3WQDA

D-threo-3-hydroxyaspartate dehydratase from delftia sp. ht23 complexed with d-erythro-3-hydroxyaspartate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHACATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
total genus 145
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqdA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqdA02
1W8GA 3HURA 4LUSA 2DY3A 3B8TA 4ZGYA 1QU4A 1NIUA 3ANVA 4QHRA 3AWNA 3BTNA 3NZQA 2NVAA 1B54A 7ODCA 2RJGA 1TWIA 2YXXA 3C5QA 4A3QA 3CO8A 2P3EA 3OO2A 3VABA 1SFTA 3WQEA 3WQFA 3HA1A 3B8VA 5BWAA 4PB3A 3KW3A 1HKWA 3R79A 3B8WA 4WR3A 1L6GA 2PLKA 3WQDA 1D7KA 4DZAA 1NJJA 5FACA 2SFPA 1XFCA 2VD9A 3E6EA 4PB5A 4BEQA 3N29A 3WQCA 4ILSA 1L6FA 4LUSB 2PLJA 1CT5A 5GJNA 2ODOA 4LUTA 4FS9A 4XG1A 3B8UA 3GWQA 3UW6A 4PB4A 1VFHA 3N2BA 4ECLA 2NV9A 1KO0A 5FAGA 2TODA 1EPVA 1SZRA 1XQLA 3LLXA 3CPGA 4BHYA 2QGHA 3SY1A 1HKVA 3MT1A 1FTXA 4BEUA 4Y2WA 5GJMA 5FAJA 4LUYA 4LUTB 4DYJA 5GJPA 1RCQA 3AWOA 1KNWA 4V15A 3NZPA 1VFTA 3E5PA 2VD8A 1VFSA 4AIBA 4BF5A 5IRPA 3ANUA 2OO0A 4KBXA 2O0TA 3WQGA 2J66A 1XQKA 2RJHA 3S46A 1F3TA 4XBJA 1TUFA 3N2OA 2ON3A 1BD0A
chains in the Genus database with same CATH superfamily
3KBSA 3W1LA 4A4AA 4IQDA 3L5MA 2DJXA 1XH1A 5A2BA 1EO5A 1XRTA 2W61A 3UA4A 3M43A 4FI4A 1ZCOA 3ITGA 1H11A 3NQGA 3VGGA 4UTTA 2DPEA 3IANA 3ZVHB 1W2PA 2QXWA 5JMUA 4DUOA 2VEGA 3V5OA 3U6WA 1Q6QA 3UF9A 2UY5A 2Z29A 3MWCA 4H1ZA 4KGJA 4QDWA 1E4MM 5DEZA 5LIWX 3EXSA 2J9ZA 1Q7QA 5T26A 4CD7A 1LRTA 3TC6A 4YJ5A 1W6TA 4PB4A 5DMNA 4MWAC 4Q4MA 1VJSA 3C2EA 1LCOA 1SZRA 1VYSX 4AF0A 4HHMA 4PBGA 4UTWA 1ZP4A 2QGHA 1H5YA 4LVGA 4J27A 5A2AA 4H41A 3S4TA 2HWGA 5B7YA 5H8MA 3P7YA 1UH2A 1BYDA 2VRQA 4B5XA 1O5KA 2ATMA 1KXHA 2GJLA 2D2OA 2WC3A 3WFZA 3VC6A 3RCNA 2AQOA 3WH7A 1S39A 4PUDA 3K8KA 2WXDM 3LI1A 4HN8A 2PDJA 3ZS4A 3HURA 4GQQA 3BOFA 4TXEA 1FOBA 1GEQA 2ACUA 5EPDA 2BY2A 5C54A 1ONXA 5AC6A 3GYEA 1ZBCA 1UZDA 1FHLA 3STGA 3BMXA 1K7EA 1XLGA 1E1FA 3W53A 3H2AA 1HKJA 3PTDA 3WQEA 3MUCA 3OQ8A 3RYSA 1JNDA 4YYCA 2G41A 1L8PA 2QCDB 2VGFA 1XHGA 1IF2A 4AD3A 1O95A 3GY1A 5IHSA 3LHZA 4F9JA 4YTSA 4RE2A 1TJRA 4EANA 2ZX6A 4GO8A 5DMYA 4HCLA 1JJKA 1TJ0A 1V0KA 2Y7EA 3GHUA 3G0SA 3VGBA 3SQMA 4U31A 4FF7A 1KCKA 4IX2A 3KDNA 4GJ1A 5F1UA 3WNPA 5HINA 4GUJA 4S3GA 4TTUA 1FCBA 3TV8A 4H01A 1XGDA 1UJPA 3I6TA 4JTDA 4S3BA 1NVMA 2PUZA 4JTKA 4W8AA 3A47A 1WBJA 4TX9A 1B4EA 5IDIA 1UKOA 2H8ZA 4Q6XA 4MSSA 4HPJA 4KERA 2BLEA 2CESA 4I9TA 4JZ5A 1CGWA 3WEMA 4FLRA 3RFAA 1OK4A 1H51A 1NAL1 4C6JA 1U1UA 4QQUA 4AXNA 4JY9A 2HSAA 3NUKA 1GTEA 3BAXA 3A23A 1V5XA 3N9SA 1DWFM 4HU4A 1OFOA 1KM3A 1RJRA 1Q66A 3DFTA 1PX3A 4E2VA 4DJFA 3N11A 1CGYA 3AS1A 3OA3A 3LMZA 3KVKA 1XYCA 2XH0A 3B8DA 3OOQA 3W6YA 3NQ7A 4HHHA 5T9BG 5CAHA 3SRHA 4LUJA 1GVYA 8XIAA 2CLIA 3W84A 1XCWA 1HP4A 4ZO6A 5EMUA 2Y24A 2YCLA 3T42A 3CV6A 1AL7A 3ABRA 2EHHA 1BFNA 5G2IA 3UWVA 5LIXX 2ZXDA 2GSHA 2DJLA 5A6TC 3HV8A 1JIBA 1J12A 3SCNA 3TQKA 4YWIA 3ZVHA 4IQEA 1UKPA 1KNWA 4E4PA 2WBGA 3MBDA 5FD0A 4IOTA 4R7WA 4YCPA 3WMSA 2EF9A 5J8LA 4KWWA 1SW3A 1BWVA 4DZHA 4LT9A 3CIWA 3UEQA 4REQA 3VFLA 4DELA 4H7VA 3GU2A 4UQBA 2WMIA 2QIIA 2DY3A 1OVDA 5K9DA 3UNDA 1FP8A 1VHNA 5I24A 3VNZA 3P84A 1S38A 1DXIA 4R34A 4B9ZA 4CN1A 4DNHA 4GKTA 1YPXA 4XZWA 4DI9A 3FJLA 2IPWA 4NP7A 2OLSA 4B90A 1J0JA 2QJMA 3WK2A 3PB2A 2Z25A 1C9WA 4J3WA 3OIHA 3E6EA 4GIYA 1UROA 2QGYA 4OHQA 1V93A 3MUZ1 4INFA 2ASHA 4O11A 1KM1A 4C6IA 1DJNA 4F79A 1W9UA 2RUSA 3P61A 1L0PA 1TWZA 5HAOA 5D38A 4GGHA 4RXGA 4I8YA 1LM1A 5I77A 2AMXA 4DZ5A 1GGOA 1GOMA 4LY4A 3SRDA 1JD9A 2R1MA 3TA9A 4AH7A 3FA4A 1M65A 1VIWA 4JX4A 3QLDA 2E0PA 4S2BA 1F6YA 3V18A 4LCQA 1ZZMA 4TVDA 4ERAA 2ANUA 2EXOA 2HBXA 4MJMA 3CZEA 4LCSA 3LDVA 1RBLA 5DX7A 3IVSA 4S23A 5CPSA 2DVXA 2O56A 3SFKA 4KCTA 2WM0A 2I56A 2W67A 3FHAA 3AMCA 3VIHA 4DPQA 4AY7A 1QNRA 3S5SA 3L4VA 1K6WA 2J77A 3ORWA 5EYWA 1WDRA 3P80A 3TEVA 4IXXA 2GGJA 4MAVA 3RG6A 3VOGA 5GPRA 3C4UA 3S5YA 3CEPA 2GL5A 1J8VA 4UMBA 2WNWA 2Z00A 3CZLA 2HVMA 1N8WA 4IXHA 4AMCA 2VOMA 4O14A 4YLWA 2QNEA 2ZX9A 1RA0A 2J6XA 7TIMA 3BLKA 1J6PA 1VJIA 3CEUA 2XH4A 3IPWA 3GXDA 3GUGA 3TFCA 2X05A 3LGGA 1PKNA 3KBWA 5T91A 3W82A 1JZ4A 1BKHA 1BGAA 3SN0A 3WF0A 1X6NA 8RUCA 1GKRA 1FWIC 4LW7A 4AUBA 1BSLA 3I7QA 3IJQA 3FAXA 4GH1A 2FZBA 1SYTA 3UXKA 3R12A 3VX0A 3G6MA 4ZSUA 2WAGA 3L12A 1BHGA 4YS1A 4BF7A 5CBJA 2VEFA 1F61A 4NNAA 3MV01 1AFSA 3ERPA 3WJSA 2EPMX 4Z42C 3ABQA 1TTPA 5C0QA 2UBPC 3B8IA 2J24A 3O6YX 3VE7A 1AQHA 2XFWA 2XN1A 1JAKA 1SMAA 1KTNA 2CEQA 2NVCA 3CYVA 2ZTJA 4A2RA 4MZ8A 2LLEA 1R3YA 1OFPA 2ZXAA 1V6TA 3LRLA 3TSDA 1WOBA 4AYGA 1LWHA 3A9BA 1HP5A 1C93A 4WY0B 1A3HA 1TV7A 3VKDA 1E6RA 3DHPA 3THAA 3OJGA 3WD1A 1WDWA 3L4WA 1VBJA 1YTEA 3I7RA 2YZRA 1QASA 3DGBA 2D20A 3TW9A 4GK8A 3QY6A 3EWBX 5A94A 4J2MA 1XIEA 1HL8A 4FX6M 1WP6A 1S2WA 4W8BA 2CLHA 1U2YA 2QJIA 3NZPA 1TJ2A 4A3YA 1SO5A 1A0CA 2DT1A 3N2XA 4E38A 2PWFA 2GQAA 4GZIA 1NWTA 5EB8A 3CLMA 2D3NA 3FYPA 3WUFA 1PTGA 2QDGA 5KETA 4HB7A 3WK3A 3G22A 4DQWA 3Q45A 4MJ4A 3R7MA 3LCWA 1RBAA 5JU6A 1UQZA 2NQ5A 4QROA 4YNGA 1O5QA 5LZLA 4IL2A 4JAWA 4XTDA 3EB4A 4LAMA 2IMRA 3GS6A 2QCEA 1VRXA 1E4LA 1ZGDA 1XUZA 2BY3A 