5EMYA

Human pancreatic alpha-amylase in complex with the mechanism based inactivator glucosyl epi-cyclophellitol
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Glucosyl epi-cyclophellitol allows mechanism-based inactivation and structural analysis of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5emyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5emyA01
1KQZA 5D8ZA 4D6FA 1ECEA 3MS8A 5F7UA 4DO5A 4QDMA 1K9TA 3SCPA 3MMWA 3AYRA 3PZMA 2XGIA 1BG4A 2XVLA 2JIWA 4HPHA 4PN2A 5JIPA 4LYRA 1UR8A 2GK1B 1J10A 1BYDA 2EQDA 2V3FA 3PZNA 2WMKA 5HBFA 4HTYA 4CN6A 1H11A 4AZGA 2X0YA 1V3LA 1PX3A 2EEXA 3WFLA 2YA0A 3CZJA 3UCQA 1WB0A 1TMQA 3N04A 3WUEA 1JNEA 1V3KA 2V3GA 2XVPA 3EDDA 2YL5A 1SMAA 5E0FA 1HVXA 3MSDA 2CERA 4Z2JA 2D20A 2X8RA 3PBGA 4GO8A 3MI6A 1LLOA 1RD6A 4XZBA 1JZ3A 5FD0A 4J7RA 2VX7A 3CZLA 3SCUA 3ZIZA 1Y7VA 1U30A 1E6NA 2XWEA 3IJ9A 5TD4A 3A3HA 1CPUA 1GUVA 4W86A 3WNPA 1CYGA 2CBIA 1QNOA 2VJXA 3AIRA 1VEMA 3AJ7A 1UQYA 3I3EA 1JXKA 1HX0A 4OOZA 2WMHA 1P6WA 4PCTA 4MNLA 3M6DA 3NIYA 1LJYA 1ISZA 1HP4A 7CGTA 5ECUA 1B3WA 3HG3A 1G01A 1V3MA 1HXKA 5CG0A 3VD4A 2J7CA 3AI0A 3GM8A 5E09A 4QLLA 2VURA 3AIVA 2WK2A 2W4XA 3CUHA 4DUXA 1HJSA 1C93A 1VENA 1C8XA 1HVQA 4E8CA 3AZTA 2CITA 2O9TA 3ZO9A 4P8UA 1M7XA 3ZJ6A 3L2MA 3CUJA 1W9XA 4W88A 2Y24A 1J9YA 2OWCA 4D6IA 4QCFA 3S5ZA 3T0DA 1H41A 2J78A 4CVWA 3NCOA 4TVDA 3K1DA 4AMCA 1RH9A 2VZUA 5CZKA 2W92A 1GHRA 1GOKA 4KGLA 2DIJA 1UA7A 1UKSA 3L4VA 3WBAA 4CN1A 1GOWA 1K9EA 1ZS2A 1TUXA 5IXEA 1J01A 6CGTA 1UKQA 4AZHA 1QOXA 1IV8A 1ZJBA 1TVPA 1BTCA 1JFHA 1W3HA 1JDCA 1GW1A 1V6VA 3UG4A 1DWHM 3FHQA 2CPUA 3DECA 4FNPA 3BH4A 2GDVA 4B9ZA 2PBOA 3VIGA 5ABHA 3CMJA 2WCAA 3QOKA 4GI8A 2WSKA 3PTQA 3ALFA 4XUYA 1WZMA 1LG2A 1J0HA 2WCGA 3AOFA 4CU7A 2UWFA 1RP9A 2VZVA 1B1YA 1OD8A 3RIKA 6TAAA 4AY1A 3PZGA 1V02E 1MXDA 2GJPA 4ZE4A 3RDKA 1E40A 2BHUA 1TQWA 5I0DA 2WM0A 1VFMA 4LX4A 1CXIA 4P7LA 2E8YA 4PTVA 3VVGA 4NRSA 5I2UA 1ZBCA 1C7TA 5AC5A 4W89A 1E70M 3WY1A 5CSYA 2W62A 1ODZA 4AIUA 4BZYA 4UQAA 3G6LA 4M80A 1TFVA 2OWXA 1H1NA 3APGA 3VPLA 2YDSA 5A2BA 1EXPA 3CUGA 4NZFA 2OW7A 3CBWA 3CZEA 1CGXA 3UR7A 1U2YA 5A69A 5A6AA 1ZJAA 4AZ5A 1H2JA 2J7BA 1OSEA 5A6BA 2Q8XA 4IPNB 2ZX9A 4HZ6A 4PBGA 1PBGA 2F18A 3GH7A 1E1EA 3WD4A 2VR5A 4U2YA 2X1IA 5A8OA 4RE2A 4YN5A 4GI9A 2YLAA 3ARYA 1VEPA 1XV8A 3KL0A 3ALGA 2WNWA 1C8YA 2J74A 2DPEA 3AIEA 1S46A 4MB3A 2VX6A 3CV5A 4LYQA 4F79A 4UFJA 3MSGA 3WL1A 1H3GA 2ZX8A 1OCQA 1FP9A 2DDXA 4FK9A 1BHGA 5FL1A 1WAWA 3T2OA 3ZMRA 2J7DA 4JFUA 3AROA 4UTFA 1PJ9A 2VRJA 1BVZA 4MNJA 1D2KA 3KZSA 4C7DA 3QHOA 5CLTA 1TZ7A 1NOFA 2ZUWA 4WKAA 4RE3A 1GVIA 1DWGM 2CHOA 3EDEA 4WJXA 1W9VA 4UFKA 1WDRA 6A3HA 3ZR6A 1XSJA 1GJUA 3ARPA 1GCYA 2EXOA 3EJRA 5CXPA 3RM8A 3AIUA 1JZ2A 4ZXOA 4PMYA 1B2YA 1BG9A 3AS2A 2EJ1A 2G3MA 2XTKA 1OBAA 1QNRA 3FN9A 3WY4A 2J75A 4PSPA 4WSKA 1B3ZA 1HJXA 1ZBWA 2GDUA 3U7VA 4J3SA 1J0IA 1XD0A 1KCLA 3PTMA 2D3LA 2BVYA 1OT1A 2XSAA 4H8UA 1XYZA 3W28A 3B8SA 3NYDA 1HJWA 4D72A 1UH3A 1ZBVA 1UWTA 4M56A 1WDPA 5I79A 2WZIA 1JGIA 1WZKA 4CD4A 4FLQA 2WVTA 4UQDA 2VNCA 1K9DA 2WHLA 1QWNA 1W1YA 1JDDA 3BUPA 2V5DA 4PYSA 3WH7A 1EH9A 4U31A 2UY3A 2WLZA 1CXLA 3VD9A 3WQVA 2Y4SA 2XWDA 1V0LA 2PWFA 4J3VA 3EBVA 4XZWA 3N11A 1KXTA 3VIHA 4AXNA 1VBUA 4AD2A 3BMWA 1UR4A 4JKKA 3NDZA 1ZB5A 1J0YA 1CNVA 3VO0A 2WMGA 3AICA 2ZIDA 3BAWA 3DHUA 3SCWA 5BXRA 2O9PA 2PWEA 3AHYA 3DX3A 4D6HA 4H04A 4ZXLA 5CGTA 4MJ4A 1UA3A 1VJZA 1OT2A 4YHGA 1MFVA 1B90A 1V0NA 3ARSA 4AZ6A 2E9MA 4QFUA 1BSIA 4B3LA 4C7FA 2XM1A 1W1VA 2PWGA 3CUFA 1XSIA 3B9DA 5ABEA 1FOBA 1GORA 3D52A 3VTRA 1JYWA 3WDRA 2ZUNA 2FH8A 2JALA 2PI6A 4KGJA 2WVSA 2BS9A 4V27A 3A23A 3DYPA 1UASA 2J79A 2J7EA 4QP0A 3L4TA 3A4AA 5CGMA 4UFHA 1J0ZA 4UCFA 1E1FA 3WDQA 2XG9A 4ZFMA 4V2XA 1WDQA 4Z2KA 3O9NA 3BVTA 1MW1A 2F61A 2CEQA 1KCKA 1UWUA 4Q22A 3FY1A 2DSZA 2FHFA 4OOUA 3VGHA 3A24A 3VMOA 3MU7A 4E4PA 5BWFA 3MKKA 3BCFA 3SCSA 4TOQA 4JCMA 4HA4A 1GHSA 1W1PA 1XD1A 3WNMA 1EA9C 3WEMA 5A8QA 4OZOA 1KFWA 3CZNA 4HOXA 1VRXA 4HU0A 4CCDA 2X2HA 1HKMA 1IT0A 1V08A 3VIJA 1QW8A 4GQQA 1O6IA 3T2PA 2G41A 1CGVA 4TX6A 2ALWA 2WPGA 2VO5A 3HMCA 3T0BA 1QX1A 3BVWA 1E9LA 3RILA 3A5VA 5HXMA 4PSRA 1EOMA 2FGZA 3FW6A 1TA3A 3W6LA 4AZCA 5BYWA 1E6ZA 3FXYA 5GNZA 3T08A 2GFTA 4JKMA 2FE0A 2V3DA 3UG5A 4CN4A 3HJEA 4JL2A 4XB3A 3KE0A 1PZ3A 3WENA 3VINA 1A47A 2JF7A 3KEHA 2WW5A 3GNPA 5C70A 3SUUA 3WFZA 2RGLA 2FYVA 3AIBA 2VQTA 2F7PA 4OJYA 4RL3A 3BLBA 1TG7A 4OBSA 4D6JA 1HKJA 4QCEA 4AD1A 1W3LA 4LPCA 1PIGA 2GJRA 3SIMA 1HTYA 1EHAA 4ZENA 3NUKA 3UEQA 3SUVA 4CVUA 3AHVA 2E4TA 2BXZA 1JI2A 3S2CA 3VM7A 4OBRA 1F4HA 3ZR5A 3W24A 3PTKA 3TA9A 2AAAA 5EMYA 1MW3A 4MDOA 1MQQA 5LA0A 2BFGA 3BAKA 1PS3A 4B16A 2XVGA 1EDTA 3ZJ8A 4YHEA 3UR8A 4BA0A 1B30A 1QNPA 5BXSA 5A6SA 1JZ6A 3J7HA 5HPOA 3WF4A 1ITXA 3OIHA 4PUDA 1EQCA 1V6XA 2WC4A 3IJ7A 3GTNA 1QHPA 2X2YA 3WH9A 4WKHA 3GNRA 2VX4A 3QHMA 2VL4A 2EPMX 3EMQA 3CC1A 5JBFA 1WZAA 5A8PA 2PWHA 1EQPA 2E9BA 2XN0A 3WY2A 3WH8A 7A3HA 2PBGA 3GZAA 3K4DA 4AYSA 1HKIA 3AMCA 4H41A 4JFWA 1MFUA 4PMVA 4AEEA 5GQBA 3WD0A 3L4XA 5AC4A 5D9OA 3AZRA 1SYTA 3MO4A 2X2JA 2OSYA 4U5IA 1HP5A 3OGRA 3QGVA 4W8BA 1E56A 5A6BD 1M53A 4AW7A 