3OLIA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iv03
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
495
structure length
495
Chain Sequence
b'YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 171
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oliA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oliA01
1P6WA 4LYRA 1EHNA 1MW3A 3F5LA 4P7RA 3CPUA 1R8LA 1I75A 2DSWA 5HXMA 4CCEA 2DSVA 2YL5A 1QI0A 1J0IA 1Q4NX 2A3HA 4BCEA 1E72M 3TTYA 4CU6A 2CKRA 1KWGA 1SR0A 2CITA 3N04A 5EMYA 2QF8A 3PZGA 2BVTA 1E6RA 1PZ2A 3BUIA 4Z2LA 4ATWA 5A6LA 1V6VA 4JAWA 2F7QA 1HJUA 4W7WA 3D5HA 4IM4A 3L4WA 3BLBA 1M04A 1WDPA 2Y5EA 3VIFA 2VCBA 4AW7A 1GOOA 3WNKA 4TX6A 3VVGA 2X05A 1JIBA 1QHPA 4E8CA 1C3FA 3N11A 2E8ZA 3AIVA 2UY2A 3VDAA 3ZT6A 2WWCA 3CGTA 3GH4A 4AZ7A 1LWHA 3THDA 3MUIA 2QPSA 4OIFA 2VC9A 1GQIA 4OBSA 4B15A 4CVWA 4UZUA 1HNYA 5IFTA 4HP5A 2IGTA 2J47A 3IJ7A 4OBRA 1E6XM 1JGIA 1UH2A 4XZBA 4WF7A 3L4VA 2C7FA 3QHNA 3VIGA 3EJPA 1ZBCA 3GXIA 1JFXA 2ZUUA 1EOMA 1UR9A 1PZ3A 3H53A 2DIEA 1QI3A 3CLWA 5KEZA 5EFDA 3AJ7A 4AD2A 4CD5A 3QR3A 1YQ2A 4J3TA 3TTOA 1UD8A 3AXXA 4HA1A 1RD6A 1VFMA 1XGZA 2BVDA 2WVUA 1GCYA 2G3IA 2O9OA 1MFVA 1JZ2A 1KCKA 1E6PA 1EDQA 4NXSA 5A6JA 4X0VA 5BXTA 4TVCA 4H8HA 3AISA 1IZJA 1GQJA 5AYIA 2D3NA 3WD1A 2ZWZA 2VCAA 1CEOA 2ZUVA 3VIMA 3WQ4A 3DX2A 1OIMA 4DUXA 3RM4A 1UR1A 2AMGA 2WHMA 2W67A 8CGTA 1XD1A 1J0KA 5I79A 3WY4A 1ITXA 3BVTA 1GONA 2EBNA 3ARXA 4IUGA 3PTKA 1H49A 4R5EA 3ARPA 5ABHA 4PMQA 4OZOA 2EPOA 2JE8A 3NIYA 3EDJA 1E43A 1DWHM 2RGMA 3BCDA 4FNQA 2D1ZA 2V5DA 3VGEA 1HKMA 2TAAA 1C92A 4DM2A 2DH2A 3BVUA 3L4UA 5E09A 1BFNA 3GNPA 1PX3A 3PZIA 4PMOA 3D52A 2G4FA 3TP4A 4CVUA 1UD3A 2E40A 4TVUA 1KTCA 2ZWYA 1J11A 1HF6A 4RE4A 4F8XA 4AYGA 5BCAA 1ZBVA 3SCUA 2WC7A 1UKOA 1E3ZA 3A4AA 2EADA 2XN2A 3BCFA 1HXKA 5BYWA 4HOZA 3II1A 1ZB5A 2W66A 2Q8XA 5C8BB 1B3VA 3JUGA 1TMQA 3S5ZA 1WP6A 4NRSA 3VIPA 3WL0A 4BQ4A 5I77A 4JFWA 3AROA 3B8SA 1GQKA 2XIIA 4AZHA 3BLPX 2EPMX 1UWRA 3WBEA 2WMHA 2AOSA 2ZXDA 4Q7NA 3GH5A 3WMSA 6A3HA 4UQCA 2VURA 1OCQA 4CCCA 5M5DA 2X1IA 4J3VA 4M8UA 1MW0A 1TR1A 5AYBA 3D4ZA 4PUDA 1JYXA 1C8YA 1IV8A 1FOBA 1QNOA 1UA3A 1UUQA 3IANA 3VIOA 2DSKA 4D6FA 1PEZA 5E9AA 2ZX6A 1NOUA 3UEQA 4HU0A 3AQUA 3AHYA 1TVPA 3WENA 4QP0A 3AZRA 3W25A 5BXPA 4W8BA 4UQAA 5E0CA 1F4HA 4PTWA 3IK2A 5HPCA 1J0JA 3NUKA 1V03A 5FL1A 3BVXA 2D23A 3N12A 2WVVA 3WD2A 5LYRA 2CETA 3A4XA 5GNXA 2J74A 3KL3A 2OSWA 3G6LA 4ZXLA 3W28A 5M17A 4NRRA 2WVVB 1W9PA 1EH9A 1D7FA 4AEEA 4N0RA 4EAMA 2IXUA 2Y2WA 2OYKA 3KLLA 4QFUA 5I0DA 1DEDA 1O6IA 3VD4A 2EXOA 1J18A 3SUWA 3EDFA 4U2ZA 3EJSA 1KR0A 2HISA 2VRKA 1B2YA 2UY4A 2CPUA 1BPLB 2EO7A 2JEQA 3AIEA 3LRLA 1E5NA 5BROA 5M3WA 1E6NA 3FNDA 3PZ9A 1QOXA 2WMKA 1UWUA 3BGAA 2UWFA 5LA2A 1EIBA 1FH8A 4W5ZA 4U3CA 3WF2A 4JFUA 3KE0A 2XWDA 2X8RA 4MB3A 2G3NA 3A22A 1M7XA 1FHLA 5I3DA 2F18A 4J3UA 5CPSA 3MMUA 2VRJA 3A23A 3BMWA 3WIJA 5FIPA 2EPNA 1QNQA 4QLLA 2W92A 4B9YA 1W1VA 5A6BA 3EJUA 4J3WA 3WQWA 1JZ7A 2ALWA 4W89A 2WHLA 2EEXA 2EQDA 2CNCA 4AC1X 3B9DA 4F66A 1RP8A 5CQ1A 1GHSA 1OBAA 3MV11 3WSUA 3VD3A 3PZTA 1W3JA 4E4PA 2V3EA 2OWCA 4NXKA 1V02A 3BVVA 1UWIA 2WBKA 3SCPA 4B3KA 2WMGA 5BXSA 4JKLA 1OINA 1VBUA 4JFVA 1B3ZA 1QWNA 2VL4A 4W86A 4U33A 2WNWA 3WL1A 4XB3A 2GUYA 1C8QA 3ZMRA 3CZ8A 3AYSA 3A21A 2CBIA 3B9EA 1LQ0A 2WHKA 3IAPA 3OA5A 4JFTA 5E70A 3DDGA 2ZUNA 4OUEA 1QWUA 5GNYA 3OGVA 3WH9A 4WKHA 1M01A 4QLJA 2RGLA 4WIWA 1CGUA 2XFRA 2OW7A 3GNOA 1W9BM 4PMUA 1D2KA 2BV9A 3AIUA 1I1WA 1HTYA 1GORA 1LL4A 4XUYA 5A6KA 4D6GA 4KGLA 1E56A 1XSIA 2PBOA 3MKKA 2E9LA 2X2IA 3DX0A 1XCXA 1OIFA 3UG4A 4NZCA 4Z2KA 3H55A 1BYAA 2WAGA 5D9OA 3GXTA 2BNJA 5FD0A 1UKTA 1HJQA 4Z2GA 1WZKA 3WDRA 3EJQA 3W0KA 1JF5A 3GBEA 1DWAM 2EACA 1JF6A 5ECUA 2GVYA 3ARUA 4B16A 3KL0A 1WZAA 1QI2A 5GPRA 2VT0A 3FW6A 5IXEA 4D1JA 2PF0A 4E2OA 1CXFA 1VFFA 1OT2A 1JAEA 4PMXA 1PBGA 1KXHA 3SCSA 4DUVA 3OB8A 1PPIA 2QHAA 1HJXA 4DWSD 4HMEA 2FH8A 3L4TA 5AC5A 4GO9A 4ZE4A 2OSYA 3MMWA 3MUY1 1W9VA 5JBEA 3BC9A 4A3HA 1JZ5A 3CMGA 5CG0A 3NSNA 1CXEA 1CGWA 3LX9A 1Y7VA 2EPLX 1TG7A 1XSKA 8A3HA 5JIWA 1V3MA 1HP4A 3ZR5A 1GOMA 1PX4A 2VX5A 1QNSA 4H7VA 1OD0A 2VO5A 2WANA 3W82A 1NQ6A 2ZE0A 4UQDA 2CEQA 1E4IA 4H41A 3BAJA 3CTTA 3SCTA 4P7LA 2ZUSA 3AFBA 2VRQA 3VINA 3PZUA 3TV8A 3PTQA 1JNDA 4PUEA 4UOZA 4D72A 3OLIA 4WJXA 3AIQA 4HPHA 3LPOA 1FP9A 4IPLA 3WDPP 4AZBA 4D6HA 1E40A 2QPUA 1E1FA 1OM0A 5CZKA 1H41A 4AISA 1BYBA 2D73A 4KRTA 3EBVA 1ZBKA 1A3HA 1DWGM 1IZKA 3VGBA 4UFKA 1RP9A 1L8NA 4UQBA 3RPMA 4MNJA 4PCTA 1B3WA 4TTUA 3IJ8A 2CHOA 3ARWA 2F61A 1Q6FA 4M1RA 2YDRA 1V0KA 1J01A 2X0HA 2W62A 3QHMA 2J7BA 3K8MA 3WUBA 3N15A 1HJVA 5KZ6A 3TTQA 1GW1A 3PZQA 3K46A 4V2XA 1E6SM 5A2BA 4H04A 1ISVA 3O6AA 1G94A 3WFLA 5JUVA 1EO5A 5A6MA 3WQVA 1HJWA 5DFAA 1PIFA 1XH2A 5I23A 3S2CA 1DWJM 2F1AA 2Z1SA 2W63A 3UESA 4W7UA 1CENA 3VIHA 2CBUA 2XFFA 1CXKA 5EBAA 3D50A 3GXDA 4PN2A 4KWUA 3SEPA 4JZ5A 1UZ1A 3L2LA 5CLTA 5ABGA 5M03A 4HPGA 3CUFA 1W3HA 1QHOA 5HNNA 2VR5A 1FA2A 2XSAA 4RL3A 3RJYA 2XN1A 4HZ6A 4XZWA 3N1AA 1JD7A 3WH5A 1G0CA 3MSDA 3MANA 4AY1A 4Z2JA 3DYOA 2YL8A 4J7RA 4BA0A 1DTUA 2F8QA 4M82A 2WC4A 2CBJA 2DQXA 3PBGA 5A2CA 1ESWA 