3LHYA

Crystal structure of the mutant i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAAIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhyA00
3IIPA 5FEXA 3LLFA 5BMWA 5IBXA 3N14A 1KFJA 5L6UA 2QCDA 3DFPA 2WSYA 1W54A 4Z1AA 4PEKA 2H8ZA 2EGZA 3C8FA 1GG0A 4AWTA 2C18A 2CW6A 1LP6A 1K8YA 3RFAA 3W7NA 3STEA 4X2RA 1RPXA 2DJXA 1EUNA 4JEQA 3WFAA 5AC8A 1RZMA 5BMXA 3HJZA 3EB2A 4ALDA 4B5NA 5LNVA 3STGA 4R33A 5C6MA 1KFKA 3CQ0A 4Z0JA 4DO6A 4ZVJA 1H7PA 1VCVA 3CB8A 3I65A 3T44A 1HFBA 2QCDB 1RD5A 1MXSA 3NL6A 3FJ6A 3LTSA 3L9CA 1YTDA 5KZMA 1FWRA 1GVFA 2CZDA 5D09A 4LW7A 3S5OA 3VKJA 2B7OA 1JQXA 1Z48A 1AK5A 4RZ5A 1SO6A 3QQ1A 3C4UA 1W5MA 3FOKA 3W7QA 1OVDA 3ZWTA 4K7YA 1SZNA 4DF1A 1SFLA 4K7VA 4CQ8A 4FEZA 4WOQA 1I4NA 4ZZ9A 4GRSA 2V5LA 4LVDA 2WNQA 4WY0B 2Y62A 5AC7A 5K3VA 3MI6A 3P74A 4NT0A 4WJEA 4N6EA 3GAKA 1SZFA 3TSBA 5FEWA 4E2DA 4DBEA 4JX6A 5CGQA 3ZS4A 1VZWA 4Y8FA 1GTEA 3ANYA 3E96A 1TPVA 3GVGA 1D3HA 3LGEA 3NOEA 3S5ZA 3EX3A 2C6QA 2HSAA 1TPH1 2C19A 3A24A 7TIMA 4PA8A 3GNDA 3QPYA 3W1MA 5C2XA 1KBJA 2QCLA 4IX0A 3UWVA 3W1AA 3W1PA 3GNNA 3QPZA 4U28A 5EKYA 2E77A 4O13A 1Q3NA 3H55A 3TFXA 1H62A 4JN6A 3DFNA 1DBTA 2OMAA 3TQKA 1AL7A 3MI2A 3UZJA 2CLMA 4JTGA 4FXRA 4JX4A 1MO0A 4FNQA 1KTBA 3IRDA 4LS0A 5LNWA 3O06A 3NL3A 5AHEA 5LKYA 4M6VA 5HUOA 1Y0EA 3PVFA 4IMCA 2RDUA 4JTIA 4XTIA 3O15A 5D05A 3P7YA 2YZRA 3GDLA 4HSNA 3P5YA 4N9CA 3CEUA 5CZTA 5E1QA 4CNPA 1OYCA 5U4NA 4N9BA 1JVNA 2ALDA 4AXKA 4ORIA 3QW3A 1IXOA 3LCGA 2NX3A 3KXQA 3B04A 4WXZA 5K9DA 2RDTA 5KZEA 5CKSA 1VLWA 3P81A 1G7VA 2W79A 5K4ZA 1K8XA 4A2RA 1PIIA 4ADSA 1MSSA 4EOUA 4XKYA 3W7GA 3DFTA 1T8XA 4HT3A 1VLIA 5I3IA 3HG5A 1PCKA 3DFSA 4JTTA 2GUUA 1A53A 1GJPA 1L6SA 3M43A 4JICA 5BOOA 4UTMA 2NZLA 3NL2A 3W3OA 4WUIA 3T55A 3FYOA 4AHOA 5CZ0A 3FFSA 4AH7A 3UXAA 4A22A 3FKKA 3HG3A 2VEMA 2YCEA 5I3HA 1QCWA 1I2QA 4MFEA 5D2YA 2YXGA 3PBUA 1KFLA 3F4WA 3LXCA 5CG7A 3W7EA 4R53A 3PM6A 1G4SA 2ZQ0A 5DBUA 2E6FA 4OBTA 3W2NA 1S5VA 4O4VA 2ZZ3A 3W7CA 2Z6JA 1F05A 4UCGA 4LUJA 1YPFA 3EWUA 3DAQA 4GUFA 3STCA 3RK8A 4IQLA 2F84A 3BARA 4UNLA 3G0XA 5J5RA 3F4NA 3ZWSA 3F1QA 3CM4A 4G1KA 5TBOA 3W1XA 3IVSA 5SWUA 1IXNA 3W7KA 3CC1A 1XKYA 3LI1A 4WXYA 1ZJIA 2A0NA 4JDYA 3MBDA 4XBKA 3KX6A 2CU0A 3S6DA 1Q6QA 2DZPA 2H3BA 4JY8A 1QO2A 1K8ZA 2QCMA 3G3DA 3WJYA 1TRIA 4LUIA 2JGYA 2V81A 1DV7A 4HN4A 4LNYA 1TTPA 3GXPA 6TIMA 2NX1A 3L2IA 4JX5A 2FQIA 4IMDA 4L4MA 2Y7FA 3S0CA 1T99A 2PRHA 2NUWA 4IOTA 4AAJA 4N2YA 3LHUA 3LBCA 1X1OA 4UTLA 3V75A 5AHNA 4HSOA 4BWLA 1WBJA 1DHPA 1EUAA 3UWQA 3M41A 1QPOA 3NQ6A 3SJ3A 4FNPA 4O18A 3MYOA 3P5ZA 4DPQA 1X8FA 3S1WA 3O16A 4NX5A 2VFGA 3TC6A 4UTUA 5U7SA 1F6PA 4RK8A 5HULA 2OJPA 3FJLA 1QPQA 2ZRZA 4OWGA 4IPJA 1MEHA 1MEWA 1VYRA 3N73A 2O7QA 4UTTC 1ZAIA 1PE1A 2ZYFA 1K3UA 5HQEA 1TV5A 4RV8A 4O8RA 4Z0SA 1VYSX 5D02A 5DBTA 1GQNA 5DCBA 1KW1A 3BO9A 4O28A 4JTJA 3TV8A 5I3JA 3BVJA 3HIJA 3S8HA 5G2HA 1H63A 1UCWA 4ZQRA 1F76A 3LCLA 3B4UA 4QJ1A 3TU9A 4AWSA 4ZQMA 5EY5A 2ABAA 4O50A 3G1AA 4N02A 5G2IA 2GOUA 2P1FA 2WSRA 3P82A 1ML1A 1LROA 2A5HA 4LVBA 3PS7A 1C8VA 4ONVA 3QQ0A 4GUIA 3G0SA 2BZNA 1NF7A 2Y70A 4JDBA 1VH7A 3AO0A 3BG3A 2UV8G 5AHLA 4BR1A 5EA9A 2ZRWA 2A6LA 4RR4A 3NM3A 4Y6GA 1QO5A 3TQ0A 1NAL1 2B7PA 1X6UA 5G1TA 2V2CA 2G95A 2Y88A 3TW6A 1QR7A 3OEXA 3C2VA 3PR2A 3QSRA 1YLVA 2CZFA 2FFCA 3QEZA 4BWLC 1YDOA 3A23A 5AHIA 3T7VA 3PC0A 5LGZA 1NF0A 3VE7A 3W71A 1ALDA 5EL1A 1AW1A 3BW4A 2ISVA 3OVQA 1LRQA 2PC4A 1JRCA 1G4PA 1H7RA 2IQTA 4ADTA 4Z1CA 4DQWA 3EKZA 4HHPA 2HS6A 3EX6A 1ZFJA 1KLZA 3G0UA 1P0KA 5HJLA 1JCJA 1TTIA 1WXJA 1RR2A 3O6YX 2NXGA 3Q94A 3PUOA 3O6CA 1UJPA 4MVAA 2OX1A 3RNDA 3MHGA 5F1VA 5F4XA 4WZHA 1DORA 5EMUA 3UWYA 5LSMA 2CLHA 1F74A 3CIXA 1JCXA 1H5YA 2DZVA 3W87A 4AF0A 2BTMA 4X3ZA 1JULA 4PCFA 3IIVA 3W6YA 3PBWA 4LS2A 3Q37A 3SSJA 3W7IA 1R2TA 1IXQA 3QSTA 3QFEA 5LGXA 3R5EA 1AMKA 1H60A 3KVKA 4WY0F 4E38A 2YFNA 2JKEA 3M5XA 1KBIA 3W73A 5CPMA 3C0JA 3NO5A 5HWNA 2VFHA 4ZQCA 5F2GA 1O4UA 2E1DA 4H4IA 1YTKA 3LXAA 1SO5A 3TR2A 2ZRYA 3S1XA 4MLRA 5ABTA 2WOQA 4C1KA 4WQ6A 4MZ8A 2X1TA 5K9CA 1Z41A 4XWUA 2QAPA 3O07A 4UR7A 3BV4A 1YXYA 4IXHA 2PE4A 4JTLA 2DZXA 2F7FA 3W9ZA 4DF0A 1EWDA 3SY5A 3STFA 3W7JA 2X1RA 3EEGA 4IWWA 4OHQA 5DY2A 4EF9A 4P61A 3OHIA 1VJIA 4MYAA 1KM3A 1OX4B 4JNMA 4PH6A 5KTLA 5I3FA 1P1XA 3E49A 1LTDA 5C54A 3C56A 3M5YA 3UY7A 3R12A 4YCPA 3F03K 3KRSA 3IGSA 2Y63A 4UFKA 2WV8A 1SR9A 1DKWA 3W72A 1W31A 4FIQA 4Q4KA 4NUWA 5CPNA 5MHBA 5AYZA 3JR2A 4DO5A 3EWBX 5FEZA 4O16A 5HINA 3W7HA 3L21A 3UPBA 3NEVA 1PHWA 2VEIA 3DXIA 4JD4A 3WJZA 3KVLA 3CLMA 4DBDA 1DL3A 1KTCA 1OX5A 4J9JA 4A29A 4OU1A 4O0KA 4EF8A 4PFMA 1XI3A 3GIYA 2C13A 2A6NA 3L0KA 3L5AA 1FX6A 2ZDRA 4CCDA 3I6RA 3YPIA 1L6WA 4NJKA 3PSVA 1GOXA 4JTKA 3O8AA 1BEUA 3BPWA 5D37A 1FQ0A 1LDCA 3L65A 4AVFA 4M7SA 2ISWA 5F2LA 3TW7A 3SGZA 2CZ5A 3LV5A 5G1YA 1JCLA 4KKXA 3IVUA 1I2RA 3W7LA 3C2FA 4DO4A 3LCIA 4JTSA 1EEPA 3QMSA 3FIGA 1VR6A 1JCNA 2OZ0A 1TPC1 4BI7A 3B0UX 3L5LA 2GQAA 5E0KA 3UYCA 2RHGA 1FWSA 4JY9A 1EA0A 3S1VA 3NL5A 3TAOA 4TX9A 4QAIA 3M9YA 3LCFA 2I14A 2Y61A 3UY8A 1H7XA 5AC6A 5D30A 4WY0A 5CSSA 5IM51 1DQWA 1W5PA 1O95A 2GQ8A 4C1LA 1U5JA 