3UZZA

Crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with nadp+ and delta4-androstenedione
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIHVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Conversion of Human Steroid 5beta-Reductase (AKR1D1) into 3β-Hydroxysteroid Dehydrogenase by Single Point Mutation E120H: EXAMPLE OF PERFECT ENZYME ENGINEERING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 113
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3uzzA00
3V0UA 2ACRA 1AH3A 4WEVX 4JTQA 4WRHA 2DV0A 2FZBA 4WDUA 4L1WA 2R24A 4G5DA 1Z89A 3RX3A 4AUBA 4GA8A 2BGQA 2IKIA 1SM9A 2WZTA 2IQDA 4LBSA 1XF0A 4PUWA 5LIWX 4GQ0A 4MHBA 4XVDA 3GHSA 1MZRA 4XVEA 2HDJA 1X98A 3D3FA 4DBWA 1LWIA 1OG6A 3H4GA 4ZFCA 2NVCA 1AFSA 3CV6A 2A79A 1EL3A 3BCJA 3R7MA 1Z8AA 1PZ0A 1FRBA 3G5EA 2P5NA 3UZXA 3WG6A 4XZNX 1YNPA 3COTA 4OTKA 3CV7A 2C91A 3H7RA 3WBXA 1RY0A 3WBWA 3LQGA 1MRQA 2PDGA 3LN3A 4JIRA 3G1RA 3RX4A 3DN5A 2QXWA 3BUVA 4GCAA 2PEVA 4LB3A 3V35A 5LIUX 2IKGA 3UWEA 4Q7BA 4LAZA 5HNTA 3GHUA 2ISFA 3CASA 3M64A 4QXIA 1R38A 4XK2A 4ICCX 2IQ0A 1GVEA 1MI3A 4L1XA 4JQAA 2AGTA 3S3GA 2IKHA 4EXBA 2HEJA 2ALRA 1A80A 2PDMA 2FZ8A 2PDWA 3ERPA 4XZIA 3R8HA 3WBYA 3M4HA 1EXBA 3V0TA 1PWLA 4NKCA 4FALA 4ASTA 3UFYA 2PDFA 1Z9AA 2PF8A 2DUZA 4HBKA 3EB4A 2PZNA 4I5XA 3VXGA 2PDCA 2PDJA 1C9WA 4JQ4A 4PUUA 4WDWA 1RY8A 5LIXX 1AH0A 3CAQA 3LNMA 2PD9A 4F40A 3CAVA 1YNQA 5LIYX 4XO6A 2ACUA 1EKOA 2WZMA 2PDHA 1S1PA 3QKZA 1PZ1A 3O3RA 5DANA 3V36A 3UGRA 3R6IA 2IS7A 2HVNA 4GABA 3MC5A 2PDYA 3GHRA 3UZWA 4QR6A 5JH2A 3DOPA 4DBSA 2R9RA 1T41A 4JIIX 4GIEA 1ADSA 1VP5A 2PD5A 4JTRA 1AZ1A 4YVXA 2F2KA 4JQ3A 4PMJA 3ONCA 1J96A 3LZ3A 3WCZA 2PDQA 4LAUA 4LBRA 1K8CA 4QX4A 4IGSA 4XAPA 3LUTA 2PDUA 2HE8A 2I17A 2PDIA 4EXAA 4HMNA 2ACSA 5AZ0A 4Q3MA 4IJCA 4XZLX 4QBXA 5AZ1A 1HW6A 5HNUA 2IPJA 3MB9A 2BGSA 4JTAA 1VBJA 5KETA 2IPFA 3LBOA 4R9OA 1YE4A 4PR4A 4PRTA 4YS1A 3BURA 3GHTA 3M0IA 4YU1A 1ZUAX 1YE6A 4H7CA 2PDPA 4DZ5A 3LEPA 3CMFA 3NTYA 3R94A 1Q13A 4RPQA 1S2AA 1PYFA 2ACQA 1IHIA 2VDGA 4XO7A 4GACA 3Q65A 2INEA 1X96A 1XGDA 4WGHA 3U2CA 2FZ9A 3V0SA 3H7UA 3UZYA 2PFHA 2PDKA 3N2TA 1PWMA 4FA3A 5LIKX 3EB3A 5C7HA 1Q5MA 2I16A 4XZMX 3UZZA 1HQTA 1AH4A 1LQAA 3R58A 1ZQ5A 2DUXA 3BV7A 3P2VA 3LZ5A 1S2CA 1XJBA 3C3UA 3N6QA 5JH1A 4JTCA 2BP1A 2CLPA 2NVDA 3F7JA 2FZDA 1ZGDA 4FAMA 1EF3A 4IJRA 2PDBA 3FX4A 4YVPA 2INZA 4XZHA 4JIHA 3UP8A 3KRBA 4LB4A 3R8GA 1Z3NA 2HV5A 4YVVA 4WDTA 2F38A 4JTDA 3EAUA 1RALA 3ONBA 1US0A 4JQ2A 3GUGA 1QWKA 2PDNA 1X97A 2PDXA 3O0KA 3R43A 2IKJA 4FZIA 1S1RA 5HA7A 3FJNA 3RX2A 3T42A 2IPWA 3LQLA 3Q67A 1JEZA 3UG8A 1QRQA 4WDXA 5M2FX 1IEIA 3B3DA 1AZ2A 2PDLA 1UR3M 4H8NA 2FVLA 4GQGA 3UYIA 4DBUA 1ZSXA 2J8TA 4JQ1A 3LENA 2IPGA 2HE5A 4PRRA 1M9HA 2FGBA 3LD5A 2HVOA 1T40A
chains in the Genus database with same CATH superfamily
1YHTA 4A29A 4IP7A 2ZX6A 3FEMA 4G5DA 4HGXA 4D6JA 3KVKA 2CEQA 4HYVA 4Z2KA 3T2QA 4BWLA 2VP8A 1XD1A 2IKIA 4Z2JA 4GUIA 2CZVA 4ZEPA 3EOEA 2IQDA 4PE8A 5DQPA 1Q45A 3PJWA 2CCRA 1L6FA 5LHEA 4Y9OA 2GUUA 5DXXA 1I75A 1HTIA 2DT3A 3SCTA 2NW0A 3CTLA 4AWSA 1AD1A 2WMIB 3WQFA 4TUFA 1AFSA 2O9OA 4AX6A 2JKPA 2JKEA 1V6TA 3W1RA 1PZ0A 2D24A 3CUIA 3OZPA 1MUWA 1L0PA 1JL8A 1IEWA 1L6WA 3N9RA 4FXFA 1IWPA 3MS8A 1R2RA 4AVOA 1DXFA 3WF1A 4ZTXA 3WQGA 1ECEA 4ROPA 3K5XA 3L4WA 5IXEA 2DIEA 2QUTA 4G2DA 3EX1A 3SGGA 4DYEA 3WL1A 3E2SA 3WQ4A 2HXUA 4LQ1A 4E2OA 2B31A 2I5GA 4D2JA 1EX1A 4AZHA 5CZTA 7REQB 2RFGA 4H8VA 5FEPA 1IV8A 4HB7A 3LRMA 2FTPA 1VEPA 3N73A 