1HVQA

Crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords HEVAMINE A
total genus 97
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 1994-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hvqA00
4ZE5A 3AXXA 3CUJA 3WQ8A 2FHCA 3U7BA 1GUVA 3QOMA 1OIMA 1PIFA 3MKKA 3IJ7A 4MTVA 4R5EA 1QI4A 5E6YA 2EPOA 1MFVA 1XRVA 3AMKA 1FH9A 2YDSA 5GQBA 1E4LA 2HVMA 4CD7A 5EBAA 4WIWA 3L4XA 3W29A 3B8SA 3VO0A 1C92A 1UKQA 3GXMA 3OGRA 4FLQA 2WANA 6A3HA 1VJZA 2C7FA 2J79A 3WUFA 2VMFA 3ZT5A 2W4XA 1ZJAA 5BROA 5HPOA 1ODUA 3OLGA 1R7OA 2VR4A 4F79A 2WCGA 1CWYA 1B3XA 1QNRA 1V0MA 1M7XA 2DEPA 3CZLA 1ZBVA 4M1RA 1X6NA 1E55A 1NH6A 4P7OA 3W25A 1HXJA 1CPUA 1H2JA 3T2OA 4J28A 4PMRA 1G9HA 4KGLA 4AZGA 2XTKA 1UD5A 1LWHA 4N0RA 1WDRA 4LYQA 1GOOA 3WMCA 3VOCA 4V28A 4WF7A 3VDBA 3WNLA 3LPPA 1BPLB 5FCZA 3ECQA 1J0KA 3WH8A 2Y4SA 1GHRA 1JF5A 1TZ7A 5ABHA 2VCBA 1EDGA 5A3HA 1H41A 2DSKA 2VZVA 1ZU8A 4OZOA 2WVTA 5HOSA 1BTCA 3BSHA 3RJYA 3ZJKA 2BY0A 3BXWA 4CN1A 6CGTA 7CGTA 3PZNA 2DH2A 3ZO9A 1IV8A 2G3JA 2JF7A 4OOUA 4AZBA 1ZB5A 1MW1A 2J78A 4D6JA 4PUDA 4IPNB 1W9UA 3VMNA 4GI9A 1C91A 4J27A 5FKYA 3WEMA 2OWXA 1XCWA 1PX8A 1UKSA 4KWUA 2YDQA 3L4YA 1BYBA 2V3GA 3MUZ1 2BY1A 4JFSA 1NQ6A 3WF1A 1W1YA 3L2MA 1SR0A 2GUYA 2GDVA 1GORA 4EANA 2CHNA 2EJ1A 4NZCA 3WD3A 3K8LA 5JBEA 2WMGA 3TONA 1FFRA 3PZ9A 2JEQA 7A3HA 3S2CA 2E8YA 1UWIA 3CGTA 4H2CA 5D8ZA 1B30A 1GJUA 2CBIA 1B9ZA 1E6XM 3GTNA 5ABGA 4MB4A 4MAZA 1MXGA 1C8YA 4CU8A 4QAWA 3EBVA 1VFUA 1I75A 1R86A 1B1YA 5CZKA 4B9ZA 5ABFA 1MYRA 1XSIA 2D1ZA 2ZUTA 4ACZB 1V03A 3GH7A 5A8PA 2X0YA 3UERA 3BAXA 3ARPA 4A3YA 3FAXA 1WDQA 2ZXDA 3VIFA 1WDPA 3K8KA 3AMDA 3WN6A 4GO8A 4M24A 4CVWA 2WVVA 1V6XA 3SURA 1W32A 3SCOA 4AD5A 1AQ0A 3VIJA 5I3DA 1W3JA 2YL8A 3SCRA 1FHLA 2AOSA 3B9AA 5D4YA 3GNRA 1XV8A 1M01A 1FP8A 2B31A 3OB8A 4AZ5A 2CHOA 4D6CA 1QNQA 1AQHA 2J47A 2JALA 1UG6A 3MMDA 3OG2A 1WO2A 1GCYA 1UKTA 1CLXA 1CZ1A 2GFTA 3KE0A 3T09A 5FIPA 2J4GA 3PHAA 2WWDA 2VRJA 1D3CA 1A3HA 1H11A 4S3JA 3DHPA 5FOOA 2WBKA 2YDRA 4M80A 4P7QA 2VZSA 4M56A 3WH5A 1QI3A 1JDCA 2OSYA 3WNKA 3N12A 1H0GA 1M03A 4LYPA 2Z1SA 1XGZA 4NSBA 2WC7A 1HVQA 3VIIA 1LF1A 4GO9A 5ECUA 2D2OA 5I5RA 2VTFA 1NWTA 4R27A 3U5UA 3WH6A 1DHKA 4UCFA 3NCOA 4JCMA 3GXFA 1E56A 3VD9A 1ZJBA 3MSGA 2FHFA 1V0LA 4FK9A 3OIHA 1US2A 3OZPA 2QV4A 2A3AA 4J3VA 4E8CA 5A2BA 2WC4A 2WSPA 1TMQA 3AZRA 4H8VA 5CPTA 3M46A 2QHAA 4PYSA 2GJRA 3ARQA 3NSMA 1H3GA 1JD9A 1V3IA 2BY3A 2DSUA 1QNPA 4WKHA 3O6AA 3GYCA 5A2AA 1V02A 1C90A 4IUGA 1OSEA 1CLVA 3WIJA 4U31A 1O7AA 3PZVA 5EFFA 1LG2A 3A4AA 3CH9A 2O9RA 1MFUA 3DECA 3ZIZA 2XM2A 3ARXA 1JZ3A 5C8BB 4W5UA 1ZBKA 2WMIB 1IT0A 2D3LA 4LPCA 2DT1A 1ESWA 1G0CA 4ATLA 3U57A 4IM4A 3KL5A 2EPNA 1FOBA 2Y24A 1NOUA 5GNXA 4LGXA 3RO8A 1JXKA 5AC5A 3K4DA 3CTTA 3VIHA 1JD7A 1UWSA 3BAJA 4RL3A 4P7LA 2Q8XA 1H5VA 4M8UA 2ZICA 2DDXA 1OGSA 4GZJA 4WK9A 3GH5A 3AMCA 3NIYA 1VEPA 3ARZA 2DT2A 4AD2A 1F4HA 2PB1A 1KWKA 1JZ6A 2EPKX 5M17A 4A3HA 3JUGA 1B2YA 1BVNP 1UKPA 3FAWA 4IISA 5D9OA 2PC8A 2Z1KA 2E9BA 5CG0A 4PMXA 2J8FA 2WMFA 4H7VA 4PTMA 4KMQA 1DWGM 1UOKA 3MUY1 5A95A 5I78A 2ZIDA 5BYWA 1TG7A 4JHZA 1GW1A 2NSXA 4BQ4A 1DWAM 1E5NA 3WUBA 2YA2A 4JIEA 1KXTA 1V6UA 1BQCA 3AS0A 2VJXA 3RPMA 2DIJA 3M07A 3AS3A 2FGLA 4TVUA 1QI5A 5BXTA 5A6AA 3RM9A 4N42A 3EDKA 3AXIA 4HU0A 2IXVA 3ZMRA 1EHNA 4W7UA 3L4ZA 2BY2A 1GONA 1KCKA 1G5AA 5CPSA 4E4PA 3W26A 2X0HA 1VIWA 1GQIA 2IUZA 2V38A 2ZUMA 1KR1A 2X8RA 2YOCA 3AS1A 4JHOA 1HP5A 2W91A 3WUGA 3VGEA 1WB0A 4FLSA 4B16A 1ISXA 4LQ1A 1PX4A 3AIBA 1H4PA 4B9YA 4MB3A 2HISA 5HNNA 1MWOA 2D24A 4U5IA 1KGWA 5LYRA 2DSWA 1ISZA 3GH4A 5C71A 3OLIA 1QHZA 3IAPA 1J18A 2OLHA 2JFEX 3PZTA 2NW0A 3CHDA 5E6ZA 4UOJA 3VIMA 1LL7A 3CHFA 3EMZA 3NSXA 3SIMA 5I6SA 2CXGA 3SEPA 1HJUA 3AS2A 1UWQA 1V08A 1PX3A 5JIWA 2VZOA 2ZX5A 3CO4A 4AZ7A 3APGA 4W8AA 2WKGA 2MANA 1J11A 4M81A 1JZ5A 3A47A 5AYBA 1V0KA 2XVPA 3A6OA 4TUFA 5I23A 4WJXA 1A47A 2F61A 2JIWA 2BV9A 1CGVA 1JYXA 1GQLA 5DF0A 2AMGA 2QF8A 2X2YA 3BGAA 2J74A 3AI0A 1UD3A 3E1F1 4UZUA 3W37A 5A6BA 1J0HA 1HX0A 4PEEA 2XM1A 4UFIA 4TTUA 1NP2A 4Z2LA 1JYNA 3FN9A 5GNYA 1WDSA 3WD0A 4MNMA 2W67A 4W88A 4JL1A 1Q6CA 2V3EA 1UH2A 1X1NA 3AZSA 3KL0A 5FL0A 4FF5A 3AOFA 3CUIA 4PMOA 4YN5A 2WBGA 2G3IA 3W4RA 3VIPA 2WW5A 4AIEA 1QW8A 4NF7A 2ZE0A 4HZ6A 1SYTA 4J3UA 1VRXA 3GNOA 3VUPA 3BAIA 2WHLA 3N15A 2PWEA 3ARUA 4HZ7A 4URIA 3SUTA 4FMVA 5E0CA 4Z2KA 2WHMA 3VKKA 1QVBA 1J12A 1W9PA 3K46A 1BG9A 4KH2A 1UH3A 3ZOAA 2DGAA 3SUSA 3M7SA 4J3XA 1WZMA 3AICA 2XVLA 3VD3A 8A3HA 1EH9A 1N82A 1EIBA 2D0GA 2ZUUA 5LA0A 5A6JA 4CD4A 4GQRA 1D7FA 2PBGA 5M5DA 1NP0A 2W61A 4EKJA 1ZBCA 3WNMA 3GXDA 1JI1A 1UD2A 2WVSA 3MANA 2UY3A 4HU8A 4YHEA 4P8UA 1UD4A 3K8MA 3AHZA 1JZ8A 4DUXA 3ARVA 1B3VA 1FFQA 3MU7A 2NT0A 3GXIA 3GDBA 4C7FA 5D8WA 2E3ZA 3VD4A 1TA3B 2WXDM 4J3SA 3WF3A 3NDZA 1E71M 3PTKA 4RE2A 1U33A 2J7EA 4P8WA 5IFTA 4XV0A 3WNOA 1XH2A 4CCEA 1E6QM 1MQRA 3G6MA 8CGTA 4DUVA 4PMQA 4AC1X 1Y7VA 3DYMA 3WKZA 3BMWA 1XHGA 4BF7A 3WMBA 1VENA 3CZGA 1HNYA 4LYRA 2FH6A 4BQ3A 1JFXA 3THCA 4PRWA 5I0DA 1E43A 2CERA 3WQ4A 2VUYA 1HKJA 3ZSSA 1OINA 4UZSA 2XGBA 4BS0A 4QFUA 4BZYA 1QBBA 4PTVA 3VGBA 1VF8A 2EEXA 