5ECUA

The unliganded structure of caldicellulosiruptor saccharolyticus gh5
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
350
structure length
350
Chain Sequence
TAYEKDKYPHLIGNSLVKKPSVAGRLQIIKQNGRRILADQNGEPIQLRGMSTHGLQWFPQIINNNAFAALANDWGCNVIRLAMYIGEGGYATNPQVKDKVIEGIKLAIQNDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIAQKFPNDFHIIYELCNEPNPTDPGVTNDEAGWKKVKAYAEPIIKMLRQMGNENIIIIGSPNWSQRPDFAIKDPIADDKVMYSVHFYTGTHKVDGYVFENMKMAIEAGVPVFVTEWGTSEASGDGGPYLDEADKWLEYLNANNISWVNWSLTNKNETSGAFVPYISGVSQATDLDLGSDQKWDISELSISGEYVRSRIKGIPYQPIERTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Caldicellulosiruptor saccharolyticus GH5
rcsb
source organism Caldicellulosiruptor saccharolyticus
molecule tags Hydrolase
molecule keywords Cellulase
total genus 132
structure length 350
sequence length 350
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
A PF03424 CBM_17_28 Carbohydrate binding domain (family 17/28)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5ecuA00
4AISA 1E72M 2W61A 4GO8A 3U5UA 5M17A 5JBDA 4W87A 4CVUA 4GINA 3BH4A 1WCGA 4JFUA 1UR4A 3N04A 2YDQA 4W7UA 4Z2KA 3WBEA 4JL2A 3AIEA 3UERA 1KGWA 4AZHA 1J0IA 4LXFA 3ZT7A 3AZRA 4RE3A 5BWFA 3MMWA 4DM1A 4E8DA 2WMIB 2YA2A 1JZ2A 1UD5A 4F9JA 4AD3A 3G6LA 1PEZA 3WF4A 3PTQA 5JIWA 1JZ5A 3CTTA 1GORA 3ZIZA 1CXEA 4D6EA 4PMZA 3CHFA 1FOBA 2XSAA 2IUZA 3UR8A 1QI4A 2VJXA 1AQHA 3PHAA 2VX4A 3EDKA 4B9ZA 1L0PA 4HZ7A 4ZENA 4AW7A 1JNDA 4J3SA 4J3XA 3FHQA 1W3JA 3UESA 7TAAA 2CERA 1TFVA 2ZX7A 3MMUA 5GPRA 1J0HA 9CGTA 3N18A 3WF3A 1ECEA 5E6YA 4QFUA 3L4ZA 5IFPA 1G5AA 1Y7VA 1CXFA 3MUY1 3QGVA 4WIWA 1N82A 4QDMA 3AMLA 3AMGA 4F9DA 2VRKA 2FHCA 2E0PA 3PZ9A 4C7GA 3UG5A 1KBBA 4FK9A 1E4LA 3SCNA 1ISWA 4W7WA 2G3IA 1NP2A 4FLQA 2XVNA 3A4WA 2VZUA 1TVNA 2BFGA 4B16A 1O6IA 3T09A 5AY7A 4AZ6A 1UA7A 4QLLA 1FA2A 2CKSA 2J7CA 5A95A 1Q6FA 2V5CA 2DSUA 3W82A 2G3NA 1WZAA 2D22A 3OLIA 1TR1A 2GK1A 3RM8A 1RP8A 4B15A 1JZ6A 5JIPA 4JZ5A 3T0AA 1FH8A 4U5IA 1V3MA 3W4RA 1K9EA 4R5EA 1NARA 4B3LA 3NUKA 2D0GA 1BG9A 4JHZA 4CKQA 2GJPA 4QLJA 4P7OA 3RMEA 1J11A 4LGXA 3GXMA 3AHXA 3WMCA 5A8PA 2JEPA 4GIAA 4LYRA 2PC8A 3PN8A 4HA3A 5CLWA 3T0DA 1CGTA 3ZT5A 3ARVA 1KGXA 1XD1A 4OOUA 3WQ8A 1QW8A 6CGTA 5A2BA 1VF8A 4CU8A 1PX3A 1GVIA 2JFEX 3ARTA 3VGGA 1C92A 4M80A 2MANA 5ABFB 2ZE0A 3LPGA 1V6WA 2OLHA 2X05A 4UNIA 5LA2A 3CLWA 1BAGA 3WD4A 3VD7A 3KL0A 2VNCA 3L4YA 3BAWA 1HN1A 1KGUA 3VDAA 3WMSA 4J3VA 1B3YA 4H41A 2J7DA 3KWXA 1UKTA 2ZX5A 4CCCA 1B90A 3SCWA 1XSKA 4PTMA 1C8QA 3ZT6A 2E9BA 3EYPA 1VEMA 4JFWA 4HMCA 4URIA 5EFDA 1JAEA 3VX0A 5BXRA 4P7NA 2PBGA 3IJ7A 1E6RA 5HPOA 2EQDA 4R27A 1B2YA 1CPUA 4FLSA 3U7VA 3SCVA 1QBBA 2CIPA 3PZNA 5A94A 1V0NA 3DECA 3WL1A 5CJ5A 1PIFA 1GJUA 4MTVA 1EO5A 4CD4A 3GXFA 2GFTA 2O9PA 1GOIA 3CZGA 1W2VA 1MW1A 2CKRA 1VEPA 3EDJA 2D2OA 2E4TA 1ESWA 4HPHA 4H04A 1BLIA 4CU6A 3CZ8A 3WUGA 4H2CA 1JXJA 3PZMA 4F8XA 1XYFA 3VGBA 4J7RA 1XRVA 5IHRA 3GYCA 2PBOA 4AZ7A 3W6MA 1C90A 1UWUA 5E9AA 2C7FA 1E4MM 1CXIA 4OBRA 5CPQA 1L8NA 1DWAM 1JI1A 5CQ1A 3PZUA 1V0KA 2CXGA 3M7SA 3RCNA 1ZJBA 5D4YA 1JL8A 3F4VA 3IJ9A 1UUQA 1BSIA 2D0FA 2YJQA 4U3AA 3AS3A 5EBAA 1OGSA 2F61A 5A6LA 4PN2A 4KGLA 4J3UA 3NCOA 2W66A 4B3KA 2ZUWA 5BXPA 4QAWA 3WNLA 3KE0A 2GDVA 3TTQA 4CD5A 5D8ZA 3WH9A 4YHEA 4PUDA 1EQCA 4PMUA 2CCRA 2YDSA 2XVPA 1KWKA 3B8SA 4IPLA 4D1IA 1B0IA 3N11A 1KFWA 1U2YA 2BV9A 4GQQA 4AEEA 3WQVA 3ARPA 2ZUUA 1JZ3A 1UR9A 3NSXA 5E6ZA 3AHZA 5A69A 1UHVA 2JF7A 3ZR6A 5HNNA 5I24A 2PI6A 5C8BB 4UQDA 4MAZA 2G4FA 1LWHA 3BCFA 4ATDA 3K4AA 4RE4A 2G3MA 1KXHA 2V38A 3J7HA 3BSGA 2ZWYA 2WMHA 3WDIA 3AIVA 4BQ5A 1WNOA 1E40A 4CN6A 3VMOA 3HU7A 5A1AA 1M53A 2AAAA 4IISA 3AISA 1GHSA 2WVTA 2NT0A 2WKGA 1SMAA 4W8BA 3OLEA 2W63A 1MW3A 2BHUA 1LL4A 3MSGA 2VCAA 3GNPA 3U57A 3POCA 4Y7EA 3UG4A 3OIHA 1LWJA 3WD3A 1FHLA 1RPKA 1GOKA 2NW0A 1WB0A 1V3HA 3S2CA 5CSUA 1FH9A 2G41A 2GK1B 4UZUA 2OWCA 1B3WA 5I78A 5D9PA 1KWGA 1R86A 5EMYA 5JBEA 3BC9A 2VR4A 3AXIA 4AMCA 3AIQA 2V5DA 2BY1A 4W5ZA 2VOTA 1J9YA 1QW9A 1CGYA 5C71A 1E5JA 2XG9A 1BHGA 1BG4A 1QNQA 2VI0A 4UQCA 1JYVA 3SIMA 3W27A 1CLVA 4ZEPA 4JFTA 2A3AA 1V02A 2DPEA 1X1NA 3BCDA 3VMNA 2Y24A 4MJ4A 2CITA 1MQPA 3AJ7A 3VIHA 3WIJA 4XB3A 1LQ0A 3OZOA 4W93A 3AYSA 1OBAA 2YKKA 1SYTA 3MO4A 3AIBA 1EA9C 4IUGA 3BAKA 1RD6A 4AZ5A 1J10A 3EDDA 2VRQA 1OT1A 1SMDA 1FFQA 1Q6CA 3THDA 2WC7A 3T2OA 3OA5A 3UEQA 1B9ZA 1O7AA 4ACZA 2E8ZA 1XV8A 4PRWA 1NOUA 3GNOA 1HIZA 4WJXA 4GO9A 2DSWA 5JUVA 1UR2A 3U7BA 2BY3A 2DIJA 2CETA 2CEQA 1C8XA 1TE1A 3AXXA 4WF7A 1D3CA 2DGAA 3CHCA 5A8OA 1W9VA 3BAIA 2D0HA 1PPIA 2FDMA 2GUYA 3AS0A 4RE2A 1NWRA 1KXQA 3MSDA 4GQRA 4EKJA 4A4AA 1OWQA 1ZJAA 3VO0A 1HP4A 1CLXA 2RGMA 2E3ZA 2ZXBA 4TXEA 3SCOA 2YOCA 2ZXQA 5E0FA 3PBGA 3WNPA 1D2KA 4U2ZA 2ZXDA 5D9NA 2F8QA 1FFRA 1CBGA 2GJXB 1GVYA 3GXDA 3SCUA 3RO8A 4MDOA 1G9HA 2VQUA 2YBUA 2E9MA 3GTNA 3K8LA 4UTFA 2CBIA 2WVSA 2J79A 3GH7A 3RM9A 2FGZA 7CGTA 3THCA 5CXPA 2QPSA 3DHPA 2GJRA 1HJXA 4AZCA 1HJUA 3IK2A 1JYNA 1M01A 3W26A 2WHKA 2J7GA 2BXYA 3WF2A 5HPCA 1RH9A 1B3XA 1UWQA 3WDRA 2WSPA 1VFUA 3OBAA 2O9TA 1HKKA 1AVAA 3VIJA 3W38A 2XYLA 1WDSA 1BVNP 3ZQ9A 4JCMA 1ZU8A 4FF5A 5M03A 1S46A 2FH8A 2QF8A 3QR3A 1E9LA 2YL9A 4HA1A 1EQPA 2BY0A 1XH1A 4PMOA 5I2UA 1HNYA 