5ECUA

The unliganded structure of caldicellulosiruptor saccharolyticus gh5
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
350
structure length
350
Chain Sequence
b'TAYEKDKYPHLIGNSLVKKPSVAGRLQIIKQNGRRILADQNGEPIQLRGMSTHGLQWFPQIINNNAFAALANDWGCNVIRLAMYIGEGGYATNPQVKDKVIEGIKLAIQNDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIAQKFPNDFHIIYELCNEPNPTDPGVTNDEAGWKKVKAYAEPIIKMLRQMGNENIIIIGSPNWSQRPDFAIKDPIADDKVMYSVHFYTGTHKVDGYVFENMKMAIEAGVPVFVTEWGTSEASGDGGPYLDEADKWLEYLNANNISWVNWSLTNKNETSGAFVPYISGVSQATDLDLGSDQKWDISELSISGEYVRSRIKGIPYQPIERTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title The structure of Caldicellulosiruptor saccharolyticus GH5
rcsb
source organism Caldicellulosiruptor saccharolyticus
molecule tags Hydrolase
total genus 132
structure length 350
sequence length 350
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
A PF03424 CBM_17_28 Carbohydrate binding domain (family 17/28)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5ecuA00
3GZAA 1V3HA 1ITXA 4J28A 4HMEA 3ZMRA 1G5AA 1C3FA 1H2JA 3K8KA 1HKJA 1B3WA 3ARTA 3SCWA 3LMYA 1R86A 1VJSA 3OGRA 2DSUA 3ZT7A 1OINA 3U7VA 1KBBA 1E73M 1CGWA 3NDZA 3WEMA 2YL6A 1BG4A 3CMGA 1W3JA 1CXEA 2WZIA 2GDVA 4M8UA 3GBDA 2WVVB 2E0PA 3AXIA 2Z1SA 4WSJA 2DGAA 4Z2IA 3WD3A 2O9OA 7CGTA 4WSKA 4PEEA 1CEOA 4NRRA 1E1EA 2WW5A 4W8BA 1GOQA 5A6AA 3VIOA 1C7SA 2A3CA 4BQ2A 3AICA 4ACYA 2V3EA 5C70A 1V0MA 4TOQA 3WFZA 2D0HA 3ZM8A 4OJYA 3T2QA 1K9FA 1TG7A 5JUVA 1HVXA 3AHYA 4TTUA 2VZVA 4QLLA 3BLPX 1J9YA 3VIJA 3AZSA 3K4AA 2RGLA 4D1IA 2VRKA 1V03A 2WC3A 3WF4A 1X6LA 2XVNA 4L4OA 2YLAA 4UOZA 3PTQA 1BGAA 5E9AA 5M3WA 4W89A 3WDPP 1MW0A 5CLTA 3VNYA 3GDBA 2ZIDA 4Z2LA 2YL5A 2AAAA 4F66A 1NP0A 2J77A 1E4LA 2IXUA 1WNOA 3CUFA 2BY1A 4RL3A 1OGBA 1WZAA 3UESA 2NT0A 1UD6A 1W91A 3BXWA 3POHA 4M56A 3VGBA 3VIPA 3QGVA 3VMPA 1W3LA 1WDPA 4PMUA 5EFFA 1UWRA 1GOWA 2JF7A 4PRWA 1CNVA 2DSWA 3SURA 2OYMA 2W5FA 4CUCA 3GH4A 2Z1KA 1QHPA 4X0VA 4D1JA 1CXKA 1VIWA 1MXGA 3CUIA 3WQ6A 2OYKA 3GH5A 3SUTA 5BCAA 4ATLA 5CG0A 4HA3A 3THDA 4Z2HA 3EDKA 1VAHA 4W88A 1WZKA 3DYOA 3DECA 3AS2A 3PHAA 2X09A 1VENA 4PCSA 4W5UA 1DP0A 1TCMA 3AZRA 4LYQA 1N82A 1EDTA 2PBGA 2BNJA 3MV01 1CXFA 2ZWYA 2FGZA 1JF6A 2XUCA 1E0VA 4MNKA 3WUEA 2J7CA 1UR8A 4JFSA 5CZKA 1BTCA 2C7FA 4ZFMA 2YA2A 3PZVA 3PZNA 3UG5A 4C7FA 4IUGA 1JYXA 3HJEA 5KZ6A 1G0CA 1H3GA 2AOSA 5DEZA 1JYWA 5A1AA 3RJYA 1FH8A 3CUHA 3QOMA 4U3AA 3CTTA 3OZOA 3IJ8A 4WK9A 2CNCA 4QCFA 4PMNA 1C8QA 4RE3A 1CXLA 2QF8A 3N18A 1US2A 3AQUA 4C7DA 1XH0A 5M03A 5KEZA 3WN6A 1V6UA 2VVNA 4FLOA 2CCRA 3RIKA 4MB1A 2OSYA 3TTSA 3PZ9A 5I77A 1J0JA 1JFXA 5A2BA 3W27A 1QI4A 4L4PA 2DPEA 1HKMA 3BLKA 1H11A 4D6DA 1BVZA 2CHOA 1NOFA 2WXDM 4UFMA 4M82A 2FDMA 3B9AA 5AC5A 1E6RA 1S46A 4N42A 5D9OA 1E15A 3CBWA 1UHVA 1HT6A 3W24A 1JI2A 2PB1A 2V38A 4E2OA 2ESCA 4AZ7A 3EMQA 2XFYA 4P8WA 1ESWA 2VMFA 3PZIA 3PN8A 3ZJKA 4Z2GA 3AMLA 2WK2A 3ZSSA 4S3KA 4AZHA 1DWHM 4YHGA 5FIPA 5ABGA 3ECQA 4TVCA 5IDIA 4QLJA 4QCEA 4URIA 4W7VA 3M7SA 3K4DA 2QLYA 2DIJA 1IZKA 5E09A 3NIYA 1BAGA 4Q22A 1EHAA 1H5VA 3VX1A 1V0LA 4B9YA 3BSGA 1JYVA 3WQ8A 1V3KA 1L8NA 2WVTA 1NH6A 4HTYA 2EJ1A 4W8AA 2WM0A 2PC8A 3IK2A 4D6CA 4ATWA 1W9UA 2Y24A 5A3HA 4FMVA 3WDRA 4KGLA 5M5DA 1XSJA 2FHFA 3B8SA 3AHTA 3ARYA 4ZEPA 1FFQA 2YDSA 2CYGA 1BGGA 4S3JA 4PSPA 2EBNA 1EGZA 5ABEA 3WH7A 1UR0A 3T0BA 2A3HA 1BPLB 1EO7A 1GONA 3WNNA 3GNRA 2BY3A 3AIWA 5CPQA 3WH5A 1RPKA 3K8MA 4HPHA 4CD4A 1JZ4A 5I2UA 4NRSA 5HXMA 4BZYA 1FP9A 2WBKA 3BGAA 3KL0A 5E0FA 4NI3A 4JAWA 5A2AA 1M7XA 1B90A 2RGMA 1PIGA 1E40A 2E9MA 4PUEA 2Q8XA 4UQCA 3WIJA 4MPKA 4AD1A 1ECEA 2C0HA 2VCCA 3EMCA 2XHYA 2V5CA 1OD0A 4IM4A 1UA3A 2J7EA 4D6IA 3CLWA 3KL3A 4IPNB 5GPRA 3THCA 1JIBA 4B3LA 3CHCA 4KMQA 4V28A 3WQWA 2FH8A 2MANA 1EIBA 2WHMA 3WF0A 2VC9A 3GH7A 5A6KA 1W9BM 1W3KA 3CGTA 1CTNA 3U5YA 3LPOA 3AMGA 1QVBA 3A6OA 4HMCA 4PTWA 3WDQA 4AZIA 2X1IA 1J01A 1CWYA 4TXEA 1E1FA 4EAMA 1UR9A 2VZOA 5D8WA 3VMNA 1CXIA 2OWWA 3AOFA 1VF8A 1KXVA 1E55A 2A3BA 3WDHA 2W62A 4M29A 1JDCA 4RE4A 1E6SM 3VMOA 3AI0A 1KGXA 2YA1A 2VVSA 3IJ7A 3IJ9A 2PWGA 1UR2A 3A47A 1W1VA 2WNWA 2O9RA 4OOUA 4F8XA 1NARA 1JYNA 3VTRA 2FH6A 1IV8A 2WB5A 4AD3A 3AS3A 2XWEA 1BSIA 1V0NA 5AYIA 1VRXA 3WL0A 1GUVA 2WBGA 1UD3A 2G41A 4UCFA 2NW0A 1F4AA 2OWCA 2EPNA 4HU8A 3MKKA 3AMCA 2CESA 4CN6A 3W6MA 4IISA 4A3HA 2YJQA 1SFSA 4EK7A 3BC9A 2V5DA 1LWJA 4AIEA 3WNOA 5D9PA 4EANA 2W61A 4W93A 2DT0A 1FHLA 1QBBA 1WDQA 5IFTA 1V3JA 2GSJA 1V6YA 2ZX8A 4AYSA 3RPMA 1ODUA 3ARSA 3BAJA 2OYLA 1UYQA 2O9PA 1QOXA 4MDPA 1ZBKA 6A3HA 1GOIA 4N0RA 2C8NA 1VB9A 4DUXA 3VDCA 3SCPA 1J0YA 2NSXA 4E8CA 4KGJA 3W26A 1ZBWA 2UY4A 4TUFA 4DWSB 1M01A 1O6IA 4MB5A 1Q4NX 3AIUA 5I6SA 3I3DA 2PWFA 4CD5A 2DT1A 2ZXDA 3ZJ6A 2J8GA 4CGTA 2CIPA 5ABFA 3T08A 1DWGM 3L4XA 3BAIA 4ATDA 1UQYA 2EXOA 2XG9A 1GHSA 1W1PA 1WB0A 4PSRA 1GOMA 4D6GA 2GJXA 1PX8A 3AZTA 2Y2WA 1WCGA 2ZUNA 4MDOA 3WUGA 5IHRA 1E4IA 4UQBA 1OCQA 1E4NA 1ZL1A 2QPUA 4PMVA 4ML4A 3MUAA 5HBFA 3DC0A 3L4WA 4UFLA 2V3FA 1B2YA 3ZJ7A 4C7GA 4XB3A 5HPOA 4CCCA 1KXHA 1MVYA 2J74A 5E70A 4MAZA 1NWSA 2WMFA 4JZ5A 3VKKA 2XVKA 4J3TA 1MYRA 2D24A 4YN5A 3ZSTA 2DSKA 1R8LA 5BWFA 1XH1A 2ZUVA 1B30A 4MTVA 4CD6A 3WEOA 4HPGA 2G3IA 2ZX7A 1XD1A 