3GKFA 4UXDA 1CW2A 2ZRVA 2VEKA 3N3MA 1ZAJA 1QOPA 2J24A 1HL2A 5F2IA 4Q32A 3DI1A 1FXPA 3SIZA 3ZR4A 1IF2A 1ZCOA 3O05A 5DCEA 1M6JA 2VFFA 1Q6OA 4K37A 1M5WA 2DORA 1LM1A 1XFBA 3WK3A 4NX0A 3MUXA 1EP2A 2DZSA 3W83A 3TC7A 5AB3A 1CX9A 3MI3A 3NQAA 1NEYA 3MHFA 2NV2A 3NM1A 1JUKA 2Y85A 4UTJA 1D9EA 1K7FA 1SO4A 2B7NA 4YL2A 1AW2A 1I45A 1VPXA 4HPXA 4OQVA 2DP3A 2EF9A 2V2DA 1G6CA 1H61A 2NXIA 3W1UA 4TMCA 1OFDA 1ZY9A 5FEPA 1LYXA 5FF7A 4PL1A 2CLOA 1B4KA 4NJGA 1L2UA 2CWNA 4QSHA 5EBUA 1JUBA 1W0MA 5FF4A 1ME8A 1ZENA 3VFLA 1RV8A 3L5MA 4UMBA 2ZFAA 4U4MA 3SI9A 2FLIA 3LHVA 5A5WA 1YDVA 1KV5A 3T78A 2BLEA 2YPIA 3TA6A 1YTEA 1GPWA 2RH9A 2J27A 3KRZA 4QIUA 3B03A 3HPSA 2XFWA 4OV9A 3S5YA 2NV1A 1OFBA 3W2JA 1VHNA 1OX4A 4JTHA 2E09A 2VEPA 4YCOA 1FUYA 3W7DA 3EX1A 1W1ZA 3W2LA 5K9XA 4A3UA 4LVAA 4IXXA 1TPB1 2CLLA 2QUVA 4OV4A 2TRSA 4PL2A 1F7BA 4JIQA 1WBHA 3H53A 4KFOA 1OFRA 3EX4A 3HQ1A 3QMRA 3DU0A 3NG3A 3OA3A 3PWAA 1VQTA 5CPOA 4MFDA 5K2ZA 4QQ3A 4O1BA 3G8EA 4HNTA 1TSIA 3LM7A 5DELA 5L9FA 3UD6A 3SW6A 4Y9AA 4O1DA 5IBXC 4S2BA 1ICPA 4XUGA 3ZFHA 2ZCGA 2H8XA 4BFAA 2R91A 1LORA 3HPXA 1YYAA 1J4EA 1LBFA 4UR8A 3A22A 3G24A 4MYXA 3LRLA 3TE9A 4UTHA 2J88A 2CZEA 3TKFA 1KFCA 4WX2A 2A2IA 4FNTA 2CFFA 1TO3A 2FDSA 2QCEA 3MP5A 3ABRA 3HGSA 5KMYA 2B0MA 3EWXA 4H3DA 3MP4A 4DELA 1UBSA 4ZQPA 3MHUA 2JK2A 2JBMA 1M7PA 2KZHA 4TU1A 3WK2A 1R30A 5AN7A 3HPZA 3QYQA 3UZ5A 3CPRA 2J9XA 4S1FA 3DKJA 1XC4A 5H91A 1J5TA 3QM3A 4N9DA 3C6CA 1W56A 4FX6M 4TIMA 2R94A 4MOZA 3W86A 2J6XA 4CNOA 4E0CA 2CLKA 4FO4A 4CCEA 3NXFA 3C3NA 2D73A 2C0AA 1C29A 2OT0A 5BNKA 1XM3A 3TH6A 3A5FA 1KM6A 2Z2UA 5TIMA 3GYEA 1OK4A 4L4LA 3DENA 1SUXA 1S3HA 5D2XA 3W84A 1BTMA 4CNNA 3N34A 1ME7A 1P5BA 2V30A 3VCRA 3W1LA 2DZTA 4AHPA 3KHJA 4FHAA 4RZ4A 2VC6A 4Y96A 4JS3A 4ORMA 1OF6A 5AHFA 5F4WA 3DFOA 1O5XA 2WSQA 2QKFA 1VHCA 1SQ7A 1XUUA 1PV8A 4LV4A 1TPUA 3N19B 4MJZA 3OBKA 3LOTA 3P67A 1B3OA 4R7JA 1Q45A 2I9EA 4BF9A 3N2MA 3GXNA 1HG3A 4POCA 1IIHA 3GAYA 2ZA1A 5G4WA 2X2GA 3FKRA 4O17A 5DN1A 1Z42A 2XN1A 3EXRA 3R2GA 4XKYB 1FCBA 1SSGA 3E0IA 3W22A 2WNZA 4NVTA 1K7EA 1W5QA 4S2CA 2Y7EA 1GZGA 2E6YA 1LZOA 1OK6A 4LT9A 4AHQA 2VELA 2YGYA 2VXNA 2ZZ4A 2Q3RA 4OGZA 3LLDA 2BX7A 4O0ZA 3KVMA 3P84A 2ZTKA 3TNOA 1DOSA 1QWGA 2QDGA 3CT7A 1TV7A 1GEQA 1FCVA 3GDRA 3DZ1A 5HMSA 4A21A 3PSWA 4LU0A 3NQGA 1LLZA 1CI1A 3T40A 1TPFA 3C2OA 3G1FA 3G1XA 3I68A 3PF3A 3NAVA 2X30A 4DXVA 2ZRUA 1RQHA 4JR5A 1FWWA 5A8GA 5F1UA 1SW0A 2ZRXA 3W7RA 5C5YA 1F2JA 1EWEA 1YXCA 1VCFA 5DXXA 1BWKA 1A5CA 2GJLA 2Q8ZA 3LRMA 1FXQA 3BLIA 3PG9A 4O11A 1QAPA 4LC8A 4CQ9A 1O60A 1SZEA 1ONRA 1OF8A 1T0OA 1WQ5A 1LBLA 1XBVA 3LV6A 4CCCA 2QDHA 5BRBA 1GVOA 3ABQA 3L0NA 3MW7A 4GUHA 3I7SA 4NJJA 4NNAA 1LOLA 3LXBA 1G7UA 1KFBA 3LBMA 5CSRA 3G1DA 1TTJA 3C2EA 5TQLA 4EWND 1KFEA 4MY1A 4JIPA 1SPQA 2P0OA 1UUMA 3PBVA 1PHQA 5AYYA 3M47A 2EHHA 3FLUA 2B4GA 3W2MA 1IGSA 1K7XA 2NLIA 3S9YA 4LTSA 4IX2A 4UTWA 3NQEA 4K39A 1RQEA 4M7TA 4MIMA 3D0CA 4R34A 4MY9A 4DPPA 2QF7A 3FYPA 1FCQA 2RKXA 1Q6LA 2ZBTA 4O54A 2V82A 3G1HA 3WK0A 3L67A 1F6KA 5D33A 2ZZ7A 3S5NA 3G1VA 2E5DA 1GG1A 3KAOA 1B4EA 4QISA 3NPWA 3P80A 3B06A 1GT8A 2R14A 3OIXA 2DJLA 2FPVA 4GWEA 4NQ1A 5LHEA 1H7OA 3GB6A 4JTFA 4MJMA 3L66A 1Q6RA 1EX5A 4NJHA 2H6RA 1SW3A 3NQDA 4NZJA 1THFD 4OT7A 4RJEA 1KM1A 4GXMA 5HR7A 3A5VA 3BG9A 4AB4A 4UTKA 4BI5A 3CHVA 2CLIA 3CEPA 3NPVA 3NZ1A 3B05A 2E5CA 3L68A 5AYXA 3PY2A 1OFAA 1N7KA 3SECA 3G1YA 1LBMA 3E9AA 2Q8LA 2YSWA 3MBFA 1WA3A 4LVFA 2RDWA 2TSYA 1GYLA 4UNKA 3GKAA 3USBA 2ZZ1A 1G4EA 3TXVA 2PURA 3LX9A 3RLUA 5D2TA 3EWWA 3Q58A 3ELFA 4O10A 4I7WA 2NX9A 2J9ZA 3W7MA 2QUUA 1TRDA 3I7QA 3W1RA 4M6PA 4FB7A 1A5BA 3QJAA 2Q3OA 2YDAA 2H90A 2QCFA 4FX7A 3M16A 1ZNNA 2YYTA 6ALDA 1FDYA 4MZYA 1NSJA 1OFEA 4XZ9A 5K4XA 1DVJA 5KINA 5K7JA 1I8JA 4AMAA 3T4CA 4QM1A 3C61A 3W74A 1LRTA 1K03A 5LNUA 3JS3A 4YLWA 2ABBA 5FF3A 3EXTA 3EWZA 3FS2A 1AG1O 1FWTA 2B7QA 3W2KA 2TYSA 3TX9A 1OABA 4GE8A 3KRUA 3G3MA 1KM0A 1XUZA 3BGJA 5HWJA 4AWUA 3P8IA 1TB3A 3PAJA 4XQ6A 1W3NA 3WJWA 4K36A 1GVSA 3NYZA 3TMLA 2FPYA 3NQVA 1EP1A 1JRBA 5G2WA 2FIQA 4N4QA 2C3ZA 4UMCA 2FB3A 3EKLA 4IGHA 3A21A 1OYAA 4X22A 2NUXA 3FA5A 3HG2A 3FEMA 1TPDA 3QH2A 3E12A 1TIMA 1ZHAA 1WAUA 3B0VC 3VI2A 3DHDA 1W5NA 2WPBA 2EPHA 1PVNA 4UUIA 4H6KA 4MUZA 3GR7A 1K02A 4HPJA 4EIVA 1DQXA 3BW3A 3PULA 4KWWA 4WOZA 3OVRA 3TXZA 1L9WA 1VS1A 4O1AA 4HNUA 2AQWA 3GDKA 4P2VA 2C14A 1XXXA 2QJHA 4NNCA 3KOFA 2QR6A 4MZ1A 2Z0IA 4UTTA 1OYBA 4RXGA 3UQNA 2V2HA 1DJNA 3NQ2A 3DHFA 4O15A 1XCFA 3HMJG 5CZJA 3LDVA 3LERA 3W23A 5T26A 5AOUA 2VOMA 2G5WA 1WOBA 3BW2A 3TK7A 3B8DA 2WQPA 3PB0A 2OCZA 4IPIA 4RX0A 2BWGA 3W75A 4MPQA 4Q33A 3OG3A 1TQJA 1W5OA 5DXYA 2NWRA 2GQ9A 3LCHA 3MP3A 4GBUA 5G5IA 3CWOX 3U2OA 1LCOA 1OHLA 4GNJA 4X9SA 3RLVA 2GVGA 4QITA 2AAMA 5EYWA 1FCUA 2ZZ5A 4JTUA 4GUJA 1SU5A 1HO4A 2G97A 1WX0A 2VKZG 3NPXA 4FNRA 3PB2A 1GVRA 1HTIA 1XL9A 1F73A 2X1SA 2ZA3A 3TMQA 3W85A 4W9TA 3DH7A 5HWMA 4NU7A 1YXDA 4NXKA 5LNRA 4Y90A 1W8SA 4HNVA 4IMEA 5FESA 4RLIA 1I2PA 4I9AA 3U6WA 4K8EA 2EAWA 3W1NA 5HNRA 4NNBA 1W37A 2W0UA 1MEIA 2PCQA 4N4PA 4DF2A 4ML9A 1I2NA 1YADA 3TSDA 4M6QA 1G69A 2EKCA 2NXHA 2FTPA 