5EMYA

Human pancreatic alpha-amylase in complex with the mechanism based inactivator glucosyl epi-cyclophellitol
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Glucosyl epi-cyclophellitol allows mechanism-based inactivation and structural analysis of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5emyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5emyA01
3WD0A 4B3LA 2WAGA 2TAAA 3LX9A 1EO5A 3WD4A 4C7FA 4Z2IA 1HIZA 3LXAA 4QP0A 5I24A 1A3HA 2OW7A 3LXCA 4N0RA 2X2IA 5BXSA 1CBGA 3GH7A 4MJ2A 2VZVA 3WNOA 1JAKA 1YQ2A 4LGXA 1NP0A 3UG5A 1WB0A 2WKLA 2DSWA 3N18A 2G8ZA 1AMYA 2ZICA 1TVNA 1NWRA 1TMQA 3VD4A 4AZIA 3HG3A 3WBEA 1JYVA 3OGSA 5CXPA 2J77A 1SFSA 3F5LA 3S2CA 3IJ7A 2EJ1A 1H2JA 2BVTA 3UESA 1GQKA 4D6FA 4UNIA 1MQPA 5CJ5A 4FNPA 2FYVA 4F79A 1CXLA 1VEPA 3EDDA 3PZQA 1OIMA 1OD8A 1HJUA 3WQ6A 2DGAA 2FHBA 3O2LA 4TX6A 3IJ8A 3W29A 2D24A 4IUGA 1R33A 1XH2A 2GUYA 1TUXA 3ARRA 3AZTA 2W92A 4PMVA 3O9NA 4MNMA 1BG9A 2CCRA 1UH2A 2WVVA 2WHMA 1QX1A 1WAWA 1H0IA 3CHFA 3KL0A 4E8DA 3ZT7A 3AIRA 2ZX8A 1KCLA 4V28A 5JIPA 1JFHA 3EYPA 4WKHA 1E1EA 3ARUA 4RE3A 2C7FA 2OYMA 3LPOA 1RH9A 3VGHA 1CXFA 5LYRA 3L4WA 1V3IA 1FOBA 1W2VA 1GJUA 1GONA 4NX0A 3U7BA 1WDRA 1WCGA 4HA1A 4W7UA 4D6DA 1ISZA 2OYLA 3N9KA 4EAMA 3EJRA 1JF6A 3EJQA 3D3AA 4CCEA 1EGZA 2XVPA 2OW6A 2ZUVA 1UYQA 3OGRA 2Y5EA 2Y2WA 3VGFA 3CPUA 3OLEA 1SR0A 1JYWA 2ZUNA 1XYFA 4AIEA 2CEQA 4QLJA 1KB3A 1WDPA 3WUEA 3T2PA 1VJSA 1UZ1A 4BQ3A 1NH6A 4CVUA 4GXPA 1VEOA 2WLZA 3A21A 5A6AA 3WD3A 6TAAA 5JBDA 2DSZA 2J8FA 1UR8A 2DSKA 3GNOA 3NUKA 5E6YA 4TXEA 2J7FA 5BRPA 4J27A 4DWSC 5F7UA 1MVYA 3LPGA 3ZOAA 1R85A 2AMGA 3WL0A 3RDKA 1B9ZA 2WBGA 4J3XA 1OGSA 2BVYA 1E0XA 1UWSA 4CU8A 1KQZA 1QNQA 5LA1A 4J3SA 2ALWA 4JCLA 4V27A 1PPIA 4F8XA 4FNUA 1V02E 2WMGA 2O92A 5GQBA 2X05A 3WENA 1GPFA 2XSAA 2EADA 2F8QA 4AZCA 3WY2A 5A8QA 1IV8A 1XD0A 2WPGA 1Q6CA 5A6JA 3N17A 3W0KA 5DT7A 3BAYA 1KGWA 3BSHA 3ZT5A 1WZMA 2E8YA 1K9FA 2Y8KA 5HNNA 2IUZA 4AC1X 1GZJA 4FMVA 3ZR6A 3ALGA 1VFOA 3RO8A 3IJ9A 2XVKA 3VMNA 1V6YA 1UOKA 4J28A 1VJZA 2WK2A 2UY5A 4PMQA 2E9MA 3BUPA 1QOXA 1CGTA 4AD1A 1R47A 2Y24A 4HA3A 3VD7A 2Q8XA 4BZYA 2WCSA 4AEEA 5GNZA 3BMWA 1JYNA 3WDQA 1E6PA 3HJEA 2NW0A 4PMDA 4MNLA 5A6KA 1ESWA 3CH9A 4W7WA 1UR0A 3CO4A 1KXQA 4U5IA 4FNQA 2F1BA 3WQ5A 2ZUSA 3KLLA 6A3HA 4D6CA 3CZ8A 2G3JA 5ABEA 2ZUTA 4P8UA 2QMKA 1PX4A 3LRMA 4F66A 3U5UA 1EQPA 3VIOA 2EPLX 1E43A 4A3YA 1KWGA 5FKYA 2IXVA 3CTTA 1UKQA 4CCCA 4TTGA 4DM1A 3TP4A 2BY0A 1HP5A 4UQ9A 1MQRA 4Q7NA 3ARVA 3BGAA 2A3EA 3FY1A 1QI5A 4QCFA 5A6BA 3QHOA 1F4HA 2EQDA 2VCBA 3DYMA 3N15A 3SCTA 4D1JA 4W7VA 4HOWA 2XM2A 1S46A 1J0ZA 1OGGA 3RM9A 1QI3A 1M04A 1UWRA 2EACA 1XH1A 3ARZA 3CZJA 2ESCA 5A6BD 1U33A 1IZKA 3POHA 4KMQA 4D6HA 2DQXA 2BXZA 1JZ2A 3RPMA 2PWGA 2WMIA 1MW0A 3SCWA 2EAEA 1V03A 2XPKA 2F18A 1C91A 4M24A 2WZHA 4AISA 1DTUA 1E9LA 2GFTA 4MDOA 2DT1A 1MFVA 5E70A 3SUUA 2VJXA 2BNJA 1W9PA 2WNWA 1UG6A 2ZUWA 4PSPA 7TAAA 4UFIA 4AZ6A 3MMWA 4MPKA 4RE4A 1QVBA 1UKOA 1JDAA 2PWFA 3W37A 1HKIA 1ECEA 2Z1KA 4B16A 2W4XA 5E0FA 1EIBA 2VQTA 2DSUA 3IANA 5IDIA 4GZJA 2GVYA 1M01A 3VGEA 2VO5A 5A94A 2GDUA 3D50A 3WF2A 3CMGA 1QI0A 1WZKA 3OLDA 2D23A 3HG4A 2A3CA 1VFUA 1HX0A 3IAQA 4H8HA 1ZBWA 2XUCA 3KWXA 1X6NA 3VIMA 1VBRA 3BVXA 1QHPA 4QAWA 4YN5A 5M3WA 3AIQA 1W1PA 1OIFA 4CN1A 5DF0A 3SCOA 2AOSA 4ATDA 8A3HA 4TUFA 1J0IA 1H1NA 7CGTA 3WDPP 2XN0A 3L4XA 4JHZA 2PI6A 1K9DA 3RILA 5EB8A 2OSWA 4AZBA 4PTWA 2D3NA 2PC8A 2DIEA 2VUYA 2XGIA 2ZE0A 1X1NA 2JFEX 4D6IA 3TA9A 1KR0A 1MXDA 2PWEA 3F5JA 3EDFA 4W8AA 3WNLA 5E9AA 5CG0A 3B9EA 2HVMA 3AHZA 3H54A 4U3AA 3WDRA 4TVUA 3GXDA 1W1YA 2EXOA 3PZTA 3U57A 2W5FA 3VSUA 4AMXA 2DIJA 2JIWA 4U3CA 2E0PA 1F4AA 2XM1A 3CIVA 3RCNA 4U2YA 1VBUA 3WMBA 2FGZA 3NIYA 3CLWA 3UCQA 2XFYA 4HP5A 1CGVA 4U31A 4A4AA 2OWCA 4JAWA 3CUGA 1JD9A 3AIBA 1BYCA 1ISXA 4Z2HA 2E9LA 3VX0A 4IPLA 1OT2A 1JGIA 1D2KA 3VNZA 2J7GA 1HJVA 2XWEA 3MSGA 5A8OA 3LXBA 2DDXA 3DX0A 2O9PA 4ZEPA 5GPRA 4Z2KA 1HJWA 4EK7A 5EFDA 3A22A 3SCRA 2QMJA 2UWFA 2OLHA 1PS3A 3AHTA 1LG2A 3T0DA 5HPOA 1QI4A 2G3IA 1ZU8A 2QLYA 5A2AA 2VZTA 3GXTA 3WNNA 2E4TA 3VIIA 4FLSA 1DHKA 1V02A 4HOXA 3CZSA 1TZ7A 1QPKA 4JFWA 4P7LA 4AMWA 5I6SA 1C8XA 1P6WA 3DHUA 3K4AA 5A6MA 1BFNA 5HOSA 4GZEA 3WBAA 3BUIA 4PSRA 4UQAA 4XB3A 3TTSA 3RIKA 1JYXA 1OGBA 1ITCA 2J75A 3QR3A 3VMPA 2VX5A 2WSPA 2J8GA 4WIWA 5CPSA 4AZ7A 4CD4A 2E8ZA 1TFVA 1V3LA 1UKPA 4F9JA 4BQ5A 4LYRA 1EDQA 3QOMA 4PCSA 3VGBA 3BXWA 4IISA 3ZJ6A 3OZOA 2WHJA 1BYBA 1LLOA 2VURA 5GNYA 4PTMA 4MJ4A 3S6TA 3BMVA 3W24A 4TX8A 1PIFA 1E1FA 2FH8A 2DPEA 3QGVA 2O9OA 3A4XA 4HPHA 3PZVA 3DDGA 3GH5A 3UG4A 4JFVA 3D4YA 2BS9A 2BV9A 2QF8A 3A3HA 4E2OA 4U5KA 4NZFA 4YHGA 1TQSA 2GK1B 3K8LA 1MWOA 3MUY1 1EOKA 2D0FA 1UA7A 3SURA 1UH3A 5FIPA 1LWJA 1GQIA 1CEOA 3AROA 1WZLA 2QV4A 4W8LA 2Y4SA 1K9EA 2ZX6A 4WLCA 3W4RA 2F7RA 4FK9A 1Y7VA 1E6XM 5CPTA 4PMZA 5CZKA 2WSKA 2W61A 3WNPA 4DO5A 4ZXOA 4DWSD 5CPQA 2BY1A 5I77A 1HNYA 4D1IA 3OLIA 1OINA 3EDKA 2V5DA 2WCGA 1JZ3A 4GPNA 4M81A 1DWHM 1Q6GA 1D7FA 3A24A 3GNRA 4HOZA 1UWIA 4WKAA 2UY4A 2GJXA 5A8NA 4PEEA 1JI1A 4H8VA 2V3DA 4R27A 1E3XA 3AFBA 3AIUA 1GHSA 4OBSA 5CGTA 4HU0A 2WBKA 2F7QA 4N42A 