2HVMA 4K68A 4AY1A 1RH9A 1G01A 3L2LA 3LPFA 2ZUTA 2CITA 4AW7A 3PZTA 4BQ4A 2VOTA 3W0KA 3FHQA 1J0IA 4QDMA 1UH4A 1UQZA 3ZT5A 3VGDA 1EA9C 3BH4A 4AD0A 4UFHA 4CD7A 3MO4A 3CMJA 3AMDA 1XSKA 2VX4A 1XYFA 2VQTA 5CJ5A 5I79A 4PMRA 3AJ7A 1HXJA 2BHYA 4U2YA 4H41A 3W6LA 3RO8A 2B31A 4B3KA 4UZUA 3WNLA 1OM0A 4DUVA 3AISA 2VTFA 3CUJA 1JI1A 1V0KA 2JEQA 3TTYA 4PN2A 2XSBA 1C93A 3VNZA 1E6PA 2DQXA 4HOXA 4M24A 1TUXA 2WSPA 2PBOA 5IHSA 2CXGA 3RDKA 1R85A 2BXZA 4ACZB 5I0DA 2XIBA 3ZR5A 1CIUA 2OSXA 1LG1A 1GQJA 6TAAA 4B16A 1WDSA 1CGYA 1W2PA 2BHZA 1QNSA 3SCTA 4CD8A 5F7UA 2PF0A 2JE8A 5BYWA 2CETA 2XM2A 2UWFA 1DWJM 2VCBA 1QNPA 4D6FA 1G94A 5HNNA 1FOBA 4D72A 1JGIA 2JIEA 1E6QM 3FY1A 1FH9A 1XGZA 4HA4A 3WF2A 1XSIA 4J27A 3D5HA 1JAKA 1TVPA 1M04A 4UQ9A 2BV9A 3ARPA 3BAWA 3WNMA 1EXPA 2QPSA 4P8VA 2CBIA 3OG2A 1JD9A 3ZIZA 2WCAA 3ALGA 5DF0A 2FHCA 5DT5A 1XCXA 1GJUA 3CZJA 3WUBA 3WNPA 1ZB5A 3OGSA 1KFWA 2ZX6A 1SMAA 3L4VA 3UR8A 5CPSA 3QHMA 5I3DA 2XWDA 2X2YA 1HN1A 1SR0A 1OIFA 4HOZA 4HZ7A 2WSKA 4KRUA 3VPLA 1VBUA 2G3JA 4A4AA 5CQ1A 3SIMA 1XC6A 4DM2A 2D3NA 1UKQA 4CKQA 4U3CA 2J7GA 4OOZA 2JFEX 2D0FA 2X8RA 2XGBA 1DWAM 1GJWA 2D0GA 4F9JA 4JKLA 1UD5A 1JZ8A 1RD6A 3RM4A 3F5JA 2BXYA 4TX8A 4UNIA 2GDUA 1HL9A 2ZX5A 4HMDA 3ARZA 2DDXA 4UQAA 5I23A 3VGEA 1HNYA 2WCSA 3N04A 4GI9A 1R7OA 1M03A 2YL9A 4H2CA 1FFRA 1GCYA 1JF5A 3OGVA 3OA5A 1GZJA 1JAEA 1KR1A 2X0HA 1H0GA 4HZ8A 2PWEA 3U5UA 1CPUA 3NYDA 1C8XA 1JZ7A 2WANA 4J7RA 1PZ3A 1X6NA 5A8NA 1ZJAA 4D6HA 1LQ0A 3G6MA 4D6EA 4AIOA 2WMHA 1CECA 2DSZA 1W2VA 2CBUA 2ZICA 5A8OA 2J7DA 1VBRA 1JZ2A 1E0WA 2DSVA 1FP8A 4CU7A 4H8VA 1XHGA 1MQQA 3WUFA 2WMIB 5BROA 2X0YA 4UTFA 4P8XA 1LL6A 3BAYA 3RILA 3WD2A 4YHEA 1HX0A 1PAMA 3CHDA 4LGXA 4J3VA 1XH2A 1KGWA 2ZXBA 1W1YA 3AIRA 1WO2A 3F4VA 1JL8A 3EDDA 1A47A 1VFMA 5ECUA 5BXSA 1WPCA 3S6TA 3U57A 4XUYA 3QR3A 2XVPA 4GZJA 5DT7A 1Y7VA 3ARXA 1DEDA 3K8LA 3LPGA 3TA9A 4ZXOA 2ZXAA 2CERA 3VIHA 4UFJA 1HF6A 8CGTA 1CLVA 4OUEA 4GIAA 4M80A 4H7VA 1TVNA 2EO7A 2VUYA 1E3ZA 4CN1A 3G6LA 3W29A 1E6NA 1B31A 3WBAA 4YPJA 1HJQA 3K46A 1XRVA 3AFBA 1NP2A 3MUY1 2F8QA 2VX7A 3IAPA 5FKYA 2WHLA 1WZLA 1AQMA 1TA3B 5TD4A 1GHRA 5CLWA 3VIKA 2F2HA 4JKKA 3N13A 2WZHA 4R27A 1KCLA 3AIEA 3F5KA 3TONA 4M81A 2WYSA 4CN4A 1PJ9A 1CENA 1E6ZA 3PBGA 2VRQA 4AD4A 4MB4A 2IXVA 1ZJBA 3N11A 3MU7A 5JBEA 4P7OA 4B9ZA 3UETA 3D3AA 1FH7A 5C8BB 1GORA 1US3A 5LA2A 3RCNA 1ISXA 1VJZA 5DFAA 1NOUA 1ZBVA 2YOCA 3W53A 5LA0A 1C7TA 3WDIA 5A2CA 4BF7A 1W1TA 5ABHA 1KR0A 1RP9A 2E9BA 2QMKA 1SYTA 2WVSA 2W66A 3VINA 3A4AA 1TR1A 1D3CA 2WKLA 1A3HA 1GW1A 4X0NA 4AZ6A 4AEFA 1CGTA 4AZBA 1TZ7A 3MSDA 1BLIA 1V6VA 5CGMA 4KWUA 1UWTA 5EB8A 3AHZA 1ISVA 3S2CA 3UEQA 3SUSA 3VD9A 4GXPA 3N17A 2W4XA 1GVIA 1UR4A 2XM1A 2JALA 3AIQA 4XX6A 4MADA 1DHKA 4GQQA 1ODZA 3GBEA 2YA0A 4HOWA 4JHZA 3VO0A 2GJPA 4UOQA 1ZBCA 1CDGA 3TTOA 2XYLA 1AQHA 4UZSA 4PCTA 3IANA 1AQ0A 2BVDA 3VIIA 2PWHA 4GINA 2W92A 3MSGA 1MQPA 1ZU8A 1HP4A 2ZUWA 4WLCA 1UD4A 3SCVA 2XSAA 1XV8A 4U33A 2VRJA 1B3XA 2VX5A 1YHTA 2UY3A 2XTKA 4NZCA 3VGFA 4ZE5A 2EPLX 1BYBA 1J11A 1C8YA 3CZ8A 4LQ1A 1TMQA 4QFUA 4GO8A 1J0KA 3SUWA 3UCQA 2D22A 2V3GA 2J4GA 2BY0A 2CBVA 2G3NA 4W7WA 3GNOA 3AROA 4CVUA 1AMYA 4AD5A 5A6MA 3KZSA 1CGVA 3M07A 4AMCA 1PBGA 3WENA 2Y4SA 1LL4A 1SMDA 4P7NA 1GVYA 1QBAA 2OLHA 3W25A 2WC4A 4RE2A 1E6XM 2CHNA 2WWCA 4MJ4A 5BXPA 2DH3A 4H8HA 2FGLA 2JEPA 1NWRA 1G1YA 2E8YA 5EBAA 1HVQA 2W67A 5JIWA 2WC7A 1JFHA 2VZUA 1KCKA 4DWSA 4J3XA 1V3IA 1BQCA 5AC4A 4V2XA 3L4ZA 3SCQA 1PIFA 1V3MA 2D20A 1U2YA 2IUZA 2XJ7A 2GUYA 5LYRA 4KRTA 1KQYA 4MJ2A 3POCA 4J3UA 2XFFA 1F4HA 1WP6A 3WH9A 4BQ5A 1QNRA 4W87A 4F9DA 2OWXA 4UR9A 4LXFA 3WMCA 1Q6GA 5I24A 4HZ6A 4JL1A 4BCEA 3CPUA 1E9LA 1OWQA 1B1YA 5FL0A 3RM8A 3PTKA 2XVLA 5A6LA 3CZGA 4GQRA 5FD0A 2GK1B 5CPTA 4GPNA 2ZUSA 4AIUA 3BMWA 4TVDA 1PX3A 2ZE0A 4AZGA 4QP0A 4FLRA 5A6SA 1WZMA 4JCMA 3VIGA 2W91A 3BCDA 5A95A 1W3HA 2GVYA 2EEXA 1JDAA 3BAKA 5I5RA 5BRPA 1KGUA 2VX6A 3MANA 2CKSA 1U30A 3EBVA 4AZCA 5FCZA 3W82A 1DWFM 1V08A 2BS9A 2DEPA 5HDRA 2WKGA 2F61A 3ZO9A 4HA1A 4AZ5A 3PTMA 5CSYA 4NSBA 3E1F1 5EMYA 3GM8A 3W81A 3DHPA 1V6XA 3ZOAA 4LYPA 1B0IA 3NUKA 4JKMA 2WMJA 1FHDA 3RMEA 1JZ3A 1BYCA 1JZ6A 5GNZA 2EPMX 2VT0A 3T0AA 3BAXA 1W9VA 1CXHA 3W37A 2WMGA 4J3WA 5BXTA 2G3MA 1H1NA 3OLEA 5A6BA 2J8FA 1UWSA 3NSNA 3SUUA 1D2KA 2WLYA 6CGTA 3EDFA 4P7LA 4ACZA 1BG9A 2E4TA 3SUVA 1E70M 4PTXA 4CU6A 3QHNA 4AC1X 3CUGA 2EPOA 4WKHA 1B3ZA 4XZBA 4AZCB 3BSHA 3II1A 1HL8A 2UY5A 3ARRA 4X9YA 2DT2A 4MB3A 5A6JA 1HP5A 4UFIA 4W7UA 1UUQA 3UG3A 3BMVA 4XV0A 3WQ5A 3SCNA 1MWOA 1AVAA 1EQPA 3GNPA 4QLKA 4MNJA 2J79A 2WHKA 5GQBA 5BXRA 4Y7EA 4GZEA 3VD4A 1WDRA 3JUGA 1MW3A 1V02A 1J0ZA 2D23A 3AYSA 3LPPA 1E3XA 5JBFA 1LG2A 1ZS2A 3A4WA 3CH9A 4U5KA 1HJVA 1QPKA 3VDAA 2GJRA 2WLZA 2JF6A 4ZXLA 3VDHA 7A3HA 4TTGA 3FAWA 1UR1A 2XGIA 5FOOA 2ZWZA 4E4PA 1H4PA 3ZR6A 2J7HA 3NSMA 1E72M 2BY2A 1MFVA 4JCLA 1H09A 4LYRA 4PMDA 4UQEA 4OIFA 3HU7A 4D6JA 5D4YA 3WSUA 1VEMA 2OSWA 3AHVA 1Q6DA 1HKKA 2JIWA 1GOKA 1UWIA 1FA2A 4HP5A 1HKIA 1VFFA 1V02E 1GQKA 1PZ2A 1OD8A 4PMYA 4UFKA 2YDQA 1K9TA 1PPIA 3A4XA 2VZTA 2VZSA 3AMKA 1UZ1A 2E40A 1NWUA 3BCFA 3WF1A 1EO5A 4A3YA 2J78A 3EDJA 4WKAA 3M46A 1OT1A 1LJYA 2Y5EA 1OGSA 1EDQA 3KL5A 3MMDA 4H8UA 2FHBA 1E5JA 2J75A 