3LHYA

Crystal structure of the mutant i199a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAAIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhyA00
3LM7A 5AYXA 4N9EA 3DZ1A 4LRSA 2E09A 1Q6QA 3W6YA 3P81A 1I4NA 2NWSA 1KFKA 1O60A 1WAUA 4QJ1A 1HL2A 3W76A 1DBTA 1F74A 4NZJA 3SGUA 3JR2A 1KM5A 2E5BA 3DXIA 4M5PA 5DN1A 3UPWA 1XL9A 1RQEA 4UTMA 3EX2A 4MUZA 2FPVA 1K03A 2B7QA 3HG2A 4P2VA 3W9ZA 1GJPA 1YXCA 5ABTA 1NVMA 1XUUA 6ALDA 3PS7A 3LOTA 1KM6A 3IVSA 4IOTA 1GTEA 1YYAA 2E5DA 4EF8A 3OVRA 1XBXA 3LI1A 1WV2A 4GXMA 3MI2A 4UTUA 5LNRA 4DO5A 2C16A 2Y85A 2WSQA 3MYPA 4S2BA 2V30A 1EP3A 2NWRA 4POCA 4IMEA 3B8DA 2QCDA 1I2RA 1O4UA 4RLIA 4X3ZA 1I2OA 4XQ6A 1H61A 3PWAA 3BLEA 3USBA 3ZS4A 3O16A 3HG5A 3LBCA 5KTLA 1P5BA 1HTIA 4MY9A 4FNRA 1EUAA 5LNWA 3HG4A 2DJLA 3D0CA 3RFAA 3A23A 2AGKA 1WQ5A 3MBDA 1UASA 4Y6GA 3RK8A 4Q4KA 3MI6A 3C0JA 3W2LA 1H7RA 1ML1A 5TIMA 1NAL1 5EBUA 5AHIA 5HQEA 1OK6A 4RJEA 4WUIA 1GG0A 1Z48A 4UXDA 3W23A 3WJWA 4LTSA 3I7QA 3I7RA 1PCKA 3MUXA 1J2WA 2XN1A 3G1SA 1YADA 3FS2A 1QOQA 2QAPA 3G1DA 3NQCA 4MFDA 2HMCA 2OT0A 3GLCA 1T96A 4X2RA 1JQVA 4JIPA 2HSAA 5AFDA 1L6YA 3KVMA 4NZFA 3W1MA 2RDUA 2Y6ZA 2CLLA 3P8JA 3P5ZA 4DF1A 1TB3A 3RU6A 2V2HA 4JTUA 3W86A 4ADTA 3N9RA 3RMJA 2ZTKA 1KM4A 1SW0A 4LT9A 1FXQA 2C0AA 3LHVA 2X1SA 4E2DA 4WY0B 3PSWA 4OWGA 3O1NA 1YDNA 3SI9A 1O5XA 2QAFA 1U83A 4H4IA 3KAOA 1W5MA 3R2GA 3M5XA 2QCEA 1XKYA 2ISVA 4LC8A 4CCEA 2X1TA 2DORA 4Z0SA 3EXTA 1ZAHA 4LWWA 4WXZA 5L6UA 2ZA3A 4OU1A 3ABRA 3B03A 4Z08A 5HNRA 3S9YA 3CWOX 3GDLA 1ICPA 3LERA 2R91A 3Q2DA 4N4PA 2BLEA 2GJLA 2D73A 3PBVA 1H1YA 4O14A 2VC6A 1OK4A 3T4CA 1WBJA 3AJXA 4UCGA 1SO3A 3TH6A 3DFPA 1EX5A 5G1TA 3RLUA 1Q45A 2C3ZA 3TV8A 3MHGA 5FI8A 3P7YA 3C3NA 2XN2A 2AQWA 3CU2A 2TMDA 4UTWA 3GYEA 3R89A 5CG7A 3GKAA 4PA8A 5TQLA 4WD0A 3BLIA 3QMTA 2QCHA 4IGHA 3L68A 1KLZA 4O8RA 2YW4A 4XTDA 3O6CA 4NVTA 3B0VC 1H7WA 4O1BA 5D37A 3ABOA 3EX3A 3M5ZA 3QF0A 2Z2UA 2GJNA 4JDBA 2QCFA 3W2MA 4R33A 4JN6A 1EIXA 2GUUA 3BARA 1LROA 1SR9A 4C1LA 5HWNA 5G2WA 2ZRXA 1SO6A 1OJXA 2YR1A 3M16A 3PUOA 3NDOA 2RKXA 3R13A 1AW1A 2XN0A 4EOUA 3B0PA 5HULA 3THAA 4GJ1A 1KFLA 5K9CA 3M41A 4M7TA 3SFKA 3S5OA 1QPQA 4KKXA 1XDMA 3EXRA 4PODA 4HPXA 4RZ4A 1GQNA 4NXSA 1XM3A 4LOCA 1FWNA 2I1OA 5C2XA 3O05A 1PIIA 3ATZA 1J4EA 3VCRA 3STGA 1ME7A 1I8JA 1TREA 2ZYFA 3NG3A 3LHZA 1B57A 2Z0IA 4CCDA 4KWWA 1KBIA 1K02A 4JTGA 2WNNA 2Y63A 3QSTA 5CPLA 3IGXA 1OG0A 4FNUA 3GAYA 4JTTA 3TMQA 3L2IA 3G18A 1FWTA 4MOZA 3W2NA 5GVJA 1SQ7A 1W0MA 5FESA 2WQPA 4PTNA 2TSYA 3IGUA 3ZWSA 3QJAA 1M5WA 1K7XA 4FB7A 2ZRWA 1OFRA 3FYOA 2A6LA 4PEKA 4N4QA 2GQ8A 3UD6A 3E0IA 3L5AA 3FJ6A 4NNAA 5EPDA 4XUGA 1XDLA 2VEPA 1RD5A 3GXPA 1AMKA 1SO5A 2YX0A 1W54A 2G96A 3WK2A 4Z0JA 2W6RA 4N6FA 1XBYA 4LVFA 1NSJA 1I2NA 4RZ5A 2EKCA 3CIXA 3HIJA 4PC8A 1A5AA 3DFOA 3W83A 3FIGA 4WY0F 1MEIA 4I7WA 2OJPA 2QKFA 1AL8A 2RDTA 4Y9AA 4AWTA 3HOJA 5J5RA 3WK1A 3LV6A 5HJLA 2QUUA 5HWMA 2RDWA 3TU9A 1OVDA 2GQAA 2JGYA 4ADSA 5FEZA 3GK0A 2B4GA 4AHOA 2BXVA 3TKFA 1H7OA 4ZQRA 4A29A 5SWUA 4O1AA 4UTTC 3V75A 1TO3A 3LHUA 1CW2A 1K7EA 4DBEA 3GDTA 2GQ9A 1ZJIA 3NPVA 2CW6A 3G0SA 1KA9F 2CZFA 5BMXA 5MHBA 4WZHA 1H50A 1RR2A 1M7OA 2ZTJA 1YTDA 2A2IA 2Q3RA 1KLYA 1EPXA 4MY8A 5BW6A 1LBLA 4MZYA 3KVKA 3P62A 1KM2A 3TQKA 2QDGA 4EWND 2NV1A 1PHQA 3NM1A 2QEZA 1LRQA 1XC4A 1X7FA 4ONVA 2RH9A 4TX9A 3L0KA 4Q32A 1MEHA 3TJXA 5K7JA 1ZCOA 5D02A 2VFDA 3GX9A 3DI1A 4IMDA 4EIVA 1F5ZA 4NU7A 1KTCA 4R34A 1PS9A 2ZZ7A 2HTMA 1FCVA 4KWVA 4LU0A 1KM3A 4MFEA 1LORA 4XBSA 2JKPA 5I3JA 3A5FA 5FEPA 2VELA 1PL9A 5FF3A 1JR1A 2A7NA 4PL2A 1WA3A 1XXXA 2A7PA 3LCXA 4XKYA 3MMTA 2YW3A 3CM4A 5HWJA 1EUNA 3IGSA 4M19A 3OA3A 1LLWA 5E1QA 3STFA 4A2RA 5KZEA 4O1CA 3FKRA 1TPC1 3EX1A 5F4XA 3UWVA 4IWWA 1BEUA 1FCBA 1TTJA 3LHYA 2V8ZA 3W3OA 4MLRA 3SSJA 1P1XA 4NUWA 1VCVA 1ZENA 8TIMA 3I65A 3PBUA 4WX2A 2RFGA 1IXPA 1Y0EA 3ABQA 1LM1A 4RXFA 1OFQA 4O16A 3DGRA 4DELA 5EY5A 2CU0A 2BZNA 1T99A 3QQ0A 2R8WA 1QPNA 5D2WA 1QWGA 5EYWA 5FF7A 3G1FA 1YDOA 4ZZ9A 2GOUA 1LZOA 3MWAA 5AHNA 3LTPA 3QPYA 3AO0A 4GC4A 3PY2A 5G4WA 3GNDA 5K4XA 1W3NA 3W7MA 1H63A 3A5VA 4OHQA 3N2MA 4Y90A 2IQTA 3HB9A 3THQA 2CLFA 1TPEA 2QCGA 2VXNA 3W7HA 2Y7GA 4UFIA 3CEUA 1AW2A 3TC6A 3Q94A 1L2UA 3UNDA 2QCDB 2V2DA 1V7YA 3OHIA 4JTFA 3Q37A 3GR7A 2X1RA 1QMLA 3S5NA 1G4PA 1F6PA 4O10A 4GWEA 1QAPA 4UNKA 1I45A 4ICNA 3KVLA 3SJ3A 3BGGA 3FLUA 3FEMA 3P84A 3LX9A 5AYZA 4LY8A 5BMWA 4TMCA 1IF2A 3ATYA 5AYYA 1WOAA 2W0UA 2Y89A 1O94A 1I2QA 4LW7A 1LYXA 4O53A 3KX6A 2OCZA 5LKYA 1FWSA 1AL7A 2OT1A 3T7VA 1Z44A 5BNKA 1L9WA 2O7QA 1FXPA 2JK2A 4JD4A 3ZR4A 1QPRA 2A1YA 3P80A 3W7EA 4PH6A 3N2XA 1FX6A 4OBTA 1S3HA 4M6VA 4QNEA 2B7PA 1SSGA 4Z1AA 2E68A 1TPUA 3BG9A 1B4EA 3H54A 3TXZA 2QUTA 3NPWA 3TUUA 3TDFA 3W1XA 3EWUA 1JCJA 2FPYA 3HO8A 4IMFA 5D04C 4JYEA 4BF9A 1UBSA 3W7OA 3GDKA 4DXVA 3C61A 2QF7A 5CPOA 3ELFA 1TPWA 4GFSA 1Q3NA 3NL5A 4KFNA 2J9XA 4TIMA 4QQ3A 1NFBA 3A24A 4BWLA 2VFHA 3KRUA 3W7LA 5D09A 1J5TA 2UV8G 4A3UA 3O06A 3EWZA 3IIPA 2WNZA 3LCHA 1E51A 1ICQA 4S2CA 1W3IA 3DFNA 3SZ8A 2X2GA 4DBDA 3G8EA 2Z6IA 3SIZA 3G3MA 3S42A 5C54A 1H7NA 1VJIA 4IJBA 3B06A 5E0KA 4MLJA 2G95A 