3W7LA 2XISA 2TAAA 3ZJ8A 1E6NA 4BQ5A 1XFBA 3L65A 4L9YA 1G7VA 3SGUA 4OIFA 2GJNA 4XD3A 3SZ8A 1KFLA 2ZXBA 1NWSA 2I16A 4FXJA 3CYJA 3IARA 1H7OA 4A05A 4JFTA 4LNYA 4I6KA 2ZZ2A 4D6IA 2XFRA 1YXYA 3N2CA 3MPGA 2GSJA 2NV1A 3BJTA 3W28A 4XO6A 4GIRA 3L4ZA 5CH9A 2X7WA 1JZ2A 1TKKA 3H2EA 1S5MA 1BWKA 3GU1A 1QPNA 3B0UX 4G7FA 2Z6JA 3HBLA 1XLEA 2CWNA 2ZYFA 4GNVA 1PWLA 1QMLA 2Y8VA 4C7FA 4QG9A 2O92A 2PB1A 3W7EA 4XD6A 2DSVA 4UTFA 1QI2A 2A5HA 3EA2A 3KLLA 5I7GA 1W37A 2BY1A 3MB9A 2QUUA 4DM2A 4UFJA 3EKZA 4XIMA 3NAVA 2XVGA 1F3TA 1ZS2A 3QM3A 3QV8A 1AUSL 1B0IA 1E3ZA 3PUEA 2W92A 4GY1A 3SGGA 3VKJA 3UERA 4Z0JA 1W8GA 1MEIA 3QOMA 1QW9A 2QKFA 2ZC1A 3OA5A 4TOQA 1I2RA 2VR2A 1M3UA 2YCEA 2QEZA 1ITXA 4LVDA 3W88A 3MI2A 1J0HA 3N12A 1IR2A 1XUUA 3FLUA 2B7QA 1K77A 1NTHA 1ENUA 1PWMA 4JTSA 5B80A 4W86A 3EWDA 3VMOA 4O13A 1IYXA 3PULA 4YTQA 3B8WA 4FNRA 3NL3A 3H2MA 1TE1A 4PBFA 5KZMA 3T4CA 1AD4A 3JW7A 3IJ9A 4ICCX 4LVAA 3VDGA 1FQ0A 2WC4A 1JR1A 5XINA 3PANA 3FCPA 1O12A 1F5ZA 4NZ1A 1UC4A 2G4JA 5HBFA 1IWAA 3LHYA 3K2GA 3CPRA 5C7VA 4ZB5A 4H9MA 2YDRA 4MUPA 3Q4DA 1RK6A 3W76A 3WDQA 4F40A 3MT1A 5DXXA 2VRJA 5FEPA 2ALDA 3WQVA 1EZWA 3RAOA 4N4PA 2FTPA 1BLIA 2WCGA 5G4EA 4PRTA 4K37A 4U5KA 3T2PA 4CVUA 1GEHA 2GGHA 4P8VA 8XIMA 4CEUC 1EJ7L 3WENA 2DVUA 4HJFA 3EMQA 4IGSA 4CU7A 5LNSA 1Q6GA 1VD6A 4UR9A 3NDZA 4QX4A 1X98A 1TSIA 3BAIA 3VD4A 4EPDC 4HKPA 3WL0A 1PVNA 3R2GA 2C1IA 2E7FA 3BUVA 3SIZA 1WZAA 1G01A 1R87A 4JTUA 4A3QA 1UBSA 1JF6A 1EIXA 1XIFA 1FXPA 1NWRA 1XIJA 3DFOA 1OX5A 2POTA 4YWSA 4L5ZA 4MWAD 4W85A 3MCOA 3RMJA 5BWFA 4JIQA 3KHDA 4XV0A 2ALRA 4S3FA 5F2IA 2Y4SA 4N6FA 2RHGA 3VIFA 3GBEA 5HNNA 1I6NA 1KRCC 2OSWA 2ZCGA 4E3VA 1V3KA 3IGHX 4GYFA 1P6BA 1XRFA 4MY1A 1Z9AA 4NZJA 4PTMA 1TB3A 3L2MA 1UA7A 2PDXA 4AZHA 4ZE4A 1TWDA 2DT2A 5AOUA 4RNHA 3WDHA 1GQLA 4E5TA 3FYYA 1XYLA 1XIIA 4NYUA 2ZA3A 2HK1A 3T8QA 3T2OA 3N14A 1DJHA 4S3AA 1OG0A 3EAUA 3N2OA 3UZ5A 2YB1A 1JYVA 1EGMA 1CEOA 2BGQA 3R8GA 1TMQA 4TX6A 3IJDA 4P7RA 1V3HA 3ZYZA 4ADUA 3E0FA 3TU9A 3ZQ9A 3AZRA 1UA3A 1ZNNA 4ZODA 2VC9A 3FAWA 4ROQA 3EWZA 5DANA 1NQKA 2YW3A 3L4XA 1YQ2A 5AYBA 4XAZA 1GOOA 2CBUA 4H7CA 3S1XA 2PURA 2YLLA 3DFSA 3NQVA 2BVWA 5I23A 3UBPC 1EC9A 3T05A 2QCMA 1W32A 4WOQA 5C2CA 3DERA 1RCXB 3D6NA 1FWJC 2WHJA 3PF3A 4AZGA 3IJ7A 4KEZA 3COTA 1ESWA 3B3DA 3RJXA 2VR4A 1KBKA 3DFHA 5HDRA 2IPFA 4KF1A 4MY9A 5I3JA 1PV8A 3SO7A 4WSHA 2WWDA 2VFEA 4MFDA 1B90A 1CXIA 1GORA 2CHRA 4C65A 4KMQA 3W72A 1BTMA 5AZ0A 3CU2A 3AC0A 3L7RA 3KE0A 2OCZA 2QMKA 4KWVA 2YL9A 3AYRA 3U57A 4B15A 3W1NA 4HOZA 1Q6EA 3MZNA 2XPKA 1X7FA 1UMLA 2IQTA 4DBEA 1EEPA 3RILA 3O16A 1V6VA 5FF3A 3AMDA 4C60A 4FOJA 3QQ1A 4K68A 1VFOA 1FRBA 1LQAA 3PG8A 3P5YA 1JD7A 3LTYA 5HNRA 4RPPA 5GNZA 1E1CA 1GVIA 4H04A 4PFMA 1G4EA 1UR8A 1KXQA 2ONEA 4DBSA 1ONEA 4GVIA 1ZAHA 3WJXA 4Q7NA 1G4PA 3SJNA 2QVHA 1U5HA 1E9LA 4JXCA 3UXDA 3WQ5A 1ISYA 3ALGA 5F2LA 3N1AA 1ITQA 2O4QA 1KGUA 2OOFA 4M81A 1R30A 3FJ4A 2BS9A 3NQ2A 2YSWA 3WL1A 4O57A 5HULA 3UG3A 3LNMA 4U3AA 3V0TA 1TVPA 1NEYA 2F2HA 2W66A 2R6OA 4GKLA 2ZDSA 4GY7A 4LBUA 1VC4A 3LB0A 4LSBA 1XBZA 5TIMA 5A3HA 2G3JA 2YFOA 2P3ZA 1YEYA 3SSZA 3UT0A 4UCGA 5CBBA 4QISA 3NXFA 4K8HA 1CTNA 4EAYA 2CBJA 4W88A 2ISFA 3C8NA 2ZE0A 1GCYA 4ES4A 3LM3A 4QAWA 3NL5A 1BF2A 4AIOA 2AQVA 3BAKA 3GNRA 2NXGA 4C6BA 3ZLHA 3KS6A 3QGAC 2PRMA 4NAFB 3TC7A 4C6MA 1QHOA 1OYAA 1QATA 3OLEA 2P88A 1UIOA 1WPCA 3ZOAA 1BD0A 3NSNA 4PUNA 1OC5A 1UP3A 2CNCA 1K02A 1M6JA 3PY2A 1EP1A 3UCDA 1HVQA 4WXYA 4GD0A 1IV8A 1ELSA 1CB2A 3C2VA 5A6MA 3H54A 4F0HA 7ODCA 2XM2A 1CLXA 4O16A 2Z1XA 3K4DA 3LBCA 5HR7A 2PRLA 3CIXA 4P7NA 1QWKA 3V3WA 1DEDA 1X1ZA 2QV4A 3FJNA 3MMWA 2HTMA 2PBOA 3CLWA 3HQOA 4CNTA 4GACA 1CB7B 1AQFA 5E0KA 2C6QA 4WY0F 1J0KA 1Q6DA 3AIVA 1M68A 3UFYA 2PWUA 2OYLA 3ZIZA 4J3UA 2PP1A 3LMYA 2YX0A 1RBOB 2P0OA 4Z2KA 1S5TA 4UNIA 6REQB 3WK1A 3VOFA 5BCAA 4W93A 4UZSA 2YR1A 4AZIA 4C7GA 3W27A 1XSKA 1KCLA 3PAOA 2DU2A 3SCVA 4KCVA 4DWSB 1KGXA 2GVGA 4JQ3A 3VKCA 5F4WA 1I45A 4S38A 4C6KA 5BNKA 3UETA 1XYFA 3RR1A 3W7KA 5LSMA 3B0YA 3LS9A 4IG2B 4ML4A 2ZUWA 2YKKA 4KIEA 1XQKA 5HATA 4LU0A 3ITVA 4DUVA 3OVPA 2Y70A 1WKEA 2A3LA 4JTHA 4QJ3B 4WIWA 4WGXA 1QNOA 1ZP3A 1O5XA 1DHPA 3ARSA 5HUOA 1EXPA 2I5IA 2GLKA 4D72A 1K9FA 2GJRA 2QDEA 3SR7A 4LEFA 1E0VA 1PUDA 2BGSA 5HWNA 2EG7A 2FGLA 4AD1A 4QLLA 1T8QA 3T0CA 3UJSA 2A7RA 2C18A 1QW7A 1OWQA 1Q4NX 4B2DD 1PO9A 5HJXA 3HQ1A 3B9NA 1OFAA 5AYZA 1HUVA 1SMDA 1H2JA 3TYDA 1SZEA 2DSUA 3AALA 1J2BA 3IIZA 5REQB 3AXHA 4C6FA 4IFOA 4LXFA 1WQ5A 3WO8A 1R3SA 1YPIA 2WJZA 4PEEA 1TJPA 4MF4A 5G5IA 3VDBA 4DWDA 1JFHA 4XD4A 1QNVA 3RX2A 1QXLA 3RCYA 4CD5A 4IX0A 4FA3A 4AHOA 1YDYA 2J74A 2ZA2A 2PDPA 4XAPA 1TV5A 3KVJA 3B4UA 4AVNA 2GQ3A 1AQMA 1GPFA 3WF1A 1ZJBA 4WVXA 3HJZA 3UZYA 3SRFA 1HN1A 3OBEA 2W62A 1OINA 2KX9A 3EMCA 5EU9A 3AUOA 1KA9F 2ZA1A 4LWWA 2ZDRA 4L7ZA 3VOCA 4AEOA 4LX4A 1QJWA 1IZCA 4GI4A 1JYXA 4XSLA 4OBRA 2OQYA 3GW3A 3PZTA 2E1WA 4RW5A 4X2PA 1MVYA 4IPJA 4RDZA 1MQRA 2WPGA 3JU2A 1XR2A 4CN6A 2NWRA 2BG5A 4K3ZA 2YL5A 4D6GA 4Z2HA 3F7JA 4Z0SA 3PZMA 3AZSA 2JKEA 4PUMA 1GJWA 2PFHA 6XIMA 3W25A 4ZE5A 3ZVIA 1NJJA 2Y88A 3P6LA 7A3HA 4LFYA 4RUBA 3ZZ1A 4NAFA 1U33A 1VBHA 