5EMYA

Human pancreatic alpha-amylase in complex with the mechanism based inactivator glucosyl epi-cyclophellitol
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Glucosyl epi-cyclophellitol allows mechanism-based inactivation and structural analysis of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5emyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5emyA01
3UG3A 1JXKA 3A6OA 5CGTA 1ODZA 3K8KA 3SCTA 1C8QA 1BTCA 2Y8VA 2J77A 2VR5A 3AIRA 2GJRA 1FA2A 3CPUA 1GQKA 1JZ6A 4UQBA 5BRQA 3CMJA 2XN0A 2EEXA 2Z1KA 5EMYA 1NQ6A 1CGXA 3CZSA 8A3HA 1E6SM 4MADA 1OGBA 2E9MA 3SURA 5GNYA 2YLAA 4CUCA 4J28A 4PMDA 3W28A 1OIFA 1JYWA 4AZGA 1QHZA 3WH9A 3NIYA 1B9ZA 3WH8A 3UG5A 2JIEA 3EJQA 3WMCA 2G3NA 2VCCA 3ZJKA 1F4AA 3PZTA 1V6WA 3GBEA 1JD9A 2VNCA 3PZGA 4AMXA 1B3WA 2XN1A 3RM9A 3WQWA 3VD4A 1MVYA 3BVUA 3ECQA 1E0WA 5C71A 1WP6A 3BLKA 3L2LA 1UWUA 2XVKA 4AZCA 3WL1A 3WH6A 1E6QM 3VDCA 4AY1A 4H8HA 3RPMA 1QX1A 1OT1A 5HOSA 2WKLA 3AIUA 4QLLA 3CHEA 1KCKA 3MMDA 2OWWA 1VAHA 3PZMA 5EBAA 3F5LA 3T0DA 5HXMA 4RE4A 2YLLA 5A94A 3VMOA 4GKLA 2GK1A 1KBKA 3QOKA 1J0YA 3LRMA 2J74A 3OZOA 5A8OA 1JAEA 2W91A 1Q6DA 5A2BA 1NH6A 4W87A 2WHKA 2EAEA 2JALA 1GJWA 4AZIA 5C70A 3W0KA 1HVXA 5LA0A 1UG6A 1B3XA 1UR1A 4DM2A 3W6MA 3CMGA 1JNDA 2G4FA 4OOZA 3MSDA 1QOXA 2PB1A 3CUIA 1KGWA 3WQ5A 4H8UA 3TTSA 3A21A 2OSYA 3VTRA 2OWXA 3I3EA 5A8MA 2WHJA 1X6NA 4KMQA 1E3ZA 4F66A 4PMYA 1R34A 1UWQA 1E6NA 1V3HA 5E70A 4NI3A 3NDYA 2ZXQA 5HNNA 3KWXA 2CIPA 4XZWA 3A23A 2VQUA 4OOUA 4L4OA 4UCFA 3QHNA 3MANA 1I1WA 1MQRA 1HVQA 1HXJA 1SZNA 4PSPA 1V6XA 3LPPA 2EPOA 2A3HA 2DT3A 2Y4SA 1ISVA 2WBGA 1UWSA 4D71A 2DGAA 3VIFA 1CYGA 2FDMA 6TAAA 1W91A 1V3KA 4U3AA 3D51A 1C91A 3BUDA 5EB8A 3WY4A 4DO6A 4JFVA 2XSAA 4JCLA 1HN1A 1VJSA 3PTMA 3AHXA 3AS1A 5A6JA 1V6UA 1XHGA 3HN3A 4W5ZA 4B9YA 2YL6A 2EBNA 1UD6A 2W67A 3LPFA 1E4MM 4AYSA 2VI0A 2IXUA 2WMKA 4LPCA 5AC5A 4CU8A 4XB3A 5E9AA 3RJXA 4OZOA 3F5KA 3DC0A 3DX0A 2CBJA 4PUDA 3VGDA 3EJPA 4JFWA 4FLRA 1VEPA 1HF6A 3BLBA 2WMHA 5D9PA 3SCUA 2XHYA 4ZE4A 2DEPA 4JL2A 1JFHA 3EJSA 3SCOA 1J10A 3AIWA 1TA3A 1JG9A 1J0HA 1NWUA 1HJVA 3A24A 3EJRA 5A3HA 3A4XA 3PHAA 2UY4A 3OA5A 3WFZA 1MWOA 4PMOA 1ZJAA 4TOQA 3ARPA 2WVSA 2J75A 1V0MA 1B3YA 2J7HA 1GW1A 2D73A 3O9NA 3ZT7A 2A3EA 3ZJ8A 3MUIA 4F9DA 2FYVA 1OD8A 1BHGA 1OIMA 3CO4A 3D50A 1JDDA 2WYSA 3HG3A 1HXKA 3ARWA 4CD5A 2ZUNA 1HJXA 3NUKA 5FOOA 4JFTA 3WEZA 1E71M 3PTQA 1FH8A 2FHBA 2J62A 1U30A 1V3MA 3SCVA 4JIEA 1EQPA 1IZKA 4V27A 4LQ1A 3A3HA 2J25A 4NRRA 3AICA 1ZJBA 1W9BM 2F8QA 3L4UA 4QCEA 2ZIDA 1JF5A 2FHCA 2BS9A 1BGAA 3NSNA 4HMEA 3WL0A 2XM1A 1DWHM 1TCMA 4OGZA 1WDRA 2VO5A 3EBVA 3SCNA 1DHKA 3U57A 4PTVA 1TQSA 1UWRA 5D8ZA 3ARXA 4D6IA 3MSGA 3NCOA 1WZMA 4CN6A 1BQCA 2DDXA 3CTTA 1RD6A 2WZEA 4CU7A 3T09A 4IUGA 3SUVA 1LL7A 1XH0A 1VBRA 1CXFA 4HA3A 8CGTA 3ZO9A 5IFPA 4HPGA 4HMCA 2WMGA 2YDQA 2ALWA 3VINA 2YDSA 2Y2WA 4TX6A 4IPLA 4W7UA 5I3DA 3HG5A 4TX8A 4AC1X 4NXKA 3WF2A 4E4PA 1J0KA 1BYCA 3AMDA 3GXMA 2DSKA 1TQVA 2OSWA 2ESCA 1UUQA 1P6WA 3LPOA 1W3JA 2CYGA 3LPGA 1TVPA 3TONA 3VNYA 3GYCA 1A47A 3PZ9A 3NDZA 2HISA 3WUGA 4W88A 1TQTA 2WVVA 3S5YA 4N0RA 1R8LA 2J7BA 1QWUA 5BROA 1HKMA 2E0PA 4UQEA 3AHZA 3K8MA 4PTMA 5FKYA 5C8BB 4AISA 2X1IA 3ARVA 4L4PA 3PZVA 2CESA 3M07A 1H09A 5BRPA 3W27A 5CXPA 3KL5A 5DT5A 4AZ5A 2ZX5A 1ESWA 2O9RA 2PWGA 4UQCA 4JKLA 2J8GA 5LYRA 1M7XA 3DDFA 4OJYA 5IHSA 5KZ6A 1XCWA 4MNKA 3B9EA 3UEQA 3D52A 2GSJA 2XG9A 1JDCA 1E6XM 2FH6A 2D20A 1CLVA 4F79A 3W82A 3VIMA 1EIBA 2J78A 1J01A 3KEHA 3IJ8A 2X2IA 3DX4A 2J47A 1UKSA 1R75A 3WNMA 3UR8A 2C7FA 1C93A 1G1YA 2CPUA 5BXTA 3OB8A 3RM8A 4E8DA 3WENA 3GXFA 1GQIA 3BUIA 3GNPA 2Y5EA 4GI8A 1GOIA 3CC1A 4QLJA 1GPFA 2GDVA 2W63A 3PN8A 1ZB5A 1PS3A 2BVYA 5CLTA 3GM8A 4XZBA 2F18A 3WY3A 1UZ1A 1AMYA 4RE3A 1DEDA 5EFFA 2DQXA 3EJUA 5AYIA 4A4AA 4D6FA 2J7CA 5CPQA 3WDJA 4W84A 4GO9A 1TFVA 2VR4A 4AZBA 3BVTA 3PBGA 1WZLA 5A6MA 5TD4A 1ZU8A 2O9PA 3SUUA 4JZ5A 3IJ9A 3VIIA 1W3HA 3BC9A 1GONA 1M03A 1UR0A 1OWQA 1V0NA 4CCCA 4MDOA 1GVYA 2CBVA 2G41A 2BHUA 3ALFA 1UD5A 1CXLA 4QFUA 1UWIA 1GZJA 3AZRA 1VFUA 5FCZA 1C3FA 5GPRA 5E6ZA 4BQ3A 4NX0A 2ZICA 2ZOXA 5CQ1A 6A3HA 4HP5A 2CKSA 1B30A 3VD9A 1B31A 1GCYA 2Z1SA 2J7FA 2F61A 2YFOA 1XGZA 1WKYA 4EE9A 2BVTA 3AYSA 4P7NA 4ACZA 3WD3A 3VU2A 3LXBA 3ZJ6A 2V38A 4AWEA 2YOCA 2ZUTA 3AXHA 1MFVA 3VO0A 5CLWA 4Y7EA 3W53A 2WMIB 4XX6A 1HT6A 3K1DA 4A3YA 2VCAA 3PZIA 4D6DA 4DM1A 3HJEA 1SR0A 1UD8A 4A3HA 2O9TA 3SUWA 4DWSB 4AZCB 2JEPA 2OWCA 4HZ8A 3D4ZA 3IJ7A 3VGGA 1E4LA 2ZWYA 3A4WA 3EMQA 3ARUA 3U7VA 3GNRA 1QNQA 2O92A 2D3LA 3W37A 4HU0A 1K6AA 4S3KA 3AXIA 1CIUA 3BAIA 1G0CA 1LWJA 2V5CA 1TMQA 3PTKA 2TAAA 2DSZA 4JL1A 4XV0A 4C7FA 2PBOA 1JGIA 1UQYA 1UD3A 3OBAA 3LXAA 3MV11 5M17A 4J3SA 1E9LA 2WMIA 4OBRA 4BCEA 3T2QA 1EDQA 1W1TA 2ZX7A 3WF3A 1AQHA 4FLQA 3SCSA 4QP0A 3VNZA 2J7DA 1D3CA 3VGFA 2CCRA 3T2PA 4QAWA 4DUXA 5AY7A 5A1AA 2UY2A 2AOSA 4E8CA 3AZTA 1AVAA 2J7EA 1UWTA 1KGUA 3WD0A 2BY2A 2RGMA 1R46A 3VGBA 1LG2A 3D4YA 1MW1A 2AAAA 1UKOA 3WY2A 2VX6A 4Z2IA 2PI6A 1ISYA 3DECA 1E43A 2WB5A 2FGZA 3VM5A 1X1NA 2QHAA 5M3WA 4UQ9A 2OYKA 2XFYA 3CZEA 1XSKA 1XV8A 3PZQA 4P7LA 3BAJA 3QHMA 1XRVA 2JIWA 1W9XA 