3WQDA

D-threo-3-hydroxyaspartate dehydratase from delftia sp. ht23 complexed with d-erythro-3-hydroxyaspartate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHACATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
molecule tags Lyase
total genus 145
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqdA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqdA02
1CT5A 1W8GA 4PB3A 1EPVA 2DY3A 4KBXA 4FS9A 3BTNA 1KNWA 1VFTA 4PB4A 4LUSB 4XG1A 1F3TA 3GWQA 5GJMA 2P3EA 3AWNA 1QU4A 1L6FA 4XBJA 1BD0A 3B8VA 3WQCA 2OO0A 4PB5A 2J66A 2PLKA 1NJJA 2VD9A 4LUYA 4A3QA 3NZPA 4DZAA 3WQFA 3C5QA 5BWAA 4DYJA 2PLJA 3LLXA 1VFSA 1FTXA 3B8UA 2NV9A 3CO8A 3E6EA 1L6GA 3ANVA 3N29A 1KO0A 1RCQA 4LUTA 3CPGA 4V15A 1HKVA 3N2OA 3S46A 3NZQA 3B8TA 3OO2A 4QHRA 3WQEA 1SZRA 1XFCA 3HURA 1TUFA 3N2BA 5FAGA 3VABA 4BEUA 4BHYA 3AWOA 3R79A 3WQDA 3SY1A 1D7KA 4BF5A 2RJHA 4WR3A 2ODOA 5FACA 3UW6A 3ANUA 4ILSA 1NIUA 1TWIA 2SFPA 2O0TA 5IRPA 4BEQA 3B8WA 4ZGYA 1HKWA 7ODCA 2VD8A 4LUTB 4AIBA 1B54A 3KW3A 5GJNA 2QGHA 1VFHA 5FAJA 3E5PA 4ECLA 4Y2WA 2YXXA 2ON3A 3WQGA 5GJPA 1XQKA 2RJGA 2NVAA 2TODA 1XQLA 3HA1A 1SFTA 4LUSA 3MT1A
chains in the Genus database with same CATH superfamily
2Z24A 4G8TA 4RDYA 1K8YA 1BWLA 3MCOA 3H2MA 3LZ5A 2GGEA 3HBLA 4ZQMA 4HSOA 4D6FA 2VZVA 4JTTA 1PCKA 3E49A 3NYZA 3BLLA 3LM7A 4W5UA 3QV7A 1SQ7A 3ARRA 3VKBA 1MEWA 1NOWA 2NT0A 4P7RA 3GIQA 2VD9A 4FALA 1LWJA 1JXKA 4LCQA 3NDOA 1GORA 5G1YA 2Y8VA 3BH4A 3JU2A 2CBUA 1AH0A 4LJ3A 1NFPA 3EOUA 4ADSA 4QNEA 4O18A 4HPJA 4ZO8A 4NNCA 1HQTA 1K9DA 3O8AA 4X2RA 4XAGA 4PCSA 1G7VA 2BB0A 1GKRA 3IEBA 2CYGA 3VOHA 1XSIA 4N6FA 4HCHA 1NTHA 3A4WA 3L4TA 4LSBA 4ZQRA 2OSWA 3TA9A 3OW1A 4H6RA 2WMIA 3O2LA 5C9ZA 2DIKA 4XX6A 4C1NB 2XIMA 1IZCA 2J7HA 4O1CA 3MI6A 1Y5WA 4YNGA 3E5PA 4JD4A 3QR0A 2HXUA 3OLDA 1KWKA 3ZT5A 3CK5A 5JUVA 2VWTA 3RHGA 4AU0A 4Z17A 2XIJA 1L9WA 3EOEA 3T0CA 3OGSA 2PEVA 1RR2A 2QCDB 1M6JA 3EXSA 3AS0A 3ZM8A 5I06A 3GBDA 5GPRA 1GQJA 3WUEA 3VE7A 3BCJA 4IMFA 5H2ZA 4H2HA 3F4CA 5LGZA 1W3NA 5C70A 4HMCA 1OFDA 2VEKA 4S3BA 2WZIA 3LHYA 3UJRA 2PLKA 3VGFA 3K4WA 5KITA 1OX4B 4MZ8A 2FHCA 1LRQA 2DUXA 3AYVA 4EP8C 1XUUA 1XXXA 3GYCA 2Z6IA 3GC5A 1RJQA 4BI5A 3E12A 4LUTA 5C7HA 1LDCA 1TQJA 3GNDA 2QZRA 3RMEA 1MEIA 3THQA 1TVPA 3PZGA 1ZUAX 1JYNA 2GK1A 2YCKX 3YPIA 2B4GA 1H41A 2XIBA 2WJZA 2EG6A 5HK4A 2PRHA 1P48A 4FNUA 3LPOA 4JTRA 3VXGA 2CLMA 3STFA 3HPXA 3WD0A 3WLTA 2PDXA 2JE8A 2WO5A 5IDZA 3BICA 3ONCA 5HJYA 4OU1A 1XF0A 5EA9A 2PGFA 3TW9A 2PBGA 5I3KA 4IGSA 3IJ7A 2AGKA 2QUNA 4TMCA 4BQ5A 2WMFA 2D24A 3MJMA 1XH1A 1DPMA 1KR1A 3DUGA 3GFYA 1ZSXA 4KPLA 3QV9A 2PTZA 3OB8A 4GG9A 8RUCA 5GNXA 1EX5A 4KIRA 2E3ZA 2CBIA 4FR6A 3T6CA 1YMYA 4MGGA 1R9XA 2WMIB 1BQCA 4KGLA 3CGTA 3HPSA 4CN4A 3AMCA 2XGZA 1BWKA 3N2XA 2IQ0A 5BNKA 3TC3A 1JZ5A 3SUUA 1S5VA 2PLMA 1TR1A 3O6AA 2NQJA 1MRAA 4LAMA 4AVNA 4HZ7A 4AEOA 4B5NA 4ML9A 2VEGA 3RO8A 3VYLA 1XD1A 4JX4A 4A3HA 1NWTA 5FSEC 3LXBA 1U2YA 1ALDA 1XRVA 3QHNA 3OVPA 3WJZA 2VELA 3G22A 1F73A 2QJGA 3TWAA 2BHUA 4XAPA 3V5OA 4UFMA 4U2ZA 3WO8A 1PPIA 2PDGA 1E73M 4FMVA 3HG2A 2QAPA 3RM9A 3I65A 3W7MA 2Z2AA 4HHMA 3QPYA 3MBDA 2BSLA 1KKRA 5DRCA 4HP5A 3B8WA 3G8EA 3VD4A 3PP7A 1GOMA 2QDGA 2AMGA 3P80A 4LUTB 4FXSA 5A8NA 2J7FA 4LFYA 3PFRA 4Y2WA 1TPDA 2DT1A 1IIHA 1GVIA 1UP3A 3TZFA 4ATDA 2RH9A 1RV8A 4DWDA 1AJZA 2O4MA 4NAFA 1B3WA 4XTDA 5E70A 3KOZA 1LCOA 3AIEA 1ZENA 2WSQA 4Q8QA 3QFEA 2O7QA 3N3TA 4TMBA 3WDHA 1LBFA 4MTVA 2F6XA 5REQA 1R7OA 5LIWX 3W25A 2WM0A 2AKZA 4FI4A 3KBMA 1TO3A 4HOXA 3S3GA 1W32A 1RQEA 2OYKA 1S3HA 3AXXA 3TYBA 2X0HA 1IXNA 5AFDA 2QUMA 3B04A 1HZYA 1OCBA 4NZ1A 4JS3A 4PL2A 4F40A 1I45A 1UD5A 2HPMA 1EJRC 1VCFA 3GH5A 3K1GA 1CTNA 2CLPA 3CUXA 1J79A 2BGNE 3W1LA 4UXDA 5CLTA 1JZ2A 1OSEA 2DZSA 2GUYA 2NWRA 4XAFA 1EHNA 2PDFA 4CQ9A 4X9SA 1L8PA 2B7OA 1GTEA 1QO2A 1ISXA 4ZBCA 3T4WA 1T8QA 5PTDA 2VOMA 1FWBC 2ZUVA 3AZTA 3T78A 1KBKA 4QSHA 4A8IA 1B4EA 1NOFA 4FR1A 1BRLA 2XN1A 1JL8A 5AZ1A 3UGRA 5M3WA 2UWFA 3KVJA 3EYPA 3TN6A 2VEMA 3MV01 4LYPA 1DJNA 2B31A 4GX8A 4FS9A 3AMLA 1GZ1A 3BTNA 3EAUA 4GUHA 1MWOA 2Y8KA 1VFTA 1HKMA 3C2FA 4G9PA 3FOKA 1KM2A 3OGVA 3CV2A 4WXYA 4JTAA 1KBJA 5C2XA 4UQEA 1S5TA 4IH3A 4L65A 3VO0A 3SZ8A 5TNVA 2W6RA 5G5IA 4YTTA 4RUBA 4AEFA 4XZLX 1RVGA 2ZTKA 4PUUA 1DWHM 1ZY9A 1CXLA 3MMTA 2GOUA 4JEQA 2Y7EA 1W5QA 3KZSA 4S3GA 3KCJA 4MF4A 3SCSA 3FFSA 4NAFB 3H55A 3SCPA 3BOXA 1BTMA 2WCAA 3D3AA 4XO7A 5AOUA 4TX9A 3ZO9A 1VQTA 3QY8A 2OR2A 3BMXA 3UU0A 5REQB 3L4YA 4CGTA 1FFQA 3FXYA 3VKCA 3W71A 2WZMA 1FX6A 2ZUWA 1TPC1 2DSWA 3N2BA 1ZCOA 4I7VA 5I02A 1YADA 4U3CA 2CCRA 1J2BA 3ERPA 4E6MA 1LQ0A 2WNNA 2OOGA 4C1LA 1Z44A 1W9XA 3WQVA 1L2QA 3PBUA 1IWBA 1GVOA 2A2IA 3AIRA 1XSJA 1I75A 4PGLA 3ZLHA 2BS9A 3N3MA 2O56A 4JIEA 4RDVA 4XZHA 2PGEA 4F2BA 1B54A 3GUWA 1J6OA 2CESA 2E6FA 4GQ0A 3W87A 5C9RA 1LL4A 1WOBA 2A7RA 3F2CA 1PKLA 2Z1SA 2DH3A 1EKOA 1Y5XA 2QULA 3UWVA 1RAKA 4PMRA 4GUIA 2NX3A 2R14A 1BLIA 2ZX6A 5DT7A 3AIVA 2D0GA 3UXLA 3NQAA 4TV5A 4S2CA 4K68A 3FEQA 1I2PA 4CNNA 1YXYA 1ZALA 1ML1A 5I78A 1XDMA 1IE7C 2J7CA 1ZL1A 3TROA 4D71A 1HL9A 1QW7A 5HWJA 1GZGA 5IHSA 1S1PA 4LX4A 4WJXA 2Q09A 2WWCA 2GVJA 4F0HA 