5ECUA

The unliganded structure of caldicellulosiruptor saccharolyticus gh5
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
350
structure length
350
Chain Sequence
TAYEKDKYPHLIGNSLVKKPSVAGRLQIIKQNGRRILADQNGEPIQLRGMSTHGLQWFPQIINNNAFAALANDWGCNVIRLAMYIGEGGYATNPQVKDKVIEGIKLAIQNDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIAQKFPNDFHIIYELCNEPNPTDPGVTNDEAGWKKVKAYAEPIIKMLRQMGNENIIIIGSPNWSQRPDFAIKDPIADDKVMYSVHFYTGTHKVDGYVFENMKMAIEAGVPVFVTEWGTSEASGDGGPYLDEADKWLEYLNANNISWVNWSLTNKNETSGAFVPYISGVSQATDLDLGSDQKWDISELSISGEYVRSRIKGIPYQPIERTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title The structure of Caldicellulosiruptor saccharolyticus GH5
rcsb
source organism Caldicellulosiruptor saccharolyticus
molecule tags Hydrolase
total genus 132
structure length 350
sequence length 350
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
A PF03424 CBM_17_28 Carbohydrate binding domain (family 17/28)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5ecuA00
3MUIA 4PUEA 1HKMA 4AD2A 3MUY1 3SUVA 3UR7A 2X0HA 3VDHA 3IAPA 4NF7A 3G6LA 3WMBA 1XSKA 4CCEA 1J12A 2OWXA 2PI6A 2VZOA 5LA0A 4MJ4A 1UH3A 2G3JA 2WMHA 2DT0A 5DEZA 4XV0A 1TE1A 3VD9A 5BXSA 2A3BA 1ZU8A 3L4VA 2DT3A 5D9OA 3WNPA 1OGBA 1US2A 2IUZA 2VRKA 3TTYA 4J3WA 2VC9A 1BG9A 4F66A 4HPGA 3WH9A 5TD4A 2BVDA 4A3YA 1W3HA 7TAAA 2XUCA 4CGTA 4P8UA 4A3HA 4BQ2A 1AQ0A 4OJYA 4FLQA 1FP9A 4BCEA 5E70A 4NZCA 5M03A 4N0RA 2FHCA 2WMJA 4LYQA 4ZFMA 1GQIA 1JF6A 1VAHA 1I75A 3WKZA 4AXNA 1E0WA 1FHLA 3RJXA 3W6LA 2XTKA 3KL0A 4U3AA 3ZJ6A 3MUAA 1B3VA 3VGGA 4DWSC 3SCUA 2BS9A 1E6ZA 1KR0A 4PTVA 1XD1A 1JGIA 1WAWA 2Y24A 4AZCA 5JIWA 2X8RA 6A3HA 4Z2LA 1PZ2A 4MNMA 1FA2A 3K8LA 2PC8A 4F9DA 4GO9A 3WUFA 4M29A 4E4PA 4W85A 1TFVA 1G01A 4HA1A 3WSUA 1BG4A 1K9DA 1V08A 3L4XA 3BAXA 1OB0A 1AVAA 3CPUA 2Y4SA 1UD5A 4ATWA 2VQTA 4JFWA 1V02E 1OGGA 1CGTA 1JI1A 3N1AA 3CHFA 3HU7A 8A3HA 4P7LA 1UD4A 1IV8A 3NSNA 4XB3A 1PIGA 4R5EA 3GNOA 1V02A 1ODZA 2WHKA 3M7SA 2VZSA 3ARSA 1HVXA 2CIPA 4JHZA 2YA0A 1NWTA 4CD7A 5AC4A 5A95A 2OYKA 2YDSA 4H8VA 1ZBKA 4AZGA 3POCA 1CGYA 3L4UA 4EK7A 2AOSA 1E1FA 3SCOA 1SYTA 4DM1A 5CSYA 1E0XA 3PZUA 3WQ5A 3K8MA 3VIPA 1XGZA 1R7AA 3WDPP 2YL6A 3LPPA 1OINA 2EPOA 3CLWA 4CD5A 2QLYA 4UFJA 4OZOA 1HJWA 2FHFA 4MDOA 3FW6A 2RGLA 2VVSA 3SCWA 1SMAA 5LYRA 1J0IA 3LMYA 1GQKA 2XG9A 3OLDA 1DEDA 3AZRA 2WYSA 3T0DA 1V0MA 4AISA 3ZSSA 4E8DA 1NWSA 1IZJA 2WCGA 1E0VA 3WEOA 1UG6A 5AYBA 3OIHA 1B3YA 1EO5A 1W3JA 2O92A 3VIFA 2WCSA 1O7AA 2J75A 2XM1A 3F5KA 4TXEA 1V0NA 1N82A 1GVIA 1GOQA 1UD3A 4J7RA 4OUEA 2PWHA 1WZMA 1VRXA 1V3HA 2WVVA 1KQYA 2TAAA 3AMKA 5C70A 3FY1A 2J7BA 5CGTA 3KZSA 5A8QA 2ZUVA 1XH0A 1W9DM 1WDQA 3A4WA 3W27A 1HX0A 2VJXA 4HPHA 2WHLA 1JZ3A 1VEPA 2WM0A 4BS0A 1KXHA 4DWSA 3AHTA 3T2QA 2JE8A 4F8XA 3AFBA 2J7DA 2WLYA 1E1EA 3AMDA 5A8OA 3WD3A 1B0IA 3D5HA 3VGBA 1Z32X 2XWDA 4AZIA 1BHGA 1H0GA 1PX4A 5GPRA 1OWQA 4M80A 2EQDA 3K46A 2ZXQA 1CGWA 5A8MA 1W1PA 3N04A 3OGSA 3T0AA 4HZ8A 4W7UA 4LYRA 1LJYA 2BY2A 5A8NA 3VIOA 2F61A 1TVPA 3WDQA 1JD7A 2FGLA 4GQQA 2O9RA 3UCQA 1KQZA 3W25A 4F9JA 1MW1A 2XSAA 3THCA 2CXGA 1IZKA 4M8UA 3RILA 3OGVA 5DT5A 2VRJA 2X1IA 1TZ7A 5F7UA 1GNXA 2WZHA 1CLVA 1Q6CA 1NQ6A 1EO7A 2XFFA 2DIJA 1W3KA 5CPQA 1EH9A 1G5AA 3WY1A 1XSIA 1FOBA 5HOSA 3L2MA 5I0DA 2PWEA 3UERA 1C91A 3VIGA 3CUIA 1G9HA 4JFTA 2D0GA 2WMGA 3BAJA 3WQVA 4HMCA 4L4PA 5I23A 1H41A 4AD1A 3OZOA 1RPKA 4CU7A 4AY1A 4IISA 4M24A 1QI4A 1WB0A 4XZBA 3SCNA 3AIQA 5JBEA 5CPSA 1Q4NX 3NIYA 3RM9A 1ODUA 1QI2A 2UY4A 3WEMA 3KE0A 1MW3A 2B31A 3WF1A 4YPJA 4XZWA 4JHOA 1NOFA 2PWDA 1ZL1A 1ZS2A 3A47A 3WL1A 1B3WA 3PZIA 3CZ8A 4D6DA 2BHUA 3F5LA 2VL4A 3K8KA 5A6LA 3L4TA 2D24A 3PHAA 2ZIDA 4UZSA 4PMYA 5ABHA 2BNJA 1UR2A 4B15A 5A3HA 4CN6A 1DWGM 3KWXA 2W67A 1JAEA 3DC0A 2VURA 1BTCA 3W0KA 1UR1A 3AHZA 4QFUA 3GZAA 1LF1A 1PBGA 5CZKA 2ZICA 1A47A 2A3CA 5HXMA 3QHMA 1KXQA 3CTTA 1BVZA 3ARRA 3EMQA 1J0HA 2VNCA 6CGTA 4W8LA 5E09A 4D6GA 2O9TA 3M07A 4GKLA 1E6QM 4W5UA 4M56A 3TTOA 3SUWA 1GOWA 5GQBA 5ABFA 4AD3A 1ISZA 2J77A 4W86A 1TCMA 1QVBA 2DSWA 3BAIA 8CGTA 1JZ8A 2J78A 5I77A 3HJEA 1JYWA 4HOWA 3QR3A 3T0BA 3WDJA 2GUYA 3VIJA 3EDDA 4V2XA 3KEHA 4ML4A 1JZ4A 2GDUA 3JUGA 3W53A 3AQUA 2GDVA 3WQ8A 3AICA 2XFRA 2YLAA 4WSKA 1G1YA 3VM5A 1RD6A 1H3GA 4CN1A 2QF8A 2VR5A 1R8LA 3MKKA 3GNRA 1BAGA 4H8HA 3UG5A 2X09A 3CZEA 5A6JA 1GQLA 1HL8A 5BYWA 4UNIA 3W6MA 2G4FA 1E5JA 1PX3A 2NSXA 1J01A 4JFSA 1I1WA 1NARA 3WNOA 3N17A 3WMSA 2JF6A 3ZQ9A 2XVKA 3ZIZA 4EE9A 1CNVA 3HN3A 3TTSA 5CLWA 3ARVA 2WZIA 1GORA 5D8ZA 2WHJA 2W66A 3A4XA 4TOQA 1BYBA 4WKAA 3ZOAA 5CG0A 4UFHA 2DEPA 3POHA 4GQRA 4WKFA 4ACZA 1J0ZA 1HJSA 1V6YA 3CGTA 3WQ4A 4CU8A 3VDBA 2EEXA 4PMVA 4Q7NA 3W26A 5JIPA 2E0PA 1ISXA 1E6NA 1MYRA 5E6ZA 3ZR6A 1XYZA 1CWYA 1UKPA 2A3HA 4RE2A 3GH7A 2VQUA 1DP0A 3CZGA 4PCSA 5EBAA 4FMVA 2EBNA 1MWOA 4P7NA 3N13A 1B3XA 4CVUA 1JXJA 1XC6A 1ZJBA 3WF2A 3ZJ7A 2VCCA 2JFEX 4MAZA 2VX5A 1HJUA 7A3HA 5CGMA 3MMWA 3BMVA 1TG7A 4M82A 4TX8A 2Z1SA 4OKDA 5A94A 1H4PA 2VVNA 1EHAA 1KXVA 5AY7A 2YBTA 2J47A 4PYSA 1XCXA 4IUGA 1CBGA 4AZ5A 4HU8A 3FN9A 3ARXA 4HOXA 3MS8A 5JBDA 4U3CA 1Q6FA 1UD8A 5BWFA 1CEOA 3VD3A 1VENA 2J74A 1G0CA 3W29A 4MNKA 4Y7EA 3ARQA 3FHQA 1RP9A 1WE5A 3MUZ1 2PB1A 