1HVQA

Crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HEVAMINE A
publication title Crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor.
pubmed doi rcsb
total genus 97
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 1994-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hvqA00
3N11A 3WKZA 4M80A 3VIJA 3A47A 1XYFA 2BNJA 1TCMA 2V5DA 3WFZA 5CPTA 3QHOA 1UR8A 5IFTA 2WVSA 4YHEA 3KWXA 4B9YA 2HISA 3POCA 1BYDA 3GXIA 4GO8A 2PWHA 1P6WA 4TOQA 2QHAA 2VR5A 3ZIZA 2GDVA 3W0KA 3U5YA 3I3BA 1ISZA 2BVTA 3QGVA 5A69A 3PN8A 4Q7NA 4MJ2A 3TTQA 3VD7A 1HP5A 1UR1A 1NARA 2JF6A 5CJ5A 1GUVA 2BVYA 3UERA 1UKSA 1HVXA 5KEZA 3LPGA 2EJ1A 1HKMA 5A6AA 5BXTA 4GZIA 4ZENA 3EBVA 3DYPA 2XGBA 1W1TA 2QPSA 8A3HA 4KRTA 3LPFA 3UETA 4PEEA 3J7HA 1B3XA 3AHXA 3OA5A 4J3WA 1UZ4A 1X1NA 2YA2A 1NOFA 4AZ6A 1GNXA 2CITA 1HJWA 1UKTA 5HOSA 2VZSA 2G3JA 2ZUVA 2WVVA 4AD0A 3VNZA 3N1AA 3FN9A 2W63A 2EPKX 1QNPA 2IXVA 2V3DA 2V3GA 2Y8KA 1W9VA 3AHZA 3AMGA 2YLLA 1JF5A 1JAKA 3PZUA 2UWFA 1PX8A 2WC3A 1QI4A 1Q6FA 3OGRA 5ABFB 1IV8A 1CGWA 3WH8A 2VCAA 3MANA 1PX4A 3AHVA 3NYDA 1R7OA 3QOKA 1UYQA 4GZJA 5CXPA 1UR0A 2JIEA 5A8QA 1X6LA 1FOBA 4A3HA 3L4TA 2XSAA 1JZ2A 2E40A 4ZEPA 1U30A 3NSXA 1CXHA 1CGVA 4PUEA 3IK2A 1FH7A 2VCBA 3FAWA 3T2PA 4LXFA 2D2OA 2A3HA 3VX0A 4U3CA 4QLKA 5GNYA 4IPLA 2EPOA 2FGZA 2WMGA 2ZWZA 3ZT7A 4MDOA 1EQCA 2XYLA 4A3YA 1TUXA 4MNJA 1UWIA 3AIVA 1R86A 4CKQA 3WH5A 2VJXA 1OIFA 2WWDA 2VI0A 3WUEA 4UFJA 4W5ZA 5GQBA 1QNSA 1NQ6A 1E0XA 3GH5A 2VO5A 3AS1A 1BG9A 2GJRA 4DWSC 1JD7A 2YA1A 3U7VA 3SUSA 4XX6A 2J47A 3WD4A 4CU6A 3ARTA 1W9XA 1EDQA 1O7AA 1Z32X 1BSIA 1V0LA 5CZKA 4LQ1A 4AZIA 2O9PA 4P8WA 4E4PA 4IUGA 5LA1A 1J0JA 3L2MA 3LPOA 3BAJA 4HZ7A 3VU2A 1VJSA 3NSMA 1H5VA 1IZJA 3RM9A 2D22A 3GXDA 1IZKA 1J11A 3A4WA 1HL8A 3SCPA 1B30A 2E9BA 3PTMA 1J01A 5JIWA 1ZL1A 4U3AA 3BAXA 3NJ3A 2GJXB 4FLSA 3ZJ8A 3W6MA 1OBAA 2NW0A 3QHMA 1L8NA 4HA3A 4W8AA 3HMCA 1LG2A 3THDA 3GBEA 3CPUA 1E5NA 2JEPA 4GPNA 2WMIB 1BF2A 4JHOA 1V0MA 1CPUA 1GOKA 2A3AA 2ZXDA 4MDPA 3L4VA 4D6DA 1CTNA 4Q22A 5I3DA 2ZUTA 1QNQA 2HVMA 2XVPA 4UR9A 4F79A 4PSRA 4GXPA 1DWFM 1H49A 3WSUA 1AQHA 4BF7A 1Q6CA 1GONA 1TG7A 1JNDA 4HMEA 2VVSA 4W85A 1KWKA 1GZJA 3AIQA 2WK2A 1EXPA 2CBJA 9CGTA 1D3CA 4CN1A 3W29A 2G8ZA 3WNPA 1UH4A 1KCLA 2VC9A 5A94A 1UR4A 1UWQA 1WAWA 1FFRA 4QP0A 3BGAA 3G6LA 5A6KA 2F8QA 4WKAA 4OBRA 3WMCA 4P7RA 5FIPA 2XHYA 2XM1A 5LYRA 4QFUA 3A4AA 4KRUA 1A3HA 4J7RA 1E55A 2J7EA 2YJQA 1UD5A 4IISA 4HZ8A 3WD3A 4A4AA 1OD8A 1HIZA 4W89A 1M7XA 2XVKA 2C0HA 1J10A 5TD4A 3ARPA 1EQPA 1M01A 3L2LA 1W9DM 1Q4NX 2VCCA 4GI8A 4UZUA 1R8LA 1TA3B 2ZX5A 4NI3A 3TP4A 2XWDA 4DM1A 1D7FA 1OT2A 3MSGA 3VM5A 1GOQA 2WLZA 3M6DA 3B9DA 1WKYA 1OT1A 4MTVA 3K8MA 5BRPA 4Z2GA 4V2XA 3BCDA 3WEMA 4CU8A 2EPNA 2J4GA 1UOKA 3ZO9A 2CHOA 1K9TA 1UD2A 3KE0A 4QLJA 5D9PA 4D6HA 1BYAA 2ZXBA 1H41A 5EFFA 1TZ7A 1V3IA 1G01A 1W9BM 3OGVA 3TA9A 1K9DA 1UA3A 5BXPA 1V08A 2J62A 4CCEA 5IDIA 3MO4A 1W2PA 2VX5A 3CZGA 1KXHA 5HPOA 4L4PA 2ZIDA 5GNZA 5ECUA 2WSKA 3PZIA 3N15A 4CN4A 1V3MA 2CBVA 3GYCA 4NRSA 3EDEA 4B3KA 4OOUA 1B2YA 2F2HA 4W93A 3L4WA 4LYRA 5AC5A 1UWRA 1LL6A 4W7UA 3ARRA 1Y7VA 1VIWA 2EPLX 4AW7A 2X0HA 4PMUA 2ZXQA 3AZRA 1JFXA 3EDFA 3ZSSA 3SUVA 3WELA 3B9AA 2PC8A 4AZ7A 1OM0A 2WPGA 1QHOA 1ZJBA 3F5KA 5M03A 2XFYA 1B9ZA 4CD5A 2G3MA 2ZX8A 2WCSA 1E6NA 1UD8A 4JKMA 2GK1B 1F4HA 4DWSA 3KL0A 2ZOXA 3BLPX 4ACYA 3GBDA 3UR7A 3EMZA 2CERA 1V6YA 3ZQ9A 1YQ2A 3AFBA 4JKKA 1LF1A 4ZXLA 1QPKA 2UY2A 1QI5A 4M56A 4AD2A 1ZU8A 1JD9A 2BY1A 1EGZA 1XD0A 1LG1A 3WD1A 3N9KA 2WB5A 3VGEA 1GVYA 3CHCA 3F5LA 2WC4A 1V02A 3NSNA 5A6JA 1QNOA 3SEPA 3O2LA 5E70A 1DWGM 3WF4A 1ISXA 1SMDA 2JEQA 3VX1A 1E3ZA 1WDQA 3UESA 3MSDA 4D1IA 3AIWA 3VIGA 1PX3A 2WZHA 4J3XA 3NDZA 2E4TA 1WZAA 5A2CA 2C7FA 1XD1A 4TVDA 4HOZA 6A3HA 3FY1A 1KWGA 5D9NA 1SR0A 1W9UA 2XJ7A 1WDRA 3AMDA 4MB1A 1VFMA 6CGTA 3AMKA 3WN6A 1E9LA 1E1EA 1XH0A 4J27A 2YKKA 2YL5A 1B3VA 4P7OA 1E4IA 3OLDA 4GZEA 3WF3A 1VFFA 3QHNA 3T2OA 2WZIA 1WNOA 2Y24A 4BZYA 1XV8A 1EIBA 2JE8A 2CESA 5HPCA 3DECA 1UKQA 3OZOA 4WKHA 2BY3A 4K68A 3IJ7A 4JIEA 1E4MM 2YBUA 4D71A 2G4FA 2V3FA 1G5AA 3D5HA 7CGTA 1JAEA 1KBKA 4U5IA 1BHGA 1B3WA 3TTYA 2EQDA 5JBFA 3W82A 4XV0A 4DUXA 2XPKA 4P7QA 1CIUA 3MV01 1GHSA 3WNLA 1J12A 3ARVA 2PF0A 2O92A 4KGJA 2WVUA 1K9EA 5JUVA 1U33A 4JCMA 3CMJA 2FGLA 4EANA 1NP2A 2WLYA 3AS0A 4ACZB 5A2BA 1JYNA 2DH3A 4B9ZA 4TTUA 2WMHA 4NZCA 1CWYA 3PZGA 2RGMA 4XUYA 3AIUA 3VIMA 4M81A 3WF2A 3SCWA 1VBUA 1PBGA 2J8FA 4PMZA 3WH6A 2Z1KA 2D0HA 3KEHA 5EBAA 4UQDA 3WUFA 2WNWA 1PZ3A 5CSUA 5A6LA 1KQZA 1CDGA 4UFLA 1UR9A 1EO7A 5FCZA 3KL5A 2BXYA 1CEOA 3VD3A 3ARSA 3WEZA 4Z2LA 3CUGA 3II1A 2DPEA 4PYSA 1B3YA 3OIHA 4Z2JA 1XCXA 1KB3A 1MW2A 3AIRA 4AIOA 3GNOA 1KBBA 1W3KA 5F7UA 3PZNA 3WDJA 4H8HA 3VINA 4CVUA 3WBAA 4W87A 4LYPA 5D8ZA 4HOWA 4IPNB 3ZR5A 1G1YA 1E6XM 3GNPA 4M1RA 1OGSA 1UUQA 2CIPA 3ZJ6A 1V3HA 1GJUA 4OBSA 2CBIA 3G6MA 1WO2A 2OSYA 4OKDA 2FHCA 1VEMA 1RPKA 4U33A 4PTMA 4YPJA 2WANA 2XVGA 3GZAA 4MADA 3SURA 2ZUNA 1W1VA 1YHTA 1ISVA 2WMJA 4KMQA 4TX8A 4C7DA 4JFVA 2VX4A 1PIFA 2YDQA 1GQLA 5BXRA 3CH9A 4AD1A 4DM2A 2BY0A 2OYLA 3CZ8A 1N82A 3LPPA 2OWCA 1VBRA 