2EO7A 2ZX8A 1ZL1A 3N11A 3ARSA 3VIGA 2AMGA 2JE8A 1H0IA 3AJ7A 1U33A 2FE0A 1PZ3A 4DO5A 2YA0A 5CGMA 1GOKA 3CZKA 1BFNA 3AISA 3W38A 1FHLA 4W85A 4MB3A 1EO5A 1W3KA 4H04A 3WF1A 3AFBA 2PWHA 3AZSA 1VF8A 3K46A 3S6TA 3MMUA 4GINA 1HP4A 1XD1A 1WDSA 2GJXB 1WB0A 3AIBA 3OLDA 1W9PA 5CPTA 2ZXAA 1XH2A 2G3MA 3BAKA 1JDAA 7CGTA 4AD5A 3MS8A 2WVUA 1E4NA 1DWAM 3ZT6A 1GNXA 1NP0A 5CJ5A 3GH4A 3EDDA 4FF5A 4J27A 1KTCA 1CGVA 2ZUSA 4D1IA 2GFTA 1RPKA 4HPHA 2YJQA 1E73M 1ZBVA 4TTGA 3UCQA 1KB3A 2WMFA 2EPKX 3B9DA 2DT1A 3TTQA 1E0VA 5IHRA 2V3EA 1L0PA 1KXVA 3VPLA 3VIKA 1E1EA 3MO4A 2G3JA 1DWGM 1T0OA 4UFMA 1CXEA 4IM4A 3WH7A 4PMUA 4D72A 5JBDA 4PTXA 3W26A 1CNVA 2D24A 2EJ1A 5CSYA 1B0IA 4UFIA 1KXTA 5I79A 1HP5A 1E56A 3VIJA 2CETA 4HA4A 3HG4A 3W4RA 3SCWA 2VX4A 3M46A 4UNIA 3FAXA 5JUVA 1TE1A 5I5RA 4GQQA 2V3DA 3ALGA 2QMJA 4NZFA 3LRKA 4GO8A 2WSKA 5IDIA 4UFHA 1ECEA 2A3AA 2GVYA 4Z2GA 1JZ4A 1E72M 3DYPA 1WPCA 3L4WA 3ARZA 5CZKA 3E1F1 3U5YA 2NW0A 1QVBA 1ZBWA 4UZUA 4D1JA 2NT1A 2VRQA 1IT0A 1W9UA 4HTYA 4HZ7A 1I75A 1QWNA 1V3JA 2GDUA 3N17A 4AW7A 2F1AA 5HDRA 3W29A 1XD0A 1DP0A 2PF0A 4PCSA 1Z32X 4U2ZA 3OGVA 4CD8A 1GOOA 4MB5A 3ZOAA 2ZE0A 2A3BA 4UFLA 2F1BA 1XYFA 4DWSC 2ZUVA 1QW9A 1H49A 1LJYA 2XM2A 4ATLA 2XVPA 3VM7A 2QV4A 3OIHA 1E6PA 1O7DC 3BVXA 1UKPA 5A8PA 4LYRA 3UESA 1JNEA 3J7HA 5E0CA 2EABA 1LG1A 1EOKA 2JEQA 1W1YA 3A4AA 1WNOA 1NOUA 4CD7A 3U7BA 3BUBA 5HPOA 1QHPA 3WSUA 2DIEA 2ZX9A 5CPSA 4UQAA 4GZEA 2J79A 4OKDA 3WNOA 4MJ4A 1TVNA 5I6SA 2WHLA 3WEOA 2V5DA 4WJXA 2YBTA 3IGUA 1UA3A 2DSVA 1HJUA 2XYLA 4CGTA 2W62A 5DEZA 4C7DA 3BH4A 1HTYA 2VRJA 2YA2A 1KCLA 4BQ4A 5F7UA 2VC9A 2WCSA 3WDIA 1UZ4A 1E6ZA 2WC4A 4QCFA 1V6YA 4AZ7A 4ATDA 2ZXDA 2CEQA 3AS3A 3CZLA 3OLGA 3WBAA 2CKRA 3AMCA 4CVUA 2X0HA 3RDKA 2BHZA 3TP4A 1UKTA 3EDKA 3RO8A 2WVVB 3GXDA 1NWTA 5ABGA 1IZJA 4R27A 3FNDA 4KRTA 4TUFA 1JZ2A 4HOWA 1ISXA 3VKKA 2C0HA 3WD1A 4WLCA 3F4VA 2UY5A 2YDRA 4U3CA 1V0LA 3BGAA 4GI9A 4WKFA 1US2A 1CENA 3OLIA 5ABFB 3AS2A 1EGZA 5A69A 4MB1A 1C7TA 1LLOA 4OBSA 1WO2A 5E09A 1UHVA 2XGIA 4UFKA 1Q4NX 1H1NA 1MQQA 4DUWA 5JBEA 4FNQA 1HKIA 4AIEA 4H2CA 1PAMA 1PPIA 2J7GA 3ZR6A 4M29A 3AMLA 4WSKA 4GZIA 9CGTA 4NSBA 4GIAA 4EKJA 1SMAA 2OYMA 1ISZA 3FN9A 5IFTA 3GH5A 4ZEPA 3T0AA 1RH9A 3PZNA 3WD4A 4CVWA 1CTNA 1HKKA 5A6KA 4PYSA 1CZ1A 3MKKA 1GHSA 3B8SA 3CLWA 2ZWZA 4MB4A 4M8UA 3CZJA 3IANA 4GPNA 1WAWA 3VILA 5GQBA 3AI0A 1E5JA 1PX4A 1ZBKA 4UOJA 3LXCA 6CGTA 1B3ZA 3AS0A 1XCXA 5BCAA 2A3CA 3OG2A 1VFOA 1H41A 1XYZA 3APGA 4AMWA 1M01A 2CBUA 2Y8KA 1G9HA 1KXQA 3RJYA 1BYDA 1FFRA 4KGLA 2F2HA 2XTKA 4D6GA 3GZAA 5BXSA 1EHNA 3MMWA 4PMVA 5FD0A 2DPEA 2VJXA 4W7WA 3OZPA 2WXDM 1L8NA 4AXNA 2WK2A 3AIQA 4MNJA 3K8LA 1UD4A 2BV9A 3L4TA 4LYPA 3AOFA 4AEFA 4B3LA 4EK7A 3VMNA 4OIFA 1SFSA 4BA0A 3VOCA 1E15A 2CHOA 2PBGA 1NARA 3EYPA 1CXHA 4M56A 3L4ZA 2W92A 1B90A 1SYTA 3EMZA 2X2YA 2CERA 5GNXA 4B15A 2DIJA 1U2YA 2Y24A 1GOQA 3QHOA 3VD7A 2E4TA 3OLEA 1BYBA 1WCGA 4CN1A 2VZOA 5BYWA 1AQMA 4P8VA 1HIZA 4UFJA 1JZ8A 3VIOA 4K68A 2E8ZA 1JI2A 3K4AA 4S3JA 2XIIA 3TTYA 1YHTA 1QNOA 3AHVA 1D7FA 3AMGA 2WZHA 4F8XA 5E1QA 4P8XA 1CGUA 1KQZA 3ZQ9A 1IV8A 2QPUA 2GK1B 4GQRA 1KWGA 1FOBA 3SCPA 1MXDA 3ARQA 2D3NA 2BXZA 2GJXA 4IPNB 2W66A 4P7OA 3WF0A 1H2JA 3BAXA 2QPSA 4FNTA 1EDTA 3VDHA 1GOMA 3D3AA 1OSEA 5GNZA 3CHDA 3N12A 2VRKA 1R33A 2BY3A 4W93A 2WC3A 5A2AA 2OSXA 3EJTA 3CZNA 1JI1A 1CWYA 1UR4A 2BNJA 2WMJA 1UR9A 1EHAA 3VIHA 1A3HA 3TA9A 1JYXA 5DF0A 4FMVA 3W6LA 3MUY1 4XUYA 3WUEA 3BVWA 1JIBA 1H0GA 4V28A 3VUPA 1W1PA 3CH9A 4CCDA 2CBIA 3POHA 1H3GA 1UD2A 3FHAA 4MTVA 1PJ9A 3VSTA 1RP9A 4ZENA 4NXSA 3KL3A 4WIWA 5ABEA 2J4GA 2BY1A 1BLIA 1XSJA 4AD1A 4KGJA 4AIUA 4AEEA 5KEZA 4W7VA 4MAVA 2VX7A 1R47A 3FY1A 2EPMX 4CD4A 4UZSA 3SEPA 4C7GA 3ARRA 3BUPA 5A6BA 1K9TA 4J3VA 2PWEA 2X8RA 4UTFA 5BWFA 1K9EA 3L4YA 1KR0A 4PMNA 3VDAA 2XGBA 3II1A 4KWUA 3WDHA 1K9DA 4MJ2A 5CSUA 1OBAA 2D0FA 4BQ2A 2D0HA 3POCA 3LRLA 4PN2A 2XJ7A 4P7QA 3A5VA 4J3XA 1JAKA 4GZJA 3W81A 3MUAA 4M80A 2VURA 4X9YA 4QLKA 1MQPA 3UERA 3SCQA 1HJWA 3VSUA 3EMCA 3GXIA 1PIGA 1Q6EA 1GQJA 1LWHA 5D9OA 4X0NA 1WDQA 1VEOA 4J3TA 1R87A 1BVZA 1W2VA 5E0FA 1CECA 2VZTA 3DYOA 4W8AA 2CXGA 1EA9C 2D0GA 3BAWA 4AZHA 2DH3A 5A2CA 5DMYA 2D23A 3UR7A 1M04A 4CCEA 2V3GA 3PZOA 1OGSA 1C90A 3BCDA 1QI2A 4NZJA 3T0BA 3RMEA 5A6BD 4H8VA 1N82A 1CXKA 2FGLA 3WEMA 3AHYA 3WDPP 1V3IA 4M1RA 4UOQA 1NWSA 1MFUA 3VGEA 4JKKA 4ML4A 1UASA 1KWKA 4W8BA 5I23A 3K4DA 3HU7A 1LF1A 4ZXOA 5JBFA 4BQ5A 4U33A 3VGHA 3WNKA 2G3IA 1VIWA 2OW6A 4UOZA 3AMKA 3G6MA 5BXPA 4YHGA 1JD7A 3ZR5A 1NOWA 4AIOA 4EANA 4D6HA 4W86A 1DWFM 2JFEX 1BG9A 1K9FA 1UOKA 5FIPA 4FNRA 2EQDA 2W5FA 1CGTA 1LL4A 5A6LA 3KZSA 1LL6A 3SCRA 3FAWA 3L2MA 2VL4A 2NSXA 2Q8XA 4ACYA 1BGGA 3RCNA 4AMCA 2D1ZA 1G5AA 4U5IA 4P8UA 4U5KA 2WWCA 1QW8A 4RL3A 5I78A 3VDBA 5E6YA 5I24A 1KTBA 4Z2KA 1PIFA 2YFNA 1NM9A 1KBBA 4CU6A 2VCBA 3BSGA 1Q6GA 4ACZB 4PRWA 4V2XA 3M6DA 4AD0A 1CGYA 2BHYA 3WQ4A 1HX0A 3ARTA 1JZ7A 5D4YA 2WAGA 1M53A 1OD0A 5ABHA 4P7RA 1MW0A 3GXNA 3GNOA 3WDRA 4Z2LA 4WF7A 3A22A 2WCAA 2FHFA 5IXEA 2QMKA 2ZUMA 2IXVA 3H55A 3HMCA 2YL8A 3SUTA 2E9LA 1ITCA 4KRUA 1MW3A 2EPLX 3WFLA 4PBGA 3DX3A 1UA7A 3DHPA 3AYRA 2QF8A 4DUVA 