5EMYA

Human pancreatic alpha-amylase in complex with the mechanism based inactivator glucosyl epi-cyclophellitol
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Glucosyl epi-cyclophellitol allows mechanism-based inactivation and structural analysis of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5emyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5emyA01
2NT0A 1VEOA 2W66A 1CDGA 3AIWA 2V3EA 4K68A 4CN4A 1BSIA 2EPNA 2J8GA 3AHZA 5A1AA 1NP0A 2VT0A 3OIHA 4CCCA 3QOKA 1UKQA 4KGJA 4AISA 1GUVA 5E9AA 3WBEA 1U30A 4P8XA 2X0HA 4ATDA 4XZWA 3W81A 1J01A 3HG5A 4OGZA 4M24A 2J7EA 2YA0A 2YFNA 4AEFA 2VX5A 3IGUA 2PWDA 1J10A 1JAKA 5BRQA 4CKQA 3MANA 1GQKA 1CLVA 2O9PA 2WMGA 1K9DA 1K9EA 2ZUUA 3D3AA 4DWSA 1W9DM 1OBAA 5ABFB 1MFUA 4GO9A 2XN2A 1CWYA 1HKIA 2YL8A 1PJ9A 3VIJA 4NX0A 4URIA 4JCLA 1XGZA 1BVZA 3VX1A 4AYGA 1GOQA 5GNZA 3SUTA 1E71M 4UFJA 4WIWA 1LWHA 4M29A 3GXTA 2YKKA 3ARTA 4H04A 1V3KA 1V3MA 4QCFA 1LL7A 4P7NA 1Q6CA 3J7HA 4ACYA 2WVTA 5AY7A 1M53A 4IUGA 3AXIA 1DWFM 2WHLA 1FHLA 2WMJA 4CUCA 1UUQA 4M81A 3ZMRA 3ZT6A 1E4IA 1EO7A 1HJQA 1TUXA 3RO8A 4FMVA 5CPTA 4OZOA 3TONA 3DDFA 2VQTA 4CVUA 1O6IA 1ISVA 4DUVA 1BYDA 2W61A 4PMYA 2WLZA 1R86A 1GW1A 1HXKA 4FNRA 5BXSA 1GNXA 2WANA 2WSKA 3VGFA 2A3BA 4AD5A 2YDSA 4UNIA 3IANA 3W29A 3POHA 1E43A 3DX1A 2VO5A 1J18A 3WDIA 5GNYA 4J7RA 1PZ2A 2AOSA 3MMDA 1E9LA 4GO8A 3OGVA 2DSKA 3PTQA 3OLIA 1IT0A 1H0IA 4DWSC 1JYXA 2OSWA 3AS1A 5M03A 3UG4A 2F7PA 3BVVA 2DSWA 1RP8A 3WN6A 3AHXA 1M7XA 5A6BD 2EPOA 4AZ7A 1HJUA 1LLOA 5I77A 3RCNA 1B1YA 4AZ5A 3UERA 8A3HA 5HNNA 3CUGA 1DP0A 3BXWA 1JYWA 1X6LA 2QHAA 3EJPA 3GNRA 4JFUA 1QHPA 1HKKA 1C8XA 3A4AA 1J11A 3ZQ9A 2Y8KA 4AZBA 1ODZA 2BY3A 3WL0A 1JDDA 4DUWA 1AMYA 4OKDA 4PCSA 2V5DA 3AYSA 4FLQA 4FNUA 4J3SA 3W6LA 2D1ZA 1PIGA 2CXGA 1V3JA 3AMKA 4OOZA 1OGBA 5FD0A 1UR4A 3RDKA 3A21A 5E09A 1OWQA 2XN1A 2QPUA 1MQPA 4MAVA 4J27A 4JL1A 3OB8A 2UWFA 1VFUA 3GBDA 9CGTA 4UOZA 1JL8A 4DO6A 2E0PA 4XB3A 1HX0A 3E1F1 4UQAA 1DWHM 2WZEA 3WD2A 3GXFA 3WNPA 3L4ZA 3WDQA 1LG1A 3L4VA 1NOWA 2WYSA 4JKKA 4UFLA 4AD4A 3VD4A 3AIVA 4BS0A 3UEQA 1HP4A 1EHAA 1XH0A 1HF6A 3T0AA 5IXEA 3VIFA 3CGTA 4TTUA 4EE9A 1HJSA 2PWFA 3SCQA 4Q22A 3AS0A 1E6ZA 4D72A 1CYGA 3VVGA 3EDKA 1E6PA 4FLSA 2UY5A 2DEPA 2XVNA 3SCOA 3SUWA 5F7UA 4HTYA 1GVYA 4OBRA 1CGWA 4X9YA 3N1AA 1UD8A 2VURA 3AMCA 3VIGA 2VJXA 3DDGA 3H53A 4XZBA 5HXMA 3WQ4A 1UZ1A 2WAGA 4WKFA 1XYZA 3WFLA 2Z1KA 4F9DA 1DEDA 5I79A 1XHGA 2VX4A 1W3HA 1QW8A 3AHVA 2BVYA 4HU8A 4PBGA 2D2OA 4BQ5A 1C7TA 2ZUVA 4H7VA 4KMQA 1O7DC 1V3HA 1WZAA 3D50A 1J0KA 5E0FA 3TV8A 1TG7A 2EAEA 3PTKA 4QDMA 3VUPA 2F2HA 5IHRA 1EOMA 4ACZB 3BVXA 1ODUA 3VNZA 2CETA 3MMWA 2WM0A 3WKZA 2AAAA 3L4YA 4RE2A 3MU7A 5IFPA 3GH5A 3VGGA 1L0PA 3DHUA 1EIBA 5BXRA 4JHZA 1D7FA 2VNCA 4BZYA 1SR0A 4MTVA 3N13A 1IZKA 4MAZA 3WQ8A 4TOQA 4M82A 3WBAA 1QPKA 1WE5A 2F7OA 3MO4A 1BFNA 2WMIA 1TMQA 1W1VA 3WY1A 4TXEA 3AIBA 1ZBKA 2C8NA 3BCFA 1R7AA 2PI6A 3WDHA 3PZIA 3BUIA 2XG9A 3KL3A 4IPLA 1CBGA 2CESA 3W6MA 3AIRA 2DH3A 3PN8A 1UD3A 2XIBA 3IJ8A 1B2YA 1O7AA 4HA3A 1KBBA 5AC4A 3HN3A 2GUYA 2FGLA 1QI5A 4D6DA 4AMXA 3VIKA 3VD9A 3AZTA 1WP6A 1NQ6A 4LYRA 1SZNA 3WFZA 1UASA 3F5KA 1TE1A 2X05A 3TTSA 4AMWA 2ZXBA 3M07A 5DFAA 1V6WA 2EACA 2XN0A 3MI6A 4Z2HA 2WMFA 1CNVA 4QP0A 1UA3A 2YBTA 3VPLA 1C8QA 5CJ5A 1QBBA 2TAAA 1HNYA 2YDRA 1JFHA 3N9KA 1PAMA 3IK2A 1OD0A 3EJRA 1WAWA 4W7UA 3WNLA 2OYKA 3WUBA 3MSGA 4WK9A 5EMYA 1KCLA 5JIWA 2W4XA 1RD6A 3SCSA 4MB3A 3SUUA 1XCXA 2XIIA 3OLEA 1KCKA 1OCQA 3AIQA 4M1RA 4GKLA 1I1WA 4HPGA 4M56A 3WD0A 3TOPA 4KH2A 2YJQA 4D6HA 1HWWA 1XH1A 4QAWA 1UH2A 3RIKA 4WKAA 2PWGA 5DT7A 2DSZA 1HJVA 1HXJA 2CBUA 2ZUSA 3U5YA 2O9RA 3GXNA 3WF2A 2OW7A 4GQRA 3CBWA 2X2YA 4OUEA 1W9XA 3FN9A 5CLTA 1WDSA 4AD2A 4ZXLA 1LJYA 1F4AA 4QCEA 4W5UA 1P6WA 4PTVA 2QPSA 4EANA 3NSNA 3VDCA 1W3KA 5E0CA 5FL1A 3AISA 4GXPA 3VDAA 2EPMX 4N42A 2ZX8A 2PBOA 3WMBA 2VZVA 3VX0A 2Q8XA 2XWDA 2PBGA 1OT2A 3CUIA 4KWUA 1E40A 1LL4A 3F5JA 1W91A 2C0HA 1KWGA 2J7HA 1GQIA 1KR1A 2WZHA 2WMHA 1NARA 2WC4A 1V03A 3CUFA 2QMJA 3WEMA 2VX6A 4MNJA 3GTNA 3ZJ8A 1A3HA 1X1NA 3TTYA 3ZT7A 1CGVA 5GNXA 1E3XA 2DPEA 5A8MA 5BWFA 1HL8A 1W9UA 4GI6A 2XUCA 1UD4A 3CZNA 5I6SA 2YOCA 3MSDA 4J3TA 1US3A 8CGTA 2XFFA 3ZIZA 2JIWA 3SUVA 4ZE5A 3D4YA 1AQ0A 2BVTA 3I3BA 2Y24A 3PZQA 2CBJA 4P7OA 3BVTA 3VMOA 1JI1A 3VIPA 4HOXA 4BQ3A 4JCMA 1TQTA 3ARZA 2NSXA 1QWUA 4J3WA 3F5LA 1C92A 2E9LA 1VBUA 3DHPA 3VM5A 4B3KA 2GJRA 3W38A 2EO7A 2E9BA 1D2KA 1GHSA 1FHDA 1C93A 2XYLA 1KTBA 3MMUA 4CCDA 1ISWA 6TAAA 1R33A 2CKRA 3LPGA 2ZE0A 1QX1A 2DT1A 3T08A 1TQUA 1W3JA 2PB1A 1TA3B 3B9EA 1FH9A 4IM4A 4MNMA 4TTGA 4MB4A 2ZUWA 4W84A 3VGDA 3POCA 3ARQA 1LL6A 1GJUA 5D8WA 4CD5A 1ZB5A 5E6ZA 2DQXA 3RJXA 2FH6A 4MNKA 1V0NA 4D6JA 1PX8A 2CIPA 4J28A 4CD6A 1TVPA 4E8DA 1KQZA 4PSRA 1PX3A 3HU7A 2VRJA 4MB5A 3T0BA 4ZEPA 4TVDA 2WHKA 2BHUA 1UWQA 3LPOA 3MV11 1UG6A 1GQLA 1C3FA 4NXKA 5D9MA 1FFRA 4PYSA 5E6YA 1R85A 1QI0A 1DWJM 3THDA 3WH9A 3GXDA 1JFXA 4AZIA 3CMJA 3THCA 4JHOA 4F79A 1ISXA 1EDTA 1QNPA 5LA1A 1QWNA 3WF4A 3GNPA 4P7RA 1R8LA 3L2LA 3PTMA 3HJEA 1JZ2A 1F4HA 2YL5A 1U33A 3K1DA 2WBKA 3GH7A 3AIUA 1EDGA 4JFVA 1E56A 2EXOA 2BV9A 