3UZZA

Crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with nadp+ and delta4-androstenedione
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIHVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Conversion of Human Steroid 5beta-Reductase (AKR1D1) into 3β-Hydroxysteroid Dehydrogenase by Single Point Mutation E120H: EXAMPLE OF PERFECT ENZYME ENGINEERING.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3uzzA00
3RX2A 3CAQA 2INEA 1PWMA 1C9WA 3R8GA 3UGRA 3M0IA 4EXBA 2A79A 4WRHA 2IQDA 5LIXX 2PDXA 4DBUA 2FZ9A 3GHTA 1US0A 4JTCA 2FZBA 2HE5A 1Q5MA 1X97A 3P2VA 3H4GA 3N6QA 2WZMA 1IEIA 4XZMX 4JTRA 4LAZA 2DUXA 2WZTA 3V36A 1RY8A 4JQ1A 2PDWA 4LBRA 1RY0A 1UR3M 4GQGA 3V35A 2DUZA 1XF0A 4GABA 3GHRA 4WDXA 2F38A 1Q13A 2P5NA 1IHIA 2FZ8A 3UWEA 4DZ5A 1JEZA 4XAPA 2IKGA 3ERPA 4JIRA 1PWLA 3LNMA 2ACUA 4LB3A 1Z8AA 2IQ0A 4FALA 1AH3A 1LQAA 3UZWA 1T40A 1FRBA 3V0UA 2IPJA 4QBXA 2IS7A 4LB4A 5KETA 3RX3A 1MI3A 1EL3A 1YNQA 4FZIA 4YVPA 2IPWA 3R7MA 3Q65A 2PDFA 2PDLA 2IKJA 2ACRA 1S2AA 1XJBA 4JQAA 2ALRA 2PDCA 4L1XA 3WBXA 3DOPA 2PDBA 4DBWA 2PDIA 4YS1A 3GHSA 3UP8A 4R9OA 4GQ0A 4JQ4A 4IGSA 1Z3NA 2AGTA 5JH1A 1EKOA 4ICCX 5LIUX 1OG6A 5AZ0A 3WG6A 2VDGA 1X96A 4I5XA 2F2KA 1RALA 4IJRA 4JTDA 2INZA 3GHUA 4XO7A 5HA7A 4PMJA 1AZ2A 3UYIA 5JH2A 4QX4A 1T41A 3BCJA 4XZNX 2I16A 3LZ5A 2PDMA 2PDYA 5M2FX 1ZSXA 2QXWA 4GCAA 3CASA 4GA8A 3UG8A 1MRQA 4XK2A 2DV0A 3LEPA 4XZIA 1AFSA 2HVOA 4XZHA 4JTAA 3R94A 1EXBA 1LWIA 4H8NA 2NVCA 1PZ1A 4OTKA 3R6IA 4LAUA 3M64A 3GUGA 4LBSA 1S2CA 4QR6A 3F7JA 3BV7A 1R38A 5AZ1A 4WGHA 2R24A 2PDJA 2PDNA 1VBJA 2IPGA 2I17A 4WDTA 4RPQA 4FAMA 4HMNA 4XVEA 3CMFA 4WEVX 2IKHA 3WBWA 4PUUA 3MB9A 3CAVA 3V0TA 3KRBA 4YVVA 3G5EA 2HVNA 1K8CA 2FZDA 1AH4A 3EAUA 2FVLA 4PRTA 1M9HA 2ACSA 3O3RA 4L1WA 3O0KA 4JQ2A 4NKCA 4JTQA 3VXGA 1ZQ5A 1AZ1A 3BUVA 2BGQA 1AH0A 4YVXA 2PD5A 2CLPA 3FJNA 1Z89A 1X98A 3LN3A 2HDJA 1S1RA 3N2TA 4H7CA 3R8HA 4DBSA 2IPFA 1YNPA 4AUBA 4WDWA 2NVDA 4EXAA 1MZRA 5LIKX 2BGSA 3S3GA 1VP5A 2R9RA 2FGBA 1QRQA 1ZGDA 1QWKA 3WCZA 4Q3MA 3FX4A 1S1PA 3UZZA 4FA3A 4YU1A 3EB4A 1J96A 2ACQA 4MHBA 3RX4A 3UZYA 4HBKA 3G1RA 1HW6A 3DN5A 4Q7BA 4WDUA 2PFHA 1XGDA 4GACA 3COTA 1GVEA 3LZ3A 2PDHA 3LD5A 3UFYA 1ZUAX 5HNTA 3LQLA 2PF8A 4ZFCA 5HNUA 4ASTA 5LIWX 2HEJA 4F40A 2BP1A 3ONBA 1YE4A 2PZNA 3LQGA 5C7HA 4XZLX 4PRRA 3MC5A 3D3FA 1ADSA 3LENA 3LBOA 2PD9A 3B3DA 3ONCA 1EF3A 3R58A 2IKIA 4XVDA 3Q67A 1YE6A 2PDPA 3CV6A 1HQTA 3C3UA 1A80A 3M4HA 4PR4A 5DANA 4XO6A 3UZXA 5LIYX 3EB3A 3CV7A 2J8TA 4G5DA 1Z9AA 1PYFA 3H7RA 3WBYA 4IJCA 3BURA 3R43A 2C91A 2PDQA 3V0SA 2PDGA 2PDUA 3T42A 3U2CA 4PUWA 1SM9A 2HV5A 4JIIX 2PDKA 3NTYA 4QXIA 2ISFA 1PZ0A 3LUTA 3QKZA 4JIHA 2PEVA 3H7UA 4GIEA 4JQ3A 2HE8A
chains in the Genus database with same CATH superfamily
4TMCA 2GJPA 4U28A 1YBQB 2EPHA 2EF9A 4GGHA 2R1KA 2DSVA 1WBJA 3M43A 4LVGA 4C60A 1DEDA 3C56A 4Q4OA 2H90A 3QHNA 4RK8A 4AZBA 4MJ4A 1E0WA 1IT7A 2C1HA 3MSGA 1D2KA 2F2HA 1X97A 2WZMA 2VFFA 1GK8A 3RLHA 3CYVA 4QSHA 2NT0A 2XSBA 2X2GA 4AIBA 3CQ0A 1S5TA 3OODA 3N2CA 2WW5A 3VGEA 3VILA 3GU2A 3WLOA 1HG3A 3MSYA 3VKKA 3WDJA 2OOGA 1GHSA 1F7BA 3ZYZA 4HPGA 2X7VA 2I56A 4J3WA 2ZZ2A 3M0JA 3EWUA 1TPDA 3TLQA 4LX4A 3WK0A 4Q8TA 2P5NA 3MCOA 5DMMA 1VCGA 4MJ2A 1LOLA 4PCNA 1XLGA 5CGTA 2PTWA 2WZEA 3EOEA 3B8WA 3CLWA 1PTGA 1UD2A 2ZC8A 4P8VA 3TXZA 3B9DA 3PAJA 2Q8ZA 3BANA 4CCEA 1O5KA 4HT3A 2Z6JA 1ZB5A 1TVPA 2QZRA 1SO5A 1EH9A 4GCXA 4G56A 6TIMA 1NF7A 4DJFA 2VZVA 1T99A 3V5CA 2GYIA 5DELA 4EX4A 3PTQA 1XX1A 1MW2A 3O7UA 1UKQA 2WHJA 3R12A 4RNIA 2GWGA 3EWXA 3MP5A 3ITXA 4L1XA 2BDQA 2C19A 4F2UA 4O1FA 3GHSA 3VOHA 4C6LA 1F73A 2O7SA 5I6SA 1XYBA 4JQ4A 3QHOA 4G7FA 2HTMA 3MVIA 1F3XA 4LVDA 5CJNA 4UTFA 4TTGA 2E8YA 3PWGA 1VHCA 4ICCX 1OYBA 2WNNA 2Y7EA 4ILSA 3E0LA 2YBTA 2YCLA 3T7VA 1HL2A 4WSHA 5BXSA 3AIEA 3K8MA 2Q02A 1X96A 1JVNA 1WYIA 4AB4A 3HGJA 4IG2A 1WUEA 5EY5A 2INZA 4DX3A 3WQEA 4PBGA 5A95A 1VZWA 1O1HA 3B8SA 1XD0A 2CXEA 3SN0A 1WCGA 3VC6A 4U3AA 2HK0A 1ALDA 4RPPA 1FUYA 1H61A 1LBFA 1BAGA 1FA2A 2WZHA 2YXGA 3R2GA 4EWND 1JDAA 4I9AA 3CV1A 1E6ZA 1UYQA 4YCOA 4GA8A 3W1TA 2VFGA 1KFEA 2DV0A 3KEHA 3TP4A 2Y7FA 3VD4A 1QI0A 4Q4KA 3GNPA 2JFEX 2LLEA 1XRFA 3TQPA 5I06A 3E38A 4Z17A 4O19A 2PTZA 5I78A 3VE7A 1S3HA 3ABXA 3DI0A 3LHVA 3ES7A 5DMLA 2OJPA 3ZLFA 3P6LA 5EMLA 1EJUC 3GH7A 4A22A 1UW9A 2ZA3A 3QF0A 4H6QA 3TJ4A 4QIUA 2I5GA 3TR9A 3MI3A 2A1YA 5G4WA 4IP4A 2QCHA 2DJXA 3IVSA 4RUBA 1SO4A 1HFBA 1FWFC 4JDYA 1GOIA 1UP0A 2I17A 4TV6A 6XIMA 3P0WA 3RU8X 4R34A 3UYCA 3B0VC 1E43A 4I9TA 1JDCA 2J79A 5DT5A 4IWWA 3PSWA 4I8DA 2PURA 2VC7A 4ZE4A 4ZO6A 2Y70A 1ICPA 1FDZA 2GQ3A 2NVAA 1JDFA 3LCGA 2G3FA 1OK6A 1MUWA 4RJEA 4JQ2A 2AAMA 1ZQ5A 2Z2UA 1XISA 1W1ZA 4G1NA 4O1DA 4WSKA 2JE8A 4I6VA 4PCTA 3ZSTA 4BI5A 3SADA 4GBDA 3UR5A 3URNA 3G22A 1P48A 2XFRA 4LS0A 4O1BA 3KP0A 5LGZA 4L56A 1QI2A 4H7CA 3GZAA 3ZT5A 2NVDA 2Z29A 4RX0A 1XS2A 2C3ZA 4CVUA 1VP5A 3PN8A 4KWWA 1T7LA 2BOFX 4ZSUA 5DBUA 5MKGB 1GYLA 5FF2A 1ZGDA 3PPFA 4MPKA 1LLZA 1QCWA 1OGSA 1S1PA 5AYIA 3UZZA 1CLVA 3UWUA 1JPMA 4FA3A 3KBWA 4H6RA 4LYKA 1JNDA 3EB4A 5T9BG 1ZNNA 3E5BA 2HNHA 2EPLX 2ABBA 1R3QA 4U10A 3TYAA 3O07A 1V08A 