4PTWA 3ARTA 3BMVA 4FLOA 3VGHA 1B3WA 5I24A 5JIPA 2BFGA 4PSRA 1J9YA 1E5JA 2OSXA 3IAQA 5D9NA 3VIGA 1IZJA 4OJYA 3PZUA 1KB3A 1I1WA 3HMCA 2OWWA 3UEQA 2V5DA 3T0AA 4UTFA 1UUQA 1C3FA 1OGGA 1YQ2A 4F9JA 3WH7A 1V3JA 3VPLA 4EE9A 1KXQA 4ZXOA 3VIKA 1E0XA 4GI6A 1SMDA 2PWHA 3AIVA 3LPFA 1XCXA 2ZWYA 5D9PA 3U7VA 1J0ZA 5ABFB 1W1PA 4HOZA 3PZQA 4JKMA 4D1IA 3WMSA 5CGMA 3W82A 2PWGA 4LX4A 1BSIA 3MUAA 2OWCA 1BYAA 1FA2A 1WZAA 2VO5A 2NT1A 4CU6A 2YKKA 2CBUA 2CNCA 1PAMA 3LPGA 1JDDA 1L0PA 2XVNA 4GKLA 2BNJA 4JKLA 4PMVA 1ZBWA 3FW6A 3M6DA 4AZIA 2EPLX 3W38A 1MW3A 5A94A 1XC6A 4HA4A 1CECA 1KBBA 1QPKA 5GNZA 3W6LA 1KR0A 2XSBA 4CUCA 2BVYA 4AW7A 2XIBA 4W5ZA 4JZ5A 4XX6A 5DO8A 1CYGA 1EOKA 2OYMA 4W86A 2X05A 3S6TA 1CGXA 3K4AA 1GOKA 5ABEA 1VFFA 4ATWA 1W9VA 5CJ5A 1QW9A 1B90A 2XIIA 1E1EA 1DP0A 1WZKA 2YL9A 2YLLA 4Q7NA 2CESA 4UFMA 3QR3A 4ACZA 4AD1A 4MB5A 2DSZA 3ZJ7A 4S3KA 2UY5A 3WL0A 6TAAA 4CN4A 1D2KA 2WZHA 4CU7A 4QDMA 2CYGA 4J7RA 5AC4A 3GNPA 2G3MA 4OKDA 2E40A 2GJXB 1CGYA 4CD8A 2TAAA 2XJ7A 3VVGA 1SMAA 4RE4A 4AYSA 3WENA 3BH4A 2FHBA 4E8DA 2OYKA 1C7TA 1EDTA 3AROA 2ZX9A 4JKKA 1J0JA 2OSWA 2GJPA 3WQVA 3OLEA 2D3NA 4X0VA 3F5JA 4V27A 1WPCA 1CXIA 2RGMA 1HKMA 1V6YA 1G01A 2A3HA 2YBUA 4FLRA 1CIUA 1V3MA 1QI2A 4CD6A 1PPIA 4PCSA 2W92A 5AYIA 2FGZA 2YIHA 4H41A 1E72M 1G1YA 3BC9A 4EAMA 4OBRA 2WZIA 5BXSA 1UR1A 2G41A 3AYRA 5DT7A 1JAEA 1K9TA 4ZXLA 3L4VA 3RM8A 3BLPX 4WLCA 3QGVA 4YHGA 3W6MA 2WZEA 4U3AA 2XHYA 3VNYA 1MQQA 1GQKA 1P6WA 2XPKA 1UWRA 2ZXBA 4D72A 4UQAA 2ZUWA 2UY2A 1QOXA 5I2UA 2DT0A 1F4AA 1IZKA 2CBJA 1J0IA 1NWRA 4PCTA 2WCAA 4P8XA 1TUXA 4PMZA 2WLYA 1DTUA 2XGIA 1HL8A 5F7UA 1DWFM 3CBWA 3DYPA 5EMYA 1HJXA 3UESA 1GOMA 4GXPA 1UHVA 4PSPA 1E0WA 2DQXA 1Z32X 3CUGA 5BXPA 4AEFA 4HP5A 3VU2A 3WNPA 2BXYA 3PN8A 2ZXAA 2D20A 4D6DA 4AMCA 4UFKA 2CKRA 1KXVA 1ISWA 1UA7A 1W9BM 3TOPA 3CPUA 5DT5A 1E6RA 4OOZA 1OIFA 2UY4A 4D6GA 1LLOA 1OB0A 5E9AA 3VM5A 4D6IA 1GPFA 2XFFA 3DC0A 3WUEA 4PUEA 3NJ3A 1XD0A 3NUKA 1UQZA 4W93A 3VGGA 4DWSD 4HPHA 5FD0A 3ARRA 1FH7A 1NOFA 2QMKA 2ZOXA 1K9FA 4TVDA 4TVCA 2VRQA 3ARWA 3UR7A 1PBGA 4A4AA 2PWDA 2WMKA 4WSJA 3SUUA 4DWSA 5CLWA 4L4PA 1CDGA 3MMUA 3ZJ6A 2DH3A 4Y7EA 2D0FA 1BYCA 4ZFMA 1GOQA 3BSGA 2J7DA 1JI2A 3AZTA 2E4TA 2WHKA 4UQEA 1TVNA 4PMYA 1EDQA 3F4VA 1HP4A 1E9LA 3RCNA 4OIFA 3WDPP 4YPJA 1E3XA 5EFDA 5IHRA 2GDUA 3ALGA 4GPNA 3THDA 1G94A 2PI6A 1BLIA 1QBAA 3PTMA 1UYQA 2CKSA 4NI3A 4QLLA 1J01A 4W87A 4W7VA 5DEZA 2PBOA 3TTYA 1W9DM 4U5KA 3K1DA 1V6WA 1JNDA 4ZE4A 2ZWZA 4AISA 1BG4A 1BYDA 1R8LA 3TP4A 4BCEA 3BCFA 2VZTA 3IANA 3F5KA 2VNCA 1B0IA 1EGZA 3W24A 4D71A 3IK2A 1HJVA 3A4XA 4GQQA 3T08A 1C93A 2YL6A 4HZ8A 1C8QA 1JXJA 2OYLA 3PZGA 1JDAA 3WDRA 3W27A 3AIEA 4UQBA 2A3CA 5CQ1A 4Z2HA 1C8XA 5CPQA 2ZXQA 3HN3A 2XWEA 3ZT7A 1CXLA 3FHAA 3B9EA 1ZS2A 4MDPA 3WQWA 1LL4A 3RILA 1E6PA 1E15A 3W28A 1DWHM 4BA0A 4B15A 1VFOA 2JEPA 4AD0A 3KWXA 3SCPA 3RM4A 1OD8A 3T2QA 3GM8A 2QMJA 2WHJA 4UQCA 1US3A 2C0HA 3GBDA 3EYPA 3HU7A 2ZUSA 5IFPA 1HN1A 1VEMA 4D6EA 2BXZA 4DM1A 1CGTA 2UWFA 2Y5EA 2V3DA 3L2LA 3WELA 3VMOA 5GPRA 3IJ9A 2RGLA 2EO7A 4Q22A 2CBVA 4M29A 2A3BA 4MNKA 4ML4A 2BHYA 3EMQA 1NWSA 1JZ7A 4F8XA 1OBAA 3WDIA 1H1NA 1WP6A 3MSDA 3WEZA 2VVSA 2VRKA 2WYSA 2ZUNA 1E0VA 5A8NA 1W3KA 1GOWA 3ALFA 3WL1A 4UFHA 5BRQA 4PN2A 3F5LA 3N9KA 1Q6DA 3VDAA 3CHCA 5D9MA 3BCDA 4MJ4A 2EXOA 1JGIA 5JBFA 2G4FA 5A6KA 9CGTA 1HKIA 3AMLA 1DEDA 1OD0A 5BCAA 3WNNA 1NARA 3T0BA 1QHOA 2YLAA 1B3YA 2CIPA 4LXFA 1DWJM 1CXKA 4D1JA 3WH9A 1EQPA 4NRRA 2IXUA 3WY1A 4D6FA 4W8BA 1V3KA 1NM9A 5A8QA 5HBFA 1GOIA 4X9YA 1JYWA 3AIQA 4GIAA 2YBTA 2X09A 4AZHA 3OLDA 3B9DA 1E3ZA 2WMIA 3WDQA 4UR9A 3W53A 4MPKA 3WBEA 1MVYA 1E6ZA 5CXPA 1WE5A 2ZUVA 5I79A 3AHXA 2CETA 1E40A 1LJYA 1KQYA 3AYSA 2WAGA 2WLZA 4JL2A 1C7SA 1OM0A 3AMGA 1HIZA 1NWUA 2F2HA 3II1A 2J25A 1W3HA 3GBEA 2VX6A 1L8NA 2E0PA 4MJ2A 2CCRA 2BVDA 1ODZA 1MQPA 4HOWA 3NDYA 1GHSA 1PEZA 2D22A 5A8MA 2V5CA 2GVYA 1W9XA 1XYZA 2W66A 4H8UA 4CCCA 1HJWA 1EXPA 4HA3A 5IXEA 1UR0A 4P8VA 1RH9A 1CXHA 5BWFA 3WD4A 3L4UA 2W5FA 3OA5A 1BF2A 1QHPA 4ZEPA 1HKKA 2FH8A 1R7AA 4GINA 5CSUA 3PZIA 1VB9A 1KGXA 3BLKA 3N17A 3NYDA 1RPKA 1W2VA 3MMWA 3WBAA 4QCFA 4QLJA 2F8QA 2W62A 2WMJA 3MS8A 3N1AA 4GZIA 4MAVA 4TX8A 5CSYA 1KCLA 1W1VA 3OZOA 1WCGA 1PZ2A 1V6VA 2XG9A 4HMCA 3IJ8A 3VDHA 1HL9A 2J62A 3SCVA 4OBSA 2WSKA 1KFWA 2G3NA 3POHA 2J8GA 2YL5A 1UA3A 3EDFA 4W7WA 3VM7A 3WEOA 1EO7A 4V2XA 3ZR5A 2YA1A 4KRUA 3O9NA 1J0YA 4H04A 3RJXA 4PTXA 1EOMA 1HJQA 1BGAA 4QP0A 3CZ8A 4XUYA 1EQCA 1JNEA 3J7HA 4ATDA 2WK2A 4XZBA 1BFNA 1V3LA 3I3BA 2C8NA 1UD8A 1XYFA 4AEEA 1GJWA 1UZ1A 1K6AA 4XZWA 4HA1A 2O9PA 3DHUA 3ZQ9A 3SUVA 2WB5A 5BXRA 5EB8A 3VINA 5E70A 1CXFA 1JZ4A 4ZENA 2X1IA 3BAWA 4JAWA 3NSNA 4C7DA 1KWGA 2ZX8A 1DWIM 1GNXA 3KEHA 4U2ZA 2VR5A 4GZEA 4WSKA 2Y8KA 1RP9A 2VURA 4AZCB 1E6SM 1XH1A 4D6HA 3CZJA 1JYVA 2XVKA 4Z2GA 2V3FA 3ZT6A 4W8LA 1ITCA 1Q6FA 3AXHA 3BAKA 3PTQA 3ZSTA 1RD6A 3SCNA 3EDDA 2WKLA 4UFLA 2J7HA 2O9OA 3AFBA 2E9LA 3TTOA 1V0NA 3PZOA 4DUWA 4TOQA 1MW0A 4IPLA 3A4WA 4B3LA 1R85A 4BQ2A 3MV11 4JCLA 1HT6A 2QLYA 4Z2JA 3EMCA 3ZJ8A 4DWSB 2G8ZA 1HVXA 1MW2A 1BVZA 2ESCA 1B3ZA 4UOQA 3T0DA 1TA3A 1TR1A 