1CYGA 3PZNA 2JFEX 4GIAA 1XD0A 2VX4A 1MQPA 4YHEA 1H09A 1ISZA 2VZVA 4S3JA 3WDQA 1EXPA 3S6TA 3WN6A 1V0NA 1WAWA 3EMCA 2NW0A 1GUVA 1JYWA 4NX0A 1HXJA 2QMJA 2BHUA 2D20A 1SYTA 3CZJA 3GXPA 4LGXA 1UA7A 3HG2A 5CGMA 2WKLA 3BSGA 2DT2A 3F5KA 2A3BA 2WM0A 3VO0A 5BRQA 5A8OA 1FHDA 2BY0A 3APGA 1KR1A 4QCFA 1UWTA 1HIZA 4H8VA 2IXVA 1VJZA 3A24A 2JF7A 4A3YA 1CXIA 1HVXA 1QBBA 1UZ4A 3CBWA 2AAAA 2BFGA 4W8LA 3K8KA 4QCEA 3AHXA 1B90A 1MQQA 5F7UA 1LG2A 1ZU8A 4JCMA 1ISXA 1W2VA 3CZSA 4P7QA 1FFQA 3POHA 4MJ2A 3KEHA 3SUTA 4D1IA 3U57A 3MU7A 3BMVA 3A3HA 3CC1A 4MNMA 1R7AA 2D3LA 1TVNA 4BS0A 1VFOA 3HJEA 1A47A 3MMDA 1MXDA 1J10A 2VOTA 3DHPA 1J0ZA 3WY3A 1UWQA 3GH7A 1JDDA 3ZSSA 5GNZA 3RCNA 1R87A 2BY2A 3ZO9A 1ISWA 4GI6A 3FY1A 4CD6A 2ZUMA 2EABA 2D2OA 2ESCA 5CSYA 1QW9A 3DECA 3TOPA 1UQZA 3AOFA 1OSEA 3LMYA 3U5UA 4ACYA 3ARYA 3LPGA 3EJRA 2YLAA 4OKDA 4AWEA 4MJ4A 4CCDA 4D6IA 4UFJA 2Y8KA 4J3SA 1H11A 2XG9A 4QLKA 1V6UA 3UERA 4D71A 1NWSA 1E9LA 1AVAA 3VSVA 1CECA 4UTFA 2HVMA 2NT1A 7TAAA 2BS9A 3WDIA 1JNEA 2W91A 2J62A 3U7VA 4GI8A 2WKGA 1KXQA 1O7AA 5HPOA 3VM7A 5D9MA 2J7CA 1X1NA 4FNSA 4AD3A 1BSIA 3VM5A 4C7GA 3VSTA 4TTGA 1VAHA 5D9NA 3LRKA 4CGTA 2XHYA 3EDDA 1J12A 1FP8A 3UR8A 1V3HA 4LXFA 5CGTA 1MVYA 3AMLA 4AIOA 2XYLA 1R86A 3CHDA 3WNLA 4U5KA 3ZM8A 2CXGA 3LXBA 4DWSA 4XX6A 3DX3A 2DT3A 4ZXOA 3MS8A 4DWSB 2XVNA 3WH8A 3GYCA 1XHGA 3FAWA 4MDPA 5C71A 2GK1B 1CXHA 5LA0A 1TCMA 3HG5A 4P8UA 3RMEA 2CESA 3VGDA 2PWGA 2QV4A 1JZ3A 2EPKX 1E4MM 2FHBA 2VVNA 1WNOA 5DT7A 4F9DA 1CGXA 1OB0A 4MB5A 3OBAA 1E55A 2JIWA 1UD5A 2DH3A 1KB3A 4GKLA 3OIHA 2ZX7A 4MDOA 4PTXA 1BQCA 2V3GA 3AHVA 3BUDA 1SFSA 2QLYA 1CZ1A 1UQYA 5HOSA 4JKKA 4C7DA 4UFIA 4PRWA 3MO4A 3W26A 2YA0A 3W37A 2XVLA 3CUIA 5I6SA 4CN4A 2YL6A 1PIGA 2OWWA 4DO5A 1JAKA 3WD3A 3ZQ9A 5DO8A 4AEFA 3WY2A 3SCWA 3T0AA 2XJ7A 1GVIA 1V3IA 4MB4A 2CERA 3VPLA 3I3DA 5A94A 4Q22A 2G41A 4AD4A 3DX1A 1B30A 5C70A 4GQRA 5CJ5A 4FK9A 4AXNA 4UOJA 1VBRA 3W6MA 3WQ8A 3IGUA 3W27A 4BZYA 3T0DA 2D24A 1FFRA 3RM8A 1W1YA 3VNZA 3K1DA 3FAXA 4UFMA 4J28A 2EJ1A 1ZS2A 3KZSA 1QI5A 1EDGA 1VENA 1Q6CA 4M24A 3AICA 1KQZA 4CD8A 4PMDA 4UQ9A 2ZXQA 3GXFA 1CIUA 1UD6A 3T08A 3UG5A 3RDKA 5E6YA 1W2PA 1MFUA 2DT0A 4N42A 5I78A 3FHQA 1TQVA 3LXAA 2X2JA 1Q6GA 4MPKA 5AC4A 1J0HA 3ZT7A 2V5CA 1OT1A 1GPFA 3OLEA 4H8UA 1SMDA 4W85A 1GJWA 4M29A 1GJUA 5FL0A 4W93A 2YOCA 3ZR6A 1G5AA 3F4VA 2YBTA 4AIEA 4JFSA 1CLVA 2MANA 1BVNP 3L4XA 1CLXA 1BYDA 1GZJA 4PMRA 1X6LA 4F9JA 2Y24A 2O9RA 1R75A 2ZOXA 1MXGA 3CZKA 1HP5A 2X09A 1VRXA 2UY3A 2FYVA 1S46A 1H5VA 3WEZA 2J7FA 2ZUWA 3GZAA 2C0HA 2Z1KA 1TQWA 1V0MA 3NYDA 3VUPA 1NH6A 3OGRA 4P8WA 4P8XA 1PAMA 1QPKA 2GDUA 4NZJA 3WY1A 3UETA 3AMGA 1ZJAA 4TX8A 1TZ7A 1UASA 2FH6A 4GQQA 3SUUA 2WPGA 5A3HA 3N17A 4X9YA 5D8WA 4HOXA 1JXKA 2WLYA 3MUAA 2PC8A 2GJPA 4DWSC 3W81A 1Q6DA 5IFPA 4Y7EA 2ZX5A 1XYZA 3VTRA 3ZJ6A 3BH4A 2VI0A 4HU8A 4AMXA 2WMJA 3BUQA 5JBFA 2YJQA 3M7SA 3EDKA 1K9TA 3I3EA 3ZJKA 2ZUTA 2VZSA 3NSXA 3SUVA 1GOKA 3EYPA 2WYSA 2WBGA 1E5JA 1B3XA 1EGZA 3GXMA 3AS3A 3CUGA 5JBDA 1E70M 2YIHA 3LXCA 4U31A 3KWXA 3SCNA 3SIMA 3L4YA 1XSJA 1CDGA 2W5FA 1EQCA 3SCOA 4CU8A 5A8NA 2ZXBA 3WELA 1OGBA 3GXNA 2XSBA 3TTSA 5D9PA 1CGVA 2DSUA 2G3MA 3CZNA 1NWTA 1ODZA 3WD4A 4TOQA 2PI6A 4M56A 2YDSA 1W9DM 1HJSA 2D0GA 1KQYA 1EQPA 3A4WA 4AD1A 1NM9A 2VR4A 1XV8A 1IT0A 3SURA 4R27A 3ALFA 4YHGA 3VD5A 2OYMA 2ZIDA 5CSUA 1ISYA 1W9XA 1UKPA 1BTCA 3VGGA 2D0FA 2YLLA 1M03A 4M81A 1E0WA 1W32A 1PJ9A 4OJYA 4PMZA 4TVDA 3VMNA 4HTYA 1B3YA 4HMDA 4C7FA 1BF2A 1N82A 5IDIA 1KGXA 3VGFA 3OLGA 4FMVA 4PTVA 4MAVA 1AQ0A 4KRUA 3BLKA 1C91A 2FE0A 1U30A 1G01A 2A3CA 1UYQA 4K68A 3WF0A 2WVSA 1K6AA 2J77A 4FNPA 3TONA 1JDAA 4CD7A 3RILA 1W1TA 1JZ6A 1BAGA 1JXJA 1OGSA 2QMKA 1W1PA 1NP0A 3SCRA 1WKYA 3GM8A 1W91A 2WSPA 1GQLA 1JD9A 3DC0A 4LX4A 3U5YA 4E8DA 2YBUA 4OOUA 3BUBA 3W29A 2VQUA 1TFVA 3LRMA 4JCLA 1GVYA 1SZNA 3WNOA 3VMOA 4PMNA 3PZOA 4XV0A 1PX8A 1ZJBA 2F7RA 5D4YA 2YKKA 4MB1A 2XIBA 4P7OA 2J8GA 2VX7A 1JYVA 1R33A 4V27A 2J25A 2YFOA 2UY5A 1GNXA 3VKKA 5FKYA 1WE5A 2XGBA 3T0BA 3AS1A 3W4RA 1MYRA 2WCAA 2WZHA 2WK2A 2G3JA 2BY1A 4GI9A 2BVYA 2XUCA 4W8AA 4BF7A 2FDMA 3QOKA 1UOKA 3DYPA 5A69A 4FLOA 5CPTA 4A4AA 2VZTA 3VIJA 2XGIA 3AHTA 3E1F1 2A3AA 1KGUA 1R47A 2CHNA 2DPEA 5EFFA 1UH4A 4IISA 3VOCA 3WBAA 4B3LA 2WVTA 3AS0A 5BXRA 3T2OA 1XH1A 1EDTA 2VMFA 2J79A 2E0PA 1JI1A 2A3EA 2X0YA 3AZTA 3ZSTA 4L4OA 2J75A 2W61A 1E1EA 4MAZA 1W9UA 1KCLA 1PS3A 3DDFA 3AHZA 4RE2A 3RO8A 3B9AA 3BSHA 1QX1A 1H0IA 1OWQA 4W84A 2CYGA 3UG3A 3N18A 1MQRA 2E4TA 4GZEA 3RIKA 4UR9A 1JFHA 4BQ5A 3K8LA 3POCA 3A6OA 4ZE5A 3W6LA 3W24A 1B9ZA 1HVQA 3WF1A 3CV5A 1C7TA 1TQUA 4NSBA 3HN3A 4Z2IA 2BY3A 5E1QA 1US2A 2BHZA 2XM1A 1V6XA 4LQ1A 3N13A 4FNUA 4ATLA 1GOWA 2IUZA 1LL6A 3VDCA 7A3HA 2C8NA 3VNYA 3GNRA 3THCA 1U2YA 2PWDA 2VTFA 1BG4A 1HKKA 3VMPA 4JHOA 3VX1A 1E73M 3VILA 2B31A 1V0LA 3ARTA 3FXYA 4P7NA 3L4ZA 4D6EA 4UNIA 4F79A 3DYMA 2WCSA 4UZSA 3FN9A 2GJXA 1FH9A 2O9TA 1W3LA 2EAEA 4GPNA 3AMCA 1WDSA 3WUGA 4WSKA 5E6ZA 2GJXB 4HOWA 1CGTA 4WKFA 1UD2A 1HKJA 2F7OA 2BXZA 3CMJA 5ABFA 1V08A 3ARQA 4ACZA 2J7EA 2JIEA 1T0OA 4EANA 4KH2A 5ABFB 3QOMA 1VIWA 1E6QM 1LL7A 4ACZB 3WF4A 1K9FA 