3OLIA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iv03
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 171
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oliA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oliA01
3CHCA 1JF5A 1LL6A 5AC5A 3H53A 1EO5A 2E40A 3RO8A 4JCLA 1JNDA 3N04A 4J3XA 1UZ1A 2J7BA 2DIJA 2YFOA 4J3SA 5M3WA 1ODUA 2DH3A 5ABFA 3S5ZA 4H7VA 4UNIA 4JHOA 4JIEA 1UR2A 1R75A 1UYQA 1W91A 4EE9A 1CZ1A 1K9DA 3THCA 3OBAA 3W29A 2WM0A 4Q22A 2CYGA 3WN6A 1E0VA 4HZ7A 3BVWA 2WZIA 1DTUA 1V3MA 1WDRA 4JKMA 4D72A 3UR7A 4HU0A 3WQ6A 2ZXQA 1UKOA 1KGWA 2VX7A 3W25A 5CZKA 2FE0A 1LWHA 1DWGM 4IPNB 1VBRA 2XFYA 1HL8A 2VX4A 4AIEA 2ZICA 3POCA 3TTSA 4CD4A 3AHXA 1FP9A 1T0OA 1EDQA 1M7XA 6TAAA 5DT5A 4AMXA 3WL0A 2BY3A 3IJ9A 1UKPA 2EEXA 4NSBA 4CU6A 1KTBA 1PX3A 2D22A 2O9TA 1QBBA 1C8YA 2XUCA 4HOXA 3D5HA 7A3HA 2D20A 2VRJA 3ZSTA 2YL9A 3MV01 4B9YA 1G0CA 1KWGA 2X1IA 3LMYA 1WB0A 5I5RA 4Z2LA 2AOSA 4JFSA 2VURA 3EMZA 4AZ5A 1WZMA 1BSIA 4P8VA 8CGTA 3WUGA 4HMDA 4W5ZA 2WMFA 2OYLA 4AMWA 4CVWA 4AZBA 5CPSA 3DYPA 3T09A 1KBKA 1JI1A 1GONA 2HVMA 3WH5A 1ISZA 1LLOA 3TTYA 7CGTA 1UWQA 4HPGA 2VI0A 4H8HA 5FKYA 5A8NA 3HG3A 1VJZA 2XN2A 4MADA 2ZX8A 2BHYA 1FOBA 1TQUA 2WWCA 3GYCA 4H41A 1CXHA 3PTQA 3GXPA 1ITXA 2GDVA 1O7DC 1UWTA 2PWDA 4JFTA 1CGTA 3VGHA 3WD4A 3WMBA 3F4VA 3BUIA 1FHDA 4AYSA 1TVNA 5LA2A 4QLKA 2BVDA 2OW7A 4MDOA 1JAKA 5D8ZA 4HA1A 3G6MA 3VKKA 1NWUA 3L4ZA 4XZBA 1KR1A 3W6LA 3F5JA 3ARWA 2XWEA 4GPNA 1XHGA 1PIGA 3BVVA 5D9NA 3OLEA 4PUDA 5FL0A 2WSPA 3CUIA 3W27A 1BLIA 3W37A 3CIVA 3BAXA 2FDMA 4PTVA 3BLPX 3CTTA 4JAWA 2TAAA 4MB1A 4BQ3A 5GNXA 3UEQA 3VINA 2G3IA 5C71A 3AFBA 4NRSA 2CBUA 3NYDA 2XVLA 3ARVA 4P7NA 1B90A 1HTYA 3VMNA 5BRPA 4UQCA 1W3JA 1EOMA 4FF5A 4U3CA 2EPLX 1QHOA 1B2YA 4Z2JA 3VIHA 4PMYA 1GQJA 1PX8A 2A3CA 1EQPA 4NZFA 3OGRA 3SCOA 3CZSA 4W93A 3AXIA 2EABA 4CCEA 1KWKA 1I1WA 1ZBKA 3L4UA 4EAMA 3MUZ1 2GVYA 2YJQA 4E2OA 1M04A 2WMIB 4A4AA 4NX0A 2ZOXA 3SCRA 1V3LA 5IHSA 1EIBA 3PTMA 4IPLA 3MUAA 1VBUA 1H0GA 2J7GA 1HJUA 2DEPA 3PBGA 4YHGA 1B3XA 1OGBA 2VVNA 5ECUA 3N12A 3VD9A 1TE1A 3FNDA 4HZ8A 4B16A 3GXNA 3BXWA 1QBAA 2VNCA 3AIRA 4P8WA 4E8DA 1H1NA 2Z1SA 3FAWA 1R85A 4TVUA 2XN0A 2Y5EA 1UA3A 2ZX5A 3ZMRA 3THDA 2EPNA 1V3JA 1WNOA 4F8XA 4XUYA 4A3HA 4CN6A 4JL2A 3MU7A 1ZBWA 2VVSA 3PZIA 5M03A 1UR0A 4N0RA 3AI0A 3HG4A 1C7SA 3WQ8A 3AS2A 5IFPA 3CPUA 2VZVA 3D52A 1FFRA 3OLDA 1HL9A 3WH6A 4BQ5A 1W9XA 2FH8A 3UG3A 3ZQ9A 3MUIA 4X0NA 3WDPP 4OJYA 2VCCA 2D0GA 1C8QA 3WELA 4PBGA 3EDKA 1M53A 3QOMA 1HJXA 1C92A 1DP0A 1UQYA 1W9DM 1KCKA 4F9JA 2DSUA 5D8WA 1E4NA 3K4AA 4WIWA 1UD3A 3NCOA 3ARYA 2WMKA 2GJXA 2FGLA 4R5EA 2MANA 1QI3A 3M46A 3IANA 1ZBCA 3AMGA 3AS0A 3FY1A 1BVZA 3AQUA 3NDZA 2VL4A 1EA9C 4R27A 4ACYA 5A6SA 3N17A 1E71M 2ESCA 1ISWA 1W3HA 3AISA 4PMXA 4E4PA 3VSTA 2DSKA 1B3YA 4TUFA 2O92A 4XB3A 2BHZA 5A6MA 1R86A 2J74A 3BLBA 1G01A 4L4PA 3SURA 1LJYA 4UQAA 1G9HA 1Q4NX 2WKLA 3SUTA 4JCMA 5A94A 1N82A 4RE4A 2G41A 3EJRA 1XCWA 1H5VA 4LYPA 4D6EA 3VOCA 3A24A 4B15A 5FOOA 3N15A 4UQEA 2XWDA 1KXTA 3BH4A 3NJ3A 2XSAA 2UWFA 1XGZA 3WY3A 2WHMA 1US2A 4KMQA 2WANA 1WE5A 3TONA 3CZEA 4LYQA 3W0KA 3OLGA 5LA0A 2FGZA 2WBGA 1TQSA 4D6HA 1KQYA 3UCQA 3VILA 1TG7A 3VGBA 5I6SA 3VDHA 3RJXA 4H2CA 1MW0A 2GK1A 5EFDA 1ISVA 1GPFA 3WY2A 4CCCA 1EHNA 2UY5A 2WYSA 4URIA 3EMQA 3ZOAA 1XD1A 4NRRA 4Z2HA 2DQXA 4AMCA 5ABHA 5AYIA 5A6AA 3WNMA 5JBEA 1BHGA 1C3FA 3W28A 1W1VA 1UHVA 1VENA 5A6BA 3S2CA 2UY4A 1OM0A 2A3BA 2PF0A 4TXEA 3HZ3A 5E0FA 1E4MM 3TP4A 3OGSA 2ZXDA 2VQUA 1J01A 1PIFA 3A4XA 3KWXA 3AS1A 1TQTA 3PZ9A 1HJQA 3HN3A 3SCUA 2VZSA 2J7FA 1V0LA 4KRUA 3WMSA 4UR9A 4Z2IA 1DWHM 1QNRA 2CESA 2X05A 2F2HA 4DO5A 3WDHA 1A3HA 4U2ZA 3U7VA 2W91A 1BGAA 4W8AA 2EACA 2VRQA 1OSEA 3MV11 1V6XA 3FHQA 1JYNA 5IFTA 1W3KA 3OZOA 1HJVA 1ZU8A 4GIAA 3LRKA 1J0KA 4FLOA 4J3WA 1JD7A 3GH7A 1XH0A 3FN9A 1W9UA 2CBJA 4YPJA 1KXHA 3NSNA 3VGEA 5HDRA 2GDUA 3A5VA 1E5NA 1H09A 1OGGA 2QF8A 3BVUA 4M81A 5HNNA 4OZOA 1SYTA 4PCTA 2W66A 4C7GA 1C90A 1UZ4A 3KL0A 4ZENA 4QP0A 3LPOA 1CWYA 1MXGA 1F4AA 1ZBVA 4PRWA 4HTYA 3U5UA 4PTWA 1J9YA 1VAHA 5JBDA 3GZAA 3MSDA 3SCPA 2PB1A 4AD3A 5A2AA 1PX4A 1E6PA 9CGTA 2NSXA 4AIUA 2YDSA 5I23A 3VPLA 2CKRA 1CNVA 1PAMA 1VEOA 1WPCA 1XYZA 2F7QA 3DHPA 4UQBA 3DDGA 3WD2A 3MMUA 2OLHA 4BQ4A 3T0AA 3HU7A 5D9PA 4QLJA 4IISA 2WB5A 3A4AA 2CXGA 5CPTA 4LX4A 1QOXA 3ZO9A 3VIOA 1QX1A 4CGTA 1JNEA 3WH8A 1NQ6A 3MMDA 4MTVA 1UG6A 5KEZA 2GUYA 3AZRA 2D0FA 4OBRA 4DM2A 2Y8VA 4NZCA 1V02A 2EBNA 1BG9A 2W4XA 1TMQA 5CSYA 1UH2A 1KCLA 1D2KA 1HJWA 1R46A 2ZX7A 3CGTA 3BSHA 3QGVA 2GSJA 4PMDA 3U5YA 3DECA 1CGYA 1E73M 4PMVA 2WSKA 1E3XA 1ZB5A 1VRXA 4D1IA 4GZJA 1JZ6A 4OOZA 3WFZA 4F9DA 5GPRA 1GHSA 2PBOA 1RP9A 4ACZB 1BYCA 2WHLA 2GJRA 3WDJA 3ARQA 5CPQA 2WAGA 2XGIA 1J0YA 2ZXBA 4TVDA 2O9PA 3JUGA 3SUWA 4CU7A 5JBFA 1W9VA 3CHEA 1FH7A 3GNRA 3ZJ8A 1CECA 5AC4A 4OOUA 2W62A 3RMEA 1KB3A 3L4VA 1JYWA 4DO6A 2X8RA 2BVTA 1ZJAA 2ZUVA 3GBEA 1G94A 2CPUA 1JGIA 1GUVA 3B9AA 2NT0A 2IXVA 3I3EA 1M03A 1VEPA 3K4DA 1QWUA 3I3BA 3DX3A 3EYPA 1H49A 4JFUA 4AD4A 4ZXLA 1NOUA 3CUHA 1SMDA 3KLKA 4D6DA 2CKSA 3VX0A 4OGZA 4PMZA 1J0JA 3NUKA 3L4YA 1K9TA 