3UZZA

Crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with nadp+ and delta4-androstenedione
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIHVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of Human Steroid 5beta-Reductase (AKR1D1) into 3β-Hydroxysteroid Dehydrogenase by Single Point Mutation E120H: EXAMPLE OF PERFECT ENZYME ENGINEERING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
total genus 113
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3uzzA00
2CLPA 5AZ0A 1HQTA 2PEVA 3R6IA 2BP1A 3RX4A 1RALA 5HNUA 3CASA 2VDGA 2I16A 3GHSA 2PDGA 4G5DA 4JQ4A 3RX3A 3UZZA 4XZMX 4MHBA 1IHIA 2AGTA 4YVVA 2P5NA 4YVXA 2PDFA 1PZ1A 4JTCA 3N6QA 5JH2A 1Z8AA 4PUWA 5LIXX 1SM9A 5AZ1A 3CMFA 2IKGA 2PD5A 1M9HA 2NVCA 2PFHA 4GCAA 1UR3M 3LZ3A 2PDNA 3O0KA 5DANA 2ISFA 2PDPA 3M0IA 4YVPA 3FX4A 2PDXA 3GHUA 2ACSA 4I5XA 3U2CA 4WDTA 5M2FX 4R9OA 4GQGA 3ONBA 4DBSA 4JIIX 3ONCA 4LB3A 3WG6A 3LQGA 1AH3A 4XK2A 2PDKA 3R58A 4YS1A 4Q7BA 2DUZA 5HA7A 1EL3A 2R9RA 2BGQA 4PR4A 3UGRA 3LNMA 1X97A 2PZNA 2R24A 1S2AA 3G1RA 1YNPA 4JQAA 4ASTA 4LBRA 1ZGDA 4EXAA 4WDUA 1X96A 2PDLA 2PDCA 4PRRA 2F38A 3F7JA 3R43A 1Z9AA 3C3UA 3CAQA 3VXGA 4GA8A 2FGBA 1OG6A 3CV6A 3N2TA 3WBWA 4HBKA 4GIEA 3BCJA 3LUTA 1LQAA 2PDMA 4LAZA 1X98A 1RY8A 1ZUAX 3P2VA 2J8TA 3H7RA 4FAMA 3V0TA 5LIUX 2ACRA 2IKJA 4DBUA 1FRBA 4PUUA 3LBOA 4WDXA 3Q67A 1PZ0A 2DV0A 1EXBA 2ACQA 4FALA 1MI3A 2IKIA 3UZWA 2BGSA 1PWMA 1Z89A 1EF3A 1YE4A 3DN5A 4XVEA 2QXWA 3EB4A 3LEPA 3Q65A 2FVLA 2PDHA 1S1PA 2HE8A 4DBWA 3LENA 4EXBA 4QXIA 1ADSA 3LZ5A 2FZ9A 2HE5A 4FA3A 2WZMA 3GHRA 4HMNA 4H7CA 4LAUA 3CV7A 2C91A 3M4HA 2DUXA 3KRBA 2IPJA 4IJRA 3T42A 2INEA 4XZLX 4YU1A 3H7UA 4LBSA 4RPQA 4F40A 4WRHA 3BURA 2HVOA 2F2KA 1Q13A 3EAUA 2HEJA 1ZQ5A 1AZ2A 3H4GA 3UZYA 4PMJA 4JTDA 2FZBA 1R38A 2HDJA 2IQ0A 1AH4A 3EB3A 3D3FA 1VBJA 3UYIA 1MZRA 1C9WA 3UFYA 5KETA 4GQ0A 4IJCA 1S2CA 4XO7A 3FJNA 2FZDA 4IGSA 3UG8A 2PD9A 2PDBA 1VP5A 3UZXA 1JEZA 4JTQA 4WGHA 4XAPA 1AH0A 1XJBA 1YNQA 3WCZA 2FZ8A 5JH1A 4DZ5A 3WBYA 3MB9A 4JIRA 3NTYA 2IPGA 4ICCX 4QR6A 4XZHA 2I17A 4XZIA 2INZA 4QBXA 3R8GA 1PYFA 2PF8A 4XZNX 3V0SA 3ERPA 3LN3A 4JQ2A 1T40A 2HVNA 1AZ1A 2ALRA 4WEVX 3V36A 3UWEA 3R94A 1J96A 3R8HA 4JTAA 5HNTA 3BUVA 3BV7A 4JTRA 4XVDA 1Q5MA 1LWIA 1XF0A 1XGDA 2A79A 2PDIA 1YE6A 2WZTA 1QWKA 1MRQA 3COTA 2PDYA 1RY0A 1A80A 1Z3NA 3V35A 1S1RA 4Q3MA 2IPFA 4GACA 2IS7A 4OTKA 4GABA 3LD5A 1T41A 3WBXA 1K8CA 3RX2A 2HV5A 3GUGA 3GHTA 4ZFCA 4JIHA 3B3DA 3CAVA 5LIKX 4QX4A 3S3GA 2NVDA 5LIWX 4JQ3A 1US0A 4WDWA 5LIYX 2IQDA 3QKZA 4H8NA 1IEIA 4AUBA 2PDJA 3O3RA 3UP8A 3MC5A 1GVEA 4XO6A 3M64A 1PWLA 4FZIA 5C7HA 4NKCA 1HW6A 4LB4A 2ACUA 4JQ1A 1QRQA 3R7MA 2PDUA 2IPWA 3V0UA 1EKOA 3G5EA 4L1WA 1ZSXA 4L1XA 4PRTA 2PDWA 3DOPA 2IKHA 3LQLA 1AFSA 2PDQA
chains in the Genus database with same CATH superfamily
5IOBA 3AXXA 4HNUA 1CNVA 3FIGA 3W38A 3WQOA 3S9ZA 5HMDA 2QDHA 3APGA 2BDQA 3NO3A 4M7SA 4C1LA 1TR9A 3TTEA 3UG5A 5D9NA 3S5YA 4KQNA 1BG9A 4J2MA 3EB2A 3W7QA 5FF0A 3TEVA 3A21A 4MKVA 1EGZA 4F0HA 1NQ6A 1PZ1A 3KXQA 3G77A 1QTWA 3RLGA 3RHGA 1R7OA 3LPPA 1WKEA 1G4EA 2YBUA 4KCTA 4RKAA 5EMKA 4YTQA 1QNRA 9RUBA 3GVGA 2J7BA 3FAWA 3GZAA 1EYWA 3GXIA 1V0LA 3G1DA 1ZAIA 2PDNA 2KX9A 3NZPA 4FXRA 1PL9A 3NEVA 2ZZ4A 5CGMA 2VEFA 4RXFA 4AD1A 4UFIA 3E96A 4NRRA 3W7RA 4BF7A 3EOSA 3CZGA 3OIXA 4UZSA 1GZGA 1KBLA 1J18A 2Y88A 3L65A 4GKTA 4AZ7A 4DIAA 3DC8A 1FHDA 3ONBA 4Q8TA 1LG2A 2QJHA 2PCQA 2P1FA 3VMOA 4DI8A 3N2CA 4XK2A 4MB3A 5CZKA 2XVGA 1GHSA 3K46A 4EP8C 2BGQA 3QBUA 5BXTA 4US5A 3VKAA 4AWUA 3QR3A 3F5LA 3FN9A 1ZGDA 4LS1A 2PDLA 4HA4A 4L6OA 3HJZA 1PXGA 3TP4A 5A8QA 3MUZ1 2Y7GA 3S1GA 3STPA 4HMEA 1WUEA 1JDEA 5A1AA 1PE1A 2RUSA 1SO5A 4L4PA 1Q63A 3N2TA 4AFYA 4GLEA 4GIEA 5EFFA 4K8HA 1F07A 3C2YA 2YL9A 2JEPA 4L9XA 4PCSA 4WKFA 3A23A 3RRXA 1AA1B 5TQLA 3GKFA 4GH3A 4IZGA 4UXDA 1D3GA 4GXWA 1VFLA 1AJZA 1SW0A 3KOYA 3WSUA 2G3IA 1PZ2A 1F3XA 4PCPA 3O6YX 1UG6A 4ZQPA 1EB3A 4UZUA 5DLCA 2YXXA 1PWMA 3RMEA 4LEFA 1T99A 3LV6A 3PS7A 1L6FA 3ANVA 4W84A 2BX7A 4EXBA 1NP2A 1R86A 2E77A 4CLMA 1WQ5A 1UROA 2OCZA 3WFAA 3MV01 4NX5A 1BWVA 2AMGA 5T8GA 2WVTA 3WLTA 4EPKA 3TSDA 1TPUA 2P8CA 1MQRA 3WDIA 1ISWA 1KFWA 1UD2A 3B8TA 3A22A 3NOYA 1RQEA 3AIBA 2DUXA 1C92A 3A5VA 1B4KA 2WHJA 4ZEPA 2X09A 3V1HA 5A3HA 3RYSA 1PCKA 3UY7A 2Z28A 1WXYA 5LA2A 3W37A 4H6KA 1VJSA 4IG2A 4X0NA 1U1HA 3UF9A 4XSMA 4B5XA 2QYGA 5HR7A 3MY9A 4JTHA 1MW0A 2VHLA 3CO4A 1N8WA 2CLIA 1XYAA 3GG7A 4IFKA 4FNTA 4YMZA 1VH7A 3QPEA 1YPXA 2H90A 3CIVA 4IUGA 1OIMA 3M7SA 3D3FA 5D02A 1CCWB 3W7GA 3W7LA 4F2UA 1XIIA 2ZE0A 3QQWA 4V1YA 3W70A 2JKEA 3WD0A 2BBFA 2DPEA 2EXOA 3KL0A 4S23A 4AZGA 4B9ZA 2OFJA 3MUAA 4PMVA 1XYMA 3C2OA 1YNQA 1WZMA 5C9ZA 1XIHA 1Z42A 3GH4A 3W88A 3WBYA 5CH9A 1P4CA 4PFMA 1EBGA 4RE4A 4DWSC 1I1XA 2IPGA 2X40A 4ICCX 4XKYB 3UR2A 4HU0A 3UR8A 3JVAA 3VIJA 2NQLA 1JQXA 3BMXA 3WJSA 3V0SA 1B90A 4H19A 1KA9F 1Q7MA 4WR3A 5G4WA 1U5HA 1OFOA 2ICSA 5KSWA 1F6KA 1JUEA 4JTSA 3VDCA 4JTAA 4M80A 1R46A 4UQDA 5DCDA 1E1EA 1C7SA 3UG4A 2FGZA 3MUIA 3U7VA 4MG4A 2PGEA 4JICA 4W7VA 4W5UA 4ONVA 4KBXA 1FWWA 3COTA 2FMNA 3TJIA 4Y9NA 3PVFA 4HSOA 4CNPA 5BXPA 1A80A 1XDMA 1X6UA 