1V02A 2DT0A 1NOFA 3O6AA 4ZE5A 2GUYA 2BVDA 3CZ8A 5D8WA 2E8YA 3ARYA 2O9OA 4B16A 3CBWA 1G94A 4HMDA 3THCA 4WSJA 3LX9A 3W25A 1KFWA 3NSMA 1GUVA 3WKZA 1JXJA 4HOZA 1VFMA 1V08A 1Q6FA 2XVNA 1VENA 3A47A 4PCTA 1PBGA 1QNPA 1J0IA 4JFSA 4JKMA 1J9YA 2WLZA 1V3LA 2EXOA 3GBDA 2NT0A 2XVGA 4LXFA 1ZBCA 3KE0A 1E6RA 2GJPA 4CKQA 1EXPA 2WKGA 2X2HA 1DTUA 1UYQA 2RGLA 2DT2A 2WNWA 1E5NA 3N04A 4HZ6A 3VMPA 3CUJA 3MUZ1 4R5EA 1OB0A 4D6JA 4AD4A 5BXRA 4PMXA 1QI4A 3ZJ7A 3WMSA 3DHUA 2X0YA 2F7RA 4BS0A 2IGTA 3WIJA 3DDGA 3WDQA 2F7PA 4AD2A 5FL0A 4D6EA 3BAYA 1J0JA 5DT7A 3U5UA 1PEZA 4ATWA 2QLYA 4Z2JA 4LX4A 3S2CA 3M7SA 4H7VA 1QNSA 1Q6CA 2VTFA 3ZSTA 3DX1A 4FLOA 3CUHA 4IISA 3QR3A 4NZCA 1UH3A 3CZGA 1HL9A 3LMYA 4DWSA 3VD3A 1D2KA 1FH9A 2HVMA 1XC6A 1VJZA 2E40A 1MXGA 3BXWA 2XVLA 4U2YA 3UG4A 1BPLB 1OGGA 1I1XA 1R86A 4MDPA 1B2YA 1UH2A 2UY3A 4ZFMA 2WVTA 3OGSA 1HJSA 3CUFA 3IAPA 1E1FA 2V3FA 3L4VA 5JIPA 2YL5A 1O6IA 2WBKA 1OCQA 1HKJA 2VVNA 1VEMA 1GJUA 1J18A 1RP8A 1JZ5A 4HA1A 1E0XA 3WH5A 2WWDA 3VD5A 2WM0A 3AHTA 3VVGA 3L4XA 4Z2HA 4AYGA 4PMZA 3IK2A 4E2OA 2WANA 4GXPA 4D6CA 2YA1A 1JZ3A 1CDGA 2WLYA 1TG7A 2OYLA 3WMBA 1X6LA 5M03A 3I3DA 1WZAA 3BMWA 2YL9A 1W9VA 3EDJA 3WY1A 1R85A 3AXXA 1TQUA 3ZIZA 4TVUA 1H5VA 2VMFA 1B3VA 1KXHA 2X09A 3AQUA 2X05A 1CXIA 1E3XA 1TA3B 1W3LA 2W4XA 3T2OA 4RE2A 5JIWA 1E70M 2C8NA 1CPUA 4B9ZA 1FFQA 3RILA 4TVCA 3D5HA 3N9KA 1V03A 1JF6A 2YIHA 1NWRA 3DYMA 5M5DA 4CN4A 1WE5A 1QI0A 3S5ZA 4LGXA 4GI6A 1UH4A 4URIA 3AROA 1DWIM 1GOWA 4QDMA 3CUGA 2XIBA 3WN6A 5LA2A 1H11A 2YBUA 3ZM8A 3EDEA 2D22A 2WCGA 1DWJM 3BMVA 1SMDA 2XPKA 1EQCA 1OINA 3PZUA 4HU8A 4P8WA 1CEOA 3WF4A 2XFRA 3CV5A 4WK9A 1EO7A 2VVSA 3FW6A 2XFFA 5A8NA 1NP2A 2WC7A 3CGTA 3AIEA 2D2OA 4PTWA 1QI3A 1KQYA 3B9AA 3SIMA 2XWDA 2OW7A 3N13A 3H53A 3BLPX 1F4HA 1GORA 3G6LA 3GXPA 1FHDA 3RIKA 4OUEA 2ZXBA 4FNPA 4W89A 5A95A 5DO8A 2CNCA 7TAAA 1C92A 4WKAA 2F7OA 5FL1A 2PC8A 2DSWA 1EDGA 3IAQA 2VZVA 1BVNP 4YHEA 1JYNA 1H4PA 4PSRA 3MI6A 1JYVA 4J7RA 1GQLA 2PWFA 2EPNA 3N1AA 1C8YA 2E9BA 1E40A 2BFGA 3QGVA 3ZT5A 3WQ8A 4YPJA 1V0KA 4TTUA 1J12A 2XN2A 3THDA 1WZKA 3VX1A 3ZMRA 1VFFA 2W61A 3WNPA 5D9NA 3WQ6A 3GH7A 2EACA 5ECUA 4W5UA 4J3WA 1VB9A 1MYRA 1V02E 2ZUWA 1UR2A 4MAZA 3WUFA 4AZ6A 5LA1A 4FLSA 4Q7NA 3KL0A 4W8LA 3WBEA 3H54A 1ITXA 3W24A 3RM4A 2XWEA 1W2PA 3NYDA 1CLXA 2CHNA 2FH8A 2WZIA 4KH2A 4PEEA 2JF7A 1BF2A 4FNUA 4ZXLA 3NSXA 3HG2A 4JHZA 2VUYA 1QBBA 4NF7A 1J11A 3N18A 2X2JA 4PUEA 4M24A 4UR9A 4DO4A 3BSHA 1J0ZA 2CITA 3GXTA 3N15A 1CBGA 1GVIA 2JF6A 4MNLA 1VBUA 2VOTA 3MU7A 2VX5A 4AD3A 3TV8A 1BG4A 4H41A 3SUSA 4B3KA 3VIPA 1UKQA 2VZSA 3UETA 4JFUA 3JUGA 3FHQA 1QPKA 1UQZA 2EADA 5I77A 3WNLA 1TZ7A 1VRXA 3GTNA 1OM0A 3TOPA 1WDPA 1Y7VA 1E4IA 2F7QA 1TQWA 1MW2A 1QI5A 4EAMA 3NJ3A 4JAWA 2WHMA 1C7SA 5CG0A 1KGXA 3AIVA 2DH2A 4BF7A 3KLKA 1AQ0A 1FP8A 1QHOA 3CHCA 2OLHA 5EFDA 2VT0A 4X0VA 2MANA 1EH9A 1LQ0A 3FXYA 3BVVA 4PMQA 4LYQA 4U31A 1C8XA 2E3ZA 3MV01 4NRSA 4DWSD 4MPKA 1OT2A 1XSIA 1PX3A 2YKKA 3WQVA 5A6SA 4JCMA 1BYAA 3F5JA 3CHFA 4MNMA 1QBAA 5HPCA 1PZ2A 1FH7A 1KR1A 1ODUA 2ZX6A 1S46A 3I3BA 1R7OA 4HOXA 1HWWA 5D9MA 2XUCA 3ZSSA 2BY0A 7A3HA 1UR8A 1GHRA 5A8QA 4N42A 3WD2A 4J3UA 1V6VA 1W32A 4PMRA 1HJQA 2ZUUA 3OGRA 4M82A 2PWDA 4UQDA 3VX0A 4F9JA 1G01A 4Q22A 4YN5A 1US3A 3EDFA 2UWFA 1B1YA 2J8FA 4TVDA 3QOMA 2DSUA 2XSBA 3KLLA 3WELA 2G8ZA 1ZS2A 2VQTA 1JFXA 3O2LA 1W9DM 4M81A 5AYBA 1CGWA 4TXEA 3T08A 1TUXA 2WSPA 1E55A 1BSIA 4FNSA 4BZYA 3DX2A 2WW5A 2VZUA 5I2UA 1EOMA 3HZ3A 1TR1A 3BUQA 3CIVA 1PX8A 4FK9A 2WPGA 1FP9A 5DFAA 1R7AA 4CD6A 5AC4A 1XH1A 2BXYA 5HBFA 3BCFA 2B31A 3GDBA 5A6AA 3TTOA 1HNYA 1QNRA 1YQ2A 3VSVA 2IUZA 4WKHA 1JL8A 3WNNA 5I0DA 1ISWA 4JHOA 5ABFA 1HL8A 1W1VA 1O7AA 1BAGA 3WUBA
chains in the Genus database with same CATH superfamily
3CXFA 3DSNA 3CVIL 4RESB 2GUOB 4Y19E 4WY7L 3UG3A 2YD1A 1PKQB 4NRZA 3TC9A 3U0TB 3VFOB 2BOBB 2ZKHH 3MV9A 3PS7A 2VLMD 3EG9B 3IFOB 3MRHB 5H6HA 1YNTF 2R29H 3K91A 4KK9D 3ZE1E 5CEZD 5IQOA 5AECA 2IPUG 3EH1A 1U42A 3KWWA 4I4WB 3VYPA 1IC5L 3MJ8B 3EA1A 1AGCB 2Y8VA 3MROB 4CADB 3VCRA 2A2QT 1S3KH 3AIRA 2GJRA 3OHXC 3O2VH 4LCQA 1WK0A 1UIPA 4Z0BH 1DBKL 2R27A 4QRPD 2YK1H 4YFLF 1GQKA 1RULH 2OMZB 4M61A 5BRQA 2J71A 3VFRA 1HZYA 2IKIA 5DEGB 4MMYB 2VFGA 2KZBA 3UJJH 1U3HA 4N68A 4DI9A 2Z1KA 3CPLB 5HYSB 4MXVF 1UM4H 3SDYL 2VE6B 5AVXB 1TVBA 3SPJA 4PM1A 3TESA 1NQ6A 4HDIA 1M65A 4WDTA 4KPHL 2CXKA 1E6SM 2PDYA 1CICC 4ORGA 3ROLA 4FJ6A 1CD1A 4P2RA 2RH0A 2PGRA 1EFXB 4IL0A 4E2BA 3PXLA 3SURA 1C8PA 2K6ZA 3T2LA 4DN3L 1NFAA 4CNIA 4CUCA 5JOFB 1NIEA 3OJDB 4PE8A 3M44A 3MV7B 5FECA 2INFA 4X6CF 1K2DA 1QTWA 4B5VA 4XT1C 5KN5A 1A4KB 3Q06A 3NPSC 5E03A 1WJ3A 2FFIA 5I5IA 4GFXA 3HG1A 5FF3A 4WDIA 5C97A 4GUOA 1RLWA 1B9ZA 3S6CA 4MVBC 1VBGA 3GTXA 2O93L 3NMEA 4LCWA 3ZYOA 3WMCA 3ZS4A 4UTWC 1NCUA 3PIQB 4RZBA 1RI8A 2CLZB 1G4RA 3BE7A 5B38G 2VCCA 5JW5A 1D3HA 1DEEA 1QSFE 4QHNB 1AACA 4KERA 3KAAA 5DMGD 1V6WA 3ZLGA 1N6QH 3PZGA 3UR8A 1S7QB 3RM9A 1JV5B 1K6QL 1RVGA 2WNQA 3EBGA 1B6UA 1T20B 1Z0MA 2BIOA 1LE9B 5CR8A 1I85A 4HUVB 4Q6YA 4U1SA 2AVGA 4XAYA 2QFRA 3V6OE 2PYEE 4Z08A 4W4NA 1GVSA 1GVQA 3U3HA 1I8LA 3DVNB 3RVXC 2DP3A 3MZ2A 3QAQA 1QX1A 