1TRIA 4JEQA 4MJMA 2Y7DA 3C56A 3W7KA 4BI5A 1F2JA 3W2UA 4K37A 1F73A 2Z1BA 2H8ZA 1BWLA 3SGZA 1YPFA 3W73A 2V81A 3C6CA 2ZRYA 3CT7A 2V5BA 1X8FA 3NL6A 1TTQA 2WKJA 1OFBA 2DZPA 4UMBA 5CSSA 3W7JA 3UPBA 2NX1A 1LCOA 1OX4A 1OABA 4UIOA 3HG3A 1W5OA 4YL2A 4DPQA 1TV8A 4I7UA 2VFIA 4QSHA 2GVJA 1NF0A 2FTPA 5AOUA 1CX9A 5D2VA 3V1PA 5LHFA 3RF9A 4XTIA 2FLIA 4H3DA 4JYFA 3LCWA 2DZWA 4MYXA 3R8RA 4RX0A 3TXVA 3FKKA 1G7VA 3NL3A 2E5CA 2WJZA 4O19A 2HS8A 3FA5A 2JBMA 1X1OA 3ZWTA 4A2SA 2DZUA 3IVTA 4UTWC 3NQDA 5KITA 1VYSX 5D30A 1VYRA 4AAJA 4EVZA 3M5YA 2YFNA 3CB8A 3W1RA 3UY7A 1DJQA 2ABAA 3LLDA 3ANYA 2E6DA 3O15A 3LCFA 4JIQA 3N9SA 3LRKA 1FY6A 2I9EA 5I3FA 1A5BA 1XFBA 1VYPX 2P10A 3LCLA 2A21A 3R12A 3MP3A 2QCLA 3FFSA 2E6FA 3OG3A 4HHPA 2PCQA 2PE4A 2Y88A 4IQLA 5HINA 3NZ1A 3NAVA 5F1VA 4RZ6A 4K7YA 3LB0A 4FXRA 3PUDA 3LI0A 4XWUA 3LDVA 2CLMA 4CNPA 2DJXA 1JCMP 3BG3A 1MEWA 1PV8A 4K6AA 2VEIA 2QUVA 5CGQA 4HNTA 4QM1A 1SZFA 4N2YA 1TIMA 1R30A 3W2KA 3NQ6A 1XCFA 1QPOA 3B4UA 1RVGA 1S5VA 4JY9A 5F4WA 3F4WA 2H6RA 1A5CA 1LOQA 1SZGA 3IEBA 5F2MA 1KFEA 1RQBA 2NUYA 1W1ZA 2YSWA 3DHFA 1VPXA 5FF0A 3P67A 3CLMA 1VGAA 3T40A 4DQWA 2X30A 4O1DA 1H7XA 3HPZA 3BG5A 3BV4A 3TC7A 1GTHA 1FCUA 3CQ0A 1OYCA 2CLOA 2FIQA 2YFOA 4O4VA 2YYUA 3PM6A 4E0CA 4B5NA 3MYOA 2A5HA 5DCDA 5K9XA 4QNWA 2NUWA 3QQ1A 3EWXA 5LHEA 3MI3A 3TFCA 1C8VA 1R2RA 3VI2A 1K8YA 2FDSA 2YYTA 3BO9A 4JX5A 3RLVA 3UWWA 5K2ZA 4WXYA 3DH7A 3NA8A 2Q8LA 5F4SA 4LUJA 5FEWA 4MIMA 3FJLA 4UMAA 3FYPA 3HPXA 1TRDA 4ZQMA 3KVJA 4R53A 5EKYA 1QO5A 3QW4B 4GUHA 4UFJA 2ZA2A 4LRTA 5AC7A 3O6DA 5G4EA 4OE7A 4TO8A 1SW7A 3O63A 1DV7A 4MJZA 5CPMA 3PB0A 4IPIA 1GT8A 2PURA 3U6WA 3QSRA 1G67A 2QR6A 3KXQA 1KFCA 1O5KA 4OV9A 3HPSA 4FNPA 1JRBA 1SFJA 5AHEA 1G4SA 4Z1BA 1JQXA 2ZZ6A 1FWWA 1Q6OA 3W1TA 3OVQA 2R94A 2YDAA 3M5VA 3LHTA 3NQEA 4ZVJA 3IIVA 2V0TA 1YDVA 1FWRA 3W88A 4TR9A 3WJSA 1DJNA 4Y96A 3VNDA 3QH2A 4AEOA 2PRHA 4AHQA 3STCA 2C6QA 2QJGA 5D32A 4O15A 4O54A 2ATMA 3L0NA 1GEQA 3Q58A 3NQMA 4CQ9A 2RHGA 4AXKA 5G2IA 3W7RA 5FEXA 3C4UA 3W1PA 4R7JA 5T26A 1KFJA 3TW7A 5LNUA 1TPDA 5DCBA 3EKZA 1W3TA 3DFQA 3G3DA 3IV3A 1MZHA 4XKYB 4YWIA 4UTLA 3GIYA 4Z1DA 4N9BA 1MXSA 3M43A 3L21A 5AHLA 3UYCA 3W7QA 2ABBA 4XZ9A 2DZVA 4NJKA 3HBLA 1HO1A 1THFD 1LRNA 4TU1A 4HKPA 5HR6A 5CKSA 5CSRA 3LTYA 4PL1A 4A22A 3KRSA 4DEFA 2A6NA 2WO5A 2NX9A 1QOPA 3GXNA 1OFPA 4MZ8A 4CNNA 3G22A 5G2HA 3VE7A 3EWBX 3U8GA 4UFKA 4RXGA 2Y61A 4YMZA 4MZ1A 5DCEA 3ZFHA 4ZMGA 3GB6A 2A4AA 3IVUA 3UXDA 1FDJA 3W1NA 5IBXA 2GPTA 3NEVA 4U28A 3NQAA 1DL3A 1M6JA 1UUOA 4O50A 5F2IA 3MHUA 5D33A 3EXSA 3W7GA 3E49A 1ME8A 4UR8A 1H62A 4WOQA 1P0KA 5DXXA 3W85A 7TIMA 5I3KA 1QNVA 4GUFA 3TSBA 3SECA 1A5SA 3OBKA 1SSDA 3M47A 3A21A 1OX6A 1ZALA 3TCEA 1OFOA 5U7SA 2H3DA 4UFLA 1KM0A 2FB3A 2TYSA 2ZZ4A 3QC3A 1ZAJA 5D05A 3S1UA 2PRLA 1OX5A 1RZMA 3CPRA 4FEZA 1SO4A 1LBMA 1W31A 5L9FA 4A21A 3WK3A 2NXHA 1UUMA 3M1ZA 2ZCGA 3TAKA 1NEYA 4JNMA 1YXDA 1TPVA 4HNVA 3EWYA 1M7PA 3SY5A 3P5YA 3DKLA 1TTIA 1R2TA 1IIHA 3EB2A 4AWSA 5DELA 1VHNA 2DP3A 4O57A 3MP5A 4FNQA 4JS3A 1S5WA 3C2EA 3G8RA 4FXSA 2H90A 1W37A 1PVNA 1VQTA 3NNTA 2C13A 1DHPA 2ZZ5A 4YLWA 2QCCA 1JUBA 4O52A 3KRZA 3MJYA 1V5XA 3FOKA 1KW1A 5EMUA 4ADUA 5G5IA 4UMCA 1MO0A 3NGJA 3B05A 3C2OA 4JTEA 2CFFA 1K7FA 5F2GA 5E93A 3NL2A 1IXOA 1ADOA 2GVLA 4XBKA 4ZQCA 1TJRA 2AAMA 1JUKA 4MVAA 3M0ZA 2NV2A 3LGEA 1TSIA 4YCOA 3N14A 5U4NA 2J27A 5HUOA 4RR4A 2BX7A 1L6SA 1KV8A 1EB3A 1VH7A 2PRMA 1HO4A 3DAQA 2CLHA 3W7DA 3VE9A 1DORA 1R47A 2J88A 3UY8A 5DY2A 2JKAA 4FX8A 2E77A 3HGRA 5K9DA 2J24A 3LHWA 2C1HA 1TPB1 1RQHA 3C8FA 3W72A 2DZSA 3KOFA 1RPXA 2VEKA 1ZY9A 5F2LA 2WNQA 4UFMA 3SW6A 3NPUA 5F1UA 3MW7A 4GRSA 1GPWA 1DVJA 3UWUA 4FIQA 5AN7A 5AHMA 3G0UA 5FF2A 2B0MA 2KZHA 4LVGA 1TV5A 2PC4A 5DBUA 5LGXA 4BWLC 5AB3A 1GVFA 2ISSA 4NT0A 1R46A 4LS0A 2FQIA 1TQXA 3E12A 4GNJA 3N34A 1PHWA 4X22A 1P0NA 1LOSA 3BPWA 4WQ6A 1GYNA 3G1HA 3L67A 4OQVA 3LV5A 3BW4A 3H55A 3HGSA 4DF0A 3YPIA 1B3OA 1OX4B 3W70A 2ALDA 4O12A 1GZGA 2BTMA 3C2FA 3N73A 2V9DA 1TV7A 4JR5A 5CZJA 2WSRA 3L5LA 3G1VA 2C18A 1KV5A 3HMJG 4LVDA 1R2SA 2J6XA 3QZEA 5D2TA 1Z41A 3W75A 2C19A 4O13A 1FQ0A 1OF6A 4WJEA 1K8XA 4CCCA 4DO6A 1JCNA 1QR7A 4HIBA 3A22A 2F84A 4I9AA 4NJGA 1ONRA 4BK9A 4BFAA 1VS1A 1YLVA 1KTNA 3P8IA 4PCFA 3F03K 3VKJA 3M6YA 3TSDA 1WX0A 1W5PA 3IIXA 4BR1A 2EPHA 1VZWA 3TJLA 2VFEA 1ZAIA 3GXTA 3OIXA 1N8FA 3W71A 4JX6A 2VFGA 2R14A 2ZRZA 5CPNA 1YXYA 5J5DA 1KTBA 3NQ7A 3P60A 3S1WA 1GYLA 1JCLA 1RV8A 1B9BA 3W1LA 3GAKA 1DQWA 1H7PA 2WSYA 4FF7A 4NNBA 1GOXA 4UNLA 4AWUA 1H5YA 3C2VA 1TPFA 2WOQA 2FPTA 3G1AA 5DY3A 2GVGA 2F7FA 2P0OA 3S6DA 1W5NA 4BI7A 3IIZA 2I14A 6TIMA 2CZEA 1ZNNA 3DI0A 3B04A 3M7WA 3TNOA 3CTLA 3W87A 1JULA 3MBFA 3TK7A 4NXKA 3W7CA 4N9CA 2G5WA 1GVQA 1WXJA 2BSLA 2ZA1A 3HGJA 3NQGA 4NX5A 4NQ1A 3W74A 2Z6JA 2P1FA 1QO2A 1C29A 3RNDA 1LBFA 3IIOA 5A5WA 5KINA 5TBOA 1Q6RA 4K36A 1OHLA 4S1FA 3A9IA 3W1AA 5BOOA 1JVNA 1XBVA 4O4WA 2Y70A 3DHDA 3PR2A 1OF8A 2V2CA 1AW5A 3R5EA 3PG9A 3CC1A 3G0XA 4NJJA 5LNVA 4L4MA 3TX9A 1W8SA 2H3BA 1UCWA 3QMRA 2E6YA 4N9DA 5DXYA 3UZJA 5D03A 1JCXA 3P74A 3UQNA 4AH7A 3PBWA 3G1YA 1I2PA 2VENA 4HNUA 3NQ2A 