5EMYA

Human pancreatic alpha-amylase in complex with the mechanism based inactivator glucosyl epi-cyclophellitol
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
publication title Glucosyl epi-cyclophellitol allows mechanism-based inactivation and structural analysis of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5emyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5emyA01
4UFLA 1JNEA 2DIJA 1UR4A 4GINA 1W9BM 3GXMA 2GJXA 4KRUA 3KWXA 4IUGA 2DSUA 3W4RA 2EACA 2BY0A 1LF1A 4C7FA 1E55A 1XHGA 3AIEA 1PIGA 3VIGA 1R86A 2BVTA 2PWDA 1VFUA 4Y7EA 2J79A 4FLSA 3GNRA 5I3DA 5C8BB 3WD1A 2ZUTA 1H0GA 1V0LA 1K9FA 3SURA 1AQMA 3BLKA 2WCAA 4MB4A 1B3VA 2E9LA 3ZT5A 2CCRA 3DDGA 3BAIA 4JFSA 1CGWA 4DWSD 2ZWZA 1V3IA 1JI1A 4PMQA 1W91A 3ZOAA 1FHLA 1RD6A 2XWDA 3PZUA 4JZ5A 3CHFA 1PS3A 3CUIA 1V6YA 4CU8A 4NF7A 1J12A 4QFUA 1OD8A 2EADA 3EDFA 1AMYA 2UY4A 2QV4A 3MU7A 3BUBA 1IZJA 2D0HA 4S3JA 4IISA 3ZSSA 4XUYA 3K8LA 1GJUA 3TONA 4AEEA 1JZ3A 2J75A 1E43A 3WY3A 4P8UA 2JIWA 2PB1A 4FNQA 1HL9A 2DSVA 5BRPA 1U30A 4NXSA 2CNCA 1BYAA 1H0IA 2WW5A 5DMYA 4XB3A 3MUAA 3GXIA 3LMYA 1E6RA 4D72A 5A8PA 3WUGA 1EH9A 3AHTA 1KTCA 1EDGA 4CN1A 1FH9A 3CUHA 2WC7A 2Y4SA 4DWSB 1W1VA 4GI9A 3NYDA 3U7VA 1GCYA 3IJ7A 3VSUA 2XM2A 5GNXA 1CGUA 1TZ7A 1UYQA 3WNKA 3VNYA 5AC4A 1JI2A 4V2XA 5CXPA 3CGTA 2UY5A 1AQHA 3SEPA 3QOMA 1JZ6A 5JUVA 1N82A 1K9EA 2FGZA 4FNUA 2YL6A 4HP5A 4F8XA 1QI5A 5FCZA 3N12A 1LQ0A 4EANA 2G3IA 2V3EA 2X2HA 3WN6A 2IXVA 3A4XA 2X2JA 1BHGA 4B3LA 3VGBA 3EJTA 3F5KA 4H8UA 5AY7A 2X09A 3HN3A 3K4AA 3BGAA 3CHCA 3WQ5A 2G3MA 3FNDA 1DHKA 4JFWA 4ML4A 1GQIA 1HIZA 3D4ZA 3M07A 2OYMA 2GK1A 4AZ5A 2OSXA 1CTNA 4P7LA 1QWNA 1S46A 1OGGA 3DHUA 4W84A 3NSNA 1WZAA 3VKKA 5BROA 1JZ2A 2GFTA 5FIPA 4F79A 3BAYA 2WLZA 3B9DA 1V0NA 3CZKA 1MQPA 2XFRA 3KE0A 4ACZA 4UQ9A 3BAXA 1V3MA 1BVZA 1QNRA 4W7UA 1UR0A 2JEQA 1US3A 5DO8A 1ZU8A 5AYBA 3WFZA 3QHMA 2YDQA 4PSPA 4TX6A 5BXTA 3ZT7A 2A3HA 2E9MA 2WVSA 2OWCA 2XGBA 3N17A 1K9TA 2WLYA 2FYVA 1UQYA 4HA4A 4PN2A 5A6BA 2VCBA 3LX9A 3IJ8A 1VFFA 4M80A 3WD2A 3WDHA 3M6DA 4U2YA 2EPOA 5DEZA 3VIMA 1Q4NX 3WUFA 3FHAA 1JL8A 2AOSA 1PIFA 3W0KA 4P7NA 1ECEA 3A6OA 4NRRA 1ZL1A 2VMFA 4AZ6A 1RH9A 1PX8A 1V6UA 3VD9A 1XSKA 3L2MA 4KMQA 4U2ZA 4HZ7A 4HZ8A 4AIUA 3PZQA 3VD5A 2WMGA 1E70M 1BFNA 1DTUA 2WB5A 5CG0A 2PWGA 1JYNA 4D6CA 1BG9A 2VJXA 2OW7A 3PZVA 2YDSA 5E09A 3GBEA 1KCLA 4GQQA 1VBRA 3VX1A 2WMIB 2NSXA 3HJEA 1E0WA 3N11A 2B31A 1H4PA 7A3HA 5ABHA 2WHKA 3VMNA 4P8XA 5JIWA 3AISA 1CWYA 1WCGA 3ARXA 4HPHA 2VT0A 3FXYA 1E0XA 3GM8A 3T2OA 3ARWA 2D3NA 3WNPA 4X0VA 2ZX6A 2J7FA 2YA0A 3A21A 3AS0A 3BXWA 4CUCA 4P7OA 3HMCA 2D0GA 3BMVA 1DWHM 3D51A 1E4NA 4GPNA 3AFBA 4LYRA 2F8QA 4FK9A 1WP6A 4MB1A 3W6LA 3W37A 3RDKA 3THCA 3EJRA 3MMUA 4MPKA 1W3HA 2XSBA 1DWGM 3WQ8A 2NT1A 4PMZA 4Z2LA 2QMJA 4KWUA 4ZENA 1MYRA 1E0VA 1LL7A 3G6MA 1X6NA 4H2CA 5I24A 2FDMA 4D6EA 4AC1X 2FE0A 4E8CA 2VZTA 3GXDA 1FOBA 2OLHA 2XYLA 2D22A 1CXHA 3PZ9A 2GSJA 4QLLA 2WZHA 3UG4A 3VMPA 3GH4A 3CZGA 4HU0A 1GHSA 3PTKA 1V03A 2CITA 1E56A 3BLPX 4RE4A 1NWUA 2XJ7A 4M82A 3VIHA 2VI0A 1L0PA 3A4AA 2XTKA 2W4XA 4HMDA 1ODZA 4NZCA 1G94A 3GH7A 4DUVA 3ARSA 1OSEA 1BYDA 3S6TA 3CZEA 3LRKA 3CV5A 1VJSA 3PTMA 1UD6A 1XH0A 1GOWA 1WE5A 1KQYA 1VEOA 1UD5A 3GNPA 1BGGA 2XN2A 2J7GA 2J62A 3OA5A 3MUIA 2C8NA 1TQTA 1EQCA 1BYCA 4P8VA 2VCAA 3B8SA 1BLIA 2WCSA 3F5JA 3RMEA 3WSUA 2BHYA 2DH2A 2VQTA 3VIFA 3AXIA 1C92A 4PMNA 1MW3A 4AD5A 2O9OA 4A4AA 5JBEA 4WKHA 2F7OA 1ZS2A 1NOFA 3M7SA 2XM1A 1UKPA 2ZICA 1C7SA 1TA3B 4AEFA 4A3HA 3AOFA 2VVSA 2DT2A 3I3BA 3LRMA 4WLCA 2WMKA 5A6SA 2DDXA 3GXTA 2CXGA 3BUIA 3VD3A 1UKTA 3CHEA 3WNLA 3FN9A 4UQDA 3WBEA 3WL1A 4J7RA 1UH4A 2IGTA 4PRWA 2EEXA 1I75A 2AAAA 1DP0A 4AZ7A 3EMCA 1OGBA 1HTYA 4W93A 3SUSA 4UZUA 1G9HA 4F66A 2CYGA 4PEEA 3N9KA 7CGTA 2ESCA 1TG7A 1SZNA 3WEOA 4AZCB 2UY3A 3EBVA 4LQ1A 1OGSA 4TX8A 3DYMA 5ABGA 1V3HA 3LPGA 1WO2A 3UEQA 2PI6A 1KXHA 1TFVA 1GOKA 3WF3A 5C70A 1OIFA 3ZO9A 1KGXA 4E2OA 3T09A 3VIJA 4U5KA 1TQSA 3KL5A 3VGDA 3WIJA 3EJUA 4BS0A 5DF0A 1V6VA 1JG9A 1SYTA 4CVUA 3RILA 1E5NA 3BVUA 1R7AA 3WF1A 5A69A 1CNVA 2HVMA 3MSDA 4U31A 3ARPA 1BAGA 2CHNA 3B9EA 3UG3A 3N18A 3T08A 1R47A 1NWRA 1UH2A 3WQ6A 3A4WA 2G3JA 3SCVA 3WELA 1C3FA 4Q7NA 2WC4A 1VFOA 1WDSA 3WY1A 3LPOA 1WZLA 1OT1A 4H7VA 2PWFA 3HZ3A 3MMDA 3WENA 4HA1A 3IJ9A 5GNZA 3BAJA 2OWXA 1XSIA 3W27A 2EPNA 1FP8A 4MDPA 3ZSTA 4AIEA 1V02E 2WWCA 3K46A 3VTRA 4Q22A 2PBOA 3PHAA 1DEDA 1EA9C 3ARUA 1UD2A 1TVPA 3SUTA 2GJXB 1C8QA 1ZJAA 3II1A 3CTTA 2E8ZA 5CPSA 3J7HA 3MKKA 5E1QA 1UWSA 2CBVA 4IPNB 4D6IA 3L4XA 4JL1A 1QI4A 2Y2WA 9CGTA 3AIBA 3ARYA 1KBBA 3IGUA 1KXTA 2OW6A 3QGVA 3ZT6A 5DT5A 3NUKA 2OYKA 3ALFA 2ZE0A 4WKAA 4D6DA 2XUCA 4KRTA 3SCTA 3WD4A 2G8ZA 4JCMA 4WJXA 1XH2A 3L4UA 2Y24A 1E40A 1HT6A 1PJ9A 5A2BA 5HOSA 4NXKA 2E0PA 3CLWA 2D20A 1OM0A 4UQEA 4H04A 2EXOA 1AVAA 4OZOA 1X6LA 3AIVA 3BSHA 2FHFA 4CN4A 1ISWA 1CGTA 3VM5A 1EQPA 5JBDA 2XWEA 3PZIA 1W1PA 2FGLA 1H11A 1R87A 4GZEA 2VL4A 2ZUMA 2JFEX 1MW2A 3ZQ9A 2YJQA 1G0CA 1MFVA 1EIBA 1W9PA 5EFDA 1BQCA 1HKJA 4CN6A 1E3XA 2A3CA 1LL4A 1UH3A 1HXKA 4GQRA 4TVUA 4DO4A 4CCCA 4AD3A 5ABFA 1U33A 4PBGA 5A6KA 2Z1SA 4AW7A 3CPUA 