1NWRA 3ZOAA 1QNPA 2WMFA 3AI0A 4PTMA 4AMCA 1WPCA 1BVZA 3UR7A 1V6YA 4EK7A 3VDBA 4W7VA 5A8MA 1TQSA 2XTKA 1JG9A 1J9YA 1VEOA 3RM9A 2E8YA 1WCGA 3ARZA 4QDMA 4CD4A 1VEMA 3PZVA 1B0IA 4P8VA 2E3ZA 1E4NA 4UFLA 3A5VA 3MV01 4UCFA 1SMAA 5I24A 3GBDA 4TUFA 3M6DA 2GSJA 4AIUA 1ITCA 4KGJA 4L4PA 1UG6A 5CLWA 4EE9A 3D3AA 3F5JA 2OYLA 4H2CA 1HL8A 4GZIA 2J7HA 4MNLA 3IJ9A 4UQEA 2DIJA 3WQ5A 4MTVA 5FOOA 3S5YA 3OGSA 4GZJA 4QAWA 2DT1A 1V3KA 5HDRA 1CXLA 3PTMA 3KL5A 4FNTA 3HMCA 5A95A 1NOFA 4CN6A 1EA9C 2YDQA 2FHFA 2DEPA 2DDXA 1QBAA 1KWKA 2F7PA 2GK1A 4AZIA 5A6SA 4MADA 1HX0A 1HKIA 5IHRA 3CIVA 1QVBA 2JEPA 1QHZA 1UH3A 9CGTA 1C93A 2OW6A 1QW8A 2YA2A 2XFYA 3EJTA 3OLDA 2WZIA 4FNRA 2WW5A 5I5RA 2F2HA 1I1XA 1ZBWA 1WZMA 3CZEA 4M80A 4YN5A 1JZ8A 2GJRA 5FCZA 4FLQA 5JIPA 1DP0A 5HBFA 2G8ZA 1XH0A 1H3GA 2O92A 1E15A 1KBKA 4CUCA 3HZ3A 1LJYA 3CUHA 3J7HA 2YA1A 3T09A 2XN0A 1CWYA 4DM1A 1BYCA 4W88A 3NJ3A 3O2LA 4D6DA 3VD7A 1DWFM 1ECEA 2WZEA 3M07A 3D4YA 5AY7A 1TUXA 1VJSA 5IHSA 3WH7A 2J7GA 3BAKA 1G1YA 2WSKA 4HZ8A 1BG9A 4J3XA 2X2YA 1W3KA 3CO4A 1RPKA 4CU7A 4HA4A 4U2YA 2XVKA 3WDHA 2CCRA 4NI3A 1BGAA 1BLIA 1AQMA 2DSZA 4D6JA 1NOWA 2VJXA 4U3AA 4HZ7A 2VZOA 1QNRA 3VIKA 1K9EA 5BWFA 2WB5A 3T2PA 2V3DA 3EMQA 3SCQA 1LF1A 1DHKA 1H1NA 4GINA 4WK9A 4WLCA 5CXPA 4JIEA 5EB8A 1QI4A 1HN1A 1G9HA 1XC6A 4PMVA 4UFHA 1EO7A 3CUJA 1UWSA 4LYPA 4FLSA 4HA3A 1ODUA 3MI6A 2E9BA 3BUPA 4AD5A 3CZGA 4TXEA 4AZGA 2Y4SA 4EKJA 5LA1A 2ZXAA 1CPUA 1CBGA 4AZ5A 4AZ6A 3WNNA 3WF3A 3WH6A 3IAQA 3VGHA 2YL9A 1C90A 3VDHA 3AZSA 5BRPA 1R46A 1UKQA 4ZENA 2CKSA 5A8QA 5A1AA 1MW2A 2OLHA 2D22A 1JI2A 3ZIZA 1KGWA 2VQTA 2WXDM 3BAXA 1D3CA 2J78A 3GTNA 3TA9A 3ZJ7A 1NP2A 3VD9A 3QHOA 4BQ3A 1US3A 4S3KA 1DWIM 1XCWA 3M46A 2WWDA 3EMZA 1F4AA 3NDZA 6CGTA 3WDJA 1XRVA 1R7OA 4MNKA 3MSGA 4KMQA 2J4GA 4JKMA 5A2AA 3AIBA 3NSMA 2CBVA 1BHGA 1VFUA 2VZUA 1GOQA 3AMDA 5A8PA 4AYSA 3NDYA 1LG1A 1NWUA 2F1BA 2NSXA 3OG2A 4PYSA 4LPCA 4B9ZA 2DGAA 1O7DC 1V3JA 1UR4A 4PSPA 4PEEA 1WB0A 3DX4A 2GFTA 4RE3A 4UOQA 3SCVA 3KLKA 2FGZA 4URIA 3FHAA 4WKAA 3WNPA 4DO6A 2D0HA 1L0PA 2V38A 4GO8A 4JL1A 1Z32X 1C8XA 4PBGA 1KBBA 2JF6A 1FH7A 1WDQA 2XPKA 3WD0A 3VIIA 3WUEA 3ZT5A 4CKQA 3O9NA 1YHTA 1TE1A 1AQHA 2YFNA 2OWXA 3AXHA 3K4AA 1HL9A 4FF5A 2XVPA 4LYQA 3CH9A 2PWEA 1E0VA 1EOKA 2NT0A 2XWEA 3WEMA 3ARSA 1MWOA 4U5IA 2VCCA 3BVWA 4DO4A 4CN1A 1TA3A 1UKSA 1E71M 1NARA 3D51A 3AIWA 3CHCA 1H2JA 1XYFA 1TA3B 3ECQA 3L2MA 7CGTA 3AMKA 5E0FA 4V28A 3WMBA 4AD0A 3VX0A 1GOIA 3CHFA 3WEOA 3VSUA 3WNMA 4JL2A 3AXIA 1AMYA 2WHJA 4NZFA 1V3LA 1Q6EA 3PHAA 1KFWA 3ZJ8A 4ML4A 3HG3A 4ZEPA 4PSRA 3SUSA 1B1YA 3H54A 3VU2A 1VEPA 2E9MA 3WMCA 1KTBA 4DUWA 3W38A 1JYNA 2BHYA 3ARVA 3EDEA 2PWHA 3ARRA 3BAIA 5CPQA 1UR0A 4PMYA 1E0XA 3N9KA 2V3FA 3BAYA 1R85A 3CZLA 4ZFMA 3PZMA 1M53A 3A47A 3BXWA 1UR8A 1BGGA 1VB9A 2XM2A 2OSXA 4WSJA 1KXTA 1WDRA 1ZL1A 4YPJA 1OD8A 1HWWA 4AMWA 1V02E 3K4DA 2ZX8A 4W5UA 5ABEA 1TQTA 4IPNB 4AZCA 2WCGA 5DEZA 1J0YA 4PCSA 2XVGA 1CNVA 4NF7A 2CIPA 4JHZA 4D6CA 1H4PA 2VUYA 3PN8A 6TAAA 2VNCA 3WFZA 2W4XA 4AZCB 1OGGA 5GQBA 3CHEA 3RJXA 4OOZA 3NCOA 3T2QA 2Y8VA 4GXPA 4FLRA 2FHCA 2ZX9A 3WQ6A 3OZPA 4BQ2A 1MW1A 2ZICA 3LPFA 1EHAA 4X0NA 5DF0A 1KXVA 2JALA 3OZOA 2WMIA 1JDCA 2BXYA 5TD4A 1V6WA 2PB1A 1VF8A 2WC3A 2J8FA 1WO2A 3LPPA 1CTNA 2WMIB 3WUFA 4OGZA 1E4LA 5I2UA 3DHUA 3AIRA 3HU7A 2WLZA 2PWFA 3WKZA 1B31A 4HMCA 1UD4A 1UR2A 3AS2A 1E3XA 1C7SA 2X2HA 3I3BA 1JZ4A 1GHRA 2J7DA 3W53A 2VX6A 3AYRA 2PBGA 1CGYA 1K9DA 5D8ZA 2VVSA 1WZLA 2O9PA 5DT5A 3QGVA 4Z2HA 3MUZ1 2FGLA 1LLOA 1JL8A 1LWJA 5DMYA 1E6ZA 3U7BA 1UHVA 2GDVA 5A6BD 1H0GA 3GDBA 1U33A 3UCQA 1R34A 4J27A 4W87A 3ALGA 3G6MA 3BAWA 1X6NA 4ATDA 5A6AA 1HT6A 3HG4A 1RH9A
chains in the Genus database with same CATH superfamily
1OE3A 1P6WA 1ITUA 2WKOF 1TNMA 4M51A 2GC7C 3AW5A 2PLJA 3GVQA 1J0IA 2CKRA 4CADB 2Y5JA 1AO7E 5E5CA 3HUJB 3MLSH 1GYMA 1F9CA 3VRJA 4M9OA 1SOSA 4KTDL 2HFFA 5FHBH 2Y5EA 4XO8A 5DEGA 4YDZA 3WNKA 3IN2A 1A1NB 3DVFA 4WSHA 4DWHA 4QRPB 1LK2B 1ZQ5A 3INUH 2Z31C 1ZNNA 2HLAA 4ERSL 2E5EA 3IJ7A 3KPSD 5IJKC 5M1TA 2XN9A 4RCXA 4ZMAT 5JPNC 3BQUA 2C18A 1WZ1L 1IC7L 2IWGA 2JQAA 1BF5A 3MCG1 5T5FA 3TTOA 3BN9C 2HVBA 4G3YL 1XGZA 2BVDA 1O1HA 2F8XC 1JZ2A 4HSQA 2Z35A 5A6JA 3UTQB 1SOXA 4JY5H 2IF7A 2D3NA 2FT6A 4GUHA 1V79A 2AGKA 4OCRL 5E2UL 4NZRL 5EF1A 3S3GA 3DTUB 4IDJL 1DZ0A 4MMWA 3RDTC 1PSKL 3L17A 2R2BA 4AQZA 1EIXA 2LU5A 3T65A 3EDJA 1VPQA 4Q4OA 3DX8B 3TX9A 4CVXB 5DT1L 4ADGA 1KOAA 4CNUA 3C6LD 3BKCL 1SPQA 3PAJA 2WD0A 4L9ZA 4R85A 1L5GA 1UD3A 2E40A 3NVQA 1MCSA 4WFEE 4J35A 2GIMA 3CH1B 4AM0Q 1DVZA 4PRHE 3PUGA 1OT4A 1S6NA 2CO4A 1SBSL 3QQ1A 2F74A 4ZUSB 2CLMA 4LOVA 3R06B 3UPAA 2WLLB 3P9MB 1WFMA 1AKJA 1V7NH 3MA9H 2H0FA 4JIRA 5AD0A 5J56B 3K6FA 5D7SH 4JDBA 1MW0A 1HC1A 3URBA 1QFOA 3PBYA 1UA3A 5DHVA 3VFNA 1HKWA 1VHNA 4GH1A 5JORA 3AQUA 4HNCA 3QUXA 2JK5B 4IRJC 5E5MB 4ZXBD 2VW4A 5LYRA 1LP9B 5HDBE 1DJSA 3LEXB 3F7PC 4CSSA 1A4JA 3LRGA 3F2DA 5K1VA 3L6FB 1W9PA 1IAKA 4C1LA 3VFGH 5F89A 4MXQC 1BM3L 1H9DA 2Y2WA 4DP8X 3U6XS 3VFPA 1GQNA 1OB1B 3MNZB 1J5IA 1DVFC 1E9IA 3LN4B 3NRFA 4NWUH 2UZ9A 3BV4A 3FU0A 1ET5A 5AG9A 3GSNL 5C5YA 3SPJA 1G6CA 1QOXA 5B3NA 