3I68A 1LTDA 2EHHA 3W7NA 1XI3A 1K3UA 4IMCA 1LP6A 3O07A 1U5JA 3UWQA 4AB4A 5LNSA 1SU5A 4JTHA 5DLCA 5H2ZA 3PUEA 4H6KA 2B7NA 4LVAA 3QYQA 1AG1O 1LRTA 1G7UA 3NPXA 4UC5A 3LCIA 2JGQA 4IUOA 2A85A 3C52A 4KFOA 4ZQOA 3EKLA 4LUIA 4AVFA 1UJPA 3UWYA 3DKJA 1EA0A 3PF3A 4E2BA 4FHAA 4O18A 3NQ8A 4ZL1A 1UB3A 2CLKA 3OVPA 2CZ5A 3GVGA 3NQVA 3TMLA 2E1DA 5H91A 4K8HA 3T44A 3I7SA 3WJXA 1F6KA 5K3VA 5EL1A 4HNNA 4LS2A 1L6WA 4JTKA 4CLMA 3LLFA 3QRHA 1BTMA 4M7SA 1D3GA 3O6YX 2NZLA 4IX2A 4O28A 2ZZ2A 2VFFA 3QPZA 4NNCA 4AMAA 4O17A 4HSNA 3GNNA 2NLIA 3HJZA 4P61A 3WJZA 4HSOA 3H53A 3QM3A 3I6RA 3S5ZA 3JRKA 4I7VA 4CNOA 2ZBTA 5KMYA 4QITA 3INPA 2YPIA 3OEXA 3GZ3A 1DQXA 3P82A 1FBAA 5K4ZA 3W84A 2BWGA 4JTLA 1JRCA 3BW3A 1EP2A 4UTJA 1F05A 1GWJA 5AC6A 3HF3A 3B0UX 3DBPA 3DENA 4OGZA 3W2JA 5D38A 3TSMA 3S5YA 3HQ1A 3GDMA 1G4EA 5AHFA 4UFHA 2O7SA 1TMHA 3W1UA 1TPH1 1VLWA 4UR7A 5LGZA 2VKZG 3G24A 4IPJA 1D3HA 4ORMA 4BI6A 3UXAA 4IX0A 2EGZA 1FUYA 4WY0A 2FJKA 2NX3A 3EEGA 1IIGA 2TRSA 5LSMA 3BLFA 2Q3OA 4FX7A 4NJIA 1NF7A 4O11A 3PAJA 4RCXA 2VEMA 3TE9A 3T55A 1SZNA 3DFSA 4DPPA 2DU2A 4E38A 3LTSA 2A0NA 4HPJA 2ZDRA 1ICSA 1S5TA 1LLZA 1TCDA 3W07A 2G97A 5AC8A 4LS1A 4TMBA 4IXHA 3P61A 2QDHA 2QCNA 1WDWA 1TQJA 3N19B 1TYGA 3E02A 3LRLA 3VFLA 5I3IA 3HGOA 3MHFA 4O0ZA 1Z42A 2V5LA 3N3MA 2B7OA 3LCGA 1QCWA 4MYAA 5C5YA 2WPBA 3TQVA 2YXGA 1LOLA 3CHVA 3PC0A 1H1ZA 5KSWA 3M9YA 1B4KA 2OX1A 1ZFJA 2VOMA 1EP1A 4RKAA 3F4NA 4X9SA 2ZRUA 4ZQNA 3T78A 1SPQA 3BK0A 1H60A 2J9YA 1MSSA 2EAWA 3NR0A 4G1KA 1PE1A 3TROA 3S8HA 1VRDA 4MY1A 1F76A 3NOEA 4U4MA 4Y8FA 3TA6A 1GVSA 3NVTA 3GKFA 1A53A 1A50A 5IBXC 3IRDA 1HFBA 1VC4A 4MKNA 4QIUA 1O95A 1G4TA 1WBHA 3UZ5A 4GUGA 3S1XA 1Q6LA 1TJPA 3QFEA 1FDYA 2DZTA 1F7BA 5D2YA 1CI1A 5A8GA 4DF2A 1ALDA 1YPIA 4IMGA 1P4CA 4GUIA 3M44A 1D9EA 1VCGA 2ZZ1A 3ABSA 3WJYA 5EA9A 2FFCA 2V82A 1JUEA 3U2OA 5DBTA 2QJIA 4FIRA 3G1XA 2Y62A 4JICA 2NXGA 1DKWA 1XUZA 3STEA 3TR2A 1SZEA 1T8XA 1VHCA 3E96A 3NYZA 3TQ0A 1PCWA 4JDYA 3EWWA 1IXNA 3DFTA 4OT7A 1C9DA 1N55A 4JY8A 5CZ0A 4ORIA 4IXXA 5FF4A 4JTSA 3BGJA 1BWKA 1EWDA 2CLIA 4RV8A 4JXCA 1IGSA 1JCYA 1ZHAA 2YZRA 1VLIA 1VR6A 2NXIA 2QCMA 4FNSA 2C15A 4JTIA 4GUJA 5BRBA 3PBYA 1X6UA 3L9CA 3QEZA 1EEPA 1OFDA 5HR7A 3TFXA 2J9ZA 1EWEA 4N6EA 4Z1CA 3W1QA 4J9JA 4AF0B 3NXFA 4JGDA 3WFAA 1K8ZA 4M6QA 3NQFA 4NX0A 3L65A 5KZMA 2JKEA 3JS3A 1GVRA 1H51A 3L66A 2X16A 1YTKA 4AHPA 3LXBA 2HS6A 5I3GA 4ALDA 3L0GA 4LC6A 1KFBA 3K30A 4K7VA 2FB2A 3PG8A 3MP4A 4QISA 4RK8A 3CIWA 3EX6A 5G1YA 2CZDA 3UWZA 4GE8A 3BVJA 1VCFA 2X1UA 3PVFA 3LBMA 4ZQPA 2ISWA 4Q33A 4UTTA 5C55A 2LLEA 2XFWA 3WK0A 1YTEA 3S1VA 2CLEA 4NJHA 4K38A 2YGYA 1OFAA 3LRMA 4JYDA 2Q8ZA 4QAIA 4L4LA 2ATSA 1HG3A 1DOSA 3NO5A 1SUXA 3LXCA 2TPSA 3TAOA 3PULA 4GBUA 3W7IA 2ZQ0A 3NM3A 4MPQA 4LV4A 2YCEA 1OFEA 3TW6A 4CQAA 2Y7FA 5KZDA 1T0OA 5I3HA 5HMSA 1QDSA 4WOZA 4DO4A 4FO4A 4OV4A 1KM1A 4C1KA 3QW3A 1G6CA 1N7KA 4JTJA 1FDZA 1OYAA 4UTIA 3W22A 2OMAA 4PFMA 5HUPA 4M6PA 2NUXA 4AF0A 4FNTA 4D2JA 2OZ0A 3CEPA 1WOBA 3NZRA 4K8EA 4UTHA 4W9TA 3L5MA 5LZLA 4LVBA 5IM51 3DU0A 4UUIA 2ZZ3A 1X1ZA 1GVOA 1SFLA 1W5QA 4HT3A 3W7PA 4FX6M 3O8AA 5CZTA 3GDRA 4YXGA 4ML9A 1G69A 4CQ8A 1JJKA 1IXQA 1KBJA 4YCPA 4KFPA 3CWNA 1ME9A 3LXAA 3EX4A 2E6AA 2Y7EA 4EF9A 3QMSA 2WV8A 1WYIA 1TTPA 4JX4A 1LDCA 3E9AA 3KFTA 1QFEA 1SW3A 1XBZA 1HUVA 4O0KA 3PB2A 4N02A 1AK5A 3MO7A 1OYBA 5C6MA 4HN4A 3PSVA 4LV9A 1W56A 4UTKA 5D2XA 3TIMA 2A7RA 3C2RA 2ZFAA 2EF9A 3SR7A 4LNYA 4K39A 5CZSA 1GG1A 2W79A 2DZXA 2C14A 2CWNA 3KHJA 1FCQA 2ZRVA 3F1QA 2QJHA 3BW2A 1BKSA 3GR8A 2H8XA 3S0CA
chains in the Genus database with same CATH superfamily
3DYPA 5AYXA 2I57A 2R6OA 1ZBVA 3MCNA 4XVEA 5A6SA 4U2YA 1DHKA 5BXRA 1TR9A 3GXIA 4C6LA 4WR3A 1WUFA 2CNCA 4QLKA 5A6JA 4PMYA 3EA1A 1SJDA 3U3HA 1HL2A 1KCLA 2XGIA 3DHPA 3K8LA 4F2BA 4NZJA 3JR2A 1KM5A 1TZZA 4S3GA 4EXQA 5DN1A 1FHLA 3GIPA 3N2BA 1RQEA 4UTMA 3EX2A 1LL7A 3AYRA 1DWAM 2ZXBA 1YXCA 3IPWA 1XLJA 3LOTA 1D8WA 1XYFA 5A6KA 2TODA 4GXMA 3ICJA 5LNRA 3TYDA 2C16A 2Y85A 4XO7A 3ONBA 3BE7A 2WSQA 1E6PA 1EP3A 3SN1A 2UY5A 4GH1A 1PTAA 1I2RA 4X3ZA 1I2OA 1VFSA 2D22A 4XQ6A 1MDRA 3BOXA 3USBA 3ZS4A 5KTLA 1UZHA 4MY9A 4FNRA 1AH4A 1P6WA 3PJWA 2WZMA 2DVXA 1WDRA 1LQAA 4MWAB 4Y8EA 3TYAA 1WQ5A 4GK8A 4IIBA 3RK8A 4JNYA 1CCWB 2WW5A 4DJFA 4RJEA 1F6YA 2C79A 2PWVA 4JIRA 3LGGA 3RG6A 3I7RA 3ONCA 3F2DA 3BMXA 4Y7EA 1P0BA 2ON3A 5C9ZA 3FS2A 1QOQA 2XH0A 4MWAC 3SURA 3G1DA 2OT0A 4MB1A 4X2RA 1I1XA 1C3FA 2Y6ZA 1GQIA 4UWMA 3QGKC 3P5ZA 4MKVA 1KR0A 1EJWC 4ADTA 1IT8A 1DE6A 3CHEA 4ES4A 1FXQA 4I6VA 5A94A 2X1SA 2ZE0A 3O1NA 3AISA 2PLCA 3FSTA 2E67A 3OLDA 3HTWA 4JFUA 1W3JA 1E5NA 1UR8A 4H4IA 1XKYA 3VINA 8RUCA 4ECLA 1ZAHA 4GI8A 1KGWA 4WXZA 5L6UA 2FZDA 3HFTA 3KLKA 2GJLA 3GIQA 5M17A 3LPOA 4H9UA 3PBVA 1J8VA 3AJXA 4P7QA 5G1TA 1YW1A 2C3ZA 3IJ9A 3MHGA 5FI8A 3P7YA 1J9YA 4GKTA 1GONA 3LLXA 3GYEA 3R89A 5CG7A 3WQ8A 4NAEA 3SSZA 2D0HA 4IGHA 3L68A 2YW4A 1UP2A 3BANA 5D37A 3S5SA 2GJNA 2X2YA 2IQDA 1EIXA 5ECVA 1LROA 1RAKA 2QJNA 3GU9A 1ZS2A 1CGWA 3ZXWA 5G2WA 4P8WA 3N6HA 3PUOA 1AW1A 4REQA 1M1BA 3AIQA 4GJJA 4IFKA 4C6NA 4EOUA 4HJFA 4LCQA 5HULA 4M7TA 1LWJA 