3LHYA

Crystal structure of the mutant i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAAIVGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhyA00
3QSTA 2VELA 4JY9A 1GTHA 4LTSA 4B5NA 4FO4A 4FNPA 3N2MA 3TC7A 1OFOA 2NWRA 4U4MA 3R89A 2G96A 4AHPA 4K8HA 4M7TA 3RMJA 2F7FA 1AL7A 4UTUA 2G97A 4Q4KA 2WJZA 3M9YA 1RQBA 1T96A 1YPIA 1UUOA 4EF8A 4LW7A 1JCNA 3NL2A 3SY5A 4JNMA 4Y6GA 3EEGA 3W1NA 2DJLA 1Z48A 2PCQA 4IMGA 5G1YA 1O95A 2CLOA 1IXOA 2RFGA 2VEPA 3QSRA 5KSWA 5AC7A 1W0MA 1KA9F 1FCBA 1I2QA 3LTYA 4E2DA 1NF0A 1ZY9A 1FCUA 3RFAA 3CIXA 2QCLA 3G0XA 3WJZA 4HHPA 3UD6A 1Z44A 3BPWA 4X22A 2W0UA 3MI3A 3TDFA 5D2XA 1ZNNA 1ONRA 4TX9A 4NJHA 4MPQA 2X2GA 2CZEA 1QFEA 2ZRZA 1WOAA 1KTNA 3NPXA 3FJLA 3W7DA 3W84A 5U4NA 4ZL1A 1QNVA 3IIVA 1R2RA 2C16A 3ABRA 3LM7A 2X1TA 3G24A 3S0CA 1OFPA 3R13A 3O1NA 3W1MA 3P8JA 3LERA 1Q6RA 3NQMA 5LHEA 4QIUA 3SI9A 2CLLA 2Y62A 4A29A 1Q3NA 2V5LA 1SO4A 1O5XA 3DHDA 3E49A 4GUHA 2FPYA 2H8XA 5BNKA 1LBFA 5D33A 5F2MA 1QCWA 4R7JA 2HMCA 1VHNA 2XN0A 2A85A 3N14A 4DO6A 1TMHA 5KZDA 4IWWA 4E0CA 2ZZ7A 2QAFA 1IXPA 3LCHA 8TIMA 1XBXA 1F05A 1G7UA 3FFSA 1LOQA 4Z0SA 2P0OA 3GDTA 4AWUA 1XXXA 4N9EA 5CZTA 1QPOA 3FLUA 5BRBA 4GFSA 2BWGA 2NX3A 4PC8A 2WO5A 3DU0A 1O4UA 2ZZ6A 4BWLA 4JYDA 1F74A 4IXHA 1LRQA 1OX5A 1QOQA 5EY5A 3NZRA 5H2ZA 3FKRA 2V2HA 4N6EA 5BOOA 2H6RA 3W2MA 2ZFAA 4LS2A 1EWDA 1YTDA 3MBFA 1SZFA 3GAYA 2Y63A 3WJXA 2R8WA 1KM0A 4OV9A 5AFDA 3BGGA 2Q8LA 1YDOA 1B4KA 4NX0A 3C8FA 5AYXA 4HNTA 1UUMA 3G8EA 3Q37A 1JCYA 1X1ZA 2ZRXA 3PSVA 2ZRUA 2E6AA 4RXFA 4NVTA 4DXVA 2ZQ0A 1DBTA 3W7PA 3MI2A 4Y96A 4UTTC 2P10A 2V8ZA 5C54A 3FYOA 1FXPA 1WV2A 2V2DA 1AW2A 3G1HA 4XUGA 3W7EA 1QWGA 3EX6A 1DQWA 2VFGA 1PVNA 5D2VA 1OJXA 1J2WA 2CLKA 2YGYA 4QAIA 2FB3A 5DCEA 1PL9A 4E2BA 1OYCA 4IUOA 1X8FA 3TMQA 1Y0EA 2RKXA 3TJLA 3A24A 3S6DA 2A6NA 2JK2A 1FCVA 1VPXA 3SGUA 3W76A 2A5HA 5J5DA 1A50A 4EIVA 3WJYA 4O1DA 2A7RA 3Q2DA 4O12A 3O15A 2YR1A 5D32A 5L6UA 4IPJA 4Z1CA 4FX8A 4UCGA 1ICPA 2X16A 4EVZA 5LGXA 1KM6A 1JULA 2A7NA 2C18A 4TR9A 2NZLA 3IVUA 4UFJA 1GG1A 1X1OA 3NQCA 3TFXA 1HTIA 3N2XA 4M5PA 3IVTA 3W86A 3INPA 1A5SA 3S1XA 3MWAA 3CLMA 3OEXA 5FEZA 3TCEA 3DI0A 3VI2A 1HO4A 3WK2A 4JTLA 1WXJA 3L65A 1OYBA 4JDYA 1VS1A 3W1UA 4O0KA 1DKWA 4PCFA 3KOFA 4NNCA 3BLFA 3ELFA 3LCIA 5CPLA 1I8JA 4I7UA 1PCKA 4KFPA 1P0KA 1UJPA 3NZ1A 5C55A 1Q6QA 4ORIA 1IF2A 3ABSA 3SGZA 3UPBA 3W1TA 3B0UX 2EF9A 1TIMA 3SR7A 5C6MA 3NQ8A 3FEMA 4ZQOA 3DFTA 3EB2A 3IRDA 1GYNA 4LS0A 2OX1A 3HO8A 2AGKA 2JGQA 1RVGA 1CW2A 1MSSA 1JRCA 4QISA 3OVQA 3PY2A 5FF0A 4UTWA 4WOZA 4MYAA 1IIGA 4NNAA 5LNVA 4O4VA 4BI7A 3Q58A 4Z08A 3MMTA 3ATYA 5LNWA 4Y90A 3OHIA 1S5TA 3B0VC 3GAKA 1VLIA 3RLVA 3IEBA 5FI8A 1W5QA 5AYYA 1KM2A 1O5KA 4ADSA 3OVPA 4PH6A 4JN6A 4X9SA 3G1YA 4K8EA 4K6AA 1W5PA 3NQ2A 1XDLA 3G3DA 2ABAA 4LU0A 4XQ6A 3F4NA 3E0IA 2C1HA 3C56A 4C1KA 1H7WA 5KTLA 5I3KA 3EXTA 4O53A 2OMAA 1W1ZA 3CPRA 3O07A 4L4LA 2C6QA 2EPHA 3O16A 3EX3A 4RK8A 2I9EA 2TYSA 3B06A 4RLIA 3PF3A 5FEPA 4IMEA 4PFMA 3RF9A 2ZZ3A 1G4EA 4BFAA 3LV6A 4GXMA 3HG4A 4HKPA 4JTEA 5F4XA 3UXAA 2FB2A 4JXCA 3D0CA 2O7SA 1H5YA 2QCHA 3EKZA 1J5TA 2B7PA 4UTJA 1AK5A 1K7EA 4RX0A 4RXGA 4HSOA 3FJ6A 4MKNA 1LDCA 3GXNA 1R2SA 3GNNA 1UCWA 2GUUA 1GOXA 2E1DA 1OK6A 1G4SA 4XTDA 4XWUA 3TW6A 3OG3A 5HINA 4ORMA 3ZR4A 2TRSA 3LCFA 1Z42A 2V2CA 1JQVA 1X7FA 4R53A 5K7JA 1OF8A 2QCNA 5HWJA 2ZRVA 2WSYA 3NAVA 3P8IA 1EX5A 3M44A 4DBEA 1SW7A 2Y88A 3C2OA 2GQAA 1YTEA 2GVLA 3IGXA 2ZRWA 5D03A 1TTIA 3LLFA 1TQXA 2NXHA 3I7SA 3L9CA 1VC4A 4MZYA 4Y9AA 3LHYA 4BK9A 4LVDA 1RQHA 2PRLA 3TXVA 4ADTA 2DP3A 2CZFA 2V9DA 4UFIA 4LVGA 1TV8A 2EHHA 1JR1A 3OA3A 3S1UA 5I3GA 1JCMP 3HGRA 3T4CA 1W3TA 3O6CA 1UASA 1PIIA 2BX7A 3W7RA 2XN2A 3O05A 4JR5A 1LRTA 3DZ1A 4CQAA 3UWUA 4BI6A 3DFOA 3LOTA 3THQA 1HL2A 1ICSA 4NQ1A 3LGEA 4MVAA 4POCA 2GJNA 4HPJA 4FEZA 4OGZA 2J9ZA 1BWLA 1HG3A 2WOQA 4I9AA 4WY0F 1GVRA 1P5BA 1YADA 4WOQA 3E9AA 2WKJA 4ZVJA 5D37A 4YWIA 5I3IA 2JBMA 4ZQMA 1W5OA 1M5WA 3L66A 4AF0B 4Z0JA 4JGDA 2R94A 5K9DA 3L5LA 1Q45A 4PA8A 1KV5A 2B0MA 3SSJA 3QPYA 1F73A 2FLIA 3ZS4A 1G4PA 1D3GA 3HIJA 3BG9A 1SU5A 3SW6A 4O52A 4X2RA 3G18A 1KLYA 3UQNA 1R2TA 2X1UA 3F1QA 3LTPA 3TSMA 1YXYA 1W31A 4IQLA 1OFRA 2H3BA 2J24A 3DGRA 4IMFA 4BR1A 3P74A 4LVAA 1KTBA 1ME9A 3UNDA 2Q3OA 1SFJA 3DH7A 1FCQA 4CQ9A 4UTIA 3BW4A 5DCBA 1TTQA 4FX7A 5LNRA 3EX2A 1T0OA 2YFOA 5E93A 3LHUA 4LVFA 3BK0A 4OV4A 1FBAA 3HB9A 3KVLA 2H3DA 3L67A 3G1VA 3I7QA 1H7XA 2GVGA 2Y6ZA 5D09A 3W1PA 1JUBA 4NZJA 3STGA 3I6RA 3W1RA 3HG2A 2A7PA 4UTMA 4R33A 5EKYA 1SO3A 5KMYA 3BLEA 3CIWA 3S9YA 3O6DA 4O4WA 1W5NA 3S8HA 4OT7A 4JTFA 3C2VA 1PHWA 1K7FA 3FKKA 4MJMA 4JEQA 4ZQPA 3TKFA 3HJZA 5C2XA 1TTJA 3R8RA 1KFCA 4S2CA 3W23A 4LT9A 1S5WA 4JDBA 3W3OA 1VZWA 5K4XA 5EMUA 5F1VA 3C61A 4UNLA 2A21A 2Y89A 1G7VA 1GPWA 4H3DA 4K7YA 2QUUA 2ZTJA 4CCCA 3PUOA 4IMCA 4OHQA 4DEFA 1BEUA 3P60A 3LXBA 2YFNA 3EX4A 4UC5A 1LBLA 3QMSA 1C29A 3TSDA 3WJWA 2VEIA 4NNBA 1GVQA 1LP6A 3M5VA 3MJYA 1TJRA 1GG0A 3L2IA 3VCRA 4K36A 3ZFHA 1LM1A 4GC4A 5G2WA 1YYAA 1IGSA 5G1TA 4MZ1A 2YXGA 3MHGA 1WX0A 1ZAJA 1I2OA 2FJKA 2VEMA 3UWZA 2A1YA 2NWSA 1H7NA 4NJGA 2FFCA 4XZ9A 