2J25A 5C71A 1V6WA 2XPKA 1MXDA 2A3AA 5I78A 3MMWA 3WEZA 3N12A 5CGTA 2Y8KA 1K9DA 5A94A 2PI6A 2VQUA 1CBGA 3OB8A 1CYGA 1VEOA 1I75A 2QMJA 3ZJ8A 4OZOA 3F5LA 3NSXA 1UH3A 3AHXA 3RJXA 2EQDA 2BVTA 1C90A 1QW8A 2D3LA 3OBAA 3EYPA 3MV11 3I3BA 3OLDA 3L2MA 3WNKA 3OLIA 1E0XA 1BYDA 2WCGA 3AYRA 2WMIA 1OGGA 1RP8A 4CCDA 1LL7A 5EFDA 1HJSA 1WAWA 3WDJA 4BS0A 1E56A 4JIEA 5FL1A 1X1NA 2VR4A 1CGXA 1ITCA 3KEHA 3PZUA 3PZOA 5HPCA 2E3ZA 3PZMA 3ARQA 3WMBA 3AXHA 3ARVA 1LLOA 2E8ZA 2A3EA 4PMQA 1UWUA 1WE5A 3DYMA 3K1DA 2J62A 4WJXA 3GXFA 3T0DA 4HU0A 3CHFA 3VDBA 1NWTA 4PTMA 3VILA 1OBAA 2YBTA 2WZEA 4W8LA 3NCOA 3CIVA 2DIEA 1QHZA 9CGTA 4CCEA 1B3VA 1JDDA 5BRQA 1J0HA 1XD0A 2G4FA 3GTNA 1HIZA 5IFPA 2WVUA 2NT1A 2YKKA 1D7FA 3CO4A 1W9PA 1Q6FA 3FXYA 3VIMA 3N9KA 3VD5A 4BQ3A 1TA3A 2VO5A 1W9XA 1E5NA 1KXTA 4U2ZA 1L0PA 1U33A 1KBKA 5D8ZA 1MFUA 2YBUA 3SCUA 3ARUA 1NOWA 1HJXA 2O92A 3HN3A 1K6AA 3UR7A 2XIIA 2QV4A 4UQDA 2J7FA 3WF3A 3SCSA 4QAWA 4MNLA 1R87A 3FNDA 3APGA 1VFOA 1PEZA 5GNYA 1EOMA 3PZGA 2WWDA 1KXQA 3I3EA 3VD3A 1E43A 2D1ZA 1O7AA 1UG6A 1JNDA 3B9DA 2TAAA 5A8MA 4JFUA 7TAAA 4FLQA 2CBJA 3W28A 4AD2A 4TVUA 3WD1A 2VR5A 4JL2A 3MUZ1 3M6DA 3OIHA 2ZUUA 2DH2A 2VL4A 4AXNA 4P7QA 3CZEA 5M17A 1C91A 2XFRA 1JG9A 4GKLA 5DMYA 3HMCA 5JIPA 4U5IA 1UZ4A 4GO9A 3VD7A 3WL1A 5CSUA 2E9LA 3AIBA 1E71M 5A69A 1B9ZA 2BFGA 3ZT6A 3O2LA 3WD4A 4F79A 3MS8A 3SCRA 4EKJA 5JBDA 1EQCA 3O9NA 1VFUA 4DM1A 5AYBA 4KH2A 1R7AA 1UKOA 3SEPA 2DT3A 2VCAA 2D2OA 2W63A 1EH9A 1QI2A 3WH8A 3WFLA 4DWSD 1J12A 2GFTA 1KWGA 3B9EA 4D71A 2ZUMA 1GQLA 1WKYA 3WQVA 3L4TA 3MUIA 3ZQ9A 4BA0A 5A8PA 3WD0A 1DTUA 1UKPA 2WPGA 1I1XA 1J10A 1Z32X 3T2OA 3NJ3A 1UD2A 2J47A 1W32A 4XZWA 1QI0A 1Q6CA 1KB3A 2BHUA 3N15A 1OB0A 3O6AA 5E6ZA 2BVYA 1K9EA 1P6WA 2G8ZA 1I1WA 4WIWA 1C92A 3WQ4A 4AEEA 3WMSA 2YIHA 3L4UA 1UD8A 1PX4A 1KQZA 1EOKA 3L4YA 4JHOA 3J7HA 4PTVA 3PZQA 3VUPA 4P7RA 3GXDA 1BYAA 5HOSA 1ISYA 4GI6A 4LPCA 3ALFA 3A3HA 3U7BA 2Y8VA 4TX6A 2HISA 2XVGA 3QHOA 3EDEA 3VVGA 4NF7A 4J3SA 2CPUA 1OIMA 1LWHA 1UKTA 1QI5A 1G9HA 1MQRA 4W84A 1UWQA 3AS1A 1UA7A 1QW9A 4DWSC 3CZKA 3W38A 3FAXA 2EPKX 3WBEA 3CHEA 2GK1A 4P8UA 1B3YA 1HJWA 1H49A 2V3DA 4EE9A 4IPLA 4WKFA 1TFVA 3RM9A 1H0IA 4GZIA 1TE1A 4FF5A 3WKZA 3DHUA 3WELA 5A8QA 1E4MM 4PMZA 1EDGA 3MMUA 3AIVA 5AY7A 1CLXA 3VGGA 5E6YA 4LX4A 3AXXA 2UY2A 3TOPA 3VX0A 1OT2A 4OBRA 4PBGA 2VJXA 3ARWA 1JZ5A 4AISA 2YDRA 4MAVA 3NDYA 4JFTA 4Z2JA 5A6BD 3W4RA 4H04A 3WH6A 3VGHA 3FW6A 4W85A 2O9TA 5E0CA 5D9MA 3AS0A 5DO8A 2CEQA 1LF1A 1IZJA 5D9NA 1GNXA 1M53A 3GXIA 3T09A 3TTQA 2YLLA 1JXKA 1VEPA 4W86A 4CVWA 1ISZA 4JFVA 1YQ2A 1GQIA 1JXJA 2PWDA 1QI3A 3CZLA 4B15A 4DUWA 5LA1A 2QHAA 3OLGA 3OZPA 3VOCA 3UG4A 2WAGA 4PUDA 1KWKA 1BVNP 1NM9A 3EMZA 3VM5A 1UOKA 1BFNA 1J18A 4E8DA 1QNOA 3VIFA 4W5ZA 1XCWA 3QOKA 4MNMA 4CU8A 2ZX9A 3GYCA 5GNXA 1GOOA 2ZOXA 3DYPA 3KE0A 4AWEA 1H41A 4V27A 2AMGA 4PYSA 2YL8A 3UERA 2WMKA 3N1AA 4FK9A 1CZ1A 4Z2KA 4GI8A 2ZXQA 3FN9A 4Q7NA 1UH2A 1BF2A 5CXPA 3IAQA 4M1RA 2J7BA 4U31A 1ISWA 4ZENA 4FLSA 4R5EA 1UKSA 1JNEA 4OBSA 1EHNA 1JD7A 1NQ6A 1MW2A 3VU2A 4ZE4A 1Q6EA 3FHAA 4WF7A 2X05A 1GPFA 3TP4A 1QHOA 2WHJA 2VI0A 4PMXA 2VNCA 2VURA 2WVVA 3WY1A 3GXMA 3SCOA 4PMOA 1CGUA 5ABFB 1QNQA 4OKDA 2CKRA 1BHGA 8A3HA 1IT0A 3KWXA 3T2PA 1MW1A 4JFWA 1DWIM 1XYZA 5IXEA 2GJXB 1V3LA 4UOJA 1W9DM 3VM7A 1HJUA 1OSEA
chains in the Genus database with same CATH superfamily
3GZAA 4IT1A 5G1MA 1PKNA 1JPDX 3GR7A 3THQA 3ZMRA 4IPJA 1UWAA 2A85A 1C3FA 1H2JA 3L12A 1HKJA 1LBLA 1TUFA 3ARTA 4UB9A 3ZVHA 3F4CA 3C0SA 3LMYA 1M7JA 3NAVA 4FHAA 1ICPA 1KBBA 1E73M 5LNWA 3NDZA 4L7ZA 4FEZA 1CXEA 2AGTA 2GDVA 5FF0A 3WK3A 2WVVB 3H12A 2C19A 3AXIA 3ZLGA 3WD3A 3EOSA 3U3HA 3B06A 4FSAA 1TE6A 5BOFA 1YPXA 3CB8A 7CGTA 2ACQA 4XAGA 5C54A 3W7JA 5BRBA 3DN5A 1E1EA 2NX3A 2NVDA 1GOQA 5A6AA 3VIOA 1C7SA 2A3CA 4BQ2A 4ACYA 2V3EA 1CW2A 3WFZA 1TQXA 1O5XA 4OJYA 3SGUA 1TG7A 3IGSA 3IIPA 4QLLA 5D2YA 2IS7A 2NWSA 1H1ZA 2RGLA 1V03A 2WNQA 1EL3A 3MSYA 3M5YA 2YLAA 3V3WA 2DZTA 1PO9A 3WDPP 3W2UA 1O95A 2KZHA 2ZTJA 1FCUA 1Q8JA 4LF2A 1R5YA 1DJYA 4JX6A 1OGBA 3N19B 1FY6A 5G2WA 4GYPA 3IIXA 4M56A 4FOKA 1UOZA 3GDLA 4TQTA 1W3LA 2QAFA 3H70A 3EAUA 2GOUA 1UWRA 3BSMA 2D2JA 4JS3A 1IR1A 3PWGA 1MXGA 3WQ6A 1XLCA 3N2OA 1D3GA 4KQNA 3H22A 1SW7A 3TK7A 3OOQA 2RH9A 2YZRA 3DDMA 4HA3A 3EWUA 5FJPA 4Z2HA 3I7RA 4H6QA 4Q7IA 1GVQA 1UP3A 3DYOA 4HCDA 1QPOA 3PHAA 3R89A 1TPEA 1GVRA 2X09A 1VENA 4PCSA 3QW4B 1TTQA 4DQWA 4QJ5B 2PBGA 2BNJA 1ZJIA 4GK8A 1PHQA 3MV01 4J5NA 4ZQPA 1JF6A 1QOPA 2XUCA 4QDWA 4MNKA 2B4GA 1YBQA 2J7CA 1UR8A 1TV8A 3TIMA 4QG8A 2OR2A 2PMQA 3UG5A 1NFBA 4IUGA 1H7OA 3HJEA 3PS7A 1LRNA 5KZ6A 4O8AA 3SN1A 1JPIA 2VEPA 3URNA 4KEVA 3RJYA 2CFFA 1FH8A 3CXOA 4MYAA 3OZOA 3IJ8A 4HNOA 1SZNA 2TRSA 1KM1A 2I17A 4LRSA 2XH0A 5M03A 3LNPA 3R2GA 4P2VA 1V6UA 2VVNA 4CNOA 1X6UA 1EJVC 3TTSA 3IJQA 4MWAB 1J0JA 4LUIA 3AUOA 3W27A 4ZOCA 4JICA 1QI4A 3BLKA 3RU6A 4LAKA 4LFYA 1BVZA 5J8LA 3IIOA 2WXDM 4FX8A 5LGXA 5HJYA 4CQ9A 1Z44A 4GUGA 1E6RA 1S46A 4N42A 2PLMA 1JI2A 2XFYA 1NVMA 1R3SA 4I7WA 3PZIA 4O1FA 3MBFA 3T6CA 5HR7A 1OG0A 3AU2A 1AMKA 5FJOA 3LHWA 1GTEA 3UBPC 2VFHA 5D37A 2WK2A 3ZSSA 4UIOA 3HMJG 4ZQNA 1SJCA 2Z1WA 4FA3A 3FA3A 1VBGA 1YNYA 5ABGA 1G4TA 1JDEA 1ZCCA 4IF2A 1ONXA 