4G42B 4LBSA 5D4JA 5IUSA 1ASOA 5AOZA 4FHBD 1YJDL 5DHXB 2YD1A 2F18A 1OSZB 4YGVB 5C0RL 4PI0A 1I3GL 3M45A 1E28B 1Q9LA 1W1VA 5C0IA 4K94H 3OKKA 1FWBC 4K8RH 3EJUA 2AJZB 1FH5H 4NQCD 2XPGA 5C9RA 1DYZA 2CNCA 4ZMOA 3UAFA 4F3HA 3VXNB 1RP8A 2DM7A 2QAFA 1UZDA 5ABDE 2CHXA 4B3KA 5KSAB 3R43A 2VL4A 2BSCA 2JELL 1VP5A 3MLPA 4XB3A 3ESPA 3P74A 3QFEA 2CBIA 1MREL 3K6SA 3OA5A 4CSZA 4R96B 5C54A 1UC5A 2AVGA 1G0XA 2EEAA 4HC1L 1ZK9A 5HGHB 4WIWA 3X11B 4TQ8A 1CLKA 3DOSA 1E5UI 3VG9B 4RUBA 4AIBA 5KS9A 4TLKA 4XODA 5C9WA 5D9OA 2BNJA 1ZALA 4ZSOA 1YEEH 1CE6B 3G04B 4UT6L 1T2JA 2BG5A 1NCAH 2QCNA 1JTTA 2BLEA 4HYTB 3LKRA 3O3AB 2BNRB 3HFYA 1AQ8A 3MBEA 3P0YL 5AVWB 4GQ9H 5AFDA 4HMEA 3T0TA 5KWYC 4GO9A 3OMZA 4IOFD 4EIZC 1OQXA 5KSWA 4KW2A 1FZJA 2R23B 5KYWA 3P61A 3MVTA 1O5DT 3E0FA 2EDXA 2HSIA 3X14A 3LX9A 1AO7A 1TG7A 1LRNA 4Q4SA 1V3MA 1PD6A 1QNSA 2VO5A 4ERSH 4YXGA 2VSDA 5AVHA 4QHUB 2ZUSA 1CF8L 3GFZA 1IC7H 5L88L 2BVWA 4GNKB 3CD4A 3G8EA 4G9FE 3ROLB 2ED7A 2XTJC 3LPOA 3ATZA 3E9AA 1E40A 3LTSA 1GH7A 1W3IA 3ALWA 1QUNB 4ZS7H 1IZKA 3VGBA 3HRZA 1F6LL 4MNJA 1NF7A 2P53A 4K8HA 5J6HB 3TU6A 3W9ZA 2ACUA 5I15L 5DUPL 1MEWA 1G7MB 3NCYS 2RHGA 4KTGA 4AT6B 3URQA 2VABB 4ZUWA 5EC2A 3BKCH 1C29A 4RDYA 4C56B 4Y16B 5IW1B 3RNQB 3D50A 4X4YB 4UV4L 1TRDA 1HQRA 1DQDH 3VW3H 3VXQA 1WBHA 1LE5B 5LGXA 3NGBC 4K2SA 5EA0H 1FE8H 2WLJA 1JD7A 3RJDA 1OGAE 2FSEA 4Y5XA 2YRZA 3ZFHA 3T2NH 2OXHB 3JU2A 4AEHH 4LKXB 2CK0L 1MQPA 3TCEA 5LGJA 5H8PA 4S3JA 2B7NA 1EXPA 5I3IA 5XIAA 4WNQA 3QDGB 1ZGLM 4LEQA 1YPZE 2VSCA 1XF3A 1RZFH 1YEDA 5KZEA 1EEPA 2V69A 3MNMA 4J5NA 2WZ5A 1X5IA 5K2ZA 3L3DA 2DMHA 2FEJA 5E2WL 3B0UX 5INDA 5DD5L 1D5IL 1EGMA 1BM3H 4FTVB 1EC9A 3REQA 3K2MC 3GD6A 2BZCA 4JDEB 3PULA 2DLHA 3TT1H 1VFOA 3HC4H 2BVQB 4NNAA 4N1HB 2DWDB 4JZOA 3G1XA 2IPKB 2EXYD 4MCZB 4JX5A 5H37G 2DP3A 1I8KB 3D0LB 1E5ZA 4RAVA 3ZO0A 3AOFA 1LDCA 1ZIBA 1XRSA 3HZKB 2AJVH 4J3SA 5DXYA 3V6OC 3CJJA 1CECA 5KJ7E 4Y4KD 3MKVA 2NXZB 4Q89A 1Y0LA 3GUFA 4Q56A 4IBVA 2B1AH 2BSTB 4WNJA 1FP8A 3HS0A 1V3HA 1T5XA 2IOIA 5IBTH 3FU9A 2DTSA 4AIOA 2NQ5A 4Y2DA 1EJ6A 1BXUA 5I06A 1EQWA 4DN3L 3U25A 3WLBA 4LUTB 1DIDA 3W39A 1UB5B 1ZE3H 1KEMH 2LVCA 4LSUL 1MY5A 3N43F 3MLWH 3QR2A 3GVGA 1P48A 4F0LA 3DKLA 4KJWC 3QJHA 1O68A 4JKNA 1N0LA 4XBEH 1VCVA 3LHZA 3UTTE 1RUQH 1Z42A 4JTSA 3TNOA 3QJQB 3C5ZB 2EDFA 4LGRB 1MG3C 3T0XA 1A4CA 2YSTA 4P8UA 3RMEA 3RL2B 5B39B 1WGOA 1WAAA 2QV4A 4ODWA 4F7PA 3I9GH 3BICA 3GMMB 2FHBA 3KYMA 4LKCA 3QGKC 4UT6H 2XWXA 4P4RB 4XAWH 1RJRA 2WXFA 1AD1A 4L4JA 2A1WH 3M8OL 3QZAA 3W7LA 2W0KA 3ZVHA 6ENLA 4ESKA 3FU8A 3TLLA 1JQVA 3T3PE 5DX7A 2CRMA 1MUJA 2UXGA 4Z9KB 1CZ1A 1LLZA 1EZVY 3HLAA 3FUHA 3N9GH 2OZ3A 1NDWA 1XCTB 2DYPD 5LNVA 5FYJE 3A9BA 2C7UB 4OD2A 3MBDA 4UT7H 1M1SA 1TPUA 4G6MH 4MWAA 3DX1A 4ZO7A 4E9RA 3VKCA 1XTMA 2D24A 5M94B 3H2AA 5ANMB 3UGUA 1QI5A 1CF8H 3QUHA 2EC9T 4UQ9A 2W5PA 5BZWB 1BOYA 1NC2B 5DS2A 4M5TA 3GVWA 2I9TA 5F1NB 3CV7A 4TR9A 2ITFA 5FOBA 4PW3A 4JFYB 5KINA 3LTVA 1FVDB 4MA7H 2PP3A 2CH8A 2MANA 2NLIA 2HTKD 1X6LA 1R75A 1TZOA 5E0QA 3CAFA 3ARDC 1EO8L 4BFEA 3UWVA 2FYVA 4WWID 5FFGA 1MNUL 2Z91A 5HYSB 3LQMA 4P23D 2E7MA 3PWLA 1PVNA 1HO1A 2BIHA 1KRCC 1X5GA 4XAGA 3MRPA 4X9YA 1LL1A 2WYZA 4KZEH 2C9XA 1FNEB 4PS3A 4Y90A 1ROWA 2IWKA 5BO1H 3L9RB 1JDEA 1WAUA 4FAAB 2Q8AL 1ADQL 2KT6A 4B27A 4BCXA 5FO9B 1K9TA 2DRUA 1B2WL 4KH9A 2XH7A 4WY0F 4FOUA 1XSOA 1IT7A 2KDGA 1FZOB 2CK0H 1JPST 5D09A 1FCCA 2BHFA 2YIHA 4AGMA 2TRSA 3W7RA 3U0TB 3NTCL 3PGCB 1RUKL 2BIIA 3TC6A 3MUHL 3HPLA 4AVKA 1QSED 2G3MA 3GB7A 4Y5VC 4DYEA 1ODZA 3LCHA 1UURA 1VZWA 1YPZA 2V67A 3C0LA 1UACH 3FB7B 1ZPTA 1W9XA 1PZDA 3WFCL 4GMSL 3DFNA 2YD4A 2JJTA 4W4NA 2TRHA 3KCPA 2FO1A 2DBLL 4KRUA 2CLZB 4TF4A 2YW4A 2FE0A 3N40F 4UTBH 1ZVNA 4HBKA 4M6PA 3CQPA 3RVTC 3DLQR 1BJ1H 1IJ9A 1YEHH 3VH8B 5BV7L 4DO7A 1GQLA 4US6A 1JP5A 1RSYA 3KVKA 4JIHA 1WVZA 1HCFX 2J1YA 3MLUL 4PJDB 5REQA 4ILDA 1OTSC 5HMSA 3PZOA 4BFAA 4WUKH 1BXBA 3FQUB 4MCNA 3VKKA 5F88B 4PBWD 1OCRB 4LCIH 3JZ7A 3D18A 3H8NA 4LAMA 4FFYH 1MNSA 5GHWL 3SD2A 4LRIA 2IDQA 3QOKA 4H8WH 3VWKB 4EKXA 1RCYA 3HG1E 4IBQA 3MHFA 3DIVA 2HX8A 4AJVA 2WVTA 1JFQL 3TN0A 2F53E 1XH1A 2J79A 4WU7B 1DJQA 1X44A 4L4OA 2OR8A 4NAFB 5AC6A 3G1VA 4Q7IA 5AALA 4FQLL 4BEQA 1BP3B 4GZEA 4B97A 5FV2A 3T8VA 3W6LA 2VL5B 1XC4A 2NLJA 2EUXA 3I6GA 3UTTA 3W0WE 5DY2A 3R8GA 4X4XA 2GL5A 2RDTA 3PWPA 2I24N 3B0PA 1DVUA 2QHRL 4WV1C 3GK8H 1BW8A 2X1WL 4PYHA 1E9PA 1EMTL 2HLAB 3FN9A 4LCQA 2C0AA 3WUGA 1ENUA 3GRWH 3NL5A 3WMQA 2BXZA 1G87A 2DVXA 2PDBA 1FJ1A 4AENA 3Q05A 1NSNH 5J9PB 3M0MA 1IKFL 1VYRA 4O11A 1NWRA 3NXFA 1PYWB 2BW4A 5BOFA 4W7VA 2CQVA 3SYAA 3LA4A 4AKOA 1T6MA 3OZKA 3EXSA 4BHYA 2HB0A 3DKHA 2R2BB 3QZWA 3RZCD 2A3TA 3LQAC 3KPPA 2J6EH 3D3AA 3ZKSD 5L4FA 2IH1B 3LAFA 3OXSB 1KTJA 1YNTF 2VDRB 3I50H 3VNMA 4I89A 3ABMB 2WMPA 4FLHA 3HUJE 1V3KA 2XG5B 3WJZA 4CN6A 2DYRB 2FBRA 2Z8SA 4Z3EA 4KROB 3AY2A 3CIVA 3FLUA 3C3NA 4NNCA 4KZ0A 1QR1B 1JVNA 3KRZA 5CLZA 2P43B 1MJ7L 5DUBA 5FGSA 4YN5A 1JZ8A 4DFIA 6XIMA 1DP0A 1LO4L 3AO0A 3QBTB 1XH0A 2Y7SA 3K3QA 1KBKA 4CUCA 3SDXF 2G9HB 3QWRA 1L9SA 4ZX6A 1KJMA 1A0QH 4GUFA 5D7HA 3HNTL 3OPSA 1KGJA 3VFNB 4KDVA 3EBHA 5JORB 3KPRA 4CU7A 