1QPKA 3AIWA 5I79A 3RJYA 2V3GA 5BXRA 2QHAA 2WMGA 1D7FA 2VQTA 4J28A 3RIKA 5D9OA 1FFQA 1QI0A 2ZUMA 4UQDA 2G8ZA 3DYOA 1R34A 1AVAA 1AMYA 1SMAA 2QPSA 3WNPA 1J0ZA 1GCYA 1UKTA 1RH9A 3WQWA 5IHRA 1CIUA 5BXPA 3GDBA 1HT6A 2RGLA 1MW3A 4FLSA 1W2PA 2X0HA 4WLCA 2WMJA 1BF2A 2CHNA 4GQQA 3VGDA 1CLXA 2ALWA 1AQ0A 1XSJA 1H4PA 3UERA 3RPMA 3SIMA 3WNOA 3KL5A 1LL4A 1TUXA 2E0PA 3WEMA 3H54A 1V3KA 5A6LA 1NARA 1XCXA 1JAEA 3D4ZA 2DIEA 1VB9A 3AYRA 3VM5A 2F1AA 1QI2A 3OGVA 2UY3A 2DH2A 2XG9A 4HU8A 4AW7A 1WAWA 1HKMA 2IXUA 1QI4A 1VF8A 3TV8A 4UFIA 4AD0A 5JIWA 1C93A 2XVPA 2WNWA 2WKGA 1G1YA 1CLVA 1DWAM 2A3AA 1JZ3A 4UZUA 5A6BD 5DFAA 3VX1A 4WKFA 3MSGA 3QOKA 1X6NA 1HJSA 3MMWA 3PN8A 4OKDA 3ZM8A 2D1ZA 1GQIA 5BRQA 2YA2A 4MB4A 4KRTA 3RM4A 4C7FA 1GQLA 2YOCA 1MQQA 2XFRA 1BAGA 2OWWA 3VIGA 2VX6A 4GZEA 4M56A 4NF7A 4X0VA 1CGUA 1PZ2A 3A4WA 3LX9A 4P7OA 5ABFB 1QI5A 4DWSC 2W61A 1H11A 1E0XA 4QCFA 4GXPA 1E43A 4CKQA 1BFNA 4Q7NA 3AOFA 4U3AA 4DUVA 4ATWA 1UD4A 2ZX9A 8A3HA 4AZHA 4DM1A 4W7UA 4WSKA 1JZ5A 3VSVA 3VMOA 3PZQA 2RGMA 2OWXA 2J7EA 5GNZA 3WNNA 5D4YA 4F79A 4HZ6A 3PHAA 3AHYA 5EBAA 1QHPA 4GKLA 4JFWA 5DO8A 2VT0A 3F5KA 3AS3A 2F7PA 4UFMA 4AISA 3CC1A 1NOWA 4W7VA 4TTUA 4EANA 7TAAA 1V6YA 1IZKA 2DSZA 2O9RA 3M6DA 1BVNP 1UA7A 2WVSA 1JDAA 3LPPA 3AIVA 4CN1A 3ARTA 1KR0A 2Y8KA 2DSVA 4AZCA 3LXAA 2F8QA 1ODZA 4UFHA 2E9BA 4S3KA 4WKAA 1ESWA 4PYSA 1GOQA 1B3VA 3H55A 1HXJA 5C70A 3OG2A 2XM1A 4D6CA 3IJ7A 5AYBA 4W84A 2VC9A 3T08A 1KXQA 1JIBA 2J62A 4FLQA 2VZUA 2XSBA 2DT3A 3PZVA 2FHFA 1U33A 2J4GA 1V6UA 3PZOA 2YKKA 1CYGA 5FIPA 3T0DA 2YA1A 4FNTA 2J77A 2WWDA 4W8LA 2D24A 2J7DA 2J25A 4CUCA 1EDGA 4OBSA 3PTKA 2YIHA 2F18A 1S46A 3UG4A 1E0WA 4DWSA 5E6ZA 3GH5A 2WC7A 3U57A 4X9YA 2WVVA 3AXHA 1IV8A 1HKJA 1OWQA 4PN2A 1C7TA 4UOJA 2EAEA 2PWHA 3EDJA 4AEFA 3K1DA 1GOMA 1QHZA 2ZIDA 4HA3A 2VZTA 1U30A 4Y7EA 1R47A 1KBBA 4GQRA 1LQ0A 1O6IA 3SUSA 3VIFA 2J7HA 5I77A 3ZJ7A 1E1FA 2X09A 5ABGA 1HWWA 1CGVA 4GZIA 2X0YA 3MUY1 1JZ8A 1WDQA 2CETA 1CEOA 3B8SA 5A8OA 1HKIA 1W1PA 2YL5A 1TR1A 1E70M 3BUQA 4HA4A 3GXFA 3WQVA 4LYRA 2G3NA 1JFXA 1XYFA 2F7OA 1OGSA 1RPKA 3SEPA 1GOKA 3POHA 2WCGA 5A6JA 3LRMA 3WNKA 1NP0A 5FD0A 1TA3A 5IXEA 3NIYA 1ZJBA 3WNLA 1IT0A 3OB8A 3CLWA 1C8XA 3D51A 5AY7A 4PSPA 1KGXA 1NM9A 1K6AA 3N13A 3CMJA 4U31A 4JFVA 2NW0A 3WIJA 3AIQA 3ZJKA 1CENA 2VR5A 1GJWA 3FHAA 4CD6A 1R7OA 5E9AA 2OSXA 4HPHA 3AZSA 1FH8A 1NP2A 3ECQA 3LPFA 1BYAA 2WBKA 3WF0A 4AXNA 2J79A 3N18A 4V27A 3BCDA 2PWEA 1EOKA 1V0MA 3KLLA 2CCRA 3GXMA 2E3ZA 1W1YA 4BA0A 3ZR5A 2YFNA 3L2MA 3WUBA 2YDRA 2O9OA 3VM7A 1BGGA 3EMCA 1Q6EA 5BROA 4U5KA 3CBWA 3AMKA 4PTMA 4CD7A 1B9ZA 2Q8XA 4NI3A 3HG5A 1E1EA 3CHFA 1JG9A 5HPCA 4PMNA 1L0PA 5GQBA 4MB5A 4QAWA 5CLWA 4B9ZA 2XVGA 3W38A 3VVGA 5HBFA 2J75A 3EJTA 1MYRA 5E6YA 2E9LA 1GNXA 4LXFA 2XVKA 4MJ4A 4FNRA 4UFKA 4QLLA 5I0DA 1RD6A 3T2QA 3EBVA 4UTFA 2D73A 3II1A 5FL1A 5CSUA 4PCSA 3L4XA 1B31A 1V02E 3WDRA 1H3GA 2PI6A 3VNZA 2DT0A 3CZKA 4EK7A 3AMLA 3ZT6A 1CXIA 4ZEPA 1SR0A 2BY1A 3AMCA 4ML4A 4WF7A 4FMVA 4JL1A 3CZ8A 5JIPA 3NDYA 3UG5A 1EXPA 3WD1A 1FHLA 3W53A 4BQ2A 2E9MA 3TOPA 4TOQA 2XGBA 3WF2A 2E8ZA 1HX0A 2C0HA 3CZJA 2JIEA 1BTCA 4E8CA 1W1TA 3APGA 4D6IA 4W5UA 1VFUA 1OCQA 1QW9A 2V3EA 4OIFA 1UOKA 2DDXA 1VFOA 1KXVA 2A3EA 4FK9A 4EKJA 5DMYA 2ZUUA 2CITA 2VX5A 2GJXB 3CV5A 3D4YA 2WZHA 2PWFA 4GI6A 3AHVA 1UD5A 2BVYA 4D6FA 3BVTA 2ZE0A 4J7RA 5A6KA 2JF7A 4GI9A 1L8NA 3FW6A 1GHRA 2G3JA 2VR4A 3BAWA 4DUWA 4J27A 1NH6A 2CBIA 1UH4A 4MNJA 4TVCA 5BXSA 5ABEA 3B9DA 3W4RA 4W87A 4WK9A 2JEPA 3SCQA 3EDEA 2QV4A 3G6LA 3AICA 2JEQA 1JFHA 2WHJA 3VDBA 1MQPA 5A2CA 1LL7A 1B1YA 1J11A 1UR9A 1JYVA 5A8MA 4IM4A 2WXDM 4CCDA 2CIPA 4XV0A 2FH6A 4F66A 4V2XA 4AC1X 2WHKA 3CZNA 4WKHA 1ZS2A 3MS8A 3WD0A 1GOOA 4U33A 2YLAA 2EXOA 1I75A 3N9KA 4TX8A 1LG2A 4PMQA 1E55A 2OSYA 3A3HA 4K68A 1HP5A 3VGGA 3WH7A 4M24A 4BCEA 3VIMA 5LA1A 3PZUA 3ARSA 2GK1B 2WCAA 2JF6A 3EJPA 1LG1A 4P7QA 3DDFA 4W85A 4UFLA 3WQ4A 1H2JA 3M07A 4U2YA 1GORA 2V3FA 2BNJA 1EQCA 3WKZA 3WUFA 1M01A 3VGFA 4W7WA 1NOFA 4WSJA 3AXXA 4W89A 1HVQA 4KH2A 4MB3A 3VO0A 1HP4A 4GINA 3VMPA 2OW6A 1V08A 2CERA 1TQWA 4PMRA 3IK2A 3NSXA 2VO5A 2YDQA 2YA0A 4HMCA 4KGJA 4UCFA 4NZJA 2VOTA 3EDFA 4GI8A 3L4WA 5GNYA 3UESA 1J0IA 1J0HA 2ZUTA 4D71A 1FP8A 3WF1A 1TZ7A 3W24A 5KZ6A 1W3LA 1R7AA 1PS3A 1CXKA 4BS0A 4C7DA 4QDMA 3ZJ6A 1K9EA 1H41A 3VD7A 1TQVA 2XPKA 2EADA 3CZGA 2YL6A 3CUJA 2FHBA 6CGTA 3A23A 5DT7A 3TA9A 3ARZA 1CXLA 2C8NA 2E4TA 3B9EA 3HMCA 2JE8A 1PEZA 2HISA 2OYKA 1E6ZA 3BAKA 4PMOA 1MVYA 1MFUA 3GM8A 4AD2A 2CBVA 5I24A 2BFGA 3OIHA 2XN1A 2YL8A 2J47A 5EB8A 1Z32X 1OIFA 3BUPA 5CGTA 1CGXA 4P8UA 1E5JA 1MW2A 1Y7VA 2VTFA 2WMIA 4CD8A 1CGWA 3GXIA 2ZWZA 3KEHA 2CEQA 1OD0A 3BMWA 3WD3A 1U2YA 1XSIA 4TX6A 4A3YA 4Z2GA 1VFFA 2F7RA 2XIBA 4ZE5A 4XZWA 5JUVA 2C7FA 2YBTA 1JZ2A 3AIUA 1JZ4A 1LWJA 1WZKA 3QHMA 4D6GA 2WZEA 4P8XA 1UASA 2DSWA 2BS9A 3DX2A 2BY2A 3L4TA 4UFJA 1BYDA 1V3IA 5TD4A 2BXZA 2ZX6A 3DX0A 3O2LA 2WMHA 5EFFA 3SUUA 2UY2A 4ATDA 2ZUSA 3BMVA 3BGAA 2OYMA 1UR8A 2JIWA 1WZAA 3BAYA 3BLKA 1E15A 1JYXA 2EPMX 2VCAA 3NSMA 3BVXA 1EDTA 3RILA 4NXKA 3M7SA 1ITCA 1CPUA 3LXBA 4PTXA 2E8YA 4AIOA 4M1RA 2J8FA 