4MLJA 2E1WA 1QXLA 3PB2A 5CPTA 4C7GA 1Q4WA 4YJ5A 1L8NA 4HHMA 1CXLA 3V16A 5CC7A 1V77A 3VKJA 4JEJA 1KM0A 5HMEA 4EF9A 1B90A 5KTLA 1KFLA 3WQFA 3GFYA 2QJNA 4OBSA 1UMLA 2XTKA 3KTXA 2FLIA 2WVTA 3PZMA 1BWKA 3TONA 5TQLA 3LHZA 2ZUNA 3C3UA 3HO8A 1ZS2A 5D05A 1WXJA 1GEQA 3B9AA 2CHNA 3OZMA 5D8ZA 2XGZA 3UR2A 1JXKA 2PCEA 1GOKA 2DZAA 4HU3A 1TWDA 5LNRA 2DORA 4B90A 2G96A 4JTHA 1N7KA 3FVDA 3ZXWA 2PTDA 3CIXA 4ECLA 3MUCA 4MUZA 3TQ0A 1PZ0A 4JIHA 4PUEA 3F4WA 4N9DA 3CM4A 4U2YA 3W71A 4UFJA 4GZEA 3MWAA 3XISA 2I14A 3GXDA 1LQ2A 3APGA 1PWMA 1EEPA 3ITVA 2ISWA 2VD8A 1NDZA 4F79A 1DIEA 1XLLA 1OCJA 1TPEA 1XH2A 4QJ5B 4Q8UA 1Z44A 4RXGA 2H6RA 4Z08A 4M6PA 2DT0A 4Q6XA 4PYSA 4UUIA 3WUEA 1IWPA 4XSLA 4Y90A 2FPYA 1XLEA 4GVFA 3BZJA 4QEEA 4HZ8A 2POZA 4YLWA 3MUAA 1ESWA 3SCOA 3UY8A 2NWRA 3L4VA 1AQHA 4AY1A 1Z7AA 3QTGA 4GABA 2J75A 4FNQA 4NT0A 3W28A 3DBPA 5DT7A 1QTWA 2PC4A 4JAWA 1U1HA 2CPUA 2BOEX 2G95A 2QCLA 2EHHA 3UD6A 3UWEA 4DZ5A 4CU7A 3EBVA 3OVRA 3C8NA 3NJ3A 1E0VA 1R2TA 1XSJA 1JEZA 2IKGA 4IQJA 2BOGX 4MAVA 4NRRA 4ZL1A 1UKOA 2PGRA 3KRUA 4BF5A 4DNMA 4LUJA 1B3OA 2B7NA 1GUVA 4O4WA 3A4WA 4D8ZA 3RM8A 4FNUA 1E0TA 1BTCA 1LP6A 1O7AA 1B3YA 3W27A 2V6AA 3O1NA 3T55A 1JFHA 4NIRA 4WZHA 3OQ8A 4GI4A 3W7GA 3VTRA 3VMPA 3O15A 2IXUA 5FF4A 3V1PA 1ZP4A 5CZ0A 3FAWA 5E9AA 2ACRA 2QJGA 2F6KA 2O4QA 3JS3A 1FWCC 3O63A 4PMNA 4RE0A 1KWKA 3N3TA 4W7UA 3DOPA 4QJ1A 5BOOA 4A3QA 4GQ0A 1ZALA 4LYRA 2HNEA 5LHFA 4UMAA 3DYOA 1GKPA 1XI3A 1EGZA 1GPFA 2AGTA 3OLGA 5A8GA 1K8YA 1PAMA 3A3HA 1EA0A 4MF4A 4D6JA 2W4XA 3IJ8A 5JBFA 2ZWYA 4KH2A 4M6UA 4YTUA 4ZSTA 1YXDA 4K36A 5AZ0A 3CGTA 3WG6A 1Q8JA 2VDGA 4RZBA 3XIMA 3OLEA 3PTMA 2QJHA 2VR5A 4I5XA 4IGMA 2F2KA 4OECA 4UTWA 2XPKA 5DRIA 4XO7A 2Q71A 3KBJA 1SYTA 5JVLA 3WUBA 1XP3A 1VLWA 1LG2A 2DZVA 3ABRA 2F6UA 3VYLA 4EE9A 3BCJA 4XZNX 5MKGA 1ZBCA 4WCJA 3W1MA 3GUWA 3SBFA 2GQAA 1MRQA 4EPKA 3SSJA 1RV8A 2WSKA 3VK5A 1OT1A 3SUSA 3LPFA 2HVOA 1JJKA 3SSZA 3T78A 4NJHA 1WKFA 3KLLA 3R94A 3B0UX 4GI6A 1BHGA 1PV8A 1O95A 3B8TA 2Y5EA 4KRUA 3NOEA 5A1AA 1CGUA 2R1LA 3S2NA 4KIEA 4DJED 3OA3A 1V4YA 1TMLA 3IK2A 4KGJA 4BEQA 1I2OA 3TUUA 3VKCA 1C8VA 4DIAA 1ZAJA 2ICSA 3VNZA 3GXPA 3PP7A 1UR0A 2OWWA 1W1TA 1B4KA 4QJ4B 5E09A 1KM5A 1J0YA 1HGWA 1QVBA 4BK9A 2Z1VA 3MMDA 3G0UA 4Q8MA 1SW3A 1DQXA 2DQXA 3LNPA 1XIHA 3P81A 1V03A 1UH4A 3TSBA 5D37A 3N34A 5CC6A 1FWSA 4W9TA 4AXNA 1YMYA 2EPOA 1PUDA 4BI6A 3WLSA 2J7EA 4GXWA 1T8QA 1S1RA 4H04A 4H8HA 3GVGA 3SCNA 1JG9A 3TAKA 1JL8A 3W73A 3RDKA 1MZRA 3CUFA 4J35A 4W5UA 1W3IA 1DHPA 1G1YA 4G8TA 1TCDA 2J47A 3AXMA 3U6WA 2WNZA 1FWRA 4YU1A 1GOOA 3LCWA 2XG9A 1KV8A 1M53A 3UG4A 1HIZA 4HSHA 3SEPA 4C6PA 1TVNA 2CZ5A 4H9YA 2PUZA 2IW0A 4GUJA 4J5NA 5IXEA 3WH9A 3AISA 4ZB0A 5CZJA 5CLWA 1GVEA 1E40A 3SRKA 2Q6ZA 2FB3A 4NL1A 1MEWA 2PF8A 1WA3A 1P5BA 5U7SA 4F40A 4PUKA 2PZNA 3CZGA 3TQVA 4C90A 1POJA 1HJUA 4UQEA 2I1OA 4LRTA 3S1WA 3WNMA 3RCNA 1W32A 5I3HA 1UBPC 1NSJA 3S2LA 1JF6A 4IPJA 1PIIA 1H7PA 1W3KA 1YDYA 2FJKA 2NV2A 1MNZA 2ZX6A 2OLSA 4R27A 2DZSA 2WSPA 2WVUA 4Z2JA 3NDYA 3N17A 3BCDA 3CV6A 4OOUA 3TMQA 2WBKA 3G6LA 3HA1A 1GVYA 2C6QA 3A3XA 2OT0A 3DKLA 5K3VA 3NOYA 2YXXA 3EDDA 1O5XA 3T8LA 5BU6A 3T2PA 4O1EA 3WX7A 2CZVA 4IUGA 4XX6A 3N04A 2JBMA 1MXDA 2VRJA 3W1PA 4B3KA 3V75A 4QNWA 1R47A 4GPNA 1SFTA 3QPEA 5FF7A 5B7YA 4B91A 1PO9A 3DECA 1SFJA 2CKSA 4RXFA 1OCNA 1Q6EA 3TR2A 3QGAC 4UFKA 3QLDA 2VZSA 2NXIA 3SCUA 1N8WA 2C7FA 4IXXA 2NQZA 3VKDA 4FNSA 1TTJA 1M3UA 3Q37A 5KEZA 3C0QA 4C6JA 2XJ7A 5DCDA 3SECA 1BQCA 4NY2A 4NAEB 1BF2A 4NJKA 7ODCA 4HKPA 1JI2A 1TTQA 3W7IA 1CBGA 3PUOA 3L7RA 1UP2A 3F1QA 1EPVA 5M1TA 1RD5A 1TWIA 1DXEA 4DUOA 3N1AA 1F2JA 4IMEA 3I6RA 4AXKA 7REQB 4NXSA 5CGQA 3L9CA 2YBUA 1JZ8A 3KBSA 2OODA 2OKOA 3IIOA 4GYPC 4D1JA 3THCA 2E25A 3IIVA 3GXIA 1XW8A 3B4YA 3P61A 5LYRA 2VM8A 2PU0A 5ABTA 3RGTA 4ZOEA 3E49A 4FOUA 3ERPA 1EIXA 1Q66A 3N4EA 1PWLA 1N2VA 3N13A 4GQBA 3RR4A 1JZ7A 3AXKA 2IQ0A 1J18A 2TRSA 1R0MA 3HMCA 3S5ZA 1ONXA 2FVMA 1DWGM 3WEOA 3A6OA 4XKMA 1AQMA 1IXOA 1CECA 1LT7A 3EOLA 1MI3A 1XLKA 4E38A 3VNIA 1KFBA 4ZTYA 1YEYA 1JDDA 1XSIA 3R7MA 3ARRA 3WH5A 4MB1A 3OHIA 1JYNA 2VFIA 3TNOA 1F9CA 4K8GA 4U5IA 3W70A 2WB5A 3T8QA 3T81A 4H3DA 3TJXA 5JQ9A 3DC8A 4DRSA 3UP8A 2TMDA 4AF0B 1YRRA 4IGSA 4Q33A 3OJGA 3S42A 1I0BA 1XGEA 3KAOA 6A3HA 4UMCA 1NAL1 3FK4A 3EDKA 1OG0A 2OLHA 1I2NA 1AVAA 3NEHA 2ZFAA 3ZJ8A 2JEPA 4EPEC 4PTXA 4CN6A 1K7EA 4V1XA 4KCUA 2FDMA 5G4EA 4LOCA 4S2CA 5HJXA 2P88A 3UJSA 3PBVA 4A35A 2E4TA 2C0HA 3WFAA 3IGHX 3LCHA 1AZ2A 4MADA 4HA3A 2OXNA 3KXQA 1OEPA 4RE4A 3P84A 2X09A 3UA3A 2Z28A 4LUTB 5AC8A 4W93A 1NTHA 4AC7C 1T96A 2XHYA 1BG4A 3SFWA 2FZNA 1G7VA 3LI1A 3NZQA 4MVAA 3GNXA 4KESA 4C7FA 1LLWA 4HU4A 3A64A 3WFZA 3BOLA 4KPLA 1HNYA 4FNRA 2DZPA 2YL6A 4UBPC 3MUIA 3NO3A 1SW0A 2I57A 2VEFA 3CYJA 3KZSA 4B2DD 3KWXA 3IVUA 3FYPA 3UXLA 1U5JA 2QVNA 2X42A 4C6IA 3OVGA 2WHMA 1S2WA 3GE7A 4HHHA 4NNBA 5FL1A 2IMRA 2BB0A 4NNAA 3M44A 1NOUA 3DU0A 4LV9A 1DWHM 5D2XA 2OYLA 2V69A 3MB9A 3RHGA 1QW9A 1A0EA 1O6IA 1E6QM 3CUIA 2CLMA 4GMEA 1L0PA 1R5YA 4W5ZA 3IIZA 1M04A 1EC7A 3UWVA 1JR1A 1Q6FA 4IX0A 1EX1A 2X8RA 3WNPA 1AZ1A 1BYAA 1E5JA 4D71A 4POCA 3OGSA 1DJGA 3ANUA 1WAWA 3W7LA 