3PS7A 2RIKA 2VHLA 3TNBA 4CQAA 1AQMA 3RTLA 1NDYA 1M6OB 5G2WA 2F84A 4IKKA 3O9WB 5KBKA 1IAKB 1NEZG 5EZIL 2Z00A 4JR9H 4IFOA 3EMQA 3HMXL 4WK9A 3GNDA 4QRTA 4PHZA 4L2YA 5CAYB 1HN1A 4ZW6A 2OQLA 1Q2RA 3VFPB 3CUJA 2DQMA 3BUPA 2ZXCA 4J6RL 1X5KA 4NN5B 2ZZ6A 3UFYA 2D9CA 2NY4C 1CFQB 4XC3L 4HT1L 2EYRB 1AE6H 2GFBB 3WS6C 4UNLA 2Y70A 1JNLL 1WFTA 3IJEA 2VQTA 4WO4A 1XIEA 2XIOA 2PO6C 2G3FA 4FR1A 3UXFA 3MGTB 5BVJA 1Q9LB 4XK2A 4K55A 4NO5B 2KERA 4G8AC 4GFSA 1ZHNB 2V7NA 3WDJA 2XYCA 1R7OA 3FOMA 4JREB 2JCWA 5EORL 2VZUA 3HE7C 2KI6A 4OHQA 3VYOA 2HWZL 3OVRA 3T4WA 1JVKA 2QVNA 3OG2A 1A21A 2IGLA 3KPTA 4PV8A 1K7FA 2X2GA 1O0VA 4P05A 1YADA 3OD3A 4IHBA 1GGIL 4RE3A 3K6SB 1AR1B 3OAWA 1LP9E 3WNPA 1SRDA 2D0HA 2V38A 4GO8A 4P2RA 4O58L 5K9CA 4US5A 3WD0A 3H7RA 3DOSB 3AXHA 1SYSB 1JFQH 2HT3C 5BQDA 3CH9A 4K9EC 3QISA 2Q8ZA 3RPKA 4P3DA 3WYZA 1QOKA 4ZOCA 3HG1A 5D71H 3I02B 1E67A 3EGDB 3A4JA 1YQVH 1WYJA 2EUVA 3EFFB 1GOIA 2F53A 4OD3H 5KBPA 3O6DA 1AGEB 3LRSB 5KVDL 3LNHA 2GY5A 1NKGA 4ML4A 4FI7A 4PJBB 3UCCA 4UDTA 3OGCB 5KYWB 1KTBA 2WZPD 1PMYA 3C6SA 1PVHA 2HQAA 2FJHB 1OWWA 3W0WA 3OL2A 4WSJA 1OD8A 3UA3A 3N42F 2EYTA 5GGQH 4GQZA 5B8CB 5DEZA 3MFFB 2PDYA 4ZZ9A 2XVGA 5J13B 2QQNL 1URIA 4F3FA 1CN4A 4YHZH 4YX2H 5JW3H 1NVMA 5DS1A 5TD4A 3NA9L 3HVDA 4K6AA 4K7YA 3LPPA 3FPYA 2Y62A 1FWTA 2EE9A 4U10A 3EO0A 3RX8A 3HQPA 1S5IH 5AKSA 3SQMA 3HS9A 5DSCA 1MCKA 4Z78A 3CVBA 3C52A 3EYUL 2BNRE 1FGNL 4Z2HA 4G7EB 5DJ0B 2FGLA 1SYVA 4Z18A 4ZUWB 1ETA1 1UHVA 5A6BD 4IXXA 1GL4B 4JFSA 1RH9A 1AMKA 4PYGA 3LD5A 4CADA 3D39B 3HUJA 1Q4NX 2Z6IA 5AVUB 5ISZD 3WV0A 3TURA 1T5AA 1XGQB 1QOPA 4PLNC 2XHNA 4HJJL 1S38A 4WWKC 5B7MA 4G7FA 3V0WL 4IM4A 2B9AA 3VQMA 1HW6A 3MLZH 1A1NA 1WF5A 4QRPA 1LK2A 3HNTH 3LIZA 1U22A 4YE4H 4H0HB 3AIVA 5DA0B 4B15A 3IDMB 3NQMA 3QC6X 2XUWA 1EJFA 5T1JA 2CUMA 1UR9A 2NYKA 2KQNA 1QI3A 4AD2A 4CD5A 1YQ2A 1QBML 5J6SA 3I74A 3KPLB 2FD6H 1CFVH 3LZ5A 3UTQA 3IIPA 5H8MA 1AR2A 3EXLA 3UTZB 5ERWB 2C1HA 2ZWZA 4Q6IB 1CYXA 1UP3A 4IPPA 4QNEA 3QR0A 4RRPM 3PJLA 1BGXL 3S88H 1Q38A 2BNQB 1LTDA 3DX8A 3DBPA 2WJFA 4CVXA 4FXKC 4MHHI 3BVUA 3COTA 4JHWH 1CBJA 5DJ2A 2QGYA 1PZ5A 2OZNA 4I6VA 3WE6A 4QXIA 4GQGA 4P4KC 1KTCA 4U6VH 2VFFA 3IGKA 3PPGA 3D09A 1OC7A 3QDGE 4G1MB 5JIDA 4L48A 3LS5H 4ZUSA 3R06A 1ZB5A 3P9MA 4R83A 3JUGA 1LTXA 2I57A 4BZ2H 1KSRA 4NYUA 2EPMX 4LHQB 1GGIH 2ZXDA 3AYTA 1TQCB 3WMSA 4JY8A 1OCQA 1E4KA 1RKRA 2FATL 4E5XA 3I2CL 1TR1A 2Y06H 4G6AD 3T8MA 4ZFOA 4Z08A 5AYBA 4O58H 2ERJC 3LQGA 4FTVE 2FWSA 1PEZA 2JK5A 4LSVL 4HCRL 5E5MA 3ZUNC 4LK4A 3W1LA 5HPCA 3UU0A 4CC1A 2YCIX 3L6FA 3BPOC 1IVTA 3KVQA 1FH2A 3KL3A 4W4OA 4MDJB 4IKIA 4O02B 3EOEA 4AEEA 1IILE 3MNZA 4H9UA 3LN4A 3GR8A 2H0JA 1RUMH 3HLAB 4PJ5D 4G6FB 4M6NL 5HQMA 4G42A 1MI5D 3R8BB 3PZ9A 3W7JA 2I25N 5AB2A 2UWFA 4DAGH 3LNFA 2BRRH 1XIDA 1OSZA 4YGVA 1U3HB 4HIQA 4X50A 2E1DA 3RWFB 1E28A 3MMUA 4LOFA 4G5DA 2AJZA 2W92A 2Y5QA 3WQWA 3VXNA 3GMOB 1S78D 3BSZA 1SJDA 5JOPE 1J2BA 4XGZA 1FWNA 5KSAA 3HHRB 2OWCA 4B91A 2HPOA 2ZTBA 5DR5H 1NANI 4XD3A 4IQEA 4DBDA 4U33A 3BIAX 4PMJA 3GMRB 5SWZB 4OF3A 4R96A 4IIEA 4UBPC 5CIPH 5CCJA 4PS8A 3DJ9A 4LAQL 2NW2B 2OR9H 5HGHA 3ZL4H 1OPGH 5C6MA 3X11A 4DOHE 2OW7A 1S9XB 2OODA 4XH2B 1EGJL 1HTYA 4IBSA 2Y1YA 5FIEA 2IC2A 3W1QA 1CE6A 2PR4H 3G04A 3NCWA 4PJ7E 2OZ8A 3O3AA 2BNRA 4DQOL 4B16A 5LWYL 2E5DA 3OAZH 4XIAA 4DUVA 4P2OC 1YDNA 2FH8A 4AY8A 3S6CA 2ZZ3A 4HJJH 2R23A 5ANME 1PLAA 4HK3N 2VEPA 4M7JH 2PTTB 2NY2B 4G59C 5JBEA 1YYAA 3BDKA 1YEKH 1FL3A 4MASA 3ERXA 1GVQA 4QHUA 5D2VA 1OYBA 2BBFA 3E0WA 2NY5L 2CEQA 4HHHA 3FUJA 3TBYB 1PZ0A 3ATDA 1ZPLA 3ROLA 2YD6A 4JY4B 3D5OF 3UP1A 4NNPL 4QS6A 2EXWC 5D1QD 5DUML 1QUNA 4JTHA 3QIWB 1ZAJA 3R7MA 1TEFA 3TH3T 5J6HA 4LCVA 2VFDA 4N3TA 2XISA 3NN8A 4ORIA 1G7MA 1RLCL 4R88A 3UR5A 3TTQA 1JMZA 1GW1A 1HH6B 2VABA 1I8LA 4I9MA 3WFLA 3LH2H 4DP6X 1KV3A 4C56A 4Y16A 3ID7A 3RNQA 5IW1A 1RQEA 4X4YA 1PWMA 4W7UA 3KLAA 3SDAB 4DN4H 3ULUE 4HV8B 1LE5A 4AWTA 1T66D 3REWB 4G7SB 4M1BA 4GFXA 3D18B 4FZIA 5DJAB 3E02A 4LFYA 4MZ8A 1OG6A 1WD8A 2VMEA 4NIRA 1AXSB 1UGNA 4GMEA 4QTHB 1N3NB 2VGGA 1BCIA 5EF3A 2QVTA 3OAUH 4PA8A 4KIRA 4LKXA 3LZLA 2AS5M 2WIIB 3QDGA 5DLLA 5FUCE 2DQCL 2APFA 3U1SH 1V0NA 2NW0A 3FJTA 3H7BB 2V5BA 2PP7A 3GSXB 5BRQA 2CR0A 4OCXH 4FF9A 1VJZA 4KK6D 2P8BA 2XXMB 3IJ6A 1UZ4A 3EAKA 1GS7A 2YBGA 4JUSA 2INZA 2NLJB 1NBYB 1OCCB 2K7QA 5AVQB 2I9UA 4FTVA 1RIUL 2VXQH 1ZU8A 3CZSA 3N25A 4XRCB 4W6YB 3MRFA 4WQOA 3S97C 4I4WB 3SKUD 3PWPB 3KEHA 3SUTA 2BVQA 4N68A 3AB0B 3I6LD 1R7AA 3UYRL 3ULVC 2DWDA 3MMDA 1F4WL 1HAUA 4MCZA 1E9PB 4UIMB 3WY3A 3DURB 4DP7X 1I8IB 1I8KA 3ARED 3V4VL 4GI6A 2A3LA 1EP2A 3SKMB 2ESCA 1COBA 4YDKL 3JZEA 2C9PA 4RJEA 3HZKA 4PTDA 3L4CA 4AENB 2IG2L 1UBPC 5FYLD 3DMMB 5DGRA 3O15A 3TA4D 4EOWH 2NT1A 1W0YT 1DE5A 6PTDA 4KJYB 2MH4A 2X6MA 5F72S 2BSTA 2WNQA 3WJYA 5M7QA 3GFUA 4YDIL 4HQQH 5IQNA 2XQYG 3FB6A 3KNBB 1LO2L 1Z7AA 1Z9SA 3PNWA 4LUTA 3KPPB 1UB5A 3LEYL 2OL3H 1FQ0A 3COOA 4O2EA 3MY9A 1N64L 2L4OA 4ZXOA 2J2ZB 5IOPB 3LZPA 3L81A 3IPFA 2ZYFA 2UXVA 2DL9A 4TNVK 4DTGH 3VNIA 3WH8A 3C5ZA 2ETWA 1L2UA 3RL2A 5B39A 3GMMA 5HI3D 4NY2A 3UP6A 2EPKX 3MLSL 4I48B 4JRFA 3UNDA 5FHBL 1UD5A 3KW8A 