5E70A 3VIJA 2WVTA 4CD5A 1V6WA 1Q6FA 3RDKA 1EGZA 2D23A 1EHAA 1I1XA 1UKSA 4YN5A 4AZ7A 2QMKA 1GOWA 4IUGA 2XM2A 4MDPA 1JDDA 2G3MA 2DPEA 1DWFM 1E9LA 5M5DA 3F5LA 2ZWYA 1FA2A 4MAZA 1ECEA 3MI6A 2GFTA 4MNLA 1CXFA 1GW1A 1B0IA 4M29A 5CJ5A 2XHYA 1CTNA 1YQ2A 2VZOA 1SZNA 4UOQA 3WBEA 3RM9A 3VSUA 2AMGA 1AQMA 1E40A 4TTGA 4KWUA 5EMYA 5I78A 1PJ9A 1HKKA 1SFSA 4CU8A 1MQRA 2IGTA 3KE0A 1X6LA 3IAQA 2A3HA 1G5AA 4FNSA 1JZ7A 1A47A 4W8BA 1R8LA 4W88A 2QLYA 3A21A 5A8PA 3LRLA 1XH2A 1DEDA 2ZUNA 2EJ1A 2J7CA 2VUYA 3EJUA 3LPGA 3GXDA 5IDIA 3WL1A 5A1AA 2JFEX 1VEMA 2XIIA 4QFUA 4W86A 4U5IA 3ALFA 4AYGA 3MO4A 5E0CA 2WCSA 5E1QA 1PZ3A 1E6NA 3O9NA 1UWIA 1IZJA 1MFVA 4AWEA 1CXEA 3AIEA 1GZJA 1WDPA 1DWIM 2OWCA 3EDDA 2ZUWA 2D0HA 3IGUA 5A3HA 6A3HA 1E6QM 2B31A 2X2IA 1UKQA 4M8UA 1QW8A 2W92A 1HIZA 3SCNA 2EO7A 5CQ1A 2NT1A 4H8UA 3WY1A 1UD2A 1W9BM 3DX4A 3IAPA 3GXTA 5C8BB 3AYSA 3LXCA 3PZTA 4JHZA 1NWSA 3BC9A 1J12A 1DHKA 1OB0A 3FXYA 2X2HA 1E6XM 3DYMA 3WF4A 1JDCA 5M17A 4AZIA 3QHNA 2Z1KA 4J3VA 3WENA 2BY0A 2Y4SA 3A22A 4DO4A 1XRVA 2VRKA 1C91A 1V0KA 2WVUA 3CHDA 3I3DA 5E09A 3K46A 3VUPA 1W9PA 1ISYA 3TTQA 1HXKA 3TTOA 1GQKA 4JKKA 3CZLA 3L2LA 3U7BA 4ZXOA 3KZSA 5A95A 2XFFA 5BCAA 2Y24A 4B3LA 1UD6A 4WJXA 2Y2WA 3VDAA 4FNPA 5HXMA 1OIMA 1PPIA 4D1JA 1HVXA 1FH9A 1UD8A 2JALA 1VFMA 1XH1A 3PZGA 4ATLA 1J18A 4MNMA 4LPCA 4OUEA 1MXDA 3O6AA 2WLZA 3WFLA 2VCBA 2QMJA 1E72M 1XV8A 2PBGA 4AZ6A 1WCGA 4KGLA 5A8QA 4N42A 1Q6CA 1XSKA 3BUDA 4HOZA 5HPOA 2V5CA 3HJEA 1B30A 3ZT5A 5D9MA 1B3ZA 1KGUA 1BPLB 3WF3A 1BQCA 1QNPA 3AMDA 1YHTA 3OZPA 4BZYA 1NWRA 4H8VA 2WC4A 1OT1A 1JXJA 1CBGA 1ISXA 1E6RA 1US3A 3SUVA 4DUXA 1QNQA 2W67A 3WEZA 3A6OA 1HN1A 3ZR6A 2CNCA 2WK2A 3D3AA 3E1F1 2VJXA 4Z2KA 3T0BA 4M80A 1EO7A 2BHUA 3CUGA 2GJPA 3ARRA 2EQDA 3A47A 3WSUA 2X2YA 2V5DA 2DT2A 1MWOA 3D50A 3EJQA 1OINA 1V0NA 1UQZA 4FNQA 2BV9A 3SCWA 3K8MA 5CLTA 3VD3A 2FYVA 1WDSA 4AZGA 3ARUA 3OA5A 2F1BA 1JXKA 3T2PA 1UH3A 3WEOA 5HOSA 1NWTA 1MW1A 3SCVA 1HF6A 5DEZA 1AQHA 1B3WA 1E6SM 1E4LA 2XYLA 3W6MA 1KTCA 3VU2A 5CXPA 4AZCB 4HP5A 2QPUA 1E4IA 1UUQA 3AHTA 2WLYA 1HNYA 4CVUA 4B3KA 4ZFMA 1V6VA 3IJ8A 3CH9A 4V28A 3WDQA 1OBAA 2J8GA 2DT1A 4PUEA 2X2JA 3VIIA 2PWGA 1JI2A 3BUBA 3VD5A 4L4OA 1R87A 3RM8A 4AEEA 4PMUA 1X1NA 1VJSA 3EJSA 3BSGA 3W81A 1V03A 5BYWA 4NXSA 3AROA 1R33A 2F61A 2OSWA 3N1AA 5DF0A 1GJUA 1GOIA 4JKLA 4PEEA 2DGAA 2W5FA 3BCFA 4XX6A 3S5YA 1JF6A 4HMEA 2D3LA 2XTKA 2G4FA 4ACZA 3VIKA 2CHOA 3VIPA 5CGMA 3VD4A 4DWSB 4J3UA 3PZNA 2J78A 5I3DA 3FAXA 2YLLA 2WVVB 2ZXAA 4GO9A 1J10A 2IUZA 1E3ZA 3MANA 5LYRA 1BYBA 1ZL1A 3WUEA 2D3NA 1KFWA 1PBGA 1VIWA 3CO4A 3N11A 3AZTA 4QCEA 3AJ7A 1V3HA 3VNYA 3WBAA 3ALGA 2WPGA 1QNSA 2FHCA 1UWSA 1F4HA 5F7UA 3DHUA 3W26A 1EH9A 3SCTA 5A2BA 2YBUA 1Q6DA 3ZSSA 3GBDA 1WO2A 2WC3A 4RE2A 2XVNA 3S6TA 1P6WA 3BAIA 3OLIA 2EPKX 3BAJA 2BXYA 4YHEA 2XJ7A 2EPOA 3CMGA 3WMCA 4D6JA 1BG4A 1O7AA 3RCNA 3DX1A 1UWUA 4UOZA 3GH4A 4LGXA 3J7HA 1H0IA 3T2OA 3KL3A 1UR4A 4H04A 1XD0A 3AHZA 5CG0A 1TVPA 1JD9A 5I2UA 1TA3B 4P7RA 1LF1A 4M82A 4JZ5A 3DC0A 4PSRA 1JL8A 4MAVA 2V38A 4RE3A 1GVIA 3QR3A 3K8LA 4J3TA 2V3DA 1TCMA 3WDIA 4AY1A 3UETA 1K9FA 1QVBA 1WZLA 4S3JA 4BF7A 3GNPA 4UQ9A 4GO8A 1D3CA 3ARPA 1QNOA 1DWJM 4AD5A 1XC6A 3QHOA 4MPKA 4FLRA 5BWFA 3GTNA 1RP8A 5A69A 3WY4A 5FCZA 1UWRA 3GNOA 3UR8A 4FNUA 1TFVA 1UR1A 4MNKA 3WQ5A 3ZIZA 4MJ2A 1WP6A 2AAAA 4HOWA 4ZE4A 3ZT7A 3AIBA 2WW5A 2W63A 4UZSA 1QWNA 3SCSA 3VDCA 1WKYA 1E56A 4RL3A 4CN4A 1OT2A 3W82A 3PZMA 3ARXA 1CDGA 1W2VA 2D2OA 1Q6GA 3VTRA 2VMFA 5BXTA 3K8KA 2PC8A 4P7LA 3MKKA 1OD8A 4AD1A 3HG2A 3WH9A 3CUFA 1KQZA 1GVYA 1W32A 4LQ1A 4DWSD
chains in the Genus database with same CATH superfamily
3LLDA 3NIGF 3D85D 4K2UL 3OSVA 4MZ2A 4KRZA 4O10A 4G8EB 1U8HA 1MEIA 3W01A 2Y1ZA 4OLXL 4K8GA 3NT0A 5FAAA 3RX7A 4Z23A 4UNIA 3T6WA 1UR2A 1JPST 4KVNL 3VCLA 2DM7A 2RB8A 2AL2B 1RIUL 3V79C 4I0PB 2CWNA 4QY8B 2BS71 5L2KE 4QRQB 5CZKA 1NCNA 1CZ8H 4ENED 3AHXA 4JTLA 1MNNA 4E0RB 3VRIB 3HE6D 2E46A 5FYJH 4C1NB 1PX3A 1Z0MA 4YFDB 4YHIA 5CCJA 2IPWA 3U9WA 3MRHA 5ID0B 4PJHB 4HCRH 15C8L 1XGYH 5SWZE 1GOGA 2Q86A 1GZHC 1JUFB 1X98A 2RKXA 3Q7JA 1J5OL 4CJ0A 3MJ7B 5CPSA 3D09A 5E9XA 4FF7A 1ISZA 4D8PA 2JXMB 3SY0A 3SB0A 4B5WA 5HJGA 5A8NA 4WIQA 1HNGA 2AS5M 3TXZA 4AGLA 2JCCF 2GHWB 1WF5A 4OCRL 3KDOA 1JRHI 3FTGA 3KPMB 4FFVC 4R0LA 5ICZA 3QFJD 4K8HA 4NJ9L 4L1GA 2HRPL 3V52H 3KPSA 3IGHX 1PZDA 4CMHC 1BLIA 3UJSA 4CBZA 2AQTA 3UEQA 2AJXL 3FHEA 4ZUUA 4GO6B 3W39B 4HZLA 5LIKX 1M5WA 3P2BA 3OKLA 1JNNL 3CDCA 3QLLA 4HN8A 1E6JL 1E27A 3M43A 1INEH 1RIHH 3QRHA 4FAAB 2Y85A 1CE1H 2JQMA 1RA5A 3S8GB 3JWNC 1HHIB 3MP4A 2PO6D 4Q6IA 3AC0A 3E2QA 4GC3A 1VBUA 1A6ZA 1XH3B 3DJTA 3M7WA 3PBGA 4LSRH 3FFCE 1KFJA 1XEUA 4XP9H 4F8OA 4JZJA 4IU3A 1R9ZA 3BXWA 3RX8A 5FYJU 4PFEA 5DJYA 4M43L 3O3DB 2R0LH 1LE5A 3THDA 5DD5H 5EZLA 3BV7A 4DVBA 4NN5C 4ZK8A 4QXIA 3FCSA 4N0CC 5GGQL 1QPOA 3OXSB 4UTIA 3W0WA 3HG4A 5F1SA 1HL9A 1AR1B 3WH6A 5IQ7H 4WOQA 4LWWA 1QBLH 3C9NB 5ISZE 4E36A 4Z3FA 4JIRA 2NY3C 1F11A 3DWTA 3L8QA 1I1AB 4BXSV 1K3UA 1IJNA 5D8WA 2C34A 2OJ1A 1E4NA 3T7VA 4Z1AA 3W86A 4RX4A 4RCXA 2SEBA 2MANA 2GSIA 3P54A 1QLEH 3TA3D 3O4LB 2CIIB 