5ECUA

The unliganded structure of caldicellulosiruptor saccharolyticus gh5
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
350
structure length
350
Chain Sequence
TAYEKDKYPHLIGNSLVKKPSVAGRLQIIKQNGRRILADQNGEPIQLRGMSTHGLQWFPQIINNNAFAALANDWGCNVIRLAMYIGEGGYATNPQVKDKVIEGIKLAIQNDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIAQKFPNDFHIIYELCNEPNPTDPGVTNDEAGWKKVKAYAEPIIKMLRQMGNENIIIIGSPNWSQRPDFAIKDPIADDKVMYSVHFYTGTHKVDGYVFENMKMAIEAGVPVFVTEWGTSEASGDGGPYLDEADKWLEYLNANNISWVNWSLTNKNETSGAFVPYISGVSQATDLDLGSDQKWDISELSISGEYVRSRIKGIPYQPIERTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Caldicellulosiruptor saccharolyticus GH5
rcsb
source organism Caldicellulosiruptor saccharolyticus
molecule tags Hydrolase
molecule keywords Cellulase
total genus 132
structure length 350
sequence length 350
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
A PF03424 CBM_17_28 Carbohydrate binding domain (family 17/28)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5ecuA00
3VGFA 2BHYA 5ECUA 1G5AA 3SCVA 1JD7A 1C92A 1M04A 3HJEA 4CN1A 1UKSA 1W2PA 3OB8A 5D9NA 1B3VA 4AISA 1YHTA 2QPUA 5DF0A 4ZXOA 1HKKA 1H1NA 4V2XA 4UQEA 3U7VA 1FH8A 3ZSTA 5E0CA 3GH4A 3I3DA 5LYRA 5M17A 5A6BA 4D6FA 2ESCA 5A6SA 2WMGA 2WCAA 3CZKA 4AZIA 3EMZA 1JZ3A 2EPKX 1PIFA 5GNXA 2CPUA 2YL6A 3BLKA 2QMKA 5D9OA 2AMGA 1UYQA 2BV9A 1W9BM 3BMVA 1M03A 2XWDA 3U57A 4HZ6A 1W1VA 4MJ2A 1NARA 3GH7A 1J10A 2CBIA 3NSNA 1WZKA 3K8KA 3BC9A 1B1YA 1ZS2A 1OSEA 5A94A 3POCA 2PWEA 3I3EA 4EAMA 2XVNA 2XWEA 3IAPA 4AD0A 1J12A 1NOFA 5C70A 4UOJA 2XYLA 1KGXA 3K1DA 1BYAA 3WFZA 4AIUA 2VX6A 4Y7EA 1ESWA 3ZO9A 1VRXA 1E3XA 1MYRA 1QHZA 1H49A 1LQ0A 1CBGA 2ZUVA 1QI5A 1J0HA 1E6PA 4NSBA 1IZKA 3AIQA 1GQLA 2DSWA 2E3ZA 3K46A 1HP5A 4PMZA 3AMKA 2X09A 3KZSA 5I5RA 1RPKA 1MQQA 3PZGA 1W3HA 1QNOA 1HJWA 2HISA 3VIMA 2E0PA 2WBKA 4HMEA 3PZ9A 1EXPA 3WEZA 4BF7A 3WEMA 4OUEA 1B31A 3AS2A 2XVLA 4CN4A 1IT0A 1LF1A 4PTXA 2CERA 1DP0A 1KQZA 1CYGA 4CCCA 1KXHA 3W24A 1F4AA 1FFRA 1JYXA 3L2LA 3EMCA 2ZX8A 1VBRA 1ZBKA 2Y24A 2JALA 1CXLA 1MXDA 1NWSA 1QW9A 2ZUSA 3AHTA 4ATLA 3RJXA 1QNPA 2O9RA 4ZENA 5A6JA 1QVBA 5BYWA 4HOZA 2CITA 4AZ6A 1BF2A 3KWXA 4UQBA 1J0ZA 4GZIA 2OSWA 3TOPA 3ARWA 4LQ1A 1V0KA 2WLYA 2WMJA 3MU7A 1V0NA 3WDIA 2QF8A 4H2CA 3VOCA 1LL6A 1QOXA 2CKRA 1BHGA 1KQYA 2WHMA 1QI2A 4JFTA 2ZUTA 4IPLA 3FY1A 3VDBA 4HA4A 3ZIZA 1XV8A 1LLOA 4MNMA 3SCPA 3W37A 3J7HA 4Q7NA 1ZB5A 1RP8A 4YHGA 2Y8KA 3TA9A 2WWCA 2DSZA 3PBGA 3MUAA 1QI0A 1XH0A 2ZUMA 4PMUA 4AY1A 2XFFA 1BVNP 4U2ZA 3AISA 3VNZA 3N1AA 2WVVA 2WVSA 2X0HA 1W3LA 1HKJA 4HZ7A 4H7VA 2E8ZA 2OSYA 3GYCA 2Z1SA 3QHMA 1JFHA 5IHSA 4AZHA 1NOUA 1QNQA 2VVNA 1EQPA 2YA2A 1BVZA 1OD8A 2VRKA 4P7QA 3OLEA 4MNLA 1MQRA 1EDGA 3AXHA 2XVPA 1XH1A 2J8FA 3UG4A 2AAAA 4WKFA 3ARUA 1GOMA 3N12A 4H8UA 2YOCA 4UOQA 4FF5A 1PAMA 2QPSA 2WCGA 5CQ1A 3JUGA 1V6WA 1Q6GA 3SCUA 3ZM8A 3EBVA 5FL0A 4PTWA 1DWGM 3IAQA 4OIFA 4W8LA 3LPPA 3F5LA 2WC7A 2VCBA 5JBFA 3K4DA 1GORA 1GVYA 1BAGA 2XTKA 1BTCA 1C8XA 2EQDA 4PSPA 1ODZA 1JNEA 2CIPA 2OSXA 3A4AA 3IJ9A 3WENA 1MW1A 4CUCA 3WD0A 4H04A 3UESA 4P8XA 1OWQA 4CD8A 3GNRA 4P8WA 4B3KA 4F66A 1WKYA 3TTQA 1HL8A 4U2YA 1SR0A 5LA1A 2VJXA 2XVKA 1OGGA 8A3HA 4RE3A 4QCFA 1GQKA 3ZT6A 3WF3A 1G0CA 4GI8A 1XD1A 3VGDA 1CXIA 4V27A 5ABFB 4M24A 3OZOA 4WSKA 3FN9A 1K9TA 2VVSA 3SCWA 4QP0A 1RD6A 2BY0A 3VVGA 4N0RA 2W67A 3OIHA 4UNIA 1ZJBA 5E09A 1JZ8A 2D0FA 2CBUA 1ODUA 3WL1A 1ZU8A 4U5IA 2DSUA 4MDOA 1U33A 4M8UA 4TX6A 4MNKA 4P7NA 5JBEA 1E6ZA 2D1ZA 2VQTA 1JZ7A 4C7GA 2WHJA 3B8SA 1UUQA 4QLLA 1JGIA 2CNCA 3EMQA 4BQ4A 4F9DA 2DT3A 1HN1A 4J3UA 1ISYA 1WZAA 3WL0A 1GOQA 4UR9A 3ZJ7A 2QMJA 2YL8A 4AZ5A 4XB3A 3WUEA 5I24A 2XM1A 1TZ7A 2FGZA 1DTUA 1R86A 1VBUA 3M46A 1VF8A 1W1PA 4B15A 1Q6CA 3BAKA 3PHAA 2XPKA 1ISWA 2WVUA 3APGA 3WH5A 1QNSA 1XGZA 2JFEX 5IXEA 1KXQA 4AC1X 1VFMA 1OIFA 3SUWA 3M7SA 2WPGA 1GVIA 2CKSA 4JKKA 3RIKA 2F61A 1TR1A 3UERA 2C0HA 4EKJA 4NRRA 1WNOA 3U7BA 1HVQA 2WMIB 1VEOA 1HJQA 4CCDA 4HPGA 1YQ2A 1VB9A 4W7VA 2OYLA 1CGXA 1OD0A 1UWSA 1DWIM 1TFVA 2VTFA 2VURA 4DM2A 5GPRA 3W29A 4HPHA 3WUGA 1F4HA 3BAYA 4ZE5A 1ZL1A 1XD0A 3GDBA 3BMWA 3W53A 5I79A 1OIMA 3O9NA 3THCA 4J3WA 2GSJA 2OWXA 1MW2A 1UD3A 3L4WA 1FHDA 1HKMA 2Y8VA 4KMQA 1KFWA 2BVDA 3E1F1 1CXKA 2PBOA 2NW0A 3VX1A 3WSUA 4NRSA 1MFUA 1E55A 2EPNA 2C7FA 1XC6A 3VD5A 1X1NA 4UFIA 1B9ZA 3OZPA 2X2YA 4B9YA 3UR8A 3CIVA 1E9LA 1OBAA 4FLQA 3ALFA 5A6AA 4XUYA 4CD7A 3WNMA 1KCKA 3WDPP 4J3VA 2AOSA 4W5ZA 2V38A 3AJ7A 2GJPA 4PRWA 3WD4A 4GI9A 2J7BA 3AYSA 4JHZA 1KBKA 3WQ8A 5AYIA 4CCEA 2CHOA 1H0GA 1E56A 3AXXA 3N13A 1UR2A 2D0HA 1R85A 3DECA 5DMYA 1ZBCA 3IANA 4DWSC 1XH2A 4S3JA 1OINA 1LG1A 2A3HA 3T0DA 1BQCA 5E0FA 5E6ZA 5CLTA 4LGXA 3UG3A 2YLAA 4XV0A 4NI3A 2VNCA 1UZ4A 3OGVA 4EANA 4UQCA 1PZ2A 1KXTA 1W9XA 2PWGA 3GXMA 1A47A 2F2HA 2XFRA 3AIEA 1E4IA 1Q6FA 2GK1A 4JCMA 1IV8A 4A3YA 4TVCA 2VCCA 4HA3A 1S46A 1XSIA 2J62A 4GQRA 4J7RA 4W85A 4PMXA 3FW6A 3AYRA 4P7OA 4D6JA 4KWUA 3RM8A 3MV01 3WFLA 3TONA 1K9FA 2YKKA 3NSMA 5DT5A 1DHKA 2GJXA 4YN5A 5LA0A 1UWTA 1LL7A 3AQUA 3CZLA 1J18A 4CGTA 2VZTA 1Q6EA 3WQ4A 1M01A 1JDCA 1KXVA 4JCLA 5A3HA 3VGHA 4FLRA 5CPSA 1H11A 4HP5A 3BAWA 3RM4A 3MV11 4BCEA 2YA0A 1H0IA 5C8BB 1HX0A 1SMAA 5E6YA 4W89A 