5EMYA

Human pancreatic alpha-amylase in complex with the mechanism based inactivator glucosyl epi-cyclophellitol
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Glucosyl epi-cyclophellitol allows mechanism-based inactivation and structural analysis of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5emyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5emyA01
1QNSA 2E40A 3VDHA 3VGHA 1J11A 4DUWA 1E6RA 3VSVA 3FNDA 3S6TA 1UD2A 2DGAA 5A6LA 1UUQA 1JL8A 3WNOA 1E0XA 3DX3A 3ZM8A 4PUDA 1KFWA 3SUWA 3QHMA 4IPNB 2RGLA 2ZXDA 3RM8A 1UD4A 1UYQA 4C7GA 4C7DA 1BVZA 3VDBA 3MANA 5HBFA 3BGAA 3GXFA 2XUCA 1CTNA 3EDDA 3POHA 2YKKA 1NOWA 4CN4A 3SIMA 4ML4A 2G8ZA 1E1EA 4DWSB 3BXWA 1VIWA 1BFNA 1BQCA 1UKPA 3A4XA 3FAWA 1W9VA 3T2QA 1H09A 1PIFA 4DUXA 4AW7A 1FFQA 4H04A 3K46A 1R85A 3WEZA 3WUBA 4L4OA 1W1TA 4IISA 5I5RA 3KL5A 1F4AA 1YHTA 2YL8A 1E3ZA 4FLSA 1C7SA 1CGYA 1EHNA 1ISWA 4W85A 2OSYA 2VZTA 2OWCA 2ALWA 1TZ7A 2XGBA 2EPMX 4PBGA 4BF7A 1OD0A 3GBDA 1BYBA 4UFIA 3AICA 4AXNA 1BGAA 3PZUA 2YA0A 2WMIB 3VD4A 1C91A 1DWAM 3LX9A 3CUGA 3WD1A 3W28A 3OLIA 5A3HA 3AZTA 4WKFA 1KGWA 4OJYA 1ZL1A 4U31A 1JAEA 4JFSA 2W63A 2VZSA 3AOFA 2FDMA 4W86A 2F61A 3EJQA 1O7DC 4MNJA 4GPNA 1DP0A 1VAHA 3L4UA 1JZ5A 2BY3A 1GOKA 4NZJA 3UG5A 1EOKA 2OSWA 2W92A 2F7QA 2J74A 3PZNA 4DWSD 2DT3A 5A8OA 5M17A 4D6GA 2PWDA 5GPRA 3K8KA 2QPUA 3ZT7A 2GK1A 5ABHA 1W9PA 1EA9C 1A47A 5BROA 3VD7A 3VM7A 4JCMA 4MAVA 4LPCA 1C90A 4FK9A 4JFVA 2PF0A 2ZUWA 3QHOA 1C7TA 2CBVA 4HOWA 1DWGM 5BXTA 1FFRA 2JE8A 2OYLA 1JZ2A 3AZSA 3WKZA 3WF0A 4W84A 3SCPA 3SUUA 4UQEA 2D22A 2XM2A 3J7HA 3VIIA 2DT1A 3BAWA 2NT0A 3WFZA 2G3JA 4AZ7A 2ZUVA 2J62A 1QNQA 2YA1A 3CUFA 3UR7A 1HKJA 1W2PA 4AD4A 1K9FA 3CZJA 1TQTA 5FIPA 1UR4A 3OGVA 2BY1A 3ALGA 1LJYA 5E6ZA 2QF8A 3BUPA 3B9DA 4CN6A 4DO6A 1FP8A 1MWOA 2FHCA 5D4YA 1R87A 1OINA 3WDHA 2GDVA 2G3MA 3NDYA 3EJRA 2X1IA 2J78A 1ZS2A 1AMYA 3WY1A 1GJWA 4PMDA 3CZ8A 3M46A 1R7AA 2J47A 3RO8A 1VBRA 1UWUA 4CCEA 2EACA 4F9JA 3GTNA 2WMKA 2ZUSA 4KWUA 1D2KA 1GOIA 4W8BA 3ZJ7A 2V3GA 4AYGA 3CHEA 2VZOA 4YHEA 4UFMA 4B15A 3AFBA 3O6AA 3GNPA 2EABA 1GVYA 2X2YA 3AROA 2DH3A 3ARPA 5LA2A 3LRKA 5JIPA 4HA3A 5JBDA 1XC6A 3WUEA 2WB5A 1V3HA 4FNRA 1B3WA 1Q6DA 4GKLA 3GXTA 2DSKA 4D6HA 2BNJA 2CERA 4UFLA 5ABFB 4HPGA 1BTCA 3BAIA 1TE1A 4URIA 4CU8A 3EMQA 1UR1A 2WPGA 4JZ5A 1IT0A 1H2JA 3VDCA 4KMQA 4MB5A 1PPIA 1J0JA 4OOZA 2E9BA 2WWCA 3W27A 1CPUA 1GNXA 1Q4NX 4JKKA 3HG2A 1CZ1A 1ZJAA 2EEXA 1VF8A 1LWJA 1CDGA 3LXAA 2XGIA 2JEPA 4D1JA 4UQAA 1JYWA 1HL8A 1M04A 1QHPA 2O9TA 4RE2A 1E4IA 4CGTA 2WZHA 5BRQA 1WCGA 2W67A 4CD7A 1QWNA 4LYRA 3AYSA 3TP4A 2FH8A 2J7FA 1W3LA 1HJXA 3WQ5A 1KB3A 2ZXQA 2VMFA 4JKLA 5E0FA 3TTYA 1GZJA 5A2BA 4H7VA 1QX1A 3VMPA 1D3CA 3W29A 5I0DA 3ZT5A 1QI0A 4MJ4A 3E1F1 2XPKA 2CESA 4W8AA 3I3BA 2VZUA 4M80A 4NRSA 1QNOA 3ARRA 1UQYA 3GNRA 4JL1A 4P8UA 1CLXA 2J75A 3BAKA 3M07A 4LQ1A 3PTKA 1UD3A 1V0MA 5HPOA 1VEPA 1BYAA 4U2ZA 4P7OA 4TX6A 1BF2A 1GJUA 5JBFA 3VGFA 2VRKA 1HVXA 1DWIM 3EDEA 1KBKA 4CCCA 5LYRA 3DDGA 3OLEA 1CXEA 3BUBA 4OOUA 3NCOA 2V3FA 3LPFA 2WNWA 3U7VA 5JUVA 1TFVA 3D4ZA 2JEQA 1SZNA 3ARYA 5GNXA 1EO7A 2PB1A 3SUSA 5FL1A 2ZE0A 2VVNA 2X8RA 5BXPA 4M1RA 4KRTA 4JKMA 4WK9A 3UETA 2E8ZA 3AHYA 4P8XA 5ABFA 3AIBA 5EB8A 2W61A 3PTQA 2UY2A 3EMCA 1SFSA 3EJPA 3PZGA 1XYFA 1VEMA 5JBEA 4TVDA 5FCZA 1CGTA 4A4AA 5CPSA 5CSYA 4PMNA 1V02A 4EE9A 3MUY1 4Q22A 3PTMA 2EAEA 1B3ZA 4E4PA 3KZSA 5A6BD 4M29A 3AMKA 2X2HA 1LLOA 3VIHA 1BYDA 5IFTA 1B2YA 4W5UA 4CUCA 4BCEA 3SUTA 3BSGA 2Q8XA 4ZENA 4QLLA 1JYXA 2WMGA 1V03A 2CKSA 1G94A 2VR4A 3BH4A 4FLOA 3WF3A 4JL2A 1AQMA 4MAZA 4CU6A 1E72M 4PN2A 4HU8A 3WNKA 2D73A 3DYMA 5GQBA 2FHBA 1KBBA 3H54A 2NSXA 3KL3A 3WH6A 1M53A 4PSPA 2EO7A 1J0KA 3N9KA 4B3LA 3OGSA 3GXMA 1E0VA 1OCQA 1JDAA 5I3DA 3VD3A 2XVGA 2BS9A 3OA5A 4NXKA 2VCCA 2J25A 1U33A 1R47A 3AIRA 5LA1A 1V3MA 3K1DA 2DPEA 1TVPA 3AMDA 4PEEA 4UZUA 4XX6A 1QI2A 3GXIA 2QHAA 2CBIA 1EO5A 1H1NA 2VUYA 4HZ7A 1V08A 3VPLA 2VO5A 5A1AA 4PCSA 3K8MA 2E4TA 4M24A 3GM8A 3ZT6A 3VX1A 2FGLA 2X2IA 1TQVA 1Q6GA 4OBSA 1HT6A 3VGGA 4IM4A 1EDGA 1XH0A 1ZB5A 2VZVA 4HMDA 4MTVA 4AEFA 3ZJKA 4NZFA 5CPQA 3CLWA 2VCAA 3IAQA 5M03A 3G6MA 3VILA 3AJ7A 1W3JA 3AIQA 3N12A 1RP9A 1HXJA 1V6YA 3AHXA 3SCWA 2DSZA 1D7FA 3I3DA 1J9YA 3WQVA 4HOZA 3U5UA 3MSDA 3WDIA 1L0PA 5I23A 4J3SA 1E6SM 1J12A 4GZIA 1W3HA 3ARVA 4WSJA 5A6SA 4P8WA 3A4AA 3PZ9A 2X05A 5DT5A 2TAAA 1W9BM 1EQCA 2C8NA 1QNPA 2CXGA 2IXVA 2DIEA 4PTMA 1RP8A 1KQZA 3MS8A 4UFJA 3ARXA 2ZX7A 5CLTA 4J3VA 1VFFA 1KXVA 2CHOA 1QHZA 2D1ZA 3CUHA 1JI2A 3PZOA 1TVNA 2WVVA 5BXRA 3SCQA 2GUYA 3MU7A 4LGXA 2F2HA 3WF2A 3AHZA 3AXIA 1PEZA 2QMKA 2WAGA 1CGUA 1XYZA 2VNCA 1FH9A 4AIOA 1W1YA 1JIBA 4OKDA 2EPLX 2XTKA 1E4MM 5ABGA 1EDTA 5A6MA 1FH7A 1VEOA 1UA3A 1V6XA 5DT7A 3EJSA 2A3EA 4DM2A 2VQTA 1H11A 1QOXA 3EJUA 4F79A 2WLZA 3PZVA 4XZBA 1ZBWA 1W32A 3BUIA 1E5JA 2DT2A 2WCAA 1OT2A 3M6DA 2J7EA 1WZMA 3EDKA 2QPSA 2J7BA 5EFFA 3SEPA 2D3NA 4U3CA 1LL4A 3WY3A 1NOFA 1H0GA 3AYRA 2J7DA 1MVYA 4Z2JA 3QOMA 1ISYA 4A3YA 3JUGA 4UQCA 1BVNP 3CMGA 1KTCA 4BQ3A 1X1NA 3D50A 4YHGA 1SYTA 1A3HA 4PTWA 1WDPA 2G3IA 1JAKA 1VBUA 2ESCA 3PZMA 3LXCA 3WSUA 1EOMA 2IGTA 