2X1SA 4DO5A 2NUYA 2R1PA 1J6OA 2QCFA 4IP5A 1PZ2A 1OX5A 4HJWA 4QITA 2ZVRA 1E6RA 1QFEA 1YHTA 3QZEA 3PJWA 1W1VA 3EXTA 2YDSA 4DWSC 4NAEA 2ZX9A 1QOQA 3EKLA 2V5DA 4UTTC 1CCWB 1GVIA 2DVXA 3M07A 3IAQA 3N6HA 2XZ9A 4N6FA 5LSMA 4TR9A 2PBOA 5CSSA 5DEZA 1TPUA 1G9HA 1V93A 2CLKA 4K1WA 1VPXA 2ZTKA 3OOQA 4MJZA 3NVDA 2E5BA 1D3HA 1DOSA 4AC1X 1D3GA 5GJPA 2C71A 1W8SA 2HEJA 3N6JA 4WD0A 2QPSA 1EDQA 3MCNA 4ZTXA 4GZJA 4MWAD 4L80A 2P50A 3VIMA 2YOCA 1MNSA 1DBTA 2Z7GA 3E2SA 3UWWA 2AL1A 3TZFA 4L4OA 1KRBC 3VUPA 1GZJA 4KEZA 5LXXA 1KXTA 1HQTA 4Z2KA 3Q4DA 3UZXA 4GOAA 2BY1A 1XINA 1JPHA 3NA8A 1AW1A 4JFVA 4HYVA 1AG1O 1DIKA 3CMJA 5M3WA 1HJSA 5FI8A 2ZE3A 2UWFA 5D04C 1GQJA 1EX5A 1P0BA 3Q58A 2XIIA 3BPWA 2XYLA 6XIAA 1RJQA 3E2VA 4UR7A 2HE8A 3RILA 3I65A 1TJ2A 3I68A 4MAZA 1FHDA 1ZRQA 3NIYA 4P2VA 4AF0A 1GZGA 1B3WA 4GIRA 4EWJA 4F0LA 3PWIA 4K8HA 4JTFA 4IIBA 1JUKA 1IYXA 3TNBA 4NJGA 3MYPA 3G6MA 3SM0A 3CPGA 4AZ7A 2FZBA 3O16A 3TH6A 3AFBA 1KGWA 3LCLA 3BAWA 2NT1A 3H4GA 7CGTA 4B4FA 5K9DA 4S1FA 4XD6A 1RQHA 1TCMA 1OFOA 4JX4A 2CERA 4LCRA 5D9OA 3STCA 3ZVHA 4EACA 1ISYA 2NUXA 2VOTA 3DFHA 4TMBA 3G77A 4KCTA 1F8MA 3AMCA 4IISA 3WLKX 2DUZA 3BICA 4LQ1A 3STGA 1I2PA 1LBMA 4L7ZA 5HWJA 5CSYA 1WDDA 3VE9A 4FPSA 2J8GA 3NPUA 1JCJA 3UXAA 1VYRA 3M9YA 3TIMA 2BHZA 1CXIA 3SAZA 1XQKA 2Y8KA 2FB2A 2FPVA 4C6FA 1UPMB 4UFLA 3ZS4A 4OVXA 2A6NA 1GQIA 3K4DA 2VUNA 4J9JA 2W66A 1FCUA 1YX1A 3NXLA 2VP8A 3GS6A 4HZ6A 3W22A 1Z8AA 4XD5A 4JTTA 3ARQA 1AH3A 5BROA 3SCQA 2OO6A 4W88A 3WQ8A 3T4WA 1SZGA 2BZNA 3EX6A 2AQVA 4PL2A 1MW1A 1R2SA 4YTTA 4MNKA 2WMIB 4TOQA 2YX0A 4I7UA 2IKJA 3LY0A 1VENA 4GJIA 4LF1A 3N2BA 4DJDA 1IEQA 1S2TA 4BQ5A 3STPA 4NYUA 5G1YA 4HNNA 2C13A 2CC0A 2J9YA 5ABGA 1Q85A 4ONVA 2P3EA 3CUGA 2J13A 1ITUA 4UOJA 2X2YA 2J78A 1X6UA 3PBMA 4JPGA 3W1UA 3W2JA 5AB3A 4HHLA 2FTYA 2VO5A 1ADDA 2OEMA 5I3GA 1TG7A 3CQKA 3TWBA 1XR2A 5KITA 3B03A 2R94A 3CIVA 2TSYA 3BZGA 3CT2A 5GPRA 1NH6A 3PBGA 3VINA 3DFTA 4Z1CA 1W8GA 1QPKA 5E6YA 3VIJA 4PTDA 4WJXA 2FPTA 1EXPA 4PODA 2DH3A 4IMDA 1BRLB 5C70A 3RF9A 3ATYA 2PDMA 4DUWA 3TCSA 3EB2A 3O2LA 4JY9A 4NZ4A 4EVZA 1E9ZB 5I23A 5G2HA 1WBHA 5HBFA 2GJRA 1LL6A 5C55A 1JCXA 3DG7A 3R0KA 2ZIDA 4IMAA 4UMBA 2NVCA 5DQPA 4WQ6A 1B5TA 5K9CA 3H6OA 1OB0A 1VFTA 1BPLB 4D8AA 3IACA 1CXHA 5EU9A 2PLCA 3WQPA 1LOQA 2EPMX 2J9XA 1H0IA 3HTWA 3CS2A 5D2TA 5HPOA 3IJIA 1H41A 3ZIZA 4TX9A 1L6GA 3DG6A 1E1FA 4Q8PA 3JZEA 2PDNA 3HMJG 1EP1A 4HMNA 3CMFA 1Q6QA 3ARUA 3CUZA 3EX2A 1TV5A 1ZU8A 3WBWA 5J5RA 2QCCA 5EMMA 4Q8VA 3DAQA 1XLFA 1U1UA 3QM3A 3TCEA 3VOIA 4LY4A 4JKLA 4Q4SA 2WPGA 1F6PA 3L0NA 4BWLC 4L9ZA 2YA0A 5CPQA 1QWGA 3A9BA 4MZYA 4H7ZA 3KBNA 2ZUUA 2CZDA 2EPNA 5FEWA 3VCNA 1XYZA 5CBIA 2BGQA 2OWXA 3K1GA 3FY1A 4YVXA 3NQCA 4L5ZA 4NILA 9CGTA 3D6NA 3W24A 2WNWA 3FJNA 4LVFA 1MUCA 4W7VA 4DBSA 2G5WA 1G7UA 1HJVA 3OLIA 2YIHA 3PANA 3B05A 3TC6A 3SCVA 1H60A 2E09A 4NI8A 3WNLA 3IJ9A 1ITXA 3W37A 1R9ZA 3G0SA 3GRIA 3URQA 1RBOB 4DN1A 2VC6A 1KFCA 2PTYA 2BV9A 2OVLA 3RCMA 4J2MA 2C0AA 1JCTA 2G0WA 2UY5A 1SO6A 4UCFA 1I6NA 1R2RA 1ZJAA 3G1YA 4XSMA 3WH6A 1LL4A 3HURA 1B54A 2D1ZA 4A8RA 2OZ3A 1XFCA 3HGRA 1XLJA 4F0SA 4PL1A 3MBFA 4I5UA 4GO9A 3LMYA 4QAIA 3S1UA 3Q2DA 1OYAA 1U83A 2X1RA 2FGLA 3CAKA 3H2NA 2Y63A 3R58A 1CB2A 1VEOA 2IKIA 2V63A 5C9ZA 2KX9A 1XLIA 3W7OA 2P0OA 1TE6A 3J7HA 4JZ5A 4GQRA 1LORA 5JBDA 3ABZA 1OF6A 3EB3A 1TPH1 4PFMA 1NDYA 1Z9AA 1V0LA 1E4MM 3O06A 1B1YA 4AD3A 1OX6A 4R7WA 4LXFA 3CH0A 4QLJA 3RYSA 1CB7B 2WMIA 1XBXA 4PUWA 2VJXA 1PKMA 5IFPA 2F84A 1RCQA 3LUTA 3QKZA 3FW6A 5HJYA 3OVPA 1NOWA 3AQUA 4CQCA 3CAQA 3C4UA 3ELFA 4QDPA 1C9WA 2UY4A 1BLIA 2WMJA 2A79A 4WRHA 2A7NA 1MEIA 5J04A 3GWQA 3GR4A 3NL2A 4LF2A 3GFZA 1UUOA 1I60A 3IGUA 4JTKA 3BOFA 4GI8A 4JOMA 4DXKA 1WXZA 3LGGA 4DI9A 1JI1A 1OK4A 2Z25A 1ZAIA 3T0BA 3ATZA 3OB8A 4O0QA 1V7YA 3QTPA 4WJ8A 4ZZ9A 1D9EA 2DQWA 2FJUB 1TMHA 3AHYA 3VD7A 3PG8A 1GOQA 4FO4A 4DUXA 2V38A 1V5XA 3L5MA 5FJOA 3FAXA 3R25A 4ZB5A 4ZQOA 4NI3A 3BQ6A 5C9RA 3NYZA 4RNJA 3HPZA 1BRLA 1OT2A 4OU1A 3VNYA 3UJEA 4PMYA 3TMLA 1TSIA 4J3XA 3MW7A 2BTMA 4ML9A 3CPRA 2HZGA 3OZOA 1PSCA 5FJTA 3PJXA 4AY7A 4HZ7A 1ZZMA 3RAOA 4DAIA 3CC1A 2D22A 3GDKA 4LRSA 5HK4A 1EUAA 4MY9A 1XLMA 4A3UA 1LZOA 4F8XA 1E5NA 2Y88A 3QH2A 4NJIA 4BR1A 4P8WA 3A4JA 2F8QA 2EO7A 1NOFA 3P74A 3W75A 3V0UA 3QV8A 3AMDA 3MSDA 8A3HA 1G5AA 3WDRA 1ZFJA 5KETA 3FA5A 3CU2A 4C6NA 1YKWA 4D6IA 3TYDA 3MPGA 3T4CA 4UR8A 1ZBWA 2BVDA 4YVPA 1U1JA 3Q65A 1VF8A 1DIDA 3ARXA 4I7VA 2J9ZA 1H5YA 2VCCA 1FWTA 1TUXA 3WQOA 2ALRA 2PDCA 3F2CA 3CEPA 2DIJA 3GTHA 3TLLA 1PJ9A 4YS1A 5E1QA 2HISA 4PB3A 5EA9A 3GVVA 4IP7A 1RLCL 2QEZA 2F7FA 5AECA 4YTQA 1KTBA 1LRQA 4PMQA 4Q4PA 1RA5A 2QAFA 1ELSA 4RZ6A 4M80A 3N15A 4PUJA 1KR0A 1YPIA 3UGVA 4UXDA 5F1VA 3V7PA 3FFSA 3U2OA 3A24A 5FJIA 5F7UA 2E5CA 4PC8A 3G18A 1Q6OA 1K03A 5FF0A 3WSUA 2FVKA 1HZYA 3M0KA 4HNOA 3T07A 4HOWA 3USBA 4MWAC 3FDGA 1C9DA 4MUPA 4D8LA 2GOUA 3RG6A 3UYIA 2B7OA 3S5OA 2GGEA 4H41A 3N18A 3LZ5A 4A8NA 1FH7A 1C8YA 3BTNA 1DYSA 4HMEA 3ORWA 1WOAA 1UD6A 2NV1A 2DT2A 3NQEA 2D0FA 1CNVA 2FFCA 2NWSA 5HATA 1W9DM 4HYRA 4UZUA 3WMLA 2VENA 1EXBA 3Q45A 5H1WA 1FDYA 1A5NC 3H2EA 5KSWA 4H9UA 4E0CA 5GNXA 1UOKA 3CUXA 