1B4EA 2DW5A 1OT1A 4PJBB 3I75A 1X5JA 3QPKA 1WUEA 1PCWA 4NJAH 2Y5SA 2D7OA 3DMMA 4AYEC 1KCKA 2FBJL 1ACYH 4YZFF 3EYSH 2VDOL 3UTTD 4CADA 4DPAX 4FX8A 4O58H 3BJSA 3W1PA 1DQJA 2AMXA 2CLLA 2C3XA 5F3BA 1HU8A 4HIXH 3CUXA 4P0DA 3T0WA 4RE4A 3DNKA 2NUTA 4Z7NF 2YLLA 4JS7A 4DX3A 1NCCL 1A66A 1DIOA 4M1GH 1LLZA 2ZRUA 1NWPA 4PB4A 1KBKA 2E6QA 4Z7VE 3L12A 4IF2A 1ND0B 4F40A 3QDMD 4XWGH 1EFQA 1SJHA 2VDMB 3IRZA 4MSWB 1P5VB 3U9PL 1A4JA 1WA0X 2CR0A 3I6GA 5AW3B 1GJWA 2WHKA 4O50A 4NNAA 3NJGA 4AZIA 3W0KA 2CW6A 1LL4A 3RVWD 3SDAC 1JWUB 5I16A 4R0LA 2R94A 1Z0NA 5DC4B 2HSIA 2AAMA 4JFZL 4DM2A 1SW7A 2E59A 3REVA 3LNDA 3DFHA 3GMOB 2W59A 5E4AA 1BZ9A 1OY3B 3LBOA 1KOAA 3S8HA 4MNGE 1FWXA 3L7FB 1AW5A 4AVHA 1MI5D 1YO4A 1X5HA 2CUMA 2VDRL 4YR6B 5HJ3A 4BEUA 1I7ZB 2X4QA 3OVGA 2KZWA 5DA0B 5DZNA 1FNEA 4FQPA 4H8UA 5D7JB 3WE1A 4PBFA 3WQ5A 1XBDA 3NGJA 4BI5A 7REQA 4A04A 1WWWX 4PJEE 3A21A 2OSYA 3TEZA 3VTRA 1T7VA 3MJ9A 4EDWL 3FO2A 1OYCA 5D2NA 5IJKA 2XZQH 1O1HA 4PMYA 4C83A 2IDFA 2HTMA 3E74A 1V3HA 5E70A 4P2RD 1GVFA 4PJIE 3VH8B 2BRRL 1TWWA 1H7OA 3VKAA 1JFQH 2PTWA 3SYAA 2CIPA 4HLJA 3A23A 2ASHA 4HJ1A 4XP5H 5AVRB 3GG8A 4FX6M 4XP4H 3S8GB 2CUAA 4XGZB 1EHXA 3HUJF 4LSPL 4UNTA 1ESOA 1XB3A 3GJFK 3ZJAA 3DMMB 3LQAH 3SO3B 3ZGHA 3NO5A 1IAKB 3W2JA 5FFGA 3H9HA 1UURA 1MQRA 2Z1XA 1SZNA 5AC6A 3Q5TA 2X4UA 5F7DB 3IWPA 2BVWA 1VFHA 2CO7A 3HMXL 3PHSA 3CSGA 1GWJA 2EPOA 3VXME 5I82A 2FDBP 2Y36L 1IFHL 4GW5A 1UWSA 2WBGA 3A3YB 1I1YB 3G6DL 2DGAA 1TPB1 4AYMC 2L7EA 2WZ0A 4R4BA 4G1EA 4PJ9C 5D7IA 4HIHA 3FQWA 5D2LF 1YMMD 3L5HA 4X8JA 5A7BA 5A5WA 4PRNA 4JGMA 1FWRA 4UQ2A 5K9CA 4MCZA 5BS0E 1Q0YH 4M51A 2W07B 4MQ7A 3JV4B 5D7EA 3PTMA 3AS1A 1IBHA 1FCBA 4U7SA 1YE6A 4HNCA 3BLIA 2XWRA 3GMOA 3QLDA 2Z6IA 1YNTB 4WKZB 2QL1A 3G6AB 5FK9A 1GVEA 4XC3H 1FF5A 5T1LD 3SDCD 2VI0A 3QFGA 2JIXB 1WYJA 4LPCA 4NKMA 3DFOA 4OF8A 1O7SA 2Z92B 1PSKL 2B39A 4IG2A 4XAFA 2QGDA 2X4QB 4N02A 2VC2B 4Q6IB 1CD0A 1D7KA 2ATSA 4FP1A 4JQ3A 1UM6H 1GOFA 3RJXA 3UIZA 3SCMA 1B2WH 5KUKA 3F5KA 3DC0A 3OIXA 1M7IA 1NSJA 1U92A 1MUJA 1XIWA 4HH8A 1E2VA 2DYPD 3MO1A 4NQDB 4EQ3A 4MZYA 4DEPC 1MAMH 5D2NB 4XMPH 4P4KA 3U46B 1BD2A 2X1TA 5I6XB 3FCUB 3MYJA 4NB7A 3SIZA 1I4FB 1DFBH 1FRGH 1U41A 3VH8A 2WINB 5EO1B 4RPPA 1CTOA 5DTFA 2F6XA 1JFHA 1G7JA 2CLVA 2BLFA 2WLIB 3FTGA 1KDJA 4QXVA 5CSBA 5T3ZH 5E6RB 1CFQB 1RBLA 4M5ZL 4JTLA 1J10A 2FVMA 3IVKA 2ZDRA 4UMBA 4QHMB 3RTQD 3JVFC 2APWA 1SFHA 3AQZA 1UC4A 1DBJH 5E99H 1UOVA 4NRXB 4PWGA 1KG0B 2PMZA 3H7BA 5DZVA 4CSSA 5DUJA 1CYXA 1J0HA 2DD8H 4I77L 3DO7A 1OOAA 1RALA 3VRIB 1JZIA 1WVZA 4HX1A 1RUQL 3VZZA 3BSZL 4F7CB 3O4LB 5EBLB 2OM5A 3DV4A 5CGQA 2DQFA 1J2WA 2D7TL 2Z6FA 4QRRB 2PSNA 1XGRB 3A4XA 5IBXC 2XX0A 3C0LA 1MWOA 4AQEB 2ZZ3A 3WEBA 4A2LA 1ZJAA 2WYZA 4G1EB 4F8QA 1KKRA 5EOTA 1U6AH 4NL1A 1ADQA 1T2QL 2CJTA 3NFNA 3OKDA 2VDRH 4BKTC 1X9QA 2RHGA 4EXQA 3KVPA 5D4IA 3RNKB 3WK1A 3TAOA 3VNIA 4MCZB 4MZ3A 2X1RA 4J2PA 1Z9SB 2BS71 4YJ5A 3OC5A 3EBAA 1MI5A 1OHZA 1R24A 1HNGA 1FUYA 1XS2A 1SQ2N 3ZTEA 2ZOKB 1OIMA 3SD5A 2RJGA 3CO4A 2JKSA 4L6HA 2HT2D 4YNGA 2KH2B 5D7LD 2AW2A 4ZSOB 1G69A 4DXKA 2PWUA 3P77A 43C9B 4HBKA 1Q5MA 4UF7C 2EYSA 1ZGLM 1HJXA 3LD5A 3RX8A 4KQNA 3JWNC 4MOZA 1KULA 1F45A 1OAZH 1XQ4A 4GMTH 4APQC 3G5ZB 4X0KA 1B0RB 2HRPH 1RQHA 4FR6A 1FH8A 2FHBA 4UTTC 3H2MA 4BF7A 2J62A 4OZHE 2O1AA 4M1BA 2WN3A 5DA4A 4HC1A 1UXSB 2A3TA 3GEWB 4Q14A 4ZO8A 5AKSA 4WD0A 3V7AG 1DJIA 4LQ1A 3A3HA 1ACXA 3S5SA 2XG4A 4HV8B 1NMAL 4RQQB 1NBZB 1GXEA 3VOIA 1SDAB 1MCOL 4TS6A 1ZLSL 3AICA 3D30A 4YSQA 3O07A 3GKWL 1Q6OA 3QNYB 2DMGA 2N0KA 5DD5H 1S3RA 1I9RL 1O0VA 4OM1L 2BS9A 4HCLA 4NKDA 4GG8B 4GQ9L 3UTQA 3S36X 4LLQA 4OQTH 6PAZA 5F6IC 2JGQA 2OJPA 4IEFB 3OKNB 3D69B 3O3BA 1W31A 5TE6L 3EJJX 5D7JC 2X1UA 1TCMA 4PYGA 5FHBL 4G8GB 5JPMB 3DO7B 2HFEA 4MAYB 2G97A 5EC1B 3UAAA 1DHKA 1OC5A 3L66A 2GTQA 3UBXI 1TJIL 3L5WB 3O8XD 4KROB 4TX9A 3CLEL 5EBLA 3ARXA 5F2FA 5KYNA 4UMCA 2VYRE 1ES0B 2J56A 3Q43A 2PF6A 5CC7A 4MDIA 4R0LC 4BRJA 1E0TA 2BCMA 1CF1A 3GZPA 4KVCL 4P59L 1LEGA 1TPUA 1WZMA 4CN6A 1TETL 1I45A 3NCOA 3CTTA 2C3HA 5E56A 1RD6A 2XPYA 4CU7A 3B8IA 2VEGA 5JMOC 4IUGA 3SUVA 3W7CA 4QCIB 1OXYA 4LSQH 4X6CA 5B3JE 1FNGA 3IDMA 1LXMA 5DI8B 2OZNA 3SKMB 1QRKA 1NKGA 5KANI 2AJVL 5FGBA 5CZXD 5C07D 4HPGA 3FVMA 1DVFA 2V7HB 2L3BA 2FSDA 1CLYH 4HXAH 4LEOA 4BFFA 4PB5A 5D71L 4N1EA 4KZEH 1FWSA 2NZ1A 5I75C 4LY8A 3CN4A 2R59A 3W1RA 5I3DA 4XZHA 3FRUB 1O95A 1TIWA 1QMLA 1S38A 5L4JA 3QUZB 2HLAA 4LF2A 3V0AC 4B5WA 4AOFA 3S4SG 2QQQA 4I2XB 1MVUA 2HWZL 2VDPL 1HL4A 3C75A 4Z77B 3AMDA 1QYGH 1UG9A 1KYFA 2BOCB 3CFEB 3Q44A 2F38A 2OSWA 3A4JA 1F02I 2ESCA 1QFUH 3JV6B 2HRWA 2ZG3A 3L95B 3QP3A 1UUQA 5EFIA 2DQTH 1JHTB 2ZZ5A 3LPOA 2CYGA 3P9MA 4Y1TA 4O19A 1L9MA 1CG9B 3GS6A 4CGUB 4GBXA 4U6XB 1U5HA 1A47A 4JFDD 3PZ9A 1GC1L 1O7DE 2FJSA 3RVWC 3P60A 4PG2A 5GGSB 3HR5A 1DDHA 4Z7UF 3VI4A 4JQVC 4GBUA 4BWLA 4DXXA 4OZFH 1KPUB 3QZWA 1FZJB 1N7KA 2G4JA 1DVXA 1R8LA 4EOUA 2X6BA 3TYZA 2XZCL 4G7QB 2PS2A 3NCYP 5CPOA 1OVZA 1HKMA 3SQBB 3EOSA 1FNFA 5E6IA 3W7NA 2H47C 2HJKA 3FCBA 1E65A 2Z91B 1XJBA 1ZNNA 2BGQA 3UTPE 3MBDA 1RZJC 3VFMA 4L1GA 3B3IB 1M9WA 4XZUA 4F0MA 4YS4A 3MBWB 1YN7B 2EXYD 2ZBTA 