1X6LA 1Q6EA 1SFSA 4ACYA 3FNDA 3TTQA 3AIWA 3EDJA 2GJXA 5BRPA 2DT3A 2VX7A 1R87A 1NOWA 5KZ6A 5CLTA 4MDOA 4W84A 1M53A 4RE3A 3KL3A 3SCWA 4AIOA 4WKFA 2WWCA 3VGDA 3CIVA 3AJ7A 1S46A 4PMNA 2VX5A 2WPGA 1GVYA 1KXHA 3OGVA 4P7RA 2DPEA 1JFHA 3UCQA 2WMHA 1OGBA 4UFJA 5A1AA 3RDKA 2VX4A 2QPUA 4MADA 4HMEA 3UG3A 5IDIA 4W85A 1Q6GA 1BGGA 2J75A 2CPUA 4W89A 3SCQA 2Y2WA 2W63A 1CGWA 2Y8VA 4UQDA 5A8OA 1GVIA 2XSAA 4PMUA 1H09A 1UWUA 2VQUA 1UR4A 5E09A 3AHVA 3I3DA 1EHAA 3CZEA 1W3LA 1UR2A 2VVNA 3WF2A 1UWTA 5IHSA 4L4OA 2VL4A 4HPGA 5DFAA 2J7BA 2EBNA 5CGTA 4QLKA 5FL1A 1FP9A 3N04A 1LWJA 1H49A 3POCA 4PBGA 3LMYA 4AZ6A 4M82A 4CKQA 2XWDA 5HDRA 5LA1A 1UH4A 2CEQA 2VQTA 4K68A 1CGUA 4WKAA 3SCSA 3ZR6A 3D3AA 1K9DA 3T2PA 1WZLA 1LG1A 4HTYA 1OWQA 1AVAA 3CZKA 3VD5A 5C70A 3VGFA 1QNOA 1QNSA 2JIEA 4HMDA 4F66A 1KBKA 1TVPA 2WNWA 3UG5A 3VMPA 3L4TA 1HF6A 5HXMA 3OGSA 3WQ6A 1WNOA 3QHNA 2WVVB 4JFVA 1U2YA 3UG4A 3RMEA 2BHZA 2EQDA 3PBGA 1ECEA 1JAKA 2XUCA 1PJ9A 1H0IA 2FDMA 1Q4NX 3PZMA 3UETA 3AQUA 1EO5A 1E4NA 3ARYA 5TD4A 1CXEA 3SCTA 3RIKA 1JZ2A 3VILA 1E73M 2DIEA 4AD3A 1RP8A 5E0FA 2YJQA 4CN6A 1V3HA 3WD2A 1J10A 1JL8A 1EA9C 3CMJA 4U3CA 2XVGA 3MUIA 2VC9A 3VIOA 3BAYA 2AAAA 3CHEA 3N18A 5JUVA 1LL6A 5A6SA 2J7CA 2VZUA 3O2LA 3QHOA 1I1XA 2E9MA 4J3WA 5A6BD 4CVUA 4Z2IA 1PIGA 1XSJA 5HPCA 3KZSA 3CUFA 7TAAA 1VBRA 3WFZA 1OT1A 4C7GA 1U30A 3VNZA 1E70M 3AIUA 4JFWA 2WC3A 1GQJA 1VFMA 3D5HA 1HJSA 4AXNA 5M3WA 2QPSA 4UNIA 3GZAA 1CEOA 2J7GA 1QI0A 2CITA 4H8HA 2D23A 1E6NA 2GK1B 1W2PA 3ARSA 4AZCA 2O92A 2ZX7A 4EK7A 1E4IA 3SCUA 4MB1A 4MNJA 2GSJA 3I3EA 4TX6A 3WD1A 2XFRA 3WFLA 1O6IA 1WKYA 4KRTA 4UOZA 2PF0A 3QOKA 5KEZA 2A3EA 2EPMX 3WSUA 2GK1A 3G6LA 4DM2A 4CCDA 4J3TA 4AD4A 5A6MA 2XFYA 3AIRA 2BVTA 1E1FA 1M04A 2BHUA 2YA0A 1KGUA 2XYLA 4JFUA 1UD6A 2WCSA 5A2CA 5M03A 1GZJA 4U2YA 3VTRA 1UKOA 4HOXA 4MNLA 3AISA 3N13A 2J7FA 3VDCA 4JFTA 5AY7A 4NRSA 5A6LA 1CNVA 4CD5A 3WDHA 4AWEA 2ZX6A 3HJEA 1OT2A 1OCQA 1CTNA 3DYOA 3U5YA 1MXDA 1XH0A 1FH8A 3AHYA 1V02E 2J77A 3WF0A 5DMYA 1JG9A 4UQ9A 1AMYA 4QCEA 3SUWA 1JIBA 4P7NA 1CENA 1PZ3A 3CMGA 3FXYA 2O9TA 3CLWA 4PMDA 3MO4A 1UZ4A 3TA9A 3VD7A 1UQYA 3WQ5A 1ISVA 1BHGA 1UR9A 2VT0A 3UR8A 2DSVA 4E2OA 1CBGA 2VI0A 1ISYA 1W91A 1W1TA 2E8ZA 2VOTA 4OUEA 3VX0A 5LA2A 1B31A 4BQ5A 3QHMA 4KGJA 4TXEA 3W0KA 3WDJA 4XB3A 2D0HA 2PWFA 1VJSA 2VCAA 2WM0A 4B3KA 3OBAA 3FY1A 1TCMA 1JF6A 1LQ0A 3WF4A 2JF6A 1XSKA 4AIUA 2WVUA 3A3HA 5I77A 4U33A 1UR8A 3FHQA 1TE1A 2JE8A 4DWSC 1XD1A 4F9DA 1ITXA 3LPOA 4GI8A 1YHTA 4TTGA 1VAHA 1TFVA 4X0NA 3EDEA 2BS9A 1ZL1A 4CGTA 3VX1A 3MV01 3L4WA 5A69A 3CUHA 5JBDA 1K9EA 3TTSA 1AQMA 3AHTA 1VBUA 3W81A 1E4MM 1WAWA 2VCCA 3N11A 1FHDA 3ZM8A 1KQZA 4AY1A 1VEOA 1BAGA
chains in the Genus database with same CATH superfamily
3VNMA 3EWDA 3CUJA 1ADDA 2V8ZA 3QBUA 1WDDA 1OIMA 4MTVA 5F2LA 4R5EA 3GDKA 2NQ9A 4BWLC 3LB0A 5I3KA 1FH9A 4IOTA 5GQBA 1KFKA 3AO0A 1E4LA 2YPIA 5EYWA 2PP3A 4Q8NA 2HK0A 1SFLA 5EBAA 4WIWA 3GXMA 5J04A 1MDRA 1ICSA 1FHUA 1VJZA 2ZC8A 2J79A 4O4VA 4RNHA 2W4XA 3V36A 2PTYA 3OLGA 1R7OA 5HWJA 1B3XA 1IT7A 1V0MA 2DEPA 5AHNA 3CZLA 2OZ3A 1ZBVA 4MF4A 1X6NA 1NH6A 1JCXA 1O94A 3OBKA 1H2JA 5CJMA 2ZDSA 1W1A1 2QCFA 2C71A 2XTKA 4NNCA 1LWHA 4N0RA 1ZJHA 4UTMA 2BDQA 3UR2A 5BOFA 2ACSA 2GDQA 4LYQA 3SQMA 3W7LA 3WMCA 4V28A 2F84A 3GG8A 1J0KA 3WH8A 2DZWA 3R94A 1OFEA 1EDGA 3HPAA 1ZU8A 4OZOA 2PP0A 3EX3A 3BSHA 4S39A 3RJYA 3EWXA 3BXWA 4XSMA 6CGTA 1W1ZA 2Y6ZA 1ICQA 3W22A 4IPNB 1W9UA 2GJNA 4OV4A 4AY8A 4YIWA 4J27A 4FX6M 3GXPA 3C52A 2OWXA 3C8NA 3MP5A 1PX8A 1Y5WA 1BYBA 2V3GA 3MUZ1 2BY1A 1NQ6A 3GD6A 2GDVA 4O50A 3SN0A 1GORA 3W7EA 4EANA 2CHNA 2EJ1A 4G2DA 3K8LA 4HGXA 5JBEA 2WMGA 3PZ9A 3LG3A 1FWTA 1T41A 2OT1A 7A3HA 2QVHA 3DGRA 2Z0IA 4ZTYA 3RCMA 4DAFA 2DFAA 1K1DA 3CGTA 1Q4WA 1XLBA 1W3NA 4GC3A 4NXSA 1U1JA 5CSRA 1E6XM 3GTNA 4MAZA 2AQWA 4QAWA 3IIZA 4I5RA 3EBVA 5CZKA 4ZQMA 2X41A 3KLKA 3DI1A 3CH0A 5ABFA 2D1ZA 3B0UX 4ACZB 2X0YA 4A3YA 4KIRA 4LF2A 1N8FA 4GO8A 2H3DA 2WVVA 2I5GA 3GG1A 3UWYA 2J13A 4JTUA 1AQ0A 3VIJA 1W8GA 4HU4A 4I5XA 1W3JA 1H61A 2CWNA 3EKZA 4XWUA 5AC8A 1KM0A 4XBJA 1M01A 2BGSA 4AZ5A 1QNQA 4IL0A 2JALA 1WO2A 3U2CA 3N6HA 2J4GA 3N9RA 1XLEA 1FCQA 3TN5A 1YW1A 2G5WA 2GGGA 1EGVA 1D3CA 1H11A 3UJ2A 2CLFA 1FWRA 5CPOA 4QIUA 3IUDA 1ZAHA 4P7QA 1EWEA 2OSYA 1H0GA 1S5NA 2DU2A 4QNEA 4NSBA 2YCLA 3FYPA 3GDMA 3GG0A 2ZRVA 1TELA 1SJBA 4H9ZA 2VTFA 3WH6A 1DJNA 3NCOA 4JCMA 3HA1A 4QG8A 3B8DA 3CWOX 4IFOA 1KD0A 4L1WA 1US2A 1X96A 2FTWA 1FWDC 3I4EA 4E8CA 3R89A 3B0VC 2WC4A 3M5YA 4RPPA 1TMQA 3TYDA 1MEHA 3W76A 3VFLA 3LRLA 1YTDA 2QHAA 1ZTVA 4CQ9A 1H3GA 3EOLA 3CLMA 4LYKA 2DSUA 4FXRA 1QNPA 1V02A 2QAPA 4G7FA 3TQKA 4U28A 4O12A 2V5LA 1QR7A 1LG2A 3A4AA 4S1FA 3THAA 4LAUA 1B3OA 2XM2A 3TWAA 4XTIA 1YE4A 4K1WA 1TPFA 1EC7A 1OG6A 1FWFC 1ESWA 5TIMA 4PUUA 4IM4A 1PKLA 3BICA 3H7RA 1GW9A 3MKVA 3S9YA 8TIMA 3RO8A 1JXKA 4FEZA 3CTTA 3E38A 2PTZA 5FI8A 3LTYA 4JIPA 4LY4A 3T7VA 3I7SA 1H5VA 1OX5A 4O1BA 2DDXA 4QGCA 4JIIX 4WOZA 1OK4A 1OGSA 4GZJA 2XU2A 1KRCC 5G1MA 3TR9A 1R0MA 3DERA 4WDTA 3A9BA 1OEPA 1KWKA 3LQLA 1HZYA 1JZ6A 4NP7A 1J96A 1UKPA 2O0TA 4IISA 2I5IA 4H00A 3ZVHB 1EEPA 