4D6EA 2VZOA 3HG2A 3DYOA 3N18A 1UZ1A 7TAAA 3RO8A 2FHBA 1TR1A 3VIPA 3WNOA 4J3XA 1UR2A 1V3JA 4JIEA 1XH2A 3RM9A 1LL4A 2X05A 4DM2A 1IZKA 1DTUA 3VSVA 1EHNA 3CHCA 1HNYA 3IJ8A 4PMDA 1SZNA 2D2OA 1WCGA 1TE1A 2X0HA 4BF7A 3A4WA 3AYSA 1CENA 1BQCA 3W37A 4Q7NA 2F7QA 2VRKA 3NDYA 2NSXA 1Q6DA 5M5DA 5I6SA 1ZU8A 4CU6A 3FAXA 4AZBA 2X09A 1WKYA 1XC6A 1DWIM 1DHKA 4MNMA 1JZ5A 4M8UA 3WF1A 4UQBA 3GXDA 4DO6A 1VB9A 5BXPA 4J3WA 1V6UA 2WXDM 2XIIA 1DWFM 2G3JA 2V3EA 1XGZA 4AMXA 4W84A 4GINA 4PTMA 2UY5A 1N82A 4WLCA 1FHLA 3ARWA 4YPJA 3AMKA 1WDSA 4IUGA 4FNSA 1K6AA 3LXAA 1V6WA 4BQ5A 4D6DA 1W1TA 3LPGA 1M01A 1E6XM 1BGGA 4NXSA 1UD3A 1BGAA 1JNDA 3OBAA 1QNQA 1UWQA 3FNDA 3ARXA 5CSUA 2QPSA 4X9YA 2D1ZA 4JHOA 3BSHA 1H5VA 3LPPA 3W38A 3DC0A 4NRRA 2ZUUA 4S3JA 5CPQA 3UERA 2G3IA 2OLHA 2WBGA 3GXNA 3CZKA 1C7SA 2OSXA 4AZ7A 3ZT5A 4HZ8A 3SEPA 5A6KA 1FA2A 1E6RA 1CGUA 3MUZ1 2WB5A 2ZUMA 5A8NA 3DX0A 2EACA 3GXTA 1LL6A 4PMOA 1QI0A 4AD5A 3UETA 3EJQA 3T09A 2DT1A 1EO7A 1UKPA 1DEDA 3D4ZA 3IGUA 2XM2A 3D3AA 3KLLA 1I75A 4MNKA 1SR0A 2YBUA 4PMRA 3WMCA 1CXHA 1TA3B 4AZCB 2E8ZA 2CXGA 2WMFA 4BQ3A 3VD7A 1ISYA 4MB1A 1UWRA 5HPCA 2EADA 4UQ9A 1GOMA 1U33A 2V5CA 4C7GA 2DIEA 4D71A 4MDPA 3F5LA 3RMEA 1VEOA 1V0KA 4AYGA 1H0IA 5M3WA 3H55A 1B31A 5A95A 4UFLA 1DP0A 2BY1A 3WQ6A 2J25A 3DHPA 1X6LA 2AMGA 3WEZA 2NT1A 4OGZA 4HOWA 5JBDA 1CECA 1OIMA 2CKRA 2A3BA 2WSPA 1I1WA 4M29A 1JIBA 4FNTA 3WD1A 1NWRA 4XV0A 1KGUA 2E9LA 3N1AA 2JE8A 2B31A 3VSTA 2YFOA 5DFAA 3WQWA 1D7FA 2ZUVA 3BVXA 3GDBA 4HU8A 3WIJA 4JZ5A 1TVNA 1CLXA 4UZSA 3CUIA 2O92A 3LRMA 1E5NA 4FLRA 3ARVA 1B3XA 4AIEA 1UG6A 3H53A 4UQCA 4A3HA 1XCWA 3W4RA 1EDGA 5EFFA 2ZX6A 2V38A 1C3FA 2YBTA 3M46A 4CKQA 4HOZA 1QI3A 2XYLA 4TTUA 1QVBA 3A4XA 4GZJA 1KB3A 2IUZA 3TOPA 1HXJA 2W91A 4DUWA 2WVVA 5E70A 4MAZA 3SUWA 3D50A 2VZTA 2YLLA 1CXEA 2VVNA 1E71M 3AXHA 3VGDA 1JYXA 1RPKA 3EJPA 2VT0A 1UHVA 4WF7A 5A8MA 3BAXA 1GQLA 3CPUA 3PZQA 3D5HA 1ITCA 1JAKA 1YHTA 3OGVA 1BFNA 3A6OA 3BUQA 1E3ZA 1OB0A 1R47A 1HJVA 2J7GA 2QV4A 2OSWA 2ZICA 2A3HA 4WK9A 5E0CA 3OLEA 2PC8A 3D51A 4UOZA 3CH9A 4H8HA 3CGTA 2YL6A 4ACZA 4Z2GA 5AY7A 2J62A 4FNRA 3VNZA 1UR0A 1ZBKA 2EPLX 3GH5A 3ZT7A 5D9NA 3ARZA 4H8VA 3MUIA 3NSXA 2F1BA 2DSKA 1W32A 2JF6A 3WKZA 1X6NA 1WNOA 1CLVA 1QBAA 1FFRA 4EANA 5BROA 2FHCA 3CLWA 3VDBA 3DX2A 2UY2A 4HA3A 1T0OA 5FIPA 4BS0A 3AMGA 1E6SM 1GOIA 2IGTA 4U3AA 2Z1SA 3ARTA 5I5RA 1R8LA 3VUPA 4E8DA 5LA1A 1WP6A 2XFRA 1KR1A 4CD8A 4UOQA 3BLKA 2YDQA 3HG5A 2A3AA 2QLYA 4EKJA 1LWJA 2WHJA 4FF5A 1V03A 1ISVA 3HZ3A 4GI6A 4GZEA 3VX1A 2FH6A 1B3VA 1V3HA 2C8NA 1X1NA 4D6CA 2J8FA 2NT0A 5IHRA 3WDPP 1G5AA 1E6QM 1BVNP 2VR4A 4ATDA 1W9PA 2ZX7A 3BLPX 3MMUA 3AHXA 2W5FA 3CHDA 3U7BA 4ZEPA 3HN3A 3WMBA 3VNYA 4B9YA 2BY3A 1EDQA 3WF3A 1TQUA 2XUCA 1NP0A 3SCRA 2D0GA 4D1JA 3L4UA 3CZGA 1OINA 2ZX5A 4EK7A 3SUSA 1KXVA 1AQ0A 3TTOA 1PX8A 3EJSA 1JZ4A 1VF8A 2F2HA 5DF0A 4B15A 1PIFA 1OWQA 5ABGA 4JFSA 4BQ4A 1O7DC 4DWSC 3RJXA 2Y8KA 3SCOA 2CETA 5DMYA 3OZPA 2QPUA 3B9EA 4CD5A 3GBEA 4J28A 2D23A 1O7AA 4W8AA 4JAWA 2BXYA 2GUYA 2ESCA 2J8GA 2YDRA 5LYRA 4A3YA 3WUFA 4IISA 8CGTA 3K8LA 1UZ4A 1PPIA 2QMKA 4QLJA 3QR3A 4R5EA 3K8KA 4MAVA 3N12A 3EDJA 1NM9A 2J77A 1TQVA 2ZXQA 3RJYA 3ZSTA 3N15A 1WO2A 3VX0A 1DWAM 1Q6EA 5E6YA 5HDRA 1HKKA 1NP2A 1GPFA 1HIZA 3WF0A 1UR9A 2WZHA 3AXXA 5C71A 4DM1A 1L0PA 1JXJA 3BAYA 1BYAA 5I24A 1BYBA 4W93A 4KRUA 3WD2A 3UG3A 1G0CA 4DO4A 3L4YA 1JDAA 2ZWZA 1UWIA 3ARRA 5JUVA 1HJQA 1AMYA 5D9MA 3N9KA 3CMGA 4Z2LA 2EAEA 1QWUA 3EDFA 3N13A 3BVVA 4GIAA 1CWYA 1E6PA 1M04A 3M07A 4QLKA 4HMDA 4FNQA 2DSWA 4FLSA 4AIOA 2HISA 1UD6A 4W5ZA 3AISA 1JFXA 4FMVA 2QF8A 3VOCA 2AOSA 1PEZA 3BUBA 2PWDA 3G6MA 2DH2A 4L4OA 4J27A 2WC7A 1MXGA 4M81A 2VCAA 1LWHA 2WANA 3AXIA 3EYPA 1JL8A 1QHOA 5BCAA 1QHZA 2E0PA 4AZIA 3W53A 2A3EA 4PUEA 3TTYA 2D0HA 3CO4A 1G1YA 4AD4A 4WKFA 1JF5A 4GKLA 1AVAA 2CCRA 3NSNA 3PZVA 2GJXB 2JEQA 4MADA 3PZIA 3K8MA 1JG9A 5A2AA 1CZ1A 1PAMA 3ZM8A 2YOCA 4UZUA 3W6MA 4W7UA 1TQSA 3DYMA 1R85A 1Q6GA 4LGXA 4F8XA 1GONA 2WWCA 2Y8VA 2WWDA 1D3CA 1B0IA 1KXHA 4M82A 3VGBA 1UWSA 1VFUA 4PMXA 1OD0A 3L2LA 2WKLA 1G94A 1J11A 5BXTA 3GYCA 5A3HA 1UYQA 3DX4A 2WVVB 2E40A 3WQ4A 2ZE0A 1AQHA 3L4ZA 3AMDA 3THDA 1UD4A 3I3DA 3VIKA 1QW9A 2XVKA 4LXFA 2VI0A 3VGEA 5IFTA 1V02A 2BVTA 3EJTA 3TONA 3WN6A 3KL3A 1E4MM 1R7AA 8A3HA 3II1A 4U2ZA 3OGSA 3CZSA 3JUGA 2MANA 3GBDA 1JF6A 3LRKA 3RPMA 4CD7A 2OWWA 4Z2IA 1E73M 5KZ6A 3VMNA 2WZEA 1PX4A 2EPNA 1VIWA 3OLIA 4U5KA 3WNKA 2QHAA 1SFSA 1VBRA 1CTNA 2XN2A 4ACZB 2WC3A 2Y5EA 4DWSA 2D3NA 1VFOA 4TXEA 2YL8A 2ZUSA 3OLDA 3AS1A 5FCZA 3THCA 4NZCA 1KBBA 4W8LA 3E1F1 5ABFB 3POHA 3AFBA 1GZJA 4FLOA 4A4AA 2D22A 1CGWA 2C0HA 3AQUA 2VQUA 2WYSA 3GXMA 1Q4NX 1KR0A 1E43A 2DSUA 1H0GA 3F5JA 3MUAA 1EIBA 1H4PA 2VVSA 1CGTA 3NJ3A 1W91A 3B9AA 3MANA 2G8ZA 4S3KA 3IANA 1TCMA 1R34A 4NI3A 1OGSA 3WMSA 1UD2A 4W5UA 3RM4A 3SUTA 3BXWA 3MUY1 2BY2A 2NW0A 1NWTA 5I23A 3WELA 3BSGA 5AYBA 5FL0A 3KL5A 2YIHA 2F7RA 1XSKA 1HT6A 5M03A 1MWOA 1L8NA 2FGLA 4P8XA 5A6MA 1CEOA 4HP5A 3EMCA 2W67A 4CCCA 3WNNA 2PF0A 2BV9A 3W81A 2WAGA 4WSJA 1R46A 1ISXA 3PZOA 2WHMA 5E9AA 9CGTA 3O6AA 4P7OA 3W0KA 2A3CA 3EMZA 1HN1A 3W26A 1XH1A 3VDAA 3OLGA 