3LHYA

Crystal structure of the mutant i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAAIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhyA00
4UNLA 5KSWA 4UMBA 3CT7A 4HNVA 2YSWA 4XTIA 4HKPA 1M5WA 1R2TA 4EOUA 3LDVA 3ELFA 3QMRA 3G8EA 3LXAA 3S5YA 5D38A 3HBLA 5LSMA 3N19B 4O16A 3G8RA 3LCLA 4Y9AA 1J5TA 4LOCA 3PBWA 1G4PA 3PR2A 2PC4A 3QC3A 3E02A 4YWIA 3L65A 3IGXA 2QR6A 3B03A 1AL7A 2ZZ2A 1Z48A 3ANYA 4K39A 4O50A 5HULA 4O14A 3W2UA 4LUJA 3LTPA 2A7PA 4MJMA 2ZZ7A 4DPQA 3UZ5A 3LI0A 4NQ1A 4WY0A 5EA9A 3NQFA 1VCGA 2ZRXA 4JTSA 3INPA 4QAIA 1LBMA 3W7CA 1W56A 4X3ZA 1I2QA 3M7WA 4UC5A 2H90A 4BI6A 1S5TA 5KZDA 3KHJA 1RQHA 3NPXA 1K03A 3L68A 4GFSA 3KVJA 1OYCA 5I3HA 4MUZA 4RLIA 1FDZA 2GQ9A 1IIHA 1TPC1 4PL2A 4JTTA 3TE9A 3RLVA 3G1AA 3UPWA 3LRKA 3O1NA 2PCQA 3NM1A 2C0AA 4MKNA 1C9DA 1YTKA 3UWUA 3HO8A 3G0UA 4RXFA 4FIQA 2B0MA 3TNOA 3M9YA 2E5BA 5LHFA 1OX5A 4D2JA 3W83A 2GPTA 2C6QA 1W0MA 2DZSA 3GDRA 5H91A 1TTJA 2NV2A 2QF7A 3PWAA 3T55A 1YTEA 4IMEA 5F1UA 4NJKA 3TQ0A 1VLWA 1ML1A 5HJLA 2NZLA 3EKLA 3LTSA 3LV6A 3T78A 2ZRYA 3P67A 3W1XA 1TJRA 1YLVA 3TV8A 3W7RA 2EHHA 2I9EA 5T26A 4CNOA 3NL3A 4WQ6A 3S6DA 2EF9A 3W2LA 3C2FA 2CWNA 2TYSA 1OHLA 3G18A 3BLIA 2ZZ3A 3NQ8A 4QNWA 1XBYA 5L6UA 5IM51 2DZVA 3W7JA 2Z6JA 1ZFJA 4FO4A 1DJQA 1K7EA 1GPWA 2ISVA 2WPBA 1FCQA 5HWNA 2DJLA 1OK4A 1G7VA 1KFKA 4HSOA 3QSRA 4HSNA 4PEKA 3SFKA 5AB3A 3W1PA 3KVLA 4NNAA 1L9WA 4WXZA 1WBJA 2HS6A 3MI6A 4HHPA 5E93A 3PSWA 4DF0A 3NDOA 4NJIA 4JN6A 3QH2A 5HMSA 5HNRA 2Z2UA 4ZVJA 1TMHA 3LM7A 2ZTJA 1H63A 1W8SA 4JX6A 4A2RA 3NAVA 3NM3A 5FEPA 5I3IA 1V7YA 2JKAA 1RR2A 1XDLA 1FY6A 4IMCA 1X1ZA 2X30A 1G6CA 1DQWA 1T8XA 1ZAJA 1JVNA 3LOTA 1OFOA 2WNQA 3A5FA 2Y63A 2VEIA 3TFCA 4FNUA 4TO8A 5C55A 5G2HA 2QCFA 3N9SA 2E77A 2TPSA 2ZDRA 5DN1A 5C6MA 3C52A 3KRUA 1TPB1 5CPMA 4HNNA 3W2MA 5FEXA 1NVMA 1PCWA 3F4WA 3G3MA 4LS1A 4I7WA 5A5WA 4XTDA 1DHPA 1H7OA 4JY8A 3T4CA 2NUYA 4MY9A 1EIXA 1Y0EA 3BLEA 2DZPA 1O95A 3G1VA 3PF3A 4GWEA 2NXGA 3HG2A 4YL2A 3FYOA 4A21A 5AC8A 1QFEA 2G95A 3TU9A 1LTDA 3ABRA 2C3ZA 4UIOA 2A5HA 4WOQA 3YPIA 3W3OA 3S1XA 2PURA 3CEUA 4FNQA 5BMWA 3SGZA 2WJZA 3BARA 4PTNA 3MUXA 3LV5A 3V1PA 4E2BA 1WXJA 1GJPA 5DCDA 1E51A 1IXPA 3IVTA 4O13A 1TCDA 4GRSA 4PL1A 4UTWA 3T7VA 4LVDA 1JR1A 2A0NA 2VFEA 4N6FA 3LI1A 4IX0A 5HUOA 2E5DA 1TIMA 4FX7A 3MI3A 1XFBA 4KWWA 1I4NA 4RR4A 1YYAA 2HTMA 1FBAA 2A4AA 2YW3A 3WK1A 2FB2A 4M7TA 1YXYA 1ZENA 4LNYA 4ONVA 4TMBA 4YCPA 4BWLA 3PG8A 1K02A 1FWSA 3LLDA 2CZFA 3UYCA 3B0PA 1SPQA 1MEIA 4N9CA 3TW7A 2X1UA 5U4NA 4UFKA 1C29A 3EWBX 3SJ3A 1ICQA 1FWNA 4JICA 3N2MA 3NQAA 1IF2A 2ZRZA 3P61A 1X7FA 4JIQA 3EKZA 3M41A 1YTDA 2ABAA 3GXNA 1GZGA 8TIMA 3BW2A 3VNDA 1RQBA 3DFNA 4EVZA 3THAA 4O0ZA 2A2IA 3P80A 3FIGA 4LRSA 4FX6M 3S5OA 2WKJA 1H61A 1WOAA 4EF8A 3W6YA 5AYXA 1TREA 3LLFA 2RDUA 1QPOA 1Z44A 3EXRA 4O28A 2NX9A 3JR2A 4JX5A 4XZ9A 2DZXA 2WO5A 5CGQA 3W1QA 2JK2A 3TC7A 1TPFA 4GUFA 3TAOA 3TJXA 4NJHA 4WY0F 1QPQA 1IXNA 2Q8ZA 2B7OA 5KTLA 2LLEA 2GUUA 3WK0A 5AHEA 4M19A 4AH7A 3QQ0A 3IIOA 5E0KA 3DU0A 5AC7A 1ZALA 5MHBA 3C61A 3FEMA 1VCFA 1XM3A 1AW5A 4O8RA 3VE9A 3B04A 3QW3A 1LM1A 3O06A 3TC6A 4JTGA 3VCRA 2ZA1A 1GVFA 3A23A 3EX4A 3G0SA 1TJPA 3OVPA 1XCFA 3W72A 3W9ZA 4OBTA 4XWUA 3P60A 1LBFA 3S5NA 4AHPA 2ZA2A 3W84A 3BW4A 1I2PA 1CI1A 4UR8A 3IIVA 2GVLA 1PCKA 2X1TA 1WA3A 3KVKA 3JRKA 2YXGA 1MEWA 2CZEA 3QJAA 1LP6A 3GKAA 3U2OA 3M1ZA 2ZRUA 1JCLA 4AHQA 1T96A 1G7UA 4AF0A 1G4SA 3HB9A 2Y7GA 3CTLA 3C2RA 4LY8A 4AF0B 1GWJA 4CNPA 4HT3A 1WAUA 3MW7A 2Y85A 2C18A 5LNWA 2WNZA 4NNCA 4O54A 3QMSA 3LCFA 3S1WA 4MYAA 3R2GA 5AYZA 4P61A 1LROA 3QQ1A 1JRCA 1T0OA 2ZFAA 3P8IA 3STFA 1H7RA 4GC4A 5FESA 4K6AA 3EX6A 3CWOX 1KM5A 1M6JA 3N9RA 2V9DA 3UZJA 3USBA 3TCEA 4HNUA 4GNJA 4POCA 5EPDA 2ZRVA 2Q3OA 2HMCA 3I7SA 1EEPA 3NGJA 3G1SA 1F05A 3LERA 4N4PA 3MP3A 3Q2DA 1MSSA 1XC4A 4NU7A 1VGAA 1VZWA 1GG0A 1GOXA 1SO3A 1WDWA 2CLLA 2P0OA 5D33A 3ZWTA 1OVDA 2FDSA 4IUOA 2CLFA 2GJNA 3N34A 4XBSA 3GDTA 5K9DA 3L66A 5HUPA 1LCOA 3ATYA 1P0NA 2H3DA 2CLHA 3W7OA 3AJXA 3AO0A 4MY8A 4XKYB 3G1HA 2X2GA 5G4EA 2WSQA 1ME9A 3BPWA 2RFGA 3MJYA 2X1RA 5CZJA 2V2DA 4UTKA 1DVJA 3QYQA 1L6WA 2EAWA 1VHCA 2ZA3A 3I7QA 4JDYA 1UJPA 4K8HA 2Y70A 3GNDA 3CIXA 3DXIA 5D02A 4NZJA 4O0KA 2R14A 1GYNA 3P62A 3O15A 3MP5A 5G1YA 4N02A 1IIGA 4GUGA 3V75A 3Q94A 4OE7A 4KWVA 4XBKA 4JDBA 4JIPA 4UTHA 4O11A 1XI3A 4IOTA 5LGXA 2A1YA 5K9XA 3M44A 3OBKA 1B57A 3DI1A 1TPDA 5HINA 3ATZA 3HQ1A 5TIMA 2YZRA 2Q8LA 3RF9A 3WJXA 4ZQPA 3BW3A 1BWLA 3SY5A 1YADA 3I6RA 5D04C 4Z08A 2OJPA 3UY8A 4JTKA 3MWAA 4YCOA 1A5SA 3KX6A 2DZWA 4ADUA 3L5LA 4QSHA 1NSJA 4X9SA 4AEOA 4MY1A 5G2IA 1A5CA 4JY9A 2H6RA 3IVSA 1JCYA 1F76A 1W5PA 5CZ0A 3UD6A 2PE4A 3ABSA 3B06A 3ZFHA 1QO2A 3W1TA 1AL8A 2Y7EA 4O52A 2WOQA 2O7QA 4M6PA 1RD5A 3GDKA 4N9DA 3NQCA 1PL9A 3NPUA 3O63A 4JTUA 4M6QA 1OABA 1TPVA 1EX5A 2AGKA 2WSRA 1F73A 2H8ZA 2RDWA 4JS3A 4MFDA 3EWUA 3IV3A 3L0GA 2QAPA 2V81A 5F4SA 3UWQA 2W0UA 1AK5A 4EF9A 4ZQNA 2QUUA 4ZQCA 5F2GA 1KV5A 3GR8A 4DBEA 4MLJA 3A22A 3BLFA 2G97A 1H51A 3R13A 2XFWA 4UTIA 4OGZA 1VCVA 1YPFA 3G24A 3LXCA 1Q6LA 1N8FA 3GK0A 2OT0A 1TTPA 1J2WA 4PODA 3NQDA 1RV8A 