5ECUA

The unliganded structure of caldicellulosiruptor saccharolyticus gh5
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
350
structure length
350
Chain Sequence
TAYEKDKYPHLIGNSLVKKPSVAGRLQIIKQNGRRILADQNGEPIQLRGMSTHGLQWFPQIINNNAFAALANDWGCNVIRLAMYIGEGGYATNPQVKDKVIEGIKLAIQNDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIAQKFPNDFHIIYELCNEPNPTDPGVTNDEAGWKKVKAYAEPIIKMLRQMGNENIIIIGSPNWSQRPDFAIKDPIADDKVMYSVHFYTGTHKVDGYVFENMKMAIEAGVPVFVTEWGTSEASGDGGPYLDEADKWLEYLNANNISWVNWSLTNKNETSGAFVPYISGVSQATDLDLGSDQKWDISELSISGEYVRSRIKGIPYQPIERTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cellulase
publication title The structure of Caldicellulosiruptor saccharolyticus GH5
rcsb
source organism Caldicellulosiruptor saccharolyticus
total genus 132
structure length 350
sequence length 350
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
A PF03424 CBM_17_28 Carbohydrate binding domain (family 17/28)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5ecuA00
3ALGA 1GW1A 1O7AA 1ZBCA 2ZUTA 4HOXA 1OSEA 3NIYA 1R7OA 3ARUA 3EMCA 3NDZA 1B2YA 2VRJA 3GH4A 5DO8A 4MB4A 1NQ6A 5LYRA 1UD6A 3UG5A 1HN1A 2O9TA 3WF1A 1V6VA 1BTCA 1UD8A 2BVYA 1W9VA 2F8QA 4H04A 3PZVA 3VGBA 1NH6A 5IHRA 3WD4A 2XIIA 1ZL1A 3WNNA 4GXPA 1P6WA 1VFFA 1V02A 1AMYA 4FMVA 3ZMRA 2WSKA 4LGXA 3UR8A 3K4AA 1OM0A 3A4AA 4AEEA 4GI9A 3VDAA 1UOKA 2G3IA 2V38A 1JZ3A 1E4LA 4AYSA 2ZOXA 4ACYA 1FHLA 1RD6A 3ZR5A 3ZSSA 1KXHA 2X05A 1ISVA 4J3UA 2VX5A 3OZOA 4BF7A 3EDJA 4AZHA 4PMVA 1J01A 1AQHA 1W91A 3VD7A 1NOWA 1J9YA 2V3DA 2WMJA 2XUCA 4F9DA 3AQUA 3WN6A 1WP6A 2EEXA 2XGIA 4AW7A 1JAEA 2W4XA 4JIEA 3VUPA 5EFDA 4IPLA 2GK1A 5E09A 1GNXA 1BPLB 3KL0A 1H49A 2DPEA 5KEZA 4KRTA 2E4TA 3MUY1 3AHVA 3GXMA 3OGVA 5A6LA 2WMKA 4PMRA 2W5FA 1E6PA 4JCMA 1J0IA 1JNDA 1UKPA 4HZ6A 3W53A 5A2BA 2W63A 3G6LA 2PWEA 2ZUNA 3W0KA 1UKQA 5FD0A 5FL1A 3WF3A 1GHRA 3GH5A 2G41A 1GOKA 2D2OA 2BHUA 1GPFA 4A3HA 2E9LA 5DEZA 2WHJA 3AMDA 1LG2A 1E73M 3VIJA 4PUEA 1EQCA 2BVDA 4WSKA 3PTKA 3VIIA 2Y8KA 2ZWYA 2YL9A 1XD0A 4PYSA 3WDIA 4B3KA 4YPJA 4JL2A 4EKJA 3ZT6A 5CJ5A 5JUVA 1JDDA 3VMOA 2PC8A 2BHYA 2QPSA 4WKHA 1KBKA 2J8GA 3SCTA 4AWEA 1LL4A 4W87A 1US2A 5LA0A 2VL4A 4HA3A 1DEDA 2WHMA 1PIGA 3CGTA 2EBNA 1E72M 2J7CA 2AMGA 2CYGA 3W37A 2WK2A 4X9YA 4FLSA 1WZAA 4MNMA 3E1F1 3VIGA 1E0XA 1C8QA 3WELA 2YA0A 1BQCA 1QI2A 3AROA 3MMWA 1E4NA 3SUWA 3CZJA 1N82A 4PTWA 2OSXA 3K4DA 1E40A 1UWIA 1OD8A 3ARQA 1W1VA 4Z2JA 1UA7A 4Q7NA 3SCVA 1V03A 4OIFA 1DHKA 1E6QM 1JD9A 1ZJAA 1JFHA 2FHCA 1X1NA 4JL1A 1PX8A 5E6ZA 2XHYA 1QI0A 3BMVA 4YN5A 2D0GA 4CUCA 5I24A 2XVPA 2XM2A 5DT7A 1JZ7A 3CZLA 1BYCA 3KL5A 2Q8XA 1GUVA 3PZNA 4OOUA 1W32A 2VQTA 5ABGA 4E2OA 2J8FA 3N9KA 1H2JA 4JZ5A 1UHVA 3TONA 4J7RA 3VIOA 1C7TA 1HJQA 3VIPA 3UR7A 2CCRA 1GCYA 3T0DA 2XG9A 3GBDA 4C7DA 2CITA 4AZ6A 1EH9A 4DWSC 4F9JA 1ZBKA 2XVKA 3RJYA 1HJXA 1B0IA 1MXDA 1WB0A 2E9BA 4DWSD 4Z2KA 4C7GA 3LPFA 4H8UA 3ZT7A 5A8QA 5FCZA 1WZLA 1PX3A 5D9PA 1OGBA 4ML4A 4QLLA 2J7EA 2EJ1A 3WEMA 2DSUA 2EO7A 5JBDA 4UR9A 1D2KA 4GQQA 5CPSA 2CETA 1D3CA 4OBRA 3II1A 1TG7A 1XCWA 3M7SA 3ZJKA 1XH0A 4MDOA 4P8WA 3MV11 3MANA 3OB8A 5A2AA 2J7HA 1CGVA 1OD0A 1QVBA 5I78A 3M6DA 1JYWA 4BQ4A 1NP2A 1B1YA 3CUIA 2WW5A 2J78A 2C7FA 3SUSA 3FNDA 3WD2A 3CUGA 4Z2LA 4AMCA 1X6LA 2WMFA 1K9DA 2BXYA 4U5IA 3EMZA 3WNOA 3WUFA 3WFLA 3GNPA 3POCA 1VEPA 1UQZA 5CLWA 4YHEA 3AHXA 3VGEA 2XSBA 1CXIA 1CDGA 4B3LA 1WDRA 2W92A 3AS1A 4JFWA 2VT0A 1X6NA 2WAGA 5A8MA 1BYDA 2Y24A 2EXOA 1GOWA 2ZX9A 1KXVA 3CZGA 1E0WA 3N18A 5CSYA 5FOOA 5DMYA 2ZXAA 3UEQA 1KCKA 3IAPA 2VC9A 2BHZA 3MS8A 1KWGA 4BZYA 4K68A 2WLZA 5M03A 1RP9A 4LYQA 5BCAA 3GM8A 4TVUA 1E1FA 1HT6A 3AXXA 3VD5A 3SCWA 3W25A 1PJ9A 1UR0A 1XV8A 4P8XA 4AD4A 4OZOA 1BLIA 3IJ9A 1QHZA 2O9PA 4M8UA 1OB0A 3PZOA 1UR8A 3SCPA 4MAZA 1KXTA 3WF0A 1UWSA 4W5ZA 3TA9A 4W8LA 2XFYA 3OIHA 3ZQ9A 4V27A 4W93A 3N13A 4Y7EA 4QAWA 3HMCA 5HPCA 3VGHA 4ACZA 1R8LA 4BA0A 2XWDA 2X8RA 3L4TA 3IJ7A 2EPOA 1GOQA 3OLDA 3WDJA 5E70A 4S3KA 2DT0A 1W3LA 3NJ3A 4OKDA 2OYMA 1V08A 1C7SA 3VD9A 4PMUA 1XYFA 3BAIA 1NWTA 2PWFA 3QHNA 3GZAA 5CGTA 1XSJA 1UH3A 2E3ZA 4OBSA 4AIOA 4DM2A 2VZUA 3VDHA 5C71A 1GQIA 4TVCA 3BLPX 5HPOA 1V3JA 1E43A 2ZX7A 3W29A 4WF7A 2FH6A 1AVAA 4NSBA 3OLEA 2VQUA 4AZIA 1GJWA 3MUAA 1E6XM 5A6BD 4AZCA 1MW2A 6TAAA 2NT1A 3QOMA 1RPKA 5JIPA 2UY5A 4HZ8A 4AD5A 2XWEA 2WCAA 4H8VA 1HF6A 1CXEA 1GVIA 4ATDA 1OIMA 4CCDA 1UKSA 4TUFA 3BAKA 3K1DA 1UD2A 1HJVA 4U31A 3ARWA 2J62A 3TTQA 1ITXA 5EB8A 1HL9A 2DT2A 2WVTA 1E5NA 1HP4A 1AQMA 3I3DA 2VZOA 5A8NA 1GONA 5A3HA 4CKQA 5CPQA 2XGBA 1J0ZA 2VR5A 2J79A 1CGYA 2GJRA 1YHTA 2YDRA 5A95A 3L4XA 4TOQA 4P7NA 1UH2A 1JAKA 3A4XA 1LL7A 4D1JA 1U33A 2OWWA 1V6YA 4GI6A 1J12A 2ZICA 3EDEA 4W84A 3ARXA 1D7FA 3WDQA 1G01A 3WUEA 1WNOA 2YA1A 1J0YA 3MUZ1 5LA2A 2RGLA 1OT2A 4CD4A 3RIKA 1M01A 1CWYA 1H09A 5IXEA 4UNIA 3AIEA 1NARA 1JI2A 4W5UA 1Z32X 4N42A 1E55A 1E3ZA 3F4VA 3DYOA 5IFTA 2V3EA 3SEPA 1E5JA 3PZ9A 4J3WA 2GFTA 3RILA 1A3HA 2YJQA 1CECA 1WPCA 3CZ8A 4MADA 3GNOA 2EPNA 4D72A 3ZT5A 1V3LA 4PBGA 1MFVA 4HU0A 2QHAA 2GJXB 1V0NA 1J0HA 3SUTA 2VRQA 1W3HA 1V0LA 4E8CA 1CBGA 1OGGA 2WANA 1PEZA 3BMWA 1PBGA 5D9OA 2ZIDA 5FIPA 4AD1A 5CPTA 2PF0A 4J3TA 4WKAA 4JKKA 3GTNA 4FLRA 1BYAA 