3PSWA 3WLOA 5GJNA 2E1DA 4GRSA 3BOXA 3BARA 1XLLA 1QI0A 5IM51 4WDXA 4JTGA 4Q8WA 2TRSA 5KSWA 1DL3A 3I6RA 2F38A 4KFOA 1G1YA 3RR4A 1EP3A 4L9XA 3YPIA 5TF0A 3W7RA 1XKYA 3KOFA 5A6LA 3PZOA 3WLPA 2WJFA 4PYSA 4WUIA 1WDSA 1UZ4A 5DCDA 1WBHA 1XC4A 4JGDA 2PGRA 2D0GA 3BSHA 4F4RA 1SR9A 1EJXC 2YJQA 2E9MA 3OLIA 2WOQA 2E3ZA 1JF5A 2ACRA 1NSJA 2CETA 3PWGA 3R5EA 4KKXA 1PDYA 1MFVA 2PE4A 4Q7IA 4X3ZA 3ABSA 1BTCA 4GO9A 3QH2A 4HJWA 4HU3A 1XISA 4MWAE 4XAFA 5D9NA 1C90A 2QCNA 1CDGA 2HPIA 1WYIA 1JI2A 1F2JA 4IGHA 3AROA 3ZJ7A 2YXXA 3MMTA 1WUEA 1R0MA 3IAPA 1Z69A 2PDWA 1ME8A 3M0VA 2C19A 3FNDA 3QR3A 4K7YA 2H3DA 4DWSA 3F4NA 3L4TA 4R27A 5LNWA 4H00A 1H1ZA 3OEXA 2J8FA 1HJUA 4D6CA 1FKWA 2C16A 4G9PA 4IG2A 1JNEA 4A6GA 1JDDA 3W2UA 1C8QA 1R3WA 2R14A 3BW4A 1WA3A 1LYXA 2WCSA 4GWEA 3KVLA 1THFD 1JL8A 2VENA 3OGSA 1LLOA 4Y6GA 1XBYA 2D69A 4GQGA 4PUEA 3L0GA 5E9AA 3V16A 4RCXA 1A53A 2DZAA 1W1YA 5D4YA 3QN3A 2OKTA 4ORIA 1A3XA 1YNQA 4Q8PA 3MS8A 3K1DA 1RY0A 4FNTA 3C2FA 1HJXA 4QTGA 3ARUA 3AIUA 4XUYA 5BMXA 1GQJA 4AQLA 1T5AA 3DYMA 4HA4A 3WNLA 1E6PA 4BF5A 4KESA 3VIIA 3URAA 2WZEA 4GYPC 4B3KA 1EOMA 1A5MC 4QSHA 2J7HA 1DJIA 3BLOA 5A8QA 4FALA 5REQA 5BXSA 3AICA 1QO5A 5D04C 3ZXWA 2VOTA 2JK2A 1VP5A 1E9IA 1FWGC 1FDJA 1RCOB 1O60A 1HL2A 1MQPA 5I3DA 5FJOA 1PL9A 3CUXA 1ZRQA 3IIOA 4TVUA 5A6JA 1TG7A 4DZIA 4Z1YA 4M0XA 1GVEA 4MNJA 2E77A 2NX1A 3EOSA 1CXHA 1HIZA 3VD7A 1EUAA 1WDPA 2OB3A 4Z2JA 3G1XA 1QI3A 2R8WA 3THQA 3UCQA 1PSCA 4LS0A 3GVWA 4WJXA 2SFPA 4HNTA 2G3MA 3W7CA 4S3JA 1AJZA 2V5CA 3W81A 2HVOA 2W79A 3BH4A 3AO0A 3WNMA 2V3GA 1YE4A 2OR2A 3VKAA 5BRPA 1W56A 4H6RA 2FMNA 2OZ8A 3PJUA 4UOJA 1YLVA 2C79A 3ITXA 1V3LA 3NNTA 3AQUA 1TV4A 3WY1A 4MKSA 2YL8A 2L5HA 4DF1A 3UPWA 1JPKA 4P7OA 3NZGA 2Z2UA 4DYJA 5FEZA 3M4HA 2V6AA 4FOUA 2GUUA 1QTWA 4Y9MA 1B3XA 2PDLA 2HMCA 4HP5A 1E6SM 5FSDC 4AHPA 4OV4A 2FZMA 3VM5A 2RDUA 2QUNA 4UFMA 2H90A 3TZFA 3BJFA 1OBAA 4U5IA 3CQKA 3H26A 4RDWA 3KRZA 2IW0A 3TN3A 1QPRA 5BRQA 3M64A 5LNVA 2PBGA 3CJPA 3QGKC 3DG7A 4QE5A 2X1TA 3WELA 4NAEB 3H8AA 3GTNA 1HKWA 3BW2A 5BXRA 4IFRA 2PGWA 3T2QA 3N6JA 4JTIA 2H9AB 3UXAA 5D8ZA 1QW8A 3AMKA 1A47A 3WQCA 5G1YA 1GHSA 3OZPA 4M1RA 2BOFX 1AODA 1OSEA 3BV4A 1K03A 3ICJA 5A1AA 1H4PA 3VKKA 1HFBA 4ASTA 3EWUA 4PMRA 4ZOCA 3CTTA 1O66A 1KO0A 1EX5A 3PJTA 5LA2A 1W3HA 4L80A 1AZ2A 1QI4A 3BMWA 3REQB 1RQHA 1A5UA 2OPJA 4JKKA 2OEJA 5TD4A 4C1KA 1JCJA 5TBOA 2FLIA 2B7OA 4BQ2A 3PK7A 2OOGA 3CZJA 3CO4A 3TXVA 3AS2A 2BX7A 1W3LA 2CCRA 2EQDA 1S1RA 4G5DA 5BXPA 1WUFA 3W1AA 1GW9A 4I5XA 4HSNA 3QMSA 2Y7DA 3HV9A 3O07A 2JBMA 4JTEA 4AHQA 2FVMA 5D37A 1QNSA 4AY1A 3CUJA 3KWXA 5KTLA 1LG1A 3DECA 4MWAA 3KTXA 1R3RA 5CZJA 3RM8A 5HA7A 2Y5SA 1WXYA 1QU4A 2Y8UA 1J01A 1DJXA 3N4AA 4IIEA 1I1WA 2F6KA 4S3DA 4XZMX 3S3GA 1FH8A 2OXNA 3N4EA 3KLKA 5M03A 1XIGA 4E2DA 1LQ0A 2ZC8A 2VQUA 1L6GA 3A4JA 2X7VA 2FFCA 3RO8A 1ZJHA 2I14A 4UFIA 5A8MA 4A3UA 2GSEA 3GDTA 1Z6KA 4CKQA 3GK0A 3M0KA 2WVVB 3VFCA 2JEPA 1S1PA 3KOZA 3GVGA 3T40A 1LT7A 2BASA 1G4SA 1AH0A 1H62A 4KW2A 4XG1A 3B8UA 1HJWA 1GTHA 4M6QA 1VFHA 2OSYA 2VC7A 4TMBA 5EBAA 3O1NA 3W1XA 2J7DA 4ZXOA 4D6DA 4F48A 4P7QA 1DYSA 3TYZA 1OM0A 1V51A 1NF7A 3I65A 1XIDA 5E0FA 1CWYA 3USZA 3GXNA 3VZXA 3ARPA 4HU8A 3DU0A 1O68A 3ARVA 3DUGA 3GZAA 4HMCA 3TONA 2QMJA 4ZQOA 2Y85A 1KCZA 4X2RA 2ZZ1A 3CTLA 3GG7A 4GE8A 2VEKA 3VM7A 1J0ZA 5I79A 1EJSC 3MKVA 1T0OA 1BYCA 3RGTA 3L5LA 3TP4A 1HNYA 4O4WA 2PU0A 5LA1A 4L9ZA 1K9DA 2Z1VA 3F03K 3OVRA 1JGIA 1AVAA 1CGUA 4DXKA 1NDZA 1JCLA 1Q4WA 3QC0A 4W5ZA 3FN9A 1K4GA 1OT1A 5I3FA 3EA3A 1SFTA 1JCXA 3SGZA 2JQXA 2I7GA 1BXBA 3T44A 4GYKA 4M1BA 4DVOA 3F5KA 2FPYA 3MCMA 3D46A 1T40A 2QR6A 2CLEA 3HOJA 3BE7A 5DRIA 4IH3A 2E67A 2DFAA 3B9OA 1MSSA 2MUCA 1H50A 2XN0A 4MZYA 4LGXA 2VO5A 2HE5A 4DX3A 3BAJA 2OJPA 1V6YA 4RDVA 3UA3A 4XB3A 4B5SA 3NM1A 1Q2RA 1XSIA 1C7TA 4XBSA 2INEA 4MOZA 1HG3A 3VCNA 1UJQA 2HJPA 3M07A 3W74A 2O7SA 5EMKA 1Z32X 3VNKA 2IQDA 2NLYA 3HN3A 7XIMA 4DJDC 2FKPA 2V82A 3G3MA 4O17A 4RZ5A 4H9UA 2QT3A 3B04A 1CLKA 2H9AA 3JZUA 2V9DA 1MUWA 4O1EA 3JVAA 3FIGA 4M8UA 4MY8A 2CLOA 3BCDA 5HQMA 1PX8A 2I9UA 4IIGA 2I57A 4Z2LA 3TWBA 4ZOEA 2ZKMX 1OD0A 2WB5A 2QJNA 3A5VA 1RD5A 4HMEA 1H1YA 2UWFA 4AD0A 2WANA 4KT2A 4EK7A 3VNMA 2ZZ3A 3Q67A 4CNSA 1QFEA 1R38A 3G5EA 3T9PA 2VX5A 3REQA 1KR1A 3NQCA 1S5NA 2NVDA 2GVEA 3BGGA 4BKNA 1ECQA 3IJLA 3P3BA 3KBVA 1E0UA 4G56A 3L0KA 1CNVA 5AECA 3ABZA 2HK0A 3VUSA 1YADA 5D9OA 5FF7A 4Q8MA 1JDEA 4ZXLA 3BOLA 1F3WA 4IPPA 2A21A 1DBTA 3MV11 1HO1A 4Q8VA 4QM1A 3W22A 2PDMA 4FK9A 1BVNP 2PDGA 3ZR5A 1FWFC 3WF2A 1I60A 3HQNA 2C1GA 3UZZA 3W7NA 1WKYA 1G94A 1HL9A 1RQEA 2EJAA 3VD9A 2QUTA 1L8NA 4K7VA 3PP7A 1W1TA 1WXJA 1D3HA 3QKZA 4PCFA 5HXMA 3BLFA 3QQ0A 3NDYA 3VUPA 4MMWA 5A69A 3W24A 1QUMA 1VB9A 1VS1A 2Z6IA 3TYCA 2HS8A 2GWGA 1YNPA 2X1SA 1BF6A 4Z1BA 1JXKA 1EJWC 1LWJA 4OV9A 1JUBA 3UWZA 1LBMA 4PZVA 2PODA 3O63A 3M0MA 1ZBVA 2H6RA 1UD2A 4WJ8A 4PUKA 4MB1A 4NHVA 3VAVA 1Y5WA 3GH7A 1Y0EA 1TTJA 3V5CA 5C71A 3VIMA 1V0LA 1IT0A 4QQ3A 1XM3A 1S46A 3EEZA 1R2SA 4F0MA 5DMMA 2OQHA 5MHBA 5AHFA 3OIXA 1VCFA 4UB9A 4RE0A 3WH8A 4TTGA 3QF0A 5FKYA 2PZNA 1Y8BA 4JTAA 2Z1SA 1T7LA 3LZ5A 1MRAA 3CHFA 3M5ZA 5JBDA 