 2DYPA 1DZBA 3VXME 4Y5XA 2CETA 3ROOA 5FXCH 4NN5C 3MFGB 5FM4A 3CDFA 3GM8A 2CSPA 2R1YB 1JZ4A 4FNQA 5ITFB 2QR0A 2VSDA 3B8YA 4FTVB 4Y4KC 3RFZC 4KZDH 2PYEE 4UT7L 3TV3L 3AIEA 3WFHA 3CPUA 1OCWL 3OAYK 4LSTL 3SQBA 4AEIH 2FE0A 3BJLA 3H6JA 3WJJA 4EBQH 3RIAF 1AO7A 4L3EB 1KGUA 4XMLL 5EH1A 4DWSD 1FH7A 3HZ3A 1MWAH 1UYWL 1KGWA 1AGDB 3VGBA 3QPQD 1MYRA 1ZVSB 2W66A 5LCVH 2EYSA 3NACL 3AAZA 3P40A 4H25B 3EYSL 5HGAA 5INCB 1GOWA 1EBAA 1GQKA 4HEPG 3QDJE 3RX8A 3QR2A 4M1RA 3MLVH 2X44D 2VX6A 2VDOL 3MTRA 3CFKB 4CRPA 4JJHA 3UPRA 5CWSA 2CHNA 1LO2L 2MCPH 3B5TA 4CD6A 1L0YA 1MHHA 1N0XH 2ERJB 2BSRA 4EDWH 1AQKL 2V2XB 4UIKL 5MENA 3QUMH 5FKPA 3UMTA 3DYPA 1MJJB 2BK8A 5DRNA 3VE0B 4JPKH 5J11B 4HF5L 2NY5L 5JBDA 4DK3A 2JJVA 4J1UB 1E6NA 2V2TB 2FBJL 2PTUA 3QPXH 3O6FC 3IDXL 4FTVE 1QR4A 2HT4D 5EN2A 3RWDB 1GPOH 3RZCD 3MUGB 4X6DA 1KIPB 3G5YA 4ZUSB 2OK0L 3ZM8A 3RVXD 1BG9A 4JY6A 4HPOH 4QXWA 1C08B 3SO5A 3KLHD 5JPNB 1LO3L 4HIXH 1MPAL 2W0KA 4WW2A 1LMKA 1AXIB 1T6WA 3H9SA 1HJUA 4QY8A 4U1KB 4MDJA 2V5YA 4P4RA 3MRQB 5EU5A 3HUJB 4G9FD 2B4CC 2NW3A 4X7SL 4OIFA 3WF1A 6A3HA 2X9WA 1ZLWK 4ODWA 1WBYB 3UPCA 3VFSA 1OD8A 2O5XL 3BXNB 4I1NB 4KJQD 3IJSB 5DS8A 1SBBA 2OTWB 1ZSDB 3IS1X 4OGAD 2QSCH 4M7LH 3VFGL 3MRHB 1DEEA 4XC3L 3SDXE 4OFYA 4AH2A 5IMMA 2APFA 1YEEL 4KKBC 4L4TB 2K1MA 4OZGE 4WIQA 4AG4H 4UILH 4PMZA 4V2BA 2VLRB 5I17A 4ZFOB 5C07D 4NXSA 4NUGL 2X2HA 2PBOA 4XNUL 1QNZH 1HZHH 5IB2B 1IKNC 2OJZL 3TZVD 4XVJH 4I48A 5BZDB 2BCKA 3NN8B 4GMSL 2ERJC 3DX8B 5EBWA 5TDOA 3UO1L 4EQ3A 1HWWA 2BRQA 3CLWA 1F3DJ 4Q9CA 4TRPH 1R47A 3RBGA 3ROLA 4HLZG 4P5TB 1PJ9A 2EDKA 2VXUL 1A7RH 3GXMA 2YFOA 1X5KA 3V2AR 4RFOH 3HI1B 4PRID 3SQOH 2WVTA 4H7VA 1DBKH 4F37K 3PGCB 5D70H 3IDNB 4LSSL 1TQVA 4GRWB 4NZUH 2F5BH 3AREB 4Q6YA 3TYFB 1S9VB 3LN4A 4NN6C 1ZHLA 3K8MA 3GGWB 3T3PF 4M1GL 2GTZB 3BPNC 5B8CC 3MFFB 2ZUTA 4NSKA 1QYGH 3IDYB 2A83B 4M7JL 4R8WL 5C3TA 1A3HA 4OIAA 2R56L 5I1HH 3PN8A 4DTGH 4XVUC 4ENED 1RZFH 2WSKA 1ZEAH 1U9KA 2HG5B 2OCFD 4RGNE 5A2BA 3LRGA 3C5ZB 1AKJB 2I9TB 1GVYA 1PS3A 2PXYD 1JK8B 4LASL 3NFSL 4G8IB 1OAQL 5D1QD 3VDAA 1KWGA 2VVNA 4HV8B 2X1OA 2LFGA 4U31A 4YXKL 9CGTA 4ZD3H 3PNWB 3I6LE 2XPGA 4XPAH 5KSBF 4BZ1H 3BESR 2J7BA 1U8QA 4X4ZA 2Q86B 1CFNB 2P8LA 2Q6WB 4QRRA 1TJGL 3QCVL 4LCUA 3X13B 4NQEB 1SBSH 4XAWL 3F4VA 1E4WH 1KPRB 4BFEA 1CLXA 4YHKL 4K2UH 4N0UB 5D8JH 3D52A 5DHYA 2DDXA 4UR9A 1PLGH 1MOEA 2SEBA 1YY9C 3ZKMC 3L3DA 5M3WA 4JREB 3K7UA 1U33A 1FFOB 1RFDL 1UJ3A 2CKBH 4LK4A 4XX1G 1DUYA 2HLAA 2VH5H 4HZLB 4RNRA 4X6DF 3WKMH 4KKAD 4PJ9A 4FNRA 1TZGH 2PR4L 4X8XA 3V6BR 3ARFD 4XZWA 1FBIL 2XVPA 4PJ8B 1AR1D 5GZOC 1R0AL 1FNFA 4AIXA 3MLTA 5C08E 1E3ZA 1MJ8H 1CN4A 3P4MA 3QXVA 5CLTA 4OD1L 1MVFA 5E8NB 4WW2F 3FN9A 43C9A 3GEWB 2PO6A 4D6IA 3MLRH 1KBKA 4WDIA 1FVEB 3O3EB 2FX8L 3BP7A 4W4NA 4LSDA 3HG4A 2ESVB 4Z7UE 3CFCL 2F19H 2V9QA 5HD8C 1I4FA 4P59L 1D5BA 2H45A 1RVFH 3IJYB 3C5SB 3QIUB 1BQHG 3MOBL 3W38A 3C5ZC 1RI8A 4XP9H 2EBNA 4AQ1B 5D7JA 5DJ6A 1I9EA 3VIIA 4WI5A 2R8SH 4OFIA 3WV0A 4EDWL 5IEKB 3UR8A 2BRRL 2YEZA 1CDBA 4AD0A 4U1JB 2OLHA 5BOZG 4IRSB 5CS7A 1NBVL 2DQGH 3BE1H 2WIIA 2C4FT 2DM7A 5SV3A 5FA3A 3VWKC 5IEHA 2IBGA 1IGJA 4XGZA 4R6UA 3QA3B 1CU4L 1E43A 1RK1A 4PJAB 3KS0J 4PJCA 1IM9A 2BJML 1OB1B 3D25A 4LL9A 4XBEL 4XVTH 4HKXB 2WUBH 4XTRC 3PQYD 2D9QB 3QJFA 1T3FB 4EXPX 1QVOA 4N8VG 4QNPE 3MXVH 1INQB 3O4LB 3CZEA 2L0DA 4JHOA 2P5WE 4PGDB 2OLDA 1TMQA 2W9DH 3CDGB 3KWWB 3QG6B 2R2BB 5CJXC 3S96B 5IG7A 5EDXA 1R3KA 4PJFE 2OL3H 4YHIB 3UR7A 3TIDA 3Q6FA 2LE9A 3CD4A 3RDTB 1UA6H 3O41A 2VTFA 4PJ8C 2F61A 1SJVA 3IJ8A 4F8XA 4MNQE 4I18C 5DHVA 4JO3H 3S4SA 3TO4D 2A0LC 1JI2A 1LP9B 4NC1E 4NNYB 4NQDB 3KLLA 3BUYA 1Q0XH 2BVDA 3WUGA 4PUEA 3CHEA 4M7LL 1W0WA 4X7DC 3LX9A 3UZQA 2FDMA 3HAEG 4Z0BL 3HG1D 3IS0X 1IL1B 3GM0A 4BS0A 1EV2E 1F11B 1LD9A 1CGYA 1PG7L 1HK6A 1J0JA 1SJEB 4LFHG 5HYJA 4HQQL 2J5LC 1UB6B 1NC2A 2UY6A 1UQSB 4PJ5B 1NAMB 4H20L 1JXKA 5IW1A 3NCBB 3PDOA 1PSKL 2AP2A 1XC6A 2WMIB 4GBXD 4NC1C 4OGZA 4Y1AD 2I60L 3QZWB 4B41A 2JCCB 5CSZA 3EMQA 5I77A 2G3NA 3BH8A 4FQ1L 2XG9A 1NC4A 5E8OA 4PGBB 2P24B 3UJIH 1JZ3A 5IFHL 4RFOL 2AV7A 3GSQB 2Y8KA 3SQOL 3O2DL 4CVUA 2AEQL 4K3JH 1G6RH 3REWB 3CAFA 1MRCH 5JW3L 3RVUD 3SDDB 5TQ2L 3W11C 1E4KC 2VLLB 1ND0B 4OLUH 2LVEA 4O2EB 3AHVA 5C0CA 4OLVH 1PVHA 4RA3A 5ANMA 1NWSA 1VBRA 5GRVL 4XZUB 2A3HA 5D7SH 4NSBA 2Z92B 1IM3A 4MXWL 3FY1A 4CD4A 2CIKA 3JTSA 3L3KA 4Y8DC 1VFOA 1YEGH 3CHFA 1NCCL 4K8RC 4OKVA 3MNWA 1GNXA 3C87A 3DHPA 1UR9A 4JCMA 4HS3A 5CZXD 4M02A 2H3NB 1UM6L 2A1WL 1I1YA 3E2HB 4JFDB 1AO7D 3CFBB 3LKQB 1C3FA 4C56B 4QO1A 3WD2A 1B6UA 2BNUA 2H1PH 2X4OB 4JFPB 1DUZB 5FO7B 3D9AL 5IVOA 4PGEB 1H5BB 4AYFA 3BUQA 3W39A 4MJ6B 1HJVA 4CD7A 3PHAA 1V02A 5IBLD 1N6VA 2AK1H 5GRJL 5EZJB 4LVNB 2F5AL 4PD4K 5T1MB 4PJEE 5TE4L 4JPIA 3HE6B 4JFZH 4C7GA 4XPHH 1MFAL 4S3JA 3P2TA 1FZKB 5MEND 2PC8A 1X3DA 3WKML 4MB5A 1TJHL 1TIUA 1FLRL 1FYHB 1RIVH 1RZIA 