3OLIA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iv03
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
total genus 171
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oliA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oliA01
2ZWZA 3RJYA 1HP5A 1ZJBA 1GOOA 2PI6A 1W9UA 2DT0A 2VI0A 2WAGA 3OB8A 2ZXDA 3OZOA 3QOMA 5JIWA 1ECEA 2O92A 1UKPA 3ECQA 2A3EA 3VPLA 2VT0A 3WF0A 2XVLA 3QHOA 2G3JA 1PJ9A 1RP9A 2WHJA 5DMYA 4Z2JA 1L0PA 2JIWA 5FOOA 2BY0A 4UFMA 5CPTA 3BCDA 1JYNA 2VURA 1TQUA 1U30A 3GXDA 4FNSA 3WF4A 1J01A 1WKYA 1WCGA 4MJ4A 3DDFA 1AVAA 3AMDA 2XN0A 3A24A 1CTNA 3WENA 1NQ6A 1VEOA 1TR1A 1Q4NX 3W29A 2ZX6A 2D2OA 2OW6A 2EADA 1TVNA 3CZNA 3A6OA 3ARTA 1LWJA 1E6QM 4LYQA 2PWEA 2HVMA 4NZCA 1JG9A 3ARWA 1UD4A 1TQSA 1E4NA 3BUQA 3WDHA 3TONA 4JFWA 3WQ4A 5HPOA 1VFFA 1H3GA 3DDGA 1LQ0A 4W88A 2WC4A 4PMRA 2GSJA 1JFHA 4HOXA 1LL7A 3D3AA 4DO4A 1MW0A 5E0FA 4H7VA 1XHGA 2UY4A 3RDKA 3T2PA 1E5NA 1MWOA 2DPEA 3KEHA 2WANA 1JNEA 3U7VA 3ARQA 2VRJA 3WH6A 4CN6A 2WVVB 5HPCA 1SMDA 1NP0A 2XSAA 4UFJA 2Q8XA 4HMEA 1HXKA 1HJUA 4TVCA 1UR8A 4DM2A 1SFSA 1UR4A 1EOMA 3WY3A 3W27A 1V0MA 1CXKA 4WSKA 4JFTA 1VJSA 1YHTA 2XN1A 1WDQA 3AMKA 4PMVA 3MSGA 2ZUTA 5A94A 1B0IA 2XUCA 2IXUA 4UFLA 1EQPA 3T0AA 3WH5A 1H0GA 1US3A 4U3CA 3AJ7A 3BVXA 2D3NA 3A3HA 3ARRA 3DX2A 4CCCA 5E9AA 2V5CA 1UKOA 4HU0A 5A2AA 3SCQA 3VGGA 4AD2A 4MB4A 2E0PA 3LRKA 1MW3A 3B9EA 1M53A 1VEPA 2CITA 3HG5A 2EPMX 1GZJA 4JKKA 2CKSA 4AZ6A 3F5LA 4AYGA 1NH6A 1MXDA 1OD8A 2OSYA 5A6LA 1PZ3A 1CGUA 1EQCA 4M24A 1UUQA 3K46A 1W1YA 1UKSA 1F4AA 2O9TA 5D8WA 1ZU8A 1JF5A 1TQVA 1XSKA 3MUIA 3TV8A 4TTUA 1VEMA 4FMVA 4JL2A 3MV11 5A6SA 4Q22A 1IV8A 2QMKA 4GQRA 3WQ5A 4FNRA 1OT1A 2A3BA 2F7PA 3WELA 5IFPA 1WB0A 3AFBA 3PTQA 3HG2A 1TFVA 5HBFA 1SYTA 3ALFA 2OYMA 4GZEA 1WZAA 3W6LA 3IJ8A 3I3DA 4QP0A 2D20A 2X2JA 3WUEA 3CUJA 4F66A 2X0HA 1C90A 1KXVA 3BUIA 1HIZA 3IK2A 1FP9A 3BVVA 3AROA 2YBUA 1FFQA 2GJPA 4UQBA 3AXIA 3W24A 5CSYA 4DO6A 1Q6FA 1R34A 4XUYA 1V08A 4FNQA 3CZGA 1L8NA 3S5YA 2PWDA 3NSNA 4QLJA 2WZHA 3WL0A 1DWFM 1AQMA 1BYCA 2ZUSA 2XHYA 1E5JA 5HDRA 1BHGA 3CZEA 1YQ2A 1VJZA 3PZ9A 4UR9A 1ISWA 5LA2A 3WH9A 3FAXA 1KXTA 3CUHA 4U31A 1KQYA 3WY1A 1GPFA 1OGBA 3UERA 5ABHA 2WWCA 5HOSA 4FNTA 2J62A 2WCAA 1V6UA 4U5KA 5BRQA 5A8PA 3AIUA 2E9BA 4NZJA 2ZOXA 4JFVA 1HJXA 1VB9A 1R8LA 2WZIA 2W66A 1JZ5A 4MAZA 1B9ZA 4JZ5A 2DT3A 3LMYA 4KRUA 3VGDA 1BF2A 3GNRA 1T0OA 4KRTA 1JF6A 4DWSB 4MADA 1HF6A 2D0FA 4LQ1A 1JZ3A 1E6ZA 1LF1A 3KL5A 1PX3A 4WKAA 4M80A 3UG3A 3WD3A 2F7RA 3EDEA 1H11A 3AZTA 4W86A 2J4GA 3LPGA 1H0IA 1HT6A 1UKTA 3L4UA 4PEEA 3EMZA 4FNPA 1OBAA 2VX4A 4LYPA 1W1PA 3BH4A 2YA2A 3TTQA 1XH1A 1HL9A 1ZB5A 4AD5A 5A8NA 3N18A 1HKJA 3NSXA 1ZBVA 5EBAA 4IPLA 1JYWA 5DEZA 1WE5A 3UCQA 1G0CA 1OINA 5F7UA 4GQQA 3AXHA 2J7CA 1MFVA 1JZ6A 1JD9A 1UQYA 2DT1A 2V3GA 4HU8A 3OGSA 3CO4A 1HJWA 4QLLA 5ABGA 4PMXA 3CUFA 3WEOA 4RE4A 1JIBA 1GOWA 1VF8A 1W32A 1JZ8A 4UOZA 3IJ9A 3VIIA 3MUZ1 4JCLA 4FLOA 1W9DM 4HA1A 4NRSA 1UD6A 1LG1A 1W1VA 2PF0A 5IHRA 1XSIA 1BSIA 3L4TA 3AS2A 3AMCA 5A6AA 1QHPA 4UFIA 4AD1A 1XCWA 2WHLA 3CC1A 4NI3A 3WDPP 1NWUA 2C7FA 1XCXA 3SUUA 3FNDA 5BXRA 4J3WA 1W9BM 1UWIA 2CBJA 4JHOA 3AZRA 5M5DA 3UR8A 1BG4A 1QOXA 1CGWA 4LXFA 4XV0A 2E8ZA 3SCTA 1RD6A 5A6MA 1QNSA 3BGAA 5A6BA 1D7FA 1Q6EA 3SUSA 4TX8A 3CTTA 3UR7A 2EPNA 3S5ZA 1JYXA 1E6PA 3QOKA 3L2LA 4S3KA 3ZR6A 2WMFA 3N04A 3WD0A 4D6JA 5E6ZA 1TUXA 1E40A 3MMUA 1E0WA 3DECA 1MW1A 5FKYA 3LPOA 1ODZA 1DWJM 2W5FA 2JEPA 3AHXA 2ZIDA 3F5KA 4AZCA 3VSTA 4DUXA 1CDGA 3RM4A 4GINA 3KL0A 1PPIA 1UD3A 5CGTA 2FE0A 5LA1A 2Z1SA 1P6WA 4M81A 1G94A 1NOFA 1HXJA 3M6DA 3ARSA 4H8VA 3WH8A 3BXWA 2YFOA 3UG5A 2XGBA 4DUWA 4F9JA 1E43A 1K9DA 5A8OA 4P7NA 3NYDA 1EXPA 3AIQA 3L4WA 3KWXA 3EMQA 1RP8A 3DYPA 2VJXA 1H2JA 3ARPA 2XM1A 3AS1A 4ATDA 4W85A 4AD4A 3VM7A 2X09A 4HZ7A 3CGTA 2VRQA 4KMQA 3PZUA 4PMDA 3ZT7A 3I3BA 2VO5A 1GQJA 2J74A 1GHSA 5JBEA 1HVXA 3QGVA 1G1YA 2QV4A 2GK1B 3PZVA 3EJPA 1WDPA 3W6MA 2X2IA 1GW1A 1QNQA 4ZFMA 4NF7A 1FH9A 3L4ZA 1JDCA 3BC9A 1O7AA 3AIWA 1V6XA 3WF1A 2ESCA 4GPNA 2GJXA 3FN9A 4RE3A 4GXPA 1EDTA 1V3LA 1OIMA 3BUDA 4GIAA 1CGVA 2A3AA 4FK9A 4B3KA 4H8HA 2EPLX 2X2HA 3ZQ9A 2DGAA 4OBRA 3GYCA 5CLTA 3GDBA 5E6YA 4JAWA 1OM0A 2XYLA 3SIMA 2Y5EA 1E0XA 3ZT5A 4AIOA 4WF7A 3W0KA 3QHMA 3PN8A 1MXGA 2VQUA 4BA0A 3N9KA 1KWGA 2X05A 1CIUA 1BLIA 2W67A 4EAMA 2XPKA 4Q7NA 1Y7VA 1E1FA 4U33A 3SCWA 3ZO9A 3WDRA 4D6CA 2J79A 1ITXA 4CN1A 2EO7A 3A23A 2DSUA 4TOQA 2IUZA 2W91A 4JIEA 4ML4A 2WW5A 1R46A 1IZJA 1UWQA 3A5VA 2V5DA 1VENA 3M46A 4LYRA 2FGLA 7CGTA 1IT0A 1VAHA 4CU8A 2XVGA 2CHNA 3A47A 1KR0A 2WK2A 4QFUA 1XH2A 3BUPA 3FXYA 4C7GA 1NP2A 2E3ZA 2W63A 4PTMA 4ACZA 2C0HA 4E8DA 3BCFA 3MANA 3WD4A 2D0GA 3VGBA 4W7WA 4BQ2A 4PMQA 3WBEA 2JEQA 5D9MA 1QWUA 3AHTA 1BAGA 4W93A 3ZIZA 1B31A 1QX1A 1HJQA 5KEZA 3HU7A 2G41A 1UR2A 1KGUA 1EO7A 5GNZA 4W5UA 1C7SA 3LRLA 4P7OA 2CPUA 1EA9C 4ZXOA 2CBIA 1B90A 3WQ6A 3WMBA 2VMFA 2BHYA 4JKLA 1XD1A 4EK7A 2UWFA 1SR0A 5GPRA 1UWUA 1JXJA 1WNOA 4P8VA 1JAKA 2ZUUA 2VX6A 4ZENA 1GQIA 4W7VA 1QW9A 2WMIB 4AY1A 3EJRA 4WK9A 1UWRA 4MJ2A 2WCGA 2VQTA 2CBUA 3F4VA 3OGRA 4HZ8A 1J0KA 3RM8A 1PIFA 2QLYA 