3T08A 1JD9A 2XVKA 1YE4A 4AD1A 3P2VA 2FIQA 2DGAA 4JAWA 3ABZA 2PF8A 4KCVA 4TV6A 5A8PA 2XVNA 3TMLA 3LBOA 3I7QA 5G2HA 3LRKA 5LA2A 2QJJA 3ORWA 3A5VA 3FHQA 4CD7A 3B0UX 2V5BA 1XYBA 5C71A 1UIOA 5CLWA 1TELA 3L5LA 4E5TA 4IQDA 1VJSA 3LCFA 2FTPA 1L8NA 1VEPA 2WLZA 3CH0A 2O9OA 4IM4A 3UXDA 4LVBA 4WOZA 3VKKA 1AMYA 1YYAA 1HUVA 3C8NA 2WC3A 2NQZA 4E38A 4N0RA 1GJPA 4JNZA 1QHOA 1KFJA 3TEVA 1YW1A 4GIYA 1KQYA 1VPXA 4ZENA 3LSCA 1W3JA 4AB4A 1K6AA 3RN6A 3WF4A 1TZZA 2I14A 2YR1A 1NDVA 4IFOA 3COTA 4WZHA 3T0DA 1DJWA 4NF7A 1PBGA 3K46A 3H2EA 3LYEA 1UA7A 4HA0A 5FCZA 3QQ1A 1K4HA 3LB0A 2AQOA 3K8LA 3FA5A 2ADAA 2EPKX 1BVNP 2I5GA 3IK2A 3QKZA 3ID7A 3GDTA 2DW6A 1DWGM 4DBWA 3O0KA 1E6XM 1OGBA 3VINA 2ZRYA 1F8MA 3FYOA 2H3DA 3PAJA 4J1OA 4BQ3A 3HV9A 3W1NA 2YFOA 1B2YA 1KFWA 2CWXA 2QIIA 1R2RA 1JGIA 2BY1A 1MW1A 3ARWA 1LRNA 2CHOA 1MRQA 2X41A 4YYFA 2OX4A 2CETA 3UZ5A 5CPLA 4AF0A 4FK9A 3TDFA 3L4WA 4DLMA 4S3FA 4GISA 3U5UA 3SUSA 4C91A 3W1QA 1KTNA 4ZSTA 2JEQA 1E5JA 4ZODA 1GOKA 5I3IA 1YNYA 4GX9A 4AZGA 4R5EA 4YYCA 2FQIA 4LUSB 4J3SA 3PULA 4XAYA 4BCEA 4Y9PA 3EDDA 2YIHA 1J0YA 1F3XA 1Q5MA 1E15A 1M7JA 3SECA 1M7OA 1XLKA 3T42A 5M17A 3V1PA 5HAOA 2ZX5A 5JXQA 1VHCA 4XB3A 3KP1A 4GXMA 2P76A 1U33A 1C9DA 1E1FA 2ZBTA 4QCEA 2QEZA 3E2SA 5D09A 4FOUA 2TMDA 1SSDA 3NO1A 1FA2A 1FTXA 1XC4A 4Z1AA 2AKMA 1GTHA 1N55A 3AU6A 4YTQA 1B3ZA 1RCQA 1V02A 3GXIA 3M0HA 3N12A 4NHVA 4EKJA 4P8VA 4JNYA 3TNOA 3VUPA 2IXVA 5CPTA 1ONEA 5ABFB 5CG0A 1A53A 4NKCA 1QK2A 5G4HC 3QN3A 1VBJA 1Q7ZA 1JPMA 4JICA 3F2DA 1YEYA 2PU1A 5A2BA 5EFFA 2FPVA 1E9ZB 3ISIX 4CCDA 5F4XA 5LSMA 4CN1A 2IPJA 3OYXA 1HVQA 2V8ZA 4H8HA 4C6OA 4MWAD 3DFOA 1MXDA 4RE0A 1W9UA 2X1TA 5E9AA 1TZ7A 3G1AA 2FPYA 3N9SA 4K39A 1E6NA 4O14A 3PWIA 1P0EA 4TX6A 4JEJA 1B31A 1OADA 4HOZA 3QV8A 3EWWA 3IGXA 2E6YA 3XINA 2JEPA 3LI0A 4JPGA 3H8AA 1GWJA 4MJZA 2FB3A 4A8NA 4AF0B 3ARTA 2VDIA 3PPGA 1DVJA 1TPH1 1W1A1 4FNRA 3RLUA 5E09A 3PJTA 4PTMA 3UP8A 3G5EA 1D3GA 2VX5A 3SB0A 4CQ8A 1XCXA 3NR0A 1OWQA 2D0FA 1OIFA 1EP1A 2XG9A 1POKA 4EWND 3E2RA 4DJDC 3K4DA 3NZGA 3W2UA 1CGVA 5AN7A 4UB9A 3TTEA 1XYMA 3URQA 3P84A 4DRSA 3CH9A 1XYAA 1Q4WA 1Q6LA 5FAGA 3RIKA 1LUCA 4L9XA 1ISYA 3SFWA 4Q8NA 3W74A 4HMEA 1FUYA 4ZGYA 1DTUA 4IFRA 3LCXA 3EB4A 2VFGA 3KOXA 4MPQA 3NL3A 1TV4A 2W62A 3LMZA 3EDFA 3VNJA 2ZQ0A 5EYWA 2RDUA 4FF7A 5I03A 3O3RA 4NIRA 2J75A 1PVNA 4B5SA 1UWQA 3L4XA 3FSTA 1I2RA 3L23A 1DOSA 1CNVA 3N17A 4WF7A 1KCLA 2HNEA 4RPQA 5A6BA 1FWSA 2PI6A 4MUZA 4WD0A 4UOJA 3L67A 2O7SA 1R9ZA 2PB1A 2J25A 4QITA 4WKAA 2GJXB 4BJHA 1LT7A 3T0AA 4PB5A 2EPOA 2EKGA 4FF5A 4R85A 4X63A 1XRFA 3JS3A 3O6YX 4Q4SA 4JYEA 1QW9A 2G50A 5U7SA 1TPWA 2VTFA 1GVEA 4Y90A 5BXTA 1MQQA 2BXYA 4O0KA 4RK8A 1RY0A 2EPNA 3SCOA 3S4TA 4LAKA 1I1XA 5LNRA 4LCRA 4FNPA 1Z3NA 2R1KA 1HXJA 2Z27A 3AAMA 4XBKA 2W0UA 4GZEA 4R34A 1REQA 4RNJA 2QT3A 4TQTA 1ESWA 2PC8A 3L12A 3R5EA 1BKHA 2SFPA 4O8RA 3WH5A 2F84A 4XSMA 2GGGA 2ALDA 4P61A 1S2WA 3VIJA 2V63A 4O1FA 4AHPA 1MYRA 2JIEA 1XIIA 4D6IA 4WKFA 3SRKA 4GLEA 4PMZA 4PMDA 3LRMA 5EKYA 1UUOA 4HYRA 3NEVA 2OJPA 1V02E 2V2DA 1QDSA 4O10A 2H8XA 3NEHA 4UR7A 1E4NA 1TMHA 4GC3A 2DPEA 3DH7A 5CBIA 2VI0A 4AQLA 5BXSA 1VC4A 3MUCA 4YVXA 2CHRA 5B7ZA 4AIUA 4C6FA 5A6KA 3WFAA 3DHFA 1W9PA 1MQRA 4QISA 3ZVIA 3G6MA 1SYTA 5BRBA 4KFNA 1XPGA 1FHVA 1TX2A 3QC0A 3TCSA 1SPQA 3GU1A 4XUYA 1H1ZA 3ENLA 1NF7A 2EJ1A 1KGWA 5EU9A 2XWEA 1ZAIA 3WDJA 2WSYA 4LYKA 4QXIA 3JUGA 3GC2A 4UCFA 9XIAA 2GUBA 2H8ZA 4U28A 2YA2A 2PP3A 2ODOA 2DT3A 4ILSA 3KTXA 1TWIA 4BS0A 1G94A 1US0A 4A2SA 3S2CA 3TVAA 4G1NA 2V2HA 4BI7A 3HB9A 3W83A 2C6QA 3PG8A 5LNVA 5AHLA 1QRQA 1AK5A 2WCGA 4GI6A 3CC1A 2YA0A 3MT1A 1FQ0A 3DFHA 3AICA 3MANA 4DUWA 4WJ8A 3C0SA 1LRTA 2Z7GA 4B2DD 1GT8A 1ZZMA 3HN3A 3V18A 3CBWA 4N02A 3MPGA 3MI2A 4HMDA 4K7VA 4LBUA 1EQPA 4H19A 3UNTA 3ELFA 3WELA 3B4UA 5JBDA 2WVTA 4G6CA 1EB3A 4PMQA 1ICPA 2GUUA 3R4IA 1NF0A 4JFUA 1NJJA 3VIMA 5MKGB 3WQFA 3C5QA 2ZXAA 1XJBA 4PBEA 3V5FA 3N14A 1JULA 3VPLA 4UTLA 2V81A 4AMCA 5A6TC 4JTFA 5ABGA 2CLHA 3ITCA 3FKKA 4N9EA 4P8UA 3RMJA 4EK7A 2OTDA 2OYMA 2QVHA 5D32A 1F05A 2WJEA 1HKVA 1YPFA 3CWNA 1RBOB 1RALA 1OF8A 4CD6A 3IAQA 4QTGA 4R7WA 5BRPA 1S2TA 3ITLA 3CLWA 3WH9A 2FZ8A 4UUIA 2OGJA 3A21A 1XYFA 4GCAA 2HVNA 3W76A 5I00A 3NPVA 2BY0A 5BZAA 3N2TA 1CWYA 4LEQA 1FWEC 1XIGA 3NDZA 4C6BA 4Q6XA 5I3JA 1QPOA 4G2DA 3IJ9A 2GVYA 5F2GA 4IG2A 4DBSA 5CQ1A 1A3WA 4S2BA 3MKVA 3GTHA 1RP8A 3MMWA 3OZYA 5B80A 1QPRA 1POJA 4B5TA 1QOPA 3VI2A 3UA3A 3TYEA 1QTWA 4E2BA 4B4FA 3EOOA 3ZIZA 3VFLA 3FA3A 3H2CA 3BAWA 4GPNA 4WCJA 2ONEA 4GI4A 3BV4A 4A22A 3SIZA 1TVNA 4GYPC 2RGMA 3W37A 4IMDA 2VP8A 4BY3A 4DF0A 1ZBKA 2V9DA 3T44A 2QIWA 3EX2A 2CLFA 1G67A 4KFPA 2ZX8A 4JL1A 3PBWA 1TJ1A 3KTSA 3VE9A 2CKRA 1K7FA 1N2VA 3UG5A 4G7EB 4CQDA 3BQ6A 1DTNA 3IUDA 4LH8A 1B1YA 3K8KA 3M0IA 1RH9A 3RCYA 1SZRA 1W3LA 2VHLA 2OG9A 1C7TA 4MAVA 3GIPA 3RO6A 4ZL1A 4O1AA 5H91A 2ZA1A 4GQBA 2PU0A 5D8ZA 4C7DA 3HF3A 3QC3A 3RM8A 3W53A 1KFLA 5XIMA 2C91A 3WF3A 3DFQA 4EACA 5FOOA 3R12A 1XSKA 5RUBA 4D6EA 1SFTA 3M6YA 4B16A 3KRZA 4IP5A 1A0CA 3GTIA 3NXLA 2JF7A 3N6HA 2XHYA 1UKTA 4KWWA 1XDJA 1ITCA 4QM1A 1QOXA 3U6WA 2FZBA 1OK6A 2E8ZA 1WZKA 2BNJA 