3KM8A 4LBSA 5DFAA 1F4HA 3F7JA 4C91A 4UTHA 8XIAA 2J7BA 2XVNA 3GQYA 4U2ZA 4KFOA 1BG9A 3W72A 4O28A 3TSMA 1UBSA 2XISA 2PA6A 3N4FA 5LGXA 4YNGA 1GW9A 1J2WA 3W53A 2PWDA 5JUVA 1W3LA 3N11A 1UROA 2ZZ7A 2D0GA 3DHDA 4I8YA 5XIMA 3KL5A 5C7VA 1A3WA 3O6CA 2VEIA 5DCEA 3NFUA 3BAJA 5F4XA 3WDHA 1AK5A 3S83A 1A4MA 4M1RA 4GXPA 1DJXA 1NELA 4CD5A 1OX4A 2VDHA 1WZAA 4Q4QA 3LPOA 4MDOA 4FXSA 4DYEA 5EPDA 1M5WA 2PLJA 1KNWA 5JIPA 2EJ1A 2W5FA 3FJ4A 1KBIA 4F9DA 4W89A 1UP3A 3WF3A 4R5EA 3MKVA 3AU2A 3CL6A 1WP6A 3OA5A 3SW6A 2VWTA 4P8XA 4PGLA 4PSPA 3IIXA 1Z42A 2QAPA 2E67A 4DBDA 3VKAA 1LDCA 3W38A 4HPXA 2ZRWA 5H91A 3IIPA 4DELA 1JDEA 3ANVA 1RR2A 4S3JA 4HB7A 5LNWA 3U9IA 3CNYA 4A3HA 1SZEA 1K6WA 3MSRA 3FX4A 3M0VA 2GFTA 3KDOA 5CPMA 2XM2A 3EPNA 4XV0A 4PTNA 3PZTA 3B40A 4CNOA 3EOOA 4MHBA 3THUA 5A8OA 3UZYA 4FX8A 4IH3A 3WF4A 1WB0A 4Q7BA 1NDWA 1FP9A 2XH7A 5BNKA 3B8DA 2YJQA 4B5VA 5HNTA 4UWMA 2XZ7A 5JMUA 2RDUA 4GRSA 4U31A 5C8BB 4JD4A 5LA2A 1A0CA 3VVGA 5AYZA 1DP0A 1ONWA 2XVPA 4HQVA 4GK8A 3REQB 1XH1A 1JZ4A 4J7RA 5LA1A 4ZENA 1OZQA 3LM7A 4MY1A 1KC7A 4Y2WA 1YADA 4ACZB 4HTBA 5D33A 5J8LA 3Q67A 3HPSA 2PE4A 4Q7NA 3LRMA 5L6UA 5E9XA 3VGFA 3PJUA 1W31A 1BGGA 4GQQA 4EANA 4L4LA 4W7WA 3S47A 3VKBA 1V3IA 2ZUMA 2VFHA 4CUCA 4G7EB 2VEPA 2PDQA 1XKYA 4JYEA 4TVUA 3EMQA 5BRQA 1R86A 2HV5A 1V3LA 4RR4A 1X1ZA 4IFKB 4ENLA 2P8BA 1GCYA 3W7JA 3OBKA 5BU9A 3SQMA 2A0NA 4BQ3A 1XPYA 2ESCA 4H2HA 2P3ZA 1KFJA 3C3NA 3W7QA 4AFYA 4MGGA 3BLDA 2WJDA 5CG7A 3E6EA 5I5RA 2Y62A 3AZSA 1X7FA 4AD5A 1FFRA 4R7JA 3VAVA 1MXGA 1EQCA 1OQFA 1X1NA 1EB3A 2W6RA 1H1ZA 3WF1A 2C15A 1REQB 4KEVA 3M6DA 2GJXB 2D3LA 2OTDA 2PTXA 1VEMA 2NQHA 4Y8EA 3H22A 4NXKA 2B0MA 4M7TA 2X0YA 1JNEA 2G37A 3W1QA 1H7WA 3PPCA 3PZ9A 4LS1A 2DT3A 1GNXA 3G3DA 2WWCA 3NURA 3OGRA 1SZNA 4WDXA 4LVAA 3BLIA 3ZLGA 1J0HA 1JAEA 3MDUA 2F38A 3SIMA 1TJRA 3BE7A 1OBAA 1W5OA 2PRHA 2RJHA 1WZKA 3FCPA 5BOEA 5D09A 2GL5A 1OABA 4IUOA 4NJJA 4RE2A 1TPB1 4M24A 4ORIA 4UQCA 1VQTA 1M1BA 4N02A 4PSRA 1JPDX 4WIWA 1W1PA 4WX2A 4Y7EA 1HUVA 4MSSA 1VYPX 2E1DA 1MXSA 1I8JA 1DWIM 1AJZA 1TRIA 3G3MA 3RJXA 3UNDA 1JFXA 2AMGA 3EWDA 3RMEA 2RAGA 3CHDA 1TV3A 4UZSA 3UXKA 5FOOA 3NO5A 4XWUA 4L6DA 1R6WA 3OPSA 4O8RA 1W1YA 3FV9A 1QATA 2BMBA 1DE6A 1R3WA 4DZIA 2BXYA 4QS6A 1P43A 1R87A 4LUSB 3VOJA 1UWTA 2YW3A 2A3CA 1V6YA 1WDQA 1W9PA 3VNLA 2ZE0A 2YDQA 1WDRA 4IFRA 4PB4A 4DY1A 3W3OA 3MHFA 4M6QA 4NVTA 2VR4A 3L4XA 2A5HA 1QOPA 2C16A 1M01A 1WE5A 3ZM8A 3MV11 1DJNA 1EP3A 2VTFA 1BKHA 3WEMA 1VFHA 1XRSA 4FLOA 4PMDA 3OW1A 3EEGA 4FS9A 3WJWA 1L2QA 2GSJA 1EHNA 4HK5A 4NQ1A 2CYGA 1C90A 2HS6A 3ITLA 1RALA 1XIBA 3NQFA 4IJRA 3DEQA 1AA1B 2YCEA 4LC6A 2O56A 1E1EA 3ISIX 4HU8A 1YIXA 5A6AA 3PR2A 1XHGA 3RO6A 2DW6A 1UKSA 3DHFA 3W0KA 2ZRUA 2CETA 5M17A 1VYSX 4JTEA 4GCAA 3OHMB 3P62A 2WKGA 1RBAA 3VFCA 1V3HA 4GYFA 3M7SA 4Q4MA 1FHVA 5HWNA 1VAHA 1H09A 3QV7A 1J4EA 5FSDC 1Q45A 4GYPA 3BSMA 4JTAA 4K8EA 5F4WA 2VKZG 3TEVA 3BGGA 3GIQA 3WQCA 1M65A 3KOYA 1EJTC 2QQ6A 1G01A 3R10A 4S3GA 4LAUA 3M64A 4FNPA 1Y7VA 2ZTJA 4J1OA 4A2RA 4JL1A 4IPIA 1C8XA 2O9RA 2XH2A 1DE5A 2Z6IA 4ACZA 3S9ZA 3E12A 3VGDA 4B4HA 4WKFA 1QBAA 4JTLA 1HVQA 4BQ4A 2Z24A 2OYKA 3MQTA 2VVSA 2PS2A 4S3EA 3EWYA 3C2YA 3ABSA 3N25A 5HQMA 3HG4A 3V0TA 1OFEA 1O68A 4FK9A 2AQOA 4OBRA 4O52A 5FKYA 3WYZA 1AH4A 3FN9A 4G7EA 4ZA0A 2FVLA 3PZUA 4WF7A 2ZUVA 3H8AA 5CG0A 2Q8LA 3BOXA 5REQB 1J0ZA 4IFKA 3M46A 1PX3A 4NKCA 2ZXAA 4CN4A 4JN6A 4FXRA 1UOZA 1UH2A 5FA5A 2HDJA 1HGYA 2QF7A 2VQUA 4V28A 2OCZA 5JIWA 4O12A 2VWSA 2XWDA 2QJMA 2AGKA 3KBVA 4LCQA 2FGBA 1UD3A 1Q6RA 1RJRA 1QW8A 3WCZA 5BRBA 1F6YA 4IL2A 3UCDA 2GJXA 1QNVA 3BXWA 3WELA 1GHRA 2ACQA 4QFUA 2J77A 1TWWA 3GNOA 3NUKA 3AWNA 4CD7A 4FHAA 3BO9A 4DUVA 4Z2IA 1NF0A 5CZKA 4NF7A 5IHRA 2C8NA 3UPMA 3WMSA 1E71M 3E02A 3WO8A 1EDTA 3HZ3A 2CLLA 1Q6DA 1PVNA 2BP1A 4XZLX 1W0MA 1AMKA 3DFOA 2Z1KA 2EPKX 3D3FA 1ADSA 1MQRA 1S3TC 1BXCA 5A6JA 2OEJA 2ZQ0A 1BF6A 3SDOA 2CIPA 2WSQA 5I3KA 2G3NA 2ZX7A 3FXGA 4QM1A 4YTRA 3SUVA 5LIYX 2FTPA 2XIQA 4HA1A 2X1UA 3WL1A 4HA0A 3QMSA 3RPDA 2NLIA 3GXMA 3H7RA 2VHLA 1Q8AA 5FJRA 2J66A 3AIVA 4FR6A 2ZXBA 5JU6A 2YSWA 4QXIA 3I4KA 3CTTA 3PF3A 1G69A 4S39A 5GVJA 3H7UA 5EMYA 3F5KA 1D8CA 1PDYA 3LXCA 3BLKA 5BOFA 2D73A 1FKWA 4K2SA 4HA4A 2XIMA 3S9IA 4QP0A 5D02A 3QQ0A 3WD4A 2F61A 3U7VA 3NM1A 3DBNA 3MVTA 3HFYA 2XVKA 3IGXA 3P8JA 3N29A 4HSOA 2JKEA 4B5TA 3WUGA 1EGMA 3C2VA 3GG0A 3E2QA 5KZDA 1UA3A 2ABAA 3U3HA 4JX6A 3GG1A 1RZMA 3NVTA 1OGGA 1TV2A 4QHRA 1R9XA 3GR7A 1W2PA 1K02A 4GX9A 5CLTA 4RNHA 2X16A 3QV6A 4DWSA 3EKGA 1XUZA 1RY0A 1S2UA 1C7SA 1WV2A 3KL0A 2XU2A 4AWUA 4OGZA 4DI8A 3JVAA 1XUUA 4MIMA 2WCSA 5IBXA 3NSMA 4UOQA 2Y1HA 3W7RA 4UC5A 3ZZ1A 4J3UA 3DX5A 1RJPA 2G3MA 4EAYA 3FHQA 3GLCA 1B3XA 3T05A 2GGIA 1DWAM 2E9BA 4BA0A 2J6XA 1QNOA 1S5VA 3NEVA 3EDEA 3KWSA 3WJZA 3WFLA 3SN1A 3CHCA 4PBEA 3TDFA 2IS7A 3M0HA 2GSEA 4U4MA 4FZIA 2OZTA 2WK2A 1DORA 4EIVA 3I3EA 4UQAA 3MJMA 2OB3A 3SB0A 7XIMA 2V3GA 3APYA 3E1F1 3L0GA 4LS2A 1J10A 3KE0A 1PPIA 1GVRA 3GAKA 3KTCA 3WBXA 1H3GA 4MZ8A 5G1MA 1EZ2A 3WH7A 2DZTA 5HJLA 2PLMA 3SY8A 1CIUA 4ZVJA 4KFNA 5HAOA 4XAZA 2C18A 4PFHA 1P0DA 3AHVA 1TELA 1SZFA 4KQNA 2HK1A 4IHCA 2FH6A 2WLZA 