3EBVA 4P7LA 2GUYA 3WUGA 4U2ZA 1Q6CA 4PTWA 2A3CA 1OSEA 2HISA 4JKMA 4N0RA 1W9VA 1XH0A 2YKKA 3GM8A 2J47A 1HL8A 5I2UA 4W8AA 3MMWA 3AMGA 2VZOA 3VOCA 1QNPA 3HMCA 1XRVA 2D1ZA 3TA9A 2WSKA 3TP4A 2VVSA 2WLZA 3LX9A 2F1AA 2JF7A 1BGAA 1HJSA 2QPSA 1UD8A 1GOKA 3GH4A 5C71A 3VD5A 2D73A 2VNCA 4WKHA 4B15A 4F79A 2YL9A 2E9MA 3AISA 2CYGA 4W89A 1W9PA 1F4HA 5FCZA 3GTNA 4D71A 1XGZA 4AW7A 3BAXA 3VMOA 1E1EA 4HMDA 4CD6A 4D6GA 4MPKA 1EO5A 4B9YA 1JYVA 2JE8A 3VIMA 4AZ5A 3MS8A 3N15A 3WQ8A 2DSZA 2WMKA 5BXTA 2E9LA 4JFUA 4GZJA 1FOBA 4PMUA 1DHKA 1W3KA 4CCEA 3VO0A 2F8QA 4PYSA 2FHCA 1B30A 4GO8A 1BYDA 4D72A 3G6MA 5CPSA 1K9TA 5AYBA 1R75A 4W5ZA 4YHEA 3WNKA 2WKLA 4AD3A 3TTOA 1X1NA 1TG7A 2ZX8A 2G3IA 1PZ2A 1GOQA 3VIGA 1BQCA 1I75A 3EJUA 3VSUA 2WVUA 1AMYA 3M07A 3FHQA 3THCA 3AS3A 3VGHA 3SCVA 3EJQA 4HA3A 2NW0A 4HP5A 3VNZA 3POCA 5I23A 3VNYA 3WNMA 3MU7A 4XZBA 1MW2A 1B3XA 4XX6A 5FL0A 4PUEA 1R47A 3WEZA 2OSWA 4KGLA 4B16A 1J0ZA 4X0NA 4BZYA 3VD7A 3ARVA 4GI9A 5CXPA 3VILA 4JHZA 1ISYA 4NSBA 2EXOA 3B9AA 3AIVA 4OOUA 2JALA 3I3EA 4PMZA 2ZX7A 1K6AA 1EDGA 3VIKA 3VTRA 4GI6A 1E71M 4AIUA 3SCPA 4Z2GA 4PMNA 3T2QA 3UESA 4TVUA 2BVYA 1UR1A 7TAAA 1U2YA 3RILA 4HTYA 2BY1A 4TUFA 3ZSTA 3CLWA 3KL3A 4OJYA 1QVBA 4J3SA 1ITCA 2FHFA 4PBGA 3ZM8A 5I3DA 1E6NA 4CD4A 1PIGA 3DHUA 3CIVA 4CVUA 3H55A 1E4IA 3RCNA 3CV5A 3AMLA 1KXHA 4P7RA 3VMNA 3WSUA 5FL1A 3DX3A 5GNYA 5DFAA 4AWEA 2BFGA 4ACYA 1DWGM 1VRXA 1GORA 3SCNA 1QI4A 2BXZA 1LLOA 4R5EA 2GFTA 2OWWA 3ARUA 1B2YA 3OLIA 1E3XA 1HKIA 2J7FA 1GQLA 3BAJA 3L4XA 1W3HA 4M82A 2GDUA 4UFKA 1GJWA 3D4YA 1OGGA 3LRMA 3KZSA 4OZOA 3U7BA 4MAVA 3PTKA 3HG3A 1JNDA 3GXTA 4JFSA 3IAPA 1JZ4A 3T08A 1GONA 3VX0A 3QR3A 4K68A 4Z2IA 1KBBA 3ZJ8A 1O7DC 3AS0A 1Q6GA 2FH8A 4DWSC 3AZSA 2WSPA 4J27A 3HN3A 1V3MA 1SZNA 5A6JA 3II1A 1J10A 1W1TA 1LWHA 2AOSA 2PBGA 2E40A 3GH5A 4PSPA 5GNXA 3VX1A 4MNJA 4M8UA 3BVWA 4D1IA 2XIBA 5IDIA 2X0YA 5LA0A 4HMCA 2YL8A 2VCCA 1G01A 3L4VA 1D3CA 5DO8A 3VDAA 3MUY1 4UTFA 3AHZA 3WEMA 3W26A 1CXIA 3APGA 4X0VA 3D50A 2WVVA 5C8BB 1PEZA 1FH7A 4YPJA 5I6SA 1BVZA 3BSHA 3CZ8A 3W82A 3ZJKA 4CGTA 3DC0A 3TTYA 3CH9A 2WM0A 2VCBA 1V0KA 5AY7A 4CU7A 2WVSA 3ZJ7A 3HG4A 3S6TA 2BY3A 1V3IA 3VIPA 1CPUA 1WPCA 4HOWA 5CPQA 1NM9A 3CZSA 1Z32X 4PCSA 1E6RA 1BPLB 2W4XA 4EKJA 1OT2A 4BQ4A 3TTSA 1HWWA 2J7GA 3CHDA 4J3TA 4XZWA 1OCQA 3PZGA 1BG9A 3T0DA 1G5AA 3N13A 1O6IA 3AXXA 2F61A 1US2A 4M1RA 1R7OA 4HA4A 4RE2A 4CN4A 3PZOA 4CU6A 4JCMA 2UY3A 1JZ7A 2YA1A 2DDXA 3ZJ6A 1S46A 3IGUA 2O9OA 3A4WA 1UWTA 2OW7A 1JZ2A 3T0BA 4QAWA 2UY2A 1JI1A 4EE9A 4EANA 1E0VA 1TA3B 2OLHA 3VU2A 5A8MA 3WF2A 4FLRA 1E15A 3EDFA 3IAQA 3ZR5A 3NSMA 2RGMA 1ZBWA 2VX7A 3AICA 2D23A 3RO8A 5I77A 2EPKX 4YN5A 5HNNA 1IZKA 2BNJA 2WVTA 4BQ3A 3MMDA 2DT2A 3S2CA 1J0JA 2WYSA 2Y24A 3G6LA 1ZBKA 5IFTA 1QHOA 3CZKA 3N1AA 2OWXA 3SUTA 4UZSA 3B8SA 4IPNB 1MQQA 1M03A 2YL6A 3VUPA 1X6NA 1MQRA 4L4PA 3WIJA 3VD9A 4D6FA 4D6IA 3GXNA 2PWHA 1HN1A 4KWUA 3AOFA 1PS3A 4UFHA 4ATLA 2VZVA 1CGXA 4D6DA 4Z2HA 3UG4A 2G3MA 2XG9A 1QBBA 1ISVA 1X6LA 3BAKA 3WMSA 3K4DA 4Y7EA 3GBEA 1EOKA 3L2MA 2ZUNA 1GOIA 4HOZA 1V3KA 1BVNP 1ODUA 1XYFA 1UKQA 1PBGA 2ZE0A 4LPCA 2F1BA 1CXEA 2CBVA 1UZ4A 4H2CA 4R27A 3JUGA 1FA2A 1CNVA 3WQVA 4DM1A 1DWAM 5ABEA 3VDCA 1H1NA 2D0HA 5D9OA 1PAMA 2VC9A 3HJEA 1J0YA 5CLWA 2YDRA 4P8XA 1R85A 1AQ0A 4H8UA 2CESA 1NWTA 2XGIA 1BYAA 4U2YA 1A3HA 5I78A 1CEOA 2NSXA 1MYRA 1E9LA 3K4AA 2YA0A 3WN6A 5JBFA 4DWSA 3OA5A 1ZBCA 2CERA 5IXEA 4AMCA 2V38A 4MTVA 5GQBA 3LXAA 3AYRA 5FD0A 1E4LA 1DWIM 3KE0A 2WCSA 3GNPA 5D8ZA 3VDBA 2XFYA 1DWHM 3AIRA 3SUVA 3U57A 2XWDA 2XTKA 2WMHA 1LJYA 1UD2A 1AQHA 3E1F1 1CYGA 4ZEPA 2CIPA 2WMJA 2ZWYA 3POHA 2ZXBA 1RH9A 3K8MA 2ZUVA 1SMAA 1M01A 2IXVA 1OIFA 2EABA 1CECA 1EHNA 2G4FA 1I1WA 2EBNA 4E2OA 2XN2A 3PBGA 3DX1A 1GCYA 2WHMA 2D24A 3ARXA 1V0NA 3T09A 2VRKA 1UR9A 4PSRA 3EDDA 1FH8A 3WD1A 1WP6A 4UNIA 1FHDA 3D52A 5BRPA 4U5IA 4AEFA 3AYSA 2J7DA 5CJ5A 3VSVA 1UG6A 4GO9A 3PHAA 1WAWA 3OLDA 4M56A 5IHSA 3FHAA 2EJ1A 1CLVA 4AMWA 2GVYA 1UA3A 4WSJA 3W53A 3DYMA 3A22A 1V3HA 4F8XA 1OB0A 1VBUA 3FAWA 3WNNA 2UY5A 5BROA 1LL4A 2XVKA 2BY2A 4FLSA 3SUWA 8A3HA 4UQ9A 2XIIA 3MKKA 4D6EA 4GI8A 1E6XM 1V6YA 2DIJA 1NARA 5CQ1A 3GXMA 1E3ZA 1K9EA 2XSBA 2C8NA 1UOKA 2CNCA 2G8ZA 4AIEA 2CKRA 5A3HA 3GXFA 3LXCA 4CUCA 1V02A 1UQZA 3THDA 3RPMA 1J12A 1PX4A 3B9DA 2CETA 2QMJA 1WZMA 4MB1A 1XC6A 5DF0A 3DX4A 1U33A 4B3LA 3O9NA 3DHPA 2EEXA 3PTMA 1CENA 1GHRA 4AD0A 1ISZA 1W3LA 4PTXA 4S3JA 3BAYA 1LG2A 3KLKA 1UYQA 3SCRA 4LGXA 1Q6DA 2WZEA 5E1QA 4HPGA 5TD4A 4BQ5A 4A3YA 4FNUA 3WF3A 2WMGA 1EH9A 4AZ7A 1NWRA 5BXSA 1FHLA 2VX5A 3VGFA 1B3ZA 2QHAA 3O2LA 1WZKA 5I5RA 3WNOA 4ZXLA 4ATWA 1DP0A 3H54A 2PWGA 1BFNA 3O6AA 3GZAA 4UQDA 1W2PA 1OWQA 4OKDA 2ZICA 3BUBA 3IJ7A 2X2YA 2J25A 1C92A 2GDVA 1JXKA 4KH2A 1EHAA 3EDKA 3F5JA 3PZIA 1TMQA 1KBKA 1V03A 2PBOA 3OZPA 3UETA 5ECUA 2YDQA 1EIBA 2ALWA 1OD0A 2PC8A 4J28A 2XJ7A 2D22A 3OG2A 1E73M 1WDSA 3NDYA 3VD3A 4YHGA 1BTCA 5E70A 3D4ZA 4P8UA 2VZUA 1H49A 2Y8KA 3WFLA 1R7AA 2GK1A 3W25A 1KGWA 1KXQA 4AZHA 1C3FA 2JFEX 4WLCA 3K1DA 4AYSA 2ZX5A 3SCUA 4WKFA 1JAEA 4W84A 1W3JA 3ZOAA 3KLLA 3SCSA 3BAWA 1M7XA 5D4YA 5A2BA 5BWFA 1XSJA 