3N6QA 5CLWA 1JEZA 1XW8A 3CV2A 4GLEA 5JXQA 2PTXA 3GO2A 3RX3A 1I2OA 3BAWA 2NSOA 3IK4A 4I3GA 1TPDA 4CQCA 2QAFA 1DJGA 2PWHA 1TRDA 3BICA 3CAVA 5FEWA 4URIA 2RH9A 3WLLA 2Y1HA 2OEKA 1K70A 1H7NA 1JZ5A 2J6VA 1VJZA 2YCJA 4JD4A 3TROA 4E3TA 1W9BM 1OG6A 3UG4A 1X38A 5FL0A 3KAOA 3IK2A 4NZ5A 1TYGA 3P0XA 5FJUA 4JCLA 1D7FA 4NXSA 2C14A 7REQA 3KCOA 4JQ1A 3H2NA 1OCBA 3VCCA 3QKEA 3UVAA 2XN2A 4B2DA 1J4EA 3KRSA 3KHJA 2YBVA 3DDMA 4AVFA 3AJXA 4NJIA 2V5KA 1B54A 3P74A 4LUIA 3GNNA 4QFUA 3AUJA 1UWUA 3P81A 1MEWA 5C9UA 3GSMA 4LJ3A 3CO8A 1PX4A 3SRKA 2W9MA 3LENA 4B4HA 3EDJA 1HX0A 1V3JA 4G7EA 3AHVA 2REQB 1E51A 1D2KA 3BDKA 3U9IA 4DBDA 2TYSA 2E68A 3AMGA 2VD9A 5LNRA 3WLQA 3LBOA 3DGRA 1H49A 4PCNA 1G67A 4YCOA 3LRMA 2E28A 2WNNA 4KWUA 4LV9A 4E0CA 3HB9A 2E9BA 1AL8A 3LLDA 1IXOA 4GC3A 2VDGA 3WCZA 1JYNA 2VL4A 2XTKA 2AL2B 3W1RA 1PB0A 3NQAA 4JFVA 4QDPA 1NP2A 2VHLA 1XIHA 3GAYA 4MNKA 2F8QA 2DSZA 1U22A 4LTSA 5C55A 1VKFA 3EPMA 1OX4A 4JTRA 2ABBA 1JG9A 3M46A 3W7PA 3F4WA 3H4XA 5FEXA 3DC8A 5K9XA 3T0BA 1AJ2A 4MDOA 1VFMA 1ZB5A 4J3XA 5EGRA 1REQA 1PKMA 4W7WA 4XZLX 4NUWA 1XLHA 3G1AA 5DCEA 4E8DA 4BK9A 4NASA 1OGSA 3M41A 4BF9A 3PUOA 1GONA 3WQOA 1VLIA 1TA3B 4HNVA 4DZAA 2NUWA 2PCQA 1KTCA 1TELA 1AH3A 4GX9A 1GQKA 2GGIA 3WUGA 2VZSA 3ZSSA 3TYBA 4AYSA 1YRRA 2P0IA 1I4NA 4JN8A 4H6KA 1LJYA 3N15A 1UOZA 4JHOA 1K9TA 1OIFA 4MLJA 4EXQA 5CGMA 3W7IA 3USBA 3N3TA 4ONVA 3WN6A 3AHXA 2ZTKA 1W9XA 5C7HA 2Z4GA 3KWSA 3T07A 4GIEA 2IPGA 2OU4A 3F4CA 3W7GA 1MFUA 4HOWA 5KEZA 4LAOA 1VPYA 3AYVA 1IEIA 2BOGX 2WM1A 1KV5A 2W5FA 1W5NA 3AOFA 3DX5A 3PPGA 3MO7A 2EGZA 4IMAA 6XIAA 3MZ2A 4HYRA 3W4RA 3DAQA 4DJFC 1WDDA 4Q8QA 2PU1A 4GGBA 4PULA 1ZQ5A 3E2QA 2WKLA 3NZRA 1QDSA 1R46A 1EBHA 4OUEA 4YIWA 3ABXA 5CQ1A 2A4AA 1UKQA 2JF6A 4A8NA 2XGBA 2ACSA 3VYLA 4LVFA 1AQ0A 2C71A 3PFMA 3Q65A 3IGUA 3SUSA 3QMTA 4JNZA 2VFFA 3E2RA 4DNMA 2XM1A 3U8GA 1KD0A 2QCCA 2QCHA 1PYMA 3NDOA 4GFSA 3WBYA 1GOWA 3G1YA 1MW0A 4O4VA 4IMGA 4Q33A 4CNNA 2Q02A 3GZ3A 3E38A 1LZOA 3LQLA 5K3VA 3LGDA 4RX0A 4YN5A 4O50A 2DVTA 1EL3A 4GABA 4B4FA 3CXOA 4NYYA 1MDLA 4UQ9A 1M9HA 4AWTA 4WQ6A 3CPGA 1JQXA 1QO2A 4L4PA 3S5NA 2EEXA 1MNZA 5CAKA 1MRQA 3A3HA 3GR4A 3STEA 1SW7A 1ZLPA 3CUHA 4IICA 1DWHM 4LQ1A 4IGMA 2YGYA 3QFWA 3I68A 4QCFA 2FDMA 3UR8A 2E6AA 1U5VA 5CJMA 4MPQA 1EQCA 3MKCA 2R24A 3QHOA 2VEPA 3IVTA 3SCRA 4A2SA 4GXMA 4P8UA 1M7XA 2XU2A 3B40A 3MI6A 1R3TA 3AIRA 3WH6A 1H61A 2GQ8A 2PD5A 1P4CA 1RPKA 4FMVA 2HCVA 4WKAA 4K2SA 5A8OA 5CGQA 2V3FA 4JL1A 3N6HA 3U4FA 2H8XA 2WYSA 3EWXA 5CZKA 1OC6A 3NVTA 2OODA 1HGYA 3AYTA 1FWDC 3C2RA 1XIBA 2QCFA 1OJXA 1GNXA 5FSEC 2X1IA 1KXVA 1W5QA 3B9DA 1TCMA 4CCZA 4CD6A 4H83A 4BJHA 2VFHA 4PBEA 2QZRA 4GJIA 4MADA 2GJPA 3BMVA 2ODOA 2PDUA 3S6OA 4S1FA 4UFKA 1A5LC 3UWYA 1IXPA 3ISIX 3M0YA 2HZGA 4X9SA 3WLIA 4C1NA 2WSRA 2P76A 1EA9C 3T7VA 3QY7A 1W3NA 2WMKA 4UR7A 3U0HA 1EQPA 3DI0A 4UTKA 2VJXA 3GG8A 2PEVA 2V5DA 1Z8AA 1DP0A 4LAKA 4AF0B 2XH7A 5E09A 4X9YA 2OWXA 4F9DA 4J3TA 3GD6A 3W23A 3DFNA 3PZNA 3CL8A 1TE6A 3R58A 3O0KA 4MB3A 3BZJA 3ECQA 3STPA 5CC3A 3CWNA 4JTQA 2XIIA 4CNPA 1U30A 2WV8A 1KFKA 5CJNA 2Y61A 2FTWA 2VI0A 1UKTA 2OZ3A 1W17A 4GCXA 2UY4A 3W75A 3WBXA 1QNQA 2E8ZA 1KBJA 1A50A 3S6DA 1MXSA 4HBKA 4P2VA 4NIRA 3WZ0E 1Z41A 1ODUA 1PHQA 2BWGA 4AZ5A 1LL6A 1DIDA 1PYFA 1ZFJA 3RDKA 1XLIA 2G37A 2ADAA 2CPUA 4ZO9A 3FA3A 3F1QA 1V02A 2EPNA 3W37A 4MJ2A 4U4MA 3TSBA 1DWAM 4AC7C 4LRTA 3LTSA 3URQA 3NCOA 4GBDA 1LTDA 5HQLA 5I78A 1GYNA 4JQ4A 1P5BA 4FXSA 4JS3A 3L0NA 3L68A 3L4YA 4NVTA 3KS5A 3VGFA 3B0XA 4JY8A 1KTBA 5FJJA 1PS9A 3LRKA 5D2VA 2CXEA 2I1OA 3ZR4A 4RPQA 3FVMA 3OB8A 4XBKA 3QQWA 3AS0A 4PR4A 4R53A 1VFSA 2XDFA 4QSFA 3E96A 3H23A 4FR6A 3MC5A 2ZUUA 3AFBA 3SN4A 4HA1A 4I6VA 1E1EA 1RJPA 1YTKA 2QPXA 4HT3A 4L6HA 4JHMA 4DO4A 4CQDA 4I9JA 3RU6A 5IHRA 1AD1A 3APYA 1XBVA 4EWND 1M7JA 3ONCA 1YIXA 4ZOAA 4DJEC 2CBIA 3G18A 1GZ1A 2Z2BA 2CHOA 4Z17A 3SQLA 1E73M 2D1ZA 4O0QA 4JX5A 2WMGA 3LTPA 2TMDA 1PIGA 1N7KA 2AMGA 3K13A 3TIMA 1SJDA 4UXDA 5C9WA 2IQ0A 1E0TA 3GC4A 5DT7A 1P0BA 3LHWA 3M47A 3UGVA 2Y5EA 1V7YA 1NF0A 4M82A 3APGA 1PIIA 4IPIA 5G2HA 3RRAA 3W7QA 5RUBA 4LC6A 4WDUA 4C5ZA 1PIFA 1KC7A 2QCLA 2V3EA 4TR9A 3TTQA 2BHYA 2O4MA 2NT1A 3DFPA 2D0FA 4AMAA 1OFBA 2GGGA 2PDBA 3UCCA 4DJDD 1KM5A 2YCLB 4JN7A 2WCAA 4US5D 1QOPA 2DZWA 3AWOA 3W1UA 2J27A 3BLDA 2DZTA 1TIMA 2VNCA 3E5PA 2VEMA 1XLAA 3CT7A 5FJIA 2ZWYA 3STFA 4AIEA 1GOIA 3PBGA 1W91A 4K8GA 2P8BA 1F4AA 4AIUA 3ARWA 3VKBA 1HO4A 3CQ0A 3EB3A 3WKZA 1H7PA 3A3WA 4RE3A 4E4UA 3XISA 3BJSA 4W87A 1Q6FA 1GOXA 3QY8A 4REQB 4R5EA 5ABTA 2AGKA 4HVXA 2IKGA 3U5UA 2O9TA 5ENLA 3D47A 2G95A 1TWIA 3PG9A 4JHZA 2WMIB 4CNUA 2Z27A 2BGNE 3AIWA 1EPXA 1C8XA 2ZRYA 4C7DA 4W8LA 1VCGA 1V8EA 3LV6A 3ITYA 1D7KA 5DMLA 5G1MA 4QITA 1QT1A 3NVDA 1XGZA 3R0DA 1UWSA 2HBVA 3PTQA 1IHIA 1LROA 1WO2A 2GOKA 2QCGA 2PLJA 2JIEA 2ZICA 1HZYA 4KWOA 1A0EA 3S2LA 3JUGA 4Q4RA 3NFUA 3V36A 4PTXA 2ZZ5A 1NM9A 4A3RA 3PNZA 1E5NA 3P8IA 7TAAA 1TTIA 4RW3A 3RJYA 5DLCA 2PTDA 4U2ZA 3POCA 3A4AA 3CNYA 3OU8A 4GZJA 1J2WA 4NJKA 3TYEA 5MKGA 2XIOA 4PFHA 3K8LA 3ZJ6A 3FSTA 1GKPA 4UQDA 5H8UA 3O6DA 3JRKA 4LBSA 2PDKA 5G4WA 2GUYA 5A95A 2VFDA 4A29A 1B9BA 