1W9VA 4YL2A 1QT1A 5REQA 3THAA 3VZZA 5BWFA 1A5LC 5H8UA 4A21A 4HN8A 1KA9F 4V15A 2UV8G 1K9FA 5I2UA 2FZMA 5DRCA 3EZ4A 4ES4A 4ML4A 1F3TA 1HXJA 1W17A 3EOUA 1HJXA 3LMZA 5CQ1A 2E6AA 2GUYA 3P93A 3N9RA 3CQJA 1RK5A 1RLDA 4XG1A 2F6XA 4UTMA 2CZFA 3GBEA 2OSWA 3IJDA 2ZICA 3CASA 4ZODA 1DHKA 4XK2A 4AVFA 3F5LA 2QGHA 4JKKA 2KAUC 4DJEA 4CNSA 1GKQA 2MANA 3LSBA 4XZIA 1EJVC 5BW6A 4M3PA 1XIJA 3FA4A 1AFSA 4XZHA 3AU6A 3VZYA 3TK7A 1U33A 4H7VA 4HCDA 4GYJA 4H8NA 2GVLA 4DWDA 3W76A 3RR1A 2DT1A 3MU7A 1KXQA 3ITGA 3QLLA 4O13A 3S5SA 3UZ5A 1FWWA 3MY9A 3M5ZA 3B9EA 3PBWA 4FOJA 4GIAA 1IZJA 2OU4A 3LOTA 3VUSA 4DZHA 3KS5A 1WOBA 2WSYA 2EKGA 1JD9A 4CQ8A 4XISA 1XIIA 3VD9A 3DYPA 3HQ1A 4M56A 3WLQA 1YTEA 4JFSA 2A3LA 3EAUA 2CW6A 2CCRA 2WHKA 1M7XA 3HIJA 1ODUA 1VIWA 1ZBKA 3DKJA 2GGGA 1G4PA 4W85A 1XYAA 1O5RA 3HJEA 1FWDC 1FTXA 3ZLHA 4QGCA 4UNLA 1E73M 2BX7A 4O57A 1W3TA 1EJ7L 1GT8A 3C6CA 1C29A 2Z26A 1YPFA 3BMVA 2BODX 3GXNA 2A6LA 2CXGA 3OZYA 4K6AA 2FQIA 1K3UA 2X30A 3A47A 2YFNA 1M7PA 4D6FA 4Z0SA 1J79A 4AZ5A 2POTA 3NQMA 3URAA 1K6AA 2V5LA 4L64A 5RUBA 2WVSA 2O9OA 4TXEA 1CYGA 1P6CA 3W02A 4UFHA 2VNCA 3HU7A 3ZOAA 5IFTA 1FKXA 5DF0A 1Z32X 2GVJA 1FXQA 2DZXA 2PDHA 2PWVA 4NP7A 3L66A 2GZXA 5LNVA 4ZFCA 1BKSA 1XDMA 3IJLA 4UB9A 2WZIA 1VHNA 1A50A 3DH7A 3F5JA 3WL0A 2RDTA 4PUMA 3NQ8A 5D4YA 4HZMA 2RJGA 3TYZA 2AKZA 2YFOA 3QPYA 3THQA 4MFEA 1FX6A 1V3JA 2WO5A 3BLLA 2Z2AA 2OGJA 1PTAA 4XAFA 2DDXA 5I3JA 1LL7A 3TA6A 2ZUWA 4M6VA 1VFUA 3NPVA 4JHMA 5C9UA 3RRAA 3C52A 4NG3A 2BVWA 2GK1B 4AIUA 2P1FA 5F2MA 4IPPA 3NTYA 1THFD 3BSHA 2XFYA 5T9CE 4GIEA 1OYCA 3AXIA 3KVJA 3T2OA 4ORMA 3MUY1 2JGYA 1OF8A 3RX2A 3ARPA 2WANA 4M81A 2YA2A 1MVYA 2VGBA 2HXTA 3K8KA 2ZDRA 4FF7A 1U2YA 3M0IA 3TW6A 1QNQA 2Y85A 4YWIA 1KLZA 2J7GA 2YZRA 1K7XA 1V6WA 5AHIA 4DBUA 1O1ZA 4FLSA 3A21A 2PWUA 3AZTA 4JIEA 1EEXA 4PMOA 4ZQNA 2BLEA 3UESA 4XZMX 4LAZA 3EYPA 3DERA 4AVNA 2WZTA 2GGHA 1H51A 1PL9A 1EBHA 2W79A 4B5WA 3ITYA 2G50A 3QGKC 4GE8A 4P5UA 2WM0A 1JULA 1F74A 3WN6A 4RDYA 3I10A 2A3HA 1IF2A 3SIZA 4ZBCA 5A2AA 1WKEA 3BAIA 3G8RA 3KP1A 2O7QA 1Q13A 3KFTA 3HGOA 5H8PA 2NXGA 4B5XA 4A8LA 3AYTA 3HG3A 4W8BA 3OGVA 4GHRA 3P60A 3AYVA 4JTIA 1GPWA 3U4AA 1Q7ZA 3H12A 4JN7A 3WQVA 5KZMA 2CLOA 2YZ5A 3EGJA 4A4AA 1V6VA 4E2BA 4V33A 1WKDA 1KXHA 2VC9A 1VGAA 4J4KA 1J93A 1HJQA 5I3IA 1FWEC 3LXBA 3QY6A 1XL9A 4ATLA 1EL3A 4NASA 3FEQA 3CPUA 3LERA 2EXOA 1HKMA 3STFA 4ERIA 1X1OA 4GY1A 1XBYA 2JKAA 1C3FA 3TJLA 3WLHA 4JQAA 4BKNA 3M5XA 3C0LA 3CXOA 3V5FA 3H2FA 4ICMA 3LB0A 4ZMGA 3IUIA 4LJ3A 1ZJIA 3KDNA 4ACYA 2OX1A 3F4VA 3T6CA 1TQXA 3AS0A 1GOWA 1ME7A 3BAKA 4XBSA 1X7IA 3G1SA 1D3CA 5I07A 2HS8A 3CUHA 3A4AA 4UTWC 3NGFA 3B9NA 4NZCA 3C2FA 1OIFA 2WC3A 5I24A 2WQPA 2VELA 4P7OA 3SFKA 5C6MA 2R1NA 3C0SA 1B0IA 1SJBA 1UCWA 4QROA 2QNEA 3BW2A 3H54A 1F4AA 1FWGC 3TYUA 3NDOA 5G4HC 4KEMA 4QE1A 1HL9A 3VIIA 3P80A 4WY0B 3GY1A 4OFCA 3ZR5A 2VX4A 4HMDA 3NCOA 1GQLA 2OR2A 3EKZA 3OYZA 4IXHA 1GTEA 1UD4A 2OPJA 4B2DA 2RFGA 3QC0A 3L5AA 3IS4A 4MNLA 2HSAA 4M0XA 4CGTA 3BDKA 5DCBA 3UERA 1VH7A 1KV5A 4AZCB 2Y8UA 3B0PA 5CGMA 1AMYA 4L1GA 3RUBL 3R0DA 1W9UA 3TC7A 2CHOA 2W62A 3MMUA 1H5VA 3R6IA 1CGYA 5AVNA 1DTNA 4CD8A 4JHOA 5AC4A 1ISXA 2YKKA 1S2CA 3AYRA 3GG8A 1PHWA 1WZLA 1EGVA 3N4AA 2QUUA 3NQVA 1ECEA 4E6MA 1VBUA 3M16A 3BLOA 3FNDA 3NAVA 1AL7A 3QYQA 1RPXA 2GDUA 5HUOA 4HN4A 3W87A 3VNJA 3QQWA 2Q3OA 2IKHA 4GKTA 4HOXA 1H62A 4AWTA 4WSJA 1FCQA 2DPEA 3BCFA 4WKHA 2DU2A 4ADSA 2BY0A 1LF1A 5AHMA 5CEWA 4AY8A 3Q94A 1UJQA 4ZO7A 3W1XA 2GK1A 3UETA 2OG9A 3CWNA 4C6MA 4V2XA 1TPVA 2YPIA 3SGGA 1FWIC 1E6NA 1R3VA 1TREA 3B9OA 4XUYA 3QSRA 1NEYA 4KERA 4HNCA 3G8EA 1SFSA 1K8XA 2O0TA 3GTXA 4CQ9A 5CPSA 2YXOA 4Q8QA 4LALA 3LN3A 3WNOA 1X8CA 5DMYA 2PU1A 4AUBA 5CC3A 3TQKA 3TN4A 1V6XA 1H50A 2X05A 2CLEA 2ZZ3A 3KOZA 1L6FA 2DZUA 3AIUA 4XTDA 3AXHA 4RLIA 3IEBA 3WJXA 2V5KA 1KRCC 1UPPA 2Q01A 3SCRA 1P1MA 5I3FA 5ECUA 5T91A 4MWAA 3AUJA 3A5FA 3HQNA 3B8VA 2W9MA 4UQBA 4DZAA 2ZRZA 1A5MC 3TWAA 1OC5A 5A6BA 4ALDA 4FNTA 1MMFA 2BHUA 4CNNA 3EPOA 1HTIA 2EG8A 5HMFA 1EBGA 3VNDA 3CH9A 3THDA 2R14A 1CLXA 2D20A 4FF5A 4B3ZA 4ASTA 4ZO8A 2R8WA 3EXRA 4JCLA 1FVPA 1GG1A 1TTPA 3CEUA 3PNZA 4DWSD 4K7VA 1QO2A 4RL3A 1IV8A 3LENA 2ZBTA 3SCWA 7A3HA 4REQB 2X1TA 3DFNA 4JNYA 3V18A 1KBKA 1POKA 3TTOA 2OLAA 2CFFA 5JXQA 4PCFA 4OV4A 4IOTA 2V5CA 1V8EA 1EUNA 3MP4A 4JICA 2NXHA 3CV7A 3SCSA 4LSBA 5K4XA 3WBYA 1G6CA 2E6YA 3INPA 2JALA 4AU0A 2PDKA 2ISFA 2IQTA 4ADUA 8XIMA 1W5QA 1XC6A 2OGYA 2WJFA 2XSAA 1DWJM 3MA8A 5FL0A 4KIRA 3W01A 3D46A 4GFIA 2GOKA 3R8GA 1UWRA 4EXBA 4E4FA 5LIXX 3IRDA 4E3VA 5BXPA 2ZA2A 4CCCA 3RLUA 2FZ9A 2VGGA 1A3XA 3AXXA 4KWSA 4I9JA 1E72M 4F2BA 2XGBA 2ADAA 2GVGA 3CWHA 4NX0A 2XIBA 4ZOAA 4DAFA 2NV9A 3VIHA 5BZAA 2EGZA 4RNFA 3T0DA 4JTRA 2V0TA 2DUXA 1BYBA 3ALGA 5AN7A 2JQXA 4OT7A 3ZJ7A 3IVTA 3W74A 1TJ1A 1TJ0A 4GD0A 4MPQA 3LDVA 4JQ1A 1IEXA 3CBWA 3H2CA 5FEPA 1CLKA 3SY5A 1RCOB 4WY0A 3PTDA 1JF5A 3XINA 3NGJA 4L61A 4MNMA 3FSUA 4AZ6A 3ZT6A 3NZ1A 4F4RA 3NL6A 4IFOA 2VGFA 1ZLPA 4EPDC 3AZRA 4M1BA 1BWVA 1VCVA 2WMFA 1OY0A 1HKWA 4CD6A 2QDGA 3C8FA 4AZCA 4NAFB 3BLPX 3E0IA 3MANA 5DXYA 4N4QA 1W5PA 3GIYA 4WXYA 3DFYA 2A2IA 1GJWA 5FAJA 4O0ZA 