5EMYA

Human pancreatic alpha-amylase in complex with the mechanism based inactivator glucosyl epi-cyclophellitol
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Glucosyl epi-cyclophellitol allows mechanism-based inactivation and structural analysis of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5emyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5emyA01
1JG9A 3OBAA 1E4MM 2YOCA 4XZBA 1TVNA 3CHCA 2C7FA 1NP0A 3SUUA 4NX0A 1UR2A 1QI5A 5CLWA 1FH9A 5M5DA 1OD0A 1E4NA 2W63A 4UFJA 3GTNA 3WY3A 4CCEA 3PZTA 3TTQA 4D6FA 2PWGA 4OZOA 3K1DA 3WBEA 3CHFA 1BPLB 3U5UA 2BXYA 4WKHA 3A4WA 4W8AA 1UQZA 1PX8A 4GI9A 5A6KA 1T0OA 1NQ6A 3CUJA 4PEEA 1UASA 3N11A 1J0HA 1G1YA 3AMLA 3IK2A 1SMDA 2J77A 1GVYA 3BCDA 3NDZA 1B0IA 4NZFA 1E4LA 3F4VA 3W6MA 2A3AA 1XH0A 1E3XA 3A6OA 3BLBA 2G3JA 2VCAA 4EK7A 1QBAA 5CSUA 2EPKX 3WN6A 1W9VA 1J18A 3VGFA 4HMCA 1JAEA 5E09A 3BVVA 2J4GA 1QNPA 3D52A 2VJXA 5ABFB 2ZUMA 2ZXQA 3EJUA 2WMFA 4CU6A 3CZGA 2GJXA 1V3KA 2ZOXA 1Z32X 4JHZA 2WKGA 1W3JA 2JEPA 3FHQA 2W61A 1E9LA 1XV8A 4ACZA 4M24A 3BAJA 3O9NA 4DWSA 4JCLA 3PZMA 1IT0A 2A3HA 1WNOA 1ODZA 4V27A 3GH5A 3T09A 3VD3A 4HMEA 4NRRA 3N18A 3CUGA 1FH7A 5FL1A 2EO7A 4J3SA 1OIMA 4HU8A 1KR1A 3ZM8A 1C7TA 1QHZA 4H04A 1V03A 1HL9A 2WHMA 1VJSA 2V3EA 4W85A 1DWJM 4WF7A 2ZX6A 2ZXDA 3WD3A 4AZCA 4BQ2A 3HN3A 1VFOA 5JBFA 3MO4A 3TTSA 3CHEA 3UG4A 4JFVA 5A2AA 4QP0A 1OGGA 4Y7EA 3VDHA 4JFWA 3WEOA 1EO5A 1PBGA 2W5FA 2YFNA 1UKPA 1UD8A 4HOWA 1E6RA 2VR5A 5BXTA 3HG5A 2Q8XA 1CNVA 1VAHA 2BY0A 3KL0A 2EXOA 1UR9A 2YA1A 1JYXA 4PMXA 3D50A 5AY7A 5AC5A 4FK9A 3VIOA 2AMGA 4AMXA 3WQ4A 4TOQA 2BXZA 2WMIB 1HKJA 2YBUA 2ZXBA 1M03A 2XVNA 4AWEA 5LYRA 3MUY1 4P7NA 1JNDA 5GNZA 3WNOA 3RILA 8A3HA 3WQ6A 1XCWA 3WH7A 4PMRA 4CD4A 2OSYA 4WSKA 3N12A 2XSAA 2VUYA 3WD1A 1GQLA 1QNSA 4LGXA 1GOIA 5E0CA 2OYMA 2E9LA 4OBSA 4F9DA 2PWFA 3PZIA 5HXMA 1KBKA 2E8YA 1RP8A 2JF6A 4OKDA 4WKFA 4DO5A 2VQTA 4P7QA 5EB8A 3AIBA 3VIGA 3UETA 3HG4A 1VRXA 3D3AA 1H1NA 3WD2A 1CXHA 3ZJ7A 1HJUA 3GXTA 3IGUA 4W8LA 3DC0A 1GHSA 3TOPA 2JEQA 5KEZA 4Z2HA 3DX1A 4FNUA 7CGTA 2ESCA 3BSGA 2BV9A 1FFQA 5DT5A 3W25A 3OIHA 4D6GA 3KZSA 4NSBA 3EJTA 1HJXA 5I77A 3UESA 3AIRA 3VTRA 5E6YA 5TD4A 2YA0A 1E3ZA 3MUIA 2ZE0A 3VX0A 1U2YA 1R87A 1XSJA 4TX8A 3GYCA 4GZJA 3W53A 5E70A 3D4ZA 3VILA 4QLJA 1TE1A 3W37A 4PMDA 4J3VA 3AIQA 5CSYA 5JBEA 2O92A 2QMJA 1GOMA 4WLCA 2J62A 4UNIA 4MJ4A 5CXPA 3DECA 5BROA 1VFFA 3BAWA 5C71A 3WEMA 5IHRA 1E6QM 5A1AA 4AMWA 1DWHM 3WF2A 1EOKA 3T2QA 2WKLA 2WWCA 1C3FA 3IJ8A 2HISA 4PCTA 1J12A 1KCLA 1O7DC 1WDPA 3WL1A 3CZ8A 5CPTA 5C8BB 1MYRA 1QI0A 3RJXA 1AQHA 1OIFA 1JF6A 3CHDA 4PN2A 1CXLA 4IM4A 1YQ2A 5FD0A 4F9JA 4BS0A 3AI0A 4IISA 5E0FA 1HNYA 3SURA 3DYPA 4FLQA 6CGTA 4Z2LA 1X6NA 3W38A 2X09A 4CGTA 8CGTA 1KFWA 4YN5A 4H2CA 3AZRA 5A6AA 4P7RA 1TMQA 4DUXA 2F7RA 2YLLA 1PZ3A 5I3DA 1W9UA 2DSUA 2VZVA 4C7FA 5CG0A 3HZ3A 1FH8A 4AZIA 2Z1KA 4ZE5A 1BG4A 3NCOA 3I3EA 3AICA 5I79A 2A3EA 3AOFA 1KGXA 1C91A 3EDKA 4IPLA 3J7HA 4PMQA 4UOQA 1Q6EA 1MQQA 3AS1A 3VKKA 1AQMA 1OBAA 1BVNP 3ECQA 3VUPA 1GQKA 4DWSB 3WNLA 4ATLA 5CPQA 3EDJA 4DO6A 1LL6A 3G6LA 4HA3A 2WAGA 1UKOA 1TVPA 4A3HA 2ZX8A 4P8UA 3SUWA 4AEEA 5A2CA 4MDOA 3L4XA 4JZ5A 1E4IA 2VI0A 1KWGA 2DH3A 3M7SA 3VU2A 4AD0A 2F8QA 5IHSA 3K8MA 2GDUA 1CWYA 3OGRA 1KCKA 4HTYA 3UEQA 1UWTA 5D8ZA 2D2OA 4R27A 2BNJA 3K8KA 1TQUA 4K68A 1BLIA 1UKTA 3ZT6A 1Q6FA 1O6IA 1HJVA 1JZ8A 3MUAA 1LL4A 1QWUA 4AW7A 1K6AA 3SCRA 2UWFA 3EBVA 3AXIA 2OYLA 1C8QA 2G4FA 3THCA 3CTTA 5CLTA 3VIKA 1CLXA 4GPNA 3KEHA 1C7SA 3II1A 1EIBA 1PIFA 1GQIA 2XVLA 2EBNA 4UFMA 2WMIA 4CN1A 3ZJ8A 2WHJA 1HX0A 2CCRA 5DFAA 2Y8VA 3AZSA 1JF5A 2OW6A 3MMUA 1J11A 3DHPA 4J27A 5E6ZA 2VRQA 3W0KA 4Z2IA 3POHA 3ALFA 3WY4A 4RE2A 2XSBA 2J78A 1WKYA 3GXMA 1UKSA 1NWTA 3K4DA 1B3ZA 5D9NA 3RM4A 5IDIA 1W9XA 1QW8A 4EKJA 3BUPA 4MB4A 1HKIA 1BAGA 2PI6A 2X2JA 1UH2A 1H49A 1GJUA 3IANA 2WHKA 3U57A 3AYRA 2WZEA 4CD7A 4D6EA 2IGTA 1JI2A 1NARA 2CBVA 2FYVA 4TXEA 4M81A 1W1YA 2WMJA 3SCWA 2UY3A 1TQWA 1CGYA 2CESA 1UD5A 2EEXA 3BUBA 2VR4A 1V0LA 3VD5A 1DWFM 5ABGA 3GH7A 1NM9A 1WAWA 2X8RA 1CYGA 1ZB5A 2O9PA 4HMDA 3CUFA 1ZS2A 1EH9A 3BVXA 1V0MA 5GNYA 1VENA 1OB0A 1B1YA 2DSWA 3N13A 3BVTA 1G0CA 4GQRA 2CPUA 2MANA 1EHNA 1G94A 4RE4A 1UR4A 3GM8A 5A6BA 2PWEA 3CZNA 5A6LA 1OWQA 3E1F1 1CDGA 5DO8A 3OGVA 4XV0A 2J8FA 4UTFA 4Z2KA 2XHYA 4YPJA 3B9DA 1E6XM 2X2HA 3CMJA 5A3HA 4ZXOA 1R47A 3APGA 4TVUA 5EMYA 3O6AA 1E0XA 2Y8KA 3ZR5A 1TQTA 3F5LA 2GSJA 1UR0A 2EAEA 2F1AA 3WF1A 4PYSA 2QV4A 1NWSA 3WDPP 2D0GA 1PJ9A 2WYSA 4JKMA 3NDYA 1HJWA 5D4YA 5LA0A 1MW3A 2EPOA 1E15A 2J25A 1H09A 3TONA 3AS0A 2BS9A 1D3CA 1V3MA 4AD5A 2D1ZA 1GOKA 1KXVA 3QR3A 2W67A 4M29A 4AZHA 3BMVA 3BVWA 4FLOA 4W87A 2ZX5A 4M80A 3ZT7A 1VEMA 4AD3A 1JFXA 3DYOA 5I24A 1CBGA 3N9KA 2XTKA 4B3KA 3HU7A 1QX1A 1WE5A 4HA4A 3H53A 5DMYA 4FNPA 1TQSA 2XM2A 2O9RA 4QCEA 3AXXA 4QDMA 1MW2A 2CKSA 2V5DA 3T2OA 1GJWA 3K46A 3AHYA 1UD2A 3MKKA 4CU8A 2DSKA 1WPCA 4GIAA 3VO0A 3LRKA 4URIA 4JHOA 1UHVA 4TVCA 1VEOA 4UOZA 4ACZB 1ZL1A 1FA2A 2VNCA 3WDRA 2J74A 1AMYA 2FHCA 4N42A 4J3TA 5A6BD 3FNDA 3PTMA 4AD2A 3L4UA 3WUFA 4NRSA 1CXFA 4A4AA 1JGIA 3ZSSA 2VX6A 2YL8A 4D71A 2FGLA 