1UMYA 5T8GA 4PODA 4EPBC 2OB3A 1FKXA 3P3BA 4F2UA 1ISWA 1FWNA 2HVOA 2I56A 2QGYA 5J8LA 3STGA 1ME7A 2JE8A 3MU7A 1TREA 2ZYFA 3LHZA 4CCDA 2WNNA 3UJFA 3IGXA 5A6TC 4CQBA 5PTDA 3L2IA 4IGMA 1IR2A 3WSUA 5GJPA 3W2NA 4FF5A 2MUCA 3UR5A 4V1XA 5GVJA 2PA6A 3MKKA 3ARWA 5FESA 3PNUA 2WQPA 4PTNA 3MV11 3R0UA 1K7XA 3T8QA 1AQ0A 5CSUA 3T4WA 1QHPA 4M80A 2OFJA 1MXGA 1XRVA 3HPFA 3L5AA 2YBTA 4XUGA 4KGLA 4IHCA 1XDLA 2DDXA 2YX0A 3PZUA 1W54A 3GM8A 2BXYA 4HYRA 3N4EA 4W7WA 3N6QA 1H09A 4HU3A 2W6RA 2ACUA 1XBYA 2VO5A 3IK2A 1NSJA 1S2TA 3BZGA 2GZXA 4PC8A 4J35A 4M1RA 1GORA 2PF0A 2Z1WA 1E6XM 3FIGA 3WYZA 3OQ8A 1JD7A 1CDGA 4WY0F 4NP7A 4I7WA 3SUTA 4EXAA 2ODOA 2OJPA 3JVAA 3TN4A 1GVIA 1PKLA 1NTHA 1F4HA 3HOJA 5J5RA 3WK1A 4RW5A 2YCKX 2Z00A 1UOKA 3I3DA 3N2CA 4MB5A 1MI3A 4GVFA 3GK0A 3V18A 3VGBA 4ZQRA 1KFWA 2IXVA 4HYVA 1R3SA 2OQYA 1OCJA 3M0JA 3VGHA 5JXQA 3R1ZA 1E0VA 1MW1A 3VFCA 4IT1A 1RHCA 1XLHA 2A2IA 4XZLX 5HOSA 2Q3RA 1E56A 1KLYA 3CB3A 3AHZA 1EPXA 4MY8A 1LBLA 3M0VA 3MMWA 4MZYA 1OEPA 2VQUA 3HQPA 2WMGA 3OW1A 2ZXAA 3THCA 4DXXA 4IP7A 1Z69A 2QEZA 4PMNA 2FZ9A 1A5OC 3E74A 3GHRA 4PE8A 5C9XA 2RH9A 3ERPA 3L0KA 1R9ZA 2RAGA 3TJXA 5K7JA 2DT0A 3DDMA 4IMDA 1F5ZA 4R34A 2ZZ7A 1UD3A 4KWVA 2FH6A 5C8BB 1M53A 2XVPA 4DB7A 4NI3A 4G9PA 2POZA 1PL9A 2YJQA 2XVNA 4GO8A 1AFSA 4I9JA 1XIMA 4XKYA 3MMTA 1V02E 3IGSA 3B9AA 4M19A 4L64A 4O1CA 3FVMA 2J79A 4D1IA 4J28A 3WG6A 3GNRA 1JDEA 3LHYA 4WSKA 2ZUNA 4LAUA 3W3OA 3SSJA 2W5FA 4X9YA 3W6MA 1J93A 2XH4A 3ZMRA 1VEOA 4Q8TA 3I65A 4WX2A 5DRIA 1E6NA 3ABQA 3MDWA 1R3RA 3THDA 1QPNA 3NDZA 5EYWA 2VMFA 4GO9A 3UXIA 3UF9A 3MWAA 2FHBA 4V2XA 5FAGA 4GC4A 3PY2A 5K4XA 3VNIA 2XTKA 4OHQA 3W53A 1W9UA 3LM3A 2CLFA 3U2ZA 1Q13A 1SMAA 4OBRA 3PAOA 3W7HA 2Y5SA 4IG2A 6REQB 5EMLA 4NY2A 1V7YA 4MADA 4DNMA 4W88A 4GY0A 1QMLA 4Q4OA 1G4PA 2FVMA 4GWEA 4UNKA 4ICNA 3BGGA 2HV5A 5BMWA 1QATA 2X05A 2YB1A 1QNSA 1A0CA 2ZVRA 1WOAA 5MKGB 4LW7A 1LYXA 4O53A 3WF0A 4ZCWA 1FWSA 4H00A 2XZ7A 5T9BG 3TJIA 5FA5A 3T7VA 5D8ZA 4GFIA 5CJ5A 3VDAA 3IS4A 4FOJA 4JD4A 3HPAA 3VIOA 3N2XA 3GNPA 1S3HA 1RPKA 3AICA 4PSPA 4QNEA 4DZIA 1SSGA 5B80A 1TPUA 3W27A 1B4EA 2Z2AA 4IISA 5XIMA 1GYMA 1KWKA 4MAZA 3EKGA 2Y8UA 3W1XA 2FPYA 3DFYA 3ZOAA 3KCJA 1ZPTA 2BVDA 3GDKA 1GKRA 5CPOA 3ELFA 2HBXA 4GFSA 1Q3NA 1W2PA 2OKOA 3DEQA 1O1ZA 4C7FA 3QBUA 1W91A 4BWLA 2VFHA 4LBSA 4A3HA 3AHYA 1PEZA 4IFOA 6REQA 5D09A 5E6ZA 3VILA 2CHNA 1S1PA 1E51A 4S2CA 3G8EA 3EEZA 2Z6IA 3Q4DA 3SIZA 3G3MA 2XYLA 3WUGA 4ICMA 1XGEA 3QOMA 3ZJKA 2G95A 1CXKA 4JEQA 2PLKA 4HZ6A 4JL2A 5I7GA 2H8ZA 5MKGA 2V81A 3COTA 4H2CA 2NT0A 2ZRYA 1TTQA 1NDYA 2DZPA 3PTKA 4UMBA 5CSSA 3D5HA 4XAPA 1OABA 2GDQA 4UIOA 4NZ3A 3HG3A 2XUCA 2CHRA 4I7UA 1Z9AA 1NF0A 2FTPA 4H6EA 1QI2A 1KRAC 4ZOCA 5IFPA 3OLGA 4RNIA 2DIJA 3FKKA 4LUTB 3NL3A 4CD7A 3H22A 1IGWA 4O19A 3FA5A 1PDYA 1VBUA 1UKQA 3ZWTA 4B2DD 1NFGA 3AIBA 1E9LA 2Y24A 3B4YA 5D30A 1VYRA 4WRHA 4AAJA 2P3ZA 2ABAA 2OU4A 3WEZA 3ANYA 2E6DA 3DERA 3LCFA 2HK0A 2ONEA 1FY6A 3QVQA 5I3FA 1XFBA 1VYPX 2PDJA 2OLHA 4QAWA 2QXWA 3CHCA 3MP3A 3PPGA 3OZOA 2E6FA 1EHNA 3T9PA 5CLWA 1SFSA 2Y2WA 5HINA 1ZBWA 4S3FA 3AHTA 3LI0A 3LDVA 1JCMP 3H12A 1WXZA 4WDUA 3K1GA 2QUVA 1M03A 2V69A 4QGCA 1TIMA 3W2KA 1XCFA 1K4GA 3VIIA 3VX0A 1QPOA 3H2MA 1S5VA 1VBHA 3H4GA 5F2MA 2PDPA 1KFEA 1W1ZA 2SFPA 2JALA 3CLMA 1VGAA 2ZADA 2WBKA 3T40A 4DQWA 4J3SA 1TJ0A 3TC7A 3GC5A 3EMZA 2PTXA 4B5XA 2YFOA 2YYUA 3IGHX 1IEXA 1VFFA 2X41A 3TOPA 2BMBA 3QQ1A 1VFMA 3O6AA 1K8YA 2FDSA 4JX5A 3RLVA 1E4NA 5K2ZA 3DH7A 1H4PA 3NA8A 3TW9A 2Q8LA 3BJTA 3DC0A 5F4SA 4B15A 1TWWA 4PMVA 3TEVA 4MIMA 4UMAA 1TRDA 1JZ2A 4GQBA 2CEQA 4DJED 1IQ8A 3E0WA 2G8ZA 4E5TA 5AC7A 2WBGA 1EC8A 4HA4A 1Q6FA 2G4FA 4C6EA 3N1AA 4NF7A 2FZNA 3L4ZA 3CUFA 2ZX6A 4ZB5A 1GUVA 1MMFA 3KXQA 1KFCA 1V3MA 3EOEA 4FNPA 5G1MA 1UJQA 3AIEA 4QBXA 5AHEA 3T07A 2BGSA 1Q6OA 2XH2A 3OVQA 2R94A 2YDAA 2ZX8A 4GVGA 3M6DA 4AY7A 1R3QA 1XLCA 1DJNA 3QH2A 2PRHA 3STCA 4Y2WA 3WQWA 1DJWA 1WP6A 3L0NA 2OYLA 3W00A 4CN6A 5FEXA 1XYAA 2PGEA 2V3FA 1TPDA 3EKZA 3DFQA 3DOPA 3G3DA 5CC3A 3C5QA 4UTLA 3GIYA 2HZGA 4N9BA 1MXSA 3UYCA 3SB0A 2ABBA 3B8WA 4HNOA 2D0GA 3U57A 1J96A 3HN3A 5CSRA 4ZO6A 4PL1A 1HKMA 4A22A 1IEVA 3L12A 4GXWA 3ITYA 3CZGA 4HMEA 2A6NA 1EJVC 2NX9A 1QOPA 2HRWA 3OZPA 1GVYA 1JGIA 5A8OA 3VE7A 4V33A 4LJ3A 3ZFHA 3RITA 3UXDA 1UZDA 4U28A 4HN8A 1DL3A 4WIWA 1GVEA 5CC5A 3TYZA 4Z42C 5ABGA 4O50A 4U2ZA 2VCBA 4KMQA 1ME8A 1XQLA 1P0KA 3WNMA 1QNVA 3GVRA 2PZ0A 1A5SA 2O9RA 2XFYA 3CZEA 2AQVA 1OFOA 1PBGA 5FSEC 3ZM8A 1W32A 5D05A 3WMCA 2PRLA 1RZMA 4FEZA 4A21A 3TAKA 4RE3A 2Z24A 3CV6A 1JG9A 2P8BA 3SY5A 3T8LA 4AZ7A 1TTIA 1VB9A 2I5QA 1ESWA 1JFXA 1R2TA 3EB2A 1J0IA 4A6GA 5A6BD 3MPGA 4O57A 3C2EA 1EO5A 2H90A 1PVNA 1VQTA 1XHGA 1L0PA 2QUNA 2J13A 4CNSA 3AFBA 1IYXA 4O0QA 4YTTA 2GDUA 3SGGA 4ADUA 5G5IA 1CLXA 1GOWA 3NGJA 2QIWA 3C2OA 4ACZB 5E93A 2GVLA 1ADOA 3LNMA 4ZQCA 3M0ZA 2NV2A 4TUFA 2PP0A 2J27A 5HUOA 1O1HA 3VM7A 2BX7A 2D3LA 1UD2A 3QZ6A 1QU4A 2ZXQA 2CLHA 3ZSSA 4LX4A 4R9XA 3DG7A 4XIMA 2J88A 3GNOA 2E77A 1ZQ5A 2R82A 3HGRA 1UA7A 3VNZA 3GW0A 4C6KA 5K9DA 1RQHA 4FLSA 5MF5A 2DZSA 3WLHA 1XLMA 2VX4A 2WNQA 4CD8A 2XJ7A 