2FPTA 3W7PA 3E02A 2V5BA 3W07A 1H7WA 3P61A 4O57A 1SFJA 1IIGA 1VGAA 3N2XA 1WYIA 1JJKA 5LZLA 3V1PA 2FB2A 3M6YA 3NQMA 5J5DA 2C16A 2TPSA 2ZZ2A 4FX8A 2FJKA 4JXCA 2R8WA 4FF7A 1PCWA 2WKJA 4CQAA 1Z44A 1LOQA 3PUEA 3UNDA 3GZ3A 2WO5A 4MLJA 5FF2A 3IIOA 3C2RA 3GXTA 4CLMA 2LLEA 3P8JA 5I3KA 1GTHA 3K30A 3NGJA 4OE7A 2WNNA 3M7WA 4LY8A 1FBAA 5GVJA 3O1NA 2XN0A 2E68A 1TJPA 1IXPA 2CLEA 1C9DA 3RMJA 4NJIA 3RU6A 4D2JA 4NXSA 1OX6A 4FXSA 2A7PA 3M1ZA 1FWNA 3GLCA 1AW5A 3ATZA 1TJRA 2QCCA 3TJLA 1OJXA 2P10A 3O6DA 2DZWA 3G18A 4LRTA 1TV8A 1JR1A 4XBSA 3CWNA 2YYUA 2A85A 2PRMA 1PL9A 1R47A 3MWAA 4HIBA 2V9DA 1ZAHA 2GPTA 4RZ6A 3LCXA 1B57A 1TREA 3TUUA 4LOCA 4TR9A 1N8FA 2VFEA 4O12A 2W6RA 5AHMA 4Z1BA 1XBYA 1EB3A 2QJGA 1XDMA 3HGOA 2NUYA 3LHYA 4E2BA 1E51A 5CZSA 2V0TA 3VE9A 3HBLA 2GVJA 4UFIA 5AFDA 3W76A 3NDOA 1KM2A 4BI6A 2C1HA 2TMDA 4QNWA 2I1OA 2X1UA 3LTPA 3G22A 3HG4A 3SFKA 4RCXA 2X16A 1GVQA 4M19A 3ATYA 4UTIA 2QEZA 5D03A 3KFTA 3H54A 2V8ZA 3NPUA 4NZFA 4O53A 4Z08A 3HB9A 4XTDA 1XDLA 4GFSA 1EPXA 2J9YA 1VCGA 1FDZA 1KTNA 1JCYA 2BSLA 4AEOA 1H1YA 2VFIA 4LC6A 3GK0A 5DCDA 3HGJA 2YX0A 4UTWC 3MO7A 3GR8A 3DI0A 1SO3A 3R89A 1T96A 3QF0A 3LRKA 3TQVA 4M5PA 5HUPA 4I7VA 2HMCA 3M5ZA 2A1YA 3R13A 3TFCA 1H50A 3N9SA 2JKPA 3EXSA 1J2WA 3I7RA 3INPA 5F4SA 4PC8A 2E6DA 3EWYA 3QZEA 2ISSA 2QCNA 2C15A 2Z6IA 5C55A 1TMHA 2ATMA 2E5BA 3IV3A 1A5AA 3NQCA 3NR0A 3SZ8A 3MMTA 1KV8A 3W70A 1R2RA 2QUTA 1MZHA 4MKNA 3NA8A 4TO8A 2YW4A 5D2VA 1H51A 4EVZA 1WOAA 3DFQA 4IMFA 3TROA 3PBYA 1M7OA 2WJZA 4QNEA 3S42A 3UWWA 5I3GA 2G96A 1KM5A 1OG0A 4LS1A 1ICSA 2QCGA 3CIWA 3OVPA 1OFPA 2AGKA 3L0GA 3P62A 8TIMA 4UC5A 4UMAA 1OFOA 5DY3A 4GC4A 2BXVA 4LV9A 3TDFA 5KZDA 2A21A 1H1ZA 3HGRA 4YWIA 3BLEA 1G67A 1JUEA 1W3TA 4AF0B 3JRKA 3M5VA 4ZQOA 4K6AA 4N9EA 1QMLA 4JTEA 3HF3A 1PS9A 3PG8A 2VFDA 1JCMP 1TTQA 4LVGA 2YR1A 1X1ZA 4IUOA 1KM4A 2YFOA 3W2UA 1S5WA 2DU2A 1A5SA 3IGXA 4O19A 3B0PA 1N55A 3Q2DA 3QC3A 4K38A 2RFGA 4RXFA 3SR7A 5LNSA 2E6AA 2QJIA 4UIOA 5E93A 2DZUA 4O4WA 4GUGA 3CU2A 3M0ZA 3IIXA 5FI8A 1RVGA 1X7FA 3QW4B 2Y7GA 4IMGA 2YW3A 1V7YA 4O14A 4FNUA 3EX2A 4ZMGA 4IJBA 2NWSA 4UFMA 3TSMA 1FDJA 3TAKA 1QOQA 4LWWA 5D32A 3THAA 1A50A 1G4TA 4FIRA 1VRDA 3LHZA 1WDWA 3A9IA 5CPLA 3BLFA 3HOJA 3M44A 3W1TA 4MY8A 1QFEA 5HR6A 1LRNA 3ABSA 3CTLA 3QMTA 3BGGA 3RF9A 4HNNA 1WV2A 4JGDA 1XBXA 1P0NA 3S1UA 1F5ZA 3LTYA 2HS8A 1UUOA 2ZZ6A 4PODA 4A2SA 3LHTA 1TCDA 2QCHA 3BG5A 4RKAA 3UPWA 3GX9A 3W7OA 3G1SA 5F2MA 4KFPA 1BWLA 1P4CA 1O94A 4KFNA 4K8HA 1R46A 3SGUA 1SZGA 1FY6A 3U8GA 4JYFA 2ZA2A 3NQFA 3WJXA 1DJQA 2GVLA 1B9BA 3GDMA 1ME9A 2H3DA 1I2OA 4O52A 1UASA 3IEBA 3TJXA 3NVTA 1EIXA 3DBPA 3NQ8A 1HUVA 4ZQNA 3IVTA 1EP3A 2XN2A 3DGRA 3N9RA 2A7RA 1UB3A 3WJSA 5H2ZA 1TPWA 1ADOA 2GJNA 3TCEA 1SW7A 4JYEA 4TMBA 3W1QA 3LI0A 1ICQA 3KVJA 1GYNA 4PTNA 1U83A 4UFLA 2JKAA 2CLFA 4HKPA 1TQXA 4Z1DA 5D38A 1SSDA 2JGQA 3HO8A 1VC4A 5FF0A 1AL8A 1YPIA 1KA9F 5BW6A 4N6FA 3VNDA 1QPRA 2Y7DA 3DKLA 5D04C 1R2SA 1H7NA 2PRLA 1QNVA 3BK0A 2A7NA 1JQVA 3WK1A 1BKSA 1HO1A 4ADUA 1O5KA 3PUDA 1OFQA 2A4AA 3UWZA 2O7SA 2HTMA 5DLCA 4YXGA 4KWVA 3LCWA 2ZTJA 1TYGA 1LOSA 4JYDA 1D3GA 4ZL1A 1NVMA 1LLWA 5LHFA 3UXDA 3GDTA 3QRHA 1YDNA 2Y89A 4DEFA 4I7UA 3IIZA 4O1CA 3NZRA 4UFHA 4BK9A 3C52A 3W88A 3G8RA 4UFJA 1VYPX 2Z1BA 2OT1A 4LRSA 1RQBA 4FNSA 1S5TA 3LHWA 1KLYA 4ICNA 3R8RA 2Y6ZA 3O63A 1TPEA 3UWUA 3ABOA 3AJXA 4WD0A 3IGUA 5EPDA 1QDSA 3MYPA 3P60A 3MJYA 4GJ1A 1L6YA 5D2WA 1ZALA 2QAFA 3NNTA 3NQ7A 1GWJA 3LB0A 5KSWA 1XBZA 1NFBA 1V5XA 5KITA 4YMZA 5G4EA 2VENA 3THQA 1QPNA 1W3IA 2ATSA 3TIMA
chains in the Genus database with same CATH superfamily
3IIPA 5FEXA 3TQPA 3T8QA 2Z28A 1W54A 1FWJC 3CGTA 1CGWA 1GUVA 3DOPA 2YDRA 2HK1A 1D3CA 3HZ3A 2EGZA 3VGBA 4KGLA 2Z4GA 3RFAA 4ZO7A 4X2RA 4F2UA 2V63A 3PK7A 4JEQA 3WFAA 1J2BA 5AC8A 4F2TA 4IQEA 4JNYA 2Z1VA 5C6MA 2Z24A 4LCSA 3I65A 3BZGA 2J62A 3NL6A 4GQGA 3SDOA 2XSXA 3LTSA 3L9CA 4E3VA 1FWRA 3S5OA 4DJFD 2PSNA 3BOXA 3VKDA 1JQXA 1ZP4A 3AIQA 4RZ5A 3WQEA 2DSWA 2XU2A 3C86A 3C4UA 3H23A 3ZWTA 1SZNA 4HK5A 2D2HA 4PUNA 3OB8A 2ZC8A 4K7VA 3NEHA 4JN7A 1XG4A 1EC7A 2FZ9A 3VDAA 1W1A1 5AC7A 2OZ8A 1BQCA 3U4FA 3P74A 4NT0A 4ZO6A 1TV3A 4N6EA 4F2BA 5FEWA 4E2DA 3VNJA 1P0EA 1XLAA 3DERA 3M64A 3VIHA 1UD4A 4JX6A 3N13A 2Q71A 2W92A 4WGXA 1GTEA 3ANYA 1VKFA 3NYDA 1TPVA 3VNIA 3GVGA 3NOEA 3QKEA 1UWAA 2ZUMA 4ATDA 3W1MA 2F9RA 1KBJA 2QCLA 3W1AA 1V7AA 2GYIA 1Q3NA 4JQAA 1B1YA 1TMQA 1B3ZA 5I02A 4YTUA 1AL7A 4HOWA 3C0LA 3UZJA 1BQGA 3T6CA 2HXTA 1V08A 3QY7A 3IRDA 3NL3A 5LKYA 4HZ7A 4JTIA 2EQDA 3O15A 5D05A 4M24A 3CTTA 4GKTA 1P6WA 3VAVA 3VMOA 4N9CA 3CEUA 4B90A 3WDPP 4GVFA 2WHLA 2HPMA 2V6AA 4W7UA 3LQLA 4ORIA 3SCRA 3QW3A 1X6LA 3S2JA 2FJUB 3SUWA 1E73M 2AGTA 5KZEA 4HPHA 3VIPA 1T41A 3GHRA 1K8XA 1IZKA 1A0DA 1PIIA 4ADSA 4XKYA 4HA0A 2WAGA 3HG5A 1PCKA 3DFSA 3L2LA 1GJPA 1L6SA 3M0YA 4WHBA 3NL2A 2BHUA 4WUIA 2WJDA 1QASA 2QPXA 4ML4A 1CLKA 4M3PA 3UBPC 3UXAA 5G1MA 2VEMA 2YCEA 4X60A 1I2QA 5IHRA 4MFEA 3EA3A 1GONA 5D2YA 1KFLA 3PBUA 3F4WA 4EAMA 1DTNA 1MNZA 5EMLA 4ZB2A 2PZNA 3ITCA 4Q8PA 1A3XA 3KE0A 2PWUA 3STCA 4IQLA 4WDUA 3BARA 4Z2LA 3WZ0E 3IAQA 1XH2A 