1HL8A 4MNLA 1JG9A 3M07A 4PEEA 3ARUA 2YLAA 1CXLA 4CD8A 3T0BA 3ARWA 4J3TA 5HBFA 4AZCB 4DWSB 1TG7A 1JZ7A 1H09A 4MNMA 2W4XA 4WKAA 4HOZA 3VGFA 2WYSA 3FXYA 4GZEA 3NDZA 4XZBA 3VM5A 3ARZA 3RM4A 1E3XA 1W9BM 1UH2A 3L2LA 5BCAA 3L2MA 3ZJ6A 4UQ9A 3ZSTA 3K4DA 5A2AA 2DH3A 4V28A 3RPMA 2DEPA 2JE8A 3VINA 1XH2A 2EO7A 2DT1A 1J0ZA 3AIWA 1OT2A 3O9NA 3CGTA 3WL0A 4V27A 4LX4A 4W5UA 1VENA 1OD8A 3WMBA 3WH6A 3WY1A 5A6AA 3NSMA 1UKQA 1MFVA 4PBGA 1GPFA 2W67A 1HVQA 3MV11 1V6XA 4UZSA 4TUFA 2Q8XA 4PMQA 3WH7A 2DQXA 3AMKA 2YLLA 4UCFA 5I0DA 1EH9A 5ABEA 2E40A 1V3KA 3TTOA 1V0MA 2VL4A 3LMYA 4NRSA 3WNKA 2FHBA 1HT6A 4M8UA 1QI3A 2WSKA 2WZHA 5A2CA 2X0YA 1PBGA 4AZGA 4NF7A 3VD5A 5GNXA 1QNPA 1ODZA 4LPCA 1BGGA 4W84A 3D5HA 1V3JA 2Y5EA 2WHJA 1GHRA 2WAGA 4XV0A 2G8ZA 1US2A 3AI0A 4CCEA 5D9MA 4ZE5A 2WM0A 1OGBA 3WUBA 3M6DA 1OSEA 4MNKA 2CNCA 2XM2A 4HMEA 2QPUA 1OIMA 3WNNA 3AROA 3F5JA 1IZJA 3ZO9A 2PWFA 4M81A 1TVPA 3ALFA 3MS8A 1LL7A 2D20A 1G0CA 1DEDA 1ITCA 3SUSA 4L4OA 1EIBA 1GONA 1TCMA 2XVKA 2UWFA 3GH4A 1R7AA 1R7OA 1HKIA 2ZUMA 3AZSA 2WXDM 4JHOA 4CN1A 3HMCA 1B31A 1ZBWA 2VQTA 5I79A 3L4WA 3APGA 1KCLA 4WSKA 2XVGA 2JEQA 1E55A 3SCRA 4ML4A 4YPJA 2NSXA 3K8MA 3EDEA 3AOFA 3SCQA 3VKKA 2X09A 3SCSA 1V6VA 4AXNA 1GJWA 1H49A 1UZ1A 4PTWA 3DYOA 1EOMA 4QLKA 2IXUA 1Q6DA 4NZCA 4X0NA 1BYAA 1GUVA 4GXPA 4Z2JA 1E6NA 4AY1A 2BY2A 3CBWA 3BMVA 1V6UA 1FHDA 5AYBA 4FMVA 1WDRA 1CXKA 3SUTA 2WLZA 3W0KA 3VIPA 2WMIA 3CUFA 1E43A 2CHOA 2J74A 4OKDA 3WNMA 4HZ6A 3L4XA 3AHVA 1DWIM 3ZJKA 4NSBA 4BCEA 4U33A 3VILA 1F4AA 1KBKA 1J0YA 3A3HA 1WE5A 4AD2A 1XGZA 3KEHA 4GI8A 4WSJA 4QCEA 4UOZA 5HOSA 1SR0A 2JF6A 2HVMA 3WH8A 5D8WA 3CIVA 3ALGA 4JKLA 3VMPA 4OBSA 1B3VA 1NH6A 2X1IA 3SURA 1CIUA 1VJSA 4ZE4A 3W29A 1H41A 4AYSA 1GOOA 1MWOA 4P8VA 4AD0A 1U30A 3GH5A 3AMCA 1CTNA 3N9KA 4GKLA 3N1AA 4AZIA 3I3BA 4BF7A 4CUCA 2PWGA 2J78A 3M46A 1BTCA 3VVGA 1H4PA 2FHFA 4H8HA 1W9PA 1EXPA 1E0XA 1UKOA 4CD7A 2XWEA 4PUEA 4M24A 1PX4A 4TVDA 2VURA 1UZ4A 1JF6A 1WPCA 1UR8A 3WEOA 4Z2GA 4D6IA 1M7XA 1D7FA 4U31A 2DT3A 2WC3A 4JFSA 2VMFA 3CPUA 3EMZA 5DO8A 3AS1A 2PWHA 4F66A 1HJSA 1ZBKA 1TZ7A 2EJ1A 1ZS2A 2A3BA 4HP5A 2W5FA 2X0HA 1B30A 3FNDA 1HVXA 2ZWZA 3GZAA 3W37A 5EB8A 4Z2LA 4M1RA 2FH6A 5A8MA 5E09A 1R85A 4A3YA 5DEZA 1DTUA 1WZKA 3ARRA 2WC4A 2VCCA 2VT0A 2WW5A 1OGGA 4JL1A 3VDBA 5A6BD 2EPKX 2CPUA 3UG3A 1OD0A 2WB5A 3VIGA 2CBUA 1VEOA 3OLGA 1J18A 3VNYA 3WN6A 2JALA 2J7FA 3RILA 4EE9A 1HXJA 1W1VA 2F2HA 2CYGA 2V3EA 2PWEA 4W86A 3WF1A 1WKYA 1XC6A 2J7EA 4YN5A 3AICA 2PWDA 4KMQA 3QHMA 1ISYA 3W81A 1W9DM 2UY3A 1EDTA 2BS9A 4CVWA 1RP9A 1YHTA 3UR7A 2J47A 1TMQA 1CYGA 1MVYA 1WO2A 1E0VA 2YA0A 4UOJA 5I77A 3WKZA 3AMDA 3AZTA 1E71M 4QCFA 2VR5A 1JIBA 1GOWA 3U5YA 1W2PA 4HZ8A 1XHGA 1DWFM 3CMGA 3SUVA 3LPFA 1P6WA 3K1DA 3T2PA 4HOXA 4AIEA 3CHEA 4TVUA 4U3CA 1PZ2A 3PTKA 1UKSA 3SUUA 2YBTA 4MJ2A 2GDUA 3WDPP 3W28A 1H0IA 1CGXA 1I1XA 1HJWA 3CZJA 1JF5A 2WMGA 2ZICA 2Z1SA 4ATLA 3AFBA 5F7UA 4JKMA 3PZVA 2OSWA 3K8KA 1E73M 4JIEA 4XUYA 3EMQA 4PCTA 2D24A 2WVVB 1LG2A 3ZMRA 3FY1A 2QMKA 5ECUA 2QHAA 3FN9A 1JDDA 1LJYA 2XGIA 1NM9A 4KGJA 1EHAA 1MXGA 1XCWA 2BHYA 1KXTA 3VU2A 2WCSA 1KQZA 3VIMA 2J75A 3NYDA 4TX6A 3IAPA 3FAWA 6A3HA 2VX5A 4JFVA 4PMXA 3CO4A 1BYCA 2AMGA 4RL3A 2V3GA 3I3DA 1QOXA 3F5LA 1OM0A 3VD4A 2D23A 3AS2A 4E2OA 1J0JA 5KEZA 2DH2A 2VX6A 4MDPA 4KWUA 1W9XA 2AOSA 1G1YA 3E1F1 5ABGA 3TONA 2J7HA 3GDBA 4Q7NA 4PTVA 2XTKA 3TP4A 2UY4A 2PF0A 3DYPA 1E1FA 4YHGA 2ZUVA 2V3DA 2CHNA 5A6BA 1PX8A 3EDFA 1W9UA 4PMDA 3WD1A 4J3WA 1CGWA 5C70A 3L4UA 1BGAA 1E5NA 2WBGA 1BPLB 1BQCA 5FIPA 5DF0A 1E15A 1HKMA 3NJ3A 1KQYA 1XSJA 3L4VA 1W32A 1AMYA 1B3ZA 1W3LA 4PTXA 3WDJA 2BNJA 3FW6A 4D6JA 2DSZA 3TOPA 1VRXA 4AD5A 4D1JA 5KZ6A 4PMRA 1H1NA 4H8UA 2JIEA 2WBKA 1H11A 2XJ7A 4DUWA 4D72A 2NT1A 3PZGA 5CGTA 5BRQA 1IV8A 4EAMA 2BXZA 2BHZA 3BXWA 2YL8A 1JD9A 4ACZB 1QI5A 5DFAA 1MYRA 1CZ1A 1JYXA 4BA0A 1UG6A 2W91A 2BVYA 3AIUA 1CDGA 3OG2A 2WPGA 3VDHA 1J12A 1IT0A 3MV01 2UY2A 4A3HA 2WLYA 2J4GA 2QV4A 4CD6A 2OSYA 3CUIA 5ABHA 5GNYA 3RJYA 5D9OA 2EPLX 4GI9A 4EK7A 4MAVA 1H2JA 3VD3A 3BGAA 3O2LA 2A3CA 5LA0A 4CN4A 4MB1A 1QI2A 2J8FA 4JCLA 3MUAA 2RGLA 3CHDA 4ACYA 1CGUA 3GBEA 3DYMA 4M56A 1M03A 2J62A 5IXEA 4W85A 2E8YA 5A3HA 2CBJA 2D3NA 2XFRA 4KH2A 3CZEA 4ZFMA 1C93A 1EGZA 4BQ4A 4DUXA 4E4PA 4H7VA 5DT7A 1UWSA 2ZUNA 5CZKA 3EBVA 4TTGA 5BYWA 3CZLA 2EEXA 4UFKA 3JUGA 1CNVA 2VTFA 5AC4A 3KZSA 4C7DA 5A8QA 2ZX8A 4Z2HA 1TUXA 3WH5A 1GOQA 4D6GA 1X6NA 3BMWA 1WP6A 1V3IA 1NOFA 3QOKA 4AIUA 4AD1A 4U5KA 3DC0A 4UQEA 1UH3A 2WMJA 2WANA 3I3EA 4BS0A 3VGEA 3MUZ1 5EFFA 4BZYA 1HJVA 4UQBA 1R8LA 1UD2A 1UR0A 4HTYA 1LF1A 5FOOA 1PJ9A 1JDAA 1UD3A 5I23A 3ARYA 4HA4A 3UETA 4CCDA 4Q22A 4MADA 2ESCA 4AIOA 3ZM8A 1Z32X 1VBRA 4W8LA 3ZOAA 1G94A 2J25A 1Q6EA 3WD0A 1JFXA 5ABFA 5AYIA 1QPKA 4W88A 4DWSA 1QHPA 2WVVA 4UOQA 1UOKA 1ZL1A 4D71A 3VUPA 1VFMA 1LLOA 2WHMA 4N42A 2VC9A 1U33A 3WD2A 1JDCA 2VZVA 2ZOXA 4WKHA 3OGRA 1G01A 1HF6A 2OWXA 1E4NA 1JYWA 4NRRA 3WEZA 2YL5A 2Z1KA 2J7BA 1NWSA 5M5DA 1VFOA 2EPMX 3VNZA 1CEOA 1QNSA 4PYSA 1MFUA 3IANA 2YIHA 3WBAA 3ZR5A 2WWCA 1E56A 3WQ4A 2ZUTA 3A6OA 1DHKA 3BLPX 5CG0A 4NI3A 3W6LA 3BLKA 5A8NA 2A3HA 4PSRA 4K68A 2BVTA 2DDXA 4AC1X 5FKYA 3PZTA 3MU7A 3MUIA 4XZWA 4HMDA 4IM4A 1KXVA 