3QR3A 1E6NA 2VZOA 5BYWA 4JKMA 2DT3A 4EE9A 3AZRA 4EKJA 4P8WA 1EO5A 5I78A 3OLEA 1D3CA 1ISVA 5IXEA 2Y8VA 3SCSA 1G5AA 4Z2IA 3KLKA 2CIPA 5E6YA 3PZGA 1JDDA 2YL9A 5A8OA 3OGSA 4M24A 4M29A 3CC1A 4JHZA 1JFHA 3W6MA 2PBGA 5D9NA 2D2OA 4GXPA 1E3ZA 8A3HA 3TTOA 1CDGA 2UY2A 3AS1A 1XSJA 4WKFA 2PWEA 2F1AA 1QNSA 4BQ5A 5HBFA 1Q6GA 3U57A 4D6GA 4D6FA 1Q6DA 5A6BD 5A6JA 4FNRA 3CUFA 3RM8A 3WL0A 3AMLA 1J0HA 5LA0A 5CQ1A 5FKYA 5BXRA 1Y7VA 1V6XA 1LG2A 2EJ1A 3WY2A 1PZ3A 1C8YA 1CYGA 4QP0A 1LG1A 3I3DA 1MW1A 3CMGA 1JAEA 2ALWA 2GK1B 5F7UA 3U5UA 3CH9A 3VMOA 5D9PA 1KBKA 4CVWA 4PTMA 1T0OA 4UTFA 3PZTA 1C7TA 4KH2A 3N1AA 4UFHA 4ACZB 2J8GA 1UWIA 4JIEA 1GHRA 5LA2A 3VIOA 4D6JA 2JALA 3A23A 4LPCA 1NQ6A 1OWQA 3DX1A 1G01A 1JYVA 3AIUA 1A47A 3SCWA 5D9OA 3T0DA 1HP5A 3WNMA 4Z2HA 1VB9A 3CZLA 1B1YA 3GNOA 4J3XA 1EGZA 4J3WA 5A8MA 1OCQA 4MADA 4GKLA 5D9MA 2RGMA 1XCWA 2WMJA 1LLOA 3W29A 1QHOA 2J7HA 2VX4A 7TAAA 4HZ6A 3WH9A 3MV01 1GOMA 3CZSA 3LXCA 2QPUA 1R8LA 3W81A 4CU7A 1GVIA 3D5HA 2IUZA 3UESA 1JNDA 4W5UA 1G1YA 3TV8A 2Y5EA 4OOUA 1HJSA 1TCMA 2ZUSA 5M3WA 3VD4A 2VRKA 4LXFA 1CXKA 5I5RA 3ZMRA 1R75A 2G41A 5HPOA 4QCEA 5BRQA 4CD4A 3WKZA 3BC9A 2W63A 2GJRA 5GPRA 4OIFA 4QLJA 1X1NA 3WDRA 4GZIA 3L4TA 1QI0A 1EOMA 3GYCA 3RCNA 3DHPA 3O9NA 3F5LA 5JIPA 3WF4A 2VRQA 2W62A 4HA3A 2GDVA 4ZE4A 5TD4A 2XVGA 5GNYA 4PTXA 3BVTA 2WCGA 4F9DA 3DDFA 3U5YA 1MFUA 5BXSA 2XVKA 4JL2A 2V5CA 1YQ2A 2X2YA 3WF0A 4QLKA 2XHYA 2W67A 4X9YA 4EK7A 3VU2A 3W24A 3EMZA 3HG5A 1JXKA 4MNJA 3OBAA 1M04A 1PX3A 1V3LA 2E8YA 1UR1A 1WKYA 4BQ4A 3T2QA 1K9DA 2YL5A 2BS9A 2PWHA 1WNOA 4AD1A 1W9UA 1J18A 3TOPA 4D6HA 3B9AA 3BVWA 4MJ2A 4RE2A 3BUQA 3SUWA 4GIAA 2VO5A 4K68A 2V5DA 4PYSA 1SMDA 2ZX9A 3LPPA 3S5ZA 4NRSA 5A2AA 5BCAA 1R7OA 4PMUA 1HJWA 5CPTA 1FHDA 1UR2A 2FHBA 1GZJA 4ATDA 2V3FA 2F7QA 3AHYA 1LJYA 2F18A 3AS2A 1NP0A 4U33A 3AJ7A 1VRXA 3L4VA 1UA3A 3WY4A 2ZUVA 1B3XA 1H09A 3VUPA 1A3HA 1VAHA 5JBFA 3KZSA 4B15A 6A3HA 1BGAA 3FAXA 1FP9A 4URIA 3VIPA 1GNXA 4YHEA 4DUWA 1V0MA 5A8QA 4DM2A 3EYPA 3AIQA 1UWUA 4W8AA 3D3AA 2VOTA 1DWFM 2GUYA 1PBGA 2J47A 4GZJA 1Q6EA 2J7BA 3CUGA 4JCLA 3EMQA 3MV11 2CBIA 2WBGA 4JKKA 2V3DA 1GUVA 1XYFA 3OG2A 1HJXA 2X05A 1ZB5A 4MNLA 3A22A 2ZXBA 1LL6A 4MDOA 2XG9A 4UR9A 1ODUA 4DWSC 3POCA 4HOXA 5CJ5A 2WAGA 1W9DM 3EDJA 3T0AA 4XZWA 4D71A 2Y8KA 4W86A 1NOUA 1M53A 1W1YA 3IAQA 2QF8A 2VZUA 5BXPA 1J9YA 1MQRA 1VF8A 4Z2JA 1J0YA 2VCCA 3H54A 2JE8A 5CLWA 4DM1A 5I77A 5CZKA 4QCFA 3UR8A 1DWJM 2F2HA 1NP2A 1JXJA 3OB8A 3O2LA 5FD0A 2EQDA 4HPGA 3OLGA 5A95A 3WH6A 4JFUA 4AMWA 3AQUA 3TA9A 4AZIA 3AIWA 1QW8A 3BLBA 5EFFA 1IZKA 5EMYA 4OBSA 5A94A 3I3EA 4YPJA 4B9ZA 1KCKA 4ATWA 1CGXA 4KGLA 3WMCA 1CXLA 3ARZA 3K8KA 1TE1A 4J3VA 3VDHA 3DX3A 1SMAA 2C7FA 2E40A 1QOXA 5E0FA 4M81A 1CPUA 1CGYA 4W89A 4QDMA 1CIUA 4LGXA 3VDBA 1H49A 5FOOA 1QBAA 1I1XA 4CGTA 1UR8A 4XV0A 5I0DA 2YBTA 4AWEA 1M01A 5A1AA 3BSGA 2FH8A 5E0CA 2GJPA 3WD0A 1UA7A 2V38A 4AIOA 1FH8A 1DWIM 3QOKA 1CECA 3OGVA 5CSUA 2ZXDA 3OLDA 3VNZA 4ZXLA 1NARA 1E6QM 2DPEA 4J27A 4CD6A 4OKDA 3AHVA 2VUYA 1HN1A 4PMXA 5LA1A 5I79A 4UFMA 2EPLX 1NH6A 6CGTA 1C91A 2D3LA 4AXNA 3TTSA 5M03A 3ALGA 1XCXA 4BQ2A 2XIBA 4WSKA 1E4IA 3W82A 4UNIA 2J7CA 1RP9A 4BZYA 1SFSA 2D0FA 2YLAA 3RJYA 4MTVA 3PZNA 1GONA 4FNSA 1XV8A 1HNYA 1E1EA 1QPKA 2DGAA 1QNPA 3WMSA 3S2CA 3LPFA 2DEPA 5EB8A 3CBWA 1QX1A 1KXQA 1BPLB 3MO4A 5M5DA 1CLXA 1UQZA 1VFMA 4DO5A 1E4MM 3RO8A 4GI8A 3WNNA 2JF6A 2WVVA 2OYLA 2PC8A 3BUDA 4PCTA 1AQ0A 3GXPA 2W92A 4JFTA 1W3JA 4RE3A 4UFIA 1BSIA 1ITXA 1NWTA 1LWJA 5DFAA 1CGVA 1ZBWA 1HXJA 1W2PA 2DH3A 1UR9A 3AMGA 4BQ3A 1DWAM 1JAKA 4ZXOA 5A6MA 3F4VA 4PMRA 2X8RA 2YOCA 4UOZA 4WSJA 2X0YA 3TTQA 4UCFA 4J3UA 4X0NA 2J77A 2ZUWA 1R85A 3M46A 3JUGA 2WYSA 1XH1A 3VGGA 2VRJA 1QBBA 2VTFA 5CPQA 1JGIA 4ZFMA 3OIHA 3WQWA 2X1IA 5CLTA 4F9JA 1W3LA 4PMOA 1B3YA 5HNNA 2VQUA 1GJWA 1V3KA 3WEZA 4FNPA 2CESA 1O7DC 4PMYA 1GOQA 3LXAA 4XZBA 2C0HA 4UQCA 2BHZA 1HKIA 1E6PA 1QI3A 2D23A 8CGTA 1XD1A 1HWWA 4W88A 2CBJA 3WH5A 3IAPA 4FLOA 1HX0A 1CEOA 3K4DA 4AZHA 5FL0A 5IHRA 3WEMA 3VM7A 1J0KA 5HXMA 1JD7A 4HTYA 3SCRA 1J01A 4AD4A 5ABFB 1O6IA 3AMKA 1M7XA 2BVDA 1EXPA 5E6ZA 1US2A 2J25A 2WNWA 3NSXA 2W66A 3GBDA 3AYSA 1F4HA 2OWWA 2XN0A 2QMKA 3TP4A 2BXZA 3OLIA 3N04A 3A3HA 2XVPA 2JF7A 3G6LA 3ZJ7A 1ZJBA 1LWHA 1E72M 1TUXA 3VGHA 1J0ZA 1BF2A 1PZ2A 5A6AA 5CGTA 3PZOA 4FF5A 5D4YA 2J7DA 3VO0A 3T2PA 4JKLA 3BAWA 5IFTA 4E4PA 3IK2A 1RP8A 4MB5A 5E70A 1UHVA 1J0JA 2XFFA 1E9LA 1C93A 3AXHA 4WF7A 3SIMA 2CKSA 3KL3A 3SCUA 2WVUA 2X2IA 3FHQA 2CKRA 3OGRA 5IFPA 4S3KA 1E71M 1GVYA 2CETA 4TTUA 2FHCA 3AYRA 1XD0A 5A6LA 3EJQA 4CD8A 5A2CA 1MW0A 4DO6A 1C8XA 2O92A 4R5EA 4AY1A 2WZEA 4NI3A 1ZBKA 3AMDA 2XSAA 3WD3A 4OGZA 3ARTA 2DQXA 3WMBA 4J3SA 2AMGA 4H8VA 2OSWA 2IXUA 4AZGA 1E15A 2DT1A 4A3YA 3S5YA 1EHAA 4UQBA 4MNKA 1UASA 4B3KA 2BV9A 2YFOA 3BVVA 4ZEPA 3AIRA 1QVBA 2BY2A 4JAWA 3ARVA 3QHNA 2UWFA 3FAWA 5CGMA 1B2YA 1UUQA 3EJPA 1V6WA 2O9RA 2A3BA 1KWKA 5HPCA 4OUEA 3OZOA 3ZJKA 1TQWA 2VX7A 3CIVA 2A3AA 5I23A 3GXFA 1GQLA 1C90A 2XIIA 4MJ4A 2BXYA 2D73A 1WDRA 1IV8A 2EAEA 1R34A 2XVNA 1F4AA 2CBUA 3D50A 3AHZA 2OSYA 2XPKA 1WDQA 2WHMA 3LXBA 2ZUNA 4CD7A 3RM9A 2WKGA 3K8MA 3NIYA 