1QFEA 3W3OA 3M64A 1VIZA 2A3HA 4QXIA 4KBXA 3UXIA 1VPQA 4XK2A 1KM5A 3PJUA 2OGJA 4JQAA 2ICSA 4EF9A 1KWKA 1E73M 1UKPA 4GK8A 4UBPC 2YFOA 3WQ5A 1XX1A 4OBRA 3HN3A 3UR8A 3U4AA 1S2TA 1DWFM 2GDUA 3IJ8A 1OBAA 2WQDA 3VA8A 1V3LA 1BSIA 2V0TA 3EWYA 1JIBA 3QFWA 2HJPA 2Y7GA 3GDTA 4MIMA 2PS2A 2G8ZA 3RM8A 2QIWA 2QJHA 1OFRA 3I3DA 2XG9A 3S2CA 1CYGA 4F9DA 3KBWA 2Y24A 3UA4A 4U33A 3F2DA 2DW6A 5CXPA 1Z9AA 1TJPA 4K8GA 2OGYA 1P0NA 3NR0A 4IXHA 2ZE0A 2HS8A 1XIJA 3CEPA 5GQBA 3W76A 2ISVA 1R85A 5BOOA 3DFOA 3WNKA 3M6DA 3CAQA 5EMMA 1V4YA 2DP3A 4AWUA 1W17A 4RDZA 3E74A 1XGZA 2ISSA 2VGIA 3K4AA 3AMDA 4CNOA 2A7NA 3R6IA 3HG3A 4JTEA 2HVNA 4OFCA 4EAMA 3H8AA 3AIWA 1CIUA 4K38A 4DBSA 3GR4A 3QN3A 3ABRA 3VMOA 3N3MA 3WY1A 1B3ZA 4XD4A 1QK2A 3NQ7A 3NFUA 2FDMA 2W4XA 4BKNA 5D09A 3N2BA 4AMAA 3RLVA 5B7ZA 5CPTA 3BLIA 4HOZA 4MYAA 4J3SA 2VX4A 3PZQA 1ME9A 3LUTA 3CTTA 2FVMA 4G7EA 1KCXA 1MDRA 1LZOA 3JZUA 4MWAA 3W28A 3FVDA 6TAAA 2ZRUA 4HP5A 2CPUA 2Y4SA 1BVZA 5L6UA 5A94A 5JBFA 1VFMA 3VI2A 1KQZA 4GKTA 4IXXA 2PP1A 1CPUA 2QGYA 4O8AA 2VI0A 4H41A 4U10A 3BURA 3VCNA 4D6HA 1AODA 1DL3A 4OOZA 4ALDA 4F0KA 1A4MA 2QV4A 3NQDA 1JYWA 3F2CA 3LEPA 2PCEA 2WMFA 2QMJA 3HQPA 1ICQA 4DJDA 3ALFA 4B5UA 3VGFA 1Z7AA 4W4QA 3PULA 4CLMA 3R89A 4O16A 1W5QA 3RHGA 1XGDA 2E6YA 2QCHA 4ZMGA 1S3TC 1HIZA 1W5OA 2PDKA 3EPNA 4US6A 3C0QA 1PB0A 4MTVA 1N2VA 2G3NA 3ZSSA 1V6XA 2CITA 3UZZA 4UXDA 2DJXA 1GJPA 2EAWA 4F2BA 2CWNA 1OD8A 3KZSA 1LQAA 4ZE5A 4DPPA 1RD6A 1VB9A 4JEQA 4X0VA 2V81A 3T4WA 3UQNA 1Q6DA 4M1BA 1R9YA 2F2HA 2JEPA 3PZTA 3GO2A 3KOFA 2GZXA 3PNZA 1CLXA 2QYGA 1UP2A 4LWWA 1GONA 3TOYA 4AD2A 5FL0A 4YVVA 4TU1A 2F38A 4Q4KA 3WQ8A 1US0A 1JNDA 5JUVA 3RPDA 2GJPA 5EGRA 1BYBA 4ML9A 1K03A 5EMJA 1TUFA 2OO6A 3AICA 1Q6GA 4ZOAA 1B2YA 3WJXA 1EPVA 1TPC1 3UG8A 1M01A 4GQBA 2UWFA 5HNNA 3V3WA 1ZALA 1JD9A 3E0VA 3N6JA 4CVWA 1NAL1 1QATA 4NJGA 4UTKA 4EE9A 4XSMA 5EMUA 2VC9A 1GOIA 1P6WA 3YPIA 4QCEA 2O55A 4M8UA 4B5NA 3OJGA 5D2YA 4F3HA 3UJ2A 3LENA 2V6AA 4X9SA 2OELA 4N6FA 4EOUA 1W9DM 2DW7A 3OG3A 3ZJ8A 1Q4WA 2HVOA 4WEVX 2Q02A 4ERIA 8XIMA 2BWGA 1R3SA 2WWDA 4F79A 2ZDSA 4AU0A 1AMYA 1W1YA 3VIOA 4UQBA 2WC3A 1EO5A 1RQBA 4PMQA 2B7OA 4MFDA 5A6BD 1ZY9A 4Y9PA 1SSGA 5FOOA 3TQKA 4QSFA 1SO5A 3P61A 2VZSA 5G1YA 4BS0A 3THUA 3TC3A 1C7SA 1A5KC 1KM2A 1TZZA 3BW3A 1K4HA 2WKLA 1MXGA 2Y7DA 5CAHA 3HG5A 3W22A 3HJEA 3B0UX 1E1CB 1GZ1A 4GUJA 4XZNX 3FW6A 4QISA 3WD3A 3PZOA 2QV5A 1OT1A 5I00A 3IJ7A 3WBWA 2OVLA 3UW6A 3I7RA 1G4SA 1LF1A 2XIBA 2NQ5A 3W2UA 1NF7A 3VKKA 3QHOA 4UOZA 1AW2A 1XUUA 2YA2A 3H6OA 1VYSX 4LB3A 3L4ZA 1B30A 3VKDA 1CGYA 1FKXA 4YCOA 3UG5A 3K4DA 2EEXA 3DAQA 1Q2SA 1LWJA 1ISVA 3BPWA 3CASA 2ZZ6A 1XCWA 4Y96A 1SO4A 1EGMA 3PANA 4GI9A 1KKRA 1CTNA 3LM7A 1G6CA 2W62A 3ARTA 3B04A 4LSBA 4O54A 2VEIA 3AUOA 1ZP4A 4HK6A 1JUEA 4AZ6A 2HWGA 3TYBA 1HVXA 1MUMA 3POHA 4LYPA 5I3HA 3CZGA 4AY7A 1KRCC 2R8WA 1H7PA 4JIEA 2J7BA 2I5QA 4Q4QA 1IZJA 1M7JA 3ERPA 3WBYA 3UETA 4GJJA 4AC7C 4K2SA 2GGJA 3KL3A 5GJNA 2P3EA 3TN4A 4REQB 4HOXA 4WSJA 4XD3A 3LTPA 3LK6A 2X0YA 4M51A 2J13A 4QFUA 5LKYA 3W86A 1NFGA 3O7UA 2TPSA 3AZSA 4GKLA 4HCHA 2ATSA 3RU6A 2VRJA 4PTNA 4FOKA 3QR1A 4QQ3A 4AWEA 3EPMA 3VNIA 1XFCA 3G1DA 4E5TA 4EACA 3DEQA 1XLIA 4B90A 3PHAA 3FKRA 2NV1A 4QG8A 4QHRA 3O3RA 1RUSA 2WQPA 1P48A 2D3NA 1TR1A 1BKHA 3QZAA 3MZ2A 2ZXQA 2XSXA 1E51A 4AEOA 2J27A 4PCTA 3CC1A 4K39A 4XAZA 3B8DA 3BV4A 3VD9A 1R87A 5C0QA 5FSEC 2Y0FA 3GNPA 1PAMA 4JTRA 1KFBA 1XLAA 1AZ1A 4Y8FA 4NZ5A 1RK6A 1Z69A 3NO5A 4LXFA 1FP9A 1SO6A 5B7YA 1HL8A 3F4CA 