3ANVA 4HP5A 3ZWSA 1OC6A 4YIWA 5TBOA 3OO2A 2BOFX 2QGHA 3UG4A 2ADAA 5CPQA 3LI1A 1UA3A 2PP1A 2A0NA 4L1GA 4JDYA 3IJ7A 5CLWA 3ARYA 2P76A 4C65A 1UQYA 3H4GA 4JY8A 1I1XA 2QCMA 3G3DA 3WJYA 4IFRA 2A3AA 1TRIA 4E3TA 4QDPA 3GXPA 3N6JA 2FQIA 2WCSA 4OECA 4FOKA 3UA3A 4EP8C 3GC5A 2GGEA 4AAJA 2PP3A 2F6KA 4X61A 3LBCA 1X1OA 3K1DA 2VURA 4KPLA 4Y2WA 1UYQA 4BWLA 1DHPA 3M41A 5H8UA 2QW5A 4I5XA 4GZIA 1S39A 3S1WA 3TC6A 1A5OC 3KZPA 1F6PA 2A3BA 4RK8A 4MKSA 3WLSA 4B5VA 1MEHA 1MEWA 2J7HA 4V2XA 1U5HA 2J78A 4KWSA 1PE1A 2O9OA 1CGYA 4O8RA 1TZZA 4LY4A 5D02A 3E2RA 3CBWA 4O28A 2C91A 4RUBA 2I16A 3KDNA 3TV8A 4EPBC 3MU7A 4ZQRA 3B8WA 3PJTA 3B0YA 3E0FA 1UWIA 4RW5A 4X2PA 2BBFA 3CUJA 5EY5A 3II1A 2WVVA 1RBOB 3DDMA 1ML1A 4RZBA 4DLFA 2XGIA 3LBOA 4LVBA 3VC6A 1U5VA 3WNOA 1AQMA 4H8HA 1GKPA 2GZXA 2QPUA 3AO0A 3RIKA 5AHLA 4BR1A 4RPQA 5KEZA 2A6LA 3NM3A 3URNA 2OYLA 4DBSA 2V2CA 2WYSA 2ACQA 2G95A 4UCFA 3BMVA 3PBMA 3C2VA 3PR2A 2F61A 3QSRA 2CZFA 4HOZA 2FFCA 3U9IA 3QEZA 4AXNA 1FWIC 3T7VA 5LGZA 3OBAA 3VE7A 1ALDA 1H41A 5EL1A 2NV9A 1CPUA 4PUKA 2PC4A 2WXDM 1G4PA 3AUOA 3BZJA 1J8VA 3AIWA 4HHPA 4AD1A 2HS6A 1IT8A 1NDVA 3EWCA 1RSCA 3ARUA 1WXJA 1RR2A 1QI3A 4MVAA 5C2CA 3RNDA 4NL1A 1DORA 1X8CA 4IM4A 2YXOA 4L9XA 5LSMA 4B3ZA 1JCXA 1H5YA 3W87A 2DEPA 1C93A 2BTMA 4X3ZA 4PCFA 3PBWA 3W7IA 2J79A 3LGGA 3QSTA 4GIAA 1JYVA 5CGMA 4CUCA 1C8XA 1IE7C 4WY0F 2CERA 3ZT7A 3E5PA 4LYRA 1LQAA 1KGUA 4H9VA 1ISWA 2VEGA 2BY0A 3H6OA 1OB0A 3TCSA 1HL9A 4XZLX 1X7IA 1Z32X 3VNYA 3S1XA 1IT7A 4MLRA 4C1KA 4WQ6A 4KCWA 3WLKX 3XISA 5AZ0A 4A4AA 3BCFA 4RNHA 5E6ZA 1XISA 4QG6A 2PE4A 4PULA 5EB8A 3W7JA 4OHQA 2VVSA 4EF9A 4HA1A 3M0LA 4MYAA 4JNMA 5KTLA 3BJSA 4KBXA 5HATA 3E49A 3M7SA 5C54A 3C56A 2VWSA 4PMQA 1OIFA 3F03K 3N2BA 3IGSA 3P93A 1SR9A 3W72A 2YOCA 4E2OA 1CEOA 4LF1A 2VP8A 4NUWA 5AVHA 5MHBA 3JR2A 1M01A 4O16A 5TAOA 1UZ1A 2OKOA 3L21A 5XIAA 3MWCA 1ZJAA 3H2EA 3S46A 2VEIA 4CD5A 2POTA 2RUSA 4G7FA 4KESA 2QQ6A 4IFOA 5CAKA 3EEZA 1QVBA 4OU1A 2QLYA 3CAKA 1TVLA 2AL2B 3YPIA 3T1GA 3VNMA 1GOXA 2DT2A 3O8AA 2WHKA 3HQOA 5D37A 1FQ0A 4B15A 2ISWA 3N4AA 4EXAA 4JIEA 2CZ5A 3KBWA 3CK5A 4Q8TA 2W4XA 1TJ0A 4JHMA 2YCIX 4H7ZA 4DI9A 3PZQA 4D72A 1VR6A 2OZ0A 4J27A 1TPC1 3B0UX 2GQAA 2RHGA 3MY9A 4R27A 3AU6A 1EA0A 7XIMA 3CV6A 3LCFA 2I14A 3K13A 1H7XA 1BD0A 1DQWA 4E6MA 1NOUA 3DIPA 4B2DA 4C1LA 2CLPA 1XYCA 2VEKA 4AG0A 5CPTA 4Z1YA 2DT3A 4Q32A 3AIUA 4XZNX 4HJFA 3SIZA 1OZMA 1ITUA 3W53A 5DCEA 1CXFA 1SZRA 4K37A 3T2OA 1XG3A 4JHZA 2DORA 4PMJA 2DVXA 1LM1A 1FFQA 3CIVA 2HK0A 4NX0A 3TC7A 5AB3A 3MI3A 4CU7A 3T8LA 1JUKA 2J7FA 3MUCA 1WDPA 1JDCA 1I45A 1VPXA 3TLLA 3TTYA 1TZ7A 4D71A 4YTRA 4DUVA 2VDGA 3CUFA 4HPXA 4OQVA 1GCYA 4AD4A 1YX1A 2BGNE 1H61A 2NXIA 1OEPA 4FXFA 2PD5A 5T8GA 4PL1A 1A4LA 1CENA 3W25A 2FZ8A 1B4KA 4NJGA 3ARQA 5FF4A 4PCTA 2BGQA 3FAXA 2ZFAA 2P53A 3LHVA 5A5WA 1YDVA 1ZBKA 3TA6A 4F40A 1XLJA 2X0SA 2ZE0A 4UZUA 4QIUA 4L4OA 2NV1A 5LIKX 2PZ0A 1OX4A 2E09A 2DPEA 4YCOA 5IOBA 3W7DA 1C7SA 3EX1A 1Z9AA 2YA2A 3M0XA 3WH9A 3Q45A 2TRSA 2GSHA 2PU1A 4HMCA 1XCWA 1OFRA 1WKFA 3PWAA 1VQTA 3LU2A 4MFDA 8XIMA 4HNTA 4PTDA 3T0CA 2D0FA 4Y9AA 4IIGA 3T08A 1AQ0A 1UKQA 4IGNA 5CPSA 1NQ6A 1O5RA 2BG5A 1NWTA 3OZPA 4AC7C 4BFAA 3OIHA 1BXNA 1YYAA 4MG4A 1LBFA 4UR8A 3EDDA 3G24A 3KRBA 4WK9A 1EDQA 3M46A 3WH8A 1XW8A 3TKFA 1KFCA 4WX2A 4ROPA 1Q8JA 4XAGA 2I5QA 3S47A 1HJSA 7CGTA 2DH3A 2VRQA 3RM4A 2B0MA 2Z1XA 3AYTA 4DELA 2Z1WA 3KUMA 2GDVA 4MADA 1VFHA 5A8PA 3MUIA 1JI2A 1UZHA 9XIMA 5HBFA 3I4KA 4U31A 1X97A 3OGVA 2X40A 1RH9A 1DJIA 5AN7A 4MPKA 1FRBA 3LA4A 4DJFA 5HK4A 1O12A 3QM3A 3NSXA 2PF8A 1BYAA 1F6YA 2W61A 1AFSA 2XINA 1S2AA 1HKIA 2CLKA 2OGYA 3ZSSA 1QNPA 3CQKA 1M3UA 5REQA 1ZRQA 3GTFA 1CTNA 3DENA 4E4UA 2OSXA 3U2CA 3W84A 3N34A 1SJCA 2JE8A 1QXLA 3ONBA 3W1LA 4NAEA 2XTKA 3BDKA 2VC6A 4BCEA 1MRAA 1JZ3A 3DFOA 1O5XA 5XIMA 1VBJA 2OU4A 5CJ5A 1XUUA 1J96A 5D9NA 3OBKA 2WM0A 4HVXA 3Q4DA 3REQB 3QR0A 4R7JA 1Q45A 1VFMA 2P8BA 3PUGA 2NSOA 2ZXQA 1HG3A 3KHDA 2XN1A 3GDBA 1FCBA 1SSGA 3E0IA 3C2YA 1XP3A 1XIIA 1K7EA 5AZ1A 1OY0A 5DRIA 4H41A 4B3KA 2E6YA 3PFRA 1RLDA 4O0ZA 2A3EA 2I7GA 2PGFA 1DOSA 3TYCA 4JTAA 1QWGA 2QDGA 4F9JA 1TWZA 1GEQA 4HA4A 3QZ6A 3DYPA 2GGHA 4HHLA 2PI6A 3QV9A 4AIUA 5A2CA 5CZKA 1LLZA 3IUHA 3T40A 4MDOA 3G1XA 4P8XA 4H6EA 3I68A 4KWOA 2WM1A 1OQFA 1RQHA 4LCQA 2C1GA 5A8GA 2NVAA 1YXCA 4MMWA 1BWKA 2GJLA 2VZOA 3LRMA 5DX7A 1B3YA 1FXQA 3BLIA 3PG9A 3CYJA 3VCNA 1QOXA 1ZTVA 4AQLA 4CQ9A 1DP0A 1SZEA 3WEMA 3SCSA 1L2QA 2X05A 2BASA 3ARZA 2QIWA 2VJXA 3L0NA 3B4YA 3MW7A 3WY1A 4MM1A 4NJJA 3PFMA 1G7UA 3LBMA 4NZCA 3NJ3A 3E74A 1RHCA 3A9BA 5TQLA 1AH0A 1CYGA 3PBVA 3IJQA 3UPMA 5AYYA 2B4GA 2NLIA 1ENUA 4DNMA 3E0WA 4IX2A 3SRFA 1QNRA 3NQEA 4W8BA 4XSMA 3D0CA 2PDJA 4R34A 1XLFA 2CKRA 3AIVA 2Q09A 2BVTA 3N3TA 2RKXA 2V82A 1VEPA 6CGTA 3WK0A 3MB9A 1I75A 1HNYA 1E6NA 2E5DA 2NQHA 4QISA 1G01A 2G4JA 3NPWA 1DJWA 2FPVA 4KEMA 3OJGA 4MJMA 4ZO9A 5CAHA 1B2YA 1SW3A 1THFD 3A3HA 2PDQA 4PMNA 4GXMA 4LEQA 3OG2A 5HR7A 1CIUA 2CLIA 3CEPA 4J3ZA 1J6OA 5C7VA 4DXKA 1OFAA 2PDFA 2VGIA 3CH9A 3R7MA 1LBMA 4LVFA 1ONEA 4UNKA 4HU4A 2PURA 2OEMA 1BGAA 3LX9A 3RAOA 3RLUA 3C5QA 3ELFA 