1OABA 1PKYA 3G24A 3CHVA 1AW5A 1CGXA 1UD8A 4LYRA 4PSRA 2A85A 2G97A 3ZWTA 3HO8A 1X8FA 2VT0A 1WV2A 2J75A 3NQ8A 4XKYA 1PHWA 5GVJA 3NQMA 1LRQA 5IBXC 3RXZA 2PLMA 2FTYA 3AXKA 4O53A 3A24A 1AW1A 1LDCA 1W3KA 5EBUA 3LHUA 4DI8A 3U2OA 4H8UA 4D6FA 4GX8A 4ZVJA 2EPLX 4C6QA 3FXYA 1EHAA 3GR8A 1P0KA 3Q37A 4CD4A 1WZKA 4QXIA 1UD4A 3SCSA 3DIPA 3UNTA 4L4LA 3EOLA 1TMLA 4JEQA 1BQCA 2E25A 3LV5A 1BG4A 1A5CA 5LGZA 2J7EA 3QBUA 2BTMA 1UWRA 3F4DA 2XGZA 3EBVA 3TX9A 4UTHA 3W07A 1XGEA 1SO4A 1ZUAX 4PCTA 3IRDA 2OO0A 3EB2A 2TSYA 5DBTA 3UWQA 1PDZA 2XJ7A 3BG5A 2PSNA 3V0SA 2A3AA 4XISA 4V27A 3WQ8A 3U48A 1XYAA 1KFCA 3KBMA 2QUVA 4IISA 3DOPA 3SY5A 3CMGA 6TAAA 3ATYA 4ZGYA 5HWMA 2CC0A 3BGAA 1NFPA 3MHGA 4E6MA 5CC6A 3HGOA 3WUBA 4KH2A 3G1SA 5AHEA 2BODX 1OF6A 2ZOXA 1UWTA 3UQNA 2RJGA 3WQ4A 5I5RA 3EKGA 4BR1A 1GT8A 1W54A 3SCUA 2ZVRA 4AXKA 5HMDA 1EH9A 2E9LA 1SU5A 1K7FA 1P0NA 4E8CA 1U1HA 4QJ1A 1E6ZA 5FF0A 1JRBA 2RAGA 2CBVA 4O10A 3S6TA 1DJWA 4N9EA 4DYKA 3CC1A 3C8FA 1JCTA 1MW2A 2W3ZA 1O1HA 1J79A 3VDCA 2R82A 4W4QA 2C15A 3O6CA 4DIAA 3GC2A 1XLBA 3WIJA 1T41A 2ISDA 3CIVA 1IEQA 3UGRA 4FX7A 2OG9A 2ZX7A 3K5XA 1Z7AA 2CXGA 3T09A 4FB7A 2F6XA 1IR1A 2EG8A 5M5DA 3M1ZA 3F2CA 4LV4A 3W83A 3UPBA 3ARZA 3QR0A 3DFQA 1HQTA 1LUCB 4OTKA 1DJZA 3WNKA 1IGWA 3TVAA 2X1RA 4IZGA 4PCPA 2FPTA 3C0LA 1XDJA 4J4KA 3AI0A 3MANA 1LL4A 1TUXA 1XINA 4GUHA 2QJJA 2GVYA 4JKMA 4AEFA 4KGLA 1R85A 2ZIDA 3PVFA 3FEMA 1WCGA 4NZ3A 3F2BA 1GJPA 3A12A 1SUXA 2VURA 2XUCA 1TVNA 5IFPA 4J28A 3L2IA 1XYMA 2X8RA 3TH6A 2ZRZA 3DCPA 5AFDA 4IJRA 1HKIA 4QBXA 4X0VA 5HOSA 1XYBA 1YTDA 1QPQA 1UR4A 3IRSA 3EXRA 1L2QA 2DP3A 1ZAJA 2KZHA 2WVUA 3E0IA 1RA5A 3SUUA 4LUTA 4H7ZA 3Q94A 3NQFA 2R1LA 3ELFA 2YFNA 2PD9A 3TCEA 4CVWA 1SSDA 1UR3M 3LLXA 3VZYA 3SY8A 1ALDA 3VX1A 4WEVX 3HG3A 7ENLA 4QEHA 4C90A 2AKZA 1GYMA 4PN2A 1MNSA 1JAEA 2I17A 4OFCA 2XIBA 4AIBA 1XX1A 1A49A 3OLGA 3HFYA 2WNZA 2NQHA 2ZWZA 4RNIA 4HZ6A 3S83A 2G3FA 3Q2DA 2DEPA 2VFGA 4YHEA 1XLKA 1OGGA 3BK0A 3PZVA 3B05A 2BXYA 1TZ9A 3LN3A 2CYGA 1B3WA 4NI8A 3FHQA 3R8HA 3QR1A 1DTUA 4KRZA 3GNXA 1RP9A 1A5BA 2GJXB 1AZ1A 3NGFA 2YA2A 3DHDA 1FWBC 2Z1BA 3GR7A 2PZ0A 2HISA 4M3PA 2V2HA 3H6OA 3W1TA 2POZA 4GYPA 3MQTA 1R7OA 2QJGA 5TNVA 5KZ6A 1KBIA 2B4GA 5AYYA 2HS6A 1OGBA 1WZLA 3SDOA 2X40A 1JFXA 4Y9PA 3VZZA 1EDGA 5A8GA 1YHTA 4KIRA 1IIGA 3S1GA 3KOWA 3ARYA 2FDSA 2J13A 4DYEA 2OWCA 2X30A 2WJEA 3TYUA 1XRSA 1M04A 4ERIA 3LEPA 3G1VA 4LUYA 4NNBA 1HVXA 2WHKA 3B8SA 1WXZA 4I5RA 3LPOA 4M7TA 2FB3A 3IUIA 2VGGA 1Z44A 3I3EA 4A21A 2IUZA 2Q09A 3GTFA 3H70A 2RJHA 2PDHA 1J11A 5AHIA 4NJHA 4Q7BA 1F8IA 4AZ6A 4M6UA 1RSCA 3OODA 3MKKA 3B8TA 4NRRA 1ICSA 2VELA 3NQBA 2A3HA 3LSCA 1SZNA 2R1NA 1GUVA 3OP2A 2XGIA 1RD6A 3RLUA 1ISZA 4RNFA 3NSMA 3T8LA 5BRBA 3HA1A 4NX5A 4UZUA 3W71A 3G1HA 2IKIA 3HMCA 5E9XA 4F8XA 3GFZA 3T08A 3G77A 1LUCA 1J0YA 3RPMA 5FI8A 2DZVA 1H0IA 5G4HC 1FCVA 2PGEA 3W7MA 4FNQA 3ZT5A 3R11A 5HR6A 1ZBWA 3AU6A 3NPUA 3FFSA 2DW7A 1QCWA 1QI5A 2NQ9A 3F5LA 2CHNA 4XQ6A 2Z7KA 1EJTC 2C13A 3MDUA 5CPTA 4OKDA 4ZTXA 4O52A 3MSGA 4HZ7A 4WRHA 3S9ZA 1Q85A 3FVDA 3MI3A 2E09A 3UJ2A 1Q13A 1VFTA 4MB4A 1LLWA 1PKLA 3MJYA 2B0MA 3R89A 3KP1A 3GM8A 1OCNA 1XPYA 3FKRA 1E72M 3NO5A 4LAZA 3WFLA 3SBFA 1GVQA 5ABHA 4DXXA 4HZ8A 2R1KA 3TQVA 1VFUA 4UTLA 1XDLA 3W1QA 3CHCA 1XCXA 3ONBA 2PDQA 3NZQA 5E1QA 1MEHA 5ABEA 1VBGA 2Y8KA 4AX7A 2JKAA 4JQ2A 3PR2A 2NWSA 4GG9A 5E6ZA 4FR1A 3V7PA 3GE7A 1FUYA 2DQXA 4WSKA 3VA8A 3IJ8A 3KOXA 4L4OA 4EOUA 3WBEA 1J5TA 5SWUA 2BBFA 1S3TC 1UZ1A 1I8JA 4WF7A 3N29A 4ILSA 1GVSA 3MSDA 4PUJA 1C29A 3M6YA 5F4XA 5I2UA 5CCZA 4HPXA 5AY7A 4FHAA 1TPH1 2D23A 1CXEA 4NL1A 3S9IA 1PZ3A 3PTKA 1UZHA 1FDZA 4O19A 3SAZA 5LNUA 3WNOA 5E5CA 6A3HA 2FYMA 4JIHA 4ACZA 3CQIA 3W3OA 2X16A 1JDFA 4UOQA 2GJXA 1GVFA 3AAMA 2D2GA 1EYEA 1PE1A 1UD6A 5CPQA 4ATWA 2BVYA 3WDJA 4L61A 5L9FA 4FPSA 4DJED 1G69A 1RALA 2WK2A 4UQAA 1KFWA 4B3ZA 1N8IA 9CGTA 5CPOA 3A3XA 2GZXA 1OC7A 1PAMA 1H0GA 4FLSA 4DHGA 5K4ZA 3M0HA 4DRSA 3DYOA 2DH3A 4CQ8A 2NUYA 4ZMGA 2IXVA 4IT1A 3KZPA 4UC5A 4D8LA 4H8NA 1B3OA 4LYKA 3N73A 4IPLA 2Y62A 1YDOA 4LF1A 3M0ZA 1E1CB 1GYLA 4WJEA 4NI3A 5CKSA 3TNBA 1EKOA 3KM8A 4GNKB 4PGLA 4H9TA 3HM7A 4XK2A 1XKJA 4N7QA 3UJRA 4A35A 4C6OA 3TN4A 4GQRA 3DI1A 4LPCA 1IXQA 1T6MA 1TTQA 1MW1A 5AHMA 1XYZA 1KQZA 3FYOA 1H1NA 2GQ9A 3DXIA 4XVDA 2FIQA 1US3A 5C5YA 4LCRA 3E2SA 3NIYA 2V3DA 5IRPA 1B57A 3HFTA 5B7ZA 3CWHA 1IEVA 2CIPA 4PUWA 1B1YA 1YE6A 3P5ZA 1Q5MA 2YCKX 4DWSC 2ZXQA 5C6MA 1V6XA 1YPFA 5KZEA 4HA0A 4RE4A 3QJAA 2FZ8A 3UPMA 1DIKA 3TDFA 3RM4A 1Y65A 1F4HA 3W70A 3BO9A 1RUSA 3O3RA 4YHGA 1F6KA 5JIPA 1GQNA 5BW6A 4V1YA 2OYKA 5D9MA 1EGZA 3AHYA 4MM1A 4UTJA 4US5A 3W86A 4XAYA 4EKJA 1Q45A 3R8RA 3BGJA 4K38A 4KQNA 2A0NA 4RV3A 1O5RA 3VNYA 4NQ1A 4B92A 3RHGA 3QTGA 1I2NA 5DN1A 1UG6A 3W1MA 4Q4QA 4L65A 1KGWA 2OT1A 4LEQA 4LC8A 1XQLA 2GPTA 3IIPA 4IMDA 3MDWA 4B91A 1F3XA 3QRHA 3LPPA 4JOMA 3E12A 2I9EA 1DHKA 3B0PA 3FKKA 3GTIA 3SCQA 2JGQA 5JIWA 3WNNA 4HSHA 3MTWA 4UFLA 3WFAA 5DY3A 4C6CA 2OX4A 2WQDA 3VIGA 2P1FA 1CPUA 3PWIA 3T81A 1V0MA 2WSQA 5IDZA 5FJRA 2QS8A 4XVEA 3EDEA 3VIPA 3CMJA 3MHFA 1NELA 2PLCA 4GZEA 2V5BA 4J7RA 1HJSA 1I75A 3QV9A 5A8PA 