2YDRA 1NP0A 1EQPA 2PWHA 1LL6A 4BQ2A 4TVUA 5A8QA 2CYGA 1E4LA 4E8CA 3MMWA 5IDIA 2ZWZA 3DX4A 5HXMA 3K8LA 1LG2A 3CO4A 2J7CA 2AOSA 3AHVA 4AZHA 4NI3A 4W8LA 4IPLA 3GH4A 1IV8A 2XYLA 5D9MA 1HJSA 4PMYA 1CGWA 2WK2A 5HNNA 3MUZ1 3AMGA 1MW3A 1WPCA 3BVVA 4K68A 4HA4A 3L4ZA 3NDZA 3PBGA 4AZIA 1UQZA 4MPKA 4JFWA 5EFDA 5A6AA 4WKAA 4GQQA 3VM5A 5I79A 4Y7EA 1QNRA 4GO9A 3ZJ6A 3FHQA 1JXKA 1JZ4A 3F4VA 2RGMA 2FH6A 3TTOA 4IUGA 3WN6A 3SUVA 3LMYA 2G4FA 1NOUA 7CGTA 3KLKA 4UOZA 4WJXA 1W2VA 5IXEA 2VOTA 5DF0A 3CUJA 5GNZA 1VFMA 4U33A 5E9AA 3W38A 8A3HA 4AZ6A 2DH2A 2XFFA 1UG6A 1ESWA 2ZX6A 1Q6CA 3DDFA 1QI3A 3OB8A 3WNPA 1WDQA 2W66A 4KH2A 3EDFA 4ACZB 1XCXA 3NSNA 1H3GA 1EXPA 1HIZA 3WEOA 4PMUA 1OGGA 1E56A 1RPKA 5A6KA 1CGVA 4BS0A 2X0HA 2VI0A 2J8FA 1W9XA 4EK7A 4D6CA 1QPKA 4D6FA 4AD2A 3ECQA 3ALFA 3T0DA 3CZKA 5DO8A 1UR0A 3CIVA 2PBOA 1JD9A 1M7XA 1E40A 4AIUA 3B9EA 4CCDA 1XD0A 4F8XA 2WBKA 2QV4A 3OGRA 3S5ZA 4ZE4A 4QDMA 1MQRA 5CG0A 3ZQ9A 1UD5A 1JDDA 1OB0A 3FAXA 1YQ2A 3MUAA 4DWSA 1NWRA 5D8ZA 1US3A 3FHAA 2AAAA 2PWFA 1V0NA 1G9HA 4UCFA 3D5HA 5A2CA 4B9YA 5CGMA 3UCQA 4WKHA 3WELA 3NJ3A 3CHCA 4QFUA 3ZR5A 2VC9A 3TTQA 1CWYA 4GQRA 4AISA 1JDCA 3H55A 1QW8A 1WKYA 3BMVA 1V0LA 1IZJA 2Y8KA 1C8YA 3VIJA 1F4HA 2OYMA 4FLRA 3HN3A 3WF4A 1R46A 2WC7A 2WMIA 1BLIA 3N17A 4RL3A 3VIGA 4P7QA 4JCLA 1VJSA 3F5JA 2C7FA 1HVQA 2EXOA 1KGUA 3MV11 1SR0A 1EHAA 3TTSA 1V6UA 2J7HA 4XV0A 1B0IA 2GJXB 1BHGA 3B9AA 3N04A 4M8UA 2VVSA 3OLDA 3WY4A 2E8YA 3GXDA 1HP5A 3LRLA 2G3NA 1KWKA 1EH9A 3BLPX 3W6MA 1S46A 5IHRA 2J79A 3WNNA 2YFNA 3IJ7A 1AVAA 2C0HA 1T0OA 1G01A 1CENA 1M03A 2PWGA 2MANA 3RDKA 4BA0A 1TA3B 3ZIZA 3SCNA 4AEEA 1R8LA 3OLGA 1QBBA 1CXIA 1LL7A 3KE0A 4R5EA 1M01A 3W6LA 1MW2A 1UZ4A 3EMZA 2VR5A 2XIIA 1HTYA 4NXSA 3GDBA 3MKKA 5FL0A 2OWWA 4H2CA 4H8HA 4AZCB 4M82A 4ZFMA 1XHGA 3WF1A 1X6NA 3RJYA 4S3JA 5C8BB 1UKTA 3BAXA 4J3UA 4P7NA 1PIGA 1BSIA 2YBTA 3WNLA 2WCSA 2VX7A 1MQPA 1HX0A 1FP9A 3A5VA 3DYOA 1KGXA 4KRUA 1OGSA 4A3HA 4CN1A 4J27A 1SMDA 4OGZA 4FLQA 2VCBA 1E6ZA 1CLVA 4FNQA 4TXEA 4OBRA 1UWRA 5AC5A 4UQ9A 4ZXLA 2ZWYA 1KTBA 2GSJA 4WF7A 2BVTA 3MSGA 1AQHA 4JAWA 4GI9A 4U5IA 2ZX9A 1PJ9A 3GH5A 3T09A 1H0IA 1HNYA 3GYCA 1V3LA 3APGA 4V27A 2WSKA 1KXTA 5E09A 5D9OA 3TV8A 2GFTA 4M56A 2F8QA 4TTGA 3HG3A 2XVLA 3AZRA 3RIKA 4E8DA 1XCWA 1VFUA 4RE4A 4LXFA 2XSAA 4CU7A 4AC1X 3GZAA 3UERA 1E3XA 1U2YA 4JFTA 3CPUA 3WBEA 1KR0A 3IK2A 3CC1A 3OZOA 1DWJM 1BPLB 2F1AA 3WQ6A 1NP2A 4UQDA 3CV5A 3AI0A 3S5YA 2XSBA 2W4XA 4MB3A 3UG3A 2J8GA 4D6IA 3BLKA 2D0HA 2WVUA 4HP5A 4E2OA 3AS2A 1GCYA 1GHRA 1XH2A 3D3AA 1FOBA 2FE0A 3RM4A 5I78A 1CXLA 2G41A 2X0YA 3HZ3A 2UY3A 4Z2IA 1E5NA 2WMHA 4D72A 4QAWA 4J28A 2AMGA 1K9TA 1H5VA 5AY7A 5BXSA 2F7OA 3BCDA 2ZX8A 1JZ8A 1HJVA 3L4TA 3IANA 4QLJA 4PUEA 2E0PA 3I3EA 2XWEA 4AZ5A 3LXBA 1DWFM 3CMJA 2ZXAA 3GXNA 1Q6FA 4FNTA 4DO4A 4ATDA 1CGXA 4OUEA 4NX0A 1C3FA 4F66A 1E6NA 3VKKA 3PZQA 4BQ5A 4ZE5A 1WZLA 5A6BA 7TAAA 1UZ1A 3THDA 5CLWA 3BVUA 3CH9A 1VB9A 1ZJBA 1JNDA 2D0FA 1BGGA 1XH1A 1E6QM 3N15A 2GVYA 3BMWA 2VTFA 1JZ3A 1JFHA 3WD4A 4GZJA 2D24A 1J0YA 4HU0A 4QLKA 5D9NA 1Y7VA 1TG7A 4YPJA 5CGTA 2WKLA 2ZOXA 4CD6A 1UKQA 3PZIA 1CXFA 3DHUA 1J18A 5M3WA 1J0ZA 1GOMA 1TCMA 3OBAA 3DHPA 4WLCA 4AWEA 4X0NA 3CZEA 3GBEA 2XIBA 3VGDA 5TD4A 5A95A 5A2AA 3CHDA 3FXYA 3EBVA 3PHAA 3AIVA 2WVSA 2UY5A 1UWTA 3O9NA 2VL4A 3VIPA 3UEQA 4XUYA 4J3TA 4FNPA 2WMJA 8CGTA 2XVPA 1PAMA 2VX4A 2YDSA 1GONA 4MDOA 1DTUA 1GW1A 2BY0A 4PCTA 1Q6EA 1GVIA 4H8VA 1FHDA 3QHNA 3W26A 4P8VA 5C70A 5JIWA 1IZKA 1GQKA 2Y5EA 2A3HA 3SCVA 5ABEA 3TA9A 1CNVA 4MDPA 4KGLA 2JIWA 3ZMRA 3RILA 3POCA 2D0GA 1UD8A 2HVMA 3DECA 1JYNA 2VJXA 3CZGA 4MNKA 5FD0A 2Z1KA 1UR8A 1FHLA 1E6XM 3VSTA 2WLYA 1B3YA 1UWIA 2W62A 1E9LA 1JYVA 1WDRA 3WQ8A 4DO5A 5CSUA 3NSMA 4LX4A 3GNOA 3UESA 2XVKA 3WBAA 4AYSA 1OBAA 3MV01 1JG9A 3A47A 4W88A 2A3AA 3SCUA 3FN9A 1PX8A 3A24A 3F5KA 3G6LA 1C8XA 1B90A 4GZEA 3WQ4A 1MFUA 3VSUA 2DSWA 3DX1A 4ACYA 2CBUA 3UR8A 4EAMA 2D2OA 4P7LA 2WHLA 1XRVA 3CBWA 1HWWA 2W91A 6A3HA 4W7VA 4HA1A 2DSVA 3NSXA 2YFOA 2WVTA 1J0IA 3LRMA 5BCAA 1ODZA 2F1BA 1EGZA 4BQ4A 2XJ7A 4CD5A 3EDJA 2J77A 3WMBA 1QBAA 2EPKX 3LPPA 2Y2WA 4FF5A 1R86A 1W9UA 5I6SA 1XSJA 4W89A 1HJQA 3WDRA 1MW0A 2F18A 3W4RA 1JZ6A 4AMXA 1HXKA 1B9ZA 1E55A 1FH8A 4PYSA 2XHYA 2O92A 3SCOA 3RM9A 2ZUTA 2ZICA 1BG4A 2BY2A 5EMYA 2GK1B 4YN5A 1GOOA 2PI6A 3DYPA 5AYIA 3SURA 1E4NA 1ZU8A 4AY1A 1MYRA 3A3HA 4WSKA 5D8WA 1VJZA 4GXPA 3L2LA 1C92A 1V3JA 4J3WA 3BUQA 2YDQA 3BLBA 3O2LA 5A69A 1TUXA 4MNLA 4AIEA 2WHJA 3K4AA 1PZ2A 4OIFA 2V5DA 4PMOA 4TOQA 4HMEA 3A23A 4X0VA 1WDSA 5BYWA 1LWHA 2WC4A 1ZBKA 5A94A 3AS0A 1GPFA 3VGEA 3WH7A 4LYQA 1J0HA 1WZKA 1VFOA 3L4VA 3AHTA 3VIOA 4AD3A 2WKGA 2XN0A 2E3ZA 2BXYA 1ISXA 6TAAA 1EIBA 4D71A 2CHNA 2OLHA 4AD0A 3AISA 4P7RA 4W87A 2BXZA 1FA2A 4W7WA 4UQBA 5F7UA 2CETA 1W1PA 3ARUA 2ZXBA 3KWXA 2E9MA 1JF5A 4RE3A 1KCKA 1XV8A 4B9ZA 1JD7A 1PBGA 4HZ6A 2GJPA 1UR2A 3VOCA 2CPUA 1UH3A 4UOJA 4GINA 1TQUA 3D52A 4H8UA 1CEOA 4DM1A 4UFKA 1CBGA 1MFVA 3L2MA 1OD8A 1NWTA 3WY2A 1UKOA 3VDAA 2FYVA 4Z2HA 1DWHM 1HKIA 4ATLA 5CXPA 1J10A 4GI8A 3PN8A 3ARZA 1HL9A 3FW6A 5HDRA 2FGZA 4UFHA 3WQWA 3UG4A 2YBUA 3HG5A 4W7UA 5CPTA 