2OJPA 5G5IA 4NU7A 1YDVA 4K38A 2B7QA 2R91A 5I3HA 5C5YA 2V82A 3QQ0A 3TAOA 3V1PA 1NFBA 1GEQA 1XBYA 3W9ZA 1YXCA 2Q3RA 1BWKA 5HJLA 1PHQA 2ZZ4A 3W85A 3G1XA 1ZHAA 4AVFA 2QR6A 5HR7A 3UXDA 1LBMA 3IIOA 4YXGA 1OFBA 3JR2A 5TQLA 4FXRA 1I4NA 4UFLA 3RNDA 5EA9A 3QM3A 2PURA 1L6YA 3A5FA 3LRMA 2E5DA 3M5XA 4FNRA 1N8FA 1W3NA 2QCFA 5MHBA 1G67A 4A2RA 4ZQNA 3TE9A 3PB2A 4DF2A 1DORA 4O57A 1TV5A 4CCDA 4LS1A 4X3ZA 4O28A 5LGZA 3IGSA 1DHPA 5HWNA 1TPEA 3HPZA 2NXIA 4PL1A 1TPWA 2NX1A 4LNYA 4LV4A 1I2RA 1H7OA 3GZ3A 1GVOA 4RZ4A 2DORA 4WUIA 3TAKA 3N9RA 3BO9A 4Q32A 1GJPA 1QDSA 3EX1A 3K30A 3PWAA 3L0GA 5DY2A 4MZ8A 3CT7A 3H54A 4QITA 2H90A 2VFFA 3S1VA 2Z6JA 4O1AA 4P2VA 2AQWA 4PTNA 3LCWA 1TV7A 3W2JA 3HGOA 4UFMA 3WK3A 2TPSA 1OFEA 2Y70A 3QF0A 4KWWA 1ADOA 1TRIA 5CZJA 3B03A 3DI1A 5D38A 3N19B 1EPXA 3W83A 2QDHA 3HMJG 4O0ZA 2HTMA 4JTKA 5HQEA 1EP3A 1WYIA 1RQEA 4JY8A 4IMDA 2A2IA 5TIMA 3W2LA 1L2UA 1VCVA 1DOSA 1JVNA 5CSRA 1TPC1 3MHUA 4OBTA 3TUUA 2WSQA 1VYRA 3W7IA 1VR6A 1K8ZA 2E77A 1DJQA 3S1WA 3C6CA 5FF3A 2QCGA 2HSAA 3ABOA 3GKFA 4O8RA 1FY6A 3NDOA 3I68A 1S3HA 3A9IA 3W07A 4Z1AA 2QEZA 2RDUA 3HOJA 2Y85A 1TTPA 1KBIA 2FPTA 3QYQA 3LV5A 3W87A 4ADUA 1KW1A 2WV8A 3G3MA 3W1LA 1ME8A 2TSYA 3P82A 3NL3A 2QCDB 3QW4B 5I3FA 3DHFA 1P1XA 4LY8A 4JYEA 3NPWA 3SECA 1XBZA 1B9BA 1L6WA 1VHCA 1KFJA 1SO6A 1OF6A 5AOUA 1XFBA 2QCMA 3R5EA 1NSJA 1DL3A 4NZFA 2Y7DA 1H61A 2EGZA 2NV2A 3NQ6A 4JTGA 4JYFA 1QO2A 1XCFA 3QQ1A 3QH2A 4FB7A 3GXTA 3NL6A 1RPXA 3GR8A 4XTIA 4U28A 3I7RA 5LSMA 4JIPA 1C8VA 4OQVA 1GTEA 2WNNA 2CZ5A 3W75A 4EF9A 2Y61A 1MEWA 3GK0A 4CLMA 2A6LA 5DCDA 4RR4A 3Q94A 4PEKA 5F2GA 3GKAA 1EP2A 4OU1A 4L4MA 3L21A 4LRTA 3ABQA 4NXKA 1I2NA 4G1KA 4MUZA 2DZPA 3UWVA 3HG5A 2X30A 4HSNA 5CPNA 3BG3A 4RV8A 3BLIA 4IPIA 4FX6M 5AHLA 2G5WA 4AF0A 5KITA 1YLVA 1RD5A 4RZ5A 1KFEA 4TMCA 2ABBA 2O7QA 3R2GA 1GQNA 3TXZA 2VFHA 4NJIA 1WBHA 3LX9A 3NYZA 4N2YA 3P5YA 5G4WA 4O13A 3QMTA 4DBDA 3CEUA 3IV3A 2ATMA 1H60A 2J88A 3UYCA 5D2TA 1YTKA 4Z1DA 1A5CA 2WSRA 1F2JA 4GUJA 3LHTA 3THAA 5A8GA 4DF1A 2TMDA 3NNTA 3NM3A 3L5AA 1FDZA 2ZCGA 2CW6A 1H7RA 4YLWA 1G69A 1VRDA 4AAJA 1QPRA 4FNTA 1ZCOA 3KFTA 1XI3A 4BI5A 3N73A 4BF9A 4UR8A 5EYWA 5DN1A 2QCEA 3EXSA 1OVDA 4AHQA 1OK4A 2ISSA 2CLIA 5E0KA 1UB3A 1JJKA 3NVTA 3GR7A 3LDVA 4JTJA 4FF7A 4O19A 3TK7A 3UY8A 1UBSA 1V7YA 5A5WA 4HN4A 4CNNA 4BWLC 1OFDA 4N02A 1LROA 1H50A 1KM5A 4YMZA 5GVJA 1TREA 1WOBA 1OYAA 3IIXA 3L0NA 3MYOA 4QNWA 4HNNA 3NOEA 1PCWA 3B04A 4IX2A 3GDLA 3C2EA 3TQ0A 1SFLA 4H4IA 1WBJA 1JCLA 1V5XA 5AHEA 4MIMA 2WNQA 4MY9A 4UUIA 4DPPA 2X1SA 3LBMA 2NXGA 3CU2A 3VE7A 4YCPA 5K2ZA 2XFWA 2VC6A 3W70A 2OCZA 4ONVA 1NAL1 1S5VA 3TW7A 3W7GA 1R46A 3LCXA 1TSIA 3NGJA 4N9DA 4I7WA 2BSLA 2EAWA 3W7CA 3M0ZA 2Z2UA 5AYZA 3P7YA 5I3JA 4AEOA 1LORA 4TMBA 1VH7A 4P61A 2E68A 3NQGA 3PUDA 1GWJA 2YCEA 1KM1A 1LLZA 1MEIA 4CNOA 3AO0A 1FWSA 3TX9A 5L9FA 1G6CA 1C9DA 2Z0IA 3PVFA 3MI6A 1TRDA 2W79A 5HMSA 1HFBA 3UWQA 1F7BA 4UFKA 3UZJA 1LOSA 2FQIA 3WK0A 2OT1A 2R14A 2QAPA 1RV8A 3O6YX 4Q33A 5H91A 1A5BA 3CM4A 1Q6OA 4OE7A 4AWSA 1HO1A 5CPOA 4GUFA 1XUUA 1GVSA 1EUNA 3GDRA 3HG3A 1TCDA 4JICA 1ZALA 1VYSX 5KZMA 3DFPA 1VQTA 2HS6A 5HR6A 5F4SA 3WK1A 4M19A 2C0AA 3DKJA 2ZZ2A 2I1OA 3FS2A 3USBA 3EWZA 2B7OA 5DELA 4DELA 2DZTA 3HGSA 4C1LA 3W22A 5DLCA 4KWVA 1N55A 3UWYA 1YPFA 3T7VA 5EPDA 3C4UA 4FNUA 4HNUA 1XDMA 3R12A 3UY7A 3NA8A 3TJXA 1SR9A 1QPQA 1EB3A 3TFCA 5FF4A 4O16A 1PE1A 1ME7A 2ZA2A 3QC3A 2GOUA 1WA3A 4FNQA 1AG1O 4MFEA 2FDSA 4CNPA 2GVJA 3HPSA 3KAOA 1E51A 3LHVA 2ZBTA 2QJIA 2CZDA 3V75A 4A2SA 4LV9A 5FF7A 1TYGA 2QCCA 2DZVA 1W54A 3DAQA 1K7XA 4S1FA 4IGHA 4ML9A 4UTWC 2GJLA 4TO8A 2WQPA 2CFFA 3TQVA 5D2WA 3EWUA 3LCLA 4EOUA 4HIBA 3PR2A 1GVFA 3C2FA 5ABTA 5HWMA 4DPQA 3BVJA 3DENA 3LCGA 2J27A 3TC6A 1H1ZA 1TPUA 1FXQA 1L6SA 5LKYA 1DQXA 1FX6A 1LOLA 2QJHA 3NPVA 3JRKA 4MYXA 1H62A 2YYTA 4KFNA 2D73A 5SWUA 1DV7A 2NUYA 4FNSA 3MO7A 3KVJA 1VJIA 3W7NA 5DXXA 4GRSA 1SZGA 4WZHA 4YL2A 2B4GA 3MP5A 4O54A 3M16A 4UXDA 3ZWSA 1OX4B 3IGUA 2V30A 5AC6A 2YW3A 4QSHA 1XKYA 3TSBA 4O14A 1VYPX 2BXVA 1TPDA 2E6DA 1LTDA 5TBOA 4CCEA 3G1SA 1BTMA 2ISVA 3GYEA 4WQ6A 1AW5A 3UZ5A 1FWTA 1YXDA 1O60A 4UTHA 3EWYA 3W74A 3N3MA 4WY0B 3MW7A 3MYPA 4JX6A 4ALDA 1WDWA 1ZFJA 2GPTA 4UTTA 3KX6A 3EXRA 3TH6A 1TJPA 3HPXA 3NO5A 3TA6A 4JD4A 5AB3A 3CQ0A 2CLFA 3LB0A 3QW3A 4H6KA 2JKEA 3NQ7A 1VCFA 1GYLA 3CEPA 3G1DA 4HPXA 4N6FA 5CGQA 2ATSA 2OT0A 4NJJA 3IVSA 2E6FA 4UTLA 3LHZA 3EWBX 2QCDA 2VXNA 3L68A 4TU1A 3NQAA 1SO5A 3PC0A 1AMKA 2H8ZA 4LOCA 3NQEA 1JQXA 3QFEA 1H7PA 1DVJA 1M7OA 5T26A 1QO5A 3LBCA 3B05A 2QDGA 1W3IA 2DZUA 2RHGA 2ZTKA 3AJXA 3PAJA 1HUVA 3T44A 3E96A 2XN1A 3ZWTA 4EWND 3DFQA 1FQ0A 3RK8A 2C3ZA 1GZGA 2OZ0A 3TNOA 3FOKA 1OX6A 1W8SA 2J9XA 4UTKA 5K4ZA 5AHIA 1JCXA 2BLEA 3MUXA 1EEPA 2W6RA 3CB8A 4IJBA 5AHMA 3ANYA 3STFA 3W7KA 3EKLA 3W7JA 2EKCA 5FESA 1ALDA 3G0UA 3KRSA 3MHFA 5D2YA 1OG0A 4MY1A 5G2IA 4HNVA 5AHFA 2ZYFA 4DQWA 4A21A 3W72A 3KRUA 4NUWA 4O15A 4ZQRA 3LRLA 4FXSA 4LUIA 5D05A 3L0KA 1I2PA 2YW4A 1F76A 2HS8A 2QKFA 4O1BA 2NUWA 1K8YA 3C2RA 4DO5A 4GE8A 1NF7A 4JTUA 1ML1A 1QMLA 3A21A 3N9SA 1H63A 4TIMA 1OFQA 1FWWA 5DBUA 5EL1A 