1XCTA 2H9AA 2HDJA 3INUL 1SFSA 4LC6A 2JKNA 3KPRB 3MO4A 1OK4A 2C7UA 3T05A 3W88A 1Q8JA 4YSQA 3TX4A 4P2QB 4M3PA 3LH9A 4I0CC 2NY0B 1OVZA 5GRWA 4I9WE 4FRWA 4WFFD 3A4EA 1KJVB 3QI9D 3TJPA 3QORC 4LHJB 5ANMA 4FI4A 4KO7A 2NY1D 5T5NG 3VXOB 4JY5L 5AW2B 2DW5A 3LV5A 2DLEA 4XB7A 5DRCA 4E9LA 3VOJA 1SGKA 5F1NA 1OF8A 4QPEA 2BOEX 1P4UA 3ERPA 4JFYA 1BQ5A 2PDCA 5LQBH 3IGHX 3LM7A 3FVDA 2ZUYA 3ZT7A 1FVDA 3OLEA 4QRBA 1BQHB 4KWVA 3SDDD 4AJYV 1K4HA 1IBHA 3NL2A 2ZPKH 2KZHA 1AW2A 1QU4A 2WN3A 5HYSA 4GRWF 3QYMA 1G4EA 3NQDA 1DANT 1KM0A 1AOZA 1T96A 4Y4HB 4ZRGA 5GRYA 3MA7B 1YXDA 2QJMA 2GDUA 4IGBD 3N19B 5IIEB 4B5SA 1V7NL 1E9OB 3MA9L 2R4RH 1FNEA 4EPEC 4EXAA 3L9RA 5D7SL 3Q8AA 4K7PY 1FI8C 1TTFA 5FO9A 3BUQA 5GJMA 4BKNA 1FZOA 1YTKA 4JZJC 2C3HA 2WYSA 4GAFB 2WBGA 2EG6A 2FKPA 3K7UA 4QCIA 3U0TA 2RALA 5BZAA 3L4YA 3PGCA 3Q65A 2XWJB 1A53A 3C2OA 1ANUA 5EPMA 5L6UA 3VFGL 4HZLB 3H9SD 4GVGA 3TNMB 3EX6A 1RALA 2GQ9A 2EG7A 2ZF8A 4PN6A 4FL4C 3IARA 1MFAH 4NUQA 2OG9A 4DJDC 4AWSA 4NWUL 3OV6A 1XLGA 2WW8A 3ALFA 1WAPA 2NXYD 3RWDB 1O5RA 1JEZA 3QV9A 1M03A 1AHWC 1FAKT 1OP5K 4TVDA 4HTYA 4YYCA 1N68A 2CLZA 5AW9B 3INPA 3C6SB 1MCPH 1F4WH 5FECB 5HK4A 1LK3L 2XDHA 1XLDA 1G01A 2FYMA 1RBAA 3CX2A 3B1UA 4KY2A 1EXGA 4YDKH 4K94L 1JXJA 3SRFA 2AK4B 1VCAA 4K8RL 5CEXB 3SCRA 3V6FB 1T8QA 4KX9A 5A2JH 1FH5L 5EU6B 4PJDA 2OQJB 4U0RC 1RUAL 3EEGA 5CLXA 3C8KB 4L0YA 5CG7A 1OAXH 4F3FB 3FYIB 3WUWG 2R0LL 4PCFA 4GBUA 4PJGF 2KLSA 2VDNB 2D2CC 3V0TA 3FQUA 2F7RA 2YKKA 5F88A 3PWVB 4Y9BA 2QCHA 1I1RA 3DI1A 1FORH 1XLMA 2NPLX 2O61B 4NQTA 4OY9A 1JGMA 4NQQA 1F00I 3CU7A 2WZHA 2E5CA 2CZNA 4ZSOE 3U4AA 4RMTA 3WJMB 2VZTA 4Z5RB 1N64H 3X2QB 3BVNA 1SYVB 2ENYA 4IIQB 1K77A 3KP0A 3FMGH 4WU7A 3SECA 1Q90A 5H2BB 1YEEL 4NAFA 1NCAL 3QY8A 2OPJA 1UM6H 4NQEA 1E1EA 2AFNA 5FGBA 4G6JH 1OK8A 5KUMA 3QCUH 4GQ9L 2VL5A 4A6YL 1G4RA 3HCVB 4W9HC 2FZ3B 1H7PA 3D9AH 4U0QB 3ZIYA 1H6TA 2W07B 4RNHA 1B88A 3LEPA 5EEUA 1P6CA 1Z2KA 2GVGA 4JHOA 1IF2A 5GRVL 3ARTA 3O7UA 1OD9A 2BB0A 3MO1B 3USZA 1KCUH 1ZLPA 4MMZB 3RFZB 1OLZA 3T3PF 3OVGA 4HOWA 3ZE1B 5ACZB 5J9PA 4MOZA 3C6LC 1PYWA 1VIWA 4LDCA 4QBXA 2B39A 2PSNA 2C34A 4HSCX 4N2NA 1ASQA 4MG4A 4ZS7L 3PCYA 2NZ9D 5CC6A 2ZCKL 4EN2A 2AQ1A 2J13A 3OB0H 3DVGB 2CKBB 2IOOA 5CSBA 3LMZA 1GY2A 3TVMC 2V82A 1ITCA 5KVGE 2P8MB 1UG6A 2IH1A 3OXSA 4LLAA 3D39E 2CLHA 2ISVA 4HEPA 2XG5A 1GHFH 5DJ2B 1PZ5B 4MA3B 4KKAD 4XVEA 3WE6B 2WQDA 1DQDL 3VW3L 2DWEB 4FNTA 4RGNB 1HSBB 5EA0L 4XOEA 1FE8L 2QJHA 4H20H 1QR1A 3I6RA 2J55A 4RRPG 3QFGA 1XBZA 1C93A 2ZSWB 1SHMA 4LU0A 1PZUB 4X5LA 1WZMA 3T2NL 4YDVA 3HRPA 4AEHL 2G8ZA 5DRIA 2G9HA 2HE8A 3UZQB 5I0YA 3LHTA 3CPRA 3CDZA 4E5XB 2HH0H 4ZFOB 1RZFL 3AXKA 2WLNA 4LCWB 4J3XA 1W3KA 3O4LD 4XBJA 3US9A 1M6OA 2V0TA 1MLCB 2DSZA 2YX0A 3O9WA 2NMSA 3OP2A 1ZRQA 4NRYB 3BJFA 4XHQA 1EJXC 4Y8EA 4HD5A 1O95A 1DXIA 2BNQE 3EKGA 2QKIB 3CDFA 3TT1L 3HC4L 2G50A 1ONRA 3WJLC 4GXWA 4ZUVB 1YRKA 3KOFA 2APWA 5L2JB 3FK4A 3UVIA 1CFQA 5GGVL 1DZBA 2Q3ZA 1RBLA 2EYRA 1UUNA 4LCSA 2GFBA 2VEIA 5LA1A 1NGPH 1X5XA 2YAHA 2ZBTA 1TV4A 4AC7C 2AJVL 1LK3H 2NUPB 1RJLA 4YVUA 1G7PB 3W07A 2Y1ZA 4RMRA 4N6QA 3MGTA 3D33A 1BPVA 3TR9A 3PGFL 1KELL 2VDQB 4NO5A 1W37A 2TPSA 3O41B 1FNLA 1ZHNA 3S2JA 1ETB1 5T3XE 1RUAH 2J6WA 1TLKA 5CBAB 2BDNH 1NCHA 3T6QC 1EUAA 1ZY9A 2B1AL 2R0LH 2VLLB 2WY3B 4XGZB 4XZNX 4S11A 1FRBA 5IBTL 2FSDA 4FS9A 3AMDA 2D69A 1EUNA 4AWUA 3M86A 4IDLA 1KEML 4LBAA 3KBWA 4PSPA 1WAAE 3MLWL 1WB0A 3TYDA 3TEUA 3SCVA 2JKRM 4IJCA 4U6XB 4DO6A 5FSEC 3H9HB 4XBEL 4JL1A 1RUQL 2P0IA 2X89D 3RHWF 1SYSA 1YHTA 4FR6A 3IB4A 2DQFB 3I9GL 1ZEAH 4LYQA 4J3OC 5CZXD 3NURA 2CWNA 5FUZH 1MUWA 4XAWL 3I02A 2A1WL 4DO4A 3EGDA 4KI5D 3EFFA 4JE4B 5K9OB 3ECQA 4ONGH 4MWAE 5E0FA 4A6YH 4PBEA 3W7HA 1UC6A 1AGEA 6FABH 3LRSA 5HUOA 4LPXA 2V2DA 3CHFA 4KNTA 4PJBA 1U8OB 3N9GL 4HAGA 1AG0A 2Z31B 3OJDB 3OGCA 3TESA 3VRLF 4M00A 4UT7L 1H1YA 4PJ6A 4G6ML 4FQXD 3NEHA 2LHAA 4HFUH 3EOTH 3LS9A 3EDEA 2FJHA 4YVNA 4FABH 1FL3B 2K6YA 1J8HB 1FYTD 4H3DA 2ZUQB 1KZYA 4MNQD 1DBKH 1JGUH 4AJ0A 5B8CA 2NUYA 4YPJA 5B1KA 3MFFA 1F97A 3EOUA 5EPDA 5SWZE 3EGSB 4MM1A 4DJFC 5JIKA 3CWOX 2W4XA 1OGGA 5GGTH 5F70A 5CO1A 3C2AH 2ZX9A 3RDTB 3OZPA 4NC0B 3EH1A 2PCEA 3EWBX 3M5XA 1T2QH 1QRKA 1I2PA 2ZCKH 4FXSA 1JDCA 3CN0A 2X9ZA 1WO2A 3N6JA 4DJEC 2UZPA 3FKKA 4MA7L 4OGZA 1G6RB 1EDYA 3NN8B 1EWEA 1UR2A 3CN1A 3OU8A 4PTTB 2K1MA 5GS0H 4G7EA 3TROA 1VYPX 4IIDA 5DJ0A 2WQVA 1WWBX 4XX1E 4I1NB 4KQ4H 3DO3A 3FTVA 2YPVA 3STFA 3GHTA 3KLAB 3EJCA 4KZEL 3GK0A 5A6AA 2D2JA 5BO1L 3HMJG 1EHNA 3VJ6B 1RK5A 2Y2TA 3D39A 4ZODA 3UDWA 4ES4A 1E1CB 1XGQA 4B0MB 1CLYL 2NUXA 3N04A 3BGGA 3H2MA 3PZGA 4IRJB 4IBWA 4JAWA 2HTMA 1GGYA 3QP3A 3VIFA 2FGBA 1JIBA 3FTGB 3RGVC 1ZTXE 3N11A 2EXYC 3RX5A 3IDMA 1T1XB 2WWCA 4X7CC 3JWDC 4GOSA 3MROB 3OAYK 3WMLA 5ADPH 2KDYA 4Q32A 3BQVA 1PTZA 4JPGA 3NYZA 1UACL 2RGSA 3Q2CA 3U79A 5AW6B 4Y4KC 1PZ3A 1VYSX 3AC0A 5D2YA 2ZONA 3KPLA 4AITA 2JI3A 3QR3A 3MRFB 4HN4A 4S1DD 1GT8A 4Q4KA 3UTZA 3QDHA 2Y7NA 5ERWA 1XKJA 1SVZA 4UTBL 4Q6IA 3AISA 3CXFA 4JUTA 1S5HB 5GGVH 2OELA 3RM4A 4TULH 4LSQH 1YEHL 4GIYA 2BNQA 1J0KA 5IR1B 2PLKA 3N55A 1XXDC 2J9ZA 1K72A 3O0KA 1LO3H 4L8DB 2RGMA 3BCDA 5GZNA 