4HOZA 1IV8A 4PTVA 2WXDM 3GBEA 1UZ4A 1FOBA 3GXNA 2ZWYA 3HG3A 2WLZA 3AHTA 3KL3A 4GZEA 3L4ZA 3W81A 4TTUA 3AIVA 3QHMA 3SEPA 3QOMA 2WC4A 1W1TA 2AAAA 4LXFA 4E4PA 1CTNA 3WENA 1UH4A 1QNRA 1JNEA 1ZBCA 3F5KA 4CN6A 4U5KA 1OGBA 3EDFA 2XN1A 2BY1A 1EOMA 4PUEA 1B3WA 2WMHA 4KWUA 2CYGA 1HVQA 5CJ5A 3VGEA 4CCDA 1H4PA 1UWSA 4PMNA 2ZUVA 1EXPA 3N17A 2VO5A 3GXIA 1TA3A 4PMZA 4CD5A 3CZSA 1OD8A 3AJ7A 2OSXA 3KE0A 2OWCA 3WQWA 1FP9A 2OWXA 4DM2A 1W3LA 1BGAA 3PZ9A 2WLYA 1WZMA 1H5VA 2WMKA 4J28A 3ARZA 2YDQA 3A23A 5D9MA 4UQEA 3QHNA 1E6SM 2DEPA 3DYMA 4XZWA 2VX5A 1ESWA 4H7VA 3RPMA 2VVNA 1CPUA 1CECA 3WMSA 1WDRA 2WK2A 4ZEPA 4QAWA 1B2YA 3WELA 4UQBA 3FN9A 4M1RA 2X0HA 1VEPA 2HVMA 1CXKA 3A4AA 1SR0A 2A3CA 2EPNA 3AISA 4IPNB 4N0RA 4TTGA 2D0HA 4UZUA 3CLWA 4D1IA 3WQ8A 3IJ9A 1V3JA 1IZKA 3VIFA 2F7PA 4X0NA 3ARWA 4XX6A 1E1EA 4HPGA 4UFKA 3GXPA 4NI3A 1AQ0A 3M46A 1CGXA 4B16A 3A22A 2C0HA 4OJYA 3S2CA 3PZQA 4TUFA 3WD4A 1K9FA 2VMFA 3ARUA 1XHGA 4D6HA 1IZJA 3GBDA 3FAXA 3SCQA 1UKQA 3A47A 2WM0A 1ISVA 1E71M 3WSUA 2G3IA 6A3HA 2FHBA 4MB5A 2XYLA 3CZLA 3SCSA 3VIMA 3BCFA 2WWDA 2IXVA 2VZUA 2PWDA 3OB8A 2DSVA 1KXQA 1V02A 1CZ1A 1W1PA 3VGDA 5I2UA 4L4PA 2PBOA 1UWRA 2CBUA 4GXPA 3WUEA 4Q7NA 1J0YA 1GQJA 1GONA 1GNXA 1MFVA 3VMNA 5HPOA 1EGZA 4OBRA 1W2PA 5IXEA 3VMOA 4WIWA 3SUSA 1CGUA 2WCAA 3BVUA 1ECEA 2E40A 1EDTA 1KQZA 1XCXA 2XWDA 1PS3A 4M82A 1PAMA 1VFMA 4X0VA 3WDIA 3UERA 1ISYA 2X2YA 5F7UA 3UR7A 1GHRA 3H54A 3OA5A 4BQ4A 2BHZA 1BVZA 1JFHA 4GI6A 1V3LA 1PX3A 3AMKA 3AMDA 5JIWA 2PF0A 2A3BA 3LRMA 4P7LA 1MFUA 3F5JA 3LPFA 1B3XA 5JBDA 3GNPA 2JF7A 1QPKA 3DX2A 4AIOA 1C8YA 2QF8A 1RD6A 3RM9A 2UY2A 2DIEA 2CERA 1E43A 1ZBWA 3GH4A 1LWJA 1BSIA 5HDRA 1EQPA 2VX4A 5ECUA 3ARXA 4OUEA 1W3KA 2W62A 1KR0A 4HZ7A 1CGVA 1WZLA 1X6LA 2CBJA 1QW9A 3EMQA 3PHAA 1KGWA 1HF6A 2E9MA 1JD7A 2X1IA 1GPFA 2VZOA 1MVYA 4AD1A 2G41A 2VOTA 5A8MA 2WZHA 1HXKA 3BSHA 1GOWA 1HIZA 2D3NA 1VB9A 3OLIA 1HJSA 3SCNA 3CMGA 4CUCA 4WKAA 1B30A 2FE0A 1XGZA 3WIJA 3EJQA 4F66A 3WQ5A 1UUQA 3LPGA 4W7VA 5BRQA 3THDA 3PZNA 2JE8A 1WZAA 3VGGA 1QHOA 2E0PA 4UQAA 3BAIA 1KWKA 3ARTA 2JIEA 1E0VA 1BF2A 5BXRA 1P6WA 5M17A 3CO4A 3OZOA 1W91A 5GNXA 4KH2A 1HL8A 2QHAA 3W6LA 3CUIA 5D8WA 2WHLA 1LJYA 4H41A 2DSZA 1G5AA 3SCUA 2F2HA 4Q22A 1MWOA 4PMYA 4HPHA 4AZBA 3CIVA 2RGLA 4DUVA 4QLLA 3O2LA 4JKLA 1A3HA 3BGAA 5IFTA 1QHPA 3SUVA 1MW1A 4C7GA 1TR1A 3U7VA 3OLGA 1OINA 3VVGA 1DWIM 3FY1A 4MDPA 4UFHA 3EDEA 3VGHA 4FNRA 1B3VA 1K9EA 3PTKA 2GK1A 5A8NA 2VVSA 1E55A 1B3YA 3HG2A 1R86A 5EFFA 3W29A 4AZCB 3L4TA 2WVUA 4P8WA 1V6WA 1V6YA 2XFFA 3DDFA 1CLVA 2B31A 1UG6A 5ABEA 3IJ7A 3VSTA 4KGLA 3BAKA 1ZJAA 3FXYA 3S6TA 3W26A 4U33A 4YHEA 2CKRA 1KBBA 5CQ1A 1V0NA 4U2ZA 4JFTA 4HZ6A 5A2BA 2D3LA 4BA0A 3L4WA 1FFRA 4KRUA 1ZBVA 1UH3A 2XIIA 4AISA 3GNOA 3VM5A 2Y5EA 1UYQA 4FNTA 4PTXA 1XYZA 3LMYA 3WL0A 3WF0A 4JFSA 1GOQA 3D51A 2XG9A 1ZBKA 1S46A 4JL1A 6TAAA 4D6CA 4W5ZA 2E8ZA 2WVVB 4AYGA 1EDGA 1ZJBA 3RJYA 1V08A 1LL7A 4B9ZA 1V02E 2GJPA 2VURA 1R7AA 2W91A 5I6SA 3MMWA 1K9DA 1PIGA 5HOSA 2V5CA 3MI6A 4RL3A 2EACA 4UQCA 5BXSA 1J0JA 4MNJA 3WF4A 4GKLA 1BFNA 2YJQA 4W84A 1L8NA 5BWFA 1JZ6A 2Y2WA 3ARSA 3NUKA 3K8LA 1V0KA 2YL9A 5EBAA 3W28A 1TG7A 3HJEA 5EFDA 1CIUA 4CVWA 4DO4A 3VINA 1OT2A 1ZU8A 5A95A 2WBKA 4ATDA 3CBWA 1GW1A 2Y24A 4FLRA 4GI8A 5M03A 5D9OA 3VIJA 3DHUA 1J0ZA 2CNCA 4MADA 3ZO9A 1V3IA 4M56A 2QMKA 4OGZA 1PEZA 2NT1A 3UCQA 2XM1A 7A3HA 4CU7A 4LYPA 2G3NA 1BHGA 3EJRA 5CZKA 3AXHA 3VSUA 1W9PA 2CETA 3ZMRA 2YLAA 3GXDA 1JYNA 5CGTA 5A69A 2CXGA 5I0DA 2XWEA 1E6ZA 3A24A 1JZ2A 3VIHA 3CZJA 2YIHA 1SFSA 1GZJA 1J9YA 4GINA 1H3GA 2VZSA 3WD0A 1M01A 4P8VA 3ZT5A 3LX9A 1W9BM 3AQUA 4UR9A 3VOCA 2YBTA 3EMZA 4PSPA 2TAAA 1UD6A 2WNWA 2VL4A 1XC6A 2DH2A 2BHYA 2YFOA 4E8DA 3PBGA 2WB5A 4W89A 4V2XA 5HNNA 3S5ZA 2E9BA 1R85A 1UD4A 3EJPA 2VQUA 4AD4A 3ZJKA 5I23A 2O9OA 1C93A 5GQBA 3VD7A 2FH6A 1R8LA 5AC4A 1D7FA 1EDQA 4U2YA 3N15A 4LX4A 1SZNA 1GUVA 2J7CA 1G9HA 2Z1SA 4GQQA 1NOFA 2OW7A 2XIBA 3MMDA 4ZE4A 4CD8A 2J8GA 2XVKA 4MTVA 3BLKA 1VFUA 1QBBA 5FKYA 2D23A 2JIWA 4AZ7A 2ZUUA 3VD9A 3VDBA 2EQDA 3DX0A 1CENA 2XVPA 4MB3A 4PTWA 2WCSA 2W92A 3NSXA 1MW0A 2XN0A 1R7OA 2DGAA 5ABFA 2YDRA 4MB1A 1G01A 3UG5A 1CGWA 4RE3A 4NZCA 2YA2A 3OLDA 3BLPX 1XD1A 4BCEA 1UA7A 3SUTA 1BG9A 4GO8A 1SYTA 3VPLA 4UFLA 1CXIA 2EJ1A 4QCFA 2VC9A 1UZ1A 1KGUA 3VX1A 2O9TA 2VRKA 4IUGA 1H0IA 1QNOA 3M07A 4LYQA 4UFIA 4ACYA 3RDKA 1MXDA 5AYBA 1FHLA 3WKZA 3LXBA 3MANA 9CGTA 4FNSA 3WMBA 5ABHA 2J79A 3WDHA 3ALGA 4MAZA 1BYBA 1BTCA 4J3WA 3LPOA 3BXWA 3EJSA 5I5RA 1QNQA 1HVXA 2JALA 1E73M 2D0FA 2OSWA 5LA1A 1I1WA 3NYDA 1BGGA 3WH6A 2CEQA 2NT0A 1KTCA 1WP6A 1XYFA 1D2KA 1UR1A 1TQVA 3TP4A 2GVYA 3GXFA 4D72A 4J7RA 2PB1A 1HP5A 3BUIA 1US2A 1WDSA 3QHOA 1JAKA 1MQRA 4FF5A 1R33A 5A6JA 4D6IA 1J0KA 4PMVA 5DT7A 1HN1A 1JDCA 2ZUWA 4AXNA 1JZ5A 4AIEA 4AZ5A 2YDSA 3A21A 1LG1A 2XGIA 5C70A 2WBGA 5CGMA 3T0BA 1EA9C 1JDDA 3L4VA 3ARQA 1TUXA 4NF7A 2F7OA 1K9TA 1ITXA 1JXKA 4DWSD 2G3MA 2CIPA 1JZ4A 3S5YA 2ZUTA 3CZEA 1Q4NX 2BFGA 2BVDA 2WANA 3ZQ9A 3OZPA 2WC3A 2XPKA 4E2OA 4GZIA 3T08A 1H11A 2E4TA 1HTYA 2J7HA 1EHAA 4H8UA 2QPSA 1B90A 4HOXA 4AEFA 3SCVA 4U3AA 3MV11 1H0GA 3D5HA 4J3UA 4AC1X 