5DX7A 5ACLA 4WXZA 4TNFA 2K9UA 2R1WA 3FOLA 4IQJA 4IEFA 4P9HC 1G9HA 3GBML 4OZGE 4DZIA 3R1GL 1EXUA 4EDXA 3SFWA 5FK9B 3BH4A 2XSAA 3WY3A 1RPXA 4NRZB 2R23A 3T0VA 1XPGA 3KBWA 4D6HA 4Z42C 4ONOA 4BH7B 2VLJD 5D1XE 4CAGA 1OW0C 4D2JA 4JTDA 3N2TA 5GZNA 1NIUA 5LG1A 4WW1B 2HT3D 5AVSB 4AMCA 2H0PA 2PDUA 3IU4L 4HGMA 1BHGA 1HOCB 1GRWA 3PY2A 2D4FA 3N9SA 3NO3A 4XD6A 3QJHB 1LEGB 1KM6A 2I1OA 1PWLA 2PF0A 4UTBL 5I19L 2VM3A 3EXTA 2FZMA 4WOZA 5JW4R 1KB5H 1RIVH 4HH9B 1QNRA 2A99A 2V5LA 4S3DA 3KWSA 3Q8AA 1MAML 3SHSA 5BVJA 3DMMA 3J27A 1OZUA 3ZE2F 1V6XA 3UTSA 1ZA3B 5IFTA 2XG4A 4DI9A 1HJVA 3R6IA 1P7QB 3I6SA 5C0AD 2HSAA 1XH0A 3FN9A 2Z7ZA 3OJMB 5CC3A 5DLCA 3V5FA 2ZG2A 3KP1A 3G1HA 5DUML 1OTTD 3JWOH 3MWAA 2ENYA 1FH5L 4K3EH 1ZBVA 3U5UA 3FUIA 3X1FA 1J9YA 2PPCA 2FVMA 3M0IA 4PUBH 2LE9A 4JW3A 2NSXA 2YDSA 3TN0C 5D02A 2DV0A 3MLZH 4ADTA 2YMOA 4AIXA 4DJED 5IT2L 2GQ3A 2KQNA 4PJEF 3A4AA 3GO2A 3ULVC 4DYEA 5CEXA 4NERA 4XCFH 5KEZA 1JWUB 4YFLF 1DZBA 4H9ZA 1T5KA 2I56A 2IOOA 1FZOA 4KO7A 1VFAB 3TU9A 1W0VA 5EG6C 4OGAC 5C07B 1M6JA 4PMDA 3VC6A 3T0EB 1VRXA 3X1NA 3FVMA 3QZWB 4G9FB 3H21A 2DY2A 3M4HA 4RAVA 3WDJA 3NQFA 4X6FB 3V9CA 2ZXBA 4NYLA 2BPBA 5DMIH 4RLIA 3ZJ8A 4MTMA 4NJAL 1FWRA 5EIQA 2FBOJ 3MLYH 4IJ3C 2VDKL 5DZAA 4JHBA 2EO9A 3OR7A 4H0HB 1BRLA 3V0TA 2Z31D 4JG1H 4PMZA 3DX6B 4XWOD 4O00A 4DF9A 2XTJD 1UQSA 4LLVB 3CVDA 5AVVB 3MNVB 1BFOA 2C3VA 4NHUB 3DI1A 4NPYB 2ZYRA 2B0SH 3WZ0E 3OJ2C 2AK4B 3D9AH 2EIZB 4UBDC 4YBLC 3HQNA 3GMPA 1XSJA 2A0LD 2NYYD 4XIMA 3UERA 5JDSA 1H7XA 5BJTB 3N43B 1XIDA 3ZRFC 5HYSA 2DIEA 5AW8B 3VM5A 3LSBA 1Q8AA 3TWYA 2CNYA 3B3IA 5D1ZA 2WNWA 4EXBA 5DWPA 5EF0A 4MMZB 3TJ4A 5F2MA 4HGXA 2B9AA 2IAND 1YAZA 4B9KC 2QQKH 1PW3A 3F85A 2DJLA 2K0RA 3QGKC 4DK6A 3MTWA 5AZ2H 5L8KB 1YYAA 1LO3L 3DFSA 3QDGB 5CIPA 1I8LC 3ETSA 4KROC 2OMYB 4R9HA 4K39A 4Q7NA 3MUJA 4H20L 8A3HA 5F1KC 4ICXA 4PRPE 5I9QB 5FOJA 3PZQA 3GIZL 1EP2A 3CEPA 1KG0B 1XLFA 5GNZA 1OAKL 3CV2A 5F72S 2ZOLB 1NCWH 4GKLA 5KS9A 3WIHH 3AS3A 3WE6B 2FLMA 4W7VA 4GRLB 3CAFA 4JFDA 3KCLA 3CHOA 3NSFA 3H55A 4GRSA 4Q4OA 4F1ZA 2Y7SA 3B34A 3H9YA 2VC9A 2KZHA 2R1XB 3QV9A 5DVKA 5DMMA 4RGNC 4MWAE 1NUFA 4X99A 1B4RA 3DUUB 2D31B 3QW3A 3HMWH 3GJFB 1SO6A 3B1UA 3GC5A 3TCLB 3U7AA 1FPTH 1QSFB 1TJHH 1OCJA 4F7MB 2C9VA 2PWHA 2R8SL 5MF5A 5IOBA 4K3JH 1U8MB 3VB8A 4EUPA 5IEHA 4DAFA 3ZDYB 2WNQA 5T1LB 3VJ6B 4HUKB 4HA3A 5EMJA 2VZTA 4FFYH 5BZWA 5BVPH 3DX5A 5C0GB 1DANT 4QOKD 4DP6X 2NLJB 4IBZA 4EKXA 4QRPD 5C0EA 3HC0B 2H9AB 1JCNA 3MX0B 3KAAA 4KVCL 4GRWB 4LBEA 4HA4A 1UACL 4TUKH 1UZGA 5IFJB 1ORQB 1JRCA 3CXHJ 1TQCB 3GTVA 4OD1L 1A65A 4F5CA 5CJBA 4IIZA 4OZIB 2QT6A 2ADFH 4X4XB 4P23A 4WGWB 4LL9A 2Z7YA 3I74A 1ZHLB 5GGTA 2NV9A 4HS6B 4FXFA 4M3PA 5C0FA 3HFFA 3GMQA 3NPXA 5E5MA 2AXFA 3GC2A 2EYSA 5IK3A 1T5WB 3VXME 4Z0XB 5CCZA 5CP3H 2OXNA 3R0UA 5CLWA 2FB2A 2I9TB 1CFTA 3QCTH 5KS9F 5FW8A 4WUKH 5EN2A 1RD6A 5I0DA 3CNYA 5CSUA 1B31A 4JQVA 4ERAA 3T1FA 3NL2A 3PQYD 4FMVA 3CZ8A 1QABA 4JRYE 4GY0A 4DQOL 4MASA 1UOKA 4TVPH 2DDXA 1VFOA 3MOAL 2G5WA 1Q85A 1S78C 4ZMWA 1R9XA 3CV5A 4JM2C 2YYTA 1I9JH 2BVYA 4Y5VC 5A6KA 1EWHA 4ZOAA 4Z7WB 5EMLA 2E9GA 4TVCA 1Q94A 2JEPA 1LOLA 1OSPL 5EU5A 2QV4A 2DW7A 2X1UA 5FYLH 5LXEA 5CZTA 4IM4A 4M3JA 2BP3A 5CEZE 4G9DB 1KFAL 2YD3A 2QGCA 4GIEA 2DQIL 3QR1A 3O2DL 3EKLA 1X5MA 3AABA 1LG2A 1KT2A 3A3HA 4QXUL 1NCAL 5D33A 4JKWA 2CRZA 2YPKB 3C0QA 2OK0H 3WQ4A 4LUTA 4KPLA 3HI6H 3SGUA 3PWPE 4PLOB 2YPVL 5EO0A 5JHMA 2IPJA 5IW3A 5FHAH 4KH2A 5CS7A 4RNRB 5LGJA 7ODCA 3NO5A 3VCRA 4G11A 1BBDH 2VOMA 5HI5D 1V08A 4AL8H 2C1OB 4LAQL 4HK3J 5IMMB 4WTXA 1ZVSA 4PJ8C 4EI5C 2CO7A 5LHEA 3ARDA 5PAZA 2EGZA 4ZW3A 1WKFA 1K9EA 1IBGH 1N9PA 4KUZL 5CZXD 4B5EA 1QYGL 1S38A 1GG1A 3HMCA 1PEZA 2HISA 5CJXA 3MVSA 2VDNB 1MFUA 5KBDA 2W95A 1CDHA 1FG2A 4KX8A 3VFOB 1O75A 5KG9A 4KZEH 3Q6FA 1KLFA 4B5XA 3OTTA 5AB0A 3ARBD 5F2GA 4AC7C 3ISIX 2AV7A 2VGLM 1ACYL 3BMWA 3WD3A 1QUNA 4OD3L 2EDXA 4XD4A 4ZW5A 4YSAA 4X0KA 4FX7A 1E9IA 4YLQT 4Q97A 3QSRA 4N4YB 4N6FA 3VE0B 4HT1H 1S9XB 5B3JE 4I87A 2K70A 1ND0B 5C1MB 4E4FA 1X7IA 1WDAA 1ZWIA 2LAAA 3BAYA 2VCAA 3RFAA 4K5OA 3MV7B 1Z3NA 3GSNA 3BN9C 2QV2A 4ZAKA 3S9YA 4WV1A 2R27A 1LQAA 4Y2DC 1TRIA 1LO4L 2P5EA 2WQAA 1JDDA 3GF8A 5J6HB 4TMBA 4JHAL 3DKLA 3F04A 1XIMA 2E6DA 2ZRWA 1IE7C 5I03A 4UQIM 1GW1A 5CJ5A 2YXGA 1CTNA 1VCGA 1WDWA 3VSUA 3U7YL 1E40A 1R3YA 3H26A 4FQXD 3V4UL 1T4KA 1BVNT 5K69A 4UI2A 4YEFA 4CNUA 1OM9A 1K8DA 3W1UA 2OL3B 2GVLA 1T96A 5IDIA 1XF5B 4QFUA 3U2IA 2C9AA 4YTQA 1UWIA 1M4KA 2QJMA 2AAVA 1WCQA 4Z1YA 3WJYA 4LDCA 5A3HA 3M0LA 5GGSB 4KQNA 5CBAB 1LBMA 1VBGA 3DOSB 4DGYH 3LXCA 4A2RA 5C09B 3VNJA 4ABUA 1N8FA 4P46C 3K6NA 5H6HA 2VH5L 1YDPB 5DS8A 3QHNA 3NESA 3DUHA 4GX8A 2VRKA 4Y8EA 1ZSDA 4K7PH 2HSIA 3LHPL 2H3BA 5DELA 3O9WC 5FYKL 4YMZA 3T4YA 4BJLA 5F7DB 4BE6A 1FH9A 1TQXA 3TBTA 1E2ZA 4XSMA 4LEBA 3KPQA 1RXOB 1MXDA 3O6AA 1URZA 2F53A 1XV8A 5AHIA 4FMFA 5T3ZE 4KTGA 4EN3A 1Q1JL 4IIHA 5REQB 3BUDA 2Q3AA 3UZEA 3S8HA 1IGSA 1IGCH 1RUQH 4EF8A 4Q4IA 5IF0A 4RRPA 1FN4B 4ZGYA 1WHOA 4E9RA 1F9CA 4Q8NA 2J8TA 1EO7A 3R79A 1TJ0A 1MLCA 4KY2A 4L61A 2GJPA 2VC6A 4R9XA 2ZG1A 2V5DA 2APVA 3FFOA 5F4WA 1C5DB 1KV7A 3NABL 