2YFNA 3ARRA 2G3NA 4AMXA 5KEZA 1MVYA 2ZX5A 1CXFA 1HF6A 3WDQA 2WHLA 2VNCA 4M8UA 4OOZA 4W85A 2VURA 3CUJA 3OZPA 3PZMA 4UOJA 2W5FA 3AXXA 2WPGA 2EPMX 1D7FA 3MANA 2DIEA 3SUVA 1XYZA 1HJQA 3L2LA 2WKLA 4D1JA 3DX2A 1V02A 2CHOA 1V08A 4V28A 3HG2A 3VSTA 2ZXAA 1HVQA 1J0IA 1V0KA 3A5VA 1QHPA 2XVLA 3WH7A 2D1ZA 1PPIA 2O9PA 4NZFA 4JFVA 3N13A 3VD7A 2YBUA 1H41A 1OB0A 4FMVA 4B9YA 5M17A 2WANA 3UERA 5I6SA 3E1F1 1TVNA 3UG5A 4YHGA 3A47A 2YKKA 3CHDA 4W87A 3HU7A 1H1NA 2E3ZA 4BCEA 1KXVA 3WQVA 4C7GA 2ZX8A 1JYXA 1IT0A 3MMWA 4AYGA 3DX0A 1B30A 4PCSA 2BY3A 2F61A 1E1FA 3IANA 1NWSA 2VC9A 2QPSA 3D4YA 3NDYA 3O6AA 4DWSA 2WK2A 3RM4A 3GDBA 4TXEA 2F7RA 4GI6A 1W2VA 3L4ZA 3AROA 1JZ8A 1W9VA 1W9XA 2O9TA 3W26A 1XC6A 1KR0A 1ZBVA 1W32A 1YHTA 4BF7A 1FA2A 3WDPP 1QNQA 4DUXA 2EBNA 1VIWA 4NSBA 2ZOXA 3VOCA 3GH5A 4W5ZA 2WMFA 2J8FA 1VEMA 5D8ZA 1MWOA 1CZ1A 5ABEA 3DECA 3KEHA 1E6XM 1VEPA 3NCOA 1KFWA 1HJVA 1GORA 2EO7A 4PMVA 2YIHA 3VGEA 1JDCA 2GDUA 1V3JA 2WSPA 1E5JA 4OJYA 4TTGA 4FNTA 2NW0A 1W1TA 4W7VA 4TVDA 1PEZA 3RIKA 4FLQA 3N15A 3ZJ6A 1HL8A 5FL1A 1GQKA 1EDQA 2YA2A 1B31A 2W61A 1KGWA 3K1DA 1E4LA 1MXGA 3L4WA 2WMHA 1R33A 5KZ6A 2ZWYA 3UETA 3T0BA 1CBGA 4J28A 2QLYA 3WDIA 2X0HA 1UWRA 4LYPA 4PUDA 2BHUA 5IHSA 2JEPA 3ZIZA 4N42A 5DT7A 3SCNA 3U7BA 1KQZA 3W53A 3CZNA 2WZIA 3FY1A 1KR1A 3PTQA 3RJXA 1R46A 1HP4A 1PAMA 2W91A 2Z1KA 1XGZA 2WBKA 4AISA 3MUZ1 3W28A 2VR5A 1ESWA 5HDRA 1FFRA 5E9AA 4V27A 1WZKA 2DSZA 3MUY1 4D1IA 2G4FA 1H3GA 4HOWA 1UZ4A 3VILA 2XGIA 5IDIA 5EBAA 5A8NA 4UOQA 4AD0A 3BVXA 4TVCA 4CU6A 1UWQA 2ZX7A 1GOIA 4AD2A 1B90A 2J7EA 4PSRA 1WPCA 2DSKA 1L8NA 1Q6CA 3EDDA 4U5IA 1ZBCA 1JZ7A 2E9BA 1BG4A 3AHXA 4IM4A 1FFQA 4UQAA 1CENA 1E6ZA 2HISA 3BUPA 4MNMA 4AMCA 1HKKA 1WDPA 2MANA 2DSWA 5A3HA 2YLLA 2VX6A 1SR0A 1JZ4A 2XFYA 2D24A 1JD9A 1HVXA 4ZE5A 3HG4A 2WC3A 3VIIA 4PTVA 1UZ1A 2WMIA 1UKQA 4H8HA 2FH6A 1EO7A 3NJ3A 1VJZA 1UD3A 2TAAA 3VPLA 1JF6A 1WAWA 3ARQA 1JYWA 2PF0A 4Z2KA 1UD8A 1ISZA 2BFGA 2Q8XA 2CERA 1B0IA 2F1BA 1UKOA 1EDTA 3CO4A 3GXNA 1UG6A 1TQVA 3SCOA 3W25A 3VDCA 4MB3A 1JIBA 4HMEA 1E73M 3WH8A 1CXIA 2WVVB 4ACYA 1ISYA 4EAMA 3NSMA 1NM9A 3GZAA 1CLVA 1K6AA 3WFLA 3WF2A 4AYSA 4UFKA 1GQJA 4NX0A 4N0RA 4W8BA 3WQ4A 4CD5A 4HU8A 4J3TA 1GW1A 1OIMA 4YN5A 4WK9A 3VIKA 1PX4A 3MS8A 4L4OA 5BWFA 4MAVA 2WVTA 1NOWA 1QWUA 1U2YA 2JIEA 1OT2A 1RPKA 3AMCA 4R27A 2VR4A 5D8WA 1WZMA 2ZXQA 1KB3A 1FH7A 3CZJA 1JDAA 1M03A 2RGLA 3L4YA 3WUBA 1P6WA 4U3CA 3AI0A 1H5VA 4BA0A 1BTCA 2DT0A 1XRVA 1D2KA 5CSYA 2J4GA 1HKMA 3UCQA 2VZSA 2YL8A 3A24A 1I1WA 5AYIA 3VINA 3APGA 4W7WA 4H41A 2QHAA 4W8LA 4C7DA 4P7RA 3KLLA 1KGUA 3ZJ8A 2WHJA 4E8DA 4WIWA 3VX0A 1KTBA 3PN8A 3VVGA 2ZIDA 3KL0A 3MI6A 2WWDA 4FLRA 4ATLA 1UWTA 1VBUA 4PTWA 1ISXA 2A3EA 1WB0A 4TOQA 4P7QA 3WNOA 2GVYA 3BCDA 1B9ZA 3TTYA 4RL3A 2YA1A 1GOOA 2EABA 1W3KA 1TA3A 2BVYA 3NDZA 1GPFA 1Q6FA 1UD4A 4PUEA 1TMQA 1J11A 1OINA 4HMCA 3ZR5A 1TQUA 3AZSA 3UR7A 2F7PA 2WM0A 5ECUA 3D52A 1QI2A 3BCFA 4CCDA 1MXDA 1UOKA 4AZBA 4Z2GA 4QAWA 1HJUA 3LRLA 3GTNA 1QHZA 3VDAA 3ZM8A 3SUUA 3SCPA 1B3ZA 4GO9A 1OD0A 1EOKA 3H55A 2J74A 4L4PA 1JFXA 1H2JA 2NT0A 1E6SM 5AC5A 5I2UA 4AZCA 2BNJA 1ITCA 1QNOA 3W38A 3ECQA 3CZ8A 4IPLA 1Z32X 3BMWA 1QW9A 4LYQA 1BYBA 3EDEA 2V3GA 3VSVA 3SCQA 1B3WA 2BY1A 5LYRA 3POHA 1JZ5A 3HG3A 4CKQA 6TAAA 3DYPA 5GQBA 4M1RA 3BH4A 1CXEA 3WUEA 2VZVA 1O7AA 3AS3A 4LX4A 4M56A 1KWGA 3VGFA 3ZR6A 2J78A 4HOZA 4B16A 4GO8A 3DC0A 3AZTA 1BVNP 4XX6A 3EDKA 4UZSA 3AICA 3THDA 2CEQA 1OBAA 4TUFA 3QHOA 1EHNA 2CPUA 1UKSA 3FW6A 1TR1A 4NZJA 2EPKX 3DX4A 3WBAA 3EJSA 4JHOA 2E4TA 3DYOA 4UFJA 2YDRA 2VX5A 3MSGA 4KGJA 3BAKA 3H53A 4OBRA 3WDJA 4U3AA 4CCEA 1J10A 4MAZA 2WSKA 3PBGA 3CMJA 2WXDM 4PMDA 1JF5A 1VENA 2XN1A 3RPMA 2ZUUA 1MQQA 2VVNA 5C71A
chains in the Genus database with same CATH superfamily
2X4RB 4GINA 3SSGA 3RAJL 5GISL 3W4RA 4M8RA 4CMMB 2Z1PA 3VIGA 1DBJL 3X1FA 4M93B 2PWDA 4L8SB 1IKOP 1Z3GL 3WD1A 3MLVH 4KKAC 1V0LA 1H3PL 4LT7A 3GB7B 2WCAA 3F04A 2XG4B 3GI9H 4QJ4B 3NL2A 1GR7A 5FECA 3FCPA 1F07A 2XWDA 1PS3A 3I2CH 3W6YA 5CS7A 4XCEA 4KW2A 1OD8A 5I8EA 4RGNB 5C09D 1TTGA 5FJIA 4NSKA 2DY2A 5L2JB 1IAIH 1E8ZA 1KFLA 3MRHA 3EOTH 5BS0B 5FHBH 4X98B 3MKCA 1WA0X 2R51A 2O72A 2DQ6A 3WLHA 1VFTA 3NFNA 1JPGB 1OSYA 2FJSA 4PJAB 2R6OA 1J1XL 2RFXA 1UYQA 2O4EA 3FOLA 4Q8WA 2NXHA 4V2XA 5E1AA 3QIUA 4W6WB 1TJPA 1T1ZB 1JZ6A 1U5HA 2P45B 4ZMLA 1K8DA 1QFHA 1QNIA 1LQ0A 2Y1ZA 1CW2A 1ET8A 4K8HA 1P4IL 1R3VA 1V8HA 1QBLH 4M5YH 5AY7A 3K4AA 1KZYA 3KM2A 1UUMA 2YXMA 1HIZA 5C2UB 2PDNA 1CTNA 5EZIL 1CICA 2YXGA 3L1FA 4XPFH 1CF8H 3MV7A 4DGIH 1DXFA 4ZAKA 3CN4A 1N5AB 2XU9A 3CZKA 3O3DB 3QR2A 1I7UA 4MXVF 3TYCA 3WLWC 1LK2B 3S3DB 1HYSD 3PP4H 2AQQA 2LABA 5FHAL 4C57C 5F7DA 5FGSA 4IIZA 4QIUA 4DKEL 1OVDA 4PN2A 2BOLA 1ANUA 3IJ8A 1IC5L 3EYFA 5F3FA 3KOYA 4R90L 3VIMA 2QTEA 1JL8A 4JG0H 1FF5A 1TELA 4HUWB 4LNVA 4WWID 1KIUB 4EN3B 5SWZD 2X6CA 1BFNA 4O2EB 3R7QA 4EVNB 2C1PA 2A4AA 3AG3B 4UQ3B 3DUUB 4QEHA 3MJ9A 5PAZA 4GQQA 4JHBA 2GB2A 2PDPA 1U93B 2WHKA 1POJA 5H91A 1O60A 4N0UB 1KBVA 2CHXA 3T3MF 3BKYH 2F53B 3RPTA 2VLKD 4MB1A 5D7JC 3EJRA 4UTAA 4BWTA 4L37B 1IBZA 4PMZA 1J8HA 2CLRB 4LY4A 5BZWB 4KFZC 2X12A 2ODIA 1R3TA 