1NWUA 4LYRA 3CPUA 1ITCA 2DQXA 4FMVA 1ISXA 3GNRA 1W3HA 4WSJA 1QVBA 2JFEX 5LA2A 3IAPA 1JIBA 3BUDA 3QOKA 3EDDA 2RGMA 4NXKA 4C7DA 1XH1A 2ZUSA 3ZSTA 1W9DM 1JYVA 4JIEA 1FHDA 3RO8A 1MXGA 3N1AA 3FAWA 4BZYA 4HZ8A 3B8SA 1VBRA 3VM7A 3PZVA 4OOUA 2VCCA 4U5IA 3WDQA 5HPCA 3CV5A 4XB3A 3OLEA 4PBGA 5FOOA 3PZOA 2D20A 1LG2A 2BVTA 3DX4A 4AY1A 4AIUA 4Z2GA 4F8XA 1JD9A 1B9ZA 2GK1B 4LPCA 2YL5A 3WEZA 2YKKA 1R75A 1UD3A 1KB3A 3L2MA 4MNKA 1VF8A 4WK9A 5BRPA 4CD6A 3ARVA 3CH9A 2WVTA 4F79A 4BF7A 1DP0A 1PX4A 1F4HA 1E5JA 2WZIA 4D1JA 2UY5A 3SIMA 4ATWA 1EQCA 5A8PA 1OT1A 2GJXB 4TVDA 2ZXAA 1DWGM 4L4OA 4UOJA 4EAMA 5HBFA 1EO7A 3OGSA 4FLSA 2EADA 3VNZA 1FP8A 3WNPA 3U7BA 3WFLA 2ZIDA 4PCSA 1DEDA 1E5NA 4PMOA 2FH8A 2BHUA 3BMWA 1M53A 2YL6A 1DWAM 2QLYA 1J01A 3H55A 1XH2A 4GO9A 1BYDA 3WNMA 1GCYA 3L2LA 1SMAA 4MNLA 3WY2A 2ZX9A 3I3DA 1UWIA 1I75A 3WUBA 4NXSA 3WQVA 3RM8A 1QOXA 1C92A 4KGJA 3ZOAA 3AS2A 5A8QA 2J7BA 4Z2JA 1ISWA 1CXEA 4ML4A 1HKKA 1LQ0A 3MV01 1CGTA 2J75A 3MUZ1 1V3HA 1BYCA 2F1BA 1HXJA 3AHVA 4ZENA 1UWQA 1NH6A 4PRWA 2DPEA 1VBUA 3KLLA 3AIWA 1H41A 3A5VA 5BCAA 4D6DA 2W66A 5M3WA 3LPPA 2CITA 2WSKA 3SCTA 3PZUA 4AMCA 4WJXA 2WPGA 4BQ5A 4CN4A 3EMCA 4W86A 2D22A 2DT0A 4W8BA 3WNNA 2F7QA 2GJRA 3DDGA 1JXJA 3RIKA 2QPUA 3WNKA 3SCPA 3RMEA 3AIUA 5FIPA 1MQPA 3BH4A 3WUGA 3MSDA 4B3LA 2IXUA 1XSIA 3B9EA 2CBIA 5AYIA 3VD4A 2ALWA 1VIWA 3EYPA 3VNYA 1UWUA 2WSPA 5E9AA 4MNMA 2WCGA 5JIPA 4FNQA 1L0PA 4CVUA 3L4YA 1NWRA 2VT0A 2BY3A 4H8VA 1QI2A 3W4RA 4QLKA 2XGBA 1XD0A 2VCBA 1JZ3A 3WH5A 1AVAA 1R46A 1WCGA 2VTFA 2DT2A 4AYSA 1KQYA 1US3A 4ZFMA 1OSEA 3AS3A 1E6PA 1LF1A 4H8HA 1TFVA 2DT3A 4KMQA 3MS8A 4AZGA 2C8NA 3VSVA 5GPRA 2BVYA 2X2IA 4W88A 2ZUNA 2FGZA 5BXPA 3PZGA 1VJZA 1Q6GA 1GORA 3FHAA 3TTOA 3CUHA 3RCNA 4U31A 4V28A 2PBGA 1JI1A 1XSKA 1W2VA 4XUYA 1PZ2A 4J3XA 4M8UA 3GDBA 1I1XA 1KTBA 1WZKA 5FL0A 4JFUA 3CZKA 4W93A 2FHFA 3AZTA 2GDVA 5D9PA 3MU7A 4KRTA 3B9AA 1DHKA 1V6VA 2VX7A 4P7OA 4DWSC 1H2JA 3VIIA 1HP4A 1E1FA 1BQCA 1E70M 2X0YA 3WDJA 3AROA 3AHXA 3T2PA 3TTYA 1WO2A 2PWHA 2XFRA 4AZ6A 2NW0A 1LWHA 3VGBA 3VMPA 3GZAA 1Y7VA 1E72M 1CEOA 2ZICA 4JKKA 1GVIA 2OYKA 1Q6DA 3K4AA 3W24A 3WY1A 1W32A 3A3HA 7TAAA 2OLHA 2XN2A 1J0IA 1GOOA 5BYWA 5DF0A 3UG3A 5KZ6A 4R5EA 5A94A 4EANA 1WDQA 4HU0A 1PPIA 3NJ3A 1U33A 1HWWA 3WF3A 1HJQA 2J7DA 2XJ7A 3VIPA 3A4XA 5E1QA 3PN8A 4MJ2A 3BC9A 4HP5A 1NOWA 3AHZA 3TA9A 3W82A 5FCZA 2UY4A 1F4AA 1E56A 1UQYA 4D6JA 3PTQA 5JUVA 4HA1A 3VDAA 2EABA 3IAQA 2WW5A 3MSGA 4W7WA 2V3DA 1RPKA 3BAYA 3M6DA 1A47A 2GUYA 3NIYA 5I78A 4B9YA 3HMCA 1QWNA 2EPMX 1E40A 3CC1A 4S3KA 3ARRA 4JL2A 4UQDA 2G8ZA 4S3JA 1JL8A 1HKMA 3LXCA 3FW6A 2CHOA 2J47A 4JAWA 1BYAA 1ISZA 2WMGA 3ZIZA 2AOSA 2V3FA 3T0AA 2BY2A 3BUQA 3U5YA 5IFPA 1JDAA 2DIJA 2J7FA 2WVVA 2ZWZA 3AMCA 1E6NA 2GFTA 3KWXA 3I3BA 1M7XA 1QI3A 1YHTA 4UCFA 1C8XA 4P8XA 2W4XA 4DM1A 4BQ3A 2EPLX 2X05A 3VDCA 1DTUA 1ODUA 2D24A 3KL5A 3T0DA 3JUGA 3CGTA 1UA3A 4CCCA 2OWWA 2J7EA 1OM0A 1V6UA 1X1NA 1JZ7A 4MAVA 4A3YA 2ZX7A 4QFUA 5A8OA 1KXTA 1Q6CA 1WB0A 1TA3B 3QGVA 1NOUA 3NSNA 1LLOA 2VZTA 2NSXA 1R34A 2PC8A 2V38A 3W27A 3POCA 4OOZA 3AMGA 2D73A 1N82A 1M04A 3AYSA 2FDMA 1UOKA 3WMCA 3LXAA 1QI4A 1TCMA 2J7GA 3WH9A 3ARPA 1U30A 1RH9A 4U3CA 3LRLA 4ZXLA 4W7UA 5CPSA 4TX6A 5A6SA 3WBAA 3WFZA 1UR8A 2V3GA 3WH8A 3NSMA 4CKQA 4PUDA 2F18A 1O7AA 2XVGA 2IUZA 2XFYA 4X9YA 4DUWA 4UQ9A 2CHNA 4OIFA 4PTMA 2XUCA 1V6XA 2WC7A 4YHGA 4LQ1A 5DEZA 2WVSA 4JCMA 2Y4SA 1J10A 4EE9A 3AIEA 3AFBA 2F61A 4E8CA 1W1VA 3KLKA 3N04A 1KXHA 2DT1A 4PMUA 4B15A 3DX3A 2VRJA 1NP2A 3ZJ6A 1XRVA 3G6MA 3OG2A 3D4YA 3ZR6A 1OCQA 1JYWA 1TZ7A 4PSRA 5A6MA 1B31A 3UR8A 3ARYA 3SCOA 4UZSA 4MPKA 3TV8A 1C90A 4NZJA 2E3ZA 1OGSA 1E0WA 1RP9A 4W5UA 2DDXA 3BAXA 1HT6A
chains in the Genus database with same CATH superfamily
2CC0A 3NP3A 3FONB 4PI0A 3BGGA 4PCNA 3U9UB 1A1MA 3OR7B 4F2ME 4MKNA 1G9NL 4AG4L 3QNZA 5DHMC 3ABMB 4IZGA 1FWEC 3V6OA 5IHUH 4HUUB 3LOWA 4QF1B 5EEZA 4GLRH 5C54A 3HMXA 4JFDA 1OLZA 1RZIA 5D96C 3ZTCC 4XMPL 5CLWA 3SGJC 1EHLL 1OD0A 2EEDA 3LKRB 1LEIB 4UFJA 1KJ2B 1QTPA 2YPLB 4KFPA 4FEZA 4B2DD 3WY3A 4R7NA 2EHHA 1DQDL 3CXHJ 3CMFA 4K7PY 1Z5LA 1RAKA 3A67L 1NCAL 2ZRZA 3KZPA 4RJEA 4UXDA 4E6MA 1SDYA 4XKMA 2NY7H 3N06B 4V2CB 5INDB 4L0YA 5DR5L 1TEGA 1FRBA 2J9ZA 3KHOA 3WBEA 4MNHA 3QJFA 3RPIB 5EDXA 3QY6A 2PETA 3T40A 1BPLB 1A1OA 3U5UA 2BXYA 2RGSA 4HW6A 4FZEH 4QYAA 4BK5A 4FQ2H 3RRQA 3DO7A 5DURB 4F2TA 3DEQA 4XZLX 3SDOA 1J7VR 3QEQB 3W1XA 3UROR 5EL1A 4PEEA 1CLYH 1TTBA 2NY3D 3EIFA 4HS8H 1OZUA 5BUGA 3A64A 3N11A 3QGKC 5JR1L 4PFEA 4RGMB 4Z7UB 1G1YA 3AMLA 1PLAA 1RIHL 4PD4J 1JJKA 4XPFH 1NQBA 2NNCA 1RURH 3HQNA 5LCVA 4AZUA 4NZ3A 3RZCB 5ISZD 5TPWL 4WNQB 4BZ1A 4NZUH 4AEHH 2BMKB 2NXZB 2XJKA 4Q6IB 1AJ7H 3SIKA 3M7OA 1JRHH 2XPGA 3HB3D 4GS7B 1ZGDA 3EB2A 4DBEA 5JPMB 3RIAK 2X1TA 2ZBTA 4X6FB 2PRHA 1DBMH 3STZB 2VCAA 1QBAA 3MRNB 4N68A 1TTUA 1KN4H 3PVFA 1HHHB 4ZPTB 1W9VA 5E51A 2FMOA 3AXLA 3VGFA 5DHVH 4HMCA 2DQJL 1I9IH 1LROA 4ODWB 4B2DA 3NL3A 2PPEA 3BVVA 4Z7NB 2J4GA 2NY4B 3HJ0A 2KZ1B 5F1NB 4KBPA 3SHSA 4HYRA 1J1XL 3IU4L 1BDYA 2EDJA 3AFLA 1IBDA 4WZ9A 1KN2L 4HUVA 1IBZA 3D3FA 2DWSA 2XTJE 3EJUA 4NNYB 4R96A 3Q67A 5J11B 