4URIA 3QQ0A 3M7SA 1IZKA 1YPFA 3TR9A 1JCMP 4HZMA 9XIMA 4IZGA 4EXQA 4DF1A 6XIAA 4AUBA 2WM0A 3V4BA 4RZ6A 2QVHA 1YXYA 3MSRA 3P8IA 4PRTA 3KVJA 4YXGA 1KA9F 2V2HA 3B8SA 1F5ZA 2OU4A 3ARYA 4ZEPA 1EP1A 2CYGA 1BGGA 1B4KA 7PTDA 3W7NA 4PSPA 4K1GA 4YL2A 3WH7A 4LY8A 1Z3NA 1GONA 3H2CA 1XUZA 3B0VC 3G1DA 3VE9A 1VPXA 3K8MA 3DIPA 2B7NA 5I2UA 4NRSA 2PZNA 5HATA 2H9AB 3B0YA 1SJDA 3BTNA 2V5LA 3BGAA 4IJRA 1Q7ZA 1M7XA 4JN6A 1DXIA 4RKAA 1UC5A 2VD8A 3ZLFA 1E40A 2E9MA 4PUEA 4UQCA 3CWNA 3WIJA 4AD1A 3NWRA 4NIRA 2VCCA 4HNCA 3LCGA 4YVVA 3RLVA 5DN1A 2RHGA 4ZO9A 2J7EA 2PEVA 3CNYA 5HANA 3CLWA 4EOUA 4WY0A 3F2CA 4IPNB 1X7IA 3NEVA 3M4HA 4XAZA 3V0SA 1VFSA 3WQWA 5IRPA 3FYYA 1EIBA 2Z26A 3KM8A 2WHMA 1XGEA 4H9MA 4GZ7A 2VC9A 1Q7MA 4OBTA 3GH7A 3R10A 1KCZA 1W3KA 3CGTA 1WXYA 4HN8A 3LPOA 2PRMA 3H55A 3STGA 4PTWA 3WDQA 3BDKA 5HWJA 2ZRVA 3ABXA 2YDAA 4LVDA 4TXEA 4EAMA 1UR9A 2J9YA 1R6WA 3S5ZA 3N29A 5LXEA 3KBJA 2W62A 4KIEA 4GNKB 1TB3A 1JDCA 3QFWA 4RE4A 1E6SM 3VMOA 3UWWA 3AI0A 1KGXA 1ME8A 4ZO6A 1MUWA 3IJ9A 1XG4A 2O9RA 1OK4A 2E1DA 2W27A 3B4YA 4KERA 2WB5A 4AD3A 3AS3A 2XWEA 1BSIA 1VRXA 4K7VA 3M43A 1DJHA 3T0TA 4TMCA 3ZFHA 2EPNA 4HU8A 1DJZA 2CESA 4CN6A 3W6MA 4IISA 3H4WA 1SFSA 1LZOA 2ZYFA 4QGCA 3JRKA 1LWJA 2OLSA 4MYXA 4K37A 3TQPA 3WNOA 3WQOA 3LM7A 3VNIA 2W61A 3GS6A 4WUIA 5HINA 2XIJA 3TN5A 3AO0A 2DT0A 1FHLA 4H9ZA 1PWLA 4M19A 2UV8G 2ZX8A 4AYSA 5E5CA 4AF0B 1ODUA 3ARSA 1M68A 3BAJA 1DJNA 5LZLA 2O9PA 4HA0A 3N2CA 3CYVA 3IACA 1ZBKA 1O68A 4A3UA 4HBKA 4PMJA 1UP0A 2E7FA 1VB9A 2VFEA 2QCGA 3SRHA 4G9PA 2QUMA 4MUPA 1QW7A 2J24A 2V81A 1PDYA 3H2FA 3W75A 2P50A 2CZ5A 5I6SA 2FJUB 4A2SA 4CGTA 3LXBA 2CIPA 1DWGM 2ZZ3A 1FWNA 2EXOA 5DXYA 4S39A 1P7TB 1KTCA 4XSLA 1GOMA 4O0KA 3O6YX 3W23A 3WUGA 3W1AA 3VNDA 1E4IA 4PMVA 3S2NA 3OVGA 1YDNA 1J96A 2NQ5A 3L4WA 5FJRA 1B2YA 3ZJ7A 2R1NA 5HPOA 1IXPA 5E70A 4MAZA 1NWSA 2WMFA 3OO2A 5C9UA 1MYRA 2P3EA 1PTAA 2D24A 4YN5A 3S1WA 2DSKA 1R8LA 1XH1A 4QRNA 2G95A 4N9EA 2G3IA 3ANUA 3FJ6A 1O60A 4K68A 2PP1A 2CITA 2VWSA 3KWSA 1HKVA 3PZTA 2ADAA 3CM4A 1T96A 3C4UA 4S2CA 3VGDA 2YB4A 5JQ9A 4UFHA 4GI4A 4WHBA 1PE1A 3MO4A 1XSKA 2VX4A 5FSDC 2RJHA 4C6IA 2QCDB 4DYEA 4WDTA 2B31A 4B3KA 4UZUA 2C6QA 1PYMA 4AX7A 2UBPC 4DUVA 3UCCA 3CUJA 5HUPA 5IDZA 2NUXA 1JI1A 2VEIA 3UNTA 5JH1A 2FKPA 8RUCA 3EWDA 2BOGX 4FNQA 4S3BA 1W17A 1CGYA 1W2PA 2BHZA 5CPOA 3OYXA 2AKMA 1P43A 4ML9A 3S1UA 3Q37A 4NZ3A 1JGIA 5TAOA 2JIEA 1I0BA 3FY1A 3MVIA 4HA4A 4O4VA 2AQOA 4WR3A 3WF2A 1XSIA 1TVPA 1K3UA 2GVGA 2V0TA 3BAWA 1ECQA 1HO1A 3M0XA 8XIMA 2PPGA 1S2WA 2VC6A 5K3VA 1RD5A 5KETA 3MCMA 3BK0A 1ZB5A 3V7PA 1KFWA 4BR1A 1FCVA 2CW6A 2P8BA 3L4VA 5DY2A 3WQEA 2AQVA 3BLIA 3ATYA 3RITA 2OZ8A 2X2YA 1VR6A 4MZYA 1A5UA 4RNIA 4HZ7A 3BV4A 1VBUA 2WSRA 2Q3RA 2DY3A 4DM2A 3RF9A 5GVJA 2QF7A 4HTBA 3TFCA 4CKQA 4U3CA 1NIUA 5D03A 1V5XA 3LTPA 2X8RA 2XGBA 4L4LA 3ONBA 4GNJA 2QVNA 2TODA 4F9JA 1YE4A 3SRDA 4WRHA 1PUDA 2BSLA 2BXYA 1ZJHA 4MLRA 3NQEA 4UNIA 1IT8A 2PDWA 4AY7A 3BW4A 3GC2A 3DFYA 5CC7A 3CL6A 5I23A 4FPSA 1TWSA 3HPFA 1M03A 3MWCA 4C6LA 4MWAA 1GCYA 2V2CA 1U1HA 3W1MA 1GZJA 1JAEA 2C15A 2QDHA 3VZZA 3DU0A 3GUGA 3WQDA 2WO5A 4Q8UA 1RQEA 3CQIA 2R1LA 1DJGA 3PG9A 4O12A 1X8CA 1FCQA 2PLKA 2QIWA 1X6NA 5A8NA 1ZJAA 4D6HA 1LQ0A 4IX2A 2WMHA 3LV6A 1WOAA 5A8OA 1LM1A 5HQLA 1DORA 3N25A 3IJDA 3GAKA 2DSVA 1FP8A 2PTWA 4X60A 4QROA 3SAZA 2WKJA 2P1FA 5FJIA 1XHGA 2O0TA 4L6OA 2EHHA 1JR1A 4HCLA 4GUFA 2BP1A 4B5SA 4B4HA 4UTFA 4R9OA 4MWAE 4UCGA 3WD2A 3CHDA 3BW2A 4LGXA 4LBUA 5EKYA 5CZSA 2PTXA 3TV8A 3DCPA 2ZXBA 6ALDA 4ZFCA 3OW1A 1MO0A 4H9XA 5ECUA 2YPIA 1ZAIA 1I2RA 3QR3A 2F6XA 1DEDA 3K8LA 3LPGA 2R91A 5K7JA 2O7SA 3KDNA 3VIHA 6PTDA 2A3LA 1CLVA 3QQWA 5CKSA 2Z6IA 1AUSL 3KVLA 3K13A 3TYDA 2ACRA 5KTLA 4CN1A 3G6LA 1WXZA 1B31A 3WBAA 2H9AA 1NP2A 3PBWA 4DN1A 3RCYA 2F8QA 2VX7A 3V5OA 1XFBA 3SY8A 1FHVA 3ITVA 5C7VA 2IQDA 1P48A 3TSMA 1AQMA 4DJDD 2DZSA 1ME7A 4R34A 2F2HA 4J40A 2WZHA 3F5KA 3KUMA 2WYSA 3E96A 1PJ9A 4CN4A 5EL1A 2VRQA 3LM3A 1HG3A 3N11A 4IMAA 3UETA 5C8BB 1GORA 3DFSA 4RDWA 3RCNA 1E51A 1NOUA 3W53A 5LA0A 1XIJA 3EB4A 1DTNA 1C7TA 3D6NA 3WDIA 1L2UA 1SSDA 4J3ZA 4BF7A 2QS8A 1LBMA 3QV9A 1SYTA 1E0UA 5LIYX 2G96A 3VINA 3A4AA 1Y5WA 2YYTA 1A3HA 3HQ1A 4AZ6A 4AZBA 1BLIA 4IP7A 1V6VA 3ONCA 3VDGA 4KWUA 5EB8A 3AHZA 1TVLA 3S9YA 4GOAA 3TU9A 1RY8A 3UEQA 1K02A 1FWJC 3BLEA 1GVIA 3DGRA 2QJGA 4XX6A 4IHCA 4MADA 3LCLA 2BBFA 3H7VA 3OZMA 1OYBA 2GJPA 4UTJA 1LQ2A 3OBEA 1CDGA 1F74A 4DBEA 2XYLA 1AQHA 4R53A 4PCTA 2VC7A 1EF3A 4N9CA 4DJDC 2HPIA 1GWJA 3TYBA 1AQ0A 3VIIA 3KOXA 1DV7A 2HE8A 1O5QA 2W92A 5LIKX 2GJLA 2LLEA 3B03A 1H5YA 4LRTA 2ZUWA 4WLCA 4LS1A 3SCVA 2XSAA 1YEYA 3QW3A 3VFLA 4ZE5A 6ENLA 2EPLX 2FJKA 3TQ0A 2BDQA 3UVAA 5HAOA 3CZ8A 3DG6A 1I0DA 4GO8A 1RJRA 2D22A 3GKAA 4C6FA 3IWPA 3GNOA 4JTEA 3PJXA 4CVUA 4AD5A 2IPJA 3M07A 4AMCA 1PBGA 3WENA 2Y4SA 3K30A 4P7NA 2OLHA 4RDZA 2CHNA 4GH3A 2QUNA 4QSFA 1IGSA 4PL2A 1G1YA 4XIMA 4FNSA 1HVQA 3B8DA 2Y63A 2WC7A 2VZUA 1J5TA 2OX4A 1S39A 3STPA 2YXOA 5G1TA 1MZRA 3RNDA 2QUVA 2DFAA 4DPQA 3SCQA 2IKHA 3CV1A 1P7TA 4HSOA 4MJ2A 5MKGB 4DI8A 2E68A 4CQBA 1WP6A 5AB3A 1K1DA 1F05A 1H7PA 5AC8A 2OWXA 1Q6GA 4BF5A 2GQ3A 1M7OA 5GJPA 4HZ6A 4BCEA 4M7TA 3ZS4A 4HK6A 1OWQA 5DQPA 1B1YA 3PTKA 2X2GA 2XVLA 