3EA3A 2NXIA 2C9QA 4Q7BA 5DCBA 2QQNL 4OIIL 1P7BA 1HXYA 2XA8L 4D0CB 3QZ6A 2QLVB 2XJLA 4K3EL 1R5IB 4OBTA 2G75B 2C1OB 3S6TA 2C3GA 4U1IA 3GY1A 3IFPB 1IIKA 1WE5A 5DK3A 4N68A 3QDJE 3DGBA 1YEYA 3QMRA 1R6WA 1TQTA 5DRCA 4N0FA 4KI5D 1SXZA 1Y65A 1KJ3H 1JWMB 1TA3B 2WNGA 2R1NA 2VGBA 2IDTA 4N2NA 4IKKA 3GAYA 2AV1A 5DD5L 2DZTA 4IJRA 3MV9E 4PMJA 4UQDA 5JH2A 4PB0H 4J7RA 1UH4A 4P46A 5ESQA 4GUPA 1FNGB 1I75A 5D6DA 3VWKB 3CFEB 4W93A 2R29L 2NNAB 2ZAIA 3H7VA 3WE6A 1SVCP 3N9KA 2OTWB 1TG7A 2X3BA 4DKDC 5DS8A 3TF7C 3L3DB 1V3HA 3TFXA 3WFBL 1VFAA 4XCCL 1FHNA 2CGZA 2CLEA 3KBSA 1OTSC 3CWNA 1O6SB 3T09A 4E2OA 5CPMA 2HVKB 4AZ8B 3GTXA 1V6VA 2ERJB 2WJDA 5A69A 1H7PA 4XSMA 4S3BA 4XO3A 2PNDA 1WDSA 4UNVA 1TZAA 3HZ3A 4E9LA 4JFQB 2VXUH 2JJTC 2FRGP 3HG1E 4AIEA 5GJSL 4LP8A 1X5LA 3BP4A 4BZ1H 4Z7VF 3KM1A 1AJ7L 5C8JB 2EG8A 4W1TA 1KENH 2QW5A 4C1NA 1LYXA 1GOFA 3AO0A 3C5ZA 3H6AA 4D6IA 4OJFH 1XPYA 3VW3L 3EJJX 4G6MH 3NQMA 3N44B 1NCCL 3WEXB 4JCMA 4O02L 3QULA 1ZP3A 4NIRA 5DMMA 4JRXA 3FU8A 3GAKA 1RBLA 4JMXA 2JLPA 3G9VA 1G87A 2IFFL 4YSPA 2PDLA 2ISWA 1AVAA 4IFKA 1WDDA 5B1AB 3WTWA 1H11A 2BFVL 4OZHA 3EAUA 1RIUL 2VL4A 5I0YA 3MVIA 4AQ8A 3DUHA 5GJTH 2H32H 3MO1A 2MH4A 3BQUB 4R7VA 2A2QT 3APMA 5JW3H 1KT2A 2DQMA 2V82A 1E6NA 4YOKA 4CSPA 5JPNB 3UZ5A 2XFXB 1DFXA 4QHNB 3P30H 1DUYB 1R2RA 2RA1A 3INUH 3HUJB 5FGBC 2NZLA 1EJOL 1UR3M 2X0SA 2PFHA 4HD5A 1U3NA 3V6OE 5F7WC 1XSJA 2H26A 2Z7WA 4WNQB 2GFBB 3EX4A 4U1SB 3BWAB 1VGKA 4Q6IA 4D6GA 2MPAL 4WEEA 1HINH 2PW1B 5LA0A 5FKYA 1OIOA 1EL3A 1C8YA 3D18B 4ZPVB 3I3DA 4BHUA 1OAQL 2ALWA 4YZFF 5ERWA 3WXWL 1NCIA 4MDIA 1U21A 4GKTA 5EEXA 5IGXL 4P07A 1C7TA 3UP6A 3RWDA 2QIIA 4O16A 2FX7H 4JG1H 2JELH 1F56A 1JYVA 3SCWA 1KRCC 4Z2HA 3RUGA 3ARDB 2HSAA 1IQWL 4FNLL 5D8JH 3VGAB 2XINA 3NZ8B 1KM3A 1XM3A 5LGZA 4MWFB 3CZSA 1DQML 3WQDA 2AGTA 3D5HA 3UTSE 1BSLA 3ARGB 1E3FA 1J96A 4QCEA 2MOQA 2V63A 1R0AH 3LD8C 4QLJA 1X1NA 1E2WA 3OKKA 5MEOA 3O3RA 2UBPC 3B6SA 1RJPA 4JK0D 1P5UB 2CO6A 4BWUA 2NCMA 1ECQA 4HEMA 1A6AA 4YL9A 1CLZH 5JDSB 4JL2A 1ZOXA 4DP0X 3PUCA 3MLPA 3RFZC 4X9YA 4PRHB 4L9DA 4Z78B 1D5RA 1BG1A 2XV0A 4A04A 4R5XA 3HR5B 1OGTA 3T2QA 1WBZA 3PU7A 4FQLH 2JCWA 4IU2B 3VZZA 4LY8A 4TO8A 1J18A 3A0OA 3AAZB 4A7TA 1T8XA 5T1LB 5HPMB 1KEMH 4BFOA 5I8KL 1MCPL 1UR2A 1L6GA 4F7EB 5IOPB 1BZ7A 4QDWA 4N4QA 2Z1VA 4H9ZA 2IQDA 3WY4A 1G69A 3NN8B 5KBMA 1AGFB 3AUVA 3Q67A 4U6YA 1UM6H 1I9IL 4URIA 3OVRA 3AIQA 2BVUA 4MS8D 3QXVA 5KVDH 4IPPA 4X7SH 5HD8D 1MRCL 1HI6B 1L6SA 1CICC 2ZXBA 3IVTA 1FWGC 4ZAKC 2B9AA 3E1ZA 3GVRA 1NOUA 4NZ1A 5C6WH 2X1XR 1ALDA 1PMYA 3SY0B 3SDCA 1W72B 3CYVA 2ZZ4A 1PG7X 3BK0A 2VDPH 2WJZA 5FAGA 3WQOA 3NZHH 5EU4B 4IOIA 1IGWA 4MJJA 1KTRL 1NFIA 2WXGA 3OB8A 2VELA 4OV9A 5I82A 4O10A 5E8EA 2QPDB 5HDOA 4FXGA 4G6JH 5DMGC 4NX5A 1PDYA 3BLBA 5EFFA 1HIMH 3NPVA 1W1A1 3W22A 4AV4A 3LRHA 1CXLA 3LK6A 4YWSA 3DX3A 4M8QB 1VP5A 5LQBH 4H26B 3ZXAC 3LQZA 3TN0B 1ONWA 3PK7A 4G9DA 3VDBA 5FOOA 1I1XA 2J71A 4PJIF 4CGTA 3RIFF 4JY5H 1RVGA 3V4VH 1R3JB 3H7BA 1CR9H 2YZ5A 3QOKA 3N0PB 1QPNA 5EZOH 4LHQB 2AKMA 3RB5A 2XDHA 3T1GA 2ARJB 3HMXH 2WP3O 3GSMA 1HN1A 4PMXA 4UFMA 2DU2A 4AUUA 1RQBA 3SYQA 1E4IA 3WJJA 4OU1A 4FNSA 2BP8A 3E0LA 3HRZB 3UDWC 3LNEA 5E2VL 5B3NA 3LCXA 3IXTA 4PWEA 1DVFA 3DGRA 2HT4D 4GI8A 2F54E 2HDJA 1DVJA 2K6YA 3OG4B 4NZTH 3QWOA 3TYGH 1R5VA 4XAKD 3EOUA 4DQAA 2FIKB 3GRWH 4ODUB 4UTMA 4BWLA 3PJSB 4H0LC 3S6CA 4YDKL 2Q76B 4H40A 1DJQA 3DVIA 4LSSL 2QGDA 3IGKA 3RWIB 4Z23A 3P3RA 2WLLA 4JM2B 4ZFMA 2LFGA 1Q4WA 2FWOB 5EU7E 4PMOA 2FATH 5ANHA 4R4FL 3SYOA 2R8WA 4NQUA 1GAFH 4HCRH 2DQJH 4XZBA 3RR1A 1X5KA 3LS9A 3U4EB 1PDKA 3MA9L 5ABFB 4OVUA 3PV6B 1KM2A 3O4OC 1M7XA 5F1KC 4DO7A 4IGSA 5E8OA 3XISA 1US2A 3BCJA 1E5UI 5F1NA 4ZXBC 4L4VB 1I3RA 1BQHA 4F3HA 1KNWA 1F4HA 3WNIA 2XN0A 2UY7B 3TP4A 5TK4A 1M7DB 1I8KA 1GW0A 3G6LA 1LWHA 4K8RC 5GGRY 5A6AA 1XF3B 3I85A 4F7PA 3P73A 1LUCA 2QDVA 5E70A 2YEZA 3ZKND 5BVPH 1C93A 1FWAC 1S38A 2UZIH 4W9LC 3W1ZA 2VXVH 1YEFL 4LPTA 1GVYA 3MRPB 2XIJA 1NICA 4Z7QB 4H2HA 4S3GA 3JTTB 4NI3A 3VCLB 3GHEH 2P1FA 1JFQL 5DN1A 3G08A 4HBCL 4NFBA 5IB1B 4QJ1A 4AXKA 1YUHB 2O7SA 2IPKA 2CXKA 4NYUA 4XISA 1DUZB 5I71B 2B5IC 5I76A 2O9RA 5REQA 2W8CA 5C0DA 1FAKT 3CVIL 4KX9A 2YR1A 4KU1A 1R3HA 2A73A 2D73A 5K4ZA 1E7UA 2VEGA 4B97A 4HJ0D 5E24E 4HNNA 4AZUA 3M1ZA 3VYOA 2Q0ZX 1UUSA 3B83A 3QDGD 3RIFK 5DRXB 4DKFL 3ARED 2HKFL 4N02A 1U4FA 1BJMA 3AGWA 3REVB 3V0UA 3DARA 5LXGH 4D1JA 4YXLH 4XSLA 4GMEA 1OLLA 1W16A 3L8QA 3APCA 1QPXA 4JRYB 1Q5MA 1O1HA 4PRBA 5H4YA 1HHKB 4AQ8C 2PTDA 1H41A 3S6DA 3UIYA 2WANA 1B4RA 2G2RB 5DBUA 4QRPB 3MHUA 4M02A 2W07A 5EU5A 5JOPE 3NABH 3TW6A 3RZCD 3GO1H 4X4ME 4FA3A 4W9GC 3CLMA 4KY2A 3MNWA 4FF7A 3RKDD 4K71C 3QRHA 3OKNA 3O6AA 1FDJA 4RV3A 4F0RA 5ID0A 4X8JA 2FFIA 3CU2A 1XC6A 1BFVH 4DPBX 1HSAB 1PG7L 4H8NA 4FL4C 2LE9A 4G8EB 2BZDA 4JTEA 2EUVA 2B1OA 4EPKA 2ZOXA 4XTIA 5D8ZA 3MMEA 4F3FB 4IIFA 1VEPA 5EHFA 1EHXA 2G4JA 2CKBL 1V54B 2J44A 3BHBA 1ESOA 3GSVB 3ELFA 3OKEB 5FACA 5HJLA 4H83A 5HJBA 4DP7X 5FKAA 3GIZL 2YA2A 5IZ7A 4HW6A 4MLRA 4Z0JA 2QLYA 2X0HA 3T4CA 1JZGA 4LYPA 1I2NA 3VVWA 2Y6TE 2RDWA 3MKGA 3GLZA 4KVNL 3BARA 5G5IA 2OEMA 4OD1H 1SM3L 4GUGA 2WQAA 