3WUFA 2WMJA 2XIBA 2X2JA 1G5AA 2GDVA 1CECA 1HWWA 1SZNA 3DDFA 1WDQA 3OGVA 1SYTA 2C0HA 4P7NA 1B3YA 4MB4A 1BVZA 3BLKA 1Q6FA 4CU7A 2YLAA 4GINA 4PUDA 3HG5A 2WMFA 4PMYA 3J7HA 2CHOA 1HT6A 1QI2A 5C70A 4B9ZA 1FHLA 3N11A 1GNXA 1XCXA 2MANA 4H41A 3VIPA 1UASA 3D4ZA 1CPUA 4PBGA 1DWAM 3BUQA 4W88A 5ABFB 4AD4A 3AYSA 4MNKA 5BXPA 5E1QA 2YBTA 3GBDA 3ZJ7A 4UTFA 1ZBVA 1B3XA 5FL1A 3CMJA 2JEQA 3BLPX 4AYGA 4AXNA 2ZOXA 4MNJA 2V5CA 3AYRA 5A2BA 5A6LA 1CDGA 5A6SA 2WC4A 3F5KA 4P8VA 1OB0A 4H7VA 4CGTA 2WKGA 1KBKA 3GBEA 2VZOA 1BF2A 3GDBA 3CHDA 3U5YA 1T0OA 4W5UA 2E40A 1WE5A 1RD6A 1E6RA 2YFNA 4J3WA 4L4OA 4W86A 3A4WA 4NSBA 5FL0A 5D9MA 2WLYA 3WH8A 2ZWYA 2OSXA 4UFJA 4UFKA 3K1DA 1R8LA 4PMUA 3AMDA 1JI2A 1BTCA 3A4AA 4M8UA 4AZCB 2OWWA 3OIHA 2VRJA 4EE9A 2CXGA 2J7HA 3WUGA 3SUVA 1RP9A 4FNTA 4WSKA 1UUQA 2ZX9A 3B8SA 3CZNA 1KXVA 3NSNA 3H53A 3AIWA 3PZ9A 2WCAA 1E4IA 1C7SA 1UWTA 3ARQA 2NT0A 2X8RA 3NSXA 2J47A 1W3KA 3LRLA 4AYSA 2CBIA 3WNMA 4LYPA 1K6AA 3VIJA 8CGTA 2JF6A 2HISA 1C7TA 5ABGA 4AY1A 2V3EA 1ZB5A 3PTMA 4PMNA 3BVVA 4W5ZA 1W1VA 3MMDA 1UD4A 1V0KA 3AI0A 1E70M 1JXKA 2WW5A 3ARSA 3ARXA 3ARTA 1ISYA 1HL8A 1TVPA 3FNDA 3N13A 3W26A 3MUIA 1ISVA 1US2A 3VNYA 2WXDM 2DH2A 2ZXBA 1GOWA 1KCKA 4FNRA 1UWUA 2D0GA 3WD1A 1W3LA 2EPOA 3VDBA 1HVXA 4CKQA 3AS1A 3G6LA 4LX4A 4BCEA 3AJ7A 2J7CA 2G3MA 4KRUA 3MV01 2G3NA 4MADA 2A3BA 1E6QM 4DO6A 5EMYA 5AYBA 3MV11 3GM8A 2VOTA 3TV8A 2B31A 1EHNA 1B3ZA 3AMCA 4L4PA 3GXFA 1MW2A 4OJYA 1E56A 2XIIA 1V3KA 4MAZA 4A3HA 2CETA 1HJXA 1OCQA 1EH9A 1J0KA 1CXHA 9CGTA 4ZXLA 3T2OA 3WY1A 1E6SM 3VINA 3AS3A 1E6NA 1JAEA 4UQBA 1KGXA 2GSJA 2EPMX 4MB1A 3MO4A 3LRKA 1CENA 2PBGA 1QBAA 1H09A 1O6IA 1VF8A 3UETA 1B31A 1O7DC 3GH4A 3L4TA 1GOQA 3IK2A 1H4PA 1XSJA 2ZX5A 1BGAA 3AXXA 1OSEA 3DECA 1UD5A 4PUEA 4JKMA 2XWDA 3IGUA 2BFGA 3ZIZA 1H41A 3OB8A 2NSXA 4ZE4A 1UHVA 1UD8A 3ZR5A 1RP8A 2A3AA 3PZOA 1MQQA 3DYOA 3WH6A 1FH9A 1VFMA 4Q22A 2C8NA 2VVSA 3WH9A 5DMYA 3VSTA 4OBRA 1TG7A 1FHDA 2WWCA 1EA9C 2WC3A 2VCCA 1IZJA 3WEMA 1J01A 1GVYA 3HMCA 3PN8A 3ZM8A 1GOKA 1WKYA 1JZ6A 3I3EA 1NP2A 2BHUA 3VSVA 1TR1A 1ZBCA 2WHLA 3VM5A 3EBVA 1LL6A 1ZL1A 1V3MA 3GXPA 1BGGA 4P7RA 3UEQA 2E9BA 1GJWA 1W1TA 2WMHA 2CHNA 4W93A 1TE1A 3FN9A 3VD3A 4AZ5A 4JKKA 1W9VA 3VIFA 3W6LA 4ACYA 2OWXA 5CSUA 5JIWA 2VNCA 2ZWZA 4GI9A 3VKKA 1GVIA 3RMEA 5A2CA 3PZIA 3PTKA 1H0GA 2J7DA 2YDQA 1NQ6A 3WF3A 1HXKA 5A69A 2XN2A 1C8YA 3AIEA 4GKLA 3BC9A 2D22A 5C71A 2DEPA 4V2XA 3W53A 4P8WA 3F4VA 3LPPA 3NDZA 2F1AA 5HDRA 3E1F1 4KGLA 5BROA 3POCA 3L2MA 3CZEA 4ACZA 1J0HA 1M53A 2D1ZA 4PMXA 2J7BA 4PYSA 1UH4A 5FD0A 4E4PA 1OBAA 3PZUA 1K9TA 1G01A 3ZJ8A 5DEZA 3QHMA 1PX3A 4BQ4A 3L4YA 1PEZA 4W87A 4IPNB 2ZXQA 1N82A 1R75A 1B90A 4KRTA 1B2YA 3ECQA 5ABHA 4UZSA 4U2ZA 5IFTA 5A1AA 1W91A 4AEFA 1E4NA 3CZKA 2JALA 4S3JA 3KLKA 2ZIDA 1QWUA 4W85A 4W84A 4WKFA 3QHNA 3WN6A 1NWSA 4NI3A 3VU2A 4JL1A 3DC0A 1LG1A 2CKRA 3MUAA 4AD3A 1NOWA 1PX8A 3AS2A 4M29A 4UOZA 2YL5A 4W89A 1GW1A 4EKJA 2WWDA 3CZGA 3WSUA 1I75A 3ZT6A 3T0BA 3PHAA 5A95A 1PZ2A 3A47A 3TTQA 5D8WA 2CBUA 1R86A 2O9TA 2FDMA 2CKSA 4CD6A 4JHOA 1DWGM 1CTNA 1NWUA 2DT3A 3CUIA 3AMGA 1KXHA 1LL7A 1VIWA 3CBWA 4J3TA 1CLVA 1BSIA 1VB9A 4CN6A 4OOZA 3KZSA 3THDA 1UQZA 1C3FA 4LQ1A 1G0CA 1UR4A 3SUSA 5IXEA 4UQEA 3BCFA 2WVVB 4NXSA 2YKKA 4OKDA 5I3DA 1CXKA 3KL3A 4DUVA 4DO4A 1FP8A 5M17A 1W9XA 4LYQA 3WELA 2EO7A 5LA0A 3MMUA 2CYGA 4BS0A 4GQQA 1WZAA 1ZS2A 1FFQA 4CN4A 3WQ4A 5FOOA 3KL5A 3T08A 5HPCA 4B3KA 1HN1A 3L2LA 1OD0A 1QHOA 2F7OA 3PZGA 2J62A 2WB5A 5JUVA 1E5JA 1DP0A 1J10A 1JDDA 2UY2A 3OLGA 1C90A 3A23A 1XGZA 4WK9A 4K68A 1GUVA 3EJUA 1TA3A 3WNKA 4PCTA 3TTYA 3T0AA 1B0IA 2EEXA 3VD9A 3BAIA 2FHCA 4DUWA 5BXRA 2W67A 3VMOA 3MU7A 1WPCA 3WF4A 1ZJAA 4GIAA 4H2CA 2YL6A 1VAHA 1W9DM 4UOJA 3CUHA 2XJ7A 5BXTA 1UD3A 1E55A 3VPLA 4C7GA 3AXIA 2WVUA 1HXJA 1W9UA 4GI8A 3EJTA 3N04A 1JNDA 3MKKA 1E40A 3OBAA 1G94A 1LQ0A 1UR2A 1EQCA 1E0WA 3S5YA 4OZOA 3VDCA 1V6UA 1IT0A 3WQWA 1H11A 2WHKA 3BAJA 4AD2A 1TA3B 3W82A 4UFLA 4F9DA 3VIKA 1B30A 3ZO9A 3N12A 3ZSTA 4HMCA 4J7RA 2X0HA 4ZFMA 3VIHA 1HF6A 4GI6A 3DYPA 1QNSA 1BPLB 2PBOA 2QPSA 1OM0A 1E0VA 4KWUA 1C93A 1NM9A 1A47A 3CGTA 1BHGA 4D71A 1E5NA 1BQCA 3RJYA 3BH4A 2BXYA 5CLTA 2WZIA 2Z1SA 5D9NA 1JXJA 2YA1A 1UWQA 2RGLA 4TVDA 2YL9A 3ARPA 4YPJA 1AVAA 4JFUA 4P7OA 5AC5A 2YDRA 3H55A 3SCVA 1WP6A 4X0NA 4FLQA 2GJXB 1MW3A 2BY2A 4FF5A 2ZX7A 3WL1A 1GHRA 1CWYA 2WANA 2W62A 3WQ8A 1W2PA 3VGDA 4D6JA 4MAVA 3SUTA 1FP9A 1U2YA 1HVQA 2ZXAA 4HU8A 4HMEA 1NOFA 3EJSA 2CITA 4IM4A 1XCWA 4AWEA 4AIOA 2XN1A 4NF7A 1DWFM 3K46A 3WEZA 1U30A 1L8NA 3M6DA 1R7OA 4TVCA 2CNCA 1KTBA 4UOQA 1QNRA 1QHZA 4PRWA 1H5VA 1WDSA 4D6GA 4CUCA 1VFFA 3I3BA 3PBGA 3WUBA 2DT2A 4OIFA 4ZENA 2V3GA 3DX3A 4MTVA 2YOCA 2VL4A 5BYWA 3RM4A 2AAAA 3WEOA 2JEPA 2EPKX 1V0NA 3D5HA 4D6EA 4PTVA 4CD7A 2GJRA 3AISA 3BCDA 4JCMA 1HTYA 2V3FA 2ZXDA 4JIEA 5D9PA 1CXEA 3BSGA 2X1IA 4XV0A 4AIUA 3WDJA 1W9BM 1ZBKA 3GNPA 5JBFA 1BVNP 4JL2A 3WFLA 4M82A 3UR7A 4RE2A 3ZJKA 3SCSA 2DSVA 3K8KA 3CUFA 1KBBA 3NJ3A 5AYIA 1QBBA 1DWIM 1KTCA 1O7AA 1US3A 3VILA 3VDHA 4JKLA 4DM2A 3AHXA 4NRRA 1E72M 3BAKA 1QNOA 1NARA 4AD5A 3EDEA 2D0HA 1V6VA 1UR1A 2FE0A 3BVTA 2IXUA 4WF7A 