1ITXA 1V3IA 4U3AA 2PWEA 4FNUA 4PMRA 4B16A 2XVNA 1QI5A 3LPOA 1I1WA 3ZSSA 1J01A 2PC8A 2UY4A 4FNSA 2O9RA 5A6JA 2QLYA 3MI6A 2YLAA 1C8QA 1MXDA 7A3HA 1BAGA 3VO0A 1XD1A 3BVXA 1UH4A 1HKMA 3WD2A 5E1QA 3SCSA 4AMCA 2F7RA 3CGTA 1MW1A 3T0AA 3MMDA 4UZSA 1KQYA 2BHZA 3SCRA 4D6JA 9CGTA 3FY1A 3W24A 4Q7NA 1LQ0A 4BZYA 1GQLA 6CGTA 4J7RA 2V5CA 5DFAA 1RD6A 3WFLA 3WUFA 1WB0A 1UH2A 5BWFA 2GJRA 4AZBA 3BAYA 1JNEA 2D3LA 1B3XA 1OGBA 4CVWA 3U5YA 4DUVA 2YA2A 1WNOA 2DIJA 4TUFA 2EJ1A 5HPCA 2OWXA 4D6DA 3WDPP 3WH8A 1V3KA 4PRWA 2DEPA 5E6YA 1H4PA 2NT1A 1QI4A 4NSBA 2ZUMA 4N42A 3OIHA 2WC3A 1UASA 3IGUA 1UA7A 1E73M 4TVCA 3CHFA 1X6LA 3VIFA 3D4YA 1E1FA 1WE5A 3WD3A 1LF1A 2EQDA 1E0WA 4HTYA 5HOSA 1R7OA 1CIUA 1UKSA 2WBGA 3GH7A 3W53A 3EJTA 1US2A 4TTUA 3IJ8A 3W0KA 4CVUA 4ACZA 2JF7A 2XFYA 3T2OA 4DWSC 3OG2A 2Y4SA 1TQSA 1N82A 2Y24A 3A6OA 3A22A 2VX5A 4C7FA 5CZKA 3VNZA 1V0KA 4XZWA 3WDJA 1G0CA 1VENA 2VRQA 3VMNA 2E9LA 1LG1A 1ECEA 2J7GA 2BHUA 3LPGA 3DX0A 5KEZA 1ITCA 1PX4A 1U30A 3AMCA 1G1YA 1TQWA 4JHZA 4KGJA 2WXDM 5BRPA 1WAWA 3N11A 5CJ5A 1G5AA 2A3BA 3W81A 3W37A 4L4PA 2XG9A 4NF7A 3WIJA 1BG9A 3L4YA 2YOCA 3A21A 1W3KA 4QP0A 4PMQA 5FKYA 1OIFA 1TMQA 3VMOA 5AYBA 4U5KA 5A8MA 4JHOA 1I75A 1V6WA 2YL5A 1MQQA 2YL9A 2WHKA 5A8PA 2OW6A 4ZEPA 1OT1A 4FMVA 3K4DA 4UNIA 3RPMA 4AMWA 1E70M 3WUGA 1I1XA 2EPNA 4J3XA 4D1IA 1ZBCA 5DMYA 3II1A 1R33A 4XB3A 2BVYA 2ZX5A 3VIMA 1Z32X 1SMAA 2CITA 2ZUUA 1OIMA 4MB4A 3QR3A 1E71M 3EYPA 1GQIA 3VNYA 1HKKA 1K9EA 4NZCA 4PMZA 4TX8A 3HMCA 1NH6A 1VRXA 1W9DM 3VX0A 2XM1A 3HU7A 3N18A 4HMCA 5ECUA 4Z2KA 3BC9A 3VD9A 4GO8A 2W5FA 2XN1A 2IUZA 3AMLA 2CBJA 3DC0A 5EBAA 3HG4A 3M7SA 1OWQA 4UR9A 3T0BA 3CZSA 1V6VA 2B31A 2D20A 4AZGA 1NWSA 5E0CA 2VX6A 1NARA 3VGBA 2VT0A 1HJWA 1B31A 3WENA 3QGVA 4PTXA 2JFEX 3W25A 2WMFA 1E15A 1GOQA 1L8NA 4UOQA 1W1VA 4ZXOA 2DDXA 1ODUA 2GJXA 3MO4A 3WL0A 2X09A 1OSEA 3ARWA 3TONA 2O9PA 3MUIA 4H41A 5D9PA 3AS3A 3BCFA 4HOXA 5DEZA 3VUPA 3NUKA 1ISVA 3B8SA 2J4GA 5FOOA 4W5ZA 1HP4A 4Z2GA 2WM0A 3CZLA 4F9DA 1BYCA 2JF6A 3WMSA 2OYKA 3VVGA 3WDQA 1ZBVA 1GOWA 1TA3A 2ZIDA 2WZEA 1H49A 2FHFA 2WWDA 1NM9A 1UHVA 3NIYA 4MNMA 4PTVA 4CD4A 3WL1A 1GUVA 4S3KA 4V28A 3U7BA 3OZPA 4JIEA 4AZCA 1B30A 3L4WA 1E6PA 4AD5A 1JZ7A 3ZO9A 2BFGA 4NRRA 2Y8VA 3VU2A 1O7AA 1RH9A 3RCNA 3A4WA 4N0RA 1KWGA 3ARQA 2DSUA 2CKRA 2WZIA 3PZTA 4HPHA 1AQ0A 2X2JA 4PSRA 3WNMA 3ZSTA 2OW7A 3VTRA 3WH5A 4JFUA 4CD8A 1O6IA 2XN2A 3TOPA 2V3DA 2XFRA 4MJ2A 4B3KA 1UOKA 1K6AA 2D23A 2Z1SA 1R75A 1WZAA 4MADA 3KEHA 2A3CA 2OSXA 3N13A 2WANA 4V2XA 2WVVB 5I24A 3ARSA 1JI1A 3RMEA 2DT0A 1JF6A 2JALA 2HISA 5CQ1A 3SCTA 3BAJA 4Z2LA 4QCEA 1JXJA 4PMXA 2JIEA 2NW0A 5GNYA 1UWQA 1QW9A 2UWFA 3BVTA 4EKJA 1HJUA 3CTTA 1QHOA 4GI6A 4HZ8A 2QMJA 1MXGA 1DEDA 1HF6A 2V3EA 1UWSA 1CYGA 1K9DA 3VIKA 1QVBA 4ATWA 2YIHA 3BSHA 2GDUA 5M5DA 3T2PA 4R27A 2BHYA 2WHMA 2DQXA 5KZ6A 1NWUA 2EBNA 1GHSA 3BVWA 1PS3A 1W91A 2F7PA 3AIEA 4MB1A 2YL6A 2BV9A 3F5LA 4OZOA 2EPOA 2CEQA 3H53A 1NQ6A 5LA0A 3CZNA 4AD1A 1B3VA 3VD5A 1KXHA 4UTFA 2CNCA 1XSIA 4EANA 3AIUA 3S2CA 2EADA 4U2YA 1V02E 5IHSA 1WO2A 1GQJA 1JFXA 2WSPA 3AIWA 2BVDA 2VURA 5C71A 5AC4A 3DX2A 1B1YA 4PMVA 3VINA 1E43A 1WP6A 3IJ9A 2CCRA 4X9YA 2WW5A 3CUIA 2PBGA 1DHKA 3WH9A 1GORA 2XWDA 1EDQA 1KCLA 1UD6A 1CXHA 4W93A 2CIPA 1XGZA 1TR1A 4GIAA 3KLLA 1H41A 2V38A 2VRJA 5I2UA 4CKQA 1UR9A 3T08A 3IAPA 2YJQA 3ZOAA 5A8NA 1KXQA 1P6WA 3AQUA 3ARTA 5E70A 2WYSA 2VQUA 3WMCA 1ISZA 3BUDA 1HN1A 1C93A 1KR1A 3ZR6A 2ZUNA 3D51A 5I77A 3WEMA 1PZ3A 1OM0A 5IFPA 4QCFA 1PX3A 1CXKA 3W82A 3AS1A 4LYPA 3KL0A 2IXUA 2O9OA 3AXXA 3MMUA 3L4XA 4M81A 3NYDA 2WCGA 1XSKA 4WIWA 3U57A 4D6EA 3RJXA 3HJEA 1R34A 3THCA 1QWUA 3QOKA 3ZJ8A 2YLLA 3N1AA 3AXHA 1CECA 3GXPA 1JGIA 3WD0A
chains in the Genus database with same CATH superfamily
4CJ1A 1OF0A 2EE9A 5AW4B 4I3SL 3QW9A 2ISFA 4MDJB 3G3LA 4YX2L 3BP5B 4TL5A 2CLZB 2R7EA 4PTTB 1KFWA 3OQ3B 4D7BA 2B1HL 5ICZB 7ODCA 4NKDA 4M6AA 1UM5L 3V0AC 3RM8A 4HIHA 3V1PA 3BV7A 5IFJA 5CC5A 5DMLA 1AZUA 1ZLSL 2WNNA 3POHA 1A7QH 3PWUB 3ZKND 4Y4FA 1KV5A 2WN3A 2KERA 1I3GL 3LN9A 3H7BA 4AHQA 3ZDZB 4PWKA 3CT2A 4OLZH 1A4JA 3APDA 4NJ9H 1R2TA 1FFQA 4I90A 1R85A 1HW6A 1P0BA 1Q1JL 4AXWB 3V0JA 4L4OA 2O72A 2R1PA 4NG3A 2HVJA 4HH8A 3LDVA 4OZFH 1TZ7A 2VE6B 3QW4B 3UJSA 2UXTA 5D7IE 1C91A 3GG8A 4JM2A 3IIOA 4H8WL 4HOMA 1OC7A 3E0GA 1FFTB 4HPJA 1N2RB 5L0QB 2FDMA 1IM3B 4LIQH 2IBGA 3N4AA 4W86A 4RNRB 5LCVL 1VAHA 3VI4E 3H4XA 3QA3A 1H1YA 1YMHA 5ABHA 1RJLA 3BZFA 4NRYA 1ZGLP 2PCFB 5FAGA 4OD3H 3QXAB 2ZUWA 1XLBA 2WQSA 5J1AB 3CXHK 4NAQA 5CEXA 5DWUL 5DT1H 3WS6C 3WF0A 4WNQB 5AW1B 3J7HA 2GEQA 1M57B 4DAGH 1U9KA 1OABA 1UR4A 4H9VA 4BHUA 3ALGA 1YE6A 5LN8A 3T05A 3FVMA 3V0TA 1L2QA 1TJMA 4L80A 3OKDA 3ABKB 1IM3D 5JHDE 4LAQH 4LSSH 3WDHA 3NAAL 4QITA 4M1DH 2G3MA 4M6NH 4L8DB 5LHEA 1T41A 5CZXC 3GJEB 3UPBA 1EJOH 4PRPA 1MAML 5E00A 4QRRB 5ESVA 4PB3A 4WZHA 2YW3A 3DH7A 1BYOA 1IAIM 2G96A 4HA3A 4HBCL 4HNCA 1XAKA 3FHEA 2FVNA 1NLDH 1ZRQA 3ISWA 3ML9A 4D6HA 1A6ZA 1YNPA 2MCAA 1UROA 4HWNA 3BAIA 1DUYB 1D9KB 1IT0A 2FB4H 5TQ2H 5DGQA 1PPIA 5FOBB 2H8PA 4OOZA 2EKGA 1YNTA 3UPMA 4JEQA 1CFQA 1W31A 2I7SA 4YE0A 2OFQA 2YPLA 3AG1B 3KOZA 1K8DA 