3NNTA 3DHFA 4LV4A 2QDHA 1VLIA 4BI7A 5LZLA 2YR1A 4UTLA 4OHQA 3PUDA 3P5YA 2QCLA 1TPEA 1SSGA 3GKFA 2KZHA 3PSVA 3EWWA 1OF6A 1S5WA 2CLOA 3W2KA 3WJYA 3W7EA 3CHVA 1W54A 4NJGA 1LYXA 3NQMA 3ZR4A 4UTJA 3C2VA 4JEQA 4CNNA 4BF9A 1GTEA 4UTUA 4JXCA 3DFSA 1QNVA 4NXSA 5CKSA 5DY2A 1EWDA 4O1BA 4TX9A 2EKCA 1JCNA 3STGA 3IIPA 3W7IA 1LOLA 1FCBA 1FXQA 3GDMA 4AVFA 1B9BA 4NVTA 2YPIA 4Z1BA 1TTIA 1ME8A 4ML9A 1VH7A 4NXKA 4AHOA 1BTMA 4HN4A 4WD0A 5BMXA 2XN2A 3EWYA 2JGYA 1FWWA 2DU2A 3S0CA 1OFPA 3M47A 3O05A 1KFLA 3PVFA 3EB2A 1PS9A 2V8ZA 1OYAA 4UTTC 3DBPA 1WBHA 3G1DA 4P2VA 1R46A 4DELA 1VYRA 4OQVA 2YYUA 4MZ1A 3NQEA 3HG4A 3RFAA 4JR5A 1PV8A 3B8DA 4Y96A 1G4EA 3NOEA 1TYGA 2Y88A 4Z0SA 3CC1A 1EUAA 3BV4A 5GVJA 1JQVA 5LKYA 2GQ8A 2NUXA 5LHEA 2FQIA 3PAJA 4ALDA 3M43A 3P8JA 4MZYA 5FF0A 4I7VA 4OV9A 2WNNA 4ZQMA 4Z1AA 3M0ZA 1WV2A 1QAPA 1HTIA 3W7QA 2EPHA 5KINA 1YPIA 1YDVA 3W1LA 1KTCA 3FYPA 1BKSA 3QF0A 3IEBA 5EY5A 2VXNA 5C2XA 2Y89A 5KZMA 5D2VA 3W22A 3N73A 4UFLA 4HIBA 4LW7A 4IGHA 5DCEA 1K8YA 3W76A 1LRNA 1X6UA 4WJEA 3WJSA 5D2XA 5CG7A 1R2RA 1EP2A 3LCWA 1A5AA 2ZBTA 4AXKA 1P0KA 4JX4A 4FX8A 1NF7A 2WSYA 2XN0A 4L4MA 4MVAA 1NAL1 1EP3A 1FDYA 1IGSA 4DPPA 5HWJA 2QCGA 4LV9A 2C13A 3HMJG 1LOSA 5FF7A 2CLIA 2QJGA 4R7JA 3TXZA 4DO5A 2TMDA 3NVTA 3LCXA 4R53A 4RZ6A 6ALDA 1VJIA 2CZDA 1OX6A 3P82A 3PBVA 5I3JA 4TU1A 1FUYA 4JTJA 5LNVA 4N9EA 5EBUA 3HJZA 4Q33A 4BI5A 1GYLA 2P10A 1RVGA 2V2HA 2ZZ1A 4ICNA 5AOUA 4HPXA 3WK2A 4K38A 1R2SA 3HPXA 2OCZA 2NX3A 5LGZA 3DKJA 5CPOA 5D2TA 4QISA 1RPXA 2R94A 4YXGA 5K4XA 1FQ0A 1WYIA 3A5VA 4JYDA 1YXCA 3MBDA 4PFMA 1LLWA 1J4EA 3UPBA 1MZHA 3WFAA 1X8FA 1NEYA 3QRHA 4RKAA 3A24A 2QJHA 3TROA 1DORA 3TXVA 3OVRA 2F84A 1KBIA 1H1YA 3NG3A 1MEHA 4FNSA 4CCCA 3S8HA 3P7YA 2E6DA 3NQ6A 5CSRA 5F4XA 1VYPX 3FFSA 3LCHA 3CEPA 4XQ6A 3TIMA 1X1OA 1R30A 5AHIA 1HUVA 3RK8A 2G5WA 3KFTA 1JUBA 3O6YX 3MYOA 1Z41A 3W74A 2DORA 1KV8A 4NUWA 1FXPA 2QEZA 3D0CA 3NO5A 3BGGA 3EWXA 1H7XA 3S5ZA 4HPJA 3GZ3A 4UFMA 2ZZ6A 1GEQA 4O17A 3C56A 3QPYA 2CLMA 4L4LA 3GLCA 1DJNA 4W9TA 5LNUA 4RK8A 1Q45A 3R8RA 1K3UA 3U8GA 3LXBA 3LHWA 4QQ3A 5DBUA 3T40A 4GXMA 1EB3A 2VFGA 4UR7A 3ABOA 4A22A 3SZ8A 5IBXA 3IIXA 3HOJA 1MO0A 1W31A 2G96A 3PUOA 1O4UA 1TRIA 3TK7A 1V5XA 3W87A 1CW2A 4MPQA 3UWYA 1AW2A 3HGRA 2GVJA 1I45A 3M5VA 2FLIA 2J24A 4FXRA 3VKJA 1VS1A 1I8JA 3NPWA 3GDLA 1XDMA 1LLZA 3GIYA 1ZY9A 3S42A 3G1XA 3QM3A 5BOOA 2UV8G 2FIQA 5D2WA 1LZOA 4K37A 1XUUA 4TIMA 3TW6A 1Q6RA 1D3GA 3W86A 1FCUA 2J9YA 4IWWA 4QNEA 5FF2A 3W07A 3S1VA 1XUZA 3GX9A 2VENA 3PULA 1VR6A 2JGQA 3TUUA 1QDSA 5CPLA 4RV8A 4UFHA 3EXSA 1D3HA 3W88A 1WX0A 3ZS4A 3DFTA 1T99A 2RDTA 3W7NA 4JGDA 1H7PA 3QPZA 4MYXA 4A2SA 1FDJA 2FPYA 4JTLA 4BWLC 3W23A 2B7PA 2HSAA 1XBVA 3BG9A 4QIUA 4O1CA 2RH9A 2PRHA 5D09A 4Z1DA 2DP3A 3BO9A 3WJWA 3DKLA 4GUHA 1G69A 3KVMA 1OFAA 4JTFA 1JCMP 4A29A 3TQVA 2NUWA 4KFNA 1KLZA 3EX2A 1SW3A 1CX9A 5KMYA 3O6DA 3LHUA 4MZ8A 1Q6OA 3N14A 3OIXA 1KM0A 4Z0JA 3L0KA 3PBUA 1PHQA 5BW6A 2FTPA 3NYZA 2W79A 2J6XA 5J5DA 4UXDA 3NQ2A 3C3NA 3NZ1A 4O1DA 1LOQA 2CLKA 3VFLA 1W3TA 3EX3A 4WUIA 1SZGA 3N2XA 2A7NA 1O60A 3JS3A 4ZMGA 5D03A 2BTMA 1SSDA 5AHLA 4XKYA 1IXQA 3VI2A 4YMZA 3C6CA 4X22A 1L6YA 3NL2A 5EL1A 2YYTA 4Q4KA 1TQXA 4C1KA 2EGZA 3W1MA 1FCVA 2V0TA 3W70A 1YXDA 3W2JA 2QUVA 5D2YA 4NT0A 1UB3A 2X1SA 1QR7A 5FF4A 3E49A 1H7WA 2O7SA 4H4IA 3ABQA 2ZTKA 3SECA 3LTYA 3TJLA 3P74A 2VFDA 1EP1A 5K3VA 1TV7A 3HIJA 1KFJA 2DJXA 1KLYA 5ABTA 4IJBA 2OT1A 4E2DA 1W1ZA 2V5BA 5K4ZA 3LCGA 2I14A 4O10A 2FJKA 1VYSX 5CSSA 1H62A 4FNTA 4EIVA 1UCWA 1OFBA 4DQWA 1XL9A 3L0NA 5DLCA 3M5ZA 5AC6A 3GVGA 2A21A 5DXXA 3I68A 3FJLA 3NL6A 2CU0A 3R5EA 5A8GA 3TH6A 5AHNA 2J88A 1S3HA 5HQEA 3F4NA 3C0JA 1OYBA 5K2ZA 1HO1A 3BGJA 4OT7A 3GNNA 4WX2A 2VFHA 2NLIA 4LC8A 3EX1A 2E1DA 1IXOA 1B4EA 3Q37A 1DL3A 2J9ZA 1FWTA 4IMGA 2DZTA 3W7GA 1MXSA 4ZQRA 3DFQA 1Q6QA 5KITA 2ALDA 3NEVA 4LU0A 1OJXA 4QM1A 5D32A 1P5BA 2VELA 1KM1A 3G3DA 1KM4A 3PM6A 3KRSA 1Z42A 4IQLA 2ATSA 1F6KA 1OG0A 5I3KA 5K9CA 3QMTA 3L2IA 3KRZA 4U28A 1FWRA 3IGSA 3RU6A 3LHTA 2Y7DA 1SFLA 1I2NA 1ALDA 3FA5A 4UTTA 3HG5A 2GVGA 3I65A 1ZNNA 3L21A 3PB0A 2ZCGA 2OX1A 1I2RA 3TSBA 1OFQA 3WK3A 4DEFA 4ZL1A 2ZYFA 1SZNA 3C2OA 3MI2A 4LC6A 4NJJA 4O4WA 4CQ9A 3C8FA 2QCEA 1TB3A 2Z6IA 2VFIA 1QPNA 3TQKA 2V82A 4GUJA 1TTQA 2FPVA 1QO5A 2QCNA 5E1QA 3GYEA 1JQXA 1SR9A 1QPRA 1P4CA 2V5LA 3IVUA 3LCIA 2OMAA 3NPVA 4S2CA 4FHAA 3G22A 1GT8A 1L2UA 2I1OA 1LDCA 4GJ1A 2P1FA 3W1UA 1EWEA 3TMQA 1LRTA 3NL5A 2B7QA 1ICPA 2DZUA 2R91A 3P5ZA 5DELA 1VRDA 1TPUA 2VKZG 3DFPA 5FEWA 3M16A 4FEZA 1F5ZA 5BNKA 3LX9A 1S5VA 2BLEA 4PC8A 1KW1A 5F2LA 4WY0B 1W3NA 4KFOA 3M6YA 1B4KA 1QOPA 2GOUA 3MHGA 2QUTA 2E6FA 4N6EA 5EYWA 2XN1A 2F7FA 1C8VA 1H60A 4JNMA 3THQA 1K8XA 1AW1A 3TAKA 1JCXA 1LORA 4O1AA 7TIMA 4UMCA 2Y62A 4AWUA 1SW7A 3KAOA 2BWGA 4HNTA 1TPH1 3W1RA 3HGJA 1BWKA 1OFDA 2JBMA 2H3BA 2V2CA 1PVNA 1SO5A 1U5JA 3PG9A 1F74A 4RCXA 3F03K 1ME7A 1LRQA 4ZQOA 4LT9A 3UXDA 3UWWA 2TSYA 1DOSA 3H54A 1JULA 3OA3A 5D30A 3C2EA 1K8ZA 1K7FA 3LBMA 4A3UA 1OFRA 1A5BA 4O53A 3DFOA 1BEUA 4FIRA 4S1FA 2YW4A 4DO6A 5SWUA 2QDGA 2CZ5A 1KM6A 3L5AA 3UWZA 2QCDA 5HR7A 