1UD8A 3LMYA 4K68A 3WNLA 3IAPA 3TV8A 2VTFA 4UFIA 4J3UA 2WHKA 1I1XA 4PTXA 3ZT6A 2WMIB 3SCTA 4CGTA 1ZL1A 3ZQ9A 2DEPA 4D1IA 5CLWA 5IHSA 1E4LA 4PMZA 4X0NA 2D0FA 1OGBA 1CDGA 2VUYA 4MTVA 4UR9A 4BCEA 2BHZA 5D8WA 4MB4A 2YJQA 3SCVA 2F8QA 3U5YA 3CTTA 2W63A 4N0RA 5A6LA 1CIUA 2WCSA 4GPNA 4CD6A 3BMVA 2YKKA 3W29A 1E5JA 3PZTA 1GQJA 5GPRA 1GOOA 3H54A 1JZ7A 2UY4A 1MQRA 2D24A 2IXVA 1W2PA 4PTWA 2FDMA 3WQ8A 2DGAA 2CIPA 3NSMA 4J3TA 1RP8A 1V3IA 2JEPA 3OB8A 3KLKA 3BUDA 1NOUA 4OIFA 5GNXA 4IM4A 4NZJA 4HZ7A 5EBAA 2ZXBA 3W27A 2IXUA 4MJ2A 1FH8A 4JKLA 2ZUTA 3ZJKA 3DX1A 3WY3A 3K4AA 3KWXA 1FH7A 3WF2A 3AIQA 4CUCA 5E1QA 2XFYA 1LF1A 2O9OA 1KTCA 3IAQA 1KWGA 5I77A 3WL0A 4JL1A 1G9HA 1SMDA 1XRVA 4JCLA 4OKDA 1KWKA 1LG1A 3HU7A 3WQ5A 5A1AA 1GNXA 2D73A 4P7QA 1GJWA 3FAWA 1KQYA 3MMDA 4OUEA 3F5KA 4AWEA 1HL9A 1XCXA 2EPKX 5LA2A 1BLIA 3T2QA 2CYGA 1BF2A 1FH9A 3VU2A 4LQ1A 1B9ZA 1H09A 2WBKA 2DT0A 5CPSA 3HG4A 4NX0A 3VDCA 4E2OA 4H7VA 1E0XA 4UNIA 1UUQA 4NSBA 1J0KA 1WE5A 1ESWA 2HVMA 3VILA 3WUBA 2DT3A 3F4VA 3DDGA 2CKSA 4KMQA 4DUVA 3TTSA 1OIFA 2J7HA 1Q6FA 3OZOA 1JD7A 4KH2A 1NWSA 2GJXA 1MVYA 5IDIA 1CGYA 1JYNA 1GOQA 5A6JA 5BRQA 4M1RA 4TVCA 1JAEA 1TQTA 2F1AA 5JIWA 5GNYA 1J18A 4XX6A 2WLYA 2YA2A 2GVYA 1EOKA 3MV11 3T0AA 4D6GA 3TTQA 3VD3A 3LXCA 1W9DM 2CBUA 3PHAA 3VSUA 2YFNA 1CBGA 3TP4A 4RE4A 5D4YA 2DT2A 3LX9A 3ZSSA 1MQPA 1XH0A 4ML4A 2RGMA 4URIA 3AIWA 1JI1A 1F4AA 4CCEA 1KGXA 1UOKA 2QMJA 1H49A 3VGFA 2Y2WA 3PZ9A 4AD3A 1K9FA 2VRQA 3SCNA 2TAAA 5BRPA 3BGAA 4EAMA 2W66A 2CHNA 4PRWA 1W3KA 5EB8A 2VX5A 2VZSA 1W2VA 2JFEX 1VJSA 1E15A 2XVNA 1HL8A 3BAIA 3AS3A 5IFPA 3GXFA 1XYFA 3GXIA 1KBKA 1C92A 3OG2A 1UKTA 4DWSB 3OA5A 3PZUA 1FP8A 4HPGA 2XJ7A 1C90A 3GH4A 4X0VA 1HWWA 3VDHA 2GK1A 4GZIA 2JIEA 4JFTA 2VCBA 3WUGA 3POCA 1UD5A 1JZ8A 1Z32X 2XHYA 5ABFA 2W61A 2WVUA 3VIFA 1NH6A 4GQRA 5D9PA 1E72M 3CHEA 2OW6A 4TUFA 1BYCA 1IZJA 3UESA 3GXPA 1BPLB 1UH2A 2YL9A 4P7RA 1JD9A 1E0VA 1HF6A 4U3CA 2VMFA 2CBJA 4W7WA 1QBBA 4IPLA 1QI4A 4BQ2A 2YA1A 4PMUA 2J7FA 3VMPA 3IK2A 3A21A 4GO9A 1MW0A 3WDHA 4ZE5A 1FFQA 2VOTA 1J0JA 1E4IA 2XSBA 3VKKA 1NARA 1GQKA 3ARQA 1ODUA 2EO7A 2X2IA 4HMCA 5A94A 1W9BM 1QI2A 3GNOA 3W82A 3L4WA 4PEEA 1JYVA 5DO8A 2XFFA 5KEZA 2ZXAA 2Z1KA 2EPOA 1KGWA 2C7FA 3ECQA 3BAJA 1B3YA 1CXFA 1UR1A 2GSJA 1UH4A 4CU8A 1R33A 1NOWA 4L4PA 1UKOA 2VCCA 1NQ6A 4UFMA 1FHDA 3AHZA 2DH3A 4HMEA 2E3ZA 1E3XA 1VAHA 5FOOA 2ZWYA 2BHYA 1WZLA 2OYMA 3AMLA 3ZOAA 1CXKA 1UQZA 4R27A 2BY0A 2CNCA 3S5YA 4NXKA 4AISA 3A47A 2WMIA 5EFDA 1OGGA 4DWSD 1US3A 3WH6A 4TX8A 1V0MA 1GQIA 4ATLA 5DT7A 2PB1A 5AYIA 1A3HA 2EBNA 3ZJ7A 4F9DA 2WMJA 4QAWA 1R7OA 3CZ8A 4MPKA 3QHNA 4KRTA 2G4FA 3VGGA 1VFFA 4FNUA 4V28A 1QNSA 2BVDA 1MW2A 1R86A 1J12A 3VD5A 2ZXDA 3VM5A 4PCSA 1E4NA 4W85A 4P7NA 5HNNA 4P8VA 1QI5A 4F66A 3AHTA 5FKYA 3U57A 2XPKA 4ATWA 2XIBA 1M03A 3LRLA 4Y7EA 4AMWA 1YQ2A 4TVUA 2DSVA 3SCQA 3WSUA 3WH5A 3DDFA 3BCDA 3S6TA 2CESA 5CPTA 3BVUA 3SURA 5CJ5A 4U33A 1HJUA 1W3JA 1LL7A 5JBEA 3LXBA 4JFVA 1BAGA 1WPCA 5M17A 1W9UA 1EGZA 3WEOA 1GVYA 3O2LA 3AS0A 4EE9A 4AC1X 1NWUA 4P8WA 3A22A 1US2A 5HOSA 3WD3A 2O9RA 2DQXA 4M24A 1LQ0A 3PN8A 3N17A 3MV01 1C8QA 4B3KA 4LYPA 2EABA 1OM0A 1XHGA 5I3DA 5DT5A 3VIOA 3ARUA 4PMQA 5C8BB 3WDIA 4Z2HA 4N42A 2ZOXA 1MYRA 1R75A 3FHAA 3I3BA 1KTBA 4TTGA 4AEFA 3EJUA 1R87A 1ISWA 4WIWA 2OYKA 3EDKA 1C91A 5E6ZA 4JHZA 3BUIA 2F7OA 4GXPA 1PZ2A 4KWUA 4AD0A 4ACYA 3QOMA 4UOJA 3K46A 2J47A 1E0WA 3W25A 4HA1A 3U5UA 5CQ1A 4F9JA 1DWJM 1Q6CA 5DEZA 4W87A 2BNJA 1AQMA 1V6YA 1E55A 3VIMA 2WKGA 4NF7A 2CBVA 1EO5A 2J4GA 1QPKA 3BC9A 2XN1A 3RCNA 1KXQA 3M7SA 2OYLA 5A2CA 2VC9A 3D4YA 2G3NA 4MB5A 4UQEA 4PMNA 5I78A 2XGBA 3WBEA 3LPOA 3VIIA 3CHFA 4H2CA 3WDJA 3LPFA 3CIVA 3AZSA 4W7VA
chains in the Genus database with same CATH superfamily
2YK1L 3F7VB 4AGPA 4DNLA 2QKIC 3MS8A 4QDMA 2CK0H 2EIEA 1XYBA 3O0LA 2XGIA 3MLXL 3ERPA 3TJLA 3MBED 1VHPA 4LYRA 2GK1B 4WEBL 4YSUA 2ZA2A 1F8IA 2WMKA 1LCOA 4YDMA 2F54B 5J9PB 4F7KA 1MRAA 4PLKD 3FTGB 3R8BB 2PP9A 1TMQA 5T1KD 3N04A 3QWRD 1C5CH 2EDTA 2JIXA 2PDPA 4AG4H 4F8PA 2QDVA 4FA6A 2PDYA 3MRHB 4XBGB 2Q3OA 3SSZA 4J39A 3ZIZA 5BOOA 1XCQB 5BW6A 4Z3EA 1QNOA 1SFDA 3E5BA 3HMWH 1HX0A 1EEQA 4I5BB 1OVZA 3NABH 4GSQA 3TJXA 3GIQA 1B3WA 2R9HD 4CNNA 2UZPA 2VURA 5JW5B 4J1UB 3CUHA 3PJNA 4LB8A 4TVPH 4Q8TA 4LSQH 5GRUL 3VB9A 4ALAC 4HGKC 4D6IA 1QLEL 4ZOBA 2UZYB 1GTFA 1RH9A 3SN4A 2Z29A 1GOKA 4JTRA 1JGUH 3K0WA 5BQDA 1S3RA 4IIGA 3W9EB 4DN4L 1HSBB 5IXEA 1A3RH 4L8SA 1U6AH 2E46A 2OJ1A 2JKPA 2B77A 1PS9A 2RIKA 2WO3B 4I8DA 2X4OA 4LCWD 4DI9A 3E6FB 2NW2A 4BWUA 2BINA 3JWNE 1E1CA 2AZUA 3QT2A 2WIIB 1WCBB 1J0HA 1NIBA 4ACTA 5L6UA 5HTSA 1P4UA 4XXWA 4E0CA 5HI5D 3WS3A 4I77L 4FX5A 1KJ3H 4U3XA 5F44A 2BVQA 4GKZA 5TBOA 4PRPB 3PHQB 4PGEA 4AYMC 4GSDH 4K3JL 4PY7B 4K8RH 5HQLA 2IPGA 3L1FA 3CBRA 3KVMA 1ZJAA 3UTOA 1ENUA 2AXGB 4LUIA 4M6PA 1RALA 3FUDA 3BFOA 1FZMB 4QJ5B 4KKCC 3DROA 5AC6A 4GBXA 3NIDF 4K36A 5F2LA 3A6BL 1W0WA 3WD4A 2J8UE 4OLZL 3ASNB 4MZ8A 2W88A 3A9IA 3H9HA 5HMFA 4HUVB 4LYQA 1NCIA 1DO5A 3LCWA 2H45A 2CZVA 3K6DA 1PJ9A 4HWEL 1N4XH 5K9XA 3QHOA 4RE3A 1DWGM 4ZZ9A 3ZWTA 3B1TA 4GWEA 4H7ZA 4LDOB 6A3HA 5I1GL 1U58B 1DXEA 