1FWAC 1VFLA 1Q7MA 1NDVA 4M7SA 1TV4A 4KFPA 1E0UA 1PEZA 4EPBC 4H6EA 4S3CA 5HPCA 5HR7A 3QBUA 3H2AA 1GEHA 2PDFA 3GIPA 1I2RA 4MMWA 1E51A 3VA8A 4RZ5A 3F4DA 1CGVA 2YDRA 5FJUA 3UU0A 4MM1A 4DPQA 2Y7DA 2Y5SA 3QQ1A 1X6LA 3WDPP 2UY3A 5AYXA 4HD5A 1UZ4A 3UQNA 2PSNA 3S2JA 4QG9A 3L0KA 3NPWA 3LBMA 1GONA 2HPIA 1EKOA 4E2DA 2J88A 4ZR8A 3FYYA 5I03A 2ZZ5A 4E8CA 4Z42C 5M5DA 3T0CA 1R8LA 5I0DA 1EYWA 4EF8A 4E5TA 4AMCA 1OG6A 4AISA 2E3ZA 3UR7A 4O15A 3L4UA 4H9VA 2GJLA 1CT5A 5G2WA 4GH3A 3QRHA 4IJBA 4MB4A 1TPWA 4GLEA 3SRDA 4ZEPA 4RDVA 1FWHC 2XVGA 2WJEA 1DJQA 3R4IA 3C2RA 3VMOA 4QX4A 5U4NA 2W27A 2QJJA 2XFWA 2A4AA 3GVQA 1N82A 4QDMA 3F4CA 3VFLA 5CCZA 1C8QA 3UEQA 1A4LA 4GNKB 5G5IA 4JYFA 3OG3A 2ZDSA 4K39A 5CPOA 1JGIA 4Q6JA 1B2YA 1PCKA 2NX3A 1SZRA 4FOKA 3YPIA 2J6VA 3QJAA 3UJRA 1AQ0A 3KL3A 3M41A 1UH3A 1QNSA 4S38A 1VD6A 1W3NA 3GUGA 3WK1A 5BXRA 4H6KA 2WCGA 3FGCA 2V2DA 4NZFA 5AZ1A 3MKCA 4REQA 2WQDA 3TX9A 2WSRA 4OE7A 4MYXA 1UWUA 1TR1A 4WEVX 1JPKA 5DN1A 3R13A 4KWUA 3CAVA 5E0KA 3S0CA 1F3EA 2WM1A 2V68A 3L2MA 1LCOA 2HMCA 1IE7C 5A6LA 3ARTA 2E7FA 2MUCA 3NNTA 1Y65A 5AYYA 4S3DA 3NG3A 4KKXA 3P7YA 3PZGA 4AD1A 5K2ZA 3QC3A 4JTQA 3LLFA 1N55A 3JU2A 4R85A 2PWEA 4PUNA 4C6QA 4CCZA 3GBDA 1ME8A 3NZPA 2YL5A 3PSVA 4N4PA 1A3HA 3EDJA 3RXZA 3GNDA 1W5MA 2O9PA 1VPYA 3G0XA 1P7TA 2DVUA 4K37A 3QVQA 1BYCA 1P0KA 1Q6LA 4FX7A 2BGNE 3ZMRA 5D2YA 2YYTA 1QWKA 3W25A 2CNCA 4Q3MA 4Z1YA 1YXCA 4WY0F 2VFDA 4GYKA 3UPWA 3NSXA 4D6DA 3QW3A 2CZEA 2HQAA 3AMKA 2UY2A 2PF0A 2QDEA 3UFYA 1QK2A 3O6AA 3WJSA 3M0YA 3PAOA 4IZGA 2JIEA 2QUVA 4JIPA 4GINA 5EBAA 1XLHA 2XSXA 3ZVIA 4LEQA 4YHEA 2VR2A 2PLKA 3CLMA 4Z2LA 2G8ZA 3DHPA 4RCXA 3ONCA 1J8VA 1IWAA 3CQHA 3MTWA 3KX6A 5GJMA 4XVDA 4NAFA 3BV4A 1MFUA 3QSTA 2BG5A 4AEFA 1WDPA 1Y5XA 1OADA 3L4TA 2PBGA 3LX9A 1ZPTA 1JAKA 2PDGA 3A22A 5HANA 1DPMA 1VLIA 4C5ZA 1V0NA 5DMNA 2V2CA 3VOCA 4ERAA 4N9BA 1BXNA 1OC7A 4C6DA 2DFAA 2INEA 3CB3A 1RD6A 3WLJA 4LAOA 1XM3A 1VJSA 4ZQRA 4Z0JA 3FEMA 3M0MA 3MZ2A 3HQOA 3GC2A 4A3YA 4W86A 3I3DA 4BHYA 3HV9A 1XLDA 4FEZA 2ZADA 1QO5A 4R53A 2QS8A 1HKVA 4F0HA 4GG9A 1XBVA 3N2OA 3PNUA 1TFVA 1A0DA 2WMGA 4B16A 1FH9A 5IDIA 3EA3A 3TTQA 4B92A 3P5ZA 2J4GA 1AJ2A 3ZVHB 4XD4A 2VRQA 2V3DA 5AHNA 2G97A 4R9XA 2GGJA 2PDWA 1UR3M 2R6OA 1KM1A 3AROA 3S6OA 3TAOA 4QAWA 3HJZA 2QIIA 1ZTVA 3D0CA 4LAMA 4US5D 4JTUA 3SUWA 4YMZA 2CBVA 1KFKA 5E0FA 3PUEA 1XPGA 1IHIA 4H8VA 5F1UA 4HNVA 4LYPA 2YW4A 1EP2A 3PHAA 3SRHA 3W7HA 1G4EA 4MLRA 1ECQA 1K77A 1XD1A 3MUZ1 1E4IA 1SQ7A 2ZX8A 1LQAA 1JD7A 4RKAA 3GAYA 1FRBA 5AKQA 1A47A 3E9AA 2HCVA 1CW2A 1SVDA 4UTLA 1BEUA 3UCQA 1LBLA 3UVAA 2FGZA 4KRTA 4I9MA 3TN6A 4DVOA 2H3DA 1SSGA 4DJDC 3ARVA 2VQTA 1MO0A 4OV9A 5LNUA 3GVWA 1XLBA 1I1XA 3CO4A 2NUWA 4U5KA 3CHVA 3FJ6A 4B9ZA 2VXNA 3PG9A 2VL4A 1P6BA 3OP2A 3TOPA 3TTYA 4Q32A 2X41A 3QFEA 4O18A 3W07A 1OIMA 1TJPA 3N73A 3MT1A 1EJRC 3QMTA 3AUOA 4AHQA 1L6YA 4JY8A 3VD5A 2BXZA 4J27A 5EYWA 3DGBA 5C0QA 4DLMA 2GWNA 3NQ7A 5HINA 1LRTA 3WQ4A 3CUJA 3OG2A 3TJIA 5CPLA 1R7OA 3H4XA 1E55A 3CIWA 4HMCA 5IOBA 3U7BA 4S2BA 1VB9A 1XLAA 2BSLA 3S6DA 3VNKA 2JF7A 4H00A 1A5AA 1VCFA 3DUGA 4XKYA 1XIFA 4YIWA 4JTDA 5D2VA 4YXGA 1JCLA 3W88A 4PMJA 4Y9OA 1NM9A 5BWAA 3UWZA 1F6KA 1P6WA 3SY1A 4GWEA 2C79A 4YHGA 2VURA 4P7QA 2BXVA 3HPFA 2J8FA 1EWDA 1UQYA 2Y7GA 1YDOA 5HDRA 3MMWA 1G67A 1UR9A 2I16A 2QCEA 5D2WA 1CZ1A 4Q7IA 2JEQA 2QCDB 4JR5A 2PAJA 3W82A 5HOSA 3LEPA 1GQNA 4PMUA 1ZJHA 1J0KA 4LANA 2PODA 4DM2A 4QLLA 4LT9A 4JIQA 3RIKA 1QAPA 4GO8A 2HRWA 4Q8NA 1XRTA 4IIHA 3ME3A 3P67A 1W2VA 2W61A 3ZSSA 3OO2A 1LROA 4H19A 4DF0A 1XKJA 4LNCA 5A6BD 4KWVA 6REQB 2BASA 1R38A 4PMVA 4C1LA 3K1DA 5JBEA 1N8IA 4A8IA 1MWOA 5HQEA 3VDGA 2YBVA 1QPQA 3QY7A 2RGLA 1OD8A 2CBJA 3IUDA 2WXDM 2ZZ1A 3R8RA 5HWMA 1OWQA 3AI0A 5DBTA 3KS6A 3W84A 3U4FA 1LRNA 4G6CA 1UUMA 2WBGA 4HK6A 2OKTA 3VM7A 1T0OA 1HF6A 1S5MA 1NQ6A 1EC9A 2OQHA 5CJMA 2B7QA 4NHVA 3UA4A 1FY6A 5F2IA 3OBAA 3K5XA 3MCMA 1UWIA 4QISA 4X2RA 3NM3A 1OD0A 4MZ1A 2ZYFA 4S23A 3F2BA 5LIKX 1QW7A 1AUSL 5FJJA 3AO0A 2OYMA 3VM5A 4UFIA 2BY3A 2FHFA 3OYXA 3AWOA 4JDBA 4O50A 1MDRA 1H63A 5D9PA 1KKRA 3ECQA 3PVFA 1E15A 3C2OA 4AD2A 1UD5A 1BGAA 1SW7A 5HQLA 4L65A 3LD5A 3NL3A 4R33A 4PRWA 3TFXA 1G4SA 1KQYA 5LIWX 3K4AA 3VIGA 4K68A 3VGGA 3TFCA 4XIMA 1W1IE 1MQQA 3WZ0E 2TAAA 4AD4A 4XTIA 5IDZA 2DSUA 3NZGA 3WLIA 4A05A 3CTLA 2DUAA 5A3HA 2I7GA 1R3TA 3QN3A 1HO4A 4TU1A 3NR0A 4C6OA 3NYDA 4ZGYA 1OC6A 2GQ8A 2DSZA 1UWAA 3I3BA 5TF0A 3PJTA 4EKJA 3ZWTA 2XH4A 3HGSA 2H9AB 3LHWA 3H21A 4MFDA 3LG3A 3VIOA 5GNYA 2E77A 5BCAA 5CZTA 2HJPA 1F07A 3WLNA 3N9SA 2V5JA 3FYOA 4DXXA 1ISWA 3L65A 2E9LA 3BAXA 2B81A 1K1DA 4KETA 2REQA 4JIIX 4LGXA 1DJZA 3L5LA 5CXPA 5C54A 3L23A 3GU1A 4JFUA 3BARA 6TAAA 3SJNA 2Y0FA 1ADOA 1X8FA 3QMRA 1BSIA 3OIHA 1YBQA 7PTDA 3OU8A 3F03K 3WIJA 3FKRA 2Z1XA 4O4VA 3FJLA 4LY8A 1MYRA 5EMKA 4JTCA 1US3A 4AWSA 3E0VA 2BFGA 1UR8A 2HE5A 2PRMA 3TZNA 3ABQA 3EWWA 3FLUA 1Q2SA 3WQDA 1W6TA 1TQJA 4PTWA 1BTMA 1CXFA 4HYWA 4WHBA 4DF1A 3N19B 1Y5WA 4GH1A 5FSEC 4UNIA 1ZHAA 1CPUA 7TIMA 3IPWA 2YCIX 4JBRA 2G4JA 2RGMA 1R46A 3GHRA 4QQ3A 4DM1A 3DENA 2YL9A 5LNSA 2FZ8A 2QCDA 1F61A 4HOZA 3ICJA 2RDWA 3RPMA 3S5YA 1DJWA 3W6YA 