1KQZA 3W53A 4O4YL 4ZSUA 4ETQA 2W91A 3M1BA 2FD6H 4H44C 4ERSH 3TA3B 4LCSA 3V3WA 3NM3A 2QSTA 5HDRA 5B3SB 1ZVSA 4JS3A 2SODB 1MFNA 4KKNA 2WV3A 1P48A 1G43A 2XGIA 2A1WH 3UFYA 2SFPA 5CUSL 1JTOA 4MA7L 5GZNC 2FT6A 4HISA 2KYIA 1GOIA 3ULAB 1T03H 3AXMA 4Y5VA 4OLUH 4NT6B 4ELMA 1AACA 5CFHA 3AHXA 4J3OF 1F13A 4UQAA 2NUTA 2MANA 4KPHH 4MIMA 3RVTD 2W59A 5INDB 5DSCA 4F7KA 4G80B 3BZEB 4JOMA 4DZ5A 1XLDA 2E56A 4P9ML 3WCYA 1OAJA 4RGOH 1ISZA 1ZPUA 3PNWA 5KVGL 1IHIA 3FK3A 5FA4B 3KCLA 3I4KA 1NFPA 4K94L 1XDLA 3KPMA 2E86A 1ICPA 1ISYA 2FT7A 2FNBA 2P5WA 4UFKA 4N0RA 1GW1A 1I8JA 3EH1A 2OR9H 1PX4A 1F6PA 4L1BA 4UMGA 3OC8A 2VEPA 3RFRA 3OKOB 4OM1L 4OTXL 3SYCA 2NLJA 3MRFB 4U1MB 3JVFC 3K91A 3UBXA 1P4BH 1FYTD 1ZLVH 1RV6X 1JCJA 1ZGDA 1IR2A 3BVDB 2C9VA 2AITA 5AZ2L 1TE6A 3GRGA 5I1KL 4Y1AE 1O5KA 2PDCA 1JGEB 2C13A 3RBGA 4S39A 3SDCC 4BM7A 4P7RA 2ABBA 5FEXA 1FWDC 3ROOB 3FT3B 3GINA 3MI6A 5LCVL 3FSTA 2VUNA 1AA1B 4TOQA 2Z93B 2YCJA 5DUJA 4G5ZH 4FXGC 3UYPA 3N85H 3ZDWA 3D48R 5D6CB 3FUHA 2FYYB 1E27A 1ZRQA 3KW3A 2B59A 4GH1A 2ZQ0A 3C5JA 1UOKA 4L29B 2I7GA 4ZFOB 5E8NB 3R89A 4GWEA 3UBGA 3HQ1A 1SOSA 1WXYA 4EIVA 1WBXB 4I0KA 5JIKA 3DOSB 4QOKB 3CHXA 3D85A 3DMMA 3TJ4A 3WZ0E 4ZZFA 2QADD 3PWPD 4RX4A 2B1AH 3RWHA 3OAYK 3ZTCC 2ZSVB 3CSFA 2PGEA 3W39A 5FJUA 3D34A 3SCQA 3UYCA 2V2TA 1JZ5A 3ESMA 3VRJA 4LARH 1M56B 2Q09A 4MQTB 3GKAA 1ZAJA 3EJYD 4HUUA 2P8LB 4KF1A 4NUQA 3SIKA 4Z3HA 4PS7A 3ZLHA 1T83C 4QCIB 2CMRH 3ITGA 1EHNA 2EPKX 5LIYX 1G7QA 1OOWA 4JHOA 2PDHA 3W0WB 2AEOA 1IQ8A 5E4AA 1DSWA 2R0KH 4GSDH 1B0RB 2XX0A 4PV8A 4XZUA 5E5RB 4S1FA 2E4FA 2H32B 5CEZL 1R2TA 5DMNA 1XI3A 4UFLA 2I14A 3LG3A 5C3IA 4KRUA 5D5MF 3U82B 4ZB2A 2YB4A 1LO4L 1UWAA 4WI7A 2BVTA 1DQLL 2I07B 3EO0A 3N1QC 2DQIL 4DAGL 2CM5A 5CBBA 4PV9A 3HF3A 1CDIA 2J56A 1XBZA 4QFUA 3TCEA 4GG8B 1H7WA 3V75A 1XGPA 5GHWH 2OMNA 4WFGE 4XUYA 4NLAA 1HZLA 3QF0A 5M94B 1YDPA 4HALA 3TZVD 5J6GA 2PB1A 5FESA 4B5TA 4ZSOA 3QEZA 4BUGA 1VZGA 4KUCF 2CFFA 4ZNCD 4LSTL 3LKRB 4ERIA 5AZEL 4ZTXA 4QRRE 1IFGA 1AR1B 5EOQH 4MWAB 1TWZA 4MY9A 4GKSA 5IQ7L 2WSYA 3PVFA 1XZWA 4XNMB 1UGKA 3WBDA 3RNQA 1TZ7A 4HN8A 2J6EH 3C09C 3TL5A 1NF7A 4JTCA 3WFAA 5AB1A 5C0GA 2NXZC 1DFBH 3QFEA 5DC2A 3WKNA 3IGXA 5HWJA 4B3LA 5DD3H 3UTTA 1ZK5A 7PTDA 2BSTA 2PWUA 2PLMA 5J06A 4E41D 3FQRA 4YC2C 1RQEA 1QMUA 1MCEA 3MLTA 2BZNA 4XKYB 1W56A 1QWNA 1S46A 4JZNB 2Y2TA 2ZPKL 4B3ZA 3CBRA 5LNDA 1JRHH 4WOZA 3LVEA 4I5BA 2NRDA 3RR4A 5D1XC 1A5LC 1BQRA 3BAXA 1WFJA 4W7UA 1WUZA 1NUFA 4HGXA 3WJSA 3VOIA 2H45A 1ZDQA 2OWCA 1WFIA 2NY0C 4DZAA 3HPLB 1IEAA 3BH8A 4Z17A 4EAYA 4Q9BA 5LZLA 2OFJA 1YBQB 4P2RD 4P7NA 3DG3A 3MGTA 3UJ2A 4JHWL 2X28A 4JPVH 3EX2A 2VMFA 3SHSA 2BDNL 2EVGA 1V6UA 3HKFA 3F12B 4BH8A 4O13A 4HZ7A 4PEKA 4G8FB 4C4KO 3CXOA 5KG9A 5KYNA 4I8YA 1OE2A 4FXJA 3TBVB 4KFOA 2CLOA 1BG9A 2B16A 3W00A 3K80A 1Z3NA 4S1RL 4F7MB 4PTDA 3VCCA 3PDOA 5CEYB 3LHPH 2VFGA 2B31A 4HHMA 5K9XA 2AP2A 1FHVA 1N18A 1CJYA 4E9XA 2J7FA 2G5BA 3IMWA 3UTQA 5IUCA 3NDZE 5JHLH 4U1NB 2VN5A 3RX8A 4C6EA 1S2EA 3THCA 3LNGA 1WHPA 2QHLA 2VDPB 3PJLA 3WTVA 5EZLA 3CAFA 5HJXA 4ODHH 1TSIA 5DQDL 3GS0A 2CAKA 3FO9B 1OE3A 3IPWA 3PIQB 3E6HB 2OLHA 4Y4FA 3SOTA 2GSJA 4ZQNA 3U2SA 2FZBA 3ANUA 4P3DA 3PTKA 4PJBE 3UZWA 1EK3A 2CITA 1BQHG 3MRDA 2UYLA 1GHFH 2BSED 2HPOA 2VEFA 4NNYB 5CD5D 1TJHH 2DIAA 2ISVA 4A2RA 4BFKA 3NSDA 1RUPL 1XH0A 1JCKA 1VEOA 5KBLA 4OGXL 4L1WA 4XUGA 4ZX3A 3V4VB 2GABA 4KEUA 1S5MA 4UOW1 3WN5C 2DQWA 5L9FA 1U95A 3DX6A 5I09A 2ZICA 3A12A 1C16A 5F8RC 3PWJB 5D72L 3KPSE 2VVSA 4XE5B 1Q1JH 4DNLA 4QNPF 3CAWA 1AIFB 4OLYH 1PTZA 4IIGA 3UX9B 2AK4A 2QCEA 1GYNA 3WL1A 1U8KB 4Z0BL 5KSAB 4C90A 5AKRA 4UINH 1SFTA 5BO1L 5K1VA 1JNNL 3E8VA 1H62A 4LAQH 4IX0A 4ISVA 4Q4SA 5C08D 2VERN 1T96A 1OFDA 3N2CA 5ABGA 2P3ZA 2CJTA 5HHOA 3WIHA 3SQBB 1QSFE 4IDJH 2GAZB 2W94A 1TFVA 3R06B 2QJJA 1U8HB 3THMH 3FU5A 2MRYA 5FK9A 3WIJA 3GC2A 1JG9A 5F9JB 2Q02A 4F8QA 5F9WB 2DBJA 4K23L 3I65A 3CZFA 2Q8LA 3W88A 1AJ2A 3NJHA 3WELA 4UBDC 3WY1A 3ULVE 3T3PF 1LT8A 3C0SA 1U36A 2MKWA 3BAJA 5MKGA 3AG2B 3ZSTA 3MV9B 1A9EB 1GKOA 1GGUA 2E8ZA 5CPSA 1WWWX 4IM8A 1UWSA 1F1AA 2CBVA 1TSRA 4N9EA 2DQDH 1UXSB 3UD6A 4H7ZA 4JL1A 1A5FH 4AB4A 3RGVB 1DEEA 2A6IA 4KRTA 1PCWA 2OZ4A 1OFEA 1HT6A 3DHDA 2XWJA 1PZDA 4NXKA 5EOCH 2D20A 4NJHA 4PBWD 4H04A 2EXOA 1GJIA 1KIRB 4CBPA 4EXKA 5EIIB 4OCNC 3RY5A 2IQAB 1B57A 1BBDL 4KI1A 4OSUL 4R3SB 3IBOA 4Q9RH 4Y4KC 4GP5B 1BQCA 3W3BA 2OZ0A 3UMTA 1TPDA 2VZOA 3AZRA 5FLVA 4EKJA 3ZL4L 5T8GA 1EAQA 3TYZA 2EDEA 2Y8VA 5F1IB 3NRQA 1MRAA 4Z7IA 4G71B 3PZGA 2YL9A 4O1EA 3LZ3A 1E9YB 1QDSA 1TVLA 2J1YA 4AW4A 1SF3A 1Y0EA 4J8QA 5FGRA 3QSRA 4UIKH 3O2DA 3B4UA 4ZUUA 3ZRSA 3M7FB 2XKSA 1FWNA 3Q7JA 3E0FA 1JAEA 3CH9A 1ZP4A 4N2HA 3QAQA 3L7EA 3H2EA 4PTMA 4KH2A 3V5KA 4AE1A 2J8GA 1E4XI 4CVZB 1MJ7L 4ZMQA 3A23A 4BZ2A 4HXBH 3GI8L 1NQ6A 4WWOA 3EKZA 1HFBA 3KBEA 4QY8B 5MENB 3JTSA 4Z1YA 1VB9A 5E8PA 4H5SA 4J3WA 4YDVB 3N3TA 3ZRFC 4WWKB 4GA8A 1LLOA 4PJ9D 2VX4A 3IF1A 1B4TA 3QPQC 3N5AA 3LI1A 1U3HC 1NAKL 3A9BA 4MNGE 1I4NA 2D9QB 2Y5EA 2NY1B 2ZP8A 2ZUSA 2VWSA 3OXRB 2ZP9A 3VKBA 2H2SD 4DCQB 3AUWB 4JTHA 1PD1A 2YAEA 4FQ1H 5HHMB 2A3LA 4XH2A 1YNYA 4DBDA 4JKWA 3NAVA 1NDGB 4NM4H 