2BVDA 2YA2A 3GXIA 2VX6A 1QW9A 4MB5A 4UR9A 7A3HA 3FW6A 2VR4A 3CUJA 3TOPA 1J9YA 5AY7A 1E15A 3RJXA 3DX4A 3DX2A 1Q6DA 1HKMA 2DT0A 4Z2GA 3WY4A 3AQUA 3T2QA 1GOIA 5D4YA 3W38A 2JIEA 2BHYA 5JBEA 4HA4A 1XSIA 4GO9A 4P7QA 3GZAA 2WYSA 4NZJA 1TQVA 3UERA 5IHSA 3ARYA 5I2UA 5M03A 2VR5A 4M56A 1JL8A 1TQUA 4BF7A 5D9OA 4OOUA 5FCZA 3II1A 2VCAA 5KZ6A 3SIMA 3FHAA 4Y7EA 4TOQA 5ABFA 2VX4A 1CGYA 4QDMA 3WMCA 3AMLA 1V6XA 1LWHA 4GO8A 3QOKA 4PN2A 1HKKA 2VC9A 2W63A 1J12A 3W25A 2CESA 2BHZA 1J11A 3L4VA 3ZSSA 1CGUA 5BCAA 1H49A 1OT1A 2CBJA 3WQVA 5D8ZA 3KEHA 3CZLA 2W91A 1EO7A 4J3UA 3OA5A 1ODZA 2XYLA 4HTYA 1KXTA 3VTRA 3GYCA 1JNEA 4DUXA 2X2YA 4WJXA 1B1YA 2F61A 1J0JA 3GXNA 3VM7A 1MXGA 1I1XA 1VRXA 3EMZA 4ZE5A 5E6ZA 3WMSA 1V0LA 4S3KA 3NCOA 3AS0A 3AICA 4JFTA 2X2HA 4KH2A 4D72A 1KR1A 2VTFA 5BRQA 3W27A 1JIBA 3A5VA 3G6MA 1FFRA 1V6WA 2VVNA 1W3JA 1HJQA 2YDSA 4UCFA 3WDIA 1EXPA 3DX1A 3S5ZA 1E4LA 3KE0A 1XC6A 4X0VA 2YBUA 1JF5A 3IAPA 2VT0A 1GQJA 1V3JA 1HP4A 2O9RA 3VD5A 2D2OA 1LL4A 2VMFA 4M1RA 3AHVA 4DWSA 4HZ6A 5E0CA 4LPCA 4Z2JA 3L4UA 4FLOA 1E4MM 4MDPA 4QCEA 4U33A 4J3VA 2XVGA 4XUYA 4DWSB 1UZ4A 1FH7A 1BAGA 3SCPA 1PBGA 1ZJBA 2XSBA 1WO2A 5TD4A 2YIHA 3BAXA 3BLBA 1LF1A 1XV8A 1PIGA 2PB1A 4UZUA 2J79A 5I78A 1ISWA 2YFOA 1UQYA 2WC7A 3OZPA 2YL8A 1M7XA 1C8QA 1CLXA 4AZGA 1QNPA 2WMIB 3WH5A 5DT5A 2PF0A 5A8PA 1XD1A 1XYZA 4HPGA 1Q6EA 2XFFA 3EDJA 4KGJA 1UR9A 3UG3A 3WF1A 1TCMA 3SUWA 1GORA 3BVUA 1CNVA 4ML4A 5IFPA 1KFWA 1CXIA 5E09A 1SMAA 3CHEA 3LPFA 5I5RA 2OYKA 4BA0A 5EBAA 1G9HA 2NT1A 3AMKA 3FAWA 4CVWA 5GNXA 3PZNA 3THCA 5IHRA 2X0YA 3HZ3A 2VX7A 4AW7A 1SMDA 1GOMA 2FH6A 4P8XA 1GCYA 1E3ZA 1JZ7A 3O6AA 1UD6A 5LA2A 3M07A 1CYGA 3L4ZA 1JZ5A 3D52A 1FH8A 1ITXA 1PAMA 3BVWA 2G4FA 3NYDA 3FHQA 3VO0A 4GZIA 4NRSA 1XSKA 3CHCA 1Z32X 3GTNA 4ATLA 2CIPA 3EMQA 3FAXA 3K4DA 3W81A 1PJ9A 1R46A 4OGZA 4FNSA 4CU6A 4CD5A 1M03A 4OUEA 4HZ8A 2F7PA 4QFUA 2PWHA 3SCQA 3WKZA 1R87A 3MI6A 4M80A 5CLWA 1HL9A 2PWDA 4UQCA 5I0DA 4UFMA 3VOCA 1I1WA 4AD0A 3CV5A 1W3HA 3WY3A 1EOMA 2QHAA 4JFSA 1JDCA 5AC4A 1UD2A 1DWJM 1X6LA 1AQMA 2XGBA 1V3HA 5EFFA 1NOUA 4Z2LA 1WNOA 3VGGA 3AXHA 1BYDA 1J0YA 3MSDA 4TTUA 1RPKA 1XH0A 2WVSA 5A8MA 4XZWA 3B9AA 3M46A 2XVNA 2CBVA 3LMYA 1BYAA 2GK1A 1NWTA 2WM0A 5KEZA 2WZEA 2A3HA 3W28A 1JZ8A 3D51A 6CGTA 1TQWA 2YJQA 2V38A 4QLKA 1HKJA 2FGLA 3NDYA 3TONA 3ZMRA 1CGWA 1KGUA 1Q4NX 2VI0A 4B15A 1L0PA 4CD8A 2VRKA 1TQTA 3AHYA 2D20A 1BG4A 2UY3A 5CGMA 3VUPA 2F2HA 1MFUA 2DH3A 3N1AA 4XZBA 4NZCA 4NXKA 4EANA 4JZ5A 2CPUA 2J25A 1MW1A 3FXYA 1DEDA 3SCNA 4WSJA 1JG9A 4LXFA 1C92A 3U7VA 3MS8A 3ZQ9A 1JFXA 3MANA 2RGMA 1AQ0A 1VEMA 1XHGA 1BLIA 4UQDA 4R5EA 2CERA 1KWKA 5C8BB 2W66A 1J18A 3ALFA 3AIVA 3K8MA 3EJPA 1E71M 5I23A 1B3VA 2XVLA 2Y8VA 5DO8A 1YHTA 4H8UA 1VENA 1AQHA 3DHPA 1R7AA 1V08A 2VZSA 2JF7A 2ZUUA 1UKTA 4PMOA 2D73A 1W32A 2G41A 4PTXA 3VDAA 2OSYA 3NSMA 1QWNA 2JE8A 2X09A 2XG9A 1E73M 4QLLA 4UFHA 2WMKA 3T09A 1KQYA 1CGXA 3MUZ1 2VRQA 2YLLA 4AMCA 2FHFA 4MB3A 4RL3A 3A6OA 3WF0A 1XRVA 3AOFA 2D3LA 3M7SA 3WIJA 4W8BA 1QW8A 3HU7A 3BAWA 4ATWA 1LJYA 2EBNA 2E3ZA 3VX1A 4X9YA 1GOOA 1EDTA 3BUDA 2IGTA 1UA3A 2EPNA 4YHEA 4AZHA 2EABA 1GQLA 3OG2A 2XTKA 3VVGA 3W6MA 1JZ4A 3GXMA 3HG2A 2VQUA 3AZRA 3CC1A 2J78A 4C7DA 1CZ1A 3WH7A 4CCDA 3WFZA 2XHYA 3B9DA 1FA2A 2QPUA 3APGA 5CQ1A 4URIA 4ACZB 3SEPA 3ARWA 1HJSA 1JD7A 3SCUA 4PMRA 5I79A 4BQ2A 5DFAA 3WDHA 1E6ZA 3VIGA 1UKSA 2J4GA 1B3WA 3UR8A 4FLRA 4HZ7A 1D3CA 3BUBA 4XX6A 3AZSA 5M5DA 3EMCA 4GQRA 5CSYA 1PZ3A 3TTOA 1ODUA 2WVTA 1H3GA 4E8CA 2XFRA 1G1YA 2YA0A 1EDGA 1MYRA 1OWQA 3JUGA 4B9YA 3PTQA 2VZUA 2GJPA 1EHAA 1V0MA 3HN3A 5ECUA 5HXMA 3RM8A 5A3HA 5HBFA 4H04A 2J7EA 2J74A 5BWFA 3PZMA 3I3DA 2ZUMA 3WD2A 1CIUA 1R34A 2BY3A 4HMDA
chains in the Genus database with same CATH superfamily
4Z7WE 3GZKA 2QVIA 2VLKE 1P0SE 1F97A 2ENYA 4R2GD 1H3PL 4M7ZC 3MNMA 1T1ZA 2TAAA 2VN5A 3QXTA 4GSDH 4HXAL 4NM8L 4ODWB 2A4EA 2PSNA 5AYXA 3RU6A 3BISA 2I1OA 4QRBA 3CDCA 5LIYX 1A3HA 3Q6GL 2JKRM 4FXTA 1XYMA 1S9WA 1XAUA 1P7QB 4HFWB 4H1ZA 5H2BB 1AS6A 1P5UA 3OR6B 2X2IA 4ZOCA 5HVFB 4Q8NA 2IOMA 1A0CA 1U8HB 3PWUB 3ME0A 1I2OA 1TWSA 4XT1C 2PDYA 4O17A 3P1VA 3UG5A 1ZANH 5T1DL 4FXJA 2G8ZA 4AK2A 1XCQB 2ZICA 4BXSV 3QTPA 1TVNA 3TBWA 4QHNA 3P9LB 1JOIA 4YLQT 4DAGL 3QMSA 2BNQE 1NC4D 2E5BA 3HG3A 3CDGA 1JYVA 3PWLA 1U3NA 3OGSA 3GWJA 5IHUL 2NQJA 4QAMB 1SFSA 3TZNA 4DY1A 3ZLHA 5FW6A 1SNRA 4Y19A 2EVGA 2ADYA 2XBDA 4IRSC 2R8SL 5IM7A 1DQDL 1ZE3H 4WENB 1GQKA 5F3BB 2J1ZA 2MCMA 3QDAA 3TWCL 3X13A 5CJ5A 4FNPA 3T4AA 1FX6A 1RU9H 2QJHA 4E9QA 4FXSA 5CSBA 3NZQA 4F79A 3DMMA 4IU2B 3QGAC 5H35A 3WS6C 1VEPA 2PDQA 3CFEB 1OIMA 1YG9A 4GAJH 1JCNA 4J6RL 3DROA 5JMOC 4HPXA 4EANA 3O2LA 1QBML 2DQFB 3EH5B 2A0NA 2LU7A 2AV7A 3QR0A 3M0KA 2ITCB 2GJ6E 4JQXC 1AZUA 1RUKL 1GOHA 1SQ2N 1T1XB 2W0FB 5BPPA 3O9NA 2Y6SD 4PMVA 3P30H 4MNMA 1BG9A 3FRUA 3O2VH 3M0IA 2HE5A 2QVHA 1L9MA 1T8QA 5DC9B 1U8KB 1T21A 2MOQA 2W9EL 1PVNA 2WHMA 4BGLA 4NT6A 3NL5A 3PG2A 3N3MA 5HVWA 5AVSB 2PLKA 4K5LA 4IIBA 1R5VA 2ZX8A 1NFDE 1SLVA 2V5TA 4OFVA 4XO3A 5EIVA 4HDIB 4BH8A 3TFBA 2B81A 5IW6A 3M5ZA 3ARUA 4IH3A 1PLGH 5T3ZH 4HUCA 1S7UA 2ATKB 3QAZB 4EN3C 4FQ2H 2OYMA 4GLRI 