3PGFH 1KELH 4U49A 3QY6A 1O5KA 3ZXAC 1PX3A 1U3NA 1RZQA 4KK8C 4WUKL 4BZ1A 2H47C 4TVUA 4G1MA 2EICA 4LCIL 4E9QA 3QGAC 4FFYL 2M83A 2MCG1 1S3RA 3A4AA 3FB6B 1UWFA 2NR6A 4H8WL 1A7OL 1Z9SB 3FQXB 3PNWB 5B1CA 2XY1A 2PEVA 4D3CH 2CA3A 4O2EB 3APYA 1KV7A 4GSDH 4PUNA 4DKFH 3WHE0 3FSAA 2A9DA 3ZR4A 1J9TA 3BO9A 2CLKA 3B9OA 3GUGA 1RXLA 1UUQA 3VIOA 3PWPE 1R2TA 3EUUA 4O15A 1GYWA 2BASA 1LP9F 1YXYA 5CJXA 5E0CA 1LWRA 3RU8X 2UBPC 5JW4N 5DFVD 4GIEA 1IQWH 4MDJA 4O02A 2WAQA 1NDMA 5CBBA 1SXZA 2WVVB 1KRBC 3TZVD 3NZQA 4ELMB 3GK8L 4KY1H 4FULA 4DKDC 3JBG7 1YEWA 2H9AB 1KT2B 3SUWA 2K0RA 2CPUA 4ZOEA 3GRWL 1D5XB 4YC2C 5BROA 1PE1A 5EWIH 3PR2A 2PF8A 1U3HA 4U3CA 1MFCL 3PL6D 4TQHA 1NSNL 5J1SC 4F8TA 3RWFA 1LBMA 2HTKC 3GTFA 4MB3A 4MFEA 1SO6A 4J3UA 1HL5A 3EYVA 3REVA 4CNTA 2BGSA 2DZSA 2NQHA 3BI9X 2Z0UA 1M4KA 3GMOA 4B9YA 4Z3JA 4YSOA 5KG9B 1ICTA 4P23C 2WSRA 2CRYA 2J6EL 1UWIA 3GMRA 5SWZA 4U6HB 4LNVA 1A7QH 1K8YA 4W86A 2VJ8A 2MOGA 3I50L 1HZKA 2GUYA 1C8QA 2NW2A 2G5RA 4F2FA 4FHJA 1IC5H 2ZUNA 1U4FA 3TSDA 1S9XA 4XH2A 3RY6C 1A6TB 5A3ID 4D6GA 4MAYC 4PL1A 1Z9MA 1FG2B 1CTOA 1JZGA 3KPRE 1T1YB 4Z2GA 3BE7A 1KFJA 1JZIA 1A0QL 3ZE2E 4E2OA 1CLYH 1NAL1 4TVPD 4XWGH 3E9TA 4K9JA 5ABZA 2PTTA 2VCOA 3HB3D 4QSFA 4ZE4A 4YCOA 2P80A 2L7QA 4QCIB 3VACA 4LSSH 1B6DA 2HPIA 4X5WB 3PXHA 3BUVA 1PKOA 5EPMB 4JR9L 5DRZA 4F2MB 3TBYA 2OZTA 1NUGA 3PB2A 1E4IA 4H41A 5CC3A 4UU9B 2YXWA 3AUJA 4JY4A 4OJEH 1UEMA 3KZPA 1IM3B 4GC3A 3NO5A 1AJZA 1LILA 3QIWA 2ADGA 1AE6L 3UYOD 4AZBA 2IAMC 2L5HA 1YDYA 3LGDA 6REQB 4AG4H 5C0CA 1KYOK 1O12A 2AGJH 4GYFA 1L8NA 1KBIA 3IJ8A 4R26H 1DL7L 3QV7A 2Y7EA 2W62A 5E4IA 2R51A 1HH6A 1MFNA 4HHLA 4N9DA 4K5NA 4N9BA 2NQZA 2Q09A 2FEEL 4FQ1H 5A2BA 4EI6B 2P3EA 3UJRA 3O6AA 1G94A 1OTTD 2ZXGA 4GVFA 3NPSB 4MD0B 2QADB 2FLRT 4P2RE 3SDAA 2GYSA 1N59A 2V8MA 1USQA 3FCBA 4HV8A 3WG6A 2VDMH 3REWA 3OG4B 2ZDRA 5DJAA 3HV9A 1LLAA 3EXJA 6XIAA 1AXSA 1G9MC 1W3HA 4CAGA 4X6DB 1GOFA 4QTHA 1N3NA 1CBVL 3N1AA 4HUXB 1A7OH 5HNUA 1GZQB 1P0EA 5I5JA 2WIIA 3OOQA 2CBJA 1ESWA 3BVNB 4WHYG 4GEJA 2VX4A 3H7BA 3WN6A 4Z1PA 3ZLHA 3W01A 5F96H 2QMJA 3GSXA 5AEAA 3ZTJH 4L8CB 4NQEB 5D71L 2A83B 1FHDA 1YQVL 2WJEA 4OD3L 4R7JA 1NBYA 4ALAC 2BFGA 2JF1A 2X3CA 1UWXK 1G0YR 4XRCA 4DXKA 4I4WA 1WA3A 4G9DB 3OZYA 2AK4E 2H90A 2J6XA 4UTWC 3KM2A 5IJCC 4DQWA 3ZE0B 2WJ7A 5E8OA 4L61A 4TLUA 4RETB 4UIMA 3DURA 3MJ9A 1I8IA 4R7WA 5HGDB 3SKMA 5KN5B 5GGQL 3RZCC 3FYPA 4L29B 2P28B 1MFCH 4I7VA 1OSEA 3EX4A 3EJRA 4YHZL 3DMMA 4YX2L 5JW3L 5DMJB 2A4AA 3VSVA 1AKPA 4UTFA 1YTDA 4KJYA 3GMNB 1IFGA 4DERA 4B9FA 1JNEA 3KTSA 3TN3A 4Y9AA 3S3PA 4WFGE 4BHUI 1A1MB 3VSQA 1S5IL 4L1XA 3KNBA 3GHRA 3GLDA 1E4HA 3APTA 4IIGA 3UR8A 3PSVA 5G2IA 2PZ0A 1UXLA 3VFUA 5CGTA 4JQVA 4KKCD 1H6EA 1IWBA 3E6FB 1TIUA 1EYWA 1HHGA 3RLHA 2J2ZA 5IOPA 3LYEA 1T6VN 3QSTA 2Z7UA 4XX6A 1UJQA 5FHAH 1DJYA 3P40A 3D87B 3GUTB 4AH7A 3MTRA 4HNLA 3FAWA 3DX5A 5C71A 1RUSA 3DU0A 4QRPE 3FO0H 2GK2A 4HU3A 4I48A 2VWTA 2HRWA 2BVPB 5EU3B 2H32A 2W94A 1JZ3A 1PL3A 4YDVB 1SOKA 3MLZL 3ZE1E 3WTTA 3IRCA 3CDZB 2JIWA 8RUCA 2DH3A 1F3XA 3GBLA 4P3CL 4YE4L 5FWRA 1F61A 3NQAA 3EOYG 4PJ7F 2FK9A 4MRBA 2ZA3A 4YTQA 2QLYA 1MAKA 4OB5L 5TQ2H 5A2IH 3UO1H 3H4HA 3HA0A 4GMTH 4P2QA 4IQLA 4YBLB 1D2OA 5A2KH 2A4EA 2Y25A 2ZZ1A 1KJVA 2MEJB 5JA9A 1HAWA 5L6YH 1RHFA 1XYLA 3FJ6A 2G60H 2DQTH 3U30C 6PCYA 2FD6L 4BQCA 1K7EA 1CFVL 3VXOA 1T41A 4LIQH 3FAXA 2IFFL 4J28A 1IM9B 3IMTA 3GF8A 2OZ4H 3BD5A 5CPMA 4I9XA 1W80A 2KC0A 4EUPB 3S88L 1OW0A 2YARA 4DI8A 2DWSA 3TU9A 4RGNE 4GG9A 4TNFA 4ONFH 1UADC 3IUDA 1BQHA 1RJLB 3ITCA 5GISH 4DNLA 1DL7H 4JHWL 2P44B 4RXFA 3RB7A 4FA7B 4LRNH 1BVNP 4U6VL 1BYDA 4HXBH 4QDGA 3S2LA 1XIIA 2GABA 3LS5L 2FVKA 4Y4HA 3NG5A 1ZWIB 3LHWA 3MA7A 3AVEA 3CDYA 1RJPA 3T3MB 2CHRA 5IIEA 5TQLA 1E9OA 1PAMA 5DVKA 4BZ2L 3GPEA 3BKJH 5IROD 1UASA 2ZAGA 3DENA 4G8FB 4P07A 3IMWA 5F1SA 4ZYKB 3BH4A 2Y06L 1CBVH 2VI0A 5JU6A 4HYRA 3ULUF 3OEXA 1T20B 2W8CA 3CFIC 5ITBH 2IBBA 2IQ0A 1E70M 3K80A 1A25A 2XWJA 3LXCA 4HA0A 4HZLA 4FEZA 3TNMA 2G75B 3FUIA 3UCDA 1KC5H 2O0TA 1XIWD 4KTYA 4WTXA 1BSLA 1LT7A 3WELA 4WV1B 1CB2A 1ERNA 4GAAA 2VDHA 4WEEA 1RUML 4LGSB 3PUDA 4PEKA 2YJLA 4DCQB 5I71C 3RWDA 1HJSA 1Q13A 4RIRB 5LCVA 5K4ZA 3DG6A 2WSQA 4TUUA 2ZIDA 5CSUA 2EH7H 4YSTA 3ELFA 5A2LH 4DAGL 5FECA 2BRRL 1KCWA 4N90E 4NCC2 4JIIX 1HG3A 1AQ0A 2H2SD 3U36B 4XHJC 4LL4A 5AVVB 1HU8A 2AK4A 4QY8B 4X7EC 4F15C 5CEXA 3V6FA 3V9EA 3JWNH 5EU6A 3WJSA 3NDYE 1W1TA 2OQJA 4XZUB 1MWAH 5LGKA 3C8KA 4C6IA 4GABA 2CLFA 4HKBB 2DQWA 3PWVA 5DR5L 4PMNA 4AVNA 2O61A 1M5WA 1H3TA 3BZEB 4BJHA 3MAWA 5T3ZH 2YFOA 1MIMH 4X5XB 3L21A 1FNSH 2XGBA 3CBKB 1TG8A 2OR9L 3ZL4L 1OPGL 1UG9A 3M7FB 1AYRA 3WJMA 4Z5RA 1BVLB 3ZZ1A 3CK0H 3DFPA 3QV6A 4IIQA 3N44F 3I75B 3VIJA 2QDVA 2WQPA 5H2BA 3L1EA 5J5EA 2PR4L 3K4ZA 2ARJQ 1JI1A 1W1A1 1PCKA 2FGWH 4X4ZA 2DMCA 3DDFA 1L0XA 4K7VA 3HCVA 2LLNA 2FZ3A 3U4FA 1J8HE 4M93C 4W84A 1MQRA 4ZB2A 1JFHA 3U2SB 2I7SA 3DFYA 4L18A 2W07A 4M7JL 1W54A 4GLRI 1JXGA 2DPKA 4P3CH 1QUPA 2AQ2A 1YEKL 4QEEA 1OSYA 5D2WA 3THCA 2OMVB 2Z92B 5EEVA 4OB5H 3MO1A 4MJHA 3UAJD 2CLEA 3CFTA 3FXYA 1DKWA 4MMZA 5G5DB 4HIBA 5JHLA 3RFZA 4FG0A 4UZSA 4P9ML 4X5QA 2EAEA 