3LHTA 2E4TA 1VYRA 2H6RA 2QLYA 1EJRC 2I17A 2OQYA 3PWIA 4LRTA 1QPNA 3W6MA 4JZ5A 3ZR4A 4H2CA 3ZOAA 3Q45A 5G2HA 1LORA 3TONA 3LBOA 1ZL1A 3SRKA 1DWAM 3MUXA 3EMZA 2QUUA 1WDDA 4EPDC 2Y1HA 1Z42A 4UTTA 4WZHA 5DO8A 4HNCA 4X60A 1ONRA 3V5FA 3NTYA 1ISZA 1SMAA 1E0TA 3ARRA 4UNKA 2ZXBA 3NQFA 3ARUA 2C16A 1KFKA 1DOSA 3WDPP 2GQ8A 1U22A 1H62A 3B03A 3CHDA 2V5KA 3Q65A 2QJNA 3W7CA 1X96A 3FSUA 3R0KA 1W9XA 4JCMA 4NZ1A 2CLMA 4LVBA 4PSRA 4XQ6A 4IMEA 3MSGA 3UR2A 4B4HA 5I23A 5FJPA 2FTWA 2O4QA 2YB4A 1KV8A 3PVFA 3TNBA 2YPIA 4H2HA 1J0IA 1CXKA 4Q8VA 2G50A 3K8KA 3LPPA 3BV7A 3UR5A 4HVXA 3G1HA 5BWAA 1E72M 1GOQA 3NGFA 3S42A 1VCVA 1R5YA 3NQVA 1IWAA 4E2VA 1NQKA 2NVDA 1WDRA 3ITVA 2DSWA 2YYTA 2NLIA 1GT8A 1M04A 2EPNA 3DYMA 3UP8A 3KRBA 5ECVA 2CLLA 4MVAA 4Q8PA 4ZZ9A 3NNTA 2E77A 1DJQA 3MT1A 3R4IA 3S0CA 1KC7A 2YCJA 5RUBA 1KBIA 4IUOA 5AYZA 3RNDA 4O1FA 4K7VA 4JGDA 4DAFA 3MY9A 1Q6EA 2J24A 3BQ5A 3W7LA 3RR4A 2J25A 3VMPA 3ZVHB 4ERAA 4FI4A 4IQJA 3R2GA 3AI0A 5D2VA 5FL1A 3OIXA 1SZNA 2VFEA 4UTWC 3AUJA 3LLXA 4FNPA 3T0CA 2P8BA 1P1MA 1B3YA 2D69A 3FIGA 3GXDA 2HXTA 1OK6A 3ABOA 5D02A 1XBVA 2XSAA 1ZAJA 2BGNE 1C29A 1CEOA 1KFWA 3CMGA 1SR9A 1V02E 3H54A 1XRSA 2DH2A 2I14A 1Q6OA 2OSXA 3ANVA 3MVIA 3AHTA 3V0UA 2QF7A 3ENLA 2VWTA 2L5HA 4L1WA 2NWRA 2GSJA 1FVPA 1Z89A 4KIEA 4TVUA 3TV8A 4OHQA 5AYBA 3L4YA 4LBSA 4MY1A 3A12A 3L2MA 1K4GA 1QCWA 1QPRA 4HSHA 2NQHA 3A47A 4US5D 2CLEA 3KRSA 3HPFA 2WW5A 3ARPA 3W26A 4LS1A 1E4LA 1OM0A 1ADOA 1P5BA 3L9CA 2MNRA 4LOCA 1PZ2A 2YCLB 1V08A 4GZEA 4GPNA 1B4KA 4F0LA 3UZXA 3WG6A 2VEMA 1YNPA 1Z48A 1RLCL 4IIHA 3KHJA 3NZQA 3CV7A 5G2WA 4MM1A 4Q4MA 1E5JA 4DZAA 5ABFB 3WD2A 1ZTVA 2R82A 1WE5A 2BV9A 4PTVA 1XD0A 3M07A 3NL6A 4OOUA 3IJ9A 1M1BA 1SFSA 3BLFA 1GW1A 3F5LA 1UKQA 4F2UA 4J9JA 1VJZA 4HPGA 3PP7A 1OSEA 4H83A 3ZJKA 4AZIA 3DFNA 2ISFA 4DHGA 2QF8A 4O53A 2O0TA 4YTRA 4FXJA 4IPPA 1YDNA 3VDGA 5A6KA 4BQ3A 1R38A 3TCEA 1V6YA 1T99A 5I77A 4O1DA 3VGGA 3HURA 4PFMA 3IK2A 1TJ1A 4JX4A 5EBAA 4DJED 4H8UA 9XIMA 2PWDA 4I9MA 4RX0A 2DY3A 1UBSA 4F48A 4S3AA 4HCLA 2QCFA 5FSDC 2R1KA 4C1KA 1UR4A 1K6WA 2PDWA 4AD5A 1OFOA 4Q8TA 1ML1A 5BWFA 1EXBA 3BG5A 3GFZA 2WNNA 1TWWA 3W87A 2X1UA 5KTLA 1ITQA 2VGFA 3VOGA 3VKCA 1LTDA 1KRMA 2VJXA 1WKDA 3VFCA 3KCLA 3PZNA 1WB0A 2A0NA 2PZNA 1QUMA 1GVQA 2VURA 4HZ8A 3CHCA 4H9TA 3HPAA 4A6GA 2V63A 5FF2A 1CGTA 1A0EA 4AY8A 3BAJA 3GZAA 1SZEA 2ACUA 4XKYB 3W1TA 1EKOA 2X8RA 4HJWA 1VH7A 5DFAA 1RK5A 3UGRA 3T81A 4MNLA 2QQ6A 4K1GA 2NLYA 1P43A 4A3YA 4MB1A 4JTHA 4IG2A 5D2WA 3GNDA 1W0MA 4JHZA 3MCOA 5C71A 2FVKA 1S5WA 1RPXA 4PCSA 3T1GA 5DMYA 4UTIA 2FLIA 1FCVA 4GLEA 3GXTA 1DQWA 3VMNA 3KRUA 4S3EA 3LLDA 3PF3A 1XH1A 4QAWA 2YXOA 4LAUA 1QNSA 4ZTYA 3M9YA 2F84A 3THDA 3DESA 4TXEA 3OA3A 5GPRA 3SRHA 2J7FA 3M7WA 3WFZA 2HK0A 4JTJA 3LPOA 2RAGA 4KT2A 1J4EA 4LH8A 4K36A 1HW6A 3A24A 4CD6A 4HMCA 5K9CA 5CPOA 4DJFC 3TZFA 3WENA 3VZXA 2CETA 3ZM8A 5I3FA 4UCGA 1X7FA 3UJEA 1QOQA 3W2KA 1UH2A 2J6VA 3SQMA 1GZJA 5I79A 3RM9A 5LXEA 4NU7A 4E6MA 3R94A 5HPCA 1JNEA 3NEHA 5D9MA 3WK2A 1JGIA 1Y5WA 3DKLA 3CQ0A 2C71A 2Z1XA 4KS0A 5JXQA 1FWCC 3UZ5A 1RP8A 2INEA 3W71A 2BY3A 4PMNA 4WGHA 4JFTA 4Q8QA 3LHVA 2PGWA 1NFBA 5D38A 2WVVA 3VK5A 5CC5A 1BGAA 3FVMA 1LUCA 4IH3A 3UD6A 2Y6ZA 3O06A 3ZXWA 3EB3A 1W3LA 3JW7A 1TYGA 1XLKA 1SFTA 4QDWA 4LV4A 3OBAA 9CGTA 1EQPA 2RDWA 3B9NA 1XLGA 1ZQ5A 1OC6A 1NQ6A 2Y88A 3ZMRA 5M5DA 2YXGA 4KEVA 3G0SA 3C2EA 3CL7A 3NEVA 3TN6A 2QIIA 2C15A 4JNYA 1F74A 5E0KA 6ENLA 4GC4A 3LS9A 1JYVA 2FZDA 3ZYZA 2PDBA 2Q71A 2ZFAA 2XIMA 2NXHA 1FWHC 