5D7JA 2QJIA 5FA3B 4FALA 3NBNA 1MFCH 2VDQB 1AZBA 4QLKA 1J8RA 2DLIA 1QMLA 4AC7C 3HHRB 1NBVH 5I6KA 1UJPA 3U0TB 5HVFB 4ONVA 4I77L 1WKYA 1VHCA 5BRBA 1B0GA 5HR6A 3TOPA 1LO0L 3KS5A 2KLSA 2VLJA 4W9IC 4PG9A 3S8HA 1QLRA 2APVA 4S2CA 5B7ZA 2OMTA 4Z6AT 4ATDA 5K3VA 1OCJA 1F18A 1EHLL 2Z91B 2GHWB 1N4XH 3AS2A 5I74C 3AACA 3L4VA 1OSPH 1SDDA 1RZJL 2ZYSA 4ENZA 1EBHA 3FAXA 3L13A 4WOQA 4UM9B 4RWHA 3I02A 5U7SA 5H2ZA 4OCWH 5GGUA 3KLHD 1WCBA 1G84A 3EHBC 3CUGA 1N7ML 5IJCC 3K2IA 1CB4A 1WS7A 2IMMA 3QBTB 4Q8PA 4ZFGH 3QXBA 3VXUD 3ZZSA 12E8H 1TPB1 4WY0A 5AVQB 2WAGA 1Q85A 2H0FA 4XZWA 4D71A 1ICSA 3QRLA 4DVBB 1AGDA 4YFLF 4RFOL 1J9YA 3SM0A 2WIIA 1AANA 3Q6GH 3UZVA 4XAGA 4PRNB 2DQUH 3WFDH 2XFGB 1RJYA 3EYVA 1UC4A 3SE6A 4MS6A 1NP2A 3MSYA 3B04A 3FYEB 4NQXA 4HPGA 5LNSA 5IJVA 1BZ8A 5HYJB 2QXWA 3MWCA 4YHLL 3P69A 1UB3A 3PPEA 2FX9L 3T81A 2OT0A 1BZOA 3WMCA 1CLOL 32C2B 2OQHA 5HGAA 2V2WA 4HS3B 4ODTH 4AYEC 1QBAA 1S9WB 2G5RA 1I8AA 3GSOB 3FKUS 2KQNA 3KXFA 1E0UA 1K4DA 3QJVB 2ZNWA 4BEUA 3NEEA 3BV7A 2PR4H 5HSFA 5F6HI 3P4OB 5TDNB 3C0LA 4J27A 3B2DC 3B0XA 2VSCA 4Z7WA 5GGVL 5I79A 4B96A 2EPLX 1Q94A 4MX7A 1AZVA 4AXNA 2AQSA 3MLXH 5GGRA 3X13A 3MLRL 4BQ2A 2XIBA 5I16B 4JTDA 1H63A 2LU5A 2DYPB 1L0YA 1GONA 1XV8A 3CFKA 4P4RA 4I7VA 1GZGA 2FLRT 4PB5A 1QNPA 4FFZL 5INCA 3SJVA 1XINA 2HRPH 1RY8A 1BPLB 3QEQD 1GC1C 4DO5A 3LRSB 1T66C 4LLQA 4LVBA 2ZC8A 5B80A 1W2PA 4V1XA 2DQEL 2AXGA 3VUSA 4G8GB 1Z9SA 4YXGA 2X0YA 3ANVA 4G8AC 5C0FA 3A9IA 1P9MC 1Q9OA 2OP4H 3NCYS 4GXMA 4C6MA 4IDLA 3REWA 2DKMA 3J07A 2FX8L 4XO4A 5FGBA 4FULA 4UQCA 5E1IA 4CADA 3G1SA 3GC3A 4P2QE 2D23A 1J48A 4P3CH 3ZQXA 1LORA 3A13A 2B7PA 3ANYA 4NP4L 3CN2A 4KV5F 2DOCA 3EZ4A 2FB4L 3JV0A 5IUSA 4L48A 4EQ2A 3C8NA 1FFOB 3G5VA 3NPUA 4KO9A 2OMZB 1ITQA 5E6ZA 2J25A 2DKSA 3FQTA 3VFTA 5DJXA 2XWTB 5CU9A 3LZFL 2J1WA 2DVXA 4O1DA 4UUJA 2VEKA 3L21A 3AWNA 4DXXA 3X11A 2F54B 3N6QA 4ZB0A 5CF3A 4K39A 3SN1A 3NJXA 4YNYB 4NM8L 4JJOA 1GS7A 1IGYA 1KC7A 3RPDA 3BAWA 3L1OL 4KDWA 2FGWL 2GT9A 4DW2H 1T1WB 1QTSA 2PCFA 4LIQH 3U4BH 3P6LA 5I8OL 3W7GA 2BRRL 4MMXB 5C0CA 3GU2A 2CKSA 3WFEL 3KCPA 4LVFA 1UEYA 2HTLC 2X2IA 1HTIA 1FRGL 1J5IA 4NQ1A 2P48B 5LIUX 4TQ8A 4U6VH 5A2CA 3GMLA 3BAEH 2QVKA 2Y2YA 2DQXA 3EFOA 3WMBA 1O75A 4OV5A 1BFOA 3IS1X 1NAMA 2PUZA 4W81A 4U05A 2XZ7A 5SWQB 2UWFA 3EJPA 3ABRA 3VWJB 4LRNH 4GMSH 4TQEH 3W11C 3HNVL 5FC9A 3RFZA 5LNGA 4LF1A 1ND0B 4L3EA 4YH6A 2EH8L 3UPRB 4CD7A 4JW3A 1AE6H 1T7VA 1A1OA 1NQKA 2DZVA 4AQAA 4L80A 2YBVA 3MA7B 4M8UA 3SDXA 5DVPA 4HX1B 3BD3A 1T5WB 2EDWA 1A7BA 3ILQD 2ZZ2A 5IF0B 4HEPA 4LEXH 4EZLA 4N1HB 2BSRB 1TVHA 3TVMD 4PRIA 1BVKA 2YHGA 1FP5A 2X4TB 2FO4A 1YYAA 5IM7B 1IGIL 4AYID 1L6PA 1WS8A 3E2QA 1F0LA 1XIWB 4L18A 1SJBA 2O4MA 4HJEA 2OS7A 2WQ8A 5IV2B 5I5MA 4HZMA 5JVLA 1Y5WA 1S7WA 1AS7A 1IAMA 4I8DA 3DTUB 2AI0H 2I56A 3EO9H 2VUOA 3EUUA 1VFBB 5GGTA 2BY3A 2AQ3A 2F61A 3IANA 4KTGA 1BOYA 1ETB1 4LUSA 4F8NA 2GJ6A 2BIPA 1YYCA 3AROA 1W9XA 4M1DH 4FQQB 1Q9LA 4QHMA 1NCGA 1ZLSL 3C6SB 1YC8A 3M0MA 1VERA 2DY3A 4TNEA 2B81A 1A4LA 2L7EA 1IM3D 1D5ZB 3ULUF 1XF2A 1EEZA 4TKWA 1BD2A 4YDIH 2EO7A 2YIHA 2HRGA 4L6HA 4WZHA 4KQ3H 4X5QA 1YYLL 1ZLDA 1NANH 1HE7A 3C12A 1MNNA 5FL1A 4C56B 1YPZA 3BE7A 4WHDA 1HHGA 2OB3A 3STLB 1R33A 5H2BB 1TJIH 1X5YA 1EJXC 4M5PA 1CBGA 4REQB 1KJ2H 5J11B 3A6CH 3UJSA 4KROC 2Y25A 1Q0YH 1C5CH 2UXGA 4WY7H 1YN6A 2ZOWA 3PTQA 3SDAB 2WBKA 1J1OH 3T55A 3W28A 3DROB 1ESWA 2IWEA 4WW2F 3VYLA 4WFFE 2DM4A 4DN4L 3WTTA 1W54A 3K74B 2UZXB 3DIDA 4JTUA 4BFJA 3HC0A 1NGQL 2AANA 1AZRA 1UBSA 4JR5A 4LSQL 3WIIH 8XIMA 3UDWA 4U5IA 4F37F 2E9BA 4O9HH 4QPEA 1S1PA 1CENA 1GPWA 4DHLA 3LKNA 2QCDB 2DSWA 1NMAH 3TT1L 2Q87A 5A6IA 1W3IA 2XFYA 2PW2A 1JD9A 2NDFA 1OC7A 3W7PA 5EUOE 1UOZA 3QZAA 1QAWA 3MLZL 1EUNA 1JF6A 3BYYA 1JYWA 1CDJA 1LO2L 4LASH 4XAPA 3FV9A 2YO3A 3H12A 4LCWE 5FJTA 1Q9WA 2VXTH 4HMEA 3STEA 3QFWA 1A4KB 2WVVB 5SWUA 1JV2A 3STBA 3OYXA 3PUOA 1HH6B 3UO1L 3N41B 3G3MA 4GRLC 5DJYB 1FH5L 5ICYA 4Q74A 4XZMX 1DN2A 4FI4A 1NOWA 1CFTB 3F6JA 3RWJB 2F6XA 4O17A 3CFDB 4PWKA 3T6WA 4ZQKA 3VNJA 2FVKA 2IKGA 1FDLL 4ZXBA 1KCRH 4R7LA 3CPLB 2A99A 1CTMA 3QV8A 1AL7A 2MIZA 2QQQA 2LHAA 4WAFA 5IOKA 3QJAA 2KPWA 3VVGA 2WAQA 3RG1C 3VQLA 4KITB 3STPA 4FLRA 1VBUA 2HS8A 4JTQA 1QFPA 5JMOC 5JXEC 2GK2A 3ZR4A 5AVYB 2ZAGA 3LGGA 1DJSA 5C7HA 1Q7MA 4A8LA 3WLKX 3OO2A 3IDNB 5ISZA 3CXDH 1XH3B 5FKPA 2PZNA 2P8MA 1LEIA 4EWND 1OD0A 4KAQH 5I2UA 2Z2UA 4PGCA 3HZYB 1NJ9A 3S5SA 4AIZB 2VITA 3EH5B 3PQYA 4P2OB 1PKMA 1ADQL 4Y1AB 4LEQA 1S3RA 1V4YA 1VKFA 4DP6X 2HTKD 3ULUL 3R2GA 2DIKA 1J5OH 1OY3B 1BVNP 1OBAA 3QHOA 3D06A 4DFHA 5D05A 1S7QB 3DX4A 1VGAA 2NX5E 3TC3A 3FL7A 1U58B 1NC4D 3GG8A 5FA5A 5CSGA 3E3QE 3EOBB 1ACCA 2KQMA 2EIBA 1V05A 1MQQA 2V5JA 5HHPB 4X6DB 2ZYIA 1W37A 1I8LC 2YD1A 1LDPL 3ALXA 1XHGA 2GJJA 3FT4A 3EH2A 5AKTA 3SB0A 3AYTA 3TC6A 2OQLA 1E9OB 2ZUTA 1T04B 3K4ZA 1PY0A 3SURA 4NILA 4EUPG 4F37K 3AB0B 1BQLL 3WK2A 1NCBH 5IQNA 1NGXB 4KTDL 3PP3H 2GBVA 4RR4A 4FS0A 2I5QA 4Y90A 2CXEA 2E77A 4ICXA 3MU7A 3BUBA 4N9OB 1JGVL 3IJHA 2VFIA 3DVNB 2BOCA 3KM8A 3B2UD 5FCUL 5JNYA 4NPYB 2EDTA 2C26A 1SMOA 5FDWB 3VFCA 2F1EA 1FH9A 1OE1A 2Q7AA 4GI9A 4ORGA 1AO7E 3M44A 5AC4A 1D5MB 