1V93A 2H9AA 4O10A 1KO0A 2NX9A 2EXOA 4XD6A 4M6PA 1XPYA 4FB7A 5I23A 5FAJA 1UH4A 4PYSA 3IK4A 1EF3A 4KEVA 1C3FA 4CQCA 4BA0A 3M16A 3RX3A 5J04A 1KQZA 5BYWA 1OFEA 1NWSA 4JCMA 4IUGA 5KINA 4DZIA 5K7JA 1I8JA 3PTMA 4QM1A 1AQHA 3W74A 2D22A 5LNUA 3R10A 1YDYA 2PDYA 1XF0A 4DZHA 5DT5A 3ZLFA 3KL3A 4GE8A 3THUA 4CD7A 3VNKA 1XUZA 1AODA 3SUUA 3D46A 3R8HA 3FCPA 2DW6A 1EP1A 1JRBA 3DESA 4L4PA 2XIIA 5G2WA 1EGMA 1EC8A 2FIQA 4I6VA 3AXKA 1IWPA 1C8QA 4UMCA 3LZ3A 2CXGA 3AMLA 4Q8UA 4R7WA 3WQDA 4X22A 1BFNA 3MPGA 2NUXA 3FA5A 1TPDA 1Z69A 2QYGA 1ZHAA 3NQBA 1EC9A 1A5LC 4LYPA 3VI2A 3DHDA 5HXMA 1N82A 2VZTA 4R9OA 1WKEA 4H6KA 5JIWA 1DQXA 4WOZA 3MSYA 4GG9A 4P2VA 2C14A 3BAYA 2QJHA 3VGHA 1V0MA 4MZ1A 2Z0IA 4RXGA 1HIZA 1NDWA 1DJNA 3NQ2A 4IF2A 3DHFA 3RILA 1Q7QA 4ZO8A 4FP1A 3HMJG 1E6XM 3ZMRA 1LF1A 1E15A 3VD5A 3C0SA 3LERA 2VHLA 3FDKA 1UR2A 5T26A 1PAMA 1V3LA 3WO8A 3WD0A 4I8YA 4DJFC 5ECUA 3IV8A 2WQPA 1MI3A 2QV5A 3GBEA 4MPQA 3R1ZA 5A2AA 3SCNA 4GGBA 2GQ9A 4GYKA 4A8IA 2AMXA 5G5IA 4GACA 1LCOA 1QBBA 4JQ1A 4JHOA 1KRMA 4GNJA 1LT7A 4HMEA 4X9SA 2V3DA 2GVGA 4QITA 2AAMA 5H8PA 2ZZ5A 4ZENA 1HO4A 2G97A 4W84A 3TC3A 2WZIA 3ISIX 5JMUA 3BL3A 1XRTA 4KWUA 2VKZG 3NPXA 1HTIA 2BODX 1E1CA 2DVUA 3Q65A 3DH7A 3ITLA 5HWMA 4XO6A 4HZ6A 2HNEA 5FESA 3FA3A 3UT0A 4I9AA 1GGOA 5FOOA 3U6WA 3WDHA 4K8EA 2BOEX 2ACRA 4RDWA 3EYPA 2PAJA 1KXTA 4W4QA 1G69A 3S4TA 5EU9A 2FTPA 4Z2GA 3W7PA 3NGFA 3GHSA 1J5SA 1IIGA 1VGAA 2VGFA 5E9AA 1RD6A 1WYIA 2W66A 3V1PA 3AXIA 3CHDA 3L4TA 2Q02A 3WBAA 4E4FA 3E38A 3QC0A 4XZBA 1Z44A 3PUEA 3UNDA 2ZUWA 5FF2A 3AALA 1UD5A 4CVUA 4S39A 1Q65A 3P8JA 3K30A 4OE7A 2WNNA 4MNLA 3SAZA 2AAAA 5ABEA 1TVNA 1F8MA 1X38A 3SQSA 1AH4A 1R6WA 2NQJA 2OSWA 4FXSA 5A8NA 4ZSUA 3GLCA 3MTWA 4H7CA 4A3RA 3RLHA 1AW5A 1XHGA 1TJRA 4N7QA 2QCCA 3TJLA 4X63A 3RM8A 5FSDC 4XBSA 3PPFA 5EFDA 1NH6A 1PL9A 1SFSA 1EA9C 4HN8A 1ZAHA 1K9DA 1ISYA 1BGGA 4QROA 3WLLA 3S5SA 1TREA 1RJPA 3ME3A 2XGBA 3UXKA 4Z1BA 2QJGA 3MCNA 1XDMA 3AS3A 5CZSA 3ALFA 5CG0A 1FWAC 4OVXA 2FVKA 4UFIA 4WVXA 5CJMA 2NW0A 1TA3B 4HU3A 1US0A 2TMDA 1GHRA 4QNWA 1SJBA 1GVYA 2GJXA 3ATYA 4UTIA 2HV5A 5AC4A 4Z17A 4XISA 5D03A 3KFTA 4QE5A 4L61A 3HB9A 4NKCA 1XDLA 1E0WA 3WMBA 3W01A 3AWNA 2J9YA 3WUGA 2XVKA 4AEOA 1H1YA 2VFIA 2WVUA 1XQKA 4MB4A 1NFPA 4F0RA 2X8RA 2FH6A 1P7TB 4U33A 3TQVA 4M5PA 3BAXA 3M5ZA 2A1YA 2INZA 1EH9A 1H50A 1UR1A 4B91A 5C0QA 1J2WA 4FLRA 2VDHA 1KC7A 4MB1A 1VD6A 4S23A 5I2UA 2QCNA 2C15A 1JDAA 2ATMA 1P1MA 2HQAA 1MZHA 3NA8A 3OQ8A 1H51A 4EVZA 3EWDA 1WOAA 1XCXA 4IPNB 4IMFA 1XV8A 3NCOA 1PEZA 1K4GA 3UWWA 1GPFA 2WMGA 3VYLA 5I3GA 5I77A 4UBPC 1OG0A 4QQUA 2P3EA 2BS9A 1ICSA 4H8UA 3VK5A 4YU1A 1GYMA 1OFPA 3MZ2A 5C71A 4ZR8A 8TIMA 3CO8A 1V3HA 3W81A 4GC4A 4LV9A 1C92A 1NIUA 1IGWA 3HGRA 1G67A 1JUEA 3JRKA 3TN5A 4K6AA 3UEQA 3A64A 4N9EA 4WDWA 3HF3A 1UZ4A 2VFDA 2H9AB 1A5MC 1J0JA 5HPOA 2YR1A 1WUEA 4IUOA 5M3WA 3BSHA 5PTDA 1S5WA 1H3GA 3F5JA 1GKRA 3TN6A 4RE4A 4K38A 5E93A 4C7FA 3A4XA 1MFVA 5HNUA 1GW9A 3IIXA 2WW5A 3BAIA 5FI8A 3VIKA 1X7FA 3UCCA 1SJAA 4C5ZA 1V7YA 2O56A 4H9MA 2P0IA 1UR0A 2FGBA 2XHYA 3HA1A 4IJBA 2NWSA 4UFMA 4TVCA 2EPMX 3TSMA 1QOQA 5D8WA 1Q2SA 4DXXA 1A50A 3PZNA 4F0KA 4CQDA 2XVNA 3F4CA 1WDWA 4QAWA 3BGGA 7REQB 3RF9A 2CITA 1Y5VA 3IJDA 1DQUA 1P0NA 4A35A 3IUIA 4XSLA 3LTYA 1IR1A 5CC5A 3VX1A 3JU2A 2QCHA 3BG5A 3VOIA 3W7OA 3GX9A 3G1SA 3FSTA 4KFPA 2FTWA 4PMZA 5BXRA 4JIRA 4KFNA 1R46A 1SZGA 3OZYA 2XFFA 4RDVA 3V36A 2R6OA 3ARTA 3WIJA 1U1UA 2GVLA 1DIEA 2QMKA 5XINA 1UASA 3IEBA 3DBPA 5IHSA 1HUVA 1A3HA 4DJDA 1EP3A 2BOGX 4PTXA 2J6VA 3DGRA 1PKMA 3N9RA 1UB3A 2PBOA 5H2ZA 2GJNA 2O0TA 4TMBA 4PTNA 4UFLA 2JKAA 2YZ5A 1QNOA 4HKPA 3THCA 2CHNA 4R5EA 4GH1A 1EYEA 1AL8A 3BQ5A 1KR0A 1W8GA 3NUKA 1GNXA 2V5CA 1XYBA 1QPRA 3VOHA 1V3MA 2DT0A 3KBNA 1R2SA 1DJHA 1DWIM 1XLBA 3CQJA 3L4WA 3MS8A 4Q8WA 1FHVA 3UW6A 3WK1A 3KBMA 5TNVA 1W9BM 2ZUSA 1CECA 3AU2A 3B8TA 5DLCA 4YXGA 2EG7A 3BURA 2QULA 4MB5A 1XIMA 2ZX9A 4NY2A 1F8IA 4ZL1A 1NVMA 3UXDA 3GDTA 4RV3A 5FJJA 3VIMA 3QQWA 1HVXA 2DT1A 3CASA 4HU8A 2Z1BA 2OT1A 4LRSA 4Y9PA 1J11A 4ICNA 3R8RA 2Y6ZA 4PRRA 3W6MA 6REQB 1IEIA 4WD0A 3IGUA 3SRHA 1R0MA 3QHMA 2HVMA 2ZADA 1W32A 3MJYA 4LALA 3RPMA 5JIPA 1ZALA 1WE5A 5BXTA 4XUYA 4YTQA 1TELA 1XBZA 1NFBA 5KITA 2AMGA 4C1NA 4MAZA 2NQ9A 1F3TA 3ZYZA 5BMWA 3UWEA 2X0HA 3N14A 5L6UA 3DFPA 2WSYA 4Z1AA 4PEKA 2OG9A 2H8ZA 1DPMA 3C8FA 3M0JA 4AWTA 4W89A 1K8YA 2ZICA 1RPXA 2QT3A 1RZMA 4FLSA 5BMXA 5REQB 2YLLA 1JEZA 1KFKA 3CQ0A 4XAPA 3O2LA 3S2LA 5A8OA 3O0FA 4JKLA 4HD5A 2NQLA 3WDIA 2VD8A 4DZAA 1PDYA 1J0ZA 1YTDA 5D09A 5AYIA 2PP0A 4UWMA 1W5MA 3FOKA 1OVDA 3ZR5A 4DF1A 5EMYA 1BF6A 1YNQA 3BE7A 2I5IA 2W27A 3GTIA 4WOQA 4C6BA 5J8LA 2REQB 2YBVA 2WNQA 4YS1A 5K3VA 4RE2A 4CGTA 5I7GA 4WJEA 1SZFA 4YYCA 4CEUC 3TSBA 4EK7A 3H21A 1ISZA 4DBEA 3MKKA 1JPIA 2NSXA 2YBUA 3T0DA 1VZWA 4EANA 1TR9A 2CWXA 1RVKA 4QCFA 4D8ZA 4DN1A 3LGEA 2C6QA 2HSAA 3A24A 3QPYA 1U1JA 5C2XA 1PX3A 1EJTC 1UKOA 1P6CA 4Q22A 4IX0A 4ZOBA 3APGA 2E77A 3TFXA 1WXZA 4Q4PA 2OMAA 3TQKA 3UNTA 3MI2A 1BYBA 4FXRA 1DXFA 4JX4A 1MO0A 2WHJA 5C9RA 1UP2A 2IPFA 1JXJA 5LNWA 3O06A 5AHEA 3NZGA 4XBJA 3PVFA 3ZJ6A 