2EXOA 1BOGB 3C2RA 3D85A 1E28A 1YPIA 2HFGH 2A1WH 3ESOA 2J75A 1M7OA 4ZW7A 4UTMA 1HJXA 4J3SA 4IK7A 1RLDA 2BC4B 2PO6B 2HNHA 5BRZB 1LMIA 2R1KA 3HE6B 6ALDA 4JRXD 4KZDL 5L4FA 5BJTA 2P5WD 3REVB 4HNCA 3IU4H 4M56A 4KJWC 1S9YA 4B3EA 3KRBA 3KS0J 1E9OB 4V1YA 4OWGA 4GEIA 2CDEB 1DN2A 3HPLA 5TE4H 1CIDA 5LQBH 5B1CA 3MXVL 1P0EA 4WFFD 2I07B 2EH8L 2Y4SA 5B7FA 1AHMA 3QFJD 2PP7A 3N34A 3KNBB 4GMSL 2FDSA 2ZRXA 4JNXA 1AGDB 1QLFA 1RIVL 1ZB5A 4MD0B 3LHYA 4B9IA 4D6HA 5DMIL 4LGSB 1S7SB 4L1SA 4P2OB 2DQ6A 1T21B 2HH0L 4QEGA 3BFQG 2ARJQ 2F53A 2ZUNA 3SE3A 2AHIA 3A23A 5KETA 4DELA 1T7XA 2VDKH 5I8KL 3OVUB 1E1FA 4NI8A 3FOMB 2LW3A 3KBVA 2CLVA 4M5SA 4ZUWA 1NIFA 4QX4A 1I8LC 2CA3A 3A24A 3STFA 2DV6A 2KERA 3MU7A 4J3OF 1F3DJ 1GSKA 3ANVA 4Q7BA 1YEFL 3H7VA 1HKMA 1MI5E 3A0OA 4GQQA 1YN7B 2G41A 2WPGA 4QS6A 4ENLA 2FK9A 1QX1A 3A5VA 5C86A 2VC6A 2E6DA 4IOTA 1PYMA 1KTLB 3UG5A 4M7ZC 3R8QA 1U8OB 3FUJA 5J1AA 4HFUL 3O6CA 5BOEA 4UINL 3T4CA 3NESA 3MGOA 4U1GB 2AXFA 2G9KA 4L8CA 1SQ7A 4RMBA 4MDRA 5JLZB 4JRXA 4OIBA 2P5WA 5I1HH 2PTXA 5G2NA 3VXQA 2EG7A 3TBBA 3SUVA 1NGPL 5G4WA 2Q7YA 4JGUA 3W7OA 4UTAL 1F4HA 2QS8A 4E41B 4XVSL 1RZJH 3QFJA 3ATZA 3MRNB 4IRSB 3GEFA 1AO7B 1BVLA 2VN3A 3NCFB 1HL4A 3DO7B 2AF2A 2XIJA 1R5IB 1QO5A 2OZNA 3MCLH 5IHZB 2OQYA 2HRPL 1V6XA 2WC4A 1UCBL 4XP1L 4JQIL 1JHLL 2EPMX 1L6SA 3WLIA 2A6LA 3ZUNC 3CC1A 1AG6A 4ZQPA 2ZC1A 3QQ9C 5D2NB 4JYFA 5GZOC 1HH6A 1OW0C 4IT1A 5D5MB 3VXOA 4KRPB 1EA0A 3PDGA 1G7QB 1XINA 2OSYA 3DJZA 1XGRA 1YN6B 4LSPL 5I0YA 1WITA 3P9LB 4QRSB 5RUBA 2J6EL 1SEQL 1XLAA 4FX6M 5FB8A 5FM4A 2FHBA 3LVTA 3BW3A 1YC7A 3NZ8A 3STGA 4FJ6A 4G59C 4ZOAA 5FUOH 3FQRA 4ONHA 1ZGLA 1B4RA 1CE6A 2FUQA 2Z1WA 3TCLB 2V81A 1JV5A 5FAGA 1X5KA 3NDYA 4NP7A 5LAXA 1J8HB 4PODA 2FQFA 2DFAA 2HLEB 4MHHG 3U9UB 3GHTA 4PTNA 2ALAA 5J3HD 3FIGA 1T1XB 4L9XA 4X3ZA 2FLIA 1CD8A 4G1MA 1L6FA 2R2EB 5GGUA 1V6UA 4B92A 1NMBL 5BZDB 2CZFA 5DK0A 1FYTD 1KFJA 2K78A 3V5DA 2UY5A 3NFUA 4ONGH 1E5BA 1ZHLA 4ZQKB 3GTIA 4D6DA 1W8OA 2Y89A 3V0AC 1ADDA 5E08L 4O0QA 4PRIB 4JHOA 1R5WA 2GBTA 3LCXA 1S5HA 2O61A 4Q8WA 4CLMA 4HS3B 3BT2L 3I9PA 3AXLB 32C2A 3U1QA 4J6RH 4K94L 1AXSA 1TIWA 2KZKA 4UTWA 4AGQA 2P52A 3GHPA 4WFHD 1VGKB 4GYPC 3UPRB 2ZJSL 5KVFL 1UC6A 4HLEA 3CFEB 4CNIB 1V51A 1TA3B 5FGCB 3MRQA 3L9EA 2E5CA 4MDPA 2BNRE 1FNGA 4BFNA 2AMGA 1PJWA 2VABA 2AEWA 4Y5VA 3ZO0A 2QQKL 2J66A 4Q6XA 4G3YH 4LSVL 5E4EC 5D2LE 3L9BA 5C09D 4M93B 2W80C 1TPFA 1W56A 2Z7YA 3RLGA 4EBQH 2GSIA 4Y9EA 3VSTA 1BQHB 3WLWC 1PZ0A 4UB0L 3LRMA 4OB5L 4BK5C 1XCWA 5F2MA 2VISB 4A2RA 4X6CF 3C0JA 1SM9A 5FHBL 4HN4A 4YVPA 2JKEA 2WVVA 2APFA 1PQZA 2BO0A 1KV3A 2XQ0A 2A7BA 2I17A 4CQ8A 3EKCA 1PCSA 4KK6D 1EP3A 4PCPA 5KVGH 5EO0A 1NANH 3S3GA 4LCCB 4BF9A 4OVUA 4E9TA 4BH8B 4S3AA 5CZXC 1GY1A 1N7ML 1G7HA 3D51A 2PDIA 4LL9A 4YC2B 4Z2GA 1UR0A 3WQDA 3GH5A 4KKBD 5B7YA 2NY3D 4X98B 2F1BA 1FFRA 3M8OL 4E5XB 1TYRA 5BROA 3LNDA 3QQ3A 4GXMA 4LNVA 1GOIA 3ARTA 2F9RA 2XACC 3PV6B 4YE4H 4K3ZA 1JEZA 3QIUC 1GL4B 2L7UA 4DVRH 4AWSA 1LWJA 1G9ML 3F2LA 4GI6A 4UTJA 3IJHA 2D8KA 2F8XC 1WC7B 4D6CA 3P3TA 2NY0B 3NQCA 1V6TA 1CE1H 1JE6A 4MA1B 3IGSA 2NQ9A 4IBVA 2E7LC 2HVKB 3LDBC 4G11A 2FIKB 5MHSD 3CVHH 4JGMA 4MKTA 2WUCH 1P5VA 4QF1A 4W8AA 1I8KA 3W11C 2XJLA 4LU5H 1BSLA 2DY3A 2X7LB 2O6EA 5D1QB 2YD1A 2OEKA 4C6JA 3N15A 5K3VA 4W68A 1L8PA 4K9EC 1SLXA 5E6YA 3N85L 4WWKC 2WZHA 4EX4A 4O58H 1L6XA 5FOJA 1G0CA 3HJ0A 5CMAB 1R3JB 4JRFA 4DY1A 2G2NA 4H1LG 3P2DA 3LQZB 2EDKA 3C0SA 1QOKA 1M04A 2FX9L 1HJBC 4HMDA 2FIRT 4X8JB 1EFXD 5I0VA 1UVQA 1XCFA 4ZNCD 3NXLA 1AUSL 1E0TA 3SADA 3HOGA 2DH2A 4J27A 4KV5E 1MWAL 3AXIA 3FOLA 5A2LH 4RWYL 1GW6A 1FKWA 1QHZA 5E0QA 3W53A 3HPSA 4LHUA 3AUOA 4AXWA 4WKFA 5H4ZA 5DZAA 3UY8A 1RAKA 1ASPA 3JR2A 3BT0A 3FB7B 2VYOA 3KGSA 3WEXB 2NV9A 1R85A 2ZONA 5CLXA 2A77H 4KAQL 4I0PA 3QNZB 2Q8BH 1UWAA 2E77A 4F9LA 3CXFA 3G5ZB 2TRSA 1RJCA 1ZGLP 3O3AB 1U8LB 4KK9C 3H23A 4AE0A 1S7TA 2VI0A 4DPQA 2Z2UA 2NWRA 2G95A 4IEFA 3D34A 2VDQL 2PCPB 3FH7A 4M1BA 4HFWB 4N90E 1TV2A 1FFOA 5CCZA 4V15A 3THML 3MV7E 1GOFA 4Z3FA 2BZNA 1Q3NA 3QCTH 2XH7A 3THCA 2NXYB 1TWSA 1OEPA 4Z0BH 4OJEH 4PRTA 5L88H 3FH8A 4FLOA 2FLRT 1D5BB 4NQCB 2CMRL 4HVXA 4O17A 2DQMA 2QDGA 3RVWD 1THAA 4JKPH 3EYVA 2Y2YA 3EZ8A 4LLQA 5E6IA 2J8UA 4JN1H 2O1AA 5EU6E 1AGFB 5D9SB 3E2VA 3GW3A 2CIIB 2P28B 4IDJL 3EJZC 1QR4A 1JNLH 1EFXA 3PR2A 5HA7A 4F33A 1PVNA 2WINA 4FCAA 2BV9A 3DOIA 4A2LA 4DCQA 2WAGA 4MJZA 4WSJA 2BX7A 2NY5H 1MI5D 3Q7JA 3KLSA 4BGLA 3ZTCC 2XTSA 3UJRA 3SE6A 4JVUA 3MXWH 3TX4A 5J56B 4JO5A 5DFWH 3LN9A 3OAYK 1KLUA 3MHUA 1FL5A 4X4XB 1NAKL 1RK0B 1NQKA 1CGSH 1CLCA 3CTTA 4FFWC 4CD6A 1TIUA 4Z7VE 4Y1TA 1H5BA 1GOOA 4FFTA 4YDJB 3B0UX 1D9KD 2JEPA 1SO3A 2YPVA 4WHTA 5ECGA 2ENQA 2E27L 5GNXA 3V4VL 2EH7L 3ARBA 1WBJA 1W0MA 1ZSXA 1I8IA 1LEGB 2WP3O 1QEWB 4JPKH 3WF2A 4BSJA 3L45A 1LF1A 4R0LC 2P4AB 4P3DA 1EHXA 1T1ZA 5CBEB 3CQFA 1XLDA 1LG1A 2AK4E 1OLLA 3UYPB 4M48H 2PDXA 3GS7A 4JO8A 2ADIA 5IGXL 3WUBA 1WE5A 1TOXA 4PCYA 5E0KA 3F58H 3C4UA 2UY7B 4QEEA 4RGMB 4W9KC 5LXGH 1K4CB 1L9NA 1T6BX 5GNYA 1AKJD 5GISL 1J18A 3L48A 2AKZA 5DMGD 5HHVH 3LG3A 1NBYA 1CO1A 1I4FB 3NJGA 3VFNB 4NN6B 3FQ2A 2XX1A 2DT2A 4WY0A 2VKZG 3GK0A 