2FHFA 3JUGA 1JXKA 5C70A 1UD6A 4IM4A 1CGUA 4LYQA 2OSWA 3T2QA 4AZBA 1I75A 4PCSA 1US3A 4JFTA 2DT3A 4BQ5A 4PRWA 4AY1A 1WB0A 1TR1A 2W5FA 5M5DA 1EOMA 4J3SA 2V5CA 5ABGA 2XWEA 3BAIA 5BCAA 3ZMRA 5D9OA 1E3XA 4FK9A 1OINA 3AI0A 4JL2A 1JDAA 2Z1SA 1JXJA 1JG9A 1V6WA 3ZR6A 4DUWA 3WBEA 1HKKA 2E3ZA 3VIOA 2GJXA 5E6YA 4V28A 1NH6A 3UG4A 1ITCA 1QBAA 3NDYA 4RL3A 7TAAA 3VD9A 2G3NA 3CHEA 2WMFA 2JF7A 1EDGA 3TTSA 2JIWA 1NWSA 2J7BA 2WYSA 1H09A 1V6UA 4AWEA 2WMIA 2VQUA 3WNMA 2WWCA 1WP6A 3OLIA 1K6AA 3WENA 1QVBA 2VNCA 3UCQA 4ATWA 2BHZA 2Y2WA 1SMAA 4HPHA 4RE2A 1LWJA 4U2ZA 3EDDA 5FKYA 3DC0A 4QCFA 1GOIA 3HU7A 3AOFA 4CD8A 1PEZA 5CPSA 1VFUA 3AHTA 2PB1A 5GNXA 3ZT6A 4GI6A 5EB8A 2W4XA 2WBKA 3VNYA 1NOUA 3PZMA 1E0WA 2WBGA 3GTNA 4PN2A 3VIKA 1OD0A 1LJYA 2DSZA 2XIBA 1UD3A 2CPUA 2CBUA 5I77A 2ZUUA 1GW1A 5AC4A 4C7FA 3BC9A 2QMJA 2VX7A 3CLWA 5M17A 4E8DA 1O6IA 2YIHA 1CNVA 3WQVA 1B31A 2Y8VA 2Y5EA 3WH9A 1NWRA 3SCUA 1GQKA 2MANA 1ITXA 2AAAA 4U31A 3K1DA 3MKKA 1C3FA 3MUY1 4PUDA 1C93A 2PBGA 3MS8A 3VILA 1MW1A 1WE5A 3MU7A 2WAGA 3GDBA 1JZ4A 4D1JA 1W32A 1XCWA 1TA3A 2J8GA 4KWUA 5JIPA 5CG0A 1W3JA 3W53A 4GINA 2OYKA 3BLKA 1FHDA 5EMYA 4QLLA 2E9MA 3VIFA 1HJQA 3L4XA 1E5JA 1HKIA 4HA4A 3AMCA 5I5RA 1VAHA 1JIBA 4UQAA 1QHZA 4EK7A 2BHYA 4B16A 2CEQA 4AD4A 2D3LA 1UKPA 1Q6DA 2AMGA 3CUHA 2XFRA 2YA0A 1D2KA 3VD4A 4HU0A 2VURA 1CXLA 1C92A 2WMKA 1H2JA 3A3HA 3W37A 3WDQA 1H11A 1BG4A 2CCRA 4AZHA 1ZS2A 1V0KA 4D6JA 1ISYA 3WD0A 2BV9A 2WKGA 3BAWA 3PTQA 1FA2A 5A95A 1PAMA 4CVWA 4P8UA 1KR0A 1W1YA 5M3WA 3RCNA 4ZE5A 1HP4A 3VIIA 3FHAA 2BFGA 1G94A 3N04A 2X2YA 3IJ9A 1CXIA 1HX0A 3ARUA 5CGTA 4CD7A 1CZ1A 3CTTA 4H04A 3GH7A 3WMBA 2D1ZA 2GFTA 3RPMA 5I6SA 2XTKA 1ZBWA 2CKSA 4MB3A 4UOZA 3AICA 1UQYA 1OIMA 1R85A 4J28A 1AQ0A 1JNEA 3SCVA 1B1YA 5FL0A 5C8BB 2VZOA 1KXVA 3CGTA 4H2CA 2VTFA 3CHFA 1H3GA 2W66A 1JZ8A 3M46A 1EHNA 3I3DA 2AOSA 4UCFA 1MQRA 5HDRA 1XHGA 4CGTA 1FHLA 1WZLA 2GK1A 1VENA 5BRQA 1CGTA 1H0IA 4E2OA 1R87A 2DT0A 1KXTA 2TAAA 1BYBA 2DEPA 1G0CA 3UEQA 1MW3A 3MMUA 3MUZ1 4FMVA 4HMDA 3ALGA 3VKKA 1PJ9A 4AC1X 4UQEA 1FP9A 2ZE0A 2J7HA 1ECEA 5DF0A 1LQ0A 2XVNA 3DHPA 3WH7A 3PZTA 3WL0A 1KFWA 1CXFA 2PWDA 4UFHA 1XGZA 1BGAA 1ZBKA 3F5JA 5BROA 4D6IA 6TAAA 3AIEA 4PTVA 2J78A 2VX6A 3WDHA 4QAWA 2RGLA 2XGIA 1NWUA 1UH2A 1CXKA 2VOTA 3CMGA 1CLXA 1DWJM 3RM4A 3UG3A 1A47A 5FD0A 4J3TA 1HL9A 4UOQA 4PMVA 4W88A 2YBTA 3AQUA 3QR3A 2O9OA 3RO8A 5HBFA 1W9PA 5AYBA 1TE1A 2NSXA 1C91A 1HJSA 1OSEA 3DYOA 5AYIA 2ZICA 1KXQA 2ZUWA 4AIUA 3OBAA 2PBOA 2YLAA 4WK9A 1JI1A 3CZJA 3W25A 3U57A 1NP0A 2WVTA 4CUCA 1HNYA 3AYSA 3T08A 4U2YA 3ARWA 4Z2KA 1E72M 4MAVA 4ZXOA 1OGBA 2YDSA 3GH4A 2X09A 3N17A 5A3HA 1DP0A 4F8XA 2DQXA 2FH8A 4UZSA 1WZKA 3ZSTA 1CENA 2Y4SA 1XYZA 2XSBA 4P7LA 2FDMA 2FH6A 3GXFA 4PTWA 1NWTA 3AISA 1WDSA 2VT0A 1NM9A 2QV4A 2OWXA 4CD6A 3VMPA 3NCOA 5LA2A 1SFSA 3PZOA 3BAKA 1M53A 1V6VA 4UQCA 4AEEA 4JHZA 1TMQA 3L4UA 1JZ7A 3B9EA 2VL4A 3MMWA 3VGBA 4NRRA 4XZBA 4H8VA 1MQPA 5LA0A 2XVLA 4ACZA 5DMYA 4FF5A 1UA7A 3AXXA 4KH2A 3U7BA 5A6BD 2WW5A 5E0FA 3OGSA 3BAYA 4J3VA 3UR8A 1JFHA 4JAWA 4HOXA 2NT1A 3AIBA 3CO4A 4BQ2A 1XC6A 1JL8A 2VZTA 1ZB5A 2X1IA 2BXZA 3VIPA 1ODUA 4HP5A 1DWHM 5A8OA 4FLQA 2J74A 4HPGA 3WFLA 4DWSD 3DYMA 1XH1A 5KZ6A 1XSJA 4W7VA 2V38A 3QOMA 1VF8A 3SCSA 3A6OA 1WCGA 3W24A 3WDRA 1UKOA 3RIKA 1QW9A 3AROA 2IXUA 4MPKA 2J25A 4OUEA 2GVYA 5A8MA 1QBBA 3TOPA 1IT0A 2WZEA 1H1NA 4MNLA 1MXGA 3ZOAA 3VOCA 3OB8A 1CLVA 1TVNA 1VJZA 2DSKA 4BA0A 5JBEA 1BQCA 3WY1A 1GPFA 4L4OA 2PWFA 4AZCB 3K4DA 3PTKA 1AMYA 2J79A 3VGGA 3D3AA 3FW6A 1E6QM 1HKJA 2ESCA 1E6SM 3MUIA 4LX4A 2QPUA 3DHUA 1C90A 1V03A 1KGWA 3WQ5A 1DTUA 2FHBA 1JGIA 2EEXA 3RM8A 2X8RA 4MNMA 4P8VA 2UY5A 5ABFA 1V02E 3IANA 5CLTA 5E09A 2XIIA 2JFEX 3L4YA 2QLYA 3VDCA 1CGYA 1LWHA 3RILA 4FLOA 4MJ4A 1W3HA 4PMRA 1XSKA 4D6GA 1XRVA 2YDRA 1RP8A 1QOXA 3W28A 4D72A 1X6NA 1Q6EA 4UQ9A 3A4XA 4PMQA 2PI6A 5BXSA 2ZUMA 1BTCA 2CNCA 4AD5A 4KGLA 1G9HA 4E8CA 2J75A 1ZBCA 4GQRA 1GQIA 1I1WA 3BSGA 3SIMA 2Q8XA 1M03A 4JCLA 1UWUA 4OOZA 1UH3A 3SCTA 3SUUA 5IHRA 3T0AA 3RJXA 1C8XA 5CLWA 7A3HA 5I0DA 4N0RA 3PZ9A 5CSYA 1HT6A 1EOKA 1GCYA 2QMKA 3E1F1 4HZ6A 3TTOA 3WDIA 3HJEA 4P8XA 4B15A 4BS0A 2VMFA 3TONA 3VM7A 4B3LA 1S46A 5I2UA 4AISA 1E70M 2EBNA 1DEDA 4TVCA 2A3BA 1UR2A 3ZJKA 3ZJ7A 2A3EA 4AEFA 1V3KA 3VGFA 2ZXAA 4CCCA 5A6MA 1M04A 3WNNA 1US2A 2WKLA 3ARXA 3W38A 2VRQA 1V3LA 3T0DA 1EHAA 2BY2A 4PCTA 1UWTA 1JDCA 2CHNA 1Q6GA 4BCEA 1GOWA 1BFNA 4MB4A 1TFVA 2VR4A 1ZBVA 2PWEA 2E8ZA 3EYPA 3L4ZA 2WXDM 1GQJA 1E4LA 1B0IA 3UG5A 2O9TA 3OG2A 2VQTA 2WVVB 4RE3A 1C7TA 3FNDA 2VVNA 2B31A 4OZOA 1BYCA 1VEPA 1E71M 1QW8A 4ATLA 1U2YA 4CN6A 1WPCA 3VDHA 4TXEA 3VDAA 1BVZA 1BVNP 1JYWA 1XSIA 1J9YA 4FLRA 1JZ5A 1JZ3A 4UNIA 4AZGA 3AZTA 1LL4A 4WKFA 4R5EA 3O6AA 1ESWA 4W8LA 4URIA 3EMQA 1BPLB 1BLIA 4GIAA 4Z2IA 3WQWA 1W3LA 2D3NA 3CZLA 1C7SA 4NSBA 2BS9A 3THCA 5JBDA 3AJ7A 1LLOA 1J18A 3I3EA 4JZ5A 2XM2A 3VGDA 4W86A 4ATDA 4WJXA 4X9YA 2EO7A 2X0YA 3BSHA 2G3IA 4V27A 3S2CA 4LPCA 1CYGA 2ZX6A 4JFSA 1L0PA 2CXGA 4PMNA 4GQQA 1W1PA 2UY4A 5E0CA 3VDBA 2EXOA 4GI9A 4HTYA 1FH9A 3VIHA 2CKRA 1QI0A 2D24A 3RMEA 2C8NA 4BQ4A 3M7SA 4U5KA 3N12A 3AS2A 