4I2XA 4QNPF 1XXDC 2WHVA 4NQEB 4UT9H 3U7WL 5IW6B 4IJTA 3C6LB 3UZEC 2V82A 4FQXB 1HI6B 5JXAH 1UM5L 4MA1C 5EA0L 1CT5A 1CXFA 3D06A 4R97C 3T3ME 1KPRB 1EC9A 2EDQA 2HH0L 3NFPA 3EJYC 3MLPA 1MCEA 1QRNE 1FOBA 1N7KA 5E1GA 3IYLW 3DIFA 4LF3A 1GONA 3RTQD 2GJZB 4GSUA 2L5HA 3B6SB 4LARL 4I85A 3ZXAC 2VUNA 1KLZA 1FL6A 2BB0A 2HTLD 5FV1L 1WCGA 4XAYA 1RIUH 3MCLH 4XX5A 1S7QA 5IB3B 3IVKA 1KB9J 1ITUA 1S3KH 1ZTVA 2QV2A 4CVZB 2AKMA 2R91A 4MY9A 5C6TL 3WCZA 4CNTA 7TIMA 2DQFA 2HT3C 1MCWM 3FUHA 2I32A 4HJGB 3O0FA 5E8EA 4XP5L 3U46B 1YEHH 2B0MA 2H32B 4IRJD 4D9QD 4H25A 1A6UL 3RVTD 3L9RA 3M7FB 1IEHA 1OGAA 1J93A 2HFGH 1KCSL 1OOWA 1S9VA 4WU7A 4APQD 4F9PC 1PDKB 3RPIA 4R4ND 3GRIA 3HPSA 3KCOA 4P61A 1EGZA 1ZLEA 2OW6A 2ZUVA 4L9ZA 5E8EB 3ZZ1A 4HUUB 1IEAB 2Y2WA 4PB0H 1Q94A 4OCRH 1LRNA 1I9RH 5IEKB 4Y2DA 2YRBA 1KIUB 3BPLB 4NWTH 1CFTB 4Y9GA 4HWUA 4YE0A 2CEQA 3WDRA 3MS8A 1FVDA 1JHLL 1KB3A 3KYNA 1WDPA 1OWRM 2WZ5A 1WV2A 1EZ2A 2XIQA 5DMKB 1FKXA 3HGOA 2Y06L 4BQ3A 3U25A 3E3HA 1NBZA 4YSSA 1USQA 3QNYB 3CQFA 1DLFL 1XQKA 2GBAA 2X1TA 1AY1L 1FO0B 1G1OA 1CD1A 3A21A 4PJDE 3IDGA 3S96B 4BRJA 3BSMA 1INDL 4IEFB 3APMA 3C0SA 2A77L 2FX9L 1Y6NR 1FLRH 4E9VA 3NPWA 5PAZA 3GNOA 5CEZD 2O72A 1J1OL 6FABL 3BP7A 1KCRH 3RLGA 5G4NA 3F64A 3OZLA 5TTRA 4X61A 2F53D 5KYWA 1MH5A 4EXPX 4BH8B 4K3JH 4HWNA 5D8JL 5BRPA 1T7LA 3W86A 4GXUM 3SPVB 2AJSH 2ED8A 5F7UA 4HGKC 4MXVF 4PRPD 5DD5L 5J1AB 1XBXA 4U7KA 3A9IA 2CIKA 3ZOAA 1NEZB 2ZWLT 1R85A 3FCSA 5D4QA 2YAOA 3CS2A 2VM3A 3H7VA 3P0WA 1KDIA 2ZOKA 4CL7A 1CI5A 3QVQA 3WL0A 3OAZK 1YX1A 3PHOA 2PDIA 4FXGB 3PWVA 5A16B 1B6UA 4J3XA 3TCTA 4JM4H 2BVYA 2VLRA 1NGQH 3G04B 4UTJA 2NLJA 4L2LA 1UWSA 1XYCA 3V10A 1QSFA 4N24A 3W1QA 3LUTA 7PCYA 4IBWA 3OTRA 3WJJC 4NQVB 1KW1A 1IHIA 2BIPA 4O18A 1WD8A 4OLVH 3WAKA 3GHBH 5E2TH 5EO1A 2VGBA 4AYDC 3T4AB 1RHCA 4IP4A 3MBEA 5F0LB 1OPOA 1SJVA 3ATAA 2HJLA 2O92A 1QTYT 1W0VB 2KLTA 2F54A 3OG3A 5EO1B 4ABWA 5DGRA 1R6WA 4YHKH 3NO1A 4AYEC 4EN3D 1X4ZA 3DTXB 1RJZA 4HCRA 4JHBA 1Y8BA 1GS7A 1H6TA 1YVLA 2FJGB 1K4HA 2WPGA 4I77L 5A6JA 4FKEA 4HIIA 2XFXB 2J1XA 2XBTA 1RULH 4WWKA 4Z8FL 3DFOA 1MY5A 3G1VA 3TW9A 5JUEL 1WK0A 3QJXA 5T3XD 1KGWA 5IHLB 3ZT5A 2VERN 1P53A 3TF4A 2AABH 4HB7A 4YVVA 1HCZA 1KGJA 1WZMA 4HWEH 1D5BB 2Y8KA 3BLOA 1T0NB 2F5BH 5EHFA 4AC1X 2BHFA 1GGCL 2QYGA 3DHJA 5DJXA 1F1AA 2YD7A 3MV8D 4PBDA 1RZ7H 1OAYH 1WIOA 2PDMA 4UMAA 3LZNA 5EY5A 4OZHB 3PXJA 3ZR6A 2G5BB 2LTQB 1TO5A 5KYWB 2C9AA 1RU9L 5CBEA 1Y5XA 2Y7MA 3BP7B 3C52A 3T3PB 2RQ8A 3IJ9A 4FFYA 4QRUB 1U8CA 1AUSL 3H42H 2CZFA 2P8LA 3IE4A 2OSLA 3AC0A 2GHWB 3LN4A 1N6QH 1VJZA 4IEFA 2Y22A 4ISVB 4JRWA 1FHUA 4XSLA 4PMQA 4HK3J 1M6OA 4G6MH 4WFHE 3QYSA 2E9MA 2SODB 3K6IA 1WTLA 4YDJA 1PIIA 3ZL1A 2XXFA 3RKDD 2Y24A 1LO4H 2V6AA 3OODA 1B4JH 1ES0B 2Q8XA 5K9KA 4DEPC 4ZW6A 1CCZA 5BXFB 4C6MA 5HR7A 3WUZA 3TFXA 1GGTA 4NM4L 1JYNA 3VW3H 3MBXH 4C6LA 2Y7GA 3VD2A 1KFBA 4GC4A 4G6JH 5EBLA 5MF5A 1TPUA 4PMDA 2WP3O 4O51A 2A99A 2JQAA 2OODA 4N4PA 5HJLA 2C9QA 4G42A 1DZBA 4K5NA 4Y5YC 2VZ3A 3H4FA 3KCPB 1AGFB 2JB6A 4NN7B 3VQLA 2GC4C 5GRVK 4DTGL 1TJIL 2EDXA 5I8OL 1XUUA 1UR0A 2E27L 1YXYA 2CLPA 5C5YA 5SX4I 1RLCL 4JQIA 1KXQA 3B9KA 4Z7UF 4BDVB 4KI5C 4W9ZA 4YGVB 1MZHA 2GJJA 1NCAH 1F5ZA 2VQ4A 5KYYA 2C26A 2IV8A 2LQRA 2VDOB 3BJ91 3BPNB 1HUVA 1VBHA 3EX6A 1K4CA 2VZ1A 4AJ0A 1HKLH 5DO2C 5HHMD 1FBIL 1IGJB 3D4GA 1MEHA 1X8CA 3CNYA 2JLPA 2ZUTA 1JSYA 3LHZA 3MTWA 3IFOA 1WX0A 4H00A 3ITCA 3RU8X 1A4CA 3FQTB 4IICA 1ZVSB 2Y3NA 3GRWA 1E7UA 4MJIA 3W9ZA 3JT0A 1JFQH 4OSUH 1FH5H 1EQPA 4FFVD 2EPLX 3QJHA 4NSKB 4A3YA 4NZ3A 4MKTA 3PL6C 3QSKB 1X5LA 5DVNA 1OANA 5F7EL 1DVJA 2X4SB 4G71B 3COTA 1FN4A 2OX5A 3L13A 4UQ9A 3WE1A 2NR6D 1CDUA 2XNAA 4Z3GA 3PG8A 5EC2A 1IC5H 1BBJB 4EN3B 4XCNA 2FO1A 2F6AA 2BWGA 5A6BA 3EYQC 3NCJH 1F4HA 4KVCH 1CFQA 1E6OH 2MTPA 3HAEA 3FQNB 8FABB 3AQXA 3C6LC 5LAXB 3SCTA 2B3IA 4A8IA 1GW6A 4FQXC 1WAEA 1U8IB 2G5UA 2ETWA 3IIVA 3DMMD 1UCTA 4XCNB 3UACA 3RM9A 5BW7A 2DM2A 1IJ9A 4XCEB 1A22B 3GSNA 4PJFF 2BWIA 2F1EA 4K3EH 5HGGS 1HXYA 3ZYJA 2GTZB 1TQCB 3TEXA 4N2FA 1LO4L 1B5TA 2ICCA 2X10A 2ESCA 1OEPA 5J6GB 2V5RA 5IB1B 2Y1HA 4JBSA 1JF1A 3IAGC 2EC8A 2EXYD 2NW3B 4C6FA 3OPSA 1LJMA 1O1ZA 3VFMB 1T1WA 2NQLA 2OXNA 3TW7A 1ACXA 2VDQB 3AMGA 2JIXB 2LVCA 4MX7B 2EDRA 3ARDB 1NGZB 5TQ0L 3STZA 4PI2A 3SJVB 2ED7A 5DURD 1TNNA 5LKNA 3M43A 1UA6L 1ZRUA 1XG3A 4QRPB 4ZB5A 1DXIA 1TE6A 4AM0A 5IW1B 4NIYE 2W9MA 3ARED 3QEQE 3UAJC 3NTCL 3SE4A 1WHOA 1JXGA 5DMGC 3L23A 4QXUH 5KS9F 3DXAB 4IGBA 1BZ9A 4TQTA 1N8ZA 1CE1H 4AISA 5F6HJ 2A6DB 2FFCA 1BD2A 3CH0A 3S46A 3E2HB 1Q72L 4ZSOB 1OHQA 3P0VH 1I1YA 1CR9H 1D3HA 3LD8B 1MFVA 2BXVA 4QUOA 1QTSA 3USZA 4U1MA 1MCFA 5FM5M 5TPWH 1KNWA 3OR6A 4Y4FC 4JNMA 2OFQA 5DWUL 1WXZA 2R9RA 5FJRA 2E7CA 3L3OC 4H0IA 2NUPB 2CCVA 1KEML 4PSPA 4UFIA 3V6FA 4AZ6A 3J27A 3U7AA 4RE4A 1Q0EA 2MQGA 3HZVB 4A7GA 4OGQC 2ZG1A 3C2SA 4IRSD 1ASOA 4OF0A 3MQIA 4YFDB 5CEYB 3RU8H 2V7HA 3W37A 2HBXA 1M71B 1HOEA 2H2PC 5DZAA 3HPAA 3P3RA 4XMVA 4PCNA 4PY7B 5B4MD 5E2TL 4ABVA 5I1KH 5C0DA 2G4GA 5FYKH 3P11H 1LM8V 3WQGA 4TUKH 4MNGB 5T1MB 1M6UA 1NPJA 3FSVA 2EYSB 3VXRB 2V30A 4UTCA 2W4XA 3BIKB 3OXSA 4N2HA 5JQ9A 1EFXB 1G9NC 2VQTA 