3WF4A 2O92A 1BXNA 1GOOA 5IDIA 3GXMA 5FJRA 3DFYA 4IICA 2G5WA 1QASA 4UNIA 1ME7A 4A3RA 6XIAA 1ZJBA 2QS8A 3CUGA 2G0WA 2ONEA 4O1EA 3DU0A 1SYTA 1DIKA 4N02A 4HHLA 4PTXA 3LQLA 1RBAA 1ZZMA 3OIHA 3WO8A 4WDXA 3BAYA 1ITCA 2ZTKA 3E49A 1A5NC 3IV3A 1AZ2A 3L2LA 3VCRA 4GCXA 4XTDA 4A35A 4NX5A 4RXGA 2BMBA 1D3HA 3VOIA 3VOJA 4TV6A 3GZ3A 2V5LA 4WQ6A 1TPVA 5CG0A 3NWRA 1GNXA 4NZ4A 3EOSA 3MKVA 4TMBA 3NO3A 3OVQA 2E5DA 4FLQA 3UESA 1MEWA 3NJ3A 2HTMA 1SW7A 1UIOA 6REQA 5C2GA 2ZC8A 1HKKA 4TX9A 3II1A 1BKSA 1YBQA 4W7VA 1E1EA 3ARSA 3P80A 3QY6A 4UUIA 1YPFA 2Z6IA 4I6KA 2D0GA 4GQ0A 4D72A 4E2BA 5M3WA 3MCNA 4N9BA 5CAKA 3RJYA 1X98A 4DBWA 5I3GA 2ZUUA 1IT7A 2V8ZA 3QMSA 5HINA 1F05A 4WOZA 2CHRA 2XWEA 2D2HA 3WUFA 3STFA 3WDJA 3K8MA 9XIAA 4L56A 4XBJA 5ABGA 2POZA 3E6EA 4HK5A 4PMRA 1RBOB 4Y9AA 3O6CA 3WH5A 4FPSA 1M41A 5GJPA 4NXSA 1G5AA 5IM51 1TIMA 3U57A 3EDDA 3JUGA 1UQZA 1P4CA 3QTPA 3SCRA 3HPXA 3TAKA 7A3HA 3I6TA 2AAAA 1RCQA 4LJ3A 1V02A 1EOKA 3NDOA 4C1NB 8XIAA 4QE1A 1REQB 2YDSA 4RJEA 1EH9A 5C6MA 1VKFA 1WKFA 4C6MA 1A0CA 4TVCA 1JZ4A 1FOBA 1I0DA 2ZWZA 3S3GA 1JPDX 3FKKA 3PB2A 3VM7A 4DYKA 1BG4A 3T78A 2J7GA 3NOEA 4I7VA 3VIKA 1QI2A 2HEJA 3SY8A 5CEWA 3BLKA 2WLYA 1KKOA 4MPKA 4J3WA 2NV9A 1SW3A 1NARA 3HBLA 1WOBA 1O5KA 1ZJIA 2J74A 1TA3A 2Z1WA 3WQVA 4NHVA 3WEOA 2NQ9A 1D2KA 4DWSC 3CH0A 5D2TA 4IPLA 1P6CA 2X0HA 1EO7A 3WDHA 4B3LA 4O0QA 1IR2A 3BGJA 4LCQA 1L2UA 3PN8A 3DH7A 3E0IA 2CBJA 3E0LA 3L4VA 2PF8A 3SCUA 1H0GA 5AC4A 1QHOA 3EB4A 2YZRA 1PCKA 3ELFA 3A4WA 1EOMA 9RUBA 4LX4A 3ISIX 1NWRA 3MSYA 4D6CA 2OSYA 3MMUA 1B3VA 1UZ1A 4M0XA 3DXIA 3DENA 5C55A 3SUTA 1YYAA 1OFBA 1I2RA 3CAVA 3DBPA 1ZP3A 5DMLA 5LIYX 3ARZA 4TV5A 4I7UA 4ATLA 3SI9A 2WZMA 3JRKA 4MNMA 3CUZA 5DANA 4OUEA 4IHCA 4YL2A 5HMDA 1E9IA 3J7HA 5E6ZA 1KO0A 5JH2A 1R7AA 3UT0A 2V68A 1WQ5A 3C2RA 3IRDA 3RIKA 2UY2A 2ZA2A 3WF0A 3B0PA 3VIPA 1BD0A 1IT0A 1ODUA 3OQEA 2BVDA 4PULA 4UB9A 1UC5A 1A5OC 1FXPA 2E0PA 1VRXA 2Y8KA 4L9XA 3B05A 2EXOA 3KOWA 3GIYA 4LBRA 5CZJA 4Z1CA 2FHCA 1FWEC 2NUWA 4XAPA 1DPMA 3A4XA 3KCJA 2RJGA 1QPOA 3WLSA 3SDOA 4M6QA 3WN6A 1EHNA 4PBGA 3NYDA 1BXCA 1WDPA 1H7RA 4J2PA 4MY9A 4QBXA 3WLJA 4JN8A 2CXGA 2EG8A 2GVYA 3TA9A 3VGHA 4PR4A 1G7UA 1TREA 3Q37A 2I1OA 4B16A 4IJBA 4XAYA 3Q94A 4L80A 4RE3A 3EA3A 3C56A 1LLOA 1XG4A 3QJAA 1SMDA 1LOSA 3CHEA 3CL8A 4GISA 5DCDA 2OQLA 3TQVA 1EYEA 4RPQA 2ACQA 3AALA 3MO4A 3VGDA 4WY0F 1VPYA 1ZU8A 3RMJA 4UTTC 4X3ZA 2VELA 1J0JA 2D1ZA 1UUMA 1E9YB 3KW3A 1D8WA 1JPHA 1K9DA 2CHNA 2KAUC 4GXWA 3TC7A 5XIAA 2Z1VA 1Q7ZA 5BXTA 1HT6A 3G24A 1PS9A 3KAOA 4IFKA 4PH6A 1QI4A 1XBXA 3F4NA 3GTFA 1O7AA 3ARXA 3GC2A 3V4BA 3MV01 3WJWA 2YCEA 2NWSA 1EPXA 3NQ6A 4S38A 2D3LA 4Q4SA 3CS2A 2ZCGA 5TF0A 1XLFA 2VEPA 1F6YA 2DT1A 4FB7A 4KFPA 1KBJA 3VO0A 2Q8ZA 3FA4A 1CNVA 5AHFA 3VKJA 3GTNA 5M17A 4AAJA 5HJLA 1CECA 1LRQA 4RPPA 3FEQA 5HNRA 2TMDA 4IM4A 1E0XA 4GYPA 2WZIA 2YA1A 5KEZA 1XLJA 4HZ7A 2Q6ZA 3EKLA 1TV3A 4WR3A 1SJBA 3FDKA 5C5YA 3W83A 3G1FA 3FJNA 4LVFA 2PU1A 3TWAA 4PRWA 3A6OA 1TVPA 3APGA 4WCJA 2Y7EA 4Y9MA 3BLLA 3OVGA 2C19A 1B3XA 2J9XA 3R11A 3AMGA 5ABHA 3AIBA 2ZOXA 3SCVA 1GZGA 2PTYA 2YZ5A 4NI8A 3SSZA 1WDSA 2OEJA 3NM1A 4TQTA 1HUVA 1VEMA 4KWSA 3U0HA 4V33A 4GUHA 4PRRA 2AQOA 2FGBA 3LD5A 3JR2A 4C6JA 4HN4A 4N0RA 3PFMA 3S1GA 3QLLA 4GA8A 1DJYA 3B9DA 1BYCA 1SM9A 1JPKA 3TKFA 1VIWA 4EIVA 2BODX 3WLMA 4JXCA 4D8ZA 1JZ3A 3RUBL 5DY3A 4FNTA 3GNOA 1W5PA 2XVPA 4NASA 2E09A 3BQ6A 4QM1A 5A8QA 3NZRA 4EVZA 1ZENA 1V6VA 4MF4A 4ML4A 2DZBA 3PWAA 3MZNA 3ZT5A 4W86A 4RW3A 4AH7A 3TDFA 