3OG2A 3L4WA 1XSIA 3ARXA 3VILA 4NRSA 3VIHA 1KFWA 3VM7A 5I23A 4LGXA 1W9PA 1NM9A 1MFVA 3OLDA 3SEPA 3A3HA 3VGHA 1BGGA 2FYVA 3ZT5A 4FNSA 2GDVA 4D6GA 2G3IA 3OBAA 3WDJA 4YHGA 4QLKA 2E4TA 1B3VA 1E4LA 1XSJA 4MJ2A 2XFRA 2BHYA 3VMNA 1MW1A 5I24A 2OWWA 1CEOA 3IAPA 2UY2A 4TVUA 2ZXDA 1JNEA 3A22A 4OOUA 3FW6A 3ARVA 4YHEA 4KRUA 1GJWA 4AC1X 5BXTA 2Y5EA 3QHOA 3RILA 2W67A 1R47A 1UKSA 2X2IA 1GZJA 2UY3A 1UWSA 3W0KA 2WCGA 4AD0A 4P8UA 1CGXA 3JUGA 3DYMA 3PZOA 3NSMA 3ALGA 2E8ZA 3LPFA 2XM1A 1AVAA 1W1YA 3RJYA 2BHZA 3NUKA 3BLBA 5CGTA 1V3IA 1JZ3A 3N11A 3SCPA 3CV5A 3DX2A 2E40A 4PCTA 3K8KA 2J79A 1UH3A 1GHRA 4HZ8A 4BQ4A 3VIOA 4HA1A 4W93A 2VZSA 4PMVA 1XRVA 4CN1A 3QR3A 1B90A 4B9YA 2W5FA 5ABHA 1JDAA 2DH2A 3EYPA 2G8ZA 1E4MM 5A8PA 1MVYA 7TAAA 4DO5A 3WH5A 3K8MA 2J7DA 2JIEA 3DYPA 1BVNP 2RGLA 5EFFA 3G6MA 2ZX6A 5A8NA 1TQSA 4V27A 7CGTA 4OBSA 1KB3A 3BSGA 3AROA 5A6AA 3GDBA 4ZENA 4UZSA 3WQ6A 4OJYA 4OIFA 3VU2A 1WPCA 3CC1A 1E6QM 1KQYA 1NH6A 4CN6A 4PSPA 2GJXB 3RPMA 1E5NA 3O2LA 1GORA 4EKJA 3S5ZA 2IXUA 3MUY1 1KXTA 3BAXA 4RE3A 1GCYA 4WSJA 2EBNA 2J7GA 3LRMA 4ATWA 2ZOXA 5A6MA 4MPKA 2GK1A 2VZUA 1UR1A 1JD9A 1EA9C 1QNQA 2VL4A 3VO0A 2WK2A 3NDYA 3IJ7A 4PMQA 2F8QA 5CSUA 4AZCA 1X6NA 1CGYA 3WD4A 3KLLA 3ZO9A 1AQMA 1B3WA 1LWJA 4NI3A 1UKOA 1PS3A 5KEZA 1V0KA 1IZJA 5BROA 4D1IA 3ARSA 4CGTA 4JKLA 2WZIA 3AOFA 5M5DA 3D52A 1UYQA 4J3XA 2CHNA 4PRWA 3CZGA 2W62A 3T0DA 4DWSD 1KBKA 3RMEA 1TR1A 3EJUA 3CMGA 3WF0A 3HG2A 1SMDA 3ARRA 3BAIA 4CU8A 3WUGA 1MWOA 2CCRA 4BQ2A 1WDPA 2Y4SA 4P8VA 3U7BA 3OGSA 5A8OA 1GVIA 4AIUA 4MDPA 2WBGA 3CHDA 1E15A 1C8YA 1IV8A 1V6YA 2BY1A 4QLJA 4NSBA 2JALA 3BVWA 1XSKA 2V3DA 1ECEA 2OWXA 3W53A 4ZXOA 2F7RA 3B9DA 1PPIA 2BXYA 3AYRA 2XM2A 3D5HA 1CXFA 2D0FA 4D6EA 1HIZA 2EPKX 1B9ZA 5A3HA 2GFTA 5M3WA 3ZR6A 5EBAA 3ARYA 4DWSB 2G41A 1G01A 2V3GA 2BFGA 2WMKA 3GXPA 5A6JA 1JDCA 5CPQA 4KRTA 2VRKA 1UKTA 4HZ7A 3H54A 1UD6A 2OYLA 3U7VA 1OINA 3GYCA 4PTXA 1JXKA 3CHCA 5HBFA 1VIWA 1V6VA 5CPSA 1AQHA 1EXPA 3GNOA 4ZFMA 3OZPA 1MXGA 3S6TA 4PMNA 2WWCA 4MJ4A 1LF1A 3N04A 1BF2A 1PIFA 4W88A 1PEZA 1WKYA 4J3UA 1CXHA 1EOKA 3SCWA 2G3NA 2VOTA 4D6FA 4LQ1A 4H8UA 4TX6A 2F1AA 4U2YA 1H09A 3BLPX 1D3CA 1KTCA 3CO4A 2XVGA 4L4PA 2VTFA 3WMSA 4UFKA 5TD4A 5E1QA 1VF8A 4GZEA 3WDRA 4AD1A 6CGTA 1KGXA 1V3LA 1T0OA 4HU0A 4Y7EA 4V28A 2X09A 4QLLA 4XX6A 4UQ9A 2DT3A 2J7CA 1NWRA 3WD1A 1Q4NX 1NOUA 2C7FA 3KLKA 1VEPA 2XVLA 3AMDA 1HT6A 1JZ5A 1W2PA 3VNYA 3AJ7A 3KEHA 4P7QA 3UETA 3W25A 3BGAA 3LXAA 1CXEA 3VOCA 2JE8A 3VD7A 1V6UA 1ZJBA 1ITCA 5BCAA 1GOOA 1E73M 7A3HA 2X8RA 3VSUA 1UR8A 1JYNA 4UCFA 1GOKA 5ABFA 3WD3A 1R87A 5A95A 5DF0A 1H41A 2WVSA 1FH7A 1HP5A 5CLWA 3BC9A 3GM8A 1XC6A 4PEEA 1S46A 1PZ3A 4CCEA 5KZ6A 1LQ0A 2D20A 2J78A 3KZSA 5CXPA 1E70M 2X0YA 3CZ8A 1FH8A 1MW0A 2VUYA 1DWGM 3QHMA 5DEZA 1DTUA 4U33A 3SCVA 1BYBA 4GQQA 3WEOA 2GJPA 1C7SA 3BUDA 3SUSA 3BMWA 3WH6A 3CZEA 2AMGA 2YFOA 4M8UA 3L4UA 5D9OA 4EAMA 3NIYA 1EHNA 3SCTA 1B3YA 2ALWA 3L2MA 1UZ4A 3BH4A 2CHOA 1W32A 4AWEA 2XGIA 3AIEA 4WLCA 2J7BA 3EDEA 4KGLA 3BAJA 4HMCA 1E3ZA 4Q7NA 1NWSA 4AXNA 1H1NA 2FGZA 3VIIA 3HG3A 4JL2A 4D71A 4H8VA 3DECA 3FNDA 4PMOA 3GXIA 1ZL1A 1W1PA 3AMGA 4WKHA 4D1JA 2ZUMA 3EJQA 4AYSA 4U5IA 5EB8A 3VSTA 1HJWA 1K9FA 3VD5A 2DDXA 3K8LA 2WVUA 2WC3A 5CSYA 3QGVA 4DM2A 5A6SA 4HOZA 1JXJA 1VEMA 1VRXA 2YL6A 2FDMA 3VIMA 1H4PA 1YQ2A 3MUIA 1UQZA 1A47A 2UY4A 4NZJA 5AC5A 3AXHA 1J0IA 1HKMA 1BYAA 5C71A 2F1BA 3EDFA 2YBUA 5JIPA 1U2YA 1UR2A 3WNMA 3WF3A 3M6DA 3AI0A 2E8YA 2VC9A 4JFTA 2ZICA 3DYOA 3PZMA 1R7OA 2CPUA 2QMKA 2CYGA 3OZOA 1N82A 1BAGA 3TTOA 4Z2IA 1JF5A 2BY2A 4HOWA 4AY1A 2D3NA 5CZKA 2ESCA 4UFIA 2NW0A 3BUBA 5A2BA 3BCDA 2WMIB 3EJSA 1WO2A 1UQYA 2EPLX 5I2UA 1MXDA 1G9HA 4F8XA 4U5KA 3VMPA 3LRLA 3SCNA 4TUFA 3TA9A 4D6IA 3EBVA 3WNOA 5A2CA 1B3ZA 4V2XA 1I1XA 1UOKA 2XTKA 4NF7A 5AYBA 5A6BA 2CKSA 5FKYA 2ZUNA 3T09A 2ZUTA 2D73A 1OGGA 3AHYA 2PWEA 3D4ZA 3CZLA 3PZTA 3BLKA 4E8CA 1GQJA 3NDZA 1SMAA 1Y7VA 1EH9A 4WSKA 3PBGA 3SURA 2W91A 2VCBA 3EJTA 2W92A 2EABA 3AMLA 3B8SA 1E6RA 1OIMA 2CEQA 2E3ZA 3HZ3A 4UQDA 1Q6DA 4PTWA 1EQCA 2WWDA 3RM9A 4JAWA 1VFOA 4H8HA 5D9PA 1VAHA 5ECUA 2J62A 1J0JA 4IISA 4YN5A 4PUEA 1ESWA 1EGZA 2VX7A 2D22A 4XV0A 2V5CA 4MB1A 4D6CA 3GXMA 1HJXA 1QHOA 1E55A 4HZ6A 2Y2WA 3ARUA 2EJ1A 3QOMA 4P8WA 3RM4A 4PN2A 3AHTA 2D24A 4GPNA 3A4WA 4UOJA 3T2PA 4ACZA 3ZOAA 3PZGA 2D0GA 1Z32X 1TQVA 4PMDA 2VZOA 2CBIA 4W8BA 2WKLA 3ZJ7A 3M46A 4AD3A 4UFHA 3BVUA 4IPNB 3CPUA 1H5VA 3SIMA 2QV4A 3WY2A 3FAWA 1CECA 4FLRA 4HPHA 4TVCA 1BHGA 2WVVB 1E0VA 1XH2A 2VI0A 3APGA 2EQDA 3UCQA 3ARPA 4W89A 4CD4A 4GI9A 1UHVA 5AYIA 4JKMA 4F9JA 2OLHA 3BSHA 3O6AA 1B3XA 1ZBVA 1L8NA 1CXKA 1R34A 3WSUA 1OSEA 4BCEA 3AS3A 3DC0A 1OIFA 1MQRA 4W8AA 1HN1A 2VR5A 1FP8A 1W9VA 2DSVA 5A6KA 3CZSA 4Z2JA 3OA5A 1E5JA 1VB9A 1WZKA 3HG4A 1CGUA 3L4XA 1QOXA 3WNKA 2G4FA 3W24A 1W2VA 1HVXA 2J25A 1H49A 1OM0A 3FY1A 4J3VA 1WB0A 2G3MA 4UZUA 4AZ6A 5A94A 1UWRA 2HISA 2WB5A 1V02A 1QW9A 2A3AA 3PHAA 3EMQA 2OSYA 1TZ7A 2IGTA 3MUZ1 5GPRA 4S3KA 4A4AA 1WZMA 2J47A 2XPKA 3FHAA 1KXVA 3MUAA 3D51A 1QI4A 3GZAA 1E0WA 3A6OA 3S5YA 1CTNA 3II1A 2ZWZA 2IUZA 4UQBA 1VENA 1MYRA 1JAEA 2J74A 4JIEA 1J0ZA 3A5VA 3WY3A 