3GM8A 2AOSA 1UUQA 2ACUA 2R82A 1UHVA 2JF6A 4C6KA 1FHUA 1T40A 1Q65A 4TQTA 4IICA 2PGEA 3A12A 9XIAA 2ISVA 4QSFA 5E5CA 1W37A 4C1NB 4HP5A 4NX5A 1Y0EA 5KZ6A 2DVTA 2WWDA 5FCZA 3W1NA 4N9EA 6REQA 4XZWA 5FEZA 1EPXA 3POHA 1HP5A 3N9KA 1DL3A 1AD1A 5ABHA 5BRPA 3A3WA 1KM4A 1V51A 3B0XA 3A5VA 2XN0A 2XM1A 3OBEA 5EB8A 4DBWA 4ROQA 4NRSA 4YCPA 1OFDA 4N42A 1E3XA 2FTWA 1BFNA 4F3HA 4B5NA 1SU5A 4QNEA 4PTMA 3QY8A 1QNRA 3S1VA 3VOGA 1LT8A 3V5OA 3UWQA 3I4EA 3UCCA 2HWGA 4JX5A 4XD3A 2OQLA 5FESA 3UXDA 1UC4A 1JZ3A 5D38A 3L12A 1MUMA 2QR6A 3FDKA 3AHXA 2ZA1A 5HA7A 2VRKA 2Z2BA 4DYJA 4X2PA 2B4GA 2RHGA 2RUSA 3RPTA 1D8WA 1T5AA 1XG3A 1XYMA 3NQ2A 2Z0IA 2Z4GA 3TTSA 2VZTA 4I90A 2PDYA 9XIMA 4TTUA 3DIPA 3RRXA 3I6EA 4PEEA 3RLVA 1NQKA 4NU7A 1OGBA 1QDSA 3RMJA 2VC5A 2DY3A 2XIJA 1VPQA 3M5YA 4HPHA 1IIHA 2CHRA 3S9YA 1Y5VA 3LTYA 3H2MA 3T2QA 3AS2A 1O60A 1EIBA 1KFWA 1TIMA 1H1YA 3WUFA 1UA7A 4MYAA 1J0JA 5T8GA 3WH8A 4OUEA 2HXUA 2DJLA 5A2BA 1LTDA 2XUCA 2DZWA 5CSRA 4B5UA 1JQXA 2H9AA 1FWJC 2WJZA 3JR2A 1KTNA 2D3NA 3HV8A 3W7CA 3WQ5A 2AL2B 1OX4B 1EF2A 3RO8A 1RCXB 2ATSA 3E2RA 3IJ7A 3MO7A 5G1TA 3L4WA 2I5IA 4KT2A 4P7LA 3FSTA 1HVXA 2E9MA 3UF9A 3AHZA 3W23A 3PS7A 3H53A 5A8QA 3ID7A 1R3RA 5FACA 3CZ8A 3N2XA 1U22A 3ZQ9A 5AYBA 3SO7A 2GLKA 2PD5A 3GSMA 4JHZA 2CLPA 3TYCA 3N2TA 4DNHA 3MJYA 3TKFA 4V1YA 1AJ0A 3UNTA 1QHZA 1J12A 3WDIA 1VFMA 4NZJA 3NL5A 1R9YA 4IMFA 1NVMA 2J27A 4EAMA 3EOSA 1JCYA 3SCTA 3SRFA 2GVEA 3LK6A 4FB7A 2WMKA 1JUEA 2VEMA 3VPLA 1EJXC 3SI9A 1OCQA 3RX4A 1E6SM 2OQYA 1ME9A 2XDFA 1B3VA 1PKYA 2PFHA 1GYMA 3COTA 4E4PA 1FHLA 1KB3A 1GOMA 3ZR6A 3VIPA 3N3MA 4PA8A 1ZUAX 1I9CB 4LPCA 3ITOA 4D6EA 2WMHA 4LUYA 2Z1BA 2GDVA 4PCSA 2E28A 4F66A 2A3EA 2QYGA 4TIMA 4UCGA 3QR0A 3GYEA 4E4UA 4URIA 1M03A 2WOQA 1KM2A 4X9YA 3CB8A 4W8AA 2PDPA 1UG6A 3MMTA 4C1NA 3G1AA 4H9MA 2Q8XA 4Z1DA 5ABFB 4D6GA 1V02E 2VUYA 1K9TA 4LWWA 1UB3A 2XGIA 4P7NA 3T42A 3U2CA 3W83A 1FH8A 4LU0A 1W1A1 1S2VA 3I7RA 4NUWA 3GVRA 2D2HA 2NQ9A 3WD2A 1SGJA 3FIGA 3O05A 4CVWA 1TX2A 1EOMA 3PWAA 2IQDA 1QPOA 4IGHA 4QRNA 1F8IA 7ENLA 3AMLA 3GHTA 4JGDA 3HM7A 3ITCA 1XFBA 1UR4A 4E8DA 4G1KA 3DDMA 1XRVA 3S6TA 5EFFA 4RW5A 1CGTA 2GDQA 4NZ5A 5A2CA 1NP0A 1SJAA 5D8WA 3IK4A 1JZ5A 1PCWA 1RY8A 4DO7A 4GQGA 3V35A 4GIYA 5D30A 1TVLA 3BJSA 2OT1A 5GQBA 4ZXLA 1VS1A 3ITTA 5DLCA 2X0HA 5K9XA 4AD0A 4A29A 2MNRA 1PX8A 1WNOA 2D2OA 1KGUA 2FHCA 4QDWA 1F76A 2QULA 3CT7A 3VCCA 3VABA 3ZFHA 1WXYA 3BW4A 2RKXA 2VVNA 1TA3B 2J7CA 5DX7A 5TAOA 4GGBA 1VRDA 2WCAA 1VBHA 4LUIA 1IR1A 4DBEA 5LA0A 2IPJA 3JRKA 1KM6A 4ATDA 5F2GA 5CZSA 2D2JA 3AAMA 4V27A 1I75A 2J74A 2BVTA 1XLCA 4L6OA 4DJFD 4WR3A 4JL2A 1P0EA 4D6HA 3TYEA 4GC3A 3I7SA 4TV5A 1RP9A 4JFTA 3G1HA 3WK2A 1E0XA 2AL2A 5AFDA 4ZCWA 1YDVA 4I3GA 5K4ZA 4M51A 3T0TA 4X3ZA 3B06A 4P8UA 4DO4A 2OX4A 1BYDA 2ONEA 1W5NA 2D23A 3P3BA 1VFSA 2J25A 4E3TA 5HUPA 4ZOCA 3DFQA 4AEOA 1W54A 4EXQA 4JYDA 4TO8A 1MEHA 3RNDA 4AG0A 1A5OC 3BG3A 3VDHA 4OHQA 3VX1A 4H4IA 4M82A 3W6LA 4BJHA 4N2YA 5JH2A 2NZLA 1ENUA 2WC4A 1GVOA 4GISA 4JCMA 3WMCA 5D9MA 1B4EA 3HQPA 2WNQA 1ZL1A 1H7NA 3RU6A 1UJPA 2QXWA 1FBAA 1SUXA 1GW1A 3UG8A 3LHTA 2PWGA 1RK6A 3BL3A 3C0JA 4CQBA 5GJNA 4BI7A 1LUCB 2FDSA 2FFIA 3UY7A 1ITQA 1WPCA 2DIKA 3GXTA 4YTSA 3W29A 3MDWA 2BWGA 1WUFA 5A69A 1PZ1A 4Y9AA 3USZA 3C61A 4UTKA 1ONEA 4OBTA 1WZMA 1B9ZA 2VX5A 3A9IA 3I7QA 1JCMP 3ARWA 1TR9A 2YL8A 2OELA 2CBUA 1EWEA 3QR3A 1RSCA 3BV7A 2VD9A 4JNZA 3AIBA 2R24A 5FF3A 1OZMA 4BZYA 2W63A 2EEXA 3G1DA 3EX1A 3TTEA 3II1A 1VJZA 2QV4A 5D9NA 4BCEA 1D7KA 5ABFA 4YVVA 3G5EA 2O92A 1S5WA 3WDQA 4XZ9A 5A6TC 3NQAA 2EBNA 4GUGA 3T40A 3L21A 4LBUA 4LVBA 4UIOA 1RHCA 2WPBA 4L1WA 2YCJA 3VXGA 3BUVA 1WQ5A 1Z6KA 1K8ZA 3GXFA 5G2IA 3PUGA 3W1AA 1H1NA 3K8LA 3UZJA 3GDLA 1BWLA 1QNPA 4YN5A 1BSLA 1TV7A 4BS0A 4OWGA 3S8HA 2VGIA 4XBKA 1JRBA 1BVWA 3AICA 2VEGA 1YDNA 3S3GA 1H7RA 2W0UA 3VU2A 3MBDA 1SFLA 3PBUA 2PB1A 3M0ZA 3MKKA 2YB4A 3V1HA 4BF7A 4N9CA 3CZEA 2WVVB 1GQKA 1TB3A 3KCOA 1IGWA 1TUFA 3MYOA 3VC5A 2GVYA 4QJ3B 3GR8A 1JCNA 2QT3A 4GUFA 4HBKA 1EJWC 3MI2A 5CC5A 1XGDA 4IQDA 1ZBVA 3C5QA 3LQLA 3H26A 1RQBA 1JUBA 2OMAA 2PPGA 3OIXA 4L9XA 4WGXA 2Z27A 4C7DA 1QR7A 1UIOA 1XGZA 5EMJA 3T1GA 3AC0A 3DG3A 3M6YA 4IM4A 1KD0A 1V3MA 1KCKA 4H1ZA 3ARSA 1TA3A 3ANYA 1EA9C 1L6WA 3EWCA 3V4BA 1HN1A 2XWEA 1EO5A 4AYGA 2H3BA 4XO6A 5K7JA 3GDRA 1NWRA 1OSEA 3CMGA 3EWBX 3BH4A 2J8TA 1UR2A 2ATMA 3BURA 2C91A 3BJTA 1K7FA 4GVIA 1C91A 1SM9A 3W85A 1U5VA 3E5PA 3WJYA 3CL7A 2VMFA 4DB7A 2W92A 5FD0A 1QASA 4XB3A 1A5UA 1E9LA 1ZY9A 4X0NA 2QW5A 1UZHA 4HSNA 3QKEA 3G1FA 3AIQA 1CWYA 3DHUA 2ZXDA 3NQGA 4MKNA 3QZAA 2J24A 1SPQA 1GOXA 4MG4A 1XXXA 1OFPA 2ODOA 1EYEA 4E2VA 4MB5A 3STEA 3WLRA 3P2VA 3PZVA 2DEPA 3K13A 1IEIA 1IGSA 3DC0A 4GKLA 4GUHA 4AYSA 3W7NA 4PUDA 4PMRA 3W00A 4DWSB 3LV5A 4LEFA 4J40A 1G4TA 3PM6A 4DEFA 3VIKA 3LS9A 5IBXC 2DP3A 4ERGA 1K4GA 3LYEA 1AW5A 4GUIA 3WLLA 7REQA 1OINA 1TRDA 3GDMA 4H83A 3LCIA 2X7WA 5I02A 4QTGA 4Z2GA 1EC8A 4ZQCA 1NP2A 2BBFA 3KVKA 3GTNA 5EMUA 3GX9A 2BNJA 1ITCA 4OOZA 1FCBA 3ABOA 4I6KA 3DFSA 1XDLA 5DY3A 4MY8A 1LUCA 2EQDA 2J7FA 3HB9A 4RZ4A 3LNMA 3GK0A 3HBLA 3GTIA 5BXTA 4ADTA 4UNKA 3WKZA 2JGQA 2ZXQA 2IXVA 5A6MA 3NQBA 