3QOKA 2RDUA 4PUUA 3W6LA 1V6UA 4XTIA 5DEZA 2E7FA 3BV7A 4KIEA 2UZ9A 3P7YA 3GDLA 2BXYA 5FJTA 5CZTA 1OM0A 3WNKA 3AISA 5U4NA 4K3ZA 4N9BA 9CGTA 5LIUX 2Z7KA 1OSEA 3K4WA 3UF9A 1IXOA 3LCGA 4REQB 1NP0A 8CGTA 3KXQA 1HGWA 3EOOA 4NASA 3QFWA 5K9DA 2FGZA 5I09A 4CU6A 3OP2A 2HEJA 4EOUA 4L9ZA 3W7GA 1T8XA 1F61A 3SURA 3WLJA 4WSHA 4O0QA 3UVAA 4JICA 5BOOA 4UTMA 5MKGA 3GNPA 2OODA 3FKKA 3HG3A 2VQTA 5I3HA 2CIPA 2NT1A 3ENLA 3VD9A 3BMWA 4S3CA 4H04A 2UY2A 1G4SA 2Z6JA 3CUZA 4I5UA 3CUGA 1W1B1 4ZSTA 3RK8A 1M7JA 2WJFA 3RN6A 1I0BA 2F84A 2BFGA 3DFHA 1GOOA 3F1QA 1AZ2A 2HPIA 4H9TA 4J35A 1UH3A 3CC1A 4X9YA 3RHGA 5CSUA 4HJWA 3T9PA 4GYFA 4XBKA 3VKAA 1VFTA 3ORWA 5E9XA 2O4QA 1R7AA 2CU0A 4ZOCA 4AZCA 3WBXA 1R7OA 1XRSA 4LUIA 2JGYA 4LNYA 2XYLA 3L2IA 4J40A 2Y7FA 2PTWA 5M17A 1YBQB 3MCOA 4HPGA 4DO7A 4HCDA 2R82A 4UTLA 5AHNA 3W27A 4HSOA 3E2SA 2E9LA 1HT6A 4ICCX 3NQ6A 2XH0A 3NSMA 3SJ3A 4M29A 4DBWA 3O16A 2O9TA 3N1AA 2WKLA 5U7SA 4UTUA 2D20A 1IZCA 3OYZA 4CNTA 3GU1A 3S3GA 2ZRZA 1B3VA 4OWGA 4IPJA 3N73A 4Q7NA 4OBRA 1XRFA 3CL8A 2ZYFA 1XSKA 1K3UA 3GXMA 3IAPA 4Z0SA 1XIGA 1E72M 5DBTA 4LYQA 3BO9A 4JTJA 1R38A 3G6LA 1MW2A 3HIJA 3S8HA 1E9IA 1NOWA 2ACUA 1F76A 3TU9A 1AVAA 1BWVA 4FMVA 3KL5A 3WLRA 4AZ6A 3PJUA 4AZBA 3OPSA 2IMRA 2R1MA 2DZAA 2GOUA 2WSRA 3P82A 4KCUA 1DJYA 1ZP3A 3UETA 2G3FA 3PS7A 4LAOA 1CXEA 2Y70A 2IQDA 3POHA 4LX4A 2ZUVA 5FD0A 1DIKA 4E8CA 2WMIA 2YKKA 2ZUTA 2FTYA 4NG3A 4Y8EA 2ZRWA 4MNMA 4RR4A 2BHZA 1V3IA 1KXHA 1QO5A 2B7PA 1S2WA 4BHYA 3ZVHB 4QEHA 4Q4QA 5JBDA 4XIAA 1FTXA 2V67A 1M9HA 5JBEA 3GIPA 2BB0A 4HK7A 3AS2A 3IJ6A 1T6MA 3KTCA 3UFYA 1RJQA 3A23A 5AHIA 5A6KA 3PC0A 1NF0A 1ZLPA 4NAFA 3RO8A 1UPPA 4UR9A 3K8KA 1AW1A 4UTFA 1GW1A 2ISVA 1UR8A 3A3XA 4LANA 1JRCA 3T0AA 5FA5A 1V6WA 2FDMA 3ID7A 3MKCA 4I9MA 1ZFJA 1KLZA 3EDEA 4RDYA 5HJLA 2CPUA 3HJEA 1FH7A 1TTIA 1DEDA 1BRLB 4H9UA 1UJPA 5KZ6A 3MHGA 4KH2A 3UGVA 3VZYA 1Z8AA 3AHXA 3RU8X 4FS9A 2CLHA 4K2SA 1X96A 1F74A 4XO7A 3AMCA 2ICSA 2OOFA 3H7VA 4AF0A 2HE8A 2REQA 4U2ZA 3SSJA 3W37A 2AOSA 3P0WA 4JQ4A 1IXQA 2B31A 3QFEA 3FGCA 3KOYA 5LGXA 1H60A 4TQTA 3TYEA 1VENA 4E38A 2VM8A 2YFNA 3RO6A 4FR6A 3W73A 5CEWA 3AI0A 3C0JA 3NO5A 2JIWA 4Q8VA 5HWNA 3T09A 2FGLA 2E1DA 4MF4A 1ISXA 3SB0A 3TR2A 2ZRYA 4B5WA 1UC4A 4BQ2A 3EOEA 5ABTA 3PNZA 1DIDA 2YL5A 4XWUA 1S2CA 2QAPA 2JEPA 4UQBA 1I1WA 2RGMA 3BV4A 5A6BD 1WZKA 4H6QA 3VPLA 5LIXX 3MC5A 4DF0A 1EWDA 1AMYA 4L6OA 2X1RA 1DJXA 4DY1A 1H1NA 1VJIA 5FJRA 5I3FA 2WMJA 3UY7A 4C5YA 2IXUA 2IPJA 2WV8A 4IIFA 1DKWA 5FJPA 2CZVA 2E9MA 5AYZA 3RRXA 3EWBX 1DWJM 5FEZA 3KOXA 4MUPA 5HINA 5HMDA 1I0DA 2HBVA 4S38A 3F5LA 3SADA 1UOKA 3KVLA 1UIOA 5I0DA 3WMCA 4PUWA 3GXDA 4DBDA 1DL3A 1OX5A 3GTXA 3XIMA 3L0KA 3C0QA 1CT5A 4CCDA 2YL8A 4L9YA 3V5FA 1XKJA 4Z2JA 1PYFA 2PDCA 1BEUA 4RE3A 1LDCA 1B3WA 5F2LA 1B90A 3TVAA 3M0VA 1KGXA 2CKSA 5M2FX 4ZOAA 1K4HA 3LCIA 4GIEA 1EEPA 3QMSA 5HNTA 3MQTA 1L6GA 4GOAA 4NZ1A 1FWSA 4JY9A 4LAZA 4ZXLA 4EPEC 2NLYA 4QAIA 3M9YA 1XX1A 3UY8A 4JNZA 2IQ0A 3HPFA 2VI0A 5IM51 1O95A 5I3DA 2F6XA 2GQ8A 3CAWA 4MB3A 3WNLA 4JL1A 1V6VA 3H7UA 2YCLA 2ZRVA 4B5TA 2WWDA 1YIXA 2J24A 1S2VA 2QIIA 1NFGA 2AQOA 4XAFA 1E4MM 1ZCOA 1M6JA 2V69A 2VFFA 3OODA 3WFZA 8RUCA 3WK3A 3RYSA 4WDXA 2PA6A 3V1HA 1CX9A 3NQAA 2NV2A 3NM1A 1EGZA 1MMFA 3AHZA 4UTJA 4WKFA 1E6SM 5CCZA 1JPHA 4EAYA 1E9YB 4YL2A 4WF7A 1JZ6A 4W5ZA 3U7VA 4Q7IA 1VEOA 2CLOA 5IFTA 3F4VA 4UB9A 1VPQA 2XM1A 1ME8A 1ZENA 3VFLA 3L5MA 4U4MA 1UD2A 1XS2A 1F9CA 1GQLA 1KV5A 2BLEA 2PTYA 1FHLA 4W8LA 2WVSA 2VTFA 2RH9A 3CPGA 4L1WA 1K9FA 4C6MA 2J27A 4GQRA 3B03A 1PWMA 1ADSA 1VHNA 2J47A 1QT1A 1ODZA 1W9UA 1FUYA 4HOXA 3W2LA 5I79A 4LVAA 1TPB1 2CLLA 2QUVA 4A8RA 4PL2A 1F7BA 1QNSA 3VCCA 5FKYA 1N2VA 1W91A 3EB3A 3HQ1A 2IKIA 3DU0A 3N18A 4HNOA 4RL3A 5CPOA 5K2ZA 3KDOA 1TSIA 5L9FA 3UD6A 3SW6A 1YBQA 5IBXC 2QF8A 4YTTA 2FZDA 1E71M 3ZFHA 2ZCGA 4KRZA 3VDBA 4LUYA 4AVOA 1TJ2A 4MYXA 3P6LA 2XZ9A 2CZEA 2X41A 4Q8OA 4PMRA 3V5CA 4FNTA 4XG1A 3ZJ7A 2CFFA 1JNEA 1CZ1A 2UBPC 3ABRA 3HGSA 5KMYA 3EWXA 4BF7A 3RCNA 2E3ZA 5AKQA 4GVHA 4S3JA 5ECVA 4OJYA 4TU1A 4IP5A 3WK2A 3VNLA 3GYCA 2BP1A 4LFYA 1US2A 2HROA 3B8IA 2DUXA 1NWRA 3QYQA 3UZ5A 1IWBA 2J74A 4IGSA 4V27A 1K9EA 4S1FA 1W1PA 3AJ7A 1W56A 4DX3A 1KCLA 3OTRA 1NP2A 2R94A 4J28A 2C1IA 3VD3A 4MOZA 3W86A 2J6XA 1XIEA 2W62A 4GIRA 3B8SA 4CCEA 3WG6A 2D73A 4P8WA 3DX5A 2OT0A 3TH6A 3OW1A 2J25A 2VNCA 3A5FA 2J7DA 5FIPA 4ZBCA 4WJ8A 2Z2UA 5TIMA 4PUDA 4IG2B 1I60A 1SUXA 1ME7A 4LJ3A 3R4IA 2G50A 2GJRA 4JFSA 4C6NA 2DZTA 4ORMA 3MVTA 5AHFA 1V51A 1IT0A 3BAJA 1TX2A 4BS0A 2GUYA 3STPA 3K8LA 2EJ1A 1XPGA 3BLDA 3L7RA 4MJZA 4AW7A 2WZHA 3LOTA 2AKMA 3DYOA 3P67A 4ICMA 4QGCA 3WSUA 3VKCA 1E0TA 3N2MA 1FWEC 3CAVA 1Y7VA 5DN1A 1P0BA 3M4HA 3R2GA 4C6QA 1XRVA 2GLKA 4QR6A 2KAUC 4HMNA 5A95A 3AS1A 1W5QA 2ON3A 4JQ3A 1A49A 4DBUA 1L6FA 1V0LA 1LZOA 4LT9A 4AHQA 5JH1A 2VELA 5CXPA 4U2YA 4JZ5A 1WUFA 2Q3RA 4OGZA 3NZQA 4F0MA 1XQLA 3KVMA 3GNRA 2ZTKA 3TNOA 1KXQA 1YKWA 3GDRA 4S3DA 5HMSA 7REQA 6TAAA 1UKTA 4EACA 4S3FA 3AMKA 4W88A 3H2CA 3RLGA 2XIQA 4TVDA 2ZRUA 5EBAA 1PX8A 3UCDA 1OC5A 3T42A 1FWWA 1RLCL 1JF5A 4D8LA 1SW0A 2PGRA 1F2JA 1RCOB 1EWEA 1KRAC 