5FD0A 2A7RA 2ZUSA 4DZIA 4D2JA 4LUTB 1PX3A 3TYCA 3A23A 3CS2A 3RX4A 5FI8A 4AHOA 3QLLA 1KFKA 5A6SA 2DP3A 4JCMA 3LGDA 1FDJA 1JDAA 3DI1A 3LMZA 1HO4A 1T6MA 2CKSA 4A22A 3MI3A 2R9RA 1DWFM 1V08A 4XBSA 2WKGA 4AZ5A 2HCVA 3PTMA 3QXBA 4S3AA 4AY8A 2PU0A 3E1F1 3QLDA 1V6XA 2QCDA 4GIEA 3KCJA 3RMEA 2VXNA 1JZ6A 1YTDA 2FMNA 4JYFA 3T0AA 3BAXA 1GG0A 4KEMA 5G4EA 4CLMA 2BGNE 3NSNA 3UZJA 3SRKA 2H8XA 3UXLA 1TJRA 2WLYA 4H1ZA 1XIHA 3EDFA 2OGYA 4P7LA 3DFOA 1EBGA 2VGIA 4FO4A 4QAIA 4FR1A 1LROA 3BSHA 2J8TA 3BLOA 2PAJA 4X9YA 2B81A 2DT2A 1AH4A 4JTAA 1RUSA 1RZMA 5DMNA 1AVAA 1MWOA 1S2CA 3VC5A 4E38A 2VEMA 5GQBA 5BXRA 4Y7EA 4GZEA 3VD4A 4OT7A 3GYEA 3WQFA 3AYSA 2FTPA 2V9DA 4Z1YA 1TRDA 2HMCA 1Q6OA 3PM6A 1KBJA 4WGXA 1ZS2A 2G37A 3M5ZA 3A4WA 3WLLA 3UWYA 4TX9A 3E6EA 3W7KA 3QH2A 3VDAA 4F4RA 2GJRA 4I9JA 2WLZA 1TZZA 3MBDA 1Q66A 4EIVA 4UTUA 4BEUA 3HFTA 3EXRA 3N14A 4JIIX 1H09A 4LYRA 4RV8A 1UR3M 5DRIA 2BGSA 4N7QA 1VEMA 2ZDRA 2QUUA 4PUWA 3QSRA 2JIWA 5CPNA 1UWIA 3VC6A 4Q4OA 4J4KA 1OADA 1JCTA 2CC0A 4IG2B 2HJPA 2ZZ6A 3G3MA 2XISA 2YDQA 1FHUA 4MY1A 2QCFA 8XIAA 4ZODA 1K9TA 3A4XA 2WV8A 3UWVA 4HGXA 2HNEA 3M0KA 1TV2A 1UZ1A 3HURA 5M1TA 4A8LA 2PE4A 3BCFA 2VWTA 3LTYA 2Z29A 3R0UA 3WF1A 1EO5A 4MF4A 2L5HA 3D47A 2A4AA 4GCXA 4WKAA 2UZ9A 3M46A 4HHMA 4JN7A 2Y5EA 1OGSA 4MFDA 1BXCA 4UBPC 4ADTA 3MQTA 2Z28A 1RVKA 3WEZA 3N12A 2BVWA 3DHFA 3WJSA 3CMFA 1XLGA 3GVQA 3ZJ8A 4O11A 3N34A 1UH3A 1S5MA 2EQDA 4QSHA 2BVTA 1C90A 1QW8A 1GYMA 1OC6A 4WEVX 2WCGA 3BCJA 2H8ZA 3AYRA 1NSJA 2Y6ZA 2YCKX 3PNZA 5G1YA 4MY8A 4BFAA 5EFDA 4Y6GA 5D30A 4LC8A 1HJSA 2FFCA 1DXFA 4IIFA 1E56A 4JIEA 4JTKA 5C2CA 5C9RA 3R43A 5FF4A 3UJFA 1J4EA 3KEHA 3PZUA 4NILA 5HPCA 4Q4SA 4XVDA 3PZMA 3VCNA 2Z0IA 3XINA 1SU5A 3AXHA 4PA8A 3E12A 4DHGA 4H7ZA 2E8ZA 1JUBA 4Q8TA 1YNQA 3RUBL 2P5NA 1WE5A 2DZAA 4Z1AA 2HPMA 5LGZA 4HU0A 2GWNA 3VDBA 1NWTA 1J2BA 3VILA 1OBAA 1R9XA 4HNUA 3NCOA 3CIVA 2DIEA 4GXWA 2PTYA 2PDIA 3W9ZA 4CCEA 1UUMA 4IGHA 3W88A 1XD0A 1JULA 2G4FA 1HIZA 5IFPA 2ZBTA 2WVUA 2NT1A 2YKKA 3GTHA 5B7YA 4NASA 2P53A 3HPAA 4BWLC 4NKCA 3A64A 4BQ3A 1AG1O 3UF9A 4LV4A 5I3IA 2Y88A 2Q6ZA 4U2ZA 1DIEA 4MUZA 2RJGA 4AWUA 1SQ7A 2ZVIA 4ZOEA 1C29A 3SCUA 1HJXA 3UR7A 3O16A 4HHLA 3NQ7A 1XINA 4MNLA 5HJXA 3UA3A 4AC7C 3SJNA 3V0UA 3APGA 4QNWA 5JH2A 1EOMA 3PZGA 2WWDA 4AEOA 1KXQA 3VD3A 4W4QA 2D1ZA 3S9ZA 3USZA 3T81A 3RO6A 3UZYA 4U10A 2TAAA 4BI5A 2I5GA 4FLQA 3A3WA 3I7SA 4N2YA 4GQGA 4R85A 3ES7A 3NL2A 3Q67A 3WD1A 1XKYA 2VR5A 3MUZ1 2GDQA 4PUNA 3ANVA 2VL4A 4E4FA 4DX3A 4P7QA 1S5NA 2XFRA 3L23A 4GJIA 2VEFA 4GUJA 3HMCA 3NOEA 3KLKA 4JTIA 2DORA 4U5IA 3WL1A 5CSUA 2E9LA 3KCOA 2ABAA 3DKLA 3LTSA 4L64A 4U4MA 4XWUA 2BFGA 2R24A 3IV3A 4XSMA 3O2LA 4BF9A 4WOZA 1QMLA 5JBDA 1EQCA 4LBSA 5DLCA 4NXSA 1KTBA 1TJPA 5FAJA 1UKOA 4DUOA 1W1ZA 3DENA 2JGQA 5FESA 1KLZA 4EXBA 1Y5VA 1EH9A 1VFHA 2Q09A 3FIGA 4Y2WA 5D2XA 3WBYA 4TMBA 2GFTA 2ZUMA 1GQLA 2PF8A 1M41A 4ZB5A 4EVZA 3W7OA 3ZQ9A 1YDVA 4L6DA 1EXBA 2XN2A 1QWKA 2HE5A 1R2SA 1TCDA 4XZWA 1QI0A 2BHUA 2AKZA 4IMFA 4UC5A 1OFEA 2BVYA 2FMOA 1JVNA 1PKLA 5CZJA 2PGWA 1C92A 1Q3NA 1WKDA 2PD5A 2EKCA 1UD8A 2EG6A 2XINA 1PX4A 1EOKA 1KQZA 4JHOA 3CK5A 2YW3A 2Q02A 4L61A 5AHFA 1KBIA 3RX2A 2VFIA 1ISYA 3M0VA 4O4WA 5HNTA 2XVGA 3QHOA 5MKGA 2WNZA 3KCLA 1IXNA 4RJEA 4DIAA 2CPUA 4O1AA 1A50A 3H53A 1U83A 3GNXA 1UKTA 3R0DA 3GD6A 1G9HA 1QW9A 1F8MA 3W38A 3GVGA 1OCBA 3LD5A 5T8GA 3SDOA 3CHEA 3BG9A 1VLIA 1HJWA 1H49A 1A5LC 4GA8A 4MZ1A 4EE9A 4IPLA 1ZCOA 3RM9A 4GZIA 3KRSA 4FF5A 4LUTA 4QX4A 2CZDA 3Q65A 3MMUA 3AIVA 2Z6JA 3RU8X 1CLXA 3VGGA 4LX4A 3AXXA 1KTNA 1FWCC 1KM6A 1TTJA 3N6QA 4NZ4A 4PBGA 3QR1A 3ARWA 1JZ5A 3P5YA 5H8MA 3T05A 1NY1A 3GVRA 2PDQA 4Z2JA 2R1KA 4OGZA 3BO9A 3FW6A 2O9TA 1A49A 4KCWA 1GW9A 1LF1A 2YFNA 3GXIA 3T09A 3TTQA 4JIRA 3ZYZA 5CBIA 1MI3A 4JQAA 3C52A 3BLLA 1YKWA 2QGHA 4D8ZA 1VRDA 3CTLA 1YQ2A 1GQIA 4JYDA 1JXJA 4US6A 2PWDA 1JPKA 1K7EA 3NZPA 5A8GA 1ZLPA 2QHAA 1BWLA 4PUDA 4AVOA 3O63A 1EP3A 4FNUA 1FWSA 4KWVA 3LGGA 1Z89A 4E8DA 1QNOA 3VIFA 1X1OA 4HHPA 4GISA 3TMQA 3QV7A 3DYPA 1TTPA 3KE0A 5FF3A 4J2MA 3G8EA 2PDKA 3BG5A 1YADA 3IS4A 4O17A 1OYAA 2W9MA 4HNTA 2VC5A 1OFBA 4FK9A 4GI8A 3FN9A 4Q7NA 4XBKA 3LLFA 4O19A 4OECA 1BF2A 3IAQA 2YCJA 3GU9A 3GVVA 1ISWA 4ZENA 3WLSA 2A79A 4R5EA 5IM51 4XBJA 4OV9A 2GVEA 3P84A 1Q6EA 3VU2A 4GX8A 4FR6A 5DCDA 4Q6XA 3EX1A 4AMAA 4XUGA 2VURA 3SCOA 1XS2A 1JRCA 5CAKA 3W7LA 2CKRA 1BHGA 1FWFC 2YCLB 3B3DA 1I8JA 3T9PA 1SW3A 3UPMA 2GJXB 2Q8ZA 5HK4A 3QZ6A 1CI1A 4ZOAA 3H4XA 2HSAA 4JPGA 1EPVA 1HJUA 4EF9A 4IG2A 1V3HA 4GX9A 4J28A 2OT0A 3DC8A 4CCZA 3DBNA 1G5AA 3NXFA 4LYKA 2PSNA 4S3CA 1B3WA 2QYGA 3MC5A 1VJSA 4O0ZA 1R2TA 3U7VA 2MUCA 3PULA 3WEMA 3AALA 3CMGA 1W3JA 5EMMA 5G2HA 3TFXA 7XIMA 3SADA 2DGAA 2A21A 2FYMA 1ADOA 3W87A 4FIQA 4WSKA 4DBSA 4PEEA 3RN6A 2OG9A 4NRRA 2WW5A 4I7VA 1V8EA 3UJEA 3N2BA 1W8SA 1L6FA 3WLPA 2PDBA 4TOQA 2D0HA 3KHDA 3VOHA 3T2QA 1K9FA 4LV9A 2QNEA 3AHYA 4ZTXA 2VZVA 1K8YA 3QBUA 3R25A 4WDUA 3KBNA 2I1OA 1BQGA 1W1IE 2WC3A 1X6LA 2XVNA 4L4OA 2ISVA 2OJPA 4Q8NA 2P0OA 1MZHA 3LQGA 1X38A 2CLLA 2NSOA 3QPZA 3GDBA 1R3RA 2Y70A 3U9IA 4G56A 3MKVA 2WPBA 1E4LA 1WNOA 3CUFA 1ALDA 4LVGA 4RL3A 3EWBX 1WZAA 2PLCA 3M0MA 3NO1A 5EU9A 3UESA 2NT0A 1A4MA 1UD6A 1AW1A 1W91A 3BUVA 