2V33A 4OBTA 4R7OA 3PQYB 5EHFA 3T0XA 1JEZA 1KB3A 5E0FA 4RH4A 2BS8A 3R2GA 4QRRD 2CGZA 2AJVL 1TEYA 2DJ4A 4G80A 4NGHL 4LLQB 3HE7A 2VZUA 4GIEA 1LOLA 5MEQB 4EE2A 2DWEB 5FA4B 4B95C 4GK8A 3GI9L 2OMVB 3EDEA 4CCCA 2OB3A 4X9GA 4G9PA 3EOUA 3IDMA 4DZBA 4XN2A 5G55A 2W88A 2P10A 1SLUA 1Q85A 3M8OH 1OAYL 2A2QT 4H5SA 5TE7H 5GNXA 2EH7L 2BM3A 3THML 2NQ9A 3GY1A 3FT1A 1F8IA 3QV7A 2NY3B 5KBLA 5JXED 3PQYD 4DTGL 3MXWL 4ODUA 1Y1UA 4WTWA 1V02A 4EE9A 1F5ZA 4ZVJA 3ULVC 3ULUE 1XIGA 3SUTA 5J13B 1AJ7L 1LWRA 2V2TB 4F40A 3BH4A 3ZLGA 2CJUH 4AT6A 4IDJH 5CD3A 1NL0H 2OQLA 4M9PA 5GQBA 2FHBA 2CAKA 2FIRT 1I4FB 1E0VA 1JDAA 3APNA 2CMRL 2BS9A 1ORSA 3QQ4B 2AK4A 3K1DA 3P3SA 3NFSL 3JVFC 1YEHH 3LQLA 1A6UH 5C97A 1HZHH 2GTZB 3KYNA 5HDLA 2CBIA 2FUQA 1V08A 1TRIA 1DBKH 4Y9NA 1K4CB 1SHMA 2DM2A 3WKNA 1L6GA 3GRWA 4HMDA 3CLWA 2VCAA 1H6EA 1H19A 3NIFB 1QR4A 4UNUA 3BQVA 5HVHB 3BG9A 4LTSA 1FGNL 4IL2A 1N8FA 4TLTA 1YTDA 3GF8A 1QR1B 2GJZB 3S1VA 4QXWA 1SUHA 3LNHA 2VWEC 4W4OA 1KQZA 1QDSA 5HI5D 1CFNB 2CK2A 4BUGA 4HSHA 2QUMA 1K03A 4RZCB 4H2HA 3T0CA 1BBJA 4PJEB 3A4JA 1UA3A 3UOAB 2RCSL 1AZRA 1JPFB 3UJIL 3NABH 4YHOH 2HSIA 3AWEA 5MI0B 2CRMA 4V1DA 5JIHA 1ZHLA 1BD2A 2YR3A 3NIGF 2PDQA 4IHCA 4KHXL 1XH3A 2IG2H 5I1AB 1E9QA 5E2TH 4N5EC 3JUGA 4X5PA 2V2WA 3T3PF 2G3IA 2ESCA 3FCBA 4XI5D 4IL0A 1NP0A 1KBLA 5EV7A 2MIZA 1E4LA 3EWCA 3GT6A 4HCRH 4DXXA 5ALCL 3D25B 3OTTA 4GLEA 4W8LA 3LKSB 2O6EA 5EBGA 4ES8A 3QFWA 4L9ZA 3KOXA 3GW0A 5TF1H 4LRSA 3K0WA 5IWLA 2YCLA 1F4WL 4GRSA 3CQFA 3GPSA 3V4UL 5DMKB 4O2FB 4YPGB 3MRKA 4NZ4A 2KQMA 4ELKB 1AJ2A 1TTCA 4YIWA 4JRYE 4AZ6A 4JB9L 2VXUL 1CFTA 2FGBA 1H9VA 4JTTA 5I3KA 1BX2A 5AAPA 3IKCB 2F6KA 3R8HA 3G6JB 4PMUA 4OQVA 3T42A 3U2CA 1PWMA 3HNVH 1DN2A 4XOBA 4PV8B 2QQKH 4G71B 1E6OH 3P11L 2JKWA 1KCUH 1TWDA 1IGCL 3Q2VA 5LQBH 2J5LC 2VC6A 1Q2SA 2M2DA 4Z7QB 1IWAA 3RUGF 1BOYA 1YQ2A 1L9RA 5HNTA 3MZNA 2O6CA 3HMXH 1G9HA 4KC3B 5A2CA 3FDGA 1QUNA 3MOAL 3QRLA 1JHKH 2VC9A 3U7WL 4GQRA 1E8YA 2BIIA 7REQA 2GFBB 2I25N 2AI0H 5DS8B 3O3DB 1VPOH 3OAZK 4YZFF 1MCFA 4PRIE 3FVDA 3KVKA 1CFSB 2JLPA 5AYTA 4RL3A 3PWNB 2GTWA 4QRSB 3DERA 2OVLA 4PY7B 3EZ4A 3WTUA 1EHAA 3G1DA 1V6UA 3FQYA 1W17A 1IZCA 2FEEL 1KWKA 1AH0A 4YIQB 3DHJA 4PGCA 4P2QE 1I2RA 2JJVA 1BWMA 3ZIZA 1UIPA 3FTZA 3QGKC 4IRZL 2BCMA 1DYSA 2OWWA 1NEUA 4MXWH 3SGJA 2WP3O 3AALA 3MRCB 3VC5A 2O93L 1FL5A 8FABB 4WGXA 1B54A 4NC2B 1EJTC 1Z9AA 2J7LA 3HZMB 3P93A 4DCQB 3F5WA 3W7LA 3GMRA 1TVHA 4KNQA 3KLQA 4Y9BA 3AT0A 1S4IA 4PD4J 5KTEL 2O61A 3VD2A 5LGJA 4O54A 4EIGB 2GLKA 3ZE1E 2DQFA 4LC8A 4F7CB 4UQ9A 4JAWA 3VDGA 3S1UA 1XMEB 5D9OA 1NANI 4MVBD 1PU0A 1NMBH 1GOXA 3QSRA 1URZA 3PWVB 1U2YA 3STLB 3OZOA 2JJUA 2GQ3A 3BKJL 8TIMA 1NP2A 3PHSA 4C47A 4MB3A 2W4XA 1YEFL 4PFHA 1Q1PA 4E2OA 3Q1EA 4LCCB 1YEIL 2OJ1A 1HH9A 2ZZ1A 5AVYB 2CGRH 2JKSA 3FU3A 5F2GA 1FWGC 2KLSA 3G1VA 2BDNL 1OE2A 2E0PA 4Q7DA 4RA3A 4U1IA 3GS7A 4AZ5A 2QHRL 4ATDA 1C3FA 2G3FA 1EAOA 4Q58C 2EAWA 2EG8A 3CH9A 3UF9A 1E6QM 2EIMB 3C0JA 3TNMA 2GBTA 5EF1A 1FA4A 2ENSA 4FZIA 4QD2E 5CGTA 3PZIA 1UWXK 3BGGA 3SDXE 4HYTB 4QROA 4NPJA 4N86A 4M5YH 2V5LA 2LABA 5ID0B 3HV8A 4Z1CA 5KW9H 3I02A 3O1NA 4ZUWA 1UXWB 5ALBL 4Z7OB 5F1IA 4MDOA 5LHDA 4MD0B 5F0LB 4HQVA 1GVIA 2WZPD 3QYSA 1FHDA 5T1JA 3P14A 4NRXA 5JIWA 1EGJH 1LM8V 4O9HH 3M0XA 5JNYB 2RD0A 1NDGB 1P2CB 5DVOA 4ZMQA 4OVVA 1BA9A 3UZYA 3V4VB 4ODVH 4K3GA 2QSQA 2IPKB 4O0QA 2FX7H 3PV7A 1MFCL 2XVKA 2PGWA 2FSDA 4MJHA 1O5KA 2XHNA 3Q43A 1GZHC 3A24A 3G6LA 4NFDA 1B90A 1T5WA 2JI3A 3AAMA 3TO2B 1P5VB 2YUWA 2VLME 2ZCHL 2QEZA 3CBWA 3UYRH 3VXGA 2PPEA 3VTTA 1P43A 1DSFH 1WFJA 2EDKA 1MUCA 5J9PB 1YYLL 3MX0B 4NO2A 4HJFA 1Y5XA 3NCJH 3W4RA 3UZVA 1NEZB 4AMXA 2WW8A 2NW2B 1GZQB 1B9ZA 3DSNB 2VEIA 5DJZB 5FHBH 1KCVH 3KWTA 2BY2A 3JW7A 4I5UA 5E8DH 2F0CA 1TX2A 1E4NA 1ODAA 4Q8TA 1IEIA 1S8DB 4CC1A 4PUKA 1Q9OB 5EDXA 4LL9A 2C7UA 1TUXA 1AG6A 1PZ2A 2OR7A 3MNVB 4LLMB 1YTKA 1F56A 4X99A 3QR2A 5T1KB 4KJWD 4N2CA 5KS9F 3QE5A 1IR2A 2X4NA 2WKGA 3IJLA 2E3ZA 1RHHB 3NQBA 4D71A 2YR1A 1FH2A 3T07A 4HNUA 1VYRA 2OLHA 4JN2A 4FXGB 2LGNA 4BZ2A 5HVHC 4OUOA 1DQVA 4WI7A 4PCNA 4DBUA 2FK9A 2VDIA 2DV0A 3BWAB 1AG0A 4ZDHB 1BEXA 4ANXA 3EOBB 2CUMA 4OFYD 1HKVA 3ROLA 2PTXA 2CLPA 1QFEA 3QFGA 3RVWD 3CS2A 4OF8A 3QUXA 3HPLB 4UFHA 4XI5C 3FQWB 1K7XA 1RBLA 4AY8A 3H9SA 1XF5B 3CMFA 4WIQA 5DUPL 2FX8H 3P3UA 5T1KD 4G7FA 2Q7NA 3ZKXC 4MXVE 1P6FA 4WUKL 4ABWA 3WD2A 4JTUA 2EEBA 2A9CA 5LGZA 5IB2B 4U1LA 5G5DA 3L54A 1KJ2A 3EOLA 4D6JA 3ARDC 2FDSA 1MJJA 1QYGH 6CGTA 3IM1A 1J1PL 3VFOB 3IT8D 1FWWA 1IGIL 1DBBH 3MRNB 2DIJA 1H1ZA 3VGAB 1VHNA 4XGZB 4BWLC 3T8XA 3QTPA 1EZUA 4XZNX 25C8H 3R25A 4N42A 3UO8B 1D7BA 1E73M 1XKJA 3UYPA 4S1SH 2J66A 2EQDA 3SE3C 4B4FA 4IXXA 1CIUA 4FI4A 5EO1A 2YEZB 3IJ8A 3U6WA 3PWLA 3ULVF 4ONFL 4LSPH 4C1LA 3A22A 3BGMA 3LLXA 2JK5A 4KJQD 2ADFL 4WTZG 3QZEA 2BHUA 2IQ9H 3DX0A 4EXBA 3B2MA 4C6PA 4NKIL 3PS7A 1RVGA 2Y7LA 2VDRB 3IS1X 1OYAA 1P7TB 3SB3A 4X8GA 4NQXB 3L3IB 2APBA 4JRXE 3OYZA 2PNDA 1E70M 3EPMA 1ZGLA 4OI9A 5F6HI 12E8L 1D6EB 3D0VA 4LBAA 2VR6A 4DVOA 5DTFA 4NWUL 1CK0L 2XVBA 3RPKA 2RDWA 4URTB 3FFCE 4M3KB 2DQIH 4TX8A 3HMCA 2IUZA 3SDDC 3APFA 5HJ3A 1OWQA 3IRZA 2YX0A 2B31A 2BVOB 