4Q58C 3O9WB 4C59B 4E0RA 1IM3D 2I85A 1UWEH 4XCFH 4I3RL 4RAUB 1NBCA 3C8KA 3G6JE 1I1AB 1AXIB 1KBKA 4KROB 2R56H 5FJUA 3TBVA 1VGEL 3VI4E 3UYOD 2L04A 1YYAA 3IIXA 2PW1B 1PHQA 3RDTC 4DN1A 3C2AL 1BJMA 5ACZB 4IUOA 4GJ1A 5T1MA 3K2UL 1T2QL 1QACA 1HOCA 3I6EA 1UIOA 2O7QA 2DQGL 3EYQC 4YU1A 2LLGA 4YL4A 5CFHA 5JPNA 3W2JA 3X11A 1Z3NA 4PLJD 3JV0A 2BIOA 4DGVL 4QSHA 2D03H 5D5MF 3F05A 2WJFA 3P9MB 5LNUA 4PEEA 5H2BB 4MZIA 4X4YB 3MHFA 1L0XA 3ECQA 1R33A 4IKJA 1CT5A 2QUTA 1IEBA 8FABA 4DGUA 3OAUH 1E3XA 2YAQA 1FIGL 4KEMA 5AKQA 3MJ8B 3S5YA 1SXNA 5E00B 3OGCB 5FJPA 5ISZB 3VXGA 2XFXA 1QFHA 2VAAB 4L5FE 2F7FA 5CHNB 4HNLA 3V7MA 1FL3A 2WOQA 2ZXDA 5F4WA 4GY1A 3D9AL 4LLYA 3GZQA 2VSKB 4WKZA 1A49A 2XIBA 4R90L 5SX4I 2HVOA 3Q2WA 4IQHA 1TJ0A 1QK2A 5CJ5A 5CIPB 2OMWA 1IM3A 4XHQA 1VERA 5IBXA 1RIHL 5IOPA 4P2QB 2Q86B 1OJXA 1NWUA 1X5IA 1M1XA 1ZIAA 4I1NB 2VGBA 3WLNA 1NSNL 3S9ZA 1SO6A 3N17A 1KELL 2DM2A 3ISRA 5I3DA 4GX9A 1MAML 1QPXA 2R83A 4WUUA 5GGSA 1FZOB 3FB5B 1CL7L 5GS0H 4Q4RA 4WIWA 4K3GA 1VPQA 4OI7A 4JHZA 5E6ZA 3HNVL 2NY2B 5L6YH 1FX6A 5E8DH 2NZ1A 1JBJA 4Q6KA 4NP9A 2ZYHA 5B38G 4FS9A 3W23A 5DEZA 4WHCA 4MKVA 2IXQA 2IBZX 4M9PA 3X13B 4WOZA 2AL2A 3GMPB 3M45A 3M44A 1E67A 3M7SA 3MPGA 5DO2C 3ZY7A 3L1EA 5IF0B 1OANA 1O60A 3BSZA 3DGDA 4X99A 4HNTA 4K71B 2ZQ0A 2VEMA 3NN8A 4JCWA 3H2QA 4OFKA 3MR9A 1LL1A 4KKXA 4PIRF 3E0WA 3ILQC 2BNRA 3RY6C 3PC0A 4ZFZA 2V9RA 5J6GA 4RGNE 4PJ5B 2X0YA 3DIFA 1U8IB 3IACA 3WFLA 3N2BA 5HI4C 1J5OL 5D2LA 2DTSA 4IBQA 4A39A 2EUXA 3OSKA 4BCZA 5IVZA 3MI6A 5TQLA 4LRSA 4MCZA 3KYOB 1GGTA 4E42A 4N24A 4A66A 3AIRA 4Y16D 1ICTA 2BODX 2WMHA 1KCBA 2Q9OA 2LAAA 4G8FB 2QCFA 2OZ3A 2YDAA 1NFDA 5HYSB 2HXTA 2P44B 2CA4A 1RQHA 4PG2A 3EZ4A 4IG2B 3KCPA 4G1EB 3L54A 1XO8A 3VD1A 4Y4HA 5C0CB 4LFYA 4Z7QF 3US9A 2X1XR 4YHPB 5F7YC 5D1ZA 1GZQA 4MZ3A 4QXGL 1FL6A 3H4FA 3H6JA 2HN7B 2FD6H 5FGRA 4Q9QL 4ZPVB 1A4AA 3E6EA 1J01A 5FUZL 5L4JA 3DPBA 5BQ7B 5FYLE 1L9MA 1XLCA 2CBPA 4P61A 3DV6A 4AYDC 4PJ7B 3T0TA 2NY4B 3FQTA 4Y4KB 3WUWG 1ECZA 1P9MA 3PXLA 2JKLA 3RNKB 1KTRL 2PBOA 1YCSA 4APQA 1M7PA 4FZ8H 3C0QA 4J9JA 1UPPA 3E96A 1BGXH 2QVIA 5F1IA 3QJFA 1OB1B 2OMVA 4XT1C 4NQSA 4GQ9L 3SHSA 4LGPB 2BS71 4JTHA 5F1VA 2BOLA 4TSAL 5CZJA 3FKKA 2W62A 1S5MA 3U48A 2QSQA 4JR5A 2FAUA 3B3IA 4JZJC 3APGA 2C1PB 4INFA 4RMWA 5LNSA 2PDJA 5A69A 5A6AA 1ACYH 4PL1A 4RLDA 1QSFB 3AM8C 3QZWG 4BSVA 1AZUA 4QLRA 2ASHA 3P5ZA 1DQXA 2DQUH 5HMEA 3GH7A 3WE6A 4WTQA 3F7RA 5AKTA 3NCYS 5HHXH 1T03L 4Y16A 3W3OA 1EZWA 4FK9A 1MVUA 3TEXA 1IFHL 3S1XA 1JNNH 1AXTL 3WQCA 4C4KO 3CNKA 3WLOA 1GVIA 4ZB5A 3VCCA 3CAVA 4FTDA 1XIFA 1DCLA 5I8OL 5C0EA 3IIOA 1JPKA 3F04A 3O7UA 4JDZA 5CXPA 3RWCA 3RM8A 2CHDA 1TJRA 1D5IH 4O4VA 5HWJA 1B2YA 1Y6KR 7XIMA 2KS0A 3N1MC 1DQDH 2F5BL 1B3ZA 3N42B 4NZRL 1XD0A 2ICCA 2JI2A 3B05A 2JIXB 1A3WA 1HHJA 3P3BA 3TJHD 1K4HA 1XYZA 5FJRA 3L7EA 4LT7A 2F6UA 1EJFA 2JKXA 2X70A 3PBUA 3O41A 3UDWA 3F01A 5HMSA 3UNTA 3EB4A 3SFKA 5FEXA 4AD2A 4N87A 1DOSA 1UR4A 3UBXA 2WNZA 4F7CA 4LOUC 4BFBD 3MLPA 1QTYT 2L0DA 3VO0A 3IVKA 1FDYA 2I16A 2TMDA 5BS0B 1WD8A 3TV3L 3UAJA 3OA3A 3ZHKA 3QUYA 4AZ6A 1YNKL 2AK4D 2DAVA 4L9LB 1XIIA 3QSKB 3MV7A 3CUFA 4C6DA 4YFLF 2Y5QA 1KPRB 3M6YA 2JALA 4RNIA 3FMGL 7ODCA 2J79A 3T7VA 3FUEA 1T7LA 3C87A 2BK8A 2X4OB 2NW2B 2AXWA 1ZTXE 4Q22A 4ZW3A 1E1CB 1DLFH 1SXZA 2FHFA 2EIDA 5EU6A 3S1UA 2QCGA 1X1OA 3NJFA 5DVNA 5EOCJ 2YR1A 4PAZA 1MREL 3WO8A 3FQ1A 4FN0A 3ZHDA 4FG4A 3IIZA 3CZFB 1CDIA 1IT0A 2BVQB 3UJFA 4NYUA 4GKZB 3BX7C 3TSDA 2VO5A 4XPAH 1ERNA 4C4BA 3GVWA 4PGEB 2H0EA 2YXFA 3OR6B 4WUKL 1JS4A 3TNNB 3HFML 1OGTB 3DROB 3LGDA 1LLZA 4GBXB 1US0A 2XXMB 4O4YH 5AOUA 1HKJA 1G87A 1F18A 4ZENA 3UEQA 4Z7VA 4N0UE 5EZLB 4HDIA 5M7QA 1QAWA 2Y06H 1M56B 3B04A 5TH2B 2PLKA 1GC1C 3FJTA 1DO6A 2AAAA 5EMYA 3A3XA 3ZPDA 1PS3A 1O5RA 2OU4A 1VZGA 4Z3JA 4DBEA 1D3GA 2DLIA 1HWHB 3IF1B 2IAMA 4OGAC 5E6RB 3QGAC 1B3JA 2V82A 3MCMA 3GTNA 5CSGA 4FG2A 3D85B 1E28B 4B5EA 3GMMB 3THAA 3U7WL 3F7JA 4B5VA 1C12A 3V79C 5CC6A 3CDCA 2PWHA 4Y4FC 5DTFA 4FX7A 2CO2A 1VACA 5FDWA 5BJTB 3U0PA 5IWLA 1LBMA 1S9YB 1FG2A 4DF1A 3SGEI 3W7EA 5LWYL 3U83A 3HPLB 3PRZA 1PY0A 5DJDA 3WKMH 2GZXA 3VWJD 5B7MA 4JIEA 3X1EA 1EHNA 2RAGA 4YCPA 3MMEB 4JTUA 3X14A 3NYKA 3ZVHA 3WNJA 1VYSX 4BF5A 1AG0A 1QLFB 2QLVB 3QV8A 3HO8A 4RXGA 3E74A 4XX1G 3VG0H 3DHDA 1KN4H 4M1CD 5JPMC 5A2JH 1WKYA 3F7YB 1H60A 3IDIA 4MNMA 1TJ1A 1PE1A 2JGYA 3URAA 1NFIA 4J3WA 3DVFA 2EXTA 1DWFM 3G6JA 5EU9A 3PGCA 3VQMA 3BWZA 2F53B 4QGYA 1EP1A 1FHLA 4FNSA 1UACH 2WBXA 3VI4A 3CMOH 1V6WA 3H9YA 4JG1L 1DJQA 3OBAA 4JEGB 3GJFK 4GC3A 2D1ZA 2QGBA 3N9RA 4P4KD 4ZUWB 3DC0A 4K55A 3SD5A 3QEQE 3GRWA 2ABAA 1I3VA 3UERA 1P53A 5D2TA 1LXMA 4H8PA 4IIDA 4NUJA 5J8LA 3S6DA 4I7WA 3LNGA 4WFFE 2GGEA 5KVDE 3G3DA 5XINA 4JBSA 3BW4A 4QJ1A 3EEGA 3O07A 4UNVA 4S1DD 3B5HA 4LKXA 4JPVH 1ZJHA 3ROOA 5LBSL 1DYZA 3C6LC 4KO7A 4FFYA 1LWIA 4FXLA 4FHKA 3CXDL 4YDKL 4WNSA 3SECA 3ZWSA 3VFTA 1FO0L 5J1AB 1O7DE 1V0KA 4DP7X 3Q45A 5M3WA 3MGOB 3KLQA 1AOZA 1DP0A 3GHBH 2AXFB 4L8CB 3LS5L 3ZW3A 3MDWA 4MJ6A 3MLUH 4W9HC 2WXMA 3VXQB 5F3HB 4RGND 4XPHL 4PWEA 4EQ3A 4FERA 3MJ6A 2Q7YB 2OL3A 4LVHB 1RA5A 3QVAA 3VOFA 5IHUH 3CUIA 4AIBA 5T5NF 1BVLB 