1Z3NA 3SUUA 4FX8A 4O54A 4AXKA 1DXIA 4NUWA 3L4VA 1T41A 4GISA 1K7EA 1QPOA 2EG8A 2X30A 3WH5A 1VF8A 1XGEA 2Y7FA 3W29A 1RJPA 1X8FA 4Q8WA 1XD1A 1RCQA 4CGTA 1JIBA 1R2RA 4PUNA 2QMJA 1KCLA 4HNCA 1E6SM 1TPC1 1D8CA 2ALDA 3LHYA 3MO7A 3CZLA 3QSRA 3T81A 4XO6A 1UASA 3LCWA 3ZSSA 3DHUA 2D22A 4LYQA 4NKCA 2E68A 1HJWA 1LBFA 4GVGA 2A0NA 5HMEA 1K6WA 1J0YA 3G5EA 2UV8G 1ZSXA 4W7UA 4GINA 4L1XA 3UPWA 3HZ3A 2HJPA 3OEXA 3PZIA 3P0WA 2IKHA 3BOFA 1DJIA 3MPGA 2VEPA 1O95A 5BU6A 2CLPA 4ROPA 3EDFA 7ENLA 5FD0A 3VCNA 1HG3A 5C0QA 2A3AA 2PBOA 4GYFA 1XH0A 3GDLA 3H22A 1OK6A 1VHCA 4MFEA 4GIAA 3VDAA 5HNUA 1FCVA 2GVLA 4JTJA 3PPHA 3IJIA 1KV8A 1ZFJA 3UVAA 3LGDA 2DDXA 1F74A 1J2WA 1OINA 1DWAM 4MHBA 1GVRA 2QT3A 2XUCA 1F76A 1GVSA 4QEHA 4LNCA 1ITUA 1VJZA 2V2HA 1UW9A 1BXBA 5HANA 3MHUA 1DEDA 1NAL1 3KL3A 3U4FA 3WUEA 2DJXA 4QEEA 1I4NA 3PZQA 3TCSA 2FIQA 1EZWA 4GQRA 1FA2A 1RD5A 4GQBA 2GJRA 3WDPP 3C2FA 1NDWA 1RK6A 3M5XA 3GTXA 1LQ0A 3H8AA 2CERA 2ZX9A 3PBMA 3R89A 3FX4A 3MMUA 1Q3NA 1GONA 4LTSA 3S5ZA 1UP0A 3DBPA 4LUTB 1ICQA 3ONCA 4HMCA 4AEFA 1Q85A 3FK4A 5T9CE 3O07A 2J7DA 3T0BA 1POKA 1PTDA 3BOXA 2ZRUA 4KIRA 2DSKA 4RE3A 4UTLA 5CPQA 2D20A 3VABA 3TZFA 4MGGA 3LTYA 3WJXA 2FFIA 2DZBA 1LLWA 1ZPTA 2ZA3A 3GAYA 4WX2A 3VOHA 1W9PA 5L6UA 1JZ8A 3OODA 3CBWA 3QLLA 5MKGB 3NL5A 3BANA 4XX6A 3HBLA 1KBBA 2FMOA 3SB0A 3S2LA 1DYSA 3H2MA 3MANA 1JPIA 3FS2A 2G4FA 3WLSA 1AL7A 2VX6A 4DWDA 1Z6KA 2Z4GA 2VJXA 1M7JA 4LUSB 2X1IA 3K8KA 2Z2UA 3I6TA 2OWCA 4MAZA 1UUOA 3UWZA 5CZTA 3MU7A 1L8NA 4PUUA 3DFPA 1GYLA 3N4AA 3B8WA 4UOJA 1ZJHA 4YTTA 1NY1A 3KBMA 3T8QA 1VRXA 4QS5A 1NQKA 3CC1A 3S47A 4CCZA 2CXGA 1K4HA 4MOZA 1NFPA 1OFDA 2PF0A 2QCMA 2RAGA 4O8AA 5C9XA 1IXPA 1R3RA 3GD6A 3CZEA 1ODUA 4LALA 1UD4A 1T6MA 1HGWA 1DWGM 1PKNA 4KKXA 1UR2A 7TIMA 3NPVA 1XLBA 3EWYA 3I4EA 1BF6A 3E49A 3BQ6A 1OADA 3PPFA 3NQCA 5H2ZA 2E6FA 1YXDA 2WO5A 3LK6A 3NIYA 4LQ1A 8XIMA 3QY7A 1GG1A 2VFHA 4J7RA 2F2KA 4QSFA 2NW0A 3QMRA 3OU8A 3WQEA 1A49A 2FLIA 3WFZA 1WYIA 3NAVA 4DM1A 3U6WA 5F4SA 5GJPA 3UW6A 3TAOA 4DUWA 3II1A 5BROA 1JZ2A 4CNUA 4G9PA 2PP0A 3QPZA 2VOTA 2J75A 3MTWA 1QASA 1XH1A 2BHZA 3WDQA 3GTNA 2PLCA 3W1MA 5HNRA 8TIMA 4I9JA 1EOKA 4KFNA 1FWGC 1XV8A 5D8WA 3VM5A 4H04A 1KO0A 1SO6A 4GQ0A 1A50A 2DZUA 3L5LA 5LNWA 4XO7A 4PGLA 4IL0A 4IISA 3B8UA 3CIWA 1VP5A 2C7FA 1NARA 5TD4A 1FWTA 2E7FA 5D2WA 5EMYA 4EPEC 2QDGA 3E0WA 1RVGA 5DMYA 4HPNA 3WQVA 1W1YA 1R3WA 3IUDA 3U0HA 1F5ZA 2EKGA 3VCRA 3CUGA 4QR6A 3KTXA 3FNDA 2V30A 1MEHA 5DN1A 2OJPA 4L9YA 1A5MC 5FJOA 3EX6A 5GPRA 1MUMA 2QS8A 3R8HA 3CEPA 4ZO6A 5HNTA 2JE8A 4GYJA 5C2GA 4ZTXA 3V5OA 4O52A 4N6EA 3AS3A 3M16A 4MFDA 3THAA 3QR1A 2PC4A 2JIWA 1EXPA 1QBAA 4LCRA 1LRTA 1VFSA 2WZTA 2X7VA 1X6NA 3M0JA 3OVRA 1ML1A 1HUVA 1S1RA 1WV2A 2XVPA 2VGGA 4MIMA 4PEKA 1DWFM 4D9PA 1P0NA 1QOPA 3A9IA 2BXYA 2VYOA 4H9TA 3GUGA 1XRVA 3INPA 1J0IA 1C9DA 2HK1A 3O16A 2QLYA 4LUJA 3MSDA 1DQUA 1E1CA 3S5NA 3VIKA 3BZJA 2Y63A 4K68A 3QV9A 1V8EA 3WLHA 3E2RA 3ARTA 2BWGA 2J47A 3O8AA 2DZVA 5JXQA 3VOGA 1IIHA 2WCSA 1BXNA 4FSAA 2PURA 2PWVA 3CQIA 3YPIA 4JN8A 1K9TA 3BMVA 5G2WA 3M64A 2CKRA 1HIZA 4FZIA 5DMMA 1RJRA 4JR5A 4PL1A 1A5BA 4DN1A 4JTLA 3MUCA 3U5UA 4KW2A 1Q6GA 3SCTA 3OO2A 4C6QA 1E1CB 5GJMA 1E71M 3PB0A 4Q4SA 3UJRA 2PDUA 3NM3A 4G1KA 4IP7A 4FF5A 2OZ0A 3GIQA 2VI0A 3RU8X 4AF0B 3VNLA 4LSBA 4O11A 3BJSA 4J3TA 4PRTA 3PHAA 2VMFA 3IV8A 4F4RA 1A5CA 3ZR6A 5I03A 4MZYA 3ZWTA 3FLUA 4ZOCA 3ITLA 3AXKA 1XBXA 3HM7A 4GBDA 2OQHA 1X1ZA 5ENLA 1TV5A 2D2JA 3VZXA 1O5KA 4OBSA 2IQTA 1J9YA 1XC4A 4NRSA 1M03A 4NZCA 3TQKA 4LX4A 3SCRA 1E40A 2OKTA 4G7EB 4JQ4A 1KXHA 4NX0A 5BNKA 1LBLA 4DY1A 2CLMA 4GZJA 3S5OA 3KZPA 4ADUA 4TMBA 3GVQA 4PULA 2EPLX 3EEZA 2P10A 1UYQA 1TYGA 1CWYA 1S38A 3DECA 2ZXAA 3UR5A 2F84A 1UR0A 2O7QA 4EVZA 1NWRA 3R2GA 1OGSA 3EDKA 1E9ZB 2WPBA 3CL6A 1JD7A 2GOKA 5JQ9A 2VTFA 1TZ9A 1WUFA 4HCLA 1PIIA 1TJ0A 1QNOA 2EKCA 3M0IA 2QJMA 5A2BA 2UY5A 3LRLA 3PTQA 5ABFB 3W24A 3LPGA 3VIIA 2ZRWA 4U4MA 2G5WA 2IMRA 1TB3A 4Q6JA 2CLOA 5DFAA 3VINA 3MZ2A 1V5XA 2WHKA 4V2XA 4AZBA 1QNSA 5AC6A 3R11A 1K9DA 4PB5A 1HP5A 6CGTA 4WK9A 2QCFA 2HMCA 1KLYA 1RD6A 4H9VA 4WKAA 3G1RA 3SQSA 1KR1A 5FL0A 1JFXA 2WCGA 2NWRA 1V3MA 3E5PA 5LYRA 1ZAHA 4Q4PA 3C61A 4PMYA 1YTDA 1FX6A 2FGBA 3CO8A 4K38A 5ABEA 5FF7A 2D23A 2P0OA 5BZAA 4GGBA 1OZMA 3LUTA 4LPCA 3VM7A 3BC9A 2HSAA 4C6OA 1O94A 3R0KA 1ECQA 3UWYA 1V6UA 1REQA 1ZJIA 3TZNA 3SZ8A 4FK9A 4XIMA 3L5AA 4EXQA 4HHHA 3WMBA 4FAMA 1H09A 4QP0A 1B3WA 1HVQA 2ACRA 3OB8A 1F05A 3M6DA 3VGFA 4ZXLA 3SUSA 2SFPA 3KAOA 3ZVIA 1XYFA 1FWEC 3GG8A 4ICMA 5IFTA 1P0DA 1SZFA 3OLGA 3B97A 3IK2A 3R0UA 5AB3A 3WEMA 2O4QA 4Z2KA 1FTXA 1S1PA 1V51A 4NJKA 3SY1A 2VX4A 4LS0A 4AC1X 5RUBA 4DWSD 2CC0A 3RPMA 3TR9A 5CBBA 1O5QA 3AAMA 2DVTA 3BO9A 2ZVIA 2QCHA 3IJ6A 5C55A 4IXXA 4M6QA 3RITA 1OABA 2C19A 4OQVA 3PZGA 1XLAA 3THCA 4XB3A 2C91A 2WQPA 1I2PA 1LTDA 2ON3A 4CN1A 2WJZA 4UNIA 5C71A 3T6CA 2DT1A 4XZLX 2V67A 5E9XA 1WOBA 3WQ5A 5KINA 4IH3A 5LNSA 3VU2A 2D73A 4H41A 4N42A 1CX9A 3W22A 1AG1O 3CU2A 3DGRA 2CKSA 2BHYA 4JX5A 1R9XA 3WNPA 3PAJA 3E2QA 4DXVA 1YTEA 4DQWA 5G1MA 3QYSA 3PP7A 1G4PA 2J8FA 4M19A 1AQFA 3TYCA 4AEEA 2VL4A 1UWAA 2J4GA 2O0TA 3T4WA 6ENLA 5EU9A 