3WUBA 3K8MA 1GJUA 3DYOA 1BYDA 3WQWA 2JEQA 5CG0A 4F79A 4AZ7A 2CXGA 2EBNA 2FHBA 2W62A 1G1YA 4X0NA 5DO8A 4D6GA 2DIJA 1GNXA 4TUFA 2V5CA 4UCFA 1VFUA 2D23A 2XHYA 3THDA 2D2OA 3ALGA 1CIUA 3L2MA 2WVTA 1US2A 2WBGA 2DSKA 1W32A 2BXYA 4H8VA 2QHAA 2IXVA 2DIEA 3WUFA 3FAXA 2EEXA 3IJ7A 2E40A 1M53A 3T2PA 1KWGA 3F5JA 2FGLA 2QV4A 3IK2A 3VM7A 2WHLA 1LL4A 1HF6A 4MB3A 3OLDA 2G4FA 2YDQA 1FP9A 5IHRA 1AQMA 4HZ8A 2O9TA 3CUFA 3VPLA 4AD3A 1LJYA 1NWTA 1I75A 4UZSA 1CXEA 2DT0A 5DFAA 1B2YA 2ZUNA 4PTVA 3MS8A 2J4GA 4HOXA 1LG2A 1EO7A 4D1JA 1GW1A 3A4WA 3SURA 4CN6A 4RL3A 3GBDA 1BPLB 1MVYA 1V6VA 2X05A 2C8NA 2DSVA 3VIGA 1QNRA 1ZJAA 7A3HA 1D7FA 2ZXBA 1AMYA 2X8RA 4M80A 2EJ1A 4MTVA 3WH8A 3KL0A 1B30A 5BXTA 3SUVA 2NSXA 2Y4SA 1J0JA 1A3HA 3WQVA 3CHDA 2D24A 4Z2LA 1GONA 5I0DA 3OLIA 1EQCA 2EPOA 1JYVA 1NOWA 1C91A 2WC4A 4EK7A 1ISXA 4PMQA 1U30A 3VIKA 4LX4A 1HJSA 5CXPA 4DWSD 3AS0A 3NIYA 3WDHA 2CEQA 2W63A 3QHNA 1UD8A 3AIBA 1AVAA 4YHEA 3NCOA 4P7RA 1J01A 3M07A 3GM8A 2FDMA 1G9HA 1UWQA 1XSKA 1ZBVA 3QR3A 4B16A 4Z2KA 3W82A 4UOZA 3VM5A 4FLOA 3RO8A 1BG9A 4F8XA 5A6MA 1NWRA 3UCQA 5JIPA 4TTUA 5IFTA 1DEDA 4U31A 2WZEA 5ABHA 1OGBA 2ZWYA 1WZMA 4LXFA 1JYWA 1LWHA 1VEPA 2V3FA 4PUDA 2CYGA 2VOTA 3SCRA 1MW3A 3T2QA 2BS9A 2YBTA 2ZUUA 5A2BA 2OWCA 4HMDA 1VAHA 2A3BA 1SFSA 2DEPA 2W66A 3VD9A 1V03A 1Z32X 1RH9A 3FXYA 1AQHA 4Z2IA 3EDKA 1UWIA 1U2YA 2DT1A 1PBGA 4LPCA 3W4RA 1NWUA 3LPFA 2A3CA 5F7UA 3VIPA 3PZIA 1E70M 3RILA 3ZJKA 5HOSA 1BFNA 3ARXA 1BYCA 4AZCA 4UFMA 4WSJA 3WIJA 2VO5A 1GCYA 1W91A 3WF0A 1UKTA 1VFOA 3NDZA 3ZT7A 2G3NA 2OWWA 1QI4A 1E6RA 1EHNA 1UD4A 4AD1A 1W9PA 1ITCA 2D22A 4AZCB 3ARPA 3SCOA 3CZ8A 1MQPA 4E8DA 3WDQA 1XCWA 2DH2A 2VCAA 1PZ3A 1W3KA 2YIHA 2ZX6A 3WNNA 3T08A 1EDQA 4JKLA 5CZKA 5BXSA 1CEOA 3VGBA 1MXGA 3VUPA 2XGBA 4AYSA 3VIJA 1MFVA 2G3IA 3SIMA 6TAAA 2VT0A 5I2UA 1UKOA 1UHVA 4BS0A 3SCTA 1E43A 4QAWA 1CECA 1GZJA 3W25A 2YDRA 2A3EA 3PN8A 1TA3B 4BQ3A 2VR4A 2WC3A 5EBAA 1CXFA 2W61A 4U5KA 1KR0A 1WZLA 5JIWA 1UKPA 3OBAA 5AC5A 1GHSA 2NT0A 4X9YA 3MSDA 3HMCA 4PMOA 5A6LA 4ML4A 5ABEA 2WM0A 6A3HA 2XFYA 2Q8XA 1D3CA 4YPJA 1FP8A 1RP9A 3AHYA 3CUGA 4JFUA 1BYBA 1GUVA 1WB0A 3BXWA 1FHLA 3BSHA 3ZJ8A 1UOKA 1TA3A 3LPOA 4HU0A 1DWAM 1QW8A 1JAKA 3CZJA 3ZR5A 1VENA 3KL5A 4P8UA 1V6YA 1J0YA 1TUXA 3AROA 2ZX9A 4TVDA 1J0KA 4OZOA 3WF1A 3I3BA 4M29A 3RDKA 3OGSA 4FMVA 5A2CA 3BAJA 1CDGA 4WLCA 4U3CA 4P8VA 4JIEA 1UKQA 4A4AA 1C7SA 1KBBA 1G94A 3PZNA 2G3MA 1UWUA 3RM9A 1WPCA 3KE0A 1ISVA 4RE4A 1EHAA 4CD5A 5BWFA 2ZX7A 5I3DA 1C90A 2X1IA 4Q22A 1H09A 4URIA 4XZBA 4CD6A 4TXEA 4IM4A 2JF6A 4OKDA 5AY7A 4GINA 2JE8A 3SUTA 3SCSA 5TD4A 3NYDA 1DWHM 3VMOA 3T2OA 1LWJA 3AHVA 4D6IA 4MAVA 3EDFA 4HTYA 1JFXA 3N18A 2QLYA 2FH6A 2UY4A 3UETA 3DYPA 3VU2A 3PZTA 4OBRA 1UG6A 4JKMA 2BY3A 3ARTA 2UY3A 4PCTA 4XZWA 1J0IA 1HKIA 4AW7A 4GO8A 1R8LA 1TVNA 4GI6A 4IPNB 5JUVA 2WAGA 2E9LA 5CJ5A 3WDJA 4QFUA 1GQIA 4MPKA 5BCAA 3VILA 5E9AA 4UQAA 2NT1A 2WMKA 4Z2GA 1CGTA 1CGUA 5D9MA 2WMHA 4UQ9A 4W87A 1E1EA 3OG2A 1WDQA 4UTFA 1JAEA 4GO9A 5DT7A 3AICA 3WN6A 3K4AA 3OGRA 3VTRA 2JIWA 5CSYA 5GQBA 2W92A 3VGGA 3WNKA 4W88A 3T0BA 1AQ0A 2PB1A 5CPTA 1E6NA 4H8HA 5C71A 1B3YA 1R87A 1UD5A 1WE5A 5BRPA 1JI1A 1XCXA 4CKQA 2RGMA 3M6DA 3RCNA 5A1AA 1UR1A 3AS3A 5CPQA 1PX3A 4AMCA 8CGTA 4J28A 3D5HA 4Z2HA 1Q6DA 2E9BA 1C3FA 3DHPA 1GJWA 2VZSA 1GOOA 3BAXA 4BQ5A 1FH9A 1OM0A 1QHOA 3OLGA 3UR7A 4GIAA 4C7FA 1CNVA 4JZ5A 3WBEA 1UQZA 3GBEA 4DWSB 2YBUA 3A6OA 3T0AA 3WMBA 3WF2A 4OJYA 4L4OA 1B3ZA 3VD4A 2JIEA 1DWFM 4FLSA 3W26A 1GQJA 2PC8A 3GTNA 2BY1A 2GK1B 1E72M 4WJXA 1OT1A 2ZICA 2EPMX 1FOBA 5GNZA 2J78A 3CTTA 4WIWA 2UY2A 5GNYA 3AMDA 4BZYA 5FOOA 2J25A 4W93A 1CPUA 4UFHA 3IJ8A 1CLVA 1UQYA 1V6XA 1V3IA 2WW5A 3A4XA 1E15A 1HXJA 1X6NA 1UR9A 1C7TA 4PMRA 2RGLA 2WSKA 1CZ1A 1BGAA 2V3DA 1WP6A 1E6SM 4JHOA 5KEZA 1E3ZA 4D6DA 2VMFA 2XGIA 2WLZA 3BLPX 2WWDA 3MSGA 2VL4A 3GXFA 1NP2A 4PUEA 3CBWA 1W9VA 4KRUA 4U33A 4QDMA 2HVMA 5A6KA 4MB5A 4PBGA 1BLIA 2FH8A 2Y2WA 3WBAA 4B9ZA 4W86A 3VMNA 3WD3A 1FA2A 4GPNA 1H5VA 1E1FA 2E9MA 3T09A 1XRVA 2PWFA 5IDIA 1TVPA 4R27A 3ZMRA 1V02E 3NUKA 4GXPA 5LA2A 3AXIA 5BXRA 3ECQA 2V3EA 3EDEA 4ACZB 2GDVA 2YA1A 2EO7A 1V6UA 4NF7A 3WMSA 4MADA 5A8OA 4W5UA 1E0WA 3NJ3A 1I1WA 5A8QA 2ZWZA 2WHKA 5EB8A 4HU8A 5A95A 3WD2A 1OB0A 3CH9A 2ZXDA 2VZOA 1JI2A 2PF0A 2W5FA 5EFFA 3A3HA 3WNLA 1KCLA 5HNNA 2XIIA 5BRQA 1XSJA 2MANA 2O9PA 2DH3A 2XSAA 4CU6A 2JF7A 1CLXA 4J3SA 3HU7A 5AC4A 3VD3A 2J7CA 2ZIDA 4WK9A 4AEFA 4H41A 4KGLA 4FK9A 3WY1A 1J11A 1WAWA 3QOKA 3AHXA 1XYFA 1EOKA 4CD4A 3CHEA 1HJVA 1HVXA 2J7DA 3AMGA 3B9DA 1W1YA 4V28A 1R7OA 1NM9A 1N82A 3WNPA 2VUYA 2Z1KA 3GNPA 2YJQA 2BY2A 3WH9A 1C93A 3WD1A 3UEQA 2J47A 2G3JA 2VRQA 1L0PA 3MKKA 3PTKA 3EYPA 1Y7VA 4BA0A 3BSGA 4A3HA 1QBAA 1JL8A 1C8QA 1HL9A 3VINA 4PMVA 5CGMA 4PYSA 1SMDA 3PZVA 1JDAA 3POHA 3ZJ6A 1FFQA 1KR1A 1PX8A 1JZ6A 1UD6A 2V5DA 1EA9C 1G01A 1OGSA 3SCQA 3TTSA 6CGTA 2UY5A 2FHFA 3TP4A 5D9PA 3PTMA 1GOWA 3QGVA 1KGUA 3MO4A 4JFVA 2J7GA 2J7FA 1B3WA 9CGTA 4K68A 5IFPA 2OYKA 3AIWA 1WDRA 4N42A 5BXPA 3VIIA 1R7AA 3RJYA 4W7UA 4AZBA 3DYMA 4W8AA 2J79A 2WK2A 4AIOA 2PBGA 1I1XA 3CMJA 1CGWA 2J77A 3VKKA 3W27A 4MDPA 1O7AA 2CCRA 2GUYA 1KGWA 1JZ2A 2XM2A 3PZOA 3G6MA 3GH5A 3F4VA 4IUGA 1UH4A 3WNOA 3ZR6A 