2DSKA 1UASA 2W62A 5D9PA 2QF8A 3RM9A 4JL1A 1KCKA 3W37A 2WC3A 2DH3A 5DT7A 3RMEA 3BVUA 2YLAA 3VINA 3PZTA 1V6WA 3BLKA 4NZFA 3DYOA 2WNWA 5CZKA 5A1AA 3LPPA 2BVDA 3BAIA 1KTBA 1TQTA 4MB3A 4J7RA 4PTVA 5AC4A 1GVIA 2BV9A 3GXIA 1W9XA 3SCOA 4AC1X 1TQWA 1B3YA 2QPUA 8CGTA 4NX0A 3VIFA 4PMYA 3WD2A 2PB1A 1WZLA 2JF6A 5CGMA 1TCMA 4QCFA 1MVYA 1KGXA 4KGJA 4AXNA 6TAAA 2J7HA 1CGYA 2DH2A 4C7FA 1UD5A 1K9FA 4A4AA 2WB5A 5CG0A 4UQEA 4OOZA 2FH6A 3GXPA 3CHCA 3AHYA 4DO5A 3RJXA 4GKLA 4CD7A 3GH7A 1HVQA 4H41A 1ZL1A 2YIHA 4MNMA 4U3AA 5AYIA 1UH3A 4AEEA 4MNKA 1C93A 3W4RA 3VIOA 3N11A 1QI2A 4CD5A 1FFRA 4AZCB 4MNLA 2NT1A 3WUBA 2AMGA 1CWYA 2B31A 1A47A 1KB3A 5M3WA 3GNOA 9CGTA 3L4YA 3HZ3A 2DIEA 2VZTA 3ZSSA 4OUEA 3VDHA 4AZBA 2WBGA 1TVPA 1ZS2A 2Y4SA 3EJTA 2WLYA 1CXLA 2VR5A 1QW8A 3DX0A 1QPKA 3OGVA 3FW6A 5A6KA 1KTCA 3WUFA 4PMOA 1DEDA 1UWSA 1H09A 5A2CA 3OLEA 1E56A 2D3LA 5DT5A 5A6BD 3BMVA 3BMWA 5EFDA 3VVGA 4N42A 3ARYA 1C8YA 2VUYA 3WL1A 2F18A 4QDMA 1J0IA 5LYRA 1UH2A 3VKKA 4TTGA 1UA7A 3H53A 4IM4A 4C7DA 1V02E 1I1XA 2XFRA 1HP4A 3BSGA 3MSDA 5I0DA 1TZ7A 3D51A 2F2HA 2JIEA 4QCEA 5A69A 4ZE5A 5AC5A 5M03A 2CEQA 2W92A 4MDOA 1E70M 4HPHA 3D5HA 1QWNA 4H04A 4E4PA 2VVNA 3BLPX 2WMIA 2IGTA 2MANA 1R87A 5EMYA 1UHVA 3LPFA 3MO4A 2XVPA 3CMGA 3WY2A 2WBKA 1HKMA 4AISA 1UZ1A 1QNOA 1JI2A 4NRRA 2GJXB 5ABFB 2X8RA 3VM5A 2DSWA 3M7SA 5BYWA 1QBAA 2OSXA 2EACA 4UCFA 5EB8A 3N17A 6CGTA 2A3HA 2BHZA 1H5VA 4P7QA 1GQKA 3OIHA 5I24A 1ISXA 3NUKA 1ESWA 3K8KA 2WXDM 1OGSA 5CSUA 3WQWA 2VOTA 2J8GA 1RPKA 4URIA 2VTFA 1E72M 4RL3A 4Z2KA 3VIHA 2WKGA 1QNRA 2WC7A 2ZUMA 1GNXA 2CXGA 3AQUA 2XM2A 1J18A 4TX6A 2YOCA 2XVNA 1WDRA 2BHUA 2G3NA 1CLXA 5E09A 1B1YA 3VIJA 1VIWA 2YJQA 4P8WA 4PUDA 2FGZA 1JDAA 1H41A 2V3FA 1VFUA 4HZ6A 2YBTA 3NDZA 1J9YA 4DWSD 3WDJA 2V3DA 1MQPA 5HXMA 1QHZA 1KFWA 3RIKA 2W61A 4M29A 3VD4A 2OYKA 5EFFA 3CUIA 3IANA 1HJVA 4PRWA 2YDSA 3WDQA 1W91A 4TVDA 4GZIA 3ALGA 4Z2LA 3CZLA 2WPGA 1E55A 2XWEA 2XFFA 2DSVA 4ACZB 2CCRA 2Y2WA 3QHNA 4OBSA 1C8XA 4UOQA 5E0CA 3SURA 2FYVA 4A3HA 3NJ3A 1HTYA 3PZQA 1H4PA 3WBAA 3GBDA 4NXKA 2ZX9A 4IUGA 5JUVA 2YL5A 3T2OA 4UQAA 3N12A 2NT0A 3CMJA 4XB3A 1GVYA 4AZIA 4WIWA 3CUGA 3LXBA 1NWSA 2O9RA 3BVTA 4ZE4A 3WH7A 3MI6A 2VL4A 5D9NA 2V3EA 2J7BA 4OGZA 4DUVA 2OWCA 1V6VA 2Z1KA 4J3VA 2F7OA 4MB5A 2J77A 3A21A 1JD7A 3CPUA 2J75A 3WMCA 5JIPA 4FF5A 3TOPA 2EPOA 4CVWA 4J3UA 2VR4A 2BXYA 3WDIA 3PZNA 4UOJA 4B9ZA 3EMCA 4BS0A 1JGIA 1TE1A 4LX4A 2X1IA 1MFUA 1CGTA 1UR0A 4W8BA 1DTUA 2FHBA 1J0HA 3CBWA 3W28A 4V27A 1JDDA 1PX8A 3WNLA 1KQZA 1VFMA 1CBGA 4L4OA 3U5UA 1VBRA 2E4TA 2YLLA 4CD8A 5BCAA 2E8YA 3UEQA 2GJRA 1W2VA 2BVTA 1XV8A 2WHKA 4AMXA 3WFZA 1BGGA 2AAAA 1E6SM 4E8CA 3CHFA 3VMPA 2J78A 3AIBA 5KZ6A 1V3JA 4NXSA 1XD0A 3K8LA 3WKZA 1JL8A 3CZJA 1UH4A 4CCDA 6A3HA 1C91A 1E4MM 1NOUA 5JBDA 1KCLA 3U5YA 7A3HA 1CZ1A 3EYPA 2ZUWA 2J8FA 4UQCA 1J11A 2EAEA 4UZUA 3VGEA 3PZMA 2Y8VA 1D2KA 5C70A 1NOWA 4IISA 4MDPA 5ABFA 1GOMA 3FY1A 1HKKA 2BS9A 2CHOA 3NCOA 3MUAA 4CKQA 4F9DA 2ZXQA 1KWKA 1EGZA 3A4AA 1R33A 3ZT6A 3W38A 2DQXA 5BXPA 4V28A 4D1JA 1QI5A 4TXEA 5I79A 3W81A 2ZXAA 2OYLA 3NIYA 1HX0A 1QI3A 3BLBA 4W87A 1B3WA 4FLQA 5FIPA 4PCTA 1C7TA 2TAAA 1M04A 4D6HA 5A8QA 2PWFA 1N82A 4OIFA 3OLGA 3ZMRA 4QLKA 2DEPA 3SEPA 1QI0A 5A95A 3A4XA 3EJSA 4AZGA 1ZJAA 3J7HA 1GJUA 3AI0A 1C8QA 1WO2A 2VCAA 3WY4A 4X9YA 5M17A 1EDQA 4BCEA 4PN2A 2VZSA 3MV01 3CHEA 4J3XA 2FDMA 3EDJA 1CXHA 1G9HA 2F7QA 4W7UA 4V2XA 1JFXA 3WNPA 1XYZA 1B3VA 1BYBA 1R86A 2O9PA 4BF7A 2RGLA 3OBAA 2J7EA 1V0LA 4W8LA 4WJXA 2EQDA 2YFNA 3ARZA 1TA3A 1KR1A 1HNYA 3AHVA 1VFOA 1LL6A 3AIEA 1CXFA 1FP8A 1GUVA 2WWDA
chains in the Genus database with same CATH superfamily
1ZJBA 3K4ZA 3PNZA 3OB8A 3JZYA 4JO1H 3SGKC 1ECEA 2X6MA 1UKPA 4ZQRA 4I2XA 5MEPB 1CLZL 3ERXA 4PGCB 1RP9A 1VGEH 3MV7D 2GT9A 1J01A 2PDKA 2ANUA 1TR1A 3W29A 4M3HA 5E2VL 2PO6C 1MCHA 3EWDA 2KAUC 5DFTA 4LRNH 2Q6ZA 3C12A 2PWEA 3QPXL 3CWGA 1NDYA 2E1DA 4QI3A 3SDXE 1TQSA 4QMEA 5CD3A 3ELFA 2ZD0A 3SGDH 3SADA 1FWNA 5DYOA 2R1LA 4MZRA 4H1LG 5K39B 2Q8XA 4EQ2A 1B9KA 5LGHH 1UR8A 4JG1L 4X4YB 4OZFG 3PGFH 1ZHAA 3QXDA 1SFSA 1UR4A 1TPXC 5SWQA 1L9OA 4WR3A 2D7NA 1VJSA 3K1KC 4OTXL 1JPEA 5T3XL 4IU3A 1HG3A 5H8DA 2IXUA 4UQ2B 1F3DH 3BSZA 1CD1B 1I7RA 2FEEL 3BP7A 5I18H 1XLMA 4H2HA 2KUTA 1AO7A 3H3PL 1S8DA 2PPFA 1AOZA 5A3ID 1H3XA 1BXXA 4AYGA 4TNVK 4K23L 4WFGD 3MVIA 4B2DD 1SFTA 5JXED 2DM4A 5KBMA 1TQVA 3CUZA 4HPNA 4UXDA 4FMVA 4WGKA 4B6ZA 3G5XB 2XZAH 3KP0A 4I0PC 3MGAA 4GI4A 3QVQA 1DVJA 3AC0A 3I9GH 3HZVB 2B7QA 3VVVA 2Y88A 1KYOK 1TQJA 2A1YA 1H5BC 3HMWH 4CCZA 1Q13A 1CF8L 3LCGA 2GJPA 3TCSA 3KPRD 4H9XA 4CDGC 4ECNA 3SGKA 4ADJA 3C60D 4A66A 5HDRA 1A6AA 4GIPD 1KXTA 4APQB 3PAZA 2IMMA 4H9VA 4N2OA 4HJFA 4FNTA 2WCAA 2VISA 5E8DH 3IKCB 3C2FA 2X4RA 4LHUD 3U7YH 4MUPA 3KPTA 2XBDA 4MYAA 3EKGA 1JF6A 3KAAA 1Q9OA 1RVGA 1Z66A 1BP3B 5F44A 2D0FA 3WD3A 4YDJA 2F7RA 1GKOA 3EDEA 3A0OA 4V1DA 1FHVA 3DFOA 3OXRA 4LAOA 4WO4D 3RVWD 4PEEA 1L9NA 3QH3A 5HJ3A 3H85A 1OBAA 3V0VB 4MNGB 3BSZH 5A16B 1ZB5A 3ARBC 1HKJA 3RU8X 1QNZL 5FEPA 5HHVH 2V8ZA 5TF1L 1X4ZA 4AL8L 3LKQB 2PTZA 3LQAL 5C86A 4MXWH 5BO1H 4YXLL 1MDRA 1A4CA 3QV7A 