1NWSA 1NARA 3S8HA 1CLYH 1AR2A 1V4YA 1B31A 4PTXA 1Q7ZA 1GOQA 3QUGA 1XI3A 3S3PA 3OX8A 1OGTB 2X1WL 3CXDH 1XGUB 1XR8B 2K6YA 3MV7A 3V5KB 4OTKA 1Z3GH 3FTVA 3HFYA 5IUSA 3AS3A 3X1EA 4R96A 3C5ZB 2B1AH 4GXVH 4P2RE 3TLRA 3CDCA 2Q0ZX 3IJHA 3FRUA 1KRCC 3O6LL 4O50A 5I1CL 4FMFA 1JPSH 4XWUA 2R0ZL 3E6HB 3AACA 2XQYG 4U6XA 1VFHA 5C0CE 1TQCB 1VADB 2F38A 1FGVL 1BQHA 2B1OA 2WZIA 2CA3A 2VLJB 2HT3D 2FATH 4XO9A 2HXUA 5ID1B 6ENLA 1J1OH 1QPOA 3TOPA 2C6QA 3DK2A 5DC9B 2DMBA 2VITB 3GUWA 2DQMA 3AZUA 1HE7A 4FXFA 1X1OA 4N8CH 3L5XH 3C5ZD 2HJKA 1AY1H 4GIRA 4DF0A 5J06A 4QYOB 2CDGA 4GZ7A 4PMXA 4X7SL 4Q7IA 1T1YA 1FO0H 5JH2A 1TYJA 4AGMA 4C90A 1ZLDA 4AUJA 2W80C 1Z9SB 3QCVL 3MBWB 4NNXB 4R7VA 2XU2A 3HHSA 2I69A 3F7LA 3ZL1A 4EI5A 2LLLA 1GQNA 1AH1A 2R8WA 3HR6A 1O9ZA 2VLJD 2GVGA 3ULUH 4M6ML 1FBIH 4B0MB 4UTFA 1AHWB 1DQMH 3HC4H 3ZE2F 2IH8A 4RSYA 5C71A 3QRGL 5EZIL 3OU8A 4DIAA 3LYRA 1WP6A 2MNWA 5CBJA 4ELMA 1KM0A 5C2CA 3JR2A 1W37A 3RHWF 1NIAA 4ATTA 2YXWA 3BW2A 3JYCA 3S34L 1NUDA 3F1QA 3QHZL 1KXQA 1F8TH 1ZMYA 3SBFA 3ARTA 3P4MA 4UBDD 1W1IE 4HFUL 3SKOA 1MJ8L 5F2LA 3PWAA 2G9HA 5DK0B 1TELA 1REQA 1QFUH 1EWDA 1I8AA 4LCCC 2WYIA 3NIGB 4FXTA 3CHRA 4M3JA 4TNVK 1Z3RA 2PYEA 1QWUA 3QOKA 4N8VG 4UV7H 1FVDA 1DFBL 2DEYX 2BP8A 3S6TA 3BPWA 3HI1A 1P4UA 3DMMA 1J1XL 2XOTA 3U79A 3I2CL 2QCFA 3FF8A 3KS0J 1E5YA 1FX6A 4GGBA 1GRWA 4LVEA 4XTRD 3EDDA 3D2UB 4MHHG 1WZ1H 5C09A 4EF8A 4HT3A 3F4CA 2LE9A 2DTML 3T7VA 4LASH 3W02A 2HLAB 1H09A 4AW7A 2FQDA 3MBEA 2IADA 3ZE0B 3WEZA 3WUBA 2D7NA 4IISA 3REWB 3LCFA 4CRPA 2BK8A 3UFIA 1I9IL 1QA9A 4FLSA 4NAEB 1C7SA 4OM1L 4UMAA 2YPKA 2NDFA 4F7TA 3ETBF 4H9XA 2AQOA 4MMZB 3W28A 5KUKA 2FT7A 1TZ9A 3TURA 5CGYD 4LFHG 2VZSA 5E6IA 1FWBC 3D2UD 4MNJA 5I8OL 4TMBA 2FFCA 2FECL 3V4PB 3WQDA 2J74A 3PZNA 2X10A 1EA9C 2H26A 3GSQA 3PABA 4KKAD 4CW1A 2UXFA 3BVJA 2ACQA 2AQRA 5HHMB 1H5YA 2NXYB 1S2AA 3PPCA 3CPLA 4NB7A 4TUOA 2Y1VA 2EC9U 5KYYB 2BP0A 3VW3H 4W84A 4RNFA 4P23C 5HP5A 4AKPA 4UQEA 1LE9B 2XM2A 3QJFA 3STFA 2GSIA 5K4XA 5B39G 2EDTA 4MAUH 3FTXA 1ROCA 3UX9B 1NFAA 3OGVA 2OYPA 3P9LB 1OZUA 4L1WA 3QARA 3KPOA 2WXGA 2BVQB 2WLHA 3Q9QA 3GSWB 3CSFA 4GYPC 4UOW0 1JE6A 2QPXA 4P3CH 2YQBA 4F9JA 3GTNA 1T2XA 1HOEA 3LGGA 4LUTB 2DM7A 3WIHA 4B15A 3FU7A 3RVWC 2QR0A 1Z0MA 4YO0B 2P8BA 2NXYD 4WSGA 2N3JA 3DUSA 2O6DA 4F7MB 1UR1A 3HMWH 3NCFB 1GA2A 4G83A 3LERA 3P80A 1KM1A 2UZPA 1I9RL 4G82A 4U1NB 3HG2A 2EEXA 1LROA 5L8KB 1LWJA 3LXAA 3U0WH 3KNBA 1GXEA 4FXGC 1M04A 5JQIB 2JKJA 4A2HA 4PGZA 1JP5A 1TMLA 5DEFA 3CLEH 2OX5A 3U82B 4R3SB 5HGDA 3RFZA 3GSNA 4M6VA 1SZGA 3G6AA 3PG2A 3LEVL 4L3EE 1HAWA 3OJVC 5EH1A 1UEMA 1IHIA 4OCYL 1UD3A 1VEPA 5CC6A 4DPBX 3DDGA 2G2NA 1XFBA 4PJAE 3NCOA 4HPXA 4TLSA 1RJZA 3FT9A 3VCLB 1F05A 5BOPA 4YSDA 2E8ZA 3AHYA 2B81A 4P4RA 5JUEH 2HUEA 4D7PA 5E8NA 2D7OA 4M43L 1RZ7H 2V17L 5D1XC 4LQFL 4NIRA 4HIJA 5KANI 2QCHA 1AL7A 1KPRA 2C9PA 1JUKA 3MRMB 2VFFA 1DQJA 4ZPTB 4EUPB 4XXWC 3FK4A 1QO3B 3BW9B 4ORGA 5BJTB 4CUCA 4BCEA 2W0FA 2IV9A 2WMGA 2E67A 1GZPB 4MAZA 2W60B 2BOBA 5AEAA 1R0AH 3GFUA 1E72M 3MGOB 3IUHA 1RUQH 3LHPH 4DYJA 3EX3A 4BWUA 4JG0L 1MCPL 3DHDA 2JSFA 5L7XL 3M88A 1FXQA 4JOMA 3OA5A 2A83B 1E42A 5T33L 3B8YA 5GGRB 2EIJB 5CP7B 2F53B 4ZMAT 3FB8B 1KYFA 3ZJAA 5E08H 2EVJA 5T3XL 5CFHA 4X6CE 3VX1A 1M1BA 2GPTA 3CVIH 2B9BA 2OGYA 4OBSA 1RJYB 1A1OB 5EB9A 1FPTL 3CSGA 3N2OA 1UB3A 3FB7B 1UW9A 1N0LB 2ATKA 3ABSA 3DJ9A 1D7FA 4B9CA 5DY3A 1CG9A 1U8QB 4J3SA 1E6SM 5D09A 3NSDA 3O3BA 4PREB 4M61A 3PS6A 4I13B 1AO7B 1W9BM 2IXVA 1SBSH 1C16A 5LB1A 4FQ1L 1VFFA 1KXVA 2XIQA 1YRKA 2F53D 3C5ZC 4MAYD 2HG5B 4YBLC 2AGTA 4B9GA 2WWNA 4LK4A 4Y7OC 1EANA 2EPLX 1CLKA 1MDRA 4JO1H 4BQ8A 2YK1L 4OFDA 4Y2NA 3CQIA 3R19A 3GD1C 4K3HA 4Q33A 5AOKA 3ZTEA 3I7RA 5I1HH 3S35L 3RWHB 5DLCA 5SX5H 1AO7D 3UEZA 2J7DA 2FUTA 3VKJA 1NGPH 2FVKA 32C2B 1BVNP 3NZGA 1AHMA 1FHNA 1SYSA 1PKQE 4OF6A 5F7YC 1IBZA 1FY6A 4UTJA 2ZWZA 2V9DA 5JZ7C 3CXHJ 1BRLB 1PKLA 1BXNA 2FMNA 4FFZH 2AOSA 4NWTL 4Q6YA 4F7KA 1IV8A 2XYLA 1MDTA 4BQ9A 5KS9B 5LGHH 4AQ1A 4UBDC 5E94A 3GX9A 3QG7H 4PRBA 2VDNH 4IIQC 3HRZC 3VM5A 5C7XH 2TSYA 3QPXL 3HJ0A 3BPNB 5HHVH 2QQLH 4ICMA 3DNKA 3E12A 3CQQA 4B3VA 3ESOA 4FA8A 4FQLH 5J5DA 8A3HA 1T3FB 1WFNA 1QI3A 5CZXD 3WV0A 2W66A 2JELL 1DQIA 1HIZA 2CO1A 3P77A 1D9EA 4PY8I 4JFZL 1MFBL 3C08L 3V0WL 1J8RA 3B2VL 4YGAB 4EF9A 2I5YL 1E40A 2Y1AA 2Z27A 3LENA 3N14A 3G6JF 3KOYA 3FO9B 1N5AA 5F9WC 3LRHA 5EUOA 1X7QA 5BO1L 1NFPA 1H61A 4QG6A 4UCFA 4U1SB 1L6ZA 5IQ9A 5H6HA 4HF5H 4W4QA 3QBTB 2GHZA 3TN0C 5LXVA 3US9A 1QW8A 1N55A 3UR5A 2OMXB 5FJPA 1ETZA 4YXLL 2CCWA 3MZTA 4MA8L 4PJBB 1A6WH 3BRFA 4ICWA 3UAFA 3MVTA 3O07A 2Z7WA 2OT0A 5CC7A 3DBSA 3GMQA 4H0IA 1LEIA 5CGYC 6FABH 1SR0A 1FAKT 1L0YA 1PV8A 4K8HA 1ZTXL 3G18A 4QIRA 1JNNH 1RIUH 4I0KA 1T89A 4KI5E 4QTFA 6XIMA 4UUJA 2MANA 4X3ZA 4PVNA 4BQBA 1YG9A 5E9NA 4ZUSA 3R8BB 3OSKA 2ZKHL 1IMHC 4BY3A 5E8EA 6XIAA 1N6QH 5A2LH 4I18C 3U30C 1TJGH 4XPBH 1IEHA 2ZCLL 2BMBA 4AOFA 4LL1A 4YLQT 3QEQA 4MJ5B 4EO5A 4KRUA 5CR1A 4M7KL 4R8WL 3L3GA 3GHPA 3NPUA 1IC5L 4Z7WE 4Z3GA 1O6SB 5CEZE 3LH2H 1ZANH 3ALWA 3CFBA 4JPIB 3VKAA 3UO1H 5HHQB 5IG7A 1U5HA 4LCIH 5EO9A 1W1ZA 2Z7KA 4JQAA 4N20A 4F5CE 5FPIA 3QIWA 