4LPCA 2FHFA 5E70A 5BRPA 3MS8A 1W3LA 4JFWA 4B15A 3GH4A 4W87A 2WC7A 1C90A 1GPFA 4UFMA 2JEQA 5D8ZA 1W1TA 2YA1A 3ALFA 5ABGA 1I75A 3CH9A 2BS9A 6A3HA 5IHSA 3DX3A 3WELA 2WNWA 1K6AA 4HP5A 2Z1SA 5CG0A 4AIEA 1DWIM 3W4RA 1OD8A 4HA4A 3RM8A 2WCSA 1JZ4A 1NOFA 1RPKA 5I78A 3F4VA 2XSBA 3BAKA 1ISZA 1E0XA 4RE4A 3OLGA 1J0HA 2FHCA 1FA2A 3N17A 4LXFA 4U31A 2XWEA 1QNOA 4XUYA 4F66A 1UD5A 2F18A 5JBEA 4CU6A 3OGRA 3AZSA 3DX4A 3FHQA 2DT0A 4H2CA 2CBVA 3H55A 3EDDA 2XGBA 5JBDA 5LA2A 2WCAA 1NP2A 2ZXQA 3AICA 4MNLA 5LYRA 3M7SA 3W27A 3L4TA 5I3DA 4PTMA 1UWIA 2FHBA 1E6NA 3AQUA 1H0GA 3G6LA 1ZJAA 1BQCA 3CHFA 1OT1A 4GI8A 4TX8A 4FF5A 3AS2A 2J7FA 2BY0A 2YDQA 1VBRA 4NZCA 1QVBA 1KXHA 4W85A 2PWHA 4NXSA 4DO4A 2WPGA 3TP4A 1JI2A 2IXVA 2RGMA 4S3JA 4UR9A 3U5UA 3WUFA 1DWAM 1CLXA 2GVYA 1PX4A 1G0CA 4C7GA 2E9MA 2XHYA 3CZJA 2A3EA 5GQBA 3LMYA 2J75A 4BA0A 1CPUA 2ZX9A 5FL0A 3ZJKA 2O9OA 1QBAA 1B0IA 4R27A 1V08A 3BAWA 3VD3A 1KGWA 1QNSA 3WEZA 2OYMA 5HOSA 4HMDA 2ZX5A 2FH8A 4AEEA 1KXQA 3BUQA 2FE0A 4CVWA 1Q6GA 3CHEA 2XVKA 1FP9A 3U57A 3IJ9A 4HMEA 4LYQA 1UH4A 4PMZA 3WQWA 1XD0A 1TVNA 3CTTA 2VQUA 1R46A 5FCZA 3WENA 3K4AA 2DIEA 3QHNA 3LRKA 3BAYA 1FFQA 3KE0A 2VVSA 1SFSA 1V02E 2EADA 2XVPA 3FAXA 3EMCA 1ZU8A 4JZ5A 1R75A 4W7VA 2G3JA 3EMZA 3UR7A 3A23A 1M01A 4LYPA 5A6LA 3ZM8A 2DGAA 4FNQA 2A3HA 1FOBA 4E2OA 1QI2A 1ISYA 5ABEA 4U3AA 1TCMA 1TA3A 2DIJA 2OSXA 3ZR5A 1ZS2A 3I3DA 1XYFA 1C91A 3WF1A 1JG9A 5CGMA 1E6SM 4H41A 3AXXA 1XCWA 2OW6A 1EDQA 1OB0A 4U3CA 4UQCA 4PUDA 3NSXA 2WLYA 1YHTA 3CLWA 2ZWYA 2YLLA 1JGIA 3MV01 2MANA 4R5EA 2WKGA 4AIOA 3VGBA 2WXDM 3UG5A 2VZTA 1JZ6A 5C8BB 3VGEA 3LXBA 1VJZA 1ZBCA 4FLOA 2D3LA 2B31A 1NWTA 1CXIA 1JZ8A 1JYVA 4NRRA 1Q6FA 5I5RA 2XJ7A 3NJ3A 4U2ZA 3KL5A 1NWUA 3VTRA 3SCUA 1LG2A 5M17A 1G1YA 3WH8A 4CD8A 4W8LA 1E6XM 5C70A 1BLIA 4RL3A 1QNRA 5DT5A 1B30A 5DMYA 1E72M 1KWKA 1K9TA 3WUEA 3ZSTA 3TTQA 1VFMA 4UQEA 3IAQA 4PMRA 5JUVA 3VINA 3WQ5A 4GZJA 1OGSA 2QF8A 1V0MA 3N12A 1HL9A 1QHZA 3WMCA 2ZX7A 2ZIDA 3ZJ6A 3VDBA 1CIUA 1TFVA 2BVDA 2GDUA 1JD7A 2GSJA 3O9NA 1MW3A 1BPLB 3VDHA 2JF6A 1WDRA 3UESA 4Z2LA 3CUJA 4P7LA 3W28A 1B31A 4CU7A 4A3HA 4NZFA 2WHJA 4UOQA 1V0LA 5A2AA 3WDPP 2CNCA 4C7DA 5I0DA 1UR9A 2J77A 2DT2A 3CUHA 3NYDA 3BUPA 4MDOA 1JF6A 2EEXA 3W82A 4AMCA 5A69A 4X0NA 1GONA 4CD7A 3PZUA 1H11A 2WVVA 1ITXA 2VCAA 5JBFA 2XFYA 2BXZA 2D0HA 2QLYA 5CQ1A 1GOWA 1M03A 4W86A 1CXLA 1QI3A 1J9YA 2GK1B 5LA0A 1BG9A 2PC8A 3N15A 1TQWA 1VJSA 3LXCA 1RH9A 2PF0A 4E4PA 4BF7A 5HPCA 4AZCB 2YIHA 5DO8A 2D23A 4X0VA 1Q6EA 5EFDA 1UWTA 5HDRA 1E1EA 4L4OA 2X1IA 1J12A 4ATLA 4M80A 4PMUA 4Z2KA 1W9BM 1BYCA 3CZKA 3LX9A 2JF7A 5BYWA 4AZHA 5FIPA 3HMCA 1V6XA 5IFTA 2ZXAA 5FOOA 2F7QA 2VRQA 3KWXA 1CENA 3B9AA 4YPJA 1WZLA 4UTFA 3A47A 1DHKA 4GZIA 3PZ9A 4GINA 2VVNA 1BTCA 2Y8VA 1M04A 1WNOA 1UR0A 1SYTA 3CIVA 3DX0A 1J0YA 2O9TA 3AFBA 1WDQA 2V38A 2YA2A 2HVMA 4W5ZA 3W26A 3K4DA 1KR0A 4PMXA 4WF7A 2J8FA 3K46A 5HPOA 4AW7A 4LX4A 3AZRA 3I3EA 4FK9A 1JZ7A 1E1FA 1HVQA 2XSAA 2WSPA 3S2CA 3MKKA 1GOIA 4EK7A 4FNPA 4ML4A 1H3GA 3W37A 1CZ1A 3N18A 2OWCA 1UWUA 1PBGA 3PZNA 1HKJA 2DSUA 3NCOA 2WHMA 4B16A 4FNTA 1UKPA 3UG3A 1RP9A 4MADA 5D4YA 4C7FA 4GIAA 3BMVA 4B3LA 1JIBA 2CITA 1H2JA 2VCCA 4B9ZA 1MW2A 2A3CA 1E4NA 2X2HA 1JNDA 1HTYA 2GJXA 5A8QA 1US2A 2JFEX 2O92A 2F61A 2V3FA 3A4XA 1EQPA 5D9NA 1ZBWA 3GBEA 2X2JA 4QFUA 3KL0A 2W63A 4WJXA 2YLAA 3WL1A 3WIJA 3ZSSA 5IDIA 2NT1A 1G94A 4Z2GA 5BXPA 2J4GA 1EO5A 1UD2A 3WY4A 3EDJA 1XD1A 3SCRA 1UA7A 3VSVA 2YL9A 2JEPA 4AZGA 1BGAA 2VR4A 1G5AA 4A3YA 3ARWA 3FXYA 3LPPA 3WNNA 4N0RA 2BNJA 3T2QA 1CGTA 2CERA 1WCGA 1XV8A 3T2OA 1VFFA 3UR8A 4ZE4A 3WH7A 1BG4A 4DM1A 4DUXA 1MQQA 4W7WA 2VMFA 3VKKA 2WW5A 1GOMA 1KGUA 3ECQA 3PZVA 4JFSA 3WQVA 3A24A
chains in the Genus database with same CATH superfamily
2XH7A 3CBKB 4OZGB 4IP7A 5A1AA 4WUUD 3BH9A 5GGSY 2A5UA 3MKCA 2X0HA 1WA1X 3W81A 3B43A 1U83A 3GW3A 4DP4X 1OABA 1GQKA 1XDMA 4YBQD 2WMGA 4JYEA 2A9NH 1W6WA 3RPIA 4NX5A 1W9DM 1NCHA 3H9HB 5ABFB 1HKIA 3IWVA 1EFXA 5DD3L 1IGML 3H3BC 1UFGA 3ITVA 4ZJ9A 2JJVA 3J7HA 1B0WA 2W1NA 1Q38A 5TF1H 1RV8A 1FHLA 3F00A 3EZ8A 3ZMRA 1W1IE 3Q06A 3LS5H 3NJGA 1EO7A 1XRFA 2DQIL 1OCNA 1P7KA 4AUJA 1PG7H 2B16A 1PKNA 2YHGA 3TT3H 1M6OB 2GKIA 4K36A 1JCNA 5BXSA 1GNXA 4XWUA 3AUJA 4G9FB 1RH8A 4YVVA 3I6GA 4M62H 1TB3A 3QZLA 4LLYA 1X1OA 4PW4A 1DBBH 1KC7A 1FFPA 1DBKL 3RVTD 8A3HA 3L3GB 2BMBA 4YSDA 2QHAA 5FYLE 2VDQL 3IETB 4PTUB 5CC6A 1E0TA 5K9JL 2V5DA 1MFDH 3IDYC 4HJIA 1A1MA 2W27A 1UR4A 4FQ1H 5E09A 4HDIB 3LQAC 2WNGA 1SJHB 3WIFA 1TPH1 3BUYA 4ZD3L 3GD1C 5E99L 3OKLA 3GXFA 3UGXA 3UTTA 4J2XA 1QOQA 1XH0A 3APMA 2GJLA 4J35A 4TTUA 5F7YC 3ZL2A 1A4KA 3MRJA 2AEIT 3KWWA 1MH5B 2NQDA 3KCJA 2AJUH 1CFTA 4LCYB 3WFCL 4XTIA 2B39A 3P2BA 2X87A 5FK9B 5DEFB 2F08A 5I79A 1N55A 4LLUA 3AM8A 3SHSA 1Y0LB 2F8XC 4JS3A 3V7PA 1FZMB 4P5MB 1H63A 2EDWA 2WMPB 1M7PA 4M3PA 5KVEH 2P1YA 3KPOB 3VGGA 2NOYA 4G7YL 3WQ8A 1BCIA 4YDZA 2CR3A 3N44F 4BCZA 5I2IB 5CIPA 3D2UA 1KYOK 4GW4B 3MBWA 2CDGA 4LPXA 2WMIA 4GIRA 4TXEA 2HRHA 2GJ6D 3TROA 2BNRB 1A2YB 3QR2A 4AENB 3MXVL 2JV6A 1IU1A 3H9YA 3V7AG 1OAYL 1YPZF 3Q1SH 2C79A 1HQTA 4DGYH 5IQLA 4X7TA 1UIPA 1XYAA 4XNZC 3QIWC 