3BJSA 3S5NA 2J75A 4MWAB 1EWDA 3NPWA 1XBZA 1XIFA 5HPOA 1HZYA 1U5JA 4PB5A 3H2FA 4B5WA 4OTKA 1RH9A 2E7FA 4E8CA 2PDGA 1BYDA 1A5BA 1JUKA 2ZUMA 2TYSA 3MKKA 1K7XA 3AMLA 3DN5A 3PJTA 1IXOA 1NP0A 2QCCA 2DU2A 4AEFA 3UWEA 3CT2A 1FWSA 1VAHA 2VGBA 3WLKX 1VCGA 8TIMA 1F5ZA 4IMGA 3UY8A 1XYZA 4KF1A 1D3GA 4WJEA 3ARQA 5LGXA 4ZQMA 2ESCA 3R13A 5AY7A 1BF6A 3BO9A 2AGTA 1PL9A 4B9ZA 1OCQA 1JPMA 1RD5A 2OODA 5A8OA 4K7YA 3W73A 2R1NA 1PZ3A 2XH0A 3M0JA 3PS7A 1GQIA 3DI1A 1UKTA 3CV1A 4KRTA 3WDQA 4HNLA 3C2FA 4GFIA 4H6EA 1DBTA 1PSCA 2KX9A 2VEKA 5E1QA 2W79A 1TJ0A 1RVKA 3QVQA 3M4HA 4HPXA 3TTYA 3EEGA 1P1XA 5A3HA 4C65A 1VQTA 5I07A 2X7WA 2HPIA 3TR2A 3E38A 2YA0A 5J04A 2MANA 1CW2A 3M5XA 4DO6A 3UXDA 2DUZA 1H4PA 3FLUA 2E5BA 3NQCA 4JIPA 2OB3A 1XINA 2HNHA 2YB1A 3HQNA 1WAWA 1AJ0A 2ZZ7A 2OYKA 4DUOA 4YXGA 2GVGA 2BTMA 1GG1A 4ENLA 2XUCA 2Z25A 2OZ0A 3PBWA 1TRDA 4HPNA 1JQVA 3TYAA 3GDBA 1VFFA 4KEZA 3TJXA 5FF7A 1S1PA 5I0DA 5AFDA 4DUXA 5JU6A 3D5HA 1I1WA 3EGJA 4LRSA 1JCLA 1EZWA 2VZVA 3GH5A 5F1UA 1FWAC 4K3ZA 4R53A 1A5AA 3UU0A 1WBJA 1H5YA 3M0KA 1T41A 4NJJA 4QITA 3UWQA 1XFBA 3RU8X 4L6OA 5BRQA 3C2OA 3VE7A 5IBXA 2CYGA 1HGYA 3GKAA 1O4UA 1QT1A 1X6NA 4MGGA 3VABA 1H63A 2QW5A 2DEPA 1RJPA 4QX4A 1IIGA 4M7SA 1E3XA 2AQVA 4XAFA 2QPXA 3F03K 1GWJA 2H90A 5HQLA 2OZ8A 1NWUA 2VDHA 3APTA 3B40A 5HAOA 3RK8A 5F7UA 2DZVA 3PTQA 2DZTA 3QSRA 1HP4A 3BL3A 4GINA 3HOJA 3CT7A 4WJXA 3T9PA 4GGBA 3G1YA 1WBHA 3DG6A 1AJ2A 1UZDA 4GY0A 4O28A 4YU1A 4I8YA 4RKAA 2AAMA 2PDPA 4DELA 1FDYA 2X1RA 4DZ5A 4A2SA 4JL2A 4ZSTA 2XYLA 4WJ8A 3AZRA 3B8TA 3VILA 1BF2A 3DC8A 3QYQA 3PZGA 3EOOA 3ZLFA 3SCPA 3QGVA 1UPMB 1RCXB 1XR2A 1FH8A 2I57A 4NVTA 2XFRA 4LNCA 2YL5A 4WX2A 1CGWA 2PFHA 2VD8A 3C2YA 2ASHA 3GNNA 1PWMA 2YDRA 4ZXLA 4HHPA 4KWVA 2P3ZA 2JGQA 1IGSA 2FJUB 2PP3A 3T2PA 5XIMA 4RE4A 1YQ2A 1GK8A 4X2PA 4AXNA 3IK4A 2O7SA 1DJXA 3FAWA 3WJYA 1QBBA 3W1QA 2WHJA 3GS6A 5LNVA 1RCOB 1KCLA 2D0FA 3CV2A 4C7GA 3CAKA 3AC0A 1LM1A 4PTWA 3LCFA 1UA3A 4FAMA 4E4PA 4A21A 5T8GA 1A5UA 5C70A 3PBGA 5CZSA 1FCUA 4JIHA 1HKJA 2XISA 3ITOA 3R8GA 3DDMA 5CH9A 1J9YA 5U7SA 4BI5A 3T8QA 1Q8JA 4AEEA 3A4AA 2YCKX 1H0IA 2A3CA 4ADTA 1XIHA 3SN4A 4QP0A 3HPSA 4UZUA 4FLOA 4EANA 4HTBA 4LVAA 3THCA 4C6IA 3VC6A 4OBTA 3C0LA 1LCOA 4M56A 3LDVA 4EWND 1OF8A 4QE4A 1US3A 2GVLA 3FCPA 1V0NA 1HJSA 1JDCA 4P8WA 1VZWA 2B7PA 3N9KA 1TTPA 3STGA 3S2NA 3K30A 4NNAA 4HK7A 3WBEA 2QJIA 2VQTA 3ID7A 3E02A 4MZ1A 1UWIA 1LRTA 4MADA 4YIWA 1A5LC 3GC4A 2OOGA 4KPLA 4HA4A 3SSJA 1D3CA 1UR2A 3TJ4A 3TQ0A 3DUGA 3LYEA 1UB3A 3GU2A 4LCSA 3W1NA 2QDEA 4QJ3B 3GDLA 4MUPA 4EX4A 4PMYA 4ZO7A 5H1WA 2X05A 3VPLA 2GJXA 4GJIA 4XKMA 4ICNA 6XIMA 2NVCA 4OT7A 2JFEX 1GVSA 5AECA 1KM3A 3NYZA 3G3MA 3R7MA 4BF7A 3L4UA 4FXSA 1TV5A 2Y5JA 4C6FA 2A6NA 1HKMA 2VO5A 3VVGA 4FSAA 1XS2A 3L5MA 3N14A 3VOFA 1LT8A 1IZKA 3H22A 3LN3A 3VD4A 2JQXA 3IGXA 4FX6M 4OIFA 3BZJA 3RX4A 4MWAD 3ES7A 4PN2A 2DDXA 4XUGA 3CB3A 1KM0A 3UJRA 4S3DA 1DJZA 1HO1A 3WF3A 2WKJA 3KEHA 4IWWA 5LIUX 1W3KA 2V3DA 5I78A 5ABTA 3OBKA 1ESWA 5EMKA 3K2GA 4DN1A 1T0OA 5G4HC 4FIQA 4K8HA 1E6QM 1PIIA 3NSXA 3GE7A 3QOMA 1A5CA 1E1FA 3I10A 3HB9A 3W7KA 4CD5A 1Y8BA 5T9CE 4AY1A 5A6JA 3L68A 1XRVA 3RMEA 2ZZ3A 4QEEA 3AISA 4DJDD 3WELA 1KLYA 3W29A 3I4EA 2ZBTA 4DBDA 1S5TA 3C5QA 3T09A 2G37A 3MP5A 3UR7A 5CLWA 1W1VA 2FQIA 5HK4A 4L6HA 2QCEA 4NKCA 5D04C 5A95A 3KS6A 4YWIA 1ISXA 2WNQA 2GDQA 4WIWA 4PTMA 3B9EA 3S9YA 1YXDA 4B9YA 3AZTA 4RZBA 1ZHAA 3S6DA 3MTWA 3DFTA 4J28A 4IQEA 4PZVA 1XV8A 2YYUA 3W9ZA 2E9BA 3NPXA 1UR9A 1H11A 3B8UA 3ZQ9A 