2D20A 3CUJA 1W1YA 4TTGA 3WMCA 3WDHA 1UKSA 3PZVA 2CITA 1ITCA 4GZEA 1V3MA 4WK9A 3WFLA 4J3VA 3WD1A 1WPCA 2OYLA 2QMJA 2J4GA 1GOIA 1Q6GA 3SURA 2CHOA 4D71A 1E72M 1BLIA 3IJ7A 2BY0A 1B1YA 4J28A 3GXDA 1D7FA 1B2YA 2A3AA 1GOMA 2WAGA 5IXEA 4YN5A 3WQWA 2FDMA 1UR9A 5AYIA 3AZTA 1QPKA 3GNPA 2YA1A 4J3XA 1HP4A 2WB5A 1W9BM 4E8CA 1I1XA 1LL7A 3AIVA 1BFNA 1BVNP 1MFUA 2V3FA 4P7OA 1W1VA 4J27A 2ZXBA 2UY2A 3PBGA 2EJ1A 1M03A 1OD8A 4U2YA 1WO2A 1PIFA 1LL6A 2V5CA 1JZ6A 1DWFM 4UFMA 2E9LA 2W92A 3DYOA 3OZPA 5HPCA 3E1F1 1OCQA 1DWJM 3O9NA 2VZVA 3FXYA 3VM7A 4AEFA 4A4AA 5I2UA 4S3JA 3W28A 1W9XA 3WENA 4CVWA 4PMDA 4AZCB 4PSPA 1E70M 5BXTA 3NDYA 3I3DA 3LPOA 1UUQA 3WNMA 2CEQA 2IXVA 1L0PA 2VI0A 3TONA 3VMPA 2EPKX 1MQPA 3EDFA 3CBWA 3TTQA 1K6AA 4PN2A 2Y5EA 3VGEA 1S46A 2WVTA 1EQCA 3L4ZA 3SEPA 1X6LA 3AS3A 1NWUA 1CDGA 1W9VA 3UETA 4AYSA 3VX1A 3AS2A 3ZT6A 4B3KA 4QDMA 1CXIA 2GK1A 1MXGA 2J62A 1CZ1A 1C7TA 2VMFA 2V38A 2W61A 4U2ZA 4GINA 4AD5A 2J7CA 2WWDA 1NP0A 3G6MA 2BV9A 3EDEA 2JEPA 1MXDA 3I3BA 4LGXA 4GI6A 1E40A 4J3TA 1R85A 3A3HA 3BC9A 2QMKA 2VRQA 5DMYA 1GQJA 5A6KA 4XUYA 3AROA 4HA4A 3WN6A 1WDPA 2F2HA 5D9MA 3EBVA 3BSHA 1VFFA 1J0KA 3DHUA 1FP8A 3AMGA 2EPMX 1CTNA 2DIEA 4MB5A 1OD0A 1J0JA 1E6RA 4MAVA 5D8WA 3FAXA 4MB3A 4W8AA 4CCDA 1LLOA 1G94A 2DT2A 4QAWA 1H5VA 1UWSA 4UQCA 1UYQA 4P7RA 1E9LA 3VKKA 3VTRA 1JFXA 2YJQA 1GVYA 2X05A 3SUSA 4U31A 3VMOA 3WEZA 1UD6A 1NWRA 4MB1A 2VTFA 2Y8KA 1HJXA 5D4YA 3VGDA 3QHNA 1GOOA 1HF6A 1U2YA 3AS1A 1RH9A 2WVVB 2PF0A 3U5UA 3OLEA 2J8GA 3ZSTA 4Z2JA 3BLKA 3NCOA 1EIBA 5IHRA 4PSRA 2WKGA 3SCQA 4KRUA 4IPLA 2ZE0A 4X0VA 2EXOA 4XX6A 2WMIA 1TMQA 5A2AA 3WIJA 4HMDA 4CD8A 2BHZA 4FF5A 2J25A 2XWEA 2WKLA 2IXUA 1E56A 1W2PA 4JCLA 1ISVA 1E6PA 4DWSB 1HXJA 5D9NA 1VJSA 4LQ1A 1CPUA 1HJQA 3II1A 3NSXA 3VIHA 3WH6A 4UCFA 1CGUA 4UOQA 3WL0A 1V3JA 3T2PA 4ZXOA 2WHMA 1CXHA 2V3EA 4JL2A 3W82A 1E55A 3SCSA 1W9PA 4OBSA 3ALFA 1XYFA 2CPUA 4MB4A 1OIMA 4BQ3A 1HP5A 3WD4A 1BQCA 4UTFA 3K4DA 1OGSA 4D6JA 1JI2A 2DSZA 1M53A 2BY3A 3BAWA 4ZXLA 2MANA 2BVYA 1KWKA 2E9MA 3L4WA 3SIMA 2WMFA 1CENA 3AXIA 2GJXA 1JF5A 2E40A 3AIWA 3M46A 2JIWA 4W8BA 2X0YA 2XGIA 2F8QA 3AHYA 3W24A 4HMEA 1QW9A 3IAQA 5BRPA 2ZX6A 3CO4A 2BY1A 4IM4A 1QNOA 2VR4A 1CXKA 3GH4A 3ZJ8A 2DH2A 1DWHM 5GNXA 4LX4A 1WP6A 1LG2A 3AS0A 1JYNA 3S6TA 1XSJA 3WQ6A 1JG9A 3CUFA 3AXHA 4L4OA 4JCMA 2WANA 4UZUA 1KBKA 2YDRA 4AD0A 3APGA 3CZLA 4EAMA 1ZBVA 3GBEA 2YOCA 3OA5A 4UOZA 4ATLA 2GFTA 2UWFA 3WH7A 1H09A 2WLZA 1MQRA 2XVGA 2JALA 2CNCA 1F4AA 1UWUA 4JKMA 4TX6A 1ESWA 1GONA 4AZ7A 5EMYA 1E4LA 4GO8A 2ZXDA 1E15A 1M04A 4UQ9A 1SFSA 4QLKA 4BQ4A 3ARUA 4NSBA 1B30A 4C7GA 3GH5A 2DGAA 1EDQA 1V0KA 1LL4A 2XHYA 3GYCA 2WWCA 4W87A 1CIUA 3CUHA 3VIMA 4B9ZA 3VDAA 1VEMA 1OSEA 2VZTA 1LG1A 4FK9A 3BXWA 1RP8A 2ZXAA 3ALGA 2ZUMA 1GHRA 4WSJA 1YHTA 4F79A 5BCAA 4ZENA 2WK2A 4GI9A 1XH1A 1QHPA 1UOKA 2AMGA 1C3FA 5M3WA 4QCEA 4MDPA 2WVUA 4PMRA 1EQPA 3NJ3A 2JEQA 3FNDA 2CYGA 1UA7A 5ABFB 4HZ6A 1CLXA 1CYGA 3FAWA 1GUVA 2DH3A 2W5FA 3PZMA 3WH5A 2VZUA 5EFFA 1GW1A 2YBUA 1H0IA 1JZ7A 1WDSA 2AAAA 4WKHA 3AIUA 1JFHA 3W4RA 3RPMA 1DTUA 2VX4A 4TVCA 3U5YA 2EO7A 3AHXA 4D6CA 5GNZA 5A6BA 2Z1KA 2ZUWA 1LWJA 2VCBA 1E43A 3AMCA 1NM9A 1J10A 3PZTA 3WELA 4KMQA 3T09A 1ZB5A 3ZMRA 1L8NA 4BZYA 1DHKA 4PMZA 1B3ZA 2J8FA 1XV8A 3M6DA 1KXTA 3A4AA 1XHGA 4PRWA 2CHNA 2J7GA 5LA1A 1E73M 3MSDA 1V6VA 2UY3A 4ACYA 2VX7A 2YA2A 1IT0A 1E3ZA 3VU2A 4AIOA 4CD4A 1OT1A 4ACZB 3AJ7A 3SCPA 5C8BB 3AI0A 4NRSA 2ZOXA 3MO4A 4PMOA 1ZBWA 2Y2WA 4H8UA 1JYVA 2J7EA 3VMNA 3BAKA 1B90A 1BSIA 4H2CA 1V3KA 4HP5A 4J3UA 1E3XA 1KB3A 2E9BA 3PTKA 5C71A 4PTXA 5I6SA 4GXPA 1EOKA 4OIFA 1CGVA 1TA3A 1DWIM 4H41A 1V03A 3ARPA 4PMNA 1HN1A 2DQXA 3UG4A 3IK2A 1EHNA 4HZ7A 3PZQA 2PWFA 1KFWA 2XM2A 4Q22A 5I78A 3BGAA 2NW0A 3VGFA 5JBFA 3VO0A 2D22A 3F4VA 1QNSA 1CXEA 4CU6A 3GDBA 1GOKA 4U5IA 1JAKA 2XYLA 5E9AA 1VF8A 1H1NA 3QHOA 4JIEA 3PN8A 3CHCA 2NT0A 1DWAM 3VINA 2WC4A 2ZWYA 1V6XA 2QV4A 5DFAA 4AEEA 2D1ZA 3MU7A 1K9TA 5IDIA 3EMZA 4U5KA 3VOCA 1EDTA 1UZ4A 2OSYA 1TUXA 2C0HA 4V28A 4U33A 3ZR5A 2ZUUA 3VGHA 2G3MA 5CJ5A 2O9PA 3WBAA 2D23A 4OBRA 1UH4A 1NOWA 3WD2A 2ZWZA 5A6MA 4CD6A 1TVNA 2CESA 2OYMA 2W91A 5HBFA 3RIKA 3AOFA 3QGVA 4E2OA 3N18A 4HTYA 4TTUA 1KCLA 1BGAA 3BCDA 4AIUA 1CGXA 1W1TA 1AMYA 3PZ9A 3U57A 1CXFA 4PTWA 1MQQA 4Z2IA 5FOOA 1BGGA 5HDRA 1B9ZA 3AIRA 2D3LA 1H2JA 3WNLA 4HU0A 1VFUA 4AMCA 1EOMA 4LXFA 1R7OA 1D2KA 4MNLA 1HNYA 4UFLA 1VFMA 2WC7A 2E4TA 2WVSA 3MMUA 1J11A 1UQYA 4ATDA 2V5DA 5E0CA 1KWGA 3TOPA 2CKRA 1WCGA 3VUPA 4UFIA 1FH9A 2W62A 3RO8A 1E5NA 1ISYA 1EXPA 2XIBA 4X0NA 5GNYA 4MPKA 1C8YA 1V0LA 3K4AA 2FHBA 2O9OA 5FCZA 1MFVA 1UR0A 4D1IA 4FLOA 1O6IA 1UD2A 1QNPA 3OLGA 5EB8A 4BQ5A 1J0YA 1UWIA 2WCAA 2E8YA 1OBAA 4LYPA 4MADA 3U7VA 4BA0A 1MW2A 2WMKA 1HVQA 5CSUA 3FHAA 2WXDM 4WIWA 2BXZA 4TVUA 5A6BD 4W7WA 4C7DA 4NRRA 5EFDA 1XCWA 4GPNA 1ZJAA 2WPGA 4H7VA 2FH8A 1YQ2A 1KGWA 5LA2A 2JF7A 1JZ2A 2GK1B 1U33A 1JIBA 3ZT7A 4W93A 4JAWA 3T2OA 3O6AA 5CPTA 4Z2HA 3ZJKA 5I24A 1FHDA 3QOKA 1CECA 2D0HA 3AIEA 3WH8A 4Z2GA 4WF7A 1E6SM 4K68A 3MANA 5DO8A 1E4NA 1SMDA 3W81A 1C93A 4QCFA 3PZNA 3UEQA 4JKLA 2Y8VA 5BRQA 1OIFA 1E71M 1UKTA 2V3GA 2DT1A 2OWWA 4AZ6A 3PZOA 3VD7A 4MTVA 1PJ9A 3B9AA 3EDJA 3IJ8A 4RL3A 2D3NA 3RCNA 4PTMA 