4QOKE 3SURA 1WGOA 2EABA 4FQCL 1JGUL 2AXGA 4JM2D 1ORQA 3BIKA 1S7QA 5J12C 5GGVL 4HIEA 1MJ8L 4CGTA 4EDXB 1HP4A 1PY4A 2JF6A 1X1NA 1KJ2A 3IGAA 3PIQB 3BZFA 5INDB 2CKSA 5BYWA 3V6FB 1E6JH 2Y9RT 4OUUA 5EUOF 1YDPB 2OSLB 4GG6A 4A6YL 3MJ6A 4Z2JA 1GHFL 3OX8A 2AJXL 3DVNA 5FYKE 2ARJB 5H35A 5AC4A 5DZLA 3K4DA 4BQ9A 3WIHH 3IDUA 3H9SD 3U1SL 1U3HA 2VB5A 2C1OA 2VLME 1CZ1A 3V6ZA 2W91A 3X11A 1JPGB 4ZYKA 3CUJA 2NY1D 5E56A 1C7TA 2YC1A 1LE9B 5T1KB 3V5HB 2BNJA 5F3HA 4LHQB 5CINH 3EFFB 1QLFB 1RZKL 3L3OB 4GI6A 1CE1L 3QHNA 3QULB 4QHNA 3STZB 4AQOA 3ALFA 1KIUA 4GAYB 5I8CA 3O6LL 3VXRB 4AIUA 4DAGL 4PMXA 1A4KA 3OQ3B 5DMJB 5EU6B 1S7UA 1HSAB 4MAUL 5IBTL 3QI9B 3UTOA 4Y4KA 1EXPA 3DPBA 2WVUA 3BAWA 4LKXA 3MUAA 1X7QA 4ETQA 4JAWA 1RH9A 3NCOA 4RA0C 5F6IB 1FL3B 5I1KL 4Z7QE 2R2HA 3BRFA 4WIWA 1SJHB 4OZFA 2P5EB 2IH3A 2HVKB 1WF5A 1HQ4B 5DJ8B 3QNZB 2YMXH 4POZC 5CQ1A 3VGHA 1XCXA 1NAKH 3SGEH 1M05A 3WL9B 5DVLA 2R39A 4YFLF 3VXMA 2NY0D 1T03L 3BIBX 3VH8A 1V03A 2VLKB 3B43A 1KELL 2WV3A 1I3GH 4FP8L 4LP5A 3WUWB 1Q38A 2WWKO 1N8ZA 2YD7A 3BGFB 1YEKH 5IB4A 4BH8B 3HR5B 1A6TB 2DQFB 1J1XL 5ICZB 1NUDA 1BSIA 4DCQB 3TVMC 3PP4L 1CVSC 5HY9B 2IH1B 4C55A 3SKNB 1W91A 2EDWA 5K59E 2CLZA 5D72H 2A74A 3EZJB 1UVQA 1U6AH 3QIBC 2X4UA 2OP4H 4HMCA 4PJGA 1XH0A 3O6FA 5A6SA 5IFAH 2VXTH 1D6EB 3D85B 1UENA 3QDJA 3F62A 3UG3A 4OIIH 1MCWW 3QHZL 4M5YL 1JD7A 3CZ8A 4NRSA 5DVNA 1RV6X 2MPAH 3MRFA 5FOBB 4GZEA 2P5EE 5IMLA 2PW1B 3KVQA 5DDHA 3NGBC 3WBAA 4LPVA 1PBYA 3WMBA 4E4PA 1I1AC 4ZSOB 4TOYH 5F9OL 1YY8A 1KJVB 5ISZE 2NTSP 1E56A 2VDRL 3JV4B 1G6RL 1JCKA 2YPLB 3UJJH 2GK1A 4HAFA 3I84A 3R06A 4IPLA 1JPFA 3WH8A 5EIVA 1QI5A 5F96L 4WFFD 1GL4B 4LLUA 4TSCL 1RU9H 1Q1JH 2FSEB 5A2KH 1LK3L 4Z0XB 5I6XB 3BAYA 2ZUYA 3MO1B 3RUGB 2Q7YA 2UYLB 4KKLD 5CSGA 3X17A 1I8IB 1IQDA 4PJ9D 3QISA 1HXJA 3EZ8A 1W0VB 4ZFGH 3MUZ1 5I3DA 5JHLH 3FQXA 4KRTA 2QADB 2ZUWA 5BO1H 4D0DA 3DX9B 5CKAA 4GG6F 1H11A 1X4XA 1UG6A 2AJSL 5GGSB 3PZUA 5D7KE 3TM6A 3LXAA 3MR9B 1ORSB 3ETBF 1X5LA 4LNRB 5HHOB 1UASA 2ZUMA 4D0CA 2NYYC 5EMYA 4ZEPA 3EJZC 2PO6D 3LEXA 4KJYA 2GAZA 3P77B 1QSZA 4H0GA 1VERA 3G6MA 3GSOA 2AKRB 1BVNP 3D3AA 2EADA 1NGZA 1HINL 4HUVB 4HOWA 3QXDA 3SDXA 4WKFA 2D0HA 2RAMA 1ZLUK 4KHTH 5HXMA 2DIBA 4EJ1C 1SFSA 4GRMB 1EAPA 2Q8AL 2GK0B 3ES6A 2CLRB 3TT1L 4TUKL 5GIRA 4X6EB 1BQUA 1KTRL 1NUNB 5D7JD 2F1BA 3ZTNL 4H8HA 5B8CA 3WN5A 2VXVH 4L29B 2XIBA 4EN3D 1T22A 3BDYH 3WFCH 4HC1L 1FNSL 5L0QC 2JB6A 3OXSB 4M3JA 2AJVH 2W92A 4JCLA 1CD9B 1JJUA 4O4YL 4WV1B 4FLOA 5A2IH 4D9LL 5EBAA 1G7LB 3GK8H 3GRWL 3C09B 1GVIA 1IKFH 1CICA 1WE5A 3IJHA 1FPTH 3A6OA 1CLYH 1IGYB 3CLEH 3MJ9A 4KU1A 5JDSB 2V7NB 1MJ7H 2MQ0A 4Z9KB 3BMWA 3BPOB 1A6VL 2NXYD 4HT1H 2HYMA 5EOTA 4KHXH 5F9WB 1WO2A 3O3BA 2CITA 3PZOA 5JORB 3RWJB 1ACZA 2N1KA 3LRHA 5C6WH 5FA4B 3FO1B 1QR1B 1R46A 4GS7C 3VXTA 4FFVD 4X4XB 2IPTH 1GIGL 5K9QI 3W6LA 5DJ2B 3LQMA 4FQQB 1OAZH 2CK2A 5T3ZD 2GCYB 5CPTA 2DT1A 3A67H 3P11L 1LE5A 3ULVE 2HMIC 3BAXA 4ACZA 1SM3L 4OFVA 4PJDA 5A16B 4ELMB 4JKLA 4X7TA 3BUBA 1K85A 4PJGF 4X83A 1A1MB 4R90L 1A6AB 2HTKC 4GKNA 1UWRA 1YNLL 4NM4H 3F7RA 3RVTD 1JWUB 1MH5B 3HE7B 3BVXA 4P2OB 1W0YT 5CEZE 1B88A 5HYJD 2YRLA 2WZHA 1H15B 1NC2D 5TF1L 5BJTA 1GYAA 3KLKA 1JIBA 2DLTA 3D0LA 4V1DE 2DT2A 1C1EH 3CUPB 5GS0L 3KXFB 1B6DA 4AIOA 2E40A 5DD5L 5ADPH 3NJ3A 3AICA 2F54E 2YMXL 3CFEB 2DQEL 4HFUL 4JRYB 4S1QL 3AMLA 2WLYA 2D7QA 3RWCA 1NC4D 5E99H 2ZXDA 1XF2A 2J4WL 3TBWB 4P9MH 1BPLB 1R5VB 3MSPA 4AD1A 3MLSL 4X98B 2YK1L 1UWEL 1BBDL 3WD1A 1JWMA 3F7YA 3GHBL 1RUMH 1QW8A 3S37X 1JRHH 3BP6A 1O0VA 1XR8A 4Q22A 5C08A 3ULUL 3SE9L 3VDBA 2JFEX 2OX5A 1QA9B 3VFOB 3BSZL 5C0CD 5I73C 1GC1H 3W24A 4LEXL 3OR6A 3P30L 3S36L 3BPOC 3A6CL 3VFNB 2NW2A 4B0MM 4Y19B 1W3KA 3OA5A 4BZ2L 5J6GB 2P47B 3SPVA 1RIUL 3VWKA 4ORZC 3ESUF 4XNZB 4NP4H 3TFKD 1S7SA 4MD5B 4PMRA 1EPFA 1U8MB 4ZUUA 1H3TA 3MLZL 1BFTA 4R97C 3WQ4A 2ADIB 5I1AA 3MJ8B 5IB5B 3DUHA 2VDLH 2E0PA 1JZ5A 4U1GB 1C8PA 4OCWL 4Y7EA 3NCEB 1GOMA 3ILQC 2EXWD 3KPNB 2XWJB 3MJ7B 2XYLA 5E9AA 4PJXB 2XVNA 4JRYE 1I7RA 2X10A 3CFDA 1U2HA 1G7QA 4XWGH 1RJYA 3HE7C 4P48A 5FYJL 2W60B 3PABB 4HJJL 1P69B 4P2OC 5DYOB 5TD4A 1KOAA 5EC1B 5AYQA 1ZXQA 2WIMA 4I18A 5IT2H 5C0IA 3T3MF 43CAA 3T4AB 3MCKB 4J3TA 4G6AC 4LLWB 3BP5A 1XRVA 3S3SA 2P5WA 4D9RE 3R8QA 4OM0L 3ZTJG 2UUDK 4YQXL 4Y19E 4PJFA 3KLSA 1B9ZA 4HKZA 3LKNB 3QIWB 1KPUB 1EO7A 4KVNH 4OAWB 4TNVF 4EKXA 4WEUD 5M7QA 1J5OL 2OYKA 4YDKL 4TSBH 5D9SA 1M53A 2UZYB 1YYML 2AABL 4ONGH 1I8LC 2P44B 5BV7C 4GAGH 1RHHA 3VFUB 3H9ZA 4JVWA 4K7PL 5JDJA 3L95A 4ZE4A 3P0YH 2YFNA 4Z7WB 4U6XA 1MUJB 3U0PB 3UC0H 3QRFM 1JNHA 5EWIL 4Y4FC 3OJDB 5C0BE 1S7VA 4PJDF 2AJ3B 5E9DB 3RWEB 4ML4A 4OLWH 3O45B 4LPXA 5DRZA 3TT3L 3ZDXF 3SKMA 5D1XD 5DQDL 1U3HD 3WLBB 3FO9B 3QZWG 3GI9L 2XN9E 1KCUH 3SKOB 1HN1A 1DDHB 3DO3A 3O0RH 4LHUB 4HDIA 4RX4A 4TVDA 3C6LC 1XR9A 2ZKHH 3EYUL 1N64H 3L4YA 1CQYA 5CGTA 1KJ3L 5FEBA 3SKUD 1II4E 