2EYTB 1TQJA 3D18A 4IWWA 4CU6A 1DVFB 2QGYA 2DM4A 4TSCH 3IFPB 5T91A 4HSAC 2A3LA 4GE8A 2EKSB 2ZWKA 1WVZA 2FBJL 2ZOXA 1BZ7B 3HA1A 2W61A 2JSFA 4ZW6A 4US5D 1L3NA 4X6DB 2VWSA 2PWVA 1M2VB 3WKML 4XE0A 4ACZA 3BGMB 3QI9C 4M24A 1JF1B 2A6DB 3W5MA 5AKVA 2PGWA 5D2LE 5HR7A 2WQRA 3RWDA 3PBVA 2VITB 3DRTB 2IBBA 4JM4H 5FACA 2GIYA 3IF1A 3GJEB 4K07A 4MNQE 4ODUA 4POZD 5I71B 3HAEH 5EC2B 4X2PA 1BSLA 1WNOA 2ZADA 3IDYB 1UXSA 4LLUA 4L8DB 3L08A 3GH5A 3VD3A 4HJWA 2J8UE 4NRRA 2DTMH 3WIHL 5I0ZA 5I75B 4XO4A 1XYLA 3QAZC 1FH7A 4BGDA 1WBYA 4O57A 2AF2A 5FGSA 2H4EA 2GYSA 5FO8B 3G3MA 3CIXA 2C9RA 4Q8UA 4OU3A 4C58B 5DJ8B 1K7EA 4WWKD 1HL9A 3H12A 3U2EA 2R1LA 3H2CA 1EAQA 2CO6B 4UINL 3TVAA 1IEHA 5IV2A 4B5NA 3WG7B 3UADA 4RDZA 2NY0B 4ZO7A 2DKMA 4P9HH 5F9AC 3I50L 4WF7A 2ZXDA 4G9FB 4P99A 3LV3A 3OBKA 4AZCA 5I0YA 4HJEA 3HN3A 3RWIA 3AT8A 3Q5OA 5TAOA 5CBAA 2VFIA 3CHEA 2XQYK 2XKUA 1TO3A 2BVPB 3O45A 4QP0A 4WHBA 5DYOB 2WZPA 4IU2A 5DMMA 5BMWA 3W85A 4LCYB 4HZLB 2JKEA 2PW2A 4BK9A 2Z31A 5I8KL 2YFNA 2ZYIA 4UMAA 4Y16D 1UD8A 5TH2B 2Q6WB 2YARA 2OLDA 3GRBA 4TVPE 1XIEA 4I5UA 1DDHB 3QDMD 5I6KA 3GSUA 4PG2A 4AM0A 3QDJD 5HHPA 3MNWB 3HG5A 2Q8XA 1UCBH 2RCSH 9RUBA 4AH2B 3NQKA 1MHHA 1HJCA 1W6TA 5J57B 2R91A 4XNQA 1G7PA 4BFRA 3WQGA 2NZIA 4QNPF 4AMXA 4X63A 8XIMA 1EZUA 3HQOA 3U6WA 4S23A 5T3ZH 3DVGA 4MLRA 5TFSL 3TSBA 3VE0A 4YIWA 4HJ0D 1DLFH 1SJHB 1RQHA 2VKXA 4CQ8A 4PP2B 2ZXBA 2J9YA 4PRDB 2Q5BA 3TWCH 1UA6L 3NCFB 3HF3A 2JKWA 1D6EB 4HJTA 4B5SA 3BYYA 2BOCB 3V5DA 5GNZA 4JQVC 4UQ3A 3WNOA 3RILA 1VP5A 4Z7NE 1QA9A 4XBKA 1ZGLB 3OTRA 4CD4A 3RYSA 3EO9H 4WSKA 1E4KC 2HYMA 2B9AA 4YGVB 3UOAB 5CIPA 1MQKH 2XSAA 3QPEA 3WD1A 1OGAE 1GQLA 3D2UD 1XX9C 3LSCA 4JHBA 3GBML 5GJSH 4HK6A 5E0CA 1P5VA 4FERA 4LFHG 4MY9A 3NL2A 4JUSA 5DD5H 3MRJA 3V0WL 3APYA 3PG2A 1P84J 2P28B 2Z8SA 3LQAL 1LBFA 3OL2A 4BCXA 2BWGA 3EWDA 4FO4A 2HT2C 4GH3A 1H3PH 4HT1L 5K9QI 1RZGB 4NILA 4OKDA 2R15A 1DZBA 4HNUA 1UZ8A 2J20A 1PLGH 1Z6JT 4Q56A 3T0WA 1XKYA 3AIBA 5D1ZA 4X8CA 3UETA 3GNXA 4U1MA 2E86A 5M1TA 1IGYA 1OD7A 4ADTA 1DO5A 3ZHLA 3ZPDA 4P5KA 1HJUA 4O8RA 1A5FH 1A5OC 3ILDA 2NX5A 2XN9D 4K5MA 4PRIE 3ZMNA 2GVEA 3BICA 4LJ3A 4YQXL 1L7TL 3FTWA 4DYKA 4GW5A 1KGCD 4Q58C 1DIEA 4L4MA 4AVOA 4B5TA 1A7OH 5F7WC 4RRPM 5AVNA 2OP4L 3BH9B 4M8QB 4BSWA 3EGJA 2A2QT 3GMMA 1DTNA 3NZPA 3WKPA 2FO4A 5ID0A 4Q8TA 4DIXA 3HS9A 2X4TA 4K2UL 4LLWB 4WSGA 5HGAA 2ICWI 1KA9F 2ESCA 3FBQA 1E90A 2BRRH 2VDLB 1TX0A 4M43H 5D6CB 2ZJSH 2DTML 3WIHH 5BS0E 4ODTH 1NGQL 2QJIA 3M44A 1C12B 4D6GA 3BQVA 3TA4D 2B1HL 3E6EA 4EUPH 2OEJA 1WS8A 2HS6A 4HKPA 2VMJA 1HJXA 5DWUH 1THAA 3W7JA 4Y19A 4PJEA 2CMRL 4ZMPA 4B3ZA 1D9KC 2WW8A 5FYKE 1IJ9A 3EOBA 5J89A 3MVSA 4CNNA 3GC5A 1T66D 4P05A 3MUIA 4JM2F 3BRFA 4JDBA 3M1CA 4IM8A 1XGUB 1R17A 1AO7A 1B4JL 2IKGA 3FMGL 1GZQA 3N43F 3O81A 3FS9A 4O4WA 3S8HA 5EOCL 2ZTBA 1OHQA 1W8NA 4HFWB 1N59B 2YD4A 2P76A 1SYVA 1OK6A 5EEXA 3CZFB 4X4MA 1XLHA 1S7WA 2YXXA 1I85C 4IBUA 1TE1A 2YEQA 2REQB 3NEHA 1J5DA 4PY8I 1FPTH 1JPSH 4XXCC 1CFQA 5TDPA 4XX1E 1QWKA 2O92A 4M4PA 4AWUA 5JBEA 3NGBC 2J62A 2RH9A 3AM8A 3P73A 4XN4A 2DBLL 4MJ4A 4N0YL 5IB2A 3TGXA 1P6AB 1I1AA 2JIXB 1VFFA 1WKEA 5C0NC 3BAWA 1AL7A 1JWMA 32C2B 1E6QM 4Z78A 1DWHM 1PNDA 3NOEA 3L67A 4NQVA 3O8XD 1C3FA 1F11A 3NCMA 3GHBL 4YX2H 4N90D 1J12A 1HQRB 4PCTA 1FVPA 2IQTA 4ZXBC 4J4PA 5KSVA 1NFKA 2Z6FA 5DXYA 3WL1A 1F42A 3S36L 1DV7A 4G6FD 1XG3A 3TC3A 4AC4A 1UT9A 3LH9A 4GXVH 4NCC1 5KZCD 1NFIA 1MYRA 1QI0A 3KWWB 3D6GA 2REQA 3HPZA 2MCAA 4MCYB 4JKNA 3GU1A 1JF6A 5EF1A 1HCZA 3VNLA 1YRRA 3ESMA 4J6RL 2HN7B 2QADB 5BZWA 5FD0A 1UMLA 5AVYB 3Q8EA 4P2YA 1FFOA 3QUZA 4ZO6A 5J1AB 3I4KA 5J8LA 4BS0A 4QDWA 1FYTE 4WVRA 3REVB 3BVNA 1I6NA 3TN0D 1IGTA 5C09B 2NRDA 1XGQA 3ZRFC 3ULVD 2QVIA 3W87A 5D2NB 2QV2A 2F19H 1IEAB 4E9YA 4M1GL 1A3QA 5E99H 1G7IB 4TSBH 4EZLA 3RJQB 4FLQA 4A2EA 4MJIE 5L8KB 1U8LA 5DRWB 1KB5A 2ESVB 2R69H 3PXLA 4QRTB 1E9YB 5HGGS 8CGTA 5JA8B 4PJBF 4YLBA 4IIBA 1QSEB 3LZ3A 2AJSH 1YEKH 3AZRA 3CWHA 4ZD3H 4P7RA 1TMQA 4MNGB 4Q9RL 2YUZA 4U4IA 2HN7A 4YE4L 2IBZX 1SOSA 2EH8H 2PTTB 4QRRB 1QU4A 2WZMA 1FWHC 4E3VA 1LUCB 2YXVA 4HF5L 3NH7H 1FVCA 2Y85A 5B4MD 3DFYA 3NCXA 3O6FA 4QE1A 3MRHA 3WAJA 4LEFA 4YSOA 4MLSA 1K4CA 2WMPA 3AB0B 4X6DA 3LNGA 1TUPA 2Z64C 2IQAB 3EDKA 5I1EH 1XF5A 3BH8B 2V2TB 4IPLA 4QUOA 4OJAA 5CSZA 3NQ2A 2R1YB 5DX7A 4UOQA 2RBLA 3W2NA 1IC4H 3THQA 2ZOLB 4I3RL 3VKKA 5L6UA 1W15A 3DOPA 4HYVA 5MHBA 1Q6RA 4DWSB 3WNLA 4ATLA 5CPQA 1W5NA 4L4TE 1EEYA 3MN8A 2GTQA 4QOKA 5J5DA 3CBRA 3UYRL 4LLUB 4HA3A 4MYAA 1KPUA 4NRYA 1O1ZA 1A14L 4YBQC 5EIQA 5FEXA 4WK0B 1UKOA 5CLYA 5E24E 3CEPA 3M0KA 2XFWA 3MNDA 4MXWL 2AVGA 2GY7B 5E7BA 3AREB 4AGNA 2C3XA 3I6RA 4D9PA 2NWRA 5CIPB 4RA0C 3PUGA 3WE6B 3BUYB 4V15A 2DH3A 2P52A 1ID2A 4M1CC 4N4YB 4Q6IA 3RYMA 3VXMB 1PHQA 2CO6A 3U79A 3SI9A 1E4XI 4R26L 3OGRA 4HTYA 5IY5B 3VXNB 3UCDA 1J8HE 3BUVA 2P43B 2D2OA 4OLUH 4JPGA 5DZNA 1H3WM 1Z0MA 4XPTH 4E36A 5HYQA 3REWB 3NCYP 5D8JL 1MRAA 2FJHA 2AJYL 1AFVL 1NFAA 4AC7C 3JVGA 1ASOA 4LHUD 3UJRA 1WT5A 3IEAA 1UKTA 4AL8H 1Q6FA 4OF8A 1U8MA 4OSUH 5I15H 1LQ2A 1TVBB 3RHWK 1GL4B 1PNCA 2PAJA 3R58A 3TQPA 4HNTA 2FLMA 1DKWA 1XGRB 3CPGA 3E80A 2B8OT 