2CRYA 1OSZA 3IETB 4CEXC 3BH9B 1TTIA 2DEYX 4ZT1A 4G6MH 3B04A 1RBOB 3HNVH 3LHPH 2F84A 4GY7A 4YAQB 1BSIA 4B53A 3FS2A 1A0DA 1OTSD 4ALDA 3WDPP 1SFLA 2AJXL 2GFBA 3DUHA 2ZRWA 3KMDA 4UOW1 4GIYA 3SPVB 2AQRA 4ODHH 1QOXA 1CGWA 1ZD6A 2IADA 2XISA 4LCWE 5AVZB 4C6FA 2ZZ2A 1UEMA 2EPNA 3S5ZA 2EDEA 1DVZA 4I0PA 1WWAX 4LC6A 3T04D 5GS0C 3KVJA 1MW1A 1OG6A 3DRTB 3ZE0F 1X39A 4ZS6D 2W5FA 1HH6B 1Q6QA 3VSTA 2WLMA 1PZ5A 3V0HA 1KG0A 1S7TB 4X5QA 3EYVB 1CLZH 1H5BA 2FE0A 2IKIA 4XBSA 5LA1A 4QTIL 2JXMB 2UZIL 1I8IA 3MOBL 3EGXA 3C2OA 2KI6A 5C0CB 4GYFA 4P7NA 2ZOLA 2JI2A 2J72A 1B4TA 4FKHA 3WD5H 1H2JA 3KOZA 2ZCKL 3MRNB 3TA6A 3UP1A 2E7LC 4HZ7A 1FXQA 2ZNWA 1YPXA 1U3HC 2H9GB 2HRGA 3UQNA 3W6MA 1F4WL 1LQAA 3CYVA 2F0CA 2D7TL 2YAQA 4Z23A 3WFCL 4JG1H 3T4AC 2VMCA 4FK9A 4OJFL 4NCDA 4OTXH 4O9HH 2Q3XA 4AIOA 3ARBA 5AWNL 4M02A 1MCIA 3HHSA 3QHMA 3GO1H 3PPGA 4YVPA 5CBAA 4MZIA 4ZZ9A 4Q8TA 1SJEB 3EGDB 1NMBH 1MFDL 4P5MB 3A23A 3LNDA 4ZK8A 1JZHA 3L3JB 3PB0A 2K1MA 2OMXB 4KWWA 3PWLA 5LG6A 3IWUA 1D5MB 4JTKA 4QR7A 4PJ7B 2VC5A 5DC4B 4KU1A 2XVGA 3T9PA 4TL4A 1HWGB 2AK4D 3FXYA 4FL4B 1TWIA 3MANA 2EEDA 4UUIA 5EOCH 3W7CA 3UW6A 2JEQA 4YLCA 2J56A 1VFSA 3HF3A 4GP4B 1D9KD 2EKSA 2MKWA 2J5WA 4A7QA 4Y5YB 2PCEA 1CT8B 1CF8H 1D5RA 3K5SA 1GYCA 1B4EA 2ADFH 4H2AA 3WMBA 4P23A 4UDTA 1IQ8A 3Q6GH 3CFJA 3AU1A 1R9ZA 4KFOA 5G4OA 3KCPA 1OC7A 5CJQL 1JRBA 1QW9A 2WMIB 4PG2C 4EX4A 1ZK9A 2J8TA 4PRHE 1WDWA 2NY6D 3LERA 2IO5A 2ISDA 4AM0B 2WZMA 3GM8A 1YEEH 1EZ2A 3IXTA 4WUUD 4BR1A 1XRVA 3UO8B 1R1CA 1ZTXL 3VFPB 5JA9A 5ACLA 5F7MC 4R26H 2QV2A 3VD5A 4HK3J 2VNCA 2BP5M 3SQMA 4W89A 4M9OA 3BDBA 4WW2B 5HYEA 4F7TA 1VCBC 2DSZA 4PJGA 1FG9C 3UU0A 4AL8H 3T4AA 3MRMB 2CR3A 5CPSA 1XZ0B 4XNYL 1YQVH 5DLLA 3QSTA 3LGGA 5DLCA 3QHZL 1D5XB 3MR9A 2WHVA 2O4MA 1GGBL 2BRQA 1NA8A 1I75A 1E2ZA 3B6SA 3VFOA 4XP1L 1IEBB 2X6UA 3VNZA 4F15C 4P2QA 3C2YA 2FR4A 1B3XA 4XX6A 2P8MA 3HN8A 4YWGL 4LEXL 2PYFB 4RFEA 2AJXH 3CFUA 3DH7A 3S42A 3VG9C 3D06A 2PCQA 3R8QA 2M2DA 3I3EA 1V8EA 4PMZA 2P8CA 4K7PX 4X4XB 3SCPA 4C1KA 1URZA 4PMNA 3BQUC 3VXTB 3AQXA 4TNGA 3RILA 3GKAA 3KYMA 3SQSA 4FZIA 4A8LA 4J6IA 2BSEA 3FT2B 3LI0A 3M8OH 1WIPA 3CH1A 3QFGA 3RU6A 1WAAE 5DT1L 2BXZA 1PCWA 4DETA 3MTWA 1FAIL 3TW6A 3EUUA 4ABUA 2QVFB 3P60A 5I09A 4QTIH 3M1BA 2UZIH 3HO8A 1GJWA 3MOBH 2X1TA 3NZGA 3E7JA 3SM0A 2MMXA 1N5AB 2NW2B 1NM4A 4LAZA 4K68A 4Z2IA 4QE5A 3PR2A 4HHAA 2ZCKH 5DHYA 3HURA 1W1TA 3OJGA 3GH5A 3HE7B 5BS0B 3Q2VA 4BKTC 1IXPA 1A9EA 2BP0A 5IB4B 2EE2A 1G01A 2YL8A 2A9BA 5IOPA 4MJIE 2D7TH 3W1XA 1B6DA 4UNUA 3WFCH 3H24A 2CBTA 1U0QA 5D2WA 4XUGA 5HINA 2I56A 3IFNL 1Z32X 3TN0C 3TZVD 4MA7H 2B4CL 2J7GA 3MXVL 3CHDA 2FL5A 3MMEB 4BXSV 5BQ7B 3R5EA 2RUSA 1CFTB 3KLAB 4P3DA 4M1RA 3KPSE 1IJNA 4R4FL 4BWUA 3VB8A 5E9NA 5F0LB 4WTQA 2OMWA 3TURA 1KFAL 2EVJA 3JV6B 4ODXB 1SXZA 1AW2A 3TWYA 1OSPL 3P4NB 1PKOA 2CMRH 1GS8A 4QYOA 4MUZA 3RO8A 4PG9B 5C08B 4QRNA 1NC2B 3UAEA 2NUTA 4O12A 3NCMA 4WY7H 3A4JA 3BQUA 5BRZE 2OWXA 1DEEA 5C07A 4FXFA 4ZO6A 4GYJA 3FO1B 4CA4A 2Y06H 4S0SD 3VUAA 5CCHE 4D6DA 3UG4A 2QAFA 4UTTC 4B5NA 1BD2D 3DJ9A 2NY1C 4LEFA 4RMTA 3DX6A 1KZYA 3PF2A 2R82A 3H9SA 5CJQH 3WQVA 3WIHA 1NGQH 5D9OA 4KEZA 2VC9A 3F7KA 3MKVA 1BWKA 4U2YA 4OLXL 4S3BA 2J8UF 3PIQB 2V2TA 3Q44A 4YSEA 1ZTXH 4B9IA 3O7UA 1UMLA 5BOPA 3KE0A 4GG6E 1OX4A 1RVKA 3REVA 1W5OA 4EN2A 4XAZA 1RHFA 3V7MA 2J5LB 3OAYK 5HR6A 5EIVA 4XOAA 1GZQA 5HVHC 3CV2A 5C09E 2R1XA 1E67A 1PF3A 3SAZA 5FYKL 2VXSL 2DWSA 2BH0A 3ZKXC 3KHDA 1A7PL 1SUXA 4Z1DA 4E2OA 1FNSL 1NDGA 2BP8B 1DLFL 4WFHD 4X5XB 3DX1A 4XWOD 1PW3A 3SD2A 3FYPA 3IMRA 3EDDA 3QHZH 4YSCA 3TN0A 4DWDA 3RURA 1KGCD 3WJLA 1WP6A 1FHDA 3L7RA 5B7YA 4GO9A 1GGBH 1JCKA 4ONHB 2CO7A 4ZD3L 2G0LA 5HSFA 3KJ6L 4MA3A 1IR1A 4HCRH 3CX5J 4C56E 4Q6XA 4M62L 3BMXA 3PK7A 4YWGH 2HT4D 4LEXH 3KPQA 1Q9KA 4F7PB 1O5QA 5C0IB 4R7LA 2TSAA 3M7OA 4Y5XA 1A7QH 4ZMLA 3DEQA 4I3SL 5EU6B 4YGVB 3VC6A 2R2BB 3VXSA 2PU1A 4C5YA 2UXTA 3A64A 1YC8A 4N3TA 3DI3B 4GVGA 3B7SA 1P6FA 1J12A 2CETA 1S9XA 5DF0A 1CGSH 3O9NA 4A22A 5DA4A 4RGOH 3HAEH 4IPIA 2UZ9A 4PTXA 4PCPA 3SRKA 1BWVA 1FAIH 3TBSB 2VABA 1CB7B 3WIHH 4UOW0 5KTEH 2DEXX 2QJMA 1TJ1A 2HT3D 4PL1A 3P8JA 1HSAB 5HWMA 4ZXLA 4ATWA 1AH4A 3F00A 4AIZB 5A3IC 1V7AA 1GH7A 3DERA 4H9TA 3MV8A 3QP3A 3NXLA 3LEVL 4XAKD 2A9ML 3L3KB 3O2WL 5JXEC 2WXLA 2A6KB 1V03A 3FFCA 2OLDA 4I85A 1NDVA 1EIBA 1SUHA 3K1GA 3PPHA 1QVOB 3C6SB 1Z9AA 4R3UA 1JRHI 1KJVA 5AOKA 4KBXA 2ED6A 1KXQA 3GKZA 4XPAL 1OAXL 4C6OA 4WKFA 4LANA 4KXZI 4W84A 1Q0YL 1RH8A 4GD0A 5I1DA 5TQ2L 1XICA 2QEZA 8PAZA 1VSCA 3PYCA 3BGJA 4NI6A 4MMXB 4MY8A 3D09A 1XH3B 5E1GA 3CDFA 2B4CH 1PDYA 3C60C 3MXVH 3PDGA 4UB0L 3WGUB 4N9EA 2GHZA 4O58L 5TK2A 4OGYL 4R4FH 2QPUA 1Z8AA 1OEZW 1WZLA 2R9HC 3D39A 1KGXA 4G3YH 1IQDA 2PN5A 1EJ7L 4HFWB 1KFAH 2FEJA 3QDGB 1OSPH 5DU7A 1HCVA 2FSEB 1NFDE 2VYRE 3W4RA 3VIOA 4WSHA 1UOZA 4CD5A 3R25A 3LSBA 8XIAA 2HFGL 3EKZA 1X8CA 3E5PA 1RJYB 3RYMA 2VDPL 4WO4C 1S7QA 1A5AA 3D0VA 1IAOA 2P44B 3B8DA 1S5VA 3O1NA 2G5UA 3VOFA 1KKRA 1LLZA 3TYCA 3QC6X 3PWIA 3GIZL 1S2VA 3X1GA 4ELDA 4PMOA 1DEDA 1FLRH 5A2CA 2D3LA 2QF7A 2CUHA 3G9AB 1Z9MA 3C61A 4DGUA 2GYIA 5KSBE 5A5WA 2F2HA 2WXQA 3I9IA 