3ILPB 3KDMB 2R0LH 4NO3A 5L2KE 1R5WA 5A40E 3DARA 3KPQA 1GZJA 2EDNA 4KY1H 2PW2A 4M8QB 4J12A 4R3SB 4HAGA 4Y4KD 1SY6A 1AP2B 3MV7A 3QEHB 3BCFA 4XUYA 4N8CL 3RDKA 4JKPH 4F7MA 1T0MA 3MRKB 4LSQH 4NKOB 4MCYB 1KN4L 4HCRL 4YWGL 3RNKA 2ZWYA 3HKFA 5IW6A 4YHGA 5GGTA 1K4CA 4M80A 4DVRH 4HWZA 5I66B 2EYTA 4HG4J 5L6YL 3VXMD 5KJRL 4H2CA 5T1LA 2DQTL 5E9DE 4GKSA 5EOQH 3N85H 3PZTA 3QIWC 3DGCR 4IOIB 4N0FA 5GGQH 2BNQE 3MZTA 5CD5C 3CZGA 5EZIH 4DJMA 5BXTA 3I6GA 4PJ7B 3QEGL 1BJ1J 4G7VH 2PYED 5D2LB 3GMOA 4X5XA 4PBXA 3U82B 2OZ4A 3PZIA 1IC5L 2XZAL 4WW1B 5KVDH 3BGMA 2IBBA 4LCWB 1YNKH 4TSAL 2A6KB 2J7LA 1Z6JT 3LKPA 4QRPE 1X44A 1QRNE 4M1DH 1ZHKA 5D9OA 5EFFA 3L3JA 5C6TH 4HWEL 3MMEA 3RP1A 1B3YA 3IAQA 2YDSA 5DD0L 1V8HA 3L5HA 3O6FD 2Z1KA 2XWEA 4OV5B 5J6HA 2ZPKL 5CJ8A 2Z93A 3QDJD 4NKDA 4OZHE 2QV2A 5DD1L 1G9NC 1RUKH 1TQUA 2VX4A 5HGBA 3RWFB 3MA7B 2FATL 4PJEA 4Q0XH 1Q9LA 3RJXA 4ZAKB 1I8KB 1DSFL 1WFUA 3V0VB 3W26A 3IDJA 1U2YA 4OCMC 3UTTA 3TA9A 2A6IA 2O5ZH 2ZIDA 5HHNA 3CK0L 4CN4A 1CXEA 1UD3A 3GMMA 1O6IA 2KUTA 4QOKA 5B38G 4AMKH 2EDEA 1FP5A 1MCFA 5D8ZA 5JOFB 4JZJC 5LGJB 4QTIH 1OGAB 4OD2B 5ACZB 5SX4H 3EOAA 4FTVD 1ES0A 1GGIL 5KOVC 4PBWD 4YHNB 4BH7B 1QEWA 1SYSA 1KNOB 2EC9T 2R2EB 4ATWA 3IVKA 3BWAB 4ZPVB 3EYFA 4Z76B 4JG1L 2ITCA 4JN2B 4MPKA 3HNVH 1HKFA 2ICEA 3WXWL 4F7TA 3NDYA 1QO3B 2XG4A 1EHLL 1IAOB 3D39B 3IB4A 1U3ZA 1KFAH 5AEAA 3IDMA 3QBTB 4PTUB 3DIFA 2QL1A 1YZZA 4P2YA 1YPZA 5HVFB 4QRSB 2NY5C 1R3JB 4OFPA 3RX7A 4Z7OE 3WFEH 1JTPA 5L88H 1CIUA 4OOZA 3G5VB 4JG0H 3GXFA 1P1ZA 3A0OA 5LQBH 3C8KA 1QHPA 2VCAA 3OV6A 3VI4E 4LU5H 3W9EA 3W53A 2F8VA 1P7HL 5HNNA 5CZKA 4LOUD 1MW3A 3BZEB 3Q3GA 1A6ZA 1FYTB 1FZOA 3SCMA 1S7TA 3VXOA 3A4WA 1T2QH 4Y5YC 5HOSA 4YIQB 4J3VA 2A9NH 5FCUL 5GZNC 3AZRA 5BROA 4GZJA 3LMYA 1PZ2A 4AZCA 4KFZC 2BFVH 2VYRE 1W72A 5IT2L 4I9WE 5IMOB 4M56A 1J0KA 2XOTA 2WW5A 3KEHA 3OLIA 1CR9L 5F6HI 3JWNC 2AK4B 4KI5E 4L9LC 3TVMA 4ZXOA 1EA9C 3D2UB 2DD8L 4HGKC 3PTKA 15C8L 3GMRA 3NA9H 1XH2A 3H2WA 4PMDA 3QIBA 3WUWG 1WDQA 2WPGA 1R8LA 3A4XA 1OAKL 1DL7L 4GW4B 3EFDL 4WI8A 1C5DA 4LPWA 4F2MB 1UXSA 4UFKA 2VDPH 3ZDYF 4JDZB 4KVCH 3RWHA 5JQ6H 4HW6A 1T21B 3GBML 1TNNA 3BAKA 5JXEA 1I3VA 3VFWB 3W29A 4C4KO 4KI5C 3AHXA 1IJ9A 1BOGA 3UX9B 2V9RA 3IFPA 5C8JA 1I1AA 3B2UC 1M7DB 3N18A 4OLWL 3FMGL 1V08A 4OLYH 5TDNB 2E7CA 4OD3H 4XB8A 1NARA 3PHQB 4RGND 2LQRA 4MLSA 2FJFA 1V6VA 2X4QB 4P2QE 4M7KH 1XGQA 1U8KA 4KTDL 2O5YH 3AMDA 1FCGA 3LQAL 3O9WB 3CUGA 5EORL 1F6LL 3U9UA 1YY9D 2X7LB 3ZKMD 3ARBA 2H8PB 1XGRB 4WNQA 4R9HA 2MKWA 3I6LD 1MWAB 4U0QB 3FRUB 5IFTA 5HPMA 3UTQA 1B3JA 1HXYA 2J6EA 3OKEB 4JQIH 5E2VH 1NGWB 4AW7A 2GJ6A 2ATKB 1B30A 5I1EL 3O2LA 4CU8A 4Q9QL 3BUPA 2D0FA 3PHSA 5J13B 1CI5A 4AZ6A 3K1DA 5E00A 2LTQC 25C8H 1U8HB 5ISZA 5GZOD 5L7XL 2FGLA 4ONFH 4AZ8A 5BRPA 5EO9A 1AE6H 3QQ9C 3W0WE 5CGYC 1A7PL 1CT8A 2J8UA 3KPRE 4JJ5B 3Q0HA 1DWJM 1W9UA 3KYKH 5AYUH 3ZE2F 4HKBA 1ZK9A 1L8NA 1TQTA 5C6PB 2C26A 3QUMB 1SYVA 1HF6A 5C71A 2FH8A 3X3GH 3S6CA 4ACYA 5HD8D 4A3YA 5DSCA 1UWTA 3AYRA 4P5MB 4RGOL 1P2CA 4PJBE 4NO2A 3DVFA 4JRXE 1MJUH 1UH3A 4Q7NA 5CBAB 4GW5A 1OY3B 4F9PC 5C08D 1IC4L 1MCLA 1J1PH 3DRQA 3SCWA 5CJBA 3FQRA 5SX4I 1AHWB 1QFPA 1YPZF 4WO4C 4CMMA 1D6VH 1ETZA 1Y18A 1HIMH 5F88B 2HRPL 3HLAA 3VSUA 3SN6N 1MCIA 3VWKD 3EYVA 2ZSWA 3CTTA 1N7ML 1OW0C 2Q1EA 1G1YA 4PB0H 2MNUA 3QO0B 3U4EA 5J89A 3M7SA 1TLKA 2DF3A 4S1DC 3VNZA 3ISWA 2OR7A 3CH8A 2V5CA 4XTRD 3UTSA 1OAXL 3SBWC 3RI5K 3PBGA 1EQPA 2C1PA 3JZ7A 2A6JA 4PV8B 3U0WL 1S7XA 3TBYB 2DL9A 5DMIL 2O5ZL 2R15A 4Q9BA 1A2YA 2X89A 2Y07H 1WWBX 3MRDA 4U6TA 1F8TH 4OCXL 2VRAA 4PRPE 1O7SA 2IMMA 5E70A 1ZLVH 2RB8A 4PMUA 3HZYB 2JELH 4GAJH 3GHEL 3IAGC 1J8HA 4QTIL 3RQ3A 3QUXB 4HHAA 2R4RL 3FT2B 1OT2A 2P7TA 3OB0K 4YFEA 2Q76A 3VPLA 1NFIA 1A9EB 4ODUB 2CR6A 2CMRH 2DKSA 4Z7VE 5BXFA 5L2JA 1U8LB 5TFSL 2P5WD 3LMJL 3N1AA 1U8IA 2V38A 1BP3B 1JGLH 3MGAA 3K2UL 3RWGA 4H5SA 8FABA 4EI6B 3MJGX 1NANH 5MEQB 5KSUB 4MAYB 2DI9A 4KROC 2GFTA 5GHWH 1YN7A 3AVEA 2IANB 1I1WA 1QFHA 1Y0LB 4BQ8A 2HLFC 2X40A 3ZKSD 4Y2OA 4AZ5A 1AY1L 1CXKA 4HUXB 1B90A 4MNQD 4N1CA 3CMOL 1GZPB 2VCCA 1RIHH 4JLRA 5HHVH 5K93A 3AIWA 3W25A 1ZVYA 1XF5A 2O26U 3FW6A 2NY6B 1AHWC 1ZLWH 1HEZB 1NDGA 1TCRB 4G3YH 4PREB 5F7HA 3PWUB 1FIGL 1CWVA 3BAJA 2YD1A 5IQ7H 2E3VA 3SCNA 1DVFC 1MCPH 5DWUH 5SWSE 1P5VA 1QBLL 4CNIB 4V1DA 1VAHA 2QV4A 1S3KL 4F3FA 4FN0A 3W11D 5DT5A 2O9OA 1RUPH 3VIKA 4YHZH 5BOPA 4E5XB 4JAMA 2OSWA 3NFPA 5HDRA 4M6ML 3KL0A 4DUVA 2F54A 4LSPL 5D5ME 4DZ8B 2BHUA 1XF4A 5HDBE 2B2XL 2J8UF 2EIDA 3WIFB 4M82A 4J7RA 3RL2A 2ILLA 2W59A 4LBEA 3VJ6A 1KXVC 4K8RD 4UBDD 2VDPL 2W07A 3MMWA 2E7MA 3O3DB 4QF1B 3QUXC 1A6PA 2CHOA 2ZSVB 2BVQA 3QFDB 3RGVA 3H53A 2EH8L 5ALBL 1VEPA 5HDQL 2XSAA 1Q0YL 5KSAA 1TFHA 3NA4A 1V7NL 4ODVL 3IFLH 3HS0B 2CKBB 1L0PA 1RD6A 5E4EB 1LWJA 1F4HA 1QSEB 2VLJE 2KBGA 2FECI 1YQVH 2DH3A 3QR3A 3JWDH 5T1LD 1NEZB 3LV3B 1CE6A 4PRNA 1UKPA 4Z2HA 