4QE4A 5M17A 4JTJA 1EB3A 2CKRA 3M9YA 3TE9A 3HPXA 1GQIA 4TV5A 1KLZA 1IT7A 1FBAA 3PUDA 2P3EA 3OO2A 5CGTA 3B8VA 3KW3A 1LG2A 2J47A 3FOKA 3QPEA 3R10A 4MKNA 1SFLA 2W6RA 4BA0A 3T0AA 3IEBA 3VILA 2QAPA 2OZ0A 3LZ3A 1UIPA 3MVTA 4GUFA 1O1ZA 4ZQNA 3W0KA 4R7OA 1L6SA 3UXIA 3VIJA 1S2CA 5E6YA 3L23A 3OQEA 3UR5A 3GNDA 1ME7A 1GOQA 4M19A 1X39A 1KM6A 2EPOA 3ARRA 3FSUA 1L6YA 4XZ9A 5JUVA 4YYFA 3T78A 3TNOA 1DPMA 2V5LA 5C8BB 1HKVA 1PJ9A 2WSPA 1DIOA 2CZEA 3CL6A 1M01A 5JBFA 3PB0A 4GYJA 1OF8A 5D8WA 4Y7EA 1AG1O 3GX9A 5EY5A 4ADSA 2OEMA 4CUCA 4H9ZA 1EHNA 1N55A 4ZO7A 4J2PA 5D2WA 4POCA 2CKSA 3V35A 2XSXA 5CZ0A 3QZAA 2J88A 1BXCA 1K7XA 3PM6A 1TZ7A 3H53A 1MWOA 3PZUA 1C91A 5FOOA 4PUUA 4JNMA 1Q6RA 3IV3A 2CERA 4I90A 2PRHA 4PRWA 1SPQA 4GI9A 4UNLA 2E5BA 3A4WA 1WX0A 2ISVA 2Z0IA 5D2XA 1EA0A 2V38A 3H12A 2E40A 3LPGA 2QJHA 1E15A 1W5OA 3VDAA 3VGEA 3G0UA 3G6LA 1E56A 1VQTA 3FK4A 4C5YA 5FACA 4GISA 1FH9A 3DFYA 2YLAA 1PTDA 1PTAA 5C9XA 3N04A 3HQPA 4QIUA 3TUUA 3SJ3A 2E6DA 5AHNA 3BVJA 2GVJA 5D03A 3M16A 4JX6A 2NW0A 1C9DA 3E5BA 1VLWA 5T8GA 2ZZ7A 6ENLA 1W2VA 4Y9OA 2BDQA 3AXMA 4LYPA 4NRSA 1DXEA 4O28A 4ACYA 4EF9A 2FGZA 2PCEA 4OU1A 3HG2A 3C2YA 1C8YA 2FHBA 3GTXA 3KOYA 4FNUA 4IMEA 1G6CA 5DT5A 4CQBA 1XF0A 3EDFA 2Q8XA 4G1KA 3HG4A 3QW3A 1OHLA 3H2FA 5AC4A 4RV8A 4Q4PA 4AFYA 1PPIA 1P1XA 1NOFA 3BWWA 1TR1A 1FCUA 3LBMA 1KQYA 4US6A 4LVBA 1A4LA 3MUY1 5JBEA 1XDMA 1IEXA 4ROPA 3AWNA 1R8LA 5K4XA 4R9XA 4O1CA 1XLMA 3OZYA 4P7LA 4V2XA 4J40A 2ZQ0A 2AGTA 3WMBA 2QPSA 3MUAA 2VRKA 1M7OA 3HPSA 2DGAA 4IFKA 1NARA 4AX6A 1M41A 3LU2A 1UMYA 4G2DA 5M3WA 3RMEA 4QJ5B 3O05A 4Q8NA 3W7OA 5AYXA 2V68A 2WHLA 3TW7A 2BXVA 2DORA 4G1NA 2YIHA 4PODA 5I0DA 5FF2A 2GFTA 4PMXA 2XYLA 2FZNA 2NZLA 4GQ0A 3GDLA 2Q6ZA 4JEJA 2PWEA 2EAWA 4PMZA 2RGMA 2OGYA 2HXTA 4Q3MA 3K46A 3UD6A 1OADA 1J0IA 1ZALA 3S5OA 3HPAA 4HOXA 2VDIA 1HF6A 1KB3A 1OK6A 3EKLA 2IKJA 1XG3A 4IHCA 1W0MA 4XSMA 1K8XA 1OFEA 3L66A 2FZDA 2QDHA 4NKCA 4BI6A 5DQPA 4AD2A 2Y89A 2BY0A 4PRRA 3RCMA 2ZZ4A 4NT0A 3SECA 3QHMA 4BQ4A 4H3DA 2R9RA 3NOYA 2NUXA 1A80A 1AJ0A 2VEIA 4X22A 4I9MA 4BI5A 3RIKA 3R0UA 3B03A 3AJ7A 5I3KA 3O2LA 3WMCA 1TWWA 5JH1A 2CZFA 3BW3A 3ZO9A 1GPWA 3AIEA 3EYPA 3N2TA 2AQWA 4KCUA 4GFIA 4RJEA 4M24A 3GVRA 1W1PA 2A3CA 1GG1A 3CQJA 3EX4A 5L6UA 3SCOA 3FW6A 3CAKA 1XFCA 3NM3A 4FXFA 1VEMA 1IZJA 1X6UA 1A4MA 4KEMA 4LS1A 3LCHA 1WZMA 5T9CE 2W0UA 1TCDA 4QAIA 1KV8A 2NV2A 4JYDA 4ECLA 1UD5A 1HTIA 5IXEA 1VYPX 1UBPC 2FH8A 3ITLA 3PBVA 1FWRA 3PHAA 3T0TA 3CAQA 1H63A 3VOIA 3LCLA 3IWPA 3LSBA 1EC7A 3RN6A 3CL7A 3DG6A 1O6IA 5DCBA 4HHLA 1OCJA 4XX6A 3ZM8A 3TXZA 1A5NC 1G0CA 2ICSA 3ZR6A 3QVQA 2X09A 4B5WA 1SVDA 3N18A 4Y8FA 3HGRA 1EWDA 4Y96A 1TPB1 3STCA 4IMCA 2RDWA 3S2NA 4GINA 1H7RA 3M0XA 2FZ9A 4QCEA 5EKYA 3KRUA 4WOZA 3LXAA 4C6LA 3SUVA 1QPKA 1GK8A 4MNLA 4Z1CA 3NJ3A 3I3DA 3V4BA 2ACQA 2C8NA 4AISA 3LPFA 4Q8OA 4FP1A 4NILA 1UPPA 1SZFA 1G9HA 3M0IA 4A22A 5LHEA 4TUFA 2YXOA 1EDTA 3R4IA 2E6FA 4FIRA 1DXFA 3HGJA 4TU1A 2V2CA 3TFXA 3UU0A 3AYSA 2VGBA 1W1IE 1EWEA 3PBWA 2X2GA 3NPVA 2PS2A 4FSAA 2G3NA 4XIAA 3QMRA 2XIQA 3XIMA 3MBFA 3CUFA 4S39A 1RH9A 1E9ZB 3EWCA 4CLMA 1YBQB 1Q6CA 3BL3A 2W91A 5BROA 2VCCA 4TVCA 1L9WA 3P60A 3NPXA 4H6EA 1A5SA 4D1JA 1XLJA 2P5NA 1OD8A 3W02A 2EPKX 1JPMA 4IQJA 1E4NA 3HPZA 3BLIA 4BI7A 1V7AA 2XFYA 3VOHA 5I6SA 5D02A 1K8CA 3P0WA 3W2MA 4UIOA 2OFJA 4BFAA 3NTYA 4TIMA 1TR9A 3MMDA 5EMMA 3UYCA 1VAHA 5HWJA 3DKJA 4YPJA 2Y7GA 1FWWA 4XTIA 4QHRA 2UY3A 4BZYA 1JXJA 1BPLB 3LX9A 2WZHA 2QCDA 3LHVA 1UCWA 4GVHA 1XS2A 3HPFA 2VC6A 4MWAB 4W5UA 1FVPA 4HPGA 1ZPTA 2P53A 3BG3A 1E55A 4FNSA 5I06A 3IUHA 4HK5A 3B9EA 1QHPA 4OVXA 1I9CB 4QG8A 4X63A 4ERGA 4EPBC 3Q58A 4S3KA 1W9DM 1Q8AA 3VOJA 1PBGA 3QGVA 3G1RA 5CSRA 5CPMA 1CT5A 4CQ9A 3A5FA 4ML9A 4FS9A 1XC6A 1K4HA 4O54A 3DESA 5F2MA 2W63A 1MI3A 4M7SA 1SR0A 4Q4KA 4E2BA 2O9OA 4N02A 2QF8A 3WEOA 4ORMA 3MWAA 2AAAA 3DC0A 3JZEA 1FHDA 4MFEA 1PEZA 4BWLC 1W1B1 1K1DA 3VDHA 5BOEA 2YBTA 3QTPA 2O55A 4C6EA 4WCJA 2D2HA 1FWAC 4IMFA 5FIPA 3RPTA 3WEZA 3WUEA 1JULA 4O1DA 2VUNA 1LT8A 3LCXA 3W26A 3D3AA 5LIYX 3B4YA 1Q7MA 5CSYA 1CBGA 4IPNB 2C0HA 3GIYA 1R9ZA 1XLDA 1MYRA 4OBTA 3P2VA 1AW2A 1TO3A 4GVFA 3A4XA 2EKCA 2F9RA 4U3CA 2ZX8A 3E74A 4P5UA 5BWAA 1U5JA 1U1JA 3U5YA 2DUAA 2VUYA 3CB3A 1QRQA 4L6OA 1YDNA 4DEFA 2B81A 1RXOB 3TJIA 4XZBA 2QQ6A 3BCFA 4DF0A 5LIKX 3RM9A 3EA1A 2GGEA 3CHEA 8CGTA 4J9JA 3H7VA 4JFWA 3EDKA 4JDBA 4X61A 6ALDA 3WH9A 4W89A 2DIEA 1ZSXA 4GH3A 5CJ5A 4DJEA 4HU0A 3DEQA 1Y5VA 2CLKA 3E0LA 3TR9A 2A3BA 1EFZA 4LYQA 3TWAA 5XIMA 4ZSTA 2J7FA 4E8GA 4XWUA 4K6AA 1FKXA 3MUXA 4Q4SA 1E6XM 4M6PA 4OUIA 2V5JA 3EEGA 1SQ7A 1Z42A 3QPZA 3KL3A 4KFNA 4DWSD 1E9YB 1D8WA 5H8PA 1JVNA 1TUFA 3O06A 1JQVA 3C61A 3S2MA 5FJTA 5A5WA 3H7RA 1XD1A 3C86A 4LB4A 3TC3A 3PPHA 1UQYA 3FDKA 3M44A 1KRAC 4HQVA 3GDBA 1US2A 3SI9A 1M03A 2PC8A 3MMUA 2TPSA 3C6CA 3EMZA 3T6CA 1YBQA 9RUBA 3ES7A 2QV5A 1F07A 1TX0A 2Y6ZA 3UZJA 1X1NA 2HDJA 5A6BD 2J7CA 2WO5A 2VC5A 3WJYA 4HHPA 1DJQA 1Z48A 3U2EA 3ZWSA 2Z26A 3WYZA 2JEQA 1J18A 2Z1KA 3NL2A 1TQJA 3CM4A 4Z1DA 4MGGA 5DF0A 3GKFA 4UMAA 1QPOA 3G8EA 4OGZA 2FPVA 3M0JA 2X2YA 1JCMP 1UB3A 4B9YA 1GKQA 3KDOA 3HJEA 