4KGJA 1JDDA 3N15A 4LYPA 3PZUA 4UFLA 1H4PA 3GXIA 1EDTA 3TTOA 1E5JA 1O6IA 4ZE4A 1PIGA 2BXZA 1J9YA 3VIFA 3AS1A 3ARVA 4MNJA 2D20A 3G6LA 2WSPA 4E4PA 4U3AA 1ECEA 4D71A 1X6LA 2OLHA 3II1A 3W38A 1M7XA 1EGZA 1NQ6A 2BHUA 3MUIA 2VC9A 1H3GA 2IUZA 3NSXA 2WZHA 3WQ5A 5CLWA 3MUY1 1TCMA 4W84A 4JFWA 4NZCA 4WKAA 1W9DM 2D3LA 3ZT5A 2WCSA 3BGAA 5FKYA 4ZEPA 1JD9A 2VRJA 1E4LA 4DUWA 1V3KA 2WMIA 3CZGA 1QI3A 1W2VA 5EMYA 2G8ZA 4QLKA 5A8MA 2X0YA 2VX7A 1H41A 3LMYA 2VZVA 5M5DA 1QPKA 3MUZ1 1MWOA 4D72A 4ZXLA 4AEEA 5ABFA 2VX5A 2DGAA 7TAAA 3ARZA 1EIBA 5HPCA 3AI0A 2VQUA 4MAZA 2A3AA 1PPIA 4L4PA 4M82A 3W6LA 3BCFA 2DT2A 3CLWA 4HMCA 2PI6A 4X0VA 3AMLA 1HT6A 1NH6A 1GPFA 2DQXA 1E71M 1JZ4A 2XUCA 1JF6A 3WH7A 4D6HA 3GZAA 1V0MA 2CETA 2YLLA 1EH9A 3L4TA 1BG4A 3WF4A 3CO4A 2XSBA 1TE1A 1L8NA 4AZGA 5FIPA 4D6CA 2GJRA 4EE9A 4S3KA 2VZUA 4PMDA 4P7LA 3D3AA 4M56A 5I6SA 1E6QM 4GQQA 3VGEA 1WDPA 2GJXB 1OT2A 1VJZA 2V3GA 3B9AA 3CUJA 4AD2A 2W4XA 1OCQA 1HJXA 4DUXA 5JBDA 2ZXQA 2WVVB 1W1TA 3A47A 3QOMA 3VMPA 2IXUA 1UR4A 3N9KA 2ZE0A 1BGGA 4MJ4A 3S6TA 3VDCA 3KL3A 1D2KA 3W28A 4J3TA 3RPMA 2EXOA 4DM1A 3SUUA 3UG5A 1UWRA 3F5KA 3K8LA 1UH2A 2CBVA 3MMDA 1W3JA 2G41A 2WKGA 3CHCA 4PCSA 1US3A 1VFFA 1HIZA 2YL9A 4HA1A 3DC0A 1UA7A 4IISA 1K6AA 1UZ1A 1E40A 1JIBA 1PX4A 4ACYA 1IZJA 2BNJA 3BAIA 3WEOA 3VDAA 5I77A 3EDDA 3VD7A 1JZ5A 3O2LA 7CGTA 4KH2A 3OA5A 1C8YA 4OOUA 1JYNA 1KB3A 1NP0A 5M03A 1UD2A 4TX8A 2YL5A 1E4NA 1GOIA 5FL1A 5ABGA 4F9JA 5DEZA 1E73M 5HDRA 2ZOXA 3L4XA 2UWFA 3ZSSA 3ZOAA 4CU8A 3N17A 2CBJA 1EO5A 4WKHA 3BH4A 2WANA 4C7DA 1VJSA 3MMWA 5HPOA 2VR5A 3AFBA 3FNDA 1SYTA 3VDHA 3ARRA 3L4ZA 2WMFA 3AIVA 3W6MA 4JL2A 2CESA 4AXNA 2DPEA 4PEEA 3EDJA 1CENA 5I23A 4UZUA 4TVUA 4PMNA 1P6WA 2WKLA 4AIEA 2FHCA 1WCGA 3FAWA 1TMQA 3SEPA 1B3XA 1HNYA 1GOKA 4CU7A 5D8ZA 5A69A 2B31A 4W8BA 5A8NA 2J75A 1VEMA 3AHZA 3CZEA 1V3HA 2XJ7A 1QHPA 3ZQ9A 3PTQA 1QBBA 4DWSA 2J7EA 4CVUA 3WMCA 4OBSA 1CWYA 3AZRA 2O92A 4AD5A 1V3LA 3ARSA 2XIBA 3SCNA 2W91A 1E0VA 3BCDA 3S2CA 3ARQA 3CUIA 3WH6A 2CHNA 5BROA 2XVGA 4ZFMA 2PWDA 1XHGA 3N11A 1H2JA 2J74A 3CMGA 4JL1A 3SUSA 4M81A 3VO0A 1WDSA 5I78A 4E8CA 3KEHA 2F8QA 1FH7A 2ZX5A 3N04A 1UR8A 2ZUWA 1DWJM 4KRTA 3VIHA 4ACZA 2TAAA 1EOMA 5FD0A 2D0GA 5HBFA 3L4YA 3PZMA 3W0KA 4D1IA 1CGYA 3AIUA 2WZIA 4BQ2A 2EPLX 1PJ9A 3FHAA 3MMUA 2BHZA 4B3LA 2VX4A 1V02A 5FCZA 3AMCA 3PZQA 4PSRA 2GDUA 3L4VA 2E4TA 1PEZA 3AIRA 3ARYA 2GFTA 4JAWA 1XYZA 1JNDA 5D4YA 3CHFA 4QLJA 4HOWA 3TTYA 1CXHA 4ATDA 1JXKA 4TOQA 1TG7A 3RMEA 3U5YA 3AZTA 1UA3A 3LPGA 4PMYA 1K9DA 2J7HA 2WYSA 2BVTA 4R5EA 3U5UA 4CVWA 4PN2A 3O6AA 1ZBWA 5E70A 4AWEA 1HJUA 5KZ6A 4LYRA 3GXDA 3CPUA 4W7WA 3CGTA 4UFKA 1V3JA 4E2OA 5A2AA 1MW0A 2OYMA 3VX0A 1CTNA 1JG9A 3DHUA 4UFJA 1CGVA 1Q4NX 2WXDM 1UH3A 5D8WA 3VNYA 5CSUA 5M3WA 1K9EA 3WELA 4OOZA 2VI0A 1E6XM 2WB5A 2D3NA 4UQDA 1UR0A 5AYBA 1ITXA 3WQ6A 4J3XA 1W9UA 3L4UA 1V3MA 4ATWA 5HXMA 1VIWA 1HP4A 4GZJA 3MANA 4GZEA 1JXJA 4DUVA 2ZXAA 4WF7A 4TTGA 3AZSA 1E5NA 5A6BD 2GVYA 4PTMA 4QCEA 3NDYA 1KWKA 2PWHA 1E4MM 4JFSA 5EFDA 3B9EA 4AD4A 4D6EA 3W81A 4MB4A 1GHRA 3HN3A 2J8GA 1B90A 1JF5A 3WDRA 1BSIA 3CUHA 2BFGA 2YDSA 1B0IA 3FHQA 3AOFA 2O9OA 2E8YA 1V0LA 2WNWA 2XG9A 2DDXA 1V08A 4M1RA 4LYQA 4Z2JA 5A8PA 2Y5EA 2BVYA 3VIOA 3GNOA 4GKLA 4RE2A 2JEPA 4J27A 1E0XA 5CGTA 4MB1A 3WKZA 1ISZA 4XX6A 1WO2A 3QHOA
chains in the Genus database with same CATH superfamily
2O56A 1TE6A 3GVWA 4JTIA 1EP1A 4C60A 3FDKA 3H4GA 4NJJA 4K1WA 3UZWA 4N7QA 1W2PA 3B4YA 3T9PA 3M9YA 1YHTA 5DF0A 1HKKA 1H1NA 1EYEA 4V2XA 3GU9A 3GTXA 2I56A 3ITTA 4G9PA 1D3HA 3S1VA 3U7VA 1R9XA 3IJLA 3ZSTA 1QU4A 2ZDRA 3SRFA 5CPNA 4XAPA 2XISA 2FPYA 4D6FA 4IHCA 2ESCA 6REQA 1HGYA 2YXXA 1IXPA 3TU9A 3CZKA 4AZIA 1JZ3A 4LVDA 3VABA 7REQA 2CWXA 5L9FA 2CPUA 2OGJA 2YL6A 1RQHA 4XAYA 1VCFA 4GI4A 2FTPA 3UZYA 2H9AA 1W9BM 2HK1A 4HYRA 3BMVA 4IQLA 3S8HA 2VC6A 3U57A 2VD8A 2OEJA 2A5HA 4IX0A 1R3TA 1ZRQA 3B0UX 1MNZA 3LXAA 1WZKA 3DFNA 3POCA 2PWEA 2YCKX 4NNAA 1J12A 1IGWA 1YBQB 4UOJA 4B90A 1MUMA 3K2GA 4JTUA 5LNUA 4AIUA 4GYFA 2DZBA 3V5CA 4DO5A 1QHZA 4JIHA 2RH9A 2HV5A 3ZLGA 1QI5A 3NO1A 4X2PA 1E6PA 4L80A 3UXAA 3K46A 1HP5A 4PTNA 1BWVA 2QUVA 2HNHA 4LY8A 2I16A 3H2AA 1ZSXA 2G37A 4LRTA 4FNSA 4GX9A 1W3HA 4MIMA 1QNOA 3TXVA 3ZVHB 1HJWA 1R0MA 2CW6A 1Q6LA 4FP1A 4HMEA 3PZ9A 3BG3A 1PWLA 3WEMA 1V51A 1RJPA 8RUCA 3F2CA 4JYFA 3CV7A 1RBOB 3TCEA 1KXHA 4NX5A 4FXRA 2PTXA 2GVJA 2XFWA 1JUBA 2TYSA 4MKNA 2JALA 1CXLA 5H2ZA 3UD6A 4DN1A 1NWSA 5HMDA 1AA1B 2ZUSA 1FWBC 2P8BA 3RJXA 2BWGA 2NQHA 3M0ZA 3QH2A 4AZ6A 1BF2A 4UQBA 2OSWA 3TOPA 3ARWA 2E6FA 3L66A 3MU7A 3L68A 1V0NA 4HMNA 3W7CA 3KBNA 1KQYA 3N2MA 2WHMA 2ZUTA 1GK8A 2A6LA 2ATMA 1EJWC 1XICA 4O10A 4J35A 4YWIA 4KBXA 1LLOA 4B5VA 1EUAA 4GQGA 3W37A 3J7HA 3KBMA 4UTLA 3TA9A 2WWCA 3T42A 1KKOA 3ISIX 4BEQA 3NA8A 3UR2A 3NQ2A 3PBGA 5KTLA 3HGOA 4PMUA 5K2ZA 1DJQA 1BVNP 4U2ZA 3TN5A 5LHFA 4YVXA 1HKJA 2DV0A 4HZ7A 3H8AA 3WLNA 2QUTA 3MB9A 3BCJA 1JFHA 4GK8A 4HIBA 1UP3A 4KQNA 1QNQA 3SQLA 3W86A 2B7QA 3G1HA 1SJDA 5CBBA 1EQPA 1Q65A 3BOXA 4I5RA 1OD8A 4M6UA 4FOKA 5FEWA 2G0WA 3R0KA 4P7QA 3OLEA 3CK5A 3W7DA 3KRSA 1Q4WA 3B8WA 2XVPA 2GJLA 3QQ1A 2J8FA 5T9CE 1EZ2A 3ARUA 3KCJA 1H7RA 2YOCA 3SQSA 5CQ1A 3JUGA 4BK9A 1B9BA 2WNQA 1R9YA 3GLCA 