1C8QA 3SUTA 3W6LA 5CGMA 4LGXA 2ZX9A 5EFDA 2BHUA 3ECQA 5ABEA 4UTFA 3T0BA 2GSJA 2QF8A 4D6CA 1GOOA 4JFUA 5I79A 1HJVA 1OGGA 1GVIA 3VTRA 1QI3A 5BWFA 3SCQA 1J0HA 1R7AA 5E6ZA 1UWSA 1KGUA 2D20A 4HMCA 3WF0A 3VD5A 3S6TA 1PZ2A 2DIEA 3ARZA 3AHYA 4UFIA 4WSJA 2WC7A 3POHA 2OLHA 4CU7A 1KR1A 4H8UA 5A1AA 4TX6A 3SUWA 5FOOA 1FH8A 3NUKA 3CHDA 5E9AA 3BH4A 1E6ZA 1BAGA 4WIWA 1E6RA 2V3EA 4GO9A 4WF7A 2ZWYA 1DWAM 4CCDA 1E0VA 1MWOA 1MFUA 4NF7A 5HNNA 5ABHA 2JALA 2W62A 2J7GA 1VB9A 4F9DA 1QNRA 1J0KA 4AYSA 4X0VA 1V6XA 4PMDA 5C71A 3W27A 3PZVA 4P7NA 3NIYA 4Y7EA 1C8YA 2J7DA 3EDJA 8CGTA 1E43A 2DSWA 1DHKA 3BCFA 1W2VA 3W81A 1E4NA 1HJUA 1WDPA 4JFWA 3APGA 4S3KA 1GOMA 3RJYA 4H7VA 2W91A 4D6FA 2YL6A 1KQYA 2YL8A 3GNRA 5IFPA 3PZQA 1V0NA 3WQ4A 3GM8A 3VMOA 1BGGA 4S3JA 5D8WA 4UOJA 4HU8A 4W7WA 5I23A 1KGXA 1UQZA 1AVAA 1JDDA 3PBGA 4PMYA 1I1XA 4PMOA 5BYWA 1E1FA 4D6EA 1E40A 2BVDA 3VO0A 3N13A 5I78A 3BMWA 3CBWA 5HXMA 1NOWA 3WF1A 2OWWA 4XZWA 4M29A 3WDPP 3PHAA 1VFOA 2GJPA 1QHPA 1CBGA 5D4YA 1F4AA 1ZJAA 4W84A 4ZFMA 1MVYA 1EO5A 2YOCA 4W8BA 3WUBA 2ZX7A 2E9LA 2WCAA 5A8PA 4F66A 2NT0A 2XUCA 3WIJA 3WNOA 2X05A 1HJXA 2DSUA 5IXEA 1V3JA 3VGHA 4W5UA 1JYXA 1SYTA 1EA9C 4RE4A 1H0GA 1CECA 5I24A 3CUIA 3VUPA 2W67A 1WZMA 1UZ1A 5A2AA 3CZEA 2XFFA 2DT2A 3BXWA 3WUGA 4AIEA 3ZM8A 4X0NA 2J77A 1MYRA 1ODZA 3VMNA 4F9JA 3M07A 3WQ6A 4M24A 5A6SA 1MXDA 2VRJA 3AYRA 1JZ6A 4GKLA 1GORA 4TVUA 4PBGA 2WHKA 1MFVA 2PWGA 4QDMA 5A6BA 2OYMA 4TUFA 1PPIA 4QCEA 2F61A 3AXHA 2WHMA 4EAMA 1CXEA 2IUZA 1UD4A 3T09A 1MW0A 4PTXA 2EPMX 4PSPA 3FHQA 5CPQA 3CUFA 1FP8A 4M8UA 3W26A 3CZKA 2UY3A 2DGAA 4YN5A 1K9FA 3W4RA 1RP9A 4ML4A 1EH9A 2CETA 3WNKA 2CYGA 2DIJA 3VPLA 4AMCA 1CGXA 1FFQA 1B3ZA 3MUAA 2VRKA 3HN3A 4EKJA 4C7GA 3GXMA 2W92A 1H4PA 4ZE4A 2D0FA 4JKLA 2XG9A 4OJYA 1J0YA 1UHVA 3MMDA 2WSPA 4YHGA 5DFAA 1OWQA 3F4VA 2ZUSA 3K8KA 1EDTA 2GUYA 4EE9A 1J0ZA 5AY7A 4UFMA 1VEOA 2E0PA 3OLEA 5DT7A 3K8LA 4R27A 3ARQA 5D9MA 5CQ1A 4H41A 3MV11 4HA1A 1UG6A 3K46A 1TVPA 1PIGA 2GDUA 3KL3A 3O9NA 3AMLA 1JF6A 4BQ3A 4AZ5A 3CUJA 4DWSB 5DEZA 3SCRA 1JYVA 1E73M 4WSKA 1HN1A 3FAXA 1J0IA 2OSXA 2J7FA 1HXJA 2VUYA 2D0GA 3EDKA 1GHRA 3K4AA 1B90A 3VVGA 1E56A 3SCOA 4M82A 1HVQA 4MAZA 4Z2HA 3LMYA 4AD3A 4UFKA 3WL1A 4AZCA 1E6PA 1VRXA 3OLGA 1E15A 2DSVA 2WHLA 4WLCA 3IJ8A 5DO8A 1KCKA 4DUVA 3B8SA 3IAPA 4TTGA 2J7CA 3AZSA 1DWIM 3WMSA 1W91A 1GJWA 3FXYA 3SCNA 3WD2A 2DT1A 2DDXA 2WCGA 5FL1A 4JL1A 2YL9A 1XH2A 2VZVA 4UQBA 1AQMA 3ARYA 1MQQA 3EMCA 4CD4A 5A8NA 1OB0A 4J3UA 2D23A 1RH9A 2E8YA 3WEOA 5IHSA 1OCQA 2O9RA 2G41A 5DT5A 3U5UA 3WQ8A 3CIVA 1LL7A 4OIFA 1JI2A 3BMVA 1ISWA 2A3CA 1HF6A 3IAQA 4N42A 4PMXA 1QI2A 2WM0A 3OZPA 3ZT5A 2VZUA 3ALFA 3AXIA 3KZSA 3AS3A 4XB3A 2WHJA 3RDKA 2DH2A 4MB5A 2W61A 1RD6A 3N18A 4MNKA 5GPRA 4AXNA
chains in the Genus database with same CATH superfamily
3N11A 3C3UA 2DW6A 2Z24A 1TCMA 3VNKA 2PRHA 3QHOA 3KWXA 4JTAA 2HISA 1EA0A 2WJFA 3W2LA 3LLXA 4G7EB 4UMBA 4O0KA 1BEUA 1P6WA 3QV9A 4FA3A 1XR2A 1VFHA 3W0KA 2BVTA 4O8RA 4UMCA 5A69A 3TZNA 5J04A 4Q7NA 4RV3A 3W74A 4K1GA 3QFWA 4UIOA 1XKJA 5CJ5A 1GUVA 1HVXA 3DDMA 2BOFX 1OK6A 3DFNA 3UZ5A 4AU0A 3VNJA 4DQWA 5BXTA 2WNQA 1ZCOA 1M65A 4WDTA 2Y70A 3LY0A 5T26A 4B5WA 8A3HA 2VWTA 2AQOA 3FFSA 3UETA 1UASA 2ZKMX 4J3WA 3EWYA 1X1NA 3BWWA 4H9MA 3MI6A 1A49A 1REQB 4QG9A 2XSXA 1UKTA 5HOSA 2VKZG 3W1AA 1IGWA 2VZSA 4GQ0A 2EF9A 3MJMA 1QNPA 2V3GA 2DJLA 2Y8KA 4JQ1A 3B03A 3W2MA 3PZUA 3QF0A 4ZCWA 4H00A 4RKAA 5HUPA 3H22A 3VAVA 1SGJA 3OGRA 5ABFB 1CGWA 5FEXA 1O94A 1KW1A 7REQA 5F4WA 3LD5A 2GUBA 3UWUA 1POKA 1VCGA 4JX6A 4NVTA 4IWWA 1BXNA 3HPAA 1ZQ5A 2PAJA 3GKFA 4Y9MA 3O15A 4I6KA 4XAPA 3NSXA 1CGVA 2GVJA 5I06A 4AYGA 3NQFA 1OFAA 1SR9A 2A3HA 4QLKA 4K2SA 1R3WA 4RR4A 1PKLA 3G3MA 4RW5A 3ZS4A 4MNJA 1DVJA 3AIVA 4FNTA 3GS6A 1F76A 2PGFA 4DN1A 4EPBC 2WV8A 5GQBA 5E0KA 1NQ6A 1ZP4A 1MO0A 4N4PA 5CKSA 4DWSC 2BB0A 1FXPA 1LUCB 1TPVA 4JQ2A 3SUSA 1SW3A 3ITLA 1QW7A 3WD4A 1S3TC 4LNCA 3ARTA 3BVJA 1W9XA 1O7AA 1VGAA 4HN4A 1BSIA 5CZKA 4LQ1A 3EX3A 5I3GA 3MY9A 3W7HA 1BQGA 2H6RA 4P8WA 4E4PA 2TODA 3FJNA 1XGDA 1UBSA 2QUNA 1IZJA 3R89A 2D22A 1N8WA 5SWUA 1J11A 5DRIA 3URAA 1TPUA 2YCLA 4RNHA 4S3FA 4BEQA 1J01A 3S5ZA 2DUAA 3BAXA 2OLAA 3NJ3A 2Z6JA 2UV8G 3KBSA 4FLSA 4GUGA 1A0CA 4FAMA 3ZJ8A 4XBSA 1JQXA 4XAGA 3THDA 2GJNA 1XFBA 1VBHA 4GPNA 3E49A 2WMIB 5G2IA 1P1XA 3G1DA 1V0MA 3VKAA 3GC4A 4XK2A 1CTNA 2V68A 1XYLA 1QNQA 4UR9A 3WLSA 4YTTA 3RCYA 2INFA 1AW1A 4C60A 1RAKA 1SFJA 4IIBA 3GNNA 1DQXA 3AIQA 1XLMA 1WAUA 2XH7A 1D3CA 4CN1A 2G8ZA 1EX1A 1KM5A 4AHQA 1M9HA 3HOJA 4WOQA 1M7JA 1UR4A 1H60A 1ONRA 3GLCA 4IQLA 1SO6A 3SRHA 4IF2A 4R9OA 1FFRA 5A6KA 2F8QA 4LOCA 3WMCA 4P7RA 3NA8A 1EIXA 3I4KA 2Y1HA 4NAEB 4XAZA 3WYZA 3CAQA 3W7MA 4KEZA 3K4WA 4K8HA 2J7EA 3VFCA 4IISA 3I6EA 2TPSA 2ZVIA 4QNWA 1OD8A 3P3BA 4GY7A 2XVKA 3FJLA 5TD4A 1XUZA 1H7RA 3EOOA 4OECA 3TP4A 4FALA 2XWDA 2GGJA 1LT7A 1OT2A 1DIOA 3N2MA 3W1PA 4O13A 5IBXC 4YVXA 3W75A 2JGYA 2B7QA 3VUSA 2Z00A 3DFPA 2HNEA 3N14A 4RK8A 4MZ8A 4CU8A 5FJJA 1MEIA 1UD2A 5C9UA 4D6HA 4LEFA 4GYJA 2O7SA 3V5FA 3OGVA 2FJKA 1UA3A 2J62A 4DX3A 4JTSA 1Q2RA 3UXKA 1W2PA 1T96A 2VX5A 1KXHA 1S39A 