3CPGA 3POHA 3ENLA 4Q4KA 1Q6QA 3QGVA 1S5VA 3VIPA 3VMPA 5J04A 4HD5A 3QMTA 4PMUA 1UPPA 1GOWA 3M0YA 3FDGA 1YPIA 1BKHA 2DSWA 2PURA 4JY8A 5JU6A 3GH4A 2Z1KA 4JEQA 4X0VA 4D1JA 4GY0A 1TWIA 3S83A 3WLNA 4Q4PA 5K9XA 3EPMA 1OX5A 4ATLA 5CG0A 4MHBA 3THDA 4GABA 3VXGA 1VAHA 4ILSA 4YJ5A 5KZDA 2OO6A 1GQNA 1D3HA 2I9EA 3TYAA 4W5UA 1DP0A 2ABBA 1EKOA 1EDTA 3M64A 4A05A 5XINA 3D3FA 1OF6A 2F38A 4LAUA 1SVDA 3WUEA 4Y8FA 3GR8A 4JFSA 4ZFMA 3NYZA 3PZNA 1XYMA 3E2VA 2E5CA 2ON3A 1G0CA 5DEZA 4XAYA 3SQLA 1JYWA 2AGKA 5CH9A 2BG5A 3CAWA 3CTTA 1KFCA 1N8FA 2R6OA 5HWNA 4PMNA 5CBBA 2QF8A 3N18A 4ROQA 3MT1A 4Y8EA 3QV6A 3AQUA 4C7DA 5H6HA 1NF7A 3B40A 3E0FA 5I77A 2DUZA 4LY4A 3R4IA 2DPEA 1KKOA 1H11A 1PKYA 5CJNA 2Z2AA 4UFMA 1RXOB 5AC5A 1E15A 4DO7A 3CBWA 2DIKA 2ISWA 3W24A 2V38A 2PB1A 4E2OA 3HV8A 3EMQA 1QPRA 1ESWA 3NM3A 4P61A 4HK7A 4GQBA 1Y65A 3PN8A 4QM1A 3W72A 3ZJKA 4Z2GA 5LXXA 3PF3A 4AZHA 4US5D 1WA3A 3WLHA 1DWHM 3C2RA 4YHGA 5FIPA 5LNRA 4JDYA 1FVPA 1ZGDA 4QLJA 1ZRQA 2YB1A 1ZTVA 4W7VA 1JQVA 3K4DA 1BAGA 2FGBA 1PZ1A 3PUDA 1H5VA 1DL3A 3WO8A 1SPQA 1CB7B 1FWIC 1BKSA 3BSGA 4D8LA 1JYVA 3CU2A 2WVTA 1NH6A 4HTYA 1UJPA 1KC7A 2DZBA 4IJBA 5EMUA 1EGVA 2Y24A 3HG5A 4JBRA 3I4KA 4KGLA 5M5DA 3RR4A 3G0SA 4ENLA 1XLIA 3U2EA 1SO6A 3BE7A 3IIZA 4S3JA 3GLCA 1MXSA 1BWVA 2A3HA 4KFPA 4OFCA 3GXNA 3AIWA 4B3ZA 1XDLA 3CWHA 1X8FA 4CD4A 4LUYA 4BZYA 2INFA 4PRRA 1DE6A 1SJAA 5D2TA 1XC4A 4LUSB 4S3GA 4JAWA 5DELA 1Q6LA 5GJMA 5KINA 1B90A 4POCA 3PJTA 4I5RA 4MPKA 4O18A 2C0HA 4E2DA 6REQB 4US5A 2V5CA 2HVOA 2PRHA 1YMYA 1BTMA 5AN7A 3XISA 1UA3A 1XIFA 1TPVA 3AC0A 1P0KA 1PV8A 5GPRA 1JIBA 2P3ZA 3CHCA 3PUOA 4V28A 4WCJA 2MANA 3GTXA 4D8AA 2ZRXA 4Q6JA 4QIUA 2OELA 1EEXA 3JZUA 5A6KA 1W9BM 4HVXA 1CTNA 3KBMA 3P8JA 1DIOA 1E1CB 2KAUC 3AMGA 3PAOA 1A5NC 3LEPA 3KDOA 3OG3A 1NELA 1RBOB 1G4SA 5FEWA 3UWQA 1ENUA 4NU7A 1CXIA 1Q13A 3AOFA 1QNVA 2F6UA 4O1EA 1KXVA 2C13A 2A3BA 5AHEA 2VM8A 2VVSA 1LRTA 3HG4A 3P60A 3H2EA 2PWGA 3TWAA 1W1VA 5H8PA 3GG1A 3U6WA 4F8XA 1JYNA 2FH6A 3KTSA 4EPBC 1NEYA 2NW0A 4V1XA 1B54A 4NJHA 3KP0A 1OK6A 5CBJA 2OPJA 3HF3A 2YJQA 3R94A 2R14A 2R1MA 2V5DA 4IICA 4AIEA 3TYUA 3B05A 2QCNA 3W76A 1TKKA 1EJUC 1V3JA 3PSVA 2NVCA 2OYLA 4E3VA 3NVDA 2FZ9A 3LHTA 4RW5A 3W7IA 1GOIA 5HMDA 4K8EA 2C8NA 1JRBA 1ZP4A 2BGQA 1ZALA 3TNBA 2NSXA 4E8CA 1DE5A 1W3TA 4HJFA 1RA0A 3EOOA 1VJIA 4RX0A 4DWSB 1M01A 3PFMA 3I3DA 5HNRA 4KETA 2PWFA 3V16A 4CD5A 2DT1A 2ZXDA 3ZJ6A 2REQB 3L4XA 2YCLA 2XG9A 2HNHA 2IPFA 4WOQA 2NQZA 4PSRA 3WFAA 2GJXA 5I3KA 3G22A 1WCGA 3H2NA 5FACA 3QN3A 3DFHA 6TIMA 1OCQA 4H00A 4ML4A 3AAMA 3P14A 1JCLA 1F3XA 4UFLA 2V3FA 4XB3A 4S3EA 3E9AA 1KXHA 1MVYA 3H6OA 1PTGA 2XVKA 1TIMA 1EJSC 4J3TA 4QJ1A 3TNOA 2JKAA 3LSCA 2ZUVA 3S0CA 5HMEA 2CLPA 1ZUAX 2JBMA 3NA8A 3LBCA 1VP5A 3GDRA 4HCHA 4N4PA 4K36A 3L2LA 1PDZA 3TXVA 2ZUTA 2XZ7A 3W0KA 2ZZ2A 1UQZA 4GGBA 3ZT5A 3CPRA 1EA9C 4GKTA 3EGJA 1W31A 5CZ0A 3CMJA 3CWOX 5I79A 5IBXA 4B5WA 5T91A 1EGMA 1XIGA 1EB3A 3RO8A 1QATA 3UWZA 2IQ0A 3TQKA 2PWUA 2JEQA 3TTYA 3KBWA 4BI7A 2WSYA 5D05A 2HBXA 3LU2A 4NYYA 3I10A 3GU1A 2V8ZA 4O8RA 4J1OA 3RDKA 4XIAA 4O15A 2XIBA 3QPEA 3ZR5A 1CIUA 2WJDA 5F7UA 1QNSA 2JE8A 3TJLA 3O0KA 3GHTA 4JDBA 1AODA 2UWFA 2VCBA 4QEEA 5HNNA 1W5MA 3PJWA 5D2VA 3DXIA 2DZXA 3PAJA 1XGZA 3NTYA 2RDTA 4R7JA 3D5HA 2GGGA 2W3ZA 1JAKA 4DJED 1M04A 2BV9A 3ARPA 2WNNA 3C3NA 4P8VA 5FJTA 1MRQA 2V69A 1JD9A 3ZIZA 3OVRA 3C56A 4QQUA 4JTQA 2RKXA 3ALGA 1GYNA 3EWWA 4F0KA 3TX9A 3MZ2A 1XCXA 1GJUA 3CZJA 3UP8A 3INPA 1FTXA 3WNPA 4UTWA 2QKFA 1SMAA 3CAQA 1NFPA 3QHMA 3VA8A 1BRLB 3P61A 4AYGA 4WXZA 1OYCA 1TYGA 1IWPA 1HN1A 1OIFA 3OVQA 3OIXA 4A4AA 1XC6A 2INEA 2D3NA 1UKQA 5HNUA 4OOZA 1OY0A 3SFWA 1WDWA 1GJWA 3SIZA 4JKLA 1VC4A 3THAA 1JZ8A 4E2BA 4IOTA 2WM1A 1RD6A 3L7RA 3PSWA 1OVDA 1Z9AA 3E2RA 1HL9A 2ZX5A 4HMDA 3O1NA 4DJEC 3ARZA 1T5AA 4TU1A 2G3FA 5FF7A 3VGEA 2RUSA 5SWUA 3N04A 1R7OA 4H2CA 1FFRA 2FTYA 4QR6A 4K1WA 4DF0A 5J5DA 2PS2A 3ABRA 4HZ8A 2PWEA 3U5UA 4RPPA 1ONRA 4CQDA 3MDUA 1PIIA 1IQ8A 1PZ3A 2DZVA 2A6LA 3ISIX 3TQVA 1P4CA 4B5NA 2DSZA 4IL0A 2D73A 4MIMA 1WX0A 1JZ2A 3QTGA 4NZJA 1E0WA 3K5XA 3E0LA 3TJXA 4HSNA 4Q8QA 3EX6A 4MFEA 1MRAA 2QCHA 1MQQA 4GFIA 3B9NA 3UZWA 2WMIB 5BROA 2H3DA 1YRRA 2C79A 4FOUA 2QDGA 4YHEA 3L5MA 3UY7A 4N4QA 3EWXA 4J3VA 1XH2A 2OQYA 3ELFA 1ITUA 2PDGA 3AIRA 1WO2A 3F4VA 2PTZA 1FDYA 4WQ6A 1VFMA 2E28A 3G2GA 1WPCA 3S6TA 2XVPA 4GZJA 1F9CA 2GPTA 3LBOA 1YX1A 1Q2SA 3TA9A 2CERA 4UFJA 3QMRA 2CU0A 5BZAA 1XBYA 1RCQA 4RNHA 3A5FA 2PDMA 2KX9A 1E3ZA 4LU0A 3K46A 3NXLA 5DCBA 1XF0A 4LUSA 4H9YA 3N9RA 3DFQA 1FBAA 3UCDA 4XISA 1P1MA 2OO0A 1QXLA 1WZLA 2G0WA 3GZ3A 1TA3B 1XR2A 4Q33A 2AL2B 1EJRC 4DXVA 4JKKA 4WXYA 3OHMB 2GGIA 6REQA 3W7RA 3PBGA 4GG9A 4MB4A 3W00A 4ZSUA 1ZJBA 3KOWA 3IVUA 4YS1A 5JBEA 4B9ZA 2FB2A 4L9ZA 1US3A 1EC9A 3M0ZA 3A9BA 4EX4A 5ABHA 1KR0A 3KS5A 4GLEA 3PUGA 2E9BA 4KPLA 2WVSA 3NZRA 1TR1A 5DX7A 3EWCA 1QDSA 1GW1A 1E1CA 3BZJA 4X0NA 3EOEA 4AEFA 3CJPA 1CGTA 4WJEA 3MSDA 4UMCA 4K39A 1K03A 2WOQA 1I2QA 3B9OA 3S2CA 3SUSA 3VD9A 1KW1A 3E0VA 1EIXA 1UR4A 2JALA 2W79A 3WZ0E 3WLIA 1N8WA 1VCVA 2QPXA 3GW0A 5HMSA 4HOWA 4JHZA 4F0SA 1VKFA 5K4ZA 1ZBCA 3W1XA 2VEKA 2QGYA 3TTOA 5E9XA 2QJIA 4UZSA 4MZ8A 3SN4A 1E0TA 4GINA 3TKFA 1FWHC 1MQPA 3LCIA 4XG1A 2WSQA 