1JI2A 5TJWK 1G1KA 3FS9A 4BWWA 3V9FA 2IEPA 1OGAD 4F8XA 5FCZA 3QYQA 4DJFC 4YFEA 1HILA 5EKYA 2UZYB 4L05A 3T8XA 1D6VH 5ILTL 2OV0A 1S4IA 2X09A 2IBZX 3HN3A 4U1GC 3D2UD 4P9HL 2BNUB 5AW4B 1P7KB 1UWGL 4PJCF 3OR7A 3MRCB 2KZKA 1F86A 3HB3C 4W84A 2OGYA 4JN6A 2Y06H 2DQTL 4EJ1C 4NT0A 3B9DA 1F11A 3MREB 3OEXA 1RK1B 3CFNA 4FXKC 5GZNA 2AJZB 2EDYA 1RHFA 5EWIL 1WDAA 5H35B 3NDOA 5DO8A 2G60H 3WFZA 2YZRA 4TX6A 5IBXA 1XIIA 1YTEA 4FZ8H 3DJ9A 1UYWH 2N56A 3GSRA 1U8CA 1GK8A 2VKZG 4M80A 1XGYH 3FFCB 1W6LA 3MOAH 2IH1A 2WTRB 1MI5E 5T1KB 2VDOL 5F4XA 2WZ0A 3CQIA 3A6OA 5DJ8A 3CHSA 5D9SA 4BI6A 3IVKA 2FR4B 2IKIA 5JLZA 4FXFA 4DPPA 4BKSC 1LM8V 4AMKH 4HCLA 3U2EA 5IQ9B 2PWGA 1N26A 3W9EB 4YHPA 2Y1VA 4OV6F 3WGUB 2W0LA 2P7TB 2XTSA 3Q65A 5HI4D 4O0QA 3UGRA 3T1FA 3VJ6A 4WCYL 1TVDA 5K4XA 4R84A 3ZL1A 4ZNEA 1BJ1J 4BK4A 1JGDB 4MJMA 4O51B 4HPHA 3T2OA 1NZRA 1XGDA 5CZVL 2HFFA 1GGOA 2OZTA 1WH0A 4RMUA 2YGVA 2D0GA 1R2SA 1DWHM 3IACA 1A5OC 3QDMD 4P8QA 2Z24A 1BJ8A 4PFMA 3A67H 4KWUA 1WD9A 4JDYA 4YBQC 3L6FB 5DYOA 5I24A 4PJ7F 4F0HA 3MNZA 1XIEA 3D25A 3V0DA 2ADJB 1T0MA 4JFFD 2FE0A 1LE9B 5FXCH 3M0VA 3V9CA 1GYVA 2OAAA 3TFKD 2JLLA 2PZ0A 5ALBL 1D7DA 3HGSA 1IAKB 3TOYA 4CNTA 3NZQA 5EL1A 5D70L 2VAAA 2PCPA 2YSWA 1HKLL 1CG9B 1UD5A 4Q0XL 4E0CA 3GRBA 4N2EA 5SWZA 3CXHK 4QRTA 3EXRA 4H20H 3QEGH 3B40A 4YR6A 1MLBA 3I50L 3BWSA 3LRMA 4WLCA 3MBEA 5LHFA 4N5UA 3GXTA 4NZRL 2ICWJ 3CT2A 2VIRB 1QUNB 2IGTA 4ZDHB 1AS8A 5E03A 4HV8A 1Q0XH 1RK7A 1FRBA 4B95C 2IDQA 1Z3RA 2NY6D 1KACB 3FTWA 3KS0H 3G5EA 4XX1G 1F7BA 1XLJA 1T83A 3FTYA 2OX4A 4UTBL 2SEBA 4APQC 3QKZA 3IM1A 1OGSA 1TCRA 4XN4A 5LO7A 5SWSB 4QHPA 1DQDH 3L66A 4XVSH 3IDYC 4O8RA 1X4XA 4PJBB 4UAOC 5JIQA 1OYAA 2IXQB 2JKNA 1LWRA 2J13A 1RUQH 2BLFA 1TQSA 1OCRB 5C2GA 4ILDA 2F8OA 1DBKH 1KCBA 5G1MA 1L4IA 1QSEB 4ZOBA 8XIAA 3G5XA 4IEFB 2W0FA 4NGHL 5F2IA 5EORL 4Z77B 3UVIA 3ZY7A 2QCHA 3U9UB 4JLRA 1Q6LA 1R5WB 1TZZA 1ADSA 1INEH 4HEPG 1BFTA 3MMDA 2CLVB 3L0NA 1FP8A 1ITBB 2KZBA 4G6AC 1IX2A 4KK8C 1C8QA 3II1A 3BZDA 2V2CA 4FYTA 4G6FD 3ECUA 4M51A 4LCCC 1ACYL 3DBPA 1G7JB 2AJSH 2WHVA 4GG6F 4LUTB 4JYFA 1N5YL 5F7LB 4HHGA 1BVOA 4BDVB 2J8UF 1N0LA 2AGJH 1HJBC 4HU4A 2BZ7A 3N9SA 5BZZA 2VLLB 4FQXB 3BSHA 4X4KA 2FHFA 5AZUA 4IPJA 2Y3NA 4NYLA 2ALAA 2AHIA 2JQXA 4MA1B 1JVOA 1XO8A 3CQHA 3KHQA 4G9PA 4S1SH 4GQRA 1GZQB 1K4CA 2EC9U 4NNBA 1LDCA 1MI3A 4L1DA 1YLBB 5ENWA 1M1SA 2P5EA 1NLBL 4JEGB 2H9AA 3FCUB 2ZDSA 2Y1AA 1YMME 5D1XA 2PBGA 4P2VA 1E3ZA 2QPEB 1N6VA 3AYVA 1TPC1 4AKPA 1VADA 2LTQC 4WHTA 5DQJA 1A5KC 4CQCA 5IRPA 1PZAA 4Y9CA 4HSOA 2OL3H 3MZTA 4Y19D 3C86A 4L8CB 4MXVE 4A68A 3HI5H 3CMGA 4WJEA 3U5UA 4F2ME 5D9PA 1KBKA 5D09A 1NU5A 2NUWA 2Y7DA 5DVLA 4ACZB 4JDVA 1KLGA 2YGPA 1ROWA 5CJQH 2ZA2A 3MA8A 3FU9A 1H5BB 4NQCB 3UJIL 3AT0A 4JDBA 3IRZA 2G4EA 5GXBB 5E9DB 2RGMA 3VD2A 4HA0A 4XBGA 1NEZA 5DR5L 2QDWA 5D7SH 4NQDA 3KGTA 2JKXA 5BRQA 3EO1A 3N40F 2FVMA 3WKZA 5AVNA 5C07A 2WZ6A 3SZKC 5C9WA 3WDRA 1TWWA 2C1HA 2CBTA 1X4ZA 5AW3B 3RCNA 5IB5B 3F5LA 4DVRH 1HOCA 1HQRA 1OCWL 1SN0A 4PJDA 4R8WL 3IDXL 1XUZA 2X4QB 1MFMA 1N7KA 1MFUA 4YSOA 4LO9A 2W67A 1C1EL 4GSQA 4LLWA 2HJLB 3ZDZF 1MRDL 3QI9D 3VU1A 1ZCCA 5TAOA 3B9KD 2VDQH 1K9DA 4AIBA 4AD1A 3QUHA 1WA2X 1E9PB 3RYMA 2Z31D 4MJ2A 3UJRA 5B8CC 4UDTA 4E4UA 1R9XA 1SMDA 4B9CA 5FO8A 3KYMB 1NCDH 2DM3A 1KJ2B 1GZJA 3L7RA 4V2CB 4RZ5A 1C08A 4YAQB 4WDUA 4JHMA 2PR9A 3QPEA 2AW2A 3O4LE 2Z28A 5CPLA 1SO3A 5CCHE 5JBFA 1BRLB 3WN5A 3LM7A 1U6AH 1XAUA 3WL9B 3RUBL 2PLJA 1DXEA 3HW7A 5LWYH 5F3HB 4NPJA 5I66B 1U8QA 1ZEAL 4HYTB 3I6RA 4NAMA 1YADA 3QUZB 3T0VA 1XCTA 4NP7A 2RD0A 1NDMA 5JUEH 1A4BA 2RFGA 6XIMA 5IBXC 3QW4B 4Z08A 4ZG1A 2ZCLL 3GG1A 1MNSA 4PJFA 4I6KA 2RGSA 5IBTL 1L9RA 3S2JA 4AZIA 3TYFB 3D69B 2HE5A 1FC1A 5TDPB 1CGXA 1OPGL 4NN6C 3QNFA 4F33B 3JV5A 3UO8B 4I18A 1CPUA 8FABB 1M7IB 1CIUA 4N9BA 4DI9A 2C4FU 4HCDA 3GDKA 4GFXA 1ZAGA 2NDGA 2FJHB 5I0DA 4AWEA 1MCHA 3E8UL 3GYRA 3NG3A 1BKSA 4AI7A 4K3HA 1EXHA 3C2SA 2X0WA 3DXAD 5I1CL 1JGLH 3V5DB 2DWEA 2WO4A 1UEMA 4OGYH 4M4PA 2AK1H 3CDZA 1I9RL 1A7NL 2JK2A 3T2NL 1JPTL 4Z7VE 4AF0B 1QOKA 4NENB 3WLQA 4H8WL 4GAAA 3QCVH 1G7PB 1E65A 1HYSC 1KXQA 1BAFL 1E5YA 4QQ3A 5IQLA 4H9VA 3TNBA 1GTFA 2AFNA 1AQ0A 2FPTA 3GXPA 4L4TD 4PJGA 3W71A 2ZXGA 4L56A 3ZDYE 1SLXA 3SE3C 4BQ3A 3A6BL 4F80A 5A6MA 2EYTA 3SGGA 4Y4KA 1KFBA 2OMYA 1MELA 3V0VB 5C0AA 2GJZA 1IEVA 1K3ZA 1R85A 2BX7A 1TZOA 1JGIA 4J40A 2FBRA 5E9NA 5A7BA 4LVNC 1US0A 2CESA 2D2GA 4JO4H 2PAJA 5DRWA 3GIVB 3AU2A 3F7LA 3G6JE 3IAPA 3S42A 2A77H 4AZHA 3R0DA 5IHRA 4YVNA 4HTYA 3MBEC 4WGKA 1KM4A 4JPIB 4XZ9A 2G2NA 4ZQMA 3D3VD 4NPKA 4IHOA 1REQA 3P8JA 3EJZD 2DZWA 1HFUA 1PZ2A 2PGFA 4HWUA 3F5WB 3T2PA 2R4RH 3FQXB 5DURB 2X4SB 2FQEA 4Y2DB 1INDL 2ZJSL 4L3AA 4UB0L 1QK0A 3OF6D 2BNRB 3DIVA 3SIMA 3EGXB 3RY4A 1A5NC 1IGTA 4S3KA 1GZHC 2JKPA 4H4NA 1K5NA 1YXCA 1U3HA 4AT6B 3PJXA 1LEGA 2ZAHA 4LJ3A 3VXPA 5BZDB 5GS1C 2FJFB 4OLXH 1KMGA 3MOBH 2XC8A 1N2RB 4JY6B 1E15A 4O28A 3OVUB 3I68A 4CJ0A 2ZZ3A 4AX3A 3IFNL 1ZNNA 3BP7B 4HUXA 3QJFB 1OXYA 5FWQA 3U6RB 2B4CH 1FVEA 4Z76B 5CGMA 4QTHB 1MCOH 4JNZA 4KI5C 1DKWA 2G9HB 3EFFB 1SRDA 4TRPL 4AL8H 3CIVA 3F3HA 2VWEC 4JFEB 5I23A 3CQJA 5FYJU 1C90A 