3B8VA 5IUCA 3PPCA 1BVWA 1XLCA 4AG0A 1OTSC 3GNDA 1E1CA 3MGTB 2L0DA 1RXLA 4DQOH 5IVZA 5HYQB 4K37A 1QABA 1UC5A 1BWLA 5K4XA 5JXEA 2V5LA 2EACA 3QORC 1XGTB 3ULSA 3H0TB 3N40P 2BHZA 1BFVH 1GQKA 5AW1B 5K59E 4JQIL 1L0QA 4X6DE 1BX2B 2QADB 3GC3A 3LU2A 4PR5A 4HNVA 2R51A 5FYKH 3MA7A 4ZS6C 2AJ3B 2VXSH 4TX6A 2QGCA 2BHUA 3PUCA 3LI1A 4WU7A 5ABAA 1GXEA 1FVEB 1K7XA 3VE7A 2JKAA 1A7PH 5C0RL 4YSRA 2F54B 1DLFH 2QVIA 4KJPD 4OD2A 3LHWA 4CMHB 5I3KA 1IUZA 1T7ZA 3L3OB 3HA0A 2V9UA 1BBDH 4NU7A 4HK5A 4ZD3H 3GHTA 1W91A 4GA8A 3D85B 2XWEA 4M62H 2DSVA 2WXRA 3DENA 2VWEE 3NG5A 4A3HA 1R3LB 2CNZA 3L21A 4FERA 1DO5A 2QXWA 4IUGA 3ZKNC 3ZBMA 5DJYB 2IPTL 4I3SH 4KH9A 1W8NA 1L9WA 2VLRA 1AZCA 4BK5C 4XAPA 2VC2L 1T0MA 2OMUA 2DVTA 4K5NA 2V3EA 4OGZA 1T2JA 4MMZB 3LZFL 4KKCC 4KEUA 2WQXA 4WO4A 4OFCA 3UYPA 4WXYA 2C71A 1DJHA 4HVBA 3VFUB 4QJ1A 2X9ZA 5FECB 4EDXA 5DJAB 1X7TA 4OZHF 4LNRB 1FDJA 2Y7GA 1FL3B 1X5ZA 5INCA 3I2CH 5IOKA 3BRDA 5GRJL 3MCNA 1SM9A 5FWQA 2AV1B 3T9WA 2YUZA 3WHXB 5I8EA 1JQXA 5A40E 1Z5LB 5I6XC 2YCJA 4NPYB 3LEVH 3O3BB 2A9MH 3O2WH 3CZJA 1UH4A 4CCDA 1KBWA 4A7SA 1QUPA 1KRAC 3VI4F 4LPXA 1A4JA 3F58L 2AANA 2NWRA 4S3CA 2EDWA 3O0RL 2DJMA 1O66A 1UCTA 3QORA 4CKQA 3CE1A 2Z00A 2IH1B 2Z28A 5FX3A 1SO3A 4GRLB 4R7DB 2CLLA 3SJVD 3VXPB 1QI3A 5TQ2H 1B3WA 5FIPA 5KOVC 2V2WB 4PCTA 2PWFA 3SEPA 4HHHA 4OV5A 4NO0D 3J7HA 2MPAL 3LHTA 5GZOD 3H56A 1F11A 4OZHA 2OGJA 2FGBA 1J7VR 4LCRA 4UB0H 3C5ZB 2BNRD 4OJAA 2YPVA 2P7TB 2PDWA 1ETB1 4GYKA 4O58H 3B03A 1UXSA 4OGYH 5FYLD 3EDJA 4P9HL 1DPMA 3W76A 4DGWC 2F7QA 4BJHA 3X12A 1KXVC 4XPFL 2NY6C 2J7EA 4W8LA 3BP6A 5CEWA 2FPYA 4H3DA 1VFOA 3QULB 2DI7A 3CDZB 4Z42C 3NDZE 1T83A 3M0KA 5IM7B 5DD6A 1KJ2B 4WKZA 2ZOWA 3T6QC 4N4YB 5BOOA 2A3EA 3E3QE 4YH6A 1LDCA 2IPKA 4XNXL 5CH9A 4Z2JA 1L0PA 5IM51 1Y1UA 4BK5A 3IFPB 5K9XA 1JPST 5GGVL 4Q8VA 3GIZH 2YAHA 4H20L 1XGUB 5AKRA 4HKZA 3TBTB 4GUQA 2C9SA 3I6GB 2DQGH 3ILQC 3JWDC 4HYTB 2VITB 2CLRB 2BSTB 4LMQE 1M41A 5DJ8A 1JFHA 3Q8BA 1HHHB 1NVMA 2GJZB 3RDKA 2XWXA 5H8MA 2JIXD 1V6TA 3EJCA 1SXAA 4KPHH 3FB8B 2VZ3A 2WLKA 3DRQB 3LEYH 3TXVA 3IPWA 2BW5A 5KZCB 1V5JA 3W27A 3STEA 3GMPB 4WSKA 5DUML 1JUFA 1XIBA 1A1MA 4MZ1A 4YHYB 3BVXA 2AK4A 5E2WL 4D0CA 3R0DA 4GCAA 3LRSA 2H1LM 4Q8PA 4MB4A 2YPVH 1MW3A 4J12A 4K73A 2IDSA 4HPOL 5HHOE 4NNYA 2WP3O 3NIGB 4QRPA 2AQPA 1IEWA 5E8PA 3EKLA 1LEGB 4F2BA 3TV8A 1QHQA 4IP5A 5A6SA 3H26A 4I5RA 5FUZH 1NAMB 3QJFA 2OYMA 4FI6A 2VWSA 1AI1L 1WZAA 2ADGB 3IJ8A 2PDIA 2PDUA 2MSPA 4AQOA 3WS3B 1KXVA 3U4KA 1KTDA 3URQA 1EJOH 4PJEF 4DO6A 4JZNB 4LT7A 4JTUA 4IJCA 4XUYA 4N28A 4YFLF 2H47C 5F7YC 1Q0XL 2BS8A 3FMGH 1FRBA 3LZFH 4YDKL 3BPWA 2YMOA 4L4JA 4A35A 4S3GA 4PJIF 2DY3A 1N12A 5L4FA 2GABA 5BRQA 1OCCB 4UM8B 5AN7A 2UX7A 4OGAD 1JZ5A 3CHXA 1ETA1 1XGQA 4Y5VC 4LGSB 4UTMA 1G7HB 1UXWA 4F0LA 1JZ3A 1S2WA 3N9GH 3IE4A 1H11A 2OP4L 1H3WM 2YO3A 1IEHA 3BH4A 3UXAA 3KG5A 3WJMB 1MDLA 3F58H 5A8NA 3SFKA 5BW6A 3O0RH 3AXHA 3ZXWA 3CFKA 3C2AL 2IGFL 1N0LA 1BXVA 3OGSA 3FJ6A 4N2BA 1G4RA 1GL4B 4RRPM 3LPWA 3AAZA 4YHML 1QQDB 1JN6A 4EN3D 1JGDA 2VERA 1IARB 3CL7A 4GY0A 2G4GA 4YFLI 4JREC 3UJ2A 4UDUB 2PCFB 4ELKA 4ZNCD 3PP3H 4J1UA 4YBLB 3HI1B 4PI2A 1TZIB 3M0YA 3HMJG 3HBPA 2VDRB 4HSHA 1BCIA 4ZRGA 4G6KL 4GHRA 3DECA 4R2GB 2X6AA 5ENWA 1KT2A 1QRNB 4ZS7H 2G2RB 4EOWL 1FIGL 2W80C 3H7RA 4H83A 4Z0SA 1FVDB 3FH8A 4G80B 4C6BA 4XNXH 4X7CC 3FKKA 4M81A 1H7OA 4I48B 5GGVH 5B3SB 4MASA 3AO0A 2J71A 3UG5A 4H20H 1QPQA 2BFVH 1X5XA 1WCQA 2WNGA 3VI3B 2JJSC 4OIBA 5E2TL 4D8ZA 1RFDH 3OQ3B 5SWZA 4L37A 4XWOC 2B8OT 1HJCA 4LUIA 3QXWA 3AU2A 2FO4B 4M93B 4L64A 3FKUS 4DCQB 3IN2A 4HTBA 2KYIA 3BW3A 3HKZA 2VDLH 1Q5MA 4D0DA 4GFIA 2SODB 4NF7A 1OCZB 2ABBA 1T22B 3KPMB 1F6AB 1X7SA 1MY5A 5ESQA 3FQ4A 5D02A 1OHLA 1YNTF 2HPMA 2PRHA 1O0VA 5DUMH 3RB5A 3WEBA 1C9WA 3TJIA 4DGIL 4J23A 1TJMA 2FJGB 3R06A 3EIFA 3DJRA 4MLSA 2XWRA 3VXQB 1CIUA 5E2WH 2YMXL 1EEYA 1AYRA 4F27A 4LVNC 1S7SA 5D7LA 1I7TA 3QEQE 4HPOH 1GZPA 5CCGE 4ILSA 3ZDZE 2HT3C 2EG8A 3VWKA 1MELA 1ZALA 4O1BA 1BD2A 7CGTA 1JTOA 3AQYA 1WTGT 3EOOA 3NABL 5DJXB 4NZ8A 3P9MA 2Z31A 4C7GA 4HHMA 3M5YA 3CASA 4UV4H 4JFHD 3W1PA 5D1QA 4X6FA 1BMWA 3HU7A 1AGDA 3NCBB 4JX0A 3KBSA 1MH5B 4QXUL 1W3NA 4KFMA 5AZUA 5TTRA 1B90A 3Q45A 4KIEA 1Q0XH 2VMFA 4AQ1B 1JGVH 1XQ4A 4ZAKB 4YDKH 1HOCA 4AWSA 1J48A 4EXBA 4BFEA 5B1AB 2HJFA 4PW3A 1UWRA 2VQTA 1J2WA 4ONGH 4XN9A 4AQ8A 4W9EC 1VPQA 2OO0A 3STLB 2GUYA 2X87A 4XWGL 2A3CA 2P50A 2VWTA 3MNWA 2IANA 2C3VA 1AKJD 3CLEL 3WL9A 1JCYA 1OB1B 4Q33A 4C5ZA 4KVNL 4ETYA 1IGMH 4APXB 3O3RA 2BSRA 3W2LA 3WIAA 3FVMA 5C71A 1RV8A 3RTQB 5IEKB 3P80A 4G8IA 1GS7A 3AISA 3THML 2WOQA 3DOSB 3VMOA 4AVHA 3N15A 1XBVA 2PR4L 3B0UX 4FDWA 4YSQA 5BNKA 2PW2B 2H3NA 4GAYB 5IHLB 3UBPC 1X7QA 4M9PA 1UQSB 4KETA 4M7ZB 1WC7A 4HJJL 2NY2D 4LKCA 5I0ZA 1Y0LB 3ILPB 1ES0B 4FZ8H 3TIDB 3FTGA 1PBYA 5L0QC 1LTDA 1D5BA 3SGUA 3C0LA 3QTPA 3QMRA 4L29B 4AQAA 3SCVA 5EF2A 3GB7A 5DMMA 5FL0A 4B16A 3G5VA 5CJOL 3CFBB 4BQ6A 4YDLB 4DXKA 2CW6A 5BOFA 5SWUA 3MBED 4XN5A 3B9AA 2D2GA 2Z25A 3VFLA 1HGWA 4XZLX 2I7SA 2BY1A 4E3VA 2V9DA 2J57A 4B3VA 1EUAA 4FTVB 2X1QA 3CV5A 1YBQA 1LHZA 1HYSD 3IGAA 2VCOA 3MRJA 3GVVA 4G6KH 3WSUA 