3PCYA 3QZOA 4W9GC 3LH9A 3NJMA 3SIKA 5CBJA 2G5BA 2GVYA 2Y88A 3V7PA 2BRRH 3EOEA 1EF3A 1TQXA 1H3XA 2VO5A 2MCAA 3KPNA 3QZMA 1Z5LB 1HO1A 3QCTL 3IJDA 2J27A 2X6BA 3SBQA 3G1SA 1QI0A 3EYSH 3IJQA 3WS3B 3HG4A 2A3CA 2D23A 1VFUA 3ECWA 4ADSA 3WUWB 4Z7AA 4KNSA 3W9DB 3OHIA 1SVZA 1IEBA 4MAUL 1DANU 2DYRB 3H2FA 4Q4KA 4WOQA 3G24A 2QNEA 5JOPD 3EPNA 4JOMA 5DVPA 3J07A 3KWXA 3TMLA 4ECLA 4JEQA 3UR5A 4N22A 3VTAA 1NFGA 3BVXA 3ATYA 4O14A 3UAEA 4UR8A 4YN5A 1TT6A 3AIQA 1S7VB 1CTMA 3PPEA 1OF8A 2UZIH 4JN7A 2QCHA 4CN1A 1C16B 1NC4B 2ZXGA 4W4NA 3WEBA 3TBSB 2DWXA 4URKA 4JJOA 1HH9A 2CG9X 3EX3A 4QIUA 5FACA 5LGXA 1CLKA 4OKVB 3U0WH 1J0IA 4HSAC 4W9LC 4JDBA 1Z5YD 1QRQA 1SO6A 2IKHA 3P4OA 4PLNC 3WDPP 2XN0A 4C90A 1XZ0B 3OJVC 3MYJB 1IGCL 2WNXA 2OS7A 3EWUA 2PI6A 4NC0B 4Z2IA 1K9DA 5D03A 5J8LA 4LWWA 2VJ8A 3WQFA 2D3NA 5KANI 2Q1EA 4L4TB 2G0WA 2XGIA 4M43H 3B9KD 3PV6A 4PL1A 1MXDA 2BSRA 1NMBL 4W6YB 3QIBB 2VFFA 3F5JA 4W8AA 1MCRA 3WNLA 3N2JA 4ZQMA 1IMHC 1UPPA 3LY0A 5F0JB 4U3AA 1KV8A 4UB0H 4ZX6A 4ICXA 3C61A 3UYIA 1J96A 1EPXA 4AC2A 1EGJL 5T1LA 3VSUA 1Q0XH 4DEPB 4OCXH 2Z7YA 1I4FB 4A7SA 1I4NA 3SAZA 3TYBA 2DYPD 2NX5E 5EN2A 1ZQ5A 4AT6B 3G6DH 2F74A 4O4VA 4AVFA 1AZZC 2FGZA 3LHAA 1BZ8A 3QISA 4BSWB 2CCLA 1A65A 4YDVB 4ZXBB 1K4GA 2DZBA 5L6UA 1A6VH 1RK0A 4I13B 2IDUA 5TDOA 3THUA 4NGHH 4HP5A 1CGVA 4U31A 1POJA 5DANA 1E5AA 1UP0A 2XPYA 1XGDA 5C8JB 3B7RL 4JAWA 3A6CH 2GGHA 5F1IB 2G3ZA 2IKJA 3ZHKA 5FUCC 5C7XL 3VA8A 3D85D 1JD9A 3EYSL 4IRZL 3R1GH 5KTEL 1RJLA 3HV8A 4H9ZA 2H5UA 2IVFC 4PW9A 4IPLA 1AJ0A 4YL2A 3QRGL 1WBZB 5BRZA 4G8EA 4P2QE 1VCAA 4PJBB 3VNZA 1D2KA 1HJVA 2J7GA 2XWEA 1CB7B 2CRZA 3O2VL 3B4YA 2E9IA 3MROB 1W72H 4KPHL 3BGMA 4HPGA 4RXGA 3U9IA 3LXBA 5A8OA 2DDXA 2LGNA 3DX0A 3QUKB 3RVXC 4ELME 2NY2D 1BXNA 4XD4A 4CNOA 5TFSH 4Y1AB 4L37A 4FFZA 5FDYA 4R7WA 4JFDE 1HJWA 4EK7A 1DVQA 3KWVA 1RZGA 2OXGB 2ZUQC 4FHKA 1LOLA 1A0EA 4Q4RA 1ID5I 3RY6A 2ZQ0A 2NDGA 3DX8B 3MCKB 4Q8MA 5AC6A 1G7LA 1QWGA 4XBGB 4Y2WA 4CSPA 2O5XL 4OTXL 5I0YA 3RU8L 1LG2A 1LCOA 4PH6A 3T0DA 4R4FH 4BSJA 5HPOA 2F54D 1U36A 4JTJA 1Q9OA 4LGSB 1PFOA 2ZT9C 3FT2A 3O4OB 5BV7H 1S5MA 3VXPA 1SLWA 4RMBA 3OO2A 2WXIA 5FCUL 5PTDA 2IJ0C 3U9PH 3KS0J 4JTDA 5XIAA 2E4TA 1TZ9A 4FLSA 1SPQA 3HE7B 2X0SA 4MNHB 1TPC1 3W70A 3AB0C 4HFUH 1C12A 1TZ7A 4JPKL 5EUOF 1JS4A 4JFWA 4OCYL 3WBYA 4HJEA 5ID0A 5I6SA 1RZIA 5E6SB 3ARBB 4Y9CA 1P6WA 2OL3L 2P1YA 4C4BA 1VGAA 1GKEA 1Q5MA 2R2BB 5ISZE 5A6MA 1GOMA 1OALA 4UT7L 1DVFD 5HJ3B 5HOSA 3FSAA 2GFTA 2OK0H 4Z2JA 5CS7A 3F2BA 3EGJA 1UUNA 4Y5XC 4HGWA 4XTIA 4YTSA 4PG2A 5IZ7A 1MO0A 1XLCA 4DJEA 3U2OA 3KPSD 4KI1A 2PA6A 3TTSA 2HUHA 3RIKA 5ADPH 4PJHF 3B8VA 4MQ7A 5KUKA 4AV4A 5DJYA 1WXYA 1ITCA 5I6OA 3S37X 4EI5B 3HHSA 2P8MB 2R59A 3QR3A 4RK8A 4GXMA 1ACYH 3VMPA 1JBJA 2WSPA 5JYMA 1RQHA 4WIWA 2V2DA 3W57A 2X4NB 5CPSA 3VOFA 2G4JA 4S3EA 3T1WA 3BVDB 3GMRB 4MJIE 3RBGA 1J8KA 5DBUA 3TX9A 3W2JA 3GRBA 4ZVJA 4ANKA 1Q65A 4WU5A 2P80A 2QDWA 4PCSA 3L9YA 4ENED 3BXWA 1RSCA 3DZ1A 3ZJ6A 3S8HA 4O2EA 1BYBA 1XLMA 3HGSA 3CT2A 4ES8A 1MEXL 1AG1O 1I3RA 3NH7L 4X8JB 3ZTJH 4TX8A 1HJCA 1U95A 4FCHA 1U3HB 5DZJA 1PIFA 3SZKC 2FH8A 5DY3A 3QGVA 1HEJC 5F1NB 4MHBA 2R1MA 1HDMA 1FO0H 4HPHA 4G72B 2V5KA 4U7SA 3H2EA 3PZVA 2X87A 4O13A 3DDGA 3GH5A 1LNUB 3C09B 1LGVA 1Q90A 2O5XH 4OTXH 4HG4K 2HEJA 2IMRA 3GK8L 1FIGH 4JFVA 5KVDE 3W76A 1W72B 3MNZB 4EOWL 2YW3A 3KPMA 2XDFA 1E4WH 4ZW3A 1Q0YL 1QP1A 1R0MA 1Q1PA 4UQIM 2H26A 2H9GA 2BM3A 3K8LA 4I0KA 1KFCA 1I8LA 2R9HD 4GG6E 1GC1L 1MHPH 3O8XD 1IWPA 3F03K 2D0FA 3DK2A 4M8VA 2X3BA 3BUYB 3QUMH 4ZO7A 1UA7A 3JYCA 1UH3A 3VH8B 3LYEA 1XP3A 3SURA 1W5PA 3IGHX 3KPRA 4HJJL 3RA7L 4NNXB 1WTGT 1MRCL 1EEXA 3VFRA 2VDGA 1WZLA 2VDLL 3BLIA 5FEPA 2OOFA 3QULA 1DVXA 2Y4SA 4XMTA 4F2FA 1JCTA 3TSDA 4CNNA 1XZWA 2ZZ2A 4PYGA 4ZSUA 3C9NB 1FAIH 2C3VB 2F7RA 1HHIB 3L45A 2MRYA 1TSRA 1Y7VA 5CPTA 2CGYA 3DV4B 2Y5TA 4Y4KA 5CZKA 2E27H 3V0SA 3GVVA 5DD1H 3NZHL 3OJDA 1MFBL 2A4AA 3UJTL 3PUOA 4K7FB 4DO5A 1BTMA 3V9CA 4R7NA 1HINL 1SXNA 4EI5A 2GITA 2X6UA 4OLUH 1KTLA 3IDIA 4AF0A 2IFFL 5MENB 1VFHA 3WEAA 4FMKA 1BVWA 1OINA 3EDKA 1X5KA 2OTWB 3UL4A 5JHMA 3OAYK 2WCGA 1YNQA 3FQXB 3V4PB 1JZ3A 4M6UA 1X5GA 4DPQA 4GBXA 2PABA 4GW5B 5F7MC 4H6EA 5HHOB 3G6DL 1TSHA 1VA9A 5D93B 4B41A 2WTPA 4NJ9H 2VITB 3JV4B 1XGQB 3RL2B 4WKAA 3C87A 4HOZA 2UY4A 2GJXA 2YR3A 3CWGA 4UU9B 3OHXC 3O3UN 2P28B 4PEEA 1ONXA 3GVGA 2VW7A 4H8VA 2BC4A 3ESOA 5HGAA 3LOWA 3NAAL 4OBSA 1GHSA 1EIXA 1B0RA 2P5EB 2VDNH 4LGPB 1SJDA 2F54E 3MNVB 4LQFH 4UT6L 4UANA 4M8QA 1XO8A 5BW7C 2WMJA 1RLBA 3AJXA 1GOFA 5K5YA 5HGBB 2X2JA 3VI4B 4PMJA 4M1DL 4XG1A 1ZFJA 3OAYH 4AVNA 1CECA 5D09A 2IF7A 1UYWL 3CBJB 3D85A 3DDFA 3FQUB 5DGQA 2CH8A 1FWWA 2H0FA 5B1CA 5T8IA 5LCVA 3OHMB 1WDQA 2YXXA 3UWQA 1AGCA 1L7TH 2KHAA 5JW5B 1JPTL 3FHEA 2MH4A 4HYTB 5AB3A 1Y6MR 3GC2A 4MB4A 3LDVA 1KPVA 1HE8A 4BFEA 3WTUA 3JVGA 1BVZA 3BLKA 2WO5A 4AGNA 3RHGA 2GITB 2YXOA 3L0NA 2GSGB 2X12A 3OMZA 4ZOBA 4R7NB 1E9PB 4N2AA 4ZUWB 4ODXB 5FO2A 3EBHA 2HT2D 4LUSA 2VLKB 4PUDA 5DDHB 4ZFGH 2WMFA 1OD7A 5C6WH 3CV6A 4MKNA 2DMHA 4J5NA 4RUBA 3NSYA 3S1XA 3URBA 2DB8A 2XGZA 1CE1L 1ZGLM 1HT6A 3D2UA 5KOMC 1QI2A 2ZYHA 1DORA 4TULL 4QXUL 4QO1A 