3BWWA 4PTMA 4KMQA 1UOKA 5I78A 4LVDA 2Q3RA 1XXXA 5BYWA 4BQ4A 3UR5A 2DZSA 2YA2A 1PSCA 1NEYA 3M44A 4JX6A 2DIJA 3M07A 5KZEA 3AS3A 2QGHA 2VEIA 5CJNA 3U2EA 2WJDA 3DDMA 3BQ6A 4DJDA 3B8IA 4HNNA 1EJTC 1IGWA 3OG3A 1AMKA 3MQTA 3VABA 4Q7BA 3S5NA 4IP7A 3KOWA 2PLKA 5DXYA 3MWCA 1G5AA 4E4PA 1P43A 5LNUA 2IUZA 3F2BA 1IXNA 3C86A 2B4GA 2YOCA 2WNQA 4JHOA 1V7AA 5TAOA 2PZNA 1ISXA 3AIBA 2XH0A 1H4PA 2QDEA 3PSVA 4GA8A 4Q32A 1MNZA 4GQGA 3Q45A 1W56A 1KGWA 4LEQA 4RJEA 5LYRA 4O1DA 3IAPA 1J6PA 3PZTA 5E6ZA 1LL7A 4IFKB 3SEPA 1AL8A 1YLVA 1MUCA 1Y65A 4JYFA 4DZAA 5TBOA 4GI4A 1O1HA 3QSTA 1FWJC 2IMRA 2FYMA 3L2IA 4N6EA 1J11A 3R8GA 5AYBA 1V0KA 5AN7A 4TO8A 1S2TA 1R2SA 1RQBA 3B9OA 4O57A 2ICSA 4B5WA 1BKSA 1CGVA 5DF0A 4RV3A 2H6RA 1UD3A 1W0MA 2FJUB 2VDGA 3L23A 3W37A 1JUEA 1J0HA 1TJ2A 3SDOA 3SJNA 5LNWA 2NWSA 4IIDA 4HZMA 1WDSA 3SY1A 3WD0A 3CQ0A 2W67A 4W88A 2JBMA 4JL1A 1Q6CA 3WLMA 1X1NA 3AZSA 1E9YB 4FF5A 1EJWC 2WW5A 2IPFA 4NF7A 3VUPA 3TCEA 3BAIA 3TSDA 3E0IA 3G3DA 3N15A 2PSNA 4PL1A 2JKAA 3SUTA 4FMVA 5E0CA 1SM9A 3PWIA 1J12A 3K46A 1BG9A 1UH3A 3ZOAA 4GGHA 5AHFA 1WZMA 3AICA 4YS1A 1N82A 3OVPA 2D0GA 5LA0A 3MYOA 3OVRA 1JPDX 4GQRA 3VC6A 2OVLA 2PGWA 4GNJA 3LHUA 3QVQA 2QS8A 1ZBCA 4TR9A 3WNMA 1JI1A 2UY3A 4POCA 2DZBA 3EEGA 4P8UA 2PDWA 4YCOA 3AHZA 4KWSA 1JZ8A 1WKEA 1F2JA 3QV6A 1I2OA 4XZNX 2PF8A 5K9DA 4A6GA 1XUUA 1CW2A 3NDZA 3PTKA 4XV0A 4J5NA 1XH2A 2I1OA 3UD6A 2W0UA 5KETA 4K36A 4MYAA 1X39A 2BASA 3GLCA 3P80A 2RH9A 3WKZA 1XHGA 3CT2A 1OG0A 3CZGA 3CPRA 4ECLA 2V67A 2CZ5A 3TTEA 2CERA 3EKGA 2QCDB 4ML9A 4UZSA 5L6UA 5TNVA 2XGBA 4ZQCA 4QFUA 1OFRA 3N6JA 3WJSA 2FTPA 4A8NA 4AF0B 2NV2A 4FR1A 1QPRA 3I68A 4DJFC 2BFGA 3LSCA 4ERAA 1E5JA 5HNRA 2OSXA 3VIGA 3HMCA 1DL3A 3UWQA 3T0AA 3UWVA 4UTFA 3H2MA 1YQ2A 3CV6A 4I9AA 4NAEA 3A64A 2HSAA 4QX4A 4LUSA 5FJRA 3NL2A 3TNBA 1T99A 3CYJA 2PDKA 3LHYA 1ECQA 5BU6A 2OZTA 1F76A 2PDXA 3TN4A 2OX1A 4M51A 2OWCA 1BYAA 1FA2A 2I9UA 3E2VA 1P1MA 2VO5A 2NQJA 2NT1A 2CNCA 3LPGA 3TMQA 2NXGA 4IMCA 1AUSL 4C6BA 3FW6A 4C6MA 5HK4A 4AZIA 1MW3A 1XC6A 3G1HA 3SSZA 3FKRA 1QPKA 3W6LA 2XSBA 4CUCA 4MJMA 3B8TA 3RLGA 3BK0A 3QFEA 5DO8A 2OYMA 2X05A 3S6TA 4CLMA 1CGXA 3ZS4A 1A4MA 1GOKA 1XYCA 4IF2A 1VFFA 3URNA 3N2BA 1ZLPA 1WZKA 3SRHA 5CSSA 3CUZA 4ZFCA 3B4YA 3ZJ7A 1IYXA 4E5TA 2BB0A 1PZ1A 3URBA 3PFMA 3BPWA 4YTUA 3EXSA 5CGQA 3VVGA 4RE4A 4IQLA 1QATA 3MP4A 3WENA 1C7TA 1X8FA 5FESA 1TVLA 3AROA 5HMSA 2OSWA 1SJCA 4X0VA 4OFCA 3TXZA 5D03A 2PGRA 5CAKA 4V1YA 3VK5A 4CD6A 2NV1A 1IGSA 2OOFA 1IIGA 2FGZA 3FJNA 1R9XA 1THFD 4XAGA 4XUGA 4FF7A 4QEEA 4PCNA 3MO7A 5BU9A 2WZIA 1XIGA 4R7OA 1WUFA 4YVXA 1XM3A 1JAEA 2C79A 4BI7A 1O5RA 1A5NC 4LS0A 3R43A 3JZUA 6ENLA 1XYMA 4L80A 3LK6A 3RM8A 1SFTA 1I2QA 1WXZA 7TIMA 3W6MA 2QEZA 1RVGA 1RZMA 5C2GA 1UWRA 3LXAA 2ZUWA 4EXBA 1YTKA 2DT0A 3M5XA 4AIBA 4R53A 1IZKA 1GTHA 2XN0A 1J0IA 2QIWA 3HV8A 3G8EA 4ZA0A 3PPFA 2WCAA 3B0YA 2NUWA 5BOEA 1SFJA 1TPUA 3P74A 3CAQA 3CBWA 3DYPA 5EMYA 3OP2A 1NF0A 3UESA 3UWWA 3LZ5A 4O17A 4UR7A 4FB7A 5BXPA 4YMZA 4NT0A 3VU2A 1UMYA 2D20A 2V81A 3RU8X 1KXVA 1OX4A 3TOPA 1EBHA 4D8ZA 1OB0A 3VM5A 4D6IA 4KFPA 1W5QA 3LLDA 3U6WA 3MJYA 2QYGA 1XD0A 6REQB 4W93A 3QY6A 3OO2A 4BI5A 4DWSD 4HPHA 3O07A 4PC8A 3L21A 2DVUA 3GYEA 3IJDA 1PDZA 2ISFA 2VRQA 3UR7A 4AHQA 1S5MA 1VR6A 4M7TA 2C0AA 4NVTA 3IPWA 4DWSA 3H22A 5CLWA 3G1DA 3WFAA 1YKWA 1G67A 2YSWA 3BSGA 2J7DA 2C19A 4EWND 2BLEA 1TVNA 1T40A 3W7HA 4PMYA 4M5PA 2PLJA 1E3XA 1SW3A 3ALGA 4GXMA 4ZOEA 1IWPA 1RCQA 1QCWA 3C2OA 1FKXA 1G94A 2PI6A 3W7PA 1LRQA 4JX4A 4C90A 4C5ZA 3MYPA 1MEIA 3LCHA 1ZUAX 1RJQA 4GUGA 3FXGA 1F8IA 3OHMB 1RR2A 1JNDA 3RGTA 1KTCA 2R14A 4AISA 4GH1A 1DV7A 2P76A 1R8LA 1MEWA 3W1LA 2VZTA 2VNCA 1B0IA 1EGZA 3W24A 3IK2A 5D04C 3RNDA 3Q2DA 1HJVA 1XYLA 3T08A 2QAFA 3KP1A 1WUEA 1XISA 4IG2B 4ZB5A 4DAIA 1JXJA 2Q71A 2A3CA 1M3UA 5CQ1A 3GR7A 4Z2HA 5HMEA 4MJZA 5CPQA 2O55A 5PTDA 2X42A 2YW4A 3K4WA 3LV6A 4LVGA 1E6PA 4WR3A 3W28A 1DWHM 4WXYA 4JTQA 4AD0A 4XD3A 3P82A 4QG9A 3SCPA 4REQA 1A5SA 2WHJA 3GBDA 3EYPA 4MY8A 3P7YA 1DPMA 3N9SA 1HN1A 1VEMA 3N6QA 2DJXA 2HS6A 1V51A 3G5EA 2V3DA 4DPPA 5GPRA 2PFHA 3TMLA 3WQFA 4W9TA 2ZZ2A 4M29A 3GXTA 3AXMA 4I6KA 1M9HA 3QF0A 4ML4A 4V15A 2BHYA 3KOYA 4HHHA 3BLFA 3C4UA 4M6VA 4DPQA 1O5XA 2E6DA 3REQA 1EXBA 4ILSA 4NZ4A 2PDYA 1W3KA 1PCKA 3LI0A 4LRSA 3N73A 2JGYA 1JR1A 4PN2A 5HWNA 1Z42A 5D9MA 3BCDA 1W1B1 4S2BA 4R7JA 1EBGA 2G4FA 3Q4DA 4C6EA 9CGTA 1H60A 5LXEA 4PBFA 2V2CA 1NARA 4M3PA 5KSWA 1B3YA 2CIPA 5K9CA 4ZODA 3MZNA 2ABBA 3GK0A 1EQPA 7PTDA 4G5DA 3VNLA 2J9XA 4O11A 1JCMP 5DCDA 5KTLA 3AIQA 4RXFA 2GYIA 4GIAA 2VGBA 2GZXA 4L9ZA 3TVAA 5LGXA 2WMIA 3E96A 1FWCC 4BJHA 3W53A 3WG6A 2NV9A 2CLOA 1WE5A 1TPC1 2ZUVA 3AHXA 1TV4A 1AJ0A 3HO8A 2CETA 4AX6A 1LJYA 1W3TA 1XBXA 3JRKA 4FO4A 4MOZA 2ZZ5A 1B4EA 1RA5A 1WA3A 2WAGA 4GWEA 3GTHA 3C5QA 3JU2A 3AMGA 4H01A 2F2HA 4IWWA 3GBEA 2VX6A 2VGGA 4QE4A 4I6VA 4QTGA 2CLPA 4TMCA 3TQPA 1ODZA 1MQPA 5FF3A 3WLIA 2JKPA 4LVFA 2VFEA 2Z2AA 1GHSA 1DTNA 1PEZA 5A8MA 2V5CA 1YX1A 4GUJA 3U0HA 2Q09A 3QSRA 1ITQA 1VFHA 1W9XA 1S1PA 1XYZA 1HJWA 4Z42C 1H62A 4NX5A 1EXPA 4HA3A 4P8VA 4DBUA 1RH9A 1CXHA 5BWFA 3L4UA 4OQVA 