4TSAH 1KJ3H 4GCXA 4FS0A 3P84A 2XACC 2QDDA 3TR9A 1DWGM 1QDSA 1GSKA 4EOWH 1FIGH 2YCIX 5AHMA 3BWAB 3QV6A 4Z7IA 2GFTA 2OWWA 2HLFD 3NPSC 3F12B 2TSYA 3G3DA 3QN3A 1INEL 3O4LB 1QLRA 2DWYA 3EG9B 2C19A 4R53A 1JMZA 4IIFA 4HKBB 2XQBH 2DL2A 3IVKA 3FT4B 3SE6A 3MMTA 4B50A 3QV8A 4E2VA 1KBBA 2XIOA 3HC0A 4PJ9D 1OD9A 4IQEA 5KZDA 1SZNA 1C5DB 3S6CA 1ICTA 4D1IA 1AYOA 3E0VA 3LKOB 5EEZA 5LGHL 3FO9B 3VXUA 3SDDB 1IGFL 3BSHA 4X6BB 2FTPA 4NUPA 1FCVA 3ZJ7A 4LVOB 2BP3A 3G22A 4A8NA 1WPCA 3M7FB 4HOWA 3CH0A 3WN5A 1BYNA 3N2XA 5LGKA 4J3TA 3OAUL 4I9XA 4NO5A 5L6YL 4YYFA 3B83A 4G70B 2WXNA 4JG0L 3QUML 2YMXH 4F33B 4DY1A 5IFJB 1KIRB 2VR6A 5FLUA 3V75A 4YCOA 1UWTA 1DUZA 4MWFB 1ED3B 1XYLA 4NAQA 4RXFA 2E7FA 3U6RA 3BO8A 2VX7A 2RD0A 1EDHA 1NPJA 1W80A 4TMCA 5E7BA 3I9GL 4HUKB 5JZ7D 3BFQG 3ZWTA 3CZKA 3DXIA 3SUTA 4JKWA 4MMWA 5JLZA 1REQA 1FG2B 4P46C 3WI9A 4DTGL 4MPQA 2A7PA 4N8VA 4HUUB 4QXUH 4MNQB 1CDYA 4TL5A 5ICZA 5ESVA 3EO0B 2IF7A 4S23A 2ZE0A 3GM0A 4IZGA 3MRKB 4MCYB 4KNUA 3V55A 2HUEA 4JDEB 4PUJA 5GZOC 4DJDD 3OWEA 4XWGH 5K33A 3PAVA 5IHZA 4F91B 1JWUB 3DIDA 3CLEH 1E9LA 3COOA 1LE9B 5E9XA 4XC3H 1VRSA 4O5LH 4KVNH 2VEGA 5EUOB 5GQBA 1DWIM 3BSZL 2Z1WA 5EBWB 2NY5C 3ZDYB 2FD6H 1R24A 2IDCA 4N0UE 3U9WA 2XNAB 5HHVL 2I57A 5E4AA 1AQHA 3H9YA 5IK3B 1UJQA 5BO1L 1I7ZA 4QG6A 4PREB 2ZTBA 4TLUA 4JYFA 4LDCA 2NV1A 1T20A 2I9UA 3NJLA 3V5DA 3QQDB 2HVBA 3SDOA 4HVXA 1C9DA 3FU9A 3LHPL 4HJJH 1UACL 2D7MA 1MHEA 4NDMB 4RGND 3KCLA 4XMPL 4ZQNA 3EB4A 4M6PA 1FQ9C 2CLZB 5LDSA 2NXYB 5HHPB 4XIMA 3DXAE 1YY9C 5KN5B 3ZHDA 3FA3A 3EOAB 2WW8A 3S7GA 2GSIB 2CR0A 1NTDA 1PX4A 1WZMA 2W88A 1MG2C 2AEOA 3VGAC 1Y18A 3TF7C 2C3ZA 3QIWB 1A7RH 4ISVB 2MCPH 1BQHB 3KRBA 1BYPA 4AENA 4N6EA 3TPUB 3N44B 4P46A 4AWJC 1INEH 1D2OA 3G1SA 2X6BA 4EF3A 2DJXA 4MNHA 3IJSA 3GC2A 3H2CA 3FB7A 3RU8H 3IIPA 5DI8A 3WD5L 3H54A 1BFNA 1S5IL 3K72B 2FLBT 1R19A 5JHDB 5IIEB 2ZXWB 4KH2A 1SXCA 4AYDC 4ES8A 4S3FA 4J28A 3GUTB 1XYBA 3PNRB 3MSYA 2WN2A 1FH2A 4JN6A 4QAIA 2A9CA 3K1DA 1CTOA 4QO1B 3W2UA 3RX8A 1K77A 4XQ6A 3NQVA 1IGFH 4JM2D 1LO0L 2EKCA 5G5DB 1P1MA 1PG7X 4O9HL 3DKHA 3BPOC 4E4UA 5D9PA 3RM9A 1WG3A 5B3NA 1KCKA 3GO1L 4U1KB 3BVUA 4NQUA 1FUNA 4HT3A 4JBRA 3UGXA 2MTPA 5I30H 1ZT7A 1V6WA 1OZMA 3WAKA 4HYVA 5IG7A 2GBAA 1FWJC 4N2AA 3OAUH 4G9DB 1I3UA 1NMBL 2MEJB 5L6YH 4JG0H 1UP3A 3QUMH 4H26A 3TMQA 3VQLA 4MJZA 3AALA 5I3JA 3BUVA 3VKCA 4ERGA 2QDEA 5HYJA 4JHAH 4OGAC 2W3ZA 4DO5A 1HFBA 4Y9OA 5MP6L 1ZL1A 5BZWB 3LKNA 2F68X 2GVLA 1S5WA 4QGYA 4MNLA 1MLBB 5EOCL 1RUKH 1NGWA 4IMCA 3PJSA 3W1MA 5I19H 3GNOA 3L4YA 1DSYA 3UPAA 2JIXA 3RFZC 2WLYA 5ICUA 2VR5A 2ADFL 1UWFA 3WUFA 4ZOCA 4NZTL 3LIZA 4Z7WB 3S98A 5EFDA 3Q6GL 4DTGH 5DMLA 3ABMB 1SZGA 2C3WA 4O02A 2QSQA 3FYIB 3OTRA 4C7DA 1HQ4B 4XI5D 1V02E 1NDZA 2FBOJ 1ET5A 2JIEA 4KF1A 1V10A 2CEQA 1JPGB 2HS8A 3JWNE 1YY8B 4EN3C 1TV3A 2PO6A 3IDNA 1R87A 1YEEL 3OMZA 4FQJH 2XVPA 3BL3A 5D30A 1HKMA 2FDBP 4NRRA 2IIJA 4R26L 1M9HA 2ICWJ 5T1LD 3EX6A 5I0YA 2RAGA 3CQFA 3GIVA 4OZGB 3S4SA 2WXDM 2OEKA 1G1KA 3TWAA 2VOTA 3RGVB 2J8GA 5EIIA 1F8IA 4UIOA 4DHGA 4HXBH 5KJ4A 1AH3A 1XAUA 2GIMA 3RIAK 3CFEA 1YQVL 4BEQA 4LBAA 4JBSA 5IJVA 1I1AD 1U92A 2YJQA 3VXOB 2APBA 2PYEA 4DKFH 3MRRA 5C9RA 3EBHA 1A5OC 1LEKA 5J13B 1F3WA 3RG1C 4P5SA 2OTWA 1FZMB 1UACH 2W61A 4NRXA 2E6AA 3TQKA 3DIFA 4PJBE 2XBZA 4WRHA 4NENA 4WI6A 4XMPH 4Z2LA 2NNAA 3G04B 4YGAB 1I2NA 3QHNA 5DY2A 5FUOH 3BQVA 2F8IA 4NXKA 5INDA 1S2AA 4Y2DB 2CLOA 2E46A 1FRGL 3T2OA 4HWZB 3IWPA 4WIWA 1PE1A 3M8OL 1NWSA 2ALDA 5I1AA 3UBXB 4A2GA 4O02H 2W81C 4LNCA 2FECL 3NIDB 3WMCA 5JIPA 2NZ1A 2BXYA 4ZQMA 4BS0A 4PJ7E 2I9LB 4N2EA 1B3OA 3RXZA 3TYGH 3TW9A 3O6CA 1TCDA 4KQNA 1RCYA 2CZEA 1PX8A 1FA4A 1CBGA 2E8YA 2JFCA 3KW8A 4OF8A 1S5IH 3ES7A 3CT7A 2FO8A 5F3FA 1MEWA 4Y1AE 3OKDB 4RQQB 3LH2H 2DQJL 1CZ1A 2ZUWA 3QC0A 3FIGA 2X9WA 1KB9K 2WWMD 3R89A 5DVOA 3EB3A 3SY6A 2VDNB 1V93A 4NYUA 1MXSA 1LO0H 1E5BA 4WSGA 4XZHA 1KF9B 4MA7L 2WO3B 1FDLH 3RL1B 3NIYA 2X16A 4H0IA 1Q72H 3UZYA 3QGAC 2XN9B 3SW6A 5D5MF 1UENA 1QWKA 2OLSA 5BZDA 4UILL 5J5DA 4AZGA 1ZJAA 3B34A 1AIFB 2MQCA 5DK2B 3RYSA 3DUUB 4PRIE 2W0PA 4DEPC 4K94C 3MV01 1P0SE 1EUTA 2CMRL 3TFKD 3QWQB 3VKDA 3NZSA 3HPLA 1A14L 3REWB 1E90A 2XY1A 3VXMB 5IQ9B 5FLVA 5MP6H 4RA3A 5D9SB 4WY7L 3T3PE 4M8QB 5JIWA 2B7OA 3BWSA 1S4IA 5D1XD 2VT0A 3RWIA 3N9SA 4Y19E 4FS9A 2G3JA 5DMYA 5D7SH 2AXJA 2OX4A 1VGKA 2Y06L 5JW5A 4DBUA 5A7BA 1AFVL 4OJCA 4C6KA 5T5NF 4NZTH 1FKXA 2OW6A 3V5HA 3N2JA 2GJ6B 43C9A 2NY2C 4OR1A 4GKSA 2OEJA 2JLPA 3TYAA 1NGQL 2JWYA 4N90E 2APXA 3H2NA 2HCVA 2GEEA 1PD1A 4ZW5A 4U7KA 5E0FA 4H7VA 1F2XK 2UY4A 3TN3A 1P4LB 1BZ7B 5ACZA 2A9AA 1GGUA 3MBEC 4M1DH 1NP0A 3OF6D 3TA3B 2E7LA 4QTFA 4NQVA 3CVIL 3CM4A 1H15A 1U3HA 5AHNA 4JN2B 3WY3A 1CXKA 3TQ0A 3T05A 2W95A 2DB8A 2OMBA 2PPDA 2V5BA 3UZVB 4O17A 2XUCA 3GSRA 3FS9A 1MJ7H 1HYSC 3ETBF 1AJZA 2FEDD 5B38B 4ZFOL 2JKNA 4FR6A 1FFOB 3GG8A 4DWHA 4OCWL 4I1NB 2CO1A 4XTRD 3UYOD 3LNGA 4PRPD 4QROA 2HLFC 1KFBA 4QXVA 3QY8A 1X5MA 4WGHA 4LDEB 3OKYA 4L3AA 3T78A 3W7PA 2R24A 3GC4A 3ZVHA 4HCRL 1XSKA 4A6YA 2JKEA 1LBMA 5CZTA 4TTUA 3NQ8A 1IV8A 2YSTA 4XHJC 4AHPA 5HATA 3UTPE 3V6BR 2WTOA 1WB0A 3DUSB 