4GY1A 4OFVA 4ZB2A 3BP4A 2DZVA 5J04A 1SVCP 3CVIH 3WBWA 1O4UA 2IBZY 1U3YA 1KTCA 3AY4C 4QCIB 3AHTA 3OZMA 2Y69B 4C57C 1VH7A 5E9DA 1BF6A 3V95A 1Q0XL 5IHUL 1ZXQA 3VD5A 4BHUI 2X12A 2ADGA 1ETB1 5FM5M 2KYIA 4RAUA 2IPTH 1W54A 4GIYA 4M1GH 1JWMB 1GOIA 3F4DA 2XVBA 3LJ3A 3TNMB 2UXTA 4KERA 1AYRA 3OJGA 3W11D 2G4FA 5IB1A 5D7KE 5F7YC 1HYSC 3RX5A 4F20A 1VGEL 2RH0A 1JVKA 2ZXAA 1RUMH 2X3AA 5C2XA 2NWSA 4PV8B 3FU7B 3HMXH 1YNYA 5AOMA 2QTVA 3GB6A 3P80A 4Z1CA 3WBAA 3DROA 1DJNA 1KM5A 3OAWA 5A2BA 4LUIA 5DCEA 3QPZA 1DXFA 2WC3A 4PW4A 2MUCA 43CAA 5TBOA 5IM51 4UT7L 1SJCA 4P9ML 3CBRA 5IKCB 1O7AA 3DPBA 4UOZA 2XZCL 2WOBA 4F37K 3TXVA 3WTYA 4WWPA 1TIUA 5I2UA 2IKJA 2QUTA 4MXVE 1Z89A 2EVIA 4S3JA 4R2GB 2Q2LA 3TBVA 1F3DH 2CUMA 5AW3B 4LS1A 1RP8A 4WHCA 1S3KH 3BW9A 3BGFB 4GUQA 4UUJB 4LY4A 3WQFA 2J6EL 2VC2B 1KZQA 2RUSA 4FOJA 2F84A 1OAYH 1ZHBA 5EMMA 3M44A 5ANME 3TLQA 3PZMA 1UEMA 2CLIA 1BZ8A 4P7LA 1ID5I 1OD8A 1SVBA 3C2OA 3SKNB 1RUAL 4LQ1A 2AJVL 2NV1A 3CHCA 1SQMA 3LZOA 4G1MA 3WFHB 3ZE1B 2CLVA 1Y0EA 3VOIA 4D9RE 4LNCA 2AJZA 2DH3A 5ABFA 2A74A 5CEZL 4G7FA 5CJOH 1U8PB 1ZLWH 4EE9A 1PL3A 4QRTB 3K6OA 4H01A 5CC7A 5LDSA 4MVBC 3DETC 3NQAA 3B8IA 1CFMA 3WQGA 3DZ1A 3I68A 5IVXB 4Y1AD 3S5NA 3CXOA 4CD4A 1MI5D 4B9GA 4U05A 4R0LC 1KCSL 1KV5A 5AAMA 5D5ME 3V4VH 4KEMA 1M7IB 1A5MC 3PFQA 3VFVB 2Q76A 2EEXA 3AGVA 5FXCH 1KTBA 1OCRB 2DV6A 4U1HA 1QBBA 5FA5A 2X42A 3CZFA 4ZQTA 3D5HA 4KK9C 4HOMA 1T1WA 1G0CA 4YHOH 3PL6D 2EF9A 2WN2A 1J9RA 1OEPA 4OZ4A 1XR8A 4IRSA 4DKDC 2SFPA 5AHEA 4OJFH 3T09A 4GMTL 4KTEL 3NDOA 4NL1A 3FQWA 1I9IL 4H8HA 1RFDH 3M47A 1MF2H 3LN4A 5DZ9A 4Q6IC 1XT5A 3GYCA 3RU6A 4UTKA 2B1HH 1V6TA 2PWDA 1X1OA 3BUIA 4JO4L 4ZS7H 2ERJC 4F3FB 2BVDA 4JZJC 4FQQA 4OZHE 1BKHA 1XHGA 4YHMH 5SX5H 3W27A 5CKSA 3MYZA 4WDXA 2PDKA 1TR9A 5C8JB 3IGFA 5LUMA 4U1IA 3PPHA 3NPSC 5FFLA 1FWXA 3UAFA 4JG5A 2JLPA 1W3JA 1V4YA 2AVGA 3VKDA 3WHXB 1MHCA 1IC4H 2FQDA 4A6YL 3OGRA 4MDIA 1MUCA 3FO1B 4X3ZA 1NF7A 3HE7A 3BYTA 3FB7A 2H2PD 4CCEA 3HM7A 4PIRF 2O6EA 1R3JA 1GZQA 2AITA 4JG0L 3PPCA 4NX0A 3IGAA 2MH4A 4PRDA 3QC6X 3WFCL 4OF6A 4PJCA 1LDPH 4X9BA 4I13B 1RLDA 1OGBA 2YBVA 2BIHA 3V4PH 4ZBJA 3SAZA 1OCCB 3VXRD 4I85A 3IDYC 2HTKC 1T21B 5FLVA 4YDKL 4AQAB 3W23A 4KI5F 2Y5EA 3BQ5A 1VSCA 4PJIA 4LKXA 4IL0A 1QG3A 4G5ZL 2QGEA 2YGOA 3AI0A 4MCZA 1B6DA 1U5JA 2K6WA 1PNDA 1W9XA 3MUGB 3ZQ9A 1TVBA 1KW1A 1T04A 4PBGA 4DH2A 5GZNC 3GI9L 1DP0A 1TJ2A 2YD7A 1CL7I 3W2UA 3CYJA 2XICA 3AT8A 2R4RH 2HFGH 2EP6A 3QMTA 4KJPD 1WOAA 4B9CA 4TUOA 1SW0A 3GT6A 4BRJA 3WYRA 3TC9A 2VL4A 4LSUL 1K5NB 1GJPA 5IZ7A 1RCOB 4I0CC 4PMXA 1EK3A 2NY1B 3AO0A 4OLUL 3OWRA 4A6GA 5L4FA 4C4BA 4P0DA 5E94B 1JHKH 2WKLA 4NOFA 4JCMA 3S1GA 4R90H 4O02B 2D2CC 3EJRA 5DVOA 4XBEL 1CU4H 5AVNA 1KXTA 1WIUA 1US2A 1AGEA 2PEVA 1MJ8H 2GQ8A 1JPKA 5E93A 3H7RA 1T7VA 3BDXA 4WTZA 3W7EA 2B3RA 1GPFA 3APFA 2IAAC 4KAQL 1JULA 1TXKA 4EPEC 2EYRA 4Y2NA 2J9XA 4RWYL 1R9YA 4N2NA 5HQLA 1XGUB 4L2LA 3O81A 4KWSA 3VYPA 3SDXA 4J3OG 1FGVH 1FJ1A 5E0FA 3M6YA 4FG2A 3OZLA 2O1AA 3KWXA 2V0AA 3QFEA 4O1DA 1X9QA 3NZPA 3EG9A 1ZKAA 4PJCF 5AB3A 5IBTH 2DS4A 4BDVA 4XTIA 1A3HA 1I1AD 4C65A 3PBWA 2RHGA 2Y07L 3C09C 4ICCX 2YEVB 1JYNA 4PS7A 1WXJA 1JV2B 4QNPF 3BTNA 1J93A 4PJIF 2HJFA 5TIMA 3RBSA 1W72L 3FT2B 4U7SA 2KMWA 1FTXA 1OGGA 3ZXWA 2OO6A 2R82A 1I3GH 1QKZH 3FUFA 2YPLE 1NTDA 3O4LD 4N8PA 1IWPA 2DOCA 1O1ZA 1MXGA 1SEQH 5DRCA 5GRVL 3B2MA 4NQDE 2FJGA 1DIEA 1PX4A 3BT2H 4LCVA 3E0WA 2FIKB 4N8UA 1RJRA 4HK3N 1RQBA 2K3TA 3VPLA 5DO2C 5E5UB 2R69L 4PPTA 1SPDA 1LLWA 4PBVC 3B06A 3DFNA 3QJZA 4AQEB 2YQBA 4IG2A 3QG6B 3BO8A 1KTJA 4P2YA 2GUYA 1X5ZA 3S4SG 5M1TA 1KEMH 1BG9A 1U95B 2BS8A 5I66A 5E2WH 4F93B 4QYOA 5D7LA 2F5AL 5ETUA 1S9VA 4ONVA 3BZFB 3WFZA 3LHWA 5L6YL 3O2DA 1SYVA 4DWHA 5CPQA 4HALA 5AYQA 3CL6A 3EUUA 5DANA 1FH7A 3VXTA 3RTLA 3IJHA 4QISA 4HT3A 2VGIA 3CO8A 2BVTA 3QJRB 3G9AB 2VDMB 1P7QD 4DCQB 4IMLB 2BIPA 5D1ZC 3SDXF 1WYIA 4AD4A 3SQMA 1SMDA 4XZLX 4RFOH 4RUBA 2QCEA 4UMGA 4WFED 1N7ML 4OGZA 5JO5A 4WI9A 4XHJD 2E25A 3AYVA 5CBEB 1KC5L 3S9ZA 2J4WL 2UZYA 5I79A 3RJYA 3TFXA 2JGQA 5D4QA 3BN3B 1EF3A 4N2MA 3O15A 5JW4N 5IBXA 4KKZA 4D9QE 2V5KA 2E75C 4DVRH 4GFSA 1QFWL 1UKTA 4NO0D 3DGGA 2OX4A 2Y3NA 3S3DB 1Z41A 3PTDA 2PGFA 3VU1A 1S7TB 4GQQA 2NZ1A 4JO8A 1CLXA 2F8IA 1QEWB 4G6AD 2OR9L 3KL5A 1YCSA 2HT4C 2AEQL 3VAVA 3M0VA 5EA0H 4U6HB 1QFWM 5HMEA 2NW2A 1NUGA 5EBLB 4DEPB 3INOA 3H6AA 1VB9A 1DEEB 1M3IA 2AV1A 2IH1B 5C07D 1UPPA 1WSST 1BJ1J 2IQ9L 3TQKA 3VWKA 3T0ED 2BRRH 4AD0A 3FT3A 3AWEA 4G9FD 1CT8B 3MSGA 1BREA 2VLME 4PGJA 5KMYA 3F7VA 1S7XB 4LMQI 3N2XA 2DMKA 3TASA 1HL4A 3BGGA 4GD0A 2XFRA 5D1QB 2IBBA 1FVEB 2VX6A 2DQEL 2P24A 4NF7A 4RMTA 1YEDA 4NNXA 4DN4H 1QI5A 1TEFA 1E0XA 4Y4KB 5HHOE 4KWOA 1DCLA 1AZVA 3N3MA 3OVQA 1RV6X 5F71A 4ABVA 3E6FA 3N4EA 5HWJA 4XZUA 4FGMA 1QHPA 3BH9B 3L16A 4EANA 4OV6F 5B38B 2WVSA 5DRXB 1JDAA 5J12C 4F4RA 2DSVA 3B2UD 4JTQA 5CAHA 4Z0SA 3RDTC 3GUGA 3JR2A 2V9RA 5FM8A 4RX0A 2AK4D 3S48A 4HMNA 4JN7A 5HQMA 4OCWH 5DR5H 1Q13A 4W8LA 4P23C 4JZNB 1IC1A 1CIDA 4AK1A 3DO7B 4F91B 2WVVA 2P7TB 4JYFA 1OG6A 1EGMA 3H4GA 1KCBA 3B6SB 4WWNA 5JHLH 1ZLUK 1O66A 4L4TD 1U30A 5AD0B 4HW6A 