1R5YA 2ALRA 1DE6A 4QLJA 3ZLFA 4XWUA 4A3UA 4Q4MA 2E68A 2E5CA 3APGA 1AQHA 3NL6A 3Q37A 3S6TA 3DX5A 3UESA 1W91A 3W1PA 1I8JA 4CQBA 3MWAA 4GABA 4DYJA 4D8AA 4O12A 4J3UA 5M03A 1DJIA 3GXFA 2YDSA 3CHVA 4ZB2A 3QM3A 4UTTC 4I6VA 5FF4A 4MJ4A 5BU9A 1XLGA 2REQA 1K03A 4ERAA 1KXTA 3MKKA 3TYUA 4RNHA 3CIVA 3ITGA 4NI8A 1E4IA 4IL0A 4DXVA 1FWDC 1XWYA 1TIWA 4L9ZA 1E72M 3WNLA 3MVIA 1HKKA 3FAXA 4LF1A 5K9CA 2HROA 4DY1A 3G3MA 4L80A 1EEPA 1YIXA 4IWWA 3PG9A 5HANA 1D3HA 1DWIM 2J62A 2YPIA 5CSYA 4GNVA 2A0NA 3G8RA 2QCFA 4WRHA 2WXDM 2D3NA 1XPYA 3K5XA 1WXZA 2NQLA 3LXCA 4FP1A 1YX1A 2ZTJA 5BCAA 1OYBA 3WQ8A 3G1RA 1SJDA 1GKQA 3L21A 2W92A 4CCEA 3KOWA 3TN3A 3HJZA 2E6AA 4DUOA 2EG8A 3QLDA 2J9XA 1DXIA 5I24A 3UR5A 2CZEA 1UG6A 4B5WA 1X98A 3AHYA 4AXNA 2YA1A 1C8XA 4KCWA 4Q8VA 1FWWA 3ZOAA 4HVXA 3P8JA 3Q94A 2BVTA 3KFTA 4UTWA 1UYQA 1QR7A 2NVDA 3BSMA 1WXJA 3PANA 1YBQB 1E0XA 3PS7A 3ZSTA 1TWWA 4U10A 3CZGA 3BANA 3CYJA 3R43A 1TWZA 3S0CA 1JF5A 1AJ2A 2CLOA 4P7QA 3GHRA 4KRZA 3I7RA 4ORIA 2NV1A 1UD4A 1ICQA 2DP3A 4QHRA 4JN8A 3MS8A 1EO7A 3VFCA 2PDWA 4NG3A 3CQ0A 1D7KA 2HE8A 4AY1A 4FXFA 3W73A 3TTQA 2P0OA 2OO6A 2DUZA 4DLFA 3EPNA 4JGDA 2D22A 3W1RA 2Y8UA 4JNMA 4F0SA 2EXOA 3UPBA 5G2WA 1KLYA 5DMLA 5ECVA 2FZDA 3B8SA 3RFAA 3PPHA 1S3TC 4HYWA 5GJPA 4AZ7A 3C0JA 3ZJKA 1U1HA 3WZ0E 3DEQA 3GG8A 3BAJA 1I1WA 2YYTA 4CVWA 3VC6A 1OB0A 1PV8A 3O07A 3T55A 2JKPA 3BPWA 4QJ1A 3BZJA 4HD5A 4EVZA 1BVWA 4B3ZA 1ZGDA 3N04A 1VYPX 5HNNA 4IGHA 4S3EA 4AD3A 3KM8A 4IL2A 4U5KA 3O6CA 4RNFA 4PC8A 3LUTA 1T0OA 1K8ZA 3ARPA 3F4NA 4HU8A 1GQNA 1V3LA 1F4HA 3S5NA 2UY2A 4DNHA 3RX2A 3LNMA 4GVHA 3RILA 3XIMA 4NZ5A 3A12A 1YTDA 3EMZA 3QMRA 3NFUA 1KFEA 3MSGA 2Y7DA 3N15A 2PDQA 2ASHA 3GY1A 1GUVA 3CUGA 2J78A 2WNQA 2BZNA 1QHZA 4W89A 3SUWA 4K1GA 3W7JA 2JALA 1NU5A 4EX4A 3OLIA 2OZ8A 2XVGA 3SY1A 1L0PA 2R82A 1IIGA 4GI9A 4JQ4A 4UOQA 4XD4A 3GDBA 1KRCC 2R1NA 2HMCA 5JMUA 1JYWA 5EMYA 3WL1A 3NVTA 4FA3A 4KCTA 4JQAA 4C7GA 5FI8A 2VEIA 3TCEA 3UWYA 1XX1A 2C79A 2RJGA 1LQAA 1KRAC 1VPQA 4GJIA 1BYAA 1TTIA 1ZJAA 3STEA 2J6XA 3WLHA 4ZOEA 4TO8A 4L4LA 3M5YA 4NJJA 4ML4A 1CPUA 1P7TB 3W7RA 4DWSA 3B9EA 4LEFA 4PL1A 5KZ6A 2YBUA 2OVLA 3M44A 2E28A 1YPIA 3IK4A 4CKQA 4DUVA 4Z2HA 4TX8A 3VIOA 4HYVA 3KBWA 5EGRA 2F61A 3E5BA 3UD6A 3CZLA 1WB0A 1A0DA 2BMBA 4V1YA 3LLXA 3ARZA 3VVGA 1XP3A 1W1YA 3TYAA 2VOTA 5KZDA 1VEOA 2YL8A 4TOQA 3SAZA 1GOWA 1A80A 4KGJA 3II1A 1HJVA 4IT1A 3VX1A 2Y0FA 1Q6OA 4H7ZA 1I0BA 5LXXA 3LX9A 3POHA 3TXVA 3TYCA 1EJ7L 4JOMA 4HTYA 3OPSA 1K6WA 4GE8A 2NT1A 2ZX7A 3TQPA 4TVDA 1ECEA 3VGHA 4R3UA 3P93A 3DHUA 1Z42A 1EUAA 4DVOA 4UFLA 1S5WA 4WSJA 3U48A 3HG4A 4W86A 4QEHA 1MW0A 1HF6A 4DEFA 3FY1A 3HPAA 3FXGA 2J7GA 1JQXA 2JQXA 1KTCA 4H7CA 4Q4RA 4IIHA 4L61A 2YB4A 1YDOA 3S1UA 3U2EA 3WN6A 4EPKA 4KS0A 5A6MA 3OP2A 3W88A 2C15A 1TSIA 1A5SA 2C16A 3G1HA 5FESA 2OLHA 1J0ZA 1KM4A 2PLCA 2VGFA 1XLEA 2BOEX 3DOPA 1EA9C 4V2XA 3MU7A 2NX1A 1MO0A 1Z6KA 1C8VA 5A6AA 4DWSB 4YPJA 2ZUSA 3K8MA 1E56A 1W3TA 1XD0A 4Q4PA 1B3VA 7TIMA 2QDDA 5M1TA 4AHQA 1K1DA 4R88A 1AQ0A 3A64A 3DERA 3G6LA 6TIMA 2A4AA 3FV9A 4O15A 3R7MA 1E0UA 4HU0A 3ARVA 3VCRA 1MUMA 3N73A 3K2GA 3RXZA 3CWOX 3P5YA 1PJ9A 3GNXA 1TPFA 1VCVA 4O17A 1PIIA 4UIOA 2ZE3A 4LS0A 2HTMA 4O52A 5J8LA 4HSNA 3IIXA 4HNCA 1FWFC 3BMVA 1R7AA 3A4XA 1PKNA 2YCLB 3KAOA 1LYXA 3C56A 3MC5A 5I7GA 2POTA 1IZKA 4Q4KA 5JIWA 1C93A 3V36A 4L1GA 3GHSA 3CJPA 3W7CA 4PBFA 3CU2A 4H7VA 2A79A 3FGCA 4GUGA 3FW6A 2WC4A 4EOUA 4Q8UA 3PWAA 2VGBA 3EA1A 3T2QA 1UJPA 4MKNA 4Q22A 1E1CA 1CECA 1TJ0A 4IPPA 5E1QA 4E4PA 3R0UA 4OWGA 2QCMA 2ZUUA 3U9IA 3AROA 1ZP4A 4G5DA 4US5D 4OFCA 4MY1A 3NG3A 3F2BA 3BUVA 1ELSA 1W5MA 5BXPA 1H5YA 3UZWA 1FHLA 5A2CA 4ZQCA 2W4XA 4W85A 3IGSA 1AQMA 1A5AA 2WVVA 3SIMA 2RJHA 1W5NA 1G4TA 5LA1A 4AG0A 4WXZA 3LNPA 2J7DA 3L4ZA 1F4AA 5C8BB 1N82A 3MP4A 1SJCA 1WA3A 1Z32X 4MLRA 2E6DA 1JCNA 2CEQA 2HISA 4XISA 1FCBA 3BL3A 2FFIA 5HXMA 1UMLA 3BLKA 2WSRA 3VD5A 2EEXA 2NVAA 4PFHA 3JZEA 3H23A 4C6NA 4OECA 1MDLA 4Z42C 1HJWA 5I3HA 2A3HA 1U1UA 1WE5A 4NSBA 3CB8A 4KWOA 3BSGA 4KETA 1J01A 1A5CA 1FH9A 2DORA 1XCFA 3SCTA 5AHEA 3SCUA 5JBEA 3UPMA 4UCGA 4ZVJA 5IXEA 4X0VA 3PK7A 3S42A 5KETA 1P1MA 5XIAA 1JNEA 4GIAA 4JTIA 3O16A 3S1GA 3L68A 4GGBA 1MEHA 1WXYA 4HSHA 5HJLA 2PE4A 4CU6A 1E1CB 2NVCA 3M9YA 4BF9A 3LMYA 1X6LA 5LGXA 3MDUA 4XIMA 4F2UA 2BXVA 3PN8A 2VZSA 3IIVA 5D37A 3RJXA 2YLAA 3IVTA 3S2NA 3AOFA 4WK9A 1HKWA 4AFYA 3L5MA 1EGMA 3L7RA 4IUOA 3QY6A 4PCFA 5A8OA 3BDKA 3M0XA 1RK6A 5A1AA 2D2OA 1UKPA 5I3FA 1QO5A 2B81A 1S5MA 2WVVB 3ABOA 4F3HA 1CT5A 4PA8A 1PSCA 5HUPA 4CD8A 4YWIA 3IPWA 2JF6A 3EDEA 3EMCA 2TRSA 4Z1CA 3DYOA 1F74A 3E0FA 1OZMA 3GVQA 2AGTA 3WYZA 3TTSA 5HWMA 1C8QA 4PTDA 1E0TA 4YS1A 3VDHA 5H8UA 1P0BA 2G41A 3WDPP 2BVYA 2PTYA 4J4KA 3R2GA 1IXPA 2ATSA 1YNQA 3KLLA 3W2NA 5E9XA 1NDWA 5BMWA 2CBVA 4PMVA 3KUMA 1VFUA 1T40A 4OOUA 1UR4A 4JHZA 1Q6DA 4CVUA 5JIPA 1TFVA 1J12A 2INFA 3VMPA 1XIFA 2A1YA 1KCKA 1JQVA 4W8AA 3DI0A 4EIVA 2ZZ7A 3IJ8A 3SQLA 4EPEC 1BXNA 5D04C 3BGGA 1X6NA 1V7AA 3B03A 3H7RA 4S39A 2PPGA 4O11A 3B9AA 1NVMA 2Y5JA 3FSUA 3POCA 4JIRA 5JU6A 1ENUA 1K4GA 1H49A 4WY0A 4HNNA 3CMGA 1ISWA 2VFIA 1DIDA 3HA1A 4C6IA 5LIUX 