5F1UA 3MW7A 4GRSA 3UWUA 2XM2A 2DGAA 3MSYA 5AN7A 5IOBA 2G3JA 4GH3A 2ZX9A 3BSHA 5HXMA 2KZHA 2PC4A 2R1MA 5LGXA 2VC9A 2W91A 2G3MA 5AB3A 1GVFA 1WXYA 1R46A 3VKAA 1FH7A 5EFFA 1XQKA 1PUDA 3PWIA 2FQIA 4JOMA 4GNJA 2VUNA 3N34A 4X22A 3VIPA 7CGTA 1PB0A 3K4DA 3ZVIA 3LV5A 4H8VA 3BW4A 3H55A 3HGSA 1O66A 3YPIA 1OX4B 5LA1A 1SGJA 3N73A 2V9DA 1TUXA 4UQDA 2PZNA 1CLVA 2J6XA 3QZEA 1YNYA 3W75A 1HX0A 3S47A 4JAWA 2PDGA 3W02A 1QR7A 3KBVA 2F84A 3PJUA 1ONRA 5IDIA 1X38A 3STPA 3P8IA 4PCFA 3M6YA 1ZBKA 2EG7A 4PUUA 2KX9A 1W9VA 4JX6A 2R14A 2ZRZA 3GXMA 4FXFA 2OZ3A 1XYMA 1M65A 3GG7A 1RCQA 1KTBA 5AYBA 4D72A 4DUXA 3T0BA 5A8NA 3BOFA 4FF7A 3R10A 4Q8UA 1GOXA 4Y9OA 2PB1A 4AWUA 1YNQA 1FA2A 1TPFA 4PTDA 3ZYZA 3WDHA 2GVGA 1XJBA 2WMHA 1DE5A 3GU1A 3WBWA 4PCNA 1W5NA 1ZNNA 3M7WA 2E4TA 1EXPA 3MUZ1 3KZPA 2YCIX 3TK7A 1XLLA 4NXKA 3W7CA 1XC6A 3QOKA 3R7MA 3ZLGA 5C70A 4GYFA 3NQGA 4G5DA 3HGJA 3V5FA 2Z6JA 2P1FA 1E70M 3RNDA 3IIOA 5KINA 1Q6RA 4K36A 3RLGA 3RGTA 3A9IA 4HCLA 3W1AA 1JVNA 1XBVA 3DHDA 3MUCA 3MZ2A 3R5EA 3CC1A 1UH3A 3BDKA 2OOGA 3KDNA 4PCPA 3QMRA 2VR4A 2YDQA 3CT2A 3RMEA 4AH7A 4HOXA 1XDJA 4KCTA 4HNUA 4J40A 3I68A 2PS2A 1B2YA 1RK5A 1XI3A 4LAKA 4W8BA 4F40A 3ZT7A 1LP6A 3H2FA 4BHYA 1TX2A 3O07A 1RJPA 4AB4A 1SU5A 4GKLA 4HK7A 1I60A 5H2ZA 3WQCA 4LVAA 3QYQA 3CL6A 2OEKA 4WKAA 1UMLA 1UG6A 4IUOA 4MB4A 3VCNA 3C52A 2YDRA 3EKLA 1EF3A 3PF3A 3B8VA 2ICSA 4FHAA 3IK4A 5LIYX 2CZ5A 4ZOBA 1WDQA 1FHUA 1RY0A 3T44A 2OLAA 1DEDA 3VKCA 4CNTA 2WVUA 3WUFA 3QRHA 4MB3A 2NZLA 4IX2A 3FK4A 3QLLA 3BXWA 3GTHA 2VFFA 2PPGA 3GNNA 3TOYA 2FJUB 4DYJA 3WJZA 4HSOA 2VC5A 3QM3A 3I6RA 1HF6A 4MG4A 1AZ1A 4I7VA 5KMYA 1QW8A 3OEXA 5T9CE 2REQA 1WCGA 2C1GA 3GR4A 3P82A 4PMZA 1FBAA 2PUZA 3QR3A 1TV4A 4XBJA 2YBUA 3J7HA 1H1NA 3G6MA 1OB0A 1F05A 2D24A 3RO8A 1A5LC 1TCMA 3EPNA 1Y5VA 5D38A 1TG7A 3S5YA 3TSMA 3GDMA 4UFHA 2YA2A 2IQ0A 4GZ7A 1VLWA 1JDFA 4UR7A 5CAHA 4AC7C 4GX9A 1D3HA 2W4XA 2Z29A 3LGDA 4BI6A 4GISA 4MNMA 4YYCA 1FUYA 4ERIA 1IIGA 4FALA 5LSMA 3DFHA 1E73M 4H9TA 4FX7A 4O11A 1GOKA 3PZ9A 3T55A 1CLKA 1BYDA 1SZNA 4FR6A 4LCRA 2ZDRA 3RX3A 1XISA 3M0IA 4K68A 1LLZA 4LS1A 2AMGA 2QCNA 1TQJA 3N19B 4D6DA 4OJYA 3N3MA 1A3WA 4AZBA 4MYAA 4M51A 5KSWA 4AC1X 2OX1A 6A3HA 2D3NA 1XLAA 4C6DA 3F4NA 4X9SA 3WL1A 2PDWA 3N4FA 1OCBA 3BK0A 1WKEA 2G4JA 5I06A 2VL4A 1VRDA 1UC4A 4MY1A 2PTZA 3CHFA 3SUUA 3TA6A 1M01A 3LA4A 2NVCA 3VO0A 2CBJA 1VC4A 2EBNA 4LAMA 1XSIA 1O95A 3MUAA 5DO8A 2YXXA 3CUHA 3CV7A 3S1XA 1FWEC 4Q4MA 2VOTA 1OIFA 2VR5A 4XD5A 4GCAA 2HE8A 1YPIA 1D9EA 1PKYA 4XK2A 4MUPA 2V82A 3WD2A 5DBTA 2FYMA 4FIRA 3G1XA 1E43A 1EKOA 1DKWA 1XUZA 1QRQA 2B31A 3U5UA 3TQ0A 3NYZA 4IMAA 3T6CA 3KWXA 1IXNA 5FL0A 1C9DA 2NVDA 1ONXA 3H7RA 3TTSA 3W01A 3LS9A 4JTSA 1EWDA 2CLIA 2V38A 3NZGA 1DJHA 1KB3A 2GJXB 2YZRA 1LJYA 1FHDA 1Y5WA 2XPKA 2C15A 2BOGX 2Y8VA 3PBYA 2QF8A 3QEZA 3N2TA 3CMFA 5M1TA 2J9ZA 4AF0B 3NXFA 1E0UA 4HSHA 4M6QA 3GYCA 3NQFA 4ZSUA 5KZMA 3O0KA 1GVRA 3H26A 5GNXA 2HS6A 5I3GA 3A3WA 4NHVA 3UZWA 5ABFA 1UIPA 4LC6A 3AWOA 4PBGA 3V5CA 1AODA 4LAZA 4P8VA 3CIWA 3EX6A 4EPKA 2CZDA 4AVNA 4GE8A 3PZNA 4Z2LA 4QE1A 4UOZA 2XU2A 1UWSA 2ISWA 4KEZA 1S3TC 2LLEA 2EG6A 1KCZA 2J7HA 3U2CA 4WJ8A 4PTWA 1OQFA 1E6SM 4L4LA 4BZYA 1K77A 4IIFA 2VZOA 1A4LA 1SUXA 1EBHA 2WB5A 5HMDA 5CC6A 3RJYA 1JZ8A 1K9DA 5A6AA 3C8NA 4QR6A 3KBJA 3W7IA 4UOQA 1CIUA 4GLEA 3UR8A 2VDGA 4LV4A 3W4RA 3WY1A 4PMJA 2GJXA 3S6TA 6PTDA 4L4PA 4FO4A 1KM1A 3QW3A 1DIKA 1G6CA 4JTJA 3VOFA 5EFDA 1OYAA 3MO4A 1HP5A 3U9IA 3BSMA 4AF0A 3ITLA 4LCSA 2D2HA 4NL1A 4L9XA 4UTHA 3A12A 4WDWA 5LZLA 4GMEA 3AOFA 4DO7A 4GYPC 3W7PA 2DZAA 1VJSA 1OINA 3SRKA 1T6MA 4A3RA 1IXQA 3L2MA 3CWNA 2J74A 4ZFMA 5BCAA 3B9NA 3IARA 3QMSA 4C60A 1VENA 1LDCA 3KFTA 1W1B1 3V7PA 3WUBA 1RBAA 1SW3A 3PB2A 4N02A 3DC8A 3C86A 3O3RA 3WLSA 3CZLA 2GSEA 4K39A 4QG6A 3VDHA 1GG1A 1R0MA 4IQEA 4GQQA 4R7OA 1IE7C 2DZXA 2C14A 4KWUA 5E6YA 5EU9A 3UZZA 1MDLA 2ZRVA 2QJHA 3BW2A 1BKSA 3FGCA 1XLKA 4CCZA 4QTGA 3DZ1A 2ACRA 2NWSA 3WF2A 1HT6A 4XB3A 3AUJA 1V3KA 1V4YA 4QJ1A 1OZQA 4RE2A 4MKSA 1QHOA 5E70A 1BLIA 1R3TA 3BAIA 3M46A 2PDUA 1F74A 3SGUA 4GYJA 4HMCA 1VRXA 2E5BA 3DXIA 1OD0A 4F0SA 1MNSA 4JBRA 1EDQA 2PU0A 4MUZA 2FGLA 3LBOA 1JNDA 3OODA 1K03A 1REQB 1C92A 2QHAA 3HG2A 4P2VA 1GJPA 4GI9A 1NVMA 6ALDA 3ITVA 3PS7A 2PWFA 3IVSA 1Z8AA 4IOTA 3OYXA 4EF8A 1JCTA 2FGBA 1E0WA 5CPQA 1WV2A 1ZSXA 5GJNA 4DO5A 1ZB5A 3AMLA 4DWSC 2VVNA 1QI3A 2G3NA 4IMEA 4PRRA 4GJIA 1DXEA 1JXJA 1O4UA 3P2VA 1J6PA 3UA4A 2XSXA 3PWAA 4DRSA 1WZMA 3O16A 1W1VA 2ZVIA 1EUAA 2DJLA 5A8QA 2HXUA 3UCQA 4MNLA 5D4YA 1U30A 2Z26A 2QUMA 1UASA 1Q66A 4Q4KA 4CU6A 4L1WA 3TZNA 2RUSA 2WKLA 2CBIA 1HL9A 3IJLA 5REQA 1XLGA 1UD8A 1L6GA 2F8QA 1NDWA 1UPPA 4C6CA 1ZP4A 1PCKA 1J2WA 3QR0A 3NCOA 1B30A 4C6FA 4PMQA 2PDCA 4IP5A 1QWKA 5I07A 3GLCA 5A1AA 1QVBA 5D9PA 1JQVA 4JIPA 2HSAA 2OZTA 1L6YA 4DZ5A 4BF5A 1JYXA 3KVMA 3W1MA 1WO2A 3LENA 7A3HA 5HK4A 1REQA 2CLLA 2AL1A 3FEQA 3I3BA 1TB3A 3MSDA 7ENLA 3ARSA 4CNUA 2G50A 3WQVA 1XCXA 1FP9A 3L7RA 3GC4A 1DJYA 2ZTKA 2C0AA 3OQEA 5DQPA 2ZIDA 3CMGA 3TTQA 3LN3A 4WY0B 3PSWA 3EAUA 4I8YA 4OWGA 5GNZA 1RCOB 1U83A 2ADAA 3R2GA 2QCEA 4CCEA 4IUGA 