5A6KA 2ZXAA 5BXSA 4F79A 4HPGA 2WMFA 3POHA 1UR1A 1QHZA 4XX6A 3VIKA 3ARXA 4MB4A 2WZIA 4P8XA 1M04A 3NIYA 2VVNA 3WUEA 3WNOA 1GNXA 1MW0A 2WMKA 3WSUA 2XFYA 4GZJA 4E8CA 1W1YA 4UQAA 3VPLA 4CU7A 1JI2A 5CGMA 4QP0A 3DHUA 4D6FA 3SCPA 2W92A 1WDQA 1BF2A 5HDRA 3OZPA 4UR9A 1ODUA 2FGLA 2VZSA 3IJ8A 4GZIA 2XSBA 1GCYA 1ISVA 4OOZA 3S6TA 5IDIA 4CGTA 3T2QA 2YL6A 2EPNA 4DUVA 4D6DA 1ZBVA 1DP0A 1MW2A 1UD4A 2G3JA 4BQ3A 3EMCA 5DMYA 2GJXA 1E6SM 3VM7A 1QBAA 2A3EA 1Q4NX 1HX0A 5CPTA 1UWRA 2HISA 1W91A 4U2YA 1HL9A 3A47A 1FH7A 3B9EA 2VVSA 3VD9A 4FLRA 5CSYA 3N12A 4Z2IA 1OCQA 4S3JA 4AZBA 1PZ3A 4OJYA 4TVCA 1V03A 1JGIA 3SCTA 3KL5A 1VJZA 1JFHA 2OWWA 4UFHA 7A3HA 1WZMA 2C8NA 1QVBA 3N15A 4D6HA 1VB9A 2CESA 5TD4A 4HU0A 3VX1A 4MNJA 2WNWA 3BAXA 5HXMA 3BSHA 1SFSA 3GNRA 2XM1A 3NDYA 4JAWA 2GSJA 4PMYA 2YA1A 1K9TA 2W62A 3ARSA 1C91A 1GOMA 5A6MA 3VIFA 3MMDA 2EXOA 1XD0A 1VAHA 2X8RA 1IZKA 2VCBA 1MQQA 5A6JA 2DT0A 4M82A 5BROA 2TAAA 1ZB5A 3VTRA 1VBUA 4N0RA 4TOQA 2Y2WA 1CGVA 4KRUA 5FL0A 3BAJA 1UWTA 2WK2A 1EHNA 1BYDA 3FAXA 2XGBA 1NWTA 5FL1A 3AHTA 2XWDA 1E70M 5FCZA 1I1WA 4J28A 2VRJA 5CLTA 3QHOA 4BQ2A 1K6AA 1K9DA 3D3AA 2C0HA 1EO7A 2V3FA 1R87A 1YQ2A 1E4IA 2WWDA 3T08A 1XYZA 2OYMA 1BVZA 2O9RA 3VGHA 3ZJ7A 1ITXA 4D6CA 2J8GA 5I6SA 2QMJA 2ZX9A 3WFLA 1UH4A 1TA3B 4WK9A 2VZOA 3OGVA 1CWYA 3ARQA 4WKFA 5I5RA 4UFLA 1GQJA 2VX7A 3OB8A 1C8YA 4UFMA 8CGTA 2DSVA 3CH9A 5DT5A 3N17A 3CMJA 2XIBA 4PCSA 1JZ4A 3WQWA 1ISXA 2DIEA 1VIWA 3HN3A 1AQ0A 1CECA 1NQ6A 4OUEA 4EANA 1PIGA 4JKKA 4W89A 2IXVA 1JAKA 2XHYA 3RDKA 1OB0A 1H5VA 1E3ZA 1OIFA 3PTMA 3RJXA 3GXIA 2Y8VA 4P7LA 1C7SA 1GQLA 3PZOA 1UA3A 3ZJ8A 4DM2A 1E6PA 1AQMA 3BAYA 3OGSA 3W53A 2QLYA 1J01A 5FD0A 1PAMA 2DT2A 2UY5A 1CXHA 2ZX6A 2CBVA 1QNRA 4PSPA 1UYQA 1GZJA 1WAWA 1UQYA 6TAAA 3II1A 8A3HA 4DWSD 3UCQA 4OZOA 3PZIA 1VFFA 4L4PA 1XSIA 3L4TA 3CUGA 1LG1A 3VIOA 5GQBA 4X9YA 3VGDA 3B9AA 3VDCA 3ECQA 4LYQA 1HJQA 2PB1A 1UKPA 3WF0A 3FHAA 5AC5A 1V3LA 1QHOA 3AQUA 3HJEA 1E6QM 3MKKA 3K46A 1V6YA 1H0GA 4UFIA 4OIFA 2XVLA 3WFZA 1NP0A 3A4AA 1FP8A 2XPKA 4WLCA 4FLOA 4GPNA 1HKJA 1X6LA 1OINA 3W25A 1GW1A 1C3FA 4AD4A 5A6SA 1EOKA 1F4HA 4B9YA 4HU8A 4UFJA 1C7TA 1K9FA 3CUHA 3WELA 1B1YA 2O92A 3SEPA 3B9DA 3N13A 3WUFA 4KRTA 1XH0A 4ATWA 2VZTA 1BYBA 4TTUA 1W3HA 1EDGA 1XCXA 4H8VA 1J0KA 3PZQA 4M29A 3AXHA 2B31A 3W24A 3OLDA 3SUWA 4IPNB 5GNZA 4AEFA 2GVYA 3O6AA 5BXTA 4MB5A 5M3WA 3VOCA 2WCGA 1KR0A 3WDHA 3WQ6A 3TTYA 1DWGM 3WQ5A 3CZKA 1W3KA 1W1TA 1HP5A 1WZLA 2XFFA 3WDQA 3RIKA 2XUCA 5LA1A 3LPPA 2WZEA 4ZXLA 2ZIDA 1A47A 1MXDA 1UD6A 5IHSA 1JD7A 3TTSA 2WVUA 1W1PA 2D3LA 2OYLA 4DWSC 4S3KA 4GI6A 3KL3A 3ZSSA 1EDQA 3CUJA 5IFTA 2OSXA 2XIIA 1TA3A 3AIRA 1V02E 4J27A 3F5KA 4X0VA 4P8WA 4V2XA 5JBFA 1H3GA 4AWEA 1MQRA 4LYPA 2VUYA 1E0WA 2OYKA 4PMVA 1UQZA 4HOWA 2JIWA 3A4XA 1ZBCA 3GM8A 3WEMA 4TX8A 3QHNA 4PMNA 2J77A 4LQ1A 4W8AA 1DWHM 2X2YA 3QOMA 1V0LA 5E0CA 1Q6GA 5LYRA 1NOWA 1QNOA 3NSNA 1BFNA 4P7QA 2VO5A 4ZXOA 2YDRA 1CENA 2BVDA 1E1EA 4W7VA 1DWJM 1QI0A 1LL6A 2DSKA 4P8UA 1US3A 2WCAA 5CPSA 2WHLA 1UWIA 1V08A 3GBDA 3LPOA 1KB3A 2O9OA 1GQKA 5E70A 1UD8A 1NWUA 2EBNA 1JXKA 3AHYA 5I3DA 1E6XM 3TA9A 3VIIA 2Y4SA 2WKLA 1WDPA 1ISZA 1KR1A 3AYRA 4C7FA 4P7RA 1GQIA 2Y8KA 2EPOA 1JNEA 1FP9A 1I75A 1KCKA 2D1ZA 5BRPA 1A3HA 3G6MA 2E9LA 1JZ8A 1E6ZA 2ZUSA 4MPKA 3IAQA 4MB3A 3WENA 3MANA
chains in the Genus database with same CATH superfamily
3MI3A 2ZA3A 5AHIA 3E3HA 1E72M 2W61A 3T8QA 2BXVA 3C3NA 4W87A 3S1XA 4WEVX 3TFXA 4JFUA 5C55A 1UR4A 3N04A 1N7KA 2YDQA 3PUGA 3WBEA 3AIEA 1AW2A 2VD9A 5DLCA 4UNKA 1KLZA 3VZZA 4KQNA 2DV0A 1DJIA 3QC3A 1DJWA 1UD5A 1JZ2A 3DKLA 2P76A 4DF2A 1TTPA 1K8CA 3CTTA 3ZIZA 4D6EA 3QTPA 2XSAA 4RNJA 4QROA 3BV7A 4O1DA 3CV2A 4O19A 4J2PA 3BZGA 3GVWA 1UIOA 1JNDA 3LXCA 4J3SA 5KZEA 3VKBA 7TAAA 1TFVA 5FEXA 2XN0A 5E6YA 3GAKA 3H6OA 3QGVA 2VGIA 4WIWA 1F2JA 1PKMA 4F0KA 2E0PA 3WLPA 4Q4MA 3PC0A 3ERPA 2RUSA 3UT0A 4Y8EA 4JY9A 4GCXA 1AODA 1DIEA 4FOJA 3A4WA 4FNSA 5FJJA 1JDFA 2BFGA 2AL2A 4JTEA 4G2DA 3R1ZA 5AY7A 3B8DA 1TMHA 4QLLA 4WSHA 5FJTA 5T8GA 4B5TA 2BGQA 2DSUA 2OG9A 4ZB2A 4NHVA 4U5IA 1V3MA 3VCNA 3W4RA 1K9EA 4R5EA 5C7VA 1PWLA 2QCNA 1I45A 4JHZA 5J5DA 2PDJA 3OZYA 3TWBA 3RMEA 4JX5A 4LGXA 3AHXA 4CNTA 3WMCA 1EBHA 5A8PA 5FJOA 1SO4A 4AHPA 3ZZ1A 5CLWA 1JR1A 2GSHA 3T0DA 3ZT5A 3DFHA 4RJEA 1XD1A 1ITQA 4GJJA 3RR4A 2PZNA 1GVIA 1C92A 3FA5A 2MANA 2IS7A 1GTHA 2H9AB 3QY7A 1EZWA 5F2IA 4PUMA 3WQOA 3L4YA 4FXSA 1A3XA 3W86A 3A4JA 4H41A 2J7DA 4IUOA 4UTLA 2J88A 2ZX5A 4PTMA 1C8QA 5EFDA 4HMCA 4ADSA 2DIKA 3VABA 1YLVA 4LOCA 4P7NA 5T9BG 4D8ZA 2PDYA 1AZ2A 4OUIA 3W74A 4R27A 1OX5A 1KM5A 1RCOB 4IQEA 1GJPA 2PDKA 3NNTA 3ABXA 4Q3MA 1QBBA 3CLMA 1NIUA 3WL1A 2P3ZA 3CL7A 4MTVA 3ZS4A 4AIBA 1OYCA 1TZZA 3ZLFA 3CZGA 1MW1A 3DU0A 4O17A 2E4TA 4H04A 4I5XA 1PUDA 4CU6A 3UJFA 2V68A 4H9XA 1KBIA 1HO1A 3O1NA 4GH1A 4UC5A 4F8XA 4J7RA 2R94A 4DQWA 1C90A 1KM1A 1E4MM 2IPGA 1F3TA 5CPQA 5D03A 4LUTA 1W8GA 2DJXA 1YTDA 5D4YA 3F4VA 1UUQA 1JCYA 1Z8AA 4KIRA 3HV9A 1NJJA 3EOOA 1FBAA 1MRQA 4DJED 3NCOA 3WNLA 4K37A 3KE0A 5CC7A 3QSRA 4CD5A 3ZLGA 3HPAA 4FR6A 2QJMA 1KTBA 4KBXA 2VEGA 1I0DA 4PMUA 3A9IA 2CCRA 4DYJA 4OV4A 1KWKA 3B8SA 3URAA 4D1IA 3KRUA 1XLIA 2W27A 3GWQA 2BV9A 3H2MA 2O55A 1Q7QA 5HWJA 7TIMA 