4Y16C 1B4EA 2NQ5A 1ZWIA 3KW8A 3LRSB 4FQCL 1HU8A 5IF0A 1RMFL 4NNXA 1I60A 4E8GA 4WY0A 2ARJQ 1JZHA 1ZEAH 2HX7A 3FOMB 2BK8A 4I1RA 5B3JE 4FR6A 4H41A 5G4WA 2WWMC 3MFGB 3D4ZA 4K8RD 1XX1A 3R10A 4UAOC 4XP5H 4GP8B 2R2EB 1G9NH 4O58L 3VWJB 1KTDA 3QUMA 1P6CA 2HTLC 4L8SB 6PCYA 1BWVA 5DU7A 4B9KC 4K37A 2Z31A 2WQWA 2VR8A 1IGTA 4JZOB 2ZCHH 5FF6B 1ZBVA 2NY1B 3G3MA 4UTFA 1L6ZA 5FL1A 1Q6OA 3MACL 3CMJA 1PYWA 2CRIA 3BLPX 4CQDA 4N8VA 2OLDA 3U6XS 1FWEC 1AHKA 2ZOXA 4MNJA 2DLTA 4HBQA 3AYRA 1CDGA 1IE5A 2Z8VC 4WK2B 3D5OF 3SKMB 4QNPE 1OB0A 2Q7AA 3IJYA 1IYXA 2WC4A 4H2HA 2OBGA 4KESA 3K5SA 2WBXA 4LLYA 2GFBB 4HIPA 4NFDA 4LVBA 2H6PA 5D1ZD 4JN8A 2IGFH 2QVFB 1U0QA 2QT6A 5GGRY 1W5MA 3EA2A 3BOVA 3U5YA 3ZIYA 5L4JA 1T0OA 2VC6A 4Y9MA 5CSZB 3S88L 1ZP3A 2PEVA 2CKBA 3BZEA 3NL2A 1EF2A 4X6DB 1RD6A 5EWIL 3MRDB 4JKWA 1RZJH 5I1IH 1EX1A 3VDGA 2DMGA 1LTDA 4G7YL 3R0DA 4Z1CA 2NLYA 2CRYA 4FZIA 1UATA 3YPIA 2NY0B 4XZUA 2OSXA 4DGYH 3ZRCC 3K1DA 3OKNA 1RK6A 1Q72H 4HHPA 4Z7VA 1JI2A 1BTCA 3AMDA 4QXVA 1F02I 2D2HA 1BJMA 2VC2H 3DKJA 5ANMA 2IWFA 3M9YA 2XU2A 3SIZA 1TCDA 3LZLA 3NP3A 3NL6A 2CHWA 5ICXA 4W9KC 2IBZX 4ZW7A 4X7TB 3CPLB 4Z3TA 3BAEL 1HHHA 3S3GA 3QIUD 4NN5C 2JF1A 4KXZH 3I7RA 1G6RA 4IBLT 3HO8A 3NPVA 4POUB 4Y5XB 4NQEE 3SUVA 3QV7A 2EIDA 1RY0A 2ICWI 2V4LA 2ZX9A 3HI6H 4X5LA 4YSTA 4KHTH 1UA6H 4KRLB 2EUWA 2R0KH 3UBXA 1NCAL 2ORBL 4MKVA 1KXVA 3GU2A 4WI0A 1LUCA 3NSNA 4PH8A 2ZZ7A 2IMNA 4OV4A 2A7RA 2FIKB 3VCLB 4XMZA 4NQXB 1IM3B 5GZOA 1UWTA 3ARQA 3ZKXB 3JWDH 4TNWK 2A6KB 3CK0L 4PJ8B 5TGBA 1W3KA 4QPEA 4DBUA 3BQUA 3LQMA 1IC7H 1ADOA 4JO2H 4E9RA 3GMPB 2Q6ZA 3LDBB 3DG6A 2FX8H 3S6CA 1PD1A 3DRQB 4ORGB 2UZXB 4FYRA 4Q9BA 1K6AA 1ORQB 3VIJA 1OFEA 1YQVH 1OCBA 4AY1A 3CEPA 3VFUB 1W15A 4XBGA 3PTMA 2JKIS 4W5ZA 1ED3A 1DE4A 2OJZH 1UD4A 3QHZH 2J1YA 1P9MA 2FX7L 1V0KA 1M68A 1I8MA 3F6JA 1FDLH 3ZVVA 3RJQB 4G6ML 1EWEA 1J2WA 3ARTA 4BQ9A 3PGCB 4UINL 2POTA 1HL8A 5SWUA 4P23A 2ADGA 1TVPA 4AUUA 4NO0B 3MUIA 3AALA 4MZYA 4CQCA 4QG6A 4LLQA 2DH2A 3ET9F 1W3NA 4DN3L 3K74B 5LXGL 1XIGA 3S4SB 5EULV 4JQ3A 2VCOA 4AMAA 43CAA 1TZHA 3QZ6A 4RXFA 3MVTA 1E0OB 2BNQD 3ETBJ 3GBMH 2CHZA 2IAMC 3MFFB 3TASA 3VDBA 4JMNA 3QR2A 3TNNA 2O5YH 4JS7A 4Y9FA 5IBTH 1FI8C 4CADB 4CKQA 3BN9C 2PDFA 4RLIA 4A05A 3Q2CA 4O53A 4L3ED 3NQEA 3FT4B 1SZFA 2G3MA 4EAYA 1NDTA 3PDOB 5IESH 2EG8A 5F9AC 1A9EA 3CB3A 1UM6H 3MCNA 4JTFA 3MA7B 4W9TA 2D7MA 1R19A 4G8IA 3LH2H 4ZT1A 3VFSB 2QR0A 4XP6L 3MY9A 4ZODA 1BP3B 3MJ8A 3GI9H 2H2PD 4HQVA 2PXYB 5JQ6H 2DUAA 1K8YA 5EMYA 4JRFA 4NKQB 2IWGA 3VFPB 3HPLB 4XNXH 1J1PL 3V0GA 2ZWKA 2QCNA 3G1AA 3R1ZA 3ZIMA 1TR9A 4FR1A 4KEZA 1MNZA 2ZZ1A 4OWGA 2UWEE 4PTNA 4RMTA 1J5HA 1GGUA 2XIIA 3BPOB 5FB8B 4KRPC 1FFOA 2DLHA 5J0BA 3IJSA 2I56A 2HFFA 1S9XA 1NINA 3BP4B 2ZYSA 3IFLL 1F58L 5DXWA 3U7YL 3E8UH 4DZ8A 4ZB0A 1FWNA 5ETUA 5DUBA 1ADSA 5DEFA 5JDSB 5AOMA 3PV6B 3RZCC 2I60H 1QKZH 2FJFB 4OGXH 4ZXLA 2DY3A 5C0BD 3C0JA 3GIQA 3VINA 2JELH 2QUTA 4KKLD 2W0UA 2V33A 2E7LC 3IIZA 2NX9A 1T4KB 3MV7A 5BQ7B 3CL6A 3U2SA 4P46D 2UZYB 2RFXB 4XNQB 5B21A 1EFZA 3C2OA 5CILL 4RVBA 2INFA 4AXKA 3ARDD 3HVNA 2YUZA 4DZIA 4BUQA 1H3PH 4NM8H 3JT2A 4WAFA 1UWAA 2HRHA 1T20B 3LRKA 2WXHA 4RBPK 2ZZ5A 4QRRD 4EP8C 1FHNA 1I9IH 1DQWA 1VF8A 5HJYA 5IMMA 2FL5B 1O7DC 1QSEE 3BZ4A 1FV1B 2BS8A 1T03L 1BBJA 3R06B 1ID2A 1YC8A 3IK2A 3HB3D 4A1RA 1H4PA 4F0HA 2ZX5A 3AM8C 4EIZC 1CF8H 1OSEA 1L9OA 3DECA 3HNTL 3ZKND 2X4SA 4F27A 3FYYA 3ZIZA 4HK7A 3IGAA 1EJFA 3G08B 4NO2A 2K8MA 1WHPA 3LZFH 5A2FA 4WGWB 2Z1WA 1YDPA 3R8GA 2LOEA 4YR6A 1UHVA 1X8FA 4QTIL 1AKJD 1R3KB 3GGWB 3CAQA 3T0TA 3CV7A 3S3PA 1N12A 1N5AB 1RZFL 1A02N 1T5WB 4DP9X 1D5IL 2RAGA 3W1PA 1ZHLB 4NQTA 3PZOA 4R9OA 3HRZC 2FWLB 2YUXA 1UWFA 4O9HL 4OZ4A 1CL7I 1QVBA 3HE6B 2ED6A 3UZVB 4ZTOH 3WH6A 1XIWB 1VFMA 1S7TA 1VDGA 2NXYD 4S1SH 2VVSA 3H8AA 3QAQA 3VSTA 3FB8B 5EZIH 3MRPA 5EDSA 1BIIA 3LSOB 3BZGA 2R56H 3GHBL 4PV9B 2QGDA 3DV6A 4BQ6A 5HHPB 2WC3A 2ZCLL 3GSQB 4Q7DA 5T1MA 5GS0C 4LVDA 3W7HA 1IZJA 1A2YB 4UOW0 2H41A 3L08A 3O8XC 3WKQA 4X7CC 2HT4C 4BFRA 4O51B 2GQ9A 2TODA 1CDCA 2FK9A 5DR5L 3FCPA 5CINL 3I3EA 5D4IA 1SEBB 2AXFA 5F3FA 3VSVA 1XLKA 1ZBCA 1WC7B 1GSMA 4AENA 2VC7A 5FO9B 2HVOA 1CC3A 1D6VH 1X5AA 3V6OA 3UEQA 1GJWA 2AEIT 3W5NA 3QQXA 5FLVA 2WMHA 3ITGA 3A64A 2CHNA 2GVJA 5BZWB 1L6PA 1NELA 1TE1A 4O2FA 4P3DB 4X7SL 5E4OA 4I18B 4LPUA 5AAMC 2QVKA 3EEZA 3W6LA 3G1HA 3EUDA 5A8GA 5CSUA 5H8MA 1TVBB 2FR4A 4GI9A 3EBGA 4RAVA 1OP3K 5C0FB 4OD3L 5LWYH 3RMEA 4JIIX 1VRSA 2DTML 4YDIH 4WO4B 4XZ4A 5IFHH 2YD2A 3PTKA 1IGML 4QRUA 3KHDA 4LBRA 5F7BA 1WBXA 3QXWA 1J8HE 4KKAC 4EDXB 2NY0C 3FTGA 1NQ6A 5E6RB 2BDQA 2ZXEB 1HFUA 1RZKC 1TREA 2REQB 1U2HA 3AIEA 2VSCA 4TKWA 2PDPA 1BZEA 4TSCH 1VFBB 1DXFA 2OP4L 4XQ6A 4GKLA 2PRLA 2ZOWA 3CUPA 3MVSA 2ICES 5C71A 1F6YA 4M7SA 4Q4QA 3WZ0E 3W53A 3EOBA 4Q6JA 3RAJL 1T7YA 3F4VA 4YR6B 5D7SL 5IB1A 3LLXA 3MB9A 4P8WA 4L23A 1X5IA 4IFRA 4QM1A 3BRFA 1CX9A 4XNYH 2QFPA 2AJYL 2F1AA 2TSAA 1RK1B 1WA3A 3JVGC 2DQJL 2UX7A 4HPNA 4DCQB 3IRZA 4JRYB 1K7EA 3TLLA 1I7TB 1OE1A 3IGLA 5CWSA 1FUNA 1X7FA 4N7QA 3WSQL 5HPMA 2MFNA 1AD4A 3S1WA 1P84K 3CZEA 2ZNXA 4WI6A 3DERA 2FEEL 3STEA 1K8IB 1J0HA 1M53A 3SZ6A 4ACZA 