4E3TA 1R3YA 1H51A 4IJRA 3GUGA 2ZQ0A 2FFCA 2X0SA 3EDEA 4OOUA 4PRRA 4LF2A 4J2MA 4C6IA 4PCNA 5D33A 5AC5A 1UWRA 4F3HA 3EOEA 3DFSA 3QR1A 3H21A 4GH3A 5I3HA 1VIWA 2P50A 5TAOA 2VFDA 4TO8A 3ABSA 1JUEA 3V1HA 3FA3A 4BK9A 3DERA 3FA5A 4GUHA 3DFOA 1OFDA 3PNUA 4ADSA 4M6QA 3B9AA 2PC8A 4AZ7A 1OM0A 2WPGA 2ZFAA 3U4AA 3INPA 2AL2A 2QJNA 3CL8A 3E96A 2VXNA 3B05A 2G3MA 1PB0A 2ZX8A 3RU6A 3CUXA 4XIAA 4S38A 4KCUA 2GK1B 1O66A 3GXTA 1KBLA 1F4HA 4DWSA 3MI2A 2E6DA 1MXSA 4ACYA 2CERA 2V2HA 3LOTA 4O1AA 1JCTA 2UY2A 2PTDA 1ZRQA 1ZU8A 1JD9A 1BSLA 2ZZ6A 1UJQA 3MKVA 2Z28A 3CYJA 1XDMA 2ZDSA 3KRSA 3UWYA 3LM7A 3A5FA 3SEPA 3LSCA 3WF4A 5AHEA 1AJ2A 1ISXA 3URNA 2I17A 5KZDA 3K30A 1E3ZA 2ZDRA 3BPWA 2NX3A 1NFBA 3ZZ1A 4C6OA 2Z2AA 1DJQA 2NUWA 4NZFA 2GGGA 3ONBA 1R2TA 3FYOA 3APYA 1X98A 4REQA 3N4EA 4NG3A 1SR0A 1LORA 1VFMA 4H19A 3WN6A 1E9LA 1XIEA 3H55A 2YKKA 1TX2A 2FMOA 2ZZ2A 3OLDA 4GZEA 5IRPA 3TSBA 2Y24A 1XV8A 1EIBA 3FDGA 2JE8A 1F05A 2BTMA 3GVVA 4RW3A 3SY5A 1HKWA 3IJ7A 2OQYA 1IXPA 4EPEC 3D5HA 1CLKA 2HK0A 4OVXA 4GA8A 2X1SA 2BSLA 2QUUA 3ZLFA 2ACQA 4N9BA 2BG5A 4NILA 1J12A 2PDLA 3RLGA 4E5TA 3UG8A 4HHLA 1E51A 2WVUA 1Y5XA 3LNPA 4JCMA 4EANA 1NP2A 1RBOB 5HA7A 1SM9A 4Y8EA 4ACZB 1ZAHA 2CZ5A 1JYNA 1L2UA 4B9ZA 1GW9A 3C56A 4Z1AA 4BFAA 3VIMA 4C6QA 3PR2A 3WF2A 1OX5A 4IMCA 1PBGA 1V4YA 2J8FA 3L5LA 3WH6A 1R3TA 4AHOA 3E2SA 2HE5A 4DRSA 2XH0A 1AFSA 5IBXA 1FWJC 4UFLA 1RLCL 5FCZA 1LBFA 2BXYA 3WEZA 4RLIA 3CUGA 3OIHA 3OODA 1MW2A 3AIRA 2CZVA 5E1QA 4AIOA 1TUFA 3GNOA 1KBBA 3EB4A 5F7UA 4H8HA 4KWVA 5E5CA 3Q58A 4AVFA 3KXQA 3TMQA 5FJPA 4R34A 2YW4A 4IPNB 3OYXA 3NQVA 1E6XM 1ZUAX 4M1RA 3P5ZA 1R47A 4JTFA 3ZJ6A 1A5AA 4KCVA 2CBIA 3G6MA 1WO2A 3QGKC 1HO1A 1VEMA 1RPKA 4DBWA 5XIMA 4GYFA 3SQMA 3E2VA 4QJ1A 2WANA 4JYFA 2WZMA 3TX9A 1JRCA 3QYQA 5DCDA 2Y88A 4LH8A 2P76A 3BJTA 4C7DA 1KBJA 3WJWA 3NXFA 1GQLA 3CH9A 5JU6A 4ORMA 2ADAA 4DM2A 3AXKA 3G3DA 1ADOA 3MWCA 3W85A 1N82A 3U8GA 3LX9A 1R46A 2Z4GA 3S9ZA 5AC6A 3JUGA 1UD6A 2XN0A 4IM4A 1D3GA 2NXGA 5AHMA 3UZJA 3WLNA 1NDVA 4JFTA 5EKYA 1AJ0A 3E0IA 1TR1A 4JIIX 1EOMA 4J3SA 3CJPA 3BAIA 3ZMRA 4L5ZA 1GQNA 1PTGA 2PDHA 1EJVC 1OINA 5I3JA 1QJWA 5L9FA 1VPXA 1W5OA 4JL2A 2R8WA 3LB0A 1V6WA 1XDJA 3WBEA 1HL2A 2FZ8A 3KOWA 3LHVA 2GJXA 4NJIA 4RL3A 3VD9A 2G3NA 1FWSA 1EDGA 2J9XA 2JIWA 4ZMGA 1NWSA 2J7BA 5DMMA 2X30A 4AWEA 1RA0A 2VQUA 1XIHA 3WNMA 1R3RA 2WWCA 4RDZA 4DLFA 1WP6A 4MY8A 4QG8A 5H91A 5LKYA 1TYGA 3H2FA 3RXZA 4NL1A 2DZXA 3PUOA 4U2ZA 5FKYA 4IP5A 1RVKA 5AECA 1GOIA 3NGJA 5KMYA 5EMKA 5CPSA 1ZZMA 3BQ6A 3BV4A 3TIMA 1C9DA 3GXNA 1HGYA 1A50A 1XLDA 2W4XA 5G1MA 3VNYA 3QR0A 1E0WA 5HWNA 3GTNA 2A4AA 5ENLA 4A3UA 3VIKA 1OD0A 4MF4A 3R8HA 2HPMA 4E2DA 3HA1A 4FNRA 4HSOA 1QO2A 2V2DA 2BP1A 3UVAA 4XZMX 3BW2A 3B8IA 4IFKA 4N6FA 3WQVA 2Y8VA 1XUUA 2Y5EA 4Q8TA 3SCUA 4PBFA 4HIBA 3V16A 1FCBA 2AAAA 1XBYA 3K1DA 3KX6A 2OVLA 3MKKA 2Q3OA 2FZ9A 1UPMB 1Y65A 2PBGA 2HJPA 2A3LA 4DIAA 1WE5A 2WAGA 4LS0A 3SY8A 3TC3A 4G8TA 3E2QA 5CG0A 1A5LC 3W53A 2OYKA 3VIFA 1MNZA 5C2GA 1YTEA 3L4XA 3DFQA 1JJKA 3ZLGA 1ZJIA 3GO2A 4LFYA 1WBJA 4AD4A 2D3LA 3CL6A 4HSNA 1B9BA 5HNRA 4LVBA 4HHMA 1D2KA 3DI1A 1IT7A 3IIVA 4JS3A 2XIOA 2VURA 3R0UA 1C92A 1XM3A 3W7OA 2WMKA 3WDQA 1H11A 1SZEA 3WQFA 4V1YA 3CT7A 4C6JA 2WNNA 3ZWSA 1QPRA 3C6CA 4CVWA 1KR0A 1W1YA 3AUJA 2HTMA 3PPHA 3WJYA 2HXTA 1YEYA 1FXQA 3VIIA 1TPDA 4XQ6A 2ACSA 1FWBC 3V75A 2X2YA 3PWIA 3DH7A 3PSWA 1JDEA 3LQGA 3GH7A 3P74A 3WMBA 1WBHA 2D1ZA 1I2PA 2GFTA 3NO3A 4MKVA 4ZB5A 1XYAA 3LHZA 1FWAC 1TIMA 1FWGC 2C79A 3AICA 1QASA 2FZBA 3A5VA 5FL0A 5DLCA 5CSRA 2VZOA 1KXVA 2OOFA 4H2CA 3L23A 1IEXA 4JIPA 3LI1A 2CLLA 4S3DA 1LQAA 2AOSA 1VP5A 3OZMA 5HDRA 3G18A 3UY8A 4CGTA 3SB0A 1VENA 5BRQA 5RUBA 4QTGA 4N4QA 1NF0A 3NWRA 3RG6A 1ZHAA 4QAIA 5JQ9A 1BYBA 2DEPA 4YTRA 2VHLA 1MW3A 4HMDA 4H7ZA 2ZE0A 2J7HA 1C8VA 1ECEA 1JR1A 2PS2A 1LQ0A 5XINA 1S2TA 4XD3A 3WH7A 5D03A 1XIIA 4UTJA 3WL0A 1FX6A 1KFWA 1CXFA 3RK8A 1LRQA 1L6FA 4UFHA 1XGZA 1ZBKA 4NX0A 4D6IA 3RR4A 3RX2A 3AIEA 4IHCA 3WDHA 3FGCB 5BW6A 1CXKA 4MG4A 4K39A 2HMCA 3UG3A 2QJHA 4J3TA 4UOQA 3AQUA 2OO0A 1TE1A 4DXKA 3S5OA 1LWIA 2OR2A 1C91A 4PCPA 1HJSA 4HCDA 5AYIA 1N8FA 3B8UA 2ZUWA 4AIUA 2EG6A 1US0A 2YLAA 4OTKA 1JI1A 3QPEA 3CZJA 3UXAA 3KFTA 4PODA 1HNYA 3AYSA 3A21A 4M51A 1P0KA 3GU1A 3W70A 5BNKA 3W1NA 1HKVA 3GH4A 2HBVA 3NPXA 2X09A 3P67A 1KV8A 4DI8A 5A3HA 1SVDA 3OYZA 1DTNA 1K8CA 1PZ0A 4H83A 1IYXA 1WZKA 4UZSA 4YU1A 1HZYA 4HK5A 5EU9A 2V0TA 3G24A 3LZ5A 4PTWA 1NWTA 3UNTA 4GFIA 1YADA 2VT0A 2QV4A 4DO6A 3NCOA 2PEVA 5LA2A 3FK4A 1SFSA 3PZOA 1V6VA 4GNKB 4GABA 4UQCA 4AEEA 1LOLA 4JHZA 3NDOA 3DAQA 1TMQA 1DQWA 3B9EA 2ACRA 1MQPA 1UC5A 3JZEA 2I1OA 5LGXA 3L21A 3FDKA 5E0FA 4AWSA 3OGSA 3TU9A 3BAYA 3IV3A 4DBSA 1JFHA 1IR1A 3B97A 4IQDA 3AIBA 4BQ2A 1XC6A 2NX1A 1JL8A 1XLFA 3QTGA 4LEQA 3IIPA 4KWSA 4IL0A 4DWSD 4DO5A 4CEUC 3GFYA 2Y61A 2C15A 2DFAA 5G5IA 2V38A 1YE6A 3SCSA 3A6OA 2D2GA 3NQ8A 4MWAB 3WDRA 1UKOA 1S1RA 3AROA 5AHIA 4IICA 3LTYA 3GG0A 4OUEA 3ITOA 1L2QA 3KZPA 5C6MA 2R14A 4EAYA 1TIWA 3AC0A 3ZOAA 4AWUA 1Z7AA 1AG1O 1TVNA 1VJZA 4I8DA 3S2JA 4BA0A 3GVWA 3B4YA 3G1YA 1GYNA 1GPFA 3WY1A 3W7DA 2R24A 2PWFA 1AMYA 2XH2A 5FJTA 