4FJZA 5I74B 2EAWA 5E4EC 4MWAB 4OLVL 4I0CC 5C97A 4H00A 4QP0A 2IWFA 4L1LA 4JO2H 1QBBA 2YDRA 1U42A 4LUSB 1LVEA 1RUQL 4MMZC 3SCSA 5DJCB 3DTUB 1KCKA 5AKSA 1F42A 3W07A 1RZKC 3VG9C 4KY2A 3TOPA 4GBXD 1XF3A 4Z7VE 5GGVL 3RVXD 3E2QA 4AWJC 5DT7A 1DQJA 5CEZH 4M00A 2WTOA 1CE6A 4AD2A 3UMNA 5FCUH 4H0HB 1ZGDA 2QIWA 3MREB 5HQMA 1MIEH 3G5XA 4LLDB 2J7HA 3SDAC 4PRNB 1AH3A 3RFAA 4EVZA 4RFNC 2OP4L 1D7KA 3WU1A 4EZJA 4NQEE 3LB6D 5JPMC 1OGAE 3BVDB 4JNMA 4R90H 2DVTA 5CN2A 5L7XL 1ZT1A 2WLLB 1RIUH 5IBTL 1OYCA 4KXAA 3WUZA 3X2QB 3HGSA 3DGDA 4ADGA 3ARZA 4J3WA 5HYSB 4XAPA 3DHPA 2CLZB 4Q52A 4N2LA 4K9EL 3VXNA 1C93A 3QUMB 4J3OD 4ZFZB 4X98A 3Q05A 1AXSA 3CXDL 4MJIB 2CK2A 2ZCLL 3ZVVA 3TA3B 3S98A 1G0YR 5TK4A 4LSTH 2EVIA 4R9OA 2FZDA 4FKEA 4TMPA 1KM2A 1E65A 4F48A 3MRDA 1KFAH 1OAQL 5DI8B 1LP6A 1V0NA 3GHEL 4QXUH 3H9SE 4DF1A 4BELD 2WNQA 4TVDA 3RTLA 3PJLA 2I17A 1UG6A 1E2WA 5C55A 1IFHL 1ZCOA 2L7JA 1I0BA 4JO5A 2Y0FA 2PXYA 5F3BB 2YPIA 4LOFA 5T5NF 1JCMP 1VJIA 4BQCA 4PGDA 1BJ1H 4NUMA 5D2NE 5CAYB 3HJEA 4F15C 3TSBA 2J2ZB 1MREH 3CLFL 3DJRA 1SJEA 4JGJA 1YDPB 5C07D 2NY5L 4F57L 1Z3NA 2YMOA 4IL2A 1F41A 2EZ0D 2PMZA 4LGXA 1EJOL 2DU2A 4ZPTB 2XZZA 5DMKA 1RUML 4LDOB 4L65A 4PP2B 1CICB 3HZKB 3V5DB 1NCGA 1XYMA 2MTPA 1GJWA 1AXIB 2Q8LA 2W9LA 5BOOA 2PWVA 4OZHA 3O6CA 1E2VA 4K8RD 1TELA 3TH4T 2V4LA 4L2YA 2DMHA 3L7EB 2EUZA 3BX7C 4YSPA 2J8UE 1DLFH 3LZ3A 2J9ZA 2IOIA 1M41A 1AVAA 3FOMA 4WI8A 3QEUA 3TJHC 4GW5B 5HYEA 4H44C 3CV5A 2QADC 4P2YA 3S36L 3U2OA 4I48A 4O2FB 3RIFK 5DUJA 1TSRA 4IMKC 1U3HA 3WJLC 4LKXB 3L3JA 1YEGL 3CUZA 4DO5A 1B5TA 2NSMA 3BKJH 2J7DA 3ISIX 3RLUA 2L0DA 4Y5VC 4QEHA 4FYQA 1NAML 2W0LA 1FBAA 2EH7L 3G6MA 3U2JA 3M0LA 1I8KB 5HI3D 1RBOB 3QDGB 3WZ0E 5A6AA 3WQ6A 1T1XA 3O3BB 4TSCH 1TJHH 4CN6A 5C9WA 3ARGD 1KPVB 3CXFA 2FT7A 1EAJA 3S5ZA 3JR2A 1MCPL 4CNIA 3CX5J 2GK1A 5JQHC 4HWEH 2R56H 1UR1A 3QUMH 3T0CA 3FH7A 5IQ9B 4MZIA 4NAEA 3RQ3A 1CL7H 4XMUA 3DIDA 4B27A 1QFUH 3FJ4A 5JQ6H 4ZW5A 5JNYA 3QJXA 3CVCA 1NDMB 3V75A 1EFXD 5AW7B 1NFPA 2IBZX 1XVSA 5CCJA 1SJVA 4H1LH 2XWRA 5IB1A 4QDWA 3DDMA 3B2VL 3H2CA 1GVIA 3QJQB 4KO5A 4BE5A 1IF2A 1OHLA 2VR2A 2O72A 3QPEA 1AP2A 1YO4A 3IAGC 2AQRA 1OF2B 3PP3H 3RR4A 2B7DT 4ZXOA 1UP3A 3N3EA 4CEXC 2CO1A 2RDXA 2AK4B 3ZKMC 1DN2A 2XM2A 3OMAB 5CKAA 3N3TA 4JFDE 3SJVB 1B9ZA 4OM0H 4ANVA 1AOZA 4FE9A 3MLXL 2YRBA 5HYJB 1UVQB 3D39E 5DMJB 1Q1JH 4HJEA 5HJDA 4OUOA 2NY1B 1J9QA 1OP3H 3QBUA 1ZK9A 4L1SA 4RISL 4MJ4A 4XBGA 3BP6B 2IALA 3N04A 1TTPA 1OPGH 3MVIA 4Y16A 3MHZA 1PEZA 4C90A 1EOKA 1ZV2A 3GHTA 3E2RA 1JPMA 1C08B 4ZUWA 3ATFA 1IKNC 3GO2A 1ETB1 3HFYA 4U1NB 3RR1A 4O15A 2VDKB 4FA8A 4TSAL 3UTTD 4OZGA 1BRLB 3O1NA 1LHZA 3QFGA 3BYTA 3IXAB 3KPLB 3T3MB 2M1KA 3KS5A 3DUGA 1U21A 4ZXBC 3EOOA 4GYPA 1EWHA 3C5ZB 5BCAA 4K0OA 4RE0A 3K4WA 3SQRA 3IIXA 4XQ6A 3H9HA 5ABFA 5DF0A 3B56A 4UQIM 5FO9A 4QTFA 3DV4B 4PJ9C 1K4GA 2GOKA 3UU0A 3S34H 4CCEA 1W5PA 5KSVB 4ZW6A 1RUPL 4WJKB 1FH8A 1ITQA 1IBZA 3H7LA 1KRAC 3FX4A 3CZEA 3DBXB 2IV8A 2NX3A 1JHKH 3PE9A 3GB7B 4AWEA 2JKJA 2LVCA 3OHXA 4DW2L 3R8QA 1NWSA 4AXNA 4G9FA 3D2UD 2BRRH 1KELL 2HJLB 5AW9B 2XN9E 2V2XA 3C08L 4X0KB 3BK0A 3VIMA 2AL1A 3HQOA 4NC1E 1FCGA 2N3JA 5H35B 3ZE1E 3L3GA 5E23A 3RJOA 3HV9A 2Y2YA 1QEWB 2E8YA 3EGDB 1TQCB 3IETA 4PTUA 4I3RL 2C5DC 1NCIA 1M3IA 4HB7A 5K1JA 5EOCH 3BESR 1V27A 1GPWA 1EHLH 3P77B 4MZ1A 4HDIA 3N4FA 5DS2A 3KHQA 1SJHA 1GZPB 1MXDA 3R8GA 1NPJA 2VKZG 3RNKB 2FVNA 1MFBL 2Q7YB 4QGYA 5LN8A 3V4UL 4KJWC 1I1XA 5DRIA 1OGGA 2YZ5A 3WLLA 3AHYA 4A3RA 3ESOA 3TYDA 3LEVL 1Y7VA 1S78D 3M47A 3PBGA 2ZAIA 3WTUA 2XVBA 1QATA 3V36A 4H8HA 4LCYA 4JN2A 5ECUA 3GMNB 3FZUC 3L1GA 5FK9A 4YN5A 5DEFA 2QCHA 4MGGA 2PDLA 1Y0LA 4JB9H 1YNTF 4AH2B 4JTDA 1R3LB 3WLBB 4JFHD 4WFFD 5BUAA 4WTZG 2Z1WA 4P5MA 3ITOA 2WMPA 6REQB 2Z4GA 1ID2A 3M0JA 4XE5B 3WQFA 1VFHA 2Z6JA 3KPOA 3PY2A 3F83A 2OK0L 4ZSTA 5BOJA 3WLKX 2M2DA 4AEIH 3TBCA 3WY2A 2BO0A 4HPHA 3MV9E 3UCQA 4W89A 5I2IA 1UHVA 4GW4A 4JKMA 4KHXH 1DYZA 3M64A 1T5AA 1QBML 4N2YA 4EI5B 5A6KA 4XE0A 2BNRA 1A2YA 4YK4C 4AENA 3L4XA 2DYRB 2ZCZA 1DE5A 1HVXA 1F4XL 3US1A 1T0NB 4J3VA 1IGJB 1CD9B 1QFEA 3S5SA 3FULA 4Z3HA 2GK0B 4LRSA 4MWAA 5HHNB 1MIMH 3ATDA 2HWZH 2Q8AL 3S2JA 4K7PH 5TIMA 3MJ9H 3A6OA 2FJHB 4UQBA 1DSFH 4BKTC 1J0ZA 2G0WA 3A5VA 4LUSA 2XBZA 2BJMH 4KO9A 5D05A 1J86A 4GXVH 4LUYA 4XI5D 5I66B 1QT1A 2ISVA 4IBLT 2EIMB 2PXYD 4HP5A 5D1ZB 1R0MA 4Z1PA 4X5PA 4XO3A 2P50A 3CL7A 5J6SA 3TO2B 1ILUA 1RPKA 3EH4B 3D3FA 5DZOA 4LRIC 2XSBA 3FU5A 4RE4A 4JXCA 4JJOA 1HGYA 2YWZA 4GGHA 1UUMA 4L4MA 4XMVA 5I9QB 1EEYB 4WZHA 4K2UL 4LLDA 1HXMA 4PRNA 4JGNA 2GVYA 2Q76B 3VUSA 4L6DA 4GJIA 4UILL 4YLCA 3LMYA 1CT5A 5IESH 4FEZA 2WLLA 3SCMC 2QV5A 3FA5A 1MI3A 4HMDA 3VB8A 4AEEA 3K74B 3W2JA 1PSKL 4RFEB 3G7TA 4LEOB 2QQNL 3W22A 2R83A 5D1XC 4AAJA 2QTVA 1E7UA 5HYSA 1OEZW 4DAFA 2CLZA 5FGCB 2VVSA 5D7HA 4B4HA 1SFSA 3IBEA 1HQ4A 3QUMA 3EMZA 5I0ZA 3WQCA 1T96A 4ZFZA 1REQB 1WOAA 4MJIA 2J13A 5A6LA 3B2UD 4DN3H 4KFPA 2VDLB 3FB5B 4EIBA 3TA3A 4TL4A 3QEQE 4ZT1A 3O2VL 3WF1A 1JTOA 5HR6A 1G7LB 5DZPA 5DI8A 3V7AE 1U3HD 1OB0A 3PU7A 1M1XB 4L29B 4JTLA 4RV8A 3EFOA 2VL5B 2MRYA 2KQNA 2ZWYA 1CLZH 3T0EE 4LV9A 4ELDA 2HYMA 3VW3L 4R2GB 