1HL2A 2VX5A 4TV6A 1DPMA 5EYWA 1VPYA 1XRTA 4I9AA 3TUUA 4W9TA 4GYKA 3NVTA 4ZQMA 2ZRYA 3OVPA 3SZ8A 1WKFA 2HRWA 3SUWA 3SGGA 2J4GA 3N4AA 2BY0A 1SUXA 1FWDC 3N9SA 3KZSA 1EJXC 1CGVA 1SFJA 3CL8A 3O3RA 1QR7A 1RLDA 4OUIA 1E6XM 5BXPA 4MJ4A 4H8HA 2JEPA 3MZNA 2E8YA 2W67A 1W56A 5JIWA 1JFHA 4IGMA 3C86A 4DWSA 1V3IA 1LP6A 5AC4A 2JQXA 2VKZG 4V2XA 1T7LA 2Y7FA 4DJFA 2REQA 2R82A 3CUXA 2E1WA 1PIFA 1V3MA 3UY8A 2XJ7A 1Z7AA 4R88A 1KQYA 3P7YA 2F2KA 4B5TA 2YBVA 5DMLA 4J3UA 2I5IA 1F4HA 3LERA 2XN1A 1F7BA 4F9DA 4UR9A 3P3BA 4H6RA 3S3GA 2Z1VA 4IPPA 4JL1A 1UCWA 3LX9A 1Q4WA 5FL0A 3RM8A 3C2FA 4NL1A 2NX1A 1J6PA 4GCAA 1AD1A 4GQRA 4GPNA 2GVLA 5MHBA 4AIUA 2QULA 3MO7A 1FRBA 4C6DA 3V1PA 2IKGA 3QTPA 4FLRA 4O0QA 4PCPA 4UR7A 4AVNA 1TIWA 3RHGA 4AX6A 3URAA 5BRPA 3DH7A 4AZCA 5FCZA 4D9PA 2F61A 4HA1A 4PUMA 1OQFA 3OBKA 3BMXA 2FFIA 1YDOA 3UJ2A 4LYPA 3TEVA 1TTIA 3NUKA 4JKMA 1FHDA 1JZ3A 3COTA 5AOUA 3BG3A 5ABTA 2VT0A 2PWVA 1S38A 4DBWA 1CXHA 1GVSA 3LS9A 1AQFA 3ORWA 3WBWA 3GY1A 4H4IA 1W3NA 1H1NA 2I5QA 3OLEA 1XDJA 4HU3A 4L1XA 4DNMA 1D2KA 4IX0A 3FX4A 4Z0JA 3DHDA 1MSSA 1BG9A 4B5XA 4Z17A 4CU6A 4PTXA 3QHNA 3CUGA 2EPOA 4LTSA 3VFCA 4WKHA 4L65A 1B3ZA 4XZBA 4ZB0A 5BOOA 1LLWA 3FVMA 3ARRA 1ZNNA 4CEXC 1HP5A 4UFIA 3SR7A 1UUQA 1ZFJA 5HJLA 3UG3A 3BMVA 4BI6A 2R8WA 3CL7A 3DG3A 3SCNA 3TMLA 1EQPA 4QLKA 1F61A 2J79A 1IEVA 2PA6A 1Y0EA 3STEA 3GXTA 1QK2A 4C60A 3V18A 2I57A 1MW3A 1LORA 5C55A 4F40A 3RRAA 2YX0A 3AWOA 4U5KA 4GH1A 4G6CA 1KFLA 3LRLA 3Q58A 5AZ0A 1QPKA 1BRLA 7A3HA 4L1WA 1UR1A 3LCFA 2ZWZA 4E4PA 4B92A 4LSBA 3NSMA 2BY2A 4JCLA 2X42A 4PMDA 2ZZ7A 4OIFA 4LEFA 4D6JA 5D4YA 3M0JA 1XYCA 3WSUA 3ITCA 4O1DA 3TR2A 3STFA 3TYEA 1DIKA 1E9YB 2FVKA 4HP5A 1HKIA 2P0IA 1OD8A 2YW4A 3E74A 3HGRA 3GU2A 4M6QA 1LOLA 1PPIA 2FZMA 2OEKA 1R38A 8TIMA 1QK0A 3TAOA 1WV2A 3BICA 3AMKA 5I06A 2ATSA 4LJ3A 2E40A 1NWUA 3T44A 4NZ5A 4A3YA 2E6FA 4LANA 3W7QA 3BURA 2FB3A 5AFDA 1EJ7L 3TROA 3KL5A 3MMDA 1UIOA 2J75A 3R13A 1L6YA 2J25A 2Z27A 1V6WA 2A3AA 1IEWA 2VR2A 4M7SA 3MMWA 1WUFA 1KCXA 2Y8KA 3L5LA 3T0CA 3ANYA 3R12A 1CBGA 1XP3A 3OB8A 1PS9A 2QMJA 4OZOA 3F5LA 2OEJA 3AHXA 3QSTA 4C6MA 5F4XA 3EYPA 3I3BA 3OLDA 3L2MA 3WNKA 1DKWA 1E0XA 2ZA3A 5K2ZA 2WMIA 4UTKA 1EWEA 1RP8A 2XH7A 3PTDA 3M41A 1XGDA 4BS0A 2HV5A 5FEZA 1L6GA 2VR4A 1CGXA 3CH0A 2X0SA 2E3ZA 1TQJA 2X1TA 3WMBA 3ARVA 3Q2DA 3APTA 1DQXA 2F6KA 3M7WA 3K1DA 2CLMA 4WJXA 3E5BA 3G1RA 1G67A 2A2IA 2YBTA 2WZEA 3VCRA 3RCMA 4BY3A 1H7XA 4JTSA 3HJZA 2GLKA 3UJSA 4AVFA 2J6VA 1QO2A 1P1XA 3NPVA 3GTNA 3BPWA 3FJ4A 4PB4A 1D7FA 1W9PA 4Y9OA 1TA3A 3LSBA 4RXFA 5XIMA 3VNMA 2AL2A 4JIPA 1Q65A 1E5NA 3R11A 3FOKA 3UPWA 4LB3A 4PB3A 1YNPA 4YNGA 4ASTA 1L0PA 1RCOB 3FS2A 4NHVA 2YBUA 5D02A 3ARUA 4QBXA 1NOWA 1CB2A 4YU1A 2O92A 3HN3A 1K6AA 2XIIA 2VFGA 3WF3A 2VGBA 4QAWA 3FNDA 3KOZA 3M5XA 4RZ4A 5GNYA 3IUDA 3QVQA 4ZOBA 3I3EA 1E43A 1XJBA 4ZQOA 2X7WA 3GHRA 5A8MA 2Z4GA 2E6DA 5CC6A 3W28A 3S47A 4B2DD 1XYBA 1RAKA 4EF8A 2C18A 3T40A 2Z00A 3M6DA 1EWDA 3OIHA 2DH2A 5M17A 1VS1A 3UXAA 3BQ5A 4XD4A 1GZ1A 1TPUA 3ITYA 2OGJA 2FVMA 5JIPA 3P0XA 4GO9A 3VD7A 1CCWB 3DG7A 3G1SA 3AIBA 4F0LA 1E71M 1B9ZA 3MP3A 4Y9NA 4C6KA 3WD4A 4NZFA 2ASHA 3RYSA 3SCRA 3W2JA 4EKJA 3ITLA 5F2MA 1VFUA 4DM1A 1KM3A 1R0MA 1R7AA 3BVJA 4B5VA 3SEPA 2HVNA 2RAGA 3ABSA 3LXAA 1V51A 1EYWA 2W63A 4AFYA 2VFDA 1X1ZA 1QI2A 3WH8A 1J12A 3DBPA 4XAPA 3NZQA 1WKYA 3S42A 1H7WA 4B91A 3ITOA 5E93A 2QR6A 1I2PA 3DFTA 2ZDSA 1I1XA 1WOBA 3EEZA 2PDFA 2J47A 5TIMA 1W32A 5C0QA 3BOFA 1Q6CA 2DJXA 1OB0A 5E6ZA 3T78A 1J8VA 1P6WA 2G8ZA 2O4QA 4MM1A 3VYLA 4AEEA 3WMSA 4J2PA 1ONEA 3C8FA 3FJNA 4IGNA 4JTUA 1H61A 3U48A 3ZLHA 4LAMA 5D09A 2PCQA 3WLOA 2Y8VA 3PPFA 4TX6A 1A5MC 2HISA 4DLMA 4C1NB 3PNUA 4LF1A 5F1UA 4QISA 2FPYA 1LWHA 1U5JA 5EMLA 1SW0A 1AH0A 4W84A 3L9CA 3P62A 2D69A 3BLDA 2C1HA 3WBEA 1K4HA 4DYKA 4JYEA 3IARA 1FKWA 4WKFA 1TFVA 4I90A 3DHUA 1UUOA 1G6CA 4HSHA 3IPWA 5HWMA 4UTHA 1R47A 4E4UA 4JR5A 1N8IA 2UY2A 3TOPA 2E67A 4OBRA 2VJXA 1HGWA 3C2YA 3S2LA 1MNSA 2HEJA 3NQGA 4MAVA 1TSIA 5A6BD 3CYJA 4RE0A 3WH6A 3OU8A 4YWSA 1B3OA 3VGHA 4W85A 1DJIA 1HKWA 3AS0A 1IZJA 1GNXA 2NV2A 1JXKA 2Y7EA 1QRQA 1VEPA 2FPTA 3NZ1A 1S3HA 4W86A 4CVWA 1ISZA 3VNLA 2O56A 4IP4A 4C5YA 1F6KA 3EEGA 3T8LA 3HA1A 1XIBA 1TJ1A 2X16A 3CZLA 4B15A 3QY6A 2VOMA 5LA1A 3WJXA 3VOCA 4O52A 4Y96A 2WAGA 4H6EA 1KWKA 4HT3A 1BVNP 2FLIA 1BFNA 1J18A 2O4MA 1OEPA 3UNDA 4TO8A 4MNMA 3UXKA 1IYXA 2ZX9A 5F2LA 5EPDA 3EKLA 3LN3A 2AMGA 4PYSA 4C91A 3G1YA 2EPHA 2F9RA 3UERA 1SZGA 4MLJA 3S1VA 3EPNA 1CZ1A 1LT8A 1VFLA 2HTMA 2J6XA 2ZXQA 4FP1A 4BHYA 4ZO8A 2IPGA 1UH2A 5CXPA 3F2DA 1GKPA 2BASA 5CC5A 3I4EA 3WCZA 4JNYA 1EHNA 3UZ5A 4Z1DA 4F2TA 1JDFA 3LQLA 4ZE4A 1T8XA 3FHAA 3W1PA 1GPFA 3TP4A 3TXZA 1L9WA 1TZ9A 1VFTA 2WVVA 3SN0A 3WY1A 1CGUA 2TYSA 2H6RA 3NQ2A 3NZGA 1IT0A 1KKRA 3KWXA 4C6OA 3H24A 3KBVA 5IXEA 2GGEA 1LCOA 4GQ0A 2QUTA 3DESA 4PE8A 4LW7A 3MHFA 3VM7A 1QT1A 3G0XA 3BJFA 4XZLX 4M0XA 4L5ZA 4HMEA 5T9BG 4FZIA 4DY1A 3SCWA 4I8YA 1R86A 1TV3A 3IVTA 3OGRA 5J5RA 3ZT7A 1OINA 3GWQA 3SO7A 1BWKA 2C0AA 3UT0A 2YL6A 4BEQA 1KLYA 4M8UA 3F4DA 3CT2A 2E0PA 4JNMA 4Z2IA 1ZP3A 3U2OA 1UB3A 1MEWA 1CEOA 2ATMA 3HGSA 4W8BA 4E5TA 3G1VA 4Y9AA 1O5RA 1V0MA 4FX6M 1B57A 4OVXA 4QE5A 3ZM8A 1HVXA 3CIXA 4WDWA 2PD9A 