1A7QL 4L1SA 3OKNA 4EWND 1C16A 4HPYL 2X0HA 1EL3A 5GS0H 1FRGH 3S2LA 1V8HA 1AKJA 2LR4A 2ODOA 1CGSL 2BJMH 3CZGA 4EIBA 4RGOL 4Y1TA 2C15A 1MREL 3WFHB 3OZLA 5HHQB 5K9OB 1E28B 4WGXA 2QQLL 1M56B 3WIHL 3WSQH 4M3KB 5KTEL 4YLBA 5DJCA 1P0EA 1H7XA 5FGSA 3NQCA 2IEPA 1FVPA 4K1GA 1QSEA 5ECVA 3P11L 5KSAB 3RNKB 1GA2A 5E9DA 3MV9E 1QSFA 3ULVD 4JLRB 4EI5D 2EDQA 4QRSA 4PU2A 2ZYIA 4C65A 4PG2A 1JVNA 2HH0H 3IJEA 2Y5SA 1UKTA 1IWAA 1EHXA 2I25N 3H2PA 5CP7A 2WUBH 3FCGA 2CLHA 3IJHB 2W59A 2VM9A 2DQJH 1PS9A 3C8FA 3KYNB 3NSXA 5DURD 1JYWA 5DEZA 3K5RA 5JZ7C 2JK5B 3OR7A 2ZYSA 1U9KA 4I6VA 3WQPA 3QBUA 4Q9RL 2VXQA 5GS2D 1X6UA 5C2XA 2J1XA 1VJIA 3WJJC 5LGZA 4ZO8A 3S1VA 3MX0B 2F2KA 5HHNA 4L8SB 5KSUA 3MHFA 2PW1A 1RIUL 2X12A 3UTTB 4A6YH 4UILH 4H4IA 2ETWA 1MEIA 3QAZC 3CC1A 4QRRB 4DK6A 2GTZB 4G3YL 3P4MB 4MLRA 5SWSD 3PQYA 1BG4A 4XNZB 2E8ZA 3CDCA 3T6ZA 3TJXA 5IB5B 1WTLA 3JUYA 5E8OA 4DJDC 3FB6B 2R8WA 3QOKA 1A14H 2ZOUA 3N04A 3GK8H 3QI9D 4WJEA 4TLSA 4DUXA 4OLEA 2W07B 1H6FA 4HNTA 4RV8A 3OJVC 5E1AB 1SR9A 1FLRL 4HAGA 3X14A 1AFVH 4H8VA 4NAFB 4RIRB 5C0AB 4DUWA 3C09B 2BOLA 3QHFL 5EU6E 2JB6A 4O57A 1PXGA 5F9WC 4I6KA 1FF5A 4KI1A 4YFEA 2VRQA 4EPSA 5MKGA 1GMEA 4RGNC 2VO5A 1H9DA 4PJCF 4ZDHB 1GW1A 4HUVA 4DQOL 4JRYA 4QF1A 4YPGB 3BURA 3LQMA 3V6OC 3EOSA 4Q6IB 3BC9A 3NPWA 3N4AA 3V5KA 1BFVL 1IJ9A 2Z7WA 3CVIH 4WOQA 2A3AA 2B5IC 3ZQ9A 4JFED 5A6IA 3IPBA 4BGDA 1KGIA 4RDZA 3DHJA 3B9KD 3LJ3A 2ZYRA 2QKSA 2VQUA 2OBGA 3UA3A 2OX1A 4M6QA 1ZJIA 4OCWH 2ZVIA 4DW2H 3FV9A 5CBEA 3B8YA 2QVNA 1GQNA 5C0FA 2IUZA 1UMYA 5LCVA 1TYEB 1T89C 1BBDL 1TO4A 2AJVL 3M46A 1MWAB 3FOMA 4X7DC 2ITFA 4MGGA 2APWA 1O6SA 4GSXA 4I7WA 4MAYB 3GC5A 4HWUA 1VAHA 4YR6A 3GSXA 1F56A 2R7EB 4LBEA 2J8UA 2HPIA 4E8DA 5D6DC 1SGJA 1IM3B 1XLFA 4XZUA 4WIQA 4HPYH 4AZUA 4B5SA 2YD0A 1TKKA 2BOBA 1XL9A 1RCQA 3WLLA 4P4KD 4P7OA 5C9XA 1T1YA 5T1MA 4XZMX 5G2NA 5BZAA 3IDJA 1FHNA 3F3HA 3IU3A 1K2DB 4JM2C 4MKSA 1MREH 1VFBB 4HNUA 1OZQA 3QDGE 5DRXB 3GSOB 1VA9A 3CU7A 4NRYB 2QQLH 2WP3T 1HH9A 2OM5A 1FWSA 4RGMC 1OV8A 1XF4A 4MJ2A 1FKWA 1J5OH 5KANG 2QNEA 3NQGA 1JWMA 5PTDA 3I2CL 3A67L 2GK0A 4U2ZA 4UTTA 3Q48A 3MRLA 4OH2A 1YEFL 4DBSA 5D2NC 3P11H 4DF2A 4F8PA 1G4SA 1FBIH 5CFHA 3PG2A 3O4OC 1VESA 2D73A 3MBWA 3W00A 4F79A 2E9MA 3D2UA 3DSNB 5AUMB 1OC6A 3PB2A 1J1OL 1YUHA 2JE8A 3V6OA 4AZ5A 4JFYB 3NEOA 3I02B 4L61A 4POYA 3I6SA 4PJDF 2C3GA 3K5XA 4Q9RH 3IJLA 4QUOA 1XUUA 4XNDA 5LCVH 1ET8A 3UXKA 3N29A 4JM2F 2OO6A 1RIUH 2J9XA 1BZ9A 2AP2A 3KS0J 1ULVA 3QUXB 4HA3A 2NW0A 5LNGA 3MU7A 4XI5C 1MZRA 2FQEA 2NV9A 2OTUA 3MV7A 5MHBA 4QXWA 2E68A 3T5WA 4NSBA 2YD2A 1KYFA 2CGZA 4OOUA 2XRAH 3EOLA 5LGJB 4WHYG 3OZ9L 2VE6A 2B2XH 4IKIA 1DUYB 3TAKA 4PBGA 3NFUA 5D7EA 2WLIA 5G1MA 1FGNL 4HA0A 3QM3A 3VXNB 3RVWC 3EPMA 1GYUA 4LPTA 5EU3B 4LVDA 2ADJA 1LLOA 1I2QA 1QR1B 4DVBB 4NQDE 5F3HB 4GBDA 1P5BA 2VM4A 4NKOB 3RP1A 1E7VA 3PHOA 1IVLA 3AXKA 2UWEF 3S8FB 3ARFD 1EZSA 4KXZH 3PP7A 4OZOA 3PUOA 2BHFA 3MZ2A 1N68A 4FX5A 2DQGL 4WTZG 1I1AC 2DAVA 3QHFH 4JB9L 5CCZA 4BFNA 1O7DC 1Q6GA 4QDGA 2FZ3A 1W5MA 2R0ZH 1ICPA 5GNXA 2ZE3A 3ZKSD 3GAKA 4KPHL 2DMCA 4CVXB 3GPSA 2CAKA 5D2NA 3LEYL 3L4VA 3VDAA 2Y7OA 3WG7B 3GJFA 3BIBX 5E51A 4GH1A 4B2DA 5C8BB 1KFKA 3ZJKA 3S4TA 1OXYA 1G4PA 5B4MD 3RPDA 1TTJA 1IE4A 3PV6A 1BQGA 1S7WA 2CLIA 3F2DA 3S9YA 2VR8A 3U46B 3UFIA 5AW8B 4PV9B 2YPVL 1IEXA 1BG9A 4RFNB 1KM2A 4Q56A 4ABQA 3L7FA 1DBTA 3KPRA 3TZNA 3UO1L 2QELA 1ML0A 4DRSA 3C60A 2Z2UA 5EWIL 4NKDA 2R1MA 2LLGA 2V17L 3F7LA 2GITB 5FUZL 4TUOA 4B5VA 2AJVH 1CD9B 3OJ2C 5J6HB 5FA3B 3PHQA 3MMDA 3L9BA 3HUJE 1WS7A 4LHUA 3DX7B 3UXFA 4G1MB 3EH2A 1ECQA 3TLQA 1RPUA 5CSZB 3V0AC 1S7VA 1EJOL 4UZSA 2GBUA 3GXNA 4KWUA 1PS3A 4UFHA 1L5GA 4XNQB 1U95A 3FMGL 5GSRB 5F2FA 2XG9A 4JTLA 2R56L 2WWMC 4X0KA 3W7OA 4WW1A 4JFQA 5JO5B 4PJ8B 1TG8A 3V36A 3FRUB 4TMBA 2F1BA 2ZZUT 1IMHC 4E68A 3LKRB 2CJTA 5HNTA 4GKNA 4IJTA 5IP4A 3JV4A 2CFFA 1BEYH 4N4QA 3C2VA 4KMLB 3A67H 4R7NA 1R85A 1YEFH 3CNKA 2CM6A 2XGIA 1DCLA 3N9GL 3OA5A 1GPWA 5IMOA 4NHUA 1WIUA 4KDWA 1F1DA 1PL3A 5I8KL 1VYRA 3D0LB 2L5HA 3DX8A 5K9QI 2VXNA 4HIIA 1J1OH 1LJYA 4LOCA 1CYGA 3QFJB 1WOAA 1TRDA 4FSAA 2TODA 1OIFA 1D9KC 1FI8C 1I1WA 2QQKH 5LBSA 2CHWA 2OL3A 5F9JB 2VIRB 5CSGA 1YEDB 3S35X 2GVGA 2F9BT 3GXUB 4Y4HD 5CJ5A 3VSVA 5IVOA 4CADA 4DPRA 1ZPUA 1A6VH 7PAZA 3SN4A 4S1QL 3EADA 3B7YA 4HGWA 3QUKA 4QEGA 4U6YA 4QRAA 2FNWA 3Q2CA 4E9SA 3S5LA 4QAMB 4UQ9A 4D6EA 3HS0C 3OZ9H 3IIOA 1NARA 3N2TA 4X6EA 2BLEA 3T6WA 2UYLA 1GSMA 1U8MA 1Q6OA 3VI4A 5DTFA 3F4DA 3THDA 3JT2A 4ZS7L 2DW5A 4S1RH 3N55A 4PJHF 1FGNH 1SQ7A 4ORIA 2NSMA 3MKCA 3UR2A 5B7ZA 2GJNA 3L54A 3PSWA 4OFYD 1ISZA 2HLAB 2XIDA 3SCRA 3WLTA 3IXAB 1Q6DA 4L7ZA 3P67A 4UBDD 2PDNA 3J8F7 2BFVL 3ISIX 5D2LB 4X2PA 3BVNA 3QNZB 5ICYB 1RFDL 2P5EE 4XTRC 3O2LA 3DU0A 1FWGC 4TUJB 3DHDA 5FSEC 5E23A 4UQDA 3UL4A 1IB5A 1JDEA 4JB9H 2Q09A 4IP4A 4WJG3 3P4OA 1PFCA 2GY5A 3OZPA 4WVRA 5CAKA 4IUOA 2PC8A 2NNXA 1TV2A 1DDHA 2VDLL 2MNJB 1E73M 2Q5BA 4JPGA 3QZAA 2FMNA 2G2PA 5FF0A 3GIPA 2ZRUA 1XBXA 3CZFA 3G6JB 5D8JL 5EC1B 4K71B 2IWFA 3JZEA 2JV6A 3GMRA 2OL3H 1MCKA 3BG9A 3G5ZA 1XDMA 3NGBC 3FSTA 3QIUB 3IFOB 3R7RA 4R96A 1GZHC 2G9HB 4Z3EA 