4R33A 3TYUA 7XIMA 3N4EA 1FWRA 3TCEA 4DI9A 3GG8A 1XI3A 2AGKA 5HNNA 1FXPA 2PI6A 3WBYA 4BEQA 3PP7A 1LWHA 3BCFA 1TPWA 3B8VA 4O4WA 4J1OA 4WCJA 3E12A 4XISA 4DVOA 4KFPA 4EPDC 1WNOA 3NQVA 2BBFA 1E40A 3VMOA 1QFEA 3MUCA 4UMCA 3HU7A 4XBKA 2QDEA 2X42A 5A1AA 1M53A 2WVTA 2NT0A 2WKGA 1W1IE 3N6QA 4PTNA 1MW3A 3E0IA 4QGCA 2LLEA 3THAA 2EG7A 1ML1A 1VR6A 3POCA 3IRSA 2OEJA 3EPNA 2P53A 4AC7C 4FIQA 2FB3A 2NW0A 2G41A 3H7RA 1KWGA 2VEMA 1R86A 1S3HA 3M0XA 8XIAA 5HMEA 2PD9A 4C5ZA 3AIQA 1V79A 1E5JA 2XG9A 4TX9A 2IPJA 3TXVA 4LB3A 1HW6A 1S3TC 1IWBA 2ACRA 5B80A 2A3AA 2CLFA 1V02A 3LK6A 4IMEA 4J35A 2INZA 3BCDA 1YRRA 2Y24A 1AW5A 3AJ7A 3APTA 4HVXA 1DBTA 1FWAC 3PBVA 3W70A 1W1B1 4W93A 1OBAA 5D09A 4IH3A 4UTKA 3AIBA 3ONCA 1EA9C 3BAKA 1RD6A 4H83A 2PDUA 3EDDA 1RBLA 1OT1A 4MZ8A 1O68A 4AQLA 1UC4A 2OZTA 3TQ0A 5AVNA 3OA5A 3IJQA 4B4FA 4ACZA 2E8ZA 4RZ6A 4V1XA 1XV8A 5CC3A 2IQDA 1HIZA 2P1FA 2WNQA 4WJXA 4GO9A 2DSWA 3NGJA 2DIJA 5G2WA 2CETA 4XD5A 3YPIA 4KWWA 4DWDA 2DGAA 4M6VA 4H9UA 1W9VA 3BAIA 5G1TA 1V8EA 2FDMA 3AS0A 4DYEA 2PUZA 1TWDA 3MBDA 1UZHA 4GQRA 5TIMA 2E5BA 4A4AA 3AXMA 3PPCA 3CQKA 3VO0A 3TZFA 2XN1A 5AN7A 1KLYA 3LENA 2YOCA 3GNDA 2J27A 4XAPA 1TWIA 1D2KA 5H8PA 2PTZA 1XIMA 3B3DA 4FOKA 3NQDA 1FFRA 1CBGA 1R0MA 1GVYA 3E74A 1AUSL 3SCUA 3RO8A 4IJCA 2VQUA 2E9MA 1ALDA 2C1GA 3TYBA 2WVSA 2XIOA 3NGFA 3FSUA 2X16A 3HJZA 4IJBA 1WXZA 7CGTA 5BU9A 4LF1A 3UW6A 2HJPA 3S8HA 1PZ1A 3HPFA 4O53A 2OX4A 1JYNA 1DXEA 4ZZ9A 3TX9A 5HPCA 3NOYA 4QDPA 3VIJA 3VC5A 3UCDA 2FDSA 3HF3A 4QQ3A 1WDSA 3MSYA 2F6UA 4FF5A 2WV8A 3DI1A 5H1WA 1SO6A 2FH8A 4G7FA 1PZ0A 1E9LA 1RJQA 1EQPA 2BY0A 3E0LA 3PUEA 4PMOA 1IZCA 4UBPC 4U28A 1HL8A 1JGMA 3L5LA 1UB3A 3W75A 3M07A 4PEEA 3G8RA 2CLLA 3CQIA 3ARWA 3T0BA 3VZXA 4F3HA 2Q8LA 2HS8A 3KBVA 4J3TA 4AZCB 4DWSB 4LV4A 1P1MA 5LXEA 5I06A 1FY6A 1DYSA 4R3UA 2WYSA 3THUA 4GZEA 3VM5A 4XZBA 2RHGA 4GNVA 5LHEA 1CW2A 2EAWA 3LRKA 1W9BM 4FEZA 3ZJ6A 4UQ9A 2CZDA 1SR9A 2DH3A 4REQB 2DEPA 5KETA 1QR7A 3VINA 1J0ZA 1JUKA 3HQ1A 4RZ4A 3UXAA 4G56A 2XINA 3I7RA 2QCLA 1TWSA 3FFSA 4NAEA 3W2LA 3DHFA 3BLOA 3MV11 4TUFA 2Q8XA 4US5D 4GC3A 4LRSA 4UR8A 3QLDA 3I4KA 4GVGA 5K7JA 1Y65A 1V3KA 1K70A 3MC5A 4TV6A 1NFGA 3ZVHA 4HNTA 2VL4A 2DVUA 3LMYA 2FVKA 3GQYA 1BKSA 1QI3A 5HULA 3THQA 2AMXA 1RK5A 3LQLA 1W5MA 1ODZA 4PULA 1FDZA 2VUNA 2WHJA 3QV9A 3OHMB 2WAGA 2TODA 4OBTA 4FAMA 2G8ZA 1H7NA 4ZR8A 5F2MA 4AX6A 4PA8A 1EGMA 1PO9A 3AI0A 3ZR4A 1OGBA 3SR7A 2Z24A 3M6DA 3E2QA 2INEA 2CNCA 3CTLA 4R7JA 1LRNA 2G50A 1AZ1A 2DUXA 2QPUA 2YZRA 2VEPA 3WNNA 2YCIX 3F5JA 1IZJA 4YLWA 3W9ZA 3RHGA 1GVOA 3TYCA 3SUSA 1K8ZA 3H26A 2XVKA 2GWNA 4QNEA 3GH4A 2PDXA 1Z42A 4PUNA 1FCVA 3R58A 1HKIA 3LM3A 5REQA 2WXDM 1P0DA 3KLKA 2WJZA 4CN1A 4Y6GA 4Q8NA 4NAFB 4HCDA 5I79A 4IIDA 4WSKA 2XVGA 3AYVA 1E55A 3W7RA 4I90A 3SCQA 3IJDA 4RDZA 3UVIA 4AXNA 5HNUA 5T91A 1UZ1A 4E6MA 5G2HA 1CLKA 1F7BA 1MZHA 4AHQA 4QLKA 3TOYA 1VGAA 2OFJA 4X0NA 4GXPA 1TQXA 4ZQCA 1RPXA 2WNZA 1UCWA 1JPDX 2R9RA 4I6VA 4WGHA 3W3OA 3NEHA 1LT8A 3PR2A 2ZZ7A 1F8IA 3SUTA 2WLZA 3VIPA 1UP3A 2WMIA 8TIMA 2J74A 4OKDA 4MWAE 1XLHA 4MLJA 1OX4B 3B97A 4U33A 3VILA 1C29A 4HCHA 4HYRA 1MNSA 5HOSA 4Q7IA 3ZWSA 1KKOA 1SR0A 1TPFA 3G0UA 2VD8A 4HQVA 2XZ7A 2VWTA 3VMPA 5JH2A 3OA3A 4KRZA 3HPZA 2RKXA 1RQBA 3KX6A 1UP2A 2D2HA 4P8VA 4AD0A 4H6EA 3AMCA 3GSMA 1CTNA 2Z2BA 4BF7A 2PWGA 2X7WA 4N7QA 2NLIA 1ICSA 4H8HA 1E0XA 3STPA 3R43A 4M24A 4KW2A 1YTKA 2VURA 1IWPA 1JF6A 3L0KA 5HNTA 1M7XA 6REQB 3GC4A 4JFSA 2XH4A 3AS1A 2PWHA 1ZPTA 3PWIA 4H9YA 1ZBKA 1ZS2A 4JTQA 2QVNA 3OG3A 4AWSA 4KEUA 2Q09A 2W5FA 4M0XA 2VGFA 3W37A 3MWAA 1OY0A 4OE7A 5E09A 1R85A 3ITVA 1KM4A 1DTUA 5CKSA 2XZ9A 2ADAA 3SECA 1OGGA 1EC9A 4UTHA 2EPKX 2CPUA 3UG3A 2WB5A 1B5TA 3PPFA 5XIMA 3OLGA 5CC6A 3VKJA 3I10A 1HFBA 1X39A 1I2NA 3RILA 1QK0A 4LBSA 4XZIA 5LIKX 3E0WA 5EKYA 1YX1A 3S1GA 1W1VA 2CYGA 5F1UA 1EL3A 2FZMA 3T78A 5G5IA 1WKYA 1LROA 1UMLA 1XC6A 4PCFA 3M44A 2J7EA 3AICA 4LANA 3GC5A 4H00A 4KMQA 3SSZA 2YFNA 1TJ1A 1RP9A 1YHTA 4XUGA 3STEA 2J47A 3UR7A 1WO2A 4UOJA 2J66A 1WDWA 1E71M 3BUVA 1W2PA 3TTEA 4HZ8A 2WZMA 3CMGA 3SUVA 3LPFA 1VFHA 4TVUA 4U3CA 2DQWA 2FVLA 1SZRA 4RV3A 3L12A 3W1RA 1US0A 1JF5A 2WMGA 2ZICA 3MSRA 4ATLA 2FTPA 2Z27A 3AFBA 5DN1A 3DKJA 4MYAA 1ADSA 1ADOA 2O7SA 4WRHA 2L5HA 4NZ1A 4RDWA 3GDTA 2D24A 4XTIA 2OGJA 4O11A 1RAKA 3OVPA 2VDIA 3P62A 1GKRA 1SU5A 4GRSA 3LSBA 2WM1A 3QC0A 4RNIA 2A1YA 1FCUA 3R79A 4H8NA 4DNHA 2GOKA 2QCDB 3TKFA 4DAIA 4ORMA 3V4BA 2XISA 4KF1A 5I09A 4ZQMA 2IKIA 4TX6A 1T99A 3IAPA 3NR0A 6A3HA 3WQCA 4R9XA 3BGJA 3PBUA 4JFVA 5RUBA 1RR2A 4HNVA 4AB4A 1DIDA 2QV5A 4NQ1A 4P2VA 3C0QA 2IKGA 3D47A 5FAGA 1IR1A 2DU2A 3G22A 1L6SA 1OJXA 3QYSA 3UZXA 3IGUA 3MTWA 4MDPA 3IACA 5F4SA 1W9XA 2AOSA 3A3WA 1G1YA 3E1F1 5ABGA 1CI1A 4Q7NA 1XXXA 4PTVA 2XTKA 3H23A 2FVMA 3UA4A 3V18A 2UY4A 2PDWA 3VOHA 4UUIA 5CG7A 5C7HA 4ZO6A 3H70A 1CGWA 3LXBA 1AH3A 2RFGA 1BGAA 3M16A 2WBGA 4WOQA 1BPLB 1YIXA 3KFTA 4L80A 2C3ZA 4X3ZA 3F4NA 1SJCA 1HKMA 2OOFA 1XSJA 3L4VA 4FHAA 4O57A 4N4PA 3C2VA 1U1JA 4PTXA 1DJZA 3WDJA 2NQHA 3AO0A 3VAVA 2DSZA 3CEPA 3ABZA 5JU6A 2QAPA 1VRXA 5LIXX 4KIEA 4D1JA 3LNPA 3W87A 2PSNA 3F2BA 4MUZA 4K39A 4C6DA 2WBKA 1RVGA 2CC0A 1XIHA 4XVEA 5KTLA 4D72A 1XC4A 3PZGA 3ABQA 5CSRA 4GNKB 4NKCA 