1J9YA 3VIJA 3AZSA 1MDLA 3TA6A 1RBLA 4MY9A 3PBMA 4C6PA 3LRKA 3MW7A 2VRKA 2R94A 5DANA 3WF4A 2QEZA 4UOZA 3PTQA 4FX7A 1YDYA 1BGAA 3C5QA 1DJWA 1S5WA 2YCIX 3LHYA 1MW0A 5CLTA 1VYRA 2ZIDA 4Z2LA 4IL2A 1TWDA 1FWTA 3TC3A 4HNVA 2DW6A 4F66A 1TWWA 2IXUA 3LUTA 2BY1A 4R9XA 2C1GA 5AC7A 2B7PA 3VGBA 3LI0A 3W2NA 2V5JA 4ES4A 3RAOA 2JF7A 3S8HA 4MJMA 2OYMA 3UZZA 2W5FA 4PGLA 3NOYA 1H62A 1UASA 1QHPA 1Y5XA 2PDXA 3R8GA 4JX4A 1FCBA 1VIWA 3CUIA 3TCEA 3A12A 1PL9A 3GH5A 2Y1HA 1ITQA 5BCAA 1T40A 3HGJA 3O8AA 3EDKA 5BMWA 1PCWA 1SM9A 3DECA 3AS2A 1VZWA 2NUWA 1RVGA 4E6MA 2GYIA 3S5OA 1XG3A 4NJGA 3AZRA 1N82A 3S9IA 1IXOA 2ZWYA 1E0VA 1BTCA 4DWDA 2C7FA 3G3DA 3MUCA 2HZGA 1JYXA 3VK5A 2DUXA 4X9SA 3FCPA 1H3GA 3GHUA 5A1AA 3T4CA 3SQSA 4MOZA 3QOMA 4U3AA 1Z48A 3NQFA 4QCFA 3UPBA 5U7SA 3DOPA 3P81A 1CXLA 1Z41A 5E0KA 1XH0A 4I6VA 1GOXA 3C0QA 1H60A 4A8RA 3TWBA 4QNEA 5M2FX 1X96A 3RIKA 4MB1A 4MGGA 3G1FA 3PZ9A 1JFXA 5A2BA 4G7FA 4L4PA 1HKMA 4D6DA 2CHOA 2WQDA 4UTTC 4M82A 2FDMA 3B9AA 1YBQB 1XCFA 4X2RA 4LCRA 3KTXA 1UHVA 1GTHA 1HT6A 4AZ7A 4P8WA 2I9UA 2VMFA 1NDVA 1MMFA 1JJKA 1YXCA 2A6NA 1HZYA 3AMLA 4V1YA 2OT1A 1KV5A 4S3KA 3HBLA 4UWMA 4TVCA 5IDIA 4I9MA 4ZZ9A 3L65A 4QCEA 4KFNA 2GQ9A 2CHRA 1AFSA 3OA3A 2DIJA 3UR2A 1E9ZB 4Q22A 1HFBA 3VX1A 3O07A 4B9YA 2JKPA 1P0NA 3WQ8A 1V3KA 4I5UA 4W8AA 2EJ1A 2PC8A 4D6CA 5C2GA 4ATWA 1W9UA 5AZ1A 4FMVA 3WDRA 3MYOA 3MPGA 4QG6A 3HPSA 3AHTA 4Z0SA 1FFQA 2YDSA 3DAQA 4QJ3B 1F73A 3OZYA 5B7ZA 4GUIA 2EBNA 1EGZA 3TH6A 1FXQA 3A5VA 4L1GA 3ZZ1A 1GK8A 3T0BA 1A80A 1BPLB 1EO7A 4YLWA 3WNNA 4C1NA 3CB3A 3WH5A 2D2GA 1RPKA 4HPHA 4QG9A 1JZ4A 3TTEA 1FP9A 4J35A 4K2SA 1GPWA 3KL0A 4IP5A 3W2LA 1REQB 4NI3A 2DJLA 3IJ6A 3O7UA 2RGMA 2Q8XA 3UR5A 1XLLA 4FI4A 3EMCA 2XHYA 4EPEC 1GG1A 3I6RA 4IM4A 1HW6A 4D6IA 2FIQA 4YCPA 2CLIA 4KMQA 3N4EA 2ZZ5A 3PBYA 5I7GA 4S1FA 2VEGA 1VPQA 3OPSA 3WF0A 4X3ZA 3TZNA 4DJDA 1EP2A 4HQVA 1GEHA 5CZTA 3RLUA 1W0MA 1J93A 2CLEA 4CQ8A 3A6OA 4RNJA 4B90A 3JVAA 3BLFA 2X1IA 1J01A 4A21A 3N2XA 3I68A 4GIYA 1VF8A 2C71A 4LT9A 4NAEB 4AF0A 1OFRA 2Y61A 1OCNA 5D32A 3VAVA 3W7HA 4LS0A 3IJ7A 1UR2A 2WNWA 1NARA 3MI6A 3NPWA 1V0NA 1XLFA 1UD3A 2G41A 4UCFA 1FDZA 3K4WA 1F4AA 4H19A 3B8VA 3MKKA 3AMCA 4A3HA 2OZTA 3OTRA 1M1BA 4EK7A 1N7KA 3BC9A 1XWYA 4XZ9A 3TYZA 1K7FA 3LZ5A 2DZWA 1WDQA 1R30A 4LB4A 4H8NA 5IFTA 3M0IA 2GSJA 3STCA 3MHGA 3OHIA 3RPMA 3L66A 3S5YA 4N6EA 1UYQA 1QOXA 3WLMA 6A3HA 4KEUA 2QJJA 4AG0A 4IQJA 4DUXA 5AHLA 3VDCA 4AQLA 1RLCL 1QCWA 5GJNA 4XKMA 1X98A 4JY9A 4KGJA 1ZBWA 5EA9A 1ZQ5A 1GKQA 4YYFA 1O6IA 1EPXA 4MB5A 3AIUA 4F0HA 3B97A 1OFQA 2DV0A 2J8GA 3W70A 1XW8A 2EF9A 5B80A 5I3FA 3C8NA 3PVFA 5HULA 3H2AA 4ZCWA 1WQ5A 1WB0A 1PX8A 3AZTA 3C0JA 4MDOA 5AHMA 3TSBA 1M65A 4DELA 5IHRA 1E4NA 4ZQCA 3MUAA 1O5KA 5BWAA 2OMAA 5C9XA 2FQIA 5HBFA 3DC0A 2H3BA 3KTCA 2HWGA 1SO5A 4CCCA 3ME3A 1TMHA 2INZA 3VKKA 3NO5A 4KW2A 5AC6A 3SFKA 5LSMA 2DW7A 3BL3A 5E1QA 3IEBA 5BWFA 4WD0A 1B30A 1F3WA 4JIHA 3VKCA 1H7NA 4MTVA 4CD6A 2AMXA 4HPGA 3PR2A 4JD4A 1XD1A 4C6CA 2HVMA 1PSCA 4AY1A 2NXIA 1RH9A 3LPFA 3IRDA 4INFA 1KFBA 4PULA 3W2MA 2VOTA 7REQB 1VYSX 5F2GA 2BOFX 2HXUA 1XDMA 4AD0A 3EA2A 5TF0A 1IR2A 1UZHA 1A0EA 2VQTA 3MY9A 3AJ7A 1HXJA 2BHYA 1ZSXA 3CEPA 1B9BA 1LDCA 1QWGA 3CUZA 3VOGA 1BF6A 3JR2A 2VTFA 1ZY9A 3LLXA 3CHVA 2Q01A 3W02A 2VGGA 4PN2A 4RDYA 2XSBA 3ERPA 1EA0A 4NJJA 1E6PA 1RR2A 2IMRA 4HOXA 4M24A 1TUXA 3QZAA 3GK0A 3QFEA 2PBOA 5IHSA 3BARA 2I14A 6XIMA 2ALDA 4HPNA 2HK1A 3ATZA 2BXZA 3EKZA 5HA7A 1IIHA 4CNTA 1IF2A 6TAAA 2A7NA 3SCTA 5BYWA 2XM2A 3GO2A 1QU4A 1DWJM 2CLOA 2RFGA 2NLYA 2DZPA 4EWND 4D6FA 1XYLA 1FOBA 4D72A 4O53A 2RDUA 4J27A 1DJQA 1FXPA 4RCXA 4UQ9A 3WNMA 5I02A 3VCCA 4H7CA 1EXPA 4RR4A 4IMEA 4WVXA 4CNNA 2WCAA 1AJ0A 2FHCA 3H7UA 3WLTA 4V33A 3WUBA 2PZ0A 3TN6A 4PZVA 1NDWA 3ID7A 1D9EA 1NDZA 4GYPC 3U4FA 3RPDA 4NNAA 3H54A 4MPQA 4I7UA 5CPSA 3PC0A 1R46A 5I3DA 2XWDA 3SY1A 2XSXA 4LOCA 2NQJA 2B7QA 2HROA 1LYXA 1SR0A 1M9HA 2WSKA 4KRUA 3VPLA 3MMTA 1BXBA 5CQ1A 3R6IA 1DBTA 1D8WA 1TV5A 1PYFA 1HUVA 2J7GA 2JFEX 2JK2A 1DWAM 3WJZA 4PR4A 1KM2A 3RM4A 3F5JA 5K9CA 2OEMA 4IWWA 4TX8A 3IGUA 3LV5A 2GDUA 1O66A 4R7OA 2HK0A 4N02A 4UQAA 5I3JA 1SZFA 1A4LA 4JN8A 2YL9A 2ODOA 1UIPA 4PFMA 3OGVA 1EEPA 2RDWA 1KR1A 2X0HA 4PUUA 3OYZA 3HB9A 4S3FA 4HIBA 3VE7A 4LCQA 2WANA 1PWMA 3GDTA 4P5UA 3W3OA 1VIZA 3PY2A 4AIOA 3B8WA 1CECA 1W2VA 2CBUA 2ZICA 2J7DA 1VBRA 3NGJA 1RQBA 4CU7A 3BANA 3F2BA 5TBOA 4JXCA 4TR9A 4M6PA 1ZENA 1YXDA 2PC4A 3AU6A 1POJA 3BOLA 3QYSA 4P8XA 3BAYA 3CQJA 1HX0A 3RR1A 1KGWA 1I4NA 1A3WA 5FA5A 3B04A 1TX0A 1W1YA 1YE6A 3C2VA 3HQPA 3W73A 4OHQA 3ABOA 1JL8A 3MYPA 3UA4A 2ZFAA 4BWLA 4LAOA 3U57A 2C14A 1Y7VA 3ARXA 2CWXA 1JEZA 1SR9A 2ZXAA 4GWEA 3JW7A 1LLZA 3GHSA 4OUEA 1AZ2A 1XI3A 4M80A 5BU6A 3NM1A 2EO7A 2V2DA 5I3HA 1C8VA 3W29A 1E6NA 1GGOA 1RK5A 2Q8LA 4YPJA 1FWAC 3AFBA 3NL3A 3MUY1 3S4TA 1I6NA 5H8UA 1REQA 2OB3A 4UUIA 3IAPA 3WQGA 5FKYA 2VFFA 4A8IA 4DO5A 5TD4A 1GHRA 5CLWA 3VIKA 4S3DA 1F2JA 4PFHA 4PTDA 4FALA 3CAKA 3MDWA 1CENA 4PH6A 1KD0A 1UJQA 2IXVA 1XICA 4MVAA 4DEFA 1FQ0A 1FH7A 1ISXA 1VJZA 3W74A 1QOQA 1UC4A 2YOCA 5A2CA 1WXJA 1YTEA 2YCEA 1ZPTA 1RP9A 4X63A 2QMKA 1WBJA 4WY0F 3ZVIA 1MNZA 2W66A 4GYJA 4NNBA 2BODX 3QEZA 2WKLA 4WX2A 3S6DA 1EBHA 2FZNA 4JTHA