1M7OA 1W1IE 4AB4A 4DZHA 1EH9A 3FJNA 3N2XA 2HBXA 4Q8NA 4Z2IA 1U2YA 5TIMA 4DNMA 4TVCA 3W7HA 2Y62A 3TC6A 4CD5A 2H8ZA 3NR0A 2QIIA 1G7UA 3W1UA 3BG9A 2J6VA 3G2GA 3O15A 3MB9A 1V3JA 3PWAA 3H53A 1G0CA 2G96A 4PMOA 2V82A 1A5LC 1ZU8A 2YL5A 3V18A 3ISIX 1UWSA 2WK2A 4Q8QA 2QCDB 4XZNX 4FS9A 2NUXA 3LPOA 1B31A 1IQ8A 1CIUA 1H7NA 2OGYA 5A6MA 2QHAA 3TLQA 4OJYA 3VFLA 3PTDA 4Z2HA 1B4EA 1B3VA 3A4XA 3QHMA 3W73A 4MDPA 4GCXA 1RBOB 2AL2B 2F7FA 1WKFA 2B7PA 4M51A 3KVJA 1RA5A 2R8WA 1CLXA 5REQA 1ZHAA 2Z27A 4H8VA 3QQ1A 2J25A 3W6YA 4D71A 3ZLHA 3VDBA 3ABQA 2L5HA 1OJXA 3SADA 1TE1A 3P84A 1W56A 2PWGA 3QRHA 4MADA 3DFSA 1W6TA 2ATSA 2A3HA 3WH8A 1XYZA 1JUBA 3MBFA 5AHMA 5I06A 1N82A 2YLAA 4ZFCA 1OC7A 3B3DA 1XPGA 2PGRA 1PTGA 2OO0A 2OLHA 2VFGA 2NVDA 3BZGA 2DZPA 3WLRA 1NWUA 9XIMA 3AOFA 1A0CA 5TAOA 4PMRA 5A6KA 2PDJA 1HO4A 3LU2A 1AW5A 3W75A 1LOQA 4L4LA 5I3HA 3P7YA 1YYAA 3EYPA 9CGTA 2J24A 3NQBA 3EWBX 3VAVA 4J9JA 4ZQMA 3WD4A 4R5EA 3REQB 4GJ1A 5JVLA 3DENA 4LV9A 3RIKA 3MHGA 3FA3A 5ECVA 1Q6CA 2CZEA 2J9ZA 2V2DA 4GC4A 4V27A 2G97A 2CLHA 2VRJA 3WJZA 4M82A 1PDYA 1KWGA 3QPYA 3VMNA 3UJ2A 4PZVA 4CD6A 3G3DA 4F0KA 1BVZA 4F0SA 2FHCA 5CJ5A 2GGJA 2WAGA 2BP1A 1FKXA 1HJXA 2AKMA 3M0VA 2DZAA 5HPOA 1DJNA 2WXDM 5A6SA 2ZX7A 2PWHA 1A5AA 3NGJA 3GBDA 2Y85A 4MWAE 4AWEA 3WQGA 1FH7A 1IWBA 2VVNA 5GNXA 1H63A 2ISVA 3GKAA 5IFPA 4UOZA 1GKQA 3H55A 4QCFA 1EHNA 3AUOA 3AWOA 4HN4A 4GZ7A 3CV2A 4YPJA 1H7WA 2ABAA 3BSGA 4A3RA 1QI4A 3N9KA 4D6GA 3T78A 1H4PA 4CD4A 4C6CA 1QW8A 5A94A 3MMDA 1X7FA 5D04C 3T2PA 2IKGA 4W85A 4NILA 1WPCA 4AZ6A 5HWMA 2ZE3A 1CXHA 5E6ZA 1REQB 1XC6A 4O8RA 3UR7A 2DSVA 1JCXA 2WKGA 3WNOA 2ZZ6A 1UUQA 1XINA 2VO5A 2Z0IA 4IIHA 1GORA 4I5XA 3FEMA 4GQGA 3VKKA 1E6ZA 3QOKA 3DFHA 5F4WA 4Q7BA 2X05A 1EL3A 4L6DA 1EIBA 2XN0A 2BB0A 2YA1A 4CNNA 3TTYA 1U1UA 1KGWA 1GJUA 2TMDA 2ZOXA 4JFVA 4Z08A 5AYZA 3UNDA 4W5ZA 3AIEA 3KRZA 4D6CA 3BSHA 3VVGA 4AWSA 3SDOA 1TUXA 4NZJA 2YKKA 2XH0A 1W91A 2DZSA 4FOKA 1XYLA 2DEPA 5MKGA 1SR9A 1UJQA 1SGJA 4MJMA 3AZSA 5DBUA 1BKSA 3S6OA 3CUFA 1MNSA 2PTYA 4JHOA 4ES4A 3S83A 3QH2A 5H1WA 1R87A 1K7XA 3O0FA 1EX5A 3URAA 2VRKA 2B4GA 3GU9A 4IJBA 3ITCA 4LC8A 3S46A 5IRPA 4TU1A 4QJ3B 1VB9A 4MYXA 3LXCA 1R9ZA 5K9XA 2G37A 4QLLA 3OZYA 3D0CA 2EPOA 3M0MA 3KZSA 3ORWA 1XLHA 2QUTA 4Z0SA 3RCMA 2VQTA 4NXKA 4GZEA 4LRSA 4TOQA 3LSCA 2JF7A 4DX3A 1ZJBA 4J28A 1SJDA 4P2VA 4UNKA 3SGZA 4FA3A 5E6YA 4NG3A 1WO2A 3BOLA 1OHLA 2Z2AA 1EZ2A 2X2YA 4P5UA 2YDAA 3PY2A 4HPHA 3OIHA 1AD4A 3QKEA 2NX1A 3IJ9A 1KRBC 1N7KA 3DKJA 3G1VA 1J01A 1OX6A 3S8HA 3W7KA 1XLIA 4HSNA 2INEA 4PCTA 1B3ZA 4D8LA 4OT7A 2W61A 4LBSA 1NWTA 3SUWA 1E72M 4LVFA 5HDRA 3S2CA 4N0RA 3K4DA 3O6DA 4E5TA 3MP4A 4OHQA 1Q13A 1UHVA 4Y9AA 3ZT7A 2HEJA 2P3ZA 2YFNA 1F2JA 1TO3A 4UOQA 3XINA 3TYZA 3TMQA 1YKWA 5HQEA 4GRSA 3BQ5A 4GXMA 4X0VA 1QNPA 3EB3A 3T05A 3FY1A 4W86A 3KWSA 1XSIA 4QG8A 1S3TC 1ENUA 4E4PA 3CT2A 4C6KA 4W8BA 2W67A 3ARXA 5CLWA 1C3FA 3HJEA 1V3LA 2HPIA 3VD4A 1BEUA 1EP1A 3RGTA 1UZ4A 1XCWA 2BVWA 1OSEA 4DZ5A 1K77A 1TX2A 3AMKA 4HZ8A 1EJ7L 3BLKA 2VEGA 5BOOA 5GNZA 3PBVA 3W28A 3AMCA 3VC5A 3EZ4A 2ZDSA 2QJIA 3WFLA 4EF8A 1VFUA 3OHMB 4ZCWA 1TRDA 4DJED 5MF5A 5HQMA 3P74A 4JTGA 3ERPA 3B0VC 1GOWA 3EX1A 1LT8A 3GYEA 1N55A 1HL2A 4A2SA 3KS5A 1HTIA 2OT1A 3GY1A 4Q4MA 5F4XA 4QE1A 1SQ7A 3SJ3A 1X7IA 2B7NA 4BI6A 1TQJA 2A79A 3WMCA 1KBIA 3FHAA 2NV9A 2YB4A 4FNQA 4OZOA 2MUCA 4TVDA 4PUEA 7A3HA 4QE5A 1U5VA 2O9TA 4E2OA 4AVNA 1OFBA 4CCEA 2Y4SA 3A3WA 4FXSA 3WBXA 4R85A 3VFCA 1VR6A 2KAUC 4RE2A 5E70A 1TJPA 3W6LA 3CT7A 2P0IA 3CHFA 4GUIA 1VYRA 5D8ZA 4ZQCA 2FPVA 1W1TA 4WD0A 4PH6A 4UFLA 4B91A 3CZJA 4TTUA 2Z7KA 4NVTA 4AUBA 4XISA 3VGBA 2CYGA 5A6BD 2WNZA 2X2GA 1XH2A 3VIHA 4K7VA 1H11A 1K9FA 1FWSA 4I90A 4O0KA 3VNYA 4FLQA 4O18A 2GGEA 1HW6A 1AJ2A 4NP7A 3B9EA 1OYCA 3SN1A 1M65A 1EC8A 2G8ZA 3H2CA 3BARA 4Z17A 2VC6A 2FH6A 1JF6A 1VYPX 2DIJA 4ZO8A 3ITYA 3IV3A 4M0XA 4R7WA 2XIJA 3W53A 5LNVA 4PE8A 2W92A 3NZQA 4QAWA 2JKPA 2O55A 3UXLA 4F9JA 4Y90A 2W9MA 1J0KA 4N9CA 2QMKA 1R3SA 1UH3A 4HYRA 1EP3A 4ENLA 2OTDA 4OGZA 3I7QA 2NQHA 5A6BA 2VDGA 3E38A 3N73A 1FWHC 1MQQA 5CSYA 1TCMA 5EYWA 4GUGA 3HGOA 3W2JA 4LOCA 1W3NA 1ODZA 2VFDA 1IHIA 2XYLA 1H60A 4PRWA 1XYCA 4XUYA 3KBJA 3MMWA 3N6JA 1LM1A 1Y65A 3QW4B 3N11A 4PB3A 1KGXA 2GPTA 4U31A 4LVBA 4MJZA 4L5ZA 1LP6A 4AXNA 4IQEA 1M9HA 4CNTA 4JN6A 2Q8LA 1HKVA 1KXTA 1G4TA 1NWSA 1H51A 3R10A 1OX5A 5AC7A 2ISFA 2G41A 1ISZA 2Z24A 1YRRA 1FWBC 1GHRA 2ACSA 4RCXA 2F8QA 4C5YA 4HQVA 1C8VA 4R9OA 3BLEA 4KWUA 4DBSA 3W83A 3OG3A 1W3TA 1LBMA 4AHOA 1XP3A 1G01A 1YNYA 1T7LA 2E0PA 1UQYA 5AY7A 3AIQA 3EDDA 1DORA 4K7YA 3SCQA 3N34A 2CBVA 4W88A 1BVWA 3JR2A 3T8LA 1KFJA 1H3GA 3A4WA 1UZ1A 2E3ZA 2EPNA 2Z1WA 1IT8A 1WDPA 2YCLB 2YB1A 3PAOA 2GGGA 1SPQA 3GX9A 3WN6A 4HPXA 3IVSA 2G4JA 3A4AA 3VXGA 1Q6DA 1GOOA 4AU0A 2ZUVA 3APTA 3LCXA 4DNHA 1XIFA 5H8MA 1WZKA 3VD5A 3F4DA 4HNNA 3LPFA 3WBWA 5G2IA 3ITVA 2ZFAA 2Y70A 5CBJA 1YW1A 2PDMA 1S2WA 1X98A 4B5WA 3EWCA 4QM1A 3CV1A 3AHYA 3IPWA 3SECA 4DPPA 1RLDA 1JPMA 1QI2A 3H7RA 1JI2A 5LIUX 2WANA 1FRBA 2X1TA 1MO0A 3B9OA 2ACQA 4I6VA 4AW7A 4MWAA 2BGSA 1VS1A 1J4EA 1HF6A 5C2XA 4CQCA 4XVEA 2VQUA 5KZ6A 1A3WA 4G56A 4WHBA 5A69A 2HE8A 