2DBLH 4PYSA 3O6LH 1RZ8A 3QUZA 2QKIA 3MRHB 1G01A 3V16A 1GKOA 4F2ME 1X4YA 1A6ZB 3HC4H 1U93B 3FH7A 2UZYA 2OT0A 2H0PA 2P8BA 3I68A 3BESR 2EC9U 3B8WA 3QHMA 3VKCA 3TCSA 3EJZC 4RBPH 1S38A 2BSTB 2HA1A 3BKMH 1M7OA 5AHNA 4RMVA 4WFHD 2P43B 4KK8D 3RO6A 1MF2L 3G1YA 1BQRA 3BYTA 3VJ6B 4X99A 2G50A 4KJWD 4KRTA 4XPAH 1TCRA 1N59A 5ABHA 5H91A 4QOKD 4I5BB 3SPCA 2H3DA 3SCMC 2CUIA 4GBXC 4IQEA 2B2XH 3KJ4C 3KLHC 4WRLA 5PCYA 4B5EA 5EKYA 5B80A 2A83A 4JE0A 4FOKA 2AK4D 3O07A 1JNNH 1HILA 3CZKA 2J2ZB 5JW3H 1OF2B 2Y1ZA 3VRLE 4ZD3L 5CEXB 1FRGL 2BP0A 2WGNB 4PRHE 2Y3AA 3ARFD 3ZE2B 2ZIDA 1QWUA 3R2GA 2QZ5A 4W85A 4W84A 3D33A 4FTVA 1DEEA 1ZLSL 5SV4A 5GGVL 3RDJA 1T1YB 1MFEL 2ZWNA 3UPRB 4R85A 2OMWB 1YE6A 2XV3A 3QG6B 2WBJA 3A6BH 1KLGB 4JQ4A 5FF3A 3VFSA 1KBLA 1CZ8L 4K3ZA 1WZ1H 2CKRA 3LKOB 4TSCL 1ETZB 1MQKL 3OP2A 1XIMA 5KSAA 5AUMA 1NOWA 4KWVA 5JORA 4LLVA 1NU5A 1BQKA 4KJPC 4GUHA 2FB4L 3GJEA 1GW1A 4NX5A 3GVRA 4Y4HB 5TNVA 2C1OB 3QT2A 2NNAB 1GZPA 5FGRA 3L66A 1UACL 3KDPB 3ZT6A 1V51A 1IR1A 5A95A 4P23D 3A47A 3TTQA 1H9VA 5D8WA 4XAWH 3VNLA 4M3JA 2Z92A 5B39G 3MCOA 4POZC 1JP5A 3MT1A 2NZ1A 5JH2A 1W5QA 3DJZA 4DZBA 2MMXA 3PS6A 4WWPA 3P0YL 1M6OB 3HS0C 3PJNA 4ONHB 3FTUA 5KVDL 1AQ8A 3DBNA 5IK3B 3A4FA 4P5SA 3GLCA 5JIQA 3HHMA 5IHBA 5LN8A 1DN2A 1W1B1 2NPLX 3CBWA 3PGCA 1OJXA 3DBPA 1HQ4B 3F2CA 2VW6A 1IT9L 1TLKA 5GRXG 5AFAA 1YJDL 4P5UA 3VQ2C 1YPZA 4OOZA 4M51A 2YGQA 3H3KA 4X2RA 2L4OA 4JPWH 4M1CD 3QRHA 2A74A 3THDA 4U3SB 4LASL 5I8EA 3DGCR 4GIEA 4CNIA 1UOZA 4IMKC 4YFLI 4LLWA 3G77A 5IXEA 4H8PA 5E8PA 3BSZA 2GSIA 3BCFA 1CU4H 2WVVB 3R4DA 5KBKA 4NXSA 5JNYA 2W6RA 1HI6A 1N2RB 1DJNA 2O6CA 3SO3B 1JTOA 4ETQA 1MNUH 1SRDA 4LCUA 1P7HL 1L9QA 4ZRGA 3VXOA 1JGMA 1FP8A 3GLDA 1XB8A 3KS5A 1SHSA 2R27A 3Q58A 4GW4B 3E3QE 4YBLB 4QOKA 1EWDA 3NM1A 2DWEB 3RNKA 4CA4A 3TS8A 1MHCB 1JPGB 3S7GA 2GGJA 2QDHA 1RERA 2CYGA 4JPVH 4LCQA 5FO7B 4L4VD 3CU1A 2C18A 1WZAA 2CDFB 4RGMB 1OCWH 5D6CA 5IMLA 1S2EA 2GCYA 1FFQA 4YX2L 4HAFA 1BREA 4RDYA 1U3HD 1Z1WA 4PJ9A 3C2AL 5K9OB 1BECA 4B5TA 4WW1A 1NSNH 1IQWL 2MTAA 1QHOA 3WE6B 1AFVH 3MRJB 4XNMB 3MRLB 4HU2A 3RVVC 3SY0B 2J62A 1J8RA 1ZHKA 2C4XA 2WB5A 5JUVA 1DP0A 2CLRB 5E99L 5CEWA 4U1GC 2WNGA 5K9OA 2AXGB 4DO7A 1FNFA 4R26H 4YVNA 4K68A 3EJUA 4IG2B 4A3UA 2XHNA 1XVSA 4NAFB 2X4RA 2UXGA 2YCLA 2PO6A 3P67A 1SOQA 2GJ6A 1VFBA 2Q09A 4RZ4A 4G5DA 3H4XA 3G6AA 1B0IA 1KC7A 4DBEA 1QPXA 2BIQA 1A6TB 2MEJB 3HI1B 5F7AA 4ZFOA 4DGVL 1MHEA 1G5GA 3CE1A 3S3DB 3EYVA 4DHLA 3NA8A 2DY2A 3SQSA 3VNKA 1CWVA 1I1CA 2QHRH 3QUXC 1AE6H 1ZJAA 4NRXB 5DYOA 2WYIA 3TBWB 5IB2B 2VR9A 5J8OA 3IJYB 1TTQA 2PODA 2YL6A 5F4WA 1W9DM 5BRZE 4PJEA 3PJSA 4NWUL 1EQWA 2BINA 5C86A 4LCCC 4E9LA 5BRBA 5EOCH 1R24A 2Y23A 1BAWA 1A8JH 4I18A 4Y7OC 1SF3A 4IS6A 1HXJA 3H26A 1W9UA 5FEZA 2AQOA 3JBG7 2AK4E 3CH1A 4LKXA 4P2QB 4PJBE 3W39A 2YEZB 1MDAA 2VXSH 4ZMTA 4O54A 3MKKA 3P14A 2E7LA 3O41B 2OMXA 1BEYH 2X89A 4H26B 4PRHD 5LNGA 1KGYE 2DWDB 3RDTA 3MYPA 1X5FA 3LNEA 3BI9X 3JWDL 1KTDB 3MRBA 5FYLL 4Y1AE 5T1KD 3W56A 3KZ8A 3QW3A 4WHBA 2DIBA 1S2WA 1J1PH 1Q94B 3D3VA 4XE0A 5GS0D 4JPSA 3ZVHA 5E9NA 2C3WA 4OZOA 4WV1C 4JIHA 2CBTA 4GKNA 4PRDB 4Z0BH 4DRSA 5L9DL 2ZSVB 4ZUVB 1IWBA 3VZZA 2KMWA 3DETC 2X4RB 4JQVC 4TV5A 4G7EA 3R19A 1B30A 4MY8A 3VIKA 5B4MC 3ZSTA 4OHQA 3LEVH 2EYRA 1FFNA 1CCWB 2EKJA 1EZWA 3DGBA 1BJ1J 2COQA 2VYRE 3EHBB 1BDYA 1KKOA 1DDHB 3MRJA 1RA5A 4LFYA 1DQML 4M1CC 3MJ7B 2VLKA 4BZ1A 1H5YA 1S6NA 2NCEA 3DYPA 1EERB 1FL6B 2OMNA 5EEWA 1QVOB 2OQLA 3QRFM 2XH2A 3AU0A 2XFWA 1ZLSH 4XMPH 4Q0XL 1C29A 1VADB 3EKCA 4F7EB 4AUYA 3FRPB 3UGUA 2PBOA 4WW2A 4Q8QA 1M1XB 1NL0H 5DRXA 4BWTA 1KEGL 1CFSA 5F6HI 3OF6D 3TNBA 3OMIB 3UPRA 3W85A 5C0EA 2O4QA 4N9CA 4ANXA 1LO2L 2WOBA 3UPMA 2HG0A 3X2QB 1DSFH 4OVVA 4AQ1C 4GZ7A 3G08A 1NGWA 3OVUB 4F3HA 1NGPH 3BH4A 5EOQL 2BXYA 5CLTA 3WKPA 2DQTH 3ARBD 5CEXA 3MRIA 2WZIA 4M0XA 1FSKC 1KYUA 2YA1A 3Q6FA 1J5OH 1UWQA 4WX2A 4BWWA 2NYZA 4NEHB 4YPJA 3IXTB 3N42F 1HIML 2PXYD 1IC4L 1F11B 4P7OA 3KYOA 5GS1C 1OK6A 1U6AL 2J9ZA 2DQMA 3EGDA 4FLQA 3F7JA 5HUPA 1MW3A 1P1ZB 1FNLA 2HCVA 1QEXA 1PYFA 4O02H 5L88H 1H5BB 3D39A 3QJFA 3W0WD 2WANA 4I3RH 2IS7A 3NZ8B 1W2PA 4P57A 4GBXB 4L1BA 3EYOB 4Z23A 2APFA 1ERNA 3SDXE 4UMCA 4Z76B 4WGHA 4U1JA 2OB3A 7REQB 1U2YA 3F6IA 2MKWA 1HVQA 2ZXAA 2E09A 4L4VE 3VXSE 2EIZB 4FKHA 5IVXE 1NOFA 5JZ7D 1R5YA 5H4YA 3O6ML 3P69A 5JOFB 3CV1A 4DK6A 3NOYA 5JO5A 2R1WA 3PPSA 4X50A 4IM4A 1WCBB 4DOHE 4KS0A 1YY9D 4AWEA 4TQ8A 1LK3H 2XN1A 3QORC 4WUUB 3TJXA 3V5CA 1ET7A 4X5WA 4BQBA 5FB8A 1UR3M 1T6VN 4IOFC 4M1GL 1P4BH 2BP8B 2Q76A 4XN8A 3FYOA 5J5RA 1L8NA 4JRYA 3CIQA 3M6DA 4UXDA 1R7OA 3LNDA 1KXVC 1KTBA 4OI8A 4YSAA 3EJZD 3TJHC 5LIKX 1MVFA 1QNRA 5JOEA 3E6FA 2YGNA 1WQVT 3WLBA 2OZ4L 4P4KC 4PRWA 5AECA 1H5VA 1WDSA 5ACZB 2K3HA 1ZGLA 4PJ5D 4JKPH 4FX7A 4WGKA 5EZLB 4WEVX 2DQTL 3BGGA 1VFFA 1WJ3A 4ERSL 1MJ8L 5EF0A 1ZV9A 3HM7A 2DT2A 2FWOB 4APXA 4GG6B 2ATPB 4ZENA 3MV7D 3BWWA 2H0EA 5AW7B 2X40A 3N2MA 1KIQB 3RM4A 2AAAA 2YN3A 2BP0B 3VGAC 4OF6A 2JEPA 3FBKA 3KVPA 4OD3H 3OJMB 1WFNA 4PTVA 1M7UA 3N19B 3A4EA 4F9LA 1J1XL 4AV5A 4UTTC 4RNFA 3K0WA 1VYSX 2P88A 1GVFA 5I1JH 1G9MC 3GKAA 3BCDA 1F3DH 1YMHA 4WVRA 4ROPA 