4KRUA 3PZGA 4W7UA 4M80A 3VM5A 2RGMA 4HTYA 3VINA 1UG6A 2DIJA 1BGGA 1HKMA 2CERA 4J3XA 5HBFA 1H41A 3BAYA 4NI3A 2FGLA 2D3LA 1B3YA 3D3AA 4NRRA 3W24A 3VX0A 4BQ2A 4MNLA 1FHDA 2XFRA 1QNRA 1M03A 2YDQA 2W66A 2G3JA 4U5KA 3L4UA 3FAWA 2F61A 3EDFA 2BFGA 3NYDA 5M17A 5IFPA 3T0AA 2X0HA 2AAAA 2VO5A 5HXMA 3LPPA 5A6MA 3AMGA 2CPUA 1UWRA 1V3HA 1M53A 2JALA 3AFBA 3T0BA 2J7GA 3VOCA 3L4WA 2J47A 3VDCA 1UD5A 1Q6GA 1CGTA 5BXSA 3AXIA 8CGTA 3L4ZA 3QGVA 3AS3A 1HXJA 1W3KA 3WEZA 4UFIA 3OLGA 1V6WA 5I0DA 3K8LA 4WKFA 1FFRA 3ZR6A 4EAMA 5JBFA 2YL5A 3FXYA 2QMJA 5C8BB 5CG0A 1QI5A 2WPGA 4NRSA 3SCNA 1C8XA 1LLOA 1W2VA 4D6HA 2OLHA 2VURA 3AHTA 4GINA 2E8YA 4AZGA 2Z1SA 5JIWA 4MNJA 4ATLA 2WCGA 4HA1A 1HVQA 4MB1A 2CBIA 1I1WA 3AIQA 5I5RA 1GQJA 4M24A 3CHCA 4DWSB 3NSXA 4BCEA 3O6AA 3U5YA 1YQ2A 1KXQA 4FK9A 3S6TA 4D6GA 4OOZA 1UUQA 3WL1A 4JCLA 1DWGM 4FF5A 1UR4A 3PTQA 4TX8A 2WLYA 2GUYA 5I79A 1TFVA 3RPMA 3CUJA 1WZMA 1GJUA 2YBTA 1FFQA 1WCGA 3KEHA 5A6AA 2A3HA 1TMQA 3BGAA 2PBGA 3DYPA 4CVUA 1CZ1A 1GVYA 1TA3B 2ZUSA 5GPRA 2WVVA 1MXGA 2V3FA 4HU8A 4W88A 4R5EA 2UWFA 2W62A 1BAGA 2VX4A 4E4PA 4GO9A 1J10A 1MQPA 4U2ZA 3GYCA 1BVNP 1MW3A 2JEQA 2Y8VA 3D5HA 2VZVA 3RM4A 2QV4A 1NM9A 1OINA 2D1ZA 1L0PA 2YDSA 4UQ9A 3SIMA 4BQ3A 3CUHA 1H11A 3WNMA 3THCA 3CBWA 3WBAA 4J27A 6CGTA 3K8KA 4FLQA 4CVWA 1MFUA 4X0VA 4TTGA 3OGRA 3T2PA 4F66A 1E71M 1EIBA 1ESWA 3BAXA 1C90A 4CD5A 1LJYA 1Q6FA 3CHEA 2OWCA 4RE2A 3U7BA 2WHLA 4CU7A 1QOXA 2PB1A 1BG4A 5IHSA 2A3AA 3ZOAA 1WAWA 2IXVA 3MMUA 1HL8A 4HMDA 2CKRA 1HKJA 5BXRA 1LF1A 4LYRA 4MJ2A 3CZEA 2VVSA 3HJEA 1JDCA 1C3FA 4JFVA 1TVNA 2DT3A 4AZBA 2BY0A 2GDUA 2QPUA 2JIEA 1JYNA 3WL0A 3BAJA 1QBAA 5D9NA 4ATWA 2WXDM 4UFHA 4JFSA 2JE8A 3I3BA 3G6MA 2OYLA 3RM8A 3HN3A 3B9EA 2VCBA 3FW6A 2OWXA 5A6SA 3W38A 1W1TA 3BLKA 4CD8A 4N0RA 2WKGA 3VGFA 3WH7A 3OBAA 3FHQA 2VCCA 2J75A 3WQVA 4AXNA 1KGXA 3TTOA 4MB5A 2IXUA 3AS0A 3WMSA 4EANA 2QMKA 3PZTA 4YHGA 3IK2A 5GNXA 3AJ7A 4C7FA 3WY1A 5A8OA 1GOOA 1E6NA 2OSYA 1EXPA 2JEPA 4W7VA 4GKLA 4Z2GA 2O9RA 2YL8A 1E15A 2VRKA 1J11A 1M04A 1EDQA 3RJXA 3GXFA 1EO5A 3VKKA 5I23A 1QNQA 1JGIA 4WSJA 3ZJ7A 4L4OA 2UY3A 1V3MA 3NDYA 4TX6A 5KZ6A 1NWRA 1HVXA 1ZB5A 2FHFA 4CCEA 2DSKA 4Z2IA 2Y5EA 1F4AA 2CXGA 3W6MA 4P7OA 4P8VA 4AD3A 2JIWA 3WH5A 3ARYA 5HDRA 5ABFB 4UOQA 2VZTA 1CNVA 4X0NA 3AIRA 1UYQA 2J7FA 4JFTA 4AC1X 1W9BM 1BHGA 1WO2A 2F2HA 3AYRA 4JHOA 1ISYA 2WNWA 2VX6A 1KFWA 3EDKA 2XVNA 2D0HA 3SCOA 2CKSA 3DYMA 3SURA 4V28A 1E56A 1Q6EA 3U5UA 3FY1A 1JI1A 1OT1A 1FP8A 3O9NA 2AOSA 3K8MA 3PHAA 1NP0A 2WWCA 2WZIA 1JZ8A 3L2LA 1EA9C 5BXPA 3WQ5A 1IZKA 1E6SM 4D71A 1K9FA 4AY1A 2BY1A 1B90A 1QHOA 1CYGA 5CSUA 1CGUA 2D0FA 3F5LA 2WMGA 3AOFA 1IT0A 3CMGA 2J25A 3TP4A 1XSIA 1QNOA 4CN1A 4MNKA 4LYPA 4M81A 2CNCA 1FP9A 3ZM8A 2YLAA 4CD6A 1G94A 1CXKA 1U2YA 1ZU8A 1XC6A 1ZJBA 2O92A 3MSDA 2BV9A 3BC9A 3PZIA 4PMZA 5BXTA 2WVUA 5BWFA 3ZJ6A 2D24A 1PIFA 2X2YA 4JKMA 4MJ4A 1UD3A 1GOIA 4EE9A 4HOWA 1JIBA 3N11A 3WIJA 1EHNA 2GSJA 1L8NA 1JZ4A 1B31A 1JZ2A 1ITCA 3WUBA 1JG9A 8A3HA 3W6LA 4D6IA 3ARVA 3UESA 1R7AA 2WCSA 3VIKA 4B9YA 4PCTA 1V02E 3PBGA 1NOFA 4HZ7A 5A94A 4CN4A 2PWDA 1JXJA 3CZKA 3WH9A 4AISA 1KBBA 3PZMA 4CD7A 2PI6A 5CXPA 1EHAA 2FDMA 2WMIB 2XVLA 3LPOA 2DIEA 3VNZA 1GORA 3WF2A 2W91A 3AISA 1PX4A 3AXHA 2YIHA 3EMQA 2VUYA 4PUDA 2PWHA 2YBUA 3BSHA 2BS9A 2VCAA 4PMNA 2E0PA 2VTFA 2DEPA 1XD1A 1BG9A 1XRVA 1KGUA 2VVNA 2ZXBA 5A2CA 1JD7A 2WWDA 4J3SA 5A6BA 5E9AA 1Q6DA 3WUGA 4JFUA 4JHZA 3AZRA 3AIVA 3ZO9A 3VX1A 1UD4A 5E0CA 3AMKA 4PRWA 1LWJA 2PWGA 4MDPA 5IDIA 4QDMA 1CXFA 3B9AA 4F79A 3VO0A 2ZUWA 1W9PA 1PZ3A 3AZSA 1J0JA 3AYSA 3AHZA 3MMDA 3VILA 4WJXA 2GVYA 3APGA 2HVMA 4IPNB 3PTMA 4HPGA 5I3DA 3ZSTA 3EBVA 2CESA 4GZEA 1FH9A 5BROA 1ECEA 4U3CA 2G8ZA 4PMXA 3OZPA 3BCDA 4P8UA 2GK1B 3THDA 3WQWA 1LG1A 3POHA 2E40A 4UZSA 2NT0A 2WHKA 1XH2A 3ZIZA 3FN9A 1ISZA 3N1AA 4PMOA 3WKZA 2YL6A 1VIWA 3J7HA 1H4PA 1QI4A 1QW8A 1BF2A 1EQPA 1V0MA 3N04A 4ZE4A 7TAAA 3VGDA 3RDKA 3WQ4A 1GHSA 2WSPA 2D20A 4D6JA 1G9HA 2GJPA 2DH3A 1LWHA 2A3EA 2ESCA 3B9DA 3MV01 3WMBA 4LX4A 1LL6A 5CGMA 2Y2WA 6A3HA 3AIBA 1MWOA 5TD4A 2BY3A 5I2UA 2QLYA 3VGGA 4TTUA 1AQ0A 1CXHA 1HJUA 3AMLA 4U3AA 4UZUA 3AZTA 3ECQA 3KL3A 3BCFA 4CCCA 2ZWZA 4PCSA 5A6JA 1UH4A 1VFMA 1VJZA 4MAVA 1HJSA 1OGSA 4ZXLA 2G3NA 1C91A 2EQDA 5AYBA 1GQLA 4L4PA 1ISXA 1UKOA 4P7QA 1ODUA 3QOKA 3HU7A 1UQYA 1HNYA 3WQ6A 3DC0A 2YKKA 1NOUA 2W67A 5ABEA 4TVDA 1UA3A 1DP0A 1BGAA 3KWXA 1HIZA 1KQZA 4V2XA 3SCQA 1EO7A 3ARSA 3A6OA 3IJ8A 4HA4A 4AD0A 4GZIA 5I6SA 3WFZA 2X0YA 3I3EA 1FH7A 2BVTA 2V3GA 1KWKA 3NSNA 2CHOA 3T08A 2PBOA 1MYRA 3VNYA 1EDTA 4J28A 4AZ5A 7A3HA 3CTTA 3VIMA 4AEFA 1Q6CA 3VMNA 3BSGA 1CLXA 2CBJA 4XZBA 3MO4A 3LPGA 3OA5A 4ZENA 1EOMA 5EMYA 3WNLA 1QW9A 3GBEA 1B30A 3A4WA 2G3MA 3T2QA 3VTRA 3ARZA 3UG4A 1W9XA 4R27A 1XCXA 3GH7A 4CGTA 2GDVA 3CLWA 1JF5A 4WIWA 2DH2A 1UR2A 1OIFA 4U33A 1FOBA 5D8ZA 3SUUA 3FHAA 2QF8A 4GIAA 1H3GA 5EFFA 4CU6A 4F8XA 1MW0A 4XX6A 1S46A 1J18A 1US3A 1WE5A 4M82A 2C0HA 3W81A 3VDBA 1VJSA 3UCQA 2YA2A 2XJ7A 3AIWA 3VU2A 2WKLA 5A69A 5D8WA 1KCLA 1ZBWA 2JFEX 2WC7A 3A47A 4UFLA 3ZJ8A 4AIUA 1DWAM 5M3WA 4UQBA 1CTNA 1ISWA 4RE4A 3RM9A 1KQYA 5E6YA 1SMAA 2C8NA 3K46A 5ECUA 1VBRA 2ZX6A 2WVSA 2OYKA 5F7UA 4D6DA 1VFOA 2GJXA 4QCEA 1E70M 