5ACZA 4GP5B 2QSCL 4G43B 2GQAA 2PPAA 2VLJB 5BRZB 1QZ1A 3MRBB 2J7EA 5IW6B 2GI0A 1FKXA 1JOIA 1KFGA 2QR0B 4G5ZH 2IFFH 4MAUH 4AXKA 4F93B 1NOLA 3ZRCC 3SRDA 2DM4A 3DVGA 3RCYA 4C56E 2CKBA 4K07A 4KO5A 3FA4A 3OPZH 3T9WA 5IREA 2P8MA 5I24A 3DGRA 2Y36H 1O9VA 4PS7A 4UMBA 4D8OA 2K9UA 3LH2L 2FNBA 1N2VA 2J7HA 5I1EH 4PULA 4MA3A 1XI3A 4PRPB 4DN4L 1PQZB 2DWEA 4GZJA 4B5NA 1HSBA 4XXWA 5AUMB 3RL1B 2MCPH 4IX2A 4OF0A 4RMSA 4PCKA 4MQXD 2DEPA 2ZSWA 1SM3H 1TPC1 3OAUL 1YCSA 1N19A 2DZPA 3UZQA 4AQOA 3U1SL 2QR6A 3UAEA 2YGQA 4AMKH 3PBUA 1DWFM 5HYEA 4LCWA 4TQTA 2DDQH 1TUXA 3IN0A 2NX1A 5HYJD 4H9VA 4OCXL 2UVFA 3IV8A 1MLCA 5KANG 3THMH 4BCZA 3NZPA 4LOCA 1L6ZA 1CDHA 2J8UB 3G1FA 4NRYA 5IVOA 2VXQL 2BTMA 1NDMB 4IFRA 4YDLC 2WLHA 2QKIA 3E0LA 3BWAA 1E9ZB 5FEXA 4ZUVA 4JFHE 3HB9A 4UUIA 5CXPA 3R0KA 2ED6A 2CGRH 1ECZA 1S78C 4NU7A 5L2JA 1XC6A 1PBYA 4N8UA 1XLLA 4FLSA 1XHHA 3H2EA 4X8JB 4PRNB 4OCYH 3QPYA 1IAOB 4TXEA 1YBQA 4NKIH 3WO4B 3LSCA 3VKJA 2NUPA 4HTBA 4ODSH 2W27A 3TYAA 1G7PA 3QHTC 2P5EB 4XXDB 4OLUH 4EOWL 5IMOB 1VBGA 3O41A 3REVB 1NBVH 3EYVB 5IDZA 2MCAA 3ZYIA 3V0GA 3VD9A 5CBAA 3A6BH 3ICJA 2WWDA 3R6IA 2GI7A 2VLLA 2FO4A 2BP1A 3FFDB 2WUCH 1F2XK 4MJIB 1NFIB 4HQQL 1TPEA 4H6RA 1R1CA 3MNWB 2HRGA 1LDPH 4NENB 5KZMA 3NDYA 2OL3L 2VWEE 4GAGH 3SPVB 3MNVB 4LE8A 1JVLA 4U6XA 1KBJA 2GZXA 3H9HA 4R7LA 4DTGL 1LVEA 5DY3A 4GXUM 3T07A 5KS9F 1KBBA 2Y7GA 4JHVA 2IBZY 3Q01A 1NC4D 5IGXH 2JF6A 3M1CA 2DQFA 4ELME 1AQHA 2HA1A 2P8CA 2OWXA 3HGOA 2QCFA 1X5HA 3FTXA 3SSGA 4WWKB 1MCNA 1ESOA 5LBVA 5K9OA 2TRYA 1MRCL 1U8OA 4XVUD 2Z31A 3OJDA 4DETA 5D1QC 4PUMA 1HHHA 5IJKA 1JPFA 5JPNA 4NQDB 3OF6A 1HCZA 1H51A 4EZJA 2OQYA 1J8HA 3BISA 4MWFB 1BMGA 2GBTA 3ARRA 5DMLA 2VDOH 1R85A 3CZLA 4U05A 5DRZB 2QZ5A 3L7FB 4P9MH 2R69H 4PGJA 5E23A 4OZ4B 1HWWA 3EGSA 3UWEA 2I14A 4QRQB 2QSCH 4JJ5B 1MOEA 1KN4H 3RDTA 1KTLB 5I0WA 1AH4A 2ADGB 4GXPA 2VLKD 2YCLB 3DFTA 5LQBL 2HYMA 5C0CB 5HVGB 4AUJA 1V6WA 1G6RA 1QWGA 3WIHA 5IJDC 2WMIB 2AQOA 4HEME 3KGUA 5I2UA 4PTTA 2ZPKL 2X2HA 1VBJA 5TDPA 5C07B 2GSMB 5EOQH 2VVSA 2UUDH 2YR1A 3LCGA 1MG2C 5DMYA 1N59B 4UAOC 2R4RL 1R34A 2BINA 4GISA 2YCJA 3MJ6A 3RX4A 3VJ6A 4ATDA 4JN8A 5KBNC 1CU4H 1A22B 1E1CA 2K8MA 5JPMC 4WJ5B 2FTWA 2ERJB 5BJTB 4TQEL 4F2ME 4IRJA 3G1HA 3WNIA 4YHML 1KWGA 2QF8A 2C5DC 3MWAA 4RBPK 3FTGA 2HUEA 2C3XA 5T1DH 5KMYA 1T1XA 1KYUA 2IKHA 2CGYA 5D72H 3AREC 5GJNA 2QGEA 3MROA 3NCEB 4L4TB 3K81A 4OGXL 4AZ7A 1LWHA 1MFAL 2J47A 3B4YA 2NDFA 5IBUG 4EE2A 5IZ7A 1H7RA 2EDQA 5HDBF 3VZYA 4PJDE 2CHWA 3EWCA 4QJ3B 3D2UB 5AYYA 1MCPL 2WVUA 3BJ91 5E8OB 1GCYA 2G3IA 2YRBA 1S5HA 1QTWA 1D8WA 5JMUA 3RUGB 4CMHC 5IR1A 5CPNA 4H6EA 5SWSD 5EBWB 4M02A 5DZNA 5I6XC 5K7JA 3NJHA 2ASHA 5IUCA 3ARPA 4QNWA 5ABHA 4L8DA 4PMQA 4DF1A 1OAXL 4X6DE 1NCWH 2XZAL 4HYVA 3R0NA 3O07A 1OEZW 3PZIA 1KDJA 1FORL 5T1LD 3ZBMA 4MUPA 2HVNA 4N24A 4AAJA 2RCSH 5FSDC 1ZBVA 1SEBB 1J5OL 3ESVF 2ALAA 3PAUA 2ZG2A 3FQXA 3VXMB 1HXKA 2JH2A 4NQEE 3UEZA 3VFUB 4I1RA 1X98A 1TMQA 3S5ZA 2ZOLB 3WL0A 3SOTA 4PB0L 2XTSA 3T0ED 1HHGB 5MF5A 5HDQH 3FMGL 2AOSA 1P43A 3HM7A 2VC2B 1XUZA 4MKSA 1UM6L 2A4CA 4G6JL 3IANA 5AC7A 1WAAF 3HFFA 3QCUL 3ZE0E 1VGEH 2BC4B 2VLRD 5CZTA 3QI9C 2H32B 3D9AL 2VM8A 1NJJA 2WVVA 2UV8G 1JTPA 1XICA 4FXRA 3N9RA 1MRCH 2YD3A 1F5ZA 3B8IA 4ELMA 3NPVA 3OC5A 2O6PA 3EH2A 4YSCA 4OTKA 1KT2A 3NZUA 4YHLH 3TT3L 3CVDA 4I3GA 3RU8H 1PV8A 1I60A 3BO8B 3VCRA 1D5XA 1KCUL 1WFNA 4L05A 4E41D 4IGMA 2XH2A 2Z7KA 1E5NA 4NHVA 3R1GH 5HJLA 3RG6A 1RCOB 1KXQE 3SDDC 2Z1VA 3KE0A 4JM0A 4H9ZA 1FHLA 2QVFB 2OEMA 5CPSA 1I9CB 2AEOA 3US0A 5KG9A 3TCTA 1J4EA 3DG7A 3UJEA 1QNQA 1YPFA 1T03H 1KB9K 3BWSA 1YRRA 3Q2DA 1W3JA 3S48A 1GZPB 4U6HA 3BVVA 3WEBA 3R79A 2WMGA 4AQ1C 1GHFL 1TWDA 2B7PA 3KVLA 3MC0A 3B9EA 3IKKA 1X5YA 4JFTA 1A6TA 2TYSA 4H20L 3QXUA 2RGLA 5JHDB 1R5WB 2R1MA 3QIBD 3FU6A 1ZS8B 4HEMA 4L23A 1FG2A 1FWIC 2NNCA 4KGLA 3H4GA 3UG4A 1T1YA 4A7TA 2I56A 4H13C 4IX0A 4ROPA 3S9IA 4XZHA 4FA3A 2YYUA 2NUTA 1JF6A 2HH0L 4I7ZC 2EC8A 4TQEH 4L4VD 4D1JA 2PF0A 4MD5B 4YHMH 3F5WB 3W1MA 5E6SB 3OB8A 2CALA 2DZBA 3TK7A 3WGUB 3R0DA 3SJNA 2Z6FA 5HGGS 1QLEB 2EKJA 4X5WA 1XAUA 3M44A 4F2MA 4XXCC 4NASA 1CURA 4EAEA 1VC4A 4OGXH 4O14A 4UU9A 4BEIA 3B43A 3ZW3A 4O57A 1MCWW 1YPZF 3FFOA 4LJ3A 5L4JA 1IM3A 2VM9A 4NDMA 1POKA 4FX6M 2JVUA 3PPFA 4E0RB 3FS2A 3QDAA 4I5UA 4D72A 1NGPL 4DWDA 4X7DC 4Z7NB 2JLPA 6REQA 4PLJC 1G7JB 5C7VA 3V6OA 1OM0A 5CZKA 1BYBA 3T3ME 1TZHB 1RY0A 2VXVH 1B3WA 5I3GA 2G0LA 3ARWA 2ZYSA 3GW0A 3HMWH 2BDNL 1FC2D 5DK2B 3N15A 1NIAA 3SGDH 4EI6A 1WTLA 1Q7MA 2AQSA 4MD0A 5AENA 2XZAH 3K46A 5AAWC 4F7TB 1PIFA 3CYVA 5CKGA 1SDDB 5J57B 4O16A 3UESA 3AG2B 3T0CA 3IACA 4YMPA 5K5YA 4X6DA 3NPWA 4E2VA 1J5OH 4HUXA 3FTUA 2EKGA 1GZQA 3DGCR 3NA4A 3VCLB 3W74A 1RU9H 3DYOA 3WLPA 4PB0H 3FYYA 2I7GA 1ZEAL 4GIAA 4Y19D 4PJBE 1Y6NR 1A5OC 4X2RA 1EC7A 1T1ZA 5FUZL 3S6TA 5C55A 4L8CA 3X17A 1HXJA 2JKPA 5F9DC 2A83A 2W81C 3U4BL 3RYSA 5CGMA 4HVBA 4H2AA 2YD2A 4ONGL 5A8OA 6FABL 5HHOD 3RI5K 2DVTA 4IMCA 4E9SA 3IIXA 4G9DA 2Y7QB 4C91A 3SQBB 3Q5TA 2H26B 4HFUL 3EOTL 2NZ9C 3QRBA 3IGFA 4FABL 4K38A 5KOMC 3TT3H 4FI8A 3U57A 4KT2A 1IT9H 3NDOA 2D3LA 4DGVL 5HGDA 3QORB 1DBKL 1JGUL 1F02I