4NZUL 1FFNA 1KJ2H 1QWUA 5GZNC 1M6OB 3ABKB 1EXUA 3DUUA 2IWFA 5D72L 3KYMB 5E0KA 2QYGA 3PL6B 3SCRA 1MLCB 2WIMA 2J1XA 4PB0H 5C3LD 1M71B 3D39B 3PXHA 1K7XA 1MAJA 2WQXA 3P40A 4OTKA 4ODVH 1IIKA 1C8QA 1KIUB 3VIKA 3CTTA 4P5MA 5J3HC 4R33A 5JVLA 3BEVA 2BX5A 3BPOB 3KEHA 4RAVB 4GPNA 4HWNA 5DC0A 3C2EA 3SRKA 3HUJA 1LNUA 3RX8A 1EIBA 1R1CA 4XCFL 1DBTA 2CLEA 2G96A 4FCHA 4V33A 5CNHA 5D7SL 1R3YA 2QNEA 2HPOA 2VCOA 4J3OG 1QYGH 3VWKD 2EBNA 4UFMA 1KTDA 3ZBMA 5BQ7B 2WMIA 3MKGA 1IBGH 2K45A 3Q2LA 5K39A 2Z65C 5KVFL 3IFLL 3ZJ8A 2FUTA 5LHDA 1HX0A 4M6QA 2CIKA 4I9WE 2XKNA 4JPQA 4JFFE 1RZPA 3UO1H 4IRSB 1UCWA 1HU8A 4C6KA 3HAEA 3Q2WA 3AZSA 5F1UA 4H5SB 4KZEH 4G7EA 2XBTA 2DLGA 3UP1A 1J11A 4KK8D 4G6JH 4Z7QF 2NY7L 4AIZB 2P8MB 4YGVA 1M9HA 3CFQA 4NHCL 3WUWA 4Z7VE 5KYUB 4IQEA 2TSAA 2CO4A 2WXKA 2VRQA 4TPRH 5FO7B 1F4YH 5I82A 3POHA 4E9XA 1QUPA 5BU6A 4HWUA 5JIMA 1EEQA 1WH0A 2J78A 3PAUA 4G1KA 5MHSE 1OTUD 2NYYD 3AIWA 1X96A 2HE8A 3N14A 4GJ1A 1N68A 1QLRA 2PF8A 3BQUA 5ERWA 5LBSL 5E08L 1BVWA 1HCFX 2X53A 4H8QA 5DO2C 5IDIA 4Y4HB 2H3NB 2I07A 2EIKB 4NO5B 3VQLA 3VRIB 4M51A 3VFUA 1JF1A 1MZYA 2A6DA 3BUPA 3LZPA 3Q48A 2YGPA 3QCUH 4MB4A 3CVIH 4P2OA 2CRZA 5FOBA 5LG6A 2VLJD 3SJNA 3S0CA 1BAGA 2P7TA 4NFBA 4DVRL 2W0PA 4ZBCA 2UV3A 5C8JA 5CEZH 1F3RB 3QHFL 3WMPA 1GJUA 4YX2L 2WHKA 4Y96A 3APDA 3KCWA 1VBGA 2F1EA 3DUSB 3F4CA 2AQ1A 2CGZA 4G83A 5FHAH 4R7LA 2ZSWB 1MJUL 3FOLA 3IFPA 1U8CB 5E6UB 2EIZA 3SDDC 4GAJH 1HH6B 1NANH 2DW6A 2PU0A 3AXKA 1BGXH 4GBUA 4KIRA 3MLVL 4D6EA 5JORA 4BSWB 4CJ1A 2CGRH 2XBZA 2QKIB 3H42L 1SW3A 3UTTA 3KJ6L 1SSDA 1XGYL 5H8DA 4K9EH 3LCXA 5AYYA 3U2OA 2PUQT 1QQDB 4ZS7H 5B7YA 1PZSA 4H6KA 1CF1A 2WMJA 3UGEA 1TQWA 1RUKH 4LALA 1CGYA 2H8PB 4GSQA 3C60C 2XFXA 2X89A 5ECJE 5L2KE 2Q6ZA 4LEQA 4J2PA 3GMOA 3VD5A 2WZTA 1EX5A 3NFSH 4L0PB 3DRTA 1XRSA 1OK0A 4YPGA 5JXEC 1VFBB 3DBNA 3UP6A 4M1GH 4N87A 3W2DH 1FQ9C 1JPTH 4OIIL 1VENA 1I9CB 1OB0A 3QO0A 1INQA 2EE3A 4JFOA 3BVTA 4PZVA 2EO1A 3WJSA 2VM3A 4NIKB 2GJZA 4FQLH 3P2DA 2P5WE 2CPUA 5IW6B 2G5WA 2MANA 4GVFA 1SOQA 1MQ8A 3TT3H 1JCKA 3DVIA 3WLJA 2OL3A 5IJVA 4F58L 4RE4A 1DXFA 3KTSA 4N8CH 3TIEA 2VEGA 1VZHA 1TQBB 1DIOA 3CZNA 3Q2NA 5A6LA 4WVXA 5D72H 3EOBB 1ZK5A 3E1F1 1E27A 3O6FD 4WOZA 3EADA 1JXDA 3H3PL 3S4SG 4H20L 3UYOD 2AI0L 3LNFA 1CDGA 1QO2A 4MWFB 4JPIB 1WRFA 5ISZE 3OGVA 4NUPA 1RPUA 3QC0A 3S4TA 4XV0A 4L4JA 2NPLX 3MNVA 5ICYB 3DVNA 1XXFC 2JK2A 5KW9H 4O1CA 3VXRD 3AWOA 5GVJA 1P4BL 5J6GA 1QABA 4YPJA 4G7YL 2FIKA 2QV5A 2G75A 4UTCA 2X2HA 3RAJH 1E6XM 2WWNA 3B2PA 1YBQA 1G7QA 1R47A 2X4PB 4C6BA 3P81A 1O5RA 1VGEH 3GDLA 5DZLA 5IQLA 5AVXB 1GVFA 3IDMA 3ABOA 3U2IA 1X98A 4AE0A 5FW8A 5KVFH 1FLTX 3C86A 4KBXA 2OZNA 3PHOB 2YR3A 4A7VA 3PWGA 5SX4H 3QIUC 2CDEA 2Y8KA 4FXKB 3MJ9H 1M3JA 3FDWA 4LSUL 3ZR5A 1HZYA 4B3EA 1NAL1 3R06B 4PJ7A 2UXFA 3K0YA 2WLLB 4H19A 4EZKA 2IDSA 4IQHA 5CAKA 1NGYB 3DMMD 5C08D 5HVHB 4ZPTA 3TN4A 4DIAA 2WQAA 1M7OA 1R0MA 4YR6B 2B4GA 2FZ9A 2IS7A 2D0GA 1PJ9A 3E9TA 3EH1A 3FFCE 1JK9A 3CDYA 3V6FB 4XGZA 3FSVA 5D4YA 1AXSA 4KV5E 4PW9A 2EPOA 2DLTA 2ITCB 3G5EA 4OTXL 5FUCC 1E15A 1AR1C 2J25A 2DTSA 4M4RB 4ZW8A 3WIIL 4PJCF 4AUJA 4F8LA 3TPUA 1ROWA 5HHNB 4HUCA 1QJWA 3EEGA 4J4PD 2EVHA 2YQBA 1GOKA 4KK5C 4FABL 1FZMB 3UJSA 2AQPA 1GY2A 3IU3A 3HE6C 3QQ1A 1MMFA 3Q05A 3S6OA 1WZ1L 3EOTH 3WHXA 1F3XA 4RNJA 3V1PA 4PJ5B 1XL4A 3A5FA 5F70A 3V0HA 1L9RA 1IEIA 5F89A 2H6PA 1W1IE 3L9CA 3RLHA 3ZVHB 3ALWA 3MRMA 3UTSA 1ONQB 1NPJA 3MA7B 3OX8B 5CWSB 1T2QH 4OLYH 4S3CA 4B0MB 1YY8A 3ZL2A 3ZT7A 4Z3EA 2JB5H 1SPDA 1W0YT 4G8EA 3W56A 5JHAA 2O0TA 5KBPA 5I24A 1MLCA 1CBGA 4HIXL 5SWSA 3KYAA 1ITQA 1IKFL 1GZ1A 1II4E 1K8XA 1KNOA 2WUCL 5KVFE 4FNPA 1KCRH 4QHPA 3EO0B 5KVDE 2HH0H 4KZ0A 1ICQA 3R11A 3NFPB 2Q7AA 3TBTA 2YEZA 1ZALA 1OQOA 3RVXD 2JKRM 5AB2A 1JUKA 4OCYL 3T2OA 4HETA 1TPUA 1VYSX 2X30A 3RF9A 4A8LA 4OM0H 3LKOB 4QJ4B 2CLVA 1TPC1 1HOEA 1X5LA 1A7NL 3I6LD 4IHOB 4JDTH 3TCTA 1KPUB 4FI7A 2FNBA 3NXFA 2JKLA 4TUKL 4ZUTB 2CRMA 1TTIA 3UXAA 5KG9A 4GYFA 2DSKA 3HM7A 4IMFA 2BWIA 4HUKB 1WPCA 5F97E 1RHFA 3GUTB 4QRQB 4AK2A 3OJDB 4P2OC 3NJLA 5DVOA 2GAZB 1PS9A 1I82A 1W2KT 4PR5B 2DBJA 3P7YA 4R4BA 5JOFA 4KW2A 1OF2B 4NM8L 4RBPK 1FZKA 5I1AA 2YUWA 4FXGC 1SJEA 2VHLA 4NQCE 4PR4A 1XINA 1MF2L 1Q6QA 2H8ZA 2OJZL 1FA2A 1RY7B 2VNCA 3WDRA 1LQAA 3S35X 1DBKL 3GNDA 1YRKA 4XRCB 4E5TA 4AD2A 3L9YA 1P69B 4XVDA 3QZWB 3L4UA 1XL6A 2ENJA 3B9KB 3H0TB 4FXGB 1BBJB 1KUMA 1UADC 1FYTB 4LEXH 1SZGA 3DHJA 2F7FA 2DIAA 4NRSA 4PJCA 5CGYD 3QEUB 1BXCA 4TMCA 3DENA 3ZSSA 2W27A 1GR7A 2F5AL 1R0AH 1QD0A 2VX6A 2GY5A 4Y9MA 3QHZH 5D1XC 4BSJA 5FKAA 3KAAA 1TNNA 1SOKA 4AK1A 2QPXA 3TA3C 1ZAJA 2P5ED 3BP4A 3GXNA 2ZWYA 3QORB 1X5ZA 25C8L 2QFRA 4W9ZA 4ZRGA 4CBPA 3VWJA 1Z9AA 3W81A 4XAKE 2YCLB 4XVSH 3VXUB 2ZYFA 3DGRA 4DHGA 1AE6H 1TEFA 2B77A 1SJHA 3HE7D 3CFBB 2E6FA 2H2SD 3G1AA 4BINA 2ZOKB 5I9QC 5D1ZI 1M9SA 4PVNA 3GSOA 1BF8A 4I77L 2H32B 2IDUA 2VDPL 1QNRA 3UT0A 1XAKA 3P3BA 3DXAA 1QPNA 1K5NA 4LBAA 4EUPB 1FUYA 2INFA 1R5IA 2HKFH 3FMGH 4L8SC 4U6YB 2NYYC 3W70A 3BRDA 3ETSA 2FJUB 4C6LA 2DQTH 1K8IA 3EDFA 1AZBA 3EFOA 4YHLL 3G9AB 3KBSA 3MC0A 2OAAA 4TUOB 2DWEB 2GFBA 1BBDL 1KB5B 2ESVA 4I2XA 3QEGL 3CYVA 3G1YA 