4WCJA 1W72L 3FB6B 4C56E 1AG1O 3QNYA 4LXFA 4WU7B 4KZEH 3KXFB 1NCOA 2AEQH 1HL2A 1F90H 1H6UA 1D5MA 1F4YL 3P30L 3LCIA 3UD6A 3ULSA 3OL2A 4FQPA 1JFQL 3KLHC 1KRBC 3AU0A 2X6BA 4U4MA 2A77L 1JCVA 3AS2A 4M19A 4BFIA 1EZVX 1PAZA 4EWJA 5LIKX 4ODXB 2JWYA 1E5NA 4ZR8A 2YKLH 1IC7H 1GJIA 3OR6B 4KFMA 1XLIA 1UGKA 3GG1A 2WQXA 3I3EA 4H1LH 4BFGA 5IHWA 1IQDB 5HYQB 1CGXA 5KJRH 4YXKL 3PZQA 4KQ4H 1P9MC 2UUDH 3KXFD 4MLSA 3QVAA 5BOJA 1XH1A 1KFBA 4LOUD 2VTFA 4QLKA 1MCSA 2G97A 3SHSA 2PYFB 4XNZC 3D6GA 4LPUA 1KIUA 4O02A 3IJEA 4WGVB 3APYA 3MKCA 1OW0A 4O4YH 3Q2CA 5JDSB 5B7FA 2OK0L 4K1WA 1U8JA 1U8KA 3HIZA 3SPVA 4LHUB 3DIFA 3ZE2B 3FTGA 3DO4A 2VGIA 4QRFA 1Q6EA 1X4YA 4H8VA 2ZONA 3GD6A 3DUGA 4HEPA 5CH9A 4FHBD 5H4ZA 4KRMB 3DGDA 1RJRA 1GQKA 2ZQ0A 1UM6H 3MR9B 4Z7OF 2JGYA 5TDPA 2D0GA 3HLKA 4LF1A 3NZRA 1E28B 1IFGA 5FD0A 4JLRA 2Z4TA 4C57C 1CIDA 2BS71 4A6YH 4GSXA 3C2EA 3VSTA 1B3YA 3OBEA 4H25B 5A3ID 3WQ8A 2QDWA 4ONHB 3QUMH 2AEPL 2FWSA 1MLCA 1VCFA 4AGQA 1XIMA 2F19L 4MXQC 1M4KA 2I07A 4MKNA 1MCJA 4LHUD 1A3RH 2QDGA 1MFUA 2Y0FA 4NNPH 3CK0L 4HLJA 2W91A 3VABA 1FWIC 3W85A 3NSXA 4EDXA 2A74A 3FV9A 2WYHA 3HC2A 1DJWA 1MQKL 2J77A 4Q4RA 4M1CC 1I8MA 1IEXA 2LU5A 1HJQA 3HURA 1HXKA 4KY1L 2RA1A 3E1ZA 3NFPA 1XIFA 1JWUA 4EN3A 1BG4A 4WWPA 1U8MA 4HKXB 5HJXA 4XN8A 1LHZA 2FT6A 4PJXA 1A5AA 1ICTA 4MAYC 3K4AA 5ITBH 2V5TA 2MTAA 3E0WA 4TOQA 4ASTA 1OWRM 2HKAA 1DBAL 3LB0A 1ZNNA 1K8ZA 4XUGA 3S8WA 4BI7A 4KJPC 1ZSDB 1W6WA 5DHYB 2PKDA 3ABGA 1URIA 1KNWA 4XAWL 1PSCA 1EZ2A 3TVMA 1RJPA 2PF8A 2R91A 3DX8A 4O16A 2IKGA 3WLIA 5AW8B 2J8UF 1A6TB 1E0UA 5E5MB 5D1QA 4UOJA 3EBGA 5AG8A 1G7LA 1WWAX 2H6OA 1UKOA 4KTGA 4M00A 2ZT9C 3PDDA 3PN8A 1SGJA 3EFOB 2HFGL 2H6PB 4ZFOL 1NBZB 5IVZB 2O4MA 2OPJA 4GYFA 4B16A 4Z95L 3KZ8A 3JWNG 4PJ7E 4MWAB 1OX5A 3MCG1 1T6VN 1HKMA 4FXRA 4N9EA 3ARFC 1RBAA 4YBQD 3PWJB 2DMHA 5K9OB 5FACA 3W1XA 5D4QA 3QMSA 2MHAB 2ENQA 3QQ3B 3L9EA 4AZ8A 3TIEB 4H26A 1P5UC 5I6LA 1UOWA 1IC1A 4YVXA 4ZZKA 1CT8A 2GJRA 2ASHA 5IVXA 1ZAIA 3VVVA 2XJKA 3WH8A 2HWZH 1O5RA 4PRWA 4DGYL 4ENZA 2SODB 3MNDA 4GT7A 4HS6B 4HK5A 1BXUA 1X6LA 2IXQB 3BRGC 3K1KC 4WV1A 3TN3A 5DRWA 1FKWA 1UKSA 4LSQL 4IKLA 1JTOA 1R3HB 3LHYA 4MWAD 3PPGA 5D72L 3A6OA 2OX1A 4QNEA 4HCHA 4XZWA 1D6VL 2GCYA 4ERGA 4WY7H 4BH8B 1G1YA 5EOTA 2XIDA 2B0SL 3Q45A 3GZ3A 3E5PA 1AE6H 3N40P 1OIFA 3BPNC 3A6BL 3WIIL 1SN2A 4N0YH 4XP4H 2X28A 3C0QA 3NNTA 3PNWB 1BDYA 2CJSA 1AQDB 5DD0L 2YD3A 5CPOA 3UWUA 4X60A 2OO0A 3II1A 3RX8A 4GKTA 4FCHA 1KYDA 3QUYA 1LUCB 2APVA 3LS9A 3GMPB 4LCVA 3HU7A 3SY0A 1A5SA 3ZZSA 4B7IA 5E0CA 3DVGB 1I85A 1WF5A 2VT0A 3WENA 5SWUA 2JFEX 1VLIA 3TWCH 4LCYB 3TFXA 2CE6A 3S1XA 3EOYG 3EO0A 3ULUC 3H22A 3HQ1A 1HYSC 4GHRA 1OO2A 4HOXA 3P9MB 4CSZA 1MCEA 3E2VA 2J4GA 4R7DB 1JZEA 2W9EL 1NCWL 5I3JA 4LRTA 1TA3A 5EIVA 5CO1A 5AVQB 1TE6A 3P67A 4KUZH 5IESH 4MQ7A 3I6LD 4O1FA 4JE4B 1OX6A 4RPPA 2WKOF 4NCC1 4NZTH 4FN0A 3C5XA 5AD0A 3PNRB 3IDNB 2VXTH 4KRPB 2V7NB 5LG6A 2CC0A 2CKRA 4RQQA 2Y0SA 3EF4A 2Q6WA 3IS4A 3WH5A 4MNQB 1W0WB 4E9VA 3TV3L 3GB7B 1DHPA 1IQ8A 3WL9A 4FR1A 3QQDA 1COBA 3KEHA 4YR6A 2WANA 1MZRA 4IFKA 3J2PA 3Q58A 1IAOB 1A7RL 2CBTA 3RMEA 2ON3A 2HISA 4XPGL 4X5WB 4W70A 3Q5OA 4P2YA 1E4KA 4MZIA 1ZT1B 3CFJB 5GISL 2UWEB 3D48R 3VRIA 4QTIH 3BLEA 4B9KC 3BPCA 1T5XB 5AHIA 1XFCA 1IGFL 2WHMA 1XGYH 5IT2L 4KRPD 2X12A 4MB1A 3KBJA 3H53A 3JSSA 4MNQD 3KBHE 4ZO6A 3S2CA 1UWGH 2EADA 3EH2A 2VL5B 2X1UA 5IHSA 4JFQB 5EYWA 3VFMA 1P1ZB 4Z3JA 1MWAB 5JOPE 3IGLA 4NY2A 4HJ0C 3HNSL 3M0JA 3OHMB 1EDQA 3R18A 4WW1B 1JHLL 5ADPL 2VLRA 2O6PA 2EYTA 4LOUC 2FX9H 3VU1A 1S2UA 3AQUA 5AHLA 3T55A 3O3AA 4OZHF 2FKPA 1EHLL 4NC1E 2XZCL 3M64A 2AZUA 4TV5A 1B2WL 5G4EA 2DQWA 4UCGA 4A2RA 1KIQA 5J12C 1KJMA 3ZKXB 1F3XA 5XIMA 2QKIC 1XSKA 5BMFL 2EDQA 5I1EL 1USQA 3FSWA 3N1AA 1LDSA 3ARDB 3ZGHA 2BSRB 1YPXA 2DGAA 1S7RA 4N1CA 5HGHB 1E0XA 4U3SB 3M5XA 3QHMA 4IPNB 4MJMA 3NEVA 3H4HA 1M7DB 4BEIA 5B3JE 4NZ8A 1MXSA 4ZTPL 2CO6B 5I1DB 4BZ1L 1FORH 2DFAA 3MJ8A 2A4CA 3EOEA 1MHCA 1V51A 4OLWH 2EDYA 5A3IC 3C60C 3K80A 4L4LA 1SNRA 5FO9A 4OR1A 2EDXA 1INEH 5B38G 1FAIL 1PIFA 1N4XL 3K46A 1S9WA 4X98B 2ZZUT 2J4WL 4WU5A 3ARDD 4GW1B 4RXGA 1ISWA 3F2DA 4IRJA 1X5YA 3ZE0F 1BGAA 5CEYB 1LO4L 2H9GA 1G4TA 1NCDH 5KVDE 4MZ1A 3WD1A 2W59A 1PZ5A 4QO1A 4P57A 1JAEA 4MZ2A 4XBEL 3BO8B 3F83A 5DRXA 5SV4A 3S36H 1V05A 3HZYA 3ISIX 2VYRE 1OK0A 1X9UA 1BJ1J 4B6ZA 2F7QA 3UTTB 4OZIA 2GZXA 2F08A 3CVDA 3SDDB 3CHOA 3VD7A 1GHFH 2NCMA 1OSYA 3BZEA 4G1KA 4E3VA 2EJAA 1AC6A 1PTAA 3RAJH 4O14A 3ISYA 3BD3A 2YBRB 2WQWA 1L7TL 3W2DL 2YA1A 5CN1A 1EC9A 3C5QA 1KO0A 1J5SA 1YNQA 3KGRA 5E6ZA 3W2JA 4K9EC 4YE4H 3VOFA 1ZS2A 2J6WA 2XH4A 4OCMC 3I6KA 5JPMC 3UTTD 3OMZA 2ZD0A 3AADB 2B0MA 2BSTA 3SDDD 3HA1A 4Z1DA 1UZ6F 4KHTL 4NIYE 1VKFA 4KOCA 5E2WL 2QCDB 3MBXL 3ZTJH 3C2OA 4QR7A 4UFLA 2A6DA 4DKDC 1QRNE 5IJKC 5I0YA 5L6YL 4JZ5A 2WQAA 1GAFL 1DE4B 3ZLQC 3LI0A 4PBXA 5D7JD 4YBQC 4Z77B 4TS6A 2BHFA 4Q97A 3VXSB 1CDGA 1A9EB 4BWTA 2H47C 4LSTH 1EYWA 1KLUA 4HUWB 4CD7A 2W67A 4X50A 2GUOA 4XNYL 2QUNA 4FF9A 3PSVA 5I5JA 4KROC 4JKLA 4EEEA 4RIRB 1P69B 1XGPB 1LRQA 3V0VA 4HPYL 5A16A 4I9XA 2GJ6A 1GT8A 2FPVA 3S7GA 4NRSA 3LOTA 4YYFA 3HLAA 2HMIC 1U8PB 