4NJGA 2RBLA 2X1QA 2WZAA 1CZ8L 5F9WB 4L0ZA 1NC4D 3L3JA 1A5UA 5AW0B 4YSEA 1D2PA 1A4LA 3B9NA 3BPOC 1S6NA 3VVVA 3A6CL 2YBGA 4WW2B 5I1DA 5I5MA 2FT6A 5EMKA 3QEZA 1HH6B 1P0BA 3VXOB 1N18A 4HSQA 3A6OA 3OWEA 1X39A 1YLVA 2J7GA 3P0WA 3NTCH 1XGRB 3EBIA 3SGDI 3VNZA 4P4KA 3R11A 5FB8B 5HPMB 4E9SA 3NZ8B 3BKMH 5D7HA 3FQRB 2VFHA 4ONHB 3B40A 4QDGA 4AITA 1JV5B 2Z1SA 3H0TA 1KM2A 3BLKA 5LAXB 3NFSH 4EKJA 3Q4DA 1U3YA 4CJ1A 2G97A 3H42L 1DSFL 2NT0A 3NL5A 3ARGC 2ZPKH 1J8RA 4O12A 3BLPX 5C6PB 3HB3D 3CHDA 3LBCA 4ZBCA 1A80A 5AUMA 4G1MB 3LNEA 1DQJA 5GGUB 2AFNA 3CIWA 5DYOA 4JTQA 4CC0A 2BZCA 3NIGE 3V5DB 1VLWA 1OSPH 4YE0A 2Y8KA 5D7EA 3R58A 1ZHLB 3SCOA 2V5BA 5AC8A 7ENLA 3ZTNH 4CILA 2XA8L 1ID2A 4RX4D 4HJWA 1QPRA 1ZIBA 2D23A 4F3FA 1MHPH 5GZND 4QYOA 2ESCA 1P4IL 1X7SA 1R5WB 2NY7L 4RDWA 4GNVA 5LYRA 1S5HB 1HESA 3K8LA 3CAWA 4IIBA 3BG9A 2VMCA 4AF0A 1YNYA 5CGQA 4UT6H 43C9A 1CYWA 1I9JH 3S6CA 1O6VA 1M1BA 4X9IA 4ONOA 5EYWA 1K7FA 3L5JA 4D0BB 1AXSB 4IL2A 3ATEA 3FSZA 1RLBA 5DZLA 2YR3A 5JUVA 5F21B 4UMBA 9XIAA 3EYUL 3BVVA 4Y2OB 2ALDA 4GFXA 2X42A 4QRTB 3U2ZA 4JTJA 2GCYA 1T4KB 4EXPX 4AGMA 3MRQB 4OQTL 4Z3IA 1P6AB 3FONA 3NEOA 2YD5A 3RHWF 2OOGA 1NTHA 4JG9A 1FNGB 1KJ2A 1FYTE 4DQOH 4BUQA 1RUPH 5TK2A 2VABB 4OD1L 2J4WH 4TQEH 1ILSA 3EYPA 1Q9LA 4OCLC 4ADSA 1G4PA 1AMKA 1ZHBB 3Q2CA 4LP8A 3Q06A 3WFDL 4KX7A 3QYCA 4DKDC 4PI0A 3BP7A 4HT1H 5ALCH 4IRJD 1YUHA 5DRNA 3PUDA 4DEUA 1MCDA 4OT7A 1TQSA 5DFVC 3M0XA 2OJZL 4H44C 3A13A 1KFAL 2XTJC 4XNXH 4IYKA 1VFUA 4PMXA 1OAKL 2AQPA 1G94A 3HG1D 1L5GB 3ZXAC 2WVVB 4WFHE 4FFZL 1PQZB 4PW3A 3M17A 3W1XA 2C18A 4JG0H 5C6WH 3APCA 4FG6D 4ZS6C 1DJXA 3EPNA 4XO3A 3TONA 2VE6A 3R4RA 1JULA 1A5OC 5EO0B 4OZIE 3N55A 4H0IA 2EPNA 1JTPA 4YEFA 3OLIA 2E5DA 3NRQA 1G7HB 3QJOA 1VBJA 4RE0A 5E56A 3DWTA 5B4MC 1O5QA 2CRMA 1MG2C 3APTA 3BWAA 5C09E 1RU9H 4O50A 4H9XA 1JRBA 2R4SH 3U4AA 3IBEA 1Q4NX 1E43A 2YN5A 1VFHA 3S8WA 1P4LA 1S2EA 4FL4C 3QXVA 3WGUB 5HI3D 3IJHB 1O5XA 1F5ZA 4KFMA 3QMTA 2I1OA 3LTPA 2QQNL 2O93L 5M03A 1FWGC 1I2PA 3VXSD 3V4UL 5DJ8A 2IPKA 4K23H 4WO0A 3QUKB 5E2WL 3TF4A 3WNNA 1PVHA 3W81A 4DBWA 1XZ0A 4UV7L 3OLGA 2D2GA 4ZMAT 3WNLA 3WXVH 4P2YA 4QF1B 3U1SL 5CCJA 3VC6A 1OCOB 5JXED 3MBWA 1V79A 2B81A 1M6OA 4D8ZA 2BHZA 4O9HH 3SCVA 1T0NA 4QDWA 1SBSL 4GPNA 4A6YA 3FK4A 3SW6A 4YIQA 1JZ7A 4UUJA 4ZFGH 4DPBX 3ULVL 4G43A 2F7IA 1I3GH 1WRFA 3X3FH 4P9HL 1HGWA 1QMUA 4MNGE 1NOUA 3T4AA 2A7PA 1U21A 4M7JL 4GX8A 1AODA 4KK5C 1G6VK 1UVQB 3W7KA 2CZEA 3EH2A 3QJTB 1TETH 2X16A 2XFYA 1KTCA 2OQJA 4XCNB 2EILB 4Z8FL 43CAA 3FOLB 5MHSE 3MBEA 4ALDA 4LHUB 3W22A 1F58L 4MFEA 3QZPA 3HBZA 4AXWB 3UXAA 4D8OA 1E0XA 2HVMA 4B0MB 2XU9A 4Q9CA 5T1KA 3QWRA 2EDXA 1YRRA 4Y2WA 4M1RA 2F1AA 1I9IH 3MNVA 1ZSDA 3PP3H 4AK2A 4I0PB 4N0YH 3PHSA 2I9UA 3H3PH 4I85A 4NZ8A 1NCAH 1UENA 4EXKA 4F24A 1S7TB 1ET8A 3HR5A 2Z2BA 3L12A 3AIWA 4ZQRA 4IEFB 3HVDA 3FTWA 3TJEL 2VZSA 1FFOB 1V27A 5AVHA 2DWSA 5IFPA 1TUFA 4ZFOA 5BVPL 1X4YA 1JGMA 5HDOA 3EOAA 2MCAA 3QA3B 3WXWH 1DIDA 4H1LA 1JTTA 4JFYA 1NDGA 3TLLA 4HWBH 3EYVB 4LLQB 3T6XA 4EI5D 3QV6A 5E6IB 2J8UB 4N0UA 4EPDC 3DETD 5LDUA 4GCXA 3DCPA 4S1RH 3LZOA 4G6KH 1E0VA 2X0VA 3HKFA 4LALA 3QEQD 1QBBA 4LCWA 4Q4IA 2YA1A 2R4RL 4PMUA 1DBAL 4MQXC 3A12A 2XSBA 4Y5YC 3CWOX 4F33B 3E9AA 2WINB 5C9RA 1SJAA 4BXVA 2BOFX 4J12A 5KEZA 2ZXAA 2PP1A 1V93A 3CFMA 5EUOE 2HG5A 3O4LD 2B4CL 1UKOA 1NQ6A 2DH3A 3BARA 4N22A 2AXHA 2BHYA 1IC5L 1FL5B 4GAAA 5AW8B 3R8RA 5EFDA 4F37F 1GQIA 4X42A 4ATLA 2Q8ZA 3T04D 4QY8A 1M68A 2UZXA 3OHXC 4ZNEE 1IBGH 3VGGA 4IBSA 1QO2A 4KKPA 3FFDA 4KXCA 3KM1A 4Z0XA 2GSEA 2YD6A 1TNMA 4P8VA 1QI5A 2ZNWA 4AQEA 2AEQL 3ARBB 3LHAA 1A8ZA 4XMTA 3G08B 3HFFA 3GWJA 4NPKA 5JBEA 4PP1D 1NGQH 1T1ZB 2YC1A 1I3RB 3TEVA 1UP0A 1HNFA 4YHLL 3MSPA 5DI8A 4LB3A 2Y1ZA 3KAAA 4PJBB 2ADIB 3L5XH 3SKNA 1IGML 2RALA 4K5PA 4AEIH 4PS8A 3LLDA 5DT5A 2B7NA 3ZN6A 2HNEA 5DVPA 3PPFA 4F0LA 3I6RA 4E2BA 3L5HA 5FF4A 4GXPA 3NGFA 2B5IC 2E7MA 4UOJA 3K46A 5GRZA 2J47A 5BOPA 1E0WA 3KP0A 2ZKMX 5KYUA 1NBYB 4YSRA 2AJUH 5ACLA 2E7DA 4FP8L 2WKGA 4XPFH 3VIMA 1DQTA 3AREC 1A9BB 3UZQA 4LY4A 4WY0B 3Q2NA 2AEIT 2X87A 4E0RB 4ZG1A 4UQEA 3ILPA 4OZ4A 1CU4H 1BJ1J 3UJIH 3C8KB 3AZSA 1M7UA 2OB3A 1BWMA 5D8ZA 3V0WL 3ULSA 3TBVB 2W9EL 3PZMA 1BG4A 2JIWA 2Z8SA 4I4WB 4YJ5A 4CEUC 3FX4A 1ZWIA 1KCVH 5FA3A 4F1ZA 3SQRA 5T1MB 2YA0A 2W3ZA 3CZJA 4FYSA 1AJZA 3RWHA 1HOCB 4XVOA 2P47B 2CU0A 3KM8A 3ISIX 2BWDA 2YL5A 4FPSA 5F7DB 2X5PA 3PE9A 5JPNB 1XDMA 4J5NA 4H2HA 4WW2F 5IRPA 3GBMH 4E68A 3T77A 2PDKA 3BO9A 4M7KL 1JXKA 4M0XA 2YYUA 4KZ0A 1YO4A 2CRIA 5LNRA 2VXTL 1X7IA 1IEBB 8FABB 2MIZA 1HXKA 1JPTH 4LSTH 4JFZL 1YNLL 2NLYA 1CD1A 1L6PA 2V5LA 1X6UA 3PXHA 4JICA 4IMLB 4GW1A 2XFXB 2QSVA 2VZUA 4LGRB 2W92A 4YWGL 3F65A 1TPC1 4NNAA 1FL3B 3BK0A 3WBAA 1E65A 3O6LH 1ML1A 1ZS2A 3M0LA 4XX1E 1XX1A 1HKLL 3IDXH 4WKZB 1KO0A 1MCJA 1OC7A 3RL2A 5LGXA 1V6VA 1NLDL 1DWHM 2EHHA 3LEVH 3OAWA 3C60D 3SSJA 4X83A 2OMWB 4GI8A 4XZMX 4HULB 2JJWA 4MZ1A 3ECWA 5IOPB 3PZGA 1M1XB 4LPXA 4LX4A 1G7PA 5CFAA 3MACL 1ZY9A 4KQ3H 4JJOA 4MLSA 3KCLA 5I2UA 2QTVA 5T9BG 5GGVY 3UR2A 3P0YL 3R2GA 2WP3T 3F2DA 4WUUB 5GGSB 2OWXA 3BRGC 3BQUB 1MN4A 4OKVA 3BOLA 4OCYH 3CBWA 1F3DH 