1BF2A 1QHPA 1HKKA 2FH8A 3V4BA 5CSUA 3PZIA 1FWWA 3IIOA 3MMWA 2DZTA 2C14A 1ME8A 3VUSA 4HNLA 1M7JA 1KTBA 3N1AA 4RNIA 2PDUA 3JS3A 4PA8A 1WBHA 3ZVIA 3MC5A 1BVWA 3G22A 1O5QA 2OFJA 3TNOA 5CSYA 1SGJA 1W1VA 3VZZA 1QU4A 4HMCA 3IJ8A 1DYSA 2KZHA 2J62A 1XINA 3D3FA 4OBSA 2BWGA 1KFWA 2G3NA 2CZFA 3POHA 3ATYA 3R13A 3EDFA 4DELA 4WUIA 3VM7A 3WEOA 3VCCA 1O60A 1XIIA 1J0YA 3U2OA 4PTXA 4R9OA 5E9XA 1BGAA 4XKYB 1M65A 3CZ8A 2YZRA 5FJOA 1JNEA 4QNWA 5C2XA 3GSMA 4ATDA 3HOJA 4GMEA 1BFNA 3KTXA 4IG2A 1PHQA 2WJFA 4IMDA 4CQDA 4IX0A 1UZ1A 2RDTA 1SSDA 1JVNA 1KFCA 3N4EA 4HA1A 1VCVA 3ID7A 3DHUA 4TV6A 3ZQ9A 1R3RA 3MHGA 2Y85A 5EB8A 1RQHA 3BG9A 1K6WA 1US0A 3WYZA 2R24A 4S3CA 2Y88A 2X1IA 4C7DA 1CT5A 2VD8A 1DWIM 4U2ZA 1MRAA 2VR5A 4GZEA 4AZCB 1HFBA 5D2VA 3A4JA 1JYVA 2PGEA 1K7EA 1ITCA 4QHRA 3AXHA 3PTQA 2CLMA 1Z3NA 3SCNA 1BXBA 3EDDA 3GFXA 3UW6A 2O9OA 3TTOA 1V0NA 1EF2A 3PZOA 1MI3A 1XDJA 2W9MA 3A13A 1RLDA 3LEPA 1HT6A 2R8WA 3KVKA 3GB6A 1A50A 1XFBA 1AA1B 1DHPA 1ME7A 5HMFA 1TB3A 4E2DA 4KW2A 3ZJ8A 4AC7C 2G8ZA 3N25A 1HVXA 4CEUC 4S38A 2FMNA 9RUBA 3LM7A 3PR2A 3BDKA 4Q8UA 3M41A 4WDWA 2GVJA 1SFSA 3W87A 3ITCA 2R1MA 3TTQA 1IZCA 3EDJA 2GJXA 4NNAA 2DT3A 2VX7A 1G4TA 1V79A 1ZSXA 4EF8A 4ROQA 2ZVIA 4W84A 1M53A 4RE3A 2AQOA 3SO7A 3SCWA 1WXYA 4X63A 2HZGA 4GOAA 5HNTA 2OO0A 2EKGA 3RMJA 3VGDA 3ANYA 3TFXA 3DH7A 2DPEA 1UJPA 1UW9A 2GL5A 4KCUA 4PEKA 2QPUA 3GXNA 1HO1A 3GC5A 4W85A 1TPVA 2CPUA 2R1NA 3M64A 3EOEA 2A4AA 3BZJA 4GCXA 3HGJA 3P81A 3UXLA 2VR2A 5AFDA 1DXEA 3VNDA 1UR2A 3V16A 2VVNA 3WF2A 3H26A 1SZGA 5M1TA 3PFRA 4HPGA 5D2WA 3ERPA 5IBXA 1PIIA 5CGTA 5FL1A 3VE7A 2GGHA 2X0SA 3GAYA 4JTKA 2CEQA 4K68A 2CZVA 1CGUA 3ZR6A 4NKCA 4HCDA 4DJFD 2PP1A 1U1HA 4RK8A 5C70A 3IIXA 3CQHA 4FOKA 3LCXA 3NQ7A 3P61A 3E2RA 3KRBA 3S83A 3VMPA 3W7JA 5HXMA 3WQ6A 4UTKA 3HG3A 3NVDA 2DORA 2INZA 4HSOA 3PBGA 1Y5XA 8XIMA 4LVAA 5EL1A 1H0IA 3UETA 2VP8A 1EO5A 1E4NA 3NNTA 1JZ2A 5BRBA 1L8PA 5EKYA 3V1HA 4CN6A 4QQ3A 2ALDA 3EOSA 1JL8A 3U4FA 3CMJA 4OVXA 1OJXA 4U3CA 2F6UA 3SECA 3W07A 4DJEC 2ZC1A 1KRMA 3N18A 2D69A 3PUEA 5A6SA 2J7CA 2TODA 3SZ8A 2HPIA 1IEVA 3P8IA 1I1XA 4GGBA 4DBEA 3IRSA 4GIRA 1EKOA 1QO2A 1PIGA 1XSJA 3LN3A 5J5RA 1N8WA 1U30A 3VNZA 1GJPA 3AIUA 4PZVA 1ZENA 3D5HA 5M3WA 5C9RA 2QPSA 3GFYA 4UNIA 3QY7A 2X7VA 2CITA 3LA4A 2YYUA 3VCNA 4H9YA 3W1RA 1UZDA 3U3HA 3ABRA 1W2PA 3R2GA 1WKDA 3K2GA 2C18A 4O19A 2C15A 4MB1A 5F2MA 3T0TA 1YRRA 5G1TA 4CEXC 4L65A 4AHOA 3WFLA 5BMXA 1WKYA 7REQB 4UOZA 1F73A 2PAJA 3O0KA 2EPMX 3WSUA 1XF0A 3ES7A 2XFYA 3AIRA 1M04A 4DVOA 2WCSA 5A2CA 4QROA 4WJEA 3VTRA 3PC0A 1REQA 1S2WA 1XLLA 1KLYA 4RW5A 4ZGYA 4FNRA 3IIPA 5A6LA 4JTEA 4QITA 4RKAA 1Z41A 4JTRA 3UYIA 3R8RA 1MXDA 1FX6A 4AF0A 3O6YX 3URQA 1T7LA 1JG9A 2LLEA 1R9YA 3QH2A 1CENA 1PZ3A 4O1CA 4ZMGA 3FXYA 3OOQA 3S47A 3MO4A 3TA9A 2I57A 2GUBA 3T9PA 4IMEA 1BHGA 1EYEA 2VT0A 3UR8A 1OCBA 2AMXA 3KOZA 5T26A 5CPMA 2VI0A 4GUHA 5DY2A 1QOQA 2NLYA 4BQ5A 3UP8A 4TXEA 3NO3A 3EPNA 2VC5A 1VIZA 5AHEA 4J1OA 3CNYA 1PL9A 4XSLA 5AC7A 3MHUA 1JF6A 3T78A 3WF4A 3V35A 3PVFA 3D6NA 3STCA 1XSKA 4AIUA 2WVUA 4FAMA 1A5CA 1JPKA 4U33A 4DNMA 4LH8A 4DWSC 2V2HA 1VAHA 1R3TA 3TJXA 1A0EA 4X0NA 3QMSA 4QM1A 1LQAA 3CUHA 3SGUA 1G7VA 4JYEA 2V0TA 2ISWA 1TPDA 4PTNA 1BAGA 2ADAA 2INFA 3SAZA 4YCPA 5LNRA 2QDDA 3EWCA 4JTLA 4NZ3A 4UTHA 1GUVA 4JTHA 3RUBL 1EFZA 1PIFA 3IJ7A 3CXOA 2ZRUA 6ALDA 2ODOA 1U22A 3AMKA 2PCQA 4NJHA 1TRDA 2Z25A 2WJZA 3I10A 3L4XA 4ZB2A 3W29A 3VO0A 1RK6A 3PBUA 4UTWC 4MKVA 2PCEA 3MZ2A 5AVNA 1XQKA 4J4KA 1AZ1A 5C7VA 4IIBA 1OF6A 1ZP3A 3DBPA 2C1IA 1ODUA 2VR4A 3MUCA 3NOEA 2WCGA 1QNRA 1M7XA 1ONRA 1C8VA 5C54A 1BWKA 3XIMA 4TQTA 4PBEA 4P7OA 2IQTA 1NFGA 5DBTA 4H1ZA 1G9HA 1V5XA 4KGLA 4AZGA 4O16A 2ISVA 4JNMA 3L0NA 2CW6A 3KZPA 3S9IA 2DZXA 2IKJA 3NTYA 4HJWA 5T9BG 5BNKA 3GX9A 3N3TA 5F1VA 4DZHA 3WNLA 4MM1A 3R58A 1BPLB 3UZ5A 3IUIA 3RO6A 1JF5A 5A3HA 4I9MA 3JVAA 2WVTA 3PPGA 4BFAA 2IQ0A 3UJRA 3SR7A 3TYZA 2WQPA 3ZJKA 4CN1A 4MPQA 4B92A 2PLCA 2J8TA 3LGGA 4US5A 4HN4A 4Q4OA 4LF1A 5LIKX 1IR1A 1UB3A 1ZB5A 4W4QA 1TJRA 4KCWA 3KVJA 3L5LA 5D30A 3CL8A 5D09A 1KNWA 5BWAA 3DUGA 4C6JA 4KWOA 2WSQA 3L4YA 4RX0A 3R10A 2UBPC 3Q37A 3INPA 1W1YA 3RX2A 2CXEA 3GUGA 1SUXA 2IPWA 3HFTA 4GX8A 4NZCA 3WD3A 4F0SA 3BSMA 3TONA 2JEQA 3MHFA 3P60A 4HU3A 4ORMA 3OIXA 3P0XA 5D32A 1H1ZA 2I5QA 2C1GA 1UWIA 4H2CA 1X97A 4IMFA 5D8ZA 5LNSA 1B30A 1GJUA 4QG6A 3E5BA 4HYWA 4B91A 1C8YA 1FQ0A 1I75A 1B1YA 3IJLA 5EGRA 4UC5A 4H83A 3PBYA 2ZUTA 2E6AA 1ZPTA 3PS7A 3GH7A 3BAXA 4XZMX 1TTQA 3H4WA 4ZTXA 3WN6A 2C6QA 3T55A 5LHFA 2VKZG 4UMAA 3MDUA 4A2SA 3SCOA 1AJZA 5M2FX 3S9ZA 4JY8A 4WX2A 3MBFA 3SCRA 2YL8A 1F07A 5U4NA 2AOSA 3CQJA 2E09A 3B9AA 3GNRA 5LIWX 1XV8A 2B31A 4LFYA 3OB8A 2CHOA 5DMNA 4HTBA 1UBSA 1UG6A 4UTJA 1GCYA 2GFTA 5FIPA 1TMLA 3BOXA 1HG3A 4KKXA 3B8VA 2A0NA 3E74A 3WLQA 3DHPA 4M80A 2I9EA 2VZSA 2VWSA 1D9EA 3WH5A 1JDCA 3WNKA 4XK2A 3A12A 2Z1SA 4MWAB 4TMBA 3N4FA 3F03K 5ECUA 1Y8BA 2P8CA 4UCFA 2E1WA 4QJ5B 3GXFA 1YPXA 4QISA 3QQ1A 4XAPA 5CBBA 4ZOAA 3OZPA 4J3VA 1CX9A 2DZUA 3SY5A 3DBNA 3NQDA 2Y7GA 2E6YA 4HK6A 4RV8A 3KFTA 2YXOA 2AKMA 3M46A 1H63A 2I17A 3W86A 3ARQA 3NSMA 2BY3A 1DJXA 