3A9BA 1QW8A 5AYXA 5D2WA 2EPLX 1UA3A 2WV8A 3HFYA 3R8HA 3EX3A 4PB4A 4LYQA 2W67A 2GDUA 3TXZA 4DN1A 3NQBA 5ABHA 4DX3A 3PSWA 2VXNA 3O1NA 1X1NA 3AIBA 4H9UA 3TE9A 2NXHA 5D9OA 2Q8XA 4GHRA 1CCWB 4DZAA 3W86A 5AC7A 3GG0A 1O7AA 3W2JA 4QAWA 3B8UA 1X39A 5J5DA 3PTMA 1OBAA 1UP0A 1W1PA 1R3VA 3INPA 1JI1A 2QLYA 3GVRA 3QTPA 2ZOXA 4MPKA 3I4EA 5DMYA 2Z4GA 1QK0A 3GUGA 1BPLB 2H90A 3N9KA 3ITTA 1YE6A 4LCSA 4CQCA 1JDCA 4AZ5A 3BO9A 4DIAA 2OKTA 3RX4A 4OJYA 1N8FA 3N2CA 1WZMA 3UETA 1W3IA 4UTUA 4ROPA 3VNYA 4AWUA 3UZXA 3BAYA 4LS2A 2NX9A 4KEVA 2OZ0A 3W82A 5C5YA 1RK5A 3WLSA 2GVEA 3LTYA 4YHGA 1UJQA 4F66A 4DJFC 3KE0A 5FJPA 1LJYA 2Y89A 3W27A 3NYDA 3MUZ1 4PBGA 1UD8A 3TH6A 1XBZA 4CNSA 3LBMA 2C1IA 2XN2A 4Q8OA 2NLYA 2ZFAA 3MSRA 4WQ6A 4YN5A 2LLEA 3LHUA 4XZBA 2NXGA 4WY0B 1XV8A 2WLYA 2E7FA 4JTQA 2GQ3A 1BXCA 3WFLA 4A29A 4KKXA 1E71M 2E4TA 3P62A 3WF0A 2RFGA 2X05A 2CZFA 1PHWA 3PC0A 4LVGA 4MDOA 3QYSA 3VIFA 2PDMA 1RD5A 1V6TA 3U2ZA 4PMXA 3VZZA 3STCA 3BC9A 4NZ3A 4ZO7A 1RD6A 2VZTA 3MZNA 3MSYA 3WQEA 1M65A 2WZTA 2CZ5A 5AHIA 2FMOA 3T4CA 1FWRA 4Y6GA 4AEEA 1UHVA 1CENA 4AZIA 5E93A 5I0DA 4P8WA 1GVFA 3BQ5A 1QHPA 4LV9A 1P6CA 1XLMA 3NQ8A 5ABEA 4PE8A 3CUIA 1UR9A 2I9EA 1HGYA 1JD7A 1JDFA 3IGHX 2YZRA 4UFKA 1NFGA 2DW7A 1AZ1A 2G8ZA 2QGYA 3BURA 1HKJA 4KBXA 4PSRA 1JPHA 3VIPA 3CTLA 1F3TA 2RGLA 3P74A 1JCLA 3GU2A 1OIMA 3NWRA 3WKZA 2KX9A 3W7PA 1CGWA 3LM3A 3H22A 1Q7MA 2DVTA 5EMMA 2OWCA 1PIGA 1KM6A 3SRFA 4IFKB 2FGLA 3T0BA 4FIRA 3BLDA 2QPUA 5A94A 4HPNA 1QI3A 2J7BA 2WKJA 2OX1A 2QAFA 1E40A 4MWAA 5T26A 4H4IA 3OZOA 2WCSA 4M5PA 3SADA 4UNIA 3ES7A 4L9YA 3GR4A 4RZ4A 4KIEA 4OBRA 3URNA 3W7GA 5K2ZA 3CIXA 2I16A 3A9IA 4FNSA 3W1XA 5E0CA 3KRUA 1I2OA 4QE5A 4GY1A 3LHTA 2VYOA 3EA3A 4EPDC 2BVDA 5LKYA 3QHOA 4C6LA 3NURA 4DZ5A 2CKSA 3EPMA 1EJXC 4LNCA 4LWWA 3TUUA 2V5LA 5AVNA 4L1XA 4BEQA 1I60A 2VR5A 2VRKA 2GWNA 3EOSA 3PZTA 2FHFA 4MB3A 2CXGA 1VFHA 2ZDSA 3M16A 4JBRA 3CS2A 2C1HA 3IGUA 4QLLA 4MFEA 4O28A 3W28A 4A3RA 1JDEA 2GQAA 1MQPA 5GNYA 1KM1A 3I4KA 3PWGA 1BVZA 1S2CA 2QV4A 3M5ZA 4DYKA 3L2LA 1KA9F 3QEZA 1CB7B 2J47A 4TTUA 2OMAA 4DUXA 5CC3A 1MMFA 4GIEA 1V3IA 4RJEA 2TYSA 1UC5A 1Q2SA 1DJZA 3TC6A 4DJDD 2VFFA 1J0KA 1XRSA 1Q6QA 3W7DA 4DPPA 3AS3A 4BQ4A 5IBXC 2CLKA 3OQ8A 3QGAC 4RXGA 3QGVA 2YLLA 1UWAA 4WUIA 1BYCA 4AHOA 4A8LA 3BGAA 4NZJA 4M6UA 3B9DA 4V27A 1O5KA 1XLHA 1U1JA 3I7SA 1UP2A 4K8HA 4V28A 1CGUA 3RDKA 3FDKA 5DELA 2XVLA 1PTGA 1QFEA 1BF6A 3QTGA 3S83A 1EJTC 4FEZA 2OELA 1A5BA 4H04A 3EWXA 4J3ZA 3TP4A 2OZTA 2V2CA 1RPKA 3EWYA 4MUPA 2GPTA 1V93A 3F7JA 1W1TA 4H8UA 1SO3A 2PCEA 2QS8A 2CFFA 1J9YA 4FX8A 4AZHA 3LCWA 4GFSA 3TX9A 2YBTA 3QZEA 4Y9AA 4Q3MA 3RR1A 3UJEA 1V0LA 2HCVA 4JTCA 5A8QA 1VS1A 1H11A 3LD5A 1VB9A 5HNRA 2FJUB 4X60A 5DO8A 2NUWA 2Q02A 3WLJA 5MF5A 4AVOA 3CNYA 3LHZA 5FJOA 3CASA 1VENA 1HO4A 4PN2A 2A3BA 3KBNA 5H8PA 1KD0A 1KO0A 3UY8A 2Y2WA 4IIEA 3IANA 1EL3A 4M1BA 3DESA 1X8CA 3UCQA 1LZOA 3Q45A 4XVDA 5JQ9A 3NVDA 1P0DA 6REQA 2PWEA 4I9JA 3FEMA 1GYMA 3K4AA 1E4LA 2Q8ZA 3G0UA 2X7WA 4GVGA 1DORA 3WBXA 1FBAA 4X3ZA 3NSNA 2PTXA 4KF1A 3B05A 3LCGA 4RPPA 2Q8LA 1O12A 3WEZA 1GJUA 3AXKA 5CG7A 2QF7A 4MNMA 4HNUA 3M0VA 1UQZA 2V38A 4DJEC 3KW3A 3M43A 1FWGC 1XQKA 2GGJA 2NWSA 2NSOA 3URBA 4MWAE 2VUNA 4QE1A 2NXIA 1G1YA 1BQGA 1VP5A 3ZS4A 1G01A 4D72A 1PS9A 4WLCA 1JJKA 3UYIA 1PE1A 3R25A 2QVNA 1KQZA 1Q8AA 1X97A 3IV3A 1W37A 2ZYFA 3PZIA 2VJXA 1KGXA 1F9CA 2HBVA 3WQCA 3RU8X 3ITVA 1JUBA 3RNDA 4CD5A 5HULA 3CQHA 3DKJA 3V0SA 4AZCB 4MIMA 4RE4A 4AH7A 2TPSA 2X42A 5LHFA 2HBXA 1R0MA 3AMGA 1MNSA 1SMDA 3C3NA 1O68A 3PZNA 3A23A 3BJFA 3TU9A 4N9BA 1ZS2A 1X38A 3N25A 1HKIA 3DG3A 1AJ0A 4JHMA 4DBDA 4QX4A 2J7EA 3PNZA 3AIWA 4C5ZA 3E0VA 5LYRA 4M24A 1GVRA 3S5YA 4YLWA 1Z8AA 4GZIA 3TQVA 2XFRA 4JKMA 3PTQA 8XIMA 1HX0A 4ICNA 4WY0F 1MDRA 2R9RA 2DQXA 4PSPA 2P8BA 5HPOA 5CEWA 3KS5A 1E6SM 4CCZA 4QG6A 4FLQA 3EEZA 4QBXA 6PTDA 4YTSA 1W5PA 4AVFA 5AKQA 2Z1KA 3M0LA 3AHVA 3L5AA 1QPKA 4Q8MA 3NSXA 4QG8A 5IFTA 3GFZA 2DIJA 1L6FA 2PAJA 4LS1A 5LIYX 4ROQA 1S2UA 3EXRA 3REQA 1KV8A 3V35A 1XLDA 3RLVA 3IRSA 1F76A 1J5SA 2VMFA 1AG1O 4B3KA 4PRTA 4Y9NA 3U7BA 4AWEA 1RBLA 1VR6A 3T09A 4D6CA 1O5XA 4QLKA 2C19A 1FKXA 3M46A 3MQTA 5DMNA 1DIEA 3A4AA 1Q3NA 3B9NA 4JX6A 5KSWA 3UCDA 1UZDA 1AODA 2F8QA 3R0DA 3WIJA 1R3SA 2X1RA 4C60A 1OCQA 1VF8A 3C6CA 2UBPC 2OB3A 4X0NA 3UWEA 1MXSA 4L6DA 3URAA 1V8EA 3S47A 3A6OA 3MMDA 3UERA 2YXXA 3ZR4A 4IX2A 3RCMA 1TMQA 4CUCA 3W1UA 3VCCA 4E2OA 4QJ4B 1Z89A 2JK2A 4L6OA 4K1WA 1OG6A 2WBKA 1KW1A 3CQIA 2DSZA 4JYDA 2XWDA 1CYGA 2PMQA 1UR8A 2X1SA 3EXTA 1JPIA 1TTPA 3WF1A 4PMOA 1LL7A 4GK8A 3MCNA 1UB3A 3CWHA 4FOKA 5HMFA 1TYGA 2ZICA 4DO4A 3QPZA 1EEXA 4EAYA 2D20A 3LCIA 2XJ7A 2FDMA 1FH8A 2DQWA 5CZSA 1TUXA 3WD2A 3CLMA 2QKFA 1OYCA 4MLJA 6ALDA 1RBAA 4NQ1A 3F5KA 3N29A 2Z1VA 4KWUA 4ATWA 2ZADA 5K7JA 2YBVA 4MAZA 2VEPA 2C1GA 5JBFA 3AQUA 3K1DA 3FJLA 3MDWA 2PURA 1Z9AA 2H6RA 3LHWA 3GHUA 2UY5A 3REQB 1D7FA 4MKVA 5FACA 5FEXA 4O1DA 3MJYA 3UZYA 4DO6A 4CD4A 2RDTA 5F4WA 3G77A 1UPMB 2HVMA 2VR2A 4XZMX 1TPEA 4QJ3B 3G1VA 1VBRA 2KAUC 2WMJA 1JFXA 1J2WA 3XISA 4IIGA 3UG8A 1WPCA 3VA8A 1W6TA 1JCXA 3LBCA 1JRBA 1LOLA 3LU2A 3P6LA 2XFYA 