3H24A 4KEVA 1XIGA 1YXDA 3BXWA 5DFAA 4PL1A 1IEXA 1CZ1A 2PF8A 1JYXA 3Q58A 1KA9F 3UWWA 2A0NA 3AUJA 1EB3A 3CYJA 1LLZA 1OYAA 3N2OA 4PC8A 1EF3A 4XSLA 4A3HA 4LW7A 2QV4A 3ZVIA 4CD6A 2OSYA 3CUIA 1AH0A 4B2DA 3WQPA 2IPFA 4MAVA 1CCWB 1DJNA 3BGAA 1T8XA 5AHFA 3O2LA 5LA0A 4Y9OA 1F74A 3VCCA 3UNDA 4GX9A 4ZODA 5GJMA 3GFXA 3HG2A 4O0QA 4ACYA 1TTQA 3B0YA 4BJHA 1W5PA 2J62A 5IXEA 5BRBA 2E8YA 3W1MA 2V5BA 2XFRA 4LC6A 2P50A 3SN0A 4ZFMA 1C93A 1EGZA 3VE7A 1EA0A 3W7IA 5DT7A 3W7HA 2QJGA 3MJMA 5CZKA 2C6QA 3EBVA 3N2MA 2EG6A 2EEXA 1T40A 4E2DA 4UFKA 3SFWA 2VTFA 4M6QA 3KZSA 4JQ2A 4C7DA 3CYVA 3RLVA 1Z48A 1JUBA 3WH5A 3PFRA 1V3IA 1UPPA 1IT7A 3QOKA 4AD1A 2HXUA 3DC0A 1UH3A 4NJHA 3VK5A 3F4CA 2ZFAA 3VGEA 4Q4KA 3MUZ1 2ZRUA 4BZYA 3TYAA 1HJVA 4UQBA 2E5CA 4X9SA 1LF1A 2QW5A 4R9OA 5FOOA 1S5TA 3W7QA 7REQA 1RQHA 3V0TA 2MUCA 4X61A 1HGWA 1C8VA 2OVLA 3SRFA 1PJ9A 1JDAA 3QZAA 1DJYA 4IGSA 5D02A 3UETA 4MADA 2ESCA 3G2GA 4Y96A 1TPH1 4NAEB 3ZOAA 3MYOA 1P0NA 3WD0A 4PBFA 5AYIA 1BXNA 4LNYA 1QHPA 2WVVA 4CQ8A 2HK1A 1A5KC 5DXYA 3CV6A 1TZ9A 4GQGA 4MKNA 1JDCA 4WKHA 3OGRA 3N25A 3NXFA 1HF6A 4GFIA 5CCZA 1W5OA 3M0MA 5I7GA 3S47A 4XIMA 1DIOA 2DZVA 2Z1KA 2J7BA 1NWSA 5CJNA 1CEOA 1QNSA 5I3FA 1ZSXA 4PYSA 4ML9A 3IANA 3LCHA 3LV5A 2WWCA 2ZUTA 3OYZA 4IPIA 3A6OA 2Z4GA 3G1SA 4OGZA 4QS5A 2ISSA 3BLKA 3TC3A 5A8NA 4PSRA 1LBLA 5FKYA 2Z2AA 3GNXA 3R12A 1EJXC 4XZWA 1JULA 5A6KA 1L6YA 1REQA 4F79A 5IDZA 4LAUA 1KCZA 1IQ8A 5FESA 1EPVA 3VIKA 3V5CA 4ZOEA 4NXSA 2VVNA 3WNOA 1PTAA 1GNXA 3ME3A 1GZGA 2PGFA 2V5JA 2YBVA 1MW0A 4C6CA 2BTMA 2XFYA 3SQMA 1GGOA 4O14A 3VPLA 4CU7A 4XD6A 4Z1AA 3NPUA 1IIHA 4CNOA 2AQVA 4Q8WA 2BB0A 3DHUA 4D6FA 1WDQA 1BF2A 4HNUA 4UR9A 1ODUA 1LWIA 2Z1XA 5I02A 4HHPA 4DJFD 3HZ3A 1S2AA 3P6LA 4CQBA 4C1NA 3TK7A 3S6TA 2X0SA 5MKGB 4CGTA 1A5SA 5T26A 3PJUA 1MW2A 2G3JA 3C56A 1NFBA 4BQ3A 4EOUA 1BF6A 4H9ZA 1E6SM 4GVFA 4FXFA 1M3UA 1BWKA 3NQEA 1Q4NX 4EACA 5CPTA 1W91A 1VFTA 3TNOA 3V75A 3TA6A 2F9RA 3NQ2A 2HQAA 3N12A 4S3JA 4HPJA 1PZ3A 3W84A 4TVCA 2DZPA 4FR1A 1OCBA 1ZHAA 2C15A 4QG6A 3SCTA 5A6TC 4L1GA 4E2VA 2OWWA 1WZMA 3PTDA 3UFYA 1VZWA 3N15A 4LV9A 2CESA 4HU0A 3VX1A 4KEZA 2WNWA 1DE5A 3O06A 4K7YA 3BSHA 5HXMA 1SFSA 3NDYA 3EWBX 3HURA 2PC4A 3GB6A 4FB7A 1ZGDA 4I8DA 4A21A 2GSJA 2YA1A 3H12A 2W62A 2PDGA 3O6YX 3P61A 2X8RA 1VAHA 3EPOA 4KWOA 5A6JA 2ZRZA 3IV3A 3KCOA 1IXPA 4M82A 2TAAA 5DELA 5BROA 3LG3A 3VTRA 3GS6A 3A9BA 4KRUA 4TQTA 3CT7A 3MKVA 5FL0A 1SO3A 4NZ3A 3BAJA 3TN5A 3GX9A 3PVFA 1IT8A 1BYDA 5FL1A 3AHTA 1YPXA 1I8JA 3QM3A 1XDLA 4XBJA 4PUUA 1LRQA 4J28A 3QHOA 4HNCA 3VZYA 1KTNA 4A29A 4LB4A 1E4IA 2UZ9A 1BVZA 5DANA 1FWEC 3GE7A 1O5QA 1VS1A 4DAFA 3BURA 4WK9A 1NY1A 5C2XA 1Z6KA 3ARQA 5J8LA 5I5RA 2A79A 3INPA 2DJLA 2Y61A 3W7KA 2DSVA 3CH9A 3CMJA 2XIBA 1QJWA 3P8IA 2DIEA 1VIWA 4LC8A 1XLKA 2QF7A 3TJXA 1LOSA 1QXLA 2IXVA 3RDKA 5SWUA 3GIYA 1OIFA 3RJXA 1QPRA 5FF7A 4KERA 2Y8VA 2B81A 1FWDC 1VH7A 5J04A 3DFPA 3IGXA 2PS2A 1RY8A 1PTDA 2AAMA 4EXAA 4YIWA 1YKWA 3OGSA 3W53A 5ENLA 1SJAA 1CXHA 4BI7A 4Q7BA 1QNRA 3N2CA 1B9BA 6TAAA 4L61A 4A2RA 3W7LA 1VFFA 3CU2A 5B7YA 1YE6A 3VIOA 1S1PA 4YL2A 3VDCA 3G1HA 3ECQA 3UZ5A 1HJQA 2PB1A 4YCOA 4DO4A 5AC6A 1K03A 1V6YA 5DQPA 3RX2A 3S83A 2NLYA 1A5MC 1R3YA 5BOOA 3FYYA 1LZOA 3KHJA 3SADA 2SFPA 4FLOA 1HKJA 1GW1A 1C3FA 3P14A 5A6SA 3BMXA 1X8CA 4B9YA 3ATYA 2Z1WA 3SY8A 1EZ2A 3STGA 1Q85A 4XZ9A 3B9DA 3N13A 3WUFA 3LHZA 4KRTA 4RPQA 2QCMA 2VZTA 3EA3A 4E4FA 3C0LA 1XCXA 1J0KA 4N9EA 3GR4A 3O63A 4M29A 2B31A 4G8TA 5I3KA 4LS1A 4R7WA 3UR5A 1NDWA 1NEYA 1GEQA 1R9XA 4BY3A 5M3WA 1V51A 3BQ6A 2ACQA 4Q8VA 3CZKA 4EP8C 4EXBA 1HP5A 3EXSA 2V6AA 5LA1A 4FXRA 5C9XA 4P5UA 4NZFA 1H61A 2YCLB 4AFYA 3TTSA 5BMWA 3LBCA 1BEUA 4DWSC 4S3KA 1KFJA 1MDRA 3CUJA 1TA3A 3AIRA 4F0SA 4PUWA 3OVQA 3KP0A 9XIMA 5JBFA 4DJFC 4LYPA 2HVOA 1A5AA 2VUYA 1UQZA 2JIWA 1P6BA 3FKKA 4FF7A 4GWEA 4K38A 1DWHM 1TX0A 1BSLA 3QOMA 4I9TA 5E0CA 1M5WA 3O3RA 5LYRA 1BFNA 3BOXA 4YVVA 4ZXOA 1CENA 4LJ3A 2BVDA 4XAGA 2QJIA 4TV5A 1QI0A 2WCAA 2WHLA 1TUFA 2EJAA 1V08A 5AYXA 2JKAA 3LPOA 3STFA 5E70A 1IIGA 2ZADA 1TIWA 2V2HA 1XR2A 4Q4PA 4CEUC 1KR1A 3F1QA 4C7FA 4P7RA 2OLAA 3LCFA 1TJPA 2Y8KA 3ELFA 4HPXA 1YADA 1A5OC 4NX0A 2ZDRA 1A3HA 3G6MA 2ZUSA 4AU0A 3IAQA 2J6XA 1G4EA 3LS9A 3ES8A 4AAJA 5K4XA 5EMUA 2AQWA 3C4UA 3BH4A 4W4QA 5FJIA 4EIVA 3AU2A 3PWAA 3S6DA 1VP5A 4Q4OA 3UERA 1J0IA 3ES7A 4I7VA 4RE3A 3CPRA 3NYZA 2V67A 3DFQA 3MMWA 2G3FA 4E8DA 2WMIB 4F9JA 2TRSA 1UJPA 4BF5A 3PTQA 3LCWA 4A22A 2RAGA 3S1UA 2Q02A 2GQ9A 3CHFA 4GUIA 4HYVA 2YX0A 1QI4A 1J4EA 2VJXA 3PHAA 2VX4A 1QT1A 2ICSA 1ZP4A 4HZ7A 3UYCA 3K2GA 2IW0A 1I2RA 2CERA 1Q6RA 9CGTA 2R1KA 2XSXA 1U1UA 4QFUA 2DW7A 3REQB 4I9AA 5HMFA 4I5RA 4HK5A 4JTLA 1Y7VA 3BE7A 1EIXA 4QDMA 3AMGA 1DE6A 3MUXA 2VRKA 3Q65A 2FHCA 1OFRA 4F0RA 5D33A 4MWAD 4EWJA 5DMMA 3UG5A 4FK9A 4LCRA 3SCNA 4W7WA 4GA8A 3BW4A 4XZNX 2G3IA 2XVNA 2GVGA 2RDTA 5LNWA 1R3SA 4MKSA 2J7CA 3BLEA 3DX5A 3OLIA 1YYAA 1TR1A 2I56A 2GK1A 4XK2A 1RP8A 1XS2A 3QYQA 3R8GA 3JS3A 2YXGA 1FH8A 1PYFA 3LV6A 1SSDA 2C91A 4WJEA 3NUKA 1TWZA 4JIHA 3MCNA 3FDKA 1J11A 1LLWA 3PFMA 1F6KA 5ABTA 1ECQA 1SPQA 2XU2A 4X2PA 3PN8A 2CHRA 4HA3A 3CIXA 1BXCA 3NURA 3W02A 1KGXA 4FI4A 1VF8A 3T0TA 2JFEX 3F2CA 1GVSA 4M80A 2PRMA 3D46A 2XFWA 4L7ZA 