5TDNB 1J05A 4FKKA 4IFKB 5JDSA 1NICA 4J7RA 1WYJA 1LDPL 1D9KA 3W1UA 1IIKA 3M45A 3ZY7A 4M1BA 4Z0BH 1PFOA 1F9CA 4AXNA 3CJJA 4P5KA 2O5XH 1JOIA 4YQXH 1J8VA 2CE6A 3UO1H 5I16B 4X9IA 3ICJA 3THUA 4XRCA 5EWIH 2V17H 3W73A 4Y4KD 3ULVC 1GYMA 3ZYOA 2CC0A 1GMIA 5EDSA 1QI2A 4UV4L 4AZCB 1RZ7H 2DIKA 2ARWA 1AHKA 1W17A 3WS6C 3ZSSA 4H6KA 2PF6A 4O1FA 4EP8C 1A6UL 2J9YA 2XKUA 4WUUA 3FDKA 1TPUA 2F8XC 2V2DA 1FYTB 1VBHA 4ML9A 1BJ1J 1JGVL 4RETB 1DTNA 5BNXD 3BMWA 4ZA0A 2R56H 2XSXA 2VUYA 5DCCA 3V4BA 5IBUG 5BRBA 1P6BA 1CFNB 4DXXA 1IL1A 4XCEB 4JFPA 4AUBA 4ELME 1O94A 5F2MA 1TZ7A 3TZVC 5M03A 4ONGL 5CJBA 4MDOA 4PYHA 3GB6A 5B80A 5FJTA 1ORSA 3BPLB 3MO4A 1IT8A 2NQ9A 2J2ZB 4GXMA 1IGML 5ABFB 4IIGA 2PKDA 3TBWB 4JPWL 3SBPA 2X4QB 5CEYA 2CDGA 1QMLA 3AG3B 3Q6FA 3QZWG 2VDKB 3ULVF 3RQ3A 3JSSA 1ESWA 2DN7A 4OVXA 4W6WB 5I8KH 4GYPC 3PPFA 4PJEA 2WKGA 3NQ2A 2PP3A 5FCSH 3KGUA 2G5BA 5D4JA 3SDCB 3V4UH 1A0EA 1OLLA 2H0JA 2A99A 3GBNH 1BQLL 4FZ8L 1H41A 2FWOA 5FO7A 3TCLA 4PJIA 4G5AA 2IOMA 1GZHA 4C6MA 3GHRA 1S5MA 2EKGA 4N6QA 3P30L 4NUJA 4S1QH 1HCYA 3E5BA 3TDFA 4XB7A 1E55A 4PV1C 2HG5B 2ZP0T 3OJMB 4AGMA 4LEQA 4QTHB 3PJLA 1GT8A 4MVBD 3TQPA 4HYRA 2NY7L 3TEWA 5GIRB 3FU7B 2MCMA 4Z78A 4TSAL 1KJ3L 1YN6A 4JYDA 1Y6NR 3MI6A 2A73B 4ZQKB 2F7OA 2UV3A 4F2MA 3GMQA 4ZQCA 3LV3A 2G5WA 2YD9A 4KQ4H 3U0HA 3P2VA 1U8PA 3PVFA 4W8BA 4NO3B 3QW9A 3FONA 4QQUA 1HQRB 1OCBA 2XQBL 1NGZB 2UUDH 1OFDA 3JWDH 3T55A 3LM3A 3GD6A 3TZVA 4KPLA 2CO2A 4MYPA 1UIOA 1R0AL 3VMPA 1W6WA 3EGSB 4L4VE 1PJWA 3K8LA 2EXSA 5KYUA 4D2NA 1LE5B 4PJ5B 4NG3A 2Y1YA 4H5SA 3FCPA 3E74A 5I9QB 4Y5VA 3BP4A 1RZJC 4YSTA 2GAZA 2HT4C 4UZUA 5DC9B 4XR8C 3NCWA 2CLVB 1TPC1 1I8AA 4JVWA 2YWYA 4BSVB 4WI2A 5D8JH 3ZE1B 1NL0H 3VZYA 5C9WA 1M42A 1FWEC 3W7LA 2WTPA 4LNYA 1YEHH 3UGVA 2ITCB 4BCYA 2WJZA 3EWUA 5FJRA 4P4KC 4GYPA 2ZTJA 4HEME 3OLGA 4LLYA 4WEBL 4PRBB 1I4FA 4CNNA 5E5MA 1TTAA 2A83B 2DJUA 1LDPH 1HXYB 1I8KA 3OKMA 2XG4A 2YC1A 5LAXB 5CEZE 2NZ9D 3EOBA 3G5EA 3KYOA 3L5LA 3IGXA 2RTTA 2VDIA 4RZCA 2QKIC 4JZOA 2O9PA 5KTLA 4L48A 4BE5A 5DK0B 3NAAH 1SYSA 1P2CA 2EXTA 4JZJC 4OZ4B 4FYRA 1KR1A 1LL6A 1KPUB 4G6FB 2JCWA 2DT0A 5E8EB 1HI6B 1NJ9B 3O6KH 3EW3B 1EFQA 5LKYA 5E4EB 3O8XB 1NCDH 1WBXB 4LVEA 1VKXB 1TQXA 6FABL 4UFMA 1YNTA 1A6UH 4ZSTA 4LUTA 3E2QA 3V9CA 2XN0A 3TGXA 2GBTA 1WZ1L 2ICEB 5TJWK 4N0YL 2OMYA 1F2JA 1DQWA 1KLFB 4Z95H 4MRCA 3O8AA 1KIPA 4QLRA 2QZQA 1YMMD 1LCOA 4JK0D 2KT6A 5EC2A 2JJSA 4JNZA 5J1AA 1XFPA 4NWUL 4P3WA 4XC3L 4O5LL 4UTLA 3KM8A 1M3JA 3N1MC 3VXRB 4U1SB 5G55A 4JPWH 4TNWF 5I1KL 1E9PB 4JHBA 1XWYA 3K6SB 4NYLA 2FD6L 4MBRA 4OZIB 1WDQA 1SJHB 5A94A 4UFLA 1PSCA 3TYZA 3MRPB 2YZRA 3A3HA 3VYLA 5E9AA 4U1GB 1SEBB 3Q1SL 1UKOA 4IGBD 4C4UA 1W3IA 1M53A 4E5TA 5D33A 4HJUA 1BZQK 5IMKA 1VCFA 2CKSA 2IQTA 4TX9A 4ZZFA 1SQMA 2QUUA 1BQLH 1K8CA 3ZZ1A 1JTTA 1KFGA 2H32B 3MYJA 1J8KA 3OGOE 4M1CD 4WU5A 1U58A 3P30H 2R2EB 3MV11 4JIPA 3BWZA 4FXJA 2A3BA 4TVSa 1NKGA 3PLYA 1SO5A 4EACA 5FF4A 4EZLA 3AZUA 4QP0A 2ARJA 2ISVA 4PWFA 2NY7H 1TV7A 1J8HB 2OCCB 5DLML 3EA2A 3ZL2A 2DMBA 2DICA 4B91A 3K0YA 3BRFA 2CCVA 3VI2A 3ZUNC 1V08A 3KDOA 4KO7A 3MJMA 1F3RB 1DWFM 1A7RL 4HIJA 3QDMD 2GUOA 2ZUSA 2MCPL 5B4MC 1ESOA 4PFHA 3IF1B 4BEIA 3GKFA 3WH9A 2EVGA 2VLKD 2Z3FA 3QXUA 4TIMA 3GBMH 4W9CC 1TKWB 3RU8L 1EGVA 1X5JA 4MAZA 3RPKA 4X9SA 4R4ND 4L9YA 3VGDA 4PRHD 4IW4C 4Y96A 4KJPC 1PYWB 4YEFA 5FDWB 4ETQA 1R0AH 4DKEH 4IGSA 3ZTCC 1OYCA 1MAKA 1MQKL 1Z9LA 1KBGH 2AVFA 5JQIB 4ICCX 3WK0A 4NWTL 2PXYD 1ICQA 3QSKB 1JD9A 4O13A 1OPGH 1WBZB 5C2GA 1HJWA 1MVFA 2DZXA 4LPWA 4RE4A 5I30L 3IU4H 4PRDA 3U3HA 2C3XA 2XG5A 1EWHA 4E41D 5T33L 1U8CB 3BXNA 3W2JA 5F7EH 4ZPVA 4WEBH 5EUOE 4J3ZA 4NI3A 4GMSL 3B4YA 4HKJA 3L1OL 4X4KA 3GTHA 1UC6A 1KTNA 4JHAL 3TYFA 4LXFA 5LN4A 2KQNA 5AOLA 2QFRA 5DWPA 3PNWB 1O12A 1QO5A 1T66D 1BFOB 1CFQB 5FKPA 4QOKB 1ZHLA 1ASOA 1PLCA 4HHWA 1RXOB 1D9EA 5I06A 1M7JA 3EWYA 3WJXA 1RUKL 3S96B 5I19L 2DV6A 2Y23A 3V8OA 2JEPA 1R9FA 5T3ZE 3ES8A 2DZAA 1CDGA 4XAGA 1UD3A 4LAJH 3FFDA 2OKTA 3ZJAA 1HHGB 3DO4A 1E3FA 6FABH 1U5JA 3ARSA 1IEAA 3DC8A 3HRZC 4ZCWA 4YSSA 1NIAA 1E43A 3QJUB 1K9DA 1WZ1H 3NYDA 4S1DD 4N0YH 1Q90A 3NURA 2OS7A 1ELSA 3TE9A 1RZGA 3VH8A 4JVPA 3TYDA 2QJNA 3FRPG 4Y4HC 1KM5A 3NJFA 4FQJL 3I3BA 5FYLL 3SSGA 1U4EA 4KXCA 2X2IA 3T8XA 4I1RA 2CBPA 5AYUL 1NEZA 3HFYA 4NWUH 3B0VC 2NY5L 4M7JL 2SEBB 2ED7A 5A2KH 1EZUA 1QASA 4GIAA 1CGVA 4KKQA 5I1KH 1EP2A 5D70L 1F05A 4NQED 4HXBL 3BJFA 1LROA 3BHBB 3FCSB 5JHDE 3U9PL 2V63A 2V7NA 4DKFL 3Q1SH 1FWHC 1GEHA 3AWOA 5H94A 2HVJB 4FG2A 2J79A 3ZIMA 2OXNA 3SPCA 1FFNA 4YTQA 3D3VD 3TH2T 3L3GB 1R46A 3H7BA 1TJIL 5CJNA 4BH7B 1BBJA 3XINA 3P81A 5FUOL 5GGRB 1BXBA 3TLRA 2APTA 3DIPA 4I9WE 4FIRA 1FDZA 3S9IA 3SQBB 1SJDA 2C0HA 1TCRA 4PMQA 4DZ8B 1U3ZA 1HJQA 3LIZL 1XYCA 3RFRA 5DLMH 2V4LA 1YDOA 1AACA 4URTB 4NI8A 2R1YA 4O02L 4GQZA 4MSSA 3WQ6A 1XL6A 5I5MA 4QJ5B 3ZS4A 2BHYA 4EK7A 1CMOA 3L12A 3TYGL 2X4PA 5C0BD 3VRLF 5C0EB 4DP6X 1JK9B 3TO4B 1N2VA 4WV1C 2HBXA 1MAML 3RVXD 1G7MA 5CMAB 4JKMA 1L4IA 2AV7A 2X2UA 5AALA 1MNSA 3SJVA 4UNVA 5I2UA 4IX0A 4GSQA 2E6DA 1UD8A 4NO0A 4Y4HA 4U6XB 1E5CA 3M47A 4K4KA 4Z76A 4F48A 3C5SA 3LH2L 5GZOA 4Z7W<