1DBTA 1CGYA 4WKHA 3UJ2A 5IFPA 1QT1A 1AW5A 2PD9A 4IMGA 2QNEA 4GA8A 4ACYA 1R9YA 1ZU8A 5F2IA 2HZGA 4L4MA 5D9MA 1XIHA 4REQA 1BD0A 3AMDA 4J3WA 5FD0A 1H3GA 2VVNA 2GL5A 4M3PA 2ZVIA 4C6DA 1J18A 1ADDA 1HJQA 2PDHA 2QCLA 4O50A 4QCFA 1ZRQA 4O19A 1DV7A 4PCPA 4PH6A 1ONWA 3ABXA 5GNZA 2AAAA 4M19A 3CHEA 1SZEA 5C7VA 4I6KA 4C90A 1FWHC 1OINA 2VT0A 4NL1A 3R0KA 3TSDA 4IMEA 7A3HA 4D6GA 4D1JA 3IJDA 3NQ6A 3SEPA 1PCWA 1X96A 1PXGA 4BF5A 2GK1B 4DNMA 5BRQA 1DJGA 5CPNA 4AWSA 5I3GA 1EXBA 2POZA 2WHJA 1EJWC 4YWSA 4F0MA 4XAZA 4E8DA 4DZIA 4GINA 4GUJA 1C90A 1WV2A 1P43A 5T8GA 1C9WA 1VLWA 4HCDA 1ZAHA 2J6VA 3LTSA 3AMKA 1C92A 1QJWA 2V5CA 3DGBA 5HQMA 2O92A 2VVSA 3TTYA 3C2OA 2IKGA 1I2QA 3H7UA 2JBMA 4EF9A 2XVPA 4K38A 3SN4A 4WDWA 2R6OA 1SO6A 4P2VA 2WBGA 1V08A 4H01A 2WZEA 3JW7A 4BWLC 2WYSA 3RM4A 2C0HA 5D33A 3QGKC 1NP0A 1GOXA 2EAWA 1NOUA 3TK7A 2PODA 2FVMA 3UG3A 2Y61A 2QJIA 4GNJA 3PBVA 1WAWA 1OFBA 4N9DA 3ANVA 1LOQA 3T05A 4JL2A 2V5KA 3QOMA 3WQWA 4AC7C 1WBJA 2G97A 3CEPA 2HDJA 1YNPA 2PWFA 1EQCA 3LRLA 2WNZA 3G1FA 3KHJA 4HTBA 4BHYA 3W6LA 2OPJA 5D4YA 3OIXA 5E6ZA 2ZRUA 1MSSA 1LTDA 4G7FA 2ZUTA 4LQ1A 4RW3A 2QPSA 1J93A 1BWVA 2VNCA 3B0VC 3WQ5A 4KWSA 2VEFA 3WFZA 1WKEA 3U57A 1I2NA 4LTSA 5AC8A 1YXCA 3VCNA 3VM5A 4XKMA 4OBSA 5JH2A 4ZEPA 3WK2A 1CXKA 4Z08A 3DIPA 1S38A 1JUEA 1UR2A 4KRTA 3BSHA 5DX7A 1XQLA 1OCNA 3CMJA 3AFBA 4WDTA 4J9JA 4I9TA 4XD3A 2DT0A 1LF1A 2PWUA 3HGJA 1UR0A 2X8RA 5LNWA 3KVMA 1E51A 1QATA 3VMNA 5HNTA 4J35A 1K9FA 3SR7A 3D0CA 2XM1A 2PSNA 1LP6A 4Z2GA 3IS4A 3GYEA 1DKWA 3RGTA 2Z1XA 2V5JA 2NV2A 4AYGA 5DQPA 4GYJA 4UC5A 4Y9MA 4B3LA 4JCMA 1T99A 5TBOA 4DI9A 4QS6A 3FN9A 4C6MA 1XG3A 4IPLA 5HJXA 5DXYA 2X16A 4IICA 4P7LA 2ZVRA 2VCAA 2UY4A 5DCDA 1H7RA 8CGTA 3E38A 4NT0A 3ZWTA 4GH1A 6TAAA 4CU7A 1NQKA 2J24A 2ZZ6A 3HGSA 4W5ZA 2R94A 1FP9A 4OQVA 1F6PA 2JKAA 4PODA 1V6XA 1X1ZA 4OIFA 4WGHA 4UTJA 4E8CA 3VOFA 3W3OA 1V0KA 1LLOA 1YHTA 3MW7A 2OT1A 4O8AA 2QJHA 2C7FA 3OVQA 4MM1A 4J28A 1X7IA 3O7UA 1ISZA 1E9LA 4MJMA 1BRLB 2A85A 4MFDA 4E2DA 2RKXA 4QIUA 3AUJA 3RUBL 3PBYA 5BMXA 3HQPA 2Z00A 5BOFA 4WJEA 4PMNA 4UQCA 2DJXA 1D8CA 1FWNA 1W3KA 1JZ3A 4W9TA 1R3YA 3S1WA 4TR9A 2JIWA 1SO5A 4LC8A 4NJKA 1H0GA 1W3HA 3MB9A 3EDKA 3M7SA 3WH7A 4HGXA 2PS2A 1SR9A 4LAZA 3UR7A 5TQLA 3CPGA 3FVMA 1THFD 1SU5A 3GW0A 4HNLA 4MYXA 4MKSA 1JIBA 3CAKA 1SO4A 1CLVA 4RW5A 3LQLA 3B0XA 4KEMA 4ACZA 4QQ3A 4WSKA 3SW6A 4NZ4A 3VD7A 4Y8FA 4H9MA 3ALGA 3MWCA 3A3WA 4EF8A 1KXVA 1HJSA 3GH4A 5FAJA 4LC6A 1F5ZA 5DEZA 3VDGA 3TJIA 3S9IA 2DVXA 3VGBA 3L4UA 3MA8A 2XDFA 4ZOBA 3DBPA 1R38A 3IACA 3RITA 1ZPTA 4JFWA 3CT7A 1J0IA 4HZ6A 3EWUA 1UH4A 1WDDA 5AHMA 3N2MA 2Y24A 1H1YA 4AD4A 1Y0EA 1AQFA 9XIMA 4TIMA 2IMRA 5C9UA 3TSBA 3D47A 4H8NA 3AXHA 1BF2A 3VAVA 1FHUA 4WGXA 1BXBA 4GY0A 3FAWA 4I5RA 3FLUA 3I6TA 3QZ6A 3SUTA 2MNRA 2HVOA 1M03A 3HPZA 2ACUA 2AAMA 2XU2A 4US6A 3QLLA 4IIBA 2JGYA 4AX6A 4OUIA 3OIHA 2FVKA 4LY4A 3G1YA 2ZWZA 4NZCA 1Y7VA 4LOCA 3ANYA 3W01A 1WQ5A 2B7PA 1F3EA 3LTPA 2C18A 2J88A 3VABA 4ENLA 1VPYA 1A49A 1TREA 1TIMA 3OBKA 3IRDA 1IEWA 3F1QA 2ZZ1A 4JDBA 2PD5A 3KWXA 4JXCA 1IF2A 2YL5A 3ATYA 7TAAA 3NOYA 1J6PA 1Q45A 1KTBA 5FIPA 3UCCA 2YZ5A 1QCWA 1QI4A 4MNJA 5D9PA 1D2KA 1QBAA 1J8VA 4HA4A 3WD1A 1I6NA 1ADOA 2IPFA 2V3FA 2WJFA 3BJTA 4US5A 4EAMA 4M80A 2WB5A 2D0HA 3WQGA 3ZT6A 3A24A 5D03A 4PMYA 4GBDA 1GPWA 4FAMA 3QY7A 2OOFA 3RRAA 3VDCA 1JR1A 2IXUA 4UQBA 3ALFA 3J7HA 2UY3A 4NU7A 1W8GA 4PFMA 1B0IA 3TQ0A 3BGJA 1XBYA 3BG5A 4Z1BA 4DELA 1DQXA 5GJMA 4PTWA 2DDXA 1D8WA 2Y88A 3CQKA 4GRSA 1V7YA 2GSJA 4KEUA 1UWUA 1OFRA 1UWSA 3PBMA 2VFDA 3PZQA 4E3VA 4K2SA 3TYZA 4U5IA 1TPVA 1DJYA 3AISA 3OLEA 1BFNA 3N6JA 4JIHA 2OSXA 2BOGX 3EX1A 3E6EA 4AC1X 3OLGA 4IXHA 4H2CA 5ENLA 1KKOA 3IIOA 4U2YA 1CXEA 3T07A 4NUWA 3N2OA 5BW6A 4I90A 3V0UA 1O60A 3UPWA 1QI5A 1KWGA 2H9AA 2R8WA 1GGOA 3EWBX 3NPWA 2I5IA 4R9XA 3A3HA 1EOKA 3KL5A 4HQVA 4NY2A 4WR3A 4A3YA 4EANA 4XV0A 1US3A 4AIOA 2FVLA 4ZTXA 4IIFA 3MBFA 1EH9A 4H1ZA 5F2LA 3ABRA 3ITYA 1QNVA 3HG5A 2A7NA 2J27A 3H7VA 3U5YA 1GW9A 3ZXWA 1R3QA 4QGCA 3ZYZA 1WP6A 2CNCA 1XLJA 4N4PA 3GAYA 4I8YA 4CNTA 1CZ1A 5LXEA 3OJGA 3R58A 5D2XA 1E5NA 1XI3A 2HSAA 2NZLA 1EWDA 4GBUA 2Z1WA 3QPEA 3H70A 2GGHA 1OGSA 1EC8A 1VLIA 2E1WA 3R8GA 4PUNA 2VGIA 2V5DA 2P50A 2OQYA 2JFEX 1EZ2A 3FIGA 4HA1A 1RZMA 1BGGA 1ZBCA 3R6IA 7ENLA 3S2JA 1GNXA 3OODA 4Q7NA 3KS6A 4PRRA 1UZ1A 3K30A 2WK2A 1MNZA 4FSAA 1M01A 4GVIA 5AC6A 4JTJA 3SY5A 1XL9A 3GO2A 4ICMA 3G1XA 4GI8A 3E9AA 1LG2A 1UBSA 2XSAA 4J40A 1MZHA 3O05A 3GXMA 1ZCCA 1WO2A 4HOWA 1QWGA 4QRNA 1C3FA 3VKJA 3NQEA 5EFDA 3QQWA 3PPFA 1E3XA 4LVDA 1H5VA 4HIBA 2VZUA 8XIAA 5CPOA 1H62A 3OGRA 3GVGA 4XD5A 3TQKA 4L4OA 1TKKA 1VFFA 2DFAA 3ABQA 4AWTA 4HJWA 3IVSA 2H9AB 4UQDA 3FJNA 2EG7A 1OHLA 3QRHA 2BXZA 3QOKA 3W85A 1FCUA 4Q4QA 1Q6FA 3T9PA 3WLIA 2KZHA 5E5CA 3DU0A 1QAPA 2PC4A 1XKJA 3USBA 2BBFA 1RSCA 2VC9A 4RXFA 3M5XA 1J0JA 3E2QA 4H8VA 3NJ3A 4PUDA 2PDKA 3MMUA 4RE3A 5FJUA 3L2MA 4F2TA 3GC4A 4CNUA 3A22A 1X6UA 2CWNA 3FDGA 1XLAA 4KESA 5FSDC 1OFQA 2Z2UA 3OA5A 1AD1A 3STPA 3WBEA 1KRMA 4H3DA 2PDCA 1S2AA 2RUSA 4NYYA 4O53A 3AHZA 3GNPA 3VOIA 1H7XA 5A6JA 4NNAA 2V0TA 1UR1A 3KRSA 3LQGA 3VNDA 