3MLUH 1UXWA 4LCCA 1J05A 4KDTC 4NRZA 3S35X 1U93B 3VMNA 2WNGA 5D93B 3MLXL 1XGPA 1NLDH 2O5YL 4RCAA 4MQ7A 3RNQA 4QRQB 3VI3E 2WANA 3QUZC 1X5XA 3H9HB 5B39A 1FFNB 4QXGL 1DQJA 2FBOJ 1BYBA 1EOKA 3X12A 3BKJH 1JGEB 4U33A 4NBXB 5IP4A 1CG9A 5EB9A 4KZEH 4AZIA 4YR6B 1XD1A 4AYGA 2X6MA 1T0NB 1K5NA 1RZGA 1DP0A 2H41A 3IU3A 5DEZA 5IKCB 4NZRL 4U1SB 2YDQA 1HXKA 3EO9H 2ITDB 4M9OA 4YNYA 4ONFL 2FX7H 2R0ZH 3T0VA 1I8LA 1HP5A 3KYNA 1E28A 1UM5L 1LEKB 4Y5VC 2MQ3A 1Z9OA 1EEYA 5JW5A 3BMVA 3OZ9H 4HZAA 1WEJH 5DQJB 3CZKA 4QGTA 3CX5J 2FECL 4IIQC 5DK3A 2CXKA 4PJHB 1AIFA 5MEOB 1DFBL 2NY2B 3BPCB 3U7YH 1EHXA 2F15A 3VGDA 4Y4FA 4UDUB 1QSEE 4HKJB 1T4KB 1CTOA 5C7XL 1IGMH 1HWHB 1A7NL 1UT9A 5FF6B 1S9YA 4QOKD 4JQVA 1OPGL 5CP7B 1ZWIA 4Y2DB 1PGRB 2Y36H 2APWA 3C60A 5I18L 1U8NB 4K94L 3ULSB 4DQOL 3WEXB 1DQTA 1CWYA 5EG6C 4E41E 1UACL 2JK5B 2IEPA 4CJ0A 3GIVA 3LKSA 1L9MA 3VILA 4UIMB 1LNUB 3C6LA 4NZFA 3RWIA 4Z18A 3F12B 1BD2E 4LF3A 3KLAA 1I3UA 3NOIA 2OL3B 4XXDA 5E4EC 3MRCA 4RDQG 3MUHL 4QP0A 3DRTB 4JHWL 5I1IL 3EJUA 5C0BA 3WS3B 4YHML 5FYKD 3FB7A 4ZO8A 2W63A 3W27A 3F58H 3FRPG 1ISVA 4LHUG 4G9DA 2AGJL 3D51A 1BZ7A 4Z77B 3E6HB 5HHQA 1SZNA 3B9KA 2VLMD 3QXUA 2XN9A 3TNMA 1OB0A 6FABH 5T3ZH 5DHVH 1YEDA 5FGCE 1BHGA 2FIKA 4JZOB 5HHPB 2ZCKH 3RKDD 1G7MA 3LS5L 4POZD 2VL4A 3WO4B 4P57A 1NCUA 1A1NA 2DDQH 3AZTA 1JHLL 4NZCA 4ZQKB 5L2KA 5I1CL 2DWDB 1EEZB 4X6CB 5EA0L 3O81A 3LSOB 3SCMD 3U4BL 5BVPH 2JELL 1IGCH 4XPGL 5FUCE 4YN5A 5D96C 4N5EC 5F70A 3VXPB 2G2RB 4P46A 1YN6B 1HCFX 1PW3A 3OPZH 3V8CA 1E4MM 5JZ7C 2Y06L 5E6IB 3L7FA 1KACB 2EDRA 1KPVA 2RFXB 3CH1B 1NWRA 2XQYG 5KBNC 1K6QH 1ZU8A 3TVMD 5GRYA 1KBGH 4YEFA 4G8EA 1XIWB 1MCHA 3QXAB 1AC6A 4AZHA 2B1AH 1ZT4B 2ED7A 1RZKC 2XQYK 2PCPA 4U1HA 3GKZA 3QIBD 5TH2B 2R0KH 5GHWL 3BKCL 1U3YA 4G43A 1N6QH 4MA3A 3GH7A 3MGOA 3B6SB 2BNQA 2RHEA 5FUCC 3VINA 5GQBA 5DTFB 2DM2A 5DK0B 5F7EL 3MRMB 5CBEA 5HHVL 2ZUUA 3RGHA 2EC9U 2MMXA 4AEHL 4FQJH 1HXMB 3PDGA 5KG9B 4F58L 5T1KD 1CFVH 3N1PC 4ONHB 2VAJA 4RISH 2NX5E 1KCRL 3QG7L 4QRPA 2X70A 1I1AD 4PRHB 1QRNA 1Z5LA 2Z31B 4M5ZL 4HIIB 3JUGA 5GS1B 4PS4H 1A0QH 2J79A 4JZJA 5D7IB 5E8PA 4JY4A 1MCPL 3FQWB 4HK3J 3S5LG 3U46B 5J1TC 3UBXA 4BSWA 2AEPH 1VGKA 3CSBA 5AZEL 3LDBB 4OZHA 2ZJSH 1XGUA 1LEIA 2VERN 3HAEH 4UFIA 4QXUL 3JTTA 3ARBD 5F7DA 3K4ZA 5B3NA 2FZ3A 2P5ED 4XCEB 5CEYB 2Q3AA 4OGYH 1OD7A 1IAIL 3DV6B 4GW1A 4Z2GA 3JV5A 3KPLA 2LAAA 2OI9B 3HCVB 1KLFA 1OP5K 2D7TL 3KR3H 5ISZD 1HNYA 1YMHB 1U8PB 4KRLB 5BRQA 5D8WA 1YJDH 1ZTXH 2E7LA 1UR4A 2VI0A 1KC5H 5A6BA 2NPLX 5A8OA 3L2MA 1UM4L 2HJFA 2NYYD 2EIBA 3EJZD 4JFXA 5E6IC 1FV1A 3T1FA 1V6XA 4X4YB 2ZX6A 2NCMA 1N59B 4U49A 4FRWA 4W89A 1IC7H 4XPTL 1XIWC 4XP1H 2BFGA 3GBNH 4Y5YA 3G6JB 4JFTA 2FO4A 4MNMA 4U3HA 2UWEA 4U1NB 4LYRA 3LRKA 5CJOL 3GO1H 4GIAA 1D5MA 1I9RH 4JRWA 4BFIB 5D7KD 5E2TL 4TVUA 3ZKQD 5GGVY 1KJ2H 4UNVA 4UT9H 5DJAB 4L9LA 4PYGA 3VWJA 5JUVA 1YC7A 3AS0A 1A5FL 1AGCA 4M43H 1E0VA 5ELIA 2NTFB 2YA1A 3GJEA 3KHOA 4P7LA 4Z8FL 5CD3A 4LLVA 4NQTA 3EBAA 1EMTH 3QRGL 3KPTA 3M8OH 5GS1C 2P8MA 4LPUA 5I19L 2DQXA 4G8GB 3HRZA 4IS6B 1U41A 1INDH 1WEJL 1R86A 3GMLB 3F7VA 5IV2A 2PI6A 3VFMB 3SE8H 3PWNB 4O02L 4ODTH 5D71L 3NCYP 4PRAB 3VFPB 5EZOL 3ZYZA 1IQWH 2QSVA 5I1DB 3BVWA 3ARXA 2X89D 3TO2A 4JFHE 3GIZL 1BFOB 4Z95H 2OWXA 3FNDA 4N90E 2EE6A 1IMHC 4ZO9A 1O7DC 1R85A 2XTKA 1C5BL 3BW9B 4AC1X 1VFMA 3C8HA 4M00A 3MBXL 3DROA 1X6NA 3IETB 1TJIH 2FYYB 2IJ0C 2EPMX 5DEFA 2HMID 1JPSL 2WBJA 5KAQG 4DW2H 1KUMA 3OAUH 4N68A 4U1MB 2UZIH 2GTWA 3EYOB 4O2CB 2HTKD 4OZFH 4ZXBB 5TPWL 3ZT5A 5JIWA 2Z4QB 4YHYB 4YDVB 2JF1A 4ELKA 3MV01 1OINA 4YHOH 1B2WL 3MBEA 3FN0H 2A38A 5E7BA 2YPKB 1ZT1B 5C0EB 2H32B 1MW1A 4NC2B 1DHKA 2PB1A 2ZICA 1XCQB 1Q72L 2HVJB 1MLCA 4P2QA 4OT1L 3H9YA 1S7RA 3WSUA 3ULVD 2WKGA 1XAUA 1S9WB 2EDBA 3WS6C 5BQ7A 5D6DA 5F3BA 1KTLB 2K7PA 2B0SL 4NHUA 1T7YA 1ZLSL 2DDQL 3BKYL 5I9QB 5CFHA 3MA9H 4R0LB 1U92B 3K8LA 1RULH 3DUSA 5CEZD 4UOJA 4R7DB 4YPGA 3WD0A 3WLWC 2GK2A 4Y8AA 2AXFB 3S34L 5F7NC 1VKXA 1P4BL 1P4LB 5DJXB 4MJIE 4CUCA 4AIZB 1M01A 3ZIZA 4V1DD 1JF1A 4XCNB 3IDGA 4F9PA 4OF6A 2Y5TA 3W0WA 5I16A 4DO4A 2EQDA 4HUWB 3THCA 4OJFL 3KPRA 4LCIH 3VTRA 1KYOK 2X4RA 3OR7A 5D7LA 4WFHE 2F54D 2F9BT 3RY6C 4NQVB 2B1AL 1FZJB 1E6ZA 3TYGH 3PL6B 2PTVA 2MHAA 1NGYB 4OZ4B 3MCLH 4Q9RH 2WMFA 4HUUB 4GXUM 4OUOA 1JZ7A 4JPVL 5F1NB 3QAZC 2R1YA 2JALA 1K8DB 4YBLB 4GXVH 4PJBA 2BNRE 4JRXA 3SBWA 3AOFA 4YUEL 5GS0C 2AS5M 2IXVA 5KSAD 3B9VA 1T0OA 4KKCC 1AGBA 4YDJA 4JFSA 1RSFA 2UWEF 4W81A 1TZ7A 4KUCF 5I1GH 2ZP0T 3HE7D 1OGSA 1TVHB 1CGSH 4P2OD 5I74B 1TPXB 4NFCA 1HYSC 2VCBA 1A0QL 1ZVSA 2ZWLT 4QWWC 1PZ3A 1E6OL 5DR5H 4LP4A 5IB1A 4KK6C 2MKLC 4GKZB 3SCRA 3SY0A 4RQQA 4WTZA 5CSYA 4G6AD 1L0QA 2J75A 5FDYA 3I02A 4EQ2A 1K4DB 3H7BB 4HU8A 4F15B 1D5IL 5I71B 2XNAB 2X2IA 4JRYD 4X80H 3N1FC 5ID1B 4M62L 2W65B 4QAWA 4R0LC 4PRPA 2NT1A 3VG9C 2VRQA 2E8YA 2G75A 2GSGA 1RAMA 1FOBA 3UESA 