4GPNA 4W8BA 1UR1A 4WK9A 4D6CA 5M5DA 1TVPA 4DUVA 4BS0A 5A6KA 3WDRA 4UOJA 4MPKA 4H8HA 4AZ7A 3QHOA 3MU7A 1NWUA 4M56A 1ZS2A 2WC3A 5CLTA 2WMHA 4AD2A 2VZSA 2XYLA 2D23A 3CH9A 1GQKA 4KWUA 5BRQA 5LA1A 4PTXA 2XTKA 4P7LA 5D9MA 4TXEA 5DT5A 3B8SA 4H2CA 7CGTA 2O9OA 4AIEA 1WDQA 1KR0A 4HPHA 3KZSA 5FKYA 3RO8A 2ZXDA 3VIHA 5E0FA 1W2PA 1QNSA 3EYPA 1ODZA 2EPLX 5DFAA 3GDBA 1MVYA 2J7BA 2WC4A 1BFNA 1QNPA 2BNJA 1W1PA 3KE0A 1XGZA 1JYXA 4GI8A 1KR1A 2WZHA 3U7VA 1DWFM 4OJYA 4B9ZA 1CGXA 1C8YA 3ARPA 1CLVA 1V6UA 1WZKA 3WH6A 4PTMA 4ZFMA 3PZUA 4HMCA 3PZQA 2CBUA 1QPKA 1KB3A 1VFUA 3WSUA 1WDSA 4HOZA 4U2YA 3GXDA 4PEEA 1V3IA 1G1YA 2Z1KA 1A47A 1OWQA 5HNNA 2UY4A 2WBKA 1RH9A 3ARTA 3SCUA 4KGLA 1W9UA 1R86A 2EPKX 1F4HA 3QHMA 3LMYA 4XZWA 4URIA 1EDGA 2D22A 2J74A 3VMPA 4D6EA 5AC5A 3WD3A 2XFFA 1HKIA 1W9DM 3AIUA 4DUWA 3VD4A 4ACZB 1NWSA 4JAWA 4DWSA 3FAXA 3RCNA 2WBGA 3AHYA 3NUKA 3TTYA 5JBEA 3UERA 1JZ5A 1CGWA 4KH2A 4NF7A 4PN2A 2J7DA 4E8DA 2WM0A 1V6XA 4W86A 1HX0A 2D3NA 1QI3A 1DWJM 3W27A 5HOSA 2ZX8A 1VB9A 4QLKA 1H5VA 3WH8A 4HP5A 4P7RA 1CXLA 1TUXA 2J77A 1VBUA 4IISA 1JL8A 1UWTA 4MB3A 1GOMA 1TA3A 1HP5A 4D1IA 1TCMA 2G4FA 1H0GA 1M7XA 3W28A 1UWQA 5FL0A 3WBEA 3WF4A 1TE1A 5GQBA 3VIFA 1HKKA 1PPIA 4AZCB 1FH8A 1UKTA 3CUFA 1PZ2A 5BRPA 1VAHA 1WKYA 3MUIA 4Q22A 4DUXA 3OLIA 4M29A 3SCSA 5GNZA 1SR0A 2VJXA 4DM1A 4LPCA 4GQRA 2CEQA 1H0IA 2XSAA 2XVGA 1IV8A 2X1IA 1E6RA 1BSIA 2DGAA 4UQCA 3DHPA 3M07A 3MKKA 3VVGA 4EK7A 5GNYA 4PSPA 2FGZA 1E6ZA 4W8AA 2DT1A 1JYVA 4GO8A 2XM1A 3N15A 1BVZA 3L4VA 4ZXOA 4UFJA 3MSGA 1DWIM 3NSMA 2VNCA 1DWHM 5AC4A 2DSZA 1QHPA 1VEOA 2VMFA 2XPKA 4OUEA 1KGWA 4BQ5A 1UZ4A 4NZCA 4WLCA 5BYWA 5ABHA 3WENA 1C92A 3CO4A 4QLJA 1SMDA 4W85A 3T09A 1Q4NX 1UZ1A 1CPUA 3OGSA 1W3JA 2CIPA 1JF6A 1XHGA 1UWUA 4RE3A 2NW0A 1SFSA 1VF8A 1CEOA 1V0KA 1G0CA 3F5KA 1QBBA 4QCFA 1R87A 1MQQA 2VR4A 4CU8A 2ZXQA 2ZE0A 3AI0A 2DSWA 1R85A 1JFXA 2NSXA 4B16A 3WD1A 4Z2HA 3CHDA 2HISA 3ALFA 2ZUMA 1UR9A 1JZ6A 2VI0A 2CHNA 3BXWA 3EDDA 3AS2A 3W26A 4UTFA 5AYIA 3NCOA 4UFMA 3SCRA 2UY2A 4H41A 2IUZA 1C93A 3WDPP 1EGZA 1PAMA 3L2MA 1VRXA 2WZEA 2WB5A 1B3VA 2ZX5A 1ZBVA 2YLLA 3A3HA 3UG3A 1G5AA 2BXZA 1TZ7A 1U30A 1B3ZA 4LQ1A 3VM7A 2XIBA 4XV0A 2DSVA 4H7VA 1OBAA 5CQ1A 1XH1A 3N12A 1EOKA 1E4IA 2MANA 3DHUA 1CIUA 1I75A 4MTVA 4XUYA 2FHBA 4JKLA 1K9TA 5I77A 4UCFA 5ABFA 3BAWA 3CMJA 3O2LA 3CIVA 2FH8A 3ARRA 1WDPA 1O6IA 4GZJA 2J4GA 3IANA 4PMYA 3GXIA 3T2OA 1LQ0A 4PMQA 1SYTA 3DECA 3WD0A 4QFUA 1B9ZA 4D6FA 1E0VA 3WNKA 5AY7A 2W61A 2Y4SA 4UOZA 1E9LA 4S3JA 1XYZA 1OCQA 3CHFA 4UFKA 1IZJA 2X09A 4QP0A 3WMCA 3AMCA 1RP8A 3JUGA 4RL3A 1VENA 4UQDA 3WQ8A 2VOTA 4FLOA 1B3WA 3OG2A 2V5CA 4ZE5A 4KGJA 1K6AA 2E9MA 9CGTA 3PN8A 2JF7A 3QR3A 4PMDA 1K9EA 1JXKA 1MQRA 4B15A 3F5JA 4HMEA 4PTVA 1H1NA 2B31A 3WDHA 4A4AA 1BYBA 5DF0A 4IUGA 1GZJA 1I1XA 4W7WA 3VD3A 2A3BA 2WYSA 2JF6A 5CZKA 1W1YA 1JDAA 4KMQA 3S2CA 5EBAA 3AICA 2EPMX 1FA2A 1TR1A 3VPLA 5A8PA 1E3XA 3WEOA 3U57A 1XSKA 5A1AA 1E1EA 4UQEA 2BY2A 5C70A 1VEMA 3TTSA 1DTUA 4IM4A 1J0KA 1HJWA 3W82A 1E4MM 3BH4A 3L4YA 3RMEA 2CBVA 1JNEA 2YOCA 2V5DA 1B3XA 4LXFA 3N17A 4M1RA 2VX7A 1MW1A 4UQAA 4W89A 5D4YA 3UETA 3SUVA 3WNPA 4A3YA 3CPUA 2TAAA 4PSRA 4XB3A 2OSWA 2DDXA 1Y7VA 1CENA 2A3CA 2E8ZA 2ZUVA 3TOPA 2DQXA 3M46A 4CN6A 2WVVB 2WMIA 3GNRA 1V3KA 4ZEPA 4J3VA 3IAQA 3W4RA 2ZUUA
chains in the Genus database with same CATH superfamily
1YBQA 1DQUA 2V69A 1TVLA 1OSEA 4Z08A 1R7OA 3FVMA 2VRJA 3GAYA 4IGHA 3NQ2A 1TSIA 5LYRA 3VKDA 1UD6A 4FNQA 1V6VA 2BVYA 4H04A 3VA8A 3MI2A 4UTWA 4ZQPA 3CWOX 3LHUA 1LRQA 2Z6IA 1ZL1A 1VFFA 1N55A 5FI8A 3B06A 3HPXA 1AMYA 1FWIC 2AL2A 4FMVA 4QJ4B 3ZMRA 3ZWTA 4LB4A 2WSKA 4LGXA 4CNSA 4LVAA 3K4AA 1KFCA 2G3IA 1JZ3A 3PFMA 2E5DA 4KCVA 1TPH1 4XBSA 3ZR5A 3TK7A 2X05A 4YU1A 5FJIA 3W1NA 1ICPA 1VBGA 3GE7A 1IT8A 2WQPA 3VNIA 1ISVA 3QM3A 4J3UA 3NPXA 3TMLA 2VX5A 3ZVHB 1WYIA 4C6EA 1DORA 4AZHA 4PMVA 2Q3OA 4HGXA 3SGGA 4F9DA 4LCRA 4KRZA 3SY5A 1PCWA 1WP6A 1L8PA 1W1B1 2XGIA 3QBUA 4NILA 4AW7A 3A9BA 3CWNA 4C1NA 4JIEA 5F4SA 5TQLA 5E09A 3QRHA 4IQDA 3LTPA 3MUY1 2EG7A 5A6LA 4EWJA 5BOEA 2A7RA 2WJEA 4WCJA 3V0SA 3KOFA 3NTYA 1JNDA 2XH0A 5A2BA 4O54A 4KWOA 2ZUNA 3B0PA 4UR8A 3UXIA 5FL1A 4EXAA 4J4KA 1LG2A 1V77A 1RHCA 1EQCA 2BVDA 4B91A 2DVXA 3TN5A 1IXNA 2IQ0A 4HNVA 3OU8A 4CQBA 3VIIA 4DJED 5AC7A 4GQ0A 4DJFD 3UPWA 3N6JA 1EEPA 3TYAA 3VMOA 2PC8A 3GDLA 1H1YA 4AWEA 4GG9A 3UWEA 2VL4A 2E7FA 1PIGA 4TV6A 1FWAC 2J7CA 3W37A 2QEZA 4X9YA 2P3ZA 1SGJA 1EZWA 3IIOA 1QI2A 5HWNA 3UJSA 3R79A 1E4NA 3SUWA 1N82A 4K3ZA 1QK0A 3TN6A 1XLDA 3ARQA 4Q7NA 5DCEA 1DJYA 1DHKA 4Z1YA 1ZJAA 1JFHA 1X1NA 3M0MA 4JL1A 1QO2A 5E6ZA 4G9PA 1R3QA 2FB3A 4YN5A 3DG3A 4CUCA 5I24A 1ME7A 4MWAC 3BPWA 1JZ7A 1S2TA 1OJXA 1TTJA 4E2OA 2G3FA 3GIYA 9XIAA 1C7TA 1HJQA 1L6FA 5K4ZA 3UR7A 3G22A 2X40A 3LRKA 5E93A 4HA0A 4XZMX 1FWCC 4OWGA 3L7RA 3TWAA 3RJYA 3RU6A 3P67A 1MXDA 1PKMA 1WB0A 3R58A 4YWSA 3TAKA 3WLTA 4DWSD 1TTIA 2JKAA 3LPFA 3IIXA 3ZT7A 5A8QA 1I2QA 4Q8WA 3ITVA 4XO6A 4F40A 1PX3A 1XYLA 1WOAA 3EOLA 4UR9A 4OHQA 1VQTA 1D3CA 4JYDA 3H26A 1XCWA 4IIHA 1TJPA 3M7SA 1XH0A 3TDFA 3MV11 4IJCA 3W7LA 2J7HA 4NZ1A 1NQKA 1OD0A 2GQ3A 3TQ0A 3MKVA 2CLPA 5I78A 4BQ4A 1DV7A 3W70A 2C1IA 2ZZ3A 2IPJA 1OCBA 2OT0A 4C90A 4NX0A 1EB3A 