1XIHA 2D69A 1NFGA 4XTDA 1DWGM 4DJFD 5CJMA 1R30A 1VH7A 2VCBA 5JBFA 2NWRA 1AQFA 3VXGA 2GZXA 5DCDA 4JIPA 3A9IA 4YTQA 2CIPA 1L2UA 1XBYA 2E67A 4EWND 3KUMA 4RKAA 9XIAA 3WENA 4MF4A 3LCWA 5C54A 4CUCA 1PTDA 2FKPA 2YZRA 3KWSA 3MCOA 4CD8A 3GNRA 3QVQA 3KVJA 1WKYA 1I2NA 4IFKB 4C5YA 1US0A 1UR3M 3CJPA 1GQKA 1CXIA 5AHLA 5ABFB 5D30A 3OZOA 1F76A 1KD0A 3I7RA 3W7RA 4F0MA 4Z0JA 4QP0A 2QKFA 1XYMA 1A53A 2GWNA 2VGGA 3OIHA 2BMBA 2BTMA 4M0XA 1JZ8A 3T40A 2CBUA 1ODUA 4MYXA 4GFSA 1ZU8A 5MKGB 2PDGA 4LTSA 1H7PA 3W07A 2HVNA 1REQA 3T55A 2PDCA 4PR4A 1XPYA 4TX6A 2C79A 4P7NA 1J2BA 1E6ZA 2D1ZA 3ITCA 3HPZA 3ID7A 3KCOA 1PO9A 1UUQA 4QLLA 4ZSTA 4BQ4A 4F9DA 3NGJA 4D8LA 1WZAA 1TJ0A 4OV4A 4GUFA 1DOSA 2PDFA 3WL0A 5KZMA 2FJKA 2ACQA 4C1KA 3LNPA 2PTDA 2QMJA 5AVNA 1AZ2A 3WUEA 4GUHA 4LT9A 1R86A 3NM3A 4B15A 1Q6CA 2EPHA 5JVLA 3APGA 1Q2RA 4Z42C 1TWWA 2FZMA 4Q4QA 1IXQA 1S1RA 3BZJA 5D05A 1KXQA 3B9OA 3MVIA 2O7QA 4BI6A 3MVTA 1DBTA 3SFWA 2QVHA 3DFSA 3LK6A 1F3TA 3N4EA 4NI8A 2ZTKA 1OCNA 1HVQA 2WO5A 1VEOA 1VS1A 4MFEA 1I4NA 1CGXA 5I7GA 1UWSA 4S3AA 3C56A 4HPHA 3LXBA 3UJ2A 3BAYA 1ZL1A 1XD0A 3UXIA 3O9NA 3GY1A 4QM1A 3UA4A 5F1VA 1KM3A 3EXRA 3TJ4A 1MW2A 1UD3A 3SY1A 1WXYA 1OFAA 5H8MA 4FR6A 3U4FA 1VYPX 3IS4A 3R5EA 2JGQA 2QCCA 4FNPA 4MUPA 3A12A 2X2YA 3K30A 3UR8A 1C9DA 2POZA 1OBAA 3ALFA 4N9BA 2Z1WA 1ICPA 1EJVC 4REQB 1FCBA 3AYSA 4H2HA 3GNDA 5AYIA 3D46A 5D02A 2ZCGA 1E0UA 3N2XA 4TMBA 2NV2A 3AXXA 3N13A 3R7MA 3BLIA 3A3XA 3E2QA 1A5CA 3GD6A 2Y7DA 1XH2A 1NSJA 1LG1A 3LM3A 4TMCA 3T0DA 1RQBA 3R4IA 3UZ5A 3FYPA 3VOHA 3IIZA 1RV8A 3OGVA 2CLLA 3UNTA 1PZ2A 4NZ4A 1W9XA 4ZL1A 5FEPA 4FR1A 2F2HA 2YW3A 3AIEA 2YXGA 4JCMA 1Q8AA 4FHAA 1XSIA 2ACRA 4O1AA 3RFAA 4PMXA 3W2NA 4LUTB 4P7OA 4D6JA 4ADUA 4I6VA 3WFLA 2ZZ1A 2NV1A 4AMAA 2P76A 1DHKA 1NDZA 3H6OA 1OABA 1UWTA 3PVFA 3IGSA 1J18A 4MZ1A 4NXKA 4CGTA 1Q6EA 1OYAA 3MUXA 4L5ZA 1XYCA 1OHLA 4DBDA 4EPDC 2PSNA 1H11A 3ZLHA 2VKZG 2YA0A 1XINA 4KS0A 5C8BB 3SBFA 1WKFA 3VZXA 1GZ1A 4M1BA 3K8MA 1GJUA 1BYDA 3B8VA 3TW7A 2WKJA 4QISA 2PURA 2EBNA 3HG3A 4XSMA 4XAGA 4X0NA 5DO8A 2DIJA 1GNXA 2Z29A 2V5CA 3O15A 4UCFA 1PCWA 1EGMA 4L9YA 3DGRA 3KZPA 1CIUA 1Q63A 4H8VA 4KT2A 2GYIA 2OX1A 2QHAA 1AD1A 2EEXA 3HF3A 1Y5VA 3T2PA 1KWGA 3F5JA 1POKA 3IK2A 3VM7A 3WQCA 4NY2A 1LL4A 3H2CA 4HZ8A 3VPLA 5BOEA 1CXEA 2DT0A 3GE7A 2ZUNA 3MS8A 2J4GA 2HPIA 1PTAA 2C19A 4D1JA 4UR8A 3NG3A 2QYGA 4AEOA 1RK6A 4KEZA 3H4WA 1HUVA 4CN6A 1GVOA 4MYAA 3GBDA 1MVYA 5FA5A 1V6VA 3KBJA 4O14A 1QNRA 1ZJAA 7A3HA 2X8RA 1BEUA 3WH8A 3SUVA 4DXKA 4Q7IA 1J0JA 1UBPC 1OX4B 1A3HA 2CZDA 3NM1A 3S3GA 5I0DA 2NVAA 2EPOA 2VWTA 1JYVA 3W1NA 4EK7A 2HZGA 1BD0A 3CWHA 1OJXA 1TREA 4N4PA 1HJSA 5CXPA 1VCVA 3AS0A 3QLDA 2R6OA 3BGJA 1H7XA 2CEQA 3G8EA 3LD5A 3ZXWA 3GFYA 4YHEA 3NCOA 4P7RA 3M07A 5EGRA 4IPIA 4B16A 2BVWA 4NL1A 4Z2KA 3W82A 4UOZA 3VM5A 2R24A 3WLIA 3UCQA 5I3JA 2QQ6A 4ADSA 4DLFA 5IFTA 3VUSA 1WZMA 1JYWA 3S83A 1LWHA 2ZZ5A 1AJZA 3TJXA 5PTDA 3PWIA 3JZUA 5CZ0A 2ATSA 4H7ZA 3W1LA 4NASA 5A2BA 5F4XA 2ZC8A 3VD9A 2V67A 3H2EA 4U28A 3FXYA 4AWTA 2HTMA 4Z2IA 1UWIA 2DT1A 1PBGA 3FV9A 1NWUA 4RDZA 1MNSA 1FWGC 3VIPA 2YFNA 2ANUA 3QV8A 2DW6A 3ITOA 1RALA 3W1RA 4FX8A 1H61A 3C3UA 1GCYA 5I3HA 1Q45A 3BVJA 1DPMA 5AVHA 3ZT7A 2G3NA 3NYZA 1T5AA 2VP8A 5H8PA 3I6RA 4MWAB 5CJNA 4AZCB 4PCNA 3SCOA 3CZ8A 1MQPA 3G3DA 4IGSA 2AKMA 3WDQA 1XCWA 5TQLA 2VCAA 1W3KA 3WNNA 2ZX6A 4DJFC 1QPOA 2QCFA 4O57A 1SO5A 5BXSA 4CNNA 3W1TA 3REQA 3VGBA 3VUPA 3H22A 1N8IA 1V7YA 4LCRA 2XGBA 4AYSA 1XKYA 2GQ8A 1EYWA 4JTEA 6TAAA 2Y7EA 4ZQMA 1UKOA 3QY8A 1PKMA 3W76A 3SCTA 1GZJA 2G3FA 3RG6A 4A8IA 3ZLFA 3TW9A 5G1YA 3W2LA 4UBPC 4HN4A 4BQ3A 5FF3A 4H3DA 2PMQA 3LDVA 4OU1A 4NJIA 4DJFA 3AAMA 3HMCA 2AAMA 3BLDA 4LANA 2X7VA 5DX7A 2Q8XA 3O07A 1D3CA 1JUKA 4DO6A 4HN8A 1BYBA 4DZAA 4WDWA 5SWUA 1R3QA 2VEIA 4C1NA 3KOYA 1PKLA 3BSHA 4XKYB 1IEXA 1TA3A 3MYPA 3DFOA 4JTTA 4ZB0A 2QPXA 4Q6JA 1XLIA 1TUXA 2ZX9A 1YXCA 3LSBA 1UMYA 3WF1A 4KEUA 3RDKA 3DX5A 5A2CA 4WLCA 5CSSA 2VEKA 4I8DA 3CV2A 2KAUC 4O13A 3PZNA 5FJOA 1UWUA 1IZCA 4S23A 1PZ0A 2ZRXA 4MJMA 1C90A 2X1IA 3IV8A 3CIXA 1IT7A 3KRBA 2JF6A 5CGQA 2P0IA 4G2DA 3PANA 3R8HA 1UB3A 2GQ3A 3SCSA 5TD4A 2V82A 3PFRA 2HXTA 2XIQA 3AHVA 4F0SA 2I14A 3N18A 2Y61A 3V35A 4ALDA 1Y65A 4Q8TA 1BSLA 2FH6A 1T41A 1ZNNA 2UY4A 3DYPA 3ME3A 4RZ5A 1HZYA 4Z1BA 3VU2A 4IICA 1UG6A 3FA3A 3MPGA 2YCLA 1XLHA 3ARTA 2WJEA 1HKIA 4LFYA 4WXZA 2ZTJA 5GJPA 1TVNA 4QHRA 4KCUA 3GR4A 2PD5A 2Z0IA 5H1WA 1W5QA 3CASA 3GXPA 1N55A 4QFUA 3WDJA 8TIMA 4G6CA 4HK5A 1HW6A 3VILA 3R1ZA 5HNRA 5D9MA 2WMHA 4L4LA 1E1EA 3OG2A 4PUJA 3QZAA 4QITA 3URAA 1KLYA 3F2DA 4DVOA 3WK3A 4W88A 1AQ0A 2PZ0A 5C71A 1UD5A 1XCXA 4JNZA 1A5SA 5BU9A 5A1AA 3CV1A 2X42A 1VFTA 4AMCA 3D5HA 4O18A 1C3FA 2Z25A 1GEHA 2PE4A 3UYIA 4BQ5A 3NDOA 1OM0A 1QHOA 4UTIA 1KFBA 1UQZA 3UQNA 1HTIA 4MGGA 2OKOA 5DXYA 4I90A 4FXFA 3TW6A 3WF2A 5HAOA 1DWFM 3B9NA 1XDLA 3MQTA 2WV8A 1EBHA 4RW5A 2GK1B 1E72M 2ZICA 4H6RA 3WQDA 3N4AA 4WIWA 4JIRA 2DFAA 4Q8OA 4JTKA 4W93A 3V5FA 1A5KC 3SGGA 2ZVRA 7XIMA 5FEXA 1V6XA 5CZJA 4RNFA 3A4XA 1G7VA 4FZIA 2EKCA 1G67A 1HXJA 1DIOA 1UR9A 4PMRA 4S3CA 3M41A 2V3DA 2Z1VA 1WP6A 1M3UA 1PB0A 4DBUA 1YXDA 1SPQA 2VMFA 2WLZA 3BLPX 2WWDA 2VL4A 1NP2A 3S4TA 3VKJA 4FSAA 3EKZA 3CBWA 1SZGA 