2JKPA 1QOPA 1WAUA 1CI1A 3O8AA 3NG3A 3S5ZA 1KV8A 2G95A 5BMXA 2JKAA 1KM3A 3TROA 3QRHA 4PODA 2FIQA 4XBKA 3TV8A 2RDTA 1M6JA 2QF7A 2Y7GA 4XKYB 3W7MA 1T99A 1DJNA 1P0NA 3SZ8A 1OFAA 1JUEA 3VKJA 2BZNA 4N9CA 3HF3A 4MLRA 3BG5A 4UFHA 1NVMA 5F2IA 2DZWA 5K9CA 2VEKA 2V81A 3U8GA 4KKXA 5CZSA 7TIMA 3F03K 4ICNA 5G4EA 1WQ5A 2RH9A 4N9BA 1QPNA 1D9EA 4UMBA 3S5OA 4OWGA 1F5ZA 4JS3A 4LWWA 2UV8G 3QMRA 2J9YA 2WPBA 1A53A 2DJXA 3GIYA 5AHNA 2CU0A 3W71A 4WXZA 3A5VA 3PBUA 1EWEA 5LNUA 3G1AA 2ZA3A 3L5MA 3PUEA 3GVGA 5LZLA 2Z6IA 5FEXA 4QNEA 1LRNA 1O94A 4FIRA 3PSWA 1H1YA 4RCXA 3T55A 4UMCA 1L9WA 4Y8FA 2VFIA 1KFBA 1RZMA 2C14A 1OABA 3GXPA 5HNRA 2B7NA 1KFLA 3MP4A 4RZ6A 1EUAA 3NR0A 3QPZA 3FYPA 3BW2A 5IBXA 3UPWA 3GDMA 4MY8A 1THFD 3MP3A 4QQ3A 4CQ8A 1R30A 5DXYA 4LC6A 1XBVA 4PL2A 3G0SA 2Y7FA 2C13A 3TQKA 5DY3A 3W2KA 1EA0A 1SZNA 4N4QA 4UMAA 4NX5A 2NLIA 4M6QA 1SPQA 1D3HA 3W2NA 3NPUA 4M6VA 2C15A 1NEYA 3W2UA 2V5BA 5KZEA 2PC4A 3NQFA 4W9TA 4O17A 1K3UA 3E02A 3P61A 5CPMA 3G22A 4FIQA 1Q6LA 5IM51 3OBKA 3LHWA 1IXNA 4AH7A 1QR7A 3IIZA 4Z1BA 1K02A 3RU6A 3LI1A 1EIXA 2PRHA 3VE9A 3KVMA 1K8XA 2PRMA 5CKSA 1BKSA 3H53A 4IXXA 2BTMA 3W7OA 3G1FA 1B3OA 2Z1BA 3LRKA 4O50A 1N7KA 5F1UA 3CWOX 3DBPA 3GLCA 3SIZA 2GQ9A 1Z41A 1XC4A 4GUGA 1B57A 2E09A 1TO3A 1ICQA 3STEA 3TU9A 3M1ZA 3W7LA 4GUIA 1RR2A 1F6PA 1SZEA 1AW1A 1LLWA 1JCJA 4XBSA 1XM3A 3GB6A 2NUXA 4LC8A 4YCOA 3B8DA 1PS9A 2ZDRA 2CLEA 2QJGA 4MJZA 3LTSA 1W56A 1TB3A 2AAMA 1PV8A 1TPVA 3YPIA 4NJKA 5U7SA 3SJ3A 3NEVA 4MOZA 1F6KA 3P81A 4LVBA 3PM6A 2X1RA 3NQVA 4IOTA 3TR2A 2YPIA 3CWNA 3LXAA 4NT0A 2YYUA 4ZQCA 5CZ0A 1LYXA 3QEZA 4LRSA 2VFEA 5CG7A 1FWNA 4O11A 3P67A 3W1QA 1TQJA 1SW0A 3BW3A 5CSSA 5EBUA 4GNJA 1W5MA 4K37A 3DXIA 3PBWA 1CX9A 1OX4A 3S5NA 2Q8ZA 3O63A 3EWWA 1FUYA 3KVKA 3PBVA 3WJSA 4WJEA 3W1XA 4WD0A 3BV4A 2V0TA 4E38A 1KFKA 3B4UA 1SUXA 3NQDA 3M7WA 1FDYA 3O06A 4WY0A 3W1AA 4QM1A 4RJEA 1OHLA 3HQ1A 4O1CA 3BARA 1U5JA 4AMAA 3U6WA 5FEWA 1ZAHA 2FPVA 6ALDA 5D30A 3OIXA 2E5CA 2VKZG 2FTPA 4KFOA 2YDAA 1EP1A 1IIHA 1MZHA 3T78A 3P5ZA 1MEHA 5AC8A 1TPH1 1KM4A 1VCGA 3NXFA 5J5RA 3S5YA 1XUZA 2ZRYA 3GNDA 2J6XA 5IBXC 4JTSA 3GX9A 3VFLA 5G2HA 3W7QA 4UNKA 3EWXA 3M5YA 4FHAA 4JIQA 5FF2A 5HUPA 3M5ZA 4JTIA 4JX4A 4I7VA 4O10A 2QUTA 2ZA1A 3U2OA 1P4CA 2JGYA 4AB4A 1J4EA 2WNZA 3M41A 3SFKA 3P62A 2DZSA 3WFAA 1M7PA 2CLHA 4NXSA 4M7SA 2ZZ5A 1LZOA 2ISWA 3KHJA 4UR7A 3DFSA 1A5AA 5DBTA 4WXYA 1U83A 2VFDA 1ZENA 2YSWA 3PG8A 3JS3A 1H51A 4K7VA 3BGJA 3KXQA 2P1FA 3M43A 3P80A 5KINA 2DZXA 1QAPA 3I65A 4K39A 3DFNA 3GDKA 1W37A 2KZHA 3DKLA 4LUJA 3QJAA 4MFDA 5BMWA 3A23A 3C52A 5K9XA 2ZZ1A 2LLEA 4GJ1A 3T40A 2YX0A 3VNDA 3IIPA 2E6YA 1SQ7A 4O18A 3C3NA 1GT8A 3ATZA 3E12A 1AL8A 4A3UA 5D02A 3NL5A 2CLMA 5D04C 4AWTA 1SW3A 4D2JA 1X6UA 3STCA 3CC1A 1MXSA 2A4AA 2Y7EA 3LI0A 3F4WA 2PE4A 1XL9A 1YDNA 4J9JA 2DU2A 4A22A 3CHVA 1KBJA 4MLJA 3G8RA 4GBUA 5LNSA 4IX0A 1MO0A 3W7HA 3A22A 1JRBA 4HT3A 2VENA 4ZMGA 4AHOA 2CWNA 2F84A 5K3VA 2IQTA 3W88A 2RDWA 3FA5A 2NX9A 2VOMA 4DF0A 4XKYA 2A0NA 2E5BA 5HULA 3KRZA 3LXCA 4QJ1A 1KTCA 3TIMA 3MBDA 4DO4A 4JTHA 1SSGA 4UIOA 1TPFA 3UWWA 4WX2A 3RLUA 3W73A 4JTTA 5F2LA 3OVRA 5HUOA 1ZAIA 1B4EA 1VLWA 3HBLA 3B0PA 3PB0A 3LLDA 3H55A 2YZRA 2C19A 4GWEA 4JX5A 4AXKA 3CTLA 1KLZA 1K03A 3M6YA 4R34A 4S2BA 1R47A 3PULA 1LCOA 1ZJIA 1SSDA 4RKAA 1IXQA 6TIMA 3M47A 3S42A 2GQ8A 3QZEA 3PBYA 3P84A 3TMLA 3HGJA 1FWRA 2NV1A 1G4TA 3W6YA 3FIGA 3C0JA 5E1QA 1VGAA 5F4WA 4N4PA 5LHFA 4ZZ9A 1TPB1 3NM1A 3PS7A 5BW6A 3N34A 1FDJA 2ALDA 5AN7A 1I45A 2I14A 1T8XA 2QUVA 4M6PA 3PG9A 1JUKA
chains in the Genus database with same CATH superfamily
2QIIA 4BQ2A 4LTSA 4FO4A 3AYVA 4ATDA 2G8ZA 3N2MA 1OFOA 3GG7A 2NWRA 5CJ5A 1M53A 2G96A 4AHPA 1PUDA 2G97A 1YPIA 1XISA 2NV9A 4A3HA 4EF8A 2RUSA 1JCNA 3NL2A 3IWPA 4DZ5A 2GUBA 2Z24A 5G1YA 2CLOA 4S3AA 2RFGA 1ZBWA 2XU2A 1RAKA 5KSWA 1W0MA 4E2DA 1XIBA 1L2QA 4A05A 1ZY9A 3UG5A 2CHNA 4V15A 4XSLA 1V02A 3RFAA 3WEZA 2QCLA 2IQDA 4RNJA 3WJZA 3WNKA 4IUGA 4HHPA 4HD5A 1Z44A 3SJNA 2I17A 2PLCA 4W85A 2W0UA 4QLLA 5BU6A 2PMQA 4V28A 4I9MA 1ONRA 4HB7A 4D8ZA 2X2GA 2CZEA 1W32A 2ZX6A 1Q85A 4WDUA 3ORWA 1KTNA 3W7DA 1TA3B 3LM7A 1YKWA 1J0YA 1EOMA 3G24A 1OFPA 5CSYA 3W1MA 3UGRA 3WDJA 4XAFA 4QIUA 3SI9A 5I6SA 2V5LA 2EBNA 4GPNA 2EO7A 1O5XA 4Q4RA 1BF6A 2R1KA 2H8XA 5BNKA 1M41A 1DJYA 4YTSA 1TUXA 5F2MA 3CQJA 4QROA 5KZDA 4AZBA 4E0CA 4FOUA 3LCHA 3DERA 5IHSA 4GKTA 1XLCA 4JTCA 3MJMA 1XLIA 1ECQA 4AWUA 1XXXA 3CV6A 5BRBA 1V0MA 2NX3A 3W53A 1A0CA 2JE8A 4JYDA 5CC3A 2E4TA 4LYRA 1QOQA 2XIIA 5H2ZA 3FKRA 4QEHA 1CCWB 1EWDA 3MBFA 1ZGDA 1WXYA 3WJXA 3GVVA 3BLKA 4GD0A 1B4KA 1IE7C 4E2OA 4EPEC 3GXFA 3Q37A 4L9YA 2VC9A 2WHJA 3AMCA 3W25A 4DUVA 4RXFA 4DXVA 3W7PA 3MI2A 5LA0A 4NZ3A 4QCFA 4F0MA 2Z29A 3VDBA 2P10A 4GFIA 3FYOA 2V2DA 5BYWA 1QWGA 2PEVA 1DQWA 4DZIA 1PVNA 5D2VA 3GSMA 3I4EA 3VILA 1IYXA 4ZXOA 3OGSA 3RR4A 2CLKA 4QAIA 1XH0A 4E2BA 4D8AA 1Y0EA 3TJLA 1GOWA 2BY0A 2JK2A 2XYLA 1QI0A 3ITCA 3SGUA 4O1DA 3O15A 1R38A 4QFUA 2YR1A 2BVWA 1ICPA 1CGUA 1JULA 4EXAA 3FXGA 4LUSA 5C70A 2CBUA 1TMQA 1IT7A 4MKVA 3INPA 3UVAA 1A5SA 2X09A 3QZ6A 3MWAA 1HXJA 3XIMA 5FEZA 