1A49A 5A2AA 3U9IA 4FSAA 1CLVA 3WIJA 3EX6A 2WZTA 4U31A 4HYVA 5EFFA 1OX4B 5AOUA 3CH9A 1UUOA 1YADA 5KZDA 2FZMA 4NZJA 1Z9AA 4Y9NA 5C8BB 3B06A 2WMIB 1IT0A 2FZ9A 4GISA 5LNVA 1J5TA 4ATLA 1XCFA 4B4HA 3W3OA 2A79A 2EPNA 3UXIA 1NOUA 3LYEA 1SR9A 4CNUA 1XIHA 4C60A 1JD7A 3BAJA 4RL3A 3S2MA 3MSRA 4P7LA 2Q8XA 2WOQA 4M8UA 4NXKA 1SO3A 2PURA 2QUUA 2VYOA 4NL1A 5CC7A 3W7OA 3NIYA 4NJIA 3ARZA 3ITYA 5HNUA 4A22A 1A5BA 3GDRA 2DT2A 3YPIA 4AVNA 5DY3A 4DJFA 2Z1KA 2E9BA 4G7EB 4H6EA 2WMFA 3BMXA 4DIAA 4LS1A 3XINA 1SU5A 4JHZA 4MYXA 4MZ1A 3WLOA 3W7KA 2YB4A 4JICA 3V1PA 1E5NA 4JIEA 4ROPA 3MMTA 5D2TA 2E25A 3BLEA 1DJYA 4TVUA 3MT1A 5A6AA 4Z0SA 1LUCA 3RM9A 3NQ2A 4N42A 1MNSA 3EDKA 4XISA 1REQB 4HU0A 3LD5A 1VS1A 3VNKA 2OLSA 4GQ0A 1EHNA 1KCKA 4H9XA 4ENLA 1HL2A 1VIWA 1I0BA 4A21A 1TYGA 2ZUMA 1KR1A 3CC1A 3WUGA 3VGEA 1WB0A 5XIMA 4B16A 3NO1A 3O06A 4B90A 1QMLA 2HISA 3GW3A 4U5IA 2PU1A 3WQPA 4IMAA 4QSHA 3NQ6A 1ISZA 1QHZA 3OW1A 1J18A 4GZ7A 1I0DA 2NW0A 3CHDA 4ZSUA 3K13A 1GZGA 5I6SA 3VI2A 1K7FA 1TTIA 3AS2A 1UWQA 4PUNA 1L2UA 3P0WA 3USZA 4BHYA 4IFRA 3SSJA 2V5JA 2F2KA 3APGA 3IVSA 3EWUA 1JZ5A 3A47A 4HJFA 4WDXA 2XVPA 5IOBA 2F6XA 4Y96A 4WJXA 2F61A 2NQZA 2BV9A 2ANUA 4ZO9A 2DJLA 3MB9A 1GQLA 4RE0A 3PTDA 4ZBCA 3UU0A 2ZFAA 3ZVHA 3MDWA 3C3UA 4LWWA 4CNPA 4GBDA 4LTSA 5A6BA 4UFIA 4TTUA 1NP2A 2B7OA 3EX2A 1XIFA 1QWKA 3G1AA 3HURA 3A22A 4FXSA 4KRZA 5C6MA 4Q33A 4A3UA 5AYXA 1DJIA 3KL0A 3OBEA 3GZ3A 4YN5A 4I8DA 3W4RA 1QW8A 1LOSA 1ME9A 2PTWA 3NZPA 1LUCB 1RD5A 4HZ7A 4URIA 4B2DD 4GJIA 3ZLHA 3L9CA 2YBVA 3NWRA 3NEVA 4KH2A 2PGFA 3JW7A 1R6WA 3TQVA 2XVLA 3VD3A 1EH9A 4K39A 5G2HA 4Q4MA 3UWEA 2QGYA 4O0QA 3CV1A 4Y8EA 1D7FA 3ZYZA 1NP0A 4Y9OA 4EKJA 3C2FA 1UD2A 2GGIA 5F4SA 3AUOA 2I56A 5LXXA 2VEKA 1K8CA 3ARVA 3NZQA 1B3VA 1W3IA 2ZZ3A 4C7FA 2E3ZA 1TA3B 3KCOA 4J3SA 3G0XA 3WF3A 4RE2A 3A23A 1RSCA 3WNOA 2PRMA 4PB4A 4CCEA 4MKSA 1E6QM 1MQRA 3H23A 4LAMA 1GYLA 4TU1A 4DJED 4RUBA 5DRCA 3CB3A 1Y7VA 3REQB 4H7CA 4BF7A 4QE5A 4ZL1A 5G5IA 4AVOA 3UXAA 4LYRA 2V63A 1F8MA 2FZ8A 3THCA 4PRWA 1IWBA 2CFFA 1BRLA 1FXQA 2VUYA 5HUPA 3AU6A 3GHRA 3QPZA 1OINA 1W5MA 1XGEA 4C6NA 1U5JA 5AKQA 1V7YA 3KHDA 4BZYA 1ZNNA 1XW8A 5CKSA 4J9JA 3VGBA 2R1PA 4X60A 3FS2A 5HMDA 1EUAA 1LM1A 4Y9AA 2INEA 3KS5A 3T8LA 1S39A 1RBOB 3Q67A 3HJZA 2BGNE 1EX5A 1LCOA 1I1WA 1CB2A 5AZ0A 3KHJA 3UEQA 3N2TA 4MUZA 1K02A 1UUQA 2NUYA 4F9JA 1K8YA 2IS7A 3WH7A 3PPCA 1V3JA 4GY1A 5DQPA 1F3XA 4EE9A 3W1AA 4RPQA 1EEXA 2PWHA 4DWDA 1O4UA 4BKNA 3U7VA 5ABFB 3EPOA 1HGYA 3PJXA 4HOZA 4O0KA 4JKMA 4NZFA 3BV4A 1BSIA 3DHDA 1KM6A 4F2UA 4O8AA 1ADSA 1XRSA 2XVNA 4PMVA 4AWUA 3ONCA 2RJGA 3HQNA 1S5VA 4JOMA 3W38A 4O1FA 4BF5A 3DFNA 4HA4A 2Z4GA 2AAMA 1CECA 1KKOA 2A6LA 3CPGA 1KR0A 2BVYA 4ES4A 1Q2SA 4W5ZA 4JZ5A 2VUNA 1UASA 3UJEA 4MIMA 1R30A 1PYMA 5I06A 3W83A 1EJXC 4KEVA 4DZ5A 1E1EA 1S2CA 3NQGA 2YL9A 2FGBA 4IFKA 2CESA 1BWLA 1O12A 4UFMA 3VKJA 3QR3A 4K8EA 4MB5A 1OYCA 3S2LA 3STPA 4Z1YA 2UY5A 1FTXA 1Q7ZA 6TAAA 4GD0A 3KWSA 3WBXA 4CN4A 4CU7A 4ZVJA 2CYGA 1VCFA 4J7RA 4LCRA 3GNPA 4OKDA 7REQA 2GJXB 3HIJA 2TAAA 2XJ7A 3H8AA 3WLLA 4AYSA 1R3VA 2FPYA 3AC0A 2FHBA 2OYKA 4MSSA 3A3XA 2XIOA 2ZX9A 4JKKA 1Q8AA 3H2OA 2JQXA 3OLEA 1XRFA 3F5JA 1XPYA 4V27A 1WPCA 2RGMA 1V6YA 3F1QA 4DF1A 1KCZA 2BXVA 4XG1A 1TWIA 1GKPA 1P0NA 1M41A 5K7JA 2F9RA 4PCSA 3UJSA 1E9IA 2YIHA 2E77A 4H41A 1S2AA 3BC9A 4EAMA 1S5TA 1QASA 1RK5A 4OBRA 1UR1A 4GABA 4Q8OA 1RXOB 5DT7A 3WQGA 4A3RA 5CEWA 3GW0A 3NURA 3DG3A 1K9TA 1TREA 4ZZ9A 4ZXLA 3UY8A 2Y89A 3UVIA 1NQKA 3L4VA 3BLPX 1I60A 3C2EA 2AGKA 2VEFA 3RX3A 3NQVA 2REQB 3AALA 5CZSA 4UQAA 1QOXA 1F4AA 2GVLA 2QJGA 3V5FA 3R1ZA 4PCTA 3ICJA 3S1XA 4QJ1A 3BURA 2ZYFA 4XVEA 3CM4A 4PMZA 2WLYA 6XIMA 2ASHA 2XGIA 3DFTA 3O05A 4LB3A 3U2ZA 4DLMA 2PDBA 2FB3A 3NQEA 3C2VA 4LU0A 4AFYA 2QUNA 3ANUA 1PYFA 1XKYA 2DQXA 3KBNA 3CUGA 2NVDA 4K8GA 1EGMA 2DZVA 3PN8A 3OJGA 4JEJA 4UFKA 4I3GA 2CKRA 1W9BM 5DT5A 3W23A 1E6RA 4YJ5A 1OIFA 2UY4A 4D6GA 3TIMA 1LLOA 4PODA 4HIBA 4K7YA 4KWVA 3CAKA 4IIFA 3FGCA 2HMCA 5CZJA 3NUKA 4S23A 1EB3A 2QUTA 1XBYA 5FD0A 2VXNA 3ARRA 1NOFA 4MG4A 4TVDA 4TVCA 2BOEX 2X1RA 2OR2A 3VKDA 4A4AA 5AC6A 1VZWA 4L64A 1JCNA 3SUUA 1OZQA 1CDGA 1OABA 4Y7EA 2D0FA 3UPMA 2HCVA 4GY7A 4O15A 1MUMA 4H9MA 4YLWA 4GRSA 1GOQA 2E5BA 2YCLB 5AZ1A 1M1BA 4UQEA 2X1TA 1FCUA 1E9LA 4YPJA 5IHRA 2GDUA 3LCIA 4K8HA 1E0TA 2FLIA 1VPXA 3PTMA 1UYQA 1ZRQA 3LX9A 3P8JA 5SWUA 4FNUA 2P53A 4QLLA 1J01A 3T8QA 3LCWA 3THUA 3EWYA 4W7VA 1EZ2A 1V8EA 2GUUA 5E93A 1W6TA 1XL9A 3OU8A 2GQAA 2ZWZA 3WK0A 1BYDA 3WQCA 1WXJA 1UROA 3P5ZA 1ZGDA 4PGLA 3BCFA 4UTWA 4HNOA 3IANA 3TFCA 3ABQA 4DBSA 5AVHA 4K6AA 2NX9A 3TV8A 1AZ2A 1C8QA 1TPB1 9XIAA 1GKQA 1DJQA 3AIEA 4UQBA 2ACUA 1ZCCA 3BLDA 3HN3A 1CXLA 3FHAA 3LRMA 1ZS2A 4NAEB 3U48A 1Q6OA 1E15A 2DW7A 3QLLA 1IXPA 4US6A 3TEVA 3DGBA 3FOKA 3GM8A 4GYFA 5I3FA 4UQCA 4Y8FA 4CQCA 1US3A 1LROA 5FF2A 3HU7A 2ZUSA 1UP2A 4XZLX 1XDMA 3W7MA 3QQWA 3WELA 1F05A 3IJ9A 2RGLA 2ZE3A 3ABZA 4IQEA 2EO7A 1SZNA 3LTSA 4Q22A 4QDPA 4MNKA 2ZRXA 1NWSA 4F8XA 1OBAA 2OELA 2Z1BA 1V4YA 1TQJA 1H1NA 4AUBA 3UG8A 1O68A 3MSDA 2H9AB 3VE9A 4ADUA 3EWBX 1J2BA 2WYSA 2OTDA 1J5SA 3BARA 3ALFA 