4U33A 4QJ1A 1TPWA 5FJUA 3UJRA 4NZ5A 4MB5A 1BLIA 2P5NA 4DWDA 2FZBA 4KWVA 4BF9A 4XAFA 5BW6A 4GPNA 1E1FA 8XIAA 2E9MA 3DKJA 4YTTA 1KTCA 4CNOA 3UWQA 3DI0A 3TN6A 2FVMA 3MO7A 3NUKA 5LA2A 3AXIA 3I7SA 1T99A 3OO2A 3ECQA 2V3EA 4I9AA 2W79A 5XIAA 1H51A 2GDVA 2EO7A 3WMSA 4KFPA 3GG0A 4MADA 4OBTA 1I2PA 4W5UA 1W3TA 2ZZ2A 4HTBA 1DXIA 5A8QA 1LUCB 4A2SA 1GJPA 3MA8A 4UTUA 3MMTA 4HCLA 5K7JA 5EB8A 1TPC1 3WD2A 3HGSA 3GTIA 3VNKA 2VZOA 3MSYA 2WNZA 3P14A 2XSAA 3TAKA 2NVDA 4RNHA 1RCOB 5T9BG 2ZIDA 4AEFA 4H41A 3RN6A 4KGLA 2HPMA 2UBPC 1J11A 3UWZA 3QOKA 4JTQA 3W73A 4ZGYA 2J7DA 4YWSA 1JCNA 3G3MA 4EWJA 3I4EA 1FCUA 4I8YA 3W74A 4GVFA 3W7OA 1ALDA 1UASA 2J47A 2VRQA 3KP1A 3IPWA 3SADA 1JL8A 1C8QA 2INFA 1HL9A 3W2JA 1WAUA 1PWMA 1W5MA 4KW2A 4ZOAA 3IIXA 3POHA 4NIRA 3GTFA 3LOTA 1UD6A 1G01A 1TPEA 3H70A 1RJQA 4BI7A 4ASTA 1U1HA 5D9PA 3QGVA 1VBHA 3W70A 3MO4A 2OYKA 5BXPA 4N42A 3M64A 3VIIA 1R7AA 1B4KA 4C1LA 1GZGA 2ACUA 4W8AA 3GQYA 1AD4A 2WK2A 4AIOA 1Q7ZA 2PBGA 4DJDD 4N6EA 3M0JA 1H5YA 4C6FA 3QW3A 4Q7BA 1XKJA 2ISSA 2XM2A 1GOXA 3CXOA 3AJXA 3N2BA 4H9TA 3EX4A 5AZ1A 4OFCA 3CQIA 2V5LA 3T78A 1SFLA 4MWAE 3W6YA 4R88A 4UFLA 1H4PA 2VGFA 4ZE4A 1J9YA 3P0XA 2WSPA 3C2RA 2HK0A 3II1A 4D71A 4KCWA 1NQ6A 2BHUA 1PXGA 2QCLA 1BWLA 2IUZA 3MUIA 3NSXA 4GKTA 4RV8A 4IJBA 2W9MA 1TCMA 5AYZA 1JGMA 4DYJA 3NQ7A 1EUNA 2D3LA 3ZT5A 2FIQA 3BGAA 1E4LA 4DXXA 1V3KA 3STFA 3H7UA 4IQEA 3H2OA 3PAOA 1Z41A 5EMYA 2G8ZA 3N2TA 1YRRA 4QNEA 5A8MA 2QJMA 3C2VA 2PP0A 1PTGA 2VZVA 3IUIA 1EF2A 1GGOA 1OVDA 2XINA 3G0SA 1JPKA 5ABFA 2C1GA 1DJNA 1EIBA 4YTSA 5HPCA 5CC7A 1KM6A 3HV9A 3WJYA 1XQLA 1WUFA 2VDHA 2VOMA 3QF0A 4EPKA 5DRCA 2PWUA 4L4PA 3NURA 4M82A 4NYUA 3BLEA 4XD6A 3CLWA 2PI6A 4YVVA 3W71A 3AMLA 1NH6A 1GPFA 1J96A 3WLMA 1V0MA 3L4TA 2XSBA 3CT7A 4Q8QA 1RQEA 5FF4A 1KFLA 5E93A 3C61A 5FIPA 4D6CA 2ACSA 1WUEA 4AG0A 3KLLA 4EE9A 4LVFA 4S3KA 2XN0A 2G95A 1UOZA 3PJWA 4BY3A 5E5CA 1TIWA 4GJJA 2NX9A 4RR4A 2V3GA 3E12A 4AD2A 2W4XA 4K7YA 3W1AA 3G1YA 5FAJA 3N9SA 3ES7A 2ZXQA 1A5NC 5E9XA 2ZADA 3LS9A 1XIJA 1TJRA 2IXUA 2WJZA 3DZ1A 2BASA 1IE7C 3S6TA 1D9EA 3VDCA 5LHEA 4J3TA 2EXOA 4K7VA 3OJGA 3M44A 5C7VA 1UWRA 3K8LA 1YDVA 2FB3A 4LALA 3MMDA 2POTA 1FWNA 2G41A 3EPNA 3GB6A 3CHCA 2BOGX 3B06A 7ENLA 5AZ0A 1UA7A 2QCGA 2VWSA 5EMMA 4IISA 1K6AA 1X98A 4ACYA 3NL6A 1KV5A 2VFGA 2YX0A 3VDAA 5I77A 3AALA 2Y70A 1WKEA 1F3WA 3IVUA 1HO1A 3I68A 2OEMA 1NP0A 5M03A 1OQFA 1BKSA 3DKLA 4GVHA 2OEKA 4PL2A 4FB7A 2VGBA 1E73M 1PKNA 5HDRA 1A5UA 3L4XA 2UWFA 2R1PA 3N17A 1WDDA 5FAGA 4B91A 3UJSA 3ITYA 3DFTA 3BGGA 5EPDA 3MSRA 2VR5A 4I7WA 4M5PA 3L4ZA 2WMFA 3AIVA 4JL2A 4QDPA 2CESA 4RK8A 3SFKA 3AXMA 4UTTC 3PK7A 3MKVA 1CENA 2PDIA 4PMNA 4QS5A 2AMXA 2AQVA 3F2BA 4HD5A 4PUKA 1B3XA 4S3BA 1GOKA 4CU7A 3S0CA 4W8BA 3WQGA 1TRDA 3IIPA 2EG7A 2P10A 1AW2A 1IIHA 4EPEC 1VEMA 4C6JA 2XJ7A 5B80A 1QHPA 3MI3A 2OU4A 3ANYA 3JW7A 3CQHA 2F2KA 2J7EA 3IJQA 1BXBA 1F6YA 2YCIX 4UTTA 3UJEA 4CLMA 2XIBA 2W91A 4U10A 3E96A 5BROA 3S47A 3GNNA 3DU0A 2C16A 5CZSA 3W9ZA 1I0BA 1FWDC 2V69A 3P93A 1H2JA 2CZFA 4JL1A 2YW4A 4M81A 3VO0A 3ZWSA 2OOFA 1A5AA 1P43A 3T4CA 2BODX 3LERA 3N04A 3VIHA 4IGNA 4RDYA 3UWVA 2TAAA 2QDDA 2UV8G 1OC7A 3RCMA 3W2KA 3TYUA 5FD0A 4ZFCA 3FIGA 3PZMA 3W0KA 3DG6A 1OFEA 4DJDA 3FHAA 1YKWA 4J1OA 4IL0A 4PE8A 1TSIA 3NL2A 3S9YA 3PZQA 2YYUA 3L4VA 3ENLA 2QVNA 2I57A 4QJ4B 1X96A 2IPGA 2VD9A 3CL7A 4PA8A 2QGHA 4ZQCA 4HOWA 4GZ7A 3TTYA 1CXHA 3W83A 4A3QA 4JBRA 4NJHA 3WLOA 3R10A 3U5UA 1ZZMA 4PN2A 2ZBTA 2WSRA 2JK2A 4AWEA 1HJUA 3JZEA 1UROA 1R5YA 4MZ8A 1L6SA 1MW0A 1LUCA 1Q4NX 1TJ2A 2EAWA 1J2WA 1UH3A 3K5XA 1XF0A 5AHMA 3LHZA 4OOZA 2VI0A 3OVPA 1Z89A 3A64A 2ZC1A 4UQDA 5AYBA 3GC5A 3L4UA 1P4CA 1V3MA 2OG9A 4GYPC 4ATWA 4Y2WA 4GZEA 4US5D 4DUVA 4RUBA 1VD6A 1E5NA 4PTMA 2VFIA 2PWHA 3RF9A 5CAKA 1E4MM 1HGWA 1YTKA 4LEFA 4CCZA 1YXYA 3F4NA 3CL8A 3C6CA 1GHRA 3HN3A 1FWJC 3CUHA 1R47A 1RUSA 2BFGA 4QIUA 2YDSA 4O0KA 3FHQA 1LBLA 5FJIA 2O9OA 4C6KA 2DDXA 2IMRA 3M4HA 5CPLA 3VE7A 4UTKA 3HPAA 3MBFA 3GNOA 4V1YA 2P53A 4J27A 4MB1A 3WKZA 1ISZA 4XX6A 3EWBX 3QHOA 2DU2A 5EBUA 4IL2A 4HYWA 3VGFA 3FYOA 4JN6A 2BHYA 3RX4A 3SCVA 4ES4A 1A4LA 3E2RA 1M04A 1UKSA 4NILA 4AISA 3VZYA 4Q4KA 4QQUA 1Y0EA 4HNUA 2RDTA 3QV6A 4XD3A 3THUA 3M5XA 1FH8A 4XZMX 5E0CA 2FZNA 1QWGA 1VZWA 3I3DA 4PULA 1H7OA 3UPBA 2C71A 1AG1O 2WCAA 2DZWA 1YDYA 1O4UA 3AO0A 3MYOA 2ZRWA 4IG2A 1LCOA 1UC4A 4WUIA 1IEVA 1GTHA 1W1VA 3KBSA 3GH7A 3PBVA 4JS3A 4ERGA 3UT0A 2CBIA 5CH9A 3K8KA 3ABZA 1B1YA 3BLFA 2B7NA 4D8AA 2V8ZA 4EAMA 2XVNA 4Q4PA 3EX1A 4AD0A 2I17A 5C70A 1VFHA 1OF6A 4HU3A 4ML9A 3DG3A 1ESWA 1E3XA 4G7EB 1H49A 3FX4A 1R3SA 1FY6A 3QXBA 4NSBA 1AMKA 2OCZA 4E3VA 4V33A 3AIQA 1GQLA 2E5BA 4DJED 4EXQA 1LWIA 1EJSC 1K6WA 3AMKA 1TV8A 5I5RA 4C6DA 5FJRA 3NQVA 4LWWA 2FMNA 4FX6M 1LM1A 2HISA 2NX1A 5HMFA 2G50A 2E0PA 3P62A 1TYGA 3NZQA 1B31A 1T8QA 2ZZ7A 2XVLA 4XD5A 4LBRA 4PTXA 1DP0A 1KQZA 3W24A 4IFOA 3WBXA 2ZX8A 4LF1A 1ZBKA 2WM1A 2Y24A 4E5TA 1EPVA 2F38A 2EJAA 2VXNA 5LSMA 4L65A 4CEUC 5JU6A 4GABA 2AGKA 4ATLA 3FK4A 5I02A 3O6CA 1QVBA 1Z42A 5BYWA 4I9TA 4US6A 1J0ZA 4GUGA 3OG3A 4FS9A 1V0KA 2FYMA 4LQ1A 2CLHA 1LL6A 1VLIA 2E09A 5G1MA 4O11A 3B3DA 1UP2A 4JFTA 2GGEA 4ZO9A 3FY1A 4UNLA 3VDBA 2VENA 4OVXA 3DFHA 4NZ1A 1JPMA 1XIIA 