4N2IA 3W2DH 2X09A 1JJUA 3B0VC 4RZCA 2Z2AA 5CPMA 5ERWB 4ZS6D 3NFPA 2DWXA 3HC3L 3TNOA 3W74A 3NCJH 4JQVC 3C0JA 4M6OL 1OFOA 1HEZB 3WQVA 4LARH 1SVZA 1D2OA 3POHA 2VGFA 2HN7A 1B5TA 1DQLH 2GK0A 5B7FA 4RMRA 2IDQA 1ZE3H 3GSWA 4RDWA 1WITA 3M7FB 1UADC 1PG7H 3CXHK 4GRLD 4HUXB 3PV7A 3ECQA 3EX1A 4LQFL 3STPA 4JVPA 3L2IA 3CH1A 3TURA 3KLLA 1G4SA 3QYQA 1U3ZA 3RNDA 2FLBT 2O9OA 3EOOA 3LHAA 5I1DB 5E4EB 3KPOA 4JY6B 1R0AL 4ES8A 1AXSB 3FO9A 2QCFA 4PVBA 3KOZA 1UMYA 2OXGA 3EBVA 4K94C 1QA9A 1FWIC 3OKDA 1AMKA 4W70A 1QSFD 5I28A 4KY1H 5IJVA 4OF0A 2BVQA 1FHLA 1XBYA 1D9KB 1N2RB 3VQ1C 2J71A 4N3UA 1UVQA 5EU7E 3TS8A 1ZANH 2KX9A 5T3XH 4O2CB 1JPMA 4JPWL 2CDGA 4FF9A 3A3XA 3SECA 1FZMB 4YL9A 5DMYA 4B9IA 2HP4A 3ZKNC 3TL5A 2FKPA 3MROB 1INDH 1KGIA 3BPLC 4LC6A 1AY1H 3TO2B 4GACA 3ARDC 4PREB 3HCVA 3ATAA 3VQMA 4IHOA 3QQ3B 2JEQA 3II3A 4CQ8A 4B96A 2NY4B 1CF8H 1LL7A 4FYRA 1SFTA 4LPVA 4HTBA 3QQNA 4D7BA 5EA9A 4U1KB 4NM4L 1CLOH 4CW1A 3KXFE 4JS7A 1ZS2A 3MS8A 5CJXC 5FECB 3RVUC 2XKNB 3RWJB 1EZVY 2ILLA 3MRIB 3S9DB 1E55A 1ZNNA 4V1DA 3DIFA 4Y16A 1OM3H 1OGPA 1DUZB 1ZOXA 1TZ9A 1N6VA 1XWVA 5C7XH 2B4CL 2QPFA 5KVDE 3U0WL 4JFFD 3L6FA 3VOHA 3SDCA 2JKIS 1AKJA 3K0YA 4PUUA 3ZLGA 1Q7MA 2CERA 4PS3A 3P67A 4RNFA 2YA0A 4OGXH 1OC7A 1HI6A 4O4YH 1TCRA 5F1NB 2J6EA 3UESA 4BH8A 4D71A 3UIYA 5GS0L 2ZRVA 1C9WA 4BS0A 5JXED 3STZA 4NC0B 3BICA 1NC4D 1CDBA 1A6TA 5SX4I 1EPVA 1KN2L 4L8BB 4ZAKC 4U0RC 5E99L 1CN4A 1O5QA 4WV1C 1W37A 3RU8H 2PDWA 2PRHA 3O6DA 3PNWA 4AD2A 3N85H 3N6QA 4XCCH 3TT3H 2V0TA 1N19A 4HHMA 1ZGLB 1C12B 1CE6A 2Y1VA 3O3RA 1FFTB 4W9IC 5I1LB 3TFKD 2VXQA 1SZRA 2XIBA 2O56A 5FF6A 2EUVA 3RCMA 2BS9A 4Z7QB 2P88A 1S5IH 4AITA 1IBHA 2NZ9C 2ESVB 3HGOA 5EFFA 2UY2A 2WJFA 1RZGB 2NQLA 3W1ZA 1O9ZA 3M7SA 3DRTB 1CPUA 3VSQA 2VD9A 2AQ1A 2E8YA 4JTFA 2OCCB 4WWID 1RULH 5BZZA 4GT7A 1UKSA 1BQKA 2I9LB 4PWEA 3MJ9H 4O51B 3QUHA 5MHSD 2O26U 4OQTL 1Q6OA 1ECEA 2X4TB 2PXYA 2V2CA 3RZCA 1IGML 1YQ2A 1IVTA 2RAMA 1AQMA 2D9QB 1W15A 2P50A 2OP4H 3DVIA 1NDMA 1EC7A 2OU4A 3IAQA 4H88L 2ZTKA 1S5WA 5LBGA 1P2CB 1V7ML 4KKLD 1RVFH 4FR6A 4OWGA 4EN3C 4AWEA 3KX6A 5CJQL 3UZEC 3PGFL 4GMEA 2D7QA 3CVHA 3D33A 5DGQA 2REQA 5E6IA 3MRPA 3SCNA 2Q7YB 5AW9B 2PP7A 3QCUH 4QWWC 5FHBH 2P5WE 2HAZA 3SYAA 1Z9OA 2VMEA 2OR7A 4A7GF 2Z2BA 4UINH 1Y6NR 4U6XB 3SO7A 4HWZA 1POJA 3Q58A 4FJYA 2AXGB 4KRPC 1CFVL 5HYSG 5D4JA 2FK9A 1F4WL 3LD5A 2F19L 2KC0A 1TV3A 5F6IC 2A7PA 4WJKB 1J18A 1TPEA 1XWYA 5DDHA 3I4KA 1HQ4B 3SE3A 3RN6A 1NDGA 3VACA 5A8QA 4N42A 2ZOWA 1B30A 1J8HE 4N22A 4M62H 1TTQA 1NWRA 2HS6A 3BDYH 4V15A 2FB3A 5EO1A 4QX4A 3U2CA 2XX1A 1QR1B 1EQWA 4M80A 4NKIL 2BHUA 4PJEA 3WTVA 3WSUA 1LBFA 1UQZA 1AH0A 3OF6D 1MFNA 2ZOOA 2F9RA 3TWAA 4PWFA 3W2MA 1PV8A 3NJXA 3KTXA 3SRKA 1OFBA 3HQ1A 1LO2L 3ARFB 3MJ8A 4AKQA 1E4IA 1F8MA 3AU1B 3QDMB 4XPAH 1JI2A 1YNKH 3FCTB 5C09D 5ACZB 4UAHA 4Z7UA 5TE6H 4DVOA 2BNUA 4YVNA 4TV6A 3VK5A 4M8QA 4JKLA 3D3VD 1BJMA 4IBVA 3MRGB 1FCBA 4YFLI 1B4LA 3F7PC 2GJZB 3MT1A 3HLKA 3E3HA 3OPZL 1AD4A 4DWSB 5F4XA 3TYFB 3MANA 2CRIA 3FU0A 4LEXH 5BOJA 2APSA 1G4MA 1ADWA 2ZKYA 4EUPG 4R84A 5ID1A 4O0QA 4YXLH 4RVBA 3W26A 4FG6C 5BZXA 5EV7A 4HHPA 2NY0B 2XZAH 5E2TH 2QCDB 3W5MA 3NZHH 9PCYA 4OUIA 3DX1A 1Z5HA 3VRJA 3IMRA 4BKLA 3WMQA 1BOGA 1RJLA 1QTPA 1OOWA 3QIWA 3SGEH 4GUPB 4AZUA 2B8OT 3PF2A 4A63A 1HKLH 2A74C 5D7IB 2VDPH 2BGNE 3OIXA 3IDGA 2AF2A 3UETA 4Y19A 2BG5A 3FN3A 4HJJH 3X3FH 3MKVA 2A4ZA 4GO8A 2DKUA 1R2RA 1F6FB 4ZSOE 1W72A 2UWEB 5CGQA 5MERA 2LOEA 2C18A 2E6AA 4UT6L 3I02B 5ITFB 1FCVA 2FQIA 3NEHA 5JHAA 1P1ZA 1WP6A 3QK0A 4Q89A 4KI5C 3HI5H 5AAMC 4Y9CA 2QSTA 2W63A 4HXBL 2YSWA 1E56A 1KMGA 4AY8A 4P2QA 1G6RA 5BU6A 3ZVVA 4QLWA 4NQQA 4FXTA 4DPQA 4J35A 1OE2A 2XN9E 1K4GA 2VLKA 3GSXB 3MJ6A 2A5HA 4WTQA 1SOXA 5MEOA 4IRSC 4MA1C 4KEVA 1MY5A 3EWYA 4YEEA 3T3PF 1T0NB 2CK0H 3PHQA 5JPMA 4S3AA 4Z7UF 3ZIMA 5DEFB 4N0YH 4A37A 2WM0A 3CDGB 4JDTL 2VDRL 2DMBA 3BVWA 3QI9B 3I2CH 1HDMA 1WDRA 1DHPA 3UR7A 4WD0A 2PP1A 1A4BA 2VR8A 2ITDB 4YHZH 4N6RB 3LNDA 4WKZA 3VA2C 5KVDL 4J9JA 4RZKA 4HAKA 3E0IA 3JV4A 4XNQB 3D0VA 3R11A 1P0DA 3FQXB 5F1IA 5DD3H 1EB3A 4CU6A 1FYTE 2DQGL 3SJVB 4EQ3A 1C8YA 4JR5A 4JDVB 5D93B 4NUJA 4C6NA 2ZRXA 2WW8A 1ZA6A 4N2YA 3GRWH 3EX6A 1PZ5B 2B4GA 5A2FA 4WK2B 5LDUA 5T8IA 4P8VA 2ICEA 5ESQB 4JQAA 3SYCA 1Q9WA 4GQGA 3B05A 1NIEA 2AQSA 4WHTB 3BMXA 3WH5A 3HE7C 3AXLB 2WUCL 4ZQCA 4X5XB 1GGCH 4QRRE 6FABH 3NH7L 2ZX8A 1FOBA 4KUCF 3LN5B 4S3FA 1XUUA 4XVUC 3VGHA 3ESUF 3WMBA 3F58H 3NJIA 2PR4H 3QUXB 3MLSL 4XVJL 3F6JA 3VAEA 3LRSB 4XZBA 1KR1A 1MAKA 5INCB 3WG6A 5J1AB 2DW5A 4UV4L 4A3QA 5KYXB 3CUIA 4R5VA 3CC5B 1S7RB 1Z6KA 3IVSA 4BQ3A 3BLFA 2VDLB 5C71A 4K23L 3N9GH 1A02N 2R15A 1HSAB 4P7NA 5B1BB 1HTYA 4FB7A 4IRZA 2A5UA 1KJ3L 1WS7A 5G55A 5D1ZI 3UY7A 4JMXA 1X7QA 1XSOA 4EPDC 1X5AA 4LDLB 1I2NA 1I0BA 4F8TA 1AD0A 1B3JA 3G5YB 3C2VA 1S2UA 5DA4A 5IHSA 3DU0A 4KK6D 2FEEL 4MLIA 3HKFA 3B7SA 2HWGA 2BP0A 4JDZB 1EWEA 5F9WB 5JIHA 2Z7KA 1TE1A 4PJAE 4AH7A 2B1OA 4GH7B 1QBAA 4XCNA 5DD0L 3LEXB 5HHXL 1I8IA 1HINH 1WNOA 4JAMB 2QVFB 4NNPL 5DWUL 2L7UA 4F7KA 2VVSA 1OHLA 2QVIA 1AO7A 4AKPA 2E59A 2Z4QB 1VKFA 3MRKB 5HYJA 4AU0A 3UPRA 3VFLA 3U25A 3E2VA 