3QEZA 2ISSA 1H5YA 3P81A 3PB2A 2AAMA 2C15A 4AWTA 3CWNA 5J5RA 2QCDB 3OEXA 5LNSA 2R8WA 1JRBA 1OX4A 1W3IA 3DZ1A 4Z1CA 1KFBA 1OX4B 1U83A 2BSLA 3W1AA 1LBLA 1O94A 3GXPA 3NQGA 5AHFA 1H7NA 3BVJA 2NWRA 3W71A 1VQTA 3OG3A 2Y6ZA 3N3MA 1KBJA 2NWSA 1AG1O 3SGUA 4IPIA 3W2NA 3LBCA 3UXAA 5LNRA 2YFOA 4M7SA 5DBTA 1ZJIA 1XKYA 4IPJA 1GG1A 3T44A 1TV5A 4PH6A 3NZRA 3TDFA 5I3GA 4TR9A 4TMCA 3W7KA 3B05A 4JTEA 4M5PA 1GTHA 1FX6A 5CPNA 4I7UA 2NV1A 4N2YA 4YLWA 4H3DA 5AFDA 3EXTA 3A21A 5G4WA 3WJZA 4LVAA 1TO3A 1NF0A 4MJZA 2J27A 2ZZ5A 4QJ1A 1N55A 3BG5A 1EUNA 4Y90A 1RZMA 5FI8A 1HG3A 3L5MA 3MMTA 2RHGA 3TSDA 1F6PA 1TSIA 3MO7A 1HFBA 2AQWA 5F4WA 1OF8A 2QCHA 3W7DA 4IX2A 4BFAA 3NR0A 4OV4A 1SO6A 1JUKA 4IXHA 4WXYA 5EMUA 3M5XA 4E38A 3IIZA 2D73A 3W7LA 3FKRA 5K7JA 5DXYA 3E0IA 1TPWA 2WQPA 4UFIA 3HG3A 2ZQ0A 3LRLA 4J9JA 4CQAA 1THFD 4O57A 3G1YA 1PIIA 2OZ0A 4OWGA 3H53A 2E6AA 1GVOA 3KXQA 4O4VA 1SU5A 4ORIA 4JTIA 3MYPA 4FB7A 2CFFA 5DY3A 2QCMA 2VFFA 3HF3A 3M5YA 3SI9A 5FF3A 3DGRA 3W75A 4M6VA 3OHIA 4JYFA 3STEA 2QAFA 2A85A 3NA8A 2HS8A 4JD4A 3DI0A 4AB4A 1HO4A 2C14A 1TQJA 1DQXA 2BZNA 4DXVA 2FB3A 3W7HA 3SSJA 3E9AA 1N7KA 1SZFA 3TMLA 2JKEA 2CW6A 1TRDA 4LWWA 3TR2A 6TIMA 3R89A 3TFXA 4O15A 2VEMA 1KTBA 4LVGA 4MLRA 5AYYA 5C54A 3L67A 4B5NA 5BRBA 5KZEA 3W7PA 1GVQA 2Q3RA 1JUEA 4X2RA 3S9YA 2ZZ4A 1KM2A 4N4QA 3LRMA 3HGSA 2YGYA 3OVQA 3QFEA 2YX0A 3CLMA 4U4MA 4FNPA 2Z1BA 2YCEA 2BX7A 4O18A 1ZCOA 4WOZA 1W5MA 3TKFA 3LHZA 1ADOA 4RZ5A 3DENA 1H50A 3S1UA 1DKWA 1XXXA 2NXIA 3F1QA 3W85A 1UUOA 1SO4A 2B4GA 1I2OA 1OFEA 2B7NA 1JCJA 4OU1A 3B4UA 3LGEA 5AHMA 4XUGA 3B0UX 3QSTA 3GB6A 1YDNA 2X16A 3W73A 2H8XA 5C5YA 2E68A 3O6CA 4AWSA 4LS0A 2V30A 4MOZA 2QJIA 2JKPA 1ZAIA 5DCBA 2ZRWA 3GAKA 1VPXA 4JYEA 2FPTA 4N9BA 1M7OA 3H55A 3R12A 3PUEA 3RNDA 1XBZA 3K30A 1WQ5A 3E96A 1PHWA 1D9EA 1SUXA 4I9AA 1GVRA 3CPRA 3G0XA 3RMJA 5G5IA 3QW4B 4ADSA 1QCWA 1A50A 1O5KA 1PE1A 1DBTA 4NNBA 4CQ8A 3U6WA 2Z0IA 2NXHA 4KFPA 1W5QA 3FOKA 4ORMA 2ABBA 3FS2A 4UUIA 4UTWC 4S2BA 5HWMA 3MHUA 1OK6A 4EWND 3SW6A 1H1ZA 4LUIA 1QOQA 4MIMA 1ZAHA 3GAYA 2FFCA 3UNDA 1RQEA 4PA8A 3CB8A 3C4UA 2A7RA 2E09A 3TSMA 4CCDA 1M7PA 4BK9A 4RJEA 5EKYA 2WV8A 2E5CA 4QITA 2VEKA 4JTHA 1F2JA 3LHYA 3FKKA 1QWGA 3W7MA 4CLMA 1SZEA 1Q3NA 1SQ7A 3IRDA 2CLEA 4IMDA 3O07A 4K8EA 2RKXA 1GQNA 3UQNA 4NX0A 1HL2A 1KM3A 1AMKA 4UTMA 1A53A 2ISWA 5I3FA 5F1VA 2C19A 2YFNA 5H2ZA 2QKFA 4H6KA 3SR7A 4O19A 5CZSA 1JJKA 4R34A 4IMFA 1W5NA 3LB0A 1KTNA 1K7XA 1VHNA 3QZEA 1G67A 5U7SA 4Q32A 2PRMA 1EA0A 4MFEA 3O8AA 1KA9F 1KFCA 1G4TA 4GBUA 1WOBA 3FLUA 3HPSA 5AN7A 1SW0A 1TV8A 3VE7A 4NX5A 3PC0A 2GQAA 2C16A 5L9FA 3CM4A 3DAQA 2IQTA 3FJ6A 3TX9A 4NZFA 2VEPA 2QCCA 5IBXC 4K36A 2A6NA 1O5XA 4UCGA 4RX0A 4LRTA 1VC4A 4FF7A 5CZTA 4UFJA 4K7VA 4Y8FA 4O12A 1YDOA 3DH7A 2E6YA 2BXVA 5G2WA 5HR6A 3O16A 3GR7A 3LHVA 3GXTA 3STCA 4LVBA 5D05A 3CIWA 3DHDA 2J9XA 3G1FA 1GVSA 4LTSA 5D37A 3HGOA 1KFEA 4R33A 3PBYA 1L6SA 1DV7A 4UNKA 2GJLA 4AMAA 3L9CA 3HPZA 4DO4A 1SFJA 5TQLA 1UASA 5G1TA 3Q58A 2NX1A 1R47A 3E12A 3UY7A 1ICSA 3KOFA 3EEGA 3UWVA 2Y7FA 1EPXA 3PS7A 4GE8A 4C1LA 2A6LA 1W5OA 2C1HA 3CU2A 4CCEA 4E0CA 3IGUA 3BK0A 3NXFA 4K7YA 1B3OA 2YDAA 4AAJA 4KKXA 3B0VC 3MP4A 4BR1A 1XBXA 3MBFA 1UUMA 2VOMA 4IXXA 1UBSA 2PRLA 3A9IA 1QMLA 3PY2A 3RLUA 2W6RA 3NQVA 4Y6GA 4RZ4A 4PCFA 4UMAA 2TRSA 2ATMA 4DF1A 3BG3A 1ONRA 4WZHA 5F2MA 4RXGA 4ZZ9A 1W37A 3P84A 5FEZA 4ADTA 1ZHAA 3NQ7A 3SIZA 3EWZA 4GUIA 5F2IA 3MHFA 4FXSA 3W1NA 3ZWSA 4DF2A 1F7BA 3I7RA 4DBDA 3TA6A 4LVFA 3CQ0A 1NFBA 4FNRA 2VC6A 1P1XA 4G1KA 5TBOA 4LS2A 2Y61A
chains in the Genus database with same CATH superfamily
5KSWA 4AYGA 2YSWA 2WXDM 2SFPA 4HKPA 4QBXA 2OKTA 3HMCA 1NFPA 1VAHA 3WH5A 2FHFA 3ENLA 3OYXA 1J5TA 2WWDA 3PBWA 2B81A 2PC4A 3E02A 1Q63A 4EKJA 2QR6A 3B03A 4PYSA 4HCLA 5I03A 1UQZA 3BOXA 3FVMA 3L12A 4K39A 5HULA 1NQKA 3W2UA 4LUJA 2PDGA 1CTNA 3V7PA 1P6CA 4WKAA 3UZ5A 1CXLA 3S3GA 3AHZA 4CU7A 1G9HA 2PU1A 5DT5A 3ECQA 1V6XA 1J8VA 3W7CA 3ARTA 4UQAA 1MRAA 4L5ZA 3DECA 3RLGA 5CBBA 3WEOA 4QLJA 4ROPA 4BI6A 5KZDA 4W84A 3E2VA 1V0LA 4Q4MA 4TV6A 3ARRA 1GEHA 2GSHA 4AC7C 1EOMA 1J93A 3LRKA 4PUMA 3O1NA 2KX9A 3LK6A 4MKNA 1IEWA 1C9DA 4QE1A 2WYSA 1ADSA 2WB5A 2E5BA 5LHFA 4MJ2A 3GXFA 4JCMA 5EMYA 1VBRA 2C6QA 5CSYA 1MMFA 1W0MA 4DJDC 4PMDA 4WHBA 5H91A 3THCA 3ZZ1A 4H04A 4U31A 1I6NA 1YTEA 3MWCA 4NJKA 1UWSA 3TQ0A 3EOOA 3IJLA 2NZLA 2XWDA 3EKLA 3LTSA 2ZRYA 4W4QA 1IV8A 4QCFA 1YLVA 2AGTA 1CGYA 2UY4A 2O9RA 4CNOA 3NL3A 1MDLA 3S6DA 3P93A 2EF9A 3W2LA 3DDMA 4BHYA 2CWNA 2TYSA 1ZU8A 1KRMA 1V6UA 1MYRA 4GI8A 2WMKA 4B3ZA 2VEFA 3DG3A 2WPBA 3OGVA 1JZ2A 1ZRQA 3OOQA 1OK4A 4E8CA 1W17A 3QSRA 1W91A 4OZOA 3SFKA 2OOGA 4AD1A 1JPIA 3MI6A 3MANA 3BAIA 2EG6A 4DF0A 4JN6A 1BRLA 1TMHA 2ZTJA 1HF6A 3NAVA 4J7RA 4GBDA 3MUZ1 1V7YA 2JKAA 4IISA 4NL1A 5MKGA 1ONEA 4TOQA 5MKGB 1JVNA 2WNQA 3A5FA 2Y63A 2VEIA 3S2NA 5G2HA 4CNTA 3AUOA 2VZVA 2Z4GA 3K46A 2OZ8A 1TPB1 3BCJA 4C6QA 4HNNA 2A3CA 3W2MA 4E5TA 4AX6A 1NVMA 4JIEA 4G5DA 1H7OA 4JY8A 3JW7A 3T4CA 5E9AA 5JU6A 5FL1A 1LG1A 1JDCA 1BGAA 3MU7A 3AS0A 2DZPA 6CGTA 2NXGA 2YLLA 2QJNA 3TYDA 1QFEA 2XFYA 2A5HA 1GQJA 3S1XA 