1IZCA 2NLYA 1B31A 1HO4A 4AZGA 4EK7A 1OYBA 1V3KA 4YYFA 4O0KA 3TWBA 4NNCA 3TWAA 3LN3A 1YPXA 3VNJA 3EGJA 1I8JA 4CD4A 3FEQA 3SSZA 1UJPA 4ORIA 1AQ0A 3UPBA 1TIMA 5C6MA 3NQ8A 4LS0A 3W4RA 3HO8A 1S39A 3PWGA 3DC0A 3CV2A 4UTWA 4OFCA 2UY2A 2ZUUA 1KGXA 5LNWA 2NVCA 4Y90A 3TVAA 4PTWA 3VK5A 6XIAA 1B1YA 3B0VC 3URNA 3GAKA 4ZODA 2OWXA 1VKFA 3EMQA 5FD0A 3RLVA 2MUCA 4JNYA 3VM7A 4V33A 4DJEA 1PIFA 4ADSA 5BOFA 4N0RA 1Q6GA 4X9SA 1KXVA 4K8EA 4LXFA 4NRRA 3TOPA 3NQ2A 4XQ6A 2FYMA 3MMUA 2PDHA 1BYCA 3E0IA 3JZEA 4JTRA 4NKCA 4C1KA 4DWSC 2PPGA 3MV11 2VRJA 3DUGA 3EXTA 3K4DA 4Z17A 2OMAA 4I6VA 3ITLA 1LUCB 2G3FA 4RK8A 1V4YA 2JQXA 2TYSA 4DI9A 2PDUA 3NUKA 2XGZA 3RF9A 1QK2A 8XIAA 3E1F1 2HVOA 2O7SA 4XZNX 1AK5A 4LAOA 4RXGA 4HSOA 3GXNA 3NO3A 5DT7A 4Q4SA 2GUUA 4RV3A 3CV1A 4ORMA 1V6WA 3LA4A 3CUFA 1RY8A 3ZR4A 2V2CA 1JQVA 5HMEA 4HCDA 4C7FA 4PR4A 2VZUA 3TP4A 4GYJA 1DP0A 3QC0A 4DBEA 4W7VA 3WQEA 3WEMA 4QLJA 2GQAA 5ABFA 3LLFA 1UKSA 4AD2A 4GQRA 3WUGA 3UXKA 4LVDA 2CZFA 5A1AA 1IZKA 3PNZA 4HSHA 3CZLA 8RUCA 4F4RA 1R6WA 3BDKA 2OOFA 3HGRA 4A3YA 3T4CA 2ALRA 3W28A 4Q8VA 1NOWA 1FFQA 1PIIA 2GUYA 4PCPA 3WLTA 1FHDA 1M03A 3FGCB 3O05A 1QK0A 2ISFA 3DZ1A 4IIEA 3EMZA 4BI6A 1V6VA 4QE1A 3OBAA 1HL2A 4NQ1A 2J79A 5A6LA 1HG3A 2P88A 2DSWA 2J77A 7A3HA 4O1EA 2WKJA 5IFPA 3S2CA 4YWIA 5I3IA 4R85A 4AF0B 3TW9A 3MSDA 4JGDA 3QHNA 5K9DA 2YDQA 3CUXA 1FHVA 1Q45A 4PA8A 5CBJA 3SUVA 3U0HA 4G7FA 3T0DA 3VIFA 3SSJA 1BG9A 2FLIA 1D3GA 3TYAA 1CBGA 3SW6A 3A3WA 4X2RA 3PP7A 1AJZA 1EJTC 5D4YA 5FJUA 4B5SA 3F1QA 1E9ZB 3LTPA 5HPOA 5DMNA 1F07A 1W31A 1OFRA 1X38A 2WPGA 2BNJA 1NOFA 3ITTA 3NXLA 1SGJA 5IRPA 4HZMA 4GHRA 4U10A 4DJEC 1EZ2A 3EOUA 4UTIA 3BW4A 3EB4A 2WVTA 5LNRA 1DJHA 2DZAA 3F4VA 3LHUA 5I06A 4PMJA 3TYUA 4AEEA 1O1HA 3T05A 3W1RA 4XVEA 2BOGX 5EKYA 2WSPA 1SO3A 1MRQA 2ACRA 1W5NA 1OEPA 3S8HA 4OT7A 3ALGA 1XX1A 2WBGA 3T0CA 1PYFA 1H49A 2A3BA 4QX4A 4QR6A 3IJLA 4S2CA 4M0XA 3WUFA 2XGIA 1S5WA 1TG7A 1MQPA 2BGNE 5K4XA 4G7EA 1WUEA 1RBLA 4RE0A 5I7GA 4UNLA 1HGWA 2QUUA 2OOGA 1N8WA 1AQFA 1E0UA 4IMCA 4DEFA 2WAGA 1BEUA 1O6IA 3LXBA 3S6OA 3EX4A 2C1IA 3EKGA 2TODA 2ZVRA 2VEIA 1GVQA 3HQNA 3MJYA 1TJRA 1GG0A 1R0MA 1PKLA 4LEFA 7ENLA 1LM1A 1YYAA 1QBAA 3CAVA 2YXGA 2I5QA 1I2OA 2FJKA 2VGIA 5JBFA 3SN4A 5CAHA 3UWZA 2NWSA 2VR2A 4PUJA 1S3TC 3FVMA 4PB3A 4S39A 2CWXA 1PZ2A 1VFHA 2B7QA 3G5EA 3CIVA 3BAYA 1NFBA 1H4PA 1REQA 2PDQA 2XZ9A 2Q3RA 1PHQA 4RDYA 1TFVA 4NILA 4AVFA 5I0DA 5HR7A 4J2PA 4MB3A 4KF1A 3T2PA 1KRCC 1WDSA 3VDHA 3PPFA 1CLKA 3QM3A 1L6YA 3A5FA 4LH8A 3LRMA 4LANA 1N8FA 2QCFA 3F4DA 3WLKX 5MHBA 2NW0A 3QGKC 2IUZA 3OOQA 4Z1YA 2PLJA 1EFZA 3S9IA 1L6FA 3AXKA 4B91A 4X3ZA 3UFYA 3A9BA 1MZRA 2D2OA 2E9LA 3HPZA 2NXIA 5EFFA 2NX1A 3PZOA 1TX0A 2GDUA 4AY7A 1YNPA 1H7OA 1XKJA 4RZ4A 3LUTA 4Y9MA 2DORA 3TAKA 1X97A 1B90A 2VJXA 3EX1A 4EWJA 4L65A 1KR1A 5IDIA 4KMQA 3ZLHA 3MSGA 4P7QA 4US5A 4O1AA 5HMFA 3LCWA 2FVKA 1DE5A 1F8IA 3FK4A 3WFLA 5D38A 3N19B 1QNQA 4J5NA 1EPXA 3WF4A 4DRSA 4UOJA 4CN1A 3HMJG 4JTKA 5HQEA 2IKIA 3TYEA 1L2UA 3NVDA 1DOSA 1JVNA 2D3NA 5CSRA 5CC7A 1VYRA 3W7IA 2DFAA 3CQKA 1FWGC 4AZHA 1XSJA 2OVLA 4G8TA 2PI6A 1FY6A 1S3HA 3A9IA 1MW3A 3HOJA 3B9NA 2YL5A 2Y85A 1TTPA 3C0LA 4MNJA 1E0XA 2UZ9A 1UWRA 3OYZA 2VDGA 4LBSA 4J3XA 4ADUA 1KW1A 1I6NA 1ODUA 4GA8A 3W1LA 3VD7A 3VTRA 2TSYA 3RAOA 4UOQA 3CWHA 3ES7A 4XX6A 3SECA 3WH5A 1LQAA 1LQ0A 1XBZA 1VHCA 1UUQA 2OU4A 3EOEA 3FJNA 5JBDA 4ENLA 3ONBA 4QS5A 1ZSXA 2R1LA 2Z27A 3QQ1A 4XTIA 4U28A 1KCZA 4F0LA 2QNEA 5LSMA 4JPGA 3SIMA 3TONA 1W3HA 2Y8VA 4OQVA 1GTEA 3W75A 4EF9A 2Y61A 4IQJA 4CLMA 1R3QA 5DCDA 4RR4A 3GKAA 4L4MA 5HJYA 3QXBA 1EH9A 1A5UA 3Q65A 5I00A 3HG5A 1Q5MA 2DQWA 5CPNA 4RV8A 1R7AA 4FX6M 2D23A 5I3DA 5KITA 1YLVA 1KFEA 1ZTVA 3ZR6A 2OZ3A 1XQLA 3CMFA 4UZSA 3E2VA 2O7QA 3TXZA 2YCKX 4N2YA 2FTWA 5G4WA 4DBDA 4AC7C 3CEUA 1A4MA 3IV3A 2PGFA 3BSMA 5A3HA 1XRVA 2YCLB 1YTKA 2CKRA 4GUJA 3DX5A 4EXQA 5I02A 5A8GA 2TMDA 3L4TA 3GWQA 1UR2A 1E3ZA 3L5AA 2CW6A 2QPSA 1H7RA 4YLWA 1RK5A 1G69A 4ZCWA 1QPRA 4HYWA 3OU8A 5BCAA 4BF9A 3GTFA 1XLMA 5DN1A 1YRRA 2QCEA 4UR9A 4GY7A 3QTGA 3LS9A 2CLIA 4S3KA 1QJWA 1EJXC 1HJSA 3NVTA 3B4YA 1FVPA 2WMIA 2WC3A 3AXXA 4O19A 1UBSA 2V69A 3P0WA 2OYKA 5A5WA 1L8PA 4D1IA 4R7WA 2YCIX 3K2GA 1UA3A 4F66A 1H50A 1ODZA 2BHZA 1TREA 3L0NA 3NOEA 1ISXA 4R3UA 2WLYA 2Q71A 3LK6A 1R3VA 1JCLA 1V5XA 4UUIA 4CNSA 2X1SA 1HZYA 4MUPA 1KRMA 3GXIA 3CU2A 5K2ZA 2WANA 2VCAA 3R8GA 3QV7A 4ONVA 2C1GA 3TW7A 2XH2A 4C1NB 1XG3A 3ZSSA 3F2DA 3NSXA 4DZHA 5AYZA 4S23A 1AZ2A 4AEOA 3ARXA 3LQGA 3I4KA 2EXOA 2YCEA 1KM1A 3RILA 2V63A 3PK7A 3P6LA 2B31A 1MEIA 3AO0A 3CMGA 3VMNA 3N2BA 1WO2A 3IANA 4QE5A 1M1BA 3MI6A 4PMQA 2W79A 4GGHA 1DE6A 1F7BA 4UFKA 4MDOA 1US0A 2OT1A 3EDKA 1E1FA 1RV8A 1V03A 4Z2IA 1CIUA 4GO9A 4OE7A 4XZWA 1GZ1A 3NOYA 3WLRA 1HW6A 4JICA 3E2SA 3I3BA 1MFUA 4TVUA 5KZMA 3G1RA 3T0TA 5F4SA 3ZMRA 5HR6A 5CBIA 7REQA 4JQAA 4ML4A 2I1OA 3FS2A 3USBA 2GGIA 2CBIA 4HOXA 2EPMX 5DELA 2DZTA 1LQ2A 1RSCA 4KWVA 1N55A 5DFAA 4WCJA 5BU9A 1V8EA 5C71A 4HNUA 3R12A 3GR4A 3UY7A 1VBGA 5M17A 2BFGA 3IUIA 4H8NA 1NTHA 1UD8A 1IEIA 1VIZA 2P50A 4Q7NA 1PE1A 2GOUA 4Q6XA 3VD3A 3D5HA 1WA3A 