5ABFB 4H6RA 3LPGA 4KCWA 1E51A 4HBKA 2HSAA 2OLHA 3H4GA 3AC0A 4R88A 1BAGA 3WD4A 4BF9A 4DZ5A 3S4TA 3KTXA 3KL0A 5JVLA 2VNCA 3NL5A 5FEWA 1CX9A 3WMSA 4S3EA 1ZAHA 3SGZA 4C90A 4J3VA 2F6XA 4TU1A 5BU6A 1UKTA 4C6EA 3MHFA 3OQEA 1F6PA 4JFWA 4URIA 3PS7A 5HJYA 4A8RA 3L9CA 4MM1A 1DJHA 1PB0A 5JMUA 2ZVRA 2FJKA 4FLSA 3P67A 4GE8A 5KSWA 3SCVA 4LT9A 3CK5A 3IVUA 3N2XA 1F5ZA 4ZTXA 3DERA 3DAQA 4YVPA 1GJUA 2X1RA 1EO5A 2BOFX 3GXFA 2GFTA 4AYGA 4LS0A 1I6NA 1UW9A 4MY9A 3EDJA 1ESWA 3Q4DA 1BLIA 4DELA 4Q32A 3CZ8A 2OKOA 1JXJA 3GHUA 3GYCA 3EWYA 4AZ7A 1UWUA 1SFLA 3I7QA 4N2YA 4OBRA 1JI1A 2INFA 5CQ1A 3HQPA 4RCXA 1ONRA 3PZUA 2NV1A 3M7SA 1QWGA 1CT5A 1JL8A 4LCQA 3IJ9A 4LALA 1YPFA 1RVKA 3GR7A 1BWVA 3ICJA 3D6NA 3TC7A 5DY2A 5C9UA 1OGSA 2F61A 5A6LA 4PN2A 4KGLA 4H3DA 4J3UA 2D2GA 3WH9A 1GVEA 3FIGA 5C2GA 2X7VA 5MF5A 1F8MA 4LUSA 3UJRA 2XVPA 4O1AA 4XZHA 3N11A 1KFWA 1U2YA 1P43A 2HNHA 4WY0F 4AEEA 3W1AA 1FWJC 2X1UA 5E6ZA 3AHZA 4K7VA 1Q7MA 3KOZA 1UHVA 4KEMA 3FEQA 3GDKA 4G7EA 4UTWA 3ZR6A 4IG2A 5I24A 3AWOA 3V16A 3B9NA 2H6RA 4UQDA 4MAZA 2V5KA 3W22A 4ATDA 2REQA 3T07A 4RE4A 3DBNA 1KXHA 1WAUA 2V38A 5HK4A 3HMJG 2WMHA 1ICQA 1JUEA 2XH0A 4O1CA 3WG6A 4CN6A 2ZA1A 4GLEA 3KDNA 1VQTA 3AISA 1Q6OA 1XL9A 1XYMA 1SMAA 3IJIA 4MY1A 5I3GA 4IQLA 5CAKA 4W8BA 5KITA 2PLCA 1UWAA 4HYWA 2GPTA 2VP8A 3SN4A 3QVQA 3BSMA 3KBNA 1UROA 1LL4A 1Q8AA 2OPJA 5KINA 3NA8A 4NNBA 3GNPA 1TJ0A 5AHEA 4ICCX 2GGJA 1PCWA 3WD3A 4HHMA 4JBRA 6PTDA 3RRXA 1GOKA 3P5YA 3S2CA 5CSUA 3WLNA 5I78A 3PB2A 3IVTA 1Q5MA 4AMCA 4KCUA 3EB3A 3MVIA 2PGEA 1O66A 3RF9A 3NVDA 2OB3A 4JIIX 1QNQA 3T40A 1JYVA 4YU1A 4HN4A 2W9MA 1AG1O 2NZLA 4JFTA 3ZWTA 2J9ZA 3FJ6A 5LXXA 2Q01A 4QITA 3RYSA 3GZ3A 1GPWA 3VIHA 1KD0A 2W3ZA 4XB3A 2ZRXA 4MWAA 3FGCA 4WGXA 1I2OA 1SYTA 3MO4A 4JD4A 1IE7C 4IUGA 5AECA 2VWSA 1D8CA 5FSEC 2VRQA 3S42A 3QSTA 3THDA 4BWLC 1O7AA 1Y5VA 2PE4A 1TPC1 3T05A 4PRWA 3GNOA 1M7PA 4JTCA 2ZYFA 2BY3A 4A8IA 1D3HA 2RJGA 4A35A 1TE1A 4WF7A 3CHCA 4M5PA 2F6KA 4IX0A 2D0HA 3SSJA 1P4CA 3ID7A 1V93A 4RE2A 1NWRA 2I57A 1KXQA 3MSDA 4DJDC 4LVGA 3E2VA 1ZJAA 1HP4A 1NF0A 2ZXBA 5C5YA 1WOBA 3UWVA 5K9CA 4JTSA 1GQNA 4U2ZA 5D9NA 2YFOA 2ZXDA 3H4WA 3GXTA 2VEFA 1Z69A 2GJXB 3GXDA 3LRMA 5EYWA 4MDOA 3GTNA 3LSCA 4UTFA 4JTRA 3OODA 2CBIA 3KBWA 3PJXA 3PBYA 4NT0A 3DHPA 1XUUA 4C6MA 4AZCA 1HJUA 3VA8A 4JYDA 3IK2A 1M01A 2YSWA 3WF2A 1EYWA 1RH9A 1UWQA 2KX9A 3WDRA 2WSPA 3OBAA 2O9TA 3WLQA 1TPUA 2PRHA 3TW9A 2QYGA 3CH0A 3VNDA 1JCTA 1FXQA 3KVLA 1PIIA 1ZU8A 3N3TA 3BO9A 1ZQ5A 3RLGA 2HMCA 2OEKA 4V15A 3ANVA 3TSBA 2FFCA 1A0EA 2V81A 2GQ3A 5L9FA 3MP4A 3BW2A 3IRDA 5HBFA 1VFLA 2PWVA 3PANA 1PKYA 3W7NA 4UNLA 1JZ7A 1H09A 3V1HA 1YTEA 2W4XA 4WKAA 2NV9A 3FXYA 4I5UA 2C19A 4G9PA 1UH2A 3FXGA 1ZP3A 1OC7A 4GHRA 3ZSTA 4ILSA 3DIPA 3UGVA 3HG3A 3QPEA 2JE8A 3A3XA 2HPIA 2HBVA 3GXPA 1XH2A 3DG6A 2DT1A 1OQFA 1OT2A 3FOKA 3WL0A 3TJLA 1RA0A 1XBYA 1VENA 2QKFA 1OD8A 3WMBA 3WH6A 3WY1A 5A6AA 3E0FA 3QR0A 1HVQA 4UZSA 4YTUA 1YNYA 3DGRA 5I0DA 1Q6QA 2VHLA 2E40A 3G0SA 4GYPC 4NAFA 1JRCA 3TTOA 1QO5A 3WNKA 2H9AA 4M8UA 3EEZA 2Y85A 3DCPA 3EX6A 1YDYA 1QO2A 3PULA 3ITLA 2MNRA 3VD5A 1QNPA 4GCAA 3PM6A 4ENLA 2ABAA 1BGGA 4WDXA 3IK4A 3KZPA 3W83A 1GHRA 4LCSA 3XISA 1H63A 4XV0A 3G1RA 3QKZA 1AMKA 1RV8A 3HQNA 3W23A 4Z42C 1OHLA 4CCEA 4LVBA 3H22A 1KFKA 5D9MA 4ZE5A 1R5YA 4MMWA 3WUBA 2HPMA 4BFAA 4BR1A 2XM2A 3I6RA 2POTA 1KO0A 2QCEA 4UTMA 2ZVIA 4O12A 3ZO9A 4XD4A 1XQLA 4Q4SA 5FA5A 1LL7A 2D20A 3TV8A 2Y63A 3NVTA 1GONA 4QRNA 1R7AA 3DGBA 4M6UA 3ZLHA 2ZUMA 4KETA 3CUXA 3NQFA 4KCVA 4JHOA 3LGGA 3OYXA 2R1PA 3I68A 4JNMA 1EJ7L 1VPXA 3L4WA 3BW3A 1R2TA 3IWPA 2JEQA 3SCRA 2NWRA 3H2FA 3PUDA 1OX4A 3K8MA 3EDEA 3SDOA 3VKKA 3RR1A 3RNDA 1EJVC 1EOMA 2IXUA 1Q6DA 1V6TA 1BYAA 4BKNA 1VD6A 2Q8ZA 3HGOA 3P80A 1AL7A 3IIPA 2G95A 6REQA 2I7GA 4FMVA 2V30A 2JK2A 1WDRA 1AA1B 2OZ8A 4ASTA 4FX6M 3CUFA 4UR7A 3L4XA 3AHVA 1JPIA 3ZJKA 1KM2A 1XRTA 1ZCOA 1F4AA 1IYXA 1KBKA 3CV1A 2GUUA 3KEHA 3UPWA 4FP1A 2DZXA 1W17A 4O10A 3A5FA 4UOZA 2JF6A 2GZXA 2HVMA 1XX1A 3VCRA 4EF8A 1WYIA 4H7CA 2OU4A 3G24A 2OEMA 4JKLA 4NJGA 4C6OA 1CIUA 1EJWC 1RLDA 3KRSA 2HZGA 1VHCA 3CL6A 1J8VA 2O0TA 4I3GA 5HNRA 3BVJA 3W1UA 4GKLA 4AZIA 4CUCA 3M46A 1BTCA 4B4HA 3VVGA 1KTCA 4NASA 2FHFA 1EXPA 3H53A 3BTNA 2QVHA 1UKOA 4CD7A 2XWEA 5F1VA 1PX4A 4TVDA 1OCNA 2YXXA 1N8WA 3NWRA 4E3VA 4Y9PA 5CAHA 1WPCA 1UR8A 3UPBA 4Z2GA 3MY9A 3JZUA 3N73A 3NXLA 4U31A 2DT3A 1S1RA 3EMZA 3CPUA 2VDGA 5DO8A 3FDGA 4LVDA 4KS0A 3OBEA 2QUMA 1EYEA 1B57A 2A2IA 1TZ7A 4NIRA 2EJ1A 3SB0A 2PZ0A 2A3BA 2YCLA 2YB1A 1S5VA 4K8EA 1B30A 2ZWZA 1GT8A 3GZAA 3LHVA 1FX6A 3GKFA 4Z2LA 4M1RA 5A8MA 4A3YA 2Q3OA 3D0CA 4M3PA 3FJ4A 4JL1A 1VPYA 3QQ1A 1OD0A 3VIGA 2VEKA 3RFAA 1KC7A 1PYMA 3VNYA 1G69A 2J7FA 1EUAA 1VCFA 3L0NA 3W2KA 5BOEA 1WKDA 5JQ9A 2F2HA 2WO5A 3W1XA 1XIEA 4LAOA 1H62A 4RX0A 2E5DA 2W6RA 4YN5A 5FF3A 4NJIA 3JW7A 2FGBA 3W81A 1W9DM 1ME8A 1VLWA 1YE4A 3MW7A 1CYGA 1V7YA 3WX7A 4GOAA 2YA0A 5AYZA 5FJRA 3AZTA 2CLOA 1FWBC 3U5YA 3WLMA 4WJ8A 5DRIA 1VPQA 1HUVA 1C9WA 4Q4QA 1OZMA 3JZEA 3CHEA 3OU8A 1EKOA 1PZ2A 5C9ZA 4Q8UA 3ITOA 1S39A 2GDUA 3QPYA 3R7MA 2A6LA 3R0KA 1R47A 4UMAA 1UOZA 4BI5A 3NQ8A 5F7UA 1Z89A 3QY6A 2OSWA 2ODOA 4JIEA 3CAWA 4GBDA 4PCTA 2WVVB 3TZNA 4XVDA 3ABRA 1DJQA 3HG5A 