5T9CE 4FSAA 5BMWA 3LNMA 2WJZA 3MUXA 3LV5A 4FLSA 4HBKA 4PMQA 1VD6A 2Q6ZA 1GONA 1E51A 1W1B1 4HB7A 4GRSA 4UTWA 3M46A 4NHVA 1JR1A 4DJED 1M53A 3S4TA 4N6FA 2PDXA 4B9ZA 1TIMA 2A3EA 3NZGA 1S38A 3MI3A 1XFBA 3KL0A 1JZ8A 1TE1A 1YYAA 1FBAA 1VPQA 2A4AA 4H2CA 2ODOA 2YW3A 1EBGA 1YXYA 4TMBA 1UWAA 1F3TA 1ISZA 2NSXA 1FWSA 7A3HA 3B0PA 4N9CA 4LYKA 4UFKA 4HYRA 3BJSA 4MB3A 3SJ3A 2VWSA 2WHMA 4JICA 3KS6A 4JOMA 3NQAA 2ZRZA 3P61A 3PPFA 3EKZA 3M41A 2X0SA 3TYAA 4E3TA 4O0ZA 2A2IA 3P80A 1F9CA 4XV0A 3S5OA 4P7NA 1VKFA 4B5SA 1WOAA 1XCWA 1I1WA 1NY1A 3IJIA 4S3KA 3WNNA 2GUBA 3TTEA 3FY1A 3ITXA 5CGQA 4ASTA 3IUDA 1XLKA 4QDMA 4HMDA 4WY0F 5KEZA 1BF6A 1QPQA 1IXNA 1RLDA 2GJRA 3WMBA 3V5CA 3D3AA 5AHEA 4AH7A 3ITYA 1KRBC 3FEMA 1AQMA 4O8RA 1JFXA 3UCQA 2FTWA 3O06A 2C91A 2VTFA 3BZJA 2YCIX 3A23A 3EX4A 3OVPA 3W72A 3W9ZA 1TJPA 4L4PA 1GOQA 3MCOA 4AHPA 3BW4A 2WWCA 1I2PA 2BOGX 4V27A 4UR8A 3ZVIA 3OBEA 5H1WA 4Y9OA 4H41A 3N17A 1PCKA 3H24A 1WA3A 3V36A 1BYBA 2D0GA 4FLOA 2DVXA 3QJAA 5FSDC 3KZSA 4S39A 3SGGA 1LP6A 3II1A 5AYIA 3MSGA 2ZRUA 3M1ZA 1EDGA 3S2LA 1G4SA 1Z6KA 2VRJA 2Y7GA 4YVVA 3C2RA 2PDMA 4CNPA 4X2PA 4C6PA 4NNCA 2FHBA 4ZEPA 4XAGA 5AVHA 3M7SA 1LROA 3AYVA 1JRCA 1T0OA 1SJBA 1T7LA 4S3AA 4L56A 5CZKA 3EX6A 2V68A 1KM5A 3CWOX 3UZJA 4XZLX 9RUBA 4POCA 5EPDA 4Q8WA 3TYZA 3U5UA 4J40A 2ZRVA 2Q3OA 1KWGA 3BSHA 3MSDA 4ECLA 3CZEA 4CCZA 4MDPA 3OIHA 2DIKA 3MP3A 1XC4A 3UXIA 2Y1HA 3TW9A 3MCNA 2W63A 3BLOA 3VK5A 3N34A 4GZIA 1RJPA 4XBSA 5HUPA 3GVVA 3AO0A 3WH8A 4Q8TA 2EXOA 3TP4A 1NOFA 3GHUA 2FFIA 4LUSA 5G4EA 3FSTA 3BSMA 3VOIA 2HQAA 2GWNA 1NWRA 2G4JA 4HMCA 1XG4A 1NELA 1UJPA 1U22A 4BF7A 3EEZA 5A95A 1PTGA 4A3RA 3GW0A 2ZUUA 4O0KA 2CXEA 3MSYA 1EFZA 4AVOA 1W32A 4A8LA 3R7MA 4HN8A 3D5HA 5AZ0A 4KWVA 4J1OA 1F07A 2NV9A 5PTDA 1E6ZA 1Q2RA 5HNUA 5K9XA 3M44A 4GGBA 1SMDA 3OBKA 5HINA 1TPDA 1LL6A 3K13A 4YYCA 5CEWA 3BW3A 5HQMA 3MY9A 1KD0A 4U5KA 2E7FA 5D04C 3QYSA 2OJPA 4Z08A 4JTKA 2DZWA 4ADUA 4XG1A 3W81A 3T81A 1EYWA 5CPQA 1GQIA 1R9ZA 3BCFA 2G3NA 4C7DA 1JCYA 1W5PA 3C5QA 1IT7A 3CMFA 1IZKA 3B06A 3ZFHA 1V08A 1AL8A 4O52A 2WOQA 1REQA 4LH8A 1RD5A 5A8PA 3GDKA 5E0CA 3NQCA 4DY1A 3GY1A 4D6EA 1OABA 1BYAA 2AGKA 2WSRA 4Q7BA 4KH2A 3T09A 3EKGA 5HOSA 3N11A 2DZAA 1BG9A 4PCNA 3GU1A 3RILA 2V81A 3AUJA 3T0TA 3OPSA 1AK5A 1DTUA 4EF9A 3P0WA 4ZQCA 2QDDA 5F2GA 2WVUA 4GABA 3BLFA 3R13A 4IICA 1O7AA 4OGZA 2ZC1A 3G24A 3LXCA 4L9ZA 1N8FA 1BD0A 2IPJA 2CNCA 3RM4A 1OC7A 3LNPA 2DSKA 1J2WA 4C65A 4PODA 3NQDA 3NUKA 2BY0A 5J04A 4FOJA 1VLIA 7XIMA 3CBWA 5EMMA 1LT8A 3WD0A 1Y8BA 3H8AA 4DYKA 3H2NA 3PSVA 4PSRA 3SAZA 1KXQA 3GTIA 1MQPA 1UKTA 1RSCA 1QNQA 1H2JA 2WJFA 3R4IA 4CNNA 3JUGA 3DFSA 4NXSA 5CKSA 4DHGA 2GL5A 1MW3A 1BG4A 4O1BA 4TX9A 1NFGA 1JCNA 3W7IA 1FXQA 1OZQA 2OG9A 4Z1BA 1TTIA 5A6BA 2PDIA 1VH7A 1BTMA 3ITOA 3EWYA 2JGYA 4Q6XA 1FWWA 4YPJA 2VCAA 3O05A 1RD6A 3EB2A 2V8ZA 4H8VA 4UTTC 3DBPA 3SRDA 1ECQA 3LD5A 3TYEA 3IUHA 4OQVA 2J66A 3HG4A 4Z2GA 4XZNX 3TTYA 1KBKA 4JFWA 3ITVA 1G4EA 2FZDA 3NOEA 1G0CA 4ZFCA 5GVJA 4C5ZA 3AU2A 3NDZA 5LKYA 1ZQ5A 2X0YA 3B9DA 4LAMA 4TVUA 4ALDA 3M43A 1XH1A 3P8JA 4R85A 2BP1A 2OQHA 5FF0A 4I7VA 3OBAA 1OCNA 2WNNA 4Z1AA 3I4EA 3TCSA 3W7QA 3GIQA 3BV7A 5KINA 1O68A 1EC8A 3OZOA 1KTCA 3W25A 2VXNA 2XINA 4KF1A 2OGYA 3BL3A 4MWAC 3W22A 1F4HA 3VDHA 2PP3A 1B0IA 4C6OA 3ID7A 4EPBC 1LWIA 4DBWA 5CG7A 1C91A 1R2RA 2CBVA 3OZMA 3MKKA 2ANUA 1E6QM 3VIIA 4MVAA 4I6VA 2XFFA 1NAL1 4AY7A 3I3DA 1X1NA 2C0HA 2V6AA 1XICA 2XG9A 4F2TA 2QW5A 4US5D 3TN5A 1EZWA 2QCGA 3ALGA 4IPPA 4D72A 3WENA 3TXZA 3SSZA 3EYPA 1R3SA 5C9UA 1UC5A 1JD7A 4YTSA 4RZ6A 4L65A 6ALDA 3VNKA 4B15A 4UWMA 4FF5A 1OQFA 1TZ7A 5HANA 4GXWA 4TU1A 2P53A 4JTJA 5LNVA 4N9EA 2R24A 1Z8AA 2BMBA 1RVGA 1DTNA 4ICNA 1R5YA 3WK2A 3L4YA 4K38A 3DG7A 4P5UA 3HPXA 1EO5A 2OCZA 2NX3A 4YVXA 5GJPA 3DKJA 4FS9A 5CPOA 8XIMA 1M01A 1RPXA 5K4XA 3A5VA 1YXCA 3T2PA 1N82A 3ZR5A 3CXOA 4PFMA 1MXGA 1LLWA 4US6A 1J4EA 2WM0A 4CN1A 4E3VA 3GS6A 2O56A 3WLQA 3VM7A 1KCZA 1X8FA 3TOPA 3TROA 3AXMA 4R9OA 4LANA 1XQLA 1E6PA 3VOJA 1MEHA 4FNSA 4CCCA 1XLJA 2J8TA 1E40A 2E6DA 1VYPX 3CEPA 3TIMA 1X1OA 1HUVA 1GZJA 4WSJA 2QMKA 1Z41A 1KV8A 1FXPA 3RLHA 2QEZA 3GZ3A 2ZZ6A 1S2CA 3C56A 1KXVA 3QPYA 4XB3A 4L4LA 4W9TA 1DJNA 2QJMA 1Q45A 4IG2A 2VYOA 2VM8A 1K3UA 1NU5A 4IG2B 3LXBA 1DJHA 4JBRA 4MNJA 5DBUA 1CXKA 3KM8A 2VFGA 2NSOA 3IIXA 1MO0A 2YCKX 3CUGA 3A13A 1XSIA 3TK7A 5JMUA 5A6JA 1V5XA 3W87A 2OO0A 4MPQA 3AMKA 1UR9A 3URBA 3HGRA 2GJXA 4WJXA 4J28A 2A3HA 4UCFA 2GJXB 3VKJA 3K8LA 1I8JA 4EXBA 3NPWA 5I02A 2R1KA 3QM3A 1W9DM 1LZOA 1Z32X 3NWRA 4H00A 5M03A 1SVDA 1Q6RA 2J9YA 3FVDA 5FF2A 1R9YA 1RK6A 1WDQA 3W07A 4L1WA 3S1VA 2VENA 1VR6A 4IP7A 2VOTA 4Y2WA 1XCXA 3Q45A 5CPLA 2YCJA 1UR0A 4UFHA 4OECA 1D3HA 4KPLA 3W88A 2QUNA 2PGEA 5C0QA 3QTGA 4JTLA 1HGWA 1XBVA 2MANA 3DOPA 2Y2WA 4KRUA 5FJPA 3LPPA 3BO9A 2CBJA 3DKLA 4QG9A 2Z7GA 2Q02A 2WVTA 3N6QA 5EU9A 1OFAA 4HNOA 4JTFA 1JCMP 2VCCA 3WNKA 3G6MA 3TQVA 5TNVA 3PZTA 3EX2A 3ARQA 4IIDA 3MVTA 3I6TA 4FMVA 4Z0JA 1WZAA 3CL7A 2HXTA 3NYZA 4JTCA 5ABGA 2EQDA 2J6XA 2Z1WA 3C3NA 1AQ0A 4MHBA 2V69A 3C0LA 3QN3A 3APGA 1VJZA 3EX3A 4ZXLA 1O66A 4DUOA 2A7NA 