4YJZL 4WTZA 2GUBA 3QIWD 4TN9A 2FQFA 3RX3A 2GSEA 1BXAA 1V77A 3UZJA 1IGCL 3MBEC 3PZVA 4LCCA 3VXMA 3NCBB 3FTUA 4D2NA 3M07A 4LWWA 4OGAD 3WSQL 2IANB 1Q66A 3H6JA 4NN5C 3X2QB 1EBGA 2JGYA 3TCTA 3KCLA 4IU3B 4M7KL 3W27A 5DT5A 4A8RA 3NQGA 5J1AB 4LU5H 4P9ML 4O0ZA 2YPKB 2ZX5A 4OTXH 1T6VN 2V9RA 3JWNE 2G37A 4JKLA 3KDMA 4NCC1 4UI2A 5JXED 4CA4A 1IUZA 5H8PA 2QVTA 1W0YT 3MUHL 4KJQC 3A4FA 2YSSB 1MOEA 5BVPL 3DERA 2EIBA 3B9EA 1QZNA 3E3QE 3PJSB 1XXXA 4MKTA 1IJNA 1NMAH 2R8WA 4BFIB 4YSAA 4HKBB 3UWZA 4NQEA 3QULA 1IQDA 2OLAA 3I7SA 1JDCA 2WUCL 1IXQA 1ED3A 5E5MB 1E6XM 3I74A 4JN2B 3F6JA 3W82A 1T5XA 3LB6C 4DERA 4DKEH 1A0QL 4PV9A 1M3UA 2EKJA 4AT6B 1JCVA 4TMPA 1O60A 1T41A 3KEHA 1QTPA 3QIWB 1JK8A 5BZXA 1CDUA 4GACA 2HH0H 4S3FA 4XO6A 1HESA 3QKZA 3KWSA 3QXAB 1GVRA 1R75A 5MENA 4TSBH 3EH2A 4Z7OF 4FYRA 5J5DA 4WO4C 3DBPA 2ZOUA 5PAZA 3QPXL 1EUTA 4XN5A 3W9EB 5IM7B 1JRCA 2C7FA 1QNVA 2A4AA 2E09A 5HYJE 4NJ9L 1BZOA 1SHWA 5E5LA 1XL6A 4WENB 1IT7A 4KWSA 2PP7A 4K3EH 2C9VA 1KJ3L 3LM7A 3SDOA 4E8DA 2J8OA 4AGMA 1EDHA 4AUUA 4M93C 1Z48A 3T3MF 4E4FA 3BX7C 2VUOA 3LG3A 3UPBA 4OCWL 1X5ZA 1LEKB 2VFEA 3GNPA 4LY4A 2YOAA 4AG0A 3R0MA 3BLEA 3VXGA 3MRMB 1PS3A 2AANA 2Z91A 3QQ4B 3IN0A 5LNVA 3ESMA 4F37K 3FTZA 3WY3A 1ZANL 2AQNA 1AMYA 2HT3D 4FL4B 5KVGE 3NRFA 1Y5XA 3MBWA 4KDWA 4GIPD 3VNLA 1WWBX 1CLYL 5IB3A 4JJHA 1UJTA 4M62L 5BS0D 2DQXA 3OVQA 5IVZA 4BWWA 1JTOA 2C9XA 1RSCA 1BWLA 3UZEA 1UCTA 3W75A 1KM3A 1S7TA 3WDJA 3ORJA 2J5LC 3B2XA 1D8CA 3SFKA 4IU3A 3NNTA 5FO7A 3VA6A 1OSPL 2HE5A 5LGKA 1ERNA 5EMUA 4RH4A 5F71A 5A6MA 4LVBA 4UNKA 4F7TB 1MQ8A 2BOBA 2BIHA 3CWNA 1QFUL 4K9JA 1FAIL 2FPVA 3W07A 2CNYA 2WJ7A 3A4EA 2QV2A 4WY0F 5HJXA 4R7OA 4JM4H 3VCLB 3IDXL 3FYIB 1GONA 3QIUD 1A50A 2ZP9A 4R3UA 3V7PA 1B0GB 2V4LA 1TJHL 4ESKA 3KM2A 4BF5A 5LGXA 4QHUB 1S5NA 5F6IB 3VQ2C 4P46A 5K9JL 3W7KA 1M05B 3S36L 3MA8A 2HRLA 4HS8H 2FTPA 2CK0L 3MV8E 3UZXA 3E0VA 4OGQC 4WI9A 3R6IA 1C3FA 4PRHA 4MAYC 4PRIB 3ZLHA 4Q7DA 2DBJA 3KBPA 2BSSB 2P5NA 2J55A 3BK0A 6A3HA 1ECYA 1EFXA 4L3FA 4N4QA 4LOFA 1DE5A 1KPVB 4MMXC 1BQHG 3ZTJH 1TTGA 4MLSA 2Z1SA 5TF1H 4BFNA 4AVKA 2F61A 5FYJE 4WJ8A 1ZLUH 1KM0A 3Q2VA 2V2DA 2R2EB 3U4EB 1CL7I 5CMAB 1RXLA 3LHPL 1FV1A 3ZMEA 4FYQA 1FZOB 2BVTA 1XIGA 4HN4A 5IGXL 1JCLA 3DX5A 1A25A 1HJCA 3WD3A 4FEMA 2J88A 3DI1A 3FHEA 4ZOCA 3ZJ6A 5FF6A 3FZUD 2YOCA 1K6QH 3GSNA 5CSZA 3HAEG 5JPNA 3VO0A 5LHDA 3I7QA 3WI9A 3W1TA 4LU5L 4NQCA 4IOIB 1ENUA 4Y7EA 1UWXH 1TLMA 1B9KA 2FIRT 4F7EA 1UZHA 2V8ZA 3N14A 4XWOC 5C0GB 5FI8A 5INDA 1MJJB 4LQFL 1O5XA 2J4WL 1XLCA 1HT6A 2XN9A 3DJSA 4JDTL 3INOA 2DQIL 3PWNA 5KW9L 1ONQA 2AJXH 2WXQA 3FFDB 4HJ0C 2YLKA 4E9RA 3TEVA 1NC2A 3ZMNA 4QO1A 4N9EA 3M17B 4YHOH 2H0EA 1JV5A 1EIXA 3BGMB 1ZQ5A 4JFDB 1HXMB 1EAQA 1DL7L 4YE4L 3NA8A 1F18A 1SXNA 2R1YA 1UD8A 1R9FA 4HHMA 2B2XH 4LYKA 4YLQT 5BVJA 1IL1B 1N8OE 2OWCA 3REQB 3BIKA 3QW3A 3GLEA 4G5ZL 1TJPA 5DS1A 2AJYH 1ZHBA 2DWEA 3D4ZA 1E42A 2XWCA 5IUSA 1N8WA 3BGJA 2OODA 3EYFB 4U1KA 4X6DA 3GR7A 2IFGA 3HQ1A 1QBLL 2RD0A 5JMRA 4Q4SA 1RUPL 2IDUA 5GISL 3HPZA 3RY5A 4WWKC 1AK5A 2FO4A 5SWSA 3UPRA 4G71B 2A7PA 3N44F 4E68A 4YXKH 1LUCA 1AIFA 3ARUA 3EMQA 2XISA 1S4IA 1QASA 3GNRA 1X4ZA 1WAUA 4QNEA 1Q1PA 2REQB 1I1AD 3W1QA 1AI1H 1F1AA 3W37A 4DJFA 2X4TB 4LMQI 1ZEAL 3KPNB 2WWKO 2A6KA 1K6AA 1DLFL 3DKLA 1POJA 1FWEC 1TJRA 2COVD 5BUGA 4L0PB 2WGXA 3M9YA 1DQTA 1AGEA 2ZTKA 1VZGA 3TTEA 1TMQA 4JEGB 5J5RA 1CF8L 4O00A 2I9EA 3P67A 3CVHB 3NIFF 2ADYA 3IGSA 2W9MA 4BR1A 4YCOA 4TNGA 3NZRA 4IJCA 5CFHA 2ICES 4KKNA 5F8QC 1HZLA 1S2CA 2R2CA 1UQYA 3RPDA 5C0ND 1OTUD 4DYJA 3OBAA 1R0AL 1YKWA 4L9ZA 4K71B 3TJEL 3RX9A 2YQ3A 1AZVA 1EJFA 2MQGA 1GZPB 1U8CB 3B7RL 3KPRD 3MV11 2MOGA 5B21A 3SRKA 4BFBD 3QA3B 3JS3A 3K13A 5M17A 1I85C 3L3DB 4HJTA 4J3SA 4Z7OB 4ROQA 4PJFE 5GHWL 5F9DC 4KZ0A 5INDB 3PG2A 1KN4L 3ZKND 2OZ0A 4OBRA 3OKOA 5CJBA 2Y7MA 1AR1B 3KTSA 3B1UA 2V67A 4I6VA 4A6YH 2X9XA 2ZX7A 3AUWB 4H5SA 5DDHA 2NYZA 2VEKA 3QN3A 4IX2A 3VNZA 2J7DA 5TK4A 2EZ0D 1D3CA 1CLCA 2MEJB 3LQAL 2VLRA 4OH2A 5E9DB 5F3HA 1AZ1A 3MZNA 5KYUB 2CCRA 2QVNA 3WKQA 3KW3A 5D2WA 4LDLB 3T2PA 4ZUTB 1R30A 2ZNWA 3FTWA 5AY7A 4LVHB 3SDCB 5A1AA 5F96L 4MKNA 1KF9B 5XINA 4QPEA 5MHBA 3THAA 3HW7A 2UY2A 5B4MC 1UB6B 4W68A 5FA3B 3UJEA 3GRGA 4E8CA 4IRJB 4HUXB 3HI6H 2QPEB 1HOCB 3AZTA 3AUJA 2F19H 1ZENA 1CFNA 3NJXA 5GS2D 3WYRA 3OB0H 1QWKA 4J3OG 2B7OA 2JKAA 2QDGA 5IHWA 3ANUA 2P80D 4KS0A 3W7OA 4KOCA 2VR9A 5D96C 4DCQA 2X4UB 3IJHB 5F9OH 1R46A 3VGBA 1TQXA 3GUTA 2A6IB 1WA3A 3NTCH 3P2VA 1U1HA 3MBED 2AAAA 4N1HB 5TPWL 2ICSA 1R9YA 4G6MH 5T5FL 2FD6H 5D1XD 2IPFA 4UZGA 3G1VA 1T1XB 1FUNA 4G42A 2HN7B 1E43A 3FO9B 4NNCA 3S2MA 1RIUH 3G8RA 3STZB 4Z3IA 4XXDA 2XVBA 3RGVD 1EPVA 2BNQA 2QHAA 4UQ9A 1IGYA 3OAYH 3EFOA 4N9GA 4WFED 2VDIA 2ADFL 2FYMA 1WFIA 2FWSA 4B9CA 3PZQA 3ARBC 3BAJA 4OF7A 5HYFA 2W07A 4K94C 4MQ7B 4O12A 1UVQA 2JIWA 1NC4D 3FXGA 4WEVX 2ZJSL 2VABA 1EJSC 3HFML 2ZX8A 4W9CC 4JX0A 1UB3A 3N11A 4P3CH 5J6SA 2GVGA 3W2MA 3D6NA 3S5OA 5J11C 4GRMA 3KYMB 3HAEB 3AJ7A 4MMZA 4AQ1B 3MI3A 3QFEA 2XDHA 1M2VA 3S2NA 2IPKA 2D31A 1AAJA 1SEBA 2GHZA 3AISA 2IKJA 1MDTA 1HKLL 4AEHH 2HVKA 4K94L 3PUUA 3LB6D 5DWUL 2XFXA 3Q7JA 4OD2B 1I0DA 