3S5SA 2F2KA 4MDPA 3S1VA 2YCEA 1T6MA 1PDZA 4K7YA 3TA6A 1XR2A 1RQHA 3WL0A 2V67A 1K9TA 3ITXA 4Q32A 4FX6M 1LUCB 1OM0A 4S38A 4GGHA 4A6GA 4C1NA 4HHHA 1XBXA 4HU4A 2UZ9A 1UH2A 2BP1A 1AW1A 2PDPA 3DC8A 3D46A 4BR1A 1SMAA 1IEQA 4AIBA 1LL6A 1UOKA 2DH2A 3H2FA 2WHLA 4R27A 5AYZA 1NP2A 2PWVA 5CGTA 1PTDA 2PDYA 2BASA 3LV5A 4H6EA 5CZKA 2PDNA 3HMCA 5FL0A 8TIMA 1IQ8A 1FDJA 3S2LA 1GCYA 4IIDA 2QCDA 5I79A 1N8WA 5EBUA 4ATLA 5BROA 3SQMA 1SZFA 1CXIA 3V7PA 1E4MM 2G0WA 3MV11 2VURA 1LBMA 3WMCA 4Q7IA 1R46A 3AHXA 4QSFA 1B5TA 4JTDA 2HWGA 3GRIA 1H61A 2QDHA 4OVXA 3AUOA 1ZAJA 3NQMA 3P81A 3MHUA 1PAMA 2NUYA 3N4EA 3SI9A 3DZ1A 4TU1A 4P5UA 1DJQA 2NQ5A 1GQLA 1GVQA 2XIOA 4XZ9A 2RHGA 3WNPA 3HZ3A 3O63A 4BI6A 1K70A 1W31A 4PTXA 5SWUA 4CNPA 2TAAA 1QASA 2FB2A 3RU6A 3DHDA 5CC5A 3W38A 4R33A 3GD6A 4S3JA 4GQGA 4MG4A 4Z2KA 5CBBA 3E3HA 3C61A 2FKPA 1XGEA 2HS6A 2JGQA 4W7WA 1ODZA 1WZLA 1REQB 1DIOA 1G4PA 1ZB5A 3C4UA 3GTXA 4DJFD 4IJRA 3DFPA 4IMCA 4OTKA 3I3EA 3VOCA 4DWSD 3VDBA 4UZUA 4RV8A 1QUMA 2V6AA 4FZIA 3DGRA 3WQ4A 1Z41A 3WUGA 1JPKA 4O1BA 3BOFA 2DZPA 1OC7A 1YDNA 4E2VA 2Z7KA 4I7UA 1DHPA 4OKDA 2D2HA 2L5HA 2YCJA 4YVPA 1Q6RA 4C7FA 2P8CA 1JYVA 2C0AA 4JFVA 3HJEA 4LYRA 4XQ6A 3EWDA 1PYMA 1MXGA 3NZRA 4O1EA 1AFSA 1WKYA 3TN5A 3A13A 1SJBA 3ICJA 1DYSA 4ZB0A 4GXWA 1RY8A 3ECQA 2ZC1A 4ASTA 3PJWA 4K8GA 4Q8WA 2C13A 2G37A 1OCJA 3O15A 1H1NA 1X1OA 1ODUA 1GK8A 1TV8A 3LOTA 3W6YA 4L6HA 1M7PA 4LNYA 2ICSA 2DZAA 2VCBA 2NW0A 5HA7A 4M1RA 4U3AA 1DXEA 2WZHA 2VGGA 5B7YA 4WIWA 2MUCA 2QQ6A 3DHPA 4DQWA 2QGHA 1K7EA 4M7TA 1OY0A 1HL8A 2IQTA 3C2EA 3H4WA 2BX7A 2E5BA 2VL4A 4WOQA 2IW0A 4F79A 1VBHA 4YTRA 3DG7A 1XIMA 4JHOA 1R47A 3M5VA 3GWQA 1OG0A 2XZ9A 2DZVA 3P60A 1Q13A 1VRDA 1O1ZA 3WEMA 2ACQA 3LN3A 3GKFA 4B5VA 2DZWA 1XG4A 2PA6A 1MUCA 1HP4A 2J77A 2OXNA 3W75A 1V03A 1JDAA 1O94A 1CGXA 4L56A 1NEYA 1T8XA 3NCOA 3PY2A 3BLFA 1ZQ5A 3N4FA 3LG3A 4J27A 1F7BA 3KBSA 1FP8A 2B7NA 4B92A 3ZR5A 3DFTA 1IEXA 4BK9A 1H51A 5CAKA 1ZP3A 4F8XA 2ISVA 1VIZA 4DXXA 4ZFMA 1OEPA 1IEIA 1AVAA 3T8QA 4F0RA 2EKCA 3EX4A 2XIIA 4DJDA 1L2UA 1IT0A 2HS8A 1RCOB 5FJTA 1HTIA 5DRIA 5BOOA 1S5NA 1GHSA 2FHBA 4JZ5A 5CKSA 1VEMA 3DENA 3MYOA 2Z6JA 4ZQOA 4LB3A 3F4WA 4E8GA 3BW2A 3M0ZA 5LHEA 4M7SA 4E4UA 3WNMA 3AYTA 3E0WA 4LVFA 5A8GA 1HN1A 4IG2B 1QNQA 1EF3A 4GACA 1H50A 1XYLA 3FJ6A 3S5ZA 2OU4A 2ZRXA 1UWTA 1GYLA 2A3AA 1P6BA 4DXKA 1O4UA 4JY9A 2QCEA 3QV6A 1V6YA 3RRXA 3WDRA 2CIPA 3HQ1A 1TPUA 1V0MA 1XLLA 4JTUA 3HV8A 4ZR8A 1UASA 3BAKA 3W23A 4DM2A 2GSHA 3E96A 4KCUA 1MW3A 3QZAA 4QS5A 3GR8A 4IPNB 4LGXA 3MSDA 5G4EA 3NGJA 2VR4A 1ITUA 4JR5A 2NQHA 1TE6A 3NSMA 1OQFA 2A6LA 3BVJA 2DZTA 4JY8A 3PZOA 3FKRA 4KRUA 1MFUA 1K9EA 1QNRA 2G4FA 3ATZA 5I07A 1GKPA 1LLZA 2WM1A 2I5QA 2I57A 1EFZA 4EE9A 3EEGA 3VKAA 1TV7A 1IV8A 1VBGA 3W7IA 2OQLA 3DC0A 1NSJA 4NX5A 5A95A 5CPSA 3WQPA 3WLKX 1E55A 3QVQA 1IR2A 4P8XA 5HR6A 1V79A 1HNYA 2OQHA 4JDYA 3BWWA 1N7KA 1JAEA 4C6CA 5TIMA 3OYZA 4I3GA 3MI3A 4YHEA 2X2YA 1VCGA 3TZNA 2D2GA 4MJ2A 2B0MA 4LU0A 2E40A 1IGSA 5DY2A 2BTMA 3O0FA 3DBNA 3W81A 3SN1A 4ZOAA 2PWGA 1TJRA 2QUUA 1V6VA 6XIAA 4XG1A 3KBVA 1V3HA 1PZ2A 4UMAA 2XGIA 3M07A 1KBBA 3LPPA 2W5FA 8A3HA 1XIJA 2O9TA 1SSGA 1ZBVA 4XBJA 1GG1A 1FH7A 1A3HA 4JQ2A 2VCCA 1ZJIA 1YKWA 1OT1A 3N6QA 4N42A 4DBEA 2GVLA 4PEKA 2VM8A 1IXOA 3I3BA 2PLJA 4AMAA 1JF6A 3VU2A 4IPIA 4Y96A 1XHGA 5TD4A 1FKWA 3BAIA 3GW3A 3B8DA 5TAOA 1YQ2A 2Y63A 2ZCGA 2PDIA 1RLDA 2WAGA 4XZWA 2OLSA 1OFPA 5FEPA 3PZ9A 3TIMA 4A05A 3MP3A 2YXOA 1SGJA 4N9CA 3M0YA 3T8LA 3RX3A 2HE5A 4UMBA 2REQB 3UXAA 4K3ZA 3VZXA 1OFEA 2Y85A 5DFAA 5DLCA 5DXXA 4DJED 3WQDA 4C5YA 4Z0JA 3UXIA 4NP7A 1G5AA 2BGSA 2CLLA 1PX4A 2Y7FA 2QCCA 3USZA 3TSMA 2PDLA 1A0EA 1H7WA 1XIEA 3NOEA 4QDMA 1AMKA 1N8IA 2HNHA 2GJPA 5CH9A 3NQGA 3QR1A 1VIWA 4ZB5A 3KLKA 3LDVA 3PB2A 3QQ0A 4Q7BA 2HQAA 1QVBA 3W29A 5AC5A 3E0IA 1P4CA 5CJNA 5EL1A 4XK2A 1VFOA 3H12A 1R2SA 3VTRA 4R7JA 3PVFA 3TW7A 3CZ8A 1IYXA 3DG6A 4Z2IA 1KC7A 4MOZA 4NILA 1GQIA 3F5LA 3B9OA 4HNOA 3EKZA 2DV0A 1JVNA 3WY1A 1R6WA 1TJPA 5H1WA 3U4FA 2YCIX 1EDGA 2XFFA 4UWMA 1K3UA 3TJLA 3QJAA 3W26A 3CL7A 3EKGA 3GSMA 2WHMA 1WUFA 1Q2RA 3RK8A 4YL2A 3ZLGA 1VGAA 1SZNA 2C71A 2FGZA 3UT0A 3VD3A 3GZAA 3PR2A 2G4JA 3WD4A 2XSXA 3H4XA 5D2YA 4AIEA 3K13A 5CAHA 4KT2A 2WSPA 3F4VA 4KH2A 4C6KA 2IKIA 4QAIA 4PMJA 4B9ZA 1CXHA 5CSSA 1DWAM 3W7EA 3UWZA 4TUFA 1QNSA 1UKSA 3KXQA 2QUVA 4JFSA 4RCXA 1VBUA 1ECQA 3APYA 3L2IA 3HIJA 3N4AA 4GXPA 5HMEA 3W7OA 1OC5A 3BXWA 2D23A 1JG9A 3WQOA 1EYWA 5CJ5A 2XM2A 4RZ5A 3AALA 4LUSA 5CGMA 1FRBA 4C6JA 3CUZA 2VFHA 1VH7A 1E0VA 3QYQA 2VRQA 4NVTA 1WBHA 3B3DA 1B4KA 4PRWA 1Q4NX 4IGMA 4POCA 1U5VA 6ENLA 5C9WA 3KL0A 4PUMA 1J10A 2PDUA 3HG3A 2EJAA 4UQ9A 4GZJA 4E3TA 3VNMA 4IQEA 2IS7A 2QR6A 3WMSA 3CAQA 4YVVA 1UOZA 5I3DA 1F3WA 2DZUA 5F4SA 5HMSA 1TR9A 2GJLA 5ABFA 4GYPA 4H41A 3VNKA 2BGQA 7PTDA 2PRLA 1T7LA 4ZZ9A 4AX7A 4AD5A 3FYPA 4QP0A 1VRXA 2PGRA 3IIZA 3UJFA 1KFKA 4JTEA 3P82A 3EMQA 3LLDA 1TUFA 4FOJA 4R9OA 3B40A 1TCDA 2ZE0A 4TTGA 1EIBA 2V3GA 3JR2A 3V1HA 2XISA 2Q3RA 1R3TA 3GNOA 1R85A 3LHVA 1Y8BA 3SY8A 3VGEA 2O0TA 2C14A 1LQ2A 2F6UA 5K9XA 3ZVHA 1EC7A 5A69A 3O9NA 1M1BA 3WBYA 2TODA 4A8RA 3QMSA 