1OGGA 1DJXA 1KRBC 2E40A 4MFEA 4AD0A 4CNPA 3KAOA 4W88A 3V75A 1TYGA 3D3FA 4WIWA 4S1FA 2XH4A 4IGHA 4LUYA 2GJLA 2WQPA 3NZGA 2CFFA 3EWUA 1LWIA 3GZAA 5DMLA 4HIBA 3A4WA 3GU2A 2DEPA 2O4QA 3IPWA 3WLJA 1FTXA 2J27A 2IS7A 1TPUA 3WL0A 1L6SA 4B5VA 3SO7A 3OLIA 3JRKA 3AISA 2YYTA 2D2HA 1MFVA 2ZUSA 3KP1A 2NUYA 5FJJA 4JHMA 5DXXA 2AMGA 1SZGA 1SJAA 5A69A 5LA1A 1R3RA 4UXDA 1UR1A 1QNRA 2V30A 5AC6A 4P8XA 1VYPX 2OPJA 2E6DA 4CCEA 3G1SA 1BTMA 1E3XA 2V5CA 1AW5A 3EWYA 1QNPA 3MYPA 4FK9A 1MDRA 1W9PA 1GCYA 3KL3A 5AZ1A 2GPTA 1CEOA 2PDKA 3EXRA 2PU0A 1TJPA 3HPXA 2YA1A 3NO5A 1QASA 5AB3A 2CLFA 3LB0A 1BD0A 3EDJA 3VNKA 3G1DA 4HPXA 2Y5SA 4PUWA 2A79A 1B3WA 3BOLA 4NJJA 3NSMA 3LHZA 2OEJA 2QCDA 2VXNA 3L68A 4TU1A 3PC0A 4F0SA 3NQEA 3QFEA 1H7PA 3VDCA 1HQTA 1LL7A 3ZIZA 1HNYA 2FMOA 3LBCA 2QDGA 4C6DA 2W91A 3EDFA 1KCXA 4ZO6A 1HUVA 3E96A 1L8NA 3ZWTA 3VC5A 3DFQA 1FQ0A 4NAFB 3RK8A 4EWND 1GZGA 1XH1A 3VGBA 1E6QM 3F4CA 2J9XA 2JEQA 3MUXA 1UMLA 1EEPA 2VNCA 4IJBA 2NVDA 3TYDA 4F9DA 3AMKA 3W7JA 4LX4A 3L4ZA 4H1ZA 3KBJA 3MHFA 1Q7MA 3WDRA 4C5YA 3D46A 3PZVA 3TYBA 3H23A 1PB0A 4H9TA 5CJNA 7ODCA 3EA1A 3VOJA 3W72A 3KRUA 4O15A 4ZQRA 4FXSA 5D05A 1RALA 1I2PA 4D9PA 4XZIA 1K8YA 3C2RA 1EF2A 1Q6EA 5A8NA 4GE8A 2HVMA 4I9JA 4JTUA 1QMLA 1UKOA 3PPGA 3TA9A 3U2EA 1DYSA 1FWWA 1YW1A 5EL1A 3O8AA 4LUTB 3S2NA 2G95A 2E28A 3FDKA 4JQ1A 3TROA 2G0WA 4LPCA 3TV8A 2RDTA 2W62A 4Q4PA 3JVAA 1M6JA 4XB3A 3WNNA 2QF7A 5ENLA 5CGTA 1A3XA 4XKYB 1KWKA 1P0NA 3SZ8A 1Z3NA 3QGAC 4MLRA 2EEXA 5K9CA 1VB9A 3UBPC 1WQ5A 3PNUA 3WFZA 1M7JA 1J10A 1WZMA 1UD3A 3QMRA 2DJXA 4Y8EA 3ZVHA 4BZYA 3A5VA 2QPXA 3H2OA 3SQSA 5LNUA 1OB0A 1OWQA 4B92A 1V3LA 3MUY1 3UZZA 3PUEA 3GVGA 5LZLA 3R0KA 4GINA 2Z6IA 4JCLA 1EGZA 3GW0A 3CPGA 3E0LA 1H1YA 3LZ5A 4XO7A 3VOGA 2PDNA 1AH3A 3ARPA 2VFIA 5C9RA 4MB5A 3MP4A 1EUAA 4JZ5A 3NIYA 3F5LA 2Q02A 3MP3A 1GOOA 4CQ8A 1R30A 1VFTA 1DWGM 2PF8A 3W2KA 1TCMA 1AODA 3WQFA 3BMXA 3FVDA 5D8WA 2CERA 3NPUA 1GQJA 2YBVA 2C15A 1FP9A 3HQOA 2V5BA 7TAAA 3SEPA 1EJWC 1H0IA 3OGRA 2BODX 3E02A 3LG3A 3P61A 1XYCA 5CPMA 3G22A 2JIWA 4FIQA 2PWHA 3GHSA 3TQPA 5E6ZA 3OBKA 3WQ8A 1AUSL 3WQDA 1W1TA 1P6WA 4TX6A 4Z1BA 2ZWYA 1K02A 3LI1A 1JYWA 4DWSD 1GYMA 3NURA 1SR0A 2ZUNA 3KVMA 1SM9A 3EOLA 1V79A 4PUNA 3G1FA 4NYYA 4X2PA 1J0HA 4REQA 1B3OA 3ITYA 3LRKA 4O50A 3GTHA 4DM1A 4GQBA 3DBPA 4Y9NA 3SIZA 2GQ9A 1NP2A 3SCNA 1Z41A 2ZE0A 2Z7GA 4GUGA 1B57A 4L56A 2PGRA 3TU9A 1TE6A 2CEQA 2WB5A 4IFOA 1JDFA 5C9UA 1CGWA 1IEWA 1T40A 2BHUA 3L4VA 4WK9A 1U1HA 2NUXA 2WMGA 3B8DA 4GG9A 1PS9A 1EOKA 3GXMA 4MJZA 2VGFA 3B8WA 1Q65A 1S2AA 1TB3A 2AAMA 5A6AA 3BJTA 4OTKA 3YPIA 5U7SA 4IISA 4HMEA 3P81A 3L4UA 4LVBA 1S38A 2O4MA 5HQLA 4PULA 3S46A 3CWNA 1MQQA 4NT0A 4BKNA 1K9EA 3SCWA 4CVWA 4ZQCA 3CK5A 1PKMA 2I56A 4M51A 4LRSA 3AHTA 2YKKA 3W81A 4DWSB 4O11A 3P67A 3BW3A 5CSSA 3V0UA 4GNJA 4C6KA 4F3HA 1OGBA 3PBWA 1OX4A 4RDWA 3MB9A 4ATWA 1JXKA 3EWWA 1FUYA 4HHHA 2V0TA 4E38A 2PWVA 2OQYA 4JFTA 1FDYA 4WY0A 1DWHM 2ZX8A 1WKEA 3W1AA 1JAKA 1UWSA 1GK8A 3HQ1A 3SN0A 3ME3A 2OKTA 1GJWA 2ZUWA 3E0FA 1ZAHA 2FPVA 4S3DA 1HJUA 1ZJAA 3OIXA 3OP2A 3DEQA 2G37A 4KFOA 3T78A 4DYJA 2E67A 1KM4A 1VCGA 1J01A 4Q8PA 3NXFA 4F0HA 1VJSA 2V5KA 3GDBA 3WUBA 1P0EA 3GNDA 4M81A 3GX9A 4NZ4A 2Y8UA 3URQA 2CKSA 2W27A 1JGIA 1PZ0A 2QUTA 4O10A 3POCA 3CHFA 4TX8A 4AB4A 3IJ8A 3M41A 2XWEA 3G6LA 1CZ1A 1HF6A 1F3TA 2ZZ5A 3BURA 3RX4A 1C90A 1A5AA 1UWIA 4NRSA 2VFDA 2GL5A 1FHUA 4FLSA 3BGJA 4ZEPA 4GNKB 3CHDA 2DZXA 2PP1A 2YOCA 2KZHA 3KOWA 3QJAA 5DF0A 4BF5A 3LPFA 1A4LA 2WZIA 3C52A 4ZSTA 4X60A 2ZZ1A 2LLEA 4LUSB 2YX0A 2E6YA 1SQ7A 2J74A 1GT8A 2X8RA 5CBBA 3SRFA 4AWTA 2PP3A 4D2JA 3MCNA 3STCA 4MF4A 2X41A 3RN6A 1VFOA 1XL9A 2DU2A 3D6NA 1EYWA 4A22A 3CHVA 1KBJA 4LALA 3VCNA 2ZDSA 2ASHA 5LNSA 4IX0A 2PWUA 4X63A 1XINA 4DX3A 4HT3A 4NL1A 4ZB2A 4LAKA 2ZC1A 4JEJA 2GFTA 2RDWA 2NX9A 3TTOA 1W1YA 2W9MA 2QW5A 1GORA 3BMVA 4S3GA 1ITQA 1WNOA 2QHAA 4LY4A 3J7HA 3TIMA 4PRRA 4GQ0A 2ZWZA 3GBEA 1YE6A 2QGHA 3RLUA 1W9BM 1BSLA 4WLCA 3AMLA 1VLWA 4QEEA 4B5XA 3H4GA 4H6EA 2OLAA 4AZCA 3OQEA 5J04A 1K03A 3TJ4A 4E5TA 1ONWA 2CESA 3R0UA 3FSTA 1SSDA 2VX4A 1VBRA 3M47A 1V93A 3P84A 1SFSA 3HGJA 1G4TA 3LLXA 1BWVA 1DWIM 5E1QA 5F4WA 1XYLA 3T6CA 1E6XM 4ZZ9A 3NM1A 3PS7A 3WLSA 4INFA 2ALDA 4B4HA 1T8XA 2AGTA 1CDGA 1BAGA 2FZNA 1FKWA 4PMOA 3DDMA 4DLFA 3QR0A 2DH2A 3GW3A 1CXFA 2O0TA 4Q8OA 1CXEA 1J0KA 3MZNA 2D1ZA 3QV8A 4FNPA 1SVDA 3TC7A 3ABZA 3R89A 2DSUA 3VUSA 5M03A 4ZBCA 2YL9A 2F7FA 3RRAA 4AISA 1AL7A 3K8KA 3M9YA 1RQBA 3EA2A 4GI9A 2GZXA 2VM8A 1UUOA 2VOTA 3SY5A 4Y6GA 3OYXA 3W1NA 4F40A 1CGTA 2DJLA 4I6KA 2J78A 2GJPA 2PCQA 3CZEA 2V3EA 5IXEA 4OUIA 3PANA 4AXNA 1IXOA 1A5NC 1TKKA 1VBHA 3GH4A 3PJXA 5JBEA 1F3EA 1KA9F 1AMYA 5AC4A 1FCBA 1DPMA 1I2QA 5ABFB 2QYGA 1FCUA 3G0XA 4OOUA 4E8CA 4R5EA 3UD6A 5JH1A 1UD2A 1JNDA 3BPWA 2DSZA 4X22A 3MI3A 3GC2A 4E3VA 3F2BA 1ZNNA 3U48A 4MPQA 3WLPA 1OD0A 1QU4A 2ZRZA 3M0JA 3W84A 3FJLA 2EPNA 4ZL1A 5JUVA 5EMJA 1KKRA 4U33A 3O1NA 4YJ5A 1Q3NA 3AHXA 4YVPA 3D47A 2PSNA 4NZ1A 4Q4OA 2J7HA 2J25A 3ANUA 1QCWA 2J62A 2HMCA 3G77A 2VWTA 1ZP3A 4QS6A 1TMHA 1N82A 4W7UA 2QAFA 2X40A 2PZNA 4Z0SA 2OO0A 