3ZHKA 1WFNA 3BZDA 2XIDA 5FGSA 2IAMC 4YAQA 4GINA 2QF8A 3W6MA 2FGWH 3AS2A 3EO0A 3VA6A 1J7VR 4Q6IB 1H09A 3TBTB 4Z7VA 3RILA 1NH6A 1S7WB 1H0DB 1I7UB 32C2B 3NIGF 4D9RD 4Y4FD 3N04A 4L8SC 1ONQA 4WJXA 1QFWL 4Y19D 1FZMA 5F89A 2V2WA 3LS4H 3PL6C 3BSGA 1EGZA 3LD8C 1R6VA 4CW1A 1DVFA 4WHTA 4OOUA 4U05A 1ZHNA 4U1KA 4AENB 1JMZA 4RMSA 2ESCA 3GKWH 3RA7H 4EI5C 3HUJA 1UG9A 3MJ9H 3WF4A 4Y4HB 3DO7B 3C6LD 4URIA 3BZ4B 2H6PB 5KZCB 5A2LH 1F4YL 4PJIE 1FNGB 1UD2A 2VUOA 3BO8B 3PHOB 1J01A 7FABL 2DLFL 4HH8A 3BQUC 2CXGA 2A77L 1PYWA 5FHAH 3HZMA 4UAOB 5C0BD 4UTAH 5IMKA 3VOCA 3W9DA 1XCTB 1NMAH 3BN3B 2WMPA 4EK7A 1TPXC 3O2VH 4YGAB 3RZWA 2N4IA 3REVB 1WFOA 3VSVA 4DN3H 3B9KD 2WBKA 3LB6C 5SWSA 1AI1H 3NCMA 4WCYL 1CPUA 2XN9D 3GSNL 2VLRA 1NEUA 3WL0A 2JEPA 5EBMA 1F4WL 1FVCB 4GQ9H 2XWTA 1NCBL 4UQ2B 4ZUVA 3DDGA 3KJ6H 1GAFL 3A6BL 5C0AE 4XP4H 5IB2A 3EGSB 3OL2A 1GW1A 3QWRA 4DWSB 5BZDA 4JQXA 4F15C 4OTXH 1E6PA 5I71C 2HWZL 1N4XH 2X4TA 5D5MA 5L2KD 5FO8A 1DWFM 5F44A 1A7OL 3QIWD 4IRZH 3F65A 4KDTA 3S88H 5CD5D 4CKQA 4LGXA 2VIRA 3HI1A 2VZUA 4P46D 2F7RA 3O2DA 2JKXA 3ARYA 4PGZA 4DW2L 5IF0A 4JO1L 3AREA 4KDVA 4DVBB 5ETUA 1N5AB 1P84K 1ZA3B 3KPMA 4D2NA 1NEZG 3TV8A 4Q6IC 1XGYL 2EIZA 3ZQ9A 2BDNH 5ESQA 1YC8A 2HJKA 2VR9A 3HNTL 1FG9C 2VLJA 2A83A 4ORGA 2AMGA 2R69L 1KLUA 3G6DL 5E9DD 4UINL 3VRLF 2QBWA 1EBPA 4XVSH 5ESVB 3PWLB 1EH9A 2BNQD 1HQRB 1R7AA 4NZDA 3QQ3A 2ZX8A 3ARZA 3O6KL 2AV1B 3RZCB 1JFQH 5LGKA 1HHJA 2FX9L 4IIQA 3D87B 5IVNA 4HWNA 4HV8A 4ZOEA 1QLRA 4QRPD 3MOAL 1DTUA 1FO0B 4XC1H 5CSBA 1M7IB 2XFXA 1QRND 2V5MA 4BFGA 3UEQA 1X5IA 3KJ4C 2HN7A 5DGRA 4PSRA 2YD8A 4KQ4L 4HPGA 1BLNB 3U4AA 1NDMB 1IT9L 2VABB 2WAGA 4P8UA 1GQJA 2YJQA 1FCCA 2WBGA 4I13B 1NQBA 4QHLA 1IGFH 4XMPH 3X13A 4G9FB 1BVLB 4P49A 2COQA 1T80A 4GMTH 1KPRA 4M29A 3CVHL 2AERT 3NZHL 4G5ZH 3UYOD 4LVEA 3B3IA 5E94B 2W5FA 2FJHA 4Q2ZB 3GJFK 3CSYA 4OF5A 3SE3A 5IHZB 4R26H 4F7PB 2XJ7A 4MA7L 3AIUA 1BLIA 1DLFH 2XKSA 2D4FA 1U58A 2ZOXA 1RUQH 1MFDL 3GI8H 4Q9RL 2X4NA 1A8JH 3NAAL 4PEEA 1JF6A 4BZYA 4JGJA 1MVUA 3D48R 4JFQB 3DMMC 3DVGA 1BGXL 3GSXB 1JYVA 5KOMC 5A6BD 4X5WB 3TWCL 5IFJB 3MLWH 2CYGA 5C07B 4OLXH 5SX5K 4E41A 3OGSA 1BAFL 1OAYL 2VL5A 4OZIE 2BVUA 1N0LA 3RBSA 3TZVB 2XQBH 3KAAA 1GJIA 5JNYA 2AQ3A 3L5WA 5JBEA 3O6ML 3WE6B 3HUJF 1F42A 3SCSA 4A6YA 3D18A 2BOCB 4J28A 1S9XA 2ZXBA 2WZEA 4ODHH 4NUJB 1AFVH 2IQAA 4K71C 4PRIB 1IGIL 3DV4A 1A9BB 1BEYH 2DQDH 4G6KH 4I4WA 1DBAL 1MAML 3PXJA 2Y72A 3WFDL 4U6YB 3Q1SH 1EUTA 4V2CB 4QYOA 2YPVL 4UNUA 1AGFA 1QKZH 4K7PY 4Y7MA 4X99A 4CVZB 4G42A 2BSTA 4R4BA 1D9KA 4MDIB 1RP8A 4GO9A 1GGYA 4KTEL 4P23C 3RMEA 2O61A 3LCYA 4PJAA 1TXKA 1A22B 3U30B 4I9WD 1E4NA 1JWSA 4MTVA 3RPKA 4JN1H 3RPIA 4I3SH 5D1QB 1UHVA 3G5ZA 4XPBH 2ICCA 4KI5D 3BVNA 5DT1L 4PGDA 1YEIH 4H88H 1E4XL 4QTHB 3B2UD 2CIIB 2R2BA 5I24A 1TQBB 4HX1B 4ZTPL 2Y25A 3L9RA 1I85A 4GRWF 2XA8L 1QFUH 4YHIA 3Q5OA 2UUDH 4WJ5B 3ZKXB 3MLYH 4MQTB 3QUYB 3WDQA 2AEIT 5K33A 4WFGE 3FQNB 1HKJA 1DBBH 1SY6H 5SWZE 4HS6B 4KUZH 3TBSB 4XP5L 3EOTL 4PLNC 1PKQB 3C5JB 2IADA 5DI8B 3MRRB 1KEGH 4K9EL 4WEBH 4NWTH 1LP9A 1MRFH 4HMEA 4AZGA 2BY2A 1J1OH 1QBBA 2V5RA 4LDEB 3T8XA 2QPSA 3DGGA 2NX5A 3FO0L 2QMJA 3FB5A 5GGTH 4ERSL 1MEXH 4L9DA 5IHUH 5I1LA 3ARFB 2J74A 3SCQA 3V7AG 4Z7NE 3LN5A 2V3EA 1UB6A 2DBLL 2VXQH 3AMKA 4GT7A 5DMGD 4P2QD 1C16A 3KNBB 3QQ9D 1UQSA 4G6JL 5EBGA 2FO1A 5CGYD 3IJ7A 1OT1A 4LYQA 2P8PA 2OZ4H 4BKLA 3OLGA 1B3VA 1MWOA 1WCGA 4P4KC 4MYWB 4HG4K 1XH3B 4DM1A 3P73A 4KJWC 1J11A 4DKEL 1H5VA 3R1GH 2A3AA 3CIVA 2EDTA 4RFEB 2JCCA 1PPIA 2YBTA 3TP4A 4ZTOH 2APBA 1BVKA 3CZSA 3PGFL 1UCTA 4Z2IA 2YD3A 4XNQA 3UJTH 5HYIA 3MRJB 4XRCB 3ELAT 5DURD 4ZFMA 1CDJA 1T7XA 2YUWA 5MHSE 2BVPB 3K8KA 2B7DT 3W0WD 3MRNA 1IEAB 3CMGA 3PWPE 1OSPL 5JLZA 3KPRD 1N2RB 4WO4D 3LQAC 3PE9A 1RP9A 2EO9A 5TE7L 4ODBD 4NT6B 4KV5E 2Q20A 2VDQL 5TDPA 3P9LB 4OLEA 2YZ8A 3O4OB 5C2UB 1FVDA 1XZ0A 1UWGL 4KK5C 3WHXB 4NRXB 5E03A 4QLJA 4I5BA 1UWSA 5A8QA 3QUYC 3G6AA 4MQSB 5ITBH 4JRXD 2F58L 3GUTA 2FEEI 5HGHA 3PQYB 1FL5A 5LWYL 1TQWA 1LG1A 1WDRA 4UT6L 4IHOB 2JIXD 3PV7A 4HOXA 4O5LH 2C0HA 3V4UH 1FO0L 1D7FA 2ZUVA 4JFPA 4S11A 3QEQB 1DUZA 5AZ2H 3T4YB 4QDMA 5FECA 5FYKH 2C7FA 3QGVA 4NQXA 1N6UA 4YO0A 1P7QA 4PP1C 4X0KA 3STLB 1VHPA 3P4LA 5A6JA 4WSJA 2OS7A 1DJSA 1LO5A 1HILB 5DD3H 3BI9X 3TO4B 2GDUA 3HE6A 3V5KB 2YLLA 4RMQA 3L3HB 1E73M 4ATLA 4PJAF 1GGBH 4KQ3L 4ZOCA 3WIIH 1R24A 3GNMH 4HC1A 2JJTC 4PY7B 4P3DA 3WEOA 4KROD 2H26B 3HG1B 5HYSA 4NKIH 4PRPD 1BX2A 2J88L 4OSUH 4TUOB 1A7QH 2HLFD 4EIGB 3EJYC 1KIRB 3W28A 3G9AB 4NGHH 3I2CL 2OSYA 3LEYL 5DUBB 3WS6A 4BA0A 3V52L 2GFBA 1PZ5A 4GBXB 4A3HA 1WZ1H 4Y1AB 1HJXA 1X5ZA 3H3PL 4JPWH 3SJVE 3UROR 5MEPA 3D0VB 3MRPA 4RWYH 1NBZB 5IHBA 1BBJA 3QEQE 1R3IH 1AQDB 1AXTL 1DE4B 1LP9F 1DVFD 1DWHM 1R3HB 2Z8RA 2G5BA 1P9MA 2BVEA 3AUVA 3Q1SL 2QQKL 4P9HH 4YC2B 1CL7H 4YFDB 5I75C 2V5SA 1TQCB 3BRDA 1RJLB 3ARDB 5EC2A 4E42B 1GZQA 