1GW9A 1R9XA 1W1IE 3LNMA 3PM6A 1GKQA 4DY1A 1MW2A 3BGGA 2PODA 3W7GA 3LSCA 1PEZA 2Y8UA 4ZODA 2ON3A 2WVUA 2PCQA 3LGDA 5BXSA 2YGYA 3LPGA 1V6UA 4NUWA 4AZGA 1O94A 4Q6JA 2A1YA 4Q8MA 3RXZA 4GABA 1A50A 1EA9C 3O63A 2XVLA 1RV8A 3T2OA 3CQJA 1FFQA 4CD8A 1FWWA 4GO8A 2EKCA 1P0DA 2EBNA 3QR0A 4O15A 4C6PA 4BJHA 3G6MA 3OODA 1Y65A 4PC8A 3T05A 3E0FA 1OF6A 1EJXC 1J96A 2OWCA 4PB4A 2PDQA 3RCNA 3GIPA 2PURA 1CB2A 1JCYA 3HV8A 1FTXA 1PBGA 1ECQA 3VIGA 1FH9A 3G22A 3VUSA 2PPGA 4WKFA 4Q33A 1WPCA 1GVIA 4JTLA 3CLWA 2BNJA 2PC4A 3MB9A 2VX7A 2NX9A 3VNLA 2ZZ5A 3D6NA 3L65A 3H21A 1U5VA 1W1B1 2EJAA 1EUNA 5FF0A 2YFNA 1SUXA 4S3BA 2MUCA 3U2OA 8A3HA 3P8JA 1E4IA 4B92A 3V1PA 5CQ1A 3N9SA 4HZMA 4HHHA 1AG1O 3EX3A 1PX8A 2V3FA 2RH9A 3VX0A 2CBVA 1UWSA 4G7FA 2OFJA 2OTDA 3D3AA 2O4MA 3W88A 3GDKA 3GU9A 4GGHA 1FCBA 3V0SA 2A7PA 4UTHA 3OLIA 4LAMA 3AAMA 5H91A 3NZPA 3U7BA 1DE6A 2AKMA 1NEYA 2WV8A 1YX1A 1Q7MA 2X1IA 3FAXA 2FH8A 4IFRA 3JS3A 2VC6A 3T0TA 1IYXA 4PODA 3PR2A 1IR1A 3N15A 5CBBA 1OIMA 4I3GA 4RCXA 1LJYA 2OMAA 1S2UA 1KTBA 1MEIA 3VNDA 2VZTA 4JTCA 2J7EA 3KVMA 2BP1A 2GQ3A 4O13A 1TWSA 3N25A 3W2JA 3EZ4A 2QJGA 3PZIA 4EPEC 5HOSA 2D2OA 2J66A 3GBEA 4XZWA 2DZAA 4MYXA 1YW1A 4MAZA 4LB4A 4Q32A 1UKSA 1A53A 1ZBVA 1XKJA 2H3BA 6A3HA 2H8ZA 3GUGA 3JU2A 4YWSA 4J4KA 4BR1A 3K1GA 2ZX8A 3T55A 2E40A 4MAVA 3IIOA 1NVMA 4RDVA 4RZ6A 2QZRA 3FY1A 5CBJA 4G8TA 1CENA 4QNEA 5KINA 2W61A 4GYPC 3PBVA 5ECUA 3WQEA 2BASA 4IMCA 1D7FA 4QG6A 2PB1A 1SJDA 3UZJA 4M29A 2PDLA 3OZYA 5F4WA 4OV9A 2QPSA 2AKZA 3LX9A 1W32A 4FNQA 4ES4A 2WAGA 4GOAA 3LXBA 1ZSXA 1NDYA 5A8PA 1N7KA 3I4KA 1MZHA 2FH6A 4CQAA 1OHLA 1V7AA 3N2OA 2J6XA 4WRHA 2DV0A 1K9EA 4MWAE 1NOFA 1CGUA 3NQEA 4FNRA 4J7RA 3BAXA 3KTXA 1K02A 4W5UA 1GQKA 1TKKA 3LMZA 4IG2B 1LOQA 3DHFA 3L66A 4FX7A 4PUWA 4YJ5A 3B8WA 2INFA 4XVDA 2PU0A 2VENA 3RCYA 1QW7A 4E0CA 4YTUA 1H2JA 1BSLA 4FR1A 2CLHA 3EXSA 5AYIA 4YTSA 2W3ZA 3M5ZA 1X39A 1RPKA 1PHQA 3CV6A 4WSHA 2A79A 2ZXDA 3OGSA 2VCBA 4L9YA 1RA0A 1GYLA 1RXOB 1WNOA 5D8WA 1TO3A 4Z0SA 3QYSA 3H7VA 4WHBA 3KBNA 1HN1A 3BJFA 6CGTA 2ZVRA 3S5SA 4J27A 2CERA 4Z1YA 2P53A 3BCDA 4JNZA 3CWHA 2XWDA 5EFDA 5AHMA 3N4FA 3PK7A 1MRQA 4CU8A 2WC7A 1PKLA 4X9YA 2WNZA 1XRTA 1KBKA 2XJ7A 4U4MA 1KFCA 1H61A 4F0HA 3WLTA 1Q2RA 1K1DA 1MSSA 2XIOA 1VENA 1H49A 3BK0A 2CC0A 3GYEA 3NSMA 1GYNA 4GG9A 1YEYA 3MA8A 3CIXA 2PTDA 1PDYA 2NX1A 2TRSA 4HA1A 1QBAA 3BAKA 4ICCX 3S4TA 2YKKA 4ZXOA 2WVVB 3MMTA 3TU9A 1LUCB 1H60A 5CJMA 1KW1A 4Z08A 4LUSA 4AD1A 3EDKA 4LALA 5K2ZA 1ONWA 4QJ1A 3O1NA 3A5FA 1SPQA 2CLKA 2D23A 3RILA 4TR9A 2PRMA 1F3WA 1W37A 4WXYA 2BX7A 5BMWA 4CGTA 2FFCA 3KZPA 3QLDA 4JFUA 4XZIA 3A3WA 4S2CA 3HMCA 4CNSA 1W1ZA 5CGMA 3A3XA 4IGNA 1J79A 3SFKA 3BSGA 5TD4A 1XLEA 5G2IA 1KWGA 4G1KA 1TV7A 1EEXA 3MI3A 3BLEA 2WXDM 3AIQA 2C18A 2E8YA 4PUUA 2J62A 4K8EA 1IGWA 1PKMA 2PD9A 4Q22A 5HWMA 1LT7A 3GXNA 3VDBA 1BEUA 4U2ZA 3FGCA 1TPWA 4QLLA 4PMZA 5CPSA 1V5XA 2RGLA 3SCQA 1UA7A 2W91A 4MKNA 4I6VA 1G0CA 3IJ6A 4LCRA 4GI8A 3FXYA 1VJSA 2CU0A 3HPZA 4QR6A 1VBUA 3D46A 2BFGA 4J3TA 3C8NA 1ADSA 3OPSA 2OR2A 4DO7A 2AL1A 2BDQA 1MMFA 2Z1BA 4FF5A 3DGRA 4CN1A 3ARYA 1QWGA 2VFDA 2WZHA 2GLKA 3HGSA 3R12A 1ELSA 3IWPA 3CH9A 4IGSA 5BOFA 1BRLA 1SFLA 3TR9A 2J7CA 8RUCA 3H26A 6REQB 1XDLA 1GKRA 3KHDA 5AZ0A 1J2BA 1YBQB 1GYMA 4JYFA 5IBXC 2E1DA 1CXEA 4W85A 2ZXAA 2Z6JA 1XDMA 3CNYA 3TSMA 2P1FA 1WAUA 3TK7A 1XYCA 5BYWA 4KQNA 3P5YA 2A2IA 2HSAA 3QPYA 3O0FA 4JX6A 4HZ6A 3WQ6A 1E4MM 1W2PA 2J88A 1W5NA 3NQGA 3ATYA 3L5LA 4JNMA 4MLRA 3WLHA 4KIRA 1ONEA 5AHEA 