1H49A 4ICNA 3BAYA 1L8PA 2QCGA 3DESA 2A21A 3TXVA 4LB4A 4PZVA 3LCFA 1YNQA 4GFSA 1E9IA 1QPNA 4L4MA 3WBAA 2PP1A 4IPLA 1V02A 1IEVA 4O0KA 4HTYA 1GG0A 1WO2A 1S2AA 2V67A 2Y5JA 2GUUA 1L6SA 5C9XA 1MSSA 1TZ7A 2PDBA 1DKWA 1ONRA 4Y9MA 1S39A 4R9OA 1RPKA 2ZC1A 4HNUA 3QXBA 3H55A 1QUMA 1R85A 3KVMA 4O14A 3LTPA 3AJ7A 4AZHA 3ALFA 3UW6A 5JH1A 3H24A 3BMWA 1H2JA 3W1LA 4F9JA 1E6XM 1MQPA 4DPPA 2VYOA 2CKRA 1CDGA 3G2GA 2GPTA 1NFPA 3ZO9A 5HNRA 1F05A 3KCLA 1VJIA 4W4QA 2CU0A 3H4WA 5F4SA 1DTUA 3VD3A 2WAGA 2H8XA 5FEXA 1TWZA 2EG7A 1XYFA 3L4YA 3GW0A 2ZUSA 3FA3A 4WOZA 4C5YA 4IQEA 4ZXOA 1A5CA 2WLYA 2C14A 4DJEC 2WV8A 4F0KA 1UR1A 2QPXA 5M2FX 4LUTA 2WVVA 2WYSA 1N8FA 1DWFM 1PX4A 3GZ3A 1Q3NA 4JN8A 1F3WA 3RITA 4HJFA 2Z1SA 1M68A 3QR1A 3KLKA 4UTUA 3W6MA 3LRKA 1H11A 3E0WA 1VRXA 3O9NA 5IHSA 4CEUC 1WDWA 4X61A 4JS3A 1E6PA 1E56A 1XIDA 3AALA 3AOFA 2HROA 5AY7A 2V30A 4Y8FA 3UXIA 4J3VA 2YCKX 3WLMA 4LV4A 3PZIA 1OM0A 3KRSA 1TIWA 2E5DA 2PI6A 1RVKA 1IZKA 3BG9A 1OFBA 4LCSA 1TE1A 3QV9A 3W2UA 2PDJA 3PC0A 1VBJA 4E2OA 3W7MA 2EJAA 4O8AA 4B5SA 3M1ZA 4GY7A 2AMXA 3IANA 2XINA 2JKPA 2DIEA 3KRBA 4Q4RA 2FZDA 4ZO9A 3KHJA 5LXEA 1J5SA 3VDAA 2Y4SA 2AKMA 4IX2A 4LYQA 5D32A 4QS5A 4PRTA 4GNVA 4KF1A 4AAJA 3LLXA 2G4FA 1SR0A 2ZX5A 4K3ZA 4YYCA 4N7QA 3PUDA 1D7FA 3SCPA 3GD6A 3K30A 4A3RA 1WDSA 2EAWA 1Z89A 1JPIA 4PE8A 3G24A 3R8HA 5CSUA 1YNPA 4WDWA 3WF0A 3ZJKA 4AW7A 3CZKA 2QCNA 3H2OA 3SN4A 4QCFA 2ISDA 2ISSA 2YB1A 3ENLA 5C2XA 3MUXA 2E40A 3ZR4A 4M8UA 1QMLA 4O10A 5AOUA 3WD1A 3QPZA 1J96A 3BGAA 4UTTA 3NPXA 3GB6A 4CD4A 2C1GA 1HW6A 1HKIA 1E9YB 3AIRA 1X6NA 2XN2A 4IMGA 4G9PA 2GSHA 3SUUA 3TW9A 3WQWA 2KZHA 2JK2A 1M7JA 5D03A 3LQGA 3RM4A 1OFQA 5LZLA 3BC9A 3AS3A 1UKPA 1XV8A 1JZ6A 1YTKA 4YYFA 4PRRA 4DJFC 3WD3A 3IJ6A 2HPMA 1GJUA 2XH0A 4K7YA 4S3KA 2X40A 1EHAA 2NSXA 3PB0A 1DXFA 3LPGA 4XQ6A 4PMZA 1FQ0A 1NIUA 4CCDA 5A6KA 2A3BA 2G3IA 4Q22A 1SJCA 1KM3A 3M4HA 4PR4A 5EKYA 1HP4A 3R11A 2XIOA 2GJNA 4J2PA 3JZUA 3M0LA 3QOKA 1W9XA 1CX9A 3VO0A 4M19A 4IJCA 3R43A 3DGRA 3BWWA 2QMKA 4BEUA 2VDIA 1JYXA 5H8MA 2GUBA 5TD4A 1R7AA 3U2EA 4NYYA 2Y89A 1RVGA 4CNUA 3BK0A 4H9TA 4CLMA 1XDJA 4H8UA 4LNYA 1KBLA 2TYSA 5PTDA 1WAUA 4LFYA 5FJPA 1US0A 4J28A 3WMBA 1HKKA 1MFVA 2R1MA 1V79A 1R3YA 3VGHA 3S1GA 3RK8A 1QU4A 1R3SA 3BLFA 3FS2A 3LTSA 2QKFA 2QIWA 2V5BA 2YA1A 1BXBA 1QI3A 1PXGA 4C6BA 1DJHA 3NO1A 4S3AA 1PIFA 3UBPC 4J3TA 3SQLA 4LBRA 4IIDA 2DH2A 4KWOA 1LJYA 4IIGA 3UJFA 1XF0A 3K4WA 5DXXA 1KRAC 2J62A 3POCA 1CI1A 4MWAE 2CITA 3WLPA 2OO0A 3KZPA 3W4RA 1U5HA 1DQWA 1JRCA 3VNMA 3EEZA 3SR7A 2A85A 1H4PA 4M29A 3TN5A 2CESA 4XIAA 2PMQA 5C71A 4R7OA 2QV5A 4D9PA 1UWSA 2D24A 4UTJA 3EA1A 4NSBA 5EGRA 4FALA 4MOZA 3RLGA 1DJIA 2HVMA 1W3HA 3B4UA 4KBXA 5XINA 5AHLA 1XSKA 1ZP3A 3W9ZA 3WNKA 4H9XA 1EOKA 1PKLA 3U0HA 3U8GA 3I6TA 1GTHA 4F0RA 3UR8A 4HPJA 4O11A 4UOZA 1Z69A 1KCZA 2Y8VA 3MS8A 1CEOA 1Z48A 3E96A 4O1CA 3TW7A 4OKDA 4QLKA 2OWCA 1IR2A 3QGVA 1JYWA 3VMNA 1ISZA 3VGBA 1I45A 3GYCA 1GVFA 1ICQA 3KRZA 2Y2WA 3BG5A 2V9DA 2CBIA 3PY2A 1XYLA 2NW0A 5ENLA 1JZ2A 1IEWA 4GXMA 4WUIA 1KBJA 3GDBA 4CQDA 1GORA 3CHFA 4LTSA 1Q2RA 1ISVA 4Z2HA 3KVLA 1O66A 2G3JA 2J7HA 2V8ZA 1YQ2A 3R0UA 3GU9A 2FKPA 3LHYA 3CQIA 1G0CA 4U33A 4D2JA 3GHUA 4X63A 1XYCA 1RAKA 3PFMA 2VCBA 4UQ9A 3DCPA 5DY2A 3VCRA 1PYMA 3L68A 4IGNA 2VZOA 4HHPA 1QPRA 2VZUA 2A7PA 3RN6A 1DVJA 4O54A 1Y8BA 1JGMA 4TUFA 4PULA 4CNTA 1EZWA 5A8NA 1J9YA 3U48A 2EG6A 1X38A 1IT0A 1PBGA 1TKKA 1WX0A 3LPPA 4IPNB 1LWIA 5B80A 2Z00A 1QK0A 3R1ZA 2QDHA 1K9EA 1CGWA 4OTKA 1HKJA 4OUIA 4Q8OA 3GC5A 2ZWZA 4AVOA 1XH0A 4QR6A 5B7ZA 1FWNA 4QE5A 1W3JA 5E93A 4ZB2A 2D0HA 5CH9A 2QF8A 2BHYA 1TV8A 2YYUA 4AQLA 1MRAA 3EPMA 4FLQA 4GVGA 5H6HA 4H01A 1HL8A 3OZPA 1VBRA 4GZIA 3OQEA 1CENA 1RUSA 4PUUA 4LW7A 3WLTA 4GZ7A 1KBBA 3CZJA 3R79A 5E6ZA 3LSCA 3U57A 3D5HA 2I5QA 3O8AA 4IIEA 3BGJA 3IWPA 4JXCA 1DQUA 4O53A 1Q6CA 5F2LA 4X9SA 2OSYA 1H7XA 4FIRA 1Q6GA 5I7GA 2OZ0A 3EMCA 3T9PA 1SMDA 2P0IA 2QHAA 3LHUA 3GC4A 4BWLA 1O12A 4HGXA 6ENLA 3R5EA 3E3HA 3GFXA 4PEKA 5CKSA 1X98A 3KOXA 2XVLA 4BY3A 3L2LA 3AHTA 4WVXA 5CJ5A 2IPFA 1VBGA 2C1IA 3VI2A 2AQWA 2J7DA 4QG8A 3L67A 1O94A 3PULA 4UFMA 4KS0A 3PPGA 2QGYA 3H7VA 3NQ6A 2ZZ4A 4RDWA 1QHPA 3T44A 3GNNA 3MZNA 4MWAB 1W1B1 2EKCA 5DO8A 3RM9A 1K9DA 1RP8A 3W2KA 3QOMA 1ZJBA 4CKQA 2UZ9A 3G1RA 3LA4A 3IUHA 1O4UA 1B31A 4GVHA 5E0CA 3LGDA 1VR6A 3TYBA 3IV3A 2ZOXA 6CGTA 5CBBA 3GH5A 1TPFA 5HNUA 4DF2A 3LCXA 1QBBA 1L2UA 1L9WA 3LU2A 5BMXA 4TX6A 5C7HA 2HBVA 3KOWA 1J2BA 1H0GA 4FX6M 1MDLA 5EL1A 2PGFA 5E70A 3OTRA 4CU8A 2B7PA 3LXAA 3CL8A 3UG5A 1V6UA 1YE6A 1WKYA 4GBUA 2OEKA 3EDFA 3O6DA 4FSAA 1B57A 1XIMA 1YXYA 2WKJA 2AAAA 1XCWA 3HOJA 4HNTA 2I9UA 1MZHA 1LWJA 5HMDA 2V82A 3LGEA 1PE1A 3S1XA 3DYMA 2CLFA 2ZRYA 4IL0A 2O55A 2PEVA 1IZCA 4JQ3A 1A80A 3WEZA 4CEXC 3PBYA 3UVIA 3MHUA 4F48A 1KKOA 3UGRA 4L6HA 4WOQA 3WQ6A 4AEEA 5FIPA 3ARYA 5EBUA 2RDXA 4Z1AA 3BMXA 3GTFA 1VFFA 1ML1A 2X1IA 3VDCA 2WC7A 2F9RA 6PTDA 1OFAA 4GJJA 2ZZ6A 3JUGA 3N6QA 1DIOA 4US5A 1SSDA 3GH4A 1E4NA 1P1XA 4K38A 2WHLA 4CU6A 2DSWA 4C6EA 2QDDA 2DZBA 1XICA 1Q4NX 4UQDA 4KRZA 2ON3A 4X0VA 2V81A 2NX1A 2BS9A 3ES8A 1CXEA 2TPSA 1JQVA 3M7WA 3DXIA 3N2MA 4EP8C