3W72A 1SQ7A 1JDFA 1HKJA 1E6SM 3VOJA 3B0XA 2ISDA 4JNMA 1HTIA 2FHBA 4MLJA 1I6NA 1JGIA 3CQIA 3RM8A 4XSLA 1W37A 3KP1A 4CQ9A 1DPMA 1SU5A 2UY5A 4JY8A 3S2MA 1XKYA 4CNNA 5ABFA 3S6DA 4MY9A 3WLRA 4U4MA 5CLTA 2QLYA 4L7ZA 3TE9A 3VDCA 1CGYA 1XS2A 3P8IA 1LWHA 4FLOA 4DBEA 4MJ4A 1W3HA 3SRFA 1XSKA 4XZIA 2YDRA 2V69A 1QOXA 3W28A 1GWJA 3QV8A 5BXSA 3DGRA 3DBPA 2F84A 2CNCA 4AD5A 4KGLA 1G9HA 3TYBA 2EG7A 3UY7A 4GQRA 1GQIA 1NU5A 1AZ2A 1EB3A 3SUUA 4DUOA 3N4FA 1EC7A 3G2GA 1BWKA 5CLWA 3TAOA 1RCOB 5CSYA 2VDHA 2VGGA 2QMKA 4DPPA 3HJEA 4P8XA 3PBUA 3BTNA 2DVTA 4BS0A 2V63A 5D04C 4O11A 2QULA 3IGSA 1FKWA 2A3BA 4A2RA 3RRAA 3ZJKA 2BGSA 4QHRA 2A3EA 4JIRA 3LRLA 3GG8A 4CCCA 1DIEA 4S39A 1AK5A 4QEHA 3WNNA 2BGQA 3ARXA 3IK4A 2VRQA 3SN0A 3RNDA 1Z44A 1EHAA 4ENLA 4F2UA 3NPWA 3EPOA 2PWEA 4JOMA 1F07A 3EYPA 2WXDM 1EZ2A 1Q8JA 1LOSA 1E4LA 2PRMA 4GOAA 1B0IA 3N73A 2HQAA 1VFTA 3QYSA 4G6CA 1OEPA 4IPIA 4BR1A 3R8GA 2VVNA 1O5QA 1OX4A 4LB3A 1KKOA 1TO3A 1BYCA 1QW8A 1JUBA 4K7VA 1WPCA 3KHDA 3MBFA 1BVZA 4FLRA 1JZ5A 5CCZA 4L9ZA 1YLVA 3TJ4A 3IS4A 3M47A 1JPHA 1AA1B 3ORWA 4URIA 1TWSA 1TJ2A 1BPLB 2ZTKA 1BLIA 1XIJA 1Q7MA 3DFTA 2P8CA 2Y0FA 4K37A 5G4WA 3GU9A 4IX0A 3BW4A 3CZLA 2UZ9A 3THCA 1KNWA 4HU4A 4IGMA 3VOFA 4Q4OA 2XM2A 4W86A 4AMAA 2EO7A 1IEIA 1QPQA 3VDBA 4ZSTA 1EUAA 2DJXA 1QI0A 4K36A 3UGRA 5FEZA 2QCCA 3SIZA 1JEZA 3NQ6A 2PP3A 3W6LA 4ZVJA 4LGXA 3ECQA 1QATA 2C1HA 3V1PA 4H6KA 3FKKA 4F2TA 4D6CA 4JFUA 5I79A 1HJVA 4Q8OA 3VTRA 1J0HA 3M0XA 3PPFA 5JXQA 4DAFA 1KGUA 4RX0A 4HMCA 3DGBA 3WF0A 3DI0A 3PWGA 1J5SA 3AHYA 3MUCA 2EKGA 4Q4KA 4YYFA 4UR8A 4MFEA 3MP3A 1LRNA 3HQOA 2GWNA 1WYIA 4GGBA 4PEKA 3BH4A 3BURA 4DF1A 1LTDA 5HNTA 2VFGA 2ZWYA 1DWAM 4A8LA 1MFUA 5HNNA 5BWAA 2J7GA 1TZ9A 3FSTA 1VB9A 4XKMA 1AL7A 5FF7A 2RDWA 4AYSA 1LOQA 4X0VA 1V6XA 5C71A 3W27A 3QMSA 4H7CA 3NIYA 3CQ0A 3WG6A 1FDJA 3ELFA 1QCWA 1KM6A 3F1QA 3W81A 1BKSA 1E4NA 3GIPA 1PS9A 3AALA 4O28A 2W91A 2D2JA 4HNUA 3WQ4A 3VXGA 3VMOA 4S3JA 2Q02A 3UZYA 4M1BA 1JVNA 3K13A 4GH1A 4R85A 2B7NA 4WSHA 2Y63A 4PMOA 4Q32A 5BYWA 1U1HA 2F6XA 3E02A 3UR5A 4X2RA 3ZVHB 4PC8A 4ZR8A 3WF1A 2AGTA 5FF4A 1TKKA 3WDPP 1Y5WA 4G9PA 4JYDA 5D37A 4CNPA 3WQCA 1CBGA 2FZDA 2QR6A 3UXIA 1EO5A 5CC6A 3SY1A 2NT0A 5HMEA 3WIJA 1Z3NA 3ANYA 1HJXA 2DSUA 1P48A 3VGHA 3M0MA 3B8VA 1SYTA 1NTHA 3STEA 3W22A 3CUIA 4JDBA 3VUPA 2W67A 1H7PA 2XFFA 3MZ2A 3T55A 3TQVA 4KF1A 3ZM8A 1ZJHA 3QVQA 4N02A 2J77A 1MYRA 1ODZA 2OQLA 3VMNA 3QW4B 5CSSA 3M07A 1A5MC 1J93A 1MXDA 2VRJA 3CEUA 2FVMA 4JTTA 5A6BA 1EUNA 4N9DA 1HG3A 4QITA 4PSPA 3FHQA 3PF3A 3V0UA 5CH9A 1FP8A 1V93A 3BOXA 3CZKA 4CLMA 5HQMA 2DGAA 4L9XA 3WK3A 3NTYA 3OQEA 1XLJA 3FLUA 2INEA 3SRKA 2DP3A 1E1CB 2VRKA 3HN3A 4AUBA 4EKJA 4K7YA 2W92A 1H4PA 4ZE4A 1W54A 2XFWA 3NQAA 4JKLA 4OJYA 2I9UA 4HCLA 3C2RA 1SW7A 5FSDC 1Q65A 2YXOA 4TR9A 3RR1A 3EKZA 5AY7A 1SO4A 3W71A 1A3XA 2YZ5A 3ARQA 2QUMA 4C6EA 3AXMA 1UP3A 4YTUA 4H41A 2YCKX 3MO7A 4ZO7A 2GDUA 3O9NA 1VYPX 3KHJA 4PZVA 1JF6A 3S2LA 3UJSA 4Z1DA 5DY3A 3B0PA 1HN1A 5MF5A 4RZBA 1J0IA 3EA1A 3SN4A 1NDWA 3K5XA 1F5ZA 2HS8A 3CH0A 3NQBA 3CWNA 1WV2A 2ZRUA 4KS0A 3VVGA 3QRHA 3FV9A 1HVQA 4IMAA 4MAZA 1GJPA 3WL1A 2I7GA 4AZCA 3WO8A 3IUHA 4YL2A 1E6PA 5CGQA 1E15A 5DO8A 3MVTA 3KLLA 4DUVA 3UW6A 1GPWA 2PODA 1WKFA 1DWIM 1DIKA 1FHUA 1Z41A 1GJWA 1TWIA 2FPVA 3H4XA 4X22A 4RPPA 3PPCA 5FL1A 3K2GA 2HNHA 1XH2A 2OCZA 2D23A 3IJQA 3ID7A 4QEEA 5HUOA 5BOFA 5IHSA 2O9RA 4HBKA 5DT5A 2ZVRA 5BMWA 4UBPC 4OIFA 4B3ZA 4HJFA 2F6KA 3JR2A 3TJLA 1E9ZB 3IAQA 1EJ7L 3ZT5A 2PGWA 4HT3A 1YX1A 3RDKA 1A53A 2DH2A 4MB5A 4UUIA 4M80A 3VIJA 4CQ8A 3WFZA 1SSGA 5IFTA 4PFHA 2GOKA 2CZFA 1H7XA 4KERA 4PH6A 4B9YA 5EMUA 3QLLA 1R2SA 3N3MA 4AFYA 1F6KA 1OADA 2PWHA 1JRBA 1I2OA 4TOQA 3WK2A 2PRLA 4JBRA 1SJAA 3GC5A 3VKDA 3I7QA 4O1DA 1HP5A 5TIMA 5FJUA 4ZZ9A 4AB4A 2BVYA 4CNOA 4XG1A 1UKSA 3SSZA 2QQ6A 2Y6ZA 1W56A 3BLOA 4Z17A 3OW1A 3G8EA 2PPGA 3BQ5A 4LUTB 3L0NA 2QPSA 4KRTA 4PL2A 1NFPA 3L9CA 2PU0A 2OKTA 3AHXA 5CBJA 4O8AA 4OE7A 1IWPA 3PJWA 3IVUA 1H63A 3UCCA 1VLWA 3P0WA 3GVQA 3PG8A 1UUMA 2J6VA 1EEPA 4B2DA 1W5MA 3HURA 4PUMA 1RVGA 2EPKX 2IXVA 4HU3A 3SBFA 2YLLA 4N9CA 4H8NA 3B0YA 1ZAIA 4HYWA 2HPIA 2WC3A 1PXGA 1Q6FA 1IV8A 3WH8A 1UB3A 4PBEA 5IOBA 2VP8A 1R7OA 3QOKA 2NQJA 1XLIA 4XZ9A 1K77A 1X6LA 3HGSA 2RJGA 3PP7A 3RITA 4ZEPA 1CXHA 1P0BA 2EKCA 3DFYA 2J24A 1FH7A 4M5PA 1RCXB 4GD0A 1FQ0A 3QGAC 5GNYA 4JX4A 4IPLA 2Q8LA 1EQCA 1UWIA 4CKQA 4LAOA 2VJXA 4H4IA 5CZ0A 3OVGA 6REQB 4UFJA 2QEZA 3N2TA 3EXRA 3REQB 1AZ1A 4EXAA 3QQ1A 1PUDA 2GJRA 3NVDA 4LWWA 2PTXA 2G97A 3H2EA 4RE0A 4HN8A 2PDWA 1K8YA 2C3ZA 1KRBC 3IJLA 5HJYA 1V0LA 4LV9A 1XIBA 2DVUA 3UZZA 1L9WA 1J0JA 1TMHA 3E0WA 3L2MA 4JX5A 3LPOA 4HZ7A 3VU2A 3L0KA 2G50A 2P53A 5AC7A 4RNJA 1IZKA 3P0XA 3A4WA 1HL8A 3SJNA 1B30A 1S5MA 4O18A 1GZGA 5JIWA 1SZNA 1TTIA 3P6LA 3BLFA 5C9XA 1ECQA 1B5TA 3W6MA 2F7FA 1VD6A 1IXOA 3QHMA 4HA3A 4W8AA 1LG2A 3B8WA 3GBEA 2B7PA 4JHOA 4E4FA 3ANVA 3GW3A 1GOKA 2ZC8A 3P14A 4MDPA 1TV2A 4Q22A 1KC7A 2ZUTA 4S3CA 4IPJA 2YYUA 4GXPA 1AD1A 4BF7A 2ZA1A 1Q6CA 1TG7A 1WA3A 3E74A 4LAZA 4HMEA 2BXVA 2VVSA 4W85A 4WCJA 2VGIA 3G1AA 7TIMA 4BHYA 3W1RA 3W29A 4YS1A 4Q8PA 1JGMA 3USBA 