5CCZA 2Q09A 3BWWA 3TYZA 1XW8A 2ZDRA 2QAPA 5DEZA 1SZFA 1R2TA 3E9AA 4QRNA 4JHOA 4AW7A 4XWUA 1JCMP 4ORIA 4WK9A 1D9EA 2ABBA 3SADA 3DFSA 3O2LA 3PPFA 4F66A 3UEQA 4FX8A 4ADSA 4AVFA 2ZX7A 3G77A 4UTUA 2NXIA 3N2TA 4FA3A 1EXPA 3N18A 3XISA 2EG6A 1IQ8A 1IWBA 1YTKA 3GG7A 4O4VA 3UCDA 4QS6A 1ICSA 1HQTA 3OU8A 3B0YA 4J3ZA 2DUXA 3VNZA 5HMFA 4YYFA 2YBUA 1GHSA 3T4CA 4L6DA 5GNYA 1QI0A 3DIPA 3CUXA 1ME8A 1OT2A 1FWJC 3GRIA 4GVIA 4LVGA 1EF3A 4CU7A 4MKVA 3DECA 1T7LA 3DFPA 1QMLA 4HNVA 2EGZA 3OVPA 5CJ5A 3AHYA 1RVGA 3OOQA 4TVDA 3SY1A 1PTAA 4NSBA 1TA3B 3MYOA 4J35A 5GVJA 2IKJA 4FZIA 4EXQA 3M0VA 5FAJA 3EKZA 3USBA 3Q67A 3H23A 1T8QA 1VC4A 5EL1A 1B90A 1W9BM 1HFBA 3W7RA 3WQOA 1K7FA 1JPIA 4HJFA 1V8EA 4L4OA 4FIRA 1U1UA 2Z4GA 1GKPA 1ALDA 2JEQA 2WVSA 3WJZA 3H2EA 1OX6A 2FZNA 1QDSA 3NA8A 4B15A 1H41A 1IF2A 5EU9A 1RBLA 1VFUA 1GQLA 2DSVA 4J40A 2XZ9A 1BQCA 2G95A 3EEZA 4WDUA 3AXIA 4XTIA 2WC4A 3AXMA 2QHAA 4IL2A 1JRBA 2VC5A 3LHZA 4Z1BA 1CXFA 3WK1A 1UWRA 1CBGA 4JOMA 2I9EA 3ARVA 1HKVA 2YDAA 3N34A 3E2QA 2R1MA 5J8LA 5EKYA 1BVWA 5K9XA 1QO2A 1OD0A 4MFEA 1V93A 3ECQA 2YR1A 4C6EA 1W3NA 1TZ7A 2F6XA 2HDJA 5AC8A 1L9WA 1GVRA 4AZ5A 4C6KA 1S5VA 5FEZA 4X2RA 1DXEA 2C0HA 1TJ2A 4PUMA 4O1AA 3QC3A 5BRBA 2ISWA 1W56A 1LROA 5BXRA 1S2VA 4PMDA 3BOLA 1PIGA 1W2VA 4BQ4A 3BARA 3H2AA 2CZFA 1ITXA 2OWXA 4JDBA 3QF0A 3IRSA 3QQWA 5A6MA 3A22A 2KZHA 1RY0A 4C6LA 2X09A 3P67A 4L65A 2QULA 4JIRA 4Z1AA 2WJEA 3LGEA 4M24A 3C61A 4S3KA 4WF7A 3O6YX 3T08A 4HD5A 3E12A 4LC8A 3IUDA 2PEVA 1J0ZA 3TMQA 2WLZA 4QROA 3GH7A 2QMKA 4O14A 4LUIA 3BXWA 3LCWA 4Q7BA 2EF9A 3E3HA 1KM4A 3WD4A 1Z32X 5HNTA 3BICA 5EMYA 5AC5A 2YJQA 1TPB1 4KCVA 3KVLA 1IT8A 4FOJA 4ZO9A 5A5WA 1X38A 4L1XA 3DX5A 4IFKB 3L0KA 2VCCA 4LUTA 3SUVA 2PGFA 3IJQA 3IJLA 4DZIA 2E9LA 3UVAA 4DYJA 2IMRA 2ZWYA 1XUZA 3LHWA 3KTSA 3TFXA 3OBEA 3GY1A 5AC6A 3W24A 3BSMA 3URNA 4BA0A 4JFVA 4DM2A 1CI1A 5H8MA 4FO4A 4Z2GA 2PC8A 1N82A 1DTUA 3LY0A 3V0TA 1TTIA 1PWLA 3SN1A 4IGHA 1F3EA 4MKSA 3F4WA 3UNTA 4V27A 5CGTA 1J6PA 3V75A 4CCDA 5K3VA 7TAAA 1EC7A 3GQYA 2ZUNA 3AOFA 1RP9A 1QOXA 2RDXA 4BQ5A 3VC5A 1MEHA 1HL2A 2ZA3A 3W72A 3UNDA 1DHKA 2VM8A 2ADAA 2V82A 4C5ZA 5HBFA 3W74A 1E71M 4D6GA 4ORMA 1KFEA 3ZJ6A 2VQUA 1V3KA 2NVAA 1W91A 4CQ8A 5K4XA 1OGGA 2AMXA 4C91A 1TQJA 4GIAA 3CUFA 1EBHA 3IJDA 2ANUA 3QPZA 1HJWA 3BMVA 3SRFA 1GPFA 5JVLA 3KOXA 1G01A 4LS2A 4Z0JA 1Q6FA 3P81A 1LG1A 2QT3A 3W75A 3M16A 4LYQA 2A3AA 1UKOA 4ZA0A 2NUYA 1HX0A 5FAGA 3UJSA 1XYMA 3G3DA 4KKXA 3WCZA 3W7EA 4CCCA 5LA1A 2NT0A 3GX9A 1EGZA 3R0UA 1V0MA 3OGVA 3PG8A 4JN6A 4EKJA 5DY2A 1ZCCA 3W27A 4LANA 4HMNA 1EDQA 1TWIA 1C7TA 4IJCA 1XCXA 2NSOA 3TCSA 3NGJA 1JD7A 4Z2LA 2GJLA 2FKPA 4XIMA 2CZ5A 4S1FA 4AD3A 3GW3A 3M0MA 4A22A 3RLUA 4R9OA 4M82A 4V2XA 1Q8AA 5D32A 1UOKA 1OINA 3DFQA 3IVTA 4UCFA 3EA1A 3QH2A 3Q2DA 1HO4A 3MUCA 2FHBA 2ZA1A 1HXJA 4H7CA 6ALDA 4NP7A 3LCGA 3BJTA 4LYKA 3AYVA 4D1IA 4LF1A 4LUYA 4L4MA 1GOXA 2AOSA 2E5CA 4PL1A 3UWVA 2OPJA 1I4NA 4GACA 2IQTA 1ZBKA 1HJUA 5GJMA 2VHLA 1DV7A 1TPH1 2UY3A 2UBPC 3H7UA 1QNOA 1RSCA 3UPBA 4A3HA 2CWXA 3U2ZA 3B9AA 3A9IA 3MBFA 1FCQA 3STEA 5DRCA 4E4UA 5C7HA 3TN5A 3NPVA 3IAQA 1JCXA 4MB4A 2VX6A 2D0HA 4AISA 2VDIA 5JMUA 1O5QA 3TXVA 4GZJA 3ME3A 3CZJA 3V5CA 4DF0A 2FGLA 3C3UA 4LAOA 3M0ZA 4E8GA 3W7PA 3GIQA 1RR2A 1KQYA 5FJJA 5JQ9A 3L0NA 1OX5A 2DZUA 1JZ8A 4H01A 5HMSA 1CGVA 4QJ4B 3URBA 5HMEA 4S23A 3VX1A 4WDTA 4DXKA 5MF5A 5HR6A 3VU2A 2E25A 3JVAA 4O12A 2WZEA 4AHOA 4FNSA 2R6OA 4GMEA 1QWKA 5F1VA 4S3FA 3T44A 1H1YA 5T91A 3K13A 1GEQA 1OG0A 2J7DA 