5I23A 4FR1A 1KCKA 1UWIA 2C6QA 1ADSA 3JZUA 3VGDA 2VEIA 3BWWA 1W5QA 1Y5XA 4LH8A 3VK5A 3DAQA 2CW6A 2B81A 3GVRA 4DJDA 1BYCA 5F1UA 3VKDA 4IFKB 2NXHA 3KCJA 3ZMRA 2HZGA 1X6LA 3SCVA 1UKSA 3OOQA 3BG5A 3GFXA 1TX0A 5H8UA 4YTSA 3LCHA 1Q6RA 3VDGA 3H7UA 3I3BA 3NSMA 4W8AA 2HS8A 3REQA 4PBGA 3WJYA 2REQB 5IHRA 2TPSA 1VBRA 1ZQ5A 3ARVA 2EHHA 3EBVA 2PTWA 4NAEA 2X0YA 1YX1A 4NASA 3CTTA 4Q4KA 2WSYA 4R33A 1VFOA 4AHQA 2YW3A 4NXSA 3N9RA 3L5MA 4LVGA 2X42A 2MANA 4HTBA 3CQKA 5D9OA 3OGVA 1XUUA 2F6KA 3AO0A 4IGSA 4XSLA 4Z2LA 1BTMA 1DE6A 1Y5VA 4WF7A 3QXBA 3W01A 1V7AA 3VD7A 3NQFA 2E40A 4WUIA 3LCFA 2DT0A 1YDNA 1G69A 1XSJA 1QPKA 8RUCA 2RKXA 3TN4A 3QC0A 2C13A 1EFZA 3Q45A 5CQ1A 4B16A 5KZEA 3SY5A 4KRZA 4ZXOA 4ADSA 4LGXA 3R8GA 3UXKA 3EXSA 1S5VA 4LCQA 2D3LA 1ITQA 1PCWA 4GIYA 4DJEA 2I7GA 1JYWA 3CHVA 3MP3A 3USZA 2FZNA 3KRUA 2PB1A 1VFFA 1Q7ZA 3G6LA 1X1NA 5ABHA 3H4WA 1Q5MA 2YBVA 4H83A 1AW2A 1JXKA 3MMTA 4JTIA 1FWAC 3BMWA 2VVSA 1YE6A 3KLKA 1EDGA 4FB7A 1PYMA 1ZJAA 1EUAA 4LBUA 4PTMA 4MM1A 2BY1A 5FOOA 1UIOA 1V02A 4U3CA 4NT0A 4Q3MA 4QTGA 3CUHA 1HKKA 1L6YA 2H3BA 4O0ZA 5LIKX 5AC5A 1ZTVA 3LRKA 2GGIA 2OYLA 3LSBA 4QLJA 1JUKA 3AALA 1B30A 3I7SA 1HJSA 5LIWX 2FTWA 2BMBA 4F2BA 2PSNA 2HISA 3PZUA 2QCNA 5CJMA 3EA3A 1E9IA 3EA2A 3MT1A 3GTFA 3UWQA 2WLZA 3TN3A 1F73A 3THQA 2AQWA 2PWUA 4C7GA 3IGXA 2FHFA 3IGHX 1LOLA 4FNRA 3BAYA 4ATLA 3ES7A 3PSWA 4H6QA 2CZDA 4JDBA 1HGYA 1M53A 2CZVA 3IIPA 1W0MA 3TA6A 1UP3A 2A5HA 1FP8A 3TIMA 3KL5A 1Q6EA 4AZCB 3GW3A 5AZ0A 1EJRC 1QPNA 3UJEA 2VZVA 1Y8BA 4JIEA 1EPXA 3E3HA 5D2YA 4QJ4B 1SW7A 2GZXA 2JFEX 3BL3A 1CGXA 3LA4A 5REQB 3SO7A 1V7YA 3G0XA 3WL0A 4JL2A 5U4NA 1C8XA 3FCPA 1J10A 4XZMX 2XTKA 1QHOA 3EXRA 3KCLA 2YZ5A 1P1MA 2E09A 1RCXB 5CGTA 5JH2A 4XG1A 4RV8A 2FHBA 3KTSA 3DFYA 3AI0A 2ZBTA 1Q8JA 2PD5A 2C0HA 5FAJA 2HWGA 3PG9A 1V08A 3QC3A 1F4HA 2QCCA 4DLFA 1IXOA 4GJJA 2QGYA 4ZOBA 3FJ6A 3HG5A 1J0ZA 1U5JA 3LI1A 2ZX6A 4CVUA 2TSYA 2ZIDA 3LHTA 3TTOA 4U5IA 1E5JA 4S3FA 2V69A 3WLKX 3TONA 2PWFA 3AQUA 1J12A 1NIUA 2CU0A 4US5D 4IP4A 2WPGA 4E2DA 3SSZA 2PRMA 1JJKA 4JAWA 1NP0A 5AOUA 5F2IA 4CVWA 1QO2A 2C1HA 3UPMA 3LRMA 1F9CA 3TQVA 3FFSA 4U33A 3R25A 3EPOA 3VNMA 1A4LA 3LMYA 2YSWA 5J8LA 3G8RA 4AZCA 1ECEA 2XGIA 3V5CA 1KFEA 1LQ2A 1FUYA 2YOCA 3P62A 1VGAA 1LQAA 4NAFB 5G4HC 2WZIA 5M5DA 2X7WA 3P2VA 2I1OA 1H0IA 1BAGA 1TPWA 3MBDA 3GBEA 2IKIA 2YW4A 5EMMA 2WC7A 2Y61A 2J66A 3WH7A 1EDQA 1MUWA 3BJFA 3BLDA 4MZ1A 2EO7A 2V3EA 4UTIA 5ECUA 3N4EA 2FVLA 3QFEA 4L6HA 5HINA 5DMNA 3GIPA 3LBMA 1VPYA 4MLJA 3CK5A 5DXXA 4U28A 1OX4A 3LZ5A 4FOUA 4WJXA 2Z1XA 2JEQA 3EOUA 1DPMA 1PIFA 4E4FA 1FWRA 3WMSA 1FWFC 2ZUTA 2J78A 1SUXA 3WK1A 4Z2JA 5XIMA 4WQ6A 5IDZA 1L6WA 5HMFA 1XLCA 5AVHA 1K6AA 3ENLA 1QU4A 4C6EA 4DAFA 2Q3RA 1LWJA 2XSBA 1R9YA 1WDSA 3TWAA 3CUIA 4ZFMA 4BJHA 2G3MA 1XLJA 1M1BA 1CLVA 3W0KA 3M43A 1E6XM 1W3KA 8CGTA 3QSTA 3BGAA 4ZL1A 3ZR5A 1GOIA 3SR7A 4V15A 1CGYA 3UEQA 3CNYA 2NZLA 3AU6A 2FB3A 2Q71A 3E2SA 3UYIA 4KCUA 1E6QM 1CPUA 1GEHA 4IJCA 4P7QA 3LLFA 2G95A 1XS2A 2C18A 1OFQA 4EWND 4RJEA 4L1GA 4OOZA 3AIVA 1I60A 4M6PA 4FNUA 3CHEA 2OSWA 4WSKA 2Z25A 1VBHA 1UC5A 4HZ7A 2BFGA 3R5EA 1MW1A 1THFD 5J04A 3BE7A 1E1FA 1CI1A 4JKLA 1W2VA 1TA3A 1ITXA 7XIMA 2BV9A 3B9AA 4R88A 1BYBA 4CCDA 3RNDA 4XAZA 5C9UA 3AYSA 3NVDA 7REQB 5E09A 1SVDA 3OYZA 3FKRA 3VUSA 3UWUA 4L61A 5AYBA 6REQA 3U5YA 1J96A 1DL3A 2IUZA 2ZICA 3K1GA 4B2DD 3PBUA 3MI2A 4AYSA 3A3XA 1XX1A 3VC6A 2VX5A 4EAYA 4DUOA 3KUMA 4NQ1A 1P7TB 1I2QA 4HJWA 3BXWA 5C8BB 4CCCA 2A7PA 1S39A 2H8XA 3EKLA 3LTPA 3A6OA 1Z44A 4DXKA 5B80A 3ME3A 3W7CA 5DY3A 1UPPA 3FA5A 1ICPA 3RJXA 3SN0A 2JQXA 2AGKA 4W4QA 3TDFA 2DSZA 4OTKA 1OT2A 1UR8A 4I3GA 2H9AB 4A8LA 3V75A 2EPMX 4AIBA 5DF0A 3CAVA 5A8PA 2HROA 2WBGA 1RH9A 3C2VA 4PUDA 4HMDA 3RJYA 2QJJA 3NNTA 3NQDA 1O12A 2VC5A 3W07A 1LT7A 4UBPC 4UR9A 1RP9A 2GJXB 3I3EA 5IM51 1KM4A 5EPDA 3E9AA 3N2MA 4RW3A 5D9MA 1RAKA 2XWEA 2WJEA 3G6MA 1QRQA 3B8IA 5DT7A 5D09A 1UCWA 3LHWA 3V0UA 1HL8A 3ZO9A 3O63A 2PBGA 4MB5A 2I5QA 2NX3A 1FH9A 1MSSA 2FFCA 4H00A 4C91A 3H2NA 1TPVA 3KOXA 4M6UA 2PDQA 3A13A 1UKOA 4JBRA 4JL1A 3TYUA 3NO5A 3R6IA 4XKYA 3LV5A 3G18A 1AMKA 4HK6A 4GI8A 1RALA 1TPEA 4GNVA 2CPUA 1PX4A 4O4WA 2RDXA 3C8NA 1ZALA 2O9RA 2E6YA 4J3VA 1V6YA 3UZZA 3SBFA 3HPFA 1H50A 3ARPA 4QIUA 1IR1A 1AMYA 1E4MM 2AGTA 1FP9A 3KCOA 1ZENA 3BAJA 3GNRA 1HFBA 2R1LA 4NI8A 2GFTA 3N6QA 1Z8AA 1R3TA 1DIDA 1TA3B 4BEUA 4WOQA 3WENA 2LLEA 2NV2A 4O1AA 1H0GA 2CZFA 3GIYA 1KFCA 3MO4A 2QEZA 5AHFA 1VCVA 2JGQA 3MKKA 3S1UA 2V5BA 3GC4A 3O0KA 3GC5A 4UMBA 1O6IA 5DANA 3AMDA 3ZJ8A 3VI2A 2A3BA 1SFSA 4MDOA 5ABTA 1W5PA 1TPFA 3RR1A 3CAWA 2QJNA 2Y89A 3PUEA 3W23A 3AIUA 2BG5A 4CQ9A 3R58A 4KCVA 4R9XA 3AXHA 5DQPA 4ML4A 1B2YA 4AZ5A 2WB5A 4W9TA 2E9BA 3VOCA 3PSVA 2HVMA 3QV6A 5BU9A 5GJNA 2J6XA 2ESCA 1EDTA 3W2LA 1ONRA 5I09A 4H01A 5C2CA 4YWIA 3UG3A 4GUJA 1BG4A 1QDSA 1L6GA 3SAZA 2QJGA 1GW9A 5D38A 4L80A 1R0MA 5DCBA 3GLCA 2ZRXA 5F2GA 1HXJA 4NJGA 4DF0A 3EEGA 4S38A 3SCUA 5CEWA 4L4OA 4H7ZA 1AQ0A 1KM6A 1CB7B 1F3EA 4WSHA 3WLPA 5A8GA 1O68A 4LNYA 2PP3A 3OJGA 2PMQA 4Q7IA 2YFOA 5I79A 3EX3A 3W74A 3NL2A 1WB0A 3WUBA 1VQTA 2XFWA 3GDMA 3ZLFA 1WZAA 3DN5A 1IZJA 4ILSA 2E1WA 