2VKZG 3TSMA 4FZIA 4A8RA 3VC5A 4Q8TA 1G4TA 1UR0A 2FMOA 3AHZA 2XINA 1SJCA 2AOSA 2BNJA 4IIFA 4PMOA 3AZTA 3VMNA 3TTSA 4RKAA 1OQFA 4FIQA 2A6NA 4UBPC 4UOZA 2OGJA 3H7UA 4AY8A 2WLYA 2ZUNA 3JR2A 2DSWA 3W87A 2KAUC 1US0A 3E0VA 2PWVA 4OOZA 1SGJA 1TJ1A 4TX8A 1POJA 3WLHA 1KBLA 3TQPA 3UESA 4D6EA 1YW1A 4XD5A 3G8RA 1PCWA 1XWYA 2J8TA 2RKXA 5H6HA 3M7SA 2ABAA 1R3VA 3OGRA 4TV6A 4WSJA 2EO7A 4JFUA 3VCRA 2VXNA 5DBUA 3ZLGA 1KBBA 3CH9A 1UR1A 4HMDA 1C7SA 2Y2WA 3E3HA 3KRBA 3OYZA 3FS2A 5JQ9A 3A64A 2PMQA 5I00A 4PSPA 5IBXA 2PI6A 4Y2WA 3GVQA 3CQHA 2PDYA 4ZB0A 1QOQA 4R3UA 1J5SA 5AKQA 3P8JA 1CXLA 4HNCA 1EIBA 1I0BA 1LF1A 4IUOA 3SM0A 4D8AA 3SQSA 3RLVA 4YVPA 9XIAA 3WQGA 4HK6A 1B3VA 3GNPA 2ZBTA 2ZUTA 4UCFA 1LRNA 3THDA 2PA6A 1EXBA 4XZIA 3KL5A 4L64A 3A6OA 8A3HA 2OKOA 6PTDA 2BV9A 2WVSA 7REQB 1VRDA 3GDRA 2OLAA 3KBNA 3VGDA 4Z2IA 3TTEA 3VD3A 4MYAA 1KRBC 3DBNA 3CPUA 4Q4OA 3GIPA 4WY0A 2ZVIA 5I3IA 1ADDA 3KXQA 2EJ1A 3KTCA 4DLFA 5ECUA 5BOFA 1EZ2A 2F7FA 2Z24A 3IUDA 4TMCA 3EDDA 4E2OA 1OZMA 1W3TA 3ES8A 1RV8A 3APTA 1E70M 1CI1A 3SCTA 3NEHA 2NX9A 4O12A 5GNXA 3EX6A 3TLLA 3ZT6A 4G7EB 1FWNA 2F84A 3CWOX 1EGVA 4EPKA 4UTMA 1R7AA 4YTRA 1ICQA 5E0CA 2EG6A 3B9AA 3O7UA 1M7PA 3BANA 4KEVA 2Q01A 1A3WA 5HK4A 2JGYA 1CLVA 1XIMA 4NZFA 4RXFA 3W38A 3MW7A 3R94A 4ZCWA 1JZ8A 4JTTA 1SZGA 1E40A 3PUGA 4GJJA 4L56A 2JE8A 5D9PA 5J5RA 3H22A 1TV2A 1X97A 2XWDA 2HXUA 1BRLB 2AL1A 4ZEPA 1FCQA 1V79A 3GHTA 3N9RA 1OX4B 2CW6A 4IIDA 4EAMA 3WLRA 4IP5A 4Q22A 4WHBA 1N82A 3DBPA 1KM0A 2JFEX 1IQ8A 4BY3A 4ZL1A 3TCSA 4F3HA 2GOUA 4R85A 4MB5A 3ANVA 1VF8A 2OQLA 2EKGA 2D24A 3E49A 1HXJA 5CSSA 3CK5A 3IVUA 1NOUA 3I4KA 1UP2A 3GNOA 1REQB 2XVLA 3NQDA 4HSOA 5DXYA 2HV5A 1TWSA 4U33A 3VNLA 3OTRA 1GZJA 1E3XA 4OECA 5EMJA 2BMBA 1JGMA 4LNCA 3H21A 3MY9A 5I3GA 3EX2A 1KM4A 3WQWA 4B5VA 3EPNA 3PZIA 1I2PA 4HA3A 4O15A 1XXXA 2BSLA 1XSJA 3W1PA 4L1GA 3W73A 4QLKA 2VQTA 5F1VA 4LAUA 5AC5A 1UHVA 2WZIA 4NX0A 4UTUA 3E2VA 1FX6A 4F66A 3UY8A 3JS3A 3PAJA 2WVTA 4EWJA 1MO0A 2VM8A 7CGTA 5GQBA 5BXTA 1IIHA 2DZXA 1JUKA 3ZSTA 4NY2A 1W1VA 3VGHA 3BG9A 5A2CA 4HIBA 4EXAA 2OWWA 1LOQA 3KTSA 4MDPA 2WHMA 4DM1A 2ESCA 1GHRA 4DPPA 3L21A 2VGIA 3LERA 4IJCA 3IIVA 3FGCB 3EPOA 3QV6A 5K9CA 2RGLA 4D9PA 1TRIA 2NVAA 3HMJG 3C2OA 1Q6OA 4H2CA 3L67A 3DHFA 2X0HA 2B31A 3D0CA 3TMQA 1OY0A 1POKA 4UTIA 4GQBA 4DBWA 2EBNA 2YA0A 3LA4A 3QFEA 3WBWA 2QDDA 4WX2A 4EXBA 1KM2A 4AZ7A 2HROA 2VWSA 1P0DA 1JCYA 4LOCA 4F0KA 4LUSB 2E4TA 2OX1A 1B30A 2RDTA 1VBRA 2O9RA 3PBYA 3L4UA 3L2LA 4HYWA 2DSKA 1OZQA 1ZTVA 3I4EA 4C6NA 1H3GA 1UASA 3UYIA 3QV7A 3GUWA 3W7DA 4UTTC 4IQLA 4D6JA 4H19A 1W3IA 3UXLA 4B5TA 3A22A 3QSTA 2VVNA 1D3GA 4C91A 4A8IA 3T0DA 2QPUA 3CGTA 1EP2A 3CZKA 4S2CA 1B5TA 4Y9NA 4WD0A 3S47A 4R7JA 5JVLA 4AWEA 3N13A 3RNDA 3GH4A 4GOAA 1T99A 3V75A 3ARXA 5EFDA 3KFTA 3C0QA 1DQWA 1O7AA 3LXCA 4TQTA 4GBUA 4N9CA 3GBDA 4DO7A 3SW6A 2A7PA 3LK6A 2C7FA 1S2VA 4N0RA 3KCJA 3MP4A 1C92A 3IGSA 5ECVA 1I1XA 4N9DA 1I2QA 5DRCA 3GC5A 2VCBA 2V2DA 1Q8JA 1H41A 1VENA 1R86A 1RP8A 3GW0A 3CV7A 3UJFA 4FO4A 3RX4A 4NF7A 3S8HA 4UTWC 5AB3A 3E02A 2MNRA 3ZMRA 3IIXA 4F0RA 3EOUA 3N4FA 4IL0A 4B5UA 3UWWA 3TOYA 3SFWA 1T96A 3T4WA 1D9EA 4OWGA 1TFVA 1BRLA 3VMPA 1KFEA 4CNOA 1YNYA 2IPJA 3GHRA 4PTNA 5CXPA 2A3EA 3A21A 3LCGA 4AU0A 4MYXA 3WLMA 3CUZA 3TKFA 5D2TA 4B3LA 5AN7A 1YYAA 3WMLA 6TIMA 1FWHC 1XH2A 4JN6A 1VGAA 2F61A 4UR8A 3LUTA 3PWAA 2QUMA 4CU6A 2BHZA 3OVQA 4Y8EA 1ECEA 4DB7A 3TN5A 3KX6A 4GMEA 3MJMA 4LY8A 3BV7A 2NLIA 2ZRUA 1UD3A 2DT3A 1OFQA 4EP8C 2HVNA 3VVGA 4C1NB 1NQ6A 1ONWA 4LBRA 2E8YA 4XO7A 3QHNA 3THUA 3VNJA 3IS4A 4I8DA 1I0DA 2G0WA 3QZ6A 1LOLA 3M5XA 4ATDA 4A3HA 4UMCA 1MZRA 4F0LA 4KFPA 4R33A 1GVRA 1S2UA 3ATZA 4GUIA 1V3IA 1ONRA 2BHUA 3PN8A 2WMJA 1JI1A 2F6UA 4GA8A 1Z89A 4O0ZA 2GVLA 3QC3A 3C3UA 3NG3A 4F2TA 2G8ZA 2BFGA 2A79A 2Q71A 4AZCB 4OOUA 3SCPA 4NJJA 4ZZ9A 3DHUA 1EF2A 3OG2A 1FWEC 3HIJA 1BVWA 3GG0A 2YL6A 4WKHA 1ZHAA 1TPFA 3LGEA 3TYAA 2Q3RA 2VX6A 2PGFA 3RPDA 4Z2GA 1MDRA 1KLYA 4WXZA 4AC1X 3B0VC 2FQIA 4Z08A 4DBUA 3FGCA 3GDKA 2NV9A 4L1XA 1JPHA 5H91A 1Z3NA 2GDUA 4HCDA 4GHRA 2HNHA 4RR4A 3E0WA 3FX4A 3G2GA 1E4IA 1CECA 1RPXA 2YYUA 4HNUA 5JH2A 2V69A 4FX8A 2WBKA 3W7JA 2PF0A 2HPMA 1W3JA 3GYCA 1CENA 3I6EA 3TZNA 2X42A 4HMNA 4BS0A 5CPNA 1VIZA 4O8AA 1VEOA 4LUSA 1FA2A 1JPDX 4XZNX 1FXQA 1DWIM 2Y63A 2OO6A 4PMQA 2AKMA 3ANYA 1IT8A 4F0SA 1GOKA 3CS2A 2J79A 2IKHA 5HMFA 1E6QM 4ICMA 1F05A 1M5WA 2CLMA 3CHDA 1XV8A 4ADTA 3OVGA 2V63A 1ZBKA 1H7XA 4YL2A 1IE7C 1A5AA 4G6CA 4KETA 1H60A 2ZUVA 2YDSA 2ZFAA 4JQAA 2DZSA 2YCIX 3H2CA 2WZMA 4QDMA 4MPKA 1LOSA 1MXDA 4EF8A 4HN4A 1C8VA 2VZVA 4L6DA 4P8WA 4O1AA 1J6OA 2VZOA 3UW6A 3W9ZA 3SURA 5ABGA 3C3NA 1WOAA 3RK8A 3MCNA 3HZ3A 1B2YA 1XL9A 4PH6A 1DWGM 4DAIA 5GJMA 1T8XA 1V0NA 2WKGA 1YKWA 3CUGA 1NFBA 2Z1WA 1DVJA 4X60A 5D2YA 3PC0A 1IGSA 2VR5A 2XZ9A 3RLHA 3OGVA 1F76A 2VMFA 3KVMA 2DDXA 1XH0A 3O9NA 4IM4A 1VFFA 4DF2A 3WLSA 3CASA 4HNLA 4GCAA 1X1OA 3ARQA 2NQJA 1L6WA 5C9RA 4JYEA 5BZAA 5J04A 3MSYA 3MU7A 1ZJAA 2Q8ZA 3FXGA 1S3HA 2B7NA 4GXPA 3WG6A 4B5NA 2DIKA 3UWUA 3PBMA 2QYGA 2ZRWA 1BGGA 2PF8A 4DXVA 4EPEC 6REQA 3AIQA 2XIJA 1IEWA 4R88A 1EBGA 4PCSA 4D71A 