2B31A 2WGXA 4PD4K 3LQGA 5I5RA 1HCVA 3BAEH 5IROA 1N0XH 4GG6B 5M17A 3I9GH 1BLIA 4JG1H 1IGYB 2AXGB 3L6FB 1H7PA 3WUEA 2VUOA 1VFMA 1MG3C 3OA3A 1YDPA 1I1AA 5FEXA 4ONHB 1ZAIA 4W4OA 2ENPA 4YTQA 2HKFH 2BS8A 4ALDA 3B2MA 3VDHA 4ZPTA 1F6AB 3MQTA 4Z2LA 4G70B 3D30A 1ECZA 3UADA 1DBAL 1CLYL 3FUDA 3K0YA 1V0LA 3CCHB 2CM6A 1UR9A 4PP2A 4GRWB 4YUEH 1CICA 3HZKA 2OMAA 4LSSL 1VESA 3J2PA 3V5DA 5F9OH 2VCAA 5JBFA 3EX1A 4PB3A 2ENJA 3LD5A 4FQ2L 4WWPA 1FVCB 2OR9L 5LA0A 4I18B 5IJKC 1F76A 4I6KA 5MHBA 4WD0A 2YD5A 3L7EA 4C65A 4LT9A 3C5SB 3BPCB 1PYWB 5IGXL 2F6UA 5D1QB 3P9LB 4G6FD 2RJGA 3QDJB 4GW5A 1QTPA 4L1XA 2A6KB 3B03A 3EPOA 5J13B 5DVLA 1HIML 5GS0L 4ZNEA 3BV4A 4QD2E 5B7ZA 3CN1A 3K4DA 4TULL 1RJZB 1TVLA 2LLLA 4LKXA 3B9VA 4PMXA 3EFDL 5E1IA 4AW7A 2OM5A 1MCKA 3IDMB 1JZ7A 3SN1A 2NUPB 2NY6C 3S2CA 1IO4C 3JZ7A 5F8RC 2CE6A 3R79A 4LLQB 1H3GA 4Y16D 1DXFA 6FABL 1I8KA 3QDGA 3LNHA 2CJUH 2AQSA 1TJIH 3NCOA 4KTEL 3BARA 3O3BA 1KGJA 3W7JA 2YPVL 5A8QA 1WD9A 3VA8A 2F61A 1VCAA 3R8BB 2X4NB 4AYMC 4JREC 4DNMA 1I2QA 1AGFB 1EO5A 4H20L 1D5ZB 4GAFB 5IQ9A 2VDLH 1DVYA 3WNNA 2RCSL 3UL4A 5C6TL 2PMQA 4H8NA 3LH9A 1WDWA 3OQEA 3DROB 2Z31B 3KWSA 3TNBA 1UCTA 1E9OB 3UR8A 3WH7A 2AAVA 2BERA 1KENH 4WU5B 4AM0B 1NDMA 3QPQC 4H88H 3MYJB 4LCVA 3F58L 3TJXA 4CN4A 4DKEL 4UBPC 3H7RA 2F5AH 3IJYB 1QYGH 3OAYK 3QW3A 5LUMA 1DUYB 1VP5A 1OF2A 1R3IH 5FF3A 5IFHH 3WBEA 3VC6A 3BPLC 1U4EA 5J89A 1A3RL 3HBGA 4OGYL 2PWDA 2AK4A 3AG2B 1AZ1A 4LEXL 3D3AA 3M17B 3SJVA 3G1VA 4G9FD 3C6CA 2PSNA 5HYJA 1UVQA 1LK3H 2XKSA 1R9XA 1UB3A 2J24A 3HMXA 4LCCC 1GOQA 2VDOH 4M5ZH 4DK3A 4WIWA 1FWEC 4KBXA 1BV8A 1ZHNB 2DQWA 4P7NA 1JHTA 1KJVB 4PRHE 4IUGA 2HFFB 1WAPA 1L7IL 3FQ4A 3BQ6A 4LSRL 4BHUA 4FMVA 3BP6A 3AQDA 1MNSA 2WSKA 1DVJA 5L6UA 4PWHA 3Q9QA 3IS4A 2XZCH 4YNGA 4EWJA 4O51B 1C08A 3MMDA 4JHAL 4U1NA 2PGRA 3U83A 3P14A 1QMLA 3DC8A 5MEQB 4X5XB 1DHPA 2V63A 3I6LE 5E5UB 3PBUA 2YR3A 1BRLA 3UPRB 5K59F 1F1AA 4Z78B 4LVAA 3IXAA 3FN0H 2P8CA 3F7VB 1P5UC 3FVDA 3C5ZA 3K5SA 4HIJB 4TV3A 3K13A 3N9GL 2J8TA 1OF8A 1UWXH 1KMGA 2FB2A 4YSAA 4P2RB 4M1DL 3QYSA 4TU1A 4WIQA 2AXFB 4XPTL 4XAKE 3EZJB 3DV4A 1FO0H 3CO8A 5EMUA 4PG2C 1WWCA 5HVWA 4ZMLA 1H7RA 2PLTA 3L4VA 3MJ9A 5KSVA 1NJ9B 4UFLA 3PWGA 2FJGB 4WWKB 3UROR 4MFDA 5FYLL 1EZVX 3SCQA 3OWRA 1E6ZA 3DBXA 5I26A 1CYGA 3EDKA 4IJ3C 3C2RA 3GB7A 1AZVA 3CIQA 4GC3A 2ZDSA 3IDXL 1GVYA 1UD8A 1NLDH 1XYZA 5EIQA 3QORB 3LIUA 1R3VA 2HJLA 2YUZA 3CVIL 2DWXA 4ZUSB 4X0KA 2BNRD 3TYCA 3X12B 4MQ7B 4WW1B 3P2DA 5FV1L 3G6JB 1F90H 6XIMA 2NWSA 4WTQA 5C2BL 4L37B 3BVXA 5H35A 2KDGA 2CUHA 1QEWA 2HT4D 3EGDA 3M1BB 1EJ8A 4FQIH 5D4IA 3IE9A 1F2QA 3M8OL 2XICA 1VFTA 4MWAD 3F7YB 4REQB 4TKWA 4R9HA 2PCXA 3PR2A 3P77A 5XIMA 3CXOA 3QJFB 4F0SA 3RNKA 1N6UA 5E5LA 2Q7YA 4IPLA 2QL1A 4AYID 3CBRA 3UW6A 2GEQA 4IIFA 3C09C 1XF4B 2KZKA 5D7LE 3I7RA 1M7JA 3BOFA 4YXGA 1RKRA 5BMFH 1ENUA 2P76A 1JV2B 4DBSA 5EA0H 4EN3C 3H6JA 3AZTA 3O6ML 1IXPA 1XBYA 3LZRA 2X05A 2EACA 2XX0A 5CLXA 2YBTA 1BF6A 3V0AC 5DLMH 3A0OA 3WJZA 3GMNA 3IK2A 2HVOA 2PTDA 4I3SH 1U8QB 5HGGS 4AH2A 3WLBA 1GS8A 1T2JA 3QO0B 2P0IA 1L0QA 4U4MA 4UT9L 3MNMA 4ODTL 3WMPA 6REQA 1MZYA 3WD0A 5B1JC 2R9HC 1A6WH 5FC9A 2PWGA 3VQ2C 1HJVA 1SYSB 3GXNA 4B60A 2XPYA 5I3FA 3VFVB 3JQOB 1GYCA 4HXBL 3ID7A 4OUEA 2FZNA 4PTVA 4G5ZL 5D55A 3BG9A 4NP9A 1Q5MA 3ZKQD 2WWMC 4P06A 4EI5A 2VZVA 4ICCX 4HS3A 1YEKH 1JFQH 1T0NA 3BO9A 6XIAA 2DVXA 4LAJH 4PCYA 1IGJA 4S3FA 5EEWA 2MFNA 3S3SA 1X1NA 4MJID 3VI4F 1T66C 1F11B 2TODA 1WV2A 2GK0A 5HHNA 3TA3D 2FLMA 4N8PA 2YD4A 2FJHA 1D8CA 1BQHB 1O4UA 4LS1A 1JI1A 3QCVH 1UWGH 4JCMA 2MPAL 1I3RB 5E2TH 3WKNA 3GMRA 3FT4B 3KJ4B 2EO7A 3CT2A 5I66A 4MNQE 5AB3A 3VOGA 3ISRA 4CCDA 5IROD 1XIFA 4P2QE 3B7TA 3WYZA 2Z7UA 3TO2A 3T08A 2R7EB 1BZ7A 2DQCH 1QR7A 4ERGA 3E5PA 4YGAB 1J9RA 4CQ8A 3LHTA 4S1SH 3CL6A 4ADSA 2DLTA 4TNWK 3IU3B 1BXUA 4XIMA 1HH6B 4FI7A 1I1AD 1TEGA 1PX8A 1BBJB 1QZ1A 4CA4A 1UWQA 3LB0A 5LIKX 5EV7A 3RL1B 2IGFL 4N2FA 1R85A 1L9RA 3THDA 1CICD 4AZIA 2X2UA 3THCA 3MP4A 2Q76A 3QW9A 1BLNB 4Z7UE 1QWNA 1HHKB 4O58H 4IG2B 3LCHA 4EIZC 4F93B 3PNUA 3NQFA 3JWDC 2ZYIA 3DARA 1DQUA 4RFEA 4LEOA 2P24B 4I9WE 2G4JA 3ZLGA 3QCUH 3A3HA 2FYVA 3KJ6H 1UG9A 1N12A 4Y89A 3NA9L 4MY9A 5I1IL 1IGCL 3NJHA 4LQFH 3FB5A 3F7KA 3IWUA 4OOUA 3EYSL 1RJLB 4JO3L 1EQWA 2WGNB 1ID5I 1YLVA 5JMUA 3RILA 1G7LA 5DCDA 2G9KA 1M1XA 4L29A 4B5WA 1UWSA 2FVLA 2VL5A 4PLKD 3CPGA 5F1UA 3P4NB 1GC1C 3RX4A 5CR1A 5AYYA 2H1PL 3PZOA 3NSMA 2R0ZH 2GQ8A 3KOYA 3QHFH 1TV5A 1JWUB 3ZLHA 3QDGD 2BHZA 4F1SA 4GG6A 5A40E 1IGYA 2AXGA 1AIZA 3L6FA 4NT6B 3IU4L 3JTBA 5E4OA 4PMVA 4JFQB 3BFWA 1RJYB 4K1GA 1A9BB 3VU1A 4GNJA 4ONHA 2WQPA 3N3MA 1CFVL 3ZPDA 3UBGA 2RGLA 5FAJA 1RK5A 1W72L 1F6AA 3WSQH 4KRMB 7CGTA 4OBSA 3MSYA 3BSGA 4TUKH 3IRCA 1SU5A 3CCHA 1ZV5A 2VB5A 4I7UA 4ODSL 4XVUC 3FO0L 1CMOA 3TW6A 3NCMA 2BZDA 2D3VA 4LF3B 3C8HA 4AIZB 5ADOL 4B9CA 3OB0H 1FCQA 4CVXB 2PW1B 1LLZA 4D9LL 1FVCA 2ZC1A 1FI8C 4I18A 1S3RA 4UNTA 3SQMA 2YYUA 4B3VA 3VO0A 2CG9X 2WK2A 4PMQA 4JTJA 4X6FB 3Q8FA 3CAWA 5IMOB 2JKWA 3WLSA 2VMEA 4BKSC 3C5SA 3BPCA 1PYWA 3ZE1F 1CCWB 3ZTJH 2AK4D 2VUKA 4JRYB 3CDCA 4CGTA 5D1QA 3SJVD 1AHKA 3P9LA 3PAOA 3FQYA 2X6CA 2NCEA 3QDJA 