2ZC1A 2R0KH 3MXVL 2DEYX 2QCDA 4XCFL 3WF1A 3OMAB 5CD3A 4FZ8L 2CZDA 3AT0A 3AFBA 1XF5B 2FTYA 3GEFA 3D12B 4C5ZA 4GAYB 3A13A 3ME0B 3TYEA 4Y4KB 2Z3FA 3GKZA 3LMZA 3TF4A 1UFUA 1FFPB 4PODA 2XBTA 4GINA 3NSJA 1PYMA 5I30H 1BEUA 4B60A 3BKCL 1Q9LA 4Q6XA 2LVEA 3RWFA 4BA8A 2FLRT 3WO4C 5K4ZA 1XD1A 2R14A 1N5YH 1EHLL 1WB0A 1ECQA 1RR2A 4AIBA 1YYML 5DU7A 1FVDA 1HSAB 2CD0A 2NNAB 5EZOH 3FQTA 2O6PA 3WQDA 5DJZA 5ERWA 1FY6A 4CNUA 1KG0A 3H7BB 3WU1A 3CQIA 4LANA 2X53A 4E0RB 3C61A 2Z0BA 3BP4B 4NAMA 3S9DB 3E80A 1RU9H 1EP2A 4XCEA 4HX1B 2GJJA 5C0CB 4H8WL 1N55A 1NQBA 5KSAB 3ZTNH 1VFBB 1DWAM 1RY8A 3LB0A 5FEWA 5E2TH 3NZ8B 4MNHB 4A2RA 1H3WM 3C5JA 5TQ0H 3ZDWA 1NP0A 2CFFA 3SJNA 3US9A 1R0AH 3R79A 4PRAA 3TPKA 4Z5RB 1HE7A 3STGA 3GH4A 4RDWA 1ACYL 1DJWA 3WS6A 1FDYA 4LKCB 2VDMH 5EZJA 1H7NA 2GFTA 1MJUH 4QY8A 4HPHA 5TDOB 1E73M 1ZBVA 3CHXA 3LM3A 1M7JA 3MWCA 3X14A 1A53A 2TYSA 4WKXA 5HYIA 4IQDA 4Q33A 2EVIA 1E4JA 1BFOA 3JYBA 4ONFL 4QJ5B 3S4TA 2EPKX 3QV7A 1WA1X 1JCXA 5EEXA 4L37B 2BZDA 3E7JA 2UZXA 1IAIM 2IADB 3DIPA 2H41A 4OZGA 2P9RA 4XWGL 5SWZB 5I66B 4OHQA 1UUMA 1QPPA 3MV7E 1JK9B 4FYTA 1UXWA 3CDGB 3V6FA 3CK5A 3QLLA 3VFTB 1BOYA 4CQAA 2RDXA 4BE5A 3T07A 4GIEA 2P49B 1OX5A 2G3JA 1DWGM 5AW1B 4UFMA 2KZKA 3NM1A 1ZRQA 3K4WA 1HAWA 1BG1A 1Z2KA 4LVGA 4HF5H 1WT5A 3U9IA 1AYRA 4ZUWA 5MP6H 2OO0A 4FCHA 1E6OL 3IGKA 4UFIA 4K8RH 5D7SH 3EOBA 2BP0A 3P4LA 1J96A 3KZPA 2VKXA 1REQA 3VIJA 3RWGB 1GR7A 4ERGA 4YFEA 3JZUA 3HG4A 3FUDA 4NP9A 3NJLA 4UQIM 3UEZA 4E41D 1QEWA 3HE7C 3HNTL 1NLDL 4G6ML 5DJYB 5T5FH 5A43C 3ULUE 2GJ6A 5GZNA 1P9MA 3L7EB 4BFEA 1ZAIA 4EWND 4MA8H 3SECA 3RR1A 1S9YB 3ECUA 3IMSA 4XP9L 5DZPA 5JIQA 4H3DA 4ZCWA 1FO0L 3LZPA 1K4HA 3H4HA 3H3BC 3HI5H 4WK0B 3KPPA 2CLPA 3ALGA 1JPSL 1QPXA 1KTNA 3D0VA 3LRKA 2O5YL 5MEPB 3PVFA 5KMYA 1P4UA 4GO8A 3DFYA 1D5BA 3MFFB 4G7VL 4IT1A 4HEME 4Q8TA 2WSKA 4HPJA 4LP4A 4ERAA 2GVYA 3QJFA 4JMNA 4G8IB 1ORSB 4UR7A 1JZ4A 1E72M 2Q8ZA 1W5MA 5I8CA 3CCHA 1WPCA 4LK4A 5CAYB 3JXAA 1R3IL 5ISZB 4YSSA 5LN8A 1EWEA 1NCWL 3LHUA 1G1KA 3QI9D 1OAKL 1VGAA 1BM3H 3OKKA 1NDZA 2ICEC 4WJKB 1Q85A 1BFVL 4LMQE 1M41A 3QZLA 4HZ7A 2CUHA 1V3JA 4WW2A 2EP6A 1PF3A 2W9EL 3HMXH 4FQCL 1BMZA 1BQLL 1OD7A 4XX1E 1MJ7H 3SZ8A 1XB6A 2I16A 3R2GA 2P52A 3RX2A 1WZ1L 2VXUL 1BYNA 2PGWA 3IUHA 5GRXG 4DJFC 2JKNA 1DHPA 3Q37A 4IQLA 1DP0A 1PY0A 2PF0A 2QLVB 1DLHB 4Y2LA 3ABSA 4F8PA 4OZFB 4HN8A 4S3EA 5KVDL 1I1AC 5DD6A 2LU5A 4P5SA 2PDGA 1IRAY 4ZW6A 2GCYB 2I27N 2CPCA 4JTFA 4X5PA 3WJXA 2V2XA 4U1MA 4UFLA 4HNOA 3RZWA 2DZXA 4DWSC 2AJ3A 4R85A 1NTDA 2EDNA 4G6AD 3MV8B 4JRYA 3BQ5A 1HCZA 3RITA 4K07A 1Z9NA 3ZKQD 3GUWA 4QQUA 1KJ2L 4I3SH 3RWGA 3KJ6H 2XVPA 2EDBA 3LQGA 2FUTA 3IE4A 2Y69B 1OTUC 4ZG1A 1TSHA 1L6WA 1U8JB 4LHUG 3G3LA 3GHSA 2MCMA 2WSRA 4F48A 3TA3C 2EUXA 1JPIA 2OMWA 2Y3NA 1WBJA 1AXTH 1SJVA 1QKZH 2VN6A 3SDDC 4AH7A 1MSSA 1MJUL 2K9FB 2Y0SA 4HHAB 1EXUB 2EABA 4XN1A 4Q9QH 3QPZA 5E0CA 5AZ1A 1LG1A 3WLKX 4A6GA 3FEMA 3UCCA 2JEQA 1JNLL 4OLYL 2ZCHL 4QIUA 2PW2A 5KYXB 3V0VB 2DIEA 3ANYA 2ZX9A 4M8RA 3DPBA 3C6LB 4JKNA 2Z7GA 4KXZH 4UQAA 4HC1L 5JHLA 5E8EA 3GTTA 1M71A 4OZHF 1ME8A 1VFSA 1CBJA 2ZTBA 4NPYB 3ZL2A 1T89C 5LXGL 3WEOA 4J2XA 1ICPA 1S7SA 5LNGA 2WHLA 3ZJ8A 2PCFA 5I1LB 5B4MD 4FA3A 1KYOJ 3MOQA 3GO1L 3ATBA 3PGDA 4WW2B 1QLFB 4XR8C 4YHZH 1P5UC 5K1JA 4CGTA 4PJGF 5ADPH 1PWMA 2HROA 1AGBB 4Q4IA 3TNNA 4K8EA 1O75A 3VYNA 5FHAH 1OCWL 4IMLB 4WUUD 5IW6A 1FDZA 4S3CA 1WAAF 2YBRA 2ZQ0A 3LDVA 2YA2A 4M6OH 5F7UA 2ZCLL 1VH7A 1ANUA 2WCSA 1DEEB 1MDAA 3DBXA 5F3FA 1FFNA 1TPVA 4KETA 5F9JB 3PBMA 1A4BA 1SXAA 5CG7A 1OP5K 5D72L 1N3NB 2CEQA 3PP4L 1G6CA 4P46D 3ARFB 4XNZC 5B8CA 3NZSA 2I26N 2BX7A 2N01B 2AJ3B 2ICWI 3I9AA 4BSJA 2Q7AA 4LC6A 2GAZA 3L23A 1LVEA 2YRPA 5F7LB 1KCVL 4I3RH 2X0HA 2QQKL 1CQKA 2YD4A 3KGUA 3OF6D 4QJ4B 4TMCA 3TP4A 3PWPE 1CURA 1UKTA 4ICCX 1IM9A 2AVFA 4OZHB 1FL5B 5GSRA 2J5WA 3U4KA 4NYLB 1MH5B 1I7RB 4B5UA 1DQJB 3MAWA 3WLSA 5ABGA 4C4KO 4KRTA 4MKSA 2I9TA 3QGKC 4TUFA 5IF0A 1JZ2A 4HOWA 2OKOA 5GJSH 4FERA 3I02B 2Q09A 2FWOB 1XH3B 2VC5A 4Z7QE 4YIQA 5CGBA 1E9IA 4F20A 3FB6A 4JKPL 2AKMA 5KITA 1J1XL 5GGQL 5HDOA 1BJ1J 4DFHA 2QT3A 4P4RB 2MKLC 1LP9B 3FH7A 2YDRA 1KFAH 4QRSA 4U3CA 3QBUA 3QUXD 3S8FB 4YVVA 3KPTA 5IFAL 5BZZA 1MNUL 3MRKB 3BVJA 4AX7A 3L5IA 2ISWA 3O6MH 3D34A 2IPTH 3USZA 2VERA 3LQMA 4GIOA 4DHLA 3TX9A 2OZTA 2NW2B 1TQCB 3L6FA 3L48A 1EC8A 4JPWH 1RK5A 5K9JH 4RLIA 4GSUA 2YPVH 4JZOA 1SZEA 5E09A 5CU5A 1PL9A 2APXA 3UTTB 4O1BA 2CK0H 1Q4NX 3TQPA 1PS9A 1DQVA 4G5AA 5JBEA 2J1XA 1HC1A 2JCCA 1YIXA 3DGBA 1JPGA 4C6LA 1HKIA 4JN6A 3BW3A 2C3ZA 3FL7A 4H2CA 4FTVD 3ZE2E 4OY9A 2J7GA 4QDGA 3W3OA 3WLMA 3B97A 3IACA 1AC0A 4JPQA 2FB2A 2H0JA 5I1EH 1ACZA 1AQDB 2AEQL 4WSKA 5LKNA 5JHDD 1OE1A 4GIAA 4PJCB 4EKJA 2OYMA 4FFWD 2CKBL 1BZ8A 2HAZA 2EKCA 5H1WA 2FQGA 2WXKA 4OU3A 1YEHH 3CAKA 3T0AA 1P84K 3QXWA 4CVWA 3S37L 3KOWA 1R3RA 4PYSA 1CZ1A 1AO7D 1GHSA 4DEWA 1KB5B 2EIMB 4JFPA 5DHMC 5JQ6H 3MHGA 3MVTA 3X3GH 3U6RB 5CEZH 1D5ZB 5I75B 3VCCA 5LBGA 2YS4A 4MB4A 4FB7A 5JOFA 4JR5A 1KJVB 4M8UA 3CZJA 3QZWG 1FKXA 5GZOC 3QM3A 4G7RB 1Z5HA 4JZJB 4N2LA 2PXYB 1NGQL 1S2TA 4C56A 3CWOX 2GJZB 2AABL 3MRDA 5EOTB 5KW9H 5GQBA 3P84A 