4A2GA 1C92A 1DJZA 3HG1B 4MQSB 3RVXC 3EW3B 2DSUA 2DYRB 3EWDA 5I0WA 3KYMA 5IQLA 4DZBA 4TUUA 4FYQA 1EA9C 1E71M 2IXQB 2P45B 4AYDC 3ROOA 5KBPA 4GQ9L 1B3YA 4D0BA 1DQQA 1BQHG 4BR1A 4XB3A 1R86A 4HU4A 1E30A 5CD5C 1IKFL 2TSBA 4NQXA 5FA4B 4BI6A 2OMUB 4XBGA 4BK8A 4B15A 1IAOB 4PRHA 5L6UA 4OCXH 4PJ6A 3MRJB 3SKOA 2UWFA 4HXAH 5DVLA 2AJYH 1LQBC 1L5GB 2JVUA 3OLGA 3VB9A 2AHIA 1ZLSL 3RJXA 4QSFA 4DZ5A 5F9OL 5B8CA 4E9VA 2WYSA 1ROWA 1N18A 3B8TA 4BFKA 4XNMA 4ZZKA 3ENEA 1E9PB 3QUMB 3HNVL 4LHUG 3EWUA 3D0CA 1WDDA 4J1UA 1ZLPA 1EZLA 3PZ9A 1QWGA 5E4IA 1EMTH 3WMSA 4NSKA 2VDHA 3FO2A 4DO5A 2BP8A 4DSYA 5EMUA 4ADGA 3LGDA 2PDJA 2OEJA 4N2LA 4HGWA 1JRHH 1G7VA 3HJZA 3TJLA 2HMIC 3NSNA 2H26B 1N0XH 1E5NA 1QT1A 3ZYJA 2K3HA 3GQYA 4LRTA 3OKKB 2VSCA 5F9AC 4FQIH 2VERA 3VZXA 2XWJA 3BPNC 3ULUD 1U93B 3O6ML 4RRPG 4W9JC 2NY1D 3LZLA 4HJEA 3LPOA 2NRDA 1FHUA 1A64A 3TCEA 4X50A 1BOYA 1OK4A 2B1AH 3R2GA 3BP7B 4X7TB 3UP1A 1LD9B 3QF0A 3EO9L 1QSEE 2CLHA 3AREA 3TSMA 4IU2B 2LHAA 3UTQB 1SPQA 5I23A 4JRXE 5LBVA 2WWKT 1OARL 1FWJC 4L3CB 3EBHA 1QX1A 5FA3B 1F8TH 2NX5B 3WS3A 1NQ6A 4MTVA 1JZHA 5EHFA 4GXWA 2OSLA 1A5KC 4WUUA 1TFHA 5IBXC 4MRCA 4XXDA 3VOGA 2NX1A 3WEXB 2IGFL 1NAMB 1E73M 1E3XA 3VFCA 3SDAA 1YIXA 2WOQA 4CQ9A 1B9KA 4UTWA 4H00A 3SQLA 4P5TB 2C13A 4X61A 3C8KA 2H0EA 2VN7A 4DPBX 3RMEA 1AIFB 3KYNA 3INUL 3CHSA 3SBPA 3KLSA 3GBLA 3L9YA 4PR5A 2G9KA 4HWEL 4B3VA 4GW4A 3VWKC 5KBKA 4XC1L 3GLEA 3UJTH 1J0JA 4AYID 4XOEA 3MREA 3AIWA 2KZKA 4M7KH 4MJIB 1DJIA 5FKPA 4N9CA 5AYXA 3CFCH 5AALA 1R34A 1KIRB 1OYBA 4RFNB 1J0ZA 4NKMA 3MFFB 4TSBL 3RZWA 4MQXD 1F58L 2FYYA 1TZGH 3M9YA 3SKMB 1ADQL 3WBYA 2CHNA 1F6KA 1IM9B 1KFLA 4C55A 3SIMA 2V2WB 1LL4A 4ABWA 3TEYA 3IRDA 1XTLA 4OI7A 1FWSA 1BJ1H 5A6LA 3A12A 3QJFB 2OMXA 3L95B 2Y7FA 3RWCA 1M68A 4E5XA 12E8L 4NZUL 5D72H 4F2ME 1AOZA 1QNZH 5JIWA 2XXCB 4R53A 1A7QL 5JU6A 1FDJA 1XLEA 1TCDA 1OSYA 1KTLA 4XWGL 4U1NA 1HJSA 2ZOKB 3ZM8A 4P3DB 4APQD 3FEQA 4JRWA 3CSFA 2NY2B 1MQQA 4DP5X 1XFCA 3LDBB 3G5VB 4J3OC 1WK0A 2W61A 2MCG1 2ZKWA 1YYMH 3P4MA 2AAMA 4LU5L 3KYKL 1BQHA 5KSWA 1U2HA 1R3VA 2NUPB 4NO3B 4F79A 1KRMA 2WJ7A 1MCDA 4XD3A 4O9HH 4OQTA 4TTUA 3RCYA 2OZTA 3LEVL 3X17A 4HHAA 5J9PB 5BRZA 3EJZD 4V11A 4E9SA 5DTFA 1RUSA 1ODZA 4Z3IA 4O2FA 4L8DA 4UM9A 1XR9A 4D6CA 2J9ZA 5HI4C 1T5XB 3K72A 2ATSA 4FLQA 2EIBA 3TEUA 5EGRA 1OK0A 3T0DA 1UIPA 4DNMA 2XG5A 2D24A 2YEZB 4WY7L 4W9DC 5CD3A 3EOUA 4LHUA 2F18A 1WJ3A 2IOIA 2GTWA 1HXYB 2DAVA 2QGDA 1X6UA 3W3OA 2F8VA 4X9YA 3EZ8A 4WDWA 2EKGA 2G3ZA 3AXHA 1AS7A 4IBSA 1IV8A 4Q56A 4MNQE 1QACA 3UEZA 3BKJL 3R8HA 5C08B 4PJXB 1VHCA 1ONXA 3FO0L 1IARB 3CJJA 4AQ1B 3S3BB 1TPFA 2WXMA 1RK7A 1NAKH 3STLA 3VFSB 2XBTA 2XV6B 3QN3A 3DKJA 2UXFA 2F15A 4Y4KD 4YNYB 3AGWA 5I1HL 4CSSA 4S3GA 4NZTH 3PWLB 1BXXA 2Z3FA 1T3FA 2DJ4A 3AG2B 2F5BL 1WBZB 4OT7A 4ZFQA 3QP3A 5GGVY 3PGDB 1YEJL 1XXXA 1IX2A 2Y1YA 4H13C 1EIXA 1YEKH 4DF1A 1VADA 2YDRA 1N5AA 4J6RH 3UZJA 1D5ZA 3M17B 5HPCA 5ENWB 5I74C 3CZUB 2CU9A 5GQBA 4PMNA 4QAWA 4NQSB 4B9ZA 3BLDA 2XVGA 3MLUH 4JHVA 5E6YA 2ISDA 1GNXA 4LXFA 4XVSH 4P3WA 3NEVA 4IOFD 1WAAA 3L4XA 5GRUH 4PC8A 4PTUA 5T9CE 3BZJA 3C3UA 2X7LA 3E49A 1MZHA 2KAUC 1AH4A 2MHAB 4U1MA 3W53A 4Y16C 3ONCA 1J2BA 2E8ZA 5F3BB 4C90A 4QEEA 2AI0L 1W1TA 1QW9A 5EDSA 3HQPA 5CUSL 3CFDA 2E5CA 3BH8A 4YDMA 3MRDA 4EZMA 5I16A 2Z24A 3HHRB 3SDCC 1T1XB 3WXVL 4NO5B 4UTBA 4DJMA 1ZLDA 5FEBA 1SOKA 1UB6B 4J27A 2H32A 4O1AA 3F7YB 5AFAA 1I1RA 4W87A 3MTRA 3UWUA 3NR0A 4JFOA 5IMKB 5IOKA 2FT6A 4AHPA 4LGRB 3OHMB 3WJWA 2A77H 1B1YA 1SMOA 4HULB 1JYVA 1FXPA 2WXDM 1YDNA 1FBIL 3ABOA 4AC1X 1UWEH 3CZNA 1JCTA 4HSAC 3S3PA 5M94B 4LASL 3L48A 3S3SA 1VPOH 4BCEA 2OTUB 4MY1A 4DKFH 3PZUA 4WTZG 3DX9A 1KM3A 2FMOA 5BMXA 4DBEA 4NNYA 1GORA 2PYED 3CSYA 5MENA 4LUJA 1PKNA 2X88A 1EQCA 4DYKA 3O8XB 1OXYA 4ODVL 2V82A 1HVQA 3BUYA 4K5MA 5ADPH 3QEQB 5D05A 4E5TA 4NRXB 4FZEH 3L3OB 4JIPA 1T1YB 2JI3A 4CJ1A 5EU6E 1D9KD 4TQPA 1FFPB 4NZJA 2Y70A 1J0IA 1KPRA 2YCIX 4JIQA 3WF1A 3PS6A 2ZFAA 5C2BL 1PS3A 4QDMA 4BXVA 1SJDA 4HF5H 1INQB 1NDZA 1JQXA 3TA9A 2QYGA 5IBLC 1I1FA 1WAAF 4MGXA 2C8NA 1I60A 3BAKA 2X4PB 3RLUA 5DRNB 4JJOA 3HG0A 4AGMA 2Z91A 1TMLA 1OB1B 4XMWA 2XDHA 5I24A 3OIHA 3HNTL 4DFHA 2GJ6D 4GIOA 1MW2A 5JQHC 2VTFA 1HH6B 2PXYC 5KANG 3RZCC 1GG0A 1V7NL 3LZ5A 4GJ1A 4XN1A 2EYTB 4XKYA 4L3EA 2NY4D 5DCCA 2KS0A 2FPYA 5JUVA 4LSTH 2IW0A 1X9LA 1K4CB 3D46A 1E5YA 2WZEA 2JB6B 3W2KA 4TV3A 4Q2ZA 4KNUA 1I53A 1JPSL 3P5ZA 3SADA 1EPXA 2OLAA 1KXQE 3WLPA 4G8FB 1W6TA 3SUUA 2ABBA 1ZMYA 2ZUSA 3US1A 4XOCA 3WGVB 1G9NH 2WIIB 5D8JH 1SU5A 4UU9A 3CIWA 3RILA 2E68A 3QVQA 5LJYH 3HHMA 3BSZL 5E6IC 4M1RA 3LY6A 5HBBA 1GH7A 2XPGA 2WVTA 3OV6A 3UYOD 2OZNA 4L8CB 1T6WA 1G67A 3AU2A 3A64A 3RX4A 4G6CA 2YJLA 4FP8L 4KTDH 1FO0L 2J3SA 4AVIA 2JK5A 5L2KA 1EEQA 1DVJA 5LN4A 5GSVA 3CTLA 4XNDA 4UDUA 5ALCL 4H1LB 3Q8FA 1SFJA 5A2LH 1JPDX 4I0PD 3B0XA 2FIQA 2HZHA 1JOIA 5F6HI 1F4YL 2R56L 4QT5A 2JFEX 1XYAA 3SE3C 1FL3A 5E0CA 5GGSY 2IDFA 8FABA 1IT8A 2X2GA 3RPDA 2BDNH 1WUFA 2VUOA 5J11C 5GSRA 5SWZA 4ELKB 1WKDA 1A3RH 1CVRA 5MEPA 4MDJB 1C8PA 3QDJE 1LTDA 2Y7GA 4TQEH 3VI4B 4L1BA 1QR7A 4KKCD 3Q8EA 5BU9A 3W1PA 3U1SL 4LK4A 