1H49A 1V6UA 1QNRA 1JD9A 1UWRA 5E0FA 3OG2A 4EKJA 4MJ2A 4TUFA 3VD4A 1HKJA 3EDKA 4KRTA 5CQ1A 4W5ZA 1QHOA 1PAMA 3DYMA 4UQBA 4KGLA 3ARTA 3B9EA 3VNZA 4M81A 1HKKA 2JIEA 2Q8XA 2G3IA 5I3DA 1UKOA 5HPOA 1UR4A 4LPCA 4UQDA 1QW8A 4UFKA 1WDRA 3ZO9A 2D2OA 1V3LA 3B9DA 4JZ5A 2XIIA 2ZUTA 1JNEA 1M01A 1QOXA 3SCTA 4Z2KA 3MSGA 2V3DA 4B9YA 1E4MM 3VPLA 2FGZA 5FD0A 2CERA 2G3NA 2DDXA 2RGMA 2WSKA 2PWGA 2J79A 2YL8A 2CBIA 5M17A 1SR0A 2CBVA 2ESCA 2QPUA 2WBGA 1WZLA 3MV11 2VO5A 3NSMA 4TVDA 3RM8A 2E8ZA 4M1RA 5BXPA 2WMIB 1C92A 1HL9A 4KH2A 5A6AA 4PMUA 3WFZA 3EMCA 2WC3A 3A6OA 1W3LA 2NT1A 1UKQA 3NDZA 1U30A 1K9EA 1HKIA 4PBGA 3WNKA 3ARYA 3ECQA 1BYCA 3WF3A 2BHYA 1R86A 3WF4A 4H04A 3AXXA 4PMQA 4KWUA 1EGZA 2C8NA 3GTNA 4CN4A 3PTMA 2DSKA 5AC5A 1JDDA 2VX6A 4YHEA 2J7HA 5ECUA 4AC1X 1KGUA 1VIWA 3HMCA 3L2LA 4GZJA 2ZUSA 2GJRA 5BROA 3WUBA 2YLLA 3CMJA 1Q6DA 1KR1A 4PCTA 1H11A 4MNJA 4X9YA 1FFRA 2GJXB 3WBEA 3WDRA 3J7HA 3OBAA 2WNWA 4P7QA 3TP4A 1QBAA 3RMEA 1KBBA 1GPFA 2CETA 1AQMA 1W32A 2FH6A 3WD0A 1EDGA 1C7SA 4BF7A 1KCKA 4D6FA 1QI0A 4DM2A 1ITXA 3O2LA 4W88A 2CCRA 1K9FA 3I3EA 1R87A 3OB8A 2UY5A 1Y7VA 1QNQA 1NOUA 1QHZA 2CBJA 1UWQA 3IJ9A 3SUTA 1V3IA 3N15A 5FIPA 4B3LA 1GHSA 3WDIA 2W4XA 4DUXA 3NUKA 4AD4A 1B31A 1J18A 3AYSA 1VEOA 1JXKA 3BSGA 4UOJA 4PMXA 1X6NA 2HVMA 3N9KA 5A69A 4AZHA 1MVYA 3WUGA 2OLHA 4AW7A 1MW0A 3U7BA 2EPLX 4ZE5A 1C8QA 1XRVA 6TAAA 4EANA 3CIVA 1WZKA 1D3CA 3THDA 3PTQA 4V27A 3VNYA 1A3HA 2EPNA 4P8VA 3GXFA 2X2YA 1C90A 4WLCA 2DSVA 5KEZA 5E6YA 4B16A 3SCRA 2YL9A 5FKYA 4D72A 3SUUA 2ZUNA 4PEEA 1P6WA 2J7FA 1VBUA 5FL0A 2GSJA 5HNNA 1JZ5A 2D0FA 3W38A 1F4HA 3F5JA 1C8XA 4JFUA 2CBUA 3CH9A 4RE3A 3EYPA 3RJYA 1CXLA 1VJZA 4CKQA 1X1NA 4OOUA 1BYDA 4YHGA 1EA9C 1GJUA 1HT6A 3T08A 1VB9A 4R27A 3DYPA 1LQ0A 1WNOA 3CMGA 3VX0A 3N12A 3TA9A 3AMLA 4HOZA 2OSWA 4DUVA 2XJ7A 1HJVA 4JFVA 3GXIA 4D6IA 3BCFA 1BYAA 4W7VA 4RE4A 2BXYA 5A6SA 2W63A 4UR9A 4DUWA 1UZ1A 2OWCA 1W9UA 2G41A 1KGXA 4CUCA 1UHVA 3VILA 4JL1A 1HIZA 1QI5A 2ZX9A 1NP2A 1FFQA 3BAYA 5FL1A 1PX8A 3CZKA 2VUYA 2YDQA 1E4IA 4J3SA 4IPNB 2DSUA 2DPEA 3VIIA 3MMDA 3KL5A 4GI8A 2A3EA 3VIKA 3DECA 2BFGA 1XD0A 1LWHA 5CLTA 2ZX5A 3DHPA 1E6XM 5M5DA 2PBOA 5I79A 3ZT5A 1BPLB 1JDCA 3CUGA 3B8SA 2XVLA 1J9YA 1ISWA 2XPKA 5JUVA 3N11A 4W84A 5KZ6A 3UESA 4UQEA 3AIBA 3K1DA 4AWEA 3W37A 3ARZA 3SCVA 2GVYA 3L4YA 2XVNA 3CHEA 4QP0A 5IFPA 2QPSA 2PBGA 9CGTA 1FH8A 1OM0A 3MV01 1WZAA 4NI3A 1UH2A 3RM4A 1US3A 5A2CA 4S3KA 4UQAA 2XSBA 1BF2A 1TA3B 3WUEA 4D1JA 5IHSA 3RDKA 2YIHA 4C7FA 2WBKA 2XVPA 2ZX8A 3NYDA 2XGBA 2QHAA 3BMWA 1JNDA 2WSPA 4DWSD 1UR8A 3ZM8A 2VT0A 4GZIA 4OOZA 4AZBA 3LPFA 4KGJA 2ZX7A 1UQZA 4HA3A 1JYXA 4WJXA 3D3AA 1PZ3A 3GBDA 4P8WA 5A2BA 3OGRA 5IFTA 3VDCA 1OT2A 1V6WA 1FH7A 3VD5A 5I5RA 4D6EA 4W89A 4ZEPA 2CKSA 1PEZA 1M7XA 4AIEA 3UR8A 3UG3A 4QLLA 5D9PA 1VFOA 2E3ZA 3AYRA 1XH2A 1UWTA 7CGTA 1W2VA 4JKKA 4D6HA 2YL5A 1Q6EA 3CHDA 3KL3A 4N42A 5ABEA 3AZSA 3ARWA 1AQHA 1QI3A 2BVTA 2OSXA 1NH6A 1UA3A 4CCCA 2XFYA 1TR1A 3IANA 1ZBCA 2VOTA 1GJWA 1W91A 3BH4A 3S2CA 5A1AA 3GM8A 1ECEA 1WKYA 5CXPA 5ABGA 1QBBA 3WNNA 1GZJA 1JL8A 3QOMA 2GJPA 3LPGA 4ZE4A 2WZEA 2VCAA 2G8ZA 2YKKA 4FLRA 3GXMA 4QLJA 4GIAA 5DT7A 1PPIA 4PUDA 3VVGA 4P8XA 3CZJA 5A8PA 3AHVA 2C7FA 3PZGA 2HISA 2WW5A 3BLPX 4FLSA 4URIA 5DF0A 3AISA 1VBRA 1GCYA 3WF0A 3OLIA 5BXRA 1JDAA
chains in the Genus database with same CATH superfamily
4PUEA 5FEWA 1QO2A 3CWOX 1HG3A 1A5NC 3HTWA 3GHUA 1J12A 2OWXA 2PI6A 2PTDA 1JR1A 4MJ4A 4GY1A 2JKEA 5HQLA 4O4VA 2G3JA 1BKSA 1A5MC 1EEXA 3CQHA 1XDLA 3VD9A 3A5FA 3EB4A 1EJVC 1SW3A 4N4PA 3P3BA 3LI1A 3TE9A 3LNMA 2IKJA 3TTYA 4F2BA 3IIOA 4K37A 4DXKA 2ZRVA 2P5NA 2BVDA 1AW2A 4MUPA 2X7VA 2HK1A 3V1HA 4P8UA 4GQGA 3UPMA 4A3HA 4BQ2A 4PZVA 2OOFA 4FS9A 4FLQA 1FP9A 4ZO9A 4NZCA 3OW1A 5M03A 4N0RA 3I6RA 1E0WA 5AC6A 1TJ1A 2VUNA 4U3AA 1RQHA 1DXEA 2NVAA 4US6A 4AIBA 4DWSC 3SCUA 4K1WA 2BS9A 4JY9A 5I3IA 1O94A 3ZR4A 1KR0A 1JGIA 3RPDA 2Y24A 1ENUA 3H2MA 3WZ0E 1Q66A 4AZCA 2O55A 3H24A 1PZ2A 2J13A 1FA2A 4XKMA 1NDWA 2VDGA 1I45A 2JGQA 1K9DA 1V08A 1OB0A 2CLKA 1VGAA 2WPBA 5MHBA 2W9MA 3FA5A 1RJPA 6XIMA 1T40A 6ENLA 1YE6A 3NSNA 1Q13A 4XB3A 2Y6ZA 3B0YA 1SPQA 2WHKA 2VZSA 2HV5A 3EXTA 1PKNA 1TWZA 1HVXA 2CIPA 1W3IA 2YA0A 4QNEA 3QY6A 3TN6A 3B8DA 1QJWA 3UW6A 4LAUA 3P93A 3DFHA 1ZBKA 2GWGA 4AZGA 4ZB2A 4EK7A 3CT2A 2OKTA 1FDZA 2QQ6A 1E1FA 5AN7A 2R82A 4YTQA 2BLEA 3VABA 3W22A 1A0CA 4LUJA 4V1XA 4DBEA 1XGZA 3NL5A 2YL6A 3WDPP 4HPNA 3QQWA 4FPSA 1EJTC 3NPUA 5FA5A 5D2YA 2DZBA 3OVRA 1SMAA 1J0IA 1P48A 2YDAA 1GQKA 4XVDA 3W76A 5J5RA 4NJIA 1EJUC 3PBWA 1FCBA 1BXCA 1M68A 3WLIA 4US5A 1V0MA 2VGFA 1NWSA 3M5XA 1QTWA 5AYBA 4PL1A 3OIHA 4DBUA 2YCLB 4QRNA 3VIFA 1OYBA 2DIKA 4O14A 5MF5A 4LBRA 3F5KA 4WDXA 4JY8A 1O68A 2PEVA 1UD3A 4J7RA 4OUEA 5K4ZA 4LWWA 1HQTA 3LV5A 1KQYA 1W31A 3NYZA 3RLVA 1XH0A 4AF0A 1Y65A 3A4WA 3VE7A 1WDDA 1JCTA 1YDNA 3TQPA 2WHLA 3EPMA 5JXQA 1JZ3A 2PFHA 2GGGA 5H8MA 4PB4A 5TF0A 3QN3A 4DYJA 1Q8JA 4RNJA 3AMDA 4CNOA 3VNMA 1B0IA 1RY8A 2XWDA 4DLFA 4GQBA 4YTSA 1BHGA 4WD0A 5EMLA 1DQWA 1G67A 1M41A 2BGQA 3N04A 2C15A 1ZUAX 1TVPA 1XYCA 4O15A 3WDQA 1XX1A 3PJTA 1OCNA 4F9JA 4U4MA 1MW1A 4HNVA 1RBOB 2V5BA 2CXGA 4OT7A 3P62A 3RILA 3NO3A 4S39A 3V3WA 5F7UA 2FZ9A 1W5NA 