4DLMA 3CGTA 3EXTA 1PIGA 2EO7A 4YTSA 3GUWA 1XIEA 2ZA3A 4LH8A 5HNRA 2R91A 3Q2DA 2D73A 5HNUA 2OEJA 3BJSA 1H1YA 1OK4A 1E1FA 4MWAD 3T4CA 3UG8A 3GFYA 4C6MA 3TH6A 5AKQA 3EDEA 4RZBA 3SRHA 2AQWA 4EXBA 2OX4A 4WGHA 3CJPA 5TQLA 5CBJA 4XTDA 3O6CA 3CZJA 4NVTA 3B0VC 1H7WA 3KTXA 3D47A 4C6PA 1BVWA 2YBVA 4JDBA 4S38A 3IJ6A 4Q4QA 4R33A 4JN6A 2GUUA 2W62A 3LG3A 4INFA 2BXZA 5HWNA 2ZRXA 1W3LA 5I3DA 3NOYA 4MMWA 3KBNA 5FJJA 3NDOA 2I16A 2RKXA 1B3ZA 4ZR8A 3LPGA 2ZUVA 3ZQ9A 3WLPA 4GJ1A 1KFLA 4NYYA 1R9YA 5K9CA 4J7RA 3S46A 4DJEA 3SFKA 1QPKA 4GZEA 1QPQA 3AHXA 3BAKA 4RZ4A 2HEJA 3SY1A 4PUWA 4AIUA 3L4UA 3O05A 1BF2A 4RPPA 1QOXA 1XIIA 1K02A 4F48A 1OG0A 1GOQA 3GAYA 4FNUA 3TMQA 4MOZA 3QY7A 1P6BA 1MRAA 2V67A 1BRLA 2BY0A 4KEUA 4CD6A 1MW2A 3QJAA 3AIVA 3GFZA 3E2RA 3QXBA 4IF2A 2D0FA 2ZRWA 3RJXA 1OFRA 1JF6A 4XAYA 4PEKA 4N4QA 3BLOA 2BS9A 5H8PA 3E0IA 3HQNA 5DRCA 5CPTA 4MHBA 1RD5A 3VIFA 3GXPA 3WH9A 3FYYA 3WK2A 1P7TB 4S3CA 4LVFA 4FLRA 1I2NA 4ZFCA 2PDNA 3V0UA 4R88A 3WEOA 3SQSA 1CB7B 3UYIA 2CKSA 1Q8JA 1JNEA 1A5AA 3W24A 2GGIA 1XH0A 4IJRA 1IZCA 2PFHA 2QKFA 1AL8A 4Y9AA 2WZTA 1XSKA 2PD9A 3LV6A 1RP9A 5HJLA 5A6MA 1HXJA 2J7DA 3H6OA 3LYEA 3TU9A 2GQAA 4ADSA 3N3TA 3PPFA 2R1PA 4C1NB 2B4GA 3TKFA 1H7OA 5SWUA 4A29A 3V75A 1ZL1A 1TO3A 4Q6XA 2DVUA 3B97A 1CW2A 2DT3A 3GDTA 4M8UA 1PYFA 2F9RA 1XWYA 1VBRA 1KA9F 3T2QA 4A05A 4WZHA 1H50A 1V6XA 1RR2A 3BLLA 2G37A 3CAWA 5A2BA 2IXUA 3OPSA 1AQFA 5CJMA 2VEFA 5CZKA 2ESCA 2EJAA 3T42A 1RSCA 5BW6A 4LUSB 2DUAA 2YKKA 5M5DA 1BVNP 3BMVA 2QDGA 2PBGA 3EMQA 3QHOA 1PHQA 3OYZA 2WHMA 1NARA 1YE6A 2PWDA 1P7TA 1X7FA 4TX9A 1L2QA 2C91A 4Q32A 1YE4A 3CUXA 1G01A 2CWXA 2DZBA 2F2HA 2VFDA 1TVPA 5H8UA 3GX9A 3DI1A 4LY4A 1KTCA 3KOYA 2HTMA 2VX5A 3MUY1 1PIFA 1QNRA 1KM3A 4MFEA 1M9HA 4XBSA 2JKPA 5I3JA 2A3HA 3A5FA 1XKJA 2VELA 1BSIA 3MVIA 3PUGA 1R6WA 3N25A 3ZVHA 1WA3A 1XXXA 1LWIA 3L4WA 4WVXA 3CM4A 1KQYA 3TCSA 1UWAA 2F6XA 3RIKA 5KZEA 3CAQA 4CKQA 3FKRA 1TPC1 4JL1A 4C1NA 5F4XA 3PN8A 1GJUA 3UWVA 3GG8A 3B8UA 4N0RA 1TTJA 3BH4A 1VCVA 3KOXA 4R3UA 4WGXA 1BVZA 2R24A 1TA3B 5CBIA 4GBDA 4KQNA 1OFQA 2R8WA 4XO6A 4FS9A 1QWGA 1UWRA 1NY1A 2P5NA 3G1FA 1DXFA 2WLYA 4LUSA 4ZZ9A 3S2CA 3SY8A 2HJPA 1ECQA 3W25A 1W2VA 1S1RA 3N04A 4BS0A 4EPDC 1H63A 3A5VA 3ARXA 4JFWA 1U1JA 4PRWA 1TPEA 2VXNA 4EKJA 2Y7GA 1AH3A 4UFIA 1MVYA 2XWDA 3WX7A 5BWFA 1U33A 2GDVA 1PZ3A 3GBEA 3Q94A 1L2UA 4HZ7A 1XH2A 2QIIA 2QCDB 3KCLA 1LL4A 1ENUA 4JTFA 3Q37A 3NUKA 2IKHA 1JI1A 3VIKA 1Q5MA 3S5NA 3KRBA 3A13A 5JH2A 3S1GA 1YBQB 4PR4A 1Q65A 1ITQA 2WVSA 3KVLA 2YCLA 5AYZA 4LY8A 4TMCA 1IF2A 2GL5A 3SO7A 2W0UA 1C93A 4Q8NA 2OCZA 5LKYA 1IWPA 2OEMA 2OT1A 2WMJA 1B54A 4GCXA 4LYKA 3ZZ1A 5BNKA 3VOJA 4GI4A 1FXPA 2JK2A 3ZR4A 1QPRA 3P80A 3W7EA 4AY1A 5CXPA 2VWSA 4O1EA 4EAMA 1FX6A 5A95A 2DQXA 1XCWA 2B7PA 1OG6A 3GE7A 1HKWA 4OUIA 3NXLA 2E9MA 1IT7A 3CASA 2F6KA 3AMCA 2QUTA 3VIGA 5E9AA 3N29A 1JCJA 3EWUA 1CEOA 1QNOA 4TV6A 1LT7A 3HM7A 1UBSA 3W7OA 4P7NA 2QF7A 3EBVA 5D9OA 3U0HA 1EOMA 4RE4A 1E1EA 1PKNA 4G6CA 2J9XA 4WDTA 3SADA 3CQKA 1JI2A 2GYIA 4TIMA 2IUZA 3A24A 3F5KA 3UG3A 1UIOA 1QBAA 7TAAA 1NQKA 2UZ9A 5IXEA 3N18A 3IIPA 2WNZA 1ICQA 2X2GA 2XH7A 4FPSA 4RUBA 3S42A 5C54A 2D23A 1HP4A 4D9PA 4JCMA 2WCSA 1TRIA 4MJMA 3TJ4A 2Y7DA 1PX8A 2DSZA 4BI5A 1F2JA 3Q65A 3KL5A 3BAXA 3IJ7A 3W2UA 4K37A 1F73A 5BZAA 2VWTA 1QJWA 3GVVA 1B1YA 3NL6A 2NX1A 2GGGA 2NQHA 3I6EA 4DZAA 4P7OA 4YL2A 3IACA 4LPCA 3SCOA 1WNOA 3H23A 5AOUA 1C8YA 3LSCA 5D2VA 2JFEX 4XTIA 1ODUA 1B3WA 2INFA 4HZMA 5HQMA 4JQ2A 3R8RA 1G7VA 4UTFA 2BB0A 3TP4A 3BCDA 5E0FA 2RJGA 1E4IA 4DM2A 2XISA 4M81A 4UTWC 1XLDA 2FVKA 2CIPA 4YS1A 4AW7A 5LXEA 3CB8A 3W1RA 1V02A 3V3WA 4W4QA 3UY7A 4BF7A 1UW9A 4DJDA 5JVLA 1Q6GA 3N2OA 5IHRA 4GIAA 3N13A 3WQ4A 4MDPA 1EC7A 2D2GA 3H2CA 4G7EB 3VGGA 1UHVA 4NYUA 3R6IA 3FFSA 4N42A 3OG3A 4HHPA 2PE4A 2Y88A 4H7CA 2J78A 1GQLA 3NAVA 4H9XA 5F1VA 4RZ6A 3ENLA 1D7FA 4O8AA 3LB0A 3PUDA 4PBEA 3BLKA 2DJXA 3TVAA 1PV8A 2VEIA 5CGQA 4HNTA 4QM1A 1SZFA 4N2YA 3IJ8A 2VT0A 5CPSA 4AZHA 1WKDA 1M3UA 5F4WA 3H24A 1EBGA 4ZE5A 4LAOA 4W5ZA 5RUBA 1V79A 1RQBA 2BODX 3WLJA 2YSWA 3BV7A 4MF4A 4B3KA 9CGTA 1BYCA 3WBEA 1E71M 3AROA 4LB4A 2WXDM 3EYPA 3CQ0A 3L2LA 3CNYA 5EMMA 3L23A 3APYA 2AQOA 1H11A 2FIQA 2FZBA 3DESA 1V77A 4XV0A 2V3DA 4QNWA 1JFHA 4G2DA 3TYEA 3MI3A 3TFCA 1C8VA 2X09A 2YYTA 3UWWA 4IP4A 4GHRA 4D71A 1TFVA 3PZMA 4QHRA 3PJTA 4WXYA 3VC6A 4K1GA 4IPNB 2WC4A 3AZSA 4LUJA 5FEWA 1NJJA 2IKJA 1FWHC 2GGHA 4C7GA 2EKGA 1QO5A 2C7FA 5DT7A 4W86A 5G4EA 1JPMA 4MDOA 4M56A 2AMXA 1VPYA 1GT8A 4OTKA 4YHGA 7REQB 4C6OA 1KXQA 1O5KA 1P43A 3VZYA 2PU1A 2Y5JA 4UR9A 2BGQA 1SFJA 4Z1BA 1JQXA 1NP2A 2ZZ6A 4Q4RA 1JZ6A 1KKRA 2Z1VA 3NQEA 4FLOA 4ZVJA 3L4VA 5AECA 3IIVA 1YDVA 2I5GA 1FWRA 2Q02A 2HWGA 1MQQA 3GHUA 3CL7A 4HBKA 3WJSA 4OUEA 4DI8A 1C90A 4J1OA 4CU8A 2X0SA 3EGJA 4AHQA 2G3FA 3SCUA 4JEJA 1SM9A 2C6QA 2QJGA 5D32A 3WQDA 4F0RA 1V0LA 3SIMA 1GEQA 1F8MA 1GHSA 4AIBA 2WZEA 2RHGA 1HZYA 3AQUA 3WNPA 4R7JA 3MKVA 3TW7A 3XINA 3VGDA 5AC4A 4PRTA 4ICCX 3IV3A 1MZHA 1EPVA 1HVQA 4NZ5A 4LB3A 1R38A 3F5JA 3AAMA 4Z1DA 4KH2A 3M0MA 5CGMA 3L21A 2AL2B 1IEIA 1LUCB 1HO1A 3RPTA 1LRNA 