2QXWA 3EMCA 4UTMA 2OU4A 1V3IA 1EQCA 4FX7A 2IXUA 4UTFA 2AL1A 5HK4A 3TC7A 4LUYA 3WLMA 5LNRA 1E73M 1K8ZA 3W7NA 5FAGA 2HBVA 5FL1A 1KCXA 1PHQA 4AY7A 3LB0A 1HX0A 1XIJA 2DZTA 4IX2A 2R6OA 3K1DA 3B03A 1VLWA 1S5NA 3GNPA 3Q2DA 4OE7A 1QAPA 5GQBA 4TX6A 3WX7A 1OVDA 3OHIA 2R1PA 4KEMA 2W63A 3FEQA 1TWIA 5HUPA 4NYYA 5B7YA 3EWUA 2PTZA 2OLAA 4N4PA 3S9YA 3FVDA 4H2HA 1R6WA 1T0OA 2YYTA 2I9UA 4PTDA 4GIRA 2OX1A 3B8DA 2JGYA 3NO1A 3ARUA 4AX7A 4PMJA 2NWSA 2WKLA 1O66A 4DO5A 1IZKA 3AYTA 1Z41A 2OOGA 1RXOB 1M6JA 5HR6A 4Z1CA 4Y8FA 2CLKA 2QF7A 3PANA 4GMEA 2FB2A 1US2A 4NJJA 1UKPA 3HV9A 4FMVA 4ACZA 3VCCA 4GKLA 1TTQA 1EO7A 1XRFA 3FA4A 1SJCA 3ZJKA 1DV7A 4GG9A 2W3ZA 2NXGA 3TNOA 2DY3A 3RCYA 3UA3A 4CEUC 3DZ1A 1K9EA 2ISSA 3TH6A 3AYVA 4F48A 3DFOA 4KS0A 3VUPA 3NTYA 3OBKA 1GJWA 1Z32X 3HOJA 1GJPA 4MWAC 4PODA 3N1AA 4XZIA 1W32A 1QK0A 3QTGA 4ALDA 1XUZA 1NU5A 5L9FA 2XFRA 3GM8A 4R7OA 4EWJA 1QATA 5K3VA 4WVXA 5CG7A 5C9RA 2BZNA 5BRBA 3AJ7A 4DF1A 3RO8A 2O92A 3NDZA 3LLDA 2ZC1A 4ZB0A 4YLWA 3TFCA 3GAKA 3W7OA 3VZYA 1OYAA 4GVFA 4QAIA 4G1NA 1LF1A 2JBMA 3DDMA 1UOZA 5A6AA 4URIA 3WF0A 2Z6JA 4XAYA 1MRQA 4KWOA 1XBYA 4PUKA 4PTXA 4L4MA 2G3NA 3H2AA 3F2DA 1MXSA 1XCXA 1YXYA 2OOFA 2OELA 1K8CA 5HOSA 4ML9A 2VFFA 2XGZA 2V3GA 1Q45A 5FEXA 4NSBA 2J7GA 4PMQA 1GYMA 3VDHA 1IT0A 1FWIC 3M0KA 4Y8EA 2V6AA 3O1NA 3VIGA 2FPTA 1KM0A 2GWNA 4JCLA 4TTGA 1UA3A 5CPOA 5DO8A 3N13A 3TJ4A 2A21A 4INFA 4QFUA 4MPQA 2WLYA 1PAMA 1KKRA 4B5SA 3G1YA 5FSEC 2BOGX 3ICJA 4Z2GA 1BWKA 1PBGA 3CH0A 1EKOA 4C6BA 2J7HA 4FR6A 5KZMA 2Z29A 3DYOA 1VIZA 4LRTA 2POTA 3VGHA 1TE6A 3FV9A 2OSYA 2WV8A 3U7BA 1GZJA 3NQ2A 3DGBA 1Q6FA 4Y9MA 2VENA 2NLYA 2XM1A 1TTJA 3LG3A 4X61A 3VZZA 2HCVA 4AYGA 4QJ1A 3L67A 4G8TA 3AHTA 5AHIA 1X39A 4XUGA 3DESA 4PMXA 1DJHA 4GNKB 4HNLA 1TJ1A 1Q4NX 4PCNA 2P5NA 3M41A 1MXDA 3RN6A 4QQ3A 1V6TA 2VGIA 1F8MA 2PDFA 3M46A 4O1BA 1NF0A 5CZSA 5CKSA 3VILA 1XR2A 3A24A 1OT1A 3UERA 2QW5A 4A3YA 3ARRA 4DEFA 1UR3M 1PX8A 2JIEA 2VCAA 1EBHA 5KMYA 3W71A 3AHZA 1TWWA 4UCGA 4C6DA 3GHUA 4RPPA 3V4BA 1S5WA 3A3HA 4Y96A 3UZ5A 2WMFA 2VDHA 3WQ8A 3GVWA 2VRQA 1M01A 4LVAA 3C0QA 4G2DA 3GB6A 1SJAA 5TNVA 4BR1A 1P43A 2BTMA 3KE0A 3W2UA 1N8IA 3VOJA 4YYCA 3UCQA 1HP4A 4Y9OA 3P14A 4QE4A 1WDRA 1LG1A 3WQ6A 3R79A 1X96A 1I0BA 2F38A 3B8SA 1MVYA 1GGOA 2PWDA 4Z1AA 2ZC8A 2WM1A 3EX2A 5I3FA 5HUOA 3QHOA 3WBAA 3H26A 1BTCA 2F9RA 3BH4A 2XVNA 4PUJA 4EE9A 3L0GA 3STGA 4P8VA 1Q65A 2XIQA 3PM6A 4IQLA 2QAFA 2GUUA 4D1IA 1HKJA 1V3KA 1UB3A 3Q58A 2HXTA 4AEOA 3D46A 1JL8A 3V0TA 5M3WA 3N25A 3C0SA 2GQAA 1I2RA 3ZS4A 2OX4A 4DJFD 4FALA 3PPCA 1XFBA 3NVTA 3EXTA 2GJLA 4RDZA 1YE4A 3GNOA 1RZMA 2WWDA 1XI3A 4MWAB 2INFA 2P88A 3S1VA 2PDHA 1F4AA 1PDZA 3OG2A 4A22A 4CU6A 4QXIA 2ADAA 4O13A 4NYUA 1IIGA 1NDZA 4IM4A 4UTUA 2XH2A 2C3ZA 4J4KA 5BWFA 5E0KA 3U2EA 4TO8A 1DWJM 2E28A 4UFHA 1I0DA 4MUZA 4IICA 2GQ3A 3GS6A 3NA8A 4FEZA 5CPLA 2CITA 1E6NA 5D30A 4IJRA 5IHSA 3STEA 3DYPA 4KF1A 2XZ9A 1BD0A 4PFHA 3CTLA 2TAAA 4C6PA 1MQPA 2YX0A 2FQIA 1ZLPA 4JGDA 4H4IA 3EAUA 3C52A 2DIKA 4CQBA 3SURA 1RSCA 2WSRA 1V79A 3CWNA 3CPGA 3WEZA 5D03A 4NI3A 1O1HA 1ME9A 3ID7A 5AYYA 3BLIA 3GZ3A 1SZNA 1I6NA 1V0KA 1UPMB 3LHVA 4R7JA 3UFYA 3DYMA 2VD9A 2FZDA 3UG8A 1XRTA 2WOQA 4Z1BA 2OVLA 1EF2A 4JTFA 3WK3A 3WDHA 4NJIA 1JEZA 1BRLB 1NTHA 1AH0A 5LA1A 2XN1A 2QZRA 4IPPA 4CN6A 1VJIA 4XD6A 5K2ZA 4PTWA 3ABRA 5FJJA 4RZ4A 4PN2A 4JIRA 1GVYA 2Z1VA 2ZTJA 3UGVA 2X8RA 3SCOA 3UXAA 5F2MA 1BXCA 2WQDA 3IS4A 3MCNA 4PMDA 3FYYA 3OW1A 2INZA 4E8DA 4QBXA 3VKJA 1EWEA 3NXLA 3QFWA 2J7EA 1VPXA 1RCOB 3CPRA 3RO6A 4CN4A 1WA3A 5FEWA 1JGMA 3CXOA 4HU3A 4GHRA 4WEVX 2OODA 3NQ6A 2QCEA 1EQPA 5T9BG 1RLCL 4QITA 3WD3A 3RU6A 1OFRA 3LCLA 4BCEA 4UIOA 1KM5A 3QLDA 3STCA 2W91A 4NZ4A 2PLJA 3ZXWA 4M8UA 1JZ5A 2X0SA 3EMZA 1QT1A 4FF7A 1JR1A 3B4YA 3MVTA 3ZYZA 1GQLA 4D6DA 2BVTA 3ARYA 5DRCA 1AJ0A 4U2YA 3HB9A 5M1TA 3V35A 3LERA 3HG2A 2WSQA 1EJWC 3P8IA 4HJFA 3VNKA 4QJ5B 2Q09A 2QUVA 4HIBA 2ZUNA 3VNZA 4O10A 1E0VA 4IGMA 1FY6A 3EOOA 3QHNA 1OZQA 4JFSA 1ICSA 4JQ3A 4J3XA 4WDWA 3VYLA 2XJ7A 3QKZA 1IEIA 4C7DA 3NWRA 1EUNA 2F6XA 1QFEA 3NEHA 1KQYA 3MC5A 1UA7A 1WBJA 2WMGA 3U3HA 2Y0FA 3LM3A 4S3CA 3ZIZA 4US6A 4RUBA 1I8JA 2P50A 4OUIA 3L0KA 1OK4A 3DFQA 1J0JA 4JYDA 3NQMA 1GT8A 3ELFA 3WQCA 1WXJA 3ZR4A 7CGTA 2QVNA 4D8ZA 4BWLC 1O5RA 3Q4DA 5A6LA 2V5KA 3RX4A 1W8GA 2ZQ0A 4TMCA 4UCFA 6TAAA 5G1YA 1GQNA 2NUWA 1QBBA 3AU2A 1I45A 4JCMA 4YWSA 5AKQA 2YJQA 2NSOA 3P5ZA 3MSGA 3OVGA 2CXEA 2Q02A 3WLQA 4Z42C 5HATA 4ZO9A 2ZZ1A 3GXTA 4HZMA 3AUJA 2OYKA 1CXIA 5CJNA 3M07A 2Y6ZA 5D4YA 5DT5A 3CYJA 5I3GA 4IIDA 3SGUA 3U57A 5C5YA 4IMFA 4AZHA 4GCAA 5I07A 1HJVA 2VZUA 5HNNA 4XBKA 4ZBCA 3DIPA 3KFTA 1DIOA 4PMZA 1C8YA 1JD9A 1GW1A 2PDXA 3CEUA 1Q66A 2R94A 3LGGA 1XIMA 3WD1A 1SZEA 3W81A 4HKPA 4EPDC 5CPNA 3UCDA 3V5FA 3Q37A 1M68A 4PBEA 2VWTA 4GO9A 1RBLA 1YBQA 2DUZA 1EX1A 3IJDA 3UGRA 3QM3A 3WBEA 4ZTYA 3ZQ9A 4IPJA 1S2AA 2PLKA 1K8YA 2X41A 1P6CA 4LBRA 1D3CA 1GTEA 3DH7A 3PUGA 2PZ0A 1CXLA 1JYNA 4O1FA 3GRIA 4K2SA 3OVPA 4D2JA 3W84A 1BKHA 1JPKA 4EANA 1P0KA 3FDGA 1SO4A 3CB8A 1UR9A 5CZJA 2ZXQA 3DEQA 3V1PA 2V0TA 4HBKA 3JU2A 4JTTA 1VZWA 4EIVA 1J79A 2EPHA 3ABSA 3AS2A 4PUMA 4I9MA 3GO2A 2V38A 