4XZHA 1EO7A 2GYIA 2QCGA 2XFFA 3WYZA 1UMYA 1DBTA 2WSYA 3P6LA 3KP0A 3C3UA 3IJQA 3WY1A 3E0IA 4C6NA 1FOBA 1N8FA 3L2MA 2VEMA 5I0DA 1JPDX 4AWTA 3UERA 2Q01A 4POCA 3VIGA 3MCMA 3CUIA 3GFXA 3DAQA 3BAJA 2A2IA 2OZ8A 4HMCA 4L4PA 4AD1A 2Y5JA 3DH7A 4CU7A 1I6NA 1IEVA 4IISA 4M24A 3GNNA 4PUMA 4C1NB 5J5DA 3DX5A 3UYIA 3EA1A 4N2YA 2OEMA 1OK4A 3VFCA 4NHVA 2B31A 3EWWA 2HEJA 4LEFA 3VOIA 1RSCA 3C8NA 5HJYA 1NOFA 4GK8A 4IGNA 4O1DA 2D2JA 1D7KA 2ABAA 4GYPA 4O1FA 3CTLA 3PZIA 2PAJA 3GB6A 2QIIA 1JEZA 4A3RA 4ZQRA 4GUGA 1TJ2A 1MSSA 4UZSA 4PMYA 1OX6A 3W7OA 4B15A 2XGZA 1PCWA 4CN6A 4GJ1A 5CEWA 4MWAD 3G1RA 2GWNA 4IL0A 4K7VA 4QFUA 4H6RA 2VHLA 3OA3A 5AHNA 3KVKA 3U0HA 1TJRA 1P4CA 1NDZA 5E09A 2O9TA 3FJ4A 2RAGA 3M07A 4GKLA 1E6QM 1GOWA 5GQBA 3L68A 3NNTA 2F9RA 4XD4A 3SO7A 3DKLA 4PL2A 4HOWA 3WDJA 3UZXA 3DKJA 3EDDA 3N19B 4V2XA 2EG7A 3DG7A 4I3GA 2GDUA 1EX1A 3JUGA 2Z6IA 3WQ8A 3DESA 2DVXA 4WSKA 1G1YA 2PDFA 1RD6A 1H3GA 1DJWA 2QF8A 4B92A 2GQAA 1R8LA 3L21A 3LV6A 3TAKA 3GVGA 3FA4A 3FKKA 3KOZA 4FNRA 4X2PA 2GVEA 4JN6A 5D09A 3W6MA 4WRHA 1RJRA 1PHQA 1XLHA 3F4DA 3MCOA 3C2YA 2HCVA 4O0ZA 2JF6A 5C9UA 2D2GA 4LS0A 3T42A 3EX2A 2VEGA 4TQTA 5CLWA 3CL8A 3GW3A 2WHJA 3HGJA 4H7CA 3A4XA 1UP0A 4TU1A 4WKAA 3WLJA 5C2XA 3ZOAA 1YMYA 4UFHA 4WKFA 2FPYA 4ACZA 3OQ8A 1VC4A 5F2LA 4GNJA 3WQ4A 4PEKA 3HURA 4Q7NA 2E0PA 2I9UA 3WLSA 2Z1VA 1EX5A 1TMHA 3GH7A 2Z2UA 2VQUA 5BU6A 4EF8A 3TJLA 4P7NA 1ZJBA 3WF2A 3T6CA 2YCJA 3OEXA 5J8LA 3BMVA 4TX8A 1K8ZA 1VH7A 5H8PA 1QWGA 2J47A 4IUGA 3V5CA 1RD5A 3SRFA 1KTBA 1SFTA 3MS8A 1Q2SA 1Q6FA 1UD8A 3VD3A 3G8EA 1G0CA 4Y7EA 2D20A 2FTYA 4TTGA 4AX7A 3WMCA 1UKSA 4YJ5A 1ITCA 3F4NA 1LOQA 3NEVA 3GUGA 1YE4A 3CV1A 3NOYA 3NQ6A 2Y89A 3QZAA 3QGAC 4JTKA 3L5AA 3SB0A 1Q6GA 3TLLA 4WVXA 1TV7A 3NA8A 1RZMA 4D71A 1W1ZA 2XN0A 5BZAA 3BK0A 4J28A 4H9ZA 1YEYA 2A3AA 1MUCA 3RU8X 5HJXA 2Z1WA 3WQWA 3BOFA 3GSMA 2BSLA 3N14A 3R79A 2FZDA 3BSMA 3GKAA 4Q8NA 1VBJA 3BURA 4L9XA 1BFNA 3TNOA 1W1VA 2DZXA 2ZXBA 2UY2A 3PBGA 2C16A 3USBA 3TQKA 2ZZ5A 4NKCA 4ZFCA 2E9LA 1N2VA 1J6OA 3OZPA 3G1XA 5L6UA 5HPCA 1Q2RA 3E1F1 1XKJA 1BWVA 4EXQA 3QJAA 5CBIA 1LLWA 2QUNA 2VZVA 4BJHA 3FXYA 3VM7A 1SQ7A 4G2DA 3RAOA 2OFJA 1ZLPA 4S3JA 5LIKX 3G0SA 1W9XA 2OVLA 4AX6A 5F2GA 4PMDA 4AZCB 3ABZA 3LA4A 3SQLA 2QDEA 1UUQA 2I16A 3WNMA 2RDTA 1EJWC 1L0PA 4Q8WA 3TONA 3ZFHA 2QF7A 3VMPA 2IQTA 3CBWA 4DJEC 3TTQA 1K6AA 2MNRA 2Y5EA 1YXDA 3EOEA 3EA2A 5T9BG 2Y88A 3SEPA 1CDGA 4PUKA 2GSHA 3AS2A 4YU1A 4LVFA 3ZT6A 3GU2A 3DG6A 4BEQA 5AYXA 2W61A 1XIDA 2P10A 4HNUA 3M47A 4GIRA 4MWAE 1EP2A 2JEPA 5BW6A 3OPSA 5C54A 2P3EA 3FVMA 4LGXA 1R85A 1JRCA 2VRQA 2BZNA 3BV4A 5DMYA 1QDSA 4XUYA 5LZLA 5D30A 4HA4A 3BSHA 3W1XA 4C6MA 3UXLA 1SO6A 4KS0A 3EX4A 1YIXA 1FP8A 3URNA 5DELA 3V5OA 1PTDA 3O63A 1SUXA 3TW7A 3CU2A 2B0MA 1F73A 1FBAA 1FWSA 3FFSA 2Z7KA 1EUNA 1G94A 3G1DA 1XUZA 5JH1A 1QR7A 2PRMA 1UYQA 4P7RA 3B4YA 1JFXA 4C6FA 1XLEA 2X05A 2C18A 1XIMA 4GBDA 1UD6A 3QLDA 3S5ZA 4IUOA 1DTNA 5D4YA 1HF6A 1UOZA 3O6DA 4PUNA 1Z89A 3U5UA 2J8GA 3RYSA 3BLKA 2PDWA 4AF0B 1JCXA 4PSRA 2WKGA 1LUCB 1GQNA 2E77A 3ZLFA 4X0VA 4XX6A 2WMIA 3LHWA 1TMQA 4HZMA 3PBVA 3S42A 3STPA 4OUIA 3DIPA 4I7VA 3T55A 2XWEA 2WKLA 1LWIA 1SZRA 1UPMB 1V77A 4JCLA 3L65A 2OZ3A 5D9NA 2QDGA 2VGIA 1CPUA 1HJQA 2X0SA 3B9NA 2DV0A 1NF0A 4O17A 3M9YA 1V3JA 2WHMA 1K4HA 5DN1A 3VOHA 4L6HA 3W82A 3SCSA 3ALFA 4DX3A 3GKFA 3K4WA 4NQ1A 8RUCA 1A5AA 1JI2A 4KWVA 2BVYA 3GXPA 5LXXA 5IRPA 2H90A 3H2FA 3C61A 3QC0A 1MEIA 5BWAA 1D8CA 3KP1A 1CENA 2INZA 1R9ZA 2A21A 1K7XA 1WDWA 3M46A 4W8BA 3UZZA 1TPC1 4LAMA 4IMCA 3TYDA 2J9YA 3PWIA 4XAFA 4NAEA 3ENLA 4FX8A 1F74A 2OG9A 5C55A 1DWHM 1VIZA 4LX4A 5GNXA 3G0XA 3SBFA 1QWKA 1TR9A 2A0NA 5BNKA 8TIMA 3PP7A 3QV6A 2HXUA 3CUFA 4C65A 1KBKA 3DI0A 1UBPC 2FVKA 1ZBVA 2NQHA 3GBEA 2TMDA 3W6YA 1XLMA 3UY8A 3CQ0A 2GFTA 3WH7A 1H09A 1MQRA 4CNTA 1PYMA 1NFGA 5EMJA 4X3ZA 4JKMA 1ESWA 1OFOA 2ZXDA 3CEUA 3IEBA 4QLKA 3H2CA 1K03A 4EPEC 2DGAA 2DP3A 2H6RA 2WWCA 4EF9A 4GG9A 3GXTA 1XLKA 1UJQA 1CW2A 2IS7A 1TPDA 5AB3A 2ZUMA 1Q45A 3IIPA 1FHUA 4F79A 1VCGA 4GI9A 4GOAA 3PNUA 4HPXA 4QCEA 4MDPA 4DXVA 2WVUA 4PMRA 4A8RA 2G4JA 5HNUA 3GAKA 1ZY9A 2JEQA 3FNDA 1R46A 2CYGA 3H12A 4IX0A 4PRRA 3O05A 3LRKA 1GUVA 3W9ZA 1JZ7A 1VCVA 3PUDA 1IIHA 3OP2A 1UJPA 3W4RA 3H7VA 3U5YA 2GVJA 3AHXA 4QBXA 3S1GA 5LSMA 1JJKA 3NO1A 5GNZA 2Z1KA 2ZUWA 2Z2BA 2ALRA 1LWJA 2HPMA 1Q63A 2OJPA 3VC5A 4TO8A 1DJHA 1GEHA 4DAFA 3LHVA 4BK9A 4R34A 1J10A 1JUKA 3GC4A 3BG9A 3NQAA 4MYXA 3OBEA 4KMQA 1SO4A 1XBXA 4BZYA 1DHKA 1B3ZA 1QOPA 2DY3A 3M6DA 3NDOA 4H9MA 2J7GA 4JICA 3U2CA 4GI4A 5ABTA 3S6DA 4IIDA 4ACYA 4GRSA 3HG4A 3FEQA 4WSHA 4AIOA 4EIVA 3SADA 1DE6A 3STCA 4ACZB 3N29A 3QH2A 3AJ7A 2YSWA 2INEA 2V69A 4PMOA 3MC5A 4NG3A 1ZBWA 2B7QA 2NXHA 2FZNA 1FWBC 2PRLA 4HP5A 1XIJA 1L2QA 2XH2A 4H9XA 3GHSA 3HIJA 2J24A 3WLRA 4OIFA 4KRZA 3LGDA 4ERAA 1RLDA 1A5SA 3M43A 3PZQA 3BGAA 3C4UA 2GPTA 3MZNA 1CXEA 1R2SA 3GDBA 3MCNA 4U5IA 1FUYA 4I9AA 2CFFA 3M0XA 5FJPA 4FOKA 3BLIA 1VR6A 2ZRXA 1VF8A 3RRAA 1OHLA 3QHOA 3P67A 3PN8A 3RPTA 1X7IA 3UT0A 3VK5A 2NT0A 2WC4A 3KCJA 4HMNA 5CAKA 2GL5A 3CIWA 5IDIA 3S2LA 4LF2A 3UY7A 4U5KA 1IEXA 1H7RA 3M64A 1DYSA 4V28A 4U33A 3SGZA 2ZUUA 2G3MA 2IMRA 1LBLA 1ZCCA 3WBAA 1W6TA 5AYZA 4B5XA 4BWLA 1R5YA 