2P0OA 3GDTA 3TTYA 4TUFA 4W5ZA 1M68A 1XD1A 3SCRA 3CH0A 3AU6A 1LLOA 2BWGA 4DUOA 1DJWA 4O0QA 1O4UA 1VENA 3RM8A 5FJOA 2OQLA 1PKYA 1DXEA 1V0LA 1LRQA 2J7GA 3NZRA 2Y0FA 3ITVA 4X61A 4NAEA 3QN3A 2ZFAA 5HAOA 1GHSA 1BXBA 4KQNA 3W38A 2PD5A 1JCYA 1X1ZA 2DV0A 1UC5A 4NSBA 1TIWA 4OVXA 3SURA 4AX7A 1Y65A 2PTWA 1EZWA 2HXUA 2E6AA 3AFBA 1VFUA 2QS8A 3FHQA 3HPFA 3F5KA 3CAWA 3NZPA 1HKWA 4UTTC 1RK6A 2V8ZA 5C54A 3CUIA 2WC4A 1WV2A 1GQIA 3EX6A 4MB4A 2VFGA 4O1FA 1J2WA 1WB0A 1U5HA 5C9XA 2J8GA 4G7EB 2YGYA 3RO6A 3EMCA 3KOYA 3OLDA 4IL0A 4IUOA 3W29A 1E15A 1X8FA 3F2CA 2L5HA 3XINA 3A24A 4MADA 5JH2A 4GJIA 4EPDC 1IEVA 3WJYA 3MQTA 1TJ1A 1XLEA 1JDCA 3C0QA 4EAYA 5D32A 4IPJA 1LG1A 5HNUA 4EVZA 5LGXA 4IIHA 2HE8A 4RDVA 1KM6A 4ZB0A 4DNHA 3HJEA 4TR9A 2NZLA 3IVUA 4UFJA 2YCJA 1GG1A 1X1OA 2PWGA 3WNMA 3B9EA 2EPLX 2A3HA 3TFXA 1HTIA 3RPDA 1EO5A 1VIWA 1VD6A 3CLMA 2HWGA 4W87A 3WK2A 1F9CA 1WXJA 3W1UA 3KTXA 1XPGA 4GI4A 4US5D 4D6JA 3VKAA 4PCFA 1REQB 3BLFA 4XG1A 3LCIA 5CPLA 1PCKA 1P0KA 2F8QA 5C55A 1GVIA 1DXFA 4GKLA 2Z4GA 5LA2A 2FDMA 3UZWA 5JIWA 2A3EA 4L64A 3SGZA 1V7AA 3VFCA 3W1TA 3NEHA 2OODA 4ZQOA 3DFTA 3EB2A 1JNEA 2CNCA 3GYCA 3KCOA 2AGKA 2OELA 1CW2A 1BGGA 1MSSA 1JRCA 3W82A 4HYVA 4PMDA 1IIGA 4KCTA 1PDZA 3RPMA 4ZOBA 2CCRA 2VP8A 3ATYA 5MKGA 5DANA 4WRHA 4HTYA 2PDLA 4UBPC 3IEBA 3PFMA 5FJTA 2VGBA 1W5QA 4M80A 1W2VA 4NZ5A 3G1YA 3FAWA 3UG3A 4K6AA 1WDPA 4KWUA 1NWTA 4CQDA 1XDLA 1LWHA 3F4NA 1QI2A 3C56A 5I3KA 1P1MA 1A49A 3N6HA 1E6NA 2BHYA 3O07A 1EBGA 4NZCA 1OCQA 3DFYA 3DGBA 3O16A 1GJUA 3EX3A 5A2BA 4W8LA 2CC0A 1D3CA 5HATA 4PFMA 1I0BA 4BFAA 1XLAA 1JI1A 4JTEA 5F4XA 3UXAA 1WP6A 3D0CA 1H5YA 5M1TA 2B7PA 5FACA 3W01A 4UTJA 5CPSA 3CB3A 1H3GA 3WQGA 1LDCA 1Z32X 4LYPA 4O8AA 3W02A 3V1HA 4HBKA 1KR0A 2E1DA 1BYBA 1QW7A 3V18A 4XTDA 4XWUA 5HINA 1Z42A 4B5WA 4HK6A 3KBWA 5HWJA 4IJRA 3NAVA 3M44A 1GQKA 1SW7A 3SCOA 2DT2A 3IS4A 1YTEA 2WHKA 3IGXA 2XSBA 3ITXA 4CQCA 1EDTA 1RCQA 1NQKA 4M29A 1TQXA 3L9CA 4J1OA 3KEHA 2IQ0A 1VC4A 3LHYA 2CBJA 3GUGA 1QBBA 4NASA 4XK2A 1RQHA 4NYUA 3TXVA 1JZ7A 2WZHA 4UFIA 2EHHA 3MVTA 5ABGA 1VEMA 3AI0A 1J0IA 3O6CA 3CAKA 1HVXA 2BX7A 3W7RA 3ANVA 1E72M 2GJXA 4JR5A 1LRTA 3UNTA 3DFOA 1ICSA 4LF2A 3AIUA 3H7UA 3CO8A 3A3HA 1JYXA 4KGJA 2GJNA 1DTNA 2DGAA 3USZA 4W8AA 4U3CA 1GVRA 3CUGA 2UY3A 3E9AA 4ZVJA 4ZQMA 3G6MA 1W5OA 5A6JA 5EBAA 3WMSA 1UWUA 1JZ6A 3H70A 3KS6A 2PBOA 4B3LA 3L5LA 2VWSA 4NY2A 2Y5JA 3AWNA 4OJYA 3B9AA 1J0JA 1F73A 3T2OA 1POKA 3THCA 4TXEA 3TLLA 2VC7A 2NT0A 3G18A 2W66A 1KLYA 1I60A 3T42A 1QI5A 1M65A 4IQLA 4HMCA 2ZADA 1O7AA 2HBXA 3H8AA 3ARYA 4H19A 3P74A 4LVAA 4B15A 1ME9A 2PC8A 3BXWA 1FCQA 2FMNA 4FI4A 1Y5XA 4HA4A 1TTQA 2PDGA 1T0OA 2YFOA 5E93A 2WMIB 5M3WA 1FBAA 3HB9A 2H3DA 3L67A 5LXEA 3G1VA 3N29A 1CXKA 3KHDA 3T08A 1H7XA 1X98A 3W1PA 3STGA 4P5UA 4IGNA 5BXSA 1KXHA 4UTMA 4R33A 3O6DA 2V3DA 3KTSA 4PTXA 2FVLA 4JTFA 3W27A 2V5JA 1K7FA 3FKKA 4MJMA 1W9XA 2ZKMX 4JEQA 4ZQPA 1S5NA 1W1IE 3W3OA 3I6TA 4EKJA 1U1JA 3LGGA 5EMUA 2ZUVA 5B80A 2V67A 2A21A 1GPWA 4K7YA 3T81A 1W6TA 4XZBA 5CCZA 3PUOA 4HK5A 1T5AA 5ECVA 5C9ZA 2A3CA 4IPLA 4AUBA 1QXLA 3QMSA 3K1DA 4W89A 3KUMA 1WDRA 4NNBA 3U2ZA 4KCUA 1LP6A 3M5VA 1R3YA 1K8CA 1JD9A 2HDJA 5E9AA 3VCRA 4K36A 5G2WA 3ZT6A 1WX0A 4CN4A 4KIEA 3AZTA 4WVXA 4JKKA 3UJ2A 4NJGA 1MDLA 2OJPA 3L12A 4NU7A 1XRTA 3S5SA 4J3ZA 2V68A 2O9PA 1UKPA 1HP4A 4QAWA 7REQB 4DB7A 5IFTA 2ZZ4A 3PJWA 1ZHAA 1ZU8A 3K8LA 3UXDA 1LBMA 4OIFA 2V38A 2QXWA 1WPCA 4HQVA 3JR2A 4ZFMA 4UFLA 3RNDA 5EA9A 4DJDA 3E74A 4FNRA 1DXIA 1E5NA 3OHMB 1NWUA 3BQ5A 1CTNA 1W3NA 4J3VA 1G67A 4A2RA 4O57A 4LS1A 5LGZA 2XM1A 2OKOA 1XICA 1DHPA 1EJUC 1TPEA 1ZL1A 4PL1A 4AD1A 4H41A 1XIDA 4LNYA 3GS6A 3GZ3A 1BVNP 1GVOA 1PWLA 1UQYA 3MKKA 4WUIA 4GIEA 1GJPA 2PBGA 6PTDA 1XPYA 1QDSA 3PWAA 3L0GA 5DY2A 3UGVA 2WBKA 2NSOA 4AYSA 2H90A 2R1NA 3OBEA 3PTDA 1RP9A 3HGOA 3WK3A 1OFEA 2PTXA 4KWWA 4C6CA 1TRIA 3B03A 1ZBVA 3S83A 1SYTA 2WVUA 2ZXAA 4O0ZA 1LL6A 4JY8A 4MJ2A 5TIMA 4RPQA 2WYSA 3HPAA 1B3YA 2GK1A 3H7VA 4GZ7A 4GVHA 1P48A 3TTQA 2PDYA 3MKVA 5FF3A 1KCKA 1TUFA 2PDCA 4TVCA 3WBXA 3WLNA 3ABOA 4QJ4B 3NDOA 3I68A 3A4JA 4Z1AA 1W8GA 4YHGA 1KBIA 3QTPA 3LV5A 3W87A 1IT0A 3ZYZA 1BVZA 1ME8A 2QCDB 1Z89A 3VU2A 4JYEA 1PTGA 4AYGA 1L6WA 1MW0A 4FS9A 1NSJA 1DL3A 1NIUA 2ACSA 2NV2A 1Y5VA 2ZE3A 4JTGA 4JYFA 1QO2A 2PS2A 1XCFA 1E9LA 5ABEA 2H9AA 2CXEA 4JIPA 4C6LA 4HJFA 1C8VA 3M0YA 3WEOA 2W4XA 2CZ5A 4Z2JA 1MEWA 3GK0A 4LBUA 3AYTA 1HKMA 3OZMA 3G2GA 5DO8A 4OU1A 1ZRQA 4PFHA 3OPSA 2VURA 4LRTA 4U31A 3I6EA 2DZPA 3UWVA 4DHGA 4LJ3A 4QTGA 3VOHA 3BG3A 4H00A 3BLIA 4U2ZA 4IPIA 3AXMA 5AHLA 4H9XA 4RZ5A 4IMAA 1AZ1A 2P8BA 5KEZA 4TMCA 2GVYA 3R2GA 4WSKA 4NJIA 3IK4A 3LX9A 4PMYA 1YDYA 3QMTA 4H2HA 2D69A 1XR2A 4B3KA 4URIA 5D2TA 1JZ4A 1A5CA 1OIFA 3LHTA 3MDWA 3THAA 3MMDA 4DF1A 4DJDC 3NNTA 1RBOB 2GJRA 3NM3A 1W91A 1FDZA 1KRAC 1RCOB 1TV3A 4DUXA 4BEQA 1VRDA 5B7ZA 1ZCOA 4Y9OA 3R58A 1EYEA 3N73A 4CD8A 5EYWA 4D6DA 4JFSA 3SADA 2ISSA 1UB3A 4CGTA 2YDSA 4B9YA 3LENA 3TK7A 1V7YA 2F2HA 2IXVA 4BWLC 1OFDA 4N02A 3M4HA 3IIXA 3MYOA 4QNWA 2ON3A 1PTAA 4Q4MA 3TQ0A 3IAQA 4MIMA 3M6DA 4MWAE 4PRTA 4L9XA 3LBMA 5GNZA 1XYAA 