2V7NA 4X7SL 4NCC2 4MZ1A 1Q90A 4DO4A 5GRJH 5E09A 3DTDA 3V0DA 4PJDB 3F2DA 5B7EA 1BM3L 4R26H 4LLDB 3WO8A 3D6GA 3U7BA 2V17H 2UV3A 4WJXA 3KUMA 1DLFL 1KIPA 2PE4A 1UB5B 1HVXA 2AJUH 3TYGL 4ORGA 4PN6A 2OJEB 1SDDA 4IS6A 2VDQL 1ILUA 1X7SA 2V6AA 3BLIA 3S9IA 1SBSH 1GGUA 2WINB 3GO1H 4WFGD 1PU0A 3WF3A 3AMDA 3TA6A 4X6DF 2XCMC 2H6PA 1JXJA 3IIPA 1E5UI 4EAEA 3MQTA 2WK2A 1MQKH 1L6ZA 5B1KA 3L08A 1W5QA 3P0YL 3D50A 4O16A 4M7LH 2BV9A 2VITA 4JFYA 4LAUA 3TZVA 3SCVA 3DMMC 2ZWKA 4D0DB 3LEYH 4HJIA 4NLHA 3FFCA 3HOJA 1NVMA 5DXXA 5AN7A 1ZUAX 4OCSH 1UUQA 4IFKA 4MAYA 5FS5A 1OBAA 4E2DA 1PDKB 5DUBA 3U6RB 2R1LA 5T3ZL 3QIWC 4U1LA 1DQDL 1GS7A 4B92A 1V03A 1QEXA 2XTLA 1J05A 1AP2A 1A5LC 4GS7C 1FH2A 4I89A 1JVLA 3P9MB 4ACZA 5ISZA 3CIXA 2NNXA 2IGLA 1AR1D 5D09A 3HAEB 1PBGA 5AHNA 3LB6C 3KZ8A 1NGQH 3LENA 3AJ7A 2I5YL 4NJKA 4DKAA 1CX9A 3ZZQA 4ZUVA 3QG7H 3C8FA 1J5CA 5EPMA 4W6YB 6REQB 5BS0B 3GBDA 3GDCA 4XNYL 4ZA0A 4YVVA 2DIAA 1ZHKA 1PCXA 2ITFA 1UWUA 3I75B 3HZVB 2VLLB 4OZGA 2QADC 4Q9RL 1RR2A 4IBWA 5JR1H 3Q3GB 3BOXA 3OQ3B 4P7RA 5JPMC 3HNSL 2OXHA 3M1OA 4WWOA 1KN4L 4ZX3A 3NZ8A 1JV5A 3P11H 1QNOA 4F2EA 2FVNA 3ARFD 5D1XA 4JNMA 1ICPA 3HHSA 4QJ4B 2FX8H 3HBGA 1V93A 5I76A 4C4KT 3BD4A 3N2OA 5FCUH 3BURA 2WNGA 3QDMD 4HIIA 1RI8A 2OLDA 4KETA 4ICMA 2BOBA 4LCWB 3MRFB 3N0AA 8XIAA 5DJ6A 3QRFM 1W2VA 3LOTA 4F9PA 2EC8A 4PRTA 1QFPA 4HZAA 3PR2A 1E28B 4DWSD 4KXBA 3NMEA 1U8KA 4G80B 2ICEC 3RWIB 4BI5A 2J7BA 2YFOA 3Q9QA 1S9WB 5EBMA 2Q8BL 3VRLE 4QXTB 3SRFA 4YBQC 1JZEA 1OGTA 5AYUL 1AQDB 4X5QA 3ME3A 1A22B 1UTDA 4BFRA 1R2TA 2YPVA 1P0EA 2D7NA 3SD5A 1Z1WA 2W9EH 1BXAA 3P7YA 4X4KA 2F7IA 2HA1A 1WYJA 2X4OB 2J1WA 2IQ0A 2ACRA 4MKMA 5KBLA 1KGCD 3MJMA 7XIMA 2O9TA 3S3JA 2XUCA 4HOXA 2LLGA 5JYMA 5I3GA 3QH2A 3ZVHA 4Z2LA 5E1AB 2XIQA 4JRFA 4W5ZA 4LEOB 2A79A 3E3QC 4OZGF 3TFBA 4WFHE 7CGTA 3G6AB 1UWQA 2QDEA 5IQNA 4WI3A 3JWNH 1U2CA 3UTTE 4Z78A 3GXPA 4ILDA 2BX7A 1O7DC 4DJDD 3HBZA 2YARA 5CM1A 1DBJL 2YS4A 2MRYA 1ADQA 1MJJB 2A6IA 2HXAA 2G2RA 4AYSA 3NJMA 3WQOA 1L9TA 4WAFA 4HA1A 4Z3EA 3MLVH 3G6MA 3VKKA 2FT7A 3LK6A 2WXIA 4WNSA 4ADIA 2J27A 3QZLA 4M51A 2YX0A 3QNYA 2Z34A 2EIEA 1AHWA 3CTTA 4PJGB 4MB1A 3VINA 2G3IA 2CLZA 4NJHA 3LNEA 3B9KB 3QI9D 4GKZA 4PYHA 3O11B 1TIMA 4B97A 4NN7B 3NCWA 2NNFA 1MWAH 3SCOA 4UQ3A 5EZIL 3UZWA 3WBXA 3L4UA 1CDUA 3OGCB 2DKSA 3C08H 4A4AA 4WEUD 2ZOXA 1DL7H 1T7XA 4UTMA 1IL1A 2XWBB 2DICA 5DN1A 4B16A 3OODA 4DW2H 2W0FB 1E5AA 4P9HH 2E74C 3F4NA 1V55B 1ZLUH 2ZX5A 1V3JA 3ZKMD 4B5NA 4E42A 5KZCB 1P5VA 4YCPA 5DRIA 4F7TA 3HPJA 2AGKA 4YHKL 4BQ5A 3PFRA 1RZ8A 3DFHA 2HYMA 4PB4A 3GSVB 2K4WA 3RLGA 3QFJE 2CBQA 1XLIA 1E8XA 3QUXD 3EJJX 3NK3A 5B8CC 1U92A 2J8UB 2QAFA 1LXMA 4P5MB 1MJUH 4OECA 1MIEH 1EF2A 3ZHLA 3HN8A 3IEAA 4PRPA 1X5GA 5IHLB 3RWDA 4DGWC 3F5WA 3S4TA 3QDGD 4DX3A 3N17A 1J9QA 1ISWA 3BJFA 3VSTA 4Q7IA 2JJUA 1S7QB 3U46A 3BLBA 2FATL 2VDOB 3FS2A 4FTVB 3TNNB 1SSGA 4P2RB 1TVHA 3O2WH 1OO2A 4LYPA 2IALB 4EIUA 4JFZL 1DXEA 3W22A 2DQJH 2BVEA 2LTQC 4LYQA 4GBXA 4AM0A 1WBYA 2V2HA 3BAEL 1E7UA 4MWAA 5EFDA 1T80A 1TPH1 1VKXA 2DQXA 3P02A 3AREC 2QF7A 2YXOA 1GKRA 3P4OB 3W28A 1W1VA 3O45A 2GJJA 3L3IA 1OM0A 1X38A 5IQMA 3S2LA 5DUPL 3H3BC 3SYPA 1E1CB 4UR9A 4Z2IA 3ULVH 2NWRA 3DRQB 2C14A 3HG1D 5T1LD 2F74B 1OSEA 4N9GB 4QMEA 4R33A 4A1RA 4L37A 1OLZA 2QF8A 1F4XL 1FAIH 1K2DA 2Y0SA 1I85A 3I7SA 3ANUA 3SDAC 4PCTA 3WNJA 4JTJA 4NKQB 1OF0A 4Z7OB 4UTWC 2EKSA 3N4FA 4KKBD 5HJBA 2X87A 3RI5F 2B4CC 4OGQC 1YY8A 5BO1L 3UTZA 4IK6A 4DZAA 5AYYA 3OKEA 4N9EA 5DRWB 4A29A 3EWWA 4GKNB 4EDWL 4UQBA 3QQDB 3HO8A 3VXMA 3ABXA 4KRNA 2VE6A 4IISA 3FC8A 3H42H 3P0VH 3QXWA 2GPZA 2QFPA 1UIOA 1NKRA 5JHDA 3SYQA 4MD4A 4DM2A 5GS0C 3EGSB 2EBNA 5IB3B 5E2VL 2NY6C 3UGXA 3W7OA 3GSQB 2GSJA 3EYOA 5D96B 3U5YA 2O61A 2WSKA 4YDLB 4F9DA 4WEEA 2XY1A 4JRYA 1NBVL 4JUTA 4F58L 3S3GA 4JPIB 5A7EA 3S35L 1SF3A 4CU7A 4ZB0A 5JBFA 4EQ2A 4AWTA 4MD0A 4O2EA 5D71L 1A3ZA 2B5IC 4YS1A 2WO5A 4TSAL 5C0AE 1L3NA 4LSPH 4N87A 4ANUA 2OV0A 3GE7A 1G94A 1GUVA 4WJ5A 1D8CA 5F0JB 4BUHA 2GITA 1CL7H 5GS3A 5IHZA 1S9KC 2OJZH 5EOCL 4LY8A 2N56A 1ZT1A 3OVPA 2BSEA 1XL6A 1UT9A 3NUKA 1X4YA 1OYCA 3ELQA 4A7GA 4NHVA 2R2BA 3SQSA 3VFGL 3WKNA 3K13A 5D9OA 1XZ0B 1QI0A 4XPTH 1D5MB 1QBMH 3P3UA 4ZVJA 2QPSA 4HKJA 3QHTC 4I18A 2V30A 4OIAA 2GFBA 1QNIA 1WKEA 3S5OA 5E2UH 1R0MA 4HCGA 1NKGA 1KKOA 4FYSA 5EUOB 5FUZL 2IWGA 2RA1A 4JEGB 3PWPA 2NX5D 1OP9A 3D2TA 3NGBB 1JAEA 3UYRL 3EA1A 3W7HA 3QPQC 1XF2B 4HU8A 3U4EA 1QI4A 5JNYA 3FKRA 5E03A 2NW3A 2V8ZA 3K6SB 2WP3O 4PRRA 3MMWA 1R3HB 1S3RA 3VW3L 3O6LL 4M1DH 4P5TD 2D7OA 4GVHA 2IQAB 1GQLA 3L9RA 1PKQE 4B5TA 1HZHL 4X0VA 4JPKH 3LX9A 4P7OA 2XWXA 1Q3NA 3GC4A 3MN8A 1JHTA 3HVDA 1T8XA 3Q5TA 3OVGA 2R0KH 2C15A 3EX4A 1FWNA 2A6KB 4YHYC 3P3TA 4N0FA 4A68A 2ZWLT 1FWTA 3MWCA 4MJID 3KPRB 1GTFA 5GVJA 4FA6A 1FO0A 2HNEA 4HIHA 1LT8A 3LXAA 1T20B 4DP1X 1Z5LB 4S3KA 4BINA 4PB0L 4MCYA 3S6OA 3QPXH 3GB7B 1ML1A 4MIMA 4M5YH 1HHHA 1QATA 3QLDA 5IMOB 1HSBB 3ZZLA 2J4GA 1ZCCA 5FIPA 2PAJA 3SOBH 5K1VA 4W9HC 2WWDA 1L6PA 4A6YA 3U2EA 5IBUG 3P1VA 3CUPA 4JFEB 2P80A 4U6TA 3E6EA 3P30H 3WX7A 1OCNA 3DJRA 3Q2NA 1OWQA 3GXUB 4KZ0A 4WENB 5CZVH 4TNWF 3MV7D 3MBEA