4H7CA 3A4AA 5D03A 2ZX8A 1YRRA 4PTMA 5AHLA 1IXQA 3RPMA 2Z26A 4ATDA 3C6CA 4X22A 1Q6FA 1L6YA 1TQXA 3RG6A 4GZEA 4QHRA 2PGRA 1GW9A 2V0TA 1BWVA 1FH8A 3LBOA 3W2JA 4W89A 2J25A 2ZUWA 3WLKX 3E49A 2GSEA 1PBGA 1H7WA 2O7SA 4H4IA 3FJ4A 1RP9A 2VRQA 3LTYA 4CUCA 4ENLA 3P74A 2VFDA 3WX7A 3FGCA 5I06A 1KFJA 2WMGA 2DJXA 3WIJA 1KLYA 4DUXA 2OT1A 1A0EA 2OWXA 4V2XA 4H6EA 5AC5A 2V5BA 2I14A 5EB8A 5CSSA 1YNYA 5J8LA 5C9XA 2OLHA 4Q4OA 1OFBA 3L0NA 5AC6A 1JZ3A 1J6OA 3W00A 5DXXA 1YNPA 2E3ZA 5DMNA 2CU0A 3R5EA 1Z69A 3TH6A 1ENUA 1BSIA 3F4NA 4W88A 3C0JA 5K2ZA 3BTNA 4ZSTA 3OVGA 4Z2HA 4WX2A 2IPWA 1ISWA 2WMJA 1B4EA 1EO7A 1OIMA 1PDYA 1W3HA 2J9ZA 3WLOA 4IMGA 4A8NA 3W7GA 1Q6QA 4LU0A 1CLVA 4G9PA 5D32A 2YJQA 1EXBA 3HU7A 4DNMA 3KRSA 4UOZA 1IR1A 1Q6CA 3VD4A 5XIMA 3KRZA 1HKJA 2F9RA 3IGSA 3RU6A 2Y7DA 1I2NA 1ALDA 2YA1A 4AC1X 3QKEA 1QI0A 2OX1A 1OFQA 3AC0A 4ZL1A 1SZNA 3L4ZA 3MI2A 4LC6A 4EX4A 4GG9A 2QCEA 4ZODA 4GNVA 1UOZA 1QPNA 3AJ7A 3VD9A 3WQWA 2V82A 4GUJA 2FPVA 5GNZA 4E8GA 1GK8A 5E1QA 4DJFA 4H8NA 4NAEA 5FJUA 3ZSSA 3LY0A 1LDCA 3W1UA 3TMQA 2PF0A 3R0UA 1TPUA 3BURA 5BNKA 2WMIA 3LX9A 1S5VA 4BA0A 2WC3A 5F2LA 1I0DA 2WMIB 2XGBA 5GNYA 1VFSA 3OLEA 1POKA 4H9XA 4N6EA 1DIKA 2F7FA 9XIMA 2YA2A 4O0QA 1K8XA 1AW1A 4RW3A 2DUZA 3TAKA 3S9IA 4O1AA 4WDTA 3KAOA 3WNOA 4C6CA 1LQ0A 3S6OA 2JBMA 1U5JA 2C7FA 1D3CA 3G5EA 3OB8A 1YW1A 3THUA 3UWWA 5D30A 3OA3A 1XIDA 3RCYA 3DC8A 3CHCA 1A5BA 3DFOA 1BEUA 3MS8A 1WE5A 4DO6A 1RAKA 1JPKA 2XGZA 1N8IA 2VGIA 3O2LA 3I3EA 3CWNA 3GTHA 3OEXA 5LNSA 3VC6A 2I5IA 3NQBA 1IT8A 4D8LA 2PS2A 4Z1CA 3BLDA 1Y65A 3MKVA 5ABFA 2BSLA 3F5LA 3W1AA 3UR8A 1US0A 3R11A 5ABFB 3NQGA 3NZPA 5AHFA 1M7JA 1H7NA 2NWRA 3W71A 3GU2A 4EP8C 3OG3A 2G3JA 2OYMA 1EF3A 1KBJA 1CXFA 1AG1O 3SGUA 5T8GA 4BF5A 1JPDX 1R8LA 2Y8VA 5DBTA 1Q7ZA 4X0VA 2NVCA 1GG1A 1HW6A 3UETA 3SURA 4PH6A 2X41A 4L4OA 5CJ5A 4EK7A 3TDFA 4TMCA 3B05A 4M5PA 2XGIA 1Q66A 5CPNA 4I7UA 2NV1A 4N2YA 5A6BD 3USZA 5AFDA 5G4WA 4F9DA 2R1LA 1RLCL 4MJZA 2ZZ5A 1QK0A 3KBWA 4J2PA 2D24A 3J7HA 4LBRA 1Q8AA 1K6WA 2RHGA 3AZSA 3TSDA 3MO7A 1P0BA 4BKNA 2VNCA 5F4WA 4M80A 4HMEA 3KBNA 3UCDA 4FALA 5HPOA 3NR0A 4P8UA 1XYFA 4UQEA 3GBDA 2FZBA 3M5XA 6XIMA 3AHVA 5DXYA 4E4UA 3E0IA 2WQPA 3AIUA 2E40A 1THFD 3TYBA 2OFJA 4O57A 4O1EA 2OZ0A 3W0KA 4ZTYA 2HWGA 2PFHA 3PZIA 3B8TA 4PMVA 3IUIA 3KXQA 1OCJA 3CMGA 4XD5A 2OYLA 3CLWA 4ORIA 2YL5A 4JTIA 1K4GA 3RXZA 5HMFA 4F2BA 3GIPA 2QCMA 3HF3A 3M5YA 4JYFA 3STEA 3SUVA 4QE5A 3NA8A 2HS8A 1EKOA 3DI0A 1HO4A 3HN3A 1ODUA 1TQJA 3WQ5A 3GM8A 5FAGA 1DQXA 3WUFA 4ICMA 2DEPA 2HBXA 4H7VA 4AD5A 1N7KA 1PX4A 3GW3A 3VIKA 2CW6A 1N2VA 1H4PA 3TR2A 2VEMA 3RPTA 3IAPA 5C54A 2VZUA 2CXGA 1RXOB 5KZEA 3WUGA 4IL2A 4Q8UA 2UZ9A 2JALA 2ZZ4A 1A3HA 3H4XA 3L4UA 4U3AA 3VNZA 2RDXA 3F2DA 2EG8A 3ERPA 4U4MA 3MMWA 2ZXDA 2YCEA 2BX7A 1J6PA 4KQNA 1Q4WA 4WOZA 4AUBA 1H50A 3S1UA 2NXIA 2OEMA 5FCZA 2D2JA 1OFEA 5FSEC 5AHMA 3FXYA 3GB6A 1YDNA 2X16A 3PJWA 1XC6A 4KIRA 2BODX 2R1NA 3WG6A 2V30A 4MOZA 1XSKA 4QP0A 1ZAIA 2ZRWA 3KOZA 5JIPA 1M7OA 1XG3A 1HP5A 4HTBA 3R12A 2XUCA 4K2SA 3HJEA 4L6DA 4NAFA 4BQ3A 4NAFB 1OC5A 3U2ZA 4C6IA 4ADSA 1A50A 2C1GA 1D7FA 3K5XA 3DUGA 1V93A 4P7RA 4NRRA 5EMKA 1FVPA 4ZSUA 1L6GA 4S2BA 4XZWA 1TUFA 3FHAA 2W61A 4EWND 3D47A 1H1ZA 3UZZA 1A80A 4LUIA 1ZAHA 4AZGA 4M51A 3CB8A 1HQTA 3SN1A 4PZVA 4C6EA 4BK9A 4ZE5A 1AUSL 4RJEA 3THDA 5EKYA 4EAYA 3VD3A 3NSMA 3V0SA 1EHAA 1F2JA 3HA1A 4GQBA 3OZYA 1QWGA 3W7MA 1VF8A 1Q3NA 3B9NA 1JDFA 1K9EA 2RKXA 3UQNA 3KWXA 3I4KA 1KM3A 1AMKA 4UTMA 3UJSA 5F1VA 2F2KA 3WDJA 5CZSA 4CQDA 1R85A 2HISA 1K7XA 1G67A 1VBUA 5U7SA 1D8WA 5I07A 4MFEA 1KFCA 3WD4A 2YA0A 4KWSA 1WOBA 3FLUA 4HHHA 1GHSA 2P3ZA 2OSXA 3VE7A 1BYDA 2GQAA 1UKPA 3MKCA 3TX9A 4NZFA 3V5FA 1S2UA 4D6CA 3ZSTA 3PZGA 4IIHA 3WLIA 3RCNA 5M1TA 4NF7A 4RX0A 2GQ3A 4LRTA 2X40A 3ZQ9A 3CPGA 1VFUA 3EOUA 1YDOA 5LA1A 2XZ9A 2ACRA 5G2WA 4J4KA 1ZBVA 2OB3A 1LT7A 4PGLA 3VKAA 1V77A 1TWWA 3DHDA 3NZQA 1ECEA 1UZDA 2I7GA 2ZUNA 4R33A 3AXKA 2IXVA 5CQ1A 4XSLA 4ZGYA 4UNKA 1V02A 3L9CA 5G1MA 3Q58A 3QPEA 2NVDA 2YCLA 1NM9A 4GQQA 3RJXA 1PZ3A 3PS7A 4OBSA 3QXBA 2WVSA 4XD3A 1R3TA 5FACA 1W5OA 4IIBA 4ZB2A 1BSLA 1XYCA 1OD0A 4Q8OA 3VOGA 1FWCC 4K7YA 7ENLA 2X2YA 4MG4A 3GC4A 2WKLA 3B0VC 1MW0A 4IXXA 2PRLA 4OVXA 2NQLA 3PY2A 3ARWA 2DQXA 4PBGA 5FJOA 2ATMA 5I79A 4MB5A 4TVDA 4KERA 3P84A 5FEZA 4JCLA 1QVBA 1YKWA 4ADTA 3AMDA 3NQ7A 1NH6A 4PCSA 4ZA0A 3W1NA 1XFCA 4LVFA 1NFBA 1P1XA 1F8MA 3UR5A 3LSCA 2Y61A 3JZUA 2HBVA 3H21A 2R1PA 2YXOA 3CT7A 3O9NA 4HNVA 1XYZA 2P8BA 1R2TA 3IJ9A 3M07A 3ARVA 3LDVA 3ELFA 1RHCA 1S3TC 5D38A 1QNPA 1SJCA 5LSMA 3N19B 2V3FA 4S23A 3LCLA 2CZVA 4LOCA 1G4PA 4JTQA 4YWIA 1W1IE 2YDRA 3L65A 3IGXA 4DNHA 5HATA 1AL7A 4L9XA 3EMQA 4Y9MA 2VMFA 3ANYA 1NQ6A 3ABZA 4YNGA 2BB0A 3KLLA 4MWAA 1TMLA 2ZZ7A 3WQVA 4DPQA 2VC5A 4NQ1A 2ZRXA 4JTSA 3VYLA 2Z1SA 4QAIA 1TFVA 1MFVA 1LBMA 1PO9A 1E0UA 1W56A 4D6IA 4D8AA 1I2QA 2DV0A 2H90A 3WN6A 4I6KA 3U7VA 2YB4A 3L68A 5KZ6A 1XD1A 3WQCA 1OYCA 5I3HA 4MUZA 4RLIA 1FDZA 2Z27A 2GQ9A 2W9MA 4PL2A 4FI4A 1CGXA 4JTTA 3RLVA 2PCQA 3UWUA 1VPYA 3G0UA 3NTYA 4HA1A 1CT5A 1OX5A 3W83A 3DFYA 4DJFD 1PJ9A 3GDRA 1E3ZA 