1W3JA 2PLMA 2XPKA 1JPIA 4WGHA 4YCPA 3W70A 3K5XA 1S5VA 2BY3A 3GXDA 3ZT7A 5BWFA 1RPKA 4LCRA 2X7WA 4A8RA 2Y5EA 2P0IA 4FXFA 3U5UA 1LORA 2JF6A 3CV7A 1VH7A 4P61A 2AQVA 3NQGA 4JQ4A 3COTA 5BXRA 4TV6A 4G5DA 3LPPA 1LLZA 3BAJA 1FWSA 4LBRA 5L9FA 3A64A 3V0SA 3KDNA 1TRDA 5LIWX 1UKQA 3UWQA 1NFGA 1LOSA 4PE8A 3WK0A 2BY2A 2QAPA 1XD0A 3CM4A 3H12A 5CPOA 4GCAA 4GCXA 1C9WA 4GH1A 1VYSX 3E6EA 4QSFA 2R9RA 2QGYA 2YLLA 2REQA 4V1XA 5T8GA 5GJMA 2ZZ2A 3VGFA 3VOFA 1OD8A 3BJFA 3MKCA 2ZIDA 3KLLA 7PTDA 4REQB 1YPFA 4NI3A 3VKCA 2IKJA 4DNMA 4H8UA 1IT8A 3RLGA 3QY8A 2D3LA 3GVQA 4O16A 2Z26A 3T8QA 3N4AA 3PN8A 4FNQA 4B5TA 4D8LA 2ICSA 3NJ3A 2QJIA 1MRAA 3C0SA 3DG6A 3T9PA 2G3NA 3M0XA 1QOXA 1GONA 3QFWA 4MKSA 3NWRA 3RGTA 1C8QA 3ARTA 4AD5A 3EZ4A 5D2WA 1GVFA 3KL0A 1GUVA 1K4HA 3C2FA 5ABTA 4DPQA 3BVJA 3LCGA 1AH0A 1J18A 1FX6A 1LOLA 3THUA 2NQJA 2FZDA 1PDYA 1EJRC 3WQ6A 1PZ1A 1DV7A 2WHMA 3SUTA 1VJIA 5FSDC 4HZ8A 4XD3A 5I24A 4WZHA 4HU3A 1OX4B 3IGUA 1VPQA 4QSHA 1XKYA 3TSBA 4I3GA 2BB0A 2ISVA 3GYEA 1DEDA 4PMVA 2NSXA 3S4TA 4UTHA 1UH3A 4ZTXA 1N2VA 4WY0B 4JX6A 1EJVC 3KOZA 1ZFJA 2HQAA 3MSYA 2GGGA 3OODA 2GWNA 2E25A 3SRDA 4H6KA 3NQ7A 1GYLA 2X2YA 2FVMA 4S38A 2VVSA 3VGGA 4RW5A 2Y4SA 3CZ8A 3NQAA 2OSYA 1GKRA 1AMKA 2G4JA 2H8ZA 4LOCA 1GOQA 1JQXA 3WLIA 3AJ7A 2DPEA 2O56A 4DBUA 3OG2A 1AD4A 3B05A 4MJ4A 2NQ9A 2DZUA 5ECUA 1GNXA 4LCSA 3KTCA 4WHBA 3T44A 2XN1A 4H9UA 2CYGA 3WLLA 4C6JA 4PB5A 3AUOA 4JN8A 4Q6JA 2OZ0A 2GOKA 3FOKA 5CC5A 4ES4A 4UTKA 5K4ZA 4ZTYA 4BQ3A 5AHIA 3SRKA 2W6RA 3VPLA 3W7KA 3EKLA 5FESA 1ALDA 1UZ1A 1ZBCA 3M0HA 4P8VA 4XVDA 5D2YA 1OG0A 4PTMA 5G2IA 2XISA 4ZO9A 2NQ5A 3B0YA 2VUNA 3RYSA 5AHFA 1B5TA 4F48A 3JU2A 4NUWA 4XZMX 3BLDA 2YW4A 1MNSA 3RM9A 2QKFA 3VIOA 4ZSUA 4C90A 3MTWA 3A21A 1H63A 4UB9A 3ZOAA 5DT5A 4XAGA 3QZAA 1CI1A 3GE7A 2PP0A 1VBJA 4H7ZA 3S5ZA 4YYCA 4J3SA 1GVEA 4IFRA 2SFPA 3QRHA 3EWCA 3RDKA 1BKHA 4K8GA 1OIMA 1VP5A 1XLHA 1T99A 1TX2A 2VR4A 5HDRA 1XIMA 2BZNA 4N9CA 3HF3A 4GZIA 5E0CA 1FHLA 3ZQ9A 1NVMA 2DZWA 2P3EA 1D8WA 2WCGA 2VEKA 2V81A 2VHLA 5EMMA 3U8GA 4DWSA 7TIMA 4ICNA 5G4EA 3HU7A 4XAZA 4UMBA 4AZCB 2DIEA 1F5ZA 4JS3A 4LWWA 2QJNA 1UH2A 3GIYA 3W71A 4PCTA 2V6AA 4JCMA 3ZT5A 3GG8A 1NDZA 5JXQA 3MUCA 3RIKA 2F2KA 4YNGA 3NGFA 2J7BA 2ZA3A 4AG0A 1JPMA 2ZOXA 4EAMA 1MQRA 4QNEA 1LRNA 1MYRA 1DJGA 5I5RA 4FIRA 2ZICA 3T55A 3WD0A 3T1GA 3GXPA 1OABA 3II1A 4C6IA 5HNRA 1XIEA 2QPUA 3QPZA 3BW2A 1FOBA 4MY8A 4GISA 3V7PA 2RDXA 3ZVIA 3OQ8A 5AZ0A 4S3EA 4PSRA 1E40A 2UWFA 3TQKA 4JTDA 4HOWA 5DY3A 1XHGA 4XAYA 1AD1A 3R4IA 1SZNA 1ECEA 5CLWA 4NX5A 2PTYA 1SPQA 1W1A1 2FKPA 3W2NA 3T2QA 1NEYA 2O55A 3W2UA 4GOAA 4ZOCA 2DUZA 3GY1A 3NQFA 1UR3M 4J2MA 4W9TA 4O17A 1FA2A 5PTDA 3T4WA 5HOSA 1BF2A 1C8YA 5G4HC 2VX7A 3H22A 1IXNA 1S1PA 5EMLA 3WO8A 2AOSA 4CD6A 4AH7A 3IIZA 3BAIA 1EXBA 1E6ZA 4H6RA 3ERPA 4PEEA 2PODA 5FIPA 3H53A 3CH9A 2PDBA 4JIEA 2XH7A 2YB4A 2Z1BA 3SUUA 4XKMA 4L61A 6A3HA 1XC4A 1X1NA 1OT2A 2YXOA 2E09A 3FSUA 4G56A 4FXJA 1TO3A 2J4GA 2PDIA 3WY1A 1EHNA 3RLHA 3M1ZA 3W7LA 3WG6A 1A3WA 2JIEA 1Q8AA 3VD4A 2VQUA 2I7GA 1AW1A 1LLWA 1PTDA 1XCWA 4XBSA 3GTXA 3BLPX 1WDDA 1S2CA 4MMWA 3GVRA 3LTSA 3TTSA 1X7IA 1W56A 4RW3A 4PSPA 3NEVA 3HZ3A 4FOKA 3N25A 1VPYA 2YPIA 3LXAA 4LYKA 4D6CA 2DUXA 2YYUA 5CZ0A 1LYXA 1FWNA 1P0DA 3KLKA 3W1QA 2E9MA 1TV4A 1SW0A 1E4IA 1MW1A 4K37A 4AD3A 2GLKA 3VXGA 5LIUX 4IIFA 3EA3A 3S5NA 1QRQA 1XLJA 8CGTA 3T07A 4WJEA 1U2YA 3PZ9A 4ASTA 5DRIA 3DHUA 4ILSA 4NAEB 4NHVA 4MAZA 3SRHA 1L6GA 1SUXA 2FHCA 4ZFCA 3M7WA 1DJIA 3VIHA 4GQQA 1ZZMA 1U5JA 3KBSA 5E09A 4UWMA 4TVDA 5IOBA 4H7CA 3AICA 3N17A 5M5DA 2EJAA 4HA3A 1XSKA 2FTPA 1UW9A 2YDAA 1EP1A 2XIJA 5AC8A 1TELA 1P0BA 3VIGA 3PZTA 1E5JA 4AC1X 1UZDA 2DSVA 4JTSA 5G2HA 3W7QA 4UNKA 1JF5A 3ECQA 1CXIA 3M5YA 4JIQA 4GLEA 4LSBA 2E3ZA 4JX4A 1BG4A 1P4CA 2ADAA 3U9IA 2WNZA 2BOFX 3P62A 3W00A 4PBFA 4NXSA 3KL5A 1M7PA 4M7SA 1OADA 4OKDA 4UR7A 3DFSA 4FA3A 4HZ6A 4R27A 3EAUA 4L80A 4PMZA 3M43A 3WH8A 3I65A 4HZ7A 3GDKA 3HFTA 2Z1VA 3EYPA 3A23A 2BS9A 2VX6A 3CUZA 3T40A 3H2CA 3BAXA 4O18A 3E12A 1ZJBA 2X1IA 5D02A 2CLMA 4RZBA 3VKBA 1MXSA 2A4AA 2DT0A 2Y7EA 1M3UA 2PE4A 1YDNA 3V3WA 4YVXA 4OBRA 1ZP4A 3LPOA 3G8RA 4GBUA 1IEQA 4IT1A 4E4FA 3W7HA 3A22A 1JRBA 4M8UA 2HRWA 5K3VA 2BMBA 2IQTA 3AQUA 4GIYA 3RX2A 4ATLA 2A0NA 3DG3A 2E5BA 5HULA 4Q8WA 3ZM8A 3VIMA 2G41A 5AY7A 1PX3A 1RCXB 4EX4A 3MBDA 3T0BA 5MKGB 2OEMA 1TPFA 3UWWA 1XIHA 4WX2A 3W73A 5F2LA 2AL2A 3HBLA 3I3EA 1I1WA 3PB0A 4Q22A 3IJQA 4K68A 4GWEA 3ZZ1A 1L0PA 1KLZA 1BLIA 4S3JA 3N3TA 1R47A 3PULA 4ZR8A 4A8LA 1LCOA 3TN5A 4HN8A 4BEUA 1NH6A 2GQ8A 3WD1A 3PBYA 1RLCL 1WDQA 2E8YA 1FWRA 4WKAA 2NV1A 3W6YA 3SFWA 3VMOA 2VDIA 1E1CA 4J27A 1OZQA 3LD5A 5LHFA 1AQHA 3H2FA 1NOUA 5AN7A 3R79A 2I14A 4M6PA 1FWIC 3EOOA 1CGXA 9XIAA 4HGXA 1E9YB 3C2YA 2VELA 3OTRA 1JXJA 1O1ZA 1GTHA 1NDWA 3GH5A 3RJXA 3E0VA 1Q4WA 4K3ZA 1XIGA 4K8HA 3RMJA 1FFRA 4UTUA 2WJZA 3VM5A 1T96A 4JTQA 4YS1A 1OSEA 4W8BA 9XIMA 4IMGA 1O95A 1RXOB 3PZUA 4RPPA 3QPEA 2VEPA 2VCBA 3PJTA 5AC7A 4P8WA 3CZKA 1XQKA 3L2LA 4WF7A 3WUEA 1J9YA 3MUZ1 4BA0A 2E7FA 3BICA 2CHRA 3M0LA 5F7UA 4JQ3A 2AKZA 4P7NA 1XWYA 3L23A 1E0WA 1TJ2A 