2PWGA 5HR6A 5CKSA 4US6A 2J8TA 3AYSA 1H5VA 1JEZA 4DEFA 4F0MA 1E9ZB 2ZOXA 2BNJA 2QYGA 5ABEA 1AQHA 2IPFA 4MNKA 1GOIA 4MZ8A 4Q4SA 5G2HA 1X39A 2ISDA 3U8GA 4JIHA 1V3JA 4RXGA 4MZ1A 3GB6A 5IBXA 2GPTA 1E4LA 1M6JA 3P93A 4ZGYA 3OB8A 2ACSA 5F2IA 3OVGA 3MHUA 2O9PA 2VRKA 4WOQA 3W85A 2V63A 3PFRA 1V0MA 4S3DA 3L4TA 3GHTA 3SECA 1AJZA 1SSDA 1UZ1A 3A21A 1OX6A 4L1GA 4Y9NA 5IFTA 1IEWA 4ZE4A 5CH9A 3TCEA 2AAAA 2HXTA 4CVWA 5U7SA 1LL6A 2H3DA 4XKMA 1KM0A 2FB3A 2TYSA 2ZZ4A 2X8RA 3QC3A 3HJEA 1TR1A 4GNKB 1SO4A 4A3QA 1W31A 1UUMA 5EBAA 1YXDA 4ZXLA 3EWYA 1M7PA 3DKLA 3DG6A 1X97A 4MGGA 1LUCA 4HNLA 4AWSA 5HA7A 2XVGA 1VHNA 4LF1A 2DP3A 1MUCA 4FNQA 2IPGA 3M0YA 1S5WA 4XD6A 3G8RA 2ZWYA 2C13A 1YIXA 1DHPA 2ZZ5A 4YLWA 4NZ4A 3MJYA 2WANA 3FOKA 4ZENA 5EMUA 4UMCA 4H7ZA 4FOUA 1JZ4A 1V3IA 2AAMA 1JUKA 2VP8A 4ZTXA 5C9RA 4KW2A 4YCOA 3N14A 3EB4A 4E4UA 1WPCA 1WE5A 4I6KA 4RR4A 3APTA 1KV8A 3AXKA 1VH7A 2PRMA 4GY1A 1G9HA 1FFQA 3HQOA 4Q4PA 3RDKA 1R47A 3UY8A 3WLTA 2A3EA 2P3EA 2OLSA 1CT5A 3AIUA 4HHHA 4B5TA 4NILA 2C1HA 2Z2BA 3IRSA 3KM8A 3KOFA 4AQLA 1NDZA 2OO6A 1ZY9A 3RCNA 1NOFA 3SW6A 3NPUA 1DVJA 2WVVB 2NQ9A 4V15A 2B0MA 1RCXB 4BKNA 5XIAA 2GWNA 4FMVA 1SZRA 4TTGA 4Y9MA 2J77A 2PDXA 2CHOA 3E12A 3GDBA 3DUGA 1LOSA 4IIDA 1GYNA 4IFRA 1XYCA 3ARTA 4B5VA 1PZ2A 1X1NA 4O12A 2BVTA 4IM4A 4YVVA 3C2FA 4OFCA 3PTMA 4JHMA 5CZJA 3B8SA 3L5LA 3SUSA 4G56A 1G0CA 4LYRA 4LVDA 1DWJM 2YL9A 4TVDA 3BAWA 1Z41A 1BYBA 1EJRC 2QDDA 3M07A 4O13A 1FQ0A 1OGBA 1K8XA 2DQWA 2P53A 4DO6A 4HIBA 2GQ3A 4NJGA 1KXVA 5FJIA 1VFTA 3REQB 1KTNA 6TAAA 4QG9A 3F03K 3VKJA 4JQ1A 2ISFA 4YTRA 1WX0A 1W5PA 5GNYA 1Q85A 2EPHA 1VZWA 4ZO7A 3W26A 4H01A 3MA8A 3GXTA 3OIXA 3WDIA 3T09A 5FIPA 4QLJA 1KQZA 4J3VA 1GYLA 3R8HA 1DJXA 3FXGA 3GWQA 3W1LA 3NYDA 1S2WA 1E0TA 3MJMA 2PGWA 1UR4A 2WOQA 2V6AA 2FPTA 2F7FA 3Q67A 2VRQA 3MUIA 2P0OA 3S6DA 3IIZA 1B9ZA 2CZEA 4S39A 4CEXC 3DI0A 2GK1B 4Q7IA 3EDJA 3TNOA 2QNEA 4EX4A 3MV01 1ITUA 1FH9A 5KEZA 2DPEA 3ZO9A 3JU2A 1OM0A 1TMQA 4NQ1A 2Z28A 1C29A 1Y7VA 5A5WA 5TBOA 3U48A 2XGBA 4S1FA 5BOOA 4RE0A 4WKHA 4O4WA 2Y70A 3PR2A 1OF8A 2PDFA 3R11A 2DEPA 3G0XA 4L4MA 4CGTA 3HFYA 1JAKA 4AZ6A 5DXYA 3REQA 5CC7A 4J2MA 3UQNA 3W6LA 1MYRA 3G1YA 1E1CB 4HTBA 2VENA 4ROPA 4AZCB 2XWEA 1LTDA 3EDFA 3WUEA 2CESA 2VJXA 3W7NA 2CPUA 1TE1A 4IMCA 1JDCA 2XHYA 2XM1A 4WLCA 2A3CA 3D3AA 3UWQA 5LNSA 1RLCL 1WZLA 3SCQA 2WWDA 3RRXA 3PUEA 2B7NA 3NPXA 5CQ1A 3NSMA 2A85A 2PDLA 4KFOA 4PTVA 4ZQOA 4AVFA 3GXFA 2X0HA 3IAQA 2HROA 2NQLA 5LYRA 3AS0A 4OKDA 1UB3A 4R85A 5B7ZA 1HJSA 3TMLA 3VD3A 3VA8A 1EX1A 4MWAA 2DT1A 1UOZA 5LIXX 4HNNA 2WZHA 4LS2A 5BXPA 3XIMA 2O55A 5BYWA 4NI8A 1MXDA 2UY2A 2ZUUA 1BTMA 4M7SA 1D3GA 2J8FA 1U2YA 4AMAA 2OO0A 3E6EA 3HJZA 1WZKA 1Q2RA 2XIQA 2PDIA 1RP8A 1KXTA 3S5ZA 4KRTA 4AISA 4DX3A 4CNOA 1UPMB 4QDWA 4NAFB 4F0HA 5C2CA 3UEQA 1EP2A 1E1CA 1BHGA 1JL8A 1CWYA 1GWJA 3HF3A 3V0SA 1V6UA 3TZFA 3W2JA 5LA2A 1VAHA 3HQ1A 1G4EA 3FA3A 3W1UA 2G0WA 3N9KA 3RR4A 3S83A 2VKZG 1CPUA 4IGNA 2BHZA 4WF7A 5BROA 3F2BA 2FJKA 5AZ0A 2TRSA 1XRFA 2Y5EA 3SDOA 5IRPA 4NJIA 1EGMA 4RCXA 4A8IA 3TE9A 2JEPA 4X63A 3DFSA 2DU2A 4E38A 3LTSA 1ICSA 5HQLA 3EA3A 4HGXA 5AC8A 3DX5A 5DMMA 3VD7A 1TYGA 3LRLA 3MHFA 1Z42A 4CN1A 3LCGA 1QCWA 2WPBA 3A4XA 1VFOA 3PC0A 2PCEA 3CHVA 1LF1A 3TYCA 3CQHA 5G4HC 2VOMA 1EP1A 5J04A 1SFTA 2ZRUA 4ZQNA 3T78A 1SPQA 2J9YA 3QZAA 4GZIA 3NR0A 2VURA 4G1KA 3S8HA 2MNRA 1Q8AA 4HB7A 4M1BA 1KBLA 4TX6A 3G6LA 3NVTA 2HQAA 3SRDA 3IRDA 4YYFA 4TXEA 5C9WA 1W3HA 3MT1A 2F6UA 4M24A 2OKTA 3UZ5A 4C6IA 1TV3A 1XW8A 4GUGA 4L65A 3DG3A 4ATWA 2O4QA 3AU2A 2DZTA 2PC8A 1ZRQA 1ALDA 1V3LA 1P4CA 1VCGA 2ZZ1A 3V0TA 2WKGA 3W29A 4D8LA 1XSJA 4N7QA 4JICA 2Y62A 3N15A 3STEA 1HW6A 1PCWA 4L9ZA 3T81A 2BGNE 4R9OA 5CZ0A 4CU7A 4EK7A 4HPHA 1WZAA 1BWKA 4PN2A 1VEPA 4RV8A 1EYEA 1ZHAA 2E9BA 4FNSA 5D9NA 4GUJA 2L5HA 4WSHA 3K2GA 5BRBA 1X6UA 3L9CA 3AJ7A 3PANA 3W1QA 4J9JA 4JGDA 3WFAA 3QKZA 1A80A 4IIHA 4QRNA 2WMIB 4RW3A 1NM9A 2WC7A 3JS3A 1H51A 2X16A 3V1HA 1YHTA 3SBFA 4K7VA 4GINA 3MP4A 4RK8A 5EMKA 3MVTA 3UWZA 1OY0A 3AUOA 3BVJA 1XD1A 4YTQA 4XVDA 1ELSA 3W0KA 2Y4SA 1R7OA 2WJDA 1W9BM 3U4FA 5DMYA 4LBUA 3WD4A 4F4RA 4PUEA 5C55A 1DQUA 3VOHA 1UR9A 3GTNA 3KE0A 2CLEA 4NJHA 4Q8WA 4K38A 1OFAA 2Q8ZA 4QAIA 2JQXA 1RVKA 4GPNA 1HG3A 1DOSA 4L61A 4ERAA 1E6RA 3H8AA 2UY4A 3ITCA 3QHNA 4JHZA 3VABA 3D6NA 3NM3A 4MSSA 2VGIA 1OFEA 3TW6A 2HPIA 3WQEA 2Y7FA 5HMSA 1NOUA 5DMLA 4L56A 3RCMA 3WH8A 4C1KA 4PMOA 3PWGA 1HKKA 1UUQA 1N7KA 2FMOA 2Z27A 1FDZA 1US3A 4HMNA 2CYGA 3R25A 2OMAA 1PPIA 2NUXA 3CEPA 3SQMA 4GC3A 3NZRA 1P1MA 1V03A 2FGZA 3L5MA 2PMQA 2ZZ3A 1UC5A 1X1ZA 1GVOA 1W5QA 3BC9A 1KO0A 3S2MA 1JJKA 1KBJA 4YCPA 1E0XA 3VNKA 5I24A 3LXAA 2E6AA 2Y7EA 3OZYA 4DAFA 4KESA 2BOFX 4EF9A 1J0JA 1HJWA 3MKCA 4UOJA 4Z2KA 1QFEA 1XBZA 1HUVA 4KEVA 3UFYA 4HN4A 3PSVA 3FDKA 1W56A 2A7RA 4IZGA 2EF9A 3SR7A 1EDGA 4LNYA 3UGRA 4UZUA 1KC7A 4FLQA 2W79A 2CWNA 4UB9A 3KHJA 1FCQA 3VC5A 3WDQA 1VPQA 2HK1A 3GR8A 2H8XA 1Y65A 3S0CA 5CSYA 3LM7A 1EDTA 4N9EA 4KCWA 1ONEA 4LRSA 1SMDA 1Q6QA 2E09A 3W6YA 3FJNA 1I4NA 2VD8A 1KFKA 3SM0A 1XIJA 3ZLHA 3PNZA 3H70A 4D6CA 1J6OA 1FWAC 2J6VA 2HNHA 