1F3WA 5DK2A 4OT1L 1Q72H 2HNHA 3K1KC 2MQ0A 2DV6A 1T4KA 3BE1H 3AXLB 3MTXA 1OOAA 4DBUA 1EZVY 2NY4B 1HHHB 2R0ZH 3TURA 4XVUC 5D1QD 5JR1L 4FA7B 3NIDB 4IRJB 1HK6A 4QE5A 2ORBL 3CUJA 4QXGL 4YSCA 1PB0A 3VFNB 3UEZA 5TK2A 1VGEL 4IS6A 4WU7A 1PFOA 4HQQL 1VESA 5IESL 2QVHA 4V28A 2BC4A 2YQ3A 1LROA 1OHQA 1HVQA 1QBML 4KKBD 2ZTKA 4IJ3C 1RJLA 5C0NC 4JZJA 1PYWB 2CDEB 1WG3A 2Z2AA 1M3JA 1EZSA 1TUFA 4W70A 3CHDA 4W87A 4GABA 4X6CA 3T0EA 3ZHLA 3FKRA 4P5MA 3PLYA 1UOLA 2POZA 2OJZH 4YEEA 4XPTH 3BUYB 2WLIA 2HXUA 4YTTA 3L17A 4GBUA 2ADIA 5AL8A 4XR8C 1OAKH 3URBA 3W26A 1ZBVA 5FB8B 1YHTA 4F2UA 1FA2A 3WDPP 2JB6B 2AXFB 4UILL 1RCYA 3P82A 3L1EA 6REQA 1TZ8A 2GDQA 3LCIA 4PTNA 2BWDA 2E09A 2WMFA 1ET7A 2WXKA 3KEHA 1ZLWH 5E6UB 4RE0A 3SQOH 4J8RB 3T65A 4KTEH 4G2DA 5IK3A 2FVNA 3IDGA 2V5RA 43CAA 1DSFH 1LNUA 1UACL 3GMMA 1KGWA 4E42B 2YKLL 2ZKYA 4O2CB 2D3JA 1CI3M 2GW5A 5AKSA 3ZRCC 5D96B 1NFKA 3ISRA 4IQHA 5K1NA 4S0SD 3LH9A 2JEPA 2GTQA 1S2TA 3U7BA 3S2NA 2Z9TA 1W0VB 1OARH 3Q5YA 3C6LD 2NQDA 4PJIE 3W1NA 3OB0H 2G4FA 1ECYA 4YE4L 4B5EA 4N8VA 2YPLA 3OX8A 1QFWL 2YCKX 4ZS7L 3CH1A 1KPVB 4XNXL 4AEHH 3HLAB 4NQED 3PANA 4WEBH 3QS2A 4AD2A 1IYXA 2J43A 4ASTA 2ITCA 4HCFA 4OCLC 5KS9E 3QO1A 1WDPA 3LS5H 4LVOC 3PBWA 2BSBA 4WXYA 2E7HA 3FT1A 3KS6A 3FB8A 1GYWA 1UZ1A 2ITEA 1JWUA 1G4TA 2R4SH 1T22A 1EWDA 2CNYA 1MHPL 5D1ZB 3TBTB 1OGPA 1OV8A 4G6KL 4DBEA 3BEVB 1MAJA 2VABA 5DY2A 5DRNB 2APWA 3IRSA 4MSWA 4WO4D 1P9MA 4LC6A 4ZUTA 1DE4A 5DZJA 4JQ4A 1XGRA 1YEKL 4GLRI 2NY5H 3BIKA 4NKOA 2X7LB 2JCCA 5I1GL 5HHXL 1RVKA 3JU2A 3GSQB 2RACA 1FE8H 5J1TC 3BJLA 1GKEA 3H22A 3D33A 5ADPL 2A1YA 3FMGL 1RPXA 2TRSA 1DV7A 4B3VA 2VZSA 4OT7A 3KTCA 3OMIB 1OSZB 3CBJB 3VKDA 4DPRA 1XDTT 5C0RH 5J4MA 3I7SA 3WBXA 2D7TL 1UWTA 4KNSA 1HEZA 4PRPA 5HA7A 1R17A 4YO0A 1W3KA 2MNRA 4LCWB 5KVEL 5ADOL 2X0VA 3CFBA 5BXFB 2I57A 3QDJB 4PUWA 4OZHF 3ML9A 1WIUA 4CCDA 5E7FA 2WINA 2XZAL 3TEXA 4WV1B 4Z2GA 3DUGA 1HHJB 4I18C 3GJFH 5AC6A 4PGLA 1X7QA 4C6FA 1IBDA 3TFBA 1PZUB 4FE9A 1JUFB 5KVGE 3HC4L 3F64A 3Q8AA 2JKIS 3ZLQC 2YD0A 1NOAA 3F7YA 3CZ8A 1Z32X 2I60H 1TTRA 4GGBA 4UYQA 1FIGL 4JQIA 4A35A 1NEZG 1PTDA 2QFRA 2H0EA 1PYMA 1G9MC 4MS8C 3LB6D 4RW5A 4LHUA 1EWEA 3OTRA 8RUCA 1PUDA 3ATEA 1CXEA 1U92B 5HD8C 2WXMA 3LN9A 3OKMB 1DCLA 1JK8B 3RTLA 4K2UL 3SBQA 5EIVA 4EMZA 3AZTA 2J4WL 4JIQA 5GS0L 4G42B 5E56A 2E4TA 4JR9L 1J9RA 3H53A 2W81C 4U3AA 3WJXA 1RZGA 5JXQA 4P05A 5HQLA 3TC7A 4RGND 5EMUA 3KP0A 4LTSA 5C71A 1B2WH 1M57B 2AKRA 4OM0L 3TC9A 4FQCL 4P5RA 1KV5A 5IMLA 1N6QL 5BS0D 4KVCL 1QZ1A 3NO3A 2J3SA 1TVBA 1R86A 1CDYA 5G5DB 2MKLC 3NCBB 1VFUA 1XPGA 2E9LA 3GS4A 4NWTL 1M1XB 3HG1B 4O58L 3RIAK 3CV1A 3RP1A 5G2WA 2GVGA 4RAHA 3ZE0F 3KPRA 2WOBA 4L9LC 1TNMA 4FI7A 5B7MA 4ENED 3JWDH 4U3SB 2CIKA 3ZGIA 2OL3B 3E49A 3RQ3A 2AAVA 3V0SA 3AU1B 2J75A 4OZGA 3P80A 1ZHLB 3QJQB 1RFDH 3QEUA 3LZQA 1SJHA 2W9EH 4C6NA 2JK5B 5BRPA 2CNCA 4OI9A 1NBYB 5HTSA 4A7GA 4NJAL 2F19L 4BELD 3HE6B 4I88A 3N0AA 4UM8B 3IFOB 3BZFB 1XCQB 2VCOA 1NCAH 4BD4A 4G1EA 3QOMA 3MBWA 2YB1A 2M26A 1KPUA 2Z8VC 3YPIA 3W5NA 3RGTA 2ZWNA 1X5GA 3OHXC 2ESVA 1MCSA 1WJ3A 1UT1A 4HT1H 3QPYA 2XBDA 3RY6C 3EZ8A 2A6LA 5CEZE 4BSVB 1QA9A 2OSXA 4P7LA 2FTPA 1KBJA 2EXWC 3JWNE 1XG3A 3TYAA 2BMKB 5A6TC 1KCXA 2G3ZA 4F79A 5JHDA 1JHLH 2W9MA 4IXHA 4TIMA 1HAWA 4EN3D 4EXPX 1O6TA 4MD0B 5I1LB 5FUOH 3K6SA 3QQ4A 1OK6A 3ES8A 5E95B 4RBPH 1V7YA 1KTLB 4KESA 1YX1A 2F53D 4ZZKA 3VD9A 5E4EC 1TUPA 5GZOD 5HGBB 4QF1B 3NA8A 3QZWB 3F2LA 1NFDF 3JV4A 4EUPA 4BCZA 4KJWD 1DTUA 4UI2A 1FLRH 2ZDRA 1XLEA 2VJ0A 1F90H 4H1ZA 3UTSB 5D2YA 2Y7QB 4JZJC 2RALA 3VG9B 1OB1A 2WMIB 2NSXA 4X7DC 4GRLA 2ZUQC 5TNVA 5DEGA 3THAA 1G4RA 2TODA 3E0WA 2WPBA 3B3IB 1E0XA 2OCZA 3K13A 3T0EC 1Q3NA 3LSCA 2K0RA 4PBFA 4ATTA 5FJJA 5J04A 2F8QA 2FQDA 3T4AB 1IO4C 2UUDH 4XE0A 3SE9H 4DZIA 3QQDA 3PWUA 3SOBH 2PYFB 3L68A 2QQ6A 4AC1X 1FSKB 3SO3B 5I73C 2E67A 3FRUB 2IFGA 4FOMA 5C9JA 5K9QI 1T7ZA 3ASNB 5JXEA 3BLPX 1L0PA 1EJRC 2AJYL 3QXUA 2NTFB 2V5KA 3AREC 2JI2A 3VWKD 5I19L 5FAJA 3UPWA 5DTFA 1VLIA 2BCKA 2CLFA 1ZPTA 4NJKA 4R7DA 5ECGA 1NLDL 1PTAA 3KR3L 3VIFA 1LP6A 2OXGA 4AKOA 2V7NB 3B8DA 4D8ZA 4ALDA 2NQ9A 4MJ5B 3PFMA 1DDHA 1GG1A 5I03A 4QR7A 4PJXA 3M0KA 1FO0A 4XD6A 3QCTL 4KTYA 2DDXA 4MRBA 2CBPA 4PWIA 5AHNA 3WBEA 2ITDB 1A65A 5C0BA 1P0DA 4TMCA 4F9LC 2VC2L 2P8BA 5H8MA 1PW3A 3A4EA 3UZXA 4AZCB 5I8CB 2UY3A 4UF7C 2BNQA 2CLZA 1U8NB 1G9NH 1RPQA 3CFMA 3RVUD 3SBFA 4GS7C 3TCXA 5L6YL 2FO1A 3BPCA 1FFTB 1I8LA 4W6YB 3MJ6A 1BAGA 3TPKA 3A4WA 5I17A 1GS6X 4AH2A 4KETA 5D5ME 4HA1A 3IJ9A 4JZOB 1X96A 2DM2A 1G7IB 1U41A 3QNXB 2GCYA 3IEAA 4N9CA 1RULL 2PBOA 3F4CA 3FOMA 3J7HA 4F0MA 5C92A 2MOGA 3BQVA 1E4JA 1Q6OA 1QI4A 5EU6A 4NNPH 3BQUD 5D2LE 2EC9T 1YECH 5JOFA 3NUKA 3ALFA 2VR7A 3WD4A 4PTTB 4B5NA 1H6UA 4HSNA 1MREL 4WI0B 3QUKB 1A5AA 4PE8A 4Y5YB 3EGJA 4LAKA 5AWNH 5AENA 4XXDA 2F38A 4OZOA 1GOXA 2C4XA 2VM4A 3NDYE 5E00B 1MAKA 3L0GA 2N7SA 1EEUA 4DJFA 1INQB 4A63A 2XZQH 3MVTA 3VFMB 4ABVA 4J2XA 4DZBB 1K7FA 3IBEA 3Q1EA 3CPUA 1GGIH 1A6UL 2EZ0D 2HZGA 3ULVH 3HNSH 3SCSA 4TV6A 1P4LB 3MODL 1BGXL 5D7LA 1PL9A 5IHZA 4OV4A 3WJLC 4G56A 1EPXA 2HEJA 4M0XA 1SEQL 4NBXB 1UZ6F 4FXKA 1CDGA 3ARDD 2PWEA 1XICA