4TNWF 1CTNA 1VGEH 5D9PA 3V5HA 3PUCA 3RY6A 5ICYA 5KW9L 2RCSH 2DYPB 3LZFL 4KMQA 5FK9A 3L3OA 5GJSL 4Y5XB 3AMCA 4ZE5A 4PTTA 4FFYL 2AJZA 1EGJA 5EU6A 1WCQA 2WHKA 4MJIA 5SWSD 2QR0B 2JCCF 2CKNA 3WFHB 1DWIM 2X2JA 4L4JA 1J0YA 4ALAL 1HKLH 1Y6KR 3DETC 2EDFA 5HHXH 1BF8A 4MX7B 1AO7B 1Q9KA 4B9ZA 4RFNB 5DUML 1I7TA 2J8GA 5IW3A 2J6EH 1MNUH 2DQJH 4UUJA 1W2KT 2EYSB 5ESAA 3AAZB 5T5NG 1RURH 5HGAB 1A3LL 5BRZE 3HN3A 5GJTH 4HUNB 1B0RA 1K9EA 2NY4C 2BNRA 2QQNH 2D3NA 3QUZD 5CWSB 2BXZA 4S1RH 1FN4B 1A7BA 5C0FA 1RUAL 4Z78A 4IOSD 1MHHB 5EBLA 2BSRB 4BH8A 2V17L 3HG5A 3MNZB 5ICZA 1JNLL 4L3CA 2VLJD 3KPOA 5MENB 5FOJA 2IH1A 5FKPB 5DGQA 2EO7A 4UTBL 3SKNA 2CKRA 1E3XA 1QPXA 5CP3A 5E95B 5DRNB 3TNNA 4V2XA 3T3PE 4I3RL 2OSXA 1ACYL 4JFEA 2IAMA 5EN2B 5GGRY 4D6GA 4I3GA 2QKIA 3LH2L 5TF0A 1BFVH 3VW3H 2VDNH 4DGIL 1FC2D 3G5YB 3QHFH 3ARDC 4GPNA 1OD0A 4L8SA 4JY6B 3LPFA 35C8H 3OJVC 5C9KA 4F66A 1ZAGA 6TAAA 1IBGL 1MCOH 4GKLA 1TVNA 2B1HL 3H9SB 4QY8B 3NTCL 4MDJB 4P4RB 2OTUA 5EU5B 1KB9J 4EI5A 2LU3A 5KSBE 2BHYA 5FB8A 2NW3B 5SV4A 3V4VH 4HZ6A 1HNFA 5E6ZA 1GORA 4UV4H 2NY1B 3WH9A 1UEYA 2FH6A 2P4AB 4LPCA 5DS8B 4H26A 4C7DA 3WJJC 3IJ9A 2JB5L 1SMOA 1MY7A 3MO1A 4RAHA 1V6UA 1QSED 1BFNA 4RFNC 4DKFH 4HU0A 4AH2B 5IMMB 1TZIA 2YD4A 5KANI 1E6RA 3MUY1 5JR1H 5D4YA 1IGTA 5JW4R 4U1IA 3D1MC 4QCIA 1QI4A 5I17B 3PGDA 1F58H 4S0TD 4NNPL 4P0DA 4E41D 4DO6A 3ARGC 4KAQL 3L3IA 4X6DE 1CD1A 1WISA 2MOVA 5HHOA 5T5FH 4KTYA 3ZL4H 4I48B 1KEMH 2NXZC 4PJIA 2J7GA 1BD2D 2BCKB 1E0WA 4H8WL 5EBWB 3CV5A 3E0GA 2AKRA 3ROLB 4NNXA 3MODH 2EDXA 1DLHA 2CUMA 2NY0B 1FG2B 4F57L 5BS0A 4HUVA 4HS8H 3FFDA 1BYAA 4N5ED 4UMGA 5CLWA 1UR8A 4OCYL 2VC2L 1PIFA 2PWDA 1IAKB 5JZ7D 4K94C 2CJUH 3NH7H 3LN4B 3TGXA 1ZHLB 1W8NA 3ULVH 1X5FA 4X6EA 2DIJA 4MCZA 5C0AA 3W2DL 2A2QT 3J7HA 4NSKB 5EUKA 4O9HH 4YDIL 1D9KD 3OXSA 4AD3A 2X1XR 5IFPA 2FWOA 1KCSL 1MFUA 4WW2C 3DX3A 1GPFA 1W72L 4R2GC 2R4SH 4HPYL 4UZSA 5C0DA 5F1SA 1OD9A 3ALPA 5I2IA 1V7MH 3OB0H 5JDSA 2V7NA 1KGCE 4P99A 1OIMA 5FL0A 2N7AA 1U8OA 1Z0MA 1DEDA 4HCRA 2XPGB 4L8BB 2I9LB 5FV2A 5JW4M 2ZCLL 5IR1A 3VM5A 1SYTA 5JORA 3RWJA 1U8QB 3ULUF 4OCSH 1OLLA 2P8LB 3K81A 3N06B 5MP6H 3CDCA 4LCUB 1IFHH 4X4XA 2CDGA 5I8KL 1OSEA 4HA3A 3DTXA 1QACA 1G1CA 2WVVA 1WBXA 4GFTB 5DHYB 2FB4H 2SEBB 4YXHH 1Q4NX 4ELMA 3OZOA 3QEUB 5I76B 4MD0B 1MCDA 4XHJC 1IC1A 2NX5D 2HLAB 4RNRB 4PJ9B 2VOTA 5CCKL 4M7ZB 5EZLA 5JXAH 3K0WA 2NY0C 3DMMA 4FZ8H 3DLQR 1H15A 5JA9A 4WVRA 1P6WA 5T33L 3HNSH 2UZXB 3KYOA 1XFPA 3PZQA 2WAHA 5GPRA 5E6ID 2R0WL 3L1OH 4ZODA 1MFNA 4RBPH 5HHXL 3NSXA 43C9B 2PO6B 2YD2A 2QMKA 5KSVA 1OM3H 1XIWD 1CLOL 3BP7B 4CMHB 1ULVA 2FHBA 2DQJL 2ZX9A 3RY5A 4ZG1A 3HC4H 1I4FB 2R2CA 4QRRE 1EDQA 2XVLA 1D5BB 4X98A 2WUCH 1OSZA 5J0BA 3IFNL 4IM4A 3RUGF 1T7VA 3MZGB 1INEH 3N9KA 2NMSA 2X2YA 3VIMA 5D7JB 5DJ6B 4ZS7L 2G8ZA 5LXGL 1RZ8A 5E0QA 1FGNH 1ODAA 2YEZB 3VRJA 4EN3B 4M7LT 1BM3L 5BXSA 3L7EA 5D9NA 2LVCA 2WIIB 5FA3B 1WB0A 2HH0L 1IGJB 4XGZB 1C7SA 4P23A 1RK1B 3BUIA 4PJCB 5C2BL 1IM9B 3S37L 3CX5K 4U5IA 3D25B 4M24A 1PY9A 2ADIA 3MGTA 3QJFB 1EO8L 4G7YL 1QVOB 4JZ5A 4JY5L 4NJAH 4WHYH 5LGHH 4PYHA 4YE4L 2NXYB 5ECJE 1GGUA 5HHME 35C8L 1JDDA 1JHTA 1R3KB 2YD5A 3CFIC 1UJ3C 4W7WA 4KKLC 3Q6FB 2DIEA 3JWDC 3E8UH 3O41B 3NVQA 3FXYA 1P7QD 3AHTA 3MACL 1CBVH 5IOPA 4PIRF 2XVKA 5DHVB 4TX8A 1T0PB 2G60L 3S4SB 3HC0A 5DZOA 5DMKA 3MCKA 4ODSL 4ZFZB 2DWEA 5C0RL 2CPCA 4PB9L 1Q6CA 1W0WB 1PKOA 2DT3A 3ZE1F 2CK0H 4DKFL 4JFHD 4ZENA 3P9MB 4N90D 1G7PA 3HMWL 3T08A 1BVZA 5HYJB 1EXUA 1KPUA 1UH4A 4IOFC 1NC2B 3VFRA 2VR5A 2FR4A 3PWVB 5IW1B 5CG0A 3V0WH 4WHCA 4ZDHA 3L5XH 4JKWA 4U7KA 3PDOB 3N12A 1KCVL 4IJ3C 5D1ZA 5HYEA 3BISA 4P4KA 1CCZA 3NCJL 4CKVX 1VPOL 1G0DA 1UCBH 3BT2L 5CSZB 3T77A 2D7PA 1WQVT 1YEJL 4JANA 2EO1A 3BH8B 2CNCA 1NC4B 5E8OB 3WLWD 2NY7L 5FO9A 3KS0H 3J8F7 2XWDA 1UA7A 4ELMF 3O45A 3SIMA 3FT3A 4KGLA 1BJ8A 2WP3T 5EUOE 5GNZA 4OF7A 5DFTA 3ET9F 4A4AA 3NH7L 1OWQA 3SKOA 4UT7H 3TV3H 1A1OA 1BIIA 3OGVA 1OCWH 5FCZA 2IC2A 1DDHA 5CUSL 2EJ1A 3QWOA 5C0CB 3ZE0F 3FKUS 4XMLH 1IAMA 3WHE1 1KTCA 2NXYC 3LHPL 1WICA 4ISVA 1UYWH 3ILPA 1IM3B 1S8DB 2CIKB 4GAFB 3RIAK 3MSGA 3JTSB 3T65A 3L3KB 4LRNH 3EYQC 3NACH 1HSBA 1RK0A 4MJID 3BWUC 2J8OA 3EYSH 4HULB 2EDDA 3C08L 3MNWB 5GS0D 3JV6A 3IRPX 5KVGL 3HAEB 4HS3B 4P2RA 2VDOH 1EZVY 4MNKA 1I1YB 5IHRA 3PWPA 3U9PL 2WINA 2Z8WC 1R87A 1VJZA 2FD6L 3TTQA 4WFHD 4NRYA 2BNUB 1H49A 4NO5A 1AQKH 4UIKH 1QI0A 3QQ4A 3AXXA 3U57A 1KR1A 1HYSD 3LPPA 4F80A 1B4JL 3UCQA 4QWWD 3SUSA 4OCNC 4RMUA 4HP5A 4HF5H 1ZANL 2NY5H 4KK6D 5C0GB 2BNRD 2FBJH 5F93C 3RCNA 1KTDA 1A4JA 4PJ7A 3IDXH 1P6AB 5IIEA 4WU5A 5HI3C 4JPIB 2IQ9L 4YXHL 4I0CC 4P7OA 2OMNA 2OK0H 4FLQA 1CGTA 5ANME 4LDOB 5J7CC 3QDAA 5EPMB 4PCSA 4RRPG 2GUOB 1RZIB 4QEGA 4MNHB 1LO3H 4TTDC 1WZAA 3FT4A 2AXGB 3IU4L 5B4MC 1ORQB 4JFED 1I3RA 4X6FA 1ODZA 1QFWM 2IAMD 2RGSA 4PJXF 3CCHA 4TUFA 3HNSL 3HC3L 4HIEB 1K2DA 4R4NC 2C5DC 1U91A 