1QK0A 1HKMA 2OMAA 3UR7A 2UY2A 5HNUA 1UYQA 5DO8A 4IIBA 1VZWA 5FJPA 5CBIA 1H5VA 2BZNA 2QW5A 1J96A 3VTRA 4Z1AA 4HD5A 2PWGA 1CW2A 2G4FA 1A5OC 3UR2A 3TTYA 2ZZ6A 3TAOA 4H8VA 1EF3A 3CAWA 3TOPA 3GVVA 9XIMA 3MYPA 1E5JA 5F7UA 1Q2SA 1EYWA 5HMSA 3W2NA 1R9XA 3E9AA 1C3FA 2YBUA 1WKDA 4AZCA 3F4VA 1AA1B 4W7VA 4FLQA 4V33A 1K6AA 1F74A 1CCWB 1DOSA 4JNYA 1CYGA 2O0TA 2J78A 4PMUA 3WK0A 1XLFA 3KL0A 1E71M 2FFIA 3LXBA 4RLIA 1KW1A 3QPYA 3NGJA 5A6BA 5MKGB 1R2TA 3SIMA 4ICNA 4QE1A 3PNUA 3RITA 1DV7A 4ENLA 2GK1B 2WLZA 5C70A 1ZAIA 1UUQA 3WLNA 1UR2A 3IJ6A 4H9XA 3TN6A 2JKPA 7PTDA 5I09A 3VE9A 1IXNA 4WGHA 5D33A 4J35A 4CU8A 3MVIA 2JIWA 1VH7A 3BLEA 2A6LA 3AHTA 5FA5A 1RQBA 3LQGA 4I7VA 1KXTA 1E0WA 1UC5A 4N6EA 3U7VA 1KKOA 2WW5A 3K4AA 2XH2A 1SO6A 3R6IA 3NSXA 3LHTA 4N9BA 3IACA 2YB4A 1UWQA 1TMHA 5DELA 1UP0A 4XKYB 1GW1A 1RLDA 1VHCA 3O8AA 4IIHA 5AVNA 3UZWA 1NP0A 3QYSA 3W6MA 3LCFA 2WMFA 4FNPA 3WQPA 3QXBA 4MUZA 4YTUA 4M6VA 3BAYA 2CLFA 1R9YA 2UV8G 3U3HA 5M1TA 1Q65A 1Q7ZA 2DT0A 4MKVA 5C9ZA 3LM7A 3WJZA 3M5VA 2PDNA 3GAKA 3THCA 3NWRA 3VPLA 3KBJA 4RZ6A 4RZ4A 3RLGA 3ARTA 4M5PA 1OFDA 4Y90A 4YMZA 4MG4A 4W7UA 2E5DA 3TJXA 4JICA 1TVLA 2DQWA 5LXEA 1VR6A 3GXMA 1AH4A 3HGSA 3LLFA 4ATLA 3U4AA 3W7HA 1XRVA 3B06A 2Q3OA 2CWXA 5AHLA 5D30A 2OT0A 1UUOA 5BU6A 2QHAA 1RK5A 3NYZA 3V1PA 1LWIA 1XD0A 4M80A 3GLCA 4JCMA 3N25A 1DE6A 3PS7A 1UUMA 4I9AA 1S5VA 2WJDA 2INFA 4ZR8A 2YXGA 2Z7GA 1FP9A 1NDWA 2V81A 1R2RA 3SUTA 4UUIA 1QOXA 4YXGA 1QAPA 1IZKA 1ODZA 1B9ZA 1TPUA 5C2GA 3AXXA 1EJVC 1TPEA 4WLCA 1HGWA 4MHBA 3WF4A 4AD5A 4CCCA 1JPIA 1W5MA 1DKWA 2PTWA 3FDGA 3W2LA 1DWJM 3W85A 5LXXA 4U2YA 3S1WA 4JFSA 3N9KA 1DQXA 4RK8A 1D3CA 4UQCA 3WD2A 1CX9A 4ZQRA 1VPQA 1TIWA 4H4IA 3MO4A 4EE9A 3QEZA 5PTDA 2DUZA 4ZB2A 1WAWA 3F2DA 4BHYA 3PZQA 3TJ4A 2GDQA 1R47A 3R25A 4D1IA 1FFRA 2GDVA 3P82A 3EOOA 2I5QA 1QNPA 4OZOA 3H4WA 4WK9A 2OYMA 3OZMA 5D09A 1R3QA 5TQLA 1VFLA 3NYDA 5D32A 4KBXA 4QLJA 1QBAA 4OJYA 5U4NA 2YOCA 2PWDA 2HE8A 2YPIA 4QEEA 1LBFA 2EPHA 2HEJA 2J7GA 3CB8A 1FHVA 1ICPA 2RDXA 5AYIA 1RLCL 3GB6A 2BVTA 2ZE3A 1NIUA 1VBUA 3ID7A 4LH8A 1RAKA 4BCEA 1VEPA 4GIAA 1P43A 5CEWA 2XSAA 3DH7A 2XSBA 1W9VA 3VO0A 2VFIA 3I7SA 3DN5A 1S2AA 5H1WA 3I10A 2X0YA 4PEKA 3MP3A 3R79A 4BQ3A 3PTMA 2J9XA 4YTTA 1ZU8A 4F2UA 5C2XA 4GI6A 4JL2A 4AB4A 1R5YA 1H09A 2JALA 4EVZA 2W4XA 1NWUA 1LLZA 4IF2A 4JTLA 3VNIA 4D2JA 1L6FA 3NOEA 3URNA 5LHFA 1MXGA 1RVKA 3V0UA 1TV8A 2WWCA 5U7SA 5F2GA 3GXPA 5J5DA 4OT7A 5BOOA 2BXZA 2GK1A 2FHFA 1WKFA 3FJ6A 3IGXA 4FXRA 3L5AA 4LUTB 1DE5A 2J4GA 3OHIA 3M0LA 4KRUA 1EEXA 3J7HA 4ZQPA 1XJBA 3NZ1A 1OYBA 1TPWA 1OEPA 5EFFA 5TAOA 3EX3A 1LP6A 2G5WA 1TREA 3WDIA 1KWKA 2V67A 2VDHA 5IFTA 4ZOBA 4QP0A 1GWJA 2P8CA 4C1LA 4C6DA 2DIJA 1MW3A 2FHCA 3OG3A 3NXLA 4CEXC 4UFHA 2VZTA 3TTOA 4YU1A 2GWNA 3ZT7A 3FA5A 4HCHA 1F73A 4LS2A 4PC8A 3ITTA 4RZBA 5HJYA 3BTNA 1K3UA 4FF5A 3T1GA 2O7QA 2WSYA 1TV3A 4GVGA 4DAFA 6CGTA 3R43A 1W31A 3CZ8A 3QOKA 3PZGA 1QWGA 1AMKA 1JZ7A 4K36A 2YW4A 5CZSA 1B3YA 3P93A 3GDMA 1KCXA 1F8MA 1ADSA 3XINA 2AAMA 3LCIA 4D8ZA 2DUXA 2D0HA 4NZ4A 3M6DA 3IAQA 4PMVA 2BB0A 3F5JA 4BEQA 4ZFCA 4GUGA 3D5HA 1YMYA 1J9YA 3W01A 3G3DA 1W8SA 4MNMA 5HQEA 1EDQA 4DY1A 2XZ7A 1QK2A 2E6YA 2XVNA 3URBA 1YDVA 3D3FA 1P0EA 3V1HA 2Q8LA 1Y5XA 4I7UA 1Q3NA 3WJWA 3K4WA 3SUWA 2V30A 1HKKA 3O15A 1HJVA 4DUWA 3IV8A 3KEHA 5I3HA 1TX2A 1UOKA 1DJYA 4XZHA 4HTBA 3W2JA 1V6UA 1V6WA 3SADA 3WBAA 4H6QA 1WDQA 4MVAA 4K8EA 2ZRVA 5I03A 2WKJA 3FEQA 4NAEA 4EACA 3ZJKA 1XI3A 2G96A 1XG4A 2ISSA 4DO6A 1PXGA 4D6HA 3C0SA 3MUIA 4HNNA 1KKRA 1TPC1 2J8GA 1GZGA 1QVBA 4PMDA 4GNJA 3AXIA 3KUMA 5E93A 5FF4A 3LG3A 1ISXA 1N8FA 3DENA 4P61A 2FB2A 4AZBA 4NSBA 2C91A 3WSUA 3EXTA 4LALA 1RZMA 1OYCA 1XICA 1KRMA 1JDCA 4PMYA 3UWEA 3BXWA 4U10A 2GUBA 1EJRC 1CGVA 1GG0A 2Z28A 3NQEA 5EA9A 3GIQA 2VP8A 1B31A 3QLLA 1BAGA 4L1WA 4XAGA 4J5NA 5FAGA 3BZGA 1O94A 3T55A 5HPOA 4AAJA 1DTNA 5FAJA 3EWYA 5DFAA 1YX1A 3OHMB 4WDTA 4JIRA 3U2CA 3NPWA 1ISVA 4V15A 2WQPA 4DN1A 4PE8A 3RF9A 4TO8A 3UJEA 3MA8A 4IUGA 1NU5A 1RY8A 2F2KA 4AVOA 4I7WA 1WAUA 3HTWA 1MMFA 4O0KA 2J25A 4XBJA 1UR9A 4GZ7A 1M1BA 1RHCA 1ZENA 3OBKA 2IXUA 4PTWA 3S0CA 3S1VA 3MP5A 2FGBA 5KITA 4ZENA 2P50A 1LL7A 1NY1A 3QYQA 1DIEA 2VWTA 4RNJA 4H8HA 5I07A 2PTYA 3M5YA 3OW1A 5HUPA 3GHSA 2ZADA 4CQAA 2WPBA 1PZ1A 3P14A 1ITUA 2WC7A 1LBLA 2QIWA 2WVVA 4FOKA 2VZUA 2CLLA 3GXFA 2OVLA 3AS3A 4M29A 1X96A 2A2IA 1E0XA 1NDVA 1SM9A 5G1TA 2OZTA 4NJGA 4ZO8A 4NNCA 1UH4A 4MAZA 4O1FA 2J9YA 2HRWA 4JKLA 2R91A 1SJAA 4DJFD 2NT0A 1TQXA 1UWIA 2R1PA 3C52A 1E43A 1R6WA 4RDYA 4HNOA 3S2CA 1EPVA 4WDWA 3UVIA 5IOBA 1UKSA 4Q6JA 2NX3A 5FESA 3A9IA 2V0TA 4L4MA 3CMFA 3W2KA 1P48A 2XVPA 3LI0A 1V3MA 3R13A 3MHUA 4JDYA 3GH5A 4HK7A 3GXTA 1BKSA 4ACZB 1UPMB 3UY7A 4HYVA 3HG5A 1VYRA 1OT2A 1FHUA 3C56A 3PJWA 3KZSA 4KEUA 1MUMA 4DLMA 4HGXA 4CGTA 5AC8A 2DZPA 4FLOA 4JR5A 4WZHA 4G8TA 3GKAA 3VXGA 2D2JA 3C0JA 4JIIX 1A5KC 4BWLA 1UW9A 2DH2A 1P6CA 2G50A 3ITOA 2C3ZA 3BQ6A 3G0XA 1JRCA 2ZX5A 1RR2A 5DY2A 4MJZA 2QLYA 3RRXA 3NL6A 3M7WA 3WDPP 4XUGA 2QF7A 3RUBL 2DZUA 1ADOA 2QVNA 2OLHA 3TW6A 3NO3A 3G1DA 3LD5A 4MLRA 2QULA 4IWWA 1MUCA 4K1GA 5HNTA 3GRIA 5CG0A 2INZA