5HYJD 3N43B 3EJUA 3HG2A 4LP4A 1SHMA 4Q4KA 2NY1D 3WUGA 3GNML 1SOSA 5J7CC 1ZPUA 4P8VA 3U7BA 1NEZB 3INUL 4ZMGA 4WCJA 4KZEH 1RJZA 1TITA 4NSBA 2HG0A 4TVPE 4NNAA 4CMHC 3BJ91 3IDMA 3SE6A 3TKFA 2NUPA 1XWVA 4KITB 3PL6B 3TN5A 4LLQA 4PTDA 1BAFH 4PMEA 3CZFB 5CWSB 1XBZA 4NEHB 1RIVH 2VDMH 4JEGB 4MCZB 3S1GA 3QKZA 3EKCA 1JDCA 2VRKA 4O00A 1P0EA 2OL3L 3G5WA 5AECA 4PVBA 2ACSA 3P3TA 2X4NA 5L8LB 1YJDL 2Z7WA 3RAJL 3UYIA 3VNIA 1T5KA 2OMXB 3GNOA 2EYTB 1F3RB 2X3AA 1MXGA 1D5ZA 3HE6A 4KDWA 5DTFB 2HFGL 1MDRA 2PE4A 3C5ZD 3E9TA 2Z31A 2INEA 1E9OA 1YNTB 5F1IB 4WU5A 5JHMA 4AM0A 4NN6C 1RA0A 3R1GL 1DTNA 3CMOH 3MYJA 4I1NB 1T0OA 4MLIA 5FYKU 3TTEA 1Q4NX 3IJYA 3DXAB 3QFEA 1NMCC 1VEPA 1DUYA 4TYUA 4Z18A 5F0LB 3TCEA 1JZ5A 4KRPB 2GC4C 5LGXA 4XVTL 3UETA 1CXEA 3OSVA 4HWUA 1E3FA 1V6UA 1TRIA 3T6QC 4DPBX 3BLFA 3R7MA 3KCWA 4UU9B 3M17A 3NZHH 4YDIH 2FMNA 3DFNA 4B53A 5J5RA 2VHLA 4LEQA 1LT7A 1ZHNA 4EDWL 3TVAA 1E70M 1KJVA 4O11A 1NIAA 4JO1L 2WLJA 2HFFA 3UO1L 4A39A 3LV5A 3JWOL 3D0LB 5CS7A 1OZUA 4FAAB 1W32A 2J7BA 4WV1C 1GZ1A 4KGLA 3HZMB 2FGZA 3HG3A 2RDWA 2F7IA 3RHWK 3EJQA 4HCHA 4KKAC 4O51A 4O9HH 1TTRA 1LDSA 5F1VA 3V6OC 4WSGA 3VKJA 3BVJA 5MEQA 2HEJA 1UQZA 4QNPE 4X5XA 4NZTL 4WDWA 2COQA 3UPRA 5CEYB 4Z78A 4QR6A 1TPDA 3F7VA 1WKEA 4DTGL 3VA2C 2X44D 2EG7A 2QJNA 1XCTB 4HIJA 5KSBB 3MRMB 2ESCA 2IFFL 3L17A 5KSUA 2GVEA 1ZLVH 2DMKA 1FCVA 1CGSL 4P2RA 3VXSE 2AXFA 3WS6A 3VMPA 1XPGA 1USZA 3ITGA 3QIBB 2AEQH 1NJ9A 3QUGA 3KDNA 2FJGA 3AY4A 3UYCA 4WWKA 1TZIB 3FU6A 3EXTA 2ABAA 2XJLA 3NDZA 5EOQH 4WSKA 2K7QA 3FRUB 2J5LC 4JM0A 3EJTA 3AMLA 3OXSB 3W71A 3ILQD 2Z7KA 4PTWA 1EQCA 3TFXA 5DC0A 4DI8A 3ETSA 2E27H 3SECA 2POTA 1KIUB 3RZCC 3QORA 3T1FB 1G6VK 4UMSA 2ZRWA 1NICA 4EI5D 4F3FB 4ZUSA 1N2VA 3X12A 3TYZA 3GK8L 4MQ7A 4WW1A 3G6JA 4N2IA 1E5AA 2D24A 3NZQA 3T9PA 3W83A 3CDGB 5BZWB 2A77L 4L37A 1ZLSH 2WKLA 3M1BA 2ARJA 4XNQB 4AD3A 4NBZB 4F9PA 1H6EA 1H5VA 1FYTB 4TVCA 3F7YA 4PRBB 4E6MA 2R15A 5JTWA 5HMFA 4DYKA 1TZ8A 4NN5B 4X7SL 2CO4A 3FU0A 1A6ZB 2HT2C 3QJFA 3CAFA 3L3IB 4OIBA 3OMZA 2EO1A 4ZS6C 4RUBA 4GE8A 4JZOB 1J1PH 5CGBA 1TZAA 4GY7A 1XF4A 3CV7A 1WB0A 4KTYA 2VENA 1M9SA 4A6YB 4Q7IA 4B50A 5AVUB 1JV2A 2WLMA 3DFPA 1EXHA 3ALXA 4RNRB 3UH8A 1BQLH 2HVNA 1ETJA 2V9QA 1ZHLB 3QZBA 4NAQA 3PREA 4RGNB 2RHGA 3MMEB 1BQGA 1VLWA 3VKCA 4NM4L 1HU8A 3AADB 2J74A 1XDLA 1JVKA 4A7VA 1P9MA 4HJFA 2YA1A 3QO0A 2LE9A 3B5GA 5IW6B 2NY3B 2EKSB 4AIEA 5GS1B 5HHXH 3PWUB 1SYSA 3EOSA 5C9UA 3VFVA 4HWNA 1AK5A 1EZWA 2XWEA 1KXVC 3BQ5A 3EDDA 3CHQA 4YZFF 1LNUB 4MNLA 1JF1B 1EV2E 4L6OA 2HN7B 5F7HA 1BJ8A 4APQC 1OT1A 2YDQA 4BA8A 1EFZA 5AAWA 3SYCA 2SODB 3NGJA 1WLHA 1F11A 4BFJA 5FHAL 5GQBA 3L5XH 4TR9A 4JRWA 4DI9A 2F54B 3KDPB 3NIDF 4WTWA 4C60A 4RXGA 4IOTA 1BQHA 5SX5K 1CB7B 2KLTA 4LYQA 4LAQH 3D12B 5FHBH 1I3RA 1A0CA 1T5WB 2QPFA 3FT4A 1KCVL 1V02E 1HCFX 2VDPL 4R2GD 1GOHA 4QJ4B 4W7VA 3Q8BA 5C6MA 4FEMA 3FT1A 4L0PB 4PAZA 2R7EA 2Q3XA 3QJVB 3LCLA 2D7TL 3I3DA 3UWWA 1YAIA 2F7FA 1XGRB 1E6SM 3F3HA 1GTHA 3IU3A 1HH6A 4PBEA 1R5VB 1VFSA 3MRFB 4PUDA 3AXKA 3N14A 3CK0L 1BBJA 4K3ZA 3NMEA 4U1IB 4L5FE 1DQVA 3RL1A 1GY1A 1GOGA 2A38A 3NJ3A 4U2ZA 1OZQA 4G7FA 2FJFB 1XGTB 3DUUB 5E9DB 4BK8A 1R6WA 5DUBB 3I50H 1BLNA 1HHKA 4IG2A 4ZS7H 2P28B 4R0LC 3OVQA 4LSPL 4KCTA 3VG0H 1FVEB 3BDKA 4A6YH 2F53E 3GE7A 2FBJH 2Y06L 2UY7A 1GZQB 1TFVA 2P24A 4UV7H 1KBWA 4UDTB 3QWRA 2Y2TA 3LM7A 4H26B 2B7NA 5D1QD 5AC7A 4AGOA 5EZIH 3QDJD 3TYBA 4MDOA 3L95B 2EEXA 1BD2E 2JKIS 3VH8G 3M5XA 4HJGB 4IPPA 2ZG2A 1UUNA 2QCGA 1B4EA 2YGYA 3P4NA 4AZCB 4X0VA 5EEUA 4FFWD 4XG1A 1RZJC 4KDVA 5I8OL 1FDLL 1JWUA 4Z17A 4HUWB 3HMCA 2FB4H 1A6TB 1CENA 2GGEA 4YVNA 1DHKA 3PZ9A 4GXMA 4NT6A 3NWRA 4NC2B 4R7XA 3CIVA 4JFQA 1A14L 5CJ8A 3QPXH 1A9BA 1X5XA 4X9GA 5DZJA 2EDJA 4N1EA 1F7BA 4S3BA 2E7MA 4U4IA 3HE6D 2AS5M 1L9OA 1GGIH 1MRFL 1YEWA 3MKKA 5CH9A 4ML4A 3VXUB 4K71B 1CZ1A 5CSSA 1RZIB 4W70A 1VHCA 2Z31D 1XKYA 3VKAA 4HV8B 4MADA 3MC5A 4ZR8A 3AB0B 1JIBA 5CSRA 1E4NA 1RZGB 3IEBA 4ZO8A 4AEHL 4AIZA 2G5WA 4W6XB 4CVXA 1ZRUA 1ZD6A 2PW1A 2V5YA 4TNFA 3UXLA 3T4YB 3L23A 3P69A 1XD1A 3SCRA 3UP8A 4X6FA 5IMOA 3PG2A 4H1LB 2P26A 5FLVA 4ABVA 5AZ1A 2DQGL 4JRYA 3T2OA 1JPTL 5MHSE 4JEJA 5T5FH 3G8RA 3DUSB 3Q6GL 4Z76A 3AWNA 3NQMA 1KC5L 3UZZA 2A4CA 4N2EA 1VEOA 1NEZA 2JKTM 2NXYD 2V3EA 1I7TB 2LOEA 3GRIA 3AHZA 1KDJA 5DT1L 4NYUA 3GDKA 4U1MB 4KQ3L 2J7EA 2J4WL 3PL6A 3MANA 3GIZH 4QHPA 2JI2A 3CZFA 5CWSA 3L67A 2FWUA 4MCZA 3B40A 5ADPL 2HUEA 4Z08A 4URIA 2X0UA 1NELA 2D7OA 4H04A 1LL7A 4DESA 5JVLA 2HPTA 4O1BA 1P84J 3PCYA 4JKPH 4LIQE 4CUCA 1UUQA 1KB9K 1UENA 3FV9A 4QY8B 1I9RL 2OMXA 2EYTA 1NOAA 4XMWA 1J2BA 3KRBA 5DTFA 4MCNA 4R88A 4MDRA 3D7PA 3STZB 3N0AA 4KXDA 2R1MA 1YNTA 4P2RD 4MD4B 1TO4A 3V0VB 3B8UA 2Y0SA 4JDTL 1M7XA 2YEQA 5TH2B 1CFQB 3W7IA 5HNNA 3NQ7A 4WWKD 3DXAA 3VNDA 5ALCL 1E9PB 3V35A 4YR6B 4AZBA 4TIMA 2BY3A 1QFWM 1Z5YD 1KJ3L 3L1OL 3AYSA 1XS2A 3KH3A 1ROWA 2BLFA 4UU9A 5FD0A 4CMMB 4UV4H 1OJXA 1MQPA 4MAVA 4J27A 3QORD 3JWNC 3ZL1A 4HLZH 4UOZA 2E0PA 1SEQH 1DWHM 1M6UA 4Q4QA 3WNPA 4HPXA 1IMHC 3VI4B 3ATBA 4GIYA 1F3DJ 3T6ZA 1ZP4A 4X2UA 1X7TA 3D0LA 4L05A 3WEAA 3U4BL 2X4UB 1EB3A 4ZBJA 1SVBA 1PYMA 3DEQA 1DQLL 