1P0NA 4O57A 3CHFA 2RDWA 2XIQA 3CZKA 1VZWA 3AZRA 1A3XA 3AS1A 3NTYA 4GIRA 2V69A 1G69A 4FXJA 3ZQ9A 4NAEA 5FJJA 1XKYA 5IOBA 1IXQA 2VQUA 3W7KA 3G0SA 3I6EA 2VQTA 3PNUA 2AQWA 2ATMA 3PJUA 4UMCA 4LT9A 3EPOA 2DT2A 4LUYA 3DECA 2ZUNA 4OUEA 4KEZA 5FJIA 2Y6ZA 4H6QA 5C0QA 1F61A 3P14A 1W9DM 3SM0A 3V5CA 4CLMA 3UFYA 3HTWA 1E6QM 1SFLA 2AL2A 3MP5A 3VNZA 3WBAA 2YSWA 4I9AA 4FB7A 1JUKA 2O9PA 3W2MA 4AW7A 1BSIA 3N13A 2CU0A 3BLEA 1V6WA 4XUGA 5I2UA 5CZJA 3OHIA 1LLWA 1ZBWA 3LGGA 5EBAA 3WG6A 1TTJA 4RDZA 3GXTA 1UWIA 3GTFA 4ZOCA 4UTTA 2D69A 3TV8A 1BSLA 3ARQA 2VX4A 5K4XA 1V0NA 1HW6A 1X8FA 4LRSA 1CB2A 1L6SA 4ZA0A 3R94A 1PDYA 3M6DA 3HGOA 3CYVA 4IGNA 1D9EA 4GFIA 3M0JA 2YL9A 4FIQA 2OWWA 4I7WA 2VX6A 1KXHA 2YXGA 4HPHA 3L0GA 1JFHA 1TE1A 3BV7A 3PTDA 3UWQA 3KDOA 4KQNA 4ERIA 4IMAA 3UR2A 1K8CA 1S2VA 4DYEA 2ZZ3A 2ZRVA 2GJXA 3D3FA 3CUHA 4M81A 1BG4A 3GLCA 1G7UA 5CZTA 3U4AA 2FFCA 1NY1A 5HQEA 2YGYA 3ZVHB 2W27A 4B90A 3SFKA 3TR2A 2YDRA 4I5UA 2OO0A 4DB7A 3DFNA 5IM51 1IEVA 2J66A 4LPCA 1ONRA 4WSHA 3EA2A 1DP0A 3CQJA 3Q2DA 3NUKA 4UTIA 2X0SA 3HPFA 4CEUC 5EY5A 3QBUA 5D05A 1VJZA 4NAEB 5AHNA 1ZNNA 2ZDRA 4IUGA 2J13A 2PTWA 5C2CA 4F0KA 3CHCA 1EJUC 2DUAA 1A4LA 4IISA 3BOLA 4JTGA 1VYSX 2GZXA 1SUXA 3TONA 5EMJA 1EP2A 4D6JA 3BAXA 2CITA 2YL6A 2O4QA 1XS2A 2AL2B 3VIKA 1V6UA 4M29A 2BODX 3HQOA 2X7VA 3I10A 1U22A 5A2AA 4NJGA 1Q66A 3C86A 3WMBA 4C6EA 3UEQA 4MADA 3DN5A 5CPQA 1H09A 2ABBA 4PEEA 1LOSA 3P5ZA 4V1XA 4BF7A 1EWEA 1G6CA 1FDZA 4BZYA 4S3CA 3OBEA 1UD2A 3OG3A 5JVLA 4HK5A 1CI1A 2ZIDA 4GNKB 1TQXA 4I5XA 3BCDA 5KZEA 5GVJA 2OEKA 4C1KA 2DIEA 4HMNA 1CDGA 3FGCB 2A6NA 1FDYA 3RCNA 4LUIA 1T96A 3M47A 1NFBA 4LBRA 5BWAA 3ZFHA 1M3UA 1TZ9A 2CBJA 2QHAA 1HL2A 1OC6A 3CL6A 1LWHA 4GJ1A 4RX0A 3PPCA 4LALA 1GJWA 2P10A 4NI3A 1J5TA 4HNVA 3WLPA 4A2RA 1W56A 4FNQA 3C2VA 4MB5A 4YXGA 3OOQA 1ICSA 5I09A 4H9ZA 1A5LC 3V75A 5EMUA 3IUHA 4IP4A 2PDBA 2WQPA 3EOLA 3E1F1 4JIQA 3NQDA 4I9MA 3I6RA 3TNBA 3G18A 4HZ8A 1SZGA 3T7VA 3E0LA 1Q6GA 3KRBA 3AZSA 4W88A 4IF2A 4ZQNA 3KCOA 3H26A 5F2MA 3F5JA 1UC4A 3MO4A 3WJSA 3WUBA 2OSYA 4UTWC 1E70M 4WDXA 1JI2A 2FH6A 2E0PA 1SW3A 3EX6A 1PZ1A 1KM3A 3IVUA 4O54A 3OHMB 3R13A 2QMJA 5I5RA 2QF8A 3WLNA 4QDPA 2D2JA 3ONBA 3P8IA 3VKDA 4HN8A 3GVVA 3V3WA 1QU4A 3G3DA 1SW0A 3GBEA 1WZAA 5MKGA 2UV8G 3NAVA 3UR8A 2P88A 5FKYA 1OZQA 3ARYA 3MO7A 4RKAA 4WEVX 3AC0A 1PKYA 1VFSA 2BOFX 5DCEA 4AY8A 4F9JA 1L6WA 4GO9A 1L6GA 4HK6A 4HNTA 4H9XA 3PZUA 1H63A 3QXBA 1ONXA 2WVSA 1M9HA 1DE5A 4CQAA 5DT5A 1H4PA 1EX1A 1TCMA 3PJXA 4MNLA 4DO5A 3LXAA 3QR3A 2PP1A 2G95A 1LWIA 2AQVA 2VUYA 4TVUA 1E0WA 1A5NC 5KINA 4ZO6A 2INEA 4D8ZA 3SCNA 3VGDA 5F7UA 5EPDA 4M6QA 1DJXA 4B5UA 5C54A 3FJ4A 1QNOA 2VD8A 4HHLA 1V3JA 1P6WA 1Z69A 3PSVA 1GVSA 1IZJA 2A5HA 3A3XA 1FWAC 1OABA 2G3IA 4B4HA 3Q58A 1QMLA 4LY8A 3WLRA 3WLOA 1E43A 2EF9A 4YCOA 3UNDA 4UOZA 2WPBA 5HWNA 3SCWA 2GYIA 4AXKA 2W79A 3T2PA 3W84A 2FMNA 1FCVA 3VIHA 5F1VA 4ADTA 1PB0A 3HO8A 1XYCA 1BTCA 2ANUA 3KHDA 3P0WA 3B4YA 2NQ9A 1EGZA 5DY3A 5F1UA 3W9ZA 5I77A 1YRRA 2ZA3A 4G7EA 1WYIA 3LA4A 2VO5A 1PEZA 2P53A 1M5WA 1NWRA 4ZSUA 4MY8A 3GAKA 4ZMGA 1AZ2A 1BAGA 2X2GA 3FA4A 4HBKA 4QROA 3PZVA 1DQUA 1RXOB 1PTAA 3Q4DA 3DFYA 2E8YA 4HCLA 3CM4A 1AW2A 1E1EA 3OG2A 3S6OA 5BOEA 3AJ7A 1UROA 1Y65A 2DSUA 3OVGA 2DU2A 2GDQA 4LUJA 1GONA 1R3RA 1GEHA 2PZ0A 4DWSC 3EBVA 2VDGA 4FPSA 1QWKA 4LF2A 3VMOA 1DXFA 4O16A 3GG1A 3W4RA 1GVYA 4JQ1A 4HKPA 1B90A 1ME7A 3BLIA 4TXEA 3LV6A 1AL7A 3NQCA 1F2JA 4XD6A 1U5HA 2A3LA 4Y8EA 3UQNA 2X1UA 5EMKA 4PTNA 4J3VA 1C7SA 3FX4A 1XYZA 1GEQA 4UNKA 2ACSA 3APTA 4MNKA 3S9YA 1NELA 1XC6A 4DBUA 1Z7AA 1HG3A 5EB8A 3H2OA 3TKFA 1RQBA 5EMLA 3U2OA 3VIGA 3GE7A 1OT2A 2XGBA 3UJSA 1UBPC 1Q6CA 3NQVA 4MHBA 4IXXA 3NQFA 1R30A 3WJWA 2ZXQA 1W1VA 3ME3A 1WDWA 3F4DA 3WSUA 3WCZA 1M53A 3VIIA 4L7ZA 3GR7A 3G0XA 3MHFA 2AL1A 2BY2A 1U30A 1RHCA 4YU1A 1WCGA 4GO8A 2QCNA 3UA4A 4DAIA 1HJXA 2V3DA 2X1IA 4UTFA 4RZBA 4P7NA 1K02A 3DAQA 1W1B1 1UCWA 3BLOA 4GVFA 4M8UA 4K6AA 1CX9A 1EOMA 4E4FA 1DWJM 2I7GA 1R3WA 1KBIA 1W9BM 1GG0A 3SCQA 3W0KA 1ZJHA 1A47A 4RR4A 3N9RA 3H24A 2GFTA 3HFTA 3HQNA 4ZE5A 3BARA 6A3HA 4QR6A 2ABAA 1FWCC 2CC0A 3RLHA 3TJXA 3RPTA 2GDVA 4L5ZA 4O4WA 4PB3A 4W7UA 3OEXA 2V30A 2EHHA 1UZ4A 4ALDA 3G2GA 4WVXA 4H00A 2XYLA 1OFOA 1H0IA 7REQA 3NA8A 1A5MC 3GQYA 4GYKA 3CXOA 1UIPA 1EPXA 1YXDA 1YBQA 3LPFA 1UW9A 5LNSA 4G56A 3B8VA 1BYBA 2X30A 4Y9OA 3WLQA 3A47A 3DYMA 4A3QA 4PTVA 5HDRA 1CLXA 1F6YA 2FDSA 3EKLA 4MVAA 1D3CA 4NRRA 3CO8A 3T1GA 4IQJA 2E9MA 1ZJBA 4QNWA 3GHTA 5HOSA 4OE7A 1VAHA 4FNTA 3N19B 2QDEA 3CV1A 2WKGA 1HIZA 4R53A 2ZZ5A 3PUGA 3OQEA 1EDTA 4OBTA 3NPXA 2ZXDA 1S39A 4LXFA 1XUZA 3WD3A 1AA1B 3EDJA 1J11A 1EZWA 2XH0A 3VD9A 3R79A 1LORA 2OWXA 1SFJA 2BY3A 1PKMA 4FLOA 7XIMA 3UYCA 3S2MA 4Q8TA 4URIA 1V77A 2E5DA 2J4GA 2XH4A 1BGAA 2ZUMA 1TG7A 3WLLA 4XVEA 2OODA 3MUY1 2J8GA 1EHAA 4MZYA 3PFMA 4PUEA 2W91A 2YKKA 5DBTA 5CSRA 1JZ8A 2CZVA 1Q65A 4XZNX 3THDA 1VYRA 3RG6A 5LIXX 4IX0A 3DKLA 2WMKA 3CPUA 3WDIA 2F9RA 2DVUA 3M41A 3RJYA 3WNNA 1EPVA 1FHDA 2BLEA 1DJHA 1CEOA 2J8FA 5HATA 4PUJA 2EQDA 4XO6A 3GDKA 4P7OA 3GVWA 3GFXA 2DJLA 3E02A 4N2YA 4AY7A 3CAWA 3CUJA 4EPBC 4D6HA 1R87A 1IT8A 