5EL1A 1Q5MA 4L9XA 3B0YA 2VC5A 4YHGA 2E6YA 2HEJA 1SO6A 2DSZA 2GGJA 3LX9A 3QYQA 3MUAA 1QI0A 3M7WA 2IPWA 4FALA 2VEGA 3VNZA 4CEXC 2WVVA 2X0HA 3N1AA 1W3LA 1LP6A 2HMCA 3NO5A 4DY1A 1A5LC 3GXTA 3OTRA 3GYCA 1OYBA 5EU9A 4UWMA 4L6HA 1G4TA 2YA2A 3FKKA 2ODOA 6XIMA 4IJRA 1EDGA 4LYKA 3AXHA 3UXKA 2H90A 4I9MA 4K38A 1KFJA 4WKFA 3W1PA 1GOMA 3N12A 3CL6A 1RLDA 1H60A 2NXIA 1JQVA 1PAMA 2QPSA 3R58A 4HPJA 2WCGA 5MF5A 4XD4A 5EYWA 3V0TA 2RDXA 1J6PA 3ZM8A 4PBEA 4PTWA 4OIFA 2GOUA 1S2UA 1UBSA 2ISFA 3QMSA 4P5UA 1QUMA 3LPPA 1XLCA 3VKCA 3F5LA 3DBPA 3K4DA 4IG2B 1C8XA 4NX0A 4BFAA 2OSXA 3IJ9A 4GA8A 3TSMA 3H53A 1LLZA 1TWZA 2KZHA 1P0KA 4MZYA 1XBXA 2V2HA 3E0FA 4PMJA 1A49A 5F4WA 4FXSA 1F6KA 1JDEA 3P6LA 3NQBA 3PJTA 2W0UA 4DPQA 3E0LA 4US5A 1XIEA 1SR0A 5LA1A 4RE3A 4QCFA 3UNDA 3QRHA 4S3FA 3WJSA 1XD1A 4V27A 3FN9A 1DXEA 1K9TA 2INZA 3RU6A 2Y5JA 3SCWA 3MJMA 4NKCA 4JD4A 3S2LA 4R3UA 4UNIA 5E09A 2D0FA 3WL1A 4JYDA 2CXEA 3LCFA 3DH7A 5D2XA 7TIMA 4M8UA 3PJXA 4MNKA 3P0WA 3NQGA 1WA3A 2VQTA 1TV5A 4WXYA 2WHJA 4DNMA 5D37A 4POCA 4ZA0A 4YTRA 1SVDA 1JGIA 2CNCA 3EMQA 2HS6A 2PRMA 4NUWA 1ISYA 3R94A 3WQEA 1NQKA 2VFFA 4UR9A 4IQDA 3HQ1A 4XISA 2H6RA 4L4MA 1U1UA 3KBWA 3NNTA 1DTUA 1VF8A 4HA0A 4B5XA 3GDKA 1SZFA 3NQ6A 3VCCA 1ISWA 1ONXA 2ZE3A 5CG7A 3PPCA 3M47A 4A22A 2VM8A 4AC1X 2QR6A 1OIFA 7PTDA 1HQTA 3W3OA 1GVEA 2C91A 5B7YA 2TODA 4JTAA 4JKKA 4TR9A 3RIKA 1TR1A 1GW9A 1GWJA 3N9RA 4NRRA 3U7BA 4CCDA 4AX6A 1YQ2A 1VB9A 3E38A 3H55A 4ZSUA 1OD0A 3BOFA 1DWIM 4HZMA 1TFVA 3EWWA 2OT1A 1KV8A 3FSTA 1JRBA 1G69A 4S3GA 3BLOA 3OBKA 4GNKB 3CH0A 1F4HA 4DYEA 5K4XA 4ZE5A 3U8GA 3GDBA 3BMWA 5CAHA 4WY0A 4J3WA 2OWXA 4DF2A 3BL3A 4LY4A 3LGEA 3M0KA 3L4WA 1FHDA 3V0SA 2EHHA 1O5KA 3S2MA 1RAKA 2NW0A 5LNSA 1MFUA 1E55A 2XN1A 2C7FA 3MHUA 3VD5A 3V5OA 4UFIA 1S3TC 4EF9A 2ZA2A 3DERA 3K4WA 1OZMA 3CIVA 4DPPA 2CZVA 4XUYA 3WNMA 3KDOA 5J04A 1A5OC 3H21A 2AOSA 3B97A 4PRWA 4UTWA 1KBKA 3W00A 4WD0A 3WQ8A 4XG1A 1H0GA 3E02A 1OFRA 3DECA 5AHIA 1OINA 2Z7KA 4C91A 4MFDA 5HNTA 3ANVA 4DBWA 1DJGA 4XV0A 4NI3A 2VNCA 5LIXX 3NEHA 5G2HA 4EANA 3NVDA 1GVRA 1KXTA 2Z28A 2GSHA 4UTWC 3NL5A 1E4IA 4AF0A 1IV8A 1XQKA 1QDSA 1TUFA 1FWFC 3QYSA 4LUYA 2JQXA 3GG7A 1D8CA 3FW6A 4ERAA 5DY3A 4CNUA 4KWUA 1M1BA 4BF5A 4HHLA 1JCJA 3NSMA 4XVEA 2A7NA 4H9MA 1EX1A 5LA0A 4UR7A 4AU0A 1LL7A 3CZLA 3QW4B 3WQ4A 1M01A 4JX4A 1XR2A 4KCVA 3VGHA 4FLRA 4IP7A 4HP5A 3DI1A 3RM4A 3W1XA 4BCEA 1HO4A 1H0IA 3S1UA 1HX0A 2PC4A 1SMAA 5I03A 3WUBA 4O8RA 2E7FA 2QEZA 2CXGA 4NNBA 1G1YA 1K02A 4UIOA 2D23A 3L23A 2DZPA 2XHYA 4QG8A 3A3WA 2WVTA 1US2A 2WBGA 2BXYA 1TTJA 3CS2A 1VIZA 2IXVA 2DIEA 4W4QA 3WUFA 2Z26A 1DVJA 2BB0A 3QR0A 1A0CA 3LQGA 3STGA 2BOFX 2FGLA 3WLSA 3W7GA 3FLUA 4JDYA 1HF6A 4MB3A 4L1WA 2G4FA 2P1FA 5C5YA 1FP9A 4JNYA 1AQMA 2O9TA 3NQEA 4AD3A 3S5NA 4C6LA 1F9CA 4C6QA 4D8ZA 2J27A 2GUUA 5D32A 5FACA 3U3HA 3LCXA 1J93A 2C8NA 1TR9A 5TBOA 3VIGA 2GL5A 4L6DA 1EF3A 1F8MA 1KTBA 4C65A 4MTVA 1B30A 1YE4A 4LCSA 4WJ8A 3WQVA 4J2PA 2F84A 1GONA 3KXQA 4JY8A 4LV4A 1EQCA 4RDWA 4E2BA 4YJ5A 4CQ9A 1GYNA 3RK8A 2OGYA 1ISXA 3VIKA 4EAYA 4LX4A 4WRHA 1EKOA 1UD8A 1J01A 4IIDA 1G9HA 1UWQA 1XSKA 3GUGA 4MLJA 3CMFA 1H62A 4F8XA 3PSWA 3UU0A 1DIDA 4GIRA 1RSCA 2EF9A 5XIMA 3SZ8A 3VC6A 4A8NA 5ABHA 2ZWYA 4LXFA 1VEPA 3GUWA 1MEWA 4BKNA 2V3FA 3W2UA 2IKGA 3S2NA 3T2QA 2YBTA 2ZUUA 2OWCA 4AC7C 1SFSA 2GVEA 2RDUA 1DJIA 1U5HA 1U2YA 3GC2A 4LPCA 1K7FA 3W4RA 4DYKA 2I5GA 5F7UA 1DV7A 3PZIA 1ONEA 3FXGA 4F40A 3ARXA 1TELA 1BYCA 1DJXA 4BR1A 4XZIA 1PHQA 4AZCA 2QGYA 4GCXA 3SGZA 4XZ9A 4UFMA 1TWDA 4LV9A 4WSJA 2X1SA 1UJQA 1NU5A 1VGAA 3WF0A 2PDNA 4DB7A 5C9WA 2OQLA 1UKTA 4REQA 1E6RA 1UD4A 1FWHC 4ORMA 4Y8EA 3BARA 3ARPA 3N6JA 4E8DA 4F0KA 4DZHA 1PUDA 1K03A 1S1PA 4JKLA 2VHLA 2Q3RA 4NZ3A 4CQDA 3CUXA 2GPTA 2Z1XA 2G3IA 4GFIA 1QO5A 1YYAA 4EOUA 1K7EA 3PTDA 4BS0A 3L21A 3UWEA 3VOGA 3LGDA 1OC5A 3EB3A 2Z2BA 3L5AA 1CECA 3W25A 4R85A 2NVCA 4JTFA 3LA4A 1EPXA 2VELA 2VR4A 2JGYA 2WC3A 5EBAA 4U5KA 1KR0A 1G4EA 1UKPA 4AVOA 2JKAA 1EBGA 2YXOA 2NT0A 5A6LA 2ISWA 4IFRA 4MLRA 2XFYA 3EPOA 3CUGA 1RP9A 3AHYA 3FYYA 4JFUA 4Y6GA 2XIOA 1FHLA 3VK5A 1M6JA 3ZJ8A 3RX3A 2AL2B 1S5TA 1GEQA 4IZGA 4HU0A 3N34A 1DWAM 1QW8A 3CZJA 4OGZA 2QCMA 3EWXA 3AROA 5DMNA 2X1TA 3IGUA 4OZOA 1OFBA 3MJYA 2GJNA 3OGSA 1CDGA 4Q8NA 3W7IA 4IMCA 4E2VA 4C6EA 3MHGA 2PTYA 1UKQA 4A4AA 1G94A 2QT3A 3ES8A 4B92A 3KE0A 1A5MC 1ISVA 4RE4A 1EHAA 5BWFA 5I3DA 2Y62A 3BW3A 4TXEA 4IM4A 3M0IA 4H83A 5AY7A 2IKIA 3BK0A 3CV6A 3NYDA 4LBUA 3IWPA 4QSHA 4D6IA 3R43A 2OELA 3B0VC 5HJYA 3EWDA 1POJA 4Y9AA 2QLYA 3WQFA 2OODA 3C2OA 1K8ZA 3UETA 3UCDA 4RZ4A 3G22A 3NAVA 4Z1AA 2UY3A 4PCTA 1XIMA 4AW7A 5C9ZA 2R8WA 3JVAA 4R7OA 4K39A 3BV4A 3CPGA 4L64A 5JUVA 1NTHA 4NG3A 4B5TA 5C9XA 1DE5A 2E9LA 5CJ5A 3MKCA 4CNSA 1TX0A 4MPKA 5BCAA 3FA5A 4UQAA 3DCPA 4HNLA 2JKPA 3P61A 1O5XA 2CLMA 3L0GA 3TWAA 4ADTA 4ZOBA 3S9IA 1WDQA 3JRKA 1TPVA 4UTFA 1JAEA 5E0KA 5ECVA 3QBUA 4H01A 1HG3A 4HPXA 3FSUA 5DT7A 1IR1A 3K4AA 3OGRA 4K8GA 3VTRA 1AH3A 3MDUA 4AAJA 3HJZA 3LRLA 4HJFA 3TEVA 2C0AA 2PB1A 5CPOA 1B3YA 1N7KA 5BRPA 4O1BA 4CKQA 4IMGA 1SUXA 2ZRVA 1PX3A 3GZ3A 1TWIA 3GHTA 1YDNA 1XBZA 4UTHA 2VZSA 1XJBA 3BAXA 3ZFHA 1KW1A 4MWAD 4FOJA 5F2IA 4KPLA 1CNVA 4JZ5A 4LH8A 2NV9A 3SRDA 2ZZ3A 3GBEA 