2PDKA 4OKDA 4PCNA 2ZVRA 2PWHA 3CMGA 1QAPA 1J93A 4A8LA 1O60A 1ONRA 1WQ5A 3VXGA 1FFRA 5CGTA 1JPKA 4GUHA 5HJXA 1NWUA 1BTCA 3LXBA 1KFBA 2I9UA 3M6DA 2QS8A 3CO4A 4GX9A 5C7HA 3C2EA 4MY1A 2P0OA 1UUMA 1LWIA 3I6EA 2Y8UA 3B97A 2EHHA 4GHRA 1K7XA 3WLHA 3S9YA 4LTSA 3QV7A 1S38A 4M7TA 1RQEA 3CV2A 3MKVA 2J77A 4DPPA 2QF7A 2YDSA 2V68A 3FYPA 4WDTA 1FCQA 7TAAA 4O54A 2FH8A 3L67A 3UJEA 2E8ZA 3S5NA 3G1VA 1J01A 4M1BA 1B4EA 5CJNA 3B06A 3U2EA 1CWYA 2I57A 4NQ1A 1GT8A 2V3EA 2DJLA 3OIXA 3M0HA 4YHEA 1V02A 5C8BB 3GB6A 4OFCA 1GVIA 4NJHA 2H6RA 3NQDA 4U5IA 4L1XA 1ZCCA 3P2VA 3SCOA 1KM1A 4PMOA 1BHGA 4PB4A 3A5VA 3IJLA 4AB4A 2PLCA 2QUNA 3NPVA 1YNYA 3O7UA 2VRJA 3NZPA 3L68A 5AYXA 2Y0FA 3PY2A 2V3FA 3SECA 1W1YA 3WLOA 2VGGA 3VGDA 1WA3A 2VX4A 2D1ZA 4GBDA 2FKPA 4K1WA 3N12A 4IT1A 4AU0A 2GOKA 3AYVA 2DY3A 1RCXB 4PN2A 3BOFA 1DE6A 5A6BA 4AIBA 1JZ5A 3Q58A 1TG7A 2E25A 3K46A 4I7WA 1E3XA 1BG9A 1DIOA 1C7TA 2QUUA 1TRDA 3I7QA 3W1RA 1QW8A 3TN3A 2XIOA 1TUFA 3QJAA 2Q3OA 4D6CA 2YDAA 1UP0A 3SQMA 1VEMA 3H2OA 2YYTA 3IGHX 3ZZ1A 4IIBA 4Y7EA 1NSJA 5CC7A 3BANA 4XZ9A 2Z26A 2UY3A 5K4XA 1DVJA 3QN3A 3TA9A 2FHCA 4UQDA 5A1AA 4G9PA 3ARVA 2POZA 3QGVA 2INFA 3WQGA 5M5DA 1YPXA 2ZX7A 2ABBA 1CXHA 3FS2A 1AG1O 1FWTA 3QTPA 1XLMA 3W2KA 2TYSA 1AZ1A 1TVPA 3KRUA 3G3MA 5HA7A 1VBUA 2P3ZA 3P8IA 1TB3A 4IZGA 3PAJA 4XQ6A 3WJWA 1GVSA 4P7OA 3CB3A 3LPOA 1NQKA 4C7DA 3SM0A 4PTWA 4GK8A 1AJ2A 4N4QA 3QV6A 2OLSA 2FB3A 3W29A 3U4AA 4IGHA 4DJEA 3A21A 1V0NA 3I10A 3HG2A 3FEMA 5A6JA 2Y1HA 2D3NA 3OQEA 3EOSA 1O1HA 1QI4A 3NFUA 4KRUA 2EPHA 4CCZA 1V3JA 1Z3NA 2GUBA 2HDJA 1J0IA 2AQWA 3WD2A 3CZKA 4ATLA 3THDA 1O68A 1XXXA 1QTWA 2QR6A 2Z1KA 1OYBA 2V2HA 5JVLA 4P7QA 2R1LA 4O8AA 3H2FA 2XFRA 1VFLA 2XISA 1ONXA 3W23A 4L56A 1EKOA 1F07A 1ZQ5A 4U3CA 3TK7A 5JBFA 4TTUA 3B8DA 1X6NA 3RM9A 4J3XA 4ZOEA 2BWGA 1XYLA 2J8FA 2NWRA 1MDLA 3MP3A 3CWOX 3TOYA 4IQDA 1JDFA 1XH1A 1OHLA 2F8QA 1PZ0A 2F2HA 4US5D 4IPLA 3MCMA 1UPMB 4D8AA 1RY8A 4IG2A 1TUXA 4GUJA 1SU5A 1WX0A 3BWWA 3A4JA 1G94A 3ECQA 3E3HA 1GVRA 5JXQA 4W9TA 1YXDA 5LNRA 4URIA 1VB9A 3SQLA 2XFYA 3JW7A 5B7ZA 1W37A 3PWIA 4G56A 1C9WA 1NY1A 4M6QA 3ZT6A 2D0HA 2NXHA 2FPTA 3E02A 2V5BA 5AC5A 3LK6A 4O57A 1M41A 2XIBA 3TTEA 3F7JA 1EFZA 5LZLA 1JJKA 2VUNA 4NRRA 1UR4A 2FB2A 1BVNP 4M8UA 3NQMA 4H83A 3VDGA 5J5DA 2C16A 1Q6EA 3VKKA 2FJKA 2R8WA 3LNMA 2OFJA 4CQAA 3LY0A 1NU5A 3GZ3A 2WO5A 3OA5A 3IIOA 3C2RA 3LPPA 1OGBA 3AIBA 3GXTA 4CLMA 4V1YA 3UZZA 1GTHA 3HN3A 3E1F1 3LS9A 3QV8A 3VUPA 2UY4A 4BEUA 1FBAA 4HYWA 3O1NA 1CGXA 1TJPA 1PXGA 1C9DA 5FCZA 4NXSA 3GNXA 3G18A 3GC4A 1TV8A 1JR1A 1IYXA 2TAAA 4GO9A 3H2AA 3RX4A 1BXBA 3CWNA 1H0IA 3MWAA 4HIBA 2V9DA 3KCJA 3WQ6A 3GO2A 2GPTA 4RZ6A 3LCXA 3LZ5A 4F48A 1XIBA 4IH3A 4TR9A 2VFEA 4O12A 5AHMA 4PTVA 4QFUA 4E2BA 1E51A 2JALA 4FOJA 3VE9A 3HBLA 4RPPA 5AFDA 1EJSC 4BI6A 4NYUA 2I1OA 3CWHA 2MUCA 4M19A 4GJIA 2QEZA 4HYVA 4NZFA 1M04A 4Z08A 3WX7A 4G8TA 2FYMA 1R3TA 3CUHA 4Z2KA 1XGDA 3URBA 3WBYA 1WCGA 3BOLA 3HGJA 3MO7A 3VO0A 3R89A 1Q66A 3B8UA 3GH7A 4NZ4A 2YB4A 4B9YA 1D8CA 4I7VA 2HMCA 1E9LA 3R0KA 4I5RA 3TFCA 1OADA 2JKPA 3RDKA 3R58A 2QMJA 3INPA 4YVPA 5F4SA 4B9ZA 3ITTA 1ADDA 4MHBA 1ONWA 4PC8A 3WL1A 3GHUA 3G1RA 3EWYA 3QZEA 4TX8A 4HA3A 3AHVA 1TMHA 3VGGA 3MMDA 4AZHA 4Y9MA 3W70A 2QUTA 2YW4A 3T07A 2YCJA 2D3LA 3DFQA 1HXJA 3TROA 3PBYA 1KR1A 2WJZA 2DZBA 3WLTA 3TR9A 2CCRA 3WQWA 3CHFA 5LA0A 3C3UA 3LPGA 3FW6A 3HFTA 5DFAA 5AY7A 2P88A 3EPMA 3P62A 3F2BA 1P0DA 3TDFA 1EX1A 1JGMA 4JIIX 5AVNA 4YWIA 1HJQA 4ZQOA 1DXIA 1MZRA 3WH7A 1PS9A 3PG8A 1A47A 4DUWA 1TTQA 3IUDA 3O3RA 1DJGA 1XYAA 2CHOA 4MSSA 4L64A 1ITCA 1UH2A 2E40A 2Z2AA 3FA4A 3IGXA 2EG6A 4O19A 5LNSA 3QC3A 3IANA 2EPNA 3VDHA 1MDRA 3WQCA 3CU2A 2HJPA 3PAOA 1PWLA 3SO7A 4ERIA 2YW3A 3E0LA 5LA1A 4O14A 4WRHA 3EX2A 5LYRA 1FDJA 4KRTA 3THAA 1EO7A 2AL2A 2C71A 1BSIA 4ACYA 3N04A 1VAHA 2WJEA 3WCZA 3BLFA 3HOJA 4GQBA 3W1TA 1QFEA 5HR6A 4GY0A 3QMTA 2OYMA 3UR5A 4W5UA 1POKA 3T2QA 3LHTA 1Q7ZA 1TCDA 2X7WA 4LB4A 4LUSB 3UPWA 5F2MA 4HMDA 1BWLA 3MUAA 1O94A 2DSZA 3U48A 2ZA2A 1FHDA 3V0TA 4Y9NA 3WJXA 4GGHA 1MUMA 1YE4A 4O52A 3TJXA 4ZQNA 2XN2A 4LAKA 5C9UA 3WJSA 2PDXA 5I6SA 1ADOA 1OG6A 3TN4A 3W1QA 1GYNA 1U83A 3ZT5A 4C6KA 4DNHA 3WLIA 1EXBA 5FL1A 1BXCA 1SSDA 4UQEA 4PMXA 1VC4A 3H24A 3SBFA 3FJNA 1H2JA 1KCXA 3L4ZA 3TYAA 1L8PA 1EL3A 1H0GA 4FXJA 3T81A 3HV8A 1P6BA 1MVYA 3DKLA 1QU4A 1H7NA 4ILSA 3PJXA 4XAZA 2PRLA 3BK0A 4MGGA 1HO1A 3ZSTA 1O5KA 1XINA 3EA1A 1HF6A 1YHTA 4C6EA 4H1ZA 1OFQA 2HTMA 3W24A 5GQBA 1AUSL 2FZMA 1GEHA 1O1ZA 4W85A 1BAGA 4JYDA 3NDYA 1PZ3A 1ESWA 1YDNA 1WKYA 4ACZA 3E0VA 4O1CA 1TV4A 4UFHA 1EOMA 1H11A 3G8RA 2GSEA 1VYPX 4H00A 4NAFB 5A6MA 1JG9A 2RDXA 2XIJA 4FNSA 4KERA 1U33A 4PMDA 9XIAA 3O63A 3ABOA 5EPDA 4IP7A 3POCA 1QDSA 1S3TC 3P60A 3H7RA 4GJ1A 1L6YA 1ZPTA 1IEXA 1J0YA 3RPTA 2V5DA 2ZDSA 3LB0A 1V5XA 4JL2A 3THQA 1QPNA 2VX7A 4GI6A 1W3IA 1M68A 2XDFA 4E8GA 4ZODA 3LLFA 4PBGA 5JUVA 4C91A 3N2CA 1E55A 2Q8XA 1GG0A 2CW6A 4GQ0A 4YWSA 1LP6A 3S6TA 3W7NA 1IEQA 1E1EA 2I17A 4FAMA 4ALDA 2BMBA 5LNVA 4XIMA 3R0DA 4DO6A 4KF1A 1VCVA 3CB8A 1RD5A 3HV9A 4XX6A 2XIMA 4D6EA 3WUEA 3WQOA 5KZMA 2PWEA 4WKAA 