3KOYA 2YYUA 3UZYA 4H7ZA 3M0IA 4GXWA 3L66A 3H7VA 3FN9A 3RN6A 4RE0A 4C6JA 3S5NA 4Q8MA 3LRLA 1RHCA 3V3WA 1OF6A 4FS9A 4RDYA 1MXGA 1XCWA 3TR2A 4OU1A 1KXTA 2WCSA 1MUCA 3WLLA 2QJHA 1YW1A 3Q67A 5EA9A 5HATA 3BCJA 4LFYA 3CO4A 1H7WA 3SGUA 2V3GA 4HNOA 1I4NA 1QOXA 3F5LA 2FMNA 4JTJA 3BK0A 3UXKA 4LY8A 3S5OA 3W7PA 4C1KA 2HCVA 3MA8A 5F4WA 3N4FA 4F0MA 4ERIA 3N2TA 4GJ1A 3LTYA 3GDBA 3TP4A 2E09A 1IF2A 3B40A 3DYPA 3OIXA 1E1FA 3M47A 3UCCA 4YHGA 3CB3A 2V3DA 2CHNA 4FALA 1KRMA 1PX8A 2ACUA 3EDFA 3M43A 2V9DA 4C6KA 3BG5A 1W9UA 4GY7A 3WD1A 3BLFA 5C70A 4YTSA 3L4UA 1KNWA 3BG9A 1E5NA 1JCLA 3P84A 3W7EA 1MUMA 3VNJA 2VDHA 3D3FA 4O0KA 3NJ3A 3KTSA 1V7AA 1TV2A 1JVNA 3NL3A 1I9CB 2BNJA 3FW6A 5LNVA 4UTUA 4PRRA 4D6JA 3VE9A 4AD5A 5KZ6A 4JGDA 2CU0A 3V7PA 2PU0A 3VKCA 5CGTA 1TJ2A 4S3AA 2F2KA 4NILA 1FWNA 1SSGA 2PDBA 3MDUA 4PZVA 3KBMA 3NO3A 1MYRA 4L9XA 4I8YA 4KCTA 4BA0A 2QDDA 3C2RA 2BVYA 4BHYA 1MI3A 2JGQA 2PEVA 2PDHA 2J4GA 1XBZA 3RJYA 1P7TB 4ROQA 3VD3A 1ZJHA 5I00A 1M68A 3S9IA 2ASHA 4MB1A 4HIBA 1K3UA 3SO7A 3EX3A 2QUTA 2V8ZA 2ABBA 5DCBA 4Z1DA 3GBEA 3DYMA 1F05A 3OEXA 3IVSA 1W5QA 2CBJA 4CQCA 3CZEA 4QQUA 2BWGA 4BQ4A 2OT0A 4GVIA 2PFHA 1KFCA 3LI0A 4M1BA 1UWSA 2YW4A 2ZUNA 3B05A 1YMYA 3CZLA 4ZA0A 3IJ6A 1SO5A 1CNVA 3ITXA 1AW1A 3VDGA 2E25A 1K7FA 1GOQA 1ONWA 4ZQRA 1S2WA 1WP6A 1QAPA 3E02A 4B5NA 4DZAA 4UQEA 2ZTJA 3GVQA 2OOGA 4JX4A 2P0IA 4H01A 3QXBA 3I3EA 4BS0A 1R9ZA 5EFFA 2CWNA 1FHVA 1O1ZA 4LVFA 1UD2A 4HTYA 3SIZA 3DFOA 4JQ3A 1H50A 4N9BA 4LAZA 4DLFA 1W54A 3NEVA 4LNCA 1UD3A 3A5VA 1X7IA 1R3QA 1MRAA 3AAMA 2C14A 2V0TA 4H9MA 3EWZA 2PPGA 4AIOA 1EJUC 1G7UA 1TR9A 2ISWA 3IIXA 1XLLA 3CQ0A 2CLEA 1XUZA 1QPKA 2PD5A 4LSBA 3VUSA 3M6YA 1LP6A 1ZL1A 3VUPA 1Y0EA 3WLTA 1M7OA 2DW6A 3LN3A 4X60A 4K3ZA 2WHMA 1UC5A 1REQB 4NL1A 5HQEA 3A12A 4O1EA 1Q66A 3UZWA 4F2TA 1B4EA 3W7OA 2C79A 3LD5A 3UVAA 4NRRA 3WEZA 4NNAA 3CS2A 3DDMA 4AY8A 4IMGA 4WR3A 4IFKA 1MFUA 1GTEA 1MZRA 2Y70A 2YIHA 4XO6A 3ZR5A 4S38A 1E56A 3WQ4A 3TC6A 1RY0A 4MF4A 3BL3A 3BJSA 2QCHA 1DHKA 3BLPX 2OX1A 2G97A 4K68A 1R3RA 1ENUA 3G3MA 2BVTA 1AL8A 3TEVA 1R2SA 3PZTA 5BXSA 4PB4A 3LTSA 3MO7A 2QNEA 3T55A 2WMFA 3QV8A 3WJXA 2QIWA 4XX6A 3O6DA 4H19A 4MYXA 1F07A 2WZIA 3ARXA 1M04A 1QWKA 1LM1A 2E1DA 1NQKA 3S3GA 4ZFCA 3TVAA 4WXYA 5CPOA 2C13A 3LEPA 3WSUA 4RDVA 1XFCA 4IXXA 1JI2A 3KM8A 5CGMA 4QP0A 1EC8A 2VZSA 3IJ8A 2TYSA 4IMDA 4GZIA 1GCYA 1VLIA 2VEIA 1XYAA 3HGJA 3T2QA 1OX6A 1WDDA 2FPYA 2VGGA 3EMCA 5DRCA 1QBAA 1OFQA 5B7ZA 3MP3A 4OECA 4DJFA 2ATMA 4U2YA 3G18A 3LX9A 4FPSA 2RH9A 3MQTA 3QQ0A 3UWYA 1J6PA 3VD9A 4RR4A 3SQLA 2ZRYA 1IHIA 2QQ6A 1DL3A 4HN8A 1JGIA 4ICMA 1Q13A 4PGLA 3SZ8A 1VJZA 3UNTA 3LNMA 1QVBA 3HFTA 2IMRA 4D6HA 1XLDA 1VB9A 3S2MA 3CQHA 5TD4A 4C60A 1FKXA 1OFDA 2A6NA 5LGXA 1NDYA 3UJEA 3ARSA 4LY4A 3VIFA 2NQLA 4RK8A 1I0BA 1M65A 2PP3A 2OXNA 3FX4A 1IZKA 3NZPA 4GIEA 4HSOA 1TB3A 3LHTA 3L23A 2CFFA 4LUSB 2DT0A 5CH9A 2WNNA 2OO0A 2G0WA 1VBUA 4TOQA 4GQBA 3QZEA 2O7QA 3PBMA 3QZ6A 1EHNA 3QV7A 3FAXA 2NUWA 1NWTA 4RNHA 2XWDA 2H8ZA 1FUYA 3OOQA 5FCZA 3BLIA 1F6YA 2VRJA 5CLTA 3R5EA 4BQ2A 2C0HA 2XIQA 1EO7A 1R87A 1JCXA 4MVAA 5E5CA 4S3GA 3T08A 4RZ5A 1XYZA 2O9RA 3ITTA 3ZJ7A 1ITXA 3NZQA 3TN4A 3W1TA 2P88A 2NVDA 4MJZA 1PV8A 1FRBA 2J8GA 2QMJA 3WFLA 2Q71A 4LTSA 3EWCA 3OGVA 4BEUA 2DZUA 4WKFA 4EPBC 1GQJA 2VX7A 4QTGA 1HKVA 2FZDA 1C8YA 8CGTA 4K6AA 2YCEA 3AJXA 3NM3A 4V33A 1JZ4A 3RPTA 4JICA 3PPHA 3OPSA 5CBBA 1AQ0A 5CZ0A 3LBOA 4OUEA 4EANA 2Y0FA 2GUBA 2FZBA 2WJDA 4PB5A 3W2NA 1JAKA 1OB0A 4HCLA 3WCZA 4JQ4A 4KPLA 3XINA 3PTMA 3GXIA 4PR4A 1V5XA 5D2XA 3IIOA 3PZOA 1UA3A 3QPZA 4JDYA 4PE8A 3E0VA 1XFBA 4R7OA 1B3OA 1J01A 4Q6XA 1PHQA 2DT2A 4IXHA 3EB2A 1RD5A 4PSPA 3TAKA 2XGZA 3II1A 5HUOA 4Y8FA 5K3VA 3E9AA 5XINA 2OR2A 1ONXA 1XW8A 4L4PA 5GQBA 1SW3A 4X9YA 3LMZA 3WF0A 1KM6A 1V3LA 1QHOA 3C8NA 3HJEA 2Z26A 3RITA 3C86A 1QK2A 3AU6A 4K1WA 4WLCA 1NP0A 1FP8A 2DZSA 2PCEA 4JIRA 3W25A 1OINA 4LBUA 1J2BA 1EOKA 1S2TA 4GY1A 4HU8A 1C7TA 1XIDA 1K8YA 1YXCA 4GZ7A 3CUHA 1MUWA 1B1YA 3KCLA 6TIMA 4IX2A 1SZFA 4HU3A 3W2UA 1Q8JA 4H8VA 4JY8A 2ZRVA 3AXHA 1GYLA 4DPQA 3SUWA 2C18A 3DN5A 2OQLA 2DORA 1ELSA 1GYMA 3I6EA 5GNZA 1OK4A 4HSHA 3RO6A 5BXTA 4MB5A 3PF3A 3M0KA 3W6YA 3WK0A 4QXIA 1W3KA 1PCKA 1W1TA 3WDQA 3N6HA 2XUCA 3LPPA 4ZXLA 3U0HA 2ZIDA 1J6OA 2XIJA 4BK9A 1JD7A 3S2NA 1F3XA 1KV8A 1M7JA 3O8AA 3KL3A 3ZSSA 5GJNA 5IFTA 2VYOA 2XIIA 1W1ZA 1PHWA 4J27A 2Y88A 4X0VA 3B8TA 1Z44A 4A3QA 4W9TA 4AWEA 1MQRA 1QW7A 1E0WA 2EPHA 3HO8A 4PFHA 3Q94A 1ZBCA 4J2MA 2FZ8A 3GM8A 4MFDA 1POKA 1WKFA 3UXDA 1X96A 4PMNA 1XJBA 2X2YA 4ZOCA 4JIQA 3NSNA 4P7QA 2VO5A 3GTFA 3V1PA 3L68A 3CL8A 1DQWA 4W7VA 4M6PA 1JQXA 3ZXWA 1TPDA 1LL6A 3P93A 7ENLA 1SJDA 2BGNE 1UWIA 4IT1A 3U4AA 3GBDA 1BKHA 3XIMA 1BQGA 1TCDA 2DUAA 2ZC8A 1JXKA 3OVGA 5I3DA 4F0HA 1WDPA 4UMBA 1EJRC 1ISZA 4IPPA 2WJEA 3GTHA 2EPOA 3M5VA 1TPVA 2ZC1A 3ORWA 1FP9A 1I75A 2D1ZA 1TE6A 4LUJA 5I03A 1TRIA 2E9LA 3GFYA 3R10A 3MANA 4IP4A 5M17A 4CVUA 1T6MA 3GNNA 5A8GA 1N2VA 3TIMA 1WCGA 3FLUA 5FAJA 1HG3A 4W7UA 2PTYA 1YDVA 2PGRA 3DG7A 4UWMA 4O1BA 1OCJA 3B4UA 5BWFA 1GOXA 4DM1A 2PLKA 3NQMA 2YA2A 3UJSA 1MDLA 4DBSA 1P48A 3G1AA 1E1CB 5JIWA 3QW4B 1CXEA 3CJPA 4DY1A 1P6CA 2IUZA 3A22A 3UR8A 4GYKA 4QHRA 3VI2A 2E67A 3GHTA 1A50A 3EDKA 