3SGGA 3L9CA 4J40A 1BF2A 4V1YA 5AVTB 3ZDXE 3FQRB 4MWAC 1TPUA 1ZUAX 4MZ8A 2W0UA 1XDLA 1L0XA 2GWGA 4FGMA 5DHVA 2JEQA 3C8DA 3UTQA 1Q9WB 4F2BA 3VXSD 5M94B 4OZFB 3VH8A 4UTLA 4NI8A 1GOGA 4YUEH 1K5NA 5HHPA 2W61A 2B7OA 2UY6B 2UY2A 3EJPA 3TBWB 5IEHA 4RGND 1TJHH 3D9AL 1WYIA 1R9YA 3S3DB 4LPYA 2WQVA 4XD3A 3M0LA 3N73A 1LLOA 3EX2A 4QRQA 3QQNA 2NDGA 3T8VA 5CEZH 1G7IA 5I18L 4Y2OA 3D08A 1PD1A 2ADJB 2WNKA 1YEGH 1OB1A 7TIMA 3SE9L 2PPDA 1CBJA 4F7PB 4CQ9A 3JWDL 2J9XA 2Z91B 4IOSA 1U33A 1CD1A 1RI8A 3AMDA 4UNKA 2NR6C 2WNZA 1JDFA 2PLMA 3HVDA 1RXLA 3EB3A 1IBGL 4YDZA 4Q3MA 4KKZA 5I30L 4XKYA 1PCXA 5FLUA 2E7LA 1TQVA 3HMJG 2VZVA 5F9JB 1IGJA 4GMTH 3W2UA 3QZWG 2DZVA 3Q3GA 2DQDL 3B5TA 5LBSH 3N55A 3F12B 3U5UA 1TX0A 4A22A 3V4PL 3SECA 4ZTEA 5DT5A 2TAAA 5CBEA 4UTAL 1EQCA 1YMMB 2QLVB 2X30A 4JE0A 3WTXA 1OARH 3R43A 3MWCA 3OKLA 2D1ZA 5F3FA 3TZNA 4GAAA 2DKSA 1O95A 2CNYA 5CF3A 1Z7JA 1CGUA 5TQLA 2VNCA 3DWTA 1DL7L 3DX6A 1FH7A 3OKNB 3I9GH 1NC4B 3K13A 5ERWA 3LQZB 2ZYFA 2P5WA 3MLXH 4TSAH 3WU1A 4KRPC 4KCVA 3EOTH 4G7EA 3PHOA 4LS2A 4P23B 5JHAA 3NVDA 2DJMA 4RMTA 1XB8A 4ZQTA 4AIZB 1YMMD 3LHUA 2R51A 4ZCWA 3QF0A 4YDMA 1H3WM 5HK4A 1DXEA 5H8UA 4G7VH 1IGWA 3KR3H 1L9OA 2WZ0A 2L04A 2ATSA 4R2GD 1ALDA 1Y6NR 1AGEA 1F3JA 3R0KA 1OOAA 2FFIA 3DAQA 2RHEA 1J5OH 1GJPA 2A6IB 3A3YB 3AU2A 4E42B 1F3RB 4U4BA 2PLTA 4IPLA 1NC4D 2VD9A 1CGWA 5HHXL 4PTNA 2IQAA 1YUHB 3QDGB 4ZW5A 4JQIL 1N59B 3HNTH 2KC0A 1G7MA 4UTKA 4MPKA 4P23D 4M8QB 4O0KA 5KINA 2ENPA 2DQTL 4Y7EA 1ZXQA 4AIBA 3WKMH 4GO9A 1L9PA 4JJ5A 2BVWA 2J8UB 1V7AA 1EJWC 4WWNA 3M17B 4LLUB 1RZJL 3MHUA 1W2VA 3CFIC 3ABXA 5I17A 5DF0A 4PWGA 1VFMA 2R1WB 1LVEA 2MCPL 3HGSA 2AXFB 2GJLA 5B4MD 1ZAHA 3MACL 3DTDA 4J8RA 2EVHA 1MHHA 4UNLA 1E30A 4PJHA 4CMMB 3LTYA 1CICC 2IDCA 3QDGD 2XDHA 2WBKA 1F4XL 2J1YA 3RTQA 1XLCA 3HRPA 3E0FA 1S7TA 1OB0A 1IM9B 1GMEA 4LVBA 4JFDA 3DG6A 1WX0A 2GTQA 3D5HA 5CGMA 4LAUA 4AH2A 1A3WA 3DFNA 2WNGA 3ZR5A 1WKYA 5D1XB 1PCSA 2Y8KA 1NJ9A 4HC1L 1HI6B 5J8OA 2VZ1A 2Q8AL 1RVKA 4XNXH 3MRJA 3HZKA 2WC7A 3WIAA 4F57H 1A7OL 1LP6A 3VIGA 4XZUB 1L5GA 3SKNB 1AS6A 2B7NA 4DWDA 4PJBF 2OPCA 1IX2A 1AIFA 5GRYA 1BWKA 5AW3B 4A1RA 1T7VA 5DRNA 2QCGA 3L8QA 4RDBA 2KH2B 1IM9D 1XIJA 2C0HA 3CFCL 2J27A 4XCCL 3F7JA 2AKRA 1F3DH 5D2NA 2WLIA 4U6HA 1OAXL 1U8HA 1MCBA 1TV8A 3W6LA 4HBQA 3AQXA 4WFGE 3F7KA 3DROA 5AN7A 4NXSA 1POKA 5D1XD 1GSKA 3V7AE 1V54B 3S5SA 3RJYA 3L1OL 4NENA 1UKTA 1FZKB 3H2CA 2BNQE 2V2HA 4TUKL 3CXFA 4LCUA 3BUVA 1IT8A 2XFXB 4G43A 1OPGH 2DBLH 4EIUA 4OGZA 4P04A 4S1RH 3WLBA 5CSRA 1CLVA 3EJCA 3FQXA 4S0HA 1T66D 2OR8A 4KCUA 1FNGA 5AVXB 5AC5A 3QUKA 3QLLA 5DYOA 4ZUTB 2E7BA 4X6EA 1AQHA 4YL2A 3RIAF 1H0IA 4KK9D 4JZJC 4L8CB 5HPMA 5E09A 5HULA 5KSUB 4YDKL 1QLFA 3Q13A 4CCZA 3QQ1A 4E8DA 3IIVA 4LOEA 3ZYIA 1FWTA 3WK0A 3LNDA 2OOFA 2A6JB 4WFFE 3D39A 3G24A 1A6AB 2ADIA 4YBLB 5D7JC 1A9VA 3TJEH 2BIOA 3BLKA 3DX7A 4WTZA 4Q9BA 1N3NA 2VN7A 4WW2A 4Y6GA 1RZFH 4DGUA 4PLNC 3V7PA 1I7ZA 4QAWA 4J28A 3THQA 1NLBL 3G6DH 5F0MB 3RVVC 4PUEA 4W9LC 5GRJH 1A9BB 1DWFM 1RQ5A 3B3IB 1FN4B 1JDEA 3QY8A 3HBGA 4MMXA 2EIKB 1I9JL 1UZ1A 2Y36L 3G08B 2DP3A 1WBZB 3KM2A 3QEUB 2OR2A 4HU0A 3NQCA 2DZUA 4RETB 5C55A 4Y9PA 2I27N 3OBAA 4LOFA 4UMSA 1MCOL 5CR8A 5FHAH 3AIVA 2HRPL 1UWTA 1GZ1A 5ISZA 2VDLH 2VL4A 2WMJA 2IH3A 1WBJA 1BFOB 4RGNC 1FFOA 4ZD3L 4IIQB 3HRZB 2YDSA 2EKSB 3PAJA 2W79A 1O7VA 5T3ZL 2B08A 2BSDA 2YXGA 3Q37A 1XYLA 4X7EC 2A0LC 2YRBA 2R0KH 4HZLA 3HI5H 5ABEA 4TVPL 3H2QA 3FJNA 2XQYA 3GMMB 2DLFH 1RR2A 3WBWA 4P9MH 4OZHB 2WUCH 3W1RA 1ZWIA 3LIZA 5FCUL 5JZ7D 1DVUA 5HR7A 1BVKA 2B7DT 3WBAA 4W88A 4OLYL 4Y19E 3O4LB 3V3WA 1F42A 3FN9A 3B3DA 2P7TB 4L37B 4ZW6A 4PI0A 4AG4L 1XB6A 5ILTL 3UJFA 1ZTMA 5F9WB 1R9ZA 2F54B 3CCHB 3V0EA 4KDTC 4MJZA 1UJ3A 4RV8A 5BV7H 4CD5A 2Y88A 2Z31A 3DXAA 3F4NA 2V8ZA 3M43A 4GG6F 4IUOA 3ULVL 1PG7H 3TN0B 5L9DH 1J2WA 4LKCA 1MW0A 3VTMA 4NILA 4G1NA 5FYLL 1F6LL 2FAUA 4HZAA 4BXSV 3BT0A 4IH3A 4RCXA 1R4XA 3OKKB 4B5VA 1WWWX 2GK1B 1E9OB 3MCOA 2K8QA 3DYPA 4LU5L 2V81A 4F9PA 3O4LD 4NKOA 1JF1A 1XGTB 1S2VA 4QOKB 1JJKA 2UXGA 4AIEA 2PRLA 2IWEA 3A23A 5K3VA 4DN1A 2CDFA 2F54D 2Z93A 1B88A 1ZBKA 4E9XA 4M7SA 3P9WB 3DHFA 3S5LG 1TZHA 1WZKA 3D0LB 1TU2A 3G0UA 1EXHA 4PUMA 1DUZB 1A7PL 3VXMB 3UP1A 1ISXA 3TN0D 2FSEA 5MEOA 4G5ZL 2ZYHA 5C0AB 5JIDA 4R3UA 4A63A 2CETA 3GJFA 1ZHBA 4I18B 1BVNT 3U30B 3WN5A 2BZCA 1QSFB 4D3CL 2ZFAA 4DI9A 1CBGA 2XKNA 1MFVA 4Z2HA 1CZ8L 5KBDA 1BJMA 4R2GC 4N8VA 4P3WA 1JPHA 3WJMB 4QOKD 4UTBA 5JOFB 4HX1A 2B59A 2CZVA 2PWEA 2PPFA 3V6FB 1WHPA 2XTSA 4I77H 4WI4A 2J6EH 3LPOA 3IAGC 3H56A 7FABH 4A8NA 4X0KB 3T9WA 3TF7C 4NKMA 3VXMD 1UQSA 1UT2A 1JV5A 1CF1A 1KQYA 3PXJA 4OD1L 4S39A 5C0AD 3B43A 1GQLA 1HSAB 4J7RA 4PC8A 3RL1A 3CTLA 5C08A 3FUDA 6TIMA 2C3HA 3VNJA 1QSFD 4EPEC 1VPXA 4EDWH 1BOGB 2VELA 4ODHL 1WJ3A 3WBDA 2EJ1A 2BW4A 2JQXA 4JNZA 2VB5A 2ZUMA 3OO2A 5B4MC 2AABH 1WE5A 5C07E 5C9JA 4NX5A 3MRHB 3DESA 3H3KA 3MHFA 4WEEA 2F84A 2DI8A 3QZOA 2VRQA 2Q8BL 1B4RA 4JY8A 1NTHA 2OEKA 4BFKA 4CQDA 1U30A 2AK1H 1HKLH 5I2IA 1Z0NA 4JO2H 4PGBB 2HX7A 1KA9F 3T4WA 3W7MA 4QEGA 5E9XA 1WFOA 4AQ8C 3CFDA 3S3JA 1HHGB 3KZPA 4TNGA 4D8AA 5FC9A 3KLHD 4AMAA 4XNZB 3UC0L 