3UQNA 1OFEA 3IGXA 3BGAA 3G6LA 3UPWA 1EXBA 4WKAA 1CX9A 2TMDA 2XHYA 1AD4A 3UWQA 4QFUA 4KRUA 3PANA 5HK4A 4J7RA 2WZTA 1G4PA 3W6YA 2RDTA 2YJQA 2GYIA 3QBUA 4A4AA 1XPGA 4QIUA 1D8WA 3UJ2A 1R3QA 2C0HA 4OWGA 3SJ3A 3O16A 3BE7A 1VS1A 3ARPA 4Z1YA 3L2LA 1W9DM 2VCCA 4UZUA 1M1BA 2ZX5A 1XYCA 1D7FA 5DBTA 1NVMA 2JGQA 2QAFA 1OT1A 2WQPA 1O1HA 4MTVA 1FDYA 4GLEA 3BCDA 5D30A 2GGHA 3MHGA 1UOKA 4E38A 2CHOA 1K9TA 4QLJA 2I5GA 1E0TA 3HPSA 5EFFA 2Q6ZA 1TZ7A 1V3IA 4DWDA 1MEHA 5BXPA 4CCEA 3QM3A 3CTLA 5HPOA 4UCGA 4L4PA 2QCNA 1TREA 1V3MA 4EP8C 3GYCA 4DYEA 1B2YA 2F2HA 2REQA 3VNDA 3C52A 3TK7A 1XCFA 2VEGA 3ARRA 4QQ3A 2VC6A 3GNXA 1BRLB 4O19A 3N2OA 3FSUA 5LNUA 4PUKA 4EXBA 4EPKA 2ZXQA 3AZRA 1JFXA 2QV5A 1X1OA 4NYYA 3MPGA 3ZSSA 2POZA 2PE4A 4G1NA 1TRIA 3KOFA 4WXZA 1Q13A 1OYBA 2Z25A 2VD8A 5M03A 2BX7A 5HANA 1XFCA 1RLDA 4JKMA 1KM1A 2PWUA 5BOOA 6PTDA 1G4EA 3KL0A 1ZCCA 3HIJA 2ZOXA 3GBDA 2OKOA 1OVDA 3EMZA 4Q33A 1V6YA 1MUCA 1YQ2A 3AFBA 5H6HA 1GGOA 1JPIA 4JKKA 3R6IA 1QPKA 5KETA 2A6LA 4QDPA 5H8PA 3V4BA 4HNLA 4EWJA 3WD1A 2WB5A 3VGEA 3CWOX 1V02A 1QNOA 2QDDA 3COTA 3Q45A 1W1B1 4L6OA 5E70A 1DWGM 2JEQA 3VX1A 4B5SA 3MSDA 4GYPC 1IWBA 4JIHA 4ZO6A 4J3XA 3BDKA 5CZJA 3UZWA 1WZAA 3LBCA 2ZCGA 2C7FA 1QAPA 3GNDA 1FTXA 1XD1A 3RGTA 2O7QA 4TVDA 1T99A 4HOZA 4WGHA 4BI5A 3FY1A 1KWGA 4L56A 3HG4A 2VEFA 3W7JA 4LRTA 4IH3A 4H9VA 4C6LA 1RD5A 1VHNA 1V77A 4B92A 1GTHA 1XH0A 4J27A 1J5TA 2ALRA 2E6YA 4KFOA 1EP1A 1T6MA 2YL5A 5C7VA 5ECVA 4P7OA 1P0DA 3QHNA 2WZIA 3CUZA 1OYCA 5HPCA 1UKQA 4FO4A 3U4FA 3UWWA 4DNMA 4ZL1A 3NZRA 2YBUA 4D71A 1LP6A 4Q4SA 4GXMA 1P7TA 4XSMA 1C29A 1BHGA 3OA3A 2WSQA 5JBFA 3W82A 3IIOA 4A3QA 2ZA3A 4DUXA 1CIUA 3MV01 3QLDA 3BL3A 2PF0A 2FQIA 4JTEA 5JUVA 1U33A 3CMJA 4YTSA 2WLYA 2GPTA 3EX4A 3AS0A 3PUEA 3U2ZA 3PZGA 4IP4A 4PFMA 4XUYA 3AIUA 4PTNA 3N6QA 1F3XA 4GFSA 1VBUA 4PMZA 3GKAA 2CC0A 2QAPA 4XVEA 2J6XA 4ZA0A 2OTDA 3MTWA 3CO8A 4UQDA 3JW7A 2WNWA 1QXLA 3N2BA 4NNBA 1SPQA 2FZNA 3N19B 2IQ0A 3MT1A 4KQNA 3B40A 1EO7A 4C5ZA 4NZ3A 1Q2SA 3ARSA 3S9IA 2Z7GA 3C0SA 2Z7KA 4PYSA 4Z2JA 2R6OA 4UTIA 4WR3A 4XKYB 2GQAA 3CS2A 1E0UA 2HRWA 1W3KA 2DY3A 1DE6A 5FAGA 4IQEA 4CVUA 4W87A 4LYPA 4V33A 4HOWA 2OLSA 1FWNA 1G1YA 1EJUC 3GNPA 4I9MA 2OGYA 3AWOA 1OGSA 3BLLA 5DBUA 2IPJA 1EBHA 5IM51 2W27A 2OSYA 2ZADA 2FHCA 3CAKA 3PBWA 1TPEA 4U33A 3CQHA 5MKGB 2Z1VA 4IGHA 3LG3A 2XVGA 1Q6OA 3GXPA 4MADA 3SURA 1W1VA 2XZ9A 3B9OA 1FBAA 4O1EA 3P7YA 1PIFA 1KKRA 1TZZA 1SFTA 3LV5A 4JTUA 3IACA 3LN3A 4C6DA 3CEPA 4Q7IA 3DHFA 3LPPA 3E5PA 1PYMA 1CGUA 3K1GA 4LYQA 1R9YA 4WX2A 1I75A 1OQFA 1W8SA 5E9XA 2NXHA 3HM7A 2R9RA 4PRWA 1WB0A 3L65A 1DJNA 5BCAA 3SRDA 2B81A 2HEJA 1JQVA 5F1VA 1MZHA 2ON3A 4IIGA 5EPDA 3GFZA 2Z1SA 3MWAA 4X60A 3BOFA 4ZQMA 4DZ5A 4DUWA 4GI4A 3URBA 4QE4A 1QDSA 1GVFA 5E6YA 5HMSA 4V28A 2Y7DA 1NH6A 1FCQA 3HJZA 3UG4A 4DJED 4GWEA 1ADSA 4ML9A 1TPH1 2H90A 4GYPA 3TTSA 1WUFA 1V6UA 3GG7A 4G5DA 4AXKA 3EOLA 4AX7A 3Q65A 4MYAA 1EZWA 3MP5A 5EYWA 3OLIA 5D02A 1K6AA 2VNCA 1NEYA 4ATWA 4B2DD 1SMAA 3UWEA 1UPPA 2GOUA 4IGSA 4HPHA 5AYXA 2OOGA 2OZTA 4QCFA 3HU7A 4HPNA 5DQPA 4CD8A 3SGUA 5GNXA 3ZT6A 1UZDA 2PZNA 3LDVA 4IMEA 4FXFA 3LGDA 1LYXA 1NELA 3SQSA 4K8EA 4PN2A 2E67A 3LCLA 1Q63A 4NASA 1SW0A 5T8GA 1EF2A 1T8QA 3UXLA 4LT9A 5I77A 1GW1A 1TWDA 1TJ0A 1MDLA 4C7FA 4ZFCA 3UA3A 4FXSA 4GQGA 2PDUA 1FKXA 1O60A 1XIDA 1TRDA 1CNVA 3ZLHA 2QJGA 3WH9A 3TLQA 4G56A 1ENUA 1QWGA 1XIFA 3KBWA 4XO6A 4UTUA 1OY0A 3MUY1 4LUJA 5T91A 1OC7A 1XCWA 3P80A 1TA3A 1BXCA 5JIPA 4WQ6A 4AF0A 2QDHA 3NEHA 2PFHA 1BXBA 2VFIA 2GJLA 1HKIA 3H2CA 3A3XA 3MQTA 3PBYA 3FVMA 1LT8A 2FDSA 1VAHA 1QHZA 4WDXA 3L66A 3VK5A 3CUHA 1UROA 2XIJA 1K4GA 4WVXA 2XFRA 1KFCA 1TPB1 3ME3A 4LVAA 1GVSA 2GLKA 3HBLA 3L7RA 1VBGA 1OC6A 3H7UA 1FY6A 3GDKA 3UXDA 5FACA 4FNQA 4AZHA 2GGEA 1ZS2A 1V0KA 2BV9A 1UC4A 5D2VA 1PWMA 2VFEA 3W86A 4S2CA 4WDWA 1RK6A 3Q37A 3RCNA 3BCJA 6ALDA 3W02A 3PS7A 3AU2A 1G94A 4CNTA 1V7YA 2FYMA 3N04A 5CGTA 1CZ1A 1UR3M 3FS2A 3HGJA 4F0RA 2CKSA 4MB3A 4HYRA 1UQYA 1R85A 2H8ZA 2NV9A 1DXIA 1VQTA 1GT8A 3CGTA 4ORIA 1H62A 2VTFA 5J8LA 1L8PA 4ZQOA 1MNSA 5DX7A 1RXOB 4UCFA 3A12A 1TR9A 1XHGA 3GAYA 3WLOA 1CGTA 3P2VA 1H0IA 1R87A 1O12A 1FDZA 7ODCA 3TV8A 2IQDA 2TAAA 3TQKA 1G0CA 3R1ZA 2NVDA 1LROA 3UEQA 3MMUA 3MUZ1 1DJXA 1ICSA 1ONWA 1XYBA 3ALGA 5CBBA 3VKKA 3E12A 3BZJA 1PZ1A 1UWAA 2G3FA 3LQLA 4I5XA 2ZC1A 4O17A 2CLFA 3GDTA 3TSMA 3EOSA 4O0ZA 2H3BA 1BGAA 1T8XA 3F5JA 4H9TA 3NR0A 1X97A 3PJTA 3HFTA 2VX6A 5EA9A 4QAWA 2RGLA 4KWWA 5LGZA 4C1NA 1UH2A 1KBIA 1XWYA 3ITYA 3NGFA 3L5MA 1CLXA 4FX6M 3M0JA 2R1LA 1DWJM 3LSBA 4LS1A 1DQUA 1OG0A 4G1KA 4RZ4A 1A47A 2ZBTA 3PBMA 5AHLA 4IJBA 4GNJA 3H2OA 3QW3A 2O9OA 3BLEA 4OFCA 3RO8A 5HBFA 1W9PA 1Y5VA 3OU8A 5AYBA 1DJGA 3R4IA 3TYAA 4N2YA 4Q7BA 3OBAA 3A4JA 1GKQA 3KBMA 1PSCA 3W25A 3U57A 2WVTA 4M3PA 1XIGA 4IJCA 5CAHA 3N17A 4I7UA 2YX0A 1DP0A 4RPQA 2H9AA 2DQXA 3ZSTA 2Y4SA 2XSBA 4P7LA 2FH6A 3GXFA 4BF5A 2CLKA 4IG2A 2EJAA 4GHRA 4JN7A 4GJJA 4CD6A 5D2TA 4WOZA 3BAKA 2ONEA 1M53A 3TAKA 3HG3A 3NL6A 1GZ1A 2Y7EA 2I5IA 2Q01A 3LENA 2P1FA 1JZ7A 2VL4A 4A8IA 2WSRA 3O05A 3T7VA 4B4FA 3A64A 4XZBA 4DZHA 3WQPA 4P5UA 4H8VA 1OCBA 4MOZA 5LA0A 