4JM4L 1KJ2B 3IGAB 4X7SH 3P9WB 3N50A 4MZ2A 3BZFB 2EDHA 1G5AA 3T0AA 1LLOA 4J3SA 2P49B 2O5XH 4OUUB 1I8KA 1ISXA 4LEOA 2WNWA 4QFUA 2XKNA 4HJGA 2VZVA 1BWMA 3OX8B 3PL6D 3HZVA 1L9NA 3DVNB 4X5LA 3VFGH 5H35B 5KS9B 4XC3H 3FO2A 3O8XC 1YEEH 1FNEA 1U3HB 1V02E 3UG4A 2AEWA 4EI5D 5JBFA 3X11B 1KV3A 5E8EA 4CN1A 1ZE3C 3I75A 4UB0L 5AD0A 5HGGS 3WQ5A 3DYOA 2YC1B 1V3LA 1AD9B 1KNOA 2R2EA 4NUGH 5F3HB 4YEEA 4H8UA 2OJZH 3BQUD 1HWGB 1E0XA 4HUKB 3SJVA 4QHNB 1VFAA 1BG4A 2HFGL 3UO1H 4JFFE 2VQ1B 5I8CB 4NN5B 3U7AA 3D39A 1A4KB 1S7UB 4I77L 2VXUH 3LB6D 1UFUA 4Y4KB 1WAAA 4Z7WF 4LKXB 5ABEA 1YJDC 1X7QB 5EIIA 3WQ8A 4ETQB 5I79A 1A3RH 4LSSH 2Z35A 4FXGA 2R2HB 3G5VA 5DJ0A 4C7FA 2IH3B 4B9YA 3CJJA 4M1GH 5GSRA 3NZ8A 3CZLA 4GG6E 1KT2A 4LVHC 3MLPA 1HT6A 1RJZA 1M05B 2GI7A 4M7JH 1T04A 3EO1A 4R8WH 3VXMB 4K68A 2R56H 1TVPA 3VH8B 3DXAE 2PKDA 2GHWB 2C4XA 2PYFB 2RR3A 1IEHA 3X14B 2PYEB 1TETL 3VXSE 3WQ6A 1N8ZB 1A6WL 1NFKA 3P4NA 4OI9A 4LASH 5IB4B 2I24N 3NFSH 5C0AD 1OAQH 1TZHA 1QOKA 1B31A 4YXKH 1NCDL 2CLZB 3PWJA 2OMBA 1CLCA 1UVQB 2EEDA 5CILL 1VCAA 1T1WA 1V3JA 4GW4A 4WI2A 5ICXA 4PTWA 1JUFB 3O6FB 4F2MA 1TJGH 5BRZA 3QCVH 1HL8A 3QDJB 3NSNA 1I9JL 3V0WL 4XAWH 4MB4A 3WH6A 3UBXI 4YHKH 3MRFB 4XWOD 3WNOA 5HVWA 5IMLB 1B0WA 2CRZA 5DDHB 1UADC 4PJ7F 1RFDH 5D2LF 1YY8B 2DMBA 4PTXA 4V28A 2PR4H 4PUBH 2F1AA 1WV7T 5TDNA 1FBIH 4H0IA 4WU7A 1R0AH 3NFNB 1FLTX 1NMBL 4LLDA 3R06B 4KPHL 1JPFB 3W82A 2CR3A 4LLUB 3O9WA 4OD1H 3AQUA 3CLFL 3WNKA 1CLVA 2Q7YB 4D6DA 2DGAA 3GH4A 2MANA 2FX8H 4GI8A 2DMCA 3NPSC 2EH7L 4LRNL 3FQXB 1XGTB 3CFCH 4HXBL 4PJGE 3DMMD 3JUYA 4P59H 4D0DB 3VO0A 1U8HA 2Q7NA 3L5JA 2QPUA 3ARGA 3VNYA 3MOBH 1MLBA 2MQCA 1EEUA 5KSBA 3H42L 4D0CB 3LEXB 2GAZB 1ECEA 4J6RL 4TN9A 3BAEL 3B83A 3ZT6A 2BRRH 4MXVF 5DJCA 2BXYA 4OZOA 1JYNA 1ZLVK 3QUMA 1NBVH 4WWKC 1NGZB 2Y7QA 3QXDB 3SDXB 4IEFB 2BV9A 4FABL 1KCKA 4CD8A 4OZGB 1CU4H 1EAPB 4AT6A 3ES6B 4R7NA 3I3EA 3BH9A 4YH6A 2BJMH 4NN6B 5GIRB 4XBEH 4WRLA 3BPNB 5B8CB 3WN5B 4E8DA 5CIPA 4W5ZA 2ICES 1KF9B 4CCDA 1T22B 3WDHA 1F4XH 1WAAF 1AH1A 2IALA 2JB6B 1I8MA 2FCBA 1BIHA 3TA3C 4P23D 2ICWJ 1T5XA 1MHPL 3QO0A 3OWEA 3T0EE 4CN6A 1B3ZA 1CICB 3IJHB 3RU8L 4MVBC 3PXHA 2RJMA 1SQ2N 2EDOA 5EOTB 2GJPA 2HP4A 4NDMA 3O3BB 3O3AA 5IESL 1MI5E 1D3CA 3CO4A 1F2XK 1CGVA 1KLGA 1CDHA 1N5YL 4IM8A 3KPSE 4Z0BH 2I5YH 3VXTB 4E0RA 3WKZA 1CXIA 1PG7H 3C2AL 4RGNB 4HQQH 3T0EC 3M1BA 1GGCL 4ACZB 1OL0A 3G04B 1LE5B 1W1YA 4H20H 1FAIL 3W4RA 5LBSL 4PJDB 1KTKE 1I7ZA 4X7TB 3AZSA 1A9EA 4Q7DA 1PSKH 1B0IA 1FGVL 4GKNB 3W0KA 2ENSA 2I60H 2L7JA 2XFRA 3VD5A 2ZE0A 3T3ME 5MEQA 4LOUC 4FQ1H 1U95A 4F7CA 3CH9A 5BJTB 5HGDA 3D0LB 4WFGD 3MV9E 5IFHH 1YHTA 1CDCA 2WCSA 5SWZD 1A3RL 3O2DH 2AEQH 5KAQF 5D1ZD 1HYRC 1KG0A 5JW3H 4P4KD 4I0PA 5TQ2H 3SDAC 1E0OB 2RGMA 4KJWD 4ZO7A 1RMFL 4ZMAT 3MRIA 3WN5C 1HEZA 3RWCB 3S36X 1NGPL 4FQHA 4JGUA 1KWKA 3VIOA 3PWUA 4MXWH 4L3AA 1QSFE 3TH2T 1JWMB 3F7YB 1IZJA 5GGUA 5F7KC 1NCCH 3TIEA 1CICC 4CNIA 2VITA 1XR8B 5C08B 4PJDE 4X7FC 3EDEA 2R23A 1MFCL 3DDFA 3ZDXE 1UM6H 2A1WH 3NCCB 4JHBA 1DBML 4K9EC 3OR6B 4QHUA 1HIZA 2NW2B 2HVMA 1E27A 3SDCC 1JL8A 3WY3A 4KK5D 4D94A 3SPVB 3VWKB 1I1XA 1QWNA 4DZ8A 3SDYL 4Z7UB 3D9AH 1S7SB 1FA2A 3QUYD 4JZNA 4ZUUB 1XYFA 1K3IA 5I1AB 7A3HA 4RGNC 5MHSD 2VWEE 4QF1A 2BVOA 5GRJH 1FQ9C 4TVPL 2F5AH 2IPKA 3PWPD 4WEMB 4NQCE 5TE4H 3SOBL 2PWHA 2G41A 3F6LA 1CEOA 5KN5A 3T0DA 4HA4A 1WZKA 2DIAA 1MFAH 3Q6GH 5ABFB 1LO4L 3IDIB 3CFDB 3UCRA 1G7QB 2OQJA 2DPEA 1RJYB 1MREL 1TJHH 3P4OA 4PUBL 4MJ5A 1FLRH 3SCVA 1UA3A 4PP1D 1CDUA 4LQFL 1MAKA 3LXBA 4FQCH 1JGUH 5BVJA 2F53E 4I18B 4NJ9L 2NW0A 5C0IB 2IFFH 2B4CL 3OB8A 1NKRA 5ADOL 1EDTA 1G7HA 5GGVH 43CAB 2IG2L 2EECA 3AXHA 2VWEC 1H2JA 4MZ3A 3WMSA 3BP5B 3WUEA 1QLEH 5E5RB 2P5WB 1FFNA 1ZGLA 4CADA 4K7PX 2XZQL 1FFPA 3WH5A 2Z8VC 4R27A 3BSHA 4PJFB 4A6YH 4HKZB 4B53A 4WTWA 5GRUL 2OJEA 3S4SG 1GHFH 5DUPL 2AJXH 3U2SA 3KYMA 2J5LB 1QZ1A 3WHE0 2D0GA 4K3EL 3EJYD 4NM8L 4R96B 5D9SB 1AQMA 4IRJC 1R75A 1B0GA 3U1SH 3HI6L 4RGMC 1RHHB 5HVHB 2XHYA 2HFFB 4MNQB 4AM0A 5A3HA 1T2XA 4H1LA 2EICA 5HBBA 3A23A 1VF8A 3MI6A 1WZMA 3MOQA 2X8RA 4FHBD 4U6XB 5I15L 1JNHB 4LSVL 3GJFH 5KTEL 1S9KC 1RZKH 1CE1H 1S7VB 4HKJA 1PAMA 5EO0B 5DRZB 3O6LH 4DAGH 2G9HB 4W6YB 5F7UA 4XB7A 2NR6C 4OF3A 4MAUH 1WC7A 1ZHBA 5IBTH 5TE6L 2APTA 3P0VL 1FSKC 2X4SA 3DX2A 1MQQA 4HDIB 4K3DL 4HWBL 5I1KH 1V0NA 5SX5H 1F4XL 3EHBC 2XRAL 2TAAA 3SJVD 5DMYA 4NO3B 1R5WB 2OL3A 3CVIL 3QEQD 3DRTA 3VRIB 2X05A 1H8OA 1T03H 4PMNA 4M3KB 3WJLC 3MV7B 3AHZA 2PWGA 5EUOA 1KELH 1BREA 3DETD 4FP8H 4JDVA 1N3NA 1T0MB 4FFZL 1IARB 3D4ZA 1DR9A 4EANA 3RNKB 5HHPA 1J1XH 5IW6B 3BAIA 5KVEL 3PG2A 4BQCA 3PP4H 1HDMA 1K4CB 3AY4A 1OP3H 4HWZB 2EYTB 3QH3A 5GS2D 2X4PA 1HVQA 5T1LB 5MI0C 4GKSB 4ZQKA 2I5YL 2DWDA 1MELA 1EEZA 2YDRA 4OLZL 4N0FB 3RIFF 3SO3C 1L6XA 1BGAA 3WF0A 3U7WL 2DLGA 2NY4D 3I6GB 4JFWA 4X5XB 2FEDC 4UU9B 1YECL 1YYLH 2CRIA 5HVHC 4ZFOL 2PUQT 1OTSC 