1T1WA 3U9WA 5GRVK 4ADJA 3UIZA 1H4PA 4PV8A 4PMNA 2ZUVA 5F0JB 1RULH 3NAAL 3SGDH 3TO4B 1BTMA 3N17A 5DY3A 1N2RA 5DZPA 4A6YL 4JQIL 2VO5A 1T1XB 5D7JB 3SDAC 3M43A 4RK8A 4CD5A 3Q9PA 2Q20A 3AJ7A 4MA3B 3TBVA 1V7NH 2EILB 4FL4B 4GW1B 4RMVA 4UAHA 4JTHA 5D1XD 3ZN6A 2OWCA 1HIMH 3SZ8A 2BFVL 1FP9A 1LVEA 2CLLA 4F58H 3O3EA 1F8MA 2BP8B 1XPGA 1H5VA 3VZXA 1SFTA 5TPWH 2ITCA 4Z7WE 4EF3A 3GVWA 4Z7QE 2HFFA 3VI3A 4TNEA 4AZ8A 4JBRA 1MJ8L 4AHQA 1T89A 3WXVH 1SJCA 1OFOA 2WJEA 4MNGA 3P0YH 4PJGE 3WJJA 5C0RH 3R1GL 5LIWX 4E9WA 5G2HA 1MHEB 2VLRB 2V0TA 5DQJB 5DZAA 3IJEA 3RPMA 1GYWA 4K8GA 2VDMH 2W0FB 3EKCA 4E8GA 3CLMA 4H8WH 3VE0B 2ZP9A 5E99L 4R4FL 3CXDL 5FLUA 1L2UA 3DHFA 4ZEPA 4BBWA 1CU4H 3BD5A 3GK8L 3P3TA 4QAWA 1LDCA 4FS9A 1HINH 1RIVH 4YUEL 5D37A 3FN9A 4GSRA 2X0HA 3FUIA 3UJIL 3FQWA 1BZEA 4QROA 1FBIL 3QG6A 3U25A 2BIIA 4Y9FA 5ACZB 4ESKA 2A3CA 4FFWD 4DJED 4D9QD 2EPNA 1YLBB 5JLZB 3C2AH 4M1DH 3O2WH 3HMWL 1L3WA 1E5JA 3KDMB 5CC3A 3EJYD 4LSRH 3ES7A 1NGXB 2UZXA 4NCC2 4XO3A 5I74C 3LH8A 2R8SH 4TMBA 4JIIX 3JZUA 1XIWC 4U1HB 1NCWH 1X5GA 2V7NA 3OM3B 4EO5A 3D0AA 3G3DA 4PGCA 2JGYA 2EDNA 4JS7A 4LAQH 2B7PA 1YDYA 4PUNA 2ZNWA 3O6YX 2EP6A 3HV8A 3U36B 2CA3A 1U92B 1MCFA 1X7QB 1PY0A 2F7PA 2O6DA 2JKJA 3ETTA 4GXUM 3VCLA 4JR5A 3U1QA 3U4BH 4JFOB 1AQ0A 1OF6A 4UT7H 2HRLA 4B16A 3A22A 4I3RH 3K6OA 5JR1H 3G1DA 1EP1A 1A4CA 4ORGB 4P4RB 5DJYB 4ADUA 3PZQA 4GGBA 1BFOA 3BT2H 5T1KB 2CCWA 3RJDA 4YSAA 2UZPA 3S3BB 3FU7B 4TUFA 4WU5B 3F7LA 5D71H 3THML 3U0WL 4LKCA 3VH8G 3WD4A 1FRGH 4H00A 3ARUA 4D6HA 3QXUA 1DBAL 2ILLA 3RURA 1MHPL 5E8NB 4XAYA 3SCQA 3LYEA 4MSWB 2Z92A 2QCDB 2YX0A 3RX7A 1IE7C 4P2QE 2ZE3A 3IV3A 3WSUA 4Y4FC 1NM4A 4NHCH 1OABA 1P5UA 5CILH 1TZHB 2FHBA 2R29H 3GEWB 1XISA 2PDBA 3CZLA 2G60L 4M5SA 5IUSA 5IGXL 3BCFA 4PWKA 2HRPL 3B7YA 4Y4KA 2IEPA 1KN2H 4GBXA 1FDJA 3QIUD 3SGUA 4NZRH 2E5DA 5KSAB 2VERA 3K71A 2DZXA 5D1ZC 4IMDA 4QRRE 4PJXE 1CZ1A 4EE2A 2HT4D 2WWMD 4YHML 5ITFB 1TO4A 1T04B 2F68X 3UDWC 2N3JA 1W1PA 2VH5L 4L4PA 1KFEA 1UWRA 5DRCA 1HNGA 4Y9GA 3WUEA 1J0YA 2GLKA 1FZKB 3V0GA 3X17A 9XIAA 4ZBJA 5L9DH 1INDL 1MFVA 3Q1SL 2IG2H 3BZ4A 1EGZA 2GQAA 3VMOA 1TZHA 5E8PA 1I4FB 4OV6F 3QNXA 4WIWA 4A21A 2GVGA 1JHLH 4GUIA 4NDMB 3P80A 1KFCA 2K1MA 3VFRB 4OQ1A 4BA8A 2W79A 2DWXA 2XVBA 3ASOB 4FF9A 2BJMH 3SDXE 4HGWB 1SGKA 2FL5A 4MMZC 4ZMXA 1KQZA 3MHGA 3KX6A 4WENB 1ZAIA 5C0AB 1YXDA 3M7FB 1PAMA 4R0LB 5D1QA 4IJCA 3RLGA 3CHXA 3HBLA 3CH8A 3K6IA 4X9FA 2OSLA 3KWUA 4YHOL 1HSBB 3BARA 1PF3A 2BVQB 2NXYD 3GINA 3UR7A 1ILUA 2IH3B 2VN5A 4KROD 4X4ME 5IW1A 2VDML 3C2OA 4GQGA 3AGWA 4F0LA 1BFVL 1JFHA 3MNMA 4XOBA 1THCA 5IEKA 1P7QB 4GI6A 3MUCA 3TEYA 1R3VA 5LKYA 1V3LA 2HVBA 1PX3A 3IE9A 3V4VA 2YQ3A 3KM1A 2ADIA 4H9ZA 4G6KL 3AMDA 1RK7A 3EUUA 2VFHA 2WCPA 4Q0XH 1G4EA 3GTFA 2X4SA 3Q6GH 4FQ1L 2EC9T 2PD5A 2PF0A 3V7MA 2A3BA 3FYEB 3KRBA 2F15A 2X1QA 1LCOA 1WFOA 1MFUA 2H6PB 2QAFA 3JT2A 1YEDB 3LPFA 5CBAB 3N50A 3FK4A 2PTVA 2WIIB 3JZYA 2VDNB 1QUMA 1F5ZA 5BW6A 3KBVA 3UX9B 2HA1A 3OKDA 4HUXB 4ZT1A 4EDWH 2BNRA 2DIEA 5SWSD 3B8UA 2I7OA 5CN2A 3KZ8A 3RM9A 1JNLH 4H25A 3L3OC 4BFKA 3K7UA 4D9QE 2FO1A 1ZBWA 4JHAL 1J9RA 1NCDH 1E9QB 2R83A 1OFBA 4RFOH 3FX4A 4A2SA 4HT3A 1HDMA 1U91B 2D3VA 5IVXA 1PB0A 4RCXA 3BGMA 4JREB 2XWBA 1BYNA 1MHHB 3ERXA 4L37A 4WI3A 1M1XB 5IKCB 3VFCA 4A29A 5CHNA 2W62A 2Z2BA 3N0AA 4MDIA 3EJCA 4F7MB 2XQBL 2NX1A 3TYZA 3FO1B 5H2BA 4HZ7A 4LIQE 3L3HB 3VWJC 2VDPB 4KKLC 1FAKT 3NACL 1R5VB 4OB5H 5AG8A 4YGAB 3KS0J 3MUGB 1R24A 1QW9A 3OB0K 2X70B 1KGWA 5TTRA 3IJLA 4OHQA 3ZFHA 3PPSA 4Y2DD 4OCLC 1XX1A 4G9PA 3KPSB 5BS0B 4BI6A 2G41A 4REQB 4GCAA 3ZTDC 1JWUA 4J3OC 2FIKB 4A2MA 2HKHL 2XWCA 1BPVA 4Z1DA 5I30L 4YXGA 1F3EA 2H3DA 2WQWA 1QEWB 3NJXA 3L3IA 1B4JH 5AQ0A 4KCVA 3T04D 3R2GA 4AT6B 4XZNX 1N26A 3NFSL 2JJTA 1FI8C 3W84A 2FR4B 5LNSA 2OJEA 4LHQB 3MLSL 3CMGA 3SCNA 3VXSE 2CDEB 3SE3A 1VPQA 4WKAA 4H4IA 4AUUA 3TN5A 1OAZH 5CAHA 3BDXA 1XGZA 5CEXB 3RTQC 3EJQA 4MFHA 4DP5X 1VDGA 2ZP0T 1UZ8B 3LPGA 1YYCA 3MV9D 5F7BA 5J1SC 1EB3A 2IBZY 4GC4A 4S1FA 1GGUA 1PG7W 3PQYE 3I7RA 4Z17A 3DKHA 3THDA 3FB7A 3WN5B 4WWID 4KKCD 5E2TH 1XG4A 2OTUB 2JE8A 1S7TB 2Q1EA 3GBNH 3N55A 2F53D 4IHOA 5ICUA 1WZAA 2VXQA 4M3HA 4UM9B 2PLMA 4S3BA 4TR9A 2HTLD 2J6EA 4ODUB 3QPYA 3EB3A 1EFXA 1QHOA 1TOXA 4Q52A 1VERA 2E0PA 1FVCB 3AWFA 3FO2B 3LZFL 4GBXB 2P47B 4UQAA 4EI6B 5FYKL 1CG9B 5A2IH 1PEWA 1I3GH 3K81A 2JIEA 5IMOA 5D70H 3S36H 4YWSA 1WC7B 3RX4A 2H32A 1ZE3H 5TE4L 1P2CB 4WNJA 4KH2A 3MPCA 4BFFA 4NENB 3KVMA 4UBPC 1M2VA 5HUOA 3W6LA 5JHLA 1Z89A 4Q8OA 2I5QA 1LJYA 4NSKA 1K03A 4RIRA 2A1YA 2QUMA 3TEVA 3EWWA 3MCNA 4W9HC 2IGFH 3B40A 4Q22A 1AD0A 1OCRB 4OT7A 4AZBA 1TVHA 3KP0A 2BSED 4WTQA 5JOPE 1BQUA 3B7UX 5HJ3A 4LSSL 4P23D 1BF5A 5CMAA 3SE6A 2BSLA 3HG1E 5IFTA 3Q8CA 4HK5A 1JUFA 2IANE 2QADC 3ARGB 1ZRUA 1E6OL 5IQ7H 4NQSB 1J1PL 1WISA 4DZBB 3WQFA 3P60A 4Q6YA 4MA3A 3TBVB 1M7PA 4Q6XA 1WAUA 2NQLA 1OINA 1HHIB 1TMLA 4GISA 4APQC 4LRNL 4BWUA 1DWIM 2PP1A 1OD9A 3BKCL 4TULH 1QNIA 3HA0A 2B39A 3BPCB 4R4NC 3EDEA 4RIRB 5JHDB 4FNRA 1IAOB 5DMGD 2ZRXA 4R2GB 3HI1A 3W1UA 2ENYA 2N59A 2OX1A 1EEZB 1V54B 3EYVB 4LOEA 2GEEA 4OUUB 1MCQA 1B4RA 1RD5A 3E2SA 4U6VL 4Y5YB 2I27N 