3WDHA 1R7OA 4TTUA 1JZ8A 4XAPA 1OBAA 4CVUA 1JI2A 2WMHA 1V3MA 3TDFA 4PN2A 3JUGA 5D2XA 4YTRA 4TX9A 4NJHA 1QFEA 3ZR5A 5E6YA 5D8ZA 1WOAA 1W9DM 2GJXB 5U4NA 1QNVA 3IIVA 1R2RA 2C16A 3ABRA 2X1TA 4IQEA 3S0CA 3GTNA 1YBQA 1BQGA 5LHEA 4A29A 1SO4A 2J7DA 3R10A 3DHDA 3QQWA 3E49A 4GUHA 2FPYA 2F6KA 1ISVA 1R9ZA 3CAQA 1TVNA 1LBFA 1HL8A 5BRPA 4FZIA 1IR2A 3QV6A 1DWAM 4R7JA 4W5UA 1XGZA 2IXUA 3N4FA 1VHNA 3PAOA 1IV8A 3UZYA 3N14A 3ZJKA 4IWWA 4P7LA 1IXPA 3L4WA 2BV9A 2I9UA 1XBXA 1F05A 1YNQA 1G7UA 5BRQA 4I8YA 1JL8A 1LT7A 4YHEA 4N9EA 3Q67A 5CZTA 8A3HA 1QPOA 3FLUA 1OGSA 2ZZ6A 4IXHA 4GH3A 1EC7A 4Q8TA 1OX5A 4PBEA 3AUJA 5EY5A 3N6JA 3PHAA 5BOOA 2H6RA 3VC6A 4LS2A 4Z2KA 1YTDA 1SZFA 3IUHA 1KBKA 4KCVA 3ONCA 3GAYA 3K13A 1VEPA 5AFDA 2Q8LA 1YDOA 1KQYA 2QMJA 3C8FA 4HNTA 2JEPA 4ZE4A 1UUMA 3G8EA 4LCQA 3V35A 5HNTA 1NWRA 4L6DA 3PSVA 1E4MM 1W1PA 2ZRUA 3O0FA 4NVTA 2ZQ0A 1DBTA 4OUEA 3AMGA 1RP8A 2YJQA 2PGWA 1UOKA 4FR1A 4Z2GA 4OECA 1PSCA 2PUZA 1RJPA 1FXPA 3V0TA 2AQOA 4ERGA 1Q6FA 4B16A 4B9ZA 3BE7A 5H8UA 3L2MA 3AALA 1OJXA 4GZEA 4H9ZA 2FB3A 4DJDD 3A12A 1PL9A 3RPTA 3TMQA 2F6XA 3CS2A 1FWHC 2RKXA 2D20A 3WMLA 2PCEA 2A6NA 2XVKA 4FOJA 4Q3MA 1FCVA 1VPXA 2A5HA 1NWSA 5J5DA 1A50A 4EIVA 4PUKA 4ZO8A 3Q2DA 2PDXA 4O12A 4L4PA 2A3LA 3F7JA 3WQWA 5L6UA 4QDWA 4KRUA 3VGDA 1I9CB 4UCGA 4A35A 3CYVA 1E6PA 2VD8A 3N12A 2C18A 2WSKA 1UR9A 3ARUA 4J3UA 3S47A 3NQCA 3N2XA 7CGTA 4M5PA 3IVTA 3AHVA 1VRXA 4HHMA 3S1XA 3M64A 3TCEA 2PTDA 3DI0A 3AIVA 4JIHA 2C79A 3TZNA 2R1MA 4JDYA 1VS1A 3VD9A 2UY5A 2QVNA 1A5OC 3KOFA 1UBPC 3ELFA 2YXXA 4I7UA 4F9JA 1JDAA 4KESA 2E8ZA 1IF2A 3ABSA 4QE4A 3E5BA 3B0UX 3TCSA 2EF9A 3SR7A 5I03A 2W67A 3FEMA 4LAUA 3LGDA 4KWSA 3WL1A 2OX1A 1RVGA 4QISA 3OVQA 3PY2A 5FF0A 4V2XA 5A2CA 4NNAA 1G94A 5LNVA 3H2EA 4O4VA 4ZB5A 3SN1A 3MMTA 3UJSA 1UR0A 1C7SA 3OHIA 3PZGA 1S5TA 1NM9A 3AXIA 2Q8XA 1ZS2A 1PZ3A 5FI8A 5AYYA 4QJ5B 1O5KA 1OCJA 4PH6A 1W5PA 4W86A 2QVHA 3G3DA 2ABAA 3L4XA 4LU0A 1ISYA 3E2QA 4O53A 2HNHA 4H8VA 1HX0A 1MVYA 1W1ZA 3CPRA 4GVFA 1XRFA 3CXOA 4L4LA 3PTMA 4H8HA 3K46A 5REQA 2EPHA 1PKNA 3U7BA 3WQ4A 3B06A 4DAIA 2R24A 4RLIA 3VKKA 3E0WA 4IMEA 2ZZ3A 2FGBA 4GXMA 3HG4A 5LIXX 4HKPA 1OC5A 2FB2A 4JXCA 3U3HA 4W84A 4PUDA 1XDJA 4Q7IA 5A8MA 1J6PA 3OZPA 1J5TA 1H5VA 1K7EA 2VDHA 4RX0A 3FJ6A 4MKNA 1R2SA 3QOKA 4Z42C 2GK1B 1UCWA 1S2UA 1GOXA 1OK6A 1G4SA 2OFJA 3OG3A 4G2DA 2TRSA 1UP0A 2I5IA 1X7FA 3A4XA 5K7JA 4F0RA 2QCNA 4G1NA 1I1XA 3P8IA 4ERAA 1Y8BA 3C2OA 1N8IA 2GVLA 5D03A 3H26A 3VGEA 1VF8A 4QGCA 1XLBA 1TTIA 2YDRA 2NXHA 3I7SA 4MZYA 4Y9AA 1J6OA 1IR1A 4WSHA 5T9CE 4BK9A 1P7TA 2PRLA 4Q8QA 2A3AA 4ADTA 2DP3A 4IGSA 4A3RA 1DWJM 4LVGA 1JR1A 3OA3A 2JF7A 1GKQA 3NZQA 1JCMP 4FP1A 1D7FA 3WNPA 1W3TA 3GFYA 3N1AA 2H9AB 2Z00A 4K1GA 4C6NA 2J47A 4I8DA 1KBLA 3LOTA 3THQA 2GVEA 3LGEA 1S1RA 3TJIA 4POCA 4HPNA 3VINA 4HPJA 2HJPA 1VFSA 4OGZA 1BWLA 1W1VA 2WOQA 3I10A 4WY0F 3HMCA 1YADA 4WOQA 4MSSA 2ACUA 1C7TA 1KFWA 1VFFA 2JBMA 5BOEA 3L66A 4GZJA 2R94A 3LSBA 2FZ9A 2KAUC 2QLYA 3AIQA 2NQZA 3MCMA 3UWEA 5E70A 2B0MA 4C7DA 5DMYA 3ZS4A 2EPKX 3WQVA 1PIGA 4I90A 4HA0A 1SU5A 4O52A 4LFYA 2E0PA 3P3BA 1R2TA 4G6CA 5RUBA 4ZXLA 2J24A 1A5LC 5AVNA 3DGRA 5AC5A 3AS0A 4IMFA 1KTBA 4JAWA 2Q3OA 3DH7A 3BOFA 4CQ9A 5DCBA 4FX7A 1EKOA 4FLRA 2ZX9A 2NQLA 1FWDC 3VMPA 3I7QA 1G0CA 3WZ0E 2GVGA 5D09A 4NZJA 3I6RA 3FCPA 4AWEA 2FGLA 2A7PA 2BGQA 3CIWA 3S9YA 4CU8A 1JGMA 2MNRA 4LNCA 3E5PA 3N4EA 3C2VA 1BXNA 2VZOA 3KCJA 4DYKA 1A3HA 3VDGA 1A5KC 3TKFA 3UVIA 3HJZA 2GQ3A 1BHGA 1TTJA 3R8RA 1KFCA 3QKEA 3W23A 1J93A 1A5MC 3QKZA 4LT9A 4B3ZA 4JHZA 3SCPA 3PPHA 4CKQA 2WKLA 3CTTA 1GOIA 5F1VA 4YVVA 3WCZA 2Y89A 2VL4A 1G7VA 4H3DA 1NY1A 4DXKA 3QHMA 4CCCA 2EG7A 3TOYA 4RL3A 4XBJA 4CN6A 3OVGA 3TSDA 3WJWA 4IFKA 1SJBA 3AS3A 4A3QA 4A8IA 4MZ1A 3B8TA 1ISZA 2VEMA 4CUCA 3F5JA 2A1YA 1H7NA 2FFCA 4XZ9A 1VJZA 5G5IA 1VFMA 4HP5A 4K38A 5C5YA 2WM1A 3PTQA 3QQ0A 3TAOA 1XBYA 1GEQA 3W9ZA 5C7VA 3MCOA 1YXCA 2Z28A 2REQB 3AS2A 2QR6A 1OFBA 3GUWA 4FXRA 1I4NA 3QGVA 2WKGA 5TD4A 3RU8X 2E5DA 5CEWA 1C93A 1GEHA 2FFIA 2E1WA 3GIPA 4PCSA 1RBAA 4DF2A 5FKYA 2VEGA 1XCXA 5BXPA 4Q7BA 1GW9A 4CCDA 2WMJA 3ZJ8A 4O28A 3IGSA 5C2CA 3VNYA 5HWNA 4KWOA 1TPWA 2DY3A 3C5QA 4MB1A 4LV4A 1I2RA 4TTGA 5A6MA 4RUBA 3EPMA 4DY1A 3BO9A 3RITA 4Q32A 2J6VA 4PTDA 3VVGA 5FL1A 3GH7A 4MZ8A 3CT7A 5FJRA 3H54A 1K1DA 4B2DD 3UESA 1K6WA 3S1VA 1YIXA 3OJGA 4GY0A 4P2VA 4PTNA 1TV7A 3W2JA 4UFMA 4AD4A 1HP5A 3QF0A 3CZJA 1ADOA 4XV0A 5CZJA 2WZMA 2WZEA 3VGHA 3OIHA 4TV5A 3W83A 2QDHA 4NG3A 3VD5A 2INZA 1V02E 1EP3A 1WYIA 1RQEA 1W9VA 2ZX5A 3K4WA 3NTYA 4KRZA 5EMKA 1VCVA 1XYZA 1TPC1 3MHUA 4OBTA 3NSNA 3TUUA 4WEVX 1DJQA 3PJUA 3S1WA 1E73M 3CJPA 2QCGA 1UD5A 2DVUA 2HSAA 2XIBA 3GKFA 3W26A 1S2WA 1K9DA 4E2VA 3S2LA 2F61A 6REQA 4WJ8A 2DIJA 4DLMA 1XLDA 3E2RA 2FPTA 3POHA 4UQ9A 2HCVA 4FMVA 3SAZA 4GNVA 2J66A 2ZXDA 2WJFA 2J7EA 4X0VA 4ZOAA 3DHFA 1P1XA 3NPWA 1Q13A 3T8LA 4M24A 3P14A 1SO6A 2QCMA 1A0EA 1PO9A 4AY1A 4NZFA 2Y7DA 5CPTA 3NQ6A 3VCCA 4TOQA 1PXGA 3QH2A 3WMBA 3NL6A 1UWAA 3GR8A 1WZLA 2ZVIA 3BUVA 4U5IA 4XO6A 5E5CA 3UA4A 1GZJA 2WNNA 3VIKA 1E9IA 4KGLA 1LF1A 3WN6A 2A6LA 3BANA 5F2GA 3WNOA