5AHMA 1L0PA 3EXTA 2V5LA 4AW7A 3LHWA 3QFWA 4J3XA 2I17A 3SRDA 2ZX7A 2DY3A 2G4JA 1J0HA 3OTRA 5GPRA 3WF3A 1ECEA 2H90A 3HM7A 1W6TA 3MUY1 3URBA 1SM9A 1WV2A 2XIMA 4ADTA 1N82A 1O95A 3DEQA 3DBPA 4C7GA 1KBBA 1KM3A 1E4LA 4ZTYA 1XRFA 3M1ZA 3R94A 1XLEA 4LU0A 1NP2A 4PH6A 2QR6A 3EXRA 4FLQA 3M5XA 2R1MA 1KRCC 4HZMA 1O6IA 3T09A 4AZ6A 1O1HA 4IIHA 1FA2A 2G37A 5A95A 2GGEA 1Q6FA 2V5CA 3L2IA 5D32A 2QCDA 3W82A 4B5XA 2G3NA 2D22A 3IGSA 4DUOA 3RLUA 3SY5A 2D2JA 4Q8TA 4B15A 3MB9A 5JIPA 5HJLA 3T0AA 4DJDD 3UGRA 4IIBA 2ALRA 3E49A 3B06A 2D0GA 1DVJA 4GIRA 4QLJA 3UR2A 2E1WA 2FIQA 2PC8A 4C6PA 1XLJA 4OWGA 4IMAA 4O15A 1QOQA 1CGTA 2HS6A 3DXIA 3ARVA 5L6UA 3M5ZA 3BANA 1QW8A 4OOUA 3WQ8A 6CGTA 1XLGA 1PX3A 3ARTA 4DF0A 3PY2A 3SBFA 1KFBA 3WLIA 4YTTA 2CLIA 1H7RA 2ZE0A 2I9UA 3MI6A 2X05A 4Z17A 5D30A 5G1MA 4AG0A 3L21A 3CLWA 2IQTA 1L6GA 1GWJA 1VCVA 3ISIX 3VDAA 3CIWA 1B3YA 4JX6A 3F4WA 2CLHA 2E9BA 1JPKA 3VX0A 1JAEA 3WK3A 3UXIA 3C61A 2PBGA 4ZGYA 2Z6JA 3EOSA 2P10A 1E6RA 5HPOA 4DYKA 4GABA 3CT2A 4WDTA 3U7VA 3JU2A 1PE1A 3PZNA 1IXQA 3DECA 2V63A 5PTDA 4C6FA 2DZBA 4ZO7A 5CJ5A 3H54A 4GXMA 2O9PA 9XIAA 1FWWA 1W2VA 3EGJA 1K7XA 2CKRA 3GW0A 2R1NA 2D2OA 1UASA 2BMBA 2ZZ1A 3WUGA 3N9RA 4H2CA 3QKEA 4XAFA 3ABSA 3WQGA 3PZMA 1XYFA 2FPTA 3WLJA 3MKCA 3Q45A 3W6MA 5E9AA 3FKRA 4CQ9A 1O5KA 1K7EA 1L8NA 1DWAM 2PODA 1ZZMA 1V0KA 4B3ZA 4GUFA 1TJRA 2CXGA 3RCNA 2JQXA 1ZJBA 5H8UA 1O5XA 4QM1A 5LGZA 1BSIA 2YJQA 4U3AA 2PDQA 3AS3A 5EBAA 1ME7A 4Z1BA 1IEQA 4RKAA 1NAL1 3RCMA 4DO5A 5HWNA 3T6CA 2G5WA 4IPLA 4TO8A 1JQVA 3QJAA 4KT2A 4GQQA 3WMLA 3FVMA 3W7DA 3WQVA 3DFNA 2ZUUA 3EWDA 1JZ3A 4G1KA 1OFPA 4Y9MA 1VIZA 5J5RA 4D8LA 4CEXC 1R9YA 5CPMA 7REQB 4AUBA 1AJ2A 4ZQNA 2G4FA 3K4AA 2J6VA 4OFCA 3GDLA 3I6TA 3J7HA 4RW5A 3BSGA 4XQ6A 2ZWYA 1Z9AA 3E6EA 3NL6A 4CLMA 4E4UA 2W79A 4DJEC 3W1PA 3AIVA 4BQ5A 2A7RA 3VOJA 5H91A 5CC5A 2AAAA 4IISA 1GHSA 3KDOA 1BXBA 2ISDA 1AK5A 1LBFA 3TUUA 1XQKA 3DI0A 2GVJA 3OLEA 2W63A 3WO8A 3NQCA 3MSGA 1OZQA 2VCAA 3H55A 4JQ1A 2QCCA 4Y7EA 3UG4A 3IUIA 4GGBA 3U48A 2BG5A 1V3HA 4HHHA 3OBKA 4I7WA 4L6DA 4FO4A 4LAKA 5EMYA 4GFSA 3AXIA 3ANYA 4OV9A 4GG9A 2ZDSA 4W5ZA 1QW9A 3CPGA 1WBHA 1CGYA 2Z0IA 5AFDA 1BHGA 1MMFA 4IOTA 2YR1A 3WQDA 3HBLA 2J9YA 3W27A 3PJWA 4ZEPA 3GDMA 2DPEA 2DVTA 4FZIA 4XIAA 4N02A 4AEOA 2OO6A 3WIJA 4EPEC 2ZE3A 2YKKA 4FNQA 4ZB0A 4EAYA 4WQ6A 3P8JA 1J10A 3HB9A 4DHGA 1L2UA 4MLRA 1SMDA 2QIIA 1FFQA 1Q6CA 3QGKC 3PK7A 2WC7A 1B9ZA 2PP1A 3QMTA 2PRLA 3G1VA 2EG8A 1UR2A 3G8EA 2WZTA 2CEQA 4MY8A 1C8XA 3AXXA 1OFEA 3MMTA 1D3CA 2YPIA 1PPIA 4NZ4A 2GWGA 3W85A 2C16A 4GX8A 3B8WA 2ZKMX 3NQ7A 1LBMA 3GHRA 4KFOA 2VFFA 1OWQA 3PSVA 5D2TA 2RGMA 2E3ZA 4LUTB 3M0YA 3SCOA 3MT1A 5E0FA 4XZLX 4IMFA 3G1FA 1E0UA 2F8QA 1H51A 1NFPA 2X1SA 1SFTA 3PBWA 1G9HA 3WJSA 1CB7B 2YBUA 5HJXA 1HGYA 3K8LA 2HXTA 5KMYA 4R53A 5DY3A 2J79A 3MPGA 5HMSA 3THCA 5CXPA 5G4EA 4N4QA 1SQ7A 1HJXA 4ICNA 3W26A 2WHKA 2J7GA 1KKRA 1P0BA 1B3XA 5CZTA 1VFUA 3LYEA 1VFSA 3TW6A 1DORA 1HKKA 1AVAA 3GG1A 5FF0A 5LKYA 2Z6IA 3W38A 3QF0A 2XYLA 1BVNP 3AYTA 2CZFA 2CZVA 4JCMA 3W1QA 2QS8A 5M03A 3NDOA 2QF8A 3ONBA 2YL9A 1G4SA 2Z25A 5EY5A 4MG4A 4MNLA 1W3IA 1RCQA 5DBTA 5FACA 1CXLA 2QDGA 2AL1A 2ZCGA 1ZAJA 4O50A 1QMLA 4JTDA 2BSLA 4S1FA 1OF8A 3EX1A 1PDZA 4IFKB 3R0UA 4A3RA 1TO3A 3NDZA 5C9RA 1YBQB 1G7VA 1TPB1 3H8AA 1E3XA 3KP1A 3L2LA 5BCAA 3N14A 4MUPA 4LEFA 3K4DA 5A2AA 2RDXA 5I3IA 4POCA 1J2WA 2EHHA 4AMAA 3AIWA 3O9NA 2PTDA 3CGTA 1MEIA 3NSMA 4PBGA 3B0UX 1GPFA 1V6XA 4GIYA 3BLDA 2H3BA 3T4WA 4UCFA 2QJNA 1Y5XA 1XCFA 4DO6A 3A13A 2QUNA 1CB2A 4H1ZA 4GYFA 3EWWA 2ZZ3A 2WZHA 2WSKA 5A2CA 2X0YA 1PBGA 2PDNA 3PNZA 4NF7A 5GNXA 4TIMA 3GO2A 1EP1A 4FX7A 4LPCA 3LA4A 3P3BA 3VOGA 4GMEA 4W84A 1V3JA 4ZL1A 4Z0JA 1YBQA 3NPVA 3LOTA 2QJJA 3HFYA 4B5SA 2A7PA 1US2A 3B4YA 2WM0A 4K1GA 3UQNA 3QV6A 3L67A 1NF7A 1OSEA 3IPWA 3SN1A 1UMYA 4HMEA 4DF1A 3CB8A 1OIMA 1W8SA 2PWFA 4M81A 1TVPA 1Z7AA 3M0ZA 3ALFA 1G0CA 4XKYA 4C6IA 4IQJA 2NXIA 1P0EA 1U5JA 2UWFA 4QSHA 3BG3A 2PLMA 3QY8A 3DFTA 3EOUA 1F3EA 3I7SA 4S39A 1JPHA 2PAJA 5AOUA 2Z1VA 1B31A 3GG7A 1ZBWA 4WUIA 4HK6A 1A5LC 3APGA 1KCLA 5BMXA 3EAUA 4JS3A 4YPJA 2AQOA 3SCSA 1V6VA 4OTKA 4R85A 3TW7A 1GJWA 1H49A 5D04C 1J93A 5E9XA 5HA7A 5EMJA 2NX3A 3B0XA 1NVMA 1E6NA 4AY1A 1M41A 1IR2A 3CBWA 4Y9AA 4O18A 1V6UA 1GK8A 3EB4A 1AJ0A 3SQSA 4MWAC 4ZOAA 1E43A 2CHOA 4M19A 4HZ6A 2PCQA 2XDFA 3BJTA 4O0ZA 4BCEA 2C71A 1J0YA 2FZ9A 1E9ZB 3A3HA 5LIUX 1IEVA 4GI8A 4WSJA 4BWLA 1O12A 2ZZ2A 5AYYA 2Z00A 1S5NA 4NP7A 4O52A 2FMOA 3USBA 4YXGA 4R34A 1BD0A 5D8WA 3TYZA 3ALGA 5H8MA 1JCNA 1NH6A 3EKLA 3SURA 1TVLA 3T1GA 1VJSA 4ZE4A 3W29A 3GR8A 4HGXA 4AYSA 1GOOA 3IV8A 3MCOA 3GH5A 4KWSA 1YNPA 4JTIA 3N1AA 1OG6A 1LOLA 2J78A 3VC6A 1QATA 1A5UA 1W9PA 3O05A 3S5ZA 1R3WA 4HJFA 5BW6A 1IEWA 3KVMA 2WPBA 4WZHA 3NZGA 3EEGA 1GVFA 3NQBA 4D6IA 1U83A 1NSJA 3SJ3A 1GKPA 2B7OA 4F66A 1KCXA 1X7FA 3UZJA 3QFEA 4HP5A 1XIFA 3U3HA 1XKJA 2C1HA 1XF0A 2X0HA 3FNDA 2ATSA 2OZ3A 3RCYA 3KUMA 2FH6A 3LB0A 1KM0A 1WZKA 3ARRA 3MHUA 2WC4A 3WJZA 3EWUA 3VDBA 5A6BD 2FB2A 3LBMA 4DB7A 1J18A 3WN6A 2JALA 1HXJA 5EMLA 4W86A 3STCA 3MZ2A 3U6WA 4EX4A 2PWDA 2QGYA 1ISYA 3FJNA 4PUKA 2UY3A 2BS9A 4CVWA 1Q7ZA 4HA0A 1B4KA 1MVYA 1S2CA 1E0VA 4IP7A 5I77A 3WKZA 4QCFA 2VR5A 1RALA