1NFPA 2ZICA 4RDWA 4JKLA 1EJVC 5A8MA 2EKGA 1K6AA 2DQXA 3AXXA 3UPWA 3IARA 1FWGC 4KCTA 1S5NA 2HBXA 3QXBA 4OWGA 3WLLA 5H8PA 2WBGA 2DT0A 3BG3A 2ZZ2A 4Q4OA 3MPGA 5AYYA 4L5ZA 2PBOA 1M7PA 3PAJA 3TW9A 1F3TA 1F2JA 3MMDA 2XH7A 3H70A 3NDZA 3ORWA 5MHBA 1XL9A 2IPGA 5H6HA 2HE5A 1JULA 4R33A 1JVNA 1FWIC 5T9BG 3RO8A 4P7NA 2ACRA 1V03A 2XVGA 5FD0A 2R24A 4NZCA 4GD0A 2YOCA 3A3HA 3RX3A 3IPWA 4PSPA 4W87A 3WFAA 1BLIA 4IPNB 2IW0A 2VFIA 4DIAA 1UD8A 2PWHA 3IUHA 1B5TA 4MJZA 3P74A 3AYTA 4F4RA 1M53A 2BZNA 4NAFA 1PXGA 1MZRA 3GBDA 4QAIA 4NI3A 1B9ZA 2ZYFA 4ZL1A 2AL2A 2G4JA 4ZB2A 1HGWA 4X63A 2OT0A 4NAEA 3NPUA 3IANA 5C9UA 4UFJA 2W67A 1UZHA 2PUZA 4JFSA 2C1GA 1VGAA 3BCJA 5D4YA 1FRBA 3G5EA 4MJ2A 4R5EA 1O1ZA 2E6FA 3MWAA 4QCFA 1PKYA 1MUCA 2W0UA 3COTA 1AK5A 4ACYA 3TJIA 3EB2A 1NOUA 4UQ9A 2WSKA 3GD6A 3SO7A 2QDGA 1XG3A 3SCSA 4DWDA 4GHRA 4LU0A 3LI0A 4UMAA 3TTOA 4ZGYA 3P60A 2PZ0A 2DZSA 2NQLA 4NYUA 5CC7A 1X8FA 1JI1A 4Z17A 1QOPA 3K8LA 3CL6A 1RJQA 3FHQA 1PE1A 3P82A 4CQCA 4U5KA 3BLDA 3KDOA 3MU7A 3AMKA 5TNVA 3SZ8A 1ZS2A 1B31A 4JAWA 2GK1A 4UQDA 3KE0A 3AYSA 3UXLA 2OEMA 4AIBA 3N04A 3AROA 4B2DA 1GOKA 1DIDA 3BW4A 3QEZA 3UERA 3WNNA 4U3AA 1NM9A 4TX8A 1Z44A 4XAGA 1A47A 3ZJ7A 3MP4A 3FV9A 4YTQA 2Y5EA 1FDJA 3IGUA 4GNJA 3TC6A 1MYRA 3A23A 3P14A 1W31A 4HU4A 4YTTA 4NY2A 3TXZA 1K77A 1VF8A 1F4AA 2WPGA 3AO0A 2PTZA 1DWJM 4GVGA 3NCOA 4PGLA 2BVTA 2UY4A 4W7UA 5DXYA 1I6NA 4XO6A 3AIUA 1H3GA 1BPLB 1FWNA 3L4TA 4UMCA 1OCBA 1LDCA 4B5VA 2VXNA 4DEFA 3WH7A 1GTHA 4ERGA 1O95A 4KCWA 1FY6A 3UZWA 1BYAA 3U2EA 3VOHA 3TSBA 3W25A 3CO4A 1Z41A 4I7WA 2PD5A 5AKQA 3GR8A 2XTKA 3FNDA 1WP6A 3FK4A 3KLLA 4CCZA 1JUBA 1I2QA 4ZQRA 1MXDA 4JD4A 2PDUA 2HE8A 1HJXA 1Q7QA 3ITYA 2Z29A 2DJLA 4HNUA 4AIEA 3OHMB 3ZLHA 4NJHA 3LHYA 2WSQA 2QCGA 1O5XA 2A3EA 4DM1A 1BG9A 1F3XA 4B5XA 1FDZA 3KFTA 4ZVJA 1WDWA 5I5RA 3TOPA 1TJRA 4H6RA 2WSPA 1LOLA 1K7EA 4K1WA 3V1HA 1QXLA 4ZB5A 2GJXB 5MKGA 3AU6A 4YS1A 3WNPA 2Z7GA 3CM4A 3GM8A 1JF5A 1WO2A 2QAFA 1BWKA 3IGHX 3CMFA 1I9CB 1KR1A 4MJ4A 5HJXA 3S5ZA 3EX4A 1XQLA 4LEFA 5DT5A 5XINA 1J0HA 1E3ZA 3DBNA 3CZKA 4HA3A 2Q8XA 4LS0A 4WY0A 3EWBX 4LC6A 1H7WA 3E2VA 1KXQA 1JFHA 2Z2UA 1VR6A 3CQIA 3LHUA 1TMLA 3WNMA 3GKFA 3CQKA 4QDMA 2XN2A 3BTNA 3AXHA 3BLPX 4J3XA 1ZAIA 1U1JA 3ABXA 1K3UA 4MJMA 3P7YA 3GNRA 4BWLC 4ZQNA 4R27A 1XIIA 1EBGA 2GPTA 1E5NA 2RKXA 3C0SA 1P6BA 3N6QA 1T96A 1DTNA 4GYJA 3CU2A 2X30A 1OCJA 3OHIA 2XVKA 4GX9A 2CLPA 5D30A 5F2LA 3WD0A 3C6CA 1ZGDA 3NQ2A 2XH2A 4DF1A 3A9BA 2INZA 1DYSA 3E2RA 3RO6A 1XLLA 3NXFA 1OC5A 3UGVA 2I7GA 3LV5A 3W02A 2BXYA 4WSKA 2VGGA 2RGMA 3FOKA 4A3UA 2XHYA 2A7RA 3G8RA 2PDXA 4XIAA 1XSJA 3ZZ1A 4AHQA 2AQWA 4X22A 2C0AA 3RRAA 3WH6A 3B4UA 3T42A 3IIVA 1FHDA 5BRPA 1JDEA 3U4FA 1FKWA 2QCDA 4AZCA 1LQ0A 1CGXA 5FI8A 1E55A 2GYIA 1KM6A 4P8UA 5DCBA 2JIEA 3T6CA 4KRUA 5F4SA 1RZMA 4P7QA 7CGTA 2ZRXA 3VGEA 5C7VA 1QNRA 1WUEA 5HANA 3LGGA 1EC8A 4O17A 2XGBA 3A64A 1MXSA 4Z42C 3WD1A 2DZXA 4CNNA 1M65A 2PLMA 3L21A 4U2YA 1XQKA 4IPIA 4BQ2A 3UWZA 5D8ZA 3L67A 2HS6A 4KGJA 3ICJA 1OEPA 1G4EA 4BEQA 1VFOA 1ZRQA 4MHBA 3KBSA 4KH2A 3S9IA 1E0VA 1UC4A 2IUZA 3CPGA 5D9PA 4ZSUA 1R7OA 4Q7NA 5DBTA 5KSWA 4Z1DA 5E6YA 4WOQA 4UTJA 3M0YA 3H4GA 4TO8A 1JJKA 3GG0A 3VOCA 1TWZA 1NDZA 2WMHA 5CPQA 1EL3A 1K8ZA 5J5RA 5E09A 1E56A 5E70A 4RZ4A 1NWSA 3L23A 3AS2A 3TFCA 2FMOA 3IEBA 1KGWA 3D47A 5CSUA 2PRLA 4RNFA 1OFAA 2BSLA 3TJLA 3M47A 3WBXA 4RUBA 2WMJA 1POJA 4A8IA 4GI6A 4MNJA 1B57A 4DB7A 3QRHA 4BCEA 1JCJA 4UTWA 1DJWA 3PC0A 3EWWA 3UPMA 4N2YA 5BNKA 1ZBWA 4B3ZA 2XