3OLIA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iv03
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 171
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3oliA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oliA01
1JXJA 3AIUA 2ZX6A 1B3XA 3ARPA 3FW6A 3SCTA 4TTUA 5BROA 4OOUA 3AXIA 3LPGA 2FH8A 2PWHA 3L4UA 2J7BA 4FNUA 4P8WA 1K9EA 1TQSA 3SCQA 1VJZA 4XX6A 2XM1A 3MS8A 3SUVA 3WH6A 1G01A 1GOQA 1OGBA 3BC9A 4MDPA 3DYOA 2XSBA 3WY2A 4XUYA 1CXKA 3SUSA 1H11A 3K4AA 2IGTA 1WZLA 1R85A 1EO7A 1EA9C 1NQ6A 1VEOA 3PZTA 3PZUA 1LL7A 4P7NA 3ZJ8A 4U2ZA 1XD0A 3CZSA 3WD2A 3GXDA 1EDGA 1PX4A 1XRVA 2CNCA 5JBFA 1PIFA 3WQ5A 4B16A 4RE3A 5HPOA 2VNCA 1OT1A 4R27A 4OBSA 1E4NA 3WDRA 1ZBKA 1QPKA 3O9NA 2BY2A 4DUWA 1E4IA 2OLHA 2VZVA 3PZ9A 1NOFA 1QW8A 3RJXA 1UQZA 3VD7A 3OGRA 3WMSA 3AMGA 1UG6A 3OGSA 2TAAA 3WELA 2JF7A 2OSXA 3A6OA 3VGDA 3WBEA 3CUIA 3ARSA 2WSKA 3AS3A 4AZHA 3BSHA 4KGLA 3L4TA 3ARRA 2Z1KA 4QCFA 3WSUA 1W9VA 3H55A 3WDQA 4UNIA 1EIBA 4ACZB 1WDSA 4P8UA 1J0IA 1BG4A 1BF2A 3WQ8A 1GQLA 2WM0A 2WMGA 1PBGA 1XCWA 3AZTA 1JL8A 4CKQA 4ML4A 2D0HA 1W2VA 1JZ2A 1UZ1A 9CGTA 3ALGA 2J7FA 3WNMA 1KXQA 1CXIA 1GOIA 2Q8XA 5IDIA 1FOBA 2D20A 4WKHA 1F4AA 1VFFA 3VD9A 2VCAA 1FH8A 1N82A 4OUEA 3UCQA 5CPTA 4GO9A 1UASA 1M04A 3DC0A 4DM2A 2Y4SA 2FGZA 2W92A 4GIAA 1JDDA 3CHEA 4AYSA 1RD6A 1J12A 1TFVA 4GPNA 2NT0A 3BSGA 2EXOA 2A3EA 3KL5A 3AXHA 1CPUA 5I6SA 3MKKA 5A6BA 4FLRA 3RILA 3W6LA 7A3HA 5HDRA 2WCAA 4ZXOA 2DPEA 1C90A 5GPRA 5BWFA 3F5KA 3PZVA 3GBDA 1E5JA 4J3VA 1ISYA 1JD7A 4UZSA 5E9AA 3ZR6A 3ZOAA 3GBEA 1UR0A 1QNPA 3UR8A 5JBEA 2PWGA 3OIHA 1E0VA 1R8LA 2CBJA 1W3HA 1UWSA 2C0HA 4E2OA 1EGZA 4PBGA 2YA0A 5BCAA 3U7VA 5CZKA 3ZT7A 4MB1A 3PTQA 2C8NA 3CMJA 1FHLA 2PC8A 1NM9A 4HMEA 5A6LA 1BVZA 1R47A 1O7AA 4UR9A 2WZIA 4ATDA 4PRWA 1U30A 3AIWA 4W86A 2JIWA 3IGUA 2WMJA 3AXXA 2BVTA 3EDKA 1EDQA 1NP2A 1QI2A 2BXZA 3EJRA 3N04A 4GZIA 3OG2A 6TAAA 3D5HA 4U31A 3MUIA 2EADA 2DT1A 4RE2A 1TVNA 1UQYA 3KLLA 1ISZA 2J7HA 4NXKA 3NJ3A 1WDRA 1UYQA 3CBWA 4GXPA 1QI0A 1WB0A 2YA1A 2MANA 4NSBA 1UR2A 2G3MA 3DHUA 3VGHA 4GQQA 4H8HA 4XZBA 7CGTA 1E5NA 3UESA 3A47A 1GQIA 3SEPA 2YFOA 5D8ZA 1VEPA 1JZ5A 3L2MA 1DWGM 2JEQA 4N0RA 4W7VA 1QHOA 3L4VA 2QV4A 2V3EA 3RDKA 2XFYA 2ZXAA 3NDYA 3GYCA 1Q6CA 1KWGA 3KEHA 1LQ0A 3WQ6A 4WIWA 1UHVA 1ODUA 5HOSA 2DH2A 1E9LA 1LF1A 4GINA 1O6IA 4CU7A 2YL8A 3A4XA 1H4PA 4BQ3A 5FL1A 2VMFA 5JBDA 3U7BA 5AY7A 2D0GA 1M53A 1HP4A 1Q6GA 1V3JA 4PN2A 2GJXB 3SCPA 5E0FA 2WHMA 1C92A 1HKMA 4NRSA 3WNKA 4PTMA 4GI6A 3D52A 4P8VA 3TTSA 4DO5A 3ARVA 1KXVA 1M01A 1UR9A 3FAXA 4LYRA 3CZKA 1DWIM 3M7SA 3N1AA 1V6WA 5AC5A 2XPKA 1XV8A 1CDGA 2VI0A 1CIUA 4NRRA 3WN6A 4KH2A 2E9BA 2DSZA 4PMNA 1VJSA 3RMEA 3QHNA 1XCXA 1E70M 1HKJA 4IPNB 2BVDA 2F18A 1FA2A 3WH5A 4JIEA 2X2JA 1B30A 1WCGA 3NIYA 3CIVA 1OIMA 1DP0A 1UD6A 1ITXA 1H1NA 5A2AA 1V6YA 4TVDA 1UWTA 5DT7A 4BZYA 3VD5A 1V3HA 2DGAA 3DYPA 1DHKA 1G94A 1BHGA 4EAMA 4JL2A 1BGGA 1XYFA 1WP6A 4AMXA 1MQQA 5EB8A 4DO4A 3AQUA 3POHA 2CBIA 1PEZA 2G3JA 2ZUNA 2GFTA 2BY3A 4LYQA 3PBGA 4ACZA 4FK9A 2VR5A 2NW0A 3WL0A 1XSIA 3WF2A 3A21A 2F8QA 1UH4A 1ODZA 2VX5A 2DQXA 4XB3A 1UA3A 3THCA 4LGXA 1OCQA 1G1YA 4NXSA 4X9YA 1V3IA 1LWJA 1RP8A 1JZ6A 4Z2GA 3WQWA 5CXPA 3BVXA 4U2YA 1OD0A 4B9ZA 1OB0A 2GJRA 3W37A 1JI1A 1B0IA 4UQEA 1E6PA 1OT2A 4Y7EA 2PWFA 3ZQ9A 1V02E 1W3KA 2DIJA 1IZJA 1J9YA 1V0LA 4GKLA 1V3MA 2QPSA 3NDZA 2DSWA 4MTVA 4LPCA 3O6AA 2OW6A 2WWDA 3CHDA 1CECA 3N11A 4TX6A 4UTFA 1B9ZA 3GXNA 4H8VA 3AZSA 3PHAA 2CESA 4PTVA 2UY3A 3VIIA 2E9LA 4PMVA 3G6LA 4JFUA 2X0HA 3L4WA 2J7DA 2VX4A 2NT1A 4FNQA 2WZHA 1U33A 3VDBA 2VL4A 4GI8A 3B9AA 4JKKA 1HL9A 2XHYA 1W9BM 5GNXA 3AIEA 1EHAA 2E0PA 1FP9A 5A6MA 2BXYA 3ARXA 2E8ZA 3AIBA 1VBUA 5D9PA 4OOZA 4L4OA 3CTTA 1E6RA 2VZSA 4KRTA 3GZAA 1TVPA 2PBOA 2VOTA 4GZJA 4PMRA 3VILA 2WXDM 2WVTA 5A6SA 3IJ9A 4W5ZA 3UEQA 4AZGA 1AQHA 1GW1A 1KXHA 2X09A 2XG9A 4PMYA 5E6ZA 2ZX5A 1B1YA 3WBAA 3DX1A 2XVNA 2ZIDA 1QBAA 3OLGA 2PF0A 3GH4A 2OWCA 3K4DA 1GORA 3CH9A 3PZGA 1WZKA 3U5UA 4ZE4A 3VX1A 1XH2A 1C8XA 1V6UA 2WCSA 3RM9A 2IXUA 5I2UA 1BGAA 4UQCA 1B3WA 2BV9A 5IFTA 3WQ4A 2WKGA 2Y24A 1BYBA 3GXFA 1HJWA 2VZUA 4L4PA 3WIJA 3A22A 3HMCA 2WYSA 5LA1A 1BQCA 3MMDA 1ZBVA 4HP5A 2J74A 4U5KA 2BS9A 3WY4A 2CHNA 3EDJA 1YQ2A 4D6HA 3VUPA 2FDMA 4AZ7A 3KLKA 5F7UA 5AYBA 3VTRA 2PB1A 4MJ4A 3VIKA 3MMUA 3BAYA 4BA0A 2DEPA 3ARWA 3D3AA 1H49A 1Q6EA 1KGUA 2XM2A 2GJXA 4C7DA 2XGBA 2PWDA 2F1AA 5GNYA 2DH3A 3BUPA 1TCMA 3A5VA 3BAXA 3WENA 3E1F1 6CGTA 4NZFA 1GVIA 1GZJA 3VMOA 4XZWA 2ZX9A 3APGA 4UFHA 5A6JA 4HZ8A 1X6NA 1CGVA 3I3DA 1W9PA 3T2QA 3WEMA 2EPLX 2YL9A 1JYXA 1E6NA 1W1VA 1M7XA 1WPCA 2WKLA 1L0PA 4PSRA 1W1YA 4AW7A 3LXBA 1G9HA 3ZR5A 4OZOA 1W3LA 2O9TA 2OYKA 2ZXDA 3QHMA 3DX4A 4BQ2A 1R75A 1VBRA 3ZJ6A 2ZWZA 1UKOA 4DUVA 1CXLA 1EDTA 2ZUMA 2QLYA 3EMCA 1KBKA 4M1RA 2W63A 3T08A 1JZ3A 4YHGA 1KQZA 4DWSC 2DSVA 1VAHA 4FLOA 3QOKA 1X6LA 1HT6A 3N17A 1U2YA 5FIPA 2J62A 2CCRA 2DSUA 2VZTA 1GOMA 3WH7A 3S2CA 4OKDA 1JD9A 4UFIA 2V3GA 1UWQA 1E4MM 4NZJA 3VU2A 3ZMRA 2Y2WA 3RM8A 1PIGA 4ATLA 3BUIA 1MFUA 3ECQA 3AZRA 1QWNA 3WKZA 2XVLA 2WNWA 4IM4A 4YN5A 5A8MA 4U3CA 1B31A 1I75A 1ZL1A 3HU7A 1H5VA 1JNDA 2X2HA 1CGUA 4WKAA 1GOKA 5IFPA 4ATWA 4UZUA 5A8QA 4WF7A 1OM0A 1SMAA 1VF8A 1WDPA 3AHTA 5KEZA 1B2YA 3TV8A 3WMBA 4CD5A 3WNOA 4H04A 4AZCB 3NUKA 1WKYA 3WUGA 4Q22A 2FGLA 3IK2A 4PEEA 3NCOA 8CGTA 1K9FA 2W62A 3CHCA 3KE0A 3VO0A 2E40A 2EQDA 1UUQA 2Y8VA 3MSDA 2WMFA 1UKTA 4W7UA 3QHOA 4IPLA 3LPPA 1ESWA 2XIBA 2F7PA 2DSKA 5GNZA 4TOQA 4HPGA 4F9JA 4DO6A 1GUVA 2G8ZA 4D6DA 1CGWA 1JG9A 3ZT5A 3TTQA 4J28A 3MV11 4AIUA 4D71A 2ZOXA 3AS2A 2DIEA 5M03A 1ZS2A 3VSUA 4BQ4A 3M07A 2V38A 4ZFMA 4MPKA 2OW7A 4W93A 1NWUA 3GXTA 4AD4A 1VIWA 4ZE5A 2V5DA 2AMGA 3UG5A 1WZAA 3K8KA 4B3KA 3CZGA 3OZOA 3EMZA 3DYMA 7TAAA 5BRPA 1FHDA 1W9XA 3AIVA 1QNQA 2BHZA 1JI2A 5A2CA 3I3EA 1W1TA 3MANA 3BLBA 3VX0A 3WDJA 4AMWA 4WJXA 5HNNA 4JKMA 3F5LA 3EJTA 3JUGA 4OGZA 1US2A 3SURA 5EBAA 2F2HA 2RGMA 1WNOA 2D23A 4H41A 4QLKA 1MXGA 1IV8A 2ZUTA 2J8FA 4NZCA 2W4XA 4AISA 2WPGA 1GHSA 1UKPA 2XVKA 1BLIA 2CIPA 2ZUWA 3WY1A 3WD1A 2VVNA 2OSWA 1E6QM 5CJ5A 4QLLA 1ZJBA 3LRKA 3MI6A 1QOXA 1HJQA 3POCA 3CZLA 2E3ZA 4FMVA 1WAWA 1FH7A 1HIZA 4H7VA 4IISA 4WKFA 5FOOA 1Q6DA 1W32A 1E4LA 3GM8A 3VNYA 1W9DM 1CBGA 1OGGA 2YDRA 4W85A 1SZNA 4AYGA 4CU8A 3AI0A 3UETA 1C8YA 1V0KA 1HN1A 4H8UA 5IHSA 3U57A 1PZ2A 3EDDA 2ZWYA 1H09A 4AZ5A 1CGTA 1VB9A 3IANA 4BQ5A 2ZUSA 4PMQA 4W8AA 1DWJM 1BYCA 4DM1A 1J0ZA 1VFMA 1VFOA 4UFMA 2XGIA 4W7WA 2UY5A 4C7FA 1SMDA 1EO5A 4MB4A 3WDIA 1JDCA 4UQAA 1KGWA 3AMLA 2J79A 2CPUA 3CV5A 3AMCA 1E71M 2VTFA 3NSMA 3BMVA 1KQYA 2GUYA 3WQVA 2V3DA 3CO4A 4UQ9A 1ZU8A 3OB8A 3W29A 3AHVA 2WCGA 4XV0A 5A8OA 3BH4A 1ZB5A 5CGMA 1CGXA 3MUZ1 5I3DA 4CN6A 1W2PA 4QCEA 4CD4A 4PSPA 1JXKA 1TQUA 2VX6A 3QOMA 3A4WA 1V6VA 1QW9A 5DFAA 2GJPA 3PTMA 3VDCA 4PCTA 4F79A 2XVPA 3ZSTA 2WWCA 4D6FA 4E4PA 2F61A 3WL1A 2WMIA 1XHGA 4Z2KA 4J3XA 3VDAA 3H53A 3FNDA 2QPUA 2EACA 3D4YA 1CEOA 5I5RA 2DT0A 3W0KA 2NSXA 1D3CA 5E09A 3H54A 3M46A 1TA3B 3L2LA 1B3VA 1E56A 2D1ZA 4JKLA 3IAPA 1R46A 1CTNA 3A3HA 1OINA 1CNVA 3RCNA 2JALA 4B3LA 3VIJA 3CZ8A 1NOWA 3AYSA 1MQPA 1MW1A 3GXIA 3ARTA 3B9EA 3EBVA 4FF5A 5TD4A 3OBAA 1TQTA 1J18A 1UD8A 2CKSA 5DT5A 4AZCA 2WLZA 3UG4A 4J3UA 5M17A 2VVSA 3WY3A 3THDA 3OLEA 4H2CA 2E9MA 4IUGA 4P7LA 3MV01 3J7HA 1E6XM 5I0DA 1UKSA 1CGYA 1C93A 5ABGA 5BXRA 1ISVA 2WANA 3AS0A 4F66A 3DX2A 3VMPA 3BGAA 2FHFA 4ZXLA 1P6WA 2OWXA 2O9RA 2VRKA 2BVYA 1AVAA 5CPSA 5EFDA 2EPNA 3LXCA 3T2PA 3MMWA 4B15A 4JL1A 1QNSA 2G3IA 5A69A 1BSIA 2VR4A 1TZ7A 3EYPA 1UD2A 4A3YA 4D6IA 1UD4A 4CGTA 1W9UA 4UOJA 3TOPA 4F9DA 2BY1A 5A2BA 4UFLA 1H0IA 1O7DC 1OD8A 3VIHA 2XFRA 3AJ7A 1MXDA 2ALWA 5C71A 1E0XA 3NYDA 2QHAA 2BNJA 4M56A 1TE1A 3AIRA 5BXSA 1HXKA 1W1PA 2V3FA 4AEFA 3ZO9A 1G5AA 3WEOA 2YIHA 2BY0A 1HP5A 3GDBA 3ZIZA 3BAWA 5CSUA 4PYSA 3WD4A 4CU6A 1E72M 3IAQA 3WD3A 4CD6A 2GSJA 2F7RA 5CPQA 4D6GA 4AD5A 2FHBA 1QI5A 1XH0A 4FLSA 5D9MA 4CUCA 4QP0A 4TXEA 1J0KA 1HF6A 4V2XA 2Y5EA 3SCRA 1V03A 1GQJA 1JFXA 1RH9A 4UQBA 2YBTA 1J01A 3FHQA 1NP0A 1TUXA 2UY4A 3CC1A 3N15A 4HMCA 3EJPA 3EJSA 3BUBA 4RL3A 1PPIA 1A47A 3ZT6A 2D0FA 1PX3A 2VCBA 1UH2A 4PMUA 3BAJA 2J47A 2CKRA 1IT0A 4MADA 4J27A 4GO8A 2YFNA 1S46A 1R87A 3BVWA 4PMZA 3GH5A 3QR3A 2WC4A 3TTYA 3AHXA 4KRUA 4C7GA 2OYMA 3VINA 5CLWA 1ITCA 4P7RA 2XJ7A 4W84A 1JNEA 4HZ6A 1VENA 1J0YA 2WLYA 4AD0A 3W27A 2XFFA 4OBRA 2VCCA 1C8QA 2AOSA 2AAAA 4FNPA 2PI6A 5I77A 4HA4A 3VSTA 5I24A 3SCWA 4D6JA 3LMYA 1V6XA 1UZ4A 4AD2A 1QNOA 1EOMA 2DT3A 5M3WA 1US3A 3I3BA 2X1IA 4Z2HA 4WSJA 2WHJA 4M24A 3PZMA 3W82A 2EPOA 2YL6A 1W91A 3K1DA 3CUFA 4M8UA 2WC3A 4R5EA 1XC6A 1HVQA 2W67A 3WNPA 4Q7NA 5BYWA 4BF7A 1DTUA 5CGTA 1JFHA 2J77A 4EE9A 3FN9A 4M29A 1JGIA 3AICA 4W89A 2GDVA 1BFNA 4EKJA 5D4YA 3T0BA 5A6AA 3VNZA 4FNTA 3DX3A 1JF6A 3TP4A 5AYIA 3T09A 4S3JA 2VUYA 3VSVA 1DEDA 4J3TA 4AZIA 3WNNA 5I23A 3UR7A 1OGSA 4DWSD 2G3NA 6A3HA 5E70A 3VGEA 2VRQA 4JFTA 4CD7A 2XVGA 5EFFA 3RPMA 2D3LA 2XN2A 4X0NA 1GOWA 5A94A 2WVUA 4HOZA 3LRMA 5CSYA 5I79A 3K46A 1RPKA 3VIPA 2ZUUA 4D1IA 5CLTA 5AC4A 3WDPP 2WZEA 4PTWA 2YOCA 3OA5A 2X8RA 1CXFA 1UKQA 1Y7VA 1TA3A 1QI3A 2CEQA 2O9OA 4HTYA 4W8BA 1XD1A 1ZJAA 3W26A 4AY1A 2Y8KA 5DF0A 5A3HA 2F7QA 3F4VA 4X0VA 8A3HA 1Q6FA 3AMKA 2BHYA 1B3ZA 3N18A 2YDQA 1SFSA 1OIFA 3ARZA 3BVTA 2EPKX 5CQ1A 5ABFA 1UWUA 2EAEA 3EJQA 2CBVA 2WMKA 1WE5A 2WMIB 4QLJA 2YA2A 3LPOA 1X1NA 2WK2A 3ZJKA 3BAIA 5A8PA 3VGGA 1H41A 1ZBCA 5D9OA 4QDMA 2EABA 3IJ8A 1K9TA 4MNLA 3S5YA 1E1FA 4M81A 1XYZA 4RE4A 4Z2JA 2XWEA 4JAWA 1HKKA 1EXPA 1KTBA 2J7GA 2OWWA 3PZIA 1R7AA 4J3WA 4UFKA 2GK1A 1BYDA 3LX9A 1BTCA 1V02A 2J8GA 3AIQA 1SR0A 3SIMA 4AXNA 4QFUA 1K6AA 2ZXBA 5E0CA 2YJQA 1CYGA 2F7OA 1CZ1A 3SCOA 3WFLA 1E73M 2CERA 2J75A 4V27A 3AHYA 4JCMA 2WVVB 1G0CA 1E6ZA 3DX0A 2WBGA 5FL0A 5GQBA 5FD0A 2B31A 2W66A 1MVYA 2ZUVA 3CMGA 4CVUA 2QMKA 3WUBA 1I1XA 4EANA 2IUZA 3OZPA 2YBUA 3FHAA 3D50A 5D8WA 2JIEA 1KB3A 3GTNA 1HWWA 3BCFA 1HJSA 5LA0A 5A6BD 1KR1A 2VO5A 3MU7A 2WW5A 2OYLA 1PZ3A 2GVYA 3GXMA 3WD0A 3ZM8A 1LG2A 1KCKA 3AHZA 3GXPA 3VDHA 1OBAA 2G41A 4WLCA 2QF8A 1ECEA 1TQVA 1UD3A 1V3KA 4D6EA 4GI9A 1J10A 1MFVA 1XH1A 3UERA 2A3HA 5BRQA 2VC9A 1C7TA 1LL4A 2W61A 5IHRA 4UFJA 1JZ7A 4UCFA 3WF3A 3OLDA 1XSKA 4HOXA 3W28A 3L4XA 2VX7A 2YLLA 2FE0A 1IZKA 5C70A 1KCLA 3SUTA 1WZMA 3KL0A 4ZEPA 1FFRA 2JE8A 2HISA 5IXEA 4CN1A 3CPUA 4HU8A 4PMDA 1LLOA 1TR1A 3S6TA 4CN4A 3W53A 5JIWA 1RP9A 2XN0A 4LQ1A 5FKYA 1UD5A 3A24A 4F8XA 1CXEA 1NOUA 4TVCA 2F1BA 1UOKA 3WF1A 1E3ZA 1JAKA 3KWXA 5HXMA 1FFQA 4CCEA 1MW3A 1KTCA 3CZNA 1HTYA 1CLXA 3W4RA 1MQRA 2XYLA 3WDHA 3GNRA 1AQ0A 2GDUA 2A3AA 1E3XA 1B90A 5M5DA 4PMXA 4Z2IA 5ABHA 4BCEA 3O2LA 1E1EA 3M6DA 5ECUA 1HXJA 3U5YA 4KMQA 1GVYA 3RJYA 3ZSSA 1D7FA 5HBFA 3G6MA 2J78A 2X05A 4DUXA 5BXPA 5E1QA 3HG5A 3VIOA 4MB5A 5DMYA 2ZE0A 4PTXA 1UA7A 1GHRA 2VJXA 2EBNA 3FY1A 1VEMA 1PJ9A 2X0YA 4PMOA 3BVVA 3WF0A 4GZEA 1PAMA 4E8CA 4P7QA 5JIPA 1MYRA 1J11A 4V28A 1NARA 3GNOA 5LYRA 4P8XA 2X2IA 1EHNA 3WMCA 3SUUA 2WVSA 2JF6A 3II1A 3MUY1 3WUFA 1Q4NX 4URIA 1NWSA 3BCDA 3HJEA 2WHLA 3W25A 3VGFA 4HA1A 3W6MA 4NI3A 2V5CA 4MAZA 3CGTA 4LX4A 4A3HA 3F5JA 4W87A 2ZX7A 3DDFA 5ABEA 1HJXA 1GPFA 1OSEA 2DDXA 2XTKA 1JDAA 1NWRA 3FXYA 4MJ2A 2VZOA 1QI4A 3A4AA 2UWFA 1D2KA 3BXWA 3CUJA 5E6YA 1LJYA 1JYWA 3HG4A 1W3JA 3W81A 2A3BA 1KGXA 1T0OA 1VRXA 3D4ZA 2W91A 1EOKA 2EO7A 1JIBA 2WSPA 3N12A 2D2OA 3T2OA 4J3SA 3VIFA 3WF4A 2UY2A 3EJUA 3DDGA 2W5FA 1CXHA 4PUEA 4BS0A 4NF7A 4PUDA 4TTGA 4CCCA 4HA3A 1UWRA 3VM7A 4AC1X 2WC7A 2WB5A 2VT0A 1J0JA 4UOQA 4HZ7A 3VPLA 1JF5A 2O9PA 5FCZA 3S5ZA 4FLQA 3AFBA 2X2YA 1HL8A 1GJUA 1E15A 3TA9A 2D73A 1CLVA 3VMNA 1XGZA 3A23A 2PBGA 3L4ZA 3VIMA 2VRJA 2CETA 4W5UA 5ABFB 1PX8A 4M80A 3ARQA 4CCDA 3PZOA 1UR1A 4CVWA 5JUVA 3N9KA 1QVBA 4AD1A 3WH9A 2WVVA 4AIOA 4AMCA 2FYVA 1DWFM 1JZ8A 4JHZA 2WBKA 5EMYA 3BLPX 1BVNP 1SYTA 1E40A 2EEXA 4DWSB 3VM5A 4U33A 3RO8A 3CZJA 1QX1A 1ISXA 1I1WA 1QHPA 1TG7A 3MUAA 1A3HA 2ZX8A 1BAGA 1NWTA 2XWDA 2GK1B 4D1JA 3ARYA 1V08A 1DWAM 4N42A 3LRLA 1OWQA 5DO8A 2CXGA 1QBBA 4B9YA 1R7OA 2IXVA 4M82A 3VGBA 1AQMA 4MDOA 4MNKA 2WAGA 2O92A 1C91A 1LL6A 4D6CA 3CHFA 3KZSA 2J4GA 2PWEA 4GQRA 3BUDA 2EJ1A 3VKKA 3DHPA 4A4AA 3DECA 4J7RA 4AD3A 1JAEA 4MB3A 2WHKA 5A1AA 1AMYA 2CHOA 1MW0A 1E43A 2ESCA 1WO2A 3SCNA 4UOZA 1E6SM 1R34A 4ZENA 3FAWA 1BYAA 1NH6A 3B9DA 2Z1SA 4NX0A 3HG2A 3B8SA 3QGVA 4P7OA 2BHUA 1V0NA 4E8DA 1KR0A 1GQKA 3MO4A 4AIEA 3RM4A 3MSGA 3RIKA 3VD3A 1UWIA 4JZ5A 4AZBA 4MAVA 3SCUA 2WMHA 3T0DA 1UH3A 2ZXQA 3PZQA 3ZJ7A 2YLAA 4AWEA 2FH6A 4YHEA 3EMQA 3VVGA 1KWKA 2C7FA 5LA2A 3LPFA 3WEZA 3AMDA 3WFZA 4U3AA 1GCYA 1KBBA 4D72A 5I78A 3PTKA 2JEPA 4HMDA 3GH7A 4ACYA 3PN8A 4HPHA 3VIGA 3WNLA 2J7EA 4AZ6A 4CD8A 3BVUA 1ZBWA 3UG3A 4JFWA 4LYPA 2EPMX 5A8NA 4KGJA 2J7CA 4MNMA 4PCSA 4EK7A 5A95A 1WDQA 1MW2A 1V0MA 2RGLA 1XSJA 1LWHA 3KL3A 4OJYA 2HVMA 3OLIA 2YL5A 1CENA 3NSXA 1YHTA 1TQWA 1J0HA 1GNXA 3AOFA 3AYRA 1CWYA 4W8LA 4FNRA 4MNJA 2FHCA 3TONA 3BAKA 2E8YA 3CUHA 3W38A 1DWHM 4JCLA 3WUEA 2J25A 1K9DA 4HOWA 3VOCA 3AISA 1QWUA 4U5IA 3K8MA 1ISWA 3AROA 3GNPA 1GONA 4KWUA 4TX8A 1HVXA 3EDEA 4WK9A 1JYNA 5CG0A 1HJUA 3LXAA 2D3NA 4JFSA 3EDFA 3CUGA 5BXTA 4LXFA 2YDSA 3W24A 1GOOA 1BG9A 4WSKA 4UQDA 4HU0A 3L4YA 4JHOA 2YKKA 3T0AA 1HX0A 1H0GA 2CITA 1EH9A 1M03A 3BUQA 5D9NA 3IJ7A 2D22A 1F4HA 3SCSA 3BMWA 1HNYA 2JFEX 2CYGA 1EQCA 2OSYA 1KFWA 2DT2A 1HJVA 3OGVA 2XSAA 4JFVA 4QAWA 2XIIA 5KZ6A 1HKIA 3SUWA 3HZ3A 3K8LA 3ALFA 4W88A 4OIFA 4S3KA 3VD4A 1FH9A 1QHZA 5DEZA 1H2JA 3HG3A 1EQPA 2VURA 5C8BB 2G4FA 1C7SA 2BFGA 3AS1A 3PZNA 4Z2LA 3ARUA 4K68A 4FNSA 1H3GA 1PS3A 1V3LA 1E0WA 3CZEA 1GJWA 5HPCA 1E55A 1B3YA 1R86A 1UR4A 2VQTA 1R33A 3NSNA 2QMJA 3WH8A 1L8NA 3CLWA 2D24A 2A3CA 2ZICA 3D51A 3HN3A 5A6KA 4YPJA 1BPLB 2VQUA 1MWOA 3SCVA 1KXTA 1QNRA 1JYVA 1VFUA 3TTOA 2E4TA 1C3FA 1LG1A 1UR8A 2CBUA 4DWSA 4AEEA 3N13A 3BLKA 1JZ4A 4TUFA 1TMQA 2XN1A 1FP8A 4TVUA 1Z32X 2XUCA
chains in the Genus database with same CATH superfamily
4YHKL 2V7HA 4LSPH 3DJZA 3QCUL 5ITBL 3R06B 4XX6A 2OZ0A 4M7SA 2V9TA 3LCYA 5EFIB 5AZ2H 3JT0A 3BO8A 4X99B 1S3KL 1NQ6A 5F7YC 5ICZB 2VWSA 1CLKA 2P8PA 4WJKB 1DVYA 5A6TC 4L1DA 3HPJB 5FHAL 1TZGL 2BY2A 3IF1A 3Q1SL 1E4IA 3E3QE 5IMKA 3AMGA 4F0RA 3W7HA 3CQQA 4GI4A 1NCIA 2GZXA 3WBEA 3CUIA 1LK2A 2X10A 3TA3D 1KIQB 5HGBA 3EOYG 4YHOL 3ZFHA 3HHRB 3JWOL 2AAVA 4P8UA 4FE9A 4KCTA 1GYUA 4C57C 4TSBL 1XF2A 1W2VA 5GJNA 4BEQA 2VRAA 3WTSA 2Q8XA 5D33A 4RKAA 4R9XA 4R4ND 3P9LA 1FH8A 1KTKE 1FPTL 4KROB 1P0NA 4AGNA 2OMUA 1JPDX 2YW4A 4AM0A 5D2WA 1WHPA 4Z7QF 2A3EA 4QTHB 1CPUA 3ESOA 1KYUA 2X1TA 2A74A 4KJQD 5BW6A 1AP2A 5DI8A 2CA4A 8FABA 4J3VA 3O0KA 1ISYA 3WG7B 5IW1A 4ZFOB 3NZ8A 4PH8A 1I85A 3OIHA 1KPRB 2YC1A 2ATMA 1PSKL 2UWEF 1IKOP 3BKYH 5FX3A 3BAEH 1IC0A 2B77A 3RDTD 4ZD3H 3EYOA 4JY9A 5ACLA 3PWLB 3FCTB 1W0WB 2NTSP 4WW2C 4LVOC 4OKVB 3OG2A 3QKEA 3S5NA 1EJWC 2HWZH 5DJXB 3KLLA 3NPZB 4PRAB 5G4MA 4FJ6A 5FJJA 3QDJD 3NZPA 3DHUA 5F7AA 4ERSH 7CGTA 1LD9B 3BPWA 1HHJA 3S7GA 2SEBB 3SKNB 3SEPA 2XZ7A 3X13A 3L3KA 4GLEA 4V15A 1QDSA 3HS0C 3SKJL 3OPZL 4XXDA 3TVMD 2FPTA 5EPMB 2AERT 3H24A 1NLDL 2D31B 2WXFA 4NENA 5KVFE 3BVJA 4GINA 3MRKA 2H6OA 3IJHA 4DNMA 4ONVA 4IJBA 4H9TA 4QYOB 4Z3TA 1HP4A 2VLJE 2WHMA 2IV9A 4JZJA 3STCA 4Z3HA 2LAAA 5I6LA 4D3CH 3G0XA 2XPKA 2RFXB 2XX1A 3IKKA 3T8QA 1MRCH 1SY6L 4AH2B 5ICZA 5L2KD 4G6FD 4C56E 1M57B 1VCFA 2GIXA 1R38A 3V6FB 4ORMA 3HPJA 1E70M 1HHHB 2BVDA 2F18A 5EPDA 3IGKA 1B30A 5DMKB 3KBJA 1F8TH 1H1NA 3B4YA 2KZWA 3VD5A 1Q85A 3MA8A 1SXBA 1KIQA 1VKXB 1NLBH 4BKLB 1PEWA 2AJUH 4JTIA 3N2XA 2NW0A 1BVNT 2VO8A 2YZ1A 4NAFB 2F8QA 3JXAA 1RZGB 35C8H 4XOBA 5BQ7B 3FEQA 2ID5A 1LWJA 5B38B 5GGRB 3ULUC 3RQ3A 1MFNA 4B9ZA 5HUOA 3VFGH 3ZN6A 4K8GA 2HKHL 5SWQB 3KBVA 3MCG1 2E9WA 3ULVF 4QTHA 3U36A 1YJDL 1WAAE 4LPCA 2DZTA 1S78D 4KVNL 4TF4A 5HQLA 4UTFA 3TBTB 3PWPD 3PHAA 3NIGE 4M9PA 5E99H 1FTXA 4EKXA 4LQFH 4ZFOA 5I6PA 4ENLA 2VL4A 3ROOB 1KPRA 3GI8H 3HBQA 1F90H 1GTEA 2E8ZA 3GY1A 2YYUA 4JKPH 4P0DA 3PWLA 1W0WA 3QUGA 4F0KA 1T0NB 4PMYA 3ASOB 4GIPD 8XIAA 1B1YA 3Q94A 4XVJH 5DJXA 3QWRA 2DKSA 4LUJA 4AV0A 1IAIL 2YZ8A 4O02B 3L1GA 2QKFA 3VX1A 3LEPA 1QFUH 1P1XA 4CEUC 1LD9A 4ANVA 4QMEA 3B0UX 2SEBA 3SKNA 1SOXA 1HJWA 3GXFA 3UZWA 2VZUA 4JQVA 1D5RA 3PP4L 3D33A 5EPMA 3O6MH 3KPRE 2C34A 3EDJA 4ZXBD 4CNOA 5ADOH 1AODA 4QRTB 4I0PC 2AZUA 4L6HA 4QYOA 3S9DB 3LCWA 1KGUA 2XM2A 4LOCA 2DW6A 2PWDA 2CGRL 3L3OC 1ZPTA 4HJFA 5HHVH 2HLFD 3DHJA 2V37A 3BHBB 1NCDH 4Z18A 4H20H 1TX0A 4IRZA 3UPRB 3FA4A 1T66D 4YH6A 5DZVA 4AH2A 2VMCA 4K2UH 3NYKA 1N8ZB 1L0PA 3EOUA 1G9NH 3CM4A 4DN4H 3V6FA 1HHHA 1XWVA 2QLYA 3WTUA 3RVUC 3U8GA 2ILLA 5DMKA 1EO8H 2ZZ1A 4FLOA 1HT6A 3N17A 3UMTA 2GSIB 5IESL 4HISA 4KK8D 3VXSB 3RM8A 4BKLA 4DT2A 2J5LC 4C6FA 4DZHA 1QWNA 3N55A 5E2JA 3UNTA 3CIWA 2X2HA 4WKAA 1RZGA 1S7RB 4UZUA 4N7QA 1OFQA 5BQ7A 3K4WA 5KEZA 5EF1A 3C2SA 4G8AC 1MRDL 5B38A 5GGRA 1TWWA 2R2CA 1E4KA 3WUGA 1IGCL 2VFFA 2WNNA 3VO0A 3KVLA 4EXPX 4IPLA 5SWQA 2IPTL 3JRKA 3F5WB 2G8ZA 4I9XA 3ZT5A 3L4CA 1Y6KR 2N1TE 3AS2A 2UYLB 5IFJB 5J3HC 2Y7GA 3IGLA 4NT6A 2Y7QA 3TBTA 5FOBB 1BVOA 5JH1A 5SV3A 4YDLB 1QSZA 1PMYA 4LDLB 4F2UA 5ALBL 3CL8A 3LHWA 4XAGA 3PPCA 1O4UA 2BHZA 1TEYA 2X6AA 3C2AH 3MTWA 3AG3B 4HNVA 3WDJA 2C1PB 5HNNA 2WKOA 1UZGA 2YN5A 4DOHB 2CJTA 5T3ZE 2H0FA 1NCNA 1KGCD 4F80A 3ZHNA 2ZUTA 1FNFA 3WTVA 1FXPA 4KETA 3N29A 1E6QM 1AOZA 4J6IA 1P9MA 4JNYA 4GSQA 4EOUA 2BNRE 3WQOA 1O7DE 4O02A 1XIWA 4QO1B 3JVAA 2XV0A 1K1DA 2FIQA 2Y63A 3VNYA 1VYPX 5CZ0A 5J12B 3BX7C 2CLMA 3JWDC 2HX9A 3QIBD 4E5XB 2OTPA 3JQOB 3UR5A 4JRFA 4BFIB 2MMXA 5IOKA 4XX1G 2IG2H 5DD1L 4QRTA 3SO5A 1ZGDA 3MC5A 4RXGA 1BEUA 3VVVA 1CURA 3QVQA 4LPYA 2EIZB 3KBPA 1VFTA 4V33A 5C07D 4TR9A 3L5XL 5AW5B 2P5WD 3BHBA 2GJ6D 1XG3A 3GM0A 3QEZA 3TH4T 5LDSA 5BNKA 3IFPB 5AFDA 1EPFA 3UPRA 5FJIA 2GJPA 4JPIB 1N8ZA 1GHFH 1FRBA 3P8IA 3U1SH 4F79A 3IS1X 1LLAA 4YLCA 3AU6A 4HUMB 2PP7A 4M5TA 1H9DA 2LLNA 3QRGL 4BZ2A 4UNVA 2OCJA 2FRGP 3BOFA 3VYOA 1LBFA 3GHTA 2Q2EB 5GZOA 2A3TA 3PV6B 1TA3B 4B91A 2O56A 4N3UA 4ICMA 3VXSA 2AGJH 1WOAA 5F4XA 4GKZB 3QUKA 3MLZH 1XRSA 3NJKA 5JXED 4G56A 3MPGA 4DWHA 4B3LA 5L4FA 5AYQA 2QVHA 3CZ8A 5MENE 5C9WA 1EFXB 1USZA 4JE4B 1JPIA 4YHYB 2CO1A 1ZEAH 5TE4L 1AZVA 5DT5A 3B8YA 1NELA 3LDVA 3MRNB 1GSMA 1JVOA 3WY3A 2ISVA 4PMJA 4PUWA 4NUJB 3QJHA 2AANA 3UABA 2WYHA 2F19L 3F5WA 4K9EH 1MF2H 1A2YB 3C6CA 5CR1A 3F2CA 1P6WA 3MHZA 2FQDA 3RGBA 1T2JA 2QPFA 2UYLA 5IFJA 5D2NB 5EFDA 3GKWL 5FOBA 4B15A 4TO8A 1OSPL 2CR6A 5DHYA 1YC8A 3EYPA 4Y19D 1W9UA 3KUMA 2E59A 2J1YA 2OZ8A 1YMHB 4ZS6C 3HE7D 4TQEH 2WY3B 2XN9E 1SW0A 3GAYA 4XAKD 2P76A 4LHUG 1NFDB 5C71A 2VC5A 1QABA 4PLJC 4AM0Q 2C1PA 3TQPA 4YCPA 2BJML 4UF7C 4FHKA 4A7TA 1G0XA 5HSFA 5AAWA 1E72M 4D6GA 5E8EA 4AD5A 4O1AA 3BE1L 4EI0A 4LVHC 1BZQK 1R24B 3EJPA 3ZHFA 1YDPB 1TTBA 1GYLA 2VDGA 1RY7B 1F4XH 4QO1A 2HTKC 2AJYH 3JZEA 3U2OA 3GDCA 1FE8L 2VGIA 3BAJA 4FXTA 3L7FB 4L1WA 3DC8A 3RA7H 3QUYD 1F6KA 12E8L 2V2TB 1KM3A 1DEEB 3FN0H 4MQTB 4E5XA 5I8KH 1ITCA 3O3BB 4BFIA 2K45A 1N5AA 4AVFA 2Q3RA 2JIXD 3FSAA 3S1VA 1QNOA 3FKUS 2EIZA 1ED3B 2ZCKL 5DX7A 1FC1A 2WC3A 4ZTOH 2VUKA 1XC6A 4RFEB 4N25A 4EBQH 3ULUH 1JFHA 5FEBA 2J77A 3MRRA 1AK5A 3PP3K 3H3PH 4PHXA 1RVGA 2P10A 2VSCA 2DL9A 3GB6A 3S6OA 1JF6A 4L4VE 4MG4A 4JPIA 3Q0HA 3FF7A 3GR8A 1KY7A 2NYKA 1US0A 4ZOEA 1R5IB 4UTAA 5E70A 3VGEA 3G1DA 4OZGB 3WU1A 3PHOB 2DQIL 5EIIB 3G5WA 1S5WA 3OJMB 5BW7A 2ALAA 1NAML 5CSYA 1J05B 2FQIA 4IL0A 3E2RA 2WZEA 3S1XA 3QFDB 4ELMF 5I71C 3TUUA 2ZA1A 1FZKB 1CXFA 1JHKH 3PV6A 1TA3A 4H9UA 3PXJA 3RPBA 5FV2A 4IOSD 4GKZA 4LS0A 1FAIL 4Y1SA 4ICCX 2I9UA 4H6KA 4HSCX 3NCXA 3OKYA 1EFXA 1DANU 2E7FA 3LEXB 5FAJA 1KIUA 2MHAA 1CIDA 3N4FA 4G6JH 3LPOA 4G6KH 1AHWA 5GVJA 2GABA 4IBSA 4G7VH 2ZAHA 4B5VA 4QXGL 3SDXF 4NUJA 3S5YA 1E1FA 3D9AL 4HSNA 3SGKA 1EXPA 4G9DA 1A2YA 1HEHC 3AUJA 1L9MA 4YDIL 5GJPA 4QFUA 2YK1L 1YMHA 3TWBA 2VXSL 2ICWJ 2RIKA 3RFAA 3W7EA 1DBJH 4XN9A 3WUBA 4GT7A 1CMOA 4GMEA 3NZUA 5E4EB 3BCFA 3GC3A 2AQ2A 1L9TA 3LZLA 2NQ9A 4NPYB 5E08H 4M5SA 2GTQA 3GS0A 1S5TA 3VXNA 1R24A 3UZJA 1YDPA 5BRQA 3PAUA 1SNRA 2W61A 3P60A 2JQMA 4ELKB 4GYPA 1L3NA 4AG4L 3LTVA 3TT3H 4IPJA 2NCMA 4HFUH 5I1EL 1DJWA 4OCWH 4BBWA 5KS9B 1DEEA 1EAJA 2CXKA 1Z9AA 4NRYB 2Z7KA 4PVNA 3L48A 3FEMA 1FGNL 2OQHA 4LCYB 4DXXA 2QJMA 1ED3A 5F2GA 4I6VA 3NSFA 2EH7L 1Q94A 2A3AA 2NR6A 4RFEA 3DJ9A 2BS71 4PMXA 1QSFA 3NO5A 5F7NC 1X44A 3ZSSA 5HBFA 1J1PH 1JP5A 2WJ5A 2GY5A 2F54E 4QR7A 4IL2A 4K3GA 1R5IA 1VEMA 2X44D 4Z95L 4DTGH 4B60A 1JGLH 3BVVA 1D5IH 3FT3B 1MYRA 5E2VH 5AVRB 5KUMA 4GAJH 4HKBB 2C5DC 3SUUA 3PBVA 1XXDC 3QFDA 4XMLL 1FZKA 4OUUB 2AL1A 5AG8A 3WFCL 3P3TA 3QFJD 3ABMB 3O41B 2RBLA 2BP5M 4ZFGH 3HQOA 3L1FA 1F4WH 2HH0L 3BJSA 2YCIX 5D55A 3DIFB 5KVEH 4B9FA 3MV7B 4RMSA 4AYBA 1VHNA 3UGUA 5KOMC 5EBLB 5E6SB 4QS5A 5I30L 2WB5A 3GIVB 4L1HA 2VDIA 1BFSA 4PAZA 3QEQE 3JWDH 4UMAA 1UB3A 4AD1A 1EPXA 3GAKA 1CL7I 4L9LC 3WIIL 2F8IA 5FK9B 1EZUA 4DKFL 1HQTA 3ZTJG 4PIBA 2ZX8A 3KPSB 1AJ0A 3ARYA 5JU6A 1Y18B 1AXSB 4B9YA 2O5YL 4MNKA 4NO0D 4NBXB 3IE9A 3KR3L 2OEMA 4IHCA 4JM2B 5F9AC 1F56A 4GXFA 3BGJA 4J7RA 1HSAB 1QTSA 4CC1A 3DZ1A 1SDYA 4PJXB 2JSFA 1E6SM 2G5WA 4NQVB 2QGYA 1QA9B 3HG2A 4MCNA 3B8SA 3EH1A 3NR0A 3P2VA 5KS9A 2AEQH 2ZYRA 3WKYA 3FJTA 3FUJA 3UBPC 1D6EB 1CB4A 4NRYA 4NJ9L 3PZQA 1FWBC 1UURA 1XP3A 1ZZMA 2CLIA 4EX4A 4DZ5A 4F9PC 2YRPA 4EACA 4HHAB 4TNWF 2D7OA 2AJSH 3P9WB 1M6JA 4LGSB 1C16B 4AZ6A 4FQXD 1UACL 5DU7A 2C3VB 4G6MH 5FYLH 3TH3T 4BXVA 4MY1A 4KZDL 3HG1D 2H5UA 1K5WA 3ARBC 1CENA 3PP3H 3VAEA 1KCUH 5LXXA 3FT3A 4OD1H 1MJ7L 5E9DD 5E4OA 1QWUA 2Y5TB 5KWYC 4HKBA 4LYKA 3UF9A 3U46B 4OUUA 4WK9A 1JYNA 1INEH 1Y07A 5G2WA 1UM5H 3RY5A 5EO0B 3L4YA 3O41A 2YKKA 3VE7A 2HLAB 1NSNH 3DIFA 3HJZA 2ZDSA 3V0TA 3HR6A 2XSAA 3MV7A 1MKFA 1ACXA 2PA6A 2OJZL 1OPGH 3MTXA 1QHZA 3RX9A 5EBLA 2DQUL 4DF0A 4ZO7A 4I90A 1YMMD 2GGHA 5I3IA 4FXGB 4PJGA 4I9WE 4N9DA 3WLQA 2N56A 3ILEA 3GIVA 4DK3A 1E0WA 1PCWA 3GW0A 4XZUB 2JTYA 4NWUH 1CFBA 2A0NA 3W9DB 3QRLA 3QTGA 2I9TB 3KPPB 3ZLHA 2D24A 2A3CA 2ZICA 5DHXB 1MFBH 1OQFA 4L8SA 1JYVA 3MR9B 2DIBA 3RIAK 1S1RA 1T1XB 1C3FA 5D9SB 5FK9A 4NN6C 2YGPA 2XUCA 3D6GA 2ZX6A 1T7YA 3L1OL 4TTUA 3KPSA 4Y2OB 3AXIA 2C7UB 4IIQB 4LCUB 1OALA 4WTWA 1VJZA 4M1DL 3OC5A 3D87B 1EO7A 1W72H 1HSAA 3LMZA 2KMWA 5TK2A 3WQ5A 5D2LF 4PJXA 1ZHNB 3O9NA 1P4BL 4FTVB 1ZP3A 3O3RA 5FW8A 1AS8A 1R3TA 1ZHAA 4XMPL 1QA9A 3Q06A 3QMSA 4S1SH 1NJ9B 4L5FL 1PY4A 1FRGH 1D6EA 1YYLH 3R1ZA 1E9PB 1U41A 3WSUA 4EIGB 2VL5B 1WBJA 1UT9A 1U8KB 3C61A 4L1SA 5D5MB 2QFPA 4XP1L 2AV7B 2D0HA 4HHAA 4MHHI 5ICYB 1C16A 2ZVRA 4XP9H 3W7PA 4E9WA 2C3VA 4XWOD 5C8JB 1VFFA 3QSKB 1N82A 3GSRB 1Y1UA 5CPTA 3GJEB 4GVHA 5I02A 2Y4SA 3L3DB 2FGZA 3CSGA 4TMBA 4OAWB 5JDJA 1K8IB 1AFVL 4XVDA 5IB1B 2E25A 3L95A 2MCG1 3MKKA 2W65A 4M9OA 2WCAA 3EXTA 1C90A 1AH0A 3QEGH 1JD7A 3U46A 5CILH 1SO5A 1W3HA 1KRAC 4PBGA 1U3HD 3TCTA 1S7UB 1OG0A 2ENYA 3F2DA 3PDGA 5EO0A 5IF0A 4YJ5A 1TPEA 5LHFA 3DI2B 2NQJA 1IBBA 1O6TA 2HLAA 4Z7UE 3WHE0 4JDEB 1UWEH 3L13A 2WMJA 4QXTB 2FX9L 3CSTA 3EDKA 4MSWB 1EDQA 4KQ3H 1N70A 2BSEA 3QYQA 2EINB 4U31A 4AZ8B 1P6AB 3C9NB 2DT1A 3V0FA 1UQYA 1M9WA 2J7HA 4K7PY 2YA1A 2FWOB 2YD0A 2HFGL 4IDJH 2DV6A 1NGZB 5HYJE 2OR8A 4NFCA 2XXMB 3QHFH 5DJDA 4AY0A 4NB7A 1VEPA 2OFJA 1QSED 4XZUA 1QFWL 4F1SA 2I9TA 3KPPA 2OZ4H 5J5RA 4CNTA 1A7NL 4WI9A 4RFNC 4OSUL 3MR9A 3J2PA 1T1XA 3QIWD 4Z1AA 5D9SA 4F7EB 5BOOA 5CP7B 2ADAA 3ZZQA 3HAEG 5GHWH 4K7PX 9PCYA 3SN1A 4Y2OA 2ZYIA 4O5LL 3W01A 2C7UA 2OELA 4JGMA 1KA9F 3IDXL 3HVDA 4GG6E 4QDPA 1XI3A 5JORA 1MNSA 1JGDB 4C59B 1TF4A 3LNEA 2YAFA 2WBJC 5IHUH 3SIKA 1T6WA 1VJSA 4CNPA 5J04A 1ZHNA 3EPMA 3WH5A 4FTVA 2X2JA 1J79A 5EORL 1AE6L 4NC1C 1SF3A 3VFCA 4LF1A 4TVDA 4YTRA 2EYSB 1NJ9A 3S98A 4EAMA 4JL2A 4AQ1B 1XYFA 1YNTB 5CEXB 4D94A 5DFTA 2YGYA 5EB8A 3SGEH 4DQAA 2VW6A 2VL5A 5I1JL 4H00A 1KELL 1U8KA 5D5MA 1OZUA 3CMOH 2AV7A 4PJ6A 2UUDK 5ICYA 3E2SA 5C8JA 5MEPB 5DY2A 4Y4FC 4JYDA 3GSRA 3UGVA 4JFFA 3GJEA 4U1NB 4PL2A 1OB0A 2LTQB 5CPNA 3STEA 4OAWA 2PWFA 1K8IA 2W81C 2OI9C 2TODA 1R19A 1EX0A 1NGPL 5K7JA 4DO7A 5C7ZA 1AIZA 5E2TH 4DERA 1S2VA 4H8VA 4HJ0C 1KRMA 2CESA 4PP1C 2Y62A 2WZHA 3QC6X 2ZXWB 2XQBL 3AUWB 1CFTB 2ODIA 3M8OH 4OLVL 3KCOA 3V4PL 3BLLA 4AGQA 4IBYA 3T71A 4JDEA 2G9HB 5T3XD 4NJHA 4QXTA 3DWTA 4MSWA 3ATBA 4JYEA 3WGVB 4NVTA 4XP4L 4M93C 4AZ8A 3C9NA 2BGSA 2YR1A 3OLGA 2OTUA 4Z1CA 2Q6ZA 1PHWA 2QVMA 1NGZA 2VKZG 4IOFC 2I32A 1LK3L 1X96A 4Y7MA 3P3SA 4NPKA 1XBYA 1QLFA 5AHNA 2H3XC 4C83B 5EOTB 4UMBA 3WY4A 5I5IA 4I77H 1D3HA 5BV7H 4EDWH 4X8XA 4F7EA 5CP7A 3H9SB 3ARWA 2MOGA 5HJBA 4F57L 2A4AA 2IQ9H 4GSUA 2ZCHH 5L0QC 2AP2A 4KQ4L 3LGDA 5JHDB 3W11D 3AXKA 5L6YL 2JCCA 4D8OA 3APGA 3X11B 2YAOA 3QT2A 1H5YA 1JGDA 4PBEA 4MA7L 3II3A 1W1VA 3N6HA 3ZHDA 4XVSH 4KY1L 4OJEH 3ZR5A 5GGTH 2WTRB 5BRZD 4YTTA 3CFNA 2ZWZA 2ROXA 3DBSA 3HIJA 3EMCA 2C91A 2O5ZH 1DJSA 2DSVA 1JHTB 4JHMA 1SLVA 4ZRGA 3IETB 2BSSB 4AQ1A 1A3RH 1YNTA 1UWQA 5CINH 4QEEA 4R4BB 4UB0H 5AG9A 3VTMA 4YUEH 2AEPH 5CBAB 2XVLA 4I7VA 1MWAH 1A9BB 3RAJH 4IFKB 1UJQA 3B4UA 2RHGA 3BRGC 4HHPA 2OXGB 5MEPA 3RVTD 3RX5A 1DFBL 3NUKA 1I2RA 1K9FA 4U1NA 3MSDA 4L1TA 5KVGL 3HQPA 2AQSA 3Q1EA 3FQTB 2OFQA 3NOEA 4ZT1A 3KVPA 4MMZC 4F9JA 3QCTH 2DM7A 4D6DA 1UJ3B 4WI4A 1ZRQA 4GIOA 4P3CH 4AJ0A 5DTFB 3FDGA 2CHZA 2GPZA 3UW6A 2AMGA 2UZIH 1DSWA 3BKJH 5HDBE 4PRNB 4FTDA 3H0TB 4P2YA 1CFTA 1SJEB 4MWAC 4U1HB 5GZNC 4GRWE 2DJMA 4AMWA 1NFPA 1F6PA 4HS8L 4GY1A 2K7QA 4S3DA 2HT3D 3EJTA 4F8LA 5D7KE 2P88A 5D71L 4XBJA 4N68A 4Z7NB 4OI9A 2QYGA 1E8ZA 4GG9A 4Z3FA 2LLEA 3C60D 5TFSH 2GT9B 4LSTL 1ZJBA 3LRKA 1QOXA 1VZGA 1MQ8A 2E3ZA 1BZ7A 5D03A 2NX5E 1HIZA 4XPGH 1JZGA 1AO7B 4NEHB 4WKFA 2ZCLH 3ZE0B 3OXRB 1FP5A 3QGKC 3IU4H 1WYIA 4PP2B 4TUJB 1SZNA 1WBZA 4IMGA 1C8YA 5EOTA 1MUMA 4E38A 1OQOA 5DMJB 3Q01A 4AKQA 1MSSA 3HNSH 2Z6JA 4MX7B 4AK1A 3H9SA 3SODB 2PGRA 1ZXQA 2WYZA 4XBKA 5TDPA 3GFZA 3USZA 4W9KC 2RJHA 2INEA 1KO0A 2VTFA 1J1XL 3P6LA 3R8BB 5JHDA 5I19L 3CH0A 2LU5A 3X11A 1UZHA 4S0SD 1J4EA 1W2PA 4LKCB 3UD6A 2PP3A 2BODX 1O75A 2Y9RT 3A4WA 4QRUB 2BB0A 3VFUB 3KWWA 2AJVL 3BG3A 1OCJA 4N9BA 2YAPA 1AQKH 2QGHA 4HUUB 3GVVA 3M1OA 4MJIE 2ENSA 4P9HH 4DUOA 2EYTA 1PCKA 1JHTA 4S3EA 3GZPA 4J3OH 4IRJB 3IETA 3O8XB 4K3EH 2H90A 2BSSA 4DHGA 1SJBA 1GPOH 4R4BA 4Q9RH 3HQNA 4Y9AA 2NY2C 4B5WA 4Q2ZB 2GJNA 3MYPA 2OG9A 1R46A 5CBAA 4E8GA 1ECQA 3F7RA 3VIJA 1A9BA 1MQPA 1MCWM 4IFKA 3GRIA 3QDME 3V8CA 4BINA 2OXGA 3UZQB 2R29L 2VKWA 2UUDH 2FJUB 4IUGA 1CGYA 3FQTA 4TLSA 3O6FB 4F66A 4OV9A 5GISL 1UJ3A 4OU1A 1VP5A 2QNEA 1BSIA 2VR4A 5DTFA 4ATTA 3QXAA 4LHQB 4IDLA 5DJAB 1HXYB 3H0TA 4KEMA 5L6UA 4U1HA 5D7HA 4JY4B 5CSRA 1JK8B 1LDCA 3L9EA 5BXSA 4AEFA 3T6QC 1Q6OA 2VDMH 4PW9A 1WLHA 5EU6B 3ZIZA 3MRJB 3UXFA 5DD0L 1DQLH 3G5XB 2BCMA 1QI5A 2VDRL 5GS0D 2GT9A 3C8NA 4YL4A 1V03A 1IEHA 4QJ1A 4UQBA 4LB3A 3FHQA 3OX8B 1B9BA 3LLDA 1AO7A 3FFCE 3IEAA 2OX4A 5C0CE 3B7RL 1V4YA 1Q63A 3IGHX 3VYPA 3BUTA 3RWCB 1ZCOA 3NO3A 2NLYA 1S46A 4PP2A 3GG7A 4TUJA 4FA7B 1MIML 3MYOA 2V30A 5GS1B 3N6YA 3GBNL 2PYEE 4W84A 3OZ9H 3WXVH 4OV4A 4MX7A 1C8QA 4BCYA 2AOSA 2CO7B 3SCWA 3C2VA 4TN9A 1V6XA 1U8HB 4KVCH 4GKSB 3F7LA 2HVNA 1J9QA 4WSJA 2WHJA 5LQBH 1LO2L 1PZ1A 4DP6X 4WV1A 4TTDD 3UY7A 1A6TB 4KZEH 3BKML 3H2MA 3MJ6A 5HA7A 5EZOH 1A3ZA 3PNUA 2GDVA 2AJXL 4LKCA 1MDLA 4FNTA 4ZPTB 4QRUA 3VFUA 4RDZA 1ND0A 3SCMB 1JVLA 3DOHA 1ML1A 4HUUA 2V5KA 1RA0A 2KLTA 3SI9A 6FABH 1OEZW 3RPMA 2MIZA 3PUUA 3V4VB 2PTXA 2DMHA 3VIPA 4WY7L 1YN6B 1I8AA 3W1RA 1FO0H 3WUWG 4TNVK 4GK8A 2CEQA 3NQIA 1ORQB 5D38A 4NHVA 4Q2ZA 4WEEA 5H8DA 1B0RB 1EBAA 1GWJA 3F4VA 3ATEA 4LCCB 1AZ1A 4FQIH 3CFTA 2WZMA 5I9QB 5CM1A 1TKKA 3Q2WA 2EPKX 3K91A 4RZ5A 4YTQA 3UZQA 1I8UA 4Z7WF 3NJIA 3ATZA 5FYKE 3MUUA 1URLA 3W0WB 5DD3L 4WGKA 5KJRL 5FGCE 3VXGA 3QG7H 3WS6A 1X1ZA 3O6FA 1X5KA 4WNQB 4Z7OE 4MD0A 4YX2L 5IB4B 2AHIA 5JQ9A 4LOUC 3WFLA 1FSKC 5I1AB 1AXTH 4XO9A 3CK0H 3AJXA 1K4GA 1ZANH 2R1WA 3DX0A 3M6YA 1TQBB 3BQVA 3STLB 1YYAA 4JY4A 1JK8A 4UQ3B 3QRHA 1S9YB 3HZMB 4RIRA 5A8GA 4C6IA 3S37X 3X3FH 5EU6A 4WFHE 3MRJA 2WXQA 4N2GA 4KDTA 4KXDA 4HBCL 3MOBH 3S8WA 1GYCA 1LG2A 3NL3A 3G5XA 2WXPA 3F6IA 1YYCA 2YSTA 3Q2VA 1XCTB 2O7SA 1DVUA 4CQAA 4PJ9B 1TTAA 4FXSA 4CRPA 4XWGH 3CFEB 2Y0SA 3AYTA 2BP8B 5SX4I 5C6PB 1FL3B 2HYMA 3FK3A 5D70L 4WI7A 1N6QH 3RWCA 2WLNA 2MKLC 3CWOX 4H25B 4O2EB 2A0LC 3VFTB 2IDCA 5GS1A 4X6DE 4WNJA 4AY8A 1DBTA 4HPYH 1KEMH 4EPSA 1LLOA 3W53A 4L48A 4H3DA 4LBEB 2CO7A 3SJVB 1U8HA 2CR0A 1NOUA 2QQNL 1E3ZA 4GKSA 3VFNB 4N4QA 2R23A 5KYYA 2ZA2A 2IV8A 4LBRA 3WDHA 2AZAA 1SEBB 1MIEH 3MJMA 1VBGA 3M9YA 4KK6C 4EPBC 4PWKA 3Q67A 3LQMA 1N2VA 4J3OF 1QU4A 1BV8A 4I5BB 2IOMA 3B8VA 4JFEB 4Z17A 2XQYK 2KT6A 1IGIH 1A5OC 4LT9A 3M16A 3CTLA 1HL4A 1Z9MA 3O9WC 4PMOA 4HPOL 3STZA 3WF0A 5EU5B 4R0LB 4N26A 2H47C 5KVFL 3W6MA 4AC2A 2V5CA 1JPSL 4K9EC 4MAZA 1ORQA 5GS0L 3F5JA 3UJJL 1B0RA 3W2UA 5ABEA 1MNZA 1NWRA 4LCCA 4PG2A 4QRNA 2FKPA 1OCCB 1NMBL 1V7ML 3GUWA 1UCBL 2A3BA 1T0OA 4ZAKD 2CZVA 1K7XA 3W0WA 2EO7A 4CCZA 4RGMB 3WJJA 3KCLA 4Q6YA 3N44B 4EDXB 4FABL 4M51A 4ZNEA 3C8FA 3UTSD 3VI2A 3VPLA 1YLVA 2VWTA 3O4LD 4FYSA 5IB4A 3R06A 1GJUA 1E15A 4K4KA 4OT1H 5KTEH 2QR0B 2W9DH 2IAMC 2BNRD 5EFIA 5I1AA 4X99A 4WFFE 1HYSD 3FYYA 4AMCA 2R0LH 4KUCD 3LNIA 1MI5D 1R1CA 1XR8B 1EF2A 3NFNB 4UQ3A 1E40A 4FFVC 3RO8A 4A68A 1S9YA 3HZMA 3W2JA 2QGEA 3PXHA 4LVNB 3WG6A 4N2BA 2EDLA 4PJHE 4P46C 1XCTA 1UFUA 4PJ9A 1RURH 1R3IH 3EJZD 4ZO6A 4I3GA 1VYSX 3VKKA 1GVFA 4YZFF 3CFEA 4B9CA 1GH7A 2BP8A 1FL3A 4LOVA 5FM8A 4DJDC 3NH7H 4BSJA 3TFKD 2CM5A 2H0PA 2VWEE 4F15C 5JQ6L 2QCFA 4P7OA 5AKVA 1GQKA 3VFTA 4JUSA 3RM4A 1INQB 4ZTXA 5H37A 5EMLA 1S9XB 4A2EA 2DKUA 5DGQA 1PG7W 4M7LT 2WOBA 5TF1H 1UJTA 2BSCA 3T07A 3QV7A 2GBTA 4BRJA 4YHEA 1OAUH 3SJVA 2OM5A 3D30A 5LA2A 1ZHLB 2N7BA 5IJCC 5AHIA 3VFNA 1H3WM 3JS3A 2OZ3A 5DJ0B 3FU6A 2H1XA 4HJWA 1SEBA 6REQB 4KGJA 3BN9C 4XNZB 1RUQH 1AGDB 2H3BA 4I5BA 1A14L 4JFEA 2YL5A 3N1MC 1GGIL 3PJWA 3GRWA 3TPKA 3WO8A 3FCTA 3VW3H 4BK4A 1S6NA 4OKVA 3F7PC 4ORIA 3CT2A 4PBVC 4X5LA 5EU5A 2OYPA 2C13A 4R0LA 2UVEA 4B92A 3I6KB 4Y9GA 3M47A 4I3RH 4NZ8A 4QXUL 4PRAA 1PWMA 1HILB 4W9CC 3URQA 2P3YA 5BXTA 1CLOH 2YJLA 4XAZA 5IZ7A 2CO4A 1TTFA 4JEGB 2VLKE 3JTTB 3RRQA 3PQYE 4JQXC 3F58L 3L5WB 1W17A 3GTXA 5CS7A 2DQDL 2ESVE 2V5LA 4NHCH 2D31A 2FZ3B 4W9DC 3KYAA 1PXGA 4YBLB 3H3BC 4F37F 3RVXD 1DVFC 1KF9B 4EDXA 3Q6GL 4DKAA 2BFGA 1OGPA 5K1JA 3EH5B 1MCKA 2DI7A 2V5RA 3BSZH 7PTDA 5JW3L 3ETTA 3SKMB 3F2LA 1IC4L 4TNWK 1R86A 2QR0A 1R33A 2QMJA 2FECI 4LCWE 3WIHH 4Y5VB 2RFXA 4ABVA 3QY8A 4Z0BL 1QWHA 2FO1A 1XR8A 4L3FA 3NFNA 1FFNB 3H9YA 2JQAA 1ANUA 2UX7A 4L3EB 2J6EL 3O16A 4AVIA 4UUIA 1SLWA 1RPQA 2XDHA 4GP5B 1VKXA 1GOQA 3F84A 3DYOA 3AWFA 3SM0A 4F8QA 5AYTA 2KDYA 1PX4A 1PY9A 1DUYB 4NAFA 1TEFA 4N2YA 1XLBA 3T6WA 4J4PA 3QZ6A 1UQZA 2DW7A 2VFEA 3OGRA 3WMSA 5CZSA 3KYNB 5D1XC 3O0RH 3QH2A 3AU0A 4TOYH 1INQA 1S9XA 1JMZA 3NT0A 4Y6GA 3TZVB 4XPTL 4KRPD 3ZKND 2X1UA 3H55A 1WDSA 3TYDA 2AMUA 5T3ZL 5DJ0A 3QS3A 3ROOA 3CBKB 5IP4A 2DICA 3VD9A 1H7OA 1HCVA 2VCAA 3MJ9L 1A53A 1A21A 5LCVH 3UBXG 3DC0A 1AGDA 3L0GA 1BZEA 4OTXH 2BIIA 3T0EE 1NCBH 5A6BA 1K8DB 2NRDA 1T0NA 3UWEA 3LIZA 4GQZA 5GPRA 4GSDL 4UT9A 1E5JA 3IJQA 1EZWA 3GBEA 3I6KA 4QDWA 1O5KA 3VWJD 3OR6B 4OLZH 4HZ1A 2W9LA 3GSNL 1WWCA 4Q4RA 5A6LA 1O7AA 1XAKA 3ELQA 2F5BL 2JIWA 3IGUA 3JTTA 5C6TL 4NT0A 2XQYG 1FYTE 3L5WA 2BXZA 4HUCA 1S39A 2B5IB 4R96B 1DE6A 2EADA 2FZ3A 5B22A 4YVUA 4N02A 1KCZA 4NUPA 3TAOA 4MNQD 1AZZC 4OJFH 3NM3A 1SZEA 4UZGA 5E1AB 1MUWA 3ASWA 1CF8L 3V6ZB 4Q6IC 4FI6A 3SKMA 4JDBA 3D34A 4GJIA 4N0RA 4XI5D 3L23A 4J23A 4Y5VA 5G2IA 3GYCA 3ARDB 1CQYA 3VXMD 3RB7A 1EP2A 1E9LA 1RQ5A 1LF1A 2XH7A 2Z0UA 3HMWL 1OK6A 3VD0A 2FNWA 1F3XA 4IKNA 1KZQA 3JWNE 2X3BA 3L81A 4XP6H 4BY3A 2WAHA 2GSIA 3BISA 4L3EA 1Y65A 4P99A 4Y16B 1YBQB 3TSDA 3FQ1A 5FGSA 1UR9A 4LYRA 3MY9A 1J96A 4UANA 4Q7BA 4FRWA 4G1MB 1R0MA 2VITB 4HCGA 4U4BA 2XISA 4MZYA 1A5BA 5CIPH 2FMNA 3KTCA 1N4XH 4B2DA 1DUYA 1MNUH 4QJ3B 1S7RA 1ZV9A 2ICWB 1LRNA 3HE6D 1WWAX 3LA4A 1YTKA 2PZNA 1L6FA 4AVOA 3KYNA 3H7RA 5KAQF 4BZYA 2YQ3A 1LYXA 3RVWD 1WP6A 3TZVA 1SBSH 4DX3A 2A2IA 1MCBA 2GQHA 4B5XA 3RWFB 5T5FA 2HT4D 4D8LA 4JY5H 5BOZG 3MLUH 2I26N 1UA3A 3GIYA 4OCYH 1G1YA 4AUJA 2C3ZA 5ESVB 2FZ9A 1JZ6A 3TCXA 2QJGA 2E7BA 4ZMGA 4PBXA 5IGXH 1PDKB 3FQ4A 2AGTA 1NY1A 1YG9A 5D1QC 4AHPA 4ELDA 3CHDA 3OZYA 2XICA 2VMDA 4OZIF 4TNVF 2RCSL 3L4WA 2VX4A 2I56A 3RZWA 2OS7A 7REQB 1BAFL 4OGQC 3VXTB 3OR6A 1EHAA 4KEVA 3DMMD 1OP9A 4ODTL 4OOZA 4JX6A 4ZK8A 4L4OA 1LBLA 2YAHA 3EKZA 4HK6A 5A6SA 1GW1A 4R96A 1VSCA 1BLNB 2ZIDA 1OVZA 2ZC8A 1K6QL 1JUKA 3R10A 1KCVH 4F8PA 1WZKA 3U5UA 5BZDB 2WCSA 5IVXF 1TVHB 3V6ZA 1TTRA 1IAIM 4PRTA 1B3WA 3GMPB 4IGBD 4F7TB 2DJ4A 4OFYA 4JB9L 4HWEH 2QGCA 2NYZA 3IFPA 3F01A 3ARDA 2FLMA 1XISA 3H1ZA 2CHNA 3ZLQC 3S48A 5AYBA 2OSLB 3VXQB 4E4UA 5EU9A 1H49A 1NCOA 4JGNA 5TF0A 2F1AA 2FJFB 2BZCA 1PZ0A 2CO3A 1IR1A 1XLKA 1YBQA 4Y16A 4AT6B 3X1NA 4YSOA 4UFHA 3UBHA 3TF4A 4G1MA 4X5PA 2VITA 1XGYL 3GB7B 2YGQA 1JYXA 2Z6IA 1I9CB 2IANE 2BINA 3TN0C 1E0UA 2F68X 1A3LL 4ZMNA 5E03A 4DBWA 2ICWA 4HK3N 4O10A 4FHAA 4DUVA 5KBMA 3MB9A 1RK0B 3MRNA 2NOYA 4M7LL 3WCZA 4IBQA 3AREB 2DWXA 2V2HA 4RMWA 3CSBA 3RBGA 4DGIH 3BRFA 3V5KB 2VMEA 3TYGH 3RWFA 1QO5A 1X9UA 5D2NA 4PVMA 1I75A 4PJ8C 2YEZB 3GIZH 3B9KD 3UXIA 2MNWA 5ESVA 5FUOH 3TV8A 3WQGA 4CD5A 4MAUL 2G60H 1PDKA 1NFDA 4HIHB 4PLOB 3HA0A 2F7PA 4TOQA 1GUVA 3TESA 3O4OC 5DUML 4LCSA 1OAQH 4HJEA 2EG8A 5LG1A 2EILB 3DBXB 3OJ2C 2PDGA 5AN7A 3M07A 2V38A 6PCYA 1S2AA 5DUPH 1VIWA 2V5DA 3R1GL 2GSHA 4WDWA 4QCIB 3VXTA 3K5XA 1QNQA 4XSLA 3QNXB 5FSEC 5A2CA 3OW1A 4P2CG 2RKXA 3L7FA 3KW3A 3GX9A 3Q9QA 4JKMA 1B4EA 4KX7A 4QEGA 2J6VA 1IC1A 1WNOA 5JR1L 2V2TA 4KFPA 2A2QT 4AZUA 3QYSA 1BLNA 2D7TL 3O3BA 4LFYA 3F85A 4HKZB 4QLLA 2K4AA 4RMBA 3MXVH 4M6AA 1YPIA 3COTA 1NM4A 2MCPH 5BZDA 4PE8A 1TVHA 1I3RB 2YKLL 3GMPA 3SD5A 3VA6A 4ES8A 4KK9D 2OJEB 2NUTB 1BG1A 5FKPB 4GW5B 1BQUA 4KO7A 4Q8PA 4H8UA 3C5QA 4BK9A 2JI2A 3TEUA 1DQXA 1HKVA 4AMKH 2D69A 2OSLA 3VXQA 2XGIA 4P2OD 4OZGA 3B5HA 3PHOA 4KKLD 3ETBJ 5EIIA 4I1PA 2FJFA 1J05A 3AMCA 3MN8A 1D9KC 3BLEA 3OB8A 1ZVNA 5I6XC 2GDQA 2O4MA 1F5ZA 3EKLA 5IEHB 5IBUG 2XVPA 2BP1A 3LEXA 4G8GD 4POZC 4IJ3C 3WL1A 1RK0A 4ONOA 3QRBA 4YGAB 3FNDA 2ZZUT 5T1DL 2EACA 4S3FA 1D3CA 4JM4H 3AREA 1AUSL 1TNNA 3O2DH 1JEZA 4CADB 3V5KA 3A3YB 4NLHA 4KUZL 3EA2A 3PXLA 2VDOL 4M5ZL 3PNWB 3GUFA 1DDHB 1CE1L 4S3BA 2YEZA 1OD9A 2JLPA 3ARTA 1D2OA 1FCQA 4PB0L 1J18A 5JOPE 1P0KA 1CL7H 2DLHA 2B4CC 1WAPA 1YHPA 1E9YB 5EU4B 1KT2B 1CE6B 2IIJA 4H2CA 3EYQD 4FA8A 3EXLA 2ENPA 5AWNH 2TRSA 2CMRH 2K6ZA 4XO6A 2VDKL 1SW7A 1OTUD 4HIQA 4G9FB 4NPYA 5KETA 1E0OB 3OAZK 3G2GA 2JMRA 1BREA 1JXDA 4QCIA 2WLKA 2SFPA 2MJWA 3QNXA 2XFRA 4X2UA 3H4HA 1TENA 5L7XL 2EVIA 1BYOA 4ELKA 1NL0H 1KV5A 5CJQH 4Q0XH 4MMXB 3VZZA 3T4AC 3C2YA 3RLHA 3IAQA 1PG7X 3L5MA 4D9LH 4KW2A 5FEXA 3ITTA 2AABH 5D96C 1J0KA 3EWXA 4HKZA 3SCRA 5BV7C 5KBPA 2F6UA 1D5MB 1MCFA 4TUKL 4LCYA 3LD8C 3BUBA 4XWUA 4PMUA 3F62A 1I3RA 4UV4H 4H9XA 3TLLA 3G9VA 2NUTA 5FKPA 3GH5A 1AS7A 4GW5A 3AHXA 4OM0L 2NXYD 1ELSA 2Q86B 1HGYA 1PUDA 1KGYE 2QPDB 1JNEA 4HWBL 3BK0A 4PTTB 1KXQE 3WJZA 1D5BB 2JV6A 1F74A 4QWWC 4M8VA 5LIKX 1T80A 2YL6A 1W91A 1U1UA 2H8ZA 3PJNA 2HVKB 3WNPA 2FO4B 3USBA 3BWZA 4OE7A 3AICA 3RX7A 3QO1B 3BUYB 4NZRH 3URBA 4CMHC 1MFCH 4XNUL 1QBLL 5IEHA 4L3CB 3DKHA 2VDQB 4Y90A 1ZD6A 1SFJA 4WUUB 4PG9B 1TQCB 4Y0GA 3PFMA 3LZ5A 4P59L 3VA2C 3FJ4A 5AC4A 1MCIA 1AFSA 2HBXA 5DJ6B 2OCZA 4EVZA 4PJGF 3RI5F 1YQVH 4RDYA 4XIAA 3PNWA 2V0TA 1DDHA 1SHSA 3NWRA 1SFSA 3ARZA 4NYLB 1PVNA 2Z2UA 1RU9H 3LKRB 2WMIB 3QV8A 3P77B 3VGGA 2KI6A 3H7UA 4O4YH 5I1LB 1KT2A 4KDWA 4IP5A 3P8JA 1CE6A 3ARGB 2XOTA 5ANME 4WJ8A 5KTLA 3GFYA 5KZEA 3VRLE 1EUTA 4UTCA 1OWRM 4FULA 3NDYE 3UL4A 4XCEB 2R27A 1Y18A 1AXSA 2ACRA 4G9FA 1YYML 5C6MA 2X6UA 1FORL 5EH1A 4JM2A 4RDVA 5I0YA 3O15A 2PTTB 3S6DA 1LE9B 2I07B 2ZUVA 3CMGA 1OB1B 4NP7A 5T1KB 2ED6A 4CQCA 1KB3A 4NQVA 4C4BA 3F3HA 4X7FC 1ACYL 1EF3A 1UT1A 3AHZA 3GXPA 3VDHA 2WO2B 2VOMA 4IKIA 4N0FB 3UERA 1D5MA 3P9MB 5HNRA 1M3UA 3N4EA 4PJFF 3Q8EA 4DBDA 1XSKA 4FF9A 3W28A 2E76C 2JJVA 3NJLA 2JBMA 2Q86A 4P07A 1JTPA 3KL0A 2CK0H 4ZMOA 4MHHG 2A5UA 3ANUA 2DZSA 1BYNA 3STBA 5JXAL 5A5WA 4PTTA 1EHLH 1IWAA 4XHJD 1D5BA 4P9HC 1I85C 3UAJD 1T03H 2Y5TA 1P4LB 1XZ0B 3BZGA 1EDYA 4J3OC 2HVKA 2FO4A 2ZF8A 4G72B 4WO4C 2Z31B 1O7SA 4QG9A 3ZE2E 3GRBA 3FS2A 3GHEL 3KX6A 3QO1A 2J6WA 1DBKH 1HXJA 3BUYA 2Z1VA 1J5OL 4DUXA 4L3CA 3TMLA 3JZUA 5D2VA 4GRLC 4O17A 1XF1A 5JIKA 2TYSA 3WFAA 2F53D 4PG9A 1WK0A 4Y1AE 4RNHA 1TITA 5EEYA 5JW4R 1C5BL 1OAXL 2D4DA 5HHOD 4EE2A 3NGBC 2FZBA 3DFSA 3VGFA 3DESA 4GMSL 1AZNA 4BEUA 4FXGA 5CGBA 4OM1L 4W87A 4RAVB 2YD3A 3T3PB 1DQML 1URIA 1LP9B 3CLFH 4NYLA 3W9DA 3UJIH 5D7LD 1NKOA 3LKRA 2Z2AA 4RWHA 4P3DB 1EOKA 3WJXA 3SQOL 5I1LA 3O6CA 4R6UA 3JV4B 5T33L 1Z6JT 4NF7A 2ZXCA 4CCCA 4JZJC 4ZUVB 5CD5C 1GS8A 4XCEA 4IIQA 4LCUA 2X2YA 3FT1A 5ABFB 3BQ5A 8PAZA 2A9MH 3N9KA 3N1GC 4PJEF 2PTTA 3PGFH 4PGLA 1CZ8L 1LE9A 1ZIBA 4NX5A 2I07A 3AQZA 4P57B 3BO9A 3SW6A 3OAZH 1RUPH 2EICA 5T1KA 3JTBA 3CZJA 1SRDA 4JQ1A 4OCSL 1E9OB 3WO4C 4XXWA 2F0CA 3M43A 1OD7A 3SE8L 2P1YA 1G6RH 3GNMH 1OE2A 1E9PA 2GAZB 4N0FA 1NUGA 1JAEA 4V1DB 3N9GL 4UAHA 3FJNA 3P9MA 3LK6A 3UYPB 2IQAB 4KROC 1R34A 4DP0X 3QPQC 4E42B 2WZ5A 1Q90A 5F1IB 3MWCA 4XPHH 1F8IA 3HHSB 3DI0A 3S4SB 2ZSVB 3L7EB 2BHUA 4MFDA 3Q3GB 3L3DA 2DLFH 3EKCA 5FYJH 3RIKA 3VD3A 3H56A 5IB1A 4MAVA 3SCUA 3VE0B 1A7OL 4IG2B 1FWXA 1KFEA 2BOBB 2AQWA 1W3IA 5K4XA 4NQEE 1P4LA 1XZ0A 4HMDA 3PN8A 1SHWA 3LXUX 1WFUA 2B4CH 4WCYH 1ZBWA 2Z31A 3I74A 4DH2A 3JV6B 4OZHF 5DSCB 4MQXD 5A95A 1MW2A 2DQHL 1S7UA 2EDJA 3KL3A 2HVMA 4LPVA 3UBFA 5AVHA 3MRCB 5FFOA 2J25A 3DGBA 4GFTB 3MLTB 2VXVL 4LPWA 1ISWA 1FWDC 1GYAA 1FBAA 2NXGA 3IXTB 5K4ZA 2FWOA 3LV6A 3I4EA 4ORGB 1NSJA 4RAVA 2PP9A 1K6WA 2W60B 2ZJSL 1KFAH 2OK0H 1CK0L 3B2DC 4V2CB 1LP9A 1MOEA 5IW3A 5LXGL 4APQD 3SCSA 3SDDD 2A79A 2VDPL 3NIDB 3LZPA 4P3DA 4YSQA 3QUMH 5CJMA 3JV4A 3FU0A 4NJKA 1ZVSB 1NDGB 4Z2LA 3EYSL 4NFBA 5DXYA 4ZUVA 4DEPB 2J7LA 4N8PA 1OFRA 5IUCA 5JIHA 1XIDA 1I1AB 2JCCF 2OQLA 4ENED 3FUHA 4ABUA 3RGVD 3SY6A 5C0CD 7TIMA 5AHMA 1OWWA 1VLWA 1FP8A 2XPGB 4M43L 2JFCA 2E6FA 4YDKL 3T7VA 2D9CA 3D3VE 3F4NA 3QS2A 2EYSA 4FNUA 1QO2A 5CEXA 4PJ7E 2R1PA 3WH6A 1G01A 4J5VA 1KJ2H 2GAZA 5SWSE 1JPST 4N9GB 4V1DA 1V5JA 4JRXB 1E4KC 2PTDA 3VUAA 4NNPH 5BO0D 3UYPA 4A7QA 3GDTA 2IQAA 4JFHD 2QS8A 4LBSA 4GABA 5F1IA 1MPAH 3HHSA 4W4QA 3S4SA 4WUIA 2ZSVA 1UG6A 3TLQA 1CBJA 3FDWA 4ZMZA 5LNRA 4HX1B 3RLGA 1ETA1 4F37K 1BRLB 4CMMB 3E9AA 3VE0A 4K73A 4IG2A 3LS5H 2BOBA 2Y70A 2OT0A 4H6QA 3FK4A 5ANHA 1RZFH 2CKNA 2CDGB 1W5OA 1GC1H 3FB5B 4OUEA 4QRQB 1AH3A 5DSCA 3L7RA 4EO5A 5A2JH 4NBYB 4M7ZB 2FX7H 1RD6A 3N34A 4S1RL 1LJMA 4N2NA 4C1LA 2G9HA 3AXHA 3I6SA 3FULA 5T1LB 2BHFA 4G3YL 7A3HA 3KBHE 1RBAA 1P9MC 3UDWA 1SM3L 3MRCA 5FYKD 3MLTA 5H91A 5FC9A 1XIWC 5E9AA 1N5YH 4FAMA 4N2CA 3O6YX 3KVKA 1UYWH 4XE5B 4ORGA 6XIMA 4R7XA 3LERA 2W60A 4WGHA 1R47A 5LVEA 4PRWA 4XBEL 4AWSA 3E2QA 1RZKL 1QI2A 4C83A 1VCVA 2DTSA 4DWDA 3QM3A 4HKPA 5IJDC 1WA3A 3UO1H 4OQ1A 1EJTC 4NXKA 2INZA 2ZYSA 1WB0A 4D7PA 4FI7A 4WFHD 5CHNB 3DSFH 3ECVA 1XXXA 1Q66A 1ZA3B 5EF3A 2XTJB 1I1AA 5E95B 4Y2WA 3I10A 4CSZA 3DHDA 4JNMA 2PR9A 2GHWB 1UHVA 1QFWM 1BKHA 2JB5H 3D09A 1CYXA 3GG1A 2WTRA 4PY8I 3THML 2JELL 1HE7A 2XPGA 5B3JF 5IB3B 5GZOC 2IH9A 2AITA 3UH8A 3GJFB 2G2RB 5KYUB 4OCMC 4B5SA 4XMVA 3ELFA 1M01A 2X4NB 1EGJL 3N0AA 1XV8A 1HZHL 5E56A 4IF2A 1PZ5B 4N9GA 3F00A 4XK2A 4P4KB 4J3OG 3RB5A 3F04A 5A7EA 2CLKA 3D46A 2WQSA 3GD1C 1XGQB 4GXMA 3LYEA 4K7PL 1BHGA 4HX1A 3A3WA 1MQQA 1MFDH 3LRHA 1BRLA 4CMMA 4C5YA 5CN3A 2CBIA 2QAPA 5FJRA 3OKMB 5IBXA 3ZTEA 3UPMA 5HHNB 2VZ1A 3QEUB 2BLFA 4PJDF 2K70A 4NN7B 2DVXA 2V6HA 3F83A 4JQIL 4X9YA 2CDGA 4PRNA 3ZXAC 1RP8A 3MDUA 1SJEA 5CXPA 2EEBA 2C9QA 3DPDA 3W37A 5AAWC 1YY9D 4BUQA 2AMXA 1OT2A 3D39B 4BWLA 1QSVA 1NGWB 2DBLL 5I74B 3SIZA 5T1LA 4POYA 3VXRE 4GNVA 5GS2D 5J6GB 3L5IA 4AVNA 4PMVA 4ANUA 3I65A 3G6LA 3NCYS 4R9HA 2J56A 4IW4C 4G7QB 5J12C 2VLJD 4PLKD 4NZUH 4AL8L 4H0HB 3HUJE 3HB3D 2YSWA 3OXRA 5KUKA 3B43A 4N6QA 1CT5A 5I15H 2YBGA 3BQ6A 5HJLA 3UEQA 4AZGA 4IMLB 3VH8G 5EIVA 3TA3B 4C56D 2NWRA 1AKJD 1TYEB 3KXFE 1QBAA 3DV4B 5AW7B 3K4DA 3FQWB 1U42A 1VBJA 3PZGA 5K9KB 4ZE4A 5CHNA 2G3XA 4D9RE 4LALA 4EIZC 4I1RA 1ZA3A 3ZKSD 5GJTL 1NCAL 1AS6A 3ERXA 1PZCA 4O28A 3SBWA 3TN6A 1WCQA 1OM3H 4Z1YA 4PUBH 1KYOJ 3DENA 3L5LA 1OW0A 5F7UA 2PB1A 3I6EA 3CSYB 5BW7C 5CFAA 2NZ9D 4QE1A 1E27B 2QSCH 9XIAA 5IB3A 1BTMA 2Y5QA 3GJFA 1YEEH 2EXWD 4PCFA 1JNJA 5KYUA 4IRJA 3BUPA 5JPNB 3O8XA 5F7WC 4DGUA 2R4SL 5IY5B 1OK0A 5FYKL 4MM1A 4PVLA 1PZ5A 3RDTB 2ADFH 1R2RA 1FWAC 3QZWB 1JGUH 1AHWC 4WDIB 4OZOA 2V2WB 3ZJ6A 2PDNA 2JB6B 4KJYB 2BX7A 3VG9B 4EMZA 4WEBL 5FIPA 2A7RA 1VERA 3QCVH 2DSUA 3K2KA 3PBYA 1H60A 1YEDB 1I1RA 1E4MM 1DCLA 3QDJB 5E8NB 4GJJA 1IGFL 1TR9A 3EWDA 4IBUA 4PODA 3ECQA 3VOHA 1N10A 5HHNA 4Y8EA 3QEUA 1ZL1A 1WIOA 3IUDA 4FHBD 4WF7A 5DJAA 1VCAA 3TVMB 3U4BL 3AHTA 1HXYA 4JRWA 2Y7LA 3SY0B 1B5TA 4AZCB 3MGOB 1Z69A 3D4GA 3W71A 3U0WH 2BPBA 3B5GA 4TVSa 3D39A 4DPRA 2DVTA 1BEYL 2XIBA 3KRBA 1NGWA 2YD1A 1RCYA 4N5UA 3WLPA 2D2JA 4XX5A 4AIUA 1MCNA 2MQCA 3KPRD 4IRZH 4JEJA 5J6GA 3GKZA 3E0FA 4C6EA 4R7NB 2A1YA 4RK8A 3GXTA 3FQRB 5J8LA 4ZE5A 1WZAA