5LNSA 3MHGA 1UBSA 2ZA1A 3TYAA 1GVOA 3RIKA 2ACQA 1Z7AA 4UR8A 2OOGA 4IFKA 3M0VA 1KCLA 1BGAA 1CGXA 3ABRA 2CLFA 3U57A 3C2RA 4Z42C 5FOOA 1BGGA 3QLLA 1PZ1A 3TEVA 1NQKA 3HV9A 1VKFA 5DQPA 1H2JA 3WNLA 4GBUA 4H83A 4WOQA 3W83A 4AY8A 4LXFA 4FNPA 5K3VA 5HNRA 3STFA 1SZNA 2O4QA 3PSWA 3W1MA 1I4NA 3TOPA 2CKRA 4UFIA 1FH9A 2YGYA 2W62A 1B9BA 1KLYA 1XRTA 1E0TA 1E5NA 3MP5A 5GNYA 4X0NA 5A5WA 4OVXA 1C8YA 1TQXA 2O9OA 5FCZA 1OYCA 4R7OA 2QAPA 4IJRA 1X97A 1UD2A 4Z0SA 1QNPA 1ZP4A 3QZEA 5EB8A 1JDEA 3ID7A 4IGHA 3U7VA 4BA0A 2PC4A 1MW2A 2WMKA 4AUBA 3UWZA 4IPJA 1SZFA 3IGSA 3UZ5A 4C7DA 2F84A 3DUGA 1ADSA 3ITGA 1A5CA 2WPGA 4Q8TA 2FH8A 4Q8UA 1KGWA 3CPGA 1AQFA 3CB8A 3NPWA 1U33A 1TZZA 4JAWA 2ZBTA 3FEMA 1PTGA 1FHDA 2AGTA 5I07A 1BF6A 5DO8A 3CYVA 4KERA 3CK5A 4HNNA 2R1KA 2ATMA 4K38A 4JS3A 2YXOA 1TRDA 4JKLA 3YPIA 1RA0A 5BRQA 5CJNA 5CZ0A 5XIMA 2DUZA 3I7SA 3PZOA 1PJ9A 1WA3A 4Q8PA 1YTDA 8XIMA 3RCNA 2CZEA 4PTMA 2Y5SA 3UF9A 2NLIA 1HKJA 3M44A 5CQ1A 4W5ZA 2E5CA 4YWSA 5G5IA 2PP0A 2AKZA 4KGLA 4HHLA 1TV4A 3VNZA 3DN5A 2G3IA 3BZJA 4WJEA 4RPQA 1UKOA 4YVVA 4FOUA 1UR4A 4M19A 4XD3A 4HSNA 4DJFA 5AC7A 5CCZA 1Q7MA 2OODA 2OX4A 2XIIA 1MI3A 5I03A 3H26A 1M01A 4Z2KA 3TFCA 2R6OA 3W88A 1RK6A 2DDXA 2KX9A 2CBIA 1SR0A 1L6GA 2QPUA 4XO6A 3QYSA 3O06A 3CAVA 4M1RA 4GKTA 2WMIB 4Z1YA 2G96A 1KC7A 4FNTA 1VS1A 2XN1A 1Z48A 5HMDA 1FCQA 1D3GA 1HKIA 3QPYA 1DXIA 3M1ZA 3S5OA 3RLUA 2FVMA 3W7LA 1O1ZA 4H04A 4PMQA 3OG3A 3M0HA 5LHEA 2HPIA 3E12A 3HGRA 4CN4A 2J9XA 2RKXA 3AC0A 2DORA 3IJIA 3LHZA 1XBVA 3OHMB 4RE0A 2GJRA 2PODA 1Q6DA 4IL2A 4HNLA 4MNJA 4M7TA 3O0KA 3WBEA 1I2NA 1YTEA 3TYBA 4P7QA 3TP4A 1VFSA 1TV3A 3N25A 5HK4A 3RMEA 5AVNA 3TC6A 1GPFA 1CB7B 2XDFA 3W01A 1EDGA 4QEHA 4BF7A 1QPNA 1QI0A 1KA9F 3O6YX 4QDWA 3QZ6A 1K9FA 4NAEB 1O5RA 1QNQA 5AOUA 2CBJA 3SUTA 1V3IA 3VC6A 2ZQ0A 3WDIA 4ZQNA 2W4XA 4TX9A 4PFHA 4NZ1A 3ZYZA 4C6EA 3NUKA 4AD4A 3AYSA 3G24A 4IHCA 3PY2A 3R5EA 3ITYA 1F3WA 4YCPA 1LOLA 3OVPA 3BSGA 3KXQA 4DN1A 3RLHA 4UOJA 3BQ6A 4PMXA 2CLMA 1U22A 4B4HA 4E0CA 1TVLA 4IG2A 3TUUA 2OLHA 1MW0A 4C6BA 1PO9A 1Z41A 5C6MA 6TAAA 4NZFA 1ONWA 3TSMA 5I3GA 3BO9A 4EANA 3P60A 3KS6A 3TSBA 4ERGA 2BGSA 4R88A 4FALA 2ZTJA 4P8VA 3O0FA 2X2YA 4A35A 3DU0A 1H61A 3BLLA 2F38A 3TC7A 2HTMA 4HQVA 1QO5A 5FJRA 4I6VA 1VBUA 3SGGA 3DFQA 1TKKA 1T0OA 2PDQA 2E6FA 3LRMA 3QY7A 1XXXA 3RJYA 3RU6A 1KO0A 1Y5WA 4O13A 5AHFA 1SZEA 1IEQA 2IPJA 3PC0A 3NQFA 1SM9A 2NVCA 1P6BA 1MNSA 3B97A 3QQ1A 3PUGA 3SDOA 4GISA 4B5WA 1EJRC 3QM3A 3A13A 2XJ7A 1HJVA 4D6IA 3MW7A 2BXYA 4UR9A 1UZ1A 2OWCA 3TXZA 1SW7A 2G41A 4CUCA 3HV8A 4HYRA 5LIXX 1HIZA 3VOJA 4GUFA 2ZX9A 3VOFA 4TIMA 1PX8A 4BI7A 2VUYA 4J3SA 1J5SA 3ANYA 3KL5A 4GI8A 3DECA 1Q65A 2BFGA 1PXGA 1E6XM 2H3DA 1NIUA 2HQAA 2A6NA 3ZT5A 1XI3A 3TMLA 4L64A 1FTXA 1KKRA 3T07A 3CWNA 1ISWA 2XPKA 5JUVA 1R2TA 1KFBA 5C9XA 3EKLA 1P0EA 3C2VA 3W37A 1IZCA 4F2TA 3ARZA 1OC5A 2XN2A 2E6YA 2GUUA 1IXOA 4GJJA 2GVYA 1NSJA 3C56A 2VFGA 1KFEA 2V81A 1SO3A 2XVNA 3CL6A 3CHEA 4QP0A 1NY1A 1BXBA 4TMCA 4MMWA 1WZAA 2YYTA 3HO8A 1XLGA 4UCGA 5A2CA 2ZZ2A 4S3KA 3WUEA 4FX7A 1OG6A 4DIAA 3NL3A 2WSPA 4DWSD 3FCPA 4AY7A 2V5JA 3GVWA 4RW3A 4RZ4A 1G7VA 4GZIA 4HA3A 3IJLA 3L67A 4WJXA 1FWNA 1TPB1 4QG8A 3VDCA 1OT2A 1V6WA 4W89A 3NVTA 5D02A 1PEZA 3UR8A 3M0JA 4DZHA 3PSVA 3ZZ1A 1VFOA 3AYRA 3CUXA 1UWTA 1LRNA 2EG8A 4C1KA 7CGTA 1IQ8A 2AMXA 4WXZA 3MDWA 4M5PA 3DFSA 2I14A 1P0NA 1Q6EA 3HZ3A 3KL3A 3GU1A 4DRSA 1SZGA 2R8WA 1XW8A 4LAZA 3QRHA 4HJWA 4F4RA 1QI3A 2OSXA 3LXAA 3ISIX 3IS4A 1UA3A 1GYMA 1T8XA 1ZBCA 4G7FA 4A3QA 4ZOEA 3V0TA 3R94A 5ABGA 1QBBA 3WNNA 1GZJA 2NXIA 4ZE4A 2WZEA 1GW9A 5BOEA 3GXMA 5DT7A 1PPIA 3GYEA 4IFKB 2EGZA 4GFSA 4PUDA 1HGWA 2A85A 3HF3A 2BG5A 3QKEA 5I3KA 5I3JA 4ZOAA 2BBFA 3GC2A 5HNTA 3U4AA 4YTRA 2C7FA 1H7XA 3B8WA 2WW5A 3LERA 4H6EA 4URIA 2B4GA 1XQLA 3C5QA 3QFEA 1GCYA 2Z29A 3N3TA 3VYLA 1IT8A 4DAIA 1JDAA 4FNUA 2Z28A 1HKMA 2NQ9A 1EPVA 4AD2A 4E4UA 3VDHA 1I60A 3WMBA 1PE1A 1XSKA 1FXQA 4FA3A 4Q8VA 4XWUA 3R0DA 1EBGA 3QY8A 3GDMA 6TIMA 3M5YA 4XV0A 3NQ2A 1F6YA 5BXSA 2A3BA 1ZU8A 3L4VA 2DT3A 2HBVA 3OIXA 1US2A 5HMSA 3IACA 4M6VA 3WH9A 3IARA 4HHPA 5TD4A 3N2CA 4JTJA 3OZYA 4H01A 3RK8A 2V5KA 3S1WA 1M9HA 4K2SA 3DDMA 1HKWA 2DW6A 1P0DA 2DZSA 4FB7A 3E5BA 4MZ8A 4M51A 4LYQA 4Q4RA 1JF6A 1XIGA 1I75A 3WKZA 4YXGA 2XTKA 4Y9MA 3E6EA 5AZ1A 2OX1A 3ZJ6A 3MUAA 3CXOA 1B3VA 2FPTA 4UTLA 3VNIA 1KCZA 2CLLA 1YPXA 3GY1A 1ZSXA 2QZRA 5KTLA 2X8RA 3HGSA 2Z1BA 1EZWA 3STEA 2AQOA 4J4KA 4GWEA 1M7PA 2PC8A 4F9DA 3VFLA 2FFCA 1AH3A 3P0XA 4HA1A 1BG4A 2RUSA 4IICA 4KWOA 3L4XA 1MDLA 3XINA 1UD5A 4JFWA 1V02E 2OLAA 1OGGA 1CGTA 5DY3A 3CHFA 4QROA 4RLIA 8A3HA 3TDFA 4CNNA 2BVWA 1UD4A 5FJOA 4B5UA 1PL9A 3FS2A 1PIGA 4R5EA 4LNCA 1WXJA 3M7SA 4JHZA 5AC4A 2VC7A 4ZR8A 2OCZA 5A95A 1O12A 3CL7A 3C8FA 3POCA 3L4UA 4NZ3A 2POTA 2OO0A 3KTSA 4DM1A 1GOXA 1E0XA 3PZUA 2P50A 4NNAA 1T96A 5FACA 1IF2A 3K8MA 3VIPA 1R7AA 3LPPA 1OINA 2EPOA 1PZ0A 3WK1A 1XC4A 1YX1A 4UFJA 2FHFA 3FW6A 4UWMA 1WKDA 3HQNA 5BOFA 3R2GA 1I2PA 3LHYA 3WK3A 2XG9A 2PDMA 3XISA 3UCCA 3SJ3A 1OK6A 2WYSA 3T0DA 3V7PA 3K2GA 4AISA 1SJCA 3NM3A 1IZJA 2ON3A 3UYCA 3HA1A 3W2MA 2O92A 1ONXA 1O7AA 4JDYA 3BJSA 1GYNA 4JYEA 4TXEA 1LT8A 3V35A 2G5WA 1WZMA 3OHIA 3REQA 3AMKA 5U4NA 3FY1A 2J7BA 1B3OA 3GX9A 