1IQ8A 2OVLA 3MP5A 3T4WA 4L4OA 3U2ZA 5MKGA 1B3ZA 2ZQ0A 5T91A 3W26A 3GTNA 2ZA1A 4WJXA 5TIMA 3R0DA 3PPFA 5GNZA 5GNYA 2UY2A 3STEA 2YB4A 2G97A 2MNRA 1CPUA 4AY7A 3OVRA 1CLVA 4QJ3B 1O68A 1V3IA 4WQ6A 1KBIA 3ATZA 2FGBA 1X6NA 1A4MA 1ZUAX 3L12A 1CZ1A 1BGAA 3CM4A 3FVDA 3PBUA 3QTPA 5JMUA 2XGIA 3THQA 3CWOX 1Z3NA 3GAYA 2X2GA 1EEPA 1YTDA 4QDMA 3TH6A 3G1DA 3KX6A 2OJPA 5A6KA 2Y2WA 4ZBCA 1KCXA 3CB3A 1E51A 4W86A 3CB8A 1FA2A 2QDGA 5TNVA 3HTWA 5IDIA 4HU4A 5AC6A 1PZ1A 2C18A 5MHBA 2FVKA 3REQB 3TUUA 1V02E 1X6UA 4PGLA 3UY8A 2GSEA 1KBLA 4ACZB 1MEHA 3H54A 2PCEA 4AVFA 2YZ5A 4C6IA 4FX7A 3NJ3A 1I1WA 5AHFA 1GG0A 1EB3A 4Y9MA 1E0TA 5JXQA 2X1UA 2YFOA 4NZJA 1WOAA 1JJKA 3CUZA 5HA7A 3CEUA 3GDLA 4S38A 1OB0A 3CH9A 2ZXDA 1JI2A 3H4XA 1TKKA 4IPJA 4KWWA 2MANA 3E6EA 2DH3A 1XXXA 3P60A 1CLXA 3HOJA 4J3SA 3HU7A 5DQPA 4JY9A 1SO3A 4IMEA 4WK9A 3AC0A 3KM8A 3WY1A 3EOSA 3AHXA 2P50A 4R9OA 3CHEA 1GKQA 1HJVA 3GR8A 4V28A 3TNBA 1R7OA 2FMOA 1NM9A 1VHCA 5IBXC 1D8WA 1XIGA 2BY2A 2Q09A 2ZRUA 1C93A 4ZB2A 1J5TA 1GG1A 3WZ0E 1KNWA 1ME8A 2G3JA 3QM3A 4RZBA 3PTKA 3EYPA 1XM3A 3GX9A 1QPRA 4INFA 3H2MA 4GJ1A 4GNJA 3LCHA 4PMVA 5H8UA 2PGEA 4NJGA 1SMDA 2X1RA 1JDAA 3ZJ6A 4QJ5B 1FFQA 1UMLA 4HNOA 3T81A 4OECA 2QCEA 1SSDA 4Q8UA 3TTSA 2UY5A 2PDKA 3XINA 2INEA 1L6WA 2PAJA 2PLCA 1PCKA 1OFOA 9CGTA 1TZ9A 3BUVA 3AIWA 1WDRA 2CLPA 4HSOA 4W7UA 1VBJA 5CC6A 3DYMA 3Q67A 2DQWA 2J79A 1BRLA 3KRUA 3W7PA 3W22A 2J77A 4PUUA 4FOUA 3VKKA 3W27A 1XGDA 2H8XA 1O7AA 2CCRA 2GUYA 3VA8A 1R3YA 1X97A 1KGWA 1JZ2A 1YW1A 3PZOA 3GH5A 9RUBA 3W7QA 3KFTA 3MI6A 1W56A 1ICSA 4XK2A 1JDDA 3N15A 3MY9A 3U2CA 4JTJA 3PZUA 2PDHA 1E5JA 3FDGA 1TV4A 3AS1A 2D20A 3ZVIA 4QDWA 3BICA 2JBMA 1M7XA 3W7LA 5F1UA 1EGZA 2GDQA 4WJEA 1X1ZA 3MUY1 3NPWA 1ME9A 3L2IA 9XIMA 1F61A 4RX0A 1Q13A 3LI0A 4WKAA 1W9DM 3H2NA 5FSDC 2WCSA 5FKYA 1JD9A 1KA9F 3UGRA 3C0LA 2WMIA 1W2VA 4QLKA 4YTUA 4IIFA 1BKHA 3I6TA 2YB1A 1OK4A 1H41A 5M5DA 2CU0A 4C6CA 2Q8ZA 4FAMA 4EVZA 1FUYA 3A5VA 2NX3A 1X8FA 1TPDA 3ARZA 3LV5A 4Q3MA 2A3AA 4MHBA 1SGJA 5AYYA 3EA3A 4FNTA 2QXWA 4X0VA 3TFXA 1VJIA 1Z48A 5AECA 3ELFA 3M43A 4S2BA 1E71M 3VCNA 7ODCA 2XUCA 4HKPA 4D6HA 1EP2A 1VPYA 2CETA 4NU7A 1EH9A 3WF4A 1L8NA 4O1DA 3STCA 4AZGA 1RBAA 2GJRA 1ZHAA 2FZ9A 1O5RA 3WLJA 1PL9A 3G8RA 1VQTA 2VZUA 4QTGA 1ZGDA 3KS6A 4PMDA 3D3AA 5I6SA 4UMCA 3MCNA 5BMXA 3B9AA 2GJXB 2PU1A 1OCQA 2YSWA 3PNZA 1J8VA 1O60A 5JBDA 2Y89A 4FIRA 3QOMA 1DKWA 3T6CA 4K8HA 3QKZA 1A3XA 1ZAHA 1UR4A 2Z00A 3NL3A 3LHWA 4MJ4A 1D2KA 1PHWA 3C8FA 3W28A 1XLEA 2QNEA 3SUUA 3UG5A 4IWWA 1JPHA 4WZHA 1W3JA 2X7WA 1F6PA 4PCSA 3AXKA 1US3A 4YCPA 1TRIA 4HA1A 3DC0A 5HWMA 1VR6A 4OV9A 1LQ2A 1BQGA 2Z1BA 4IT1A 4GCAA 1E40A 2ZZ4A 1BWKA 5C7HA 2CLOA 5G4WA 3SJ3A 3O2LA 3EXTA 4OOUA 3ORWA 4DIAA 1F2JA 1TCDA 1QOQA 2R94A 4LJ3A 4TX8A 3RLHA 1KFKA 4WOZA 5ABGA 1TWSA 4F9JA 1LRNA 2OLAA 1Q6OA 3ZOAA 1I45A 2F6KA 4CU8A 4L9ZA 1VKFA 2OKTA 1TPFA 1NELA 2WANA 4S3DA 4R9XA 3MMWA 3NOYA 3AFBA 1SYTA 3VDHA 1U22A 3N29A 1P6CA 4AXNA 1NFPA 4IIHA 2FZ8A 5C2XA 1I2QA 3FFSA 3WLLA 3TQPA 5HULA 3B0XA 3BANA 2FHCA 4QXIA 2WOQA 1TMQA 4FNQA 3SEPA 2V0TA 3BPWA 1HNYA 2XDFA 5D8ZA 5BWAA 1DJHA 1FHVA 1FRBA 2PFHA 3KHJA 4JQAA 3P74A 1U5JA 1QWKA 4RE0A 4ZQNA 1DE6A 1QBBA 4ERIA 4GRSA 4F48A 5HQMA 4OBSA 1UIPA 1CWYA 1VCGA 2ALRA 4O15A 3URBA 4AD5A 4E8GA 1OFDA 3BCDA 3HG2A 3ARQA 2CHNA 4ZFMA 4OTKA 6XIAA 3QPEA 4W9TA 1ADOA 3DESA 5LGXA 2FB2A 3KEHA 2F8QA 2AQOA 1SW3A 3V16A 4DLMA 5KZDA 1MDRA 3AYVA 4KRTA 1TV2A 1OADA 2DORA 1PYFA 4D1IA 4JEJA 2V5KA 3AIUA 4JTSA 4QRNA 2WZIA 1EC8A 2FZDA 2EPLX 3SJNA 2QCDA 3BV7A 2BHZA 3NO3A 2H3BA 1BXCA 5FCZA 3AMCA 4BHYA 3NWRA 4IMFA 3LU2A 4H00A 3ZZ1A 1I8JA 2A3LA 1K1DA 1SJAA 4H9UA 2GFTA 1QAPA 3KP0A 2A21A 5D4YA 4IP5A 4B5NA 1JXKA 1ONRA 1EFZA 3MZNA 1C9WA 1G7UA 1FWTA 3U5YA 1K9DA 4CVWA 2I7GA 1ZBWA 2MUCA 3VKDA 5E70A 5KZ6A 4LYRA 1J5SA 3ABSA 3GXDA 1WBHA 3CPUA 4W7WA 2FLIA 4WDUA 3RUBL 4O8AA 4UFKA 3SIZA 5A2AA 1UZDA 2OYMA 4YIWA 1PDYA 3KTCA 3MHFA 2X41A 4WR3A 3K13A 4HT3A 3WELA 2WB5A 1W9UA 1EIXA 4AH7A 3FJ6A 3KAOA 1JXJA 4BI5A 3URQA 2ZXAA 4WF7A 3R25A 3AZSA 3H7VA 2GVYA 4I9JA 3NDYA 5KETA 3V1PA 4MB4A 2J8GA 4LEQA 2QJNA 3TSDA 3D0CA 1X7IA 2DP3A 3FGCB 1OZQA 1P48A 5BNKA 2ISDA 3SO7A 1B0IA 3I65A 3FJLA 1IYXA 3AOFA 2E8YA 1V0LA 2XG9A 1U83A 1V08A 5M1TA 1I6NA 4EP8C 4Z2JA 5A8PA 2Y5EA 3APYA 1MSSA 5C2GA 5LNRA 4MVAA 1E0XA 4ZQRA 4GLEA 1THFD 4IUOA 1WO2A 5FI8A 1AW5A 2P3EA 4AHOA 4HK6A 3GVQA 3UXDA 1T6MA 2R1MA 4NHVA 2C1HA 1JD7A 1C92A 3HJEA 4XSLA 3LRMA 5HR6A 3A21A 3OB8A 4M51A 5D9NA 1B3VA 2CFFA 4HNVA 3IJDA 4ZXOA 1S5NA 3OBEA 2W27A 2Y63A 4MM1A 2WZTA 3T8LA 3GH4A 3F1QA 1QPNA 1X1OA 4IOTA 1DJZA 1V7AA 5M17A 5A6BA 1BRLB 3LSCA 2WMGA 1UPMB 3EMZA 3P8JA 1PIFA 2F7FA 4O12A 3B0PA 5GNXA 5D9OA 2AMGA 4LUIA 3TVAA 2BV9A 1PKYA 4RNJA 3CNYA 1TPB1 3S1WA 4X63A 2QAPA 1M03A 1V5XA 3G0UA 4HZ6A 3LMZA 4NQ1A 4O4VA 1OEPA 5D04C 1P1XA 4MWAC 1U1JA 3BC9A 1ZS2A 3QLLA 2J88A 1OSEA 5A94A 2XWEA 3IAPA 2FVLA 1NOFA 3O1NA 5FEZA 4HPNA 1ITQA 4L1GA 3WFZA 4L61A 1XLMA 2VX6A 3VOJA 1VRXA 1P5BA 1MYRA 1LQ0A 1RVGA 4QEHA 1XG3A 5H6HA 5DANA 4HHHA 2E1WA 2ZUVA 4LB3A 1J0HA 3VOIA 3VKAA 5EY5A 3HQPA 5FF2A 5H91A 1IZKA 3IIVA 4QEEA 2E3ZA 2E25A 5DBTA 3G5EA 4HGXA 4FEZA 2X09A 2B7OA 3CQ0A 3KZSA 1RPKA 4YXGA 1MQQA 2GVLA 3PZGA 