4OLVH 4MA8L 3HG0A 3MCLH 1VPYA 3FTVA 4GAYB 3TNOA 4AZCB 4BHYA 2F5AH 4KKLD 3IIVA 3B0VC 3OKEB 4C83A 3CX5J 3DDFA 3QEHB 5HHMB 1XR9B 5CEZE 1PTZA 2Z7GA 4J3BA 5AOMA 3NYKA 2PDFA 1KD0A 3WH9A 1CZ8L 3SDYL 4TS6A 4WJKB 2X7VA 3IJ7A 4L4VE 4EN3D 1FWDC 1FUNA 3GGWB 4PC8A 3KPPB 7TIMA 3FXYA 4BUGA 3S6TA 2XT1B 3WQEA 3HKFA 4KI1A 4U33A 4YHEA 4JDVB 2HTMA 4HFUL 5E6IB 3QWOB 4ZSUA 1ULVA 3MRFA 4XBMA 4KTGA 3BJTA 1NIBA 4LW7A 4C90A 1V0NA 4L1WA 2Y7QA 3UWEA 2O6FA 4KVCH 4JFTA 3I50H 2QT3A 2C1IA 2N7SA 4FYSA 4XZHA 1S8DA 4WJEA 5F9DC 5GSVB 4Z23A 5C2UB 3MBEB 5HTSA 5AW8B 1ZBVA 1NIUA 1FN4A 4JZJB 5I30H 2ZVIA 4YDJA 3SPVA 4DQWA 4RDYA 4AISA 2ENPA 2YRLA 4JDTL 2W0KA 1M41A 1UYQA 4FNTA 4PTXA 5F88A 1QG3A 2FZBA 5E1AB 3U0TB 3IGSA 1CK0H 1QRNA 4DW2L 1NVMA 1OX4A 4UT6L 1U3HC 2PC4A 4L8SA 4PRIB 3TWYA 1KM3A 3RVWC 5FB8A 1G9EA 4G5DA 2X70A 1LE9B 1MCPL 2XG9A 1CICD 1S46A 5FM5M 1DIKA 6TAAA 1ZAGA 3HMJG 3TN0C 2O6EA 4WFED 5JQ9A 4W5ZA 3KBNA 1D5BB 1NC4D 1FG9C 2O5XH 2O5ZL 1TPEA 1GSMA 2CA4A 3FF8A 3L4CA 3LS4L 2BNUB 2AGKA 5I16A 3CSYB 2ZWLT 1EDGA 6FABH 3ZE1F 1V08A 4LSVH 3R13A 1E2ZA 1R3HA 1LL7A 1OALA 3F6LA 1JVNA 4B9ZA 4YAQB 4M7SA 2DQHL 4P57B 3IGFA 5CD3B 4A2RA 1JCLA 1ROCA 3V79C 5EPMA 2W91A 5AYQA 3G5ZA 1FWCC 1CS6A 3ZE2F 4UTBA 2NX3A 4IQDA 1KYDA 3C5SA 1BEYL 3DNKA 3HNSH 4OM1H 2MKWA 4RBPH 2CJTA 1SFHA 3GZ3A 4LFHD 3QCVH 2OMXA 1GZPA 2W6RA 2WJZA 1BQKA 1J0JA 1EX1A 4Q9BA 5C0IB 1C29A 3EXRA 4GKLA 1OAXL 3WJYA 1OANA 3H1ZA 1DVXA 4U1NB 4DB7A 4DEUA 2PODA 3GKFA 3R0UA 5DD1H 1QSFE 4R0LC 2Y7SA 2O6CA 4X6BB 5CJNA 5EBAA 3W28A 1SEQH 3T6ZA 1TG7A 3HJEA 2O7SA 4MCMA 4TV6A 4RAUB 1AH4A 3NFUA 4NQ1A 4OZHA 2EXWD 4M7ZC 3IVKA 3EX2A 1E27B 4IXHA 5G1TA 5K9CA 2UUDH 1CICC 4U1LB 4U3SA 3UTOA 2I16A 1EZLA 2GG1A 4FJ6A 4LOVA 3VFSB 5AB0A 2VGFA 2RJHA 3UW6A 3FA3A 3ARFD 4PLOB 2UUDK 1R38A 1RK1B 2NDFA 3QUKB 1CE6B 1J0ZA 1RJZB 2X4OA 4OIBA 1EC9A 2CNCA 2BWDA 3PF3A 3QZMA 4AV4A 5IR1A 1ZIBA 4MADA 1XYCA 5SWUA 4LU5H 4I1RA 6PTDA 3PPCA 2IFGA 3ZRSA 3FYPA 1IBYA 2VLLA 5T5NF 4XVJH 5GHWL 4O51A 3PJXA 3TR9A 3D1MC 1YEIL 4JMXA 1YDOA 3TYUA 3EYOA 4YFLF 5D1ZB 2VLRE 2NT1A 3FFCB 3UCQA 1RUSA 1TJ2A 1AODA 3O9WD 4WCYL 2HCVA 4GP5B 2YMXH 3OGOE 1ML1A 1EWHA 2G3NA 1BHGA 2APVA 4G5AA 1KDIA 4IS6B 3UXDA 2HUEA 5KINA 3EJRA 3RDJA 3AXHA 3IJEB 4C47A 4KK6C 1JDEA 1WXYA 2YGVA 1D6VL 4PLNC 2YUVA 3S34L 3TCEA 5DTFA 4Y2DC 4LSTH 3SYCA 3ZMRA 1Y18A 4BCYA 3CIQA 4QRBA 3RCMA 4IGBB 5GS2H 1DBJH 2AEPH 5E9NA 4ZTPH 4DPAX 1VLXA 4M4RA 4QNPE 1A5SA 3T2LA 5IEHA 3B8DA 1JGVH 1VBJA 5EU5B 2D03L 4PUBL 3VFGL 4BRJA 4I4WB 2QAPA 5I0DA 5CFAA 3FONA 4KVCL 4B9FA 4NYYA 3MW7A 3V0TA 1ZPUA 4WEEA 2IPUG 4TVPL 2EXYD 5HHVH 4K2SA 2VUKA 2B7OA 4RV3A 1RIUL 5EBGA 1ML0A 4G8GD 4QPEA 2OZ3A 3OBEA 2WLKA 2PR9A 1SFSA 3Q45A 4AHOA 1JMZA 3FRUA 3QUGA 1D2OA 3FO0H 4KC3B 3DG6A 1F0LA 4QXUH 5T1LD 3QP3A 5D2LF 4PEKA 3D0VA 3ZT5A 4L6OA 3ME0A 3LX9A 4J23A 1KJ2A 1ZT1B 2BSTB 2QQQA 1A9VA 3ZTNH 1DQLH 4OCRH 1XIWB 1YYAA 1D7KA 4NAJA 3B4UA 3ITTA 1UD6A 1Z5HA 5I71C 3REVA 3X3FH 4QHLA 1D5ZB 2EDMA 4B97A 3CU2A 1KJ3H 4LLMA 5DA4A 3CL8A 2V6AA 5B80A 3GSWB 4KZCA 1HKFA 4M02A 3GHBH 3NEVA 2BHYA 5KOVC 4GRSA 3IN2A 4YH6A 5AB9A 2FLRT 3GZOA 3MOBL 2PS2A 4MQ7B 3EW3B 1CFSB 4QE4A 4N20A 4XVUD 3I6EA 1BWWA 3EUDA 5L88L 2V5BA 1WICA 4ZQPA 2VP8A 3RTQB 4XPHL 4GRWB 3O3AB 2XN9E 2O30A 2EDLA 3KHDA 3NGFA 4FALA 2O9OA 1F11B 3IKCB 4KJYA 3SGEH 4DVBB 1PY9A 4OLWH 5GQBA 4HH8A 3VD7A 3MTWA 3QV7A 5XIMA 4BJHA 5AC4A 1IILE 1CC3A 1MIEH 2Y5TA 2XV3A 1TJHL 3CSYA 4E5XG 3PWIA 2ZWNA 2QJDA 2IKHA 1OSPH 4YS4A 2VUNA 4TNGA 2OW7A 4KI5C 2CMRH 4E41D 2FQFA 2J8GA 1DN0B 4NYLA 1VFUA 2BDNL 2D9QB 2B59B 2IQAA 3MCMA 5FKYA 3B9KA 3SZ6A 1X5FA 4AZ7A 5FSDC 3M0MA 2CSPA 3O16A 1CYXA 3VD9A 4LUJA 4N2OA 2EE9A 1HJBC 5ETUA 2XZZA 2C15A 1XGEA 4O13A 3OMZA 3GR8A 4L4TA 4IXXA 1IU1A 2CHXA 4LPXA 2XG4A 4DTGH 1IQ8A 1MHEA 2WXRA 3TS8A 2BB0A 4ZFOL 3ORWA 4DO7A 1ZHNA 4LCQA 5C07E 2ZKWA 4JDZA 2X3BA 3RWHB 4V1DB 1XIDA 4R3SA 4MB1A 3FQXA 5C7XH 1BVLB 4QOKD 4LCWE 3JTSB 2NTFB 2YA2A 5GRJL 2DVXA 2ED9A 5I76B 4NZCA 1XD1A 2I7GA 3WUWB 2WSRA 1UA7A 4HS3B 5KVEL 4AEOA 1BG9A 3HGRA 5TJWK 2CLZB 4GI4A 1AKJB 1WHPA 4JE0A 4WI8A 3BHBB 1F18A 1RCYA 3RWFB 2EJ1A 4G70B 2P26A 2XG5B 3P61A 4LGPB 3R10A 1OC7A 4QAIA 5B3JF 3VX1A 3HNTH 5ABZA 2UWEE 3MODL 5T33L 4IUGA 3PAOA 1MIMH 4JKPH 3CMOH 4TVPD 2Y6SC 3V4PA 1UGNA 2X4QA 3MZ2A 4LBUA 3SN0A 3M07A 5I3IA 3BP5A 2CUMA 3OZ9L 2NX5D 2Q3AA 5AL0A 5HDQH 2H6RA 5IOBA 3EJZD 2PYEE 3HUJB 3RKDC 4IMLB 1NUGA 4XMZA 4ZAKB 3B7TA 4D9LH 3STLB 3WMBA 4QS5A 4PBWD 1WG3A 4LASH 1WGVA 5DVMA 3VXPA 3X1BA 5I19H 1J2BA 3QORC 3NK4A 4QGTA 3X12B 4I8YA 3FJTA 3LEXA 5K7JA 4RDWA 2F8IA 5DFWH 4ZXBA 3QJVB 1QNQA 2HNHA 4MVBC 1HVXA 3AZUA 5HJGA 1S5IL 3ZHDA 1A22B 2OSWA 2MQGA 4PGEA 4NFCA 2JCCE 4PS7A 3ABXA 1F7BA 4YBLB 1I2PA 3LI0A 4NUQA 2CEQA 2XACC 1X5IA 3PWPB 2Z4GA 4XC1L 4PTUB 1XYFA 5AZEL 1OC6A 4OCRL 3Q3GA 4X6CE 4R5XA 5EZIH 3H70A 3PPFA 4WY0A 4X4XA 2EDDA 2IJ0C 4FFYL 4YR6A 2ZPKL 3PNWA 4URKA 1P0EA 1US2A 1VCFA 1VBHA 1WDSA 2KI6A 2H0JA 3MMTA 5C1MB 1XIFA 2UWEB 1RBOB 3RJOA 1GYUA 4YWIA 2YGQA 3EYSL 3ECBA 1MQRA 3FSOA 3S46A 4EDXB 1A6TB 2QFPA 2X3AA 3OQ3B 3GZKA 3BIKB 4X7FC 5GRUH 2Q6WA 2V17H 4K5PA 2Y7QB 3DETC 5DYFA 4PGBB 