1WDQA 3W27A 1HX0A 2V30A 1X1ZA 1EJXC 1TWSA 2Z00A 3W7KA 3CS2A 1VQTA 1VEPA 3TXVA 1A5UA 3T2QA 2JE8A 1LP6A 2E6AA 5TBOA 2J7DA 1E1EA 2B7OA 4PBEA 2Y70A 4XKYA 2F2KA 1H0GA 1QRQA 1OWQA 4M80A 3HPZA 5A8MA 2BASA 1V51A 3OTRA 3OGSA 3W1PA 3RN6A 1LJYA 2BY2A 3W1RA 3VIOA 1O5QA 2QPXA 5HWMA 1JD7A 2FGLA 1YDVA 3BV7A 2O9RA 1KQZA 3W25A 2XSAA 3SRDA 4IG2B 1BSLA 4JQAA 4D8LA 3S4TA 3CIXA 1IZKA 3B9OA 4G9PA 3OGVA 5FSDC 2O56A 3NVDA 1CLVA 1Q6CA 2DZTA 2EF9A 1ONEA 3BJTA 5CPQA 1EH9A 3UCDA 3NQCA 1AJ2A 4LALA 3TH6A 4R53A 3MSYA 2PWEA 4GD0A 3UGVA 1C91A 1HO1A 1KV8A 4JFTA 1JUBA 2D0GA 2Z27A 3WQVA 3HPXA 5I23A 1A5OC 1H41A 3NZRA 4R33A 1RPKA 3TZNA 3WLMA 4HCLA 3TCSA 4LH8A 4KWSA 3JZEA 3RR4A 1QI4A 1ZJHA 3KFTA 4XZBA 4OV4A 5JBEA 9XIAA 2QGHA 1Q4NX 3WEMA 1Q7ZA 3WF1A 4YPJA 3FK4A 2VGBA 3D3FA 3TJ4A 1ZS2A 5AHIA 3WL1A 1B3WA 3T40A 5DBTA 4N6EA 2VL4A 1TIMA 1SR9A 5A6LA 1S2VA 1U5VA 2BNJA 1GKRA 3BL3A 1S3TC 1QXLA 1GK8A 1TX0A 1DWGM 3USZA 3DGRA 3E96A 2A1YA 1K6WA 1X8CA 1JAEA 4HNOA 5CH9A 3GR7A 2X40A 1BTCA 3OVGA 1HGYA 4H00A 7TIMA 3KCLA 3AHZA 4RCXA 2ZRYA 2I5QA 1DKWA 2IPWA 2A3CA 3QHMA 4QHRA 3S3GA 3N6QA 1K7EA 1RA5A 2Q71A 2FDSA 1N8WA 1J0HA 2VNCA 3SY8A 2QKFA 4S38A 3A9IA 4XQ6A 4L7ZA 4W5UA 3TTOA 2J77A 4W86A 1QVBA 2DSWA 1H63A 3BAIA 2ACSA 3OOQA 8CGTA 1WX0A 3HJEA 1JYWA 3QR3A 3TYCA 1BRLB 1O95A 3KEHA 3O07A 4ML4A 4FSAA 3M7WA 3AQUA 3EKGA 2GDVA 3AICA 1PIIA 5A8GA 5FAJA 1BTMA 3RX2A 1NF7A 4PUWA 1L2UA 5HR6A 3H2AA 3CM4A 3MKKA 3BMXA 3GNRA 4QDPA 1BAGA 4H8HA 3UG5A 4BY3A 2X09A 3W07A 5A6JA 1GQLA 2VEIA 1HL8A 3FIGA 2R94A 1PX3A 2WM1A 5HUPA 3WQFA 2Z25A 2NSXA 2PDCA 2OKOA 3N17A 2R1MA 4O1EA 3ITLA 2WJDA 3ZQ9A 4XK2A 2DZWA 2Y0FA 3RF9A 4AVOA 4TOQA 1QK0A 4RJEA 3DC8A 4RXFA 1V6YA 3GTHA 4DO7A 4IJBA 5PTDA 2DJXA 3VDBA 1IEIA 4DJED 3TWBA 3V4BA 3UA4A 1R30A 3ES7A 3OO2A 1XDJA 1E6NA 3ZR6A 5LXEA 2QCHA 1XYZA 4RKAA 3CAKA 3C0SA 4JGDA 1DP0A 4L56A 5I3HA 3R43A 5TIMA 4A8IA 3N13A 4DJDC 5K9XA 4O54A 2VCCA 2H9AA 4MAZA 2R24A 3MMWA 1TG7A 3W00A 4M82A 1MMFA 5A94A 1H4PA 2VVNA 1KXVA 4FR6A 1F3EA 3TW9A 1W1IE 1V6TA 1S2WA 3LTPA 4HU8A 5I00A 3FN9A 3PG9A 3ARXA 4HOXA 2CC0A 1CEOA 1VENA 3B0PA 4MNKA 1WE5A 2PB1A 3QC3A 2WSRA 3QQ0A 1FWHC 4O0KA 3CUJA 1W1YA 3LZ3A 4QISA 3PZVA 4UUIA 2CITA 4K8EA 1MO0A 4WK9A 3WFLA 4J3VA 5FF0A 2J4GA 1H7PA 3G8RA 1Z9AA 1E72M 2BY0A 1NTHA 1B1YA 3GXDA 1D7FA 5HAOA 1B2YA 2WAGA 3E0WA 3A24A 3S1VA 4Q8MA 1NVMA 4YN5A 2XZ9A 2DW7A 1QPKA 4GJIA 4OBTA 4L5ZA 4E8CA 1LL7A 1MFUA 2V3FA 4UTTA 1YLVA 4J27A 3ABSA 3B0VC 1VFTA 3GG8A 4KW2A 1WO2A 1UUOA 5F1UA 2V5CA 1LL6A 3MYOA 3DYOA 4IQEA 2FVLA 2GUBA 2ACRA 3AU6A 2NWSA 3VKCA 4LVGA 3T81A 4AEFA 3F1QA 3CV7A 2A7NA 4A8NA 4Q6JA 3HQOA 3WENA 2HSAA 3KOWA 2FMNA 1P1MA 1ME8A 3S1UA 1KBIA 5AHMA 1DXFA 3I3DA 4LCRA 4HVXA 2X42A 1Q6QA 2P1FA 1W3TA 3T0CA 2EPKX 3EDFA 4HD5A 3E0LA 1R3TA 3VGEA 2ZRUA 4Q8OA 3S8HA 5F2IA 1W9VA 4AYSA 4B3KA 4QDMA 1CXIA 2GK1A 4IP5A 2VMFA 4JTTA 1GKPA 2LLEA 3M6YA 1NP0A 3G6MA 1WAUA 4HBKA 2OO6A 5C9ZA 4O18A 2P0IA 3ABQA 1ONRA 1W5QA 1MXDA 3STGA 3PUEA 3WLKX 3BC9A 2QMKA 2JK2A 4MWAA 1DIEA 3RHGA 2HNHA 2W79A 1OCBA 1ZJIA 2F2HA 3E38A 3EBVA 2E1WA 2ANUA 1XFBA 3G77A 4GIYA 3CC1A 1XGDA 1ZALA 3IK4A 3LRLA 3WBYA 5D2VA 4GUJA 2QCDA 1A4MA 3ICJA 3UZYA 5LGXA 4ASTA 2HK0A 5FJUA 4IH3A 4MB5A 4UC5A 1J0JA 3APYA 2V6AA 1E6RA 3GR8A 3WLTA 2C71A 1AJ0A 4W8AA 4CCDA 4ZODA 3FLUA 4QAWA 2GOUA 4RK8A 4UQCA 5EYWA 1LOSA 3O7UA 3INPA 1GVRA 2A4AA 1IXQA 3EEZA 1NDVA 3CLMA 3EEGA 3ABXA 1FWGC 4MY9A 1TYGA 4WDTA 1AW5A 4NXSA 3VMOA 3WEZA 3TLQA 2Y8KA 4GNVA 3VGDA 1BKHA 3QHNA 2BB0A 3REQB 5CC6A 1V79A 3OLEA 3ZSTA 4Z2JA 1O66A 3P80A 4CQDA 3HPFA 1HTIA 4INFA 4Y9OA 1HZYA 1W5PA 1SSDA 2TRSA 2J25A 1ISVA 1E6PA 4NILA 3II1A 3VIHA 3WBWA 1VP5A 3M0ZA 1BWKA 2PDXA 3Q37A 3T2PA 4XKYB 1AD4A 5E93A 2V3EA 4BFAA 1DJZA 7REQA 3SAZA 4OBSA 1GJPA 4KFOA 1XYFA 2CPUA 1OIMA 4BQ3A 4DF1A 1BQCA 3UG8A 4WZHA 4D6JA 1S2CA 1W1B1 2DSZA 1HO4A 1M53A 3ZVIA 1PKMA 2QYGA 3BAWA 3GFYA 2MANA 4IP7A 1F6PA 3BW2A 3L4WA 4XBKA 3S2JA 4LV9A 4EACA 2C91A 5MKGA 1XJBA 3AXIA 2GJXA 2XH7A 3ATZA 3AIWA 4PB3A 2JIWA 3EWXA 2NVDA 2XGIA 1F8MA 1UUMA 2A6LA 5CG7A 1UZDA 2QJGA 3BVJA 3PPCA 5BRPA 3CO4A 2BY1A 1L6FA 4HYVA 2VR4A 4GNKB 1KFJA 1EUAA 4GXWA 4JXCA 3W1QA 2DH2A 2H8ZA 4KCWA 4RPPA 2AL2A 4YVXA 3GFZA 1WP6A 1JYNA 1XSJA 3WJYA 1I9CB 1RUSA 3WQ6A 4L6OA 1NAL1 3NO5A 4LB3A 4JCMA 5HJLA 4AD0A 2Y7GA 3APGA 1I2RA 3U6WA 1PS9A 3L66A 2FZ8A 3WQPA 4RDWA 4UOZA 1FKWA 4ATLA 3MMTA 3SQSA 3ABOA 4B91A 1UWUA 1GONA 1LDCA 1AK5A 4GO8A 1M04A 1NELA 3KBWA 4UQ9A 4LC6A 4BQ4A 5G2HA 1LL4A 1X98A 4W87A 1CIUA 1VEMA 4FK9A 3BXWA 3UJEA 3EXSA 1RP8A 2ZXAA 1GHRA 4WSJA 3ORWA 5CZJA 4ZENA 2WK2A 2PMQA 4S23A 4JOMA 4ZOBA 1QHPA 3WK2A 1QK2A 3GDKA 4IMFA 2Z7GA 1C3FA 4DI9A 3PWAA 4YYFA 4HZ6A 5F4XA 1CLXA 1CYGA 4O8AA 1ZRQA 3NR0A 3N2MA 1F3XA 1H0IA 1S2TA 2AAAA 3AIUA 5J04A 3RPMA 4ZO7A 4OFCA 2VX4A 3DERA 5A6BA 1GEQA 3PULA 3QV7A 4IWWA 1J96A 1XRSA 2VCBA 4GA8A 3D46A 3FV9A 2Z6JA 3QXBA 1N55A 1XPYA 3N73A 3T09A 3ZMRA 1L8NA 1POKA 3E2VA 1FXPA 4HPJA 4ORIA 4AVFA 4PMZA 4XG1A 1KRBC 1XHGA 3UGRA 4PRWA 1P7TA 4O4WA 5LA1A 1AZ1A 1V6VA 2C0AA 2IQ0A 3G1VA 1E3ZA 3UVAA 1Z69A 3LMZA 2OGJA 4EPBC 4B2DD 1X96A 3VKJA 3SCPA 2EKCA 3WLLA 4NRSA 1A3WA 1KTCA 1DVJA 3S6OA 4H8UA 3W84A 3VMNA 1IT7A 3BAKA 4A8LA 1MEHA 3KDNA 2NQJA 3RG6A 3ME3A 4H2CA 1V3KA 2MUCA 1KB3A 3PTKA 4GVIA 4DPQA 4LF1A 3GHRA 1F9CA 4GXPA 1F76A 1TA3A 3NGJA 3W2KA 3ARPA 5FAGA 1P43A 2H9AB 3NXLA 1G4TA 3TWAA 4XZMX 3AWNA 4KCTA 2CU0A 4X2RA 1KFWA 2XM2A 5I78A 3VGFA 2D22A 1CX9A 1OQFA 1E9ZB 4UTKA 2E6DA 1JAKA 5E9AA 4OV9A 5G2IA 4S2CA 3V18A 3W2NA 3NZGA 1H1NA 2R14A 2ZCGA 2PTWA 2PF8A 3LSBA 4ICMA 3VINA 2ZWYA 3S5SA 1LBFA 2QV4A 4AEEA 2J66A 3MU7A 3T1GA 1LYXA 2BP1A 1IIGA 2Q8LA 1UZ4A 3LSCA 2OSYA 3B05A 5T8GA 1U5JA 3ZR5A 2XIMA 2VGGA 1UIOA 1UH4A 1TV8A 4UIOA 4N4QA 3MHFA 5EBUA 3U9IA 3FYPA 4CD6A 2CESA 2W91A 3EX1A 4L61A 2QCNA 5E5CA 3P7YA 4TTUA 3DXIA 2NZLA 2OMAA 3PAJA 3GWQA 4Q4MA 4N9DA 1CXFA 1EPXA 1OZMA 2CZ5A 1I0BA 1B9ZA 2PDIA 5HDRA 1ZENA 3PB2A 4UR7A 3AIRA 2Z0IA 3U4FA 3M0YA 1EOMA 3AYTA 4M6QA 3MP3A 3GVQA 1R7OA 2V2DA 4RNIA 3H23A 2DZAA 4UFLA 1PWMA 4FHAA 4C6IA 1VFMA 3PPHA 1OFRA 1FWJC 4TR9A 2E4TA 1IWBA 1UQYA 4ATDA 5E0CA 1KWGA 3KCOA 3TKFA 4KKXA 3VUPA 1F05A 4BKNA 4XAPA 7ENLA 1TTIA 4QQUA 1PYFA 3K4AA 1OZQA 1EC8A 4DZ5A 1MFVA 4UTWA 2Y1HA 4FLOA 4GUIA 2F6XA 3LLFA 4K1GA 2C3ZA 3DHFA 1SO5A 4BQ5A 2WCAA 2ONEA 3N2BA 1WKFA 3FHAA 4TVUA 1XLIA 4AHPA 4DYKA 5FSEC 4W7WA 1X8FA 1RLCL 1XCWA 4Z1CA 1EA0A 3IGUA 3W85A 2XZ7A 4LY4A 2GK1B 2GGJA 3MVTA 1EB3A 3NXFA 4Z2HA 5D37A 1S39A 4Z2GA 3BGJA 4K68A 2PDLA 1SMDA 3FXGA 3WQGA 1P0KA 1C93A 4QCFA 3KHJA 6PTDA 2PU1A 3NZQA 4R7JA 3GD6A 4MWAB 1KM2A 1OIFA 2V3GA 3SI9A 3ITXA 3V0SA 4EPDC 5TNVA 4UTIA 2OWWA 4DO5A 7PTDA 1DQXA 4MTVA 3NG3A 2QCDB 3IJ8A 3H22A 3W75A 4DF0A 5E0FA 2E68A 4MJ2A 3QW4B 4A3UA 2XISA 4I8YA 3DFNA 3I6TA 3B9EA 3EXRA 1VRDA 3AU2A 1QPOA 5DX7A 4KFNA 5I3DA 1QAPA 5HPOA 2CWNA 4LYKA 4PUJA 3TSDA 1QW8A 3ZO9A 1WDRA 1XIHA 3IUIA 2D2OA 1OC6A 2BX7A 2ZYFA 2V3DA 4B9YA 4IIBA 2NXGA 4HHMA 3HPAA 2G3NA 2YL8A 2F6UA 1Z3NA 1E0UA 5LNWA 3UZJA 4Q33A 2RH9A 1EEPA 5M17A 2WBGA 3L23A 4RZ6A 3RM8A 4GCXA 2PGFA 1B4KA 1C92A 1K02A 2WOQA 1HL9A 4FOJA 5M2FX 2A5HA 1E9IA 3LY0A 3PF3A 4PMUA 1TPWA 1W17A 2WC3A 2NT1A 1OEPA 3NDZA 3R58A 3ZWTA 3RITA 3WNKA 3V5FA 2ABBA 4JIQA 4JTEA 3O1NA 1T41A 2BHYA 4JTRA 4CQBA 7REQB 4PODA 3XIMA 2DSKA 1ITQA 1VIWA 2FIQA 2ZUSA 2UBPC 4QG6A 4WY0A 4XD5A 1H1ZA 4MFEA 4KFPA 4AVNA 3CMJA 2G0WA 4PCTA 4X9YA 2GJLA 3GC5A 5MKGB 1GGOA 2GJXB 1A4LA 4UTJA 1C9WA 3FSTA 1QBAA 2CETA 3IJ6A 3O2LA 3SIZA 2CCRA 2C19A 3VNKA 2WKJA 1M3UA 2UY5A 4NAFA 2PTXA 1XF0A 1NOUA 3TJIA 3KAOA 1QHZA 1XRFA 2V68A 2AL2B 3N15A 5FIPA 1GG0A 1GHSA 3SY5A 3H8AA 5JU6A 4GY0A 5HA7A 2PCQA 5LNUA 5D38A 5JQ9A 4O0QA 1J5TA 3LDVA 4NYUA 2HVMA 3N9KA 1H7WA 3H2OA 1MVYA 3IIXA 3MA8A 5CZSA 4P5UA 2EPLX 4ZE5A 1KM6A 3IV3A 3CIVA 2AGKA 3ERPA 3W7DA 3THDA 3PTQA 3IUHA 4V27A 3VNYA 1A3HA 2EPNA 3GXFA 2YYUA 3L0GA 3B8TA 4BR1A 1C90A 3EWUA 2PDJA 2CHRA 3MKCA 1KBJA 2ZVIA 3HQ1A 3SUUA 4GH1A 3KRSA 4FXFA 4PEEA 3KBNA 2J7FA 5FL0A 5G4HC 5HNNA 1JZ5A 4H9VA 4B90A 3SN4A 1KM0A 2QUTA 3CH9A 4RE3A 1C9DA 1S1RA 3LG3A 1F5ZA 3GUWA 3WG6A 2QUMA 5D2XA 4YHGA 3RO6A 3THQA 1GJUA 1XL9A 1AFSA 1JCNA 3DYPA 5E1QA 1LQ0A 1WNOA 4MZYA 3VX0A 1BWLA 1H50A 3IVUA 2FFIA 2GZXA 3TA9A 4HOZA 3KDOA 2FJKA 4RE4A 1J2BA 2W63A 4JNYA 1XINA 3KTXA 4FNQA 3EAUA 2F6KA 2OT1A 1UHVA 3VILA 1S1PA 3TU9A 4JTSA 2REQA 4DJFD 4G1NA 1QI5A 3FYOA 1K8XA 5BOOA 4IIEA 2BXVA 3Q65A 1YXYA 4XIMA 2DSUA 2HVNA 3VIIA 2A3EA 2NV9A 4IGSA 5M5DA 4IX2A 3FYYA 2C1IA 3WQDA 5LHFA 1BPLB 1P7TB 1FQ0A 4BHYA 1OC7A 1OF6A 3N9RA 3B8SA 2VEKA 4AWUA 3QSRA 2ZRWA 1JDFA 2PLJA 3KRUA 4W84A 5KZ6A 3UESA 4UQEA 1NEYA 4EAYA 1W56A 3FX4A 1V93A 2WQDA 4KETA 2XIOA 1Q4WA 1JQXA 2G37A 3SM0A 2Q3RA 1EC9A 4LCSA 3T78A 1P5BA 1GZGA 2PBGA 9CGTA 1FH8A 1FDJA 3RM4A 2D69A 2QCEA 3KBVA 3N6HA 1TA3B 2KAUC 2PLKA 3RDKA 4GZ7A 5EMMA 2WBKA 4C7FA 3CO8A 3GVVA 3BMWA 1UR8A 3G1HA 5C9RA 2VT0A 4OOZA 2C1GA 1A5BA 4O16A 5H2ZA 4UNLA 4AZBA 1KM5A 3R25A 2VD9A 2ZX7A 1UQZA 1GVQA 3D3AA 4ZGYA 2GGIA 3LBMA 5IFTA 4QSFA 1FH7A 2PDKA 3ZLGA 4KESA 4Y8EA 2CKSA 3UG3A 4QLLA 1LRTA 2QNEA 1K70A 2ZVRA 3ELFA 2EKGA 2HS8A 4Z1AA 5D2WA 3CHDA 2NUYA 5F4WA 2DZUA 2PDPA 5C5YA 2QJHA 5K9DA 3KVLA 1XG4A 2VOTA 3P8IA 3BH4A 4O28A 4KEZA 1WKYA 2NX3A 1JL8A 3QOMA 1OCJA 2GJPA 3HG3A 4XZ9A 4N02A 3SSZA 4GIAA 3W7QA 1VFLA 2TSYA 5F4SA 4LRTA 4CCZA 4JIRA 4HNCA 2HISA 3BLPX 4ZTYA 1KW1A 4IZGA 1ZNNA 3H70A 4PE8A 1WUEA 4REQA 2QCMA 5LIUX 2H3BA 3MWAA 3SUVA 3UR7A 3T4CA 2X0HA 3PBMA 4DXXA 3R0KA 1RPXA 1G4SA 2Q09A 2Y8UA 3CEPA 4IT1A 3QW3A 1UH3A 1JPMA 1K4GA 4WOZA 3PBUA 1SJBA 2DT0A 5DEZA 2PDYA 1NJJA 1W0MA 4BEUA 1FWWA 3CV2A 3URAA 3UWEA 1OFEA 2X1SA 1O1HA 1PB0A 4IOTA 4F66A 1OG0A 4HPGA 4GXMA 4H2HA 3AUJA 3FJ6A 1JCJA 1W3HA 7TAAA 1L8PA 3EWDA 2XUCA 3CH0A 3GIQA 4CGTA 3S9YA 3UU0A 1K1DA 5DY2A 4DYEA 4ADSA 2PWVA 4GUHA 1AQ0A 4OJYA 4BCEA 3PNZA 4IQLA 2R91A 3W7EA 2FHCA 2WMJA 3A21A 3P5ZA 5KMYA 4ZFMA 1GQIA 3GO2A 3QFWA 1VAHA 2DUAA 1TV2A 4AXNA 1FHLA 3KW3A 3RJXA 3KL0A 3O3RA 1N7KA 1Q8AA 2ZZ1A 3TMQA 3VGGA 4QSHA 3W23A 4H7ZA 5EA9A 3F03K 3RCMA 1I2OA 2YXGA 1WAWA 3QMRA 3UWYA 2P0OA 3EGJA 5JIWA 6A3HA 4MNMA 4CLMA 1UCWA 1H5YA 5K2ZA 5CC5A 3K8LA 3OVQA 4GO9A 5KZEA 3WUFA 3WQCA 4GIEA 3UBPC 4E4PA 1G01A 3WSUA 2INFA 3UJFA 3CPRA 2W3ZA 4XUGA 1DE5A 3BAXA 4MUZA 2NQZA 1AVAA 3CPUA 2Y4SA 5CBBA 5AFDA 3KS5A 3TYUA 3UWQA 1JI1A 1L6YA 3N1AA 4QE5A 3BPWA 3HU7A 4LANA 4P7LA 1IV8A 3BLDA 2PSNA 2AAMA 4RZBA 3TROA 1V02A 1ODZA 4XZNX 5EL1A 4EOUA 4CD7A 3QEZA 1XIBA 2OYKA 2C79A 4S3DA 2YDSA 1B5TA 3W1LA 2I56A 1VD6A 1SYTA 3BDKA 4J1OA 1IYXA 3IIVA 4J2MA 1Z6KA 4JQ4A 1XYLA 4R9XA 1AH4A 3CLWA 3R8RA 1I8JA 5B7ZA 2QLYA 1QPQA 1HJWA 2RGLA 2VVSA 4FXRA 5LYRA 4GYPC 4LUTA 5HUOA 4UTUA 4AH7A 1DEDA 1NDYA 3AZRA 2RJHA 3B8IA 2WCGA 4FXJA 4NASA 2CLPA 3NQBA 3WEOA 1UG6A 2E28A 1IWAA 2E7FA 3L7RA 3P61A 2E67A 2EJAA 4RNFA 1MXSA 2J75A 1MEWA 1V0NA 3U8GA 5FEZA 4WY0B 1N82A 2YCLA 3WJZA 4FI4A 5EGRA 2TAAA 4JX5A 5CGTA 3VI2A 5A8QA 4PC8A 1W9DM 4GHRA 2QIWA 3QV8A 4G1KA 1EGVA 2VJXA 3C2FA 4JQ2A 4HPHA 3RX4A 1WUFA 2WM0A 5FF7A 4BS0A 1KXHA 4DWSA 3AHTA 4F3HA 4NAFB 4F0SA 1XS2A 1EXBA 1YKWA 1KKOA 3KRBA 3D5HA 3WLQA 3VGBA 1Z32X 1SJDA 3LLXA 1PX4A 3SJNA 5GPRA 4JNMA 1XQKA 3K46A 1CGWA 3T0AA 4LYRA 5A8NA 3B3DA 4GQQA 3NOEA 3UCQA 1RK5A 1LZOA 1YNYA 1R9XA 3THCA 1TREA 1DJIA 2Y61A 4M8UA 1BVWA 2VELA 2VRJA 1TZ7A 2OB3A 2WZHA 1NQ6A 1Y5XA 3KM8A 4GYFA 2DIJA 3OYXA 2PU0A 3B40A 3VA8A 1W3KA 4MG4A 2WNQA 4KBXA 1DIKA 1G5AA 5KSWA 6XIAA 1EZ2A 4L1GA 1PDYA 2RFGA 4QX4A 1QASA 1S5VA 1EF3A 3S9ZA 3UVIA 3MVIA 3OZOA 3HG2A 4AY1A 4I7WA 3VZYA 3KUMA 5CPMA 1WB0A 1BQGA 3H2EA 1Y8BA 2X30A 3U2ZA 2Q3OA 3KE0A 4J9JA 1V8EA 1UASA 4DJDD 4XZWA 3MQTA 3EWZA 3IGHX 4JHOA 1AJZA 1FWDC 2PWDA 3CASA 2HE5A 3A47A 4D6DA 1XBYA 3F5LA 3H4XA 3QTGA 3IRDA 4G8TA 1TWDA 3KBSA 2D24A 1O60A 1XBZA 3PFMA 3PHAA 2ZIDA 3PS7A 5ABHA 3NL6A 3W70A 3P5YA 2W6RA 3NGFA 5FESA 1EWDA 1YXCA 4AEOA 1YBQA 2REQB 2VEFA 2QUVA 2VURA 4QS5A 3W7PA 1ZAIA 2GQ3A 2Z4GA 2GGEA 1TWWA 1UR1A 1PBGA 1LROA 2X1UA 2ZICA 4AXKA 1A47A 1THFD 5HXMA 4M7SA 3CTTA 3NQDA 1BVZA 3ARRA 4DBWA 3EMQA 5KITA 3CQJA 5G1YA 1RALA 3TJXA 3SUWA 1MZHA 2NUXA 1ISZA 1Q5MA 3NQMA 1TJPA 3QBUA 2VYOA 1JZ8A 4LB4A 2J78A 3R1ZA 5I77A 4DBDA 3EOUA 3VNLA 3P0WA 4IMGA 2GUYA 1EJ7L 3VIJA 1JZ4A 3R0UA 3VNJA 4V1YA 4E4FA 3GG7A 3W53A 4EX4A 1WOAA 4QR6A 3A23A 3COTA 3F2DA 2YLAA 3P82A 2ODOA 2VR5A 3THAA 4GYKA 2YBVA 3K5XA 3RX3A 4JBRA 2G4FA 4YMZA 1E5JA 3W86A 3U2EA 1J01A 4PCPA 3LU2A 3WNOA 4K7YA 5HMEA 4R9OA 2XVKA 4PTNA 3ZIZA 4EE9A 3JRKA 1CNVA 3M4HA 1GORA 4MY8A 2W66A 3PM6A 2J9ZA 1BYBA 4F0LA 1ECQA 4F0KA 5CG0A 4GQRA 4PMVA 1EFZA 3I4EA 2VDIA 5JIPA 2VEPA 1MYRA 5E6ZA 1CWYA 1UKPA 4RE2A 5C9WA 1S38A 3WLPA 3PFRA 3CV6A 4X63A 4FMVA 4S2BA 4EP8C 1MWOA 4LT9A 3IV8A 1GT8A 1XC6A 5AZ0A 1UMLA 3ZJ7A 3HMJG 2NX9A 4LNYA 2I9EA 1ZZMA 3HB9A 4LUYA 4D8AA 2Z1SA 3MP4A 4OKDA 1EHAA 2YBTA 4AZ5A 4J35A 2V2HA 1H7NA 4R3UA 1S3HA 2HXTA 3G22A 3H53A 4TV6A 4U3CA 3S2MA 5BWFA 1ZQ5A 1M6JA 3W29A 2VWTA 3UNDA 1QPRA 3MUZ1 2FPVA 4K3ZA 3WDHA 5AC8A 2PDNA 3DBPA 4OU1A 3VXGA 3DENA 2YPIA 2QMJA 2HMCA 5FI8A 3N4FA 3SURA 1YW1A 2CHOA 2FB2A 4NIRA 3IJ7A 1UWAA 1EIXA 5DXXA 2X16A 1GOMA 1R3WA 2JQXA 4KQNA 4LJ3A 5IXEA 5FEPA 4O57A 2FDMA 4H1ZA 5AYIA 4EPKA 2P8CA 3AZTA 1HP4A 3PVFA 1I1XA 1RQEA 3AIVA 4P7OA 4O1BA 3BCJA 5GJMA 1A3XA 2Q6ZA 3M0IA 3E74A 2EJ1A 4HK5A 2C1HA 1MUWA 4QAIA 1PIFA 1JZ6A 1DWFM 3THUA 2I5GA 2W92A 2ZZ6A 4NT0A 3SGUA 1W3NA 4ALDA 1DWJM 3O9NA 3H7RA 4ADTA 7ODCA 1QMLA 3C52A 4C1LA 5FF4A 4Y9NA 2A7RA 1E9YB 3HM7A 1RCOB 2IPFA 3W1NA 4FIQA 2PCEA 3TYEA 5CKSA 4CVWA 5AVHA 4ROPA 1QU4A 3LK6A 3MJMA 3R11A 4PSPA 1E70M 5BXTA 3V16A 1M7JA 4D8ZA 3LPOA 3A4JA 4NXKA 1ZPTA 4JTLA 1MQPA 4KPLA 3MTWA 1AODA 1IXPA 1G7UA 4O52A 4PN2A 1S46A 4GC4A 2WVTA 3LTYA 5CAHA 1EQCA 2C14A 3L4ZA 1X6LA 3AS3A 1NWUA 3UETA 5CBJA 4HYWA 4J3ZA 2J62A 3AAMA 3M16A 1ZFJA 1CZ1A 3VKBA 3GS6A 4U2ZA 4GINA 3RNDA 2J7CA 2BV9A 5H1WA 2PURA 4B5SA 4H8NA 1DJXA 3I3BA 4GI6A 1E40A 4JPGA 4J3TA 4TV5A 1HUVA 3U48A 1DIOA 3A3HA 1E51A 4C6JA 3NQGA 1GQJA 4AB4A 4GLEA 3AROA 3WN6A 1VHNA 1VFFA 4UB9A 3DHUA 3WLNA 5JMUA 2GVLA 3AMGA 4U10A 2EPMX 1OD0A 4JTAA 4O10A 3NM1A 4C6PA 2VFDA 5D8WA 3LN3A 3FAXA 4LUTB 3LXCA 4Q32A 4LUSA 4AC7C 1GZ1A 2PS2A 4LS2A 1H5VA 1UWSA 4D9PA 4DZIA 4QJ4B 1UPPA 1E9LA 3KLLA 3VKKA 3QMTA 1DL3A 3WQEA 4E5TA 1FHVA 5DMMA 3ZVHA 5HINA 4IMEA 1JCLA 3BUVA 4GVGA 2VTFA 1HJXA 2WSQA 1RV8A 1IR2A 2PF0A 1W8GA 3C6CA 4KRUA 4QTGA 4IPLA 1D9EA 4RDVA 2EXOA 3LOTA 5A2AA 4DNMA 4FF5A 1X7FA 2IXUA 1W2PA 3NQ8A 5LIYX 4DWSB 1LUCA 1HXJA 1VJSA 4MYAA 3M5ZA 3S2NA 3R8HA 1VYPX 1FWEC 4UCFA 4L1XA 4UOQA 3WL0A 4EXBA 5U7SA 2WNZA 1GTHA 4ZXOA 5XINA 1IGSA 1FWCC 3FSUA 3M41A 4JL2A 2QW5A 1W9PA 4DBSA 2VKZG 4MB4A 3V0UA 3CNYA 4DJEA 4HK7A 4UTFA 5CPLA 1OGSA 4WGHA 1YPFA 3LBOA 1LT7A 4ZXLA 5BMXA 5H8UA 2E9MA 3GZ3A 3TQVA 2ZZ7A 2E40A 4Y9AA 2X0YA 3VKAA 3W24A 3F7JA 1H7OA 4HMEA 1QW9A 3IAQA 3E9AA 3GTIA 2WJEA 1TPEA 3VDGA 3RMJA 4HA0A 4FO4A 3TVAA 3T05A 3GH4A 2YFOA 1UZHA 2HDJA 4P61A 3G3DA 3GIYA 1LG2A 5D03A 1SFLA 3AS0A 3GNXA 1P6CA 1GTEA 3C3NA 1XYAA 1JG9A 2P8BA 4O12A 4L4OA 3TQ0A 5CPOA 2WANA 4UZUA 4RW5A 3DG3A 4IFOA 1XCFA 2B81A 3BTNA 3CZLA 2EPHA 4JDBA 1FWAC 1B54A 3GDRA 5KZMA 2UWFA 4HIBA 1F4AA 2P76A 4TX6A 2R9RA 5EMYA 4XZLX 1E4LA 2G95A 4K39A 1J8VA 3TC3A 1SFSA 1F07A 2PP3A 3BZGA 3ARUA 4C7GA 3GH5A 3SY1A 3N2TA 1V0KA 3NTYA 2XHYA 4HCDA 3MJYA 2QJJA 1YBQB 4G7EA 3GYCA 1F3TA 4LY8A 3CUHA 4Z0JA 2OZ0A 4G5DA 3EPOA 3EB3A 1EYEA 4F48A 1KFKA 4PA8A 1YHTA 1YPIA 4GE8A 3SFWA 2Y63A 1UOKA 3CYJA 3HFTA 4P2VA 5IOBA 5M3WA 2FTWA 2O0TA 3NJ3A 3A22A 3FAWA 3W7RA 1KRCC 3F4CA 4BWLC 2DH3A 2W5FA 3PZMA 3WH5A 4WDUA 3G1FA 4L80A 4QM1A 3F2CA 4LAKA 1T8QA 4ML9A 1RAKA 1YTKA 1XP3A 5HMFA 4TVCA 2VFFA 4A05A 4CQ8A