1MI5A 3K4DA 2WGXA 2ICES 1QVOA 1FYTE 4WXZA 5GS0H 4IFOA 3GU9A 4HKZA 3US0A 4HKJB 4PMZA 3GMNA 4FFYA 3VX0A 3K2GA 5HJGA 4OM0L 4ZOAA 1ENUA 4X4YA 5FUZH 3KBMA 2VKZG 2D20A 1OAQL 4WGKA 5KVGL 2DEWX 3UZQB 1J5CA 2VHLA 3R13A 3U2OA 1J4EA 1W1VA 4OLEA 4BCYA 1DVZA 4XPAL 2BX5A 3JBG7 4AM0A 1R5VA 3SKMA 2IEPA 2VKXA 3GMLA 1S5MA 4J8QA 4RAVA 4HUVA 4OJAA 3N85H 2ZYSA 4Z7NB 2OYKA 4JY5L 1A0EA 2H8ZA 2D7TL 3R7MA 5LNRA 4RLIA 2C9RA 2XUWA 1JNJA 3O6DA 1W5NA 5DD3H 4PTVA 3VXTA 4V28A 4GOSA 2Y72A 2P28B 3SQOL 3QS2A 4CL7A 3HKFA 2HZHA 5KSWA 4U1MA 3RMJA 5E03A 4PB9L 2QZ5A 1T20B 1GKQA 4HPHA 1AQ0A 3UQNA 3STCA 4NUPA 2DLHA 3C6SB 3P8IA 4R5VA 4D2JA 3PDOB 4UWMA 1T66C 4GQ9L 3TCEA 3Q4DA 2Z1SA 1KPVA 2KMWA 3S96B 1MRFH 2WLLA 5FM4A 4ZZ9A 2PPGA 4KK9C 3GSXB 2R29H 1E65A 3VFPB 1I0BA 3IIXA 2NW0A 2VLKE 5DK2A 4NHCH 4JANB 2OSLA 4MXQD 5D7IB 3TH6A 4NLHA 3W56A 5DZAA 3T2PA 4MAYB 5LVEA 2PP8A 2EBNA 1WG3A 2A2IA 3VXNA 2UWEF 3WK1A 3AIEA 1F7BA 1QO5A 4P5KA 1R5YA 2CEQA 1DCLA 4QLRA 1EJ7L 3VI4B 3VD5A 2OQJA 5C5YA 3L1GA 4M1CD 4QT5B 4BDVB 1L8PA 4MF4A 4OCNC 3EYOA 4LARL 3T77B 3D30A 5CSZB 2CCRA 2V2XA 2PGEA 1CU4H 3ALXA 2G5BA 2L5HA 1X5KA 3KLLA 5IW6A 3TYGL 1KYAA 3HBQA 4GW5A 4B5WA 4MFEA 3GLCA 3F58L 1IT9L 2YAQA 4ZUVB 5JHDB 2ZP0T 3MQIA 2YAPA 3CWOX 1K77A 1S9XB 2ED8A 4KJPD 3PJSB 3ARFB 2CD0A 3IU4H 5KSVB 1ITBB 5K9QI 3ZGIA 3QQ0A 5I76A 1P5UB 1EUTA 3FNDA 1A3LL 4QWWD 1XCQA 1G7UA 3B9KA 3DVNB 3KMDA 2CIIA 1ZA6A 3FT0A 2DJXA 4Z0BL 3C6LC 3NTCH 2X1XR 3F6LA 4E9SA 4F9LC 5I7GA 3X3FH 1Z44A 5JHDD 3S6OA 3E2HB 3QSKB 4ZS6D 1F61A 4TPRH 3LKRB 1WV7T 4ZNCD 1KEGL 4NAFB 3ARFD 2P9RA 2XGZA 4FI6A 3MCKB 3B40A 5DXXA 4OAWA 5ABZA 1Q9LB 5T1MA 5HYSG 1R5IA 1MPAL 3EYUL 1BYBA 4UFIA 3YPIA 3TBSB 3FKRA 3UPWA 5IZ7A 4WHYH 3CUGA 2EDNA 1KGWA 2P44B 1IGYA 3HPJB 2W63A 4LHQB 3BICA 3SOBH 4GSDL 4OGXL 3KBVA 2J88L 1FO0B 4LRIA 4GPNA 4UT6A 1I1YB 4JTAA 4YTUA 4RWHA 5A8OA 5FKAB 1YC8A 3FJ4A 5TDOB 2CHXA 2PWDA 3K8KA 1LQBC 4AAJA 4K0OA 1DQKA 1O60A 4MAVA 4QF1A 4CILA 4X4ZA 4U1JB 2A85A 1FFRA 4YVNA 1OALA 5GZND 3SUUA 2D22A 4XNMA 4IXHA 3D8MA 3BJFA 2ZUVA 2J62A 3AAZB 4FQHB 3IDGB 1OTUC 4AC2A 4H8PA 3UW6A 1EEUA 4HWZA 2QF8A 4XXCA 3QTGA 4ZQPA 2FHCA 1JPMA 4P9HH 1OQXA 3FIGA 2BZDA 1IAKB 1UOZA 2R69L 1VPYA 4ETQB 3WXWH 2CKBA 1M7PA 2ZP9A 2K8MA 1H5BA 1SN0A 2NSMA 4XIAA 1EBPA 4Z0XA 2X2YA 1BQUA 5D03A 1IYXA 4JO5A 3Q2NA 1MF2L 3ULUD 1BTCA 1HYSD 5DZLA 4CU8A 3L3OC 3GR8A 2C3ZA 4LUSA 2N56A 3P2VA 4CQ8A 2HG0A 4L5ZA 4HK3N 3GNXA 3IS0X 4X2PA 1FNSL 1RQHA 3SE4C 3FCSB 3PAVA 2HS8A 1LL1A 4G6JL 3ASOB 2WLJA 1ONQB 1RD5A 4XQ6A 1J8SA 5C0QA 3HC0A 2Y5TB 4M5ZL 3WQ5A 1D5ZB 4N2EA 1QMLA 3VZZA 2FJKA 1D3CA 2X1QA 5DQ9B 3DG3A 3GZPA 4QXGH 1LYQA 2NZIA 1MNUL 3I3BA 2FJGA 2FWUA 2IFFH 4PQXA 4Z7UE 2IAMC 1V77A 2LW3A 5JBFA 3QG6B 5E1AB 3MSPA 5E99H 3T6VA 3BUBA 2YSSA 4L8SC 4MX7A 5ICYB 4M6PA 2DQJL 1OP3K 1MJ7H 3DGCR 2FQIA 1KENH 2VVNA 3MA7A 2OMYA 4W9FC 2XC8A 4WI0B 2X4SA 3IDIA 4YHYB 1KGIA 4UDUB 3PZGA 5IBTL 1PDZA 4BFRA 3WKQA 1CO1A 5H37G 3K74B 3QT2A 3JVAA 1E27B 1FCGA 4NYUA 4QKTA 2VAAA 1HXYB 4K71C 5EU6A 5J12B 1BYDA 4GY1A 2DZAA 4QTHB 2QKIB 2YAEA 4PJ5A 1QRQA 5KZEA 4NQQA 2O4QA 1JZHA 4Q8PA 1TYRA 3BT2L 1F6AA 5E8OA 4HJ0D 4RAUA 1X38A 3H54A 3FQUB 3GWQA 4PSPA 5HMFA 3GXMA 5HJBA 5I3DA 5J1TC 4X4MA 1E0TA 1ORQB 3V5DB 3KOWA 4F2TA 3UTSA 2IPUK 1V3MA 2DPEA 1TVPA 5ESQB 4DZ8A 1VDGA 2P3EA 3PP3K 4JMNA 1TMCB 2YD2A 2YZ1A 1BM3H 3TA6A 1ACYL 1E9YB 4HZ7A 3C60B 1BIHA 3MRIA 2E4TA 3U4EB 1JUEA 2X2IA 1VZIA 2XT1B 4RMSA 3Q1SH 1KGCE 5FYKE 1KOAA 1ZLWH 3LZ3A 1KNOB 1XYCA 1T1XA 1J9YA 3W0WA 3NQDA 4H9MA 1MCRA 4YDIH 1IGTA 3WDIA 1AP2A 3QRHA 1RUKL 1F45A 3M47A 1XLMA 4DK6A 3IGHX 4AEOA 4LPVA 3R10A 2HV5A 2CHOA 3VE0B 2GBAA 1LLZA 2DW6A 3RHWK 3NO5A 5BXRA 1CTOA 4JRYD 4N6QA 3C60D 5ADOL 3MJWA 4AIOA 3VKCA 5JU6A 3A4DA 2E9JA 2XTKA 1A8JH 3OB0K 4K94H 5EC2B 4BA8A 3D3VA 1V6XA 4PRIB 1ULVA 2WLZA 4ILDA 4QCIA 4GG6B 2WCAA 1FNAA 1NGYB 2UZXB 3L5LA 2PU1A 2NNFA 4RVBA 5KYWA 5CMAA 3L7EA 4K3EH 2DS4A 2Y3NA 4XCNB 1D8CA 1SHXA 4HHLA 1I2OA 4YHGA 5JHLH 3T0WA 4P2QB 3N2TA 5KVFE 4A3RA 3TL5A 2Y5SA 3AG4B 5JPMB 3QYCA 2XG4B 2DIKA 4CVXB 1D7DA 1ELSA 3ZU8A 2OTPA 2E74C 2AJZA 2IANA 5C0IA 4PRID 5D9MA 4PMYA 4YOKA 5HGGS 3G5EA 5CLXA 2A7BA 5F7WC 1VQTA 3LNMA 1A8ZA 3FEMA 3BP7B 3F05A 4OLVL 3P4NA 4GS7B 2XNAB 3CG8A 1GVSA 2OU4A 2PUZA 2Z25A 2DPKA 1U8IB 2VR8A 4NP7A 4JPGA 2NY6B 4OT1H 1X7TA 4P2QD 1LO2H 3B37A 1SXBA 1SO3A 1JGVH 3GYRA 1OYBA 2WV3A 4DEFA 1SY6A 4QWWC 2BRRL 3MJ9A 2VWTA 2QQNH 3O6ML 4KROB 3NK3A 2E09A 1F07A 1CGVA 3SQBA 1QPKA 2QZQA 1DQDH 1WCBA 3LM3A 1XP3A 3VFUB 4OUUA 4H0HB 4KIRA 4KITB 4FP8L 3DPDA 1TJRA 2VN3A 4A3QA 2XWJA 5LXGL 5J0BA 2ZXWB 4NT6B 3B8VA 4YXHL 4ZS6C 1NWRA 3MSRA 3SFWA 4GY0A 3WFDL 2AAAA 1HCZA 1VRSA 2NY6D 3P6LA 3SY1A 3UCQA 4GSRA 1CGSL 5J57B 4CNNA 4H9ZA 1U3ZA 5AB2A 4N2AA 3QWOA 4KROD 4H9TA 2CIKA 4CVZA 3C3NA 2PDUA 2FJFA 4K8RH 4HULB 3WF4A 4KWOA 3UWEA 4UR8A 1VJSA 1SSDA 3BEWB 3OHXC 1RULL 4O0ZA 3NJIA 2HMID 1QU4A 2BSSB 4TQEH 5B22A 3SDXB 2P8LA 4DJDD 4PODA 2X53A 5DT1L 1U3JA 2ACUA 1B4EA 1J87A 1HHHA 3E2HC 3OLDA 1MFEL 4HFWB 3H6OA 3LRLA 4G6CA 4REQB 4U6YB 2AKMA 1OF2A 5M1TA 1CENA 2ZWKA 1Q72H 5C3LD 2ZKXA 3O11B 3WJSA 5K1VA 4LAQL 1CXIA 3G5WA 4M1DL 2TRH