3HZMA 4WEMB 2DJUA 3V0EA 5CGYD 2A4ZA 4ZFGL 1NF0A 1C7TA 3C8DA 1LDPL 1O7DC 3N2XA 4NQDB 3STEA 4IMDA 3BDYL 3PTKA 1XR9B 4FALA 1ODUA 3ZKXB 4FQCL 2QQLL 2V2WB 1JNHB 4PS4L 1MFEH 2DKSA 5K9QG 1XCTA 1U36A 5KSBA 3MRMA 4Q9QL 3NQGA 4ICXA 3W1NA 3S6OA 5DMGC 4OECA 3EHBB 5HYQB 3PN8A 3QIBA 4X9BA 1YXYA 4I8YA 2I27N 3R06B 3RLHA 1TZIA 2EG6A 4D2NA 3FRUA 1LTXA 1ML1A 3SOBL 3OXSA 5DFAA 1V6WA 3EJCA 2D8KA 4IRSB 3S5LG 1DQDH 1B4RA 1SR9A 4LY4A 1XAUA 1KIUA 4TPRH 3T1FA 3SFKA 1BP3B 5BS0B 3WE6B 1MWAL 2W4XA 4C6MA 3OLEA 3ECVA 1OE1A 1PB0A 4OLUL 3CDGA 1UPMB 5BZWA 2YD0A 9XIAA 2YJQA 3JVFC 2PFHA 4KK8C 4XNQA 2EHHA 2QGYA 2Z7GA 3U48A 3E6EA 1FYTA 4PRBA 3NPSB 1ZANH 1LE9B 1E2ZA 4KI1A 3EEGA 3SKUD 4OI8A 5L2KE 3VDAA 2F58H 1A6ZA 2PBOA 2YD3A 1K72A 3L3IA 1WIPA 3MCG1 2GITB 3ZYIA 1IGSA 5DJ6B 4MUZA 4ORMA 4JZOA 3F5JA 1W91A 4TQIA 1I7UB 3O2DL 3M5VA 4HYRA 1V03A 2ZRVA 3TBVB 1NBYB 1AO7B 4ES4A 4A6YA 4OU3A 1RHFA 1U8OB 2PPCA 4RNRA 4DVRL 5GNXA 4QTIL 4JZJC 1M6OA 5CJXA 4GI6A 4XPGL 1ZHLA 3RPDA 2OMZB 5F44A 5C6PB 2JKXA 4WGWB 5DY2A 4FXKC 2EGZA 4IGHA 2VDGA 4K39A 1JUBA 5CF3A 1C92A 1CDCA 1CYXA 2YZ8A 3MLWL 2APBA 5IW6A 2E9BA 4LU0A 3SIZA 4FHBD 3RFZB 3P5YA 3W2UA 2EKSA 2AQPA 1Z9MA 5GS1A 1PZ0A 3ILDA 3QCTH 1Z6KA 3PWUA 1WJ3A 1J4EA 1DVQA 4HK7A 1I8MB 2NDGA 4MB4A 4NVTA 2ZUWA 1KZYA 1FBIH 4UTBL 3Q44A 1GJUA 3FUFA 1GVSA 3O4OC 7ENLA 2E9IA 2K8MA 3VI3E 3QZNA 3ASOB 1LNUA 3COTA 4NKIL 1JF1A 1L6WA 4E8DA 2HN7A 2WUBH 1X9QA 3QWRD 3N19B 4DF0A 5DJ0B 2DJXA 1F4WL 4NQTA 3V4VH 4HYTB 1T83C 2IIJA 2VFDA 1JFXA 2H0EA 1RURH 4QOKE 1MH5A 3FSOA 2QT6A 4EXQA 2F54A 3QG6B 3M6YA 3AIUA 2IQ9L 2O5YL 4JK0D 5KVDE 2EIEA 2EXOA 3W7MA 3VILA 2AMUA 4LPWA 4NRSA 1C1EH 1QRNE 3WKML 1T5WA 1FZMA 4MPQA 2FB3A 5LDSA 3QWNA 4NOFA 3STPA 3WLWD 3AU6A 5L0QC 2OWWA 4IZGA 3UABA 3VFLA 3F12B 4RZBA 5EU9A 3ZTEA 4FCAA 5E08H 1XGRA 2YUXA 3IM1A 1AQFA 3OJGA 1R5VA 1I3GH 2OPJA 3MRFA 4YVUA 2EH8H 3UIYA 4P8UA 3GC5A 3PULA 1KTLB 4ZPVB 2DM7A 4PLJC 4U1IA 2PWUA 3BDBA 1I9JH 4XGZB 1HKVA 3NP4A 4S38A 1JJKA 4A6GA 4FNLH 2GI0A 3RJYA 1PZ1A 4HK3N 1XX9C 2FJFA 3M0YA 1XGTA 4H4IA 3DUUA 5DUBA 5B8CB 1ZLPA 1P1VA 2CBMA 1KM6A 2W95A 4HWBH 1NQBA 4AUUA 1J5OL 3NXFA 2DH2A 1FVEA 5K9QI 1AHMA 3CQKA 4J2MA 4HQVA 3GHPA 5J5DA 4IOSA 4OF7A 3WH5A 3CHSA 1GZQA 2VDQB 5DJCA 4UDTA 4MVBC 2AEPL 2ZYHA 4K3JH 5FACA 4V27A 1I60A 2ASHA 4H26A 4L9XA 4JRYD 1OSPL 2BFVH 3RWDB 3L95A 3FNKA 2GJXB 1E5NA 1FHGA 2NZIA 3VXRE 5DYOB 4HJGA 3UJEA 3VWKB 2VZUA 2GQ9A 1G9EA 4Q33A 3IJ7A 4AZCA 3MREA 5ILTH 4XCFL 2RH0A 1GWJA 4QNPF 3WD4A 3O3AB 3AAZB 3PL6D 2BBFA 3R43A 2XTSA 1W31A 4JKLA 1KTJA 2R23B 2X89A 4MM1A 3AO0A 4X8GA 4HH8A 2X9ZA 5LWYH 1KBLA 1UM4H 3CMGA 1A6TA 5EBMB 1K3UA 2Z9TA 3RVWD 4S1DD 1J05B 5EKYA 1BXNA 5DRCA 3QG7L 4X4ME 3ZZLA 4MDPA 1BEYH 2JALA 5DVOA 1ECEA 2XXFA 2WIIB 3GLCA 5FSEC 4X5RA 4BK5C 5IUCA 2PNDA 3VXUA 2BIOA 4EPEC 1L9TA 2EPKX 1RZIA 2GFTA 2IQTA 1XBRA 3FSAA 3R10A 1QLEL 2YJLA 3VXGA 3C2OA 1XYBA 3QXDB 2XBTA 4IGSA 3C5QA 1RZGA 3KPPB 2QTEA 3TEZA 4D9PA 3S42A 1JRBA 3GI9L 2O6EA 4ZQTA 3OAZH 3CHCA 3T4YA 4I8DA 5IEKB 4TVPL 3DXAD 1UOZA 4LAKA 4OVXA 3S6TA 4PB9H 4I90A 4H1LA 3NCJL 5DD3H 4GQ0A 1IGMH 1C5BL 5F3BA 4N02A 3DUSA 4ECLA 4PWFA 3BLPX 4LMQI 5IFAL 1SXSA 2MTAA 3WMSA 2DQIH 3VYLA 2J2ZA 4WEVX 3NEHA 3TURA 3A4DA 3F64A 1U3ZA 1I7TA 3IGAB 5MKGB 4U6HB 1LZOA 2GUBA 3RDTC 1GTEA 1W2PA 2VDOB 3KD4A 4U1MA 3NEEA 3MNVB 1BBDL 3WGVB 5G4WA 1LBFA 5AHNA 4JQVC 3WOVA 3IS1X 4C6BA 1QOPA 1PXGA 1SO4A 1WCBB 2F9RA 3HFFA 1DBKH 3WD3A 3DX7B 2Q9OA 5E4IA 2ZNXA 1OFEA 2ENSA 2VDQH 4NG3A 2NNRA 1TZZA 1QEXA 2X0YA 3ALWA 4DP7X 1BYOA 4E4UA 1XIJA 3E0GA 4QY8A 5EU7C 1O7VA 3K6OA 3R0UA 5KN5B 4XWOC 4ZD3H 1SDAB 5E99H 4Q7NA 4H9XA 3DECA 3GXIA 3AMGA 4L64A 2ZUMA 5EB8A 3KS6A 4KI5C 3MHGA 3OODA 4MD4A 4ALAL 1GVOA 4O2FA 2C3HA 3ATZA 3QIUC 1YQ2A 3QIBD 4ZSOB 5TH2A 3K1KC 1CFQA 3KPSE 2V8MA 2BRQA 3LCXA 1N7ML 1E9PA 3WFCH 3GVGA 1FO0B 1JNNL 4AQAB 1MJ8L 4YR6A 3GHRA 4YC2B 4KKQA 1JF5A 1D6VL 1WBHA 1J2WA 3AWEA 3H7BB 3NTCL 3EEZA 5CD5D 2LT9A 4CMMA 3IF1B 1UQYA 4Q0XL 1SN5A 3O2WL 3F4CA 4F8XA 1KPVA 4HX1B 2G97A 4F0MA 4RZCB 1ZT4B 3I9AA 2CKSA 3VI4A 5TTRA 4G7YH 1XG3A 4WDUA 1SMAA 4IWWA 1EO8L 3JV4B 3NIDB 2X4UA 3UJRA 3B8SA 5JZ7C 2R0LL 4AQ8C 4JGUA 4ILDA 1FYTD 1ND0B 4Q6XA 1TTBA 2QQKL 1VAHA 3MXVH 2I57A 2DQHL 3FQNB 1KM0A 5JH1A 3K0WA 3MCYA 3TN0B 5HUOA 2P5WB 3VOHA 3ULVL 2EJ1A 2PP7A 3QOMA 5SWZB 3DOPA 3WG6A 4NQDA 4E0RB 1XR9A 4OLVH 4BIKA 43C9B 2Y1YA 2V2WA 1JNHA 2Q3ZA 4QXGL 3N44B 3LRHA 4WFED 4ENZA 1WVZA 5GRYA 1RUQH 3DNKA 5GZNA 4RGND 1SFTA 1XT5A 1M9HA 4CNNA 4TO8A 1QNVA 4HIHB 2UZ9A 2ERJB 1AE6L 1MQRA 4WRLA 1NKRA 5CEZD 5KWYC 1YPZB 5HYQA 1KFBA 5GGVH 4RRPG 2CNZA 3IDUA 3L9BA 4POZC 4YH6A 2QPEB 4QRPB 1AQDB 3R06A 2FNWA 2NY3D 2GEEA 1LUCB 4KKLC 3BTNA 4LNYA 1VKXB 1CW2A 4Z7VF 4IRSA 3BYYA 5AB0A 4ZOBA 5IJVB 4A22A 1FWXA 3V4PL 1MYRA 2I5QA 3WY3A 2OP4H 4H83A 5BS0A 3WE6A 1OFQA 3RX2A 3BPOC 4XCCL 4Q9RL 1CK0L 5IHSA 4M6UA 2DUXA 1ZRQA 5L7XH 1MRCL 5IBTH 2C34A 3KPLA 4Y5XC 3P8IA 3W4RA 2VEKA 2JKLA 1NOFA 5I1HL 1VDGA 2F54D 1ICQA 3P2VA 1LE9A 3VTTA 3L3KB 2AXWA 5JBEA 4X2RA 1BMGA 8RUCA 1BEXA 4K9EH 2GSMB 2CBVA 5EUKB 4KJPD 2XGBA 1OM9A 2GITA 5LYRA 5DHVH 3L4TA 3CXDH 5I3DA 3X1BA 2ZCLH 5DJ6A 