4AD0A 4DO7A 3P0XA 2VZOA 4O0QA 1AUSL 2V3EA 3FS2A 1XLCA 3BK0A 3PF3A 3S9ZA 5I23A 2D73A 3QFWA 3LENA 2CERA 3R1ZA 4KFOA 4ZXLA 1TPB1 2OYLA 3TR9A 7REQB 2IPGA 3SCVA 3WBWA 4MWAB 2EGZA 3W7QA 1JZ4A 3AIUA 3S46A 4HPXA 4CEXC 2QCGA 2IKHA 2P1FA 3TTOA 4G1KA 7CGTA 1W1IE 3TW6A 2P3ZA 4UZSA 5H8MA 5BU6A 2Q01A 4PR4A 1MUWA 5CC7A 2ZRWA 1KFBA 1AH4A 3LSBA 4Y7EA 1WKFA 3NXFA 3NDYA 2G3FA 3C0LA 2G3JA 1XRTA 4MMWA 5D8WA 1R2TA 5DN1A 3WDQA 1IWAA 3W1MA 4I8DA 4NX0A 3BCFA 1A4MA 1DQWA 1FY6A 5DF0A 2PRMA 5HQLA 2JKEA 4M56A 3WK1A 1PZ3A 4EXBA 1QNPA 3O06A 2IKJA 1XLFA 2OGYA 1P7TA 1XLBA 2QMKA 4D9PA 3NL2A 2ZX9A 1QPNA 1CIUA 1CW2A 3NZ1A 4JFTA 2E09A 2Q3OA 5LIKX 4BQ2A 5LNUA 3HOJA 1KCXA 1RCXB 1WAUA 4ZCWA 3P7YA 1UKOA 3R10A 6XIMA 1M41A 2P5NA 3JRKA 1XW8A 1FCQA 1BKSA 3GDRA 3QKEA 2DZXA 3D6NA 4LV4A 3W1TA 3QF0A 1JXJA 4O4VA 2BHZA 1JEZA 2P0IA 1ITQA 2J79A 2PDJA 3ZJ6A 3ITOA 1JYXA 1A5OC 4RE2A 1EJVC 3GH7A 4DM1A 4U31A 5T9CE 1DIKA 4JYFA 2I56A 1FFRA 5I6SA 3KVKA 3RPDA 2R91A 4H9VA 1OD0A 1HFBA 5AB3A 1W8SA 2E25A 3NGFA 3GXDA 4J7RA 2IPWA 5A6LA 2FYMA 2O55A 3NM3A 3U2CA 1LROA 2F7FA 4Q6JA 2W61A 4Z2LA 5FL1A 4UBPC 5AECA 2W66A 3PUEA 1GZJA 3QSTA 2HRWA 3NIYA 1TMLA 4ZE4A 3FCPA 1RA5A 4XTIA 3KP0A 1YTEA 3IJLA 5HUOA 1S1RA 4BEUA 1O6IA 2VFEA 5FF2A 1TV3A 4WHBA 1NDYA 2PCQA 3AO0A 1EF2A 2FGBA 2B7QA 2XUCA 2YDAA 3LK6A 1O66A 4IJCA 4UFHA 1XFBA 1UMYA 4CCCA 2AMXA 5D9NA 3IUIA 1LM1A 4EWJA 3HMJG 4K37A 2EBNA 5FA5A 2QPXA 3W6MA 3SURA 2XH7A 2QW5A 1CGTA 4DJFA 2Z28A 1K7XA 1EO5A 4B2DA 3WH8A 3PTKA 2ZC8A 4J3XA 9RUBA 2CZDA 5AZ0A 4CN6A 3R8RA 1EIXA 2GJNA 1US2A 5AVHA 1UD3A 4WX2A 1V4YA 3TFXA 2CLIA 1YLVA 5CPMA 4J5NA 3L9CA 5J04A 5M2FX 4LW7A 3U8GA 6REQB 1PZ0A 3KOFA 1JPDX 3UY7A 2XFWA 5T9BG 1CLKA 1B3YA 3ANUA 3NPUA 4PZVA 1NIUA 5FEZA 2ZWYA 1EUNA 2WSKA 1GHRA 4C6QA 2OEMA 1QBBA 3GNRA 4HA3A 3W7HA 1V3MA 4X2PA 1U5JA 1BYDA 4MSSA 2INZA 4OV9A 4JTKA 2YCLA 1W5OA 2AOSA 3TLQA 3ZMRA 2YJQA 4BA0A 4W7VA 5JH1A 2WQDA 3CPRA 2H3BA 3S8HA 1KCZA 3NO5A 2Z29A 4ES4A 1G0CA 4F4RA 3U3HA 5CC6A 1P5BA 5E6YA 3WJYA 5CGQA 4GCXA 1SFSA 4NRSA 4LAOA 4HHPA 4J2PA 1XIBA 3WF2A 4Z2JA 2QCHA 1ISVA 1NARA 5AYYA 3VC5A 2DSVA 4XIAA 4W8BA 1QPQA 1HO1A 2E77A 1B57A 1JNDA 3CO4A 4PYSA 1ZTVA 2CXEA 4PMUA 3L4VA 2GLKA 1OX6A 4CU8A 1PUDA 3NO3A 1UUQA 2A7PA 2IQDA 3SBFA 2PFHA 2WJDA 3SGUA 3B97A 4DI8A 1YTKA 4W87A 1W17A 2QUTA 2Z1BA 3OVRA 2I1OA 3SGGA 2FJKA 3MUXA 4W84A 1PIFA 3S1XA 1B3XA 3MVTA 1BG9A 1XM3A 1ADSA 1JCMP 4GQRA 4JTSA 1W2VA 1NDZA 3TC7A 1HVXA 2OCZA 3HM7A 4H9TA 1KR0A 1TX0A 3CL8A 4B91A 3H2NA 3W22A 2ISDA 1KM0A 1Z48A 1KV5A 4RLIA 2GWGA 5GJNA 2RAGA 4ECLA 3V4BA 3GKAA 3EB2A 1IT7A 4UQAA 2R1PA 3I3DA 1FWTA 2J74A 4KMQA 5GQBA 3VK5A 1A50A 1HGWA 1GYNA 1E9YB 3PUOA 1W0MA 1XH0A 3UG4A 4IP7A 2DY3A 4FLSA 3UZZA 3VOJA 1EA0A 3DCPA 1P1XA 3DXIA 1KFCA 4JIIX 3THAA 2QJMA 4Q4OA 1WDSA 3W00A 6CGTA 3W1AA 3C2YA 1W54A 3ZWSA 4ERGA 1BHGA 1MI3A 4YIWA 2GJRA 3GTNA 3CZJA 3NZPA 1Q7QA 2X09A 3ZSSA 4W93A 3WK0A 2GQ8A 3BG3A 5DANA 3Q67A 3UWWA 1T41A 3AJXA 3AXMA 3I68A 3P61A 1UWRA 4AYSA 4LAUA 2E67A 1UUMA 3CMFA 2WANA 3GXPA 3W7NA 3Q65A 4AAJA 3SGZA 4HJFA 3VUSA 2XINA 1C91A 2Z0IA 3V0TA 4M6PA 4L64A 2VRJA 5IBXA 3LCHA 1PHQA 1IGWA 5HPCA 4JTLA 1ME8A 3LEPA 2X40A 1OYAA 5L6UA 3A4JA 1PL9A 2XZ7A 1PWLA 1QI2A 5HBFA 3B0PA 1OD8A 2ISSA 3E2VA 2VC6A 2YW3A 2R24A 1JAKA 3OTRA 5IDIA 4EXAA 1TVLA 4NASA 3TYDA 2PWHA 1FXQA 1FOBA 2V68A 1C8YA 4HT3A 2OFJA 5AY7A 5D30A 4M0XA 4F48A 3QHMA 1QOQA 4NXSA 5C2GA 1K77A 3IWPA 3QW3A 4NZFA 4FXRA 3QW4B 3M1ZA 4MWAC 4MY9A 2P3EA 4IZGA 3P67A 1H7PA 3P3BA 3SSJA 3ARSA 1B30A 3ZZ1A 1DWFM 3ARXA 4CNOA 4AD2A 3FK4A 4XSLA 2E9LA 1E6ZA 3KBJA 2DZBA 4IQLA 2Y1HA 4RNIA 3BE7A 2NV9A 1AL8A 4UFJA 5DBUA 3UZJA 2FZNA 4JCLA 3B06A 3TMQA 1G4SA 4A4AA 4DPQA 1B3OA 1DEDA 2HJPA 3OA3A 4AISA 4KW2A 4MZ1A 3VILA 4S1FA 3WX7A 2ZZ2A 3GX9A 1W9VA 4QQUA 1TWDA 1Y5VA 3KCLA 5K9DA 4NYUA 4WDUA 4QE4A 1B9BA 5HMDA 3MKCA 3U7VA 2HEJA 1H7NA 4B15A 2XN0A 1JDDA 4XZIA 5U4NA 3LY0A 4HU3A 3VNLA 3EZ4A 3W07A 3IARA 4M6VA 3SRHA 4S3KA 5KZMA 5CJMA 3NL5A 4UFIA 1V5XA 3B8IA 3WNKA 2VDHA 2GSEA 2QYGA 2CLEA 4D6DA 2F2HA 2WNWA 2HK1A 5G1MA 4GQQA 3T2OA 1RJPA 2PP0A 1SR0A 4DJEA 1F07A 2EO7A 4NNBA 4BFAA 5HNUA 4M51A 3SJ3A 3SO7A 3AWNA 4LVAA 4RL3A 1ZHAA 1RPXA 1PX3A 3M7WA 4AUBA 1LG1A 4AZ6A 4OV4A 2OZ3A 3CUFA 4REQB 5G4WA 5BXRA 3DDMA 2YFNA 5LZLA 3S6DA 4U33A 2FZ9A 1WDPA 2Z26A 3RR4A 1JGMA 4ZQPA 3GG7A 3UWUA 4KWVA 2VWSA 2VKZG 5AYBA 1DHKA 5A6BD 1QI0A 1XFCA 1WKDA 3KOYA 2YW4A 3EGJA 1UKQA 5FJRA 3BLPX 2NUXA 1SM9A 4OHQA 5ECUA 1EBGA 1E6PA 1KXQA 1P0KA 1EXPA 4UR9A 3NM1A 3NNTA 5C55A 3HGRA 5E0KA 1CBGA 1K8XA 1I4NA 3ZT7A 4ZO9A 1EP3A 1W2PA 2FZMA 1V51A 2GVGA 3KDNA 4PUKA 2PTDA 4N4QA 1TWSA 1OF6A 2Y5EA 4HPGA 1OFAA 3L66A 4N7QA 4D1IA 4S3AA 3TJ4A 3CB3A 3CV7A 5L9FA 3OZMA 3H21A 5CSUA 4F9DA 3UGVA 3TN4A 4HB7A 4OT7A 3UBPC 2ISFA 2ZRZA 1VFLA 4MYAA 2J9ZA 2BDQA 5DMMA 3MUAA 5AYIA 3WJXA 2FH8A 3QSRA 3FVDA 1KB3A 2ZKMX 3GZ3A 1OJXA 1CXFA 2MANA 3C2RA 5E0FA 2PWDA 1OX5A 1AD4A 1JCTA 3HU7A 4W4QA 2CPUA 4IHCA 2YOCA 5D2VA 4V15A 1AH3A 4JIPA 2A21A 2HXTA 3VZYA 9CGTA 1FVPA 4DAFA 2BWGA 3ABSA 3ZJ8A 2F38A 1TB3A 1B9ZA 5D2TA 3SDOA 4GH3A 5BYWA 4IJBA 4DF1A 2WWDA 4GOAA 1VD6A 4DZHA