2PODA 4UQCA 3GG7A 1EQCA 1HT6A 5F1UA 3GBEA 1ML1A 5HJLA 3DHUA 4NI8A 4E6MA 5E6ZA 1XLHA 4IJRA 1GOKA 4M81A 3SY8A 3PJXA 3W7RA 4RNFA 1QRQA 4N42A 5T26A 2VEGA 1UH2A 4DI8A 4WQ6A 1UH3A 4MDOA 2HVNA 4NKCA 1OHLA 3BLIA 2ZZ3A 1XLAA 3TONA 5L6UA 4QXIA 3RCMA 4GXPA 3NXLA 1W9UA 2Z6JA 3GQYA 3GYCA 3BLLA 2GJPA 1DJQA 2VX5A 1K7EA 1UP2A 4R7WA 1FCQA 2VO5A 5HWNA 4QFUA 1QTWA 4HSOA 4QROA 4DUVA 4UZUA 4HSNA 2W27A 3M4HA 2XVKA 1HIZA 4NNAA 4WXZA 4M3PA 1LF1A 4HHPA 5E93A 1VP5A 3NDOA 4NJIA 5HMSA 2HXUA 1HL8A 4ZVJA 4JX6A 3NM3A 3BZGA 5FEPA 5I3IA 3QY7A 1FY6A 2X30A 1DQWA 1Y5WA 3LOTA 3AISA 5BCAA 3IK4A 3M0KA 4FNUA 4H1ZA 2XIOA 4TQTA 1X6NA 5DN1A 3WEMA 5C6MA 3PZUA 3C52A 5CPMA 1AMYA 3HM7A 4W85A 3MMUA 3R25A 3UVIA 1WDDA 1PCWA 4DI9A 2WANA 4XTDA 4FR6A 1YIXA 2QNEA 1K70A 1JZ5A 2NUYA 1EIXA 3BLEA 3H2OA 1XLEA 2PCEA 4KRTA 4GWEA 4JFTA 5A1AA 4YL2A 4MNMA 1CB7B 2PDLA 2PB1A 1VRXA 2VWTA 2C3ZA 1QW7A 5A2CA 1S5MA 4WOQA 5DFAA 3YPIA 3WD2A 4FNQA 3LZ5A 3V1PA 2E1WA 4LBUA 4P7OA 1GJPA 3IVTA 3R1ZA 4PRTA 1TCDA 1X96A 2A0NA 3GNPA 3CAWA 1V3IA 5I23A 2E5DA 1RP8A 1US3A 4WCJA 1P6BA 3VMOA 4JAWA 2FB2A 3T1GA 4QG6A 4YCPA 1FWAC 5XIAA 5A6TC 3LLDA 3UYCA 5HQLA 1SPQA 1K9TA 4Q22A 3EWBX 3KE0A 1UPPA 4C1NA 1ICQA 1WNOA 3LEPA 2I16A 3DYMA 4C1NB 3N2MA 1X7FA 4JIQA 3E3HA 2ABAA 3GXNA 3BW2A 2UWFA 3QHOA 1OINA 3DFNA 4PB5A 3CYJA 3SFWA 4FX6M 3GD6A 1H61A 3W6YA 2CEQA 5D9OA 1HJSA 4A8RA 2IKIA 4XZ9A 2WO5A 3UXKA 3W1QA 3CK5A 1Q6DA 1JYWA 3OLIA 3GXDA 1TPFA 3TC7A 3TAOA 3TNBA 3MA8A 5C9ZA 3AIQA 1CPUA 2B7OA 2DSUA 1DJZA 2DQWA 3UGRA 3WK0A 5C71A 3QQ0A 3IIOA 5E0KA 2NQHA 1ZALA 4FLQA 4DVOA 1WO2A 1TV4A 2GK1A 1AW5A 3APTA 2GK1B 3B04A 3QW3A 3IJ6A 2J47A 4ICCX 4JTGA 3VCRA 2WZTA 4PMXA 2ZA1A 1XCFA 4XWUA 3P60A 1DJGA 1J0HA 1ZJHA 4DWSC 4XKMA 2ZA2A 4EPEC 3M0JA 1TELA 1R3RA 4IL0A 3QTPA 2VL4A 3URQA 4G6CA 3QZ6A 2X1TA 2I5QA 3KVKA 2DY3A 3L2LA 5FAJA 3VVGA 2QGYA 2CZEA 4GKLA 6PTDA 3VM5A 1UD5A 3GKAA 3U2OA 1JZ4A 1JCLA 1U30A 4JIHA 4AF0A 3HB9A 4AZCA 5C9WA 3D6NA 3UYIA 4AF0B 1GWJA 2BY3A 4AZCB 1UMLA 1JGIA 1T5AA 3MW7A 2TODA 8CGTA 1IEVA 2E67A 4ZE4A 1UIPA 3S1WA 4XX6A 3OU8A 4P61A 1G1YA 3MUCA 3QQ1A 3EDJA 3P8IA 4GC4A 5FESA 3VNLA 4TUFA 1IEIA 1UD8A 1XINA 1ADDA 3CQKA 1SFSA 3I7SA 5CGMA 1EEPA 3LERA 4WSHA 1R3VA 3FDKA 2J6VA 1VGAA 1VZWA 4PE8A 1GG0A 1GOXA 2CYGA 2P0OA 2DIJA 5D33A 4FAMA 1OVDA 2HRWA 5D9MA 1VFFA 1UR3M 1YMYA 3L66A 2YIHA 2DW6A 2VGBA 1QU4A 1W1YA 4KCUA 3SCRA 4DBSA 1AH3A 3AJXA 4MY8A 4XKYB 2VX7A 1X39A 2WSQA 1ME9A 3A4XA 2BBFA 3MJYA 1PPIA 2X1RA 1R3QA 2OZTA 2F61A 1CZ1A 1DVJA 1L6WA 5I09A 2EAWA 1VHCA 1GQLA 3GFZA 4CVUA 3HQPA 4K8HA 2Y70A 9XIAA 4P7LA 3CIXA 4NZJA 2R14A 3O15A 5I00A 3POCA 4GUGA 3Q94A 4M56A 1QI4A 4UTHA 3T2QA 1XI3A 5MF5A 3A3WA 4XZIA 4YJ5A 3WBYA 1ZB5A 1Z89A 6TAAA 1QPKA 1NDYA 2CBUA 4HCHA 3HQ1A 5ECVA 3E2RA 3AQUA 2CHNA 5TIMA 5A3HA 2YZRA 1DYSA 4DWDA 4KS0A 1YADA 3I6RA 4REQA 1KGXA 3UY8A 4M0XA 3BJFA 1A5SA 3KX6A 1T41A 4REQB 3L5LA 1S1RA 2FJUB 4X9SA 4YTRA 4O8AA 3KLKA 4GACA 4JY9A 5JBDA 4KIEA 3UA4A 4CU6A 4LNCA 4BQ4A 2PE4A 1RJQA 5FA5A 1NP0A 1UP0A 4TXEA 1AD1A 3W1TA 5CJNA 1WKDA 4M6PA 3AI0A 2D0FA 3E0VA 4N9DA 2WNWA 1P43A 2HVOA 3O63A 1E1CA 1TPVA 2Y24A 1E1CB 1F73A 4JS3A 3C8NA 3E74A 3L0GA 2ACUA 3UWEA 2DFAA 4LQ1A 5CC7A 1KQZA 2W0UA 1QNSA 3HURA 1FWDC 3VD5A 1UW9A 3MZ2A 3GR8A 4MLJA 3A22A 4GVHA 2XFWA 1F6YA 1U5VA 1TVNA 1VCVA 1DIDA 3DEQA 1YDYA 3GK0A 1EA9C 2XIIA 2O0TA 1BFNA 3WH6A 4JEJA 4V33A 1V3MA 3IRSA 3NNTA 3WQFA 1W6TA 3DHFA 1OZMA 4BI7A 3CV7A 2DT1A 2YDQA 2OGJA 2YR1A 4UTLA 4OHQA 3F5JA 3PUDA 3P5YA 3GTXA 1XH2A 1SSGA 2FVLA 4Q8VA 3EWWA 4HQVA 2IMRA 2XJ7A 4GQGA 2CLOA 4JKKA 1WDPA 1JGMA 2CHRA 3AMGA 3L4TA 5JBFA 3W29A 3KBSA 3WJYA 3UZWA 4H83A 2VJXA 3NQMA 3ZR4A 1DXFA 1JYXA 1FH7A 4PR4A 1E1EA 4E2OA 3UW6A 4YU1A 4L61A 1JL8A 4BF9A 4UTUA 1QNVA 1E0TA 3R0KA 1EWDA 3PZQA 4GYPC 5M3WA 1W3KA 1VBGA 1IWPA 1W1PA 2O9TA 4HNLA 4NVTA 2YPIA 1ME8A 5A8MA 5BMXA 2W91A 4DX3A 4JHZA 2X09A 2HE8A 2DU2A 1OFPA 3M47A 1KFLA 3PVFA 1PS9A 1OYAA 4A05A 1WBHA 3CZ8A 1R46A 4DIAA 1VFLA 4GGHA 2ZUMA 1VYRA 2YYUA 3L4XA 2JIEA 2PMQA 3IV8A 4JR5A 1SGJA 5JH1A 1WAWA 4Y96A 1TYGA 2Y88A 3CC1A 1EUAA 3BV4A 4CD4A 4QLKA 2GQ8A 2NUXA 2FQIA 4NYYA 1F3XA 4YYFA 1VFOA 2AAAA 2OZ3A 1QAPA 4XVEA 2HEJA 1HTIA 1X7IA 4GD0A 4W7UA 5E6YA 2EPHA 3W1LA 3FYPA 5EY5A 1QI3A 1MW2A 4I9TA 3S1GA 3LSBA 2F6XA 4AIEA 4H7ZA 2XWEA 3N73A 4HIBA 4LW7A 4MF4A 5DCEA 2I17A 4HA3A 5A2AA 3E6EA 1MVYA 4FXJA 3LCWA 4B92A 2GLKA 2ZBTA 2V3GA 4AXKA 4FX8A 1NF7A 4K1WA 1SYTA 1R38A 2XN0A 1XRVA 1V6VA 1AD4A 2VX6A 1HL9A 3NO1A 3N13A 1P48A 4AU0A 1XLMA 1WDSA 2C13A 1LOSA 1M03A 5FF7A 1JG9A 4HHLA 1B30A 2CLIA 2QJGA 2XDFA 3L23A 5D4YA 4R53A 4ZR8A 1AQHA 2ZXAA 4LSBA 2CZDA 5EBUA 1V79A 3BH4A 4M6UA 4Q33A 2V2HA 5AOUA 3PZNA 4HPXA 1IEXA 4PMYA 2WCAA 1PUDA 3PANA 3QY6A 4Q6JA 3RX3A 1NIUA 4QISA 3MSRA 4ERIA 1EPVA 4YXGA 1AJ0A 1WYIA 4JYDA 4BEQA 4S3GA 1V3KA 7TAAA 3KTCA 3QOKA 4A8IA 3U3HA 4TX6A 3DC0A 3WFAA 1XDJA 3QRHA 3A24A 4MADA 4LPCA 2QJHA 1DORA 3OVRA 4F0SA 1UR2A 1KBIA 1UZ4A 1PZ2A 3S8HA 4AZIA 3P7YA 2PDNA 1HJQA 3FFSA 1NDVA 4MJ4A 4AZ5A 2QS8A 1KGWA 5GJMA 3RK8A 3GO2A 1JUBA 3O6YX 2I56A 3VD7A 1F8IA 3NO5A 1ZPTA 5HMEA 3KHDA 2V67A 