1A5UA 1E6NA 1ZJAA 4J2QA 1I7UA 4GI8A 2P5EE 3VFMB 4R9XA 3TBVA 1NBYA 1AO7A 5I00A 1UMLA 4NPJA 3T0VA 2XWJB 3KOWA 1SBBA 1DWAM 1U8OA 1OAQH 4HOMA 4JFFE 2G50A 2A3EA 2Z91B 4FC3E 1CPUA 2OMZA 2O9OA 2DJ4A 1GG1A 2QEZA 2XH4A 2ZADA 4O57A 1S5WA 1IFHH 1PZSA 4PMZA 1U8HB 3WQWA 3FA4A 4E5XB 2F8OA 3SDDC 3ERPA 2QSCL 1BD0A 2A4AA 3DGRA 2XFGB 4Q32A 2LLGA 5H8UA 2WNZA 2XVPA 3FAXA 4ZMVA 1ZU8A 2IJ0C 1MMFA 3CLFH 4K8EA 3URAA 2R8SL 3RFZA 2ODHA 5KITA 3TEYA 3HE7C 2NY5H 3DK0A 1GSKA 4F57H 4AUBA 4F7CB 1I8MA 2OSXA 1EJOH 2TPSA 2XTJB 1AZBA 4TOYL 6PTDA 1XCWA 2OW6A 3GSWB 4L9ZA 1GZPA 3NSXA 1FL5B 4JM2F 2ZG3A 1RUMH 4R5EA 3DGGB 4IOSD 4RMUA 2XFWA 5XIAA 3MUJA 1Q45A 2KMWA 1NGXB 5TGBB 1JZ8A 1JYVA 4NZUL 3SE3C 2Q20A 4R26L 5E24E 1BIHA 4M4RB 5IB3B 1NCWL 3AWGA 4W8LA 3QFJE 4MKVA 2ZA3A 4RL3A 5I71B 4L3EE 3HPLB 3QG6A 3H2OA 4ABQA 2X1RA 5JUVA 4DKFL 3M7WA 3RPTA 9RUBA 3GAYA 3WMCA 3ABSA 4PV8B 1R3LA 4PB0L 1VFLA 4L5FL 4OLYL 3L65A 4HK3J 3LZNA 3S36H 4HG4J 4RDQG 2X89D 3EA1A 4IIQB 1WGOA 4XD3A 2J8UF 2ZUYA 1CI1A 1I4NA 3BQUC 4JQXA 2CLPA 2H0FA 3WGUB 3F12A 1YEGH 1PZAA 1VCGA 2QLYA 3TVMB 3BWAB 3C6LC 1MSSA 2EH7H 2XQYK 4BF7A 1Z3GL 4R4FL 3HPJB 4CC4C 1KTLA 4ZPVA 4L4OA 2EEBA 1UZ8B 4M80A 3UGEA 4XGZA 1KBGL 3VXUD 1MCPH 2QSQA 3W57A 2O6PA 4QDPA 4ERSL 4FI6A 4Y9CA 5B8CA 5E1GA 2JXMB 3A47A 1W5NA 3T8VA 5EN3A 3L0KA 3D05A 4ZX4A 4LMQE 3UBXI 5G5IA 4PGZA 1HKWA 3PJSB 3WLNA 4WF7A 5ETUB 3WFBL 2I5GA 3AZRA 1OD9A 4TQTA 4Y8FA 3KRSA 1HVQA 5DC9B 3H8NA 3NJVA 3EX3A 4FABL 3PZNA 1RZPA 2IVFC 2DSUA 5T3XL 5FA3B 4A8LA 3B2VH 2WLHA 5D1ZA 3CU1A 2EEAA 4GIAA 2ISFA 4S3CA 4B3LA 5DQPA 3RWDA 2EDEA 4FF9A 2GJXA 1B3JA 2DW6A 3HW7A 3FSVA 1CC3A 3MDUA 4XT1C 5DYOA 2Z00A 3VWKA 4FQJL 2NT1A 1TTCA 2VM9A 5MERB 4AL8C 1EEYA 1LDCA 2V9RA 3MLXH 3CSYB 2ZYSA 2VMJA 3O3AA 4GYKA 3AAZA 4AV5A 4DKAA 4G8GE 1Z8AA 2AJXL 2R23A 4LUJA 3TLRA 2Z64C 2Z8WC 2MOQA 1MQQA 5EBMA 3TNMB 3EBGA 2B5IC 1Q66A 4JHVA 1J05A 3FC8A 1OCJA 5AG9A 4RISH 1EANA 2VDMB 5I75C 4M51A 3WEBA 2J8GA 4PGLA 2HROA 1E9ZB 1U30A 1KJ2B 3SBQA 2WIIA 3VOFA 3SZ6A 4OGZA 4MZ3A 4FF7A 2PRMA 2O4MA 1NMBH 1OF6A 2PLKA 1OANA 1REQA 3UY7A 4TSAH 4JQ2A 5CLYA 1OBAA 2O4EA 4GO9A 1ZGLM 2XH0A 3QXDA 1AZRA 4YXLL 2H6RA 1XGZA 4K5MA 4KH9A 3KPPA 3UZ5A 1KLUB 2GSGB 1RV6X 3QPZA 4KBPA 3U1PA 5AY7A 4N0UE 1E6JL 4KMTL 4IKKA 3UZYA 5IEKA 1T7XA 1ACZA 3DKLA 2Z2BA 4O0QA 3TONA 4E42B 2VC5A 4BEQA 3SGEH 3HQNA 4DZ8B 4F8NA 1R0AL 5FO8B 1RUPH 2X3BA 4LEEA 1JRHI 1AW2A 4DJMA 4DEFA 1FNHA 2BIQA 1A5NC 2X7LB 5EIIG 1EF3A 4LIQL 4OFIA 4BEIA 2F74B 4U6HA 4DW2H 4JNZA 3S9DB 2E6DA 4NGHL 3A4AA 4XHJC 5I6OA 1JTTA 5KBNC 1KELH 3MNVA 1J9SA 5HVGB 1RU9L 3C08H 4OT1L 2BZ7A 4M7KL 1WCBA 3L9EA 3DX7A 4GSXA 4ODVL 2VLLB 4I3RH 4D8ZA 1F3EA 4NQDD 5C8JB 2CMRL 3V6ZB 1SFLA 2GYSA 4IRJB 3G04B 3MRBB 4D72A 4GRLB 1JCYA 5DC4B 4BZ2L 1A6AB 4FLSA 1EGJH 1V7NL 1SXCA 4P9HC 5KN5A 1MFBH 5GZND 1OAZL 1F2JA 1I0DA 2EVHA 4WKFA 4P8QA 2C9RA 2KAUC 2PTZA 4F9DA 3GDMA 1SY6L 2A6KA 1AKPA 5B4MC 3LEVH 3EHBD 1JPIA 3AU2A 5IFJB 4YL2A 4O8RA 4G6KL 1WXZA 4DUOA 1XL4A 4ZSOA 3IIPA 2QHRL 2CETA 4C47A 1FO0A 4AQAA 3TAKA 5DU7A 4DGUA 1D7FA 2XCMC 4NJAL 2E1DA 1E5ZA 1FWHC 3H7BA 4M82A 4IRSD 4PQXA 2QUTA 2JJTA 4JX5A 2R0KL 3IF1A 5HHOE 4ENEC 1KJ2H 3BCFA 3W74A 4HX1A 1FDJA 5BS0D 1A7PL 4BZ1L 4RZCA 3BUIA 1YTDA 1ZT4A 3IGHX 2OK0H 4AG0A 4PJAE 4Q7BA 1DVFC 4A37A 1AGFA 1Q13A 2EIKB 1MDTA 2DJLA 1ONRA 3VD9A 3JV4A 4AZ8B 2D9QB 1QBMH 5F7DB 1X5GA 1ND0A 3QRFM 3DROA 4C5ZA 2E6YA 5LKNA 3EJZD 1JFHA 5ERWB 3EWDA 1J5CA 1F4XH 1OG6A 3TN0A 1N5YL 5D37A 1KCLA 3ZMNA 2ADAA 5SWZA 3P11L 2MCMA 4E0RA 1TETL 2ZRXA 1W17A 4AHOA 2R59A 2Q8AH 4M56A 1AO7D 43C9A 3QPYA 3UWYA 4AIBA 2V68A 5LBGA 4AVOA 2PD5A 4N5ED 3IBOA 1HXJA 1IEBB 2NUWA 3FN9A 1YVLA 4LSBA 2QPSA 1M3UA 4HIHA 2FUQA 1KKRA 1AGEB 2PBGA 5ALBL 2IC2A 2PKDA 1YPZA 2BDQA 5PAZA 1KWGA 1NGQL 3O0LA 4LBSA 1NUGA 1E9YB 4QRPA 1R30A 2WYTA 3GTNA 3ZJ8A 1A3HA 1J5TA 4C4KT 3BD5A 5I8CB 1LUCA 4QSHA 3MCLL 3N6QA 5I6SA 5K5YA 1VKXA 1YHPA 5DJDB 3Q2CA 2OZ8A 4JQ1A 4K2UH 3CVHL 4QLRA 5IJVA 3BUTA 4N90D 3I3BA 4WO4C 2D31B 2NSXA 1F61A 1XUZA 3IWPA 4UILH 1CQKA 1UUSA 2H6UA 2X0WA 4IJTA 4NIRA 1PSKH 3OKDB 2VDHA 4UNKA 2UX6A 5BNXD 2QQNH 2X6AA 4KK9D 3L3KA 2APSA 3SE4A 3QY6A 2A7PA 4U3XA 4NFCA 1M1SA 5EUKA 3ULVE 3QYQA 1TVPA 1W8NA 2BHUA 5C7XL 1EAOA 4JN8A 3HFML 3BEWB 3VFMA 4O2CB 3PUGA 3O2VH 1I1YB 2XWJA 1GAFL 2PO6C 1WQ5A 2HVJB 2Z91A 3GNPA 1FWGC 4X8JB 4P7RA 1F4HA 3K1DA 1KGCE 2V2CA 4IU3B 4NKMB 4JUSA 3LU2A 4R4NC 3VW3H 3FJTA 1WBXB 5BZZA 2B20A 2JTDA 3QXTA 1U8HA 3BGMB 5I23A 4E5XA 1X5IA 3V5KB 3ZY7A 2E3VA 4MAYB 3KP1A 3WUWG 4F9LA 4YE4L 2BHYA 3E3QC 1ZALA 1OCBA 2ZP9A 1Q90A 1JNEA 3A22A 4REQA 3Q2LA 4F7CA 4HWZB 1TU2B 5KVDL 2Y5EA 4YDJB 4FXTA 3GSWA 1DBAH 2RUSA 5HATA 2VXQL 1CLYH 1FL5A 1T4KB 4OCSL 3S2NA 3KVMA 1OP4A 3DGGA 3CQIA 3UDWA 1RXOB 4OH2A 4LSSH 4Y5YC 2VXNA 5AL8A 3SSGA 1NGXA 5TGBA 5KTLA 3N1PC 4FQ2H 2OR9H 5D1ZD 4M4RA 5IB3A 5CJNA 5TE6L 1DDHB 5FJTA 5AVQB 2JFCA 1ZEAL 3HPLA 4KXZI 3KR3L 3VWKD 4C6OA 2Y7OA 5IGXH 1U8QA 3VD1A 1J5HA 4WGHA 4PV8A 4Y7MA 3L21A 4IICA 5IQ7L 2EJAA 4LASL 1QPXA 3D2TA 1CLOL 1DVUA 1KPUB 1HIMH 4IIQA 4UTWA 3LBOA 3OAWA 4EI0A 5REQB 2JQZA 4LBUA 4X7DC 5GS0H 3WK1A 3BEVB 1FNFA 4TULH 2EO9A 5C9K