1JCXA 1UOLA 1EAOA 1MEWA 1I45A 2X1QA 5IROC 3L3OA 4WDIA 4AX3A 3P60A 4H5SA 5K1VA 3OKDA 2CLMA 1UQSB 1VZHA 4QTHA 4MBRA 1WA1X 3WDJA 4B5ZA 2P1FA 5JBFA 1L9TA 2DBJA 4JL2A 3MBED 1XPGA 1MI3A 1PD0A 1RH8A 3SO3C 4L3FA 5DO2D 4J3OH 4S1RH 4F93B 3BWZA 3NJ3A 4GX8A 4MCYB 5HHOE 2M83A 2V5JA 5MERB 3EEGA 3R89A 4GG8B 1COBA 4YNYA 5IFHL 1I2RA 4ZK8A 1GT8A 4MAYB 5FESA 4C60A 2UV3A 1RI8A 2EE3A 4JY5L 3RWEB 4FTVE 1LYQA 3UTSA 3D6NA 4PWJA 4BFOA 3FQWB 3MPCA 4KOBA 4UMGA 5BVPL 3O11A 4JFQA 2VL5B 1I0DA 2F58H 1QNOA 1QFOA 4A2HA 1UWYA 2JKXA 1Z6KA 1JGVH 1KTJA 3KPSE 4DCQA 1U21A 2OMZA 3ARGD 4UQ2A 2NYKA 3U48A 2IWKA 1N10A 2D0HA 3X3GL 3ZE0B 4QRRA 1U6AH 2FIQA 2Y25A 2XN9B 2FIKA 2EF9A 1WDDA 3P40A 3BT2L 5F70A 3UDWC 1G4TA 1DJXA 4BIKA 1VFSA 2ONEA 2DSWA 3P81A 1QW9A 3X1GA 1DIOA 4WEUD 1QWKA 3GC4A 4JZNA 4YTTA 2YEVB 5F8QC 1Z44A 1TZGH 1ONRA 1ZSHA 3DX7A 3TNMB 4LVHC 3U82B 3BZ5A 2ZCLH 4HC1H 1JNHA 3QY6A 2JQZA 3MV9B 3TCXA 3TXVA 2XX1A 1E0TA 3U2EA 1U91A 1M56B 3CVIH 3F6LA 1NCHA 1T0MA 2DT0A 4AW4A 1AXTL 3C2YA 2W9LA 5I3JA 4KERA 5HHNA 1I9IL 5F9DC 4Z2GA 3VXNB 1F41A 3MRKA 3FQRA 4GKZA 4XZMX 4IX2A 3V3WA 1UGKA 4ZJ9A 2NZIA 1GOIA 2Y0FA 3S2MA 4A2GA 4RAVB 3SGEH 4WQ6A 4GYPA 1FV1A 1EXUB 1XHHA 3HMXA 4M6MH 2BHYA 4M4PA 1TYJA 3RVWD 2PU1A 2MWCA 4W6WB 1K3UA 3GUGA 4HA4A 3RITA 1XSIA 1WWAX 4GO9A 4G8GA 4Z3IA 2IH8A 4ZX4A 3GZAA 5AVQB 2B4CL 5EO0B 3FV9A 4PJHB 4NZJA 1JE6A 3ITVA 5L9DH 4JR5A 4LCIL 2P49B 2BVQB 2P24A 1WC7A 3MV7B 4LAJH 5BQ7A 1UGNA 2XPZA 3KOXA 2G9HA 1U3JA 3O3BA 3KPOA 3EO9H 2YQBA 3QNXA 3U7YH 5KYXB 3QZAA 3QH3B 1N4XL 3M41A 5M03A 3IM1A 2QDGA 5INDB 1ZT4A 3MA9H 1JL8A 1NCJA 1WEJH 3AUWB 3QJRB 1N7ML 1PXGA 4IW4C 3WV0A 2CJ3A 5ENLA 5F7DA 3MA9L 4BF7A 2ZE3A 1FY6A 4UDTA 2VXSL 4GH7B 4L29B 1E4KC 3II1A 5D02A 2VLME 1L2QA 3SIMA 2R1YB 1MRFL 1CE6A 5TAOA 1ALDA 2E9WA 3WN5C 4QDMA 4X22A 3UU0A 5DK3A 4JN2B 3L5IA 5HI5D 4GUCA 1LWHA 4L4TD 3DIDA 2BMBA 4GO8A 4Z3HA 4PJ5E 2CU0A 2VC9A 1A7BA 2X4TA 3DG7A 3ZJAA 4ZPTA 3LB6C 4XBKA 2C6QA 3OVQA 2MOVA 3G5ZA 4X6DE 4XNZC 1PCKA 3W25A 5HR6A 4WJ5A 3MJ8B 5FJJA 3HC0B 1IAKB 2IAMD 1DBJH 2YARA 1XR9B 3J8F7 1R3VA 2V68A 1Q0YH 5I16B 1LE9B 4MZ2A 3FB6B 3U0PA 2O5ZH 4KO6A 4RGND 1TV2A 2YCEA 3C0QA 1XW8A 2YCJA 4GVIA 5BCAA 4DKFH 2O5NA 1H49A 3NGBB 3B8DA 1WFUA 4C47A 1ZJHA 5E9XA 1OX6A 3WIFB 4EJ1C 3PFRA 3CJPA 1OGTB 2CO3A 4FA6A 4YJ5A 2CA3A 1ADWA 2HWZL 1WGOA 2OAAA 1CICD 3W7CA 3HLKA 3ZE1E 3OVPA 1FSKB 5M94B 4MIMA 2W91A 5B7ZA 4QE4A 1EO7A 4LNCA 5BS0B 4J3UA 4QYOB 4WEMB 4IHCA 5F93C 1O5XA 1WUFA 4ORIA 3MLYL 4GKTA 2WINB 3PR2A 2G5WA 1PLAA 1UM6L 1YLVA 1ZENA 2K8QA 5IESL 3FXIC 5KSBE 4OKVA 4EUPG 1ML1A 5E00B 3SDXA 2YW4A 2QLVB 3IWVA 1DJHA 4NNYA 4ZGYA 2BCKB 4FG2A 4DUXA 3AT9A 1QBLH 2X2YA 3V8CA 3CV2A 1BQHA 1B0GB 4ZSTA 3OX8B 1MLCA 4S0SD 4ZDHA 5BUGA 5C92A 4U4MA 1DQIA 4LSUL 3O9WD 1RSYA 3LHPL 4RMWA 2XV0A 5DUBB 1RLDA 1J0JA 5AALA 2VDRH 3VM7A 2Z1XA 4V1XA 4BZ1L 3H9SB 1VRXA 3UJEA 3WMSA 4TRPL 1V0LA 3ESPA 1P7KB 5C7XH 2V17L 5JHDE 3NCOA 4S3KA 4J23A 1TNMA 2W9DL 5CD5D 3QQ1A 3Q8EA 5SWSE 2ADJB 2CLZA 3JWNG 3K4ZA 4D72A 2OMZB 4KHTL 4P04A 4AHQA 4L80A 3VXTB 1U42A 1KR1A 4QXTA 3KP1A 1T6WA 2PYEA 1NMAH 2VXQA 3CSTA 3EOOA 5FW8A 2A1WH 1JQVA 2ZC1A 3EOAA 2HQAA 3WJJA 3BPLC 5L8JB 3K2MC 3BLFA 3H4WA 1T83C 1PZ5A 3S5ZA 4JJ5A 1E4LA 4B2DD 4H83A 3EJYD 1XC6A 2OX1A 1AH4A 4TMPA 4CVXA 3C2FA 4G8IB 4X0VA 1SVCP 1IC7L 2YBUA 1M7IB 3IJIA 1JF5A 1J1XH 3BN9D 4JFOA 5DFVC 3Q06A 1EPFA 5ICXB 1FL3B 1V3JA 2QIWA 3S2LA 1QNIA 3VC6A 4MNGA 3FDWA 4OZIE 2FZMA 1LT8A 3V0UA 3AHVA 4Z0XB 2GLKA 1BEXA 1D5ZA 1FGVH 3Q0HA 3LKPA 5GS1A 4N6FA 5TQLA 5E0CA 2HFTA 1XLJA 3L4UA 4FLOA 4M48L 1ZK9A 1A14L 3C6EA 2ICEA 1MJ8H 1L3WA 4TNFA 4ZFZA 5ES4B 5HTSA 1TPEA 4ZQKB 2V7HB 1V7NL 2EEFA 5D72L 3AYTA 4U33A 2Z7ZA 3ECBA 5JR1L 1KIRB 2R1XA 4GGHA 3CHVA 5EBUA 4GHRA 5J57B 1UZ4A 3COOA 4BEUA 4HKZB 4TSAL 1RUPL 1MWAA 4MXVE 4AVJA 4B7LA 1EHXA 4A6YB 1JTPA 4AQ1A 3NJIA 2IH3A 1IXQA 2GYIA 2XSBA 3T05A 1KFJA 5TD4A 1S7RB 4O12A 1OF6A 4IFKB 3GHEL 4K94H 5AZUA 3CSYB 4BEIA 5JHBA 2G2NA 2PTZA 3SOBH 1ZTXL 4AQ8A 5JW4R 1M6JA 2QCFA 3OVRA 3KOYA 4HCGA 4QHRA 3HS9A 2GUBA 4N90D 3RZCD 2J79A 2BERA 5I78A 3Q37A 4IPJA 4GS7C 3FC8A 1QHQA 2GSHA 4IUOA 1JNNL 3EFFA 4OJCA 2I85A 1QFWH 1LDPL 4OLYH 4NPKA 2A3LA 4R2GC 1TZIB 2A4ZA 3EX1A 4BFBD 4AZGA 1CLXA 3FB5A 4GXVH 3O0KA 1DZ0A 4U6YB 1DVYA 5IW1A 1FZMB 3WH5A 4MA7L 2HFEA 3CN2A 5EOCJ 1I2PA 4K7YA 3QCVL 3T4CA 1YEJL 5HDBE 3ATZA 2JJSA 3GJFK 4YS1A 1ZEAL 4LFHD 1A6VL 3DUSB 3U6RA 4I7WA 5LNSA 1BAFL 1XD1A 3BN3B 5GIRA 3RWGA 4JR9H 2NW2A 4YE4H 3MC5A 1O6VA 3IACA 2A3TA 1EXHA 1OB1B 5E95B 2XFFA 4XCCH 1T8XA 2RHGA 1CB2A 1AMKA 1OCRB 3ZGHA 5I1DB 2HRPL 2B1AH 4YSEA 3UG3A 3D12B 1YEEL 5D7JA 3WF1A 1XLLA 2OTPA 4ML9A 1Q0XL 5D2TA 1TCMA 2YGPA 1LMKA 3BVUA 4ML4A 3OAUH 5GRYA 1YYAA 2D7TL 1FL5B 4DKAA 4HHMA 1TYGA 2VDML 3Q8CA 3CHEA 2VDQH 5G2HA 3MRFB 3LPFA 4JO5A 1LO2H 5I5RA 5FECB 4NZDA 4BA0A 1OOAA 4YDLB 5AVNA 3C2VA 5EBAA 3TAKA 1G9HA 5GNXA 5FGCE 4QR7A 1S5VA 3KYOB 2H8PB 2I5YL 4XNYL 5HA7A 2DQWA 3VNDA 4XAZA 3TQVA 1I9JH 1IGFH 3KPQA 4RX4A 3TEUA 4BFIA 1DUZA 3AWOA 3TNOA 1X7SA 3SDYL 1G7JB 1SMDA 4PLOB 2FH6A 4TULH 1FN4B 4ODSL 4OFPA 4C4KT 4KITB 4W6XB 2HTKD 4OGAD 2V7NB 2LU4A 1PFCA 5EU3A 4HETA