2XVLA 1T0OA 1ZP3A 1UOZA 1ONEA 3ANUA 2WW5A 2OZ3A 3NQ7A 4LV4A 2FPYA 1KRMA 3PWAA 3UR8A 4HOXA 3CO4A 1DV7A 3V3WA 2VZTA 3VIPA 1DWHM 3WFLA 3T44A 4PUNA 1XH1A 5KZ6A 3TWBA 1QOQA 4W7VA 3C2VA 4JR5A 2J8TA 1TWZA 4I8YA 1RQHA 1AW2A 2NQLA 1A0EA 4GRSA 4MPKA 3CMFA 1AH4A 2Z1WA 1MXGA 4MSSA 1DJZA 1YBQA 1KFEA 1NDZA 2PDJA 3AJXA 5LIUX 2PU1A 4LUSB 3V0SA 5JBEA 5MHBA 4FOKA 4MWAD 4UTHA 2QCDB 3M0YA 4L4OA 3R5EA 2WJDA 4A22A 2JBMA 1QUMA 1ZLPA 1P0NA 1KA9F 2J79A 4ZQRA 3BZGA 3NNTA 4FX8A 3FW6A 2E1DA 1E6QM 2QPUA 3MCMA 2C6QA 4L9YA 3UYCA 3LCWA 4MNMA 1EC9A 2OG9A 4NUWA 4Y6GA 1AMKA 3IANA 2JFEX 3L4YA 3G1FA 3MB9A 3EB3A 2PD5A 1XRVA 4GE8A 1RP8A 2BVWA 4D72A 1X6NA 3ITCA 4LVDA 4Y9NA 1IIHA 4HK7A 5DCEA 1WOBA 5CC7A 3LBMA 1BTCA 2DV0A 3KTSA 2VM8A 4C6NA 3PAOA 4C1KA 1OZMA 4AH7A 5JVLA 2J75A 5LNWA 1TV4A 4DXVA 1ZBCA 4H1ZA 4OU1A 1M03A 1UWUA 2RUSA 3CL7A 1F3EA 2FTPA 1OFRA 1EFZA 1YYAA 2ABBA 1RJQA 1R38A 3I68A 7A3HA 3PZ9A 5T9BG 1HT6A 3VKJA 3E1F1 4B15A 4FR1A 1LRTA 1XINA 2HDJA 3RN6A 3LRMA 1U22A 2LLEA 2EBNA 1B54A 3MHFA 2IKJA 4I3GA 3W7CA 4XBJA 3R0DA 3ZJ7A 4C1LA 1O4UA 6ENLA 3TW9A 4AEFA 3TDFA 2OODA 1V3KA 5C9RA 1F9CA 2C18A 2WKLA 3F7JA 2IPGA 2Q71A 3W38A 4XAYA 1V3LA 2PTZA 5LNRA 4PCTA 4UR7A 4NZ4A 1UWTA 1JDCA 1RY8A 1Q6GA 1BFNA 4JQ4A 1LLWA 4FXRA 1TFVA 2VR4A 1ZBVA 3BV7A 3TW6A 3SFWA 3ABRA 3C0JA 3WLPA 1MRAA 1I2RA 3M41A 3IVSA 4GZ7A 3UG5A 2O9TA 1EP2A 2VQTA 3I6RA 1FWHC 2PDNA 4B5VA 4JTDA 4LU0A 1FWIC 4OZOA 4UTLA 1VEPA 3NL5A 5DMNA 3NL3A 1PKNA 1WOAA 1ZY9A 4TXEA 3DCPA 1WKEA 1BVNP 3OHIA 4UNIA 3VYLA 3T81A 4L65A 4WKFA 3O6AA 7REQB 5GJNA 3MSRA 3GTIA 3N9RA 4ICMA 1JCYA 5LXXA 2Y62A 4JTKA 3THUA 3LTPA 1Q5MA 4GIAA 3OVPA 1W3LA 4DJDC 2CLEA 1I2QA 3CHVA 3QSRA 5CPOA 5JBDA 4Y8FA 1RHCA 4A29A 1LLOA 1DJWA 1H50A 1IEVA 2HXUA 3CXOA 4GX9A 2JKPA 2FZMA 1VYRA 3XIMA 3S2CA 4H6RA 4LPCA 3I7RA 4JN6A 4KEUA 1W1PA 2UY4A 3FVDA 4HTYA 5K9XA 3VIHA 2CKRA 1GG1A 3RMEA 1DORA 1UCWA 1T7LA 1WXJA 3SUTA 5CGMA 2ZX9A 5EFDA 2BHUA 5ABEA 4UTFA 4NNAA 1WDWA 3T0BA 2GSJA 1W1A1 2BWGA 1TPC1 3DN5A 1T41A 2QGYA 2E6AA 1QI3A 4NT0A 3SCQA 5K4XA 1DKWA 1J2BA 1R7AA 1FWWA 1UP2A 3EWDA 3AUOA 2NQ9A 3S6TA 5DN1A 1PZ2A 1QWKA 4UFIA 1OCJA 3EEGA 2A7RA 1KM4A 3G0SA 3W83A 5A1AA 2YCLB 2YR1A 2PF8A 4GUIA 4KIEA 4KWOA 3EWWA 3DKLA 5E9AA 3N6HA 1ZPTA 3ITXA 2PGEA 2CLOA 1BAGA 5ABHA 2QKFA 4A3RA 1I2NA 4PMDA 4LF1A 1S5WA 3BJSA 4Y7EA 3G8RA 3WLQA 3MDUA 1KFJA 2DU2A 4IXXA 1TJRA 3FYPA 1DHKA 1IXQA 1W2VA 1SJDA 3DUGA 4S3KA 1IWAA 3M0IA 2PWVA 5LSMA 3IUDA 4D6FA 2YL6A 1KQYA 3UVIA 5IFPA 3KRZA 1H1YA 5B7ZA 3TN3A 1UQZA 1JDDA 2PDCA 4PMYA 1TSIA 2GWGA 1E1FA 2PDQA 4D6EA 3TKFA 3HPXA 3BMWA 2R1PA 5HXMA 4E3VA 2OFJA 4Q8QA 2OWWA 3OVRA 2O4MA 1FCVA 3KTCA 2GJPA 3GC2A 4BWLC 1WQ5A 5D4YA 1F4AA 2P88A 2V5LA 4DVOA 2YOCA 3WUBA 3YPIA 4Z42C 3VNIA 2WCAA 1VR6A 3HG2A 2G5WA 3BMXA 4FNUA 3W88A 3H24A 5IXEA 1G4SA 4LVFA 3L67A 3B06A 2X40A 5A2AA 3CZEA 4XO7A 4A35A 3NQEA 3BGGA 4X0NA 3G0UA 1F7BA 2DQWA 4F9JA 2RDXA 4J1OA 4DF2A 1O68A 3IGHX 2WHKA 4LRSA 4QDMA 3LU2A 1PPIA 2B7OA 5HJXA 1UD4A 1MW0A 2Y5SA 2EPMX 5CPQA 5A5WA 1F6PA 4M8UA 2ZA2A 2UY3A 1K9FA 2ISWA 2ISFA 2E7FA 3EAUA 1RP9A 4ML4A 1EH9A 3QSTA 5K9CA 1ZENA 4BJHA 2CYGA 2DIJA 1IF2A 4AMCA 1YNQA 2RDUA 3VC5A 3SGZA 3GXMA 4DJDA 4PE8A 3KVKA 2IKIA 2INZA 3CQJA 3MMDA 1S5NA 1IT8A 1OWQA 2L5HA 3GDRA 1OF8A 3K8KA 1P5BA 4EE9A 4UFMA 1XRFA 1KLYA 3TCEA 2PZ0A 3G5EA 5D9MA 2Y85A 3GU2A 2AL2B 4GISA 3Q67A 1XBZA 2X1RA 3KL3A 1KFBA 3AMLA 2VUNA 4B4HA 2RHGA 3CPRA 3V0TA 3ATYA 5HMDA 1LZOA 4H6QA 1XGEA 4DWSB 1XLCA 4X61A 1KCZA 3VA8A 1MZRA 5E93A 1NFGA 4KT2A 3IEBA 3DG3A 4HYVA 3VI2A 4NXKA 1TWWA 3TR9A 3GHTA 3SCOA 4UTMA 4AD3A 1AJZA 4WLCA 3OLGA 2WHLA 1XX1A 4GG9A 3B8SA 4HKPA 1FWDC 5DY2A 1H5YA 3WMSA 4KEVA 1W91A 3S83A 2X42A 2A6NA 2DT1A 1LBLA 3STCA 4UQBA 4REQB 3CV2A 2IPWA 3EMCA 5A8NA 4J3UA 3ES7A 1RH9A 2E8YA 4NAFA 3WEOA 2G41A 4ECLA 1OJXA 1XC4A 1IR2A 3WQ8A 3G77A 2Q8ZA 3B4UA 4UTWC 2ISSA 1JPKA 4MGGA 5EL1A 3KLKA 2WM0A 3OZPA 5DXYA 3IARA 2WHJA 5JMUA 1RD6A 3USZA 4AXNA 3R7MA 3A47A 4DNHA 1XYFA 3IWPA 3F4NA 4I9TA 4WY0A 3WFAA 4HTBA 2WVSA 3POCA 3GXIA 4GO8A 3RFAA 4NKCA 3M5VA 3EGJA 2QHAA 3T42A 3ZIZA 1VLIA 2GDVA 3U5YA 3I3BA 2IPFA 3QGVA 5FF0A 3H2NA 4JTGA 2CLMA 3TTQA 3VD7A 1K7EA 1UR1A 1NARA 4LCQA 1YW1A 2CFFA 3N2XA 3NOYA 3TROA 5KEZA 2AMXA 2EJ1A 5A6AA 5BOEA 4GZIA 2QVNA 4BWLA 2RJHA 3EBVA 3DYPA 4LANA 2XGBA 1W1TA 2FB3A 3GHUA 3LPFA 3UFYA 4PEEA 3J7HA 1B3XA 2V67A 3OA5A 1UZ4A 2CWNA 2ABAA 2YA2A 2HWGA 2XGZA 1O95A 4AZ6A 1GNXA 3QC3A 3G1XA 2EHHA 1TE6A 3TQPA 4HNCA 2GQ9A 4CEXC 4Q4QA 2G3JA 2ZUVA 2WVVA 4DJFC 1S38A 2V3DA 1MEWA 2DZVA 3AMGA 1JF5A 4GQBA 1GG0A 5HULA 1QI4A 3MANA 3AHVA 3H2MA 3NYDA 3QQ0A 3GIYA 4GZJA 1UR0A 2JIEA 5U7SA 2F9RA 1FOBA 2CZDA 1JULA 2XSAA 2E40A 1U30A 3FEMA 5H8UA 4PUEA 8XIMA 4ZQCA 3IK2A 2DZAA 1K02A 2VCBA 1UMLA 4QRNA 1WX0A 3T2PA 4LXFA 2D2OA 1DYSA 4U3CA 2YXGA 2X7WA 3STPA 2EPOA 2FGZA 1W5NA 2WMGA 4MDOA 2XYLA 4A3YA 1TUXA 3FA4A 4MUZA 1R86A 2NUXA 3WH5A 4QROA 1OIFA 3WUEA 4JEJA 5T9CE 1E0XA 3GH5A 1CB7B 5C7HA 2VO5A 5F4XA 3W1QA 2QJMA 4PL1A 1YXYA 4INFA 3NURA 1CI1A 4GVFA 3MZNA 3U7VA 1BD0A 2J47A 3QKZA 3T40A 4AX6A 4DYKA 3ZWTA 3F4CA 4R7OA 3MCOA 1HQTA 1KFKA 3UF9A 4AZIA 3KVJA 