4HC1H 4B9GA 1CICD 1LTDA 3PQYA 5XIMA 1OQFA 5FF6B 4F57H 3HMJG 3VNKA 4LJ3A 4OT7A 1DL7H 4MG4A 5I18L 2WTPA 4OIIL 3B8VA 4GY0A 4UOJA 4K1GA 1F3RB 5I76A 3VQ1C 1XLBA 4BK5C 5IMOA 2ZOWA 5CSGA 3MLVH 1UWAA 3EGDA 1FFOA 2XH4A 2DQJH 3F7QA 5JW5B 1QVOA 3M88A 2P8LB 3U1SH 3RWEA 1THCA 3WAKA 5EF1A 1U5JA 4LFHG 4GGHA 1ZWIB 2XZCH 1OWRM 1M01A 2C14A 4HUUB 2Y8KA 3APGA 3BIAX 3TXZA 1F61A 4DJEC 4M6OL 2Z7ZA 5ESVA 3TLRA 5H37G 2JJVA 4XN2A 3ZL1A 3M5ZA 4RUBA 3RAOA 3T7VA 2CJUH 4BWLC 3KVDD 4HFWB 5CLXA 5J13C 2YMOA 2ACRA 2XTKA 3CASA 1BZ7A 4Z95H 2YHGA 1GGTA 1WBXA 2NZ9D 1KXQE 1MVFA 2X4RA 2EH8L 3APCA 3GZAA 3I6EA 4J4KA 3NCWA 3PU7A 4NKMB 2QV5A 4O4WA 5J06A 3MMWA 4GAAA 1RHFA 2VLJA 4HJSA 4B0MB 3LKNB 4P9HC 2E27L 1PTGA 3L9YA 3T4AC 2DI9A 3THMH 4C6JA 1PW3A 3KXQA 5HAOA 1ZE3H 1H5BB 2H6OA 4I3RL 4MDRA 1L8NA 4P9MH 5LNDA 2WXDM 5AVYB 1XFCA 2AEIT 2W60B 2IPUK 2QF7A 2NUTB 4JAMB 3FQNB 4KRPB 3AIQA 2P3EA 4C54A 4IBVA 1OADA 3KBFA 1PKNA 1IAIH 3BQUB 5E1IA 4HYRA 5ANME 3VKJA 4Z1YA 3SRFA 4I9XA 3KPSE 4WW2C 4C8XA 4F9LC 2VWEE 3V4BA 5E7FA 4A2MA 4MYXA 4QHLA 2JQXA 1SJHB 5FACA 4M7LT 4OIFA 4BA0A 5HYJB 1CZ8L 5HVFB 3OEXA 1HHJA 3BO8A 4OJCA 1NARA 3BDKA 2YD6A 1KRCC 1XZWA 3VWKD 3D18B 3CU7A 4AL8C 4IHBA 1MNUH 3W86A 3JWOL 1FC2D 2ESVE 3REVB 3W7HA 5C0BB 2CERA 4P5MA 2J73A 3EHBB 3L3HB 3KS5A 3PB0A 2QHLA 4OJDH 2CM6A 1QAWA 3DJRA 1X7TA 4LNVA 3J2PA 5FW6A 4YDLB 5AHMA 4XVSL 1URZA 4NAFA 2Y24A 1E6JH 4EN3C 4R4FH 2A79A 4G6FB 3VXNA 2VN3A 3ZIYA 3N50A 3UACA 2W81C 1YDOA 3BCJA 1VADB 4Z3HA 3RNQB 5D7JA 3RI5K 4IOSA 2C13A 1WCGA 3Q05A 4CN1A 5D96B 2UVFA 3TEYA 4P23D 3E6FA 1QFPA 1UZ6F 5I1EL 1IZCA 3VIOA 2YRLA 1ADQL 4XHJC 1F90H 5ID0B 5GS1A 3PYCA 1CUOA 3TH6A 1TZIB 1IGML 1JZGA 3H70A 5JHLH 1OKEA 5HHVH 4K68A 1N12A 2E8ZA 4PLKC 5J6HA 4XIAA 1AHKA 3QQ9C 2KS0A 2H3BA 4MCMA 4QE5A 3P77B 1KB5H 3TTYA 1OLZA 4MZ2A 3V7MA 3ET9F 1C9SA 5HGBA 2ZXGA 3JR2A 4DH2A 4PFEA 3AHVA 3IS1X 4QNWA 3SGGA 3BRFA 2Q7YA 5KETA 3CHSA 3KHOA 5HMFA 3SRDA 3GIPA 3DUSB 2FLBT 3OM3B 1FPTH 2WZHA 5DRXA 1KJMB 3VXQB 4F8XA 1Q13A 1NCIA 3GUTB 3S37X 3R89A 2HFFB 1UYWL 3NFPA 2JTYA 4NNPL 2M2DA 3FT3A 4GG6F 1M3JA 1QRNE 1U3ZA 2FYYB 2OP4H 2X4OA 4GQRA 3ZX1A 5JOPE 1KWGA 2X1OA 3W56A 2CLMA 4G8EB 2J6XA 2J20A 1JCNA 4HCRH 2PYEB 1MLCB 2OMYA 4NBZB 4OI7A 2PLMA 2QTEA 3AALA 3VCNA 3NZPA 1E28B 2W0KA 2D3NA 5CPNA 5FEBA 4V11A 2BXZA 2E86A 5IB1B 7FABL 3UNDA 3W7PA 4K4KA 2V6HA 3TWYA 5KVGH 1O66A 4K94H 2NZIA 5DLMH 3L0GA 4MWAB 1EO8H 3FXIC 5DHVB 2Z4TA 3ARGA 4NO3B 1WH0A 2W0LA 3RLUA 2Z2AA 1OSEA 3BW4A 2GABA 3H85A 3GHTA 3G8EA 4CEUC 2DRUA 4GI4A 1YNTA 4MXWL 3QAZC 1R33A 4LCSA 3DGDA 3WO4B 2QCEA 3V16A 5JA9A 3TBTA 1ES0A 2OSXA 1F6AA 4TOYL 2C4XA 1O7VA 2HVKB 1CWYA 1UR4A 3PGCA 1MCEA 1FYHB 1L0QA 2EIJB 2FGWH 2GT9A 2IAMC 4ODVH 5T8IA 4ZFOA 4Q6IA 4E9LA 2R2BB 3OKLB 1EHAA 2QVIA 5GJTH 4U7KA 2OJEA 1QFWL 3L3KB 4X6CB 4ZTOH 3QSTA 3HIZA 5EZOL 2IDQA 4FNLH 4UM9A 4M02A 1U92B 1XIWB 1GAFL 4XODA 1IX2A 3A6BL 3FUEA 3U4BL 3D25A 1A21A 2E6FA 3DOIA 2QCFA 2VUKA 4AIZA 1W1PA 5T1DH 4WGKA 3LV5A 3KLHD 4F27A 5F93C 4L6OA 2GVEA 1TTAA 1H3GA 3LDBC 3N9GH 1B3JA 4TNWK 4ZJ9A 4HWEH 2I14A 2Y1YA 2DV6A 4J1UB 5D5MA 4WIWA 5ABEA 4N6RB 2Z35B 4Q6JA 2P3YA 4RGNC 5D03A 3B5HA 1VERA 2Y5TA 4R88A 1SBBA 2BY1A 2PXYC 2ZF8A 5CP7A 1L7TL 2NY3B 3JTTA 3GHUA 3PBUA 4B5NA 4IPIA 5KEZA 1GCFA 1IGTA 2XG5A 3ECBB 5I1DA 4DO7A 5CEZE 3MSYA 1R47A 1J2BA 4UTJA 2BC4B 3N06B 5CN2A 1YNQA 5GS0C 1MRDH 2X7LA 3UO8B 1LRQA 5I3GA 3RTQC 1HGWA 1SW0A 2VEPA 3LIZL 4J3VA 4P3WA 4JR9H 2YAFA 1I9CB 2GZXA 5AYZA 4PMNA 1VCBC 1EBPA 3EO1A 1JV2A 2XGBA 4I7WA 3LN5A 3UYOD 3K5XA 3LY6A 3BFQG 5J3HC 1CDYA 1Q65A 1RLBA 3WFDL 3F4CA 4FO4A 3BSZH 1M7DB 3BKYL 3JV0A 4F8LA 5GIRA 3Q94A 2A1YA 3KPQB 4LBAA 5FO8B 4ERSH 1ELSA 5DHYA 4Y5XA 5DVKA 3SE8H 3VXMD 5JZ7C 4NQDD 4PJHF 1IEWA 4RDZA 3Q1SH 1VHCA 2ITCB 5AYXA 1KY7A 4AXKA 1XLEA 4FKHA 4ZSOA 4HZMA 4J3XA 3QCVH 3V6FB 3QARA 4FFWC 3MDWA 1HDMB 3HBGA 1SYSA 4LARL 5EN3A 4M80A 4DW2L 2BCKA 4W1TA 2VURA 2VXNA 4QLKA 3IJEA 3P9WB 4RSYA 3FU5A 2P5WB 3RG1C 3C8DA 1K8CA 3SCQA 2R2BA 4WO0A 1R3VA 3DAQA 1RCQA 4L9XA 4Y9OA 2WOBA 2DQ6A 2WXJA 2YQBA 3GXIA 2V9DA 3TIDB 1LWHA 5AHEA 3MCMA 4P5KA 3BDYL 4KHXH 1T8QA 3Q58A 3QY6A 4LO9A 1AODA 4J35A 3Q3GB 1I8IA 1XR9B 3KS0J 1R87A 2E6JA 1QUPA 1W2VA 1OAZL 4G7VH 4TUJA 4EI5D 4PRDB 4EN3B 3LQZA 5KINA 1KFBA 2NX5E 2BDNL 3IV3A 1ASPA 1RL1A 2CXGA 1PG7X 3D09A 1NFGA 1DZBA 2D0GA 4R26L 3JTTB 2Q76A 4LLUA 2I56A 3QMSA 4AZHA 1GL4B 1H51A 4JTAA 4GFIA 5MEPA 1V93A 3ERPA 3QF0A 4Q8QA 1T5AA 3IBEA 4ZQOA 4FQQB 4LEBA 4ACPA 2V3GA 3H22A 3QXAA 3PZOA 4Y1AA 1W5QA 3QUZC 2QDVA 3TZVA 1XPGA 1QPOA 2F19L 4HLEA 4O57A 1ZXKA 5DMLA 1OGAE 1QI2A 1ZAJA 3RO6A 1SUHA 4WHTB 5I5MA 3HZYB 3CMOL 5D8JL 1XUZA 3C8FA 3RMEA 4E2VA 3GGWB 1VD6A 2PRMA 1N82A 3BGFC 4YDKH 5I15H 5IMKA 4J39A 2HVJA 3GI8H 4N0UB 4OV5B 5IJVA 2NY1B 1S9VB 2B20A 1JUBA 3HZKB 3WDPP 4M1RA 1LYQA 2BP8B 1HKVA 3VGEA 4C6OA 1EL3A 1TX0A 3ISIX 4S1FA 4CQ9A 5HGAB 2CZVA 2L4OA 3FT2B 5BV7H 5JBFA 1ZVYA 3MMEB 4XC1H 4R9HA 2HLAB 3WNKA 1E27A 3VSQA 3BPNC 3W1XA 2BVUA 2YLHA 2V5LA 3TQ0A 3OPZL 2OW6A 4MJJA 1CI1A 4LAKA 1ML1A 4XO7A 3LUTA 4Q9CA 1MHHB 3SHSA 3HFMH 3Q8EA 3AMKA 3BAEL 2XBZA 3SE9L 5BXPA 5AWNL 1ZS8A 4DP9X 3ZR5A 