1NDVA 3W23A 2Z2AA 4WX2A 4F0LA 3SSJA 3VIMA 1FWRA 2R1LA 3NPXA 4BF7A 1H1ZA 1EXPA 3MWAA 3C5QA 4KIRA 3GW0A 2RJGA 4OUEA 3UZZA 4J5NA 3AS2A 4A3RA 4XVDA 4CN4A 1TMHA 4CCCA 2DVXA 4F4RA 1F4AA 3EMCA 1VBRA 3F4CA 4GUIA 3QSRA 5EMUA 1F05A 1OYCA 1MXDA 4EXBA 1QW9A 1TJ1A 2PDUA 4FF7A 1H7NA 1QNPA 3PPGA 2O9RA 4RLIA 4DQWA 3LCIA 4GZIA 1FWEC 1EXBA 1ZY9A 3WDIA 4H2CA 3VOCA 1QOXA 2BDQA 1QI2A 4XBJA 2A0NA 4MNMA 3SCPA 2V9DA 4LUSA 3N25A 4Q7NA 4UNKA 3WK2A 1ZB5A 3ITLA 4TIMA 2Y8KA 3H7RA 4V1XA 2PDMA 1XS2A 2C15A 3OYXA 2BOEX 1X7FA 3V18A 3PR2A 3KVMA 4AY1A 1FBAA 3URNA 3A24A 3A4JA 3AISA 2CZEA 2DJXA 3AUOA 1K3UA 1P7TB 3OPSA 2E8ZA 4C6BA 2X40A 3E5BA 3KOWA 4GOAA 3LHTA 3QHMA 1X38A 5IHSA 3JS3A 1M41A 3VE9A 3EZ4A 3EKGA 1E9YB 3WK1A 1AL8A 2VRKA 2W6RA 1MQRA 2DW7A 3O7UA 1XLGA 1XH1A 3UG4A 2AAAA 4LUTA 2WQDA 4AVNA 1J79A 3RRAA 1AK5A 4H8UA 4UOQA 4FF5A 3GU2A 3LHYA 1Q8JA 1XBVA 1SFTA 1Q6GA 1LLWA 1V6WA 1W5PA 2C6QA 3TR2A 3A23A 2HROA 3OOQA 1A80A 3GG8A 3QPZA 3EBVA 5FL0A 3IAQA 4WY0B 1YPXA 1XI3A 3QR1A 5CBJA 2A6NA 4PCFA 1PYMA 1GORA 4R7WA 2RDWA 3VNLA 3N73A 2XTKA 1QPQA 1BTCA 2EQDA 1YLVA 1KM0A 1ODZA 1JNEA 4DJEA 3W1UA 1W1ZA 3GHUA 4NNCA 4AY8A 4E3TA 1SFJA 3VNJA 4Y8FA 3R12A 3EWCA 1XUZA 4H04A 4P8XA 3UESA 3BSMA 4WDXA 4WDTA 4B3KA 4F66A 3TTQA 1Q7MA 2NQLA 2VJXA 8A3HA 1OGGA 3SN4A 3B4UA 3WF3A 5LIYX 1G0CA 4ZVJA 2OZ8A 3VGDA 4M24A 4WSKA 4B5UA 1RD6A 1S5VA 1TVLA 4FIQA 1ZJBA 1CW2A 5LIUX 3AU6A 2Y0FA 4MDOA 1O1HA 1U33A 3BG9A 1S2TA 3B04A 2DIKA 5JBEA 1JZ7A 4C7GA 2HWGA 1I9CB 3RITA 1W6TA 3PG9A 1CLKA 3P3BA 3KW3A 1HN1A 4ROPA 4AYGA 3HBLA 1OFQA 2FTWA 1GOQA 1QOPA 3ZJ7A 4XB3A 3TNOA 4I5XA 3IARA 5I24A 1TZ7A 2FGZA 3UCCA 3WLKX 1VBUA 3M46A 4ZO6A 1GYLA 3BAKA 3PHAA 2XPKA 2A79A 3QEZA 2WVUA 4DEFA 1FX6A 5TF0A 2XIJA 3WH5A 2QW5A 1ML1A 1XGZA 2NSOA 4M6QA 5IXEA 2PU0A 3DDMA 3R11A 1VFMA 1GKRA 3HG5A 4P2VA 4GG9A 1IWPA 2WPGA 1GVIA 3M5ZA 4DAFA 1P7TA 4YL2A 2CKSA 3S9ZA 2F61A 3LI1A 2C0HA 4EKJA 3QY7A 3QN3A 4YU1A 2OR2A 2WMIB 1H50A 1HJQA 3PPHA 2OYLA 4W7VA 3TR9A 5CEWA 2Z6IA 4GH3A 4DXVA 3R89A 3C0JA 5L6UA 5GPRA 3W29A 1IXNA 1NY1A 2QUMA 4PRTA 3WUGA 2WSQA 3NPVA 3EB4A 3THCA 4S39A 2KX9A 1OY0A 1HKMA 4HBKA 1KFWA 2BVDA 3B8TA 2PBOA 2HXUA 3H2FA 3VX1A 2IPJA 1IT8A 1XLDA 1R3RA 1OC6A 2R91A 4NRSA 3O0FA 2EPNA 1QK2A 1XC6A 1SZNA 1UCWA 1X1NA 3A9BA 4LS1A 5M2FX 5AC7A 2Q02A 1E9LA 4FLQA 1R38A 1FKWA 5A6AA 4CD7A 1FDYA 1M7JA 3I4KA 3WDPP 4LRSA 4GWEA 2V38A 3AJ7A 2YPIA 5EA9A 2GJPA 4RPPA 2J7BA 4KERA 4X22A 3E0WA 4XO7A 3P5YA 3UZXA 4H9XA 3CTLA 4YYCA 4IQJA 2QUNA 2CHOA 4DAIA 1B3OA 1E56A 1ENUA 3EAUA 4GYJA 3IRDA 1UR2A 2D0HA 1R85A 5FJPA 1REQB 4NYYA 3NFUA 3E9AA 2A3HA 3V75A 5U7SA 1BQCA 5E6ZA 3UWYA 3QPYA 1LORA 4GYKA 4LGXA 3UG3A 2YLAA 3AWNA 4C6PA 4XZHA 5K3VA 5FF0A 4GY0A 1ZTVA 2BP1A 3GXMA 5I00A 3P5ZA 4K8EA 4Y9OA 1Q6FA 1XPGA 2PGWA 4LCQA 4A3YA 3SN1A 2QV5A 2DZTA 2VCCA 4HA3A 3U6WA 4MY1A 1S46A 1YMYA 4S3EA 2J62A 4GQRA 4W85A 3AYRA 3COTA 3RM8A 3MV01 2YKKA 3UYCA 4GE8A 5DT5A 3G77A 5IRPA 3NQCA 4YN5A 2RHGA 3Q37A 4JN8A 6TIMA 1GPWA 4QAIA 1JDCA 4JCLA 5A3HA 1QW7A 3BTNA 5CPSA 1N8FA 3BAWA 3MV11 1TZZA 1ZCOA 5U4NA 5E6YA 4W89A 3G1RA 3WQWA 2CWNA 2JEQA 3O06A 4G1KA 2I9UA 1DIEA 1AW1A 4ZCWA 4F79A 2FHBA 2ON3A 4IPPA 4KFNA 4D6GA 4TUFA 5HJLA 1OCJA 4K37A 2O7SA 1XISA 3L2MA 5LXEA 1EL3A 2DSKA 4G7EA 3FAXA 3IJ7A 1XFCA 4MPQA 3IEBA 2O55A 2QV4A 2NXGA 2Q01A 5CCZA 2WHLA 5DELA 4Q4MA 5IHRA 1W54A 3GIYA 3R0UA 4WOQA 1I75A 1B2YA 1TTPA 5DMLA 5HUPA 4PTVA 1W1B1 4G56A 3E3HA 1EO7A 1ZJIA 3UXLA 3P80A 3A4WA 1FWIC 3LGGA 4RL3A 5AHEA 1BPLB 4WGHA 3U4AA 1WKDA 2X05A 5DXXA 4Y9NA 1VC4A 3L65A 3V36A 4DELA 5F2MA 4O1EA 5BXTA 3CC1A 3U2EA 2NSXA 1LYXA 2D24A 4Z2LA 5TAOA 3FGCA 2WC4A 3WLRA 4XO6A 1W3IA 1MRQA 1U30A 1SW0A 4XKMA 1ZALA 3TYEA 1G6CA 3CIWA 4ZO7A 3WDHA 3QHNA 5KINA 5D38A 2HBVA 3W75A 4TV5A 3HURA 1ZBVA 3MWCA 4NT0A 4FLOA 3RO8A 5A6MA 1NWRA 1ZLPA 5JIPA 3CT2A 4TTUA 5I09A 5CBIA 3FEQA 2I1OA 1DEDA 2WZEA 3QFWA 4PUMA 5I3FA 3PAJA 1ZJHA 3MBDA 3SCRA 1MW3A 3QJAA 3VC5A 2BS9A 2L5HA 3V4BA 1VAHA 2A3BA 2W66A 1XWYA 4E0CA 1AODA 3OYZA 1AQHA 4X9SA 3QC0A 3EDKA 2D2HA 3P7YA 2DVUA 2A3CA 3L0NA 1SM9A 1XIBA 3LZ5A 3NQ8A 1VPQA 1BFNA 1VHNA 5A8GA 2EG6A 3WIJA 2FFCA 4GVIA 2VO5A 6ENLA 4JPGA 3TLQA 1VFOA 3NDZA 1LZOA 1QI4A 3IRSA 2XZ7A 3EX6A 1KC7A 4H9YA 2D22A 1A0DA 2ZA3A 3GDRA 2IPFA 2Q71A 3IJIA 2DH2A 1PZ3A 4G5DA 2YIHA 4DHGA 3T08A 4D2JA 3EEZA 5BMWA 1IHIA 1F5ZA 3SI9A 4O53A 3XISA 2VT0A 5I2UA 4DF0A 2ICSA 4C6OA 4QAWA 1ZPTA 2PP1A 2YDRA 3CWNA 2IQDA 4FNUA 3VNMA 1FCVA 2DY3A 3E49A 2W61A 1WZLA 5JIWA 1M7OA 1Q6RA 2V5BA 2HQAA 3MSDA 4PMOA 5ABEA 4WVXA 1S2VA 4XBSA 4HQVA 6A3HA 4M6VA 4YPJA 1FP8A 4KCTA 3V7PA 3PY2A 3BXWA 4KEVA 1O94A 2EG8A 3BDKA 4R34A 1UOKA 2YDAA 4PL1A 3PSVA 4JTHA 1VRDA 3IJ6A 1JAKA 2VFHA 2VFEA 1VENA 2G4JA 3KL5A 4P8UA 1V6YA 1J0YA 3GYEA 2QDEA 3S5YA 1J0KA 1FTXA 1DJWA 2OQHA 3I3BA 4M29A 1M7PA 1KRCC 4FMVA 2BLEA 3QQ0A 3LBOA 4JIEA 4QE1A 3ZWTA 4WHBA 1C7SA 4D9PA 5G2IA 3TK7A 1RY0A 1SO4A 1S5WA 3E0VA 1GVSA 3RM9A 1WPCA 3PC0A 1AJ2A 3W1MA 4CD5A 4X61A 2ZX7A 3LM7A 1H09A 2J13A 4URIA 4XZBA 2ZRYA 3GXNA 4GINA 2JE8A 3QV7A 3SUTA 4NJKA 4ROQA 4PUNA 4DBEA 3T2OA 1LWJA 5J5DA 3RGTA 4MAVA 2HSAA 1JFXA 3SN0A 4N4QA 4MOZA 5T26A 4OBRA 2XH7A 3RLUA 4JKMA 2BY3A 1J0IA 1R8LA 4KWSA 3W7KA 4GI6A 4HVXA 1KM4A