4X50A 3ZMEA 3B8IA 4IQLA 4KS0A 3RXZA 1JZ5A 3I74A 3QARA 3UPCA 3VFLA 5KSAC 3AY2A 4B9IA 1LD9A 2OGJA 4MD4A 1MNUL 4A4AA 5I9QB 2HVKA 2PTYA 4LO9A 5C70A 1AOZA 3TK7A 1QOQA 5C09A 5EA0L 1J6PA 2ZKMX 5KN5A 2XQYA 1QR7A 3AXMA 1TRDA 3N2TA 1XLCA 1K9TA 1PLBA 2ZZUT 1HCYA 1ITXA 4ZTYA 4I1PA 2IXQB 4KK5D 1AO7E 3KCPA 4PV9A 3W7HA 5B1BB 5B22A 3MKCA 4JPIA 3S5YA 1JPGA 2FWUA 1CICA 3GC4A 3CZEA 4XN5A 2BVDA 4OFIA 1FO0H 5F1KC 1B4KA 3GTXA 3OZPA 3P4OA 1B5TA 2DEWX 2AJZB 2WXOA 3LDBC 1WDAA 2WWMC 4F33B 4P9HL 3T08A 1X5YA 4JY9A 4WKXA 1CD1A 5CLXA 1EHAA 4H8UA 5DEJA 4B9PA 4ZFZA 4Q74A 1NOLA 2J57A 3PWJB 1XSOA 3CLEL 2PR4L 5AZ0A 4DTGL 5IBTL 2JLLA 4WWPA 1YVLA 5ALCL 1DQTA 3ZE0B 1NWUA 1ITCA 1NLBH 3GG8A 3PQYD 3AYVA 3GNRA 2W59A 4UB0H 3RGTA 4A66A 2JFEX 1PZUB 1UZHA 2Z93A 5HULA 1OB1B 1R19A 4WV1C 5D8JH 1NC2A 3BZFB 5LA2A 1QSVA 3EFFA 3QOKA 3EDDA 3CSBA 2GGHA 4C7DA 4PJBB 4PR5A 4L0ZA 3T07A 4AL8L 5HI4D 5E0QA 1QPXA 4QHLB 2DN7A 3GB7A 2EC8A 3IFNH 4O9HH 4PJ9B 1FYHB 4LSQH 4FQXD 3VACA 1TVLA 3GVGA 4RV8A 5EMMA 4PTDA 1WCBB 1ECZA 3PZVA 2VCCA 2Z6IA 2CDFA 2MKLC 4U5IA 1I8LC 1TENA 3WJMB 2ATAA 4FG2A 3NP4A 1A5CA 3NA4A 3FRPA 1JVOA 3AUVA 4XB3A 2EXTA 1ZGLP 1CDBA 3TYCA 5KTEL 2N1TE 3CE1A 1XICA 4IU3A 5U4NA 2C9PA 4S1RH 3OYXA 4FKHA 5EV7A 3VNIA 5E6IA 1SMOA 3L3DB 1FWXA 5C0BD 4IGBA 2VXSL 4EOWH 1M6JA 4LV9A 1RFDH 1EERB 3LNHA 3F7RA 3GBMH 4P49A 4I0PC 4UYPA 4JO1L 3NCEB 3V4BA 1PG7H 2ENSA 4WW2F 3RWJB 4MAYD 3UR5A 4MNKA 2KLSA 1MCPH 1IGFL 3F1QA 2POZA 3CH9A 1THFD 1NFDE 4KNTA 5A6TC 4KRPD 2BNQE 1LK3H 3GXUB 4Y2LA 2COQA 1HGWA 5DSCA 5DK0A 1ME7A 2G75B 3U9PH 3IAGC 1YBQB 2ZF8A 2PW2B 4I5BB 2V30A 4DVOA 4D1JA 1Z66A 2UY5A 3L3IB 3RHGA 4UDTA 3BLOA 4P5TB 2X0VA 1AJ2A 4QRNA 2ADGB 4LSRL 4P3DA 3TLQA 1HH9B 4C1NB 4BKNA 2GUBA 4K3GA 2N56A 3A4DA 4WTZA 4B5VA 4S1QL 5IEHB 1H5BC 3I10A 2G9HA 4W9KC 4L4OA 5IJKA 2F9BT 3DJ9A 1YEYA 2I9EA 4IIEA 4AVHA 1FP8A 3LBMA 1RK1A 1ZJHA 3HPFA 3O6CA 3HC0B 3PAVA 2RFGA 3IPFA 1KYAA 5I1KH 3U7BA 4AF0A 5LNRA 1KEGH 2AKRB 2V5MA 3K72B 4C57C 1ZTXE 3F7JA 3C60B 4P2QA 1VCVA 3B2UD 1DEDA 3PNZA 1QR4A 2FH8A 2QELA 3TZVD 3S1XA 4F8QA 1DO6A 3ASNB 3F05A 4I3SL 4LT9A 7ODCA 1FRGL 3EYOB 3D06A 4O4YL 2QLYA 3VRLE 1R9FA 4NZDA 1DOSA 4IG2B 2R2BA 5BRZE 4GO9A 3DURB 3BP5B 1MJ8H 2Z28A 1BYDA 2V2XB 4P5SA 4AMKH 2GK2A 1GCYA 5L6YL 1NDMB 3OKMA 3EO9L 1PKLA 2FZMA 1L9SA 3D9AL 3EBHA 1ECYA 2CLMA 2L7JA 3ZR4A 4KK8C 4KRZA 2JLPA 2DDQH 3RK8A 3PREA 3NJGA 2D31B 4YAQA 3GLZA 1AY1L 3K5SA 2B2XH 1I9RH 4OU1A 4GUOA 2VQ1B 3QXAA 1I9IL 1S3RA 2WLLA 4XMLH 1KFLA 3FOKA 4OI9A 2J13A 5GGSY 3DX8B 3T5WA 3PWAA 1ZV9A 4HPOL 3EWCA 5AYUL 3NCYS 4WFHD 2WQ8A 5AC7A 4F5CE 1K4HA 3ML8A 5FYLD 4ETQB 3MLYL 3TYDA 1CXEA 3TIDA 3SQMA 2OTDA 3M0YA 3W02A 2J75A 3U2JA 3OYZA 5ADPL 4P3WA 3S6CA 5CZTA 1A6ZB 3BH9A 4M8QA 3QNYA 5E5RB 2VDQL 4NJAH 3TA3D 4QMEA 1JGDB 1LO2L 1UWQA 4NRYB 1C08B 4IEFB 1O7DE 3GRGA 3OPZL 2ALAA 4RGNB 2UWEF 43C9A 5AW9B 5HYSB 4Q8QA 4D6DA 3G6DH 5FAAA 3SYAA 1CYWA 5M3WA 3V36A 3BKJL 2HRGA 4AJVA 1AH0A 4E41E 2C7UB 2WSKA 2AFNA 1UIPA 4Y2NA 3S8WA 1OFRA 4Y5XC 3RGHA 5FO9B 1TYRA 5L2JB 1MZRA 3LHUA 1DDTA 3NPUA 1XDLA 2J56A 1G7LA 2NQ9A 5J13C 4PJEB 3NVTA 4JN6A 3GRIA 3VE7A 2QJHA 3T6XA 5BOPA 3RI5F 3TYAA 4ZNEE 2EDQA 5BUPA 1TU2A 2J71A 4LLYB 4MA1C 4U0QB 4ZQRA 3MLUH 1H7WA 3WNNA 4YXLL 2EE6A 4EKXA 3UZZA 2RACA 2VL5A 4WEMB 2WWKO 2GL5A 4NM8H 3UAAA 1G6RA 2FWLB 3WBWA 2VAAA 4L23A 3SGKC 2FVMA 2Y7FA 2D3JA 3RMEA 2EDHA 4HC1H 3OB0H 1FGNL 1HILA 1MFCH 3ULAB 3UTTD 3WUGA 1JHTB 3ANUA 4XP1H 3I4EA 5AVSB 4XCYA 5HMSA 4MLIA 3IGXA 4XVJL 4S3EA 5I06A 1XSIA 3FQUA 4TUJB 2VDQB 1XRTA 2LU5A 4IJBA 1IGML 1WK0A 3CVCA 2A6KA 3TO2A 3FU5A 1X6UA 4Y8EA 3WCYA 1JQVA 5JW5B 4YXKL 1UWUA 2WSPA 3V0EA 4BSVA 3H4WA 4EVNA 2DI7A 2WCGA 4HTBA 1TUFA 5DRNA 5HR6A 1USQA 3RR4A 2WO5A 5GGQH 1RLCL 4PWEA 3SD5A 3UBXG 2BVOA 3L9BA 3TF7C 1PGRB 4JCWA 2X9ZA 5FGCB 3NQFA 1AL8A 2QVFB 4IBLT 3AAZA 3FFSA 3NPZB 1RZQA 3P62A 1U0QA 5DMIL 3SKJL 3W11D 5C97A 1U22A 1GHFL 1NWPA 3MA8A 2IO5A 4JN2A 2GC7C 1W8GA 1HL2A 3EO1B 3A6BL 4MCYA 2ZZ7A 3IVTA 2IFFL 1F6AB 4OB5L 2DZVA 4R4ND 2PTXA 3WH5A 1AVAA 3OD3A 4ZO8A 4JR9L 2APWA 2AGJL 4MMXB 2HH0L 1Z44A 2Y1ZA 3XINA 4L3EB 1FCBA 2DT2A 3UYCA 3HI6H 1SJAA 1IT9H 3O9WC 3LEYL 4JK0D 1FKXA 1X8FA 2DQJH 3OPSA 2R39A 1CFBA 4GQZA 3TBWB 1EO8H 3AS3A 5EWIL 3DMMA 5C08A 3Q7JA 3P69A 4PJ6A 5HDBF 1OCWL 3LZRA 1IGWA 3GMPB 1LF1A 1AR1D 1TB3A 4H8HA 3IK4A 3FO9B 3KHJA 3MLWH 4QEHA 3ICJA 2VW4A 3KVQA 3PP4H 5D7EA 5E2WL 1U8LB 3ARFA 5DRWA 5LAPA 3TVMC 1T7WA 4NQXA 1LEKA 3QG6B 1EWDA 2B5IC 1OTUC 5I6NA 4JM2D 4ICNA 1K5NB 3T05A 3UP8A 2ICWA 3LK6A 2F08A 3VCNA 5ACLA 3O0KA 4Z7UF 3LG3A 2A38A 4MAYA 5GRJH 3JWDC 3MRGB 2V2HA 3PPGA 4HOMA 1ZSXA 2F8VA 5I17B 5ISZB 1JPEA 3ILQD 3SJVB 4DGWC 1VHPA 4GRMB 5EMKA 1EGJH 1E9OA 3O3BA 3TTOA 1K6QH 3HB3B 3FSZA 4IOIB 4R7JA 2CLRB 4PL1A 2VFEA 1CE6A 4U31A 1ADQH 1IAIL 1FXQA 3MROB 1FX6A 1W2VA 1XF4B 2VDOH 3GS0A 3U6XA 1OE2A 4KO5A 5C9WA 3NABH 5T3XD 1KTBA 5C6TL 5JW4Q 1RZJC 4XH2B 2ABAA 5HDQL 5JNYA 3DGBA 3TMLA 2XWTA 4JFUA 4UTAH 5FCUL 4PIRF 5BW7A 3AZTA 3SGGA 4JANA 3QHZL 1UOVA 4K23L 4OD1H 1T7LA 4F0SA 4MD5A 1BQRA 3CV1A 3O3EB 1T8XA 4DKFL 1CX9A 4ETQA 4LHUG 2X7LB 4ODHH 2WWOA 1RBAA 3IRCA 3FRPG 2OB3A 2C79A