3NG3A 1JCTA 2Z1BA 1BYDA 4J5NA 3GG0A 1ZBWA 4JDYA 4B2DA 3PZ9A 5FESA 3ARZA 3MUXA 4LAMA 4CNOA 3TLLA 4AIEA 1XQLA 4K6AA 1MI3A 2WSPA 1G4SA 1MEWA 4GJIA 1WBHA 1NELA 3VKCA 5K4ZA 3MKVA 2GQ8A 4H2CA 3TA9A 3NDYA 1TMQA 3LENA 3UBPC 1VFMA 3N3MA 4MJ2A 5E0CA 3DG6A 3SSJA 3VOIA 2ZRZA 4Z1DA 1TWSA 2HK0A 4AWTA 4TUFA 3CMGA 2VFIA 3F2CA 2HE5A 4WSJA 3L2IA 1TUFA 2GDQA 5FF2A 4QNWA 3GU2A 1DHPA 3PG8A 1IWPA 3B40A 1CW2A 3AHXA 4XD4A 3ITOA 4Y6GA 3C56A 3SM0A 4QLKA 3SFWA 3T42A 1VRDA 4LANA 3HV8A 2D0FA 3ALGA 5CAKA 1BF2A 4O17A 1JPHA 4H8HA 1DBTA 3LCIA 3CUXA 1LUCB 5I24A 3HPAA 3QY8A 2DQXA 3APYA 3HQ1A 1KQZA 4HOXA 2ONEA 3HURA 4DLMA 4AD4A 4DWSA 2HDJA 4HP5A 1E0UA 2UBPC 4XV0A 4RZ5A 1UD6A 4EX4A 3BLFA 3WDRA 2FDMA 1MFVA 3WF2A 3HMJG 2A85A 2ISWA 1AW1A 3CPUA 5E93A 4IFOA 1KNWA 2TRSA 2YA0A 5CSUA 3DKLA 4LUTA 2C14A 1S2CA 2X1SA 3POHA 3G1FA 3GWQA 3ZT6A 2DW7A 1DE5A 1GG0A 4HOWA 3GW0A 3LX9A 4OVXA 3WCZA 1EJSC 2FZ8A 1EA0A 1R3YA 1IEWA 5I3DA 3TXVA 3S1XA 3I65A 3WK0A 3U48A 3H21A 2QF8A 3QMTA 1DOSA 3GC2A 3TC3A 3FGCB 4MB1A 4FHAA 1A47A 4E3TA 3L21A 5D05A 4IQDA 2P8BA 5I2UA 4DYEA 1DVJA 3NQEA 1GZ1A 1T40A 4A21A 2ALRA 4ACZB 3IGSA 2V3DA 1OD8A 2C79A 5IXEA 1J0HA 1BGAA 3D47A 5HAOA 4DBDA 2RDTA 5JMUA 4YHGA 2QKFA 4M24A 2NLIA 4OV4A 2DP3A 4NAFA 1P0EA 4HA1A 2WHMA 2QCLA 4LCSA 4OUEA 2YA2A 3W72A 3N15A 4NY2A 3MDUA 3DG3A 1NSJA 4B3ZA 3LD5A 1K3UA 1WX0A 1E3XA 5XIAA 3DHFA 4YN5A 3FOKA 1JG9A 2ZXDA 2QIWA 3I4KA 3CJPA 3L68A 5HBFA 4YCOA 1S2UA 2UWFA 1CB2A 4Q22A 1US3A 3CL7A 1LOSA 1EOMA 2E5CA 3PPGA 2ZKMX 3WLOA 1QOXA 1DTNA 4KCWA 4GY0A 3M44A 4ZB5A 4UMAA 2J74A 4QISA 1RQHA 1FQ0A 1IF2A 3AMLA 3N12A 1D8WA 4MKSA 2VC9A 5FCZA 4F0MA 5FKYA 2QAPA 5A2CA 1CT5A 4HHMA 3PR2A 1YQ2A 3NQ7A 3TOYA 3JZEA 8A3HA 1T8XA 2PDWA 2BOFX 4XBJA 1Q4WA 3WQFA 4QRNA 5FJIA 4C1NB 1QHZA 2FZMA 4M1BA 4WOZA 1QI5A 4BZYA 4J3WA 3FYPA 1JCNA 1PHWA 1S5TA 3GH7A 3PBYA 3TJXA 1H5YA 1KCZA 3URNA 2I16A 3B9DA 3BDKA 1GKRA 1DIKA 4E4UA 1A0DA 3RX3A 3AMGA 3NPUA 3KX6A 4AZIA 3G1HA 3EWZA 3UA4A 4G6CA 3RILA 3NL6A 2D0HA 4I9TA 1EPVA 4S3GA 3FW6A 2F61A 5CLTA 4B4HA 1DP0A 3FGCA 4K37A 3RPTA 1SJBA 2C16A 3F5KA 3F1QA 3C86A 3N29A 3UU0A 2PFHA 5E1QA 4XAFA 2GVEA 3I68A 3TAKA 4X3ZA 4S2CA 3W4RA 4A8IA 5EMLA 3C8FA 1J6PA 1M3UA 2PP1A 3PUOA 4JPGA 3LBCA 2YPIA 1TMLA 4WDTA 4WXYA 1QK2A 4V33A 4ZQNA 2CEQA 3QYQA 3MJMA 3KHDA 4OECA 2XINA 4UUIA 1QPQA 2ZYFA 1A0EA 2ZRVA 4PA8A 4KWSA 1W1B1 4S3KA 3OA5A 1A3XA 3RPDA 5CAHA 3VD3A 4ATWA 2VR5A 4W89A 3WNLA 3P81A 1KTCA 3OBEA 1RA0A 1TVLA 3GSMA 4FLSA 1LUCA 2XVKA 4LXFA 3NXFA 3SN4A 1YPFA 4E2BA 3IRSA 4WDUA 4LC6A 3LHZA 4QQUA 1FKWA 3UXIA 4PRRA 5C6MA 4NAEB 3NFUA 3ABOA 3CQ0A 1XXXA 1Q2RA 3TROA 5J5DA 3PWIA 3PZOA 3L4UA 1XLLA 5PTDA 1XW8A 3K8LA 3CYVA 4GFIA 5IDIA 3AZRA 2YZRA 1OFPA 3GG1A 3U4AA 1H7PA 1SYTA 3I7RA 4C1KA 4FI4A 4UQEA 4O57A 1J5SA 2VURA 3MW7A 1KRAC 1G94A 3NJ3A 3IVUA 3T1GA 4HA3A 2F2HA 1TWDA 3M0XA 2PUZA 2NVAA 3I10A 2IKJA 5KTLA 5CC5A 1V93A 1PZ0A 1SMDA 1QWGA 2DV0A 2PODA 3EOLA 5FI8A 2V5JA 5CPTA 3UZWA 1O60A 2VWSA 3GXFA 4IWWA 3GFYA 1EF3A 3VIFA 3PN8A 2CBIA 2ZUUA 1R3QA 4A3HA 1ZCOA 3STFA 3B0PA 2QV4A 1VEMA 1K1DA 3B04A 1HKIA 2R14A 1V02E 3H6OA 2QCGA 5LGXA 2C71A 2WKJA 3W02A 1L2UA 3TJLA 2WW5A 4PL2A 4I5RA 1XLEA 4W7WA 3UJFA 4HMNA 4JX4A 1MWOA 4O4VA 1TV3A 4FPSA 3T08A 3OVQA 1HN1A 3ITGA 5HULA 4OBRA 4XZBA 3CZKA 1VEOA 4HK7A 3UQNA 3QF0A 4EF9A 4F40A 3P67A 1F61A 2G0WA 4RR4A 4AY1A 3RM4A 4IFRA 1GVOA 3KBNA 5CPSA 1H7XA 1SFLA 4P8UA 3VIOA 3CHDA 1V0MA 4UTTC 4A3UA 1EEPA 4MZ8A 2FZBA 1P7TA 1R38A 2BLEA 5BXSA 2ZDRA 4KEUA 1C91A 2JALA 3DUGA 1Z69A 4JKKA 5EY5A 4FNSA 2CNCA 3DG7A 1GVQA 2YXOA 1C9WA 4LVDA 2ZZ7A 2WZHA 4CQAA 1XFCA 1HL9A 2VD8A 5DBTA 1EWDA 5EA9A 3AHVA 1YHTA 1NDYA 2WMHA 1KGUA 3BAWA 3QN3A 4JTQA 3G24A 4AHPA 4WGHA 1R8LA 2CIPA 2E6DA 4KWWA 4XTDA 3BTNA 1JZ4A 1V77A 5LXEA 4MPKA 1SFTA 4XKMA 1RVKA 1PX3A 1CYGA 5CC7A 2OEJA 1CENA 3L4WA 4IMDA 3KOWA 2XM2A 2BVYA 1X8CA 2O9PA 3ZOAA 1VIWA 2PWEA 4D1JA 4Z1YA 4C6FA 1FWDC 1W5MA 5IBXA 1S2VA 2HVNA 1OF6A 1MUCA 1PJ9A 4YL2A 5LHEA 5A6JA 4XQ6A 3ANYA 4KWVA 1KD0A 1TV4A 4GYKA 4ZO7A 5DMLA 3GDKA 3L2MA 4NZFA 3KS6A 1XF0A 1XGDA 1G1YA 2I57A 4AMAA 2ZA2A 3GXNA 3SI9A 4JKMA 2CLFA 4M1RA 2NSXA 1W3IA 4RX0A 3DC0A 2WNNA 1CEOA 3IUIA 3PB2A 4GACA 4GABA 4UFKA 3VKBA 2HV5A 2A3CA 3RRAA 2D69A 1UP2A 1QHPA 4DI9A 4JNMA 1GUVA 4FP1A 4LY8A 2PU1A 5D33A 3OGSA 3IIXA 3M1ZA 4TX8A 3IAQA 1EC7A 2FGLA 3NL3A 4GO8A 3FJLA 4HOZA 2VOMA 6XIMA 4A8NA 4LW7A 4GVIA 4LF2A 4DJDC 4IT1A 1QW9A 3K4AA 2EF9A 3WIJA 2VCCA 3N2BA 2PU0A 1UOKA 1RPKA 1PTAA 1TFVA 2OSXA 3VO0A 3AIWA 3PFMA 3TR2A 4L9ZA 1C90A 3EWWA 1UD3A 2AMXA 4H1ZA 1JZ7A 1XLDA 3HGJA 4BFAA 4DYJA 1MW3A 1NFGA 2VP8A 4BI5A 1OF8A 1HZYA 4H7VA 2RDWA 3RFAA 3W1XA 3WQWA 1XIDA 3GDTA 5D2VA 5FACA 2PEVA 2VKZG 3U2OA 2YDQA 4C65A 4DYKA 3HGRA 2XDFA 3WNNA 1ZRQA 1TV8A 1NF7A 1UMYA 2J7FA 3CASA 1C7TA 3PNZA 1JRCA 2D2OA 3MWAA 3NURA 2XN2A 3PJWA 2OYMA 4J3UA 3E0FA 2X1RA 1G67A 2A2IA 2A4AA 2ZA1A 3NZGA 1UR4A 3TYBA 3KWXA 4YVXA 3N6HA 1MEIA 2V81A 1MXGA 4KPLA 4HNTA 1B0IA 1W5OA 4AQLA 1DTUA 3HO8A 1C93A 2Y1HA 2ZTKA 2V3FA 1PS9A 2VGBA 1BGGA 1JNDA 4JX6A 4M81A 1XHGA 3QV7A 1AODA 4WXZA 1I9CB 1KB3A 5CSRA 3LXBA 3M7WA 5FJTA 5DXYA 3M9YA 4IP5A 1HKMA 4AD3A 4PSPA 2YCEA 4DWSB 3W82A 3O7UA 3UY8A 4DB7A 5LGZA 1XPYA 3MSRA 2E8YA 3M0LA 4LB3A 3B8VA 1E15A 4ZE4A 1KRCC 3VPLA 1GQJA 3LMZA 2J9XA 2RFGA 3T4CA 3G0SA 5I78A 3SRKA 4PC8A 3KOZA 3AXMA 1YNPA 4DBEA 4XWUA 2AAMA 3GTIA 3VNIA 1XYBA 3TKFA 2QUUA 2Y5SA 4DM2A 3HN3A 3RXZA 1JCLA 1GEQA 4BS0A 2WMJA 1BPLB 4UTWA 2CHNA 2Z2BA 1OFAA 4LAOA 1VKFA 5E9AA 3OZPA 2FTYA 1KRMA 2WJDA 1K4GA 5E0FA 3OQEA 4LAZA 5FEPA 4GPNA 4QHRA 3R8RA 3ANUA 4DELA 1UIPA 4ECLA 1ZP4A 2J8TA 3CLMA 4QDPA 4JEQA 5AVNA 2Z00A 1KM1A 1O4UA 3Q67A 6PTDA 3ES8A 1N8FA 1NOFA 4YNGA 4A3QA 8XIAA 4MNMA 4W8LA 1GYNA 2E9MA 2DIEA 3SGGA 4HCDA 4H6EA 4AISA 3Q65A 4GK8A 4D72A 1DWIM 1VCGA 1WDWA 2ZX5A 2VR4A 4C60A 1WP6A 2FZ9A 2OZTA 4MY8A 4XD3A 1GKPA 4OWGA 2EG6A 2QPUA 4EACA 2XU2A 4O14A 2GK1B 3R0DA 2YIHA 4HTYA 3C5QA 4Q8PA 4L56A 3PK7A 4O16A 2ANUA 1R2SA 1PIGA 2CZ5A 5M03A 2O56A 4MYAA 1U1JA 1KBJA 1Z7AA 4RPQA 5I3KA 1KXQA 3A12A 4WY0A 3UESA 1DJZA 4QDWA 1VFHA 1NVMA 4KERA 1TTPA 4O53A 2V5LA 2JF6A 4YIWA 1Q6LA 4BA0A 3QEZA 3IJ8A 4GI6A 4I7WA 1ZBKA 3K4WA 7REQA 3UNTA 2OZ8A 3LTSA 1OCNA 1VBJA 1MZRA 2OPJA 4JFUA 5EBAA 1OEPA 1T5AA 3VOFA 1GVFA 3TU9A 1F7BA 1HVXA 3ABXA 4OFCA 4QG9A 4AX6A 5T26A 4C6MA 4KETA 1KFBA 3MI3A 1WDDA 3N18A 4MSSA 4GUHA 4HCHA 4O19A 4RDYA 5HMSA 2QVHA 1PSCA 3VX1A 3SW6A 3QOMA 4ORIA 5KITA 1TMHA 2MNRA 4B15A 1LL6A 4ZQOA 4BI7A 3MYOA 3PWGA 3CLWA 2Y5JA 1PYFA 4DHGA 4MY9A 2AL2A 4CEXC 1IEQA 3S4TA 4KMQA 3UD6A 2OEMA 2PS2A 3NM1A 1I1WA 3BLPX 3L9CA 1L6SA 4MJ4A 1PO9A 4AH7A 1QO5A 3QY6A 3V36A 7ODCA 3MCMA 3A4JA 4FLOA 3FVMA 2OMAA 1V4YA 2RJGA 2QV5A 3OPSA 4NU7A 3H7VA 2QCDA 4XVDA 1Q6QA 1LWIA 2NQ5A 2XISA 1QI3A 3GYCA 1KLZA 2GUBA 4X9SA 4L7ZA 9XIAA 2PE4A 4B3LA 2REQA 4JXCA 4BHYA 4V28A 5I6SA 5JBFA 2G3JA 3R4IA 3OLIA 3POCA 5D37A 3WL1A 2OQYA 1NJJA 2XIBA 2YDRA 4O1CA 2CWXA 2G3FA 2V5CA 1XWYA 3W7PA 1BSLA 3UETA 2D2HA 5CBIA 4BF5A 1E0WA 3QGVA 5DELA 1LCOA 5CC6A 1ZBCA 1HNYA 1EEXA 4W93A 3QGAC 5KEZA 4OBTA 1XIBA 3E6EA 2Q01A 1NFBA 2PLMA 1EGVA 4KEVA 3G1SA 3TYAA 3EX4A 3F4CA 3S1WA 4ERGA 3SRDA 3C2EA 5A6TC 3AZTA 4XTIA 3UWWA 4E8GA 3ALFA 3QW3A 2ACUA 4KIEA 1AVAA 1E4NA 1E56A 4PSRA 1L9WA 4F2TA 3NSXA 2GDVA 2AQOA 1FWCC 2A3LA 1JFHA 7PTDA 1J5TA 1YDYA 1QCWA 2RH9A 3LY0A 3URQA 3HG4A 3N04A 3TV8A 3LQLA 1V6WA 1NOUA 1UBPC 3GR8A 3BW3A 1JDAA 3BCFA 4UNLA 2W5FA 1GPFA 4RE0A 4AD0A 1W9XA 1LWHA 5FSDC 1SZGA 3QTPA 1JPDX 4OIFA 1DJWA 4CU7A 1GCYA 3W1QA 1V3HA 1FXPA 4RNHA 3JW7A 3W2MA 2PI6A 3TX9A 5C9WA 4UFJA 4P8WA 4Z0JA 1XDJA 3KBVA 2XIOA 3EPNA 3QZEA 1W3JA 2CHOA 4N9EA 1LROA 2GVYA 2ABBA 4RL3A 3LYEA 1ONWA 4KRUA 2V63A 3IIZA 4P7OA 3IVTA 2DW6A 3C2RA 3O6AA 3AROA 5LIXX 1SMAA 3F4WA 2FH8A 5BRPA 2XVLA 2EQDA 5HWJA 4DJFA 5K9DA 3H2FA 1I2NA 3R1ZA 4HHLA 1LRQA 4G7EA 3K30A 1OIFA 2CETA 1TIWA 2NUYA 4YVPA 1LDCA 2DH3A 3UPBA 4E0CA 4DJEC 2ZRYA 3LI0A 4LT9A 3L7RA 3E74A 4H3DA 4IXHA 5BOFA 5G4EA 1HT6A 3W87A 1OYBA 1S46A 4RZ6A 1SO3A 4MVAA 1TZZA 1A5NC 1YLVA 1R47A 4P7RA 4S2BA 3GH5A 1QPRA 3PJTA 3MVIA 3B0YA 1GOQA 3K8MA 4HNOA 1H1YA 3GXDA 2ZUWA 1MDLA 3T09A 3LNMA 4HN8A 3MSYA 4JQAA 3N2OA 1TRIA 4JEJA 4JY9A 1XSKA 4IL2A 4A35A 2GUYA 4R27A 3C3UA 4JTUA 1JCMP 4LEQA 1BQGA 4WJEA 3UT0A 3OP2A 3EOEA 2WMIB 5AYXA 4D6FA 1JYXA 5T91A 3FAXA 4JN7A 3BW4A 3EPMA 5D2TA 3BCJA 2UZ9A 3ATYA 1V6XA 3PTMA 4H9YA 3S9IA 3H12A 3BG3A 2PPGA 4D8AA 3G3MA 1PZ3A 1B9ZA 4J3ZA 4REQB 3FHQA 3WLIA 3LCGA 4M6VA 3BICA 4IIFA 1W1PA 2V68A 4ORMA 2IXVA 2DQWA 3GK0A 3MYPA 1IEVA 3S2MA 3KHJA 3VNDA 1WCGA 3HPZA 1W9BM 1Z89A 4WGXA 3SY8A 3DU0A 3TW7A 4DUXA 2R1KA 5M17A 1W2PA 3ZT5A 3TCEA 4A8RA 2J13A 4GI9A 6TIMA 4Y9PA 1OY0A 4LWWA 1E55A 1UKQA 1RHCA 4HU4A 1AQMA 3S2NA 3T0AA 1JXJA 2XPKA 5GVJA 3GHRA 1Q7QA 4H7CA 5KZDA 2QPXA 1G6CA 1MW2A 3KRBA 3GDBA 4MUPA 1Y0EA 2G50A 3NCOA 2C0AA 5CSSA 4YU1A 1TREA 1RR2A 4IX0A 3WF3A 1ZNNA 4U2ZA 1TQXA 3BURA 4WRHA 4UB9A 3PZNA 5CXPA 2CLEA 3B4UA 2UY3A 4S3DA 4LU0A 4HU8A 4K3ZA 2GWGA 1E4IA 3KVLA 4UTTA 4WCJA 3QMSA 3WMLA 1O1ZA 5AHNA 3W7IA 3ZVHB 4YTUA 3BLLA 1UWRA 3RR4A 4PTNA 2DFAA 2RGMA 4FOJA 2BGNE 1XBVA 5KETA 3MWCA 2CLLA 1GQIA 2GVJA 3VIMA 5A2AA 2QGHA 1TPDA 3W1PA 1G5AA 3E2VA 5G2HA 3UZXA 1OC5A 4N02A 4RNFA 1RPXA 2VT0A 1XJBA 3T40A 4NZ5A 2XSAA 1A3HA 5JH1A 3S42A 5LSMA 2A1YA 5I3JA 5AN7A 5AHEA 4J3SA 1KTNA 1JDFA 1YXCA 1F3WA 3S0CA 1W5NA 4ADTA 4CNSA 3KDNA 3RK8A 3UVIA 2Y8VA 4ZA0A 4D6HA 1ZCCA 4TVUA 4L64A 5CGQA 5A5WA 4MNLA 4P8XA 5HJYA 3AFBA 3IJQA 1RBAA 1W9DM 2EG7A 3VGGA 4X2PA 2Z1SA 4NL1A 4UR8A 4AMCA 1KV5A 1CDGA 4MB4A 4JTRA 5AC8A 4A2RA 3ZM8A 2TODA 1B3YA 3S6TA 2WHLA 4XBSA 2GGHA 2FJKA 4J27A 4B3KA 4B5VA 2VGFA 4P61A 1OGBA 5G5IA 1ZY9A 3W00A 1U83A 2PDYA 4LYRA 2UY2A 3RMJA 4JYFA 2I56A 1LL7A 1MZHA 3TK7A 5I77A 1GOKA 1CZ1A 3H24A 3N3TA 4FXJA 2DSWA 3AWNA 4DF2A 2DVUA 3GHTA 1JYVA 2EAWA 4KT2A 1RUSA 5AFDA 4WIWA 4BK9A 2VUNA 1CLKA 4DRSA 3W85A 1JRBA 2EJAA 2OXNA 1T96A 3O3RA 4O1DA 3RLHA 2ZZ2A 4NIRA 2GJXA 1LORA 1K8XA 2AOSA 4JYEA 3WEOA 3WJWA 1TELA 2OZ3A 2GSJA 3IIVA 4DZAA 2BNJA 4JQ1A 1BLIA 1VPQA 4DO6A 2C1IA 4N9BA 4PMNA 3TSBA 3P0XA 2FPYA 3WF1A 3WDJA 1E4LA 5JBDA 1H62A 3I6EA 3GXMA 1XBZA 3CS2A 1NEYA 2GDUA 2ATMA 3CAKA 2XH7A 1U22A 1H61A 3U9IA 4GC3A 1EIXA 5HWNA 2O4MA 2XSXA 2PDGA 3OBAA 3E0IA 3OA3A 1RV8A 4N4QA 3IK4A 4K39A 4O28A 3MJYA 1B57A 5BMXA 3CQJA 1QR7A 4GWEA 5ABFA 1DJQA 1WAWA 7TAAA 1PKYA 2BSLA 1EJTC 4YVVA 1W37A 1QXLA 3H2OA 2JK2A 3ZZ1A 1JI1A 1SSDA 2HNHA 4LAKA 4PUWA 3AC0A 2HXUA 3O05A 3W2NA 3OYXA 4IPLA 2DJLA 3CMFA 3PJXA 1H1ZA 3QZ6A 3T2QA 2NVCA 3KP1A 3PNUA 3EWXA 3PZTA 3NYZA 3G22A 2A7RA 3GDRA 3AICA 2E67A 1Y7VA 4H6RA 2FYMA 1EGMA 4IOTA 2GOUA 4KRTA 2QUNA 1V6VA 3IIOA 4I7VA 3U2CA 4RNIA 4TXEA 5EGRA 3CH9A 1BWLA 3IRDA 4Q4OA 3LQGA 2QPSA 2W6RA 4D6JA 3AIRA 3E5BA 5K9CA 2CHRA 3DERA 3WQDA 3F4VA 4LUIA 4PCFA 5TBOA 4C5ZA 3PZMA 4DXXA 3P5YA 4F0RA 3A64A 4O12A 4DUVA 1JCYA 2J9YA 2EJ1A 3TQ0A 4UFMA 1UWUA 1VC4A 3P8JA 4EXAA 1DJYA 2IW0A 3ZVHA 4ZB2A 3ZJ6A 3WK2A 5FA5A 1A5OC 2VEMA 3O2LA 4CD7A 5I02A 1D9EA 4GA8A 1QMLA 3TNBA 2XIIA 2UY4A 4I8YA 3FDKA 3AS0A 1SW3A 4IF2A 4B5TA 1GOMA 1UZDA 1QI0A 3C0LA 3O9NA 3I3DA 3BW2A 5DX7A 4F0LA 3W26A 4BKNA 1TJRA 1ZBVA 2AQVA 1BRLA 1U33A 1L8PA 3SUTA 2V2CA 2C8NA 3KTCA 5BXRA 1OX4B 5LNUA 4IGHA 2Y7DA 4I7UA 3D5HA 1BYAA 3JS3A 3XISA 4H9ZA 1E0TA 4K1WA 4GY7A 1VBUA 2WC4A 3M6YA 3TTQA 3FXYA 5I00A 3FXGA 1TCDA 2NXIA 4IUOA 4GD0A 1BHGA 3GNXA 2B31A 3IUHA 4KGLA 4DBWA 5GNYA 3T9PA 3WH6A 3EWDA 2OB3A 1RP8A 1IGSA 2DUAA 3OLEA 3SJNA 5BYWA 3F03K 3TFXA 1QOQA 2YCLA 4DAIA 2YCJA 4S1FA 3CGTA 3OTRA 2BXZA 2DT2A 4K8EA 2WMKA 4EAMA 3KP0A 1V0NA 4FNPA 2Z26A 2W4XA 1QUMA 1P6BA 3HQOA 2ISDA 5AYIA 2WM0A 2V5DA 4ERIA 2E5DA 1XL9A 3I6RA 3HPSA 1LZOA 4B4FA 1E9LA 4ZOAA 3EDEA 4B92A 4WY0B 1IGWA 2EGZA 3K2GA 1WZLA 4JFWA 4C6LA 1FDJA 1Z48A 4NZ1A 3MDWA 1VEPA 3UCCA 4JTDA 1UWQA 3TQPA 3RM9A 2IQ0A 4MLRA 1WE5A 3BK0A 5DY2A 2VZTA 2HQAA 1XM3A 2P53A 1CTNA 2WZEA 3H54A 1TR1A 4C6JA 4UC5A 4AD5A 3VD9A 3LM7A 4NZ3A 1PPIA 3E12A 4JIPA 5C7VA 4UTJA 3RDKA 1JZ6A 1MRAA 1CXKA 3TTSA 2YGYA 4MNJA 4GYPA 2DT3A 1XKYA 1B9BA 3PJUA 3WLLA 3V7PA 1AK5A 3T0TA 1BFNA 1OD0A 5A8OA 1K03A 3M5ZA 6A3HA 2PF8A 1J2BA 4Y7EA 2WC3A 1UR1A 1JDDA 2PA6A 3ARWA 4N6FA 5F1VA 1MDRA 4BQ5A 3RM8A 1YTKA 1K02A 3FKKA 1JQVA 3HIJA 3F4NA 2DZXA 1QWKA 3KVKA 3ITXA 4RDWA 2I5GA 2YL8A 4A6GA 1CECA 3GR4A 4GY1A 1QNQA 4WLCA 4ROQA 4CQDA 3B05A 2H3DA 5LKYA 4JIHA 1TJ2A 1XD0A 4TX9A 3CM4A 2B7OA 4UTHA 1KFKA 2D3NA 1KW1A 1P1XA 2O9OA 2B7QA 2YL6A 2WVSA 2WCAA 3KEHA 1ME8A 4M5PA 1A5SA 3MQTA 2NX9A 5A95A 1XG4A 2Z1KA 4TR9A 4LB4A 1ZP3A 2WSKA 5F7UA 3J7HA 1VENA 3R7MA 2W0UA 2J8GA 3G8EA 4HZ6A 3WLNA 3VX0A 5FJPA 4IG2B 1SFJA 1PKMA 1O5XA 3W1LA 3S2JA 1CXFA 1R7AA 2J88A 4JTEA 4C90A 3SCPA 2E25A 3HU7A 2HTMA 2R1MA 3QQ0A 1AD1A 3AS1A 4HK5A 4GOAA 2PCEA 1GWJA 1OM0A 2E6AA 2KZHA 3NDOA 4EPBC 1FFRA 2AKZA 4GX9A 2Y7EA 3P93A 2PRHA 3G1AA 1ISXA 1E51A 2YR1A 3HA1A 4KFOA 1XISA 3C3NA 1DJXA 3IANA 4DJDD 1PKLA 4KFPA 3H2EA 1GK8A 4P7NA 1UD8A 1NDVA 1D7KA 1PVNA 3IARA 3AXIA 4IPIA 1V03A 3IWPA 3H23A 4NHVA 3WO8A 1M04A 4MNKA 4PB4A 2GSEA 1GOXA 2PDPA 4TQTA 1Q2SA 3KW3A 3U8GA 3SFKA 3A47A 2J77A 1F6PA 1DQXA 2A3EA 2ZUSA 5M2FX 4HSHA 1UH4A 4RLIA 3RAOA 3CWHA 4NF7A 5A8MA 5CG0A 4YS1A 2NQ9A 3OZMA 2YDSA 1P5BA 1D2KA 1N2VA 1NM9A 2R9RA 4DO7A 4PR4A 3RLVA 1VCFA 3AISA 2PGWA 2PZNA 4IMAA 3IJLA 3TXZA 4CU8A 1FOBA 3BGGA 4GE8A 2E1DA 2ZVRA 4ASTA 2GJNA 2VEKA 3CHCA 3MHFA 5LA0A 2YCKX 1DKWA 1AL8A 3R43A 1XDLA 4KESA 2X1UA 1HJQA 3UJSA 3RF9A 2Y8UA 3CAQA 3CIXA 5TF0A 2PC8A 1A5UA 3UZJA 2GJPA 3WZ0E 3CV6A 4ZVJA 1D7FA 1OCJA 1SU5A 1IR2A 1R30A 4U3AA 4LV4A 3L0NA 1MMFA 1VBGA 4UQ9A 3W86A 1RY8A 3VIPA 4GH1A 4RK8A 2OO6A 4J1OA 2J79A 4LUSA 5EMUA 1VLIA 3QVQA 1FHLA 3RCNA 3VGEA 4A29A 2HS6A 4NNCA 2OKOA 4PYSA 1LYXA 2W27A 1TV7A 3RG6A 3LEPA 3NGFA 1KBKA 2ZXBA 1UC4A 4O15A 3WNMA 2FKPA 5HXMA 3MZNA 1E6RA 2RGLA 1HO1A 4WKHA 3T0DA 3KOFA 4QSHA 1YPIA 2BXVA 3S5SA 2WZMA 4FXFA 5JU6A 2WNQA 4QCEA 4EK7A 4HT3A 3ZJ7A 2FDSA 4LAUA 2NQZA 1FCUA 3M4HA 1DHKA 1XCFA 1VHNA 1YADA 3C4UA 3SIZA 4L65A 4GQQA 2VCBA 3HG3A 1XQKA 5FIPA 2CBJA 3QJAA 1KWKA 2CWNA 2ZWYA 5G1TA 1UBSA 4E38A 2HVOA 1OFEA 2DSUA 4ZMGA 4IIEA 2RJHA 2DORA 4HVXA 3GR7A 4I6KA 1GNXA 1AZ2A 3IEBA 3LOTA 2BODX 3MV11 3UZYA 4UTKA 1UD5A 3ZWSA 4ZSUA 4HPGA 3ARQA 4FIQA 3L66A 3WQPA 2I5IA 3QZAA 1QVBA 1ISYA 3PTKA 2WNWA 1KXVA 3FSTA 4S3JA 3BSMA 2AAAA 1SZRA 2YXGA 1GPWA 1XRSA 3E1F1 4JNYA 4CKQA 1FWNA 2J62A 4H9UA 2R91A 5LHFA 1CBGA 4MF4A 1ME7A 4XAPA 1EYEA 2F6UA 1TPH1 4ICNA 1RJQA 4IIGA 3WUFA 3E02A 1FVPA 3R12A 3B06A 2CESA 3NUKA 4F79A 2POZA 5FJUA 3URBA 1M7PA 1LJYA 5LZLA 3BPWA 1YMYA 2I17A 4D6IA 1ITCA 4HGXA 1KM3A 4IGNA 4LYKA 1W3LA 1HJUA 1DQWA 5HQLA 1J93A 3ZLGA 4M56A 2GLKA 1QJWA 1XLMA 4AY8A 5DEZA 1IXQA 1C8QA 1ZZMA 3BLOA 4HNVA 3JRKA 3UWEA 3R94A 2WBKA 3N17A 4DJFC 1FWJC 1E5NA 3BUVA 1VD6A 1F6YA 2YBTA 3N9SA 3PBWA 5JIWA 4JZ5A 4RNJA 3CWOX 4H9MA 2XG9A 5D2XA 2PDIA 3KBSA 3EGJA 4Q33A 3TOPA 3W7EA 3HF3A 2OGJA 2WJFA 4B5UA 1FXQA 1RY0A 1K7FA 3CMJA 3WH9A 2IS7A 2VELA 4MAVA 3RX2A 5EBUA 1WDQA 4DO4A 2ZADA 1UJPA 5FF3A 1LLOA 1A4MA 3W9ZA 1SSGA 2V8ZA 1Q6OA 1OWQA 4Y2WA 3GXPA 4H8NA 4F8XA 1H49A 1PB0A 4O50A 3W76A 3FYOA 3UP8A 2VZSA 2O7SA 3WKZA 3ZFHA 3RUBL 3FSUA 4LF1A 3L4ZA 4LFYA 4UQBA 1OCQA 4QDMA 3M5VA 1LL4A 3H70A 3VMPA 1EP2A 4Q4QA 2IPWA 3HTWA 2BY2A 2H9AA 3H4XA 3T2OA 1EJUC 1MFUA 4QG6A 5EKYA 3DOPA 3T44A 1JF5A 1DIEA 1DJGA 2J7CA 3GUWA 4OV9A 4UQCA 4F66A 2Z6IA 1HQTA 5XINA 3WQ4A 3P80A 4MY1A 5AC4A 1TVPA 3KDOA 3DFNA 1FFQA 4GFSA 1G9HA 5JBEA