3QHZH 4M5YH 3OLEA 3CH1A 3EJQA 5LA2A 3LKPB 1PX3A 4HH9A 3MU7A 5D2NE 2YD9A 1XD0A 3MS8A 3BIAX 3L3JB 5T3XL 5CZVL 3MMEB 1C90A 1A6UL 3CXDL 5F9OH 3T0WA 4UQ9A 4NIKB 1TENA 2H2PC 5J12B 2VDKL 5J6HB 5BRZD 4HGWB 3BXWA 3MV7E 4NKDB 3EDDA 3M46A 2VDRH 4WUUE 4UZUA 5DTFA 4PRDA 5DK0A 3L5IA 3CHCA 4KRPC 1QNRA 4PJEB 3ARDD 1CNVA 5FOOA 5F96H 1LO0L 1Q9LB 4GXPA 5E08L 1C5CL 1HXMA 2HFEB 4TSCH 1LK3H 3ZDYE 2DRUA 1VEMA 3WFZA 2A6IB 1GCFA 5D2NC 2DYPD 5HHNB 1ESWA 2D7OA 4OFKA 3BLPX 3LQZB 4QOKB 3O8XA 2YKLL 5F9JA 5GSVA 3INUL 4LDLB 3VGFA 5HPCA 3WN6A 1CFBA 3TJEL 1CFSA 4TOQA 4PMOA 1KB5B 4UBDC 3EOAB 3FFCA 1ES0B 5E2WL 1H0GA 5TGBA 4XI5C 1QEWB 1UD5A 2AJSH 3FCTA 3DHMA 2WQ8A 4J3OC 1XF3A 3IVKB 4YBHA 3EYFB 4FQXA 2ITCB 3L4XA 3BPLC 5GS3A 2I07A 3ZOAA 4XCEA 2ICEB 4F7TB 1H0IA 4U6VL 4N0RA 4F9LC 1VIWA 5ECUA 4PD4J 2CDEA 4ZFFA 3C2SA 3IDMB 2IF7A 1HINH 4ONOA 3DIFB 1NCAL 2HTLC 4JDTL 3AMGA 3ARWA 4D8PA 1BJ1H 1YMHA 1U8PA 4PJHF 4Y0GA 2Q8AH 1CXHA 3ARGD 1FH5L 3BKML 4NO0A 3ZDZF 3U36A 3TT1H 3EAKA 4TUKH 1P1ZB 1UR2A 1FDLL 1M7XA 2CDFB 3C8KB 2E4TA 4EOWL 2NXZD 1RZ7L 3BD4A 3ZTNH 4X6BA 3W9EB 3Q6GL 5EFDA 1N59A 4HSQA 4XCFL 5TJWK 3UTTE 4P3WA 2K9UA 3LKRA 1FNSH 4HC1H 3Q3GB 2VX5A 1A6ZB 4JFFA 2X5PA 4PGCA 1FZOB 3VD3A 3BDBA 4XBGA 3RL1A 1S7TB 2EXYC 3SCMB 2EKSA 3HPJA 1O5DT 3VXOB 5J9PB 4O4YH 2LU4A 4OZFG 4PP2A 5HTSA 1OF2A 1HH9A 3ZE2E 4D9LH 3SUVA 1IZKA 2CGRL 3GRWH 5C70A 2IFFL 4U1NA 3N1GC 4WKHA 5E8DL 3QYCA 3TPKA 4BFIA 2N7BA 2XVGA 5B38B 3EJJX 3WNMA 1QLEL 2BX5A 4QRUB 1EFXA 3TVMB 3VH8G 3QJHA 3T2PA 1LJYA 1FORL 1A6VH 3GMRB 2XY1A 3MRBA 1JFHA 4K3HA 1PX8A 1U36A 4MGXA 3QIBB 4PFEA 3WFLA 1C5DB 1UXSB 1QX1A 3DXAA 1LF1A 1YPZE 4LPTA 4R2GD 1P4IL 5A3IC 1GIGH 1AR2A 2G5RA 4BSJA 4JO4L 3RWHB 1OARL 3C6SA 3GSNA 3VXSA 2WMHA 1QSVA 2VKXA 4WI3A 3P11H 1SM3H 4N0CC 4RAUA 4X6CF 2DQHL 3NGBB 4PRAA 2D03L 4KGJA 1NGQL 4R90H 1BOGB 2VT0A 3VFPA 4C54A 3IFPB 5C8JB 1FHGA 1I1AB 1YNLH 4H8WC 3VMOA 2FIRT 1W3JA 1H4PA 1ZJBA 1A02N 4OFYD 4DOHE 1OGBA 4M6OL 5F7FA 4ETYA 1WBZA 4FXKA 2FJFB 5CEXA 5TF1H 1XGQB 2GT9B 1U8KB 4FS0A 5CXPA 5GS0H 4KK9D 3G5XA 4XMKL 1I9IL 5A1AA 3U9UB 3ARBB 3EYOA 1KGCD 2W9EL 4MDOA 3G08A 3MXWL 4XHJD 1FRGL 1JZ8A 5DD5H 1WITA 2DICA 3RKDC 5HPMB 4YX2L 3UTQB 2PN5A 1HXYB 1NFDA 2DQEH 4HFUH 4S1QH 3W5NA 5EO1B 5K9KA 1QOXA 6CGTA 2J4WH 2WWKT 3AU1A 2WZPD 4OFDA 3KPPA 5E00B 5ISZB 2H32A 3SCMC 3MLSH 1AGEA 2BY3A 4K8RL 1TR1A 2YK1H 2BSSA 1UWEH 2OR9H 1BBDH 5EO9B 3GHBH 5FUOL 5K9JL 1CT8B 1O7VA 3DSFL 1RZJL 4FZEL 3ULUH 3QCUL 3L6FA 3SE9H 2Z91A 3WXVL 4HKBB 5D7IF 1QTYT 4XNYL 3BSZH 4XP6L 4LEXH 3P30H 5BCAA 1SYVB 3S36H 1Q9OB 3A6CH 4WWKA 2G4FA 4BZ2H 1KR0A 1RIUH 5CP3H 1MRDL 4R7DA 5DSCB 2YUZA 4CU6A 1P2CB 2E5EA 2R1WA 1P4LA 4NO2B 1JZ2A 5JOPE 3MLZH 4GW5B 1JI1A 1PG7W 1BZ9A 3OHXA 5FM5M 1S5HA 1NAML 3DRQB 1E55A 1YYLL 3VKKA 5E1QA 2VN7A 4P9HC 3WFBL 3CVHA 3FQRB 4OCWH 4AEFA 1C8YA 2WSPA 1ETZB 1Y18B 3HLAB 1HH6A 5JXEC 5L0QB 5IB3A 3IF1A 3EYVB 2ZSWB 3TA3A 5C0JA 3K1KC 3K4AA 2EDYA 2GJ6E 1QBML 3U0TB 2VE6A 3U4EB 1JAEA 4YDLC 5FYJH 2JLLA 4HJJH 4OZ4A 4QRRD 1MQKL 4RMVA 4RE4A 4PCTA 1DN0A 4PR5A 2DJ4A 3BFOA 4BK5A 4FQ2L 2J8UE 3THML 4DN4L 1IRAY 1URLA 3LRSA 2C1PB 4NYLA 1WT5C 3MRLB 1TA3B 1ED3A 1S7XB 3BHBA 3G6JF 3CPLA 3ARBC 3HFML 1A2YB 3MRDB 4OM0H 2FGZA 5HJ3B 5FFLA 4YQXH 3WD5L 5JQHC 1BMGA 3ARSA 5IM7B 4GS7B 5EU4B 3SUWA 1UR1A 3QSKB 5IVXA 4BQ2A 2HT3C 1G84A 3T0EA 4HHAB 4YDKH 1J5OH 2GJXA 1ZT7A 1UQZA 4CCEA 1UKQA 4I2XE 4UFLA 2P7TB 1YYMH 2Q76B 1Q9WA 2AABH 4K7FA 4Y88A 1GOOA 2NT0A 5M03A 4DZBA 1ADQL 1C93A 4O58L 5L2JB 4DGVL 1FJ1A 2JJSC 4E2OA 4K7PH 1U8IB 3LKOA 3HMXL 4LLAA 4KRMB 3L4WA 4W6XB 3RWGB 4H5SB 1MFEL 5HHMD 4L5FL 2XNAA 3MV8A 1MI5A 3MMDA 5EWIH 4PG2C 1YN7B 1UWQA 4L4VE 3KPSA 4IOFD 5F1IA 3FQTA 2DLHA 3TT3H 5IQ9B 4XH2A 5DQDH 1W2PA 3UTSE 2E3ZA 2QQLL 1UD8A 4W8BA 3GI9H 4JLRB 4I8DA 1QQDA 3SDAA 3TBTA 1EO5A 2E9JA 2V6HA 3WY2A 1DN2A 3EYUH 1SEQL 1NDGB 1OGTA 2WHMA 3QQNA 1KJ3H 1QRKA 2VDML 2Y8VA 5A2CA 1UZ6F 4N0YL 4YXLL 1J8HE 3NYDA 3MV9A 4V1DB 1IM9D 4N1EA 4DEPC 2CLVA 4F3FB 1E6SM 1NFDF 1P7KB 1MVYA 4N8CH 4LXFA 3OZPA 4JAMB 3NFPB 2W4XA 4Y4HA 1VACA 3ARTA 5I73B 4JFOA 2G3IA 1KN4H 4HCRH 3BO8A 1U3JA 2F54B 4YWGH 3SDCA 1DANT 3RHWF 1XF4B 1HHGA 1EQCA 1H1NA 1CF8H 2VUYA 2Q8BL 3RL2B 1DWGM 3EYQD 4DGYL 1S5IL 4J3WA 4LBEB 5KJRH 5L6YH 2DQTH 3R0MA 1FL6A 4R97B 3VIGA 1JGIA 1QSFA 2WK2A 3C9NA 1OWWA 3VD7A 1YNTB 4A2LA 2BVQB 3QEGH 2EPLX 3RGVB 5E4IA 1ZL1A 5DFWH 5KSAB 1FVCA 1IT0A 4JFVA 1IC5H 2XZAH 3AXLA 1QNPA 3VXUE 4LLYB 3QFJE 4TSAH 1F6AA 3V4PL 3EGSA 5ID0B 2XTJE 4QT5A 1CE6B 4PRNB 4HWEH 2R29L 2QQQA 4OB5L 1UXWB 4TQEL 4LCCB 1EGJL 3PJSA 4X9FA 4NRZB 5HSFA 2XYCA 5DD0H 5E2UL 3DHJA 1QD0A 3QDGE 4GUPA 3RNQB 4MQ7B 4P8WA 4LAJH 1U30A 1I75A 2ZPKH 4CCCA 4RMRA 4LKCA 5HI3D 2GJRA 5DD1H 1ITBB 5CMAA 4F7EA 1YMME 3ULVC 1DQJB 3CUHA 2D31A 3X12B 2GSIB 4NQCA 2FATH 2ATPA 1JPTL 2GUYA 3EMZA 5FM8A 1DSFH 1CG9B 5DJDA 7TAAA 1NPUA 1V3MA 3N9GL 2XTJC