4ANVA 1TFPA 2YCKX 4MHBA 5F7FA 5CCHE 1KEML 2GAZA 2DLTA 4GLEA 2OI9C 4X9BA 1CB4A 4YQXL 5HYFA 2DD8L 2IXQB 3PBVA 1RIUL 1XV8A 3KVLA 2AL2B 1OAJA 3MSGA 3UGEA 4MNJA 3M0VA 4X99B 2HEJA 3GTVA 4OFQA 1BF6A 3NN8B 1ZPUA 3E8UL 2X4QA 4G42B 3OKYA 3MR9B 4L9ZA 2BNRB 3GIVA 1XSJA 4Z18A 4ZFZB 1OCWH 5J6GB 3WYZA 3A64A 1FYTA 1SR9A 4MBRA 5D2LB 4G7QB 1E2ZA 1O1HA 3M1BA 4R4FH 3DX7B 3LXUX 5IVZB 4OGYH 4XVJH 4YHOH 5C9KA 1LBFA 4LBEA 4GIEA 4PJGE 4E42B 1B2WH 1FSKB 3C60A 1KNOA 1NAL1 1JDDA 4JHBA 4NZ5A 4YHMH 3FCGA 2H6RA 2BSSA 1YXYA 4IGSA 1NFDB 4OIIL 1J4EA 1KBGL 2VC2L 4TRPL 3B2MA 4FKEA 3H4XA 2E67A 2AS5M 4OQ1A 3KCPB 1KZQA 2PWEA 4Y4HB 1G4MA 2UV8G 5D1ZB 1GZQB 5B38A 4NM4L 1F41A 2YAPA 3VG9C 1BSIA 1AD0A 5KSUA 2EDBA 2NV1A 1CS6A 3VTRA 3RFZC 4NO3A 3DPBB 3V6FA 5BU9A 2Y88A 5C09A 3DV6B 4WJKB 3HHSB 5ALBL 5F0PB 5CIPH 4JIHA 3FQTB 1SU5A 2XG9A 1BQLL 1QMLA 4DEFA 3KRUA 4ERGA 4WGWB 4R5XA 2FWLB 4QSFA 1B4TA 3SPIA 4APQB 3SOBH 4MJID 5BWFA 1PAZA 3GU9A 1IKFL 3WFCH 3SO7A 3C8DA 4JCMA 4MMXC 1RURH 2P50A 1HFBA 1A3LL 5F1IB 3QJFB 2OMVB 4W6YB 4NQSB 4RV8A 2ZXGA 1OM9A 3OZ9H 1BD0A 3ZUCA 1E9PA 3V6ZA 4ZCWA 3L2NA 1SW7A 1JGEA 1E9LA 4HZLA 3B3IB 2HPOA 3NCCB 2YMTA 5PTDA 2ZYSA 4WUIA 4BSVB 1SJHA 2F5AL 5EORH 4OY9A 3PYCA 2BMBA 1J1XL 4JN2A 2WO5A 4OJYA 3B7YA 3WE6B 3FO0H 5FACA 3NUKA 1JI2A 4R97C 2XWCA 5E4OA 2X0WA 1EZVY 2VN4A 4DZIA 4MNGA 5FO8B 2X2GA 4YHEA 1XYCA 1MRFH 5CUSH 1EAPA 4N2OA 4K7PY 5F0JB 3HI5L 3BE1H 1MJ7H 1AZNA 5IR1A 5C0EB 4JDZB 3E7JA 3KPOA 2VDGA 5C9ZA 3EMQA 3IJQA 5HSFA 5JBFA 1RUAL 5TJWK 1K03A 4M5YL 4KCTA 4JO4H 3WNIA 2BJMH 3WUWA 3RB5A 3TH3T 3RKDD 3ZL2A 1HKIA 2XV2A 2ITCA 4HUUA 1HP5A 2W1NA 3T44A 3L7EB 1M53A 2QIWA 3TXZA 4ZDHA 2B08A 2X70B 3WFBH 3O41B 4W9JC 4ABUA 3IPBA 2IV9A 3NZSA 3BDXA 1LL4A 1DTUA 5K59E 1F4YL 2NW3B 3RRAA 4C6QA 3LSCA 4LEOA 3A4WA 2G3XA 1TZ8A 3PNRB 1IEWA 2IDUA 3UBXB 4F7CB 1Q66A 1NEZG 1ZP3A 3U2SA 3IVKB 2J5LB 4GUFA 1TJHH 3QZWA 4I2XE 2JKIS 2B59A 3M5XA 4KOBA 4N0CC 4HS8H 1VB9A 3SDXE 2P45B 5JQ6L 3ESPA 2J8UF 3GKZA 3QUYB 2WXDM 2MPAL 1HDMA 3P2TA 5CCKH 1UGKA 1GRWA 4XVDA 3DUHA 3MV7B 5G1MA 5E95B 1H6UA 5AHLA 5EA0H 4NRYA 5CBBA 4RNJA 4NXSA 3U2IA 3ARXA 1YPXA 3PNZA 4XO7A 4X9YA 3AG1B 1W17A 1R0AH 5IBLC 3W38A 3H24A 5TE7H 3DMMC 5IM7A 1CICB 2UX6A 3AC0A 3NPSB 4G70B 3VOJA 3ELAT 5EU6B 1SDYA 2NLJB 2NSMA 4KDWA 3NQ7A 2DZBA 4MNQB 1SVBA 1KTJA 3J27A 5AOMA 4AD5A 2PKDA 3QUML 4G7FA 2IAND 3K4WA 1WICA 2X1WL 3ZL4L 4MNKA 1SR0A 4WJG3 4XD3A 2KZWA 1SFTA 1DVQA 5EUOA 3LK6A 3MLSH 3AUJA 3MJGX 3FQUA 5HYEA 1NFGA 1S5WA 1H9DA 4UBDC 3GFXA 3PM6A 1RUKL 5ABAA 3QCUH 5C2BH 1DV7A 2RH0A 3NEVA 4LQFH 5JBDA 1JGDA 5TDNA 2WSPA 2LTQC 4Z7VB 4M29A 4DAGH 4OCNC 5TQ2H 2WZ0A 4GT7A 1A7PL 4XWGL 1NC2D 4ZD3H 4ZNEA 4IQEA 4JQVA 3QVQA 1TO5A 3BWWA 1KM0A 4Q9RL 5FYKU 1NPUA 1CLXA 5IQ9A 1B3XA 4PJBF 4XK2A 2WAHA 2IAMB 1X44A 4QXUL 5DHXB 4EN3D 4AUYA 3IPWA 3QQNA 3BZFA 1I8UA 4FXKA 1E71M 3OJMB 3AXHA 1LZOA 1MI5A 4OT1L 1HHKA 3CPUA 3D7PA 1U3ZA 5DN1A 3CHRA 1VACB 4V1DE 2ED9A 4P99A 5FDWB 1EJTC 1OB0A 4JPQA 5F6HI 4OUUA 2NY1C 3U0PB 4XKMA 3HRZA 4C4KT 3CH9A 3C8NA 1FG2B 2YRZA 5E51A 5I1CL 2HLFD 3R4DA 5KN5B 2HT2D 4XNUH 1MFAL 5IY5B 3DFNA 2VH5H 2BMKA 4LVDA 1AD1A 1FWWA 4ROPA 1QPQA 4K5NA 1CYXA 2V5KA 1D9KA 5HVHB 4JO3H 4LOCA 3C08H 3ZKMD 2IPUK 3DFOA 1G5AA 2ADJB 5I73C 3P4NA 1SZRA 3IDIB 3MMUA 2JJSA 3C09B 5KANI 5C9WA 3N1GC 4GRWB 3VXUD 5I6PA 3G5VA 4ZTXA 1VF8A 3QUGA 1XF4B 1MEIA 4B15A 4JTIA 5ABGA 4NY2A 4U7SA 3VI4B 4YOKA 3LZPA 2CETA 1KTKE 2QPUA 5IB4A 1MY5A 4WSHA 4HQQL 2ILLA 5B8CA 1NC2A 1S3HA 1KYAA 4AB4A 2H0PA 4NUJB 5IZ7A 1AKJA 3M0YA 4G7VH 2GSMB 3U0WH 1GPFA 4JDVA 1IFGA 4UTBA 1H8SA 1P6BA 3L08A 4RZKA 3DLQR 3ALXA 5D7SL 1I82A 4F20A 1Z9MA 4LKXB 3VFOA 5E23A 2XINA 4FXGC 2YQGA 1E6PA 4Q6IC 1BP3B 4XSLA 3EO0A 4KTDL 4K7VA 1UD6A 3V0VA 2K45A 3CUPA 3CN3A 1NJ9A 1MUMA 4MJ6B 3Q2LA 2XBDA 3LAFA 2IDSA 1B3IA 1NGWA 1KBLA 5DRXA 4AVKA 3BP6A 1TB3A 2CCRA 2OL3B 4ZI8A 2WCPA 2ISWA 4YDLC 5D7JD 1X5MA 1IBDA 3EX2A 2YCEA 1KLYA 3EG9A 3VGAB 4ALAL 3W6MA 4ZS7H 4XN2A 4O53A 1UYWH 4GW5B 1PKYA 3ROLA 2KL6A 3L3JB 3PQYD 4LVOB 4LH8A 3KPLA 1U0QA 1JVNA 1UB5A 4O57A 2XC8A 5EBUA 4YMPA 2OT1A 3WN6A 4HPYH 3GPSA 5AVNA 3OGSA 4OTXH 3RPMA 4Z2IA 1F73A 2I5GA 1U8HA 2J6XA 5J57B 3F2CA 2N7SA 3SDAC 5CG7A 5EU7C 2KLRA 4OW6A 4IWWA 2WNGA 4FC3E 4AV0A 4GYBA 1IGWA 2P8PA 3JUYA 1KR0A 2DSUA 2H3KA 3H0TB 2GJJA 3MANA 1MNNA 3OPZL 3IANA 2YUXA 5ID1A 2X1OA 4DAIA 1DSYA 4HYRA 3BXWA 3TO2B 1BVKA 2NQHA 4Q4OA 3KPRD 4JY9A 3OD3A 3U6RA 5AUMB 5A6MA 1U8JB 1XGTA 5F89A 3WLJA 5DYOB 3G1VA 4P23C 4P05A 2TSBA 3ABSA 5HNTA 1ZTMA 1U92A 7FABH 4OM1H 4G8IA 5LIYX 3VXTB 3SKOA 3WLQA 3Q01A 5E94A 1ZK5A 4YYFA 3DI2B 4F3FB 4PTXA 1J48A 3ZT6A 3EUDA 3MBXH 5GRJL 4QYOB 2XWTA 5ERWA 2D0FA 5DD5H 1J9SA 4YR6A 3EX3A 2ZKXA 4AF0B 5D8WA 3IJEA 3TFXA 1MJ8L 4X7EC 2F8QA 43C9B 3QF0A 4OCXL 4L4TD 1NFDF 3U4BH 2QGCA 4QRAA 2XKSA 2D4FA 2NMSA 4M6OH 1P43A 1W2KT 4F93B 5EO1A 4PJGA 4DFIA 3NZ1A 3HI1A 3ZHNA 4GRLD 4KETA 3QPXH 2JLPA 4NC1E 2BNQE 3LKQB 4WJ5A 5DMNA 4QRPE 2ADFL 4JKLA 2ZUTA 3FONB 5D04C 1NGZA 1KJ2B 1MIMH 4ODVH 1XRVA 3PU7A 3H26A 1VA9A 3W7DA 3KWUA 5JOPD 1T96A 2EPKX 1G7LA 4LSUH 4RAHA 3SPVA 2GUOA 4WO4D 4MLRA 5SX5K 3BP7B 1NL0H 4UNIA 2D69A 