3WX7A 4A21A 4EIVA 3W76A 1PO9A 2NVAA 3W3OA 2PLKA 4K3ZA 4DO7A 4JHMA 5FA5A 4O4WA 2GGIA 3NSMA 3GQYA 5REQA 5I03A 1GKRA 5BZAA 4JD4A 3PTMA 3ABQA 4GJ1A 2GJXB 3WJSA 3R58A 2QW5A 4GVGA 1B3OA 1FUYA 1LLZA 3CPUA 1E5NA 2JEPA 2Z6IA 3W1TA 4IP7A 2PDKA 4NNCA 2A3AA 2ZXDA 3QH2A 5CJMA 2IKGA 4D6DA 3I65A 1O1ZA 3MSYA 5I3DA 2GUUA 2XVPA 1W5PA 4KKXA 4PSRA 1DWFM 1ICQA 3WSUA 4GUFA 2OQHA 3M7WA 4UTWA 4Z0JA 1GONA 1U1UA 1KWKA 2WK2A 2QCHA 1UH4A 1EPXA 4ZGYA 3ICJA 5C2XA 2VC9A 3KDOA 3QV6A 5A94A 1UWQA 1XRSA 1CT5A 3CIWA 4OBRA 5B80A 1I8JA 5FIPA 4Q8VA 4OUIA 4IFKB 3S5YA 1A3HA 3GG1A 1UUOA 1E55A 3KBJA 1B4KA 3S5NA 1UD5A 4HZ8A 2PDXA 1OF6A 2YDAA 3WD3A 3N25A 5H2ZA 3RO6A 1M7XA 4WDUA 3KS5A 4MYXA 1AL8A 4YIWA 1J10A 3OZYA 3DG7A 3VABA 3LTSA 1M01A 3ZR4A 2QCEA 3O6CA 2V6AA 3LERA 3OQ8A 1R8LA 3C8FA 4NI3A 3KOXA 4B5XA 2Z27A 1RBAA 3BG5A 2NXIA 3VM5A 2OO6A 2WLZA 3L5AA 3B9DA 3M6DA 4ERIA 4NZ1A 3K8MA 5BRPA 1IQ8A 4RZ6A 3VOGA 3CV1A 4QJ4B 3WEMA 2EPNA 3OOQA 2J4GA 3IV8A 4ZO9A 2ZXBA 4UTTC 3L2IA 4V1XA 4AEOA 1AODA 4LALA 1TJPA 2CLIA 3OG3A 4FOUA 1V08A 1WUEA 4BY3A 3WQEA 4DJFA 2DZWA 3MO4A 3CZGA 5GNZA 2ZIDA 4FXJA 5ECUA 2WSKA 3LCGA 3N15A 3EWCA 4CN4A 2CBVA 4UNLA 1AUSL 4B3KA 3EA3A 2W6RA 4ZSUA 1X1ZA 3M5ZA 3TJIA 1EL3A 1J8VA 1XICA 4W7UA 1LCOA 2VD9A 1XXXA 1Y7VA 3SM0A 4H9UA 2EPLX 2YCJA 4AW7A 2CLPA 4O54A 4ZODA 2YBVA 5I00A 4GNVA 1EX5A 2H3DA 2XN2A 4KCTA 1I0DA 2PP1A 1R6WA 1RALA 3P60A 2A5HA 3N9SA 2Y5JA 3HTWA 3NQDA 5AB3A 3NO5A 3WELA 4R88A 1ME8A 3WZ0E 1DOSA 3EWBX 1QHOA 4KCWA 5LIYX 3VE9A 2XFYA 4X3ZA 2G37A 4H9XA 4CD5A 4ZOBA 2WCSA 1E6NA 5HQEA 3SW6A 4A8RA 3V7PA 4NHVA 3DKJA 3O0KA 4X63A 1PDZA 2NV1A 3BLPX 3UR7A 3MC5A 3ZQ9A 3GY1A 1N55A 2CXEA 4S3GA 3C86A 2Z2BA 5C55A 3NAVA 1LF1A 4GIEA 2ISVA 5DCBA 1PKMA 1TPFA 3I7SA 4KRZA 1GVYA 3F5LA 3TFXA 2WC4A 4AG0A 3NSNA 2ZTJA 5FI8A 3O2LA 4E2VA 1OFPA 3KWSA 4D1IA 2V9DA 2X7VA 3NOEA 3VIGA 1R9XA 1PX3A 5FEWA 1KFLA 2E4TA 3BOLA 3WBXA 1NF7A 2XZ7A 3BGJA 3MCNA 6A3HA 4ES4A 4ZOCA 1RCQA 5D9NA 2V8ZA 2FVLA 4EPDC 3F03K 3PC0A 3VDGA 6CGTA 2P0IA 2IKHA 1H1ZA 3E9AA 3IVTA 5CEWA 3AMKA 5D32A 3NQMA 1VBJA 2BMBA 3VCRA 4H01A 6TIMA 3W7GA 2YCEA 1B3VA 1E4IA 3WF3A 3VNLA 1EC8A 3T2OA 3DECA 3OZOA 1O5RA 4WKHA 1OYAA 1X7IA 2BY3A 4K68A 3HGOA 2G4FA 2V3FA 1G5AA 1GEHA 1PYFA 4G7EA 1JAEA 1KBKA 2BGNE 3TTYA 1U5HA 4P61A 3L12A 3WLMA 4XV0A 2XPKA 1GHSA 1PVNA 3RMJA 3H7RA 2O92A 3H4WA 4KGJA 4DJDD 2Z0IA 4ZQPA 5AN7A 1K9EA 3A24A 4O1FA 2ZE3A 1IZCA 3KCJA 4LBRA 5A2BA 3FJ6A 4KBXA 2WMHA 1SZFA 1CWYA 1A5NC 2OGJA 1K6WA 2G0WA 7ENLA 2Z1KA 4M6PA 4E2BA 3H12A 2OPJA 2HBXA 2QCLA 1REQA 2C19A 3R11A 1U5JA 3WUFA 3GWQA 5CSUA 1CDGA 3KBNA 2WOQA 1K4HA 1FWEC 1PE1A 1CEOA 4Z2LA 3II1A 4HHHA 4UTTA 5TQLA 3S4TA 1XCXA 1KB3A 4IIEA 2V81A 1Q3NA 5ABTA 3MP4A 1IHIA 2EPHA 4N9EA 3D3FA 3LA4A 3TMLA 5D8ZA 3V5OA 3ENLA 3SI9A 2NX9A 1M7OA 3ZR5A 3JU2A 4F4RA 4Q8MA 1UUQA 4CQBA 1GJUA 4OKDA 3S0CA 3HV9A 1F74A 3R12A 2OEKA 4F48A 4QE5A 4ERGA 2XIMA 4QSFA 4PTMA 4YPJA 4GC4A 1UJPA 3GZAA 3C0QA 3D46A 4H9YA 3IUIA 2WMJA 1RY0A 4FP1A 3HQNA 1T40A 4PGLA 2YDQA 1P6BA 4XZNX 3PBVA 1TELA 3ABOA 1R3SA 1QMLA 1LUCA 1NQKA 4A8NA 2OU4A 2G96A 3NZGA 3HZ3A 3M16A 1VBRA 2FHFA 2PP0A 1JXKA 1SSDA 2OSWA 3KDNA 3IPWA 1R2RA 1EBGA 1YDNA 2DT3A 4BQ5A 2W5FA 1ZGDA 2V5CA 3W7PA 4ZBCA 2XWEA 1UMYA 4MVAA 3OPSA 5D9OA 1E3XA 1OCNA 4GX8A 4CCZA 3AI0A 5AYZA 4KIRA 3APTA 3TW7A 4LY4A 1JG9A 3O8AA 3ZR6A 3P62A 1HKKA 4NJHA 3VIOA 4IXHA 4IZGA 3T0TA 1QBAA 3NDYA 5F2MA 2WMFA 2JF7A 2A2IA 4DAIA 2WYSA 4E0CA 2WMIA 1K8ZA 4J40A 3LBOA 5I07A 2ASHA 4BKNA 3I4EA 1I4NA 3UCQA 1RJRA 3SFKA 1KLZA 3QY7A 1A4LA 2UBPC 3F2DA 1LWJA 2X1UA 4D8ZA 3EDDA 5HQLA 3MKCA 2XH4A 1KRCC 3AHTA 2PB1A 3GDLA 4GI6A 5AZ0A 3N29A 3UCDA 4KESA 4JN8A 3PZMA 5G4EA 2WBGA 3TYZA 1JUKA 1LJYA 1V5XA 1OX4B 2DSZA 2XIBA 2CPUA 3OIXA 2CBUA 4UTKA 4U10A 4QISA 4WGXA 4POCA 5AC4A 1M68A 2NQHA 2KAUC 3CLWA 4NAEA 4E8DA 1O6IA 1W8GA 3JRKA 2BOEX 1B31A 1NWRA 1QOPA 1XIMA 1GQKA 2MANA 2P0OA 1ITXA 1PCKA 3DG6A 1U83A 3C2OA 1C3FA 2D73A 2XU2A 2C1IA 4PUDA 4EF8A 1MW1A 1AH3A 1JZ4A 3QN3A 1W32A 4D1JA 4JPGA 4LVGA 2I57A 4D8AA 1FHDA 5EMYA 4QLLA 1X8FA 1HJQA 1KTNA 3TWAA 4HNOA 2Y7FA 4HA4A 1X96A 4C6MA 5I5RA 1JIBA 4FX7A 4EK7A 2BHYA 5TBOA 2CEQA 1UKPA 3U2CA 4KW2A 3PSVA 3AAMA 3OO2A 2YA0A 4US5A 3VD4A 5H1WA 1BWVA 5DRCA 1BG4A 4OT7A 4JIQA 3SO7A 2OZ0A 4D6JA 3DHDA 3UT0A 1Z42A 3WD0A 3P61A 1N2VA 2Z26A 3CPGA 3O6DA 4DLMA 3MYOA 4UWMA 3PTQA 1FA2A 4NZ5A 1PAMA 4X9SA 3QEZA 3S6OA 1Q8AA 3CNYA 1ELSA 3FHAA 2BFGA 4XTIA 1WXZA 4RZ5A 4DBUA 4HQVA 1IIGA 2SFPA 3IJ9A 1CXIA 1HX0A 1V79A 3LHUA 3ARUA 4CD7A 4JXCA 3CTTA 5C2CA 4WJEA 2A21A 3RPMA 1J2WA 2QF7A 2XTKA 2ZZ7A 2CWXA 4L80A 3KVMA 3CM4A 1OIMA 4KFNA 4J28A 1AQ0A 2PDYA 1JNEA 1B1YA 3RX3A 3CB8A 3O6YX 4ZB0A 4WZHA 3CHFA 1H3GA 5G2HA 1JZ8A 4HGXA 4JYEA 4DPQA 3HF3A 1UIOA 3QJAA 3QTPA 1WZLA 2GK1A 4E6MA 5C5YA 3UJFA 2DT0A 1KXTA 1YMYA 3TTEA 3L68A 4DJEC 3EPMA 1ONXA 3GZ3A 1A5UA 2P5NA 1PJ9A 1FP9A 1GYMA 1HUVA 4LAUA 2O4QA 2EAWA 4XIMA 3OTRA 1JCJA 4LB4A 3LXBA 2ALDA 2XVNA 3CLMA 4XAFA 4PR4A 4UXDA 2PWDA 1CB2A 2WKJA 2ZZ5A 5BROA 6TAAA 4LAKA 1PHWA 2J78A 2VFHA 2XGIA 2Z29A 3LHYA 1NWUA 3GD6A 4F0HA 4C6PA 3CMGA 3DENA 4NJGA 3TOYA 1YDYA 4W88A 3W7QA