4V1XA 3SI9A 3GTIA 1FVCA 2H6PB 5SX4I 3E3QC 4CQDA 1MRFH 5I71C 3RHWK 1LBFA 1UBSA 1X5FA 2OEMA 1AMXA 3WFHA 2A9ML 1MCJA 1NEZB 4QHKJ 5D1XA 3ABKB 3SYOA 3VWKC 4G3YL 1K9FA 2V2HA 5CBIA 4XAZA 2EQDA 3GB6A 1MAKA 3II3A 5E1HB 1OP5H 3UDWA 1PQZB 1MG3C 3V0GA 4EVNA 3WTTA 1R6VA 3VXUE 4X4YA 3G0SA 5BS0A 1TYRA 1OK8A 1F56A 3IYLW 3HUJE 1RIHL 1BGGA 1XTMA 2VFDA 2CRYA 1DQDH 2MTAA 2XJLA 4W9ZA 5KAQF 1E50A 3WUWA 1YXYA 1RIVH 1QK0A 5I30L 3WN5A 3MRPA 3HS0B 1OP3H 4GY1A 3WHE0 5BPPA 1LP9F 2VLKD 4N9OB 4RL3A 3O2DA 3U2IA 3G08A 1W5OA 3HRZA 4JG9A 4WHBA 1KPVA 1U2CA 1F42A 1PIFA 2K6WA 2ZWLT 1C5DA 1I2RA 3AREA 3RVUD 2XWJA 4J6RH 1W72L 3HZYA 3WQEA 4LARH 3Q6FB 5K93A 3F84A 1YRKA 4KTDH 4UOW1 4C4UA 5IMMA 4PLKD 4J1OA 2B81A 3PAJA 3LQLA 3IF1A 4HD9A 4DPCX 1WLHA 4GXUM 1LP6A 4MF4A 1AIZA 5I26A 3MRBB 3MV9B 4HKXB 4JFXB 1FH5H 1R3HA 3QY7A 5LN4A 4Y5XC 1M6UA 5DGQA 3RTLA 4OGAC 5KVMC 2XV3A 3L5JA 3DHDA 3CAVA 3MJ8A 2O6EA 4F7MA 3CG8A 2EDWA 4QG9A 4GEIA 3WK0A 2ED7A 2DMBA 4ZTPH 4AX3A 3CIXA 3WIFA 1FYTA 4LGSB 4GK8A 1UZDA 4D2JA 1OF2A 2BW5A 4XMPL 1TPDA 3G18A 4L29B 1ONQB 3FFDA 4AMKH 2CCVA 4ELDA 3TE9A 5IIEB 3V6OC 2TRYA 4MMYA 2ZUMA 5HNUA 2IOIA 3LZ5A 3PJXA 1NUDA 3RTQA 3PNZA 3NK4A 3CN1A 3BVNA 4XXCA 4IP4A 4FF7A 4PTNA 1UEMA 4QTIL 5CP3H 1LORA 4Z7IA 2GQAA 4MIMA 4DXVA 5J04A 3FQ1A 4RWHA 1J6OA 4LNCA 3AYTA 1IC7L 1CD1B 2G5RA 4NOBA 4UTLA 2GQ3A 1MFDL 2XINA 2WYTA 4H40A 4YUEL 1ZHBB 4W81A 5D1XB 2CO6B 3ZFHA 4N8PA 4IK7A 2Q87A 3QJVB 1F9CA 5F7AA 3T78A 1VPXA 4O2EA 4PBGA 5K2ZA 5H2BA 3O6FC 1LJMA 4MLRA 3GSXA 3LHYA 3EB2A 3OGCB 5A40E 1EX5A 1LDCA 3MLUL 3OR7B 1NOFA 2I9TB 4FA6A 3S2LA 1WHPA 3GMNB 5H91A 2BVDA 5D70L 2X4TA 4WEMB 1EC7A 2I60H 3GIQA 4PY7A 3K6SA 4UINL 3N43B 1N6UA 4B16A 4NJ9H 3CBWA 1G94A 1PKOA 4MJ5B 2OEJA 2P5EA 4WI6A 5I3HA 4UBDD 3LX9A 4EUPB 3TYGL 1SY6H 3LZQA 4PJBE 1O12A 3QUML 4Q8BA 1MF2L 1U2HA 3O3DB 4GG6E 3THUA 3WKZA 1MHEA 1S7QA 4P2AA 5BV7L 1VFMA 3IAGC 4X7SL 3ETSA 3VFPA 2BNRD 3QRLA 2XVNA 3V4VH 2EEFA 3A47A 1JDEA 2YCIX 1FO0B 4WZHA 3DVNA 2E6AA 3PHQA 1PBGA 4G8GD 5EUOB 3B04A 1SHSA 4JKMA 35C8L 4ZSTA 4S0SD 1O6TA 4M48L 2UXFA 3VCLA 4UTIA 1E4XI 1VGKA 2ON3A 4I9MA 1B0GA 2IDTA 2DJXA 3VWJD 2OT1A 3FCPA 1OSPH 5AOJA 3A67H 1B4LA 1OTTC 1EXPA 3L67A 4LAOA 4GW1A 5GS0D 2D3JA 2WKGA 2Z31B 1GPWA 3XINA 1UYQA 3H4GA 1T0MB 4GG9A 4L1BA 2PO6B 1E5NA 3OAZH 3N04A 4M5PA 1T20A 1LE9A 2G2NA 2PU0A 3VMPA 4HZ6A 3QIUC 1WG3A 3JBG7 3QHZH 1OB0A 1POKA 3AXLA 5DMIH 1EVTC 4N2NA 4K1WA 4PJIF 3NEHA 4ODSH 4PYHA 3ZKMD 3N9RA 3QEHA 1CLZH 4PMXA 4LU0A 1CI5A 2RDWA 1OCJA 3WMSA 5B7ZA 2X0YA 2F7RA 1CIDA 3V7AE 1G4SA 2IGTA 4BS0A 3GFUA 3DDGA 5JVLA 5CUSH 4N0FB 1AKJD 4AD2A 2DQWA 1NCHA 2VH5H 1COBA 4D9RE 4PB3A 1JRHH 1J0JA 4DGVH 1NTHA 5DT7A 1G67A 3W01A 4Q8WA 1YEKH 12E8H 3X12A 1KGYE 3GPSA 3MLSL 4LESA 4ONGL 4IFKA 3S2CA 4L8CB 1AQFA 2JB6A 3DTUB 3HPAA 4NKCA 4GJIA 5MI0B 5F2MA 2XN9B 5C54A 1F6FB 4LB8A 3TAKA 3R7RA 1S8DB 4XX5A 3D3VA 1ZWIA 4N5EC 3FT0A 3IDIB 3AGWA 4K7PX 3TO4D 3U0HA 4K8HA 1JGLH 3BW9B 5IKCA 3M17A 5HYEA 2TSAA 5AW5B 4NZCA 5CKGA 4C83B 2EDHA 5B1KA 3CZGA 3IJ6A 4EI5C 3QGAC 1D2KA 4DF1A 1BZ7B 4AHOA 2B59A 3QORC 4LQFH 1VJZA 4MJIE 3IFOA 2GK0A 2IPKB 4OT1H 3F2BA 4L18A 1JNHB 1Q72L 3Q2NA 4ISVB 2BRQA 1V7AA 4RK8A 2DQTL 2CBMA 2K1MA 2XX1A 3GB7A 5EU6A 2PDCA 1AGCA 1XGYL 4CEXC 1BPLB 3EFFA 1QOKA 1I1XA 1R86A 1DJSA 2CHXA 2IGFL 3LS9A 2PTVA 1NDTA 2EDTA 1SQMA 3MX0A 5CD3B 5IW3A 5IUCA 1UH2A 5L8JB 1XF1A 4I5XA 4UM8B 4MDPA 2OMZA 2WVTA 3VFRB 3OGSA 2VC6A 1EPXA 2V5BA 4PS3A 2QZRA 4OM1H 3RKDC 4LUTA 5BOZG 4G9FE 2CRZA 2AJYL 2RACA 3HRZC 4N2GA 3GU9A 3KBHE 4GRLA 2J8UE 3TMQA 4MMXA 2Q2EB 1X5MA 4FIQA 3KZ8A 2AJUH 2WBKA 5F1IA 3N41F 2LQRA 3QUYC 1O6IA 3EPMA 1QQDA 3NBNA 1TJIH 3T8VA 1KKOA 1OCQA 1LK3L 5SWUA 3O4OC 5L88L 1HKJA 1PZ5A 3MV7A 1RP8A 4AM0Q 1Q6QA 1NKOA 1MCNA 4OZIA 1OP9A 1LTXA 1U58B 2AJZA 3CFCL 1W8GA 3FDGA 4ZD3H 3X11A 4LE8A 4UDUB 3S97C 2CXEA 4EWJA 1NLBH 3AHTA 3G6AA 3MJWA 5IWLC 4HCFA 4S2SA 4DTGL 1ID2A 1X7IA 4AYGA 3TA6A 4XVOA 3S3GA 2R56H 3V4VL 2CA3A 2Z29A 4PBXA 5KUMA 4GXPA 4LCWB 4X9SA 4D6CA 4IG2B 3T0XA 1I9JH 2B4CL 1YNKH 4RNFA 5DVMA 1FVEA 2MNJB 4I9JA 3R19A 1T1ZA 4PJDE 1TG7A 4KFZC 4MSSA 1FIGH 1X6LA 5DHXB 5KZCD 3IK4A 5G2NA 5AAMC 2P1YA 1DBAH 4GPVA 4ENZA 1MREH 3CFKB 5K39B 1J5DA 2AV7A 2DWTA 2Q3XA 3BMWA 1RUSA 1DQKA 1NFIA 3SO5A 1R85A 5LIYX 3C3UA 3ZIZA 5EA0L 3WXVL 3LCWA 4TVUA 2YN3A 2UZXB 2OXNA 2NW3A 5C0EB 1TZGL 3F62A 5FA3A 1G7MA 5LHFA 1XM3A 2R1XA 5FYKL 8RUCA 2EDRA 3A6CL 1KXHA 1AC6A 5D1ZD 4C47A 4DKEL 1TTFA 3LEXB 7PAZA 1RQ5A 2X05A 1VR6A 1CFNB 4GKTA 1J93A 2W4XA 2AAVA 5B39B 5JIWA 2EXTA 4A55A 2OGYA 4NJKA 5HI4C 1TYGA 1FFQA 5FEZA 3TR2A 4BY3A 4NERA 4DN3H 4YAQA 3DG6A 2PPEA 2Y88A 4Z8FL 4AQ8A 4OUOA 4TVCA 3EYUL 5LGJA 1OCCB 3N9KA 3MSPA 3RDJA 2YWZA 1SRDA 3QAZB 3CX5K 1KBIA 4XB8A 1OG0A 1E51A 1H3UA 5DN1A 4X99A 5HHXL 1OIOA 4IRSB 5HTSA 1RY7B 2J6EL 3MYJB 3Q5YA 5TDPB 5LDSA 3NVTA 2ZKYA 2Q71A 3E2HB 3ZVIA 4GRLB 4KTEL 3AROA 3ATZA 4TUOB 1LO0H 2XNAA 3KH4A 4A66A 4TXVB 4WHCA 4Z7OE 1BCIA 1C16A 3P3UA 2H9AA 4QDMA 5LA2A 5CF3A 1DSYA 2SODB 3EDEA 2YBUA 5AYUL 5D4JA 3VZYA 2C9UA 3B7SA 3N2CA 2WCGA 3NSYA 5F9WB 3V5FA 5AL8A 4XISA 3PZUA 1H8SA 1OINA 4P8WA 1PLAA 4KK6D 3WF4A 3NABL 3IMVA