5CEZE 4L7ZA 1YUHB 5DRNB 4C6KA 2CXEA 2CKSA 4W9FC 2DN7A 3V9EA 4Y88A 5IDIA 4Y9AA 1S5VA 1E6JL 2HCZX 1HYSC 3NOYA 4OZFA 2R2BA 3LIZA 1CK0L 4IJBA 4TQPA 3MV11 1SN5A 3OW1A 4NIKB 3BGGA 3QIBC 1W9DM 5CR1A 3M17B 2NY6B 5EO9B 3QXBA 3UADA 1IXNA 4UQ3A 4GUQA 2RGMA 1F4AA 3A4EA 1H49A 2VE6B 5FM5O 4GXVH 3VGFA 1E8YA 2C9XA 4AD3A 4N2KA 4NJKA 4NUGH 3BVJA 3GXIA 4M1GL 4HPOH 2H8ZA 2JELH 3BWAB 3WN5C 4WY7L 2CZ5A 2EDFA 1HWWA 4AQAA 4MYPA 2JFCA 4IJTA 4XZHA 2LVCA 2FLMA 1EEPA 5ABFA 1P4LB 3DURA 2WD0A 3BZEA 3EX4A 3UA4A 3ATBA 3GMLA 2I5IA 2QUMA 3LQGA 4YZWA 4AJ0A 2Y8UA 4OFVA 5I17A 2P0IA 2CBJA 4CMHB 4KV5F 2W0KA 1MW0A 3K5RA 5DJ8B 2FX8L 4JM2C 4RX0A 3HG1E 2IPKB 3WQPA 4P04A 1AQKL 1W9BM 3KBJA 1NDVA 3W82A 3TXVA 2FCBA 1XZ0B 5GS1C 3QEGL 1SY6A 2ZAGA 1PEWA 1UR1A 2GSJA 4CU8A 3EWDA 2Q8AH 3MBWB 3GMQA 2CNCA 2WMIA 1X7QA 3SRHA 1T0NB 3JZ7A 3PFQA 2LU5A 4A6YB 3BMXA 1K7XA 2QVMA 1TTUA 1R7OA 3H3KA 4YIQB 5F9OL 4PU2A 4UUJB 4L8SB 4G43B 1NIDA 4MRCA 1BVNT 1AR2A 5I8CA 3QAQA 4PPTA 5DR5L 3EFFA 4F7PA 3SYAA 3GTXA 3DGRA 4MSWA 2V9TA 3IGLA 4TVUA 3LMJH 3WHXA 3VXSE 3S6TA 5CPTA 1BMZA 4ZQNA 2OQJB 2HVJA 3K6FA 3LCLA 3WS3B 2SODB 1MZRA 3UT0A 3QYMA 4I2XA 3UO1L 3WEOA 1OAUH 3LKPA 3AU6A 2HJKA 3MBEB 1WA0X 3SDXA 1IUZA 2FB3A 2FB2A 3DH7A 4YWIA 2HTMA 1TWWA 4V1DD 2ZOXA 1R75A 5T1KB 1FI8C 3I3BA 5AHNA 4ICWA 1MFDL 4FYTA 3SJ3A 2PLJA 4PGZA 1ME7A 5CC5A 3MNVB 1ZSDB 1W0WB 2R69L 4RSVA 1HINH 1FWFC 4W87A 3H9HB 3EIFA 3KDNA 3QC0A 2V5MA 5E2UH 5AYXA 1CBVL 3FUHA 2XN1A 5L4MA 3SIKA 2VUOA 1T6WA 5FCUL 4DSYA 5EIQA 5EC1A 3OJDA 4FQQA 5I78A 4HJEA 1CL7I 4Z7VF 3FFCE 2VD8A 1U5HA 1N8IA 3SDYL 5HDQH 3AYRA 4RBPK 4XAWH 3EOAB 4N6EA 1AZCA 2AK4A 2QFPA 5AKRA 4CN6A 4H1LB 2DJ4A 4JFYB 4E36A 3EFOA 1NDGB 1V3LA 4UU9A 1H3PH 3HE7D 4KQNA 5FEZA 4DF9A 2V3GA 4IIQA 2X0UA 4WRHA 4N85A 4LCWB 3PBGA 5FIEA 3WIHL 2XZZA 4LNRA 3TYGL 3JZUA 4F4RA 1NCWL 4I18A 5TD4A 2CBIA 5DMLA 3UROR 3KEDA 4ESKA 2APBA 4LAUA 3W2MA 1XEUA 3Q2DA 1GPOL 2HG5B 1BD2E 2DQHH 4BEUA 1AZ2A 1V3MA 2Q3XA 5J5EA 4QLLA 1VENA 2EGZA 4H9VA 2QCDA 4P8UA 1DFXA 2Y1AA 4XMKL 3MLRL 1ZPTA 2OWCA 1DUYA 5CKSA 3S36X 4GA8A 4V1DA 3UIZA 4IL0A 4QY8B 3PGDA 2UZXB 2H41A 1IAII 3S5NA 2WBJC 2NXIA 3FFDB 1F4XH 1K9EA 4JY8A 4WK4B 1TUXA 1LYQA 4Z0XB 1MZYA 3MTWA 2CLVB 4AQEB 3PWPE 4DZHA 4GRWF 3RAJH 3LNMA 5JORA 3TUUA 2CPUA 3BRDA 2XY1A 5TF0A 1PSKL 4B9ZA 4MS8C 4MZRA 2FO1A 4JQXC 3VI4F 1K70A 4YXHH 3F62A 1K3ZA 5MKGA 2YC1B 1QW7A 1E9QA 4P5TD 2VZVA 3RIKA 2XKNA 2XZCL 5DI8B 3O4LE 1MRQA 1EBHA 4PTVA 3S8GB 4R4BA 3C8FA 1E70M 2XN9D 4XE0A 4PB9H 3VPLA 4C83A 3SBFA 1EXPA 3HE7A 3CUGA 3JWNH 4JRXB 1LMKA 2P5WB 1YEYA 3DSFL 4HKZA 5LGKA 1PTZA 4O8AA 2APWA 5KYUB 1PBGA 4FS0A 4RLIA 2EKGA 3W7JA 2VR5A 3VWJA 2VM4A 1K5WA 1QXLA 3G22A 3IIPA 3QFJB 2NZLA 3CV5A 1FPTL 2C16A 2VQ4A 1BHGA 3EXLA 4Q8PA 4OZ4B 1BVZA 2NUTA 3BEWA 3D8MA 3QNXA 2PABA 5KAQG 3LQMA 2P8MA 5DWUL 3KMDA 2ZUWA 4M5ZL 3ULSB 3HZVA 4K9EL 1XAKA 3R1GH 4C6MA 1GCYA 2E1DA 3BZGA 5FA3B 4M4PA 4CVXA 3II3A 1C9WA 4KWVA 3RWHB 2VEPA 3LTVA 4B27A 1Z3GH 4BFGA 4TTDC 4GNKB 4LLUA 1EMTL 4NQ1A 3KWWA 5T8IA 4B7IA 1H7XA 2X2UA 5ACMA 3QNYA 1XB8A 1UWTA 2PPAA 3KLHD 3L7RA 1NIUA 4CD4A 4HUXA 1BXXA 3T77B 2WHLA 3MP5A 5SV4A 2OT0A 1ZGLB 1CE6B 3MRFA 4LAMA 1EH9A 3RGHA 4U31A 4YO0A 4GABA 5E5CA 5CKGA 3GC4A 2QCLA 3IM1A 4N25A 3FGCA 3TWCH 4KUCD 2BNQD 2KYIA 4QRPD 4N1EA 5D2WA 4OZFG 4TL5A 5I1IL 1IQWL 1AA1B 4X9SA 3MMTA 1Y0LA 2Z8WC 1OP5H 3I74A 1ASQA 5DK0B 4YJZL 2FBOJ 1LO3H 2WWMD 5GGVL 1HU8A 3TJPA 1V0NA 4QFUA 2B1AH 1M3JA 2G5UA 5DD3L 2YZRA 2YPVH 4QG6A 3MA9H 4TM9A 2PI6A 2WYZA 2AKRA 4JJHA 4DFHA 4JIIX 4IRZA 5CEZD 2CSPA 2O61B 3A4AA 3RL2B 3EHBC 5CGMA 2FVLA 3GW0A 3PP4H 5F93C 1XIMA 4NKIL 2CHWA 1W16A 3UBGA 2Z0IA 4CKVX 1V05A 3N43B 3IXAA 1MCLA 2AABH 32C2B 4ONVA 2DSZA 2ZKHH 4XMXA 4XCCL 2CRZA 1KB9K 4HB7A 3FJ6A 3BCFA 4XSMA 4X7FC 3WEMA 2UXFA 3NZRA 2PLMA 1CTMA 2Q5BA 1NC4A 3CDYA 4PY8I 4RFNC 2EEDA 4YHYB 1MEXH 4MJMA 1G7PB 3O4OB 5JYMA 5I75B 5EZOL 1AR1C 3D05A 3SZ6A 5EOTA 5IJKC 3E80A 3HMCA 1ZV2A 1KG0A 1EOMA 2I69A 2L7QA 3KJ6L 4OKVB 4PJ7F 4KK8C 4G82A 1J2WA 4Y5VB 3LQLA 4KX9A 2WGXA 5A7BA 2X10A 1MCIA 2GAZB 3GSUA 2H1LM 4N28A 1CB7B 3SUUA 1MFBL 4UI2A 2AK1H 3QXDA 2VQTA 4M00A 4AD1A 3O6KL 1PIGA 3FT9A 2GSIB 2UZIH 4LAQL 4NO0D 1BBDL 3Q9QA 4UM8A 3M1CA 4UV4L 3VM7A 1E4XH 3VFSA 3BZ5A 3F84A 2UY6A 3TA9A 4HGMA 4HIHA 4K8HA 1GZHC 2BNQA 4ODTH 1A22B 2X4QB 1EDYA 4QRPA 3ZE1B 3OIHA 4N02A 6FABH 3S1GA 3GIVB 3E0LA 2X2YA 2VDLH 3OYXA 1FYTB 1P0KA 2ROXA 3IRSA 2OR7A 2WO4A 4NZ3A 5JYLA 2XQYG 4W4OC 4A1RA 4RX4A 3VQ2C 3LBMA 7A3HA 3M1BB 4JFWA 2XIQA 2R15A 4XN7A 3NQ8A 4AEHH 5GZNA 3L4CA 2IPTH 2H3BA 3BJ91 1FORL 4ZBJA 2VZOA 2BVPA 4DBSA 4GXFA 3ZKXC 3QQ3B 1TR1A 4UB9A 1IU1A 4IMCA 3RCMA 4YGAB 2VMEA 4V1XA 4LMQE 2BSSB 1OKEA 4H9MA 1A25A 2QPEB 3GHSA 4P48A 5GS0C 1BQCA 2QCEA 4I9WE 1I7TA 3RPKA 1Q6DA 2V9DA 4LO9A 5DRIA 4A63A 3Q5YA 2C3ZA 2YWYA 3N42F 4QHPA 5EU3A 1RKRA 5B38B 3HBPA 2FB4H 2BDNH 1AD0B 5KSUB 5GJSL 4B5ZA 4GINA 2O72A 1P5VB 4RRPA 3W2NA 1I8KB 2Z35A 5C09B 5D7IE 4BQ5A 1INQA 5CEWA 4I0CC 1QLRA 4I8YA 5CSZA 1BGAA 4IRJA 3MV8D 2XIOA 1I1FA 3MX0A 2CKBA 3CEUA 5I6XB 3BD4A 2OLHA 4IOIA 2WBGA 2QR6A 1GYNA 4OR1A 2X88A 5TIMA 4B9JA 1SGJA 4DP5X 1XRFA 2WB5A </