1X6LA 3JU2A 5K7JA 3ME3A 3K13A 3HG3A 1A5LC 2HSAA 2PTDA 5G1MA 1V4YA 3C4UA 5H8UA 3VGEA 2V2CA 1CDGA 4B3LA 2FTWA 3TZNA 2WAGA 5FEWA 1KXVA 3CZGA 4UTIA 5DMYA 5C2CA 1A3XA 3MS8A 1Z9AA 4K68A 2PWVA 1RP9A 5BCAA 1SJDA 1E1FA 2QCEA 5CBBA 4FNSA 1OCNA 1SJCA 3KCLA 5LGXA 1SUXA 2QUVA 1UR0A 1XV8A 2FZNA 2CWNA 3B8VA 3KTXA 1OADA 1HO1A 3NXFA 4R33A 4M8UA 4NASA 5CJMA 3PZOA 1PE1A 3KRBA 4Q6XA 3GIPA 1FDYA 3WF0A 4QQUA 4EXBA 3SFWA 3TA9A 2PEVA 2XFYA 2DZSA 2Z26A 3EKZA 3M41A 1QK2A 3HMCA 1IEIA 2Z2UA 1YDYA 4ACZA 1ZJHA 4BA0A 2X8RA 1ENUA 1MZRA 4JXCA 3W2JA 1I45A 3IJ7A 2PZ0A 3BSMA 5E70A 3GAKA 3UWVA 4S3KA 2DT0A 4C6BA 2OYMA 5K9DA 3D47A 1RY0A 5KETA 3L68A 2O7QA 3GG0A 3G3MA 5CGTA 2QJNA 5BMXA 1XF0A 5C9WA 3HV8A 2GUBA 5C71A 3GFYA 4MF4A 2C14A 1XRFA 1E43A 2DP3A 1AVAA 3OLEA 3KBVA 4OE7A 1GJWA 1PTDA 3P61A 3HG5A 2NT1A 1T8QA 1RPKA 3IUHA 3VKJA 4FIQA 1GYNA 4E5TA 2WCAA 4CEUC 4LW7A 1OIMA 2DZAA 1UKSA 3BAKA 3L65A 1HJVA 1OCJA 1Z48A 3DI0A 3N19B 5EB8A 2GVJA 2DT2A 1M6JA 1C9WA 5I3GA 3W02A 5C9XA 3HG4A 1HP4A 2DJLA 2G96A 1EJXC 2XGBA 1OFQA 2J79A 5CAKA 1TWWA 3ABRA 4P7NA 1UH2A 2KZHA 3TYBA 3ITTA 1SFTA 4ZQNA 1ZHAA 3FA5A 2X30A 2OWWA 5CPMA 2QAFA 1J12A 2VFDA 3QY6A 3ARXA 5JQ9A 1G01A 4GBDA 2YA1A 3WK2A 5EMUA 5LA2A 4QE1A 4RJEA 1KFLA 5DQPA 4W5UA 1Z32X 1E55A 1SFJA 1OYAA 2QUMA 4LUJA 1S2VA 5IFTA 3SEPA 1TELA 2GFTA 2BWGA 2TSYA 1CECA 4FOJA 3H21A 4NZJA 3W1QA 2DW6A 3FVDA 4HU0A 4XAZA 5G1YA 3SQSA 2QHAA 1V0NA 4JGDA 5HWJA 3DDMA 3B4YA 1VBHA 4U28A 1PEZA 3BMWA 2QGHA 4P5UA 3MVTA 4D9PA 2JKPA 5LNRA 1K8XA 4AD1A 1R47A 3NEHA 4J3TA 4WKAA 4JHMA 4FLRA 3NVDA 4WQ6A 4X60A 4W7UA 4M80A 3VM5A 2RGMA 3W2LA 5DCDA 3PBWA 1UG6A 4XAPA 1BGGA 5HBFA 3KFTA 3KRZA 1MEHA 1QOPA 3BQ6A 2YFOA 5HANA 4MWAE 3W24A 2D3LA 4NRRA 5HUPA 4BQ2A 2V6AA 2YDQA 5KMYA 2PPGA 4C1KA 3EDFA 2ZA3A 3SR7A 2BFGA 3NYDA 5IFPA 3T0AA 5T9CE 5IM51 5ECVA 1QXLA 1V3HA 2CZEA 3VDCA 4IT1A 4Q8TA 1O60A 2CU0A 3UFYA 3AXIA 2OODA 8CGTA 3QGVA 4M1BA 1HXJA 1IEWA 3TJIA 2ZYFA 1B4EA 4UFIA 5I0DA 1OC7A 1V7AA 3K8LA 5JBFA 2D69A 2Z2AA 3HPAA 3FXYA 1W5PA 2QMJA 1Y5XA 4NX5A 1TPEA 5SWUA 2WPGA 1PVNA 3STGA 4NRSA 3SCNA 4KWSA 5HJLA 3MSYA 2INFA 1XBVA 5C9RA 5HQMA 4J1OA 7ENLA 3C2YA 1O95A 1KRCC 4AX7A 5RUBA 3HPZA 5JIWA 5I00A 2ZRVA 4MNJA 3THAA 2PGRA 5D37A 4ATLA 2WCGA 4HA1A 4IFOA 1HVQA 2CBIA 3AIQA 1GQJA 4LAMA 4M24A 3NSXA 3A23A 3AU6A 2VOMA 2REQB 2YCIX 4D6GA 3WL1A 5I02A 3MYPA 2E68A 4Q4RA 3PWIA 5I79A 4DF0A 1TFVA 3JS3A 2QZRA 1DXFA 3BGAA 1TMQA 2PBGA 2NUXA 1KKOA 4CVUA 4NJJA 4IICA 4YTQA 1QATA 2ZUSA 1XR2A 1S2AA 4QG6A 4R5EA 2XH7A 5AKQA 2EGZA 1WA3A 2VX4A 4GO9A 2R14A 3CEPA 3GYCA 2JEQA 1GTHA 3CQKA 4CNTA 3RM4A 1N2VA 2G95A 1OC5A 4H4IA 2GWGA 1OINA 4FOKA 1IEXA 2V5KA 4NYYA 2HEJA 1R2TA 1HZYA 4BI6A 4IMDA 1MFUA 4X0VA 3KHJA 2R1NA 5G2HA 4F66A 1EIBA 4O4VA 1R38A 3MCNA 2QIIA 4G7EB 4XZHA 2P50A 2WHLA 2DY3A 4GACA 4EF8A 4H7CA 2PB1A 2Y62A 3BW3A 1TJ2A 3GB6A 5IHSA 5DBTA 1WAWA 4F0KA 4HMDA 1HKJA 4IHCA 3EPMA 4GISA 2ACRA 5BXRA 1LF1A 4J2PA 2Y85A 2ZE3A 1C3FA 4ZOCA 3ZVHA 4DJDA 2QPUA 1JYNA 3BAJA 1QBAA 4ATWA 2E6YA 3I3BA 1KO0A 1P6CA 2V0TA 1VZWA 2FZMA 4JTQA 1KV8A 2OELA 2QJMA 4MUPA 3C0LA 1W1TA 3K30A 1OHLA 1SZEA 3VGFA 3D6NA 3OBAA 3CT2A 1A53A 4NJHA 3WQVA 3ZZ1A 4AXNA 4MB5A 2IXUA 4UWMA 1R3WA 1BQGA 1PYFA 4I90A 1VRDA 1GOOA 1E6NA 2OSYA 4AHOA 4ICNA 2JEPA 2ISVA 4Z1DA 1FY6A 4HU3A 3I7QA 4DO5A 3R7MA 4I7UA 3GXFA 3TU9A 1EO5A 4B5UA 1BSLA 5I23A 1QNQA 1W17A 4RZ4A 4FX6M 4WSJA 3W7JA 5H6HA 5KZ6A 3UWQA 4XVDA 3RRAA 5C9UA 2FHFA 5JVLA 1K7XA 1Y5VA 4LF1A 3A5VA 1TUFA 4Z2IA 3K1GA 1R3RA 2Y5EA 4UMAA 2Y8UA 3IGSA 2CXGA 3QQ1A 4PCFA 2JIWA 2DU2A 3ARYA 5ABFB 3SRFA 2ISSA 4X0NA 3B8DA 3RYSA 2PDHA 2QVHA 4MVAA 4JFTA 4AC1X 1DPMA 4DI8A 1QUMA 3P84A 1I9CB 2F2HA 2J66A 2I57A 2V5JA 2WNWA 1KFWA 3MY9A 3UWYA 2XN0A 1T5AA 4C6DA 3SURA 2YSWA 2RUSA 4L65A 2FVLA 3H2AA 1JI1A 1OT1A 4A2SA 2Z1XA 5FA5A 5CC6A 1EP1A 1XUZA 4REQB 1U1HA 3P8IA 2X0SA 2XFWA 4N6FA 3L2LA 3TN4A 4IJBA 3MSRA 1MI3A 3RR4A 2RHGA 4D71A 3WLHA 2BY1A 4NZ5A 1QHOA 1CYGA 3NYZA 2DUAA 3TX9A 2V68A 1QU4A 2QDDA 2PDMA 3MP5A 3S8HA 1MZHA 2FQIA 3SW6A 1P48A 4HN8A 4CN1A 2CNCA 3ZM8A 2DUZA 1CXKA 1RCQA 1AJZA 1U2YA 4HYWA 1EPVA 1XC6A 3PZIA 1XG4A 3MSDA 4MKNA 4KETA 3FGCB 3ZJ6A 4QRNA 2X2YA 4MY1A 4JKMA 1SZNA 4EE9A 2W0UA 3RG6A 3T8LA 5GJPA 4UXDA 3L67A 3WUBA 3BG5A 1JG9A 4YJ5A 3ID7A 4IIBA 2ZC1A 3UPMA 1R7AA 3VIKA 4B9YA 3TOYA 4E2DA 4PCTA 3PBGA 3OIXA 1RJQA 3WH9A 2BP1A 2A5HA 1A5OC 1KBBA 3PZMA 2E09A 4CD7A 1ICQA 3FK4A 4YVXA 1X7IA 4LV9A 4K2SA 3LUTA 4AIBA 2P0IA 4FSAA 1GQNA 2C0AA 1AFSA 3AXHA 3MHUA 1TV4A 4OECA 1V7YA 2PWHA 5ABTA 3LHVA 1RBLA 2VCAA 2E0PA 1DIEA 5T9BG 4IFKB 4DF1A 1KTBA 3C2EA 1K02A 2PTYA 2DEPA 3VC5A 3W2NA 1POKA 3W84A 5F2GA 4C6JA 4LBUA 4J3SA 1GZGA 1QWGA 3CYJA 2ZCGA 2Q8ZA 2OCZA 3A12A 5DLCA 1SSDA 4TO8A 5E9AA 4GC4A 2PTZA 3AIVA 3P0XA 4OT7A 1SW3A 4Q8MA 1PZ1A 5E0CA 3W75A 3AMKA 2J88A 2OKTA 1LWJA 1U83A 5IDIA 2WOQA 4G2DA 1KTCA 1XIJA 3VO0A 2ZUWA 1F3TA 3KBNA 2VFEA 1V93A 3MMDA 2GVYA 3UJFA 3APGA 3SRHA 2HVMA 3MBDA 4XISA 4HPGA 5C2XA 3ZSTA 1LP6A 3TLQA 3EBVA 4V1YA 2ISFA 1FH9A 3CXOA 5CCZA 2KAUC 2G8ZA 2DORA 4PUJA 3CEUA 3OZPA 3BCDA 4FR6A 3B0YA 4XZ9A 3THDA 2BOFX 4N4QA 3POHA 2V67A 1M3UA 4KW2A 3FN9A 4YS1A 3N1AA 1A0CA 2YL6A 1GKPA 1H4PA 1BF2A 7TAAA 1A5BA 2YB1A 3IV3A 1V79A 