4DJEC 1GEQA 1X98A 1BXNA 2CLMA 1OT1A 1EHNA 3MMDA 1PX3A 1X8CA 3WH7A 3K4WA 4YTUA 1UD3A 4RPPA 4A22A 1TMQA 1IZCA 3HOJA 1TJ1A 4Z2LA 1W31A 2AL2B 3PUOA 1O4UA 1TRIA 3D3FA 1P6WA 3ME3A 3CZLA 2J8FA 3E38A 2CLPA 1KCXA 1MW1A 5JXQA 4NZ3A 2GVJA 2QIWA 2ISDA 3PFRA 2FLIA 2J24A 3E5BA 4JNYA 2DVUA 1ISVA 3GDLA 4QS5A 1XDMA 1LLZA 3PPCA 1ZY9A 1PIFA 3G1XA 5BOOA 1C92A 2FIQA 1EGVA 2DDXA 4TIMA 4L1GA 1WZLA 1UUQA 1D3GA 3W86A 1Q5MA 1HJUA 2WZMA 1J01A 3BMWA 1EJXC 1KBLA 4ILSA 3HV8A 3B4YA 2JGQA 1V3JA 3CTTA 4RV8A 3T4WA 2O4QA 1VENA 3IK2A 2PDUA 3ZS4A 1A47A 3DFTA 4A2SA 1H7PA 3QPZA 4IZGA 4MYXA 2INEA 3W23A 4C6DA 1TCMA 4LALA 1MRQA 2PRHA 1AA1B 3W28A 1UD2A 1VEMA 3SUWA 4GUHA 3RN6A 5C2CA 4OIFA 3KVMA 4IHCA 1XF0A 1S2VA 4B5UA 2WBGA 1J9YA 1XLFA 4HZ7A 4KFNA 1KLZA 3LPOA 2QMJA 2J75A 3O6DA 1JDEA 4MZ8A 1O12A 1PHQA 2DPEA 2FTPA 4W7WA 3PJTA 3STPA 1EIBA 4LCSA 4C6LA 4HP5A 3NQ2A 4NI3A 3NZ1A 4GK8A 3W37A 2QIIA 2FYMA 4WUIA 2HNHA 1CGTA 4XO7A 3JS3A 1QI2A 1EH9A 4PRRA 3ARXA 3BC9A 4ZOEA 1SSDA 3VI2A 3W27A 5EL1A 2YYTA 1UWIA 3W1MA 5BU6A 1QATA 4A3QA 4UR9A 2OSYA 5BXSA 1E5NA 5D2YA 5JUVA 1EQPA 4PUEA 5IDZA 4IQEA 1KWKA 1XIJA 2WLZA 2G41A 3ABQA 2QUMA 3UR2A 5K3VA 1TV7A 1FWBC 3HIJA 5ABTA 3BQ6A 3SJNA 2GGIA 5K4ZA 3LCGA 1TZZA 2W3ZA 4W5ZA 4O10A 4F0LA 2PGWA 1U1UA 4A35A 5ABHA 4EIVA 1UCWA 4DQWA 1UH4A 3GVGA 3UFYA 1UR4A 3FJLA 5AHNA 3N4EA 1S3HA 3EB3A 1NARA 3AMLA 1OYBA 1M1BA 2OQLA 3GNNA 4GH1A 1XPGA 1A5OC 4MMWA 1IXOA 1FWTA 1K8CA 1MXSA 2IQDA 4ZQRA 1OJXA 4I90A 3BLPX 1OIFA 3ALFA 5FJJA 4X63A 3SCOA 3SADA 4IQLA 2Z2BA 3AYTA 1OG0A 3GH7A 3QMTA 4E4PA 4U28A 5BU9A 2F8QA 3AXIA 1QW8A 3PJUA 3PB0A 3WK3A 1Q13A 3SO7A 1E3XA 3C8FA 3CHEA 2PTDA 2VFIA 3RAOA 4IGNA 2D0HA 1TTQA 3R43A 3LA4A 1XHGA 4GNKB 1BLIA 1NOWA 1DWIM 4S2CA 4FHAA 3VNYA 1A5UA 2AMGA 5AZ1A 1QJWA 5A8NA 2B7QA 1ICPA 3P5ZA 3URNA 3UZXA 3DFPA 3N9KA 1F5ZA 4ZO9A 1TWIA 3CJPA 2E4TA 2BHUA 1KW1A 1NOUA 2PZNA 3AIEA 4A3HA 1B4KA 1CNVA 2GOUA 3MHGA 3UG5A 2DGAA 4S3JA 3ZT6A 5DMLA 3EA2A 1C8VA 2W62A 4JNMA 2PP1A 3K8KA 3VDAA 1WCGA 2KAUC 7TIMA 4UMCA 1GVEA 4MTVA 3S2JA 1TPH1 3HGJA 1JI2A 4I5RA 3U7BA 1AZ2A 4CN6A 3PTQA 2V2CA 1PVNA 2EO7A 2XIMA 2WQDA 1LRQA 3UXDA 5HMDA 1XSJA 2OU4A 1W3LA 3H54A 3NURA 1K8ZA 2BS9A 4A3UA 3GG0A 3KDOA 4O53A 4FIRA 5EGRA 5SWUA 2QDGA 3UWZA 5HJYA 4PTVA 2PTYA 4GVGA 3PB2A 2C15A 2J7CA 3M6DA 5J5RA 1EYEA 1OX4A 5CJMA 1W3IA 3OHMB 3DZ1A 4NY2A 3SQLA 1OX4B 3AWNA 4AZHA 1KCKA 3CL8A 1UPMB 1O94A 1K6AA 3MUY1 4PTXA 5BOEA 3VNMA 4HU8A 5LIXX 1Q7QA 1HX0A 2NWSA 4XUYA 4IPIA 3W2NA 3B9OA 3LBCA 5LNRA 2YFOA 3IJQA 1ZJIA 3GC5A 4IPJA 2AMXA 4GIYA 2BV9A 3R8HA 1HGYA 4OOZA 1GTHA 2OO6A 2XIJA 3VNJA 2PBGA 3EXTA 3A21A 1ZP4A 4Y9PA 3BAKA 3QOMA 1EUNA 1O1HA 1BRLB 4JFVA 1BAGA 1OF8A 3KP0A 4BFAA 4TV5A 3ZO9A 4OV4A 1VFMA 4WSKA 3Q4DA 4E38A 5BZAA 2D73A 3W7LA 3FKRA 4AWEA 3LN3A 4CQAA 4LF1A 3RHGA 3H26A 3NDYA 3O3RA 3KL5A 3RX2A 2FGZA 3G1YA 1E71M 4OWGA 4GMEA 3SY1A 4S3DA 4G7FA 1XIEA 1GVOA 3NJ3A 1US2A 8XIAA 1EL3A 4C6BA 4DUWA 1RBAA 4FB7A 3H7UA 1A4MA 2CFFA 3SI9A 3GSMA 3CV1A 1Y7VA 3RJYA 1U1HA 4M82A 1P7TA 3SQSA 1P7TB 1E6SM 4XSMA 3FEQA 4DXVA 3W7HA 3SSJA 1EJUC 1UZ1A 1XIHA 1B5TA 1SZFA 1LQAA 8A3HA 5G4HC 1TRDA 4LWWA 4C6JA 3TZNA 3GH4A 1C90A 3TFXA 4O15A 1KTBA 3LMZA 4MLRA 3L67A 4U33A 2IXUA 1BTCA 4B5XA 3PNZA 3RM9A 4HZ8A 2Z1XA 4PFHA 4OFCA 4O1FA 1GVQA 4GO9A 1JUEA 4JQ3A 3AFBA 2OSWA 1TG7A 3S9YA 3LRMA 3VINA 4R88A 5CLTA 2YGYA 3VKKA 2IW0A 4FNPA 2Z1BA 3UCCA 4CNUA 1ADOA 1DKWA 3F1QA 1IWBA 2B7NA 4H9UA 1J12A 4OU1A 3B4UA 3SCWA 5BXTA 4GYKA 2ZX6A 3WEZA 3W73A 2H8XA 1F3WA 4RV3A 4LS0A 1DWGM 2QJIA 3M0YA 3NOYA 4PCTA 1A5MC 4W8AA 1XLLA 2FPTA 2E25A 3PUEA 3R58A 4L6HA 4AD3A 4HU0A 3GG1A 3KUMA 4LCRA 1SUXA 2XISA 1BVZA 1MNZA 3CPRA 2V63A 3G0XA 5G5IA 3RMJA 3V18A 4W8BA 2MNRA 4B3KA 1DBTA 2OX4A 2VCBA 4CQ8A 3GUWA 1BYCA 4EE9A 3KDNA 4GX8A 2ABBA 3FS2A 4UTWC 2PI6A 5HWMA 4GY7A 3MHUA 1OK6A 3AXHA 4AMCA 4QLLA 1QOQA 3T9PA 5M17A 1RQEA 4Q4SA 3TSMA 4CCDA 3OG2A 1K9DA 3VIHA 1PKLA 5ABEA 4HA0A 4IMDA 1DXIA 5B7ZA 3ZM8A 1B3VA 4NX0A 2BY1A 4JL1A 2WPGA 1XKJA 5I3FA 1VJSA 4H6KA 2HK1A 3SR7A 4O19A 1ZL1A 3SCUA 3VGDA 2E9BA 3REQA 1XIIA 3REQB 2G50A 1JJKA 3FA4A 4IMFA 4LAZA 4UTFA 1W5NA 1MQRA 4ZOCA 4Q32A 4LY4A 3O8AA 1RA0A 1BHGA 1G4TA 2OKOA 1OBAA 1AH0A 4HPGA 1TV8A 1MI3A 5A6LA 4EXAA 3CM4A 2IQTA 5H8PA 2X0HA 3RO6A 2VEPA 2QCCA 5IBXC 3B9AA 3H2FA 4Q7IA 3PFMA 3W02A 1O5XA 4DLFA 4GJIA 4YHGA 2X7WA 2QGHA 2V5KA 2NT1A 3GH5A 4K7VA 3DH7A 4DZAA 4E4FA 5BXPA 2E6YA 3EDEA 3O16A 2FTYA 4H8HA 1BVNP 3LHVA 2P3EA 3STCA 4LVBA 2BGNE 4LUSB 3CIWA 1R0MA 2XM2A 5IDIA 4AG0A 3V0UA 1GVSA 3ZT7A 3HGOA 3RR4A 3PUGA 3W53A 1E5JA 3H22A 2PD9A 1WUFA 3WF2A 5BWAA 5G1TA 2NX1A 4TTGA 3UY7A 1FTXA 1OGSA 3KOFA 3EEGA 1EPXA 2PLMA 4MNKA 3SUUA 5C9RA 2C1HA 3CU2A 3JVAA 3MP4A 5H8UA 3MBFA 2VOMA 3NFUA 4ZO8A 4GYPA 3A9IA 3NQVA 2EPNA 1XQKA 2ZDSA 4PCFA 2CIPA 3BG3A 1AJ2A 4RXGA 3AIBA 3GZAA 1PKNA 4IFRA 2H9AA 4OTKA 4Z2KA 3SIZA 5F2IA 1UWTA 2H9AB 1ONXA 1CGUA 4I8YA 4DBDA 3M0XA 3TA6A 2NQ9A 4J3WA 4CQBA 2HK0A 4FNRA 3DIPA 4CGTA 3U2EA 4URIA 4G1KA 5TBOA 5T91A 3OGRA 3N4AA 4UMBA 4KT2A 1FRBA 4R3UA 1REQB 5DRCA 3RUBL 1UR1A 4ZO7A 3QMRA 3G8EA 1DE5A 3NCOA 3M0HA 