3O0KA 2QJJA 1AK5A 3O9NA 3QQ1A 4PB5A 3WQFA 2HVNA 3IJIA 4IJCA 3W7QA 1XDJA 1F3EA 1CNVA 4S3BA 5LXXA 1FWCC 4CQ8A 4FEZA 1I4NA 4ZZ9A 4R85A 4GRSA 4H01A 1DJZA 4LVDA 4QE4A 4WY0B 3WDJA 4I9JA 2Y62A 3ZVIA 2VZUA 3GAKA 4BF5A 3WLMA 1ITXA 3SN0A 1KNWA 2BVYA 2WBKA 4QS5A 3KBJA 4W7WA 4QJ3B 2PLKA 3K5XA 2V3GA 1RA5A 3JZUA 4M82A 5D8ZA 2Y24A 3E96A 4EE9A 3LUTA 3GSMA 4S3GA 4NRSA 3GG1A 3S5ZA 1QK0A 4L6HA 7TIMA 1OCBA 4PA8A 6XIAA 5IDZA 3NTYA 1XYFA 2GDUA 4AVNA 1GHSA 1E6QM 3GNNA 3QPZA 1LT8A 4O13A 1H62A 4JN6A 3USZA 4Q8NA 1DBTA 4HZ8A 1GOIA 4RNJA 4D6FA 3U5UA 2W3ZA 4JTGA 1PIFA 2VZVA 2V5JA 3OHMB 3WF3A 4FNQA 3CMFA 4DWSA 4MTVA 1SJDA 5DRCA 3EDKA 1I6NA 1Y0EA 1HGYA 2X2YA 2QZRA 1HJXA 3ARPA 2VEFA 3VIJA 4HSNA 1M65A 5E1QA 1QW7A 3IARA 2GL5A 3PTDA 3NURA 1JVNA 2BDQA 1EF2A 1Q63A 1QI0A 2DH2A 1EJVC 1QJWA 2VMFA 1XR2A 3W82A 4JKKA 5FACA 2NX3A 1SYTA 2RDTA 1VLWA 4JCLA 2W79A 1T40A 5RUBA 4BQ4A 4KW2A 4UOJA 4Q8QA 4PTMA 1OWQA 1D8WA 4QG9A 4GH3A 2GUUA 3WLQA 3KOZA 3VOFA 4P7RA 2FHFA 1PZ2A 3T55A 3FYOA 3DG3A 5CZ0A 3CNYA 2J4GA 4BEQA 4AH7A 4KEZA 3AOFA 4QTGA 3AYSA 1V6XA 3FSUA 2FVLA 1MXDA 4IICA 3LXCA 5CG7A 2ZQ0A 3W2NA 4ZE4A 4O4VA 1S5MA 1LQ0A 4UCGA 4LUJA 1YPFA 3IACA 3DAQA 1WPCA 2XSBA 2CBUA 3V7PA 3G0XA 3F4NA 3WFLA 1ECEA 3CM4A 4G1KA 4ZB0A 1QNQA 3IVSA 1IXNA 1XKYA 2PLMA 4TVUA 4WXYA 1OC7A 1GOKA 2W5FA 5I03A 1Q6QA 3S9IA 1K8ZA 1QO2A 2V81A 1DV7A 1JIBA 5A8MA 3T05A 2F38A 4XVDA 1ITQA 4JX5A 2XM2A 4IMDA 3S0CA 1R5YA 2ANUA 1UD6A 4IHCA 4IOTA 4N2YA 4RE0A 5M03A 1XLEA 4HTBA 5CBJA 3LHUA 1EOKA 3IJ9A 3GD6A 2X42A 4WR3A 1KWGA 1HJWA 3CUXA 3UWQA 1QPOA 4E4PA 3MYOA 4DPQA 3GU2A 4NX5A 4AIEA 3H22A 5HULA 3FJLA 1QPQA 2O7QA 1RY0A 4I3GA 5HQEA 3APTA 4RV8A 3VM5A 3MSGA 1W1IE 1GQNA 5DCBA 3S9ZA 1KCKA 3EOLA 1W9DM 1UA7A 4GNVA 2J7GA 4FZIA 5G2HA 1UCWA 1GOWA 1Z89A 4QJ1A 3PP7A 2ZX6A 4ZQMA 1PX4A 3G1AA 4N02A 5G2IA 4GZ7A 5HNNA 2P1FA 2XVLA 1PTGA 1LROA 2A5HA 1WO2A 1OCJA 2PDGA 3VOJA 1LL7A 3OLGA 3VMNA 2RAGA 4JDBA 1VH7A 3BG3A 1JZ4A 2UV8G 1HKVA 4FK9A 5EA9A 3HURA 3AROA 1UWUA 2BY3A 3TQ0A 1NAL1 3HTWA 3W0KA 2E0PA 3P0XA 3TW6A 3PBGA 3OEXA 2WMIB 2G37A 3EMCA 2VCAA 2OEKA 4GZJA 2AKZA 3PANA 5IXEA 4BWLC 4QHRA 4LB3A 4UQCA 2CESA 4LSBA 2VOTA 4JEJA 4FLOA 1TWSA 3W71A 1EZ2A 1K1DA 4B4FA 3BW4A 1LL4A 5BWAA 3U5YA 3FK4A 3QOMA 3DN5A 4GLEA 3R8GA 1H7RA 1LUCA 1MW1A 4ADTA 1KBKA 3EX6A 2YL9A 3G0UA 1JDDA 1JCJA 4Q6JA 3S6OA 3TZNA 3PZUA 3LM3A 3O6YX 2NXGA 3O6CA 1EJXC 2OX1A 3KTXA 5F1VA 2WBGA 4WZHA 4GISA 5EMUA 3WDQA 6REQA 3U2ZA 3K2GA 4PR4A 3CIXA 1RBAA 4X0NA 2V38A 2VC9A 1JULA 3UJFA 3W6YA 4LS2A 3Q37A 3QVQA 4PBFA 1OINA 1UOZA 2EG8A 3KVKA 1ZL1A 4RNIA 2D69A 1KBIA 5BROA 4ZQCA 4H4IA 1YTKA 3LXAA 2IUZA 3CT2A 5DF0A 3VDCA 3LQGA 1MUWA 3GY1A 2X1TA 5K9CA 1Z41A 4ZTYA 3HMCA 3UZWA 2VCCA 1YXYA 3CZLA 1A80A 1YRRA 3LNPA 3GVRA 4JTLA 2F7FA 3FY1A 3MUZ1 3W9ZA 3STFA 4IWWA 3WNNA 1XLGA 1X1NA 4IISA 5BZAA 3PPGA 3KS6A 4P61A 3OHIA 1KM3A 4PH6A 1G5AA 2WZEA 1J0HA 3N17A 3M5YA 1R3WA 2PWGA 4YCPA 1KFWA 2Y63A 3W00A 3B0XA 4UFKA 3BLKA 3BMXA 2YIHA 4Q4KA 5CLTA 4YYFA 3AZRA 4LUTA 2A3CA 3G2GA 3DG6A 1HKWA 4GINA 2O9PA 1PHWA 3DXIA 3JUGA 5BOFA 2FMNA 1UKPA 4OOUA 3GUGA 3FJ4A 2R9RA 3CLMA 1KTCA 4A29A 3R94A 4EF8A 3APYA 4PFMA 1XI3A 2A6NA 4J4KA 4H8VA 1FX6A 3QLDA 3GNOA 3KWSA 1OZQA 1TZ9A 2EPLX 2W63A 1EQCA 3BPWA 4DZ5A 2NVCA 4N0RA 4AVFA 3TW7A 2OSYA 5G1YA 4U3AA 3UR7A 2GGJA 4GNKB 2O55A 3TTSA 3VFCA 1EJUC 2VO5A 3W4RA 4DO4A 3KP1A 4JPGA 4JTSA 4XAYA 1PKNA 2CXEA 1MQRA 1JCNA 3R79A 3S2CA 3MV01 3UYCA 3BH4A 3A6OA 5ENLA 3S1VA 4NILA 2ZC1A 3TAOA 2WC3A 1ZS2A 5IDIA 2PTZA 1Q8AA 5D30A 4KMQA 5CSSA 1W5PA 6PTDA 3BAKA 4UXDA 3GKFA 1CW2A 1ZBWA 1XGZA 3N3MA 1ZAJA 4ATWA 3E5BA 3A4WA 3IK2A 3DI1A 4PBEA 3VOGA 1EIBA 1QBAA 4LBSA 3FHQA 3BLOA 2D24A 1M5WA 1BVWA 4X0VA 3V16A 1UP3A 3N9KA 2DZSA 3W83A 3OGSA 1DHKA 1QRQA 1KWKA 5EMMA 1NEYA 1ZB5A 4H2HA 3NOYA 1D9EA 1SO4A 3RXZA 2B7NA 4O1EA 3RMEA 1HKKA 3KLLA 1W3LA 2V2DA 3LYEA 1ZY9A 3QY8A 3BCJA 3WF2A 4MWAD 3U7BA 1JYXA 3DHUA 5EBUA 2CWNA 1W0MA 2CETA 4EPDC 3SCWA 1GOQA 4D6GA 3T78A 2YPIA 1GPWA 1HL8A 4MWAA 1OD0A 3EAUA 1UMLA 4CN1A 2XFWA 4OV9A 3SJNA 2E67A 1QHZA 4KCTA 3KW3A 4WIWA 3QGAC 1W1ZA 4GX8A 5K9XA 4A3UA 4QS6A 1BYCA 4OV4A 2GDQA 3MO4A 3I3EA 1WBHA 4JIQA 1RXOB 2WZMA 3EX4A 3QMRA 1HJUA 2OX4A 3GM8A 5H1WA 1B30A 4NP7A 4O1BA 1EEXA 3LPFA 1FVPA 3LM7A 3TYZA 5B7YA 4C6IA 4ROQA 4O1DA 1XFCA 3IWPA 2YL6A 5D9OA 4B5XA 1CGUA 4IP4A 3ERPA 3RX2A 4XZHA 3ARRA 1FP8A 3SIMA 1UWTA 2GVYA 2R91A 3WNMA 1LORA 3HPXA 4R88A 1J4EA 3VABA 1Q7MA 3LRLA 1TWWA 3ANUA 2W9MA 2D2JA 3ONCA 2A2IA 4LBRA 2YCLB 1DTUA 3GW0A 2VZSA 5AECA 1R9XA 1TO3A 2FDSA 3GWQA 3AZTA 4Q4OA 2QCEA 4FR1A 3AQUA 4QJ4B 1VPYA 1Q6DA 3DYMA 3WEOA 1VFFA 4H3DA 1UBSA 3B40A 4ZQPA 5BU9A 4GABA 2ZXDA 3COTA 1TCMA 2XWEA 1M7PA 3N15A 3ABXA 1S1RA 4MJ2A 4YN5A 2OWXA 1LG2A 1R30A 3RRAA 3HPZA 2CBIA 3ZM8A 4V33A 3DKJA 4QP0A 2BXZA 1XC4A 4J5NA 1E6RA 5H91A 1J5TA 1GZJA 4N9DA 3C6CA 4FX6M 2ZUNA 3AWOA 4LF2A 1WP6A 2HNHA 5E5CA 4TIMA 1CLXA 4CVWA 4CNOA 3NXFA 4AWEA 3C3NA 1JI1A 1UR9A 2DQWA 5BNKA 1WZAA 2ZUUA 1XM3A 4GY1A 1UHVA 4P8VA 1KM6A 3ZLGA 3GYEA 4L4LA 5D2XA 1T7LA 1BTMA 4CNNA 3WQPA 3BSGA 5GNYA 3QZAA 4FHAA 4RZ4A 1JZ7A 3BC9A