1LWHA 1N8WA 2QQ6A 2Q09A 2NUWA 3G1XA 1KM6A 3MV01 3WMBA 4LWWA 2CZDA 3LBMA 4HNCA 3AIBA 1MWOA 4QSFA 5TD4A 2BY3A 1EX5A 3VGGA 4TTUA 1KTNA 4UZUA 1F3XA 3ERPA 3KL3A 3WCZA 3BCFA 4CCCA 2GLKA 1FWSA 5A6JA 5LHFA 3B9NA 3IUIA 4E4FA 1OGSA 4BEQA 4UTUA 4JNYA 2I5GA 3LXCA 2EQDA 5AYBA 3KVJA 4IGNA 1GQLA 4XD5A 4L4PA 3KLLA 3ZXWA 1UKOA 1R30A 4ZQCA 2IQDA 2YKKA 4KQNA 4UTTC 2W67A 4JOMA 4TVDA 1UA3A 3C2FA 4RDVA 4F0SA 1HIZA 4O18A 3UJ2A 1EO7A 3ARSA 5I6SA 1GGOA 1VIZA 1FWNA 4DXVA 1EWEA 3BUVA 2OPJA 2QV5A 3NSNA 5F1UA 1Z42A 4IP5A 1H61A 4XG1A 3N2MA 2ZVIA 1OEPA 2QULA 4DZAA 1Q6OA 3MO4A 3OA5A 3S42A 4ZENA 2WM1A 2G3MA 4LANA 2XSXA 1XCXA 2FTYA 2OX4A 4LSBA 3W86A 4CGTA 2DH2A 4R85A 3P14A 3ABOA 4U33A 2YCLB 2XIMA 3BJFA 5AHLA 4I6VA 4CU6A 2BZNA 2C0HA 3DFNA 3NQFA 1RLDA 1VJSA 2YA2A 4LY8A 3AIWA 1DTNA 2WKLA 2FZDA 5D8WA 4B5NA 2JFEX 1XIMA 2DJXA 4IP7A 2VD9A 3PWAA 4FP1A 2I17A 1UROA 1YPFA 4RE4A 2OJPA 4JTAA 4GJ1A 3S2LA 5E6YA 3K46A 1J2BA 4GXMA 2PDNA 2OYKA 4GFSA 4IIFA 1O66A 4XTIA 2W9MA 5EY5A 2GSEA 4S38A 1J93A 2FZBA 4JNMA 3URBA 4QDWA 5D2YA 4MPKA 2QJIA 1K70A 4NKCA 5MHBA 1PUDA 1RPXA 3TFXA 4GE8A 4B92A 1W3IA 1W56A 6PTDA 1AG1O 3E2SA 1JUKA 3CC1A 1GKRA 4LEFA 4N2YA 2V8ZA 1ZNNA 2YW4A 4G7FA 3K5XA 5D9MA 4TXEA 3TAOA 2O9OA 3QQWA 3H70A 4AIEA 1UZHA 2DZUA 2Y5SA 1KR0A 3N4EA 1YTDA 5FKYA 3W72A 4RK8A 4OVXA 2BASA 4JTRA 3GDBA 1QNPA 1ZY9A 1HG3A 4ZCWA 5HULA 2FGBA 3BQ5A 1JYXA 2WZHA 1DWFM 1A50A 3HQNA 4B9ZA 4KWWA 5AHIA 3BICA 1H7PA 2I7GA 2VGIA 1CLVA 3RFAA 1WZKA 4HMNA 4DJDD 3PZUA 2Y61A 4HMCA 1SO4A 1QPKA 1SO6A 1FUYA 3DOPA 1WDSA 3GXDA 3KVKA 1G1YA 2Z1KA 2IS7A 5AHMA 3ARTA 1QPQA 1YW1A 3VKBA 2EPKX 2IPWA 3AXMA 4URIA 1EDGA 2D22A 5KSWA 4F0LA 3WD3A 4ZTXA 4QSHA 1TMLA 1GZ1A 4A8LA 1GTEA 4NU7A 4JNZA 3NA8A 1G69A 3OYXA 4RR4A 3FAXA 5F1VA 2WBGA 2REQA 4IQLA 1VPQA 1T8XA 2J7DA 3FSUA 1OK6A 1NAL1 1ZENA 5BZAA 4O1EA 3W27A 2EKGA 3EXSA 1VBUA 2EG8A 1MXSA 3WLQA 3APYA 3BV4A 1GOMA 1UP2A 2BOEX 1KM5A 1TCMA 4Y9OA 1M7XA 1ME9A 1AL7A 3B9OA 1TE1A 2VDIA 1PZ2A 1MRAA 1XW8A 1A5CA 4IX2A 5GNZA 1L2QA 1FHVA 2WJDA 2YZ5A 4NNAA 2OZ8A 4K38A 4AUBA 4RE0A 4GQRA 2XSAA 4GMEA 3DZ1A 4GQBA 4QISA 3KRUA 4UQCA 3RO6A 1KC7A 4G7EA 5DRIA 1S3TC 4B5SA 4PTDA 2JGYA 1KRAC 1CB7B 3VZYA 2FGZA 4M0XA 4N9BA 2XDFA 1S2WA 2XM1A 5H8PA 1BVZA 4UFJA 4AC7C 4FNRA 5AYYA 3UP8A 1R46A 4IJRA 3NQBA 3NSMA 1DWHM 1QHPA 4OUEA 4BQ5A 4MFEA 2O55A 2CZFA 1UZ4A 4WLCA 4Y8FA 1MNSA 3WENA 1C92A 1OFBA 1SMDA 3C6CA 3BK0A 3IGUA 4GX8A 1JCMP 1Q4NX 4QR6A 3MHGA 3OGSA 5HATA 4ADUA 3N6HA 1UWUA 4V15A 3H2CA 4RE3A 1HKVA 2NW0A 3LBCA 1CEOA 2R94A 3F5KA 1TV7A 3BG3A 4O14A 4CU8A 3UY8A 2ZXQA 1R85A 2NSXA 3WD1A 3CHDA 2HISA 1TR9A 2PP0A 1UR9A 2NQ9A 1JZ6A 2O0TA 1MDRA 3BXWA 2OOFA 1VYRA 1OY0A 3NNTA 2O4MA 4QNWA 3LG3A 1RBOB 1AD1A 3L2IA 3TA6A 1EGZA 2WZEA 4ZB2A 3RF9A 4QJ5B 3WLRA 3UG3A 1GVEA 2R1MA 3LI1A 1OFRA 4LQ1A 6XIAA 3T6CA 1FKXA 2DSVA 1UCWA 5CQ1A 4EXQA 4L1GA 3PAJA 4HHLA 3DHUA 3PG8A 2NQ5A 2ZKMX 2PODA 1YX1A 3LA4A 3UZWA 1K9TA 2WSRA 3QV7A 5ENLA 5I77A 1RZMA 1TPB1 5ABFA 1OX4B 4YCPA 3O2LA 4QHRA 3CIVA 4IMEA 5HAOA 1WDPA 3XIMA 2VM8A 3KTCA 1WV2A 3IANA 4WR3A 5FAJA 5AZ1A 3T2OA 3P5ZA 5B80A 1TPDA 1BWLA 2HJPA 1N8FA 3W7DA 3WD0A 1B9ZA 3E3HA 1BTMA 2V5LA 4A3QA 2C6QA 2A85A 1PDZA 4ZSUA 4S2BA 2NSOA 3CHFA 4BY3A 2GYIA 4Y9MA 4UTJA 3UVIA 4REQA 4AWSA 3HB9A 4A29A 1RP8A 3REQB 3JUGA 3S46A 3MYOA 1VC4A 4PBEA 4UQDA 3WQ8A 2VOTA 3OG2A 3F7JA 3V5FA 4GVIA 4PB3A 3T81A 3T42A 1K9EA 1ZAIA 3H7UA 1JXKA 1JUEA 4PTVA 4EF9A 1VJIA 4WOQA 1W5QA 1XQLA 4K7YA 3WDHA 5LIWX 2PCQA 1HTIA 1ZCCA 4W7WA 2E67A 2WYSA 5CZKA 3S2CA 4KMQA 1E0UA 1DYSA 1X38A 4UCGA 3WJYA 3DHFA 1TR1A 3TR9A 3VPLA 3BE7A 5A8PA 1XSKA 3FGCA 3UXLA 5DXYA 3G3DA 1PL9A 3Q65A 1FXPA 4PUKA 3U9IA 5KITA 5LIYX 4IM4A 3C0JA 1J0KA 5FSEC 3BH4A 3C0SA 4RXFA 4DAIA 4EX4A 2V5DA 3SECA 1PHWA 3UETA 1ITQA 1E9YB 3SQLA 4JX4A 1LUCA 1W1ZA 3L0GA 4PSRA 2OSWA 1CENA 2E8ZA 3BGGA 1MMFA 3CWHA 3TOPA 2HBVA 4M5PA 3SADA 2DQXA 3DFQA 3M46A 4CN6A 3WX7A 4EAYA 4O16A 3NZPA 2ZRXA 5EMJA 3W4RA 2ZUTA 4HOXA 4CQCA 3ARUA 2HCVA 3ZYZA 4IFKA 1NFGA 3WF1A 1BTCA 2WKJA 3S6OA 2B7OA 3O05A 2F8QA 1LROA 7ODCA 4X9SA 3PUDA 3EXTA 1GEHA 1IXPA 3NQGA 4LVFA 3WD4A 2XIIA 4FXSA 4GXPA 1P6WA 4S2CA 1AH4A 1V02A 5CC3A 1W54A 4RNFA 3Q4DA 2G37A 2OG9A 1NDVA 4AEEA 1UOKA 4L6DA 4CQDA 1XIEA 3M0YA 3BLOA 4KWVA 5EMLA 2ZOXA 3BZGA 5D2VA 4Z1BA 1P4CA 4UB9A 2ISDA 4QEEA 4S23A 5FJUA 4L6OA 2X1UA 1NOWA 3HQ1A 1J9YA 1RV8A 3AQUA 3WN6A 1YXCA 5FJOA 1Q3NA 2FJUB 1JAEA 1NELA 1NJJA 4M19A 3HFYA 4HVXA 3M1ZA 1ZJIA 1BPLB 1B5TA 4DELA 3H4WA 2E4TA 4HNUA 5HK4A 3U4FA 1YADA 5BOFA 1EJRC 2W5FA 4FNTA 2PRMA 3W53A 3PPCA 2A6LA 2PWEA 4UIOA 3RITA 3GDMA 1JCXA 4MLJA 1GHRA 1DE6A 3GH5A 4DI9A 4AY8A 2G41A 1ZALA 3TXZA 1GOKA 2ZADA 1MSSA 2BHUA 2E28A 3TSMA 2E6AA 1EJTC 2WHJA 3AMDA 1QCWA 1E73M 4H6KA 3VIJA 4DJEC 3M5YA 3LGGA 1J8VA 1Z7AA 3H8AA 3GLCA 3I6TA 4PYSA 3G1SA 4YPJA 4ZQOA 2PLMA 5JUVA 3G1AA 1FWTA 1LBLA 2QPSA 1DIDA 1KBKA 4V33A 4W87A 4AG0A 3KBWA 5LA0A 2VWTA 3DFPA 1DEDA 3I6EA 2FMOA 4XSMA 3GDRA 4UUIA 4YL2A 1XLBA 1E72M 2VYOA 2WK2A 2X2GA 4MNMA 4ORMA 4BJHA 3E1F1 4S3DA 3VIGA 1E0XA 1EZ2A 2GDQA 1YRRA 3MW7A 1H1ZA 2FYMA 5BRBA 1RJPA 3MMWA 4PTWA 1FWGC 1HL2A 3F4WA 1E40A 3CAKA 5HA7A 3ITGA 1OD8A 3PTDA 4Z2JA 1V03A 3EB2A 2QVNA 1E6QM 1JD9A 2FHCA 5C2GA 4JQ3A 3GDKA 5DX7A 3H6OA 4RNJA 3CV6A 2D0GA 3NQ7A 3UY7A 2QS8A 1GUVA 1W32A 2VQTA 5ABGA 2YR1A 3FV9A 3N9KA 1H7XA 1UHVA 5AVHA 4PH6A 1PKLA 3G77A 1VCFA 2XG9A 3LCIA 4AZ6A 4IFRA 4DWSC 4F9JA 2XVKA 1Y0EA 2PCEA 2PDGA 5FCZA 3N9SA 2GGHA 4JTEA 1XI3A 1Y65A 4IXXA 1WZLA 1ZAHA 5D9PA 4QLLA 1PKYA 2J7EA 3H54A 5FF4A 1TCDA 1ONRA 3IJ6A 3L9CA 4L5ZA 2EO7A 2CETA 4JN6A 2C15A 3ZJKA 3TSDA 3URAA 4P8WA 3MANA 1BKSA 4M6VA 2PRHA 1NP2A 3CUIA 2PD5A 2WW5A 1KM1A 4NUWA 3WD2A 3P0WA 1X1ZA 5AYZA 4KS0A 5LIXX 1VKFA 1IEVA 3S5OA 1JCJA 2WMFA 1HGWA 3HZ3A 3WUFA 1MUWA 4GQGA 4C6IA 4YHEA 2XSBA 8RUCA 1BF6A 2ZRZA 3OVRA 3AS1A 4JFWA 2VT0A 4Z1CA 1X6NA 3LENA 5A8MA 1GOWA 1YNQA 1E0WA 3N18A 5D38A 4LU0A 1IHIA 4L4MA 3QFEA 2BHZA 4LS0A 1D9EA 4IH3A 1PXGA 3R0KA 2PTWA 4PFMA 4PMJA 4BF5A 5M03A 4LYQA 2QPXA 2HK0A 3U2OA 2WO5A 3HV9A 2P88A 5FAGA 1XLMA 4L9XA 3VD5A 3SCWA 4UMCA 3W25A 1RK5A 2IPFA 1KW1A 5I3KA 4OZOA 4ZB0A 4QG8A 1YLVA 3EA3A 3L0NA 1QHZA 4Y96A 7REQB 4JQAA 3SCPA 1KXTA 4Q4QA 1UWSA 3UBPC 4R3UA 1TIMA 1QPOA 4W8LA 5KTLA 2VENA 3ZQ9A 2OT1A 2DZVA 1LCOA 3N13A 2VHLA 3DX5A 3QGKC 5HPCA 1DJQA 3EB3A 3W3OA 1IR2A 5J5RA 2XWDA 4NP7A 1DQXA 3L4TA 2QJGA 2TPSA 3PJXA 4CEXC 2HVOA 1ZLPA 1W3LA 3WK0A 2A4AA 3V3WA 3VD9A 4JICA 4JEJA 1NY1A 2RDXA 2OLAA 4PMUA 1XYFA 1EWDA 4IIEA 1NWTA 1EC7A 1S5MA 4CNNA 4E2VA 5B7ZA 1UB3A 3QSTA 4WJ8A 4OBSA 3VDHA 4L80A 4QX4A 3ZWSA 5HPOA 1YBQB 1V3JA 3W29A 3G0UA 1LWIA 4WF7A 3UWWA 3ABSA 2NVAA 1E6XM 3GNNA 4JQ1A 2Y88A 5CGQA 5JIPA 2UY5A 1M41A 3OZYA 4R9OA 3O8AA 3NPUA 4ATDA 4O0KA 4TUFA 3WQPA 3G1YA 1UD2A 4U31A 2J62A 3TTQA 1ITXA 3Q67A 2XZ7A 2ZZ5A 1HL9A 1IEQA 2GVGA 3W73A 1JPDX 1AQMA 2VZOA 5FSDC 3MHFA 3SBFA 5CPQA 1J0ZA 1XLKA 1YHTA 2YDRA 5A95A 4LRTA 1JAKA 3A4XA 1R0MA 9XIMA 1AK5A 4ZL1A 4O53A 5G5IA 2NWSA 2VC5A 2ZZ4A 5BU9A 1HO4A 2Y63A 3GTIA 1V6YA 4GI6A 1FCUA 3EDEA 2GGJA 3STFA 3WUEA 1G4SA 2CZ5A 2RGLA 4C1NB 4RKAA 3LB0A 1XRSA 4C6QA 4ZBCA 3TLLA 3EX4A 1CWYA 3F4CA 3CHVA 3AIEA 3CB8A 1Y5WA 2NXHA 4FIRA 3RCMA 4N42A 3QMTA 4GY7A 4KIRA 1E5JA 3EWDA 5CKSA 4J3WA 5TNVA 1O1HA 4GY0A 5GVJA 2YJQA 4Q6JA 1WPCA 3CZ8A 5DMLA 1B3OA 3LHZA 1V3LA 4F0MA 4Z0JA 4FNPA 4Q8UA 3KAOA 2GJXB 1J0HA 3PUOA 5CPOA 4E8CA 1OGGA 5HNUA 3FJ4A 2CXEA 4OFCA 1PBGA 5I3FA 3KP1A 4W9TA 2J6VA 1OF6A 4JTJA 4GH3A 4AX6A 4AFYA 1BYAA 4KRUA 3W7KA 1OC6A 1VFSA 2YCJA 1Q85A 4PRTA 2VUNA 4H9VA 1TE6A 4J3XA 4A05A 4DBSA 3BAYA 1M7PA 2QCGA 2E25A 4UTWC 1OX4A 2FGLA 3WLOA 1FHDA 1QNRA 3L4UA 3UWUA 4TX9A 2F61A 2E6FA 2GQ9A 4K36A 2AAAA 2VO5A 5HXMA 3LPPA 4HNOA 3FYOA 2JALA 1E51A 1AL8A 4XIAA 4XAYA 1SQ7A 1UD5A 3QW4B 1GVSA 1Q6GA 1KLYA 1SM9A 4HSNA 5BXSA 1OFEA 2Y7DA 3QJAA 1W3KA 3TQPA 5AECA 3GVQA 2PDWA 3OLGA 1V6WA 3N3MA 4WKFA 1XQKA 3S47A 4EAMA 1Z41A 1H7OA 3F4NA 3RGTA 2BOGX 1EPXA 1X39A 3RCYA 4B5TA 4AZGA 3SRKA 1L9WA 1YDOA 2OQHA 3AU2A 1Q6LA 3UWZA 3T4CA 4DO4A 1K03A 1TV5A 3L5LA 5I5RA 1ZQ5A 4O8RA 2ZVRA 3CHCA 3U5YA 3DU0A 2VDGA 4FK9A 3G5EA 4OOZA 2NLIA 4HJWA 3KXQA 3EWCA 1FBAA 2WLYA 5AZ0A 3RPMA 1GEQA 3CNYA 1EYWA 1WZMA 2YBTA 5DMMA 1FFQA 4FXJA 4I5XA 3FKKA 2QF7A 2HS6A 3P5YA 4Z17A 3DYPA 1FDJA 1CZ1A 1HW6A 1TA3B 4DJFA 4W88A 2UWFA 1I2PA 3UZJA 4E4PA 4DUOA 1YKWA 1J10A 1MQPA 4RDYA 4U2ZA 5G2WA 1IGWA 3QPYA 3I68A 3RX3A 4O0QA 3EA1A 4RUBA 2QXWA 4BQ3A 3CUHA 3PP7A 1P0KA 4J27A 3K8KA 4H3DA 4J35A 4CVWA 4I3GA 4TTGA 1DL3A 3OGRA 2ONEA 1E71M 3BAXA 1VCVA 1US0A 4I5UA 1LT8A 1ZPTA 3U7BA 1EX1A 1M65A 3ABZA 1BG4A 1KBJA 1F3EA 3OEXA 3ZOAA 3SRDA 1FCQA 1K8CA 4YTUA 1WXZA 5U4NA 5DELA 3PJTA 5EU9A 1HQTA 1H51A 2VVSA 1XS2A 5FJPA 1XYMA 4AZBA 2JIEA 4MWAD 2YYTA 5D9NA 4UFHA 2JE8A 3EOUA 4D2JA 4KKXA 3PULA 3BARA 5D05A 2VCBA 5A6SA 5T26A 1R9ZA 4LS1A 1TV2A 4N0RA 3B8IA 3EA2A 2J75A 4LJ3A 3AS0A 3WMSA 2QMKA 3IK2A 1MUMA 3A24A 5GNXA 2G97A 3AJ7A 2QDGA 3RUBL 2VWSA 3WY1A 3W2KA 5A8OA 4B5XA 5D02A 3ITCA 3AUOA 2VGBA 4W7VA 3QFWA 4GKLA 1W1A1 3EX6A 2ZZ7A 3LRLA 2O9RA 4ICMA 1E15A 3RJXA 5BMWA 1UJQA 3VOFA 5FJJA 4KIEA 1JGIA 3V16A 1UUOA 2WNZA 1Q2RA 1V3MA 4KEVA 1T41A 3IWPA 1HVXA 1XC4A 4WD0A 3LXAA 2Y6ZA 2DSKA 2ZC8A 2DZXA 1F4AA 4GWEA 5A8GA 2E5BA 3WH5A 5HDRA 3NZGA 3MC5A 4X3ZA 2UZ9A 3A64A 1CNVA 3UGVA 3T40A 2H3DA 1SW7A 1W9BM 4WEVX 4EPEC 2X7VA 1W0MA 4JHOA 3G1DA 3O6DA 1ISYA 4L7ZA 2OVLA 3EDKA 3VYLA 3EWBX 3DYMA 1H7RA 1Q6EA 4E38A 1VYSX 1GVRA 4Q8OA 1WXJA 1FP8A 3KS6A 3W1AA 4BWLA 3PHAA 3HBLA 3QMSA 1NP0A 2WWCA 1JZ8A 4KT2A 3S1XA 2QUUA 3S4TA 3SO7A 3S9IA 5I09A 3VOJA 1K9FA 3LXBA 3VZZA 2XIJA 3FX4A 1CGUA 4H19A 2WMGA 3CQIA 1QWKA 3AOFA 3CMGA 2J25A 3TP4A 4M7TA 5EBUA 4LYPA 3O6YX 4RX0A 5LKYA 2YLAA 1G94A 5FESA 5FF0A 3MI3A 3TXVA 2O92A 2BV9A 5BWFA 2D24A 1NDWA 3S9ZA 2I9UA 1UD3A 4MJ4A 1GOIA 3QTGA 3N11A 1IQ8A 1O68A 5C6MA 1ZCOA 1ITCA 1EL3A 2FPYA 4D6IA 2ZDRA 1KNWA 3O7UA 2WCSA 2VEPA 1J79A 3B03A 4GYPA 4MLRA 3V35A 1XUUA 3CZKA 4AISA 1UMLA 3UR2A 5LSMA 1GYLA 2FDMA 2R91A 2WMIB 2X1TA 3VNZA 1KM3A 1NFPA 1W8GA 2PTXA 2W91A 1KV5A 1I0BA 2ABAA 1IR1A 4AQLA 2DUXA 2WSQA 4N02A 2YBUA 3L23A 2BS9A 3TYZA 1HKWA 4PMNA 2ANUA 5AHEA 3I4EA 1RCOB 2G50A 3O3RA 3KBMA 1XRVA 2VVNA 2ZXBA 2QT3A 3EEZA 5A2CA 2PDXA 3SM0A 2Y70A 3U48A 4HHPA 3HPSA 3L5MA 1LOQA 4MUZA 1XRTA 2F7FA 4H1ZA 3DFTA 4P2VA 4FEZA 3W7CA 3RX4A 1UD4A 3O07A 4A2RA 4Q8QA 4U4MA 3H12A 1XXXA 4NNCA 3O6CA 3BW2A 1REQB 1W9PA 4I9TA 3DN5A 1PZ3A 3AZSA 1J0JA 3AHZA 3VILA 3WLSA 4WJXA 1TQJA 3UR5A 2NQZA 3CH0A 3OVPA 5I3DA 1VP5A 1XGDA 4XD6A 3UGRA 3VAVA 3DIPA 2CESA 4GYFA 4GZEA 5K9XA 3QY7A 4AY7A 4U3CA 2HV5A 1AMKA 2Z0IA 4PMXA 3WQEA 5T8GA 2FDSA 4P8UA 1PKNA 3VXGA 3GVWA 1TPFA 1LG1A 3THQA 4UZSA 1EP3A 1G7VA 1XH2A 1S1PA 4PULA 1ISZA 1VIWA 7REQA 4PUUA 2O56A 5EYWA 1QW8A 1EQPA 1V0MA 2GSHA 3N04A 3VGDA 3WQ4A 1GHSA 1CW2A 1TJ1A 2D20A 1K4GA 1G9HA 2EAWA 2GJPA 4WJEA 4XKYA 1XKYA 2A3EA 2VFHA 4LX4A 5CGMA 3DERA 4A3RA 3W7QA 3EZ4A 3UJRA 2HNEA 3PJUA 5I2UA 4B90A 2Y0FA 1HJUA 3AMLA 1D7KA 1GVQA 3AZTA 3G1HA 3EOEA 2PURA 4PCSA 4B2DA 2NX3A 3WYZA 2PFHA 4WRHA 4DYKA 1UH4A 1VFMA 2G3NA 4JN8A 3HQOA 4F4RA 1ECQA 2PLKA 4KERA 4R7OA 3PBMA 4P7QA 1ODUA 2DIKA 3LNPA 3HU7A 3NFUA 4UTTA 3NQVA 5ABEA 5A5WA 1DP0A 2D2HA 1SFLA 3KWXA 3UU0A 1FCVA 1THFD 3H2MA 3QLLA 3VCNA 3S2MA 3GNXA 5CSSA 3ICJA 5CG7A 4DIAA 3O06A 3T0TA 1QPNA 3T08A 3KOZA 1FWBC 1MYRA 1UWAA 4PODA 3VNYA 1S5NA 2IPGA 4AZ5A 3HGJA 3CV7A 3VIMA 3U0HA 3AWNA 4FX7A 3L21A 3BSGA 4R7JA 4XZBA 3BG9A 3S2NA 5EMYA 1QW9A 1KFJA 4C6MA 1TJ0A 3A4WA 3KX6A 5D2XA 5FF2A 1W9XA 4JS3A 4DX3A 3OQ8A 1KRBC 2GDVA 2I16A 3BL3A 4WIWA 1UR2A 5AHFA 1AZ2A 1FOBA 2E1WA 3TN3A 2QF8A 4RZ6A 1WKEA 2NVDA 1DIKA 1XYCA 1J18A 2RJGA 3W81A 2HS8A 3EEGA 2OQLA 4XO7A 1JPHA 3S83A 1KCLA 6REQB 3A47A 1TREA 4UFLA 2DV0A 3N25A 2VGGA 1PO9A 2PDIA 4Q7BA 4AIUA 1DWAM 4WDUA 2RH9A 3W7OA 4PBFA 4HT3A 4UQBA 2YYUA 4G6CA 2NQJA 4NAFB 2ZZ1A 5ECUA 5HQEA 5REQA 1XIFA 1X98A 3DBPA 1GOXA 2P76A 3N4AA 1VFOA 2Y7GA 3IJDA 2GJXA 4QCEA 1E70M 3FYYA 1ZRQA 4QG9A 2C91A 3VFLA 1X1OA 4GPNA 3UXKA 3BOFA 4A35A 3MJYA 4D6CA 5J5DA 4MSSA 5M5DA 2IMRA 2YZRA 4UOJA 3CU2A 3MU7A 1TTPA 4JTUA 1AODA 3E6EA 3KM8A 4WGXA 3LSBA 3MQTA 3MUXA 3JZEA 2D23A 1A0DA 3D46A 1FTXA 1T96A 2FVMA 2AKMA 5LXXA 4KWUA 1M68A 2F9RA 4A21A 2XTKA 4MZ8A 3B8SA 4C6PA 3BOXA 3TWBA 3MZNA 2PF8A 3RO8A 3VIHA 3VE7A 1RD5A 2FIQA 3PUEA 5DFAA 2Z29A 3M0JA 2WC4A 5AC8A 2BNJA 4AWUA 5IOBA 4LF2A 4UNKA 3WO8A 3W01A 1A49A 3U7VA 1VPXA 2ASHA 1YE4A 3T9PA 4RW3A 3JR2A 1RK6A 3WH6A 4PTMA 4ZFMA 1LQAA 3PNZA 2CBUA 5CZTA 3W76A 4HOZA 1V3IA 1E0TA 3PBYA 4US6A 1RH9A 3W1TA 3SCUA 2QCHA 4XK2A 3I65A 4RV8A 2XFFA 3VNLA 1HKIA 1W9DM 3UXAA 4S1FA 2VEGA 2ZA1A 2A2IA 3PS7A 4GH1A 3KS5A 3KOYA 4DBWA 4I8YA 3N6QA 3UERA 4NF7A 4PN2A 4LAUA 1V6XA 1RLCL 3CASA 4J5NA 2ZX8A 2HXUA 3PY2A 3F2DA 4GJIA 1VB9A 1H5VA 3WH8A 2R1KA 3KZPA 5K9CA 1XYAA 3P7YA 2J77A 1AH3A 1ADSA 4L1WA 3MWCA 4MB3A 1XLIA 3QSRA 1TA3A 1HP5A 3R43A 2BGQA 2G4FA 5C55A 1LOSA 1B9BA 2B0MA 3W28A 1UWQA 2UBPC 5GQBA 3VIFA 4AZCB 3DFOA 1FH8A 3CQJA 3CUFA 1F8MA 5BRPA 3LD5A 2BG5A 1Q65A 4DUXA 3OLIA 4M29A 4I5RA 2V30A 2E1DA 3AALA 1SPQA 3QYSA 1T7LA 1XM3A 3RLHA 3P93A 1U5VA 4LPCA 3JRKA 4RLIA 3QMRA 2CEQA 1XFBA 4NYUA 1P6BA 2FVKA 2CLKA 3U2EA 1BKHA 2GGEA 2X1IA 5U7SA 3DFSA 1Q2SA 2HVNA 4E4UA 3IVSA 3GXNA 4KEUA 2ZRUA 4AVNA 3LSCA 3E96A 2RFGA 5I3JA 2GVLA 3G0XA 4JTDA 2AQWA 3B97A 3D0CA 3VABA 3MSGA 3VOHA 2VMFA 1KGWA 3C0QA 4I8DA 4YCOA 3HO8A 2YB4A 1O12A 3CO4A 4JYFA 1MEIA 3E0IA 2OEMA 2XH2A 1M1BA 3OPSA 2H3BA 4Q4KA 1PB0A 3UCDA 4IMCA 1A5UA 4RNIA 2CLFA 5HR7A 3F03K 1SFSA 1VF8A 1V0KA 4YMZA 1Q8AA 1MQQA 2VR4A 3OQEA 2CLOA 3M0ZA 1KFEA 1JFXA 3IGHX 1JQVA 3W23A 3VNKA 3ALFA 4K8EA 1R3YA 4NQ1A 1BXBA 3KBSA 3WFAA 3W26A 4UTFA 3GUGA 3W87A 3EPOA 3W7RA 3LCFA 1PAMA 1VRXA 2EKCA 2WB5A 3CQHA 1XPGA 2QW5A 2YLLA 3P74A 3QY8A 3HURA 4HN4A 1TZ7A 1U30A 2XIBA 3BVJA 4XV0A 4YYFA 1FWFC 4LVBA 1IWPA 3TUUA 4E3TA 3N2BA 3HMJG 1E4IA 3VNDA 4C60A 1XBYA 4UNLA 4XUYA 4XUGA 1K7FA 1UR3M 1UOZA 3BAWA 4M6QA 3CLMA 1PTAA 4Q32A 2Z7GA 4N6EA 2FH8A 4BEUA 4DF2A 4O4WA 4GZJA 3R1ZA 3R8HA 3E2QA 1WXYA 1LQ0A 3EOSA 3LZ5A 4D6FA 4P61A 5D32A 3SSJA 2BTMA 1XFCA 2Y4SA 1XLLA 1X6UA 2GQAA 1GG0A 2WZTA 1IZJA 1TB3A 3V0UA 3GG8A 4QP0A 3WMCA 4S3EA 3AMCA 4HKPA 1VENA 3M7WA 4O8AA 3O16A 1IT7A 2PLCA 1MQRA 3F5JA 3LX9A 4GC3A 1H1NA 3SJNA 1BYBA 4IUGA 1I1XA 3NZ1A 3EWZA 1LZOA 1YYAA 4HHHA 2A3BA 2JF6A 2Q71A 4O1BA 4IOTA 3NQ6A 3AICA 1J2WA 1E3XA 2GJNA 1IWBA 3TMQA 3QPZA 3TTSA 3RHGA 2NXGA 4L1XA 1SSGA 3IACA 2OZ3A 1E4MM 1PHQA 4QJ3B 4IX0A 3QZ6A 5FEXA 3OYZA 1B3XA 1VCGA 3N17A 4M1RA 1L6GA 1MW1A 4UQAA 2HZGA 1SU5A 4UTLA 4W89A 1EC9A 4DNHA 5D4YA 4WY0F 4AB4A 4D8LA 4A3YA 3EX2A 4O17A 5FJRA 1Z44A 1GK8A 3TQKA 4XB3A 3F2CA 2A3CA 3CYVA 2C1HA 3NGFA 5FF3A 3C8FA 4DN1A 2X16A 4B2DD 2E77A 2WMIA 3STEA 3QW3A 2R6OA 1A4LA 3QC0A 3R11A 3EMCA 4AU0A 3GH4A 5DO8A 4MB4A 1HN1A 5TF0A 1UD8A 2QUNA 1W9VA 3NG3A 1FWWA 2Z7KA 3LCXA 2Z00A 1H62A 3WNNA 2P1FA 2PDQA 4DQWA 4OU1A 1MO0A 3UR8A 3URQA 4QAIA 4YWIA 4JTFA 3VDAA 2OZ0A 1E4LA 1XG3A 4ACYA 1FHLA 3ZSSA 1KXHA 3APTA 1REQA 4W4QA 1UPMB 1AW5A 1P0DA 3GFXA 3FJLA 3VFCA 3IPWA 3EDJA 4LC8A 1AQHA 3VD7A 1TQXA 1Q66A 2V3DA 3U4AA 3S5SA 4BHYA 3EX1A 2W4XA 5EFDA 1GNXA 3IRDA 3QV6A 2C13A 2DPEA 2X42A 2OOGA 4DYJA 3AHVA 1UC5A 3OGVA 2WMKA 1R3VA 1E6PA 3E2VA 5HMEA 4GXWA 4JCMA 1A5MC 3BLEA 1UKPA 3G6LA 1XIHA 2CLLA 1OG6A 2YCKX 5FD0A 2FZ9A 1TTQA 3O1NA 1JPIA 3MP3A 3TW7A 4A3HA 2E9LA 5DEZA 3DG7A 4LS2A 4PUEA 4GA8A 4WSKA 5D04C 3PTKA 3GS6A 3WQGA 5AVNA 3MJMA 4F0RA 3CL6A 2V5BA 2D2JA 2Y8KA 2ZWYA 2YL9A 3WDIA 4LFYA 4EKJA 3ZT6A 4G1NA 3SY1A 2PDPA 2J6XA 3LHYA 2AKZA 3A13A 1O5KA 3RRXA 4HNTA 2PDYA 2G0WA 4WKHA 4F48A 2PWUA 3PK7A 3A21A 2J8GA 1SZFA 1Z8AA 1LL4A 2WHMA 2F38A 1ME8A 4ROPA 3CGTA 2V81A 4RW5A 1BD0A 2AMGA 3CK5A 4H6EA 3CO8A 2MUCA 1DKWA 1C8QA 3GIQA 2YA0A 1BQCA 5LNWA 1Q7MA 3CPGA 1H5YA 3CZJA 1D3GA 3RLVA 1E1CB 1F61A 3K4DA 4H6RA 2PAJA 1K7EA 2PDUA 4DBEA 2X7WA 4C91A 4ERGA 4GUIA 3N3TA 1JUBA 3SCVA 1ITUA 3SSZA 3E12A 4POCA 2DZTA 3KW3A 4AHPA 2QJHA 3IIVA 3N14A 2QNEA 3TYDA 4EACA 1QI0A 3BMVA 1AA1B 5E5CA 4RZ5A 1F73A 2XVPA 5DT7A 1BYCA 3RNDA 3PZNA 3GHTA 3SAZA 2J8FA 4JR5A 3VE9A 4QE5A 4MKVA 1H2JA 3ENLA 4JZ5A 3TONA 3RK8A 5XINA 3WJWA 2VFFA 1S2CA 2GOKA 5CPLA 3XINA 4GZ7A 1EP2A 2CCRA 4GX9A 4D8ZA 5G2IA 1ADOA 3QQ0A 2ISWA 3ITLA 2CITA 3AAMA 6REQA 1EH9A 3ORWA 3E49A 3CUXA 3WBYA 1NF7A 1ZBKA 3OVGA 4NHVA 3R89A 4DVOA 4HQVA 4Z2KA 4C7GA 1O5QA 4NAFA 3BLFA 4YVPA 1OG0A 2J8TA 2VGFA 1RR2A 3CL7A 3B0XA 1DE5A 4ML4A 3WEMA 4IG2B 5JBDA 1D2KA 2YFNA 5CPSA 4HK7A 4OBRA 1VYPX 3TKFA 1TG7A 2B7QA 1TZ9A 1LTDA 4MDOA 1R9YA 4RPPA 3OB8A 5A2AA 1CGVA 3HFTA 4H00A 4AH7A 1UBSA 3A9IA 5TAOA 1JYWA 2AAMA 4X2PA 2C7FA 1RCXB 3SUSA 3CUGA 4WY0B 4Z2LA 2ZZ2A 4ZGYA 2BXYA 3WNOA 1XPYA 1IIGA 3GG7A 3WFLA 3NO5A 1VEPA 1UQZA 4IL2A 4GYKA 2CC0A 1CXIA 3SN0A 1WDRA 2HROA 2W92A 3GG1A 2V63A 2EXOA 2ZX9A 4OV9A 5CSYA 3WLKX 5FOOA 2RDTA 3LTSA 4LBSA 3W2MA 3UEQA 2WPBA 5L6UA 3PF3A 1KWGA 1ONXA 3ISIX 1JULA 2WLZA 4NNBA 1LBFA 1AUSL 2I5IA 4WHBA 1TPC1 3ZLFA 3W7IA 4TVUA 5I03A 1FWRA 4IGSA 4L61A 3AXXA 1AQFA 2ZTJA 1OABA 2INZA 1Q45A 1BVWA 1WX0A 4P8XA 5LHEA 4AD4A 2AL1A 3XISA 1AJ0A 3ABQA 2XIQA 4JX6A 1BLIA 3IJ9A 3WMLA 4F2TA 2O9PA 5XIMA 1OB0A 4MAZA 1XYBA 1R3SA 1OFDA 3VI2A 5K3VA 4HB7A 4W5ZA 3A3XA 3U6WA 4GKTA 3OIHA 1S39A 4V27A 4IMAA 3NQAA 4QAWA 1FQ0A 4EPKA 2X41A 4LCQA 4WGHA 4A22A 3LLDA 2W6RA 4IMGA 1JDFA 1W8SA 2G5WA 3CM4A 3WLIA 2XN2A 4I9MA 3OLDA 1LUCB 3NJ3A 4OKDA 3LYEA 5DY2A 1V08A 1C7SA 5CBIA 3NXLA 3QHNA 3VCRA 3H7RA 2E3ZA 4AIOA 3R0UA 1GQIA 4TVCA 4HU4A 3BLPX 2ZX7A 2FH6A 1AW1A 4H6QA 4NSBA 5FACA 2VQUA 3DC8A 2A21A 5A6BD 4AZCA 1MW2A 6TAAA 3S9YA 2H9AB 5LZLA 1YMYA 2QCMA 5I07A 3TEVA 4HIBA 5HNTA 4AD5A 4IIGA 2XWEA 1YDNA 1HF6A 1GVIA 3M5XA 1PCKA 3BURA 1P43A 1JVNA 1Q6RA 3QKZA 2HE5A 3GQYA 4EOUA 2ZZ6A 4M51A 3SN1A 2WVTA 4Q7IA 3LLXA 1E5NA 2DVTA 4C6LA 4JY9A 3V0TA 1GONA 3QV9A 2FLIA 4CKQA 4PC8A 4FHAA 3R12A 5I06A 4JBRA 1LL7A 2A0NA 3ANUA 3WQCA 9RUBA 1ZFJA 1EKOA 2ZICA 4W84A 1D7FA 3WDQA 1FKWA 4S3CA 4RXGA 2PD9A 1J0YA 3N2XA 3MUZ1 3RIKA 1M01A 1DOSA 3AYVA 1NARA 3IRSA 1JI2A 3U8GA 1JR1A 6ENLA 1E3ZA 3IVTA 5BOOA 4GFIA 3RILA 1A3HA 3GNOA 1O4UA 2AQVA 4D8AA 3SUTA 2VRQA 1W3HA 1V0LA 1CBGA 2WANA 4PB5A 1AH0A 3S3GA 5D9OA 1DBTA 5FIPA 5CPTA 4GIRA 1YPXA 4JKKA 4GK8A 3G24A 2ALDA 1FX6A 2A6NA 3UNTA 4ES4A 4TU1A 2CERA 1OYCA 3HTWA 4LV4A 3S1WA 1P0EA 2PDBA 4ROQA 2PSNA 4YTSA 4NI3A 1F6PA 5EMMA 2ODOA 2JGQA 1ZZMA 2QKFA 1B3YA 4MNLA 2YXXA 2W66A 2PU1A 4WDXA 4U5KA 3ZVIA 2OGYA 3FAWA 1S2UA 3WJZA 2X0HA 3FXGA 4AVOA 5IRPA 4IWWA 2CPUA 1Q4WA 1M53A 3T0BA 1J96A 2J7GA 3WBWA 1CGTA 4JTKA 3L4ZA 4K39A 4QITA 5MKGB 2B7PA 1RXOB 4KFOA 3W85A 2V82A 1XLFA 3TIMA 2XU2A 5F2LA 3ZR6A 3LV6A 2YL5A 4HCLA 3LGEA 1QTWA 5C8BB 4HD5A 4LBRA 4C5ZA 3G18A 4MWAB 1C8XA 4UMBA 1ZP3A 3UW6A 2CHRA 4GINA 2E8YA 2EF9A 4NVTA 3RX2A 4DBDA 3FA4A 2Y1HA 4LTSA 4LUTA 4LAKA 3NPWA 5FEZA 4O15A 4LY4A 4GYJA 1XIGA 2AGTA 2YDAA 4K8GA 4BCEA 2RAGA 3O6AA 3VKAA 3S6TA 1UUQA 4QJ1A 4JCLA 3EB4A 1EIXA 3PTQA 1GVFA 3EXRA 4QE4A 3IV8A 3QN3A 4LNCA 3NM1A 5A6AA 5AB3A 2W27A 4DXXA 1UIOA 3WLLA 4C6FA 1GVYA 1DVJA 1JRBA 2LLEA 2Z28A 1MXGA 2V3FA 5FEPA 3G8EA 3P80A 4UBPC 4TV5A 2OB3A 4ZO8A 4HSOA 1MW3A 4ADSA 4E2BA 3D5HA 2P53A 2VZVA 3PBUA 1S5WA 2QV4A 1NM9A 2OR2A 4IMFA 2QCLA 4ZZ9A 4JQ4A 3N29A 1L0PA 2YDSA 4UQ9A 1F8IA 2HRWA 3THCA 1TPVA 3CBWA 5HMFA 3G2GA 4FLQA 5D30A 3VK5A 3KDNA 3T2PA 1ESWA 1LJYA 1I0DA 2OWCA 4RE2A 4LUSA 3R0DA 1YDVA 3ATZA 2A3AA 4IQJA 2IXVA 3MMUA 4NJIA 4K1GA 3KDOA 1HFBA 1DHPA 2VFGA 3UCCA 4MJ2A 2JBMA 1WUFA 1JDCA 1TVNA 3GUWA 5JH2A 5EL1A 2BY0A 4FAMA 2GDUA 1VFTA 4XIMA 2EPHA 4GNJA 5B7YA 2WXDM 3T0CA 3LU2A 3LOTA 4JFSA 4JYEA 4OUIA 1TWIA 3S6DA 2PS2A 2ACQA 1YXYA 4N4PA 3HN3A 3FDKA 3FW6A 4ZO7A 3W38A 3CL8A 1OZMA 3URNA 1TRIA 2V2DA 4CD8A 2WKGA 5GJMA 2AMXA 1KGXA 3TTOA 3P2VA 4EANA 4YHGA 1NIUA 4C7FA 3HA1A 3LNMA 3CIXA 3M47A 4MY8A 1ICSA 4Y9AA 4TR9A 1K1DA 3W7GA 1U1JA 3B04A 1I2OA 4HPJA 4Z42C 3VDGA 3PPFA 1M04A 1EDQA 3OO2A 1RQBA 3CTLA 4WUIA 4DY1A 1O1ZA 2Z1VA 4JDBA 4MM1A 3VKKA 3BGJA 1XLCA 3QYQA 1VLWA 3TJLA 4L4OA 3N4FA 2F6KA 1EBHA 1NVMA 1TWSA 2BDQA 3QV8A 2UY3A 2QAPA 1B4KA 4ERAA 1ZB5A 3C2OA 3GHUA 4CCEA 3W7NA 1UASA 3W6MA 4P7OA 4LRSA 3B3DA 3SQMA 1L6WA 3AIRA 1UYQA 2C1GA 3S1GA 4N9CA 4UTHA 1QW7A 5AHNA 3MDUA 1I2RA 1ALDA 3EX3A 3EWWA 2XVNA 3JZUA 3INPA 2D0HA 3SCOA 1KCZA 2CKSA 2J9XA 1A5SA 1E56A 3U5UA 4PTNA 4DPPA 1E1CA 3O9NA 1FRBA 3PNUA 1YTEA 3GTXA 3CIWA 3N2OA 2EHHA 2F6UA 3COTA 1E6SM 3GNDA 1NF0A 5F4XA 5CSUA 3GR8A 3F5LA 3O15A 3QZEA 1A4MA 3TFCA 1IT0A 4NT0A 1QNOA 1F3WA 1P5BA 4R88A 4S3FA 4O0ZA 5IBXA 5K4XA 2FKPA 3DHDA 3BC9A 5DY3A 4NL1A 4DYEA 1AW2A 1PIFA 4JPGA 4HOWA 4XD4A 1F07A 1IF2A 3VNMA 2Y89A 3B05A 2GSJA 1L8NA 1JZ4A 4GOAA 1JZ2A 4HTBA 8A3HA 3R25A 3NL3A 3KUMA 4G8TA 3OVQA 3L12A 3ARVA 2OQYA 4HYVA 3VOGA 1V02E 1NOFA 4HZ7A 5A94A 2PWDA 2GJLA 3B8WA 5BWAA 2PI6A 4IG2A 1TKKA 1EHAA 3LPOA 3IK4A 2DIEA 1RQEA 3AISA 1RALA 4XD3A 1MDLA 4KEMA 3EMQA 2VUYA 4K1WA <