1E9LA 1J96A 3HBLA 4O16A 3DX5A 3G8RA 2Y0FA 3EWCA 2Q8XA 1UWQA 4MGGA 3QC3A 2P50A 2AQVA 4GY1A 3VO0A 4K1GA 2ZZ2A 3H2EA 3QV9A 2PWEA 3KCLA 1IYXA 1ZTVA 3KBMA 2Z29A 1XS2A 2A7PA 3POHA 3LI0A 2HJPA 4WY0A 5EA9A 3NQFA 1VCGA 2CESA 5CXPA 5HAOA 4KCWA 2E8ZA 4X3ZA 3M7WA 4UC5A 1V8EA 1S5TA 3WNMA 3WCZA 1RQHA 1YBQA 1K03A 1TVPA 4GFSA 5FJTA 2ZUSA 1YBQB 1IIHA 1TPC1 1A5NC 4HD5A 3DBNA 1QBBA 3UPWA 3SCTA 2C0AA 1GKQA 2AOSA 1UC4A 4FIQA 2B0MA 4RXFA 1CWYA 1V0KA 1Z3NA 1EZ2A 4MPKA 1D2KA 4D2JA 2FH8A 2JF6A 2DZSA 2ZUVA 4Z2JA 5IRPA 1TTJA 2NV2A 3PWAA 1W9PA 3OYZA 4IMEA 5T9BG 1W2PA 1VLWA 4JHOA 2W92A 3FA3A 3LYEA 1E43A 3W1XA 1TJRA 1WDRA 4PTWA 2BGSA 2I9EA 2V5DA 3T6CA 3CUIA 3LZ3A 1IT0A 3C2FA 4PRWA 2WM1A 1JIBA 1O5QA 4U10A 1XBYA 2DZVA 2I5GA 3WDQA 2ZUTA 1FP9A 4FO4A 2OQYA 2J78A 5A6AA 1GPWA 2ISVA 3E0LA 5D9NA 1OT2A 4X0NA 3UJRA 1NP2A 4B5VA 2V5CA 4PEKA 2XFRA 3UU0A 5AB3A 1E9YB 4GI9A 4J3SA 1RBLA 2EPLX 3N2OA 2XZ7A 4S38A 2PF8A 3PSWA 4D6GA 3QH2A 3APYA 2BVWA 2Z2UA 3LU2A 3LM7A 4NRSA 1W8SA 1WZKA 5BROA 1HJWA 3DG6A 1XDLA 1KRCC 4RUBA 4IMCA 2PD5A 1Z7AA 4DJEA 1T8XA 1OFOA 1LLOA 3TFCA 4TO8A 4B5TA 5C55A 2J13A 2ZDRA 4D1IA 4B16A 3NGFA 3JU2A 4B9YA 3KRUA 1XLGA 3CQJA 5FEXA 5A6MA 3F4WA 3G3MA 2RAGA 4I7WA 4LS1A 4PUWA 2J7HA 5A5WA 1TWSA 1C8XA 1DHPA 2VDGA 4MY9A 3AAMA 3MTWA 3SCSA 3PF3A 1JAKA 4QJ4B 3FN9A 3EPNA 1UA7A 5AC8A 3WF0A 1LTDA 2Z7KA 2ZX7A 1HJVA 4RE2A 3FXGA 1KC7A 3R10A 3W3OA 3HFYA 3SGZA 4NIRA 3BARA 1HVXA 3TA9A 1EJRC 1VIWA 4TX8A 5D9PA 2RJGA 2VQUA 4LVDA 1CLXA 4XAFA 1J0KA 2VFEA 1PKYA 5HUOA 1F61A 5GNXA 4QE4A 4FX7A 4JTRA 4GI4A 2VGGA 4RR4A 3CPUA 1UHVA 3WK1A 4M7TA 4D6DA 3EWDA 3ANVA 2CZFA 1MEIA 1TE6A 2Q71A 2X1UA 5U4NA 1C29A 3SN0A 4BJHA 3G1RA 3BICA 4GHRA 1W9BM 1UP3A 5CG0A 2JE8A 4OUEA 5TF0A 4PMOA 4GZJA 4B4HA 4GY0A 2WJDA 1RQBA 4XD4A 1V02E 3FIGA 5IHSA 4D71A 4LFYA 1O5RA 2WKJA 1ZBCA 5AYXA 1TREA 3ZJ8A 2RDUA 2EPKX 3MJMA 3T0DA 1Z44A 3EXRA 2NX9A 3JR2A 3B8VA 2R6OA 3F5KA 3PN8A 3LENA 2JK2A 5I2UA 4CKQA 2WKGA 5ECUA 4GUFA 3TJXA 4NJHA 5CBJA 1GOMA 4W8LA 4PB3A 4B5WA 4GA8A 1SJDA 5KTLA 2LLEA 3UJ2A 3QLLA 5E0FA 3F4CA 3HFTA 3OA5A 1JF5A 4KW2A 5HBFA 3DU0A 5AC7A 5MHBA 2VRKA 1XM3A 1ZCCA 3OQEA 1CIUA 4GKTA 3VE9A 1RK5A 5BYWA 1LM1A 2WMHA 5BRQA 3ES8A 5BRPA 1EJTC 3QV7A 3G0SA 1A49A 4OBTA 2G3FA 1LBFA 2AQOA 3S5NA 1CI1A 1C9WA 3EA1A 3IIVA 3CT2A 1AFSA 2QF8A 1MNSA 2GVLA 3VAVA 3FCPA 1LWHA 4V15A 3ZLGA 5AC4A 1J11A 4G2DA 3CZJA 3JRKA 4EPDC 1UA3A 1NWSA 2RJHA 2QVNA 3PZOA 1KKOA 2D22A 3UESA 4MSSA 1T96A 4CEXC 2XHYA 4LY8A 1CXHA 2GYIA 3RMEA 3E0WA 3SN4A 3H70A 3VUPA 1J2BA 1WAUA 1FWJC 2Y85A 2HROA 2OEJA 2WNZA 4O54A 4MWAE 3LCFA 1RCXB 4DZHA 1DQUA 3QFWA 4MYAA 3R2GA 1ZP3A 4DM1A 1SFTA 3STFA 1EC7A 1H7RA 4WDWA 4NZ1A 4K6AA 2AL1A 2XIBA 4FR1A 4LAOA 1KNWA 4RDWA 3NGJA 2ADAA 3G1SA 1F05A 1RH9A 4N4PA 1MUCA 3OZPA 8RUCA 4NU7A 1JCTA 2A3BA 4LF2A 2CLLA 1MUWA 1E0VA 3ZWTA 1DWFM 3ZYZA 3AHTA 1GKRA 4IUOA 3UF9A 3GDTA 2V3EA 3ATYA 2PSNA 2CLHA 2HNEA 1XJBA 3N3TA 3G1HA 4WDXA 4F0RA 3BPWA 2RFGA 7CGTA 3BOFA 3IJ8A 2WVVA 5CZJA 3TQPA 4CVWA 3VDCA 2PDHA 2WVVB 2PLCA 2ZA3A 3GHTA 3I7QA 4C6FA 4DYJA 3ZJKA 4S3CA 5A6KA 4PUJA 5D02A 1QXLA 1GYNA 1BPLB 2WBKA 4GO8A 4N02A 4R9XA 4PBEA 3GTFA 1IIGA 3FGCB 3UVAA 4DXXA 1R86A 2OWWA 4XBKA 4JDBA 4JIPA 4O11A 3UG4A 3NSNA 4IOTA 4HJFA 1PWMA 3ATZA 2CCRA 4BY3A 3AIVA 4ZQPA 4J5NA 1AODA 3T08A 1R7AA 1HKMA 2YLAA 4QSHA 4DJDA 3AZTA 5G2IA 2ACQA 1AJZA 1A5CA 4GYJA 2H6RA 1TWZA 1F76A 3ABSA 2P5NA 4U2ZA 4BZYA 3SCPA 1Q6EA 2Y7EA 3CQIA 5JIWA 2O7QA 1PL9A 3NPUA 5EFFA 1CYGA 5FKYA 4JTUA 1EX5A 5H6HA 2H8ZA 3KS5A 4QS6A 3PWGA 2RDWA 3EWUA 1GPFA 4RE4A 3OW1A 3QR1A 2BVYA 3B9EA 1C3FA 2IQ0A 2QAPA 4DZ5A 4Y9NA 5F4SA 3UA3A 1OEPA 3UJEA 2QUUA 2PP0A 3BQ5A 2I9UA 1E4NA 4CD5A 2G97A 4UTIA 1UWUA 1PTDA 2A3AA 2D3NA 5LIKX 4F48A 4NAEB 1R9XA 1FHLA 1TTPA 5HK4A 4EXQA 1V4YA 2A3LA 1YQ2A 4HU3A 3WBWA 4UBPC 2QCLA 1TPEA 3AIRA 3PP7A 3GKFA 3UG8A 2KZHA 1OF6A 3QHNA 3WZ0E 1HKWA 4JFUA 1K1DA 2DH2A 3CHVA 1OB0A 1GYMA 2WC7A 3BSGA 4JEQA 4W87A 5HDRA 3SBFA 4HOXA 2Y5EA 1UOKA 1GTEA 3U4AA 3W24A 2X8RA 3RIKA 4A3YA 2PDPA 1EDTA 3L4VA 1QNOA 3STGA 5F7UA 1LQ2A 2HDJA 1FCBA 3KTSA 3GDMA 4AVFA 1B9BA 4GJJA 4JTAA 4AHOA 3WLSA 3EOEA 1BXCA 1TX0A 3N04A 3S0CA 3WKZA 5FD0A 4QAWA 4LYQA 3F4DA 3G1DA 3CUZA 4FOUA 3TTSA 4DELA 3W38A 4MZ1A 2JF7A 3M0IA 3NQEA 4GLEA 1IHIA 3ARUA 3WMSA 3AMCA 4B3LA 2CBIA 1PV8A 3EDFA 4XIAA 3E0FA 4Z0SA 3NEHA 4GISA 4AVNA 4US5A 2FZ9A 5LHEA 3ITTA 1ZBKA 4MZYA 4DJFC 1MQQA 3GG8A 4OV9A 4ZQMA 4BS0A 5CC5A 2VI0A 1ITUA 4CNSA 1B90A 1YDVA 1A3WA 1ZBWA 3QF0A 3IEBA 4RDVA 3WQPA 1EXPA 2Y89A 5FL0A 1O6IA 2RUSA 4ACYA 3KBVA 1RA5A 2DT0A 3EDDA 5HPCA 1I9CB 2HPMA 1LRNA 1X6UA 4WJEA 3WJSA 1DPMA 5D2XA 3BGAA 1EJVC 1EP2A 3CZGA 4J3VA 3WDRA 2Z28A 2ZXQA 4IP4A 1P0KA 2CKRA 2VR2A 4PMRA 4AZ7A 3E1F1 1RBOB 3LQGA 1H11A 3M0LA 3LGDA 1EP3A 3QV6A 1WXZA 1FDYA 3CAKA 1A5KC 1EBHA 2EPMX 3PNUA 5HWJA 4DPPA 3HMJG 2GSJA 1DIEA 1KXHA 4H19A 4LBSA 1FWFC 3KW3A 3T0BA 3KP1A 4DO5A 2TMDA 3LCXA 2ESCA 4UQDA 1B54A 5E09A 3TYUA 3P82A 3WD3A 1YHTA 3PBVA 5I3JA 1DWAM 3K4AA 1GYLA 4OUIA 2PTZA 4LUYA 2ZIDA 5D2TA 3CZKA 1SR0A 2R94A 5JBEA 3MBDA 4PTDA 1Q85A 4P8XA 4KCVA 3UPBA 2V38A 5I6SA