4YWSA 2FVLA 3L4YA 1DBTA 1UR1A 2XZ9A 1CNVA 1DJGA 3HURA 4H7VA 1XL9A 3WENA 4Q8OA 3LMZA 1XUUA 2Z4GA 1KM6A 4W5UA 2Y0FA 1EO7A 2VQTA 3OVRA 3E3HA 4UTUA 3H2NA 4D1JA 2XSAA 4S2BA 3MYPA 3K4WA 2V30A 1IWBA 3LZ5A 4POCA 1B90A 4I5UA 3VMPA 3GTFA 3B8DA 1Q6DA 2DW6A 1CXEA 2QVHA 3BLEA 3HG5A 3LBCA 2QPUA 1HTIA 3BQ6A 2Y1HA 3BURA 3HG4A 4E6MA 3WDJA 1JZ5A 4ZB2A 3A23A 5CBBA 3MBDA 4Y6GA 2PWEA 3C0JA 1H7RA 3EWCA 2OZ8A 4LEFA 3R4IA 5TIMA 4P7RA 5EBUA 5AHIA 1VD6A 3MANA 4WUIA 4IQJA 1Z48A 3W23A 2BVWA 3A4AA 4AEFA 4JTDA 2OSXA 4PFHA 3WNKA 3CAKA 3I7QA 3V35A 3MUXA 2XN1A 1O6IA 3CZKA 2KAUC 3IV8A 3NQCA 1CGTA 2HMCA 4AVOA 1XGDA 4F9DA 1US0A 1XLIA 4DF1A 3RU6A 4JIEA 2V2HA 1EJTC 1GK8A 4JTUA 3PK7A 3W86A 4TVCA 8CGTA 4G8TA 1JDAA 3VKKA 5TNVA 3CV1A 3A4WA 3NSNA 1KM4A 2WM1A 4LT9A 3LHVA 4E2DA 4WK9A 3WD1A 3SI9A 5H6HA 3WF1A 1WDSA 4YN5A 3KAOA 3M5XA 1FKWA 2ISVA 2CETA 1B3XA 2X1TA 2DORA 4Z0SA 2OQLA 3ZJ7A 2VUYA 4PUDA 4P8XA 4LWWA 4OU1A 3ABRA 3S9YA 4FSAA 4N4PA 4JTQA 3C0LA 4L6DA 2WQDA 4YIWA 4W89A 4O14A 2VC6A 2W66A 4F79A 5JU6A 1WBJA 1SO3A 3DFPA 3RLUA 3D46A 2J75A 5B7YA 4JFSA 2XN2A 2TMDA 4B9YA 1BWVA 4FXJA 4XZNX 3WD0A 5I5RA 1XF0A 4PA8A 3VD4A 4WD0A 3BLIA 1AZ2A 3QMTA 2OELA 1KLZA 1RALA 4QG8A 2DSWA 4O1BA 3ABOA 2YB4A 4A3YA 3VD5A 2Z2UA 3W28A 5JUVA 4LUTA 1TX0A 3BARA 1SR9A 2E8YA 4WKFA 4OOZA 2YR1A 1EF2A 1OT1A 1R87A 3CWHA 3M16A 2EPNA 1OBAA 2NSXA 2CC0A 2BP1A 3N12A 2BVYA 3B0PA 2YIHA 1TVLA 3R8GA 3M41A 4KKXA 1XDMA 2NT1A 3ARPA 3EXRA 2E0PA 1FWIC 1ISXA 4HPXA 1UROA 1GQNA 2PGFA 1FFRA 4LQ1A 2I1OA 1PIIA 3ATZA 1J4EA 1ZBCA 3VGFA 2WK2A 4O1FA 3NG3A 1B57A 2Z0IA 1KBIA 4U33A 3V5OA 5CPLA 4FAMA 4JTTA 1QUMA 1V8EA 3WQOA 5HANA 2HNEA 2VM8A 1SQ7A 1W0MA 1XG4A 3KCOA 3PZQA 3TTYA 1DWGM 3WBYA 2TSYA 1GCYA 3WLIA 2GOKA 1M5WA 4B4FA 4AUBA 4B4HA 1KGUA 2C0HA 3NEHA 3FJ6A 5EPDA 3AZRA 4H9ZA 3EOLA 5HMFA 3VIMA 3ABZA 1AMKA 1SO5A 2G96A 4Z0JA 2W67A 1XYZA 1QI0A 4MTVA 3IUHA 4H83A 3NDYA 2EKCA 3KTCA 3CIXA 3HIJA 4Z2GA 4WCJA 3DFOA 4E3VA 2HVNA 4MJ2A 4KRUA 4D8AA 3ME3A 3TR9A 4EWJA 1O68A 4HHLA 2RDTA 1NQ6A 1FH8A 4AWTA 4NASA 1Q4WA 2QUUA 5HWMA 2RDWA 4Z17A 4AXNA 2PD5A 1PX3A 1F9CA 4AHOA 2BXVA 1PAMA 2YL6A 4UTTC 3BZJA 3LHUA 5HMEA 1V6TA 2DH3A 4DBEA 3A47A 2CW6A 3G0SA 1GGOA 5MHBA 2BDQA 1AH0A 2ZTJA 3KL0A 4D6IA 1YTDA 5I2UA 1RJQA 4E8CA 3UG5A 1TV2A 2TAAA 4PZVA 3VVGA 1GW9A 3KP0A 1RJRA 2R1KA 3B8IA 3CH0A 3M0LA 4EWND 2NV1A 1HL8A 3T0TA 2Z1KA 3GBDA 1LRQA 1OGSA 1XC4A 3PTQA 2D1ZA 3U4AA 1JF5A 5IHSA 5D02A 1F61A 1YPXA 2R9RA 4ZXOA 4NU7A 3OBAA 2FFIA 4JZ5A 3M64A 4C91A 3CMJA 4J3ZA 3T1GA 4IIGA 5FEPA 2X7WA 1Y5XA 3K8MA 4DBWA 4ZEPA 1NWUA 1XX1A 5FF3A 5BU9A 1JR1A 2A7NA 4PL2A 3VK5A 3LCXA 1TE6A 3MSRA 1I9CB 2YW3A 1XIGA 3MQTA 5HWJA 3OA3A 3STFA 2EG8A 4DVOA 5TD4A 4X2PA 3VZXA 2WMKA 1T8QA 4KS0A 3EOOA 4OVXA 4IWWA 1UKOA 3VAVA 3RM4A 1EL3A 3H2EA 2V8ZA 3WEMA 5CG0A 1P1XA 4B90A 3OZMA 8TIMA 4BQ5A 1Z6KA 3PBUA 1IXPA 2Z7GA 1LM1A 4O16A 5EY5A 1KD0A 2CU0A 2BZNA 1ZU8A 4W85A 2EJ1A 3WDRA 5JMUA 2BG5A 2V5KA 5FF7A 2GJRA 1YDOA 2VCCA 3S2JA 1LZOA 3LTPA 3QPYA 2XINA 5G4WA 2OWCA 4NRSA 3W7MA 3N2MA 3PBGA 2IQTA 3HB9A 3THQA 2QCGA 2PGRA 4PYSA 1XYBA 4YVXA 3CEUA 2WSKA 3TC6A 2XIJA 4L6HA 3UNDA 2V2DA 2DSUA 3OHIA 4BQ4A 3GR7A 4E8DA 1WKYA 2P88A 7XIMA 3VX1A 3BSGA 4X61A 4A8RA 4ASTA 4KERA 4KEMA 3SAZA 1QAPA 4BQ2A 1I45A 3APGA 3FEMA 1R9XA 5AYYA 2VEGA 1UA3A 3KTSA 1VBJA 1I2QA 2XGZA 4ZO9A 3KX6A 1AL7A 1Q4NX 3ZSTA 1R3WA 3UR7A 4E2OA 3THUA 1Z44A 3UGVA 3N11A 2O7QA 3ARZA 1EA9C 3UPMA 2OGYA 4AWEA 1TJ1A 4OBTA 3HA1A 4Z1AA 1FRBA 3B40A 3BG9A 1C9WA 4IICA 3H54A 3PBMA 1JPIA 3KW3A 1NWSA 4I8DA 3PZVA 4DJFC 4ACZA 4D6HA 3HO8A 3M0XA 5D04C 4JYEA 4AEEA 4BF9A 4H6QA 1F3EA 4H19A 3C61A 4DXVA 4S3JA 3NL5A 3BCJA 4F2TA 3AU6A 4WHBA 2QPXA 1C7TA 1DIDA 1CECA 3OGRA 4D8ZA 4QQ3A 4Q22A 3OA5A 3O0FA 3A3XA 4J4KA 3I4KA 1XIBA 3OTRA 4A3UA 2ZUMA 3O06A 3LCHA 4NZCA 3SZ8A 2DH2A 3FAWA 3PPCA 3FAXA 2WNWA 4H8UA 2ZICA 1VJIA 4IJBA 4XSLA 3B06A 1KRBC 3AIWA 4QE5A 3W7KA 4QS6A 2WHLA 3AXHA 1YPFA 1EGVA 3ABXA 3W73A 2GWGA 5E09A 4AD2A 4CVUA 3C6CA 3FA4A 2ANUA 2V5BA 1X8FA 3KBMA 1OFBA 5EMJA 3W7JA 1CGXA 1LCOA 1OX4A 3E1F1 3WQ6A 1X6LA 1A5MC 1O5RA 3P0XA 4NAEB 4QSHA 2WHKA 4F9JA 1TMLA 3WH7A 1KBKA 1CX9A 1LLOA 3V1PA 3RF9A 2FLIA 3S2NA 4JYFA 1EQPA 1P48A 3LCWA 2DZWA 3ZT5A 4MYXA 2CXEA 3TLQA 3TXVA 4Q8MA 1XD0A 2PAJA 3WDPP 2F38A 3UP8A 4X0VA 4RL3A 2WCGA 1SR0A 2HS8A 4M6UA 1X1OA 1B3VA 1QW9A 3HZ3A 4GVHA 4B3LA 1A5KC 2DZUA 3IVTA 1BAGA 3N17A 3NQDA 4DAIA 4AFYA 4REQB 4IFKB 4EVZA 2PLJA 2YFNA 3BTNA 1XS2A 4BEQA 1ADSA 4D6FA 3O15A 3N9SA 3LRKA 4KIRA 1W9PA 2I9EA 1A5BA 1GEHA 3LCLA 1MW3A 2IS7A 2IPWA 1L6FA 3WMBA 4HCHA 1XRTA 3BAJA 3BJFA 4IQLA 1DPMA 4DJDD 3QTGA 3BGAA 2RGLA 3AMDA 1EJUC 4K7YA 4FXRA 1ZUAX 4XWUA 4CNPA 1IWAA 1MEWA 1CGVA 4K6AA 2PP1A 1H41A 3MMUA 1AMYA 4YJ5A 3B4UA 5D8WA 4UZSA 5I77A 4J5NA 4JY9A 3F4WA 4DIAA 4FI4A 1UR0A 2H6RA 1X98A 1LOQA 1SZGA 1S39A 2VGGA 1BFNA 1ZTVA 2NUYA 3RILA 4CQDA 2A3BA 1VPXA 1IZKA 1EOKA 4QQUA 2X30A 4O1DA 3HPZA 3GH7A 3K46A 3MCOA 1GTHA 1NELA 3T0AA 1X6NA 4QSFA 4S3BA 2CLOA 1AA1B 1TUFA 3KUMA 4O4VA 3CL8A 3PM6A 4E0CA 5A6LA 3MYOA 2JF7A 5DT5A 4JKMA 4PUKA 5DCDA 5K9XA 2NUWA 3CZ8A 3UETA 3WFLA