1GOWA 2QULA 2A7NA 3M6YA 5BRQA 2YDAA 4AB4A 4GYJA 4PE8A 3N4AA 1NJJA 3VDAA 1TCDA 4FXJA 4UTTC 5K2ZA 5DXXA 4GLEA 3TU9A 4QXIA 3AMLA 3UXDA 4GX9A 6REQA 5BCAA 3OVGA 3WNNA 1QHOA 1X7FA 1LZOA 2YLAA 3LCGA 2GPTA 3WH9A 2PS2A 1AL7A 4QQUA 1M7PA 4NRRA 1PHWA 4LV4A 5JVLA 2VELA 4D2JA 5HBFA 3MI3A 4CQBA 4C6QA 2YBTA 3TAOA 3LSBA 2O7SA 4PMJA 3OLDA 4KPLA 2FVKA 3B9DA 1E3ZA 3WDQA 4MPKA 3GNDA 5CXPA 4OHQA 3H55A 3MTWA 4JN7A 3SADA 1EJ7L 2OODA 3TLLA 4GVFA 3AYSA 3KRZA 4O1EA 2Z6IA 1C7SA 4WY0F 3SRDA 3RYSA 3EKLA 3FJ6A 3FDGA 3P84A 3II1A 2J25A 1W3HA 1PE1A 4UUIA 3MP3A 1G4SA 2CCRA 3M47A 1RHCA 2EJAA 4H4IA 3TK7A 2H9AA 1JPHA 4H6KA 3PK7A 3PNUA 4H8UA 4WVXA 2Q02A 3ABXA 2UV8G 5IXEA 1UR0A 1TPWA 3SIZA 4CQ8A 4PH6A 1QPNA 4ZEPA 3D0CA 1F9CA 3LENA 2X16A 2Y62A 1Q7MA 1QRQA 3EA3A 3LGEA 3N17A 3RG6A 3NYDA 1LRNA 1W2VA 2P5NA 3WBAA 4QCFA 4QLJA 4BEQA 1Z69A 4F0KA 3MS8A 3M43A 4IXHA 1AW1A 3QEZA 3QR1A 1TJPA 4LOCA 4MAVA 1PWLA 3UZXA 3FKKA 3VOIA 1WCGA 4OWGA 3M0MA 2NX1A 1HL9A 1PWMA 3SCVA 1QFEA 4GJ1A 2GGJA 4O14A 2J8GA 4F2BA 1XFCA 3S46A 1PZ0A 3ZLFA 2OO6A 2BP1A 3UGRA 4V2XA 3ZR5A 4PUJA 2HJPA 4H04A 1ITUA 4DF0A 4M1BA 4QP0A 4IJBA 1AD1A 2XN2A 2POZA 1B5TA 1TWSA 3BANA 4L56A 4JYDA 4L7ZA 2QDHA 4XZBA 1V3LA 4KF1A 2C8NA 4AEEA 3BJSA 4PUKA 4G8TA 4QSFA 5DMLA 1M68A 3GTXA 5DMMA 1IF2A 3ME3A 3SUVA 1TIMA 3WK3A 2WB5A 5BXRA 1XIEA 2Q3OA 1CXFA 5K3VA 1JZ4A 4JAWA 4YTTA 3TYCA 2ZX8A 2J9ZA 4NAFB 2PA6A 1XLHA 4D6HA 5HA7A 2XVKA 1AD4A 4DQWA 4W8LA 4O0ZA 4HT3A 1POKA 5DRIA 4UFLA 2ZDRA 3GNNA 2E9LA 3E0VA 3GDLA 1SZRA 2TRSA 4TOQA 1MW0A 4DI9A 3MV11 3WLNA 2QLYA 3R6IA 1PVNA 4FR6A 4EPKA 3EMCA 3MUXA 3GRIA 1K77A 1BVZA 5I03A 1B3ZA 4UOQA 3F2CA 4RZ6A 1PXGA 3T0DA 1TA3A 1XLJA 3VCRA 3IRDA 1Q6EA 5CC6A 1W17A 4ACYA 3AIWA 5BRPA 2BX7A 2A3LA 1R87A 1NOWA 2IQDA 3I4KA 4LBSA 3GTFA 5CLTA 5TQLA 3QGKC 3NPXA 4FZIA 4S3AA 2YYTA 4AIOA 3RAOA 3M0KA 3C0LA 4O18A 2PODA 4KETA 3AJ7A 1S46A 2Z28A 1XWYA 1P6BA 1GYMA 1GQNA 3OGVA 4P7RA 2WMHA 1OGBA 3HQOA 2R9RA 1LBLA 1R3SA 4PUMA 3H6OA 4DYJA 2FVLA 3L5MA 1BGGA 4MMWA 4KIEA 2Y2WA 5FACA 3W7NA 4D9PA 1DIEA 4UQDA 5A8OA 1GVIA 2XSAA 1H09A 5E09A 2P8BA 3AHVA 1POJA 2G97A 3H12A 4HPNA 4DRSA 5I02A 1EHAA 4YVVA 3CZEA 4RDZA 4DJDD 1KM1A 1YBQB 1RY8A 5DFAA 2J7BA 3H4XA 2EBNA 3IARA 1C9WA 1FP9A 3N04A 3VA8A 3POCA 4AZ6A 1FRBA 4M82A 1FDZA 4CKQA 5HDRA 2REQA 3EB3A 5HUOA 3D3AA 1LG1A 3DEQA 4MWAD 2PPGA 5EMUA 4LJ3A 1GVOA 3VD5A 4BI6A 3VGFA 3R7MA 4KEMA 4G1NA 1QNOA 3WMLA 4HMDA 1TVPA 2WNWA 3VOFA 3OGSA 4XKMA 1WNOA 4MWAA 1W5OA 3M4HA 1ZCOA 3BL3A 3UG4A 2PDLA 4IIEA 3RRAA 2BHZA 2R6OA 2VDIA 3PWAA 2XUCA 1GVFA 4I90A 3M0JA 2PDMA 4X2PA 2OXNA 5ENLA 4WGHA 4L4LA 4UNLA 1YDOA 4HYRA 3GIYA 4M6UA 2DIEA 4WRHA 1RP8A 1IQ8A 2OZ8A 4OU1A 5JH1A 1QDSA 3ABOA 3NQBA 4DYEA 3DI0A 1SO5A 1K4GA 3OYXA 1OY0A 2BODX 2OT0A 4JIHA 1KV5A 2VC9A 3KBWA 3BAYA 1EP3A 5A6TC 1IT8A 2A7PA 2D2GA 3CHEA 4J2MA 2VZUA 2QF7A 3HM7A 3O2LA 1XG3A 3PAJA 4Z2IA 2W27A 5HPCA 3CUFA 3L12A 1VBRA 4F2TA 3CO8A 1RV8A 4RLIA 1GQJA 1VFMA 1ONWA 2HTMA 1OYAA 3N2MA 4XZIA 4BY3A 2XIJA 1VP5A 3GZAA 1PB0A 3N14A 3WQDA 1GKRA 4C5YA 4NZ1A 1RAKA 3MCOA 1E6NA 5BOOA 2Z6JA 3CL7A 1LOQA 1TWDA 1S38A 3QFWA 3ARSA 2O92A 1KBJA 1IEWA 3HF3A 3KUMA 4EK7A 1E4IA 3SCUA 4XIAA 2VFHA 4MNJA 2EG8A 1YNYA 1PKYA 3LHZA 5H2ZA 3I3EA 5D2YA 4TX6A 4EOUA 2XFRA 3HG5A 2CLIA 3P62A 3QOKA 1G4PA 3V75A 3LHWA 4P2VA 3WJZA 4K1GA 5FEXA 2PZ0A 4DM2A 3NL3A 3OYZA 2GOKA 4I7UA 5HINA 4AU0A 2OEMA 2XYLA 3C8FA 4JFUA 4EAYA 1GVEA 1AQFA 3C6CA 3UZJA 4IMGA 3R0KA 4PTDA 3AISA 1AODA 1FWGC 4Q4SA 1P5BA 4RDYA 5C9UA 3CIXA 5AY7A 4DB7A 4KWWA 1F7BA 4GNKB 1I45A 3S6DA 4M6QA 3IGUA 1ZHAA 2ZX6A 1BXNA 5DCBA 3RR1A 3DYOA 1TWZA 3WF0A 3DOPA 1AFSA 4R34A 1YXCA 1XR2A 4PCPA 1OHLA 4QCEA 1CI1A 3DIPA 3CMGA 4C6OA 2O9TA 4PMDA 4R88A 4A35A 5LGZA 1ISVA 3O63A 5EMMA 2GQ3A 3KDNA 2R82A 1O5KA 4O54A 2DSVA 1G69A 4O52A 4WJ8A 1ISYA 4WQ6A 1TRIA 5F1UA 2VOTA 1JRBA 3VX0A 5LA2A 1B31A 2GWNA 1I2PA 1KFBA 4ADTA 4OV9A 1K7XA 3M0YA 2D0HA 4ASTA 1VJSA 2Q8ZA 4XD4A 5H91A 3GUWA 1UJQA 2PDJA 2CC0A 2ZA2A 1Q8JA 2Z26A 2BOGX 3A3HA 3FHQA 1FHVA 1HTIA 2JE8A 2YCEA 4DO7A 3GU2A 1Q13A 4CGTA 1ZL1A 3VX1A 4GKTA 1VYPX 4BEUA 3AUJA 3W88A 2OKTA 3L4WA 2X2GA 1W54A 3TTSA 1AQMA 3T42A 1VBUA 3N11A 2BTMA 2VFIA 4C6DA 3MVIA 2ZQ0A 2WSYA 3XISA 2CZDA 1VBGA 1QOPA 2PC4A 4Q4QA 4ZE5A 1XLDA 1DJGA 3RK8A 3VKBA 3C0JA 4GC4A 5LSMA 4ERGA 5EPDA 4DX3A 1DKWA 4HK7A 2P3ZA 3H70A 1L6GA 3E5PA 2ZTKA 1MFVA 3E2QA 4IQDA 1M5WA 3TDFA 3DKJA 4CD7A 1OC7A 3B8SA 2WNNA 1GK8A 3GWQA 1P4CA 2WANA 4FLQA 6A3HA 4DI8A 2F38A 4E6MA 2VMFA 3VKAA 3ZT5A 4G9PA 3M5ZA 1K70A 1ZJAA 3CU2A 4V33A 2ISDA 5HPOA 4DBWA 3ENLA 1ZAJA 4F79A 1CWYA 4GY0A 1AJ2A 3CASA 3EXRA 4XO7A 3P2VA 3NPWA 4M1RA 4F0HA 1FXPA 1FY6A 2V68A 3W25A 4NY2A 1KC7A 2PRLA 3T2OA 3TWBA 4PMRA 3NO5A 2XH2A 2X30A 3ZLGA 1UD5A 3BW4A 5JMUA 3GHTA 3TYEA 4RNJA 3USBA 3H24A 1LP6A 4JBRA 5REQB 4C6IA 3VOCA 2ZVRA 3TW9A 4WF7A 1FWIC 3IJQA 3LPPA 5FCZA 4Z1DA 3ECQA 2Y4SA 3TH6A 2VCBA 1H41A 2VZVA 4DF2A 2PDPA 3KTSA 1BTCA 1E1CB 4XD6A 2BY0A 2CLHA 2E6FA 7CGTA 3Q58A 2DH2A 3ZO9A 1IV8A 3PSWA 2JF7A 4OOUA 3OPSA 1DORA 4Z1BA 2J78A 4D6JA 5FA5A 5GJMA 4GI9A 5FJTA 3ISIX 1C91A 2FQIA 1BD0A 4OUIA 5FKYA 3WEMA 1ZQ5A 3NQ8A 5FF0A 1T8QA 1C9DA 1DIKA 1TX2A 1UKSA 1XCWA 2YDQA 4KWUA 4NYYA 7XIMA 3WF1A 2PEVA 4CNNA 3RX4A 1MUWA 3QPYA 4OE7A 1TR9A 3NGFA 4JNYA 4B5XA 4JS3A 3URAA 4FHAA 3W6YA 4C6KA 1QT1A 4YU1A 4O4WA 3IIVA 2NQLA 1P1XA 3RRXA 2DW6A 1W5NA 2F6KA 2CBIA 2RFGA 4OBTA 1GPWA 2BSLA 4Q6XA 5ABGA 3P93A 2OLAA 4MB4A 1MXGA 1GT8A 1UPMB 1R86A 3N19B 4B9ZA 1ADOA 1MYRA 4PULA 1V03A 3UERA 1FVPA 3CHVA 1WDQA 3FAXA 3LS9A 3VIFA 3NXLA 1WDPA 4JTTA 3AMDA 4FNPA 5CPLA 4M24A 4CVWA 3SRFA 3LY0A 1TZZA 3H2EA 2D2HA 3QC3A 2EKCA 1Q65A 1FHLA 4GE8A 3HFYA 1HKWA 5D4YA 1KFJA 4AX7A 4D6CA 4Q8PA 1AQHA 3CV2A 4JTIA 3MMDA 1UKTA 1CLXA 3KE0A 3CIWA 2YR1A 1NFBA 5C9XA 1YXYA 3A9IA 2VRJA 2NQHA 2Z27A 4D8AA 2WBKA 1VKFA 4YWIA 3S8HA 4QDWA 1T96A 4QAIA 4X61A 1TTJA 1RQEA 4LUSB 1M03A 4LYPA 5XINA 4EF9A 1BF6A 1HVQA 5A5WA 3KRUA 3VIIA 4GO9A 4S3EA 2HNHA 1YDVA 3IVUA 4XZHA 1RY0A 4ONVA 5I5RA 1NWTA 4ZO7A 4R27A 1DHKA 3NYZA 5F4XA 1RBAA 3TR2A 2J88A 1E56A 1ZJBA 3W7QA 3MSGA 4UR8A 2FHFA 2QR6A 3U8GA 1V0LA 4FK9A 1RJRA 2QV4A 2A3AA 5A2BA 4N7QA 3PP7A 3QXBA 1BEUA 2YXXA 5CPTA 1VFTA 2GJRA 2OCZA 2QCDA 1JD9A 3QV7A 5JXQA 3O6AA 4C6LA 1X8CA 1VRDA 4IUGA 4M7SA 5D2XA 2RUSA 3PZVA 2GVGA 5IBXC 2O9RA 1MFUA 1PTGA 1SJDA 4N4PA 4L5ZA 4LCSA 3HBLA 3ARXA 3C3NA 1JZ3A 4W5UA 3KLLA 1ZBKA 3VZYA 2DT1A 4P61A 2Y1HA 3U57A 2QCNA 3BCJA 3C56A 5DANA 2Y24A 4GBUA 2XZ7A 1SO6A 3VIHA 4ZOBA 2ACQA 1N7KA 2WKJA 3KP0A 2QVNA 3QJAA 1TO3A 1OQFA 2YB1A 4WK9A 3ITLA 3AMCA 1BSLA 4GVGA 3ZZ1A 2VGFA 4HNVA 3TQ0A 4MLJA 4AD2A 2PB1A 3EA1A 2GSEA 1F6YA 2EPKX 2G0WA 4A3HA 1SQ7A 3JUGA 1B2YA 1BVNP 3FAWA 1WOAA 5D9OA 3FSTA 1KLZA 1LRTA 4PMXA 3S5ZA 3PBVA 1DWGM 5A95A 5LIYX 4O28A 1QUMA 3CAWA 1GW1A 3CB8A 3VOGA 1NF7A 1DWAM 5H1WA 1WAUA 2E5DA 1V6UA 1BQCA 3N2CA 4ICMA 4LBRA 1DJWA 1R47A 1QI5A 5BXTA 4UCGA 5EA9A 4ORIA 3COTA 3M5VA 2IXVA 2V2DA 1XLIA 2GSHA 2BY2A 1GONA 5U7SA 3PJUA 4UTIA 1KTNA 4JTGA 1LYXA 2OZ0A 2X0HA 4WGXA 1DXIA 1GOXA 1HP5A 1TIWA 3JZEA 1YE6A 1EWDA 4C6CA 1PX4A 4MB3A 3T6CA 5HQMA 4H19A 3QY8A 3LI1A 1MWOA 4UXDA 3GH4A 5C71A 3OLIA 2Y61A 2OLHA 2JFEX 4XBSA 4EPDC 4KFOA 5J5DA 3CHFA 4HHLA 2POTA 3IV3A 4KCVA 1V08A 3KW3A 4LRTA 5JIWA 2VZOA 4AZ7A 1X98A 4W8AA 1UUMA 3NZGA 4AVFA 3S5SA 1KRAC 1XGDA 5I23A 4LS2A 2Q01A 1A47A 5DELA 3F7JA 5FEZA 1JYXA 2AMGA 2QF8A 3DFHA 2FPTA 2WM1A 2V5KA 2ZKMX 3E1F1 4G7EA 1EPXA 2H8XA 4PEEA 1JUKA 4Z2LA 1JYNA 5K9XA 5HR6A 1ML1A 1EC9A 1KW1A 4ZOCA 2V3EA 1UH2A 4MFEA 5FL0A 1U1UA 3CUIA 4PMOA 2WBGA 4NU7A 2G3IA 4HZ6A 3IV8A 1IIHA 4J3UA 1OF8A 5ECVA 2WHLA 3VOHA 4H8NA 3RPTA 3OA3A 4K37A 2EG7A 3PUDA 4Z2KA 4WY0A 3LHVA 4EPBC 1OC5A 3LMZA 1QVBA 4MWAC 1XKJA 2B7PA 1NU5A 5HWMA 2DGAA 3M7SA 2P50A 3ZXWA 4JTJA 1EIBA 4F48A 1C29A 5A6JA 7ODCA 2GQ8A 5M5DA 2W61A 4LB4A 1H7NA 3GXDA 3CS2A 3MANA 3FYYA 5DLCA 3GU9A 3CL6A 4WEVX 1BRLB 1UD4A 3K8MA 3OHIA 2G50A 3PG9A 3T4CA 3MU7A 1FFQA 1W5PA 1EYWA 3GDBA 3GXIA 3TA6A 4JX5A 3VD4A 1UP0A 2QCGA 3GFZA 3QN3A 1E71M 2E1DA 4YWSA 1U33A 2J7EA 4Z17A 5IFTA 3G6MA 1TJ0A 2DVTA 8CGTA 4DUVA 4PMQA 4AC1X 4R3UA 3ITOA 1FWNA 4Q4KA 3DYMA 2OEKA 4QE1A 1X1OA 3G2GA 1VENA 5DBUA 1P48A 3ABSA 2FH6A 8RUCA 2O4MA 4BQ3A 4Y9MA 5C2CA 3WQEA 1JFXA 5GVJA 4RXGA 4MUPA 5I0DA 2V9DA 2VEMA 1AH0A 1HKJA 5G1YA 1OFDA 3OZMA 1VYSX 4JTDA 1XRTA 4NJJA 4BS0A 1XDLA 3B05A 4WXZA 3T1GA 2IKHA 3A5VA 2HS8A 3NQAA 4O13A 3TYUA 4PTWA 2EAWA 3ARTA 3VGHA 1KBLA 3BOFA 4PSRA 3IAQA 1IZJA 5HATA 4OJYA 1RPXA 1KB3A 2Z2BA 3M0XA 1TSIA 1OGGA 1X6UA 4LAOA 3GVRA 3VPLA 1M6JA 1ELSA 1Q6RA 4ZXOA 3VIKA 1A5AA 1E0XA 4GI6A 1SMDA 3NFUA 5DX7A 2ZWYA 1J0ZA 1XBZA 1KRBC 2QW5A 3Q65A 2HDJA 3PZQA 4Y6GA 4D1IA 3WMSA 5CGMA 3W82A 4LX4A 4KERA 3MUAA 1WZAA 3GIQA 1K03A 3D47A 2YKKA 3E0FA 4FIRA 3W7GA 4E0CA 1PAMA 1MSSA 1JDDA 4E3VA 5FSDC 2BNJA 4JKLA 4WD0A 3TE9A 1XYAA 3B03A 1KKRA 1YMYA 3M6DA 4GG9A 3P14A 3E2SA 1NDWA 3GY1A 3QKEA 3CEUA 3TYAA 3BQ5A 3UVAA 5F2GA 5GNZA 4IQJA 1JCJA 1A4LA 1QO5A 2AL2B 1ZALA 1CYGA 4W86A 1KO0A 5LKYA 3RFAA 3UWZA 5ABEA 3IJIA 4AWTA 1QJWA 5CJ5A 1YYAA 1DP0A 2YLLA 4Q7NA 4L9XA 3HZ3A 4ACZA 1IR2A 3TXVA 3IACA 2OU4A 2YW3A 1MZRA 3AJXA 4HPJA 2PDQA 1Q3NA 4S3FA 1D2KA 2WZHA 1XLKA 1I9CB 4TX9A 3E9AA 4ZB0A 5AC4A 2G3MA 1JUBA 2E40A 3LM3A 4RR4A 3HB9A 1CGYA 1VPYA 4CD8A 4HD5A 3GC4A 4FPSA 1SMAA 2NSOA 3UWUA 4E8DA 3TC6A 2J6XA 1EDTA 1YDYA 3WQVA 2D3NA 3W1MA 5HR7A 2H90A 2HVNA 1G01A 4EIVA 3EWZA 2A3HA 4C1NB 2YBUA 4FLRA 3BUVA 4PB3A 1V3MA 1QI2A 2W92A 5CG7A 5AYIA 3S1GA 4AH7A 1E72M 1NIUA 3KBVA 1X38A 1JJKA 5BXSA 2G41A 4AG0A 1J2WA 1OFAA 1TPEA 3R12A 3TN3A 4NAFA 2OJPA 3KM8A 5FAJA 4E38A 4WLCA 2WSRA 4F0RA 3SW6A 1E1CA 1IXQA 2WZEA 1BWVA 1F3TA 1I6NA 4JDBA 3W2NA 1MQQA 1P6WA 2XPKA 3EWWA 4D72A 5B80A 3L66A 5I2UA 2YFNA 4ZO8A 3SB0A 5DCEA 3O6CA 4XZ9A 4GFIA 2CBJA 5FJPA 1NWRA 2FFCA 2H3BA 4GVIA 3AAMA 4P8XA 2I7GA 4B5UA 1DTUA 3WCZA 1HL8A 4CNOA 5HULA 5F7UA 1DWFM 4IUOA 1GOMA 1KFEA 2WV8A 2ISSA 2XDFA 1UHVA 4PSPA 1E0WA 4KEZA 3LCFA 1RCOB 1TPH1 3G1RA 1PKMA 1Z32X 4NZ5A 3VYLA 3G0UA 3WNPA 3P5YA 2QUMA 3PBMA 4D6DA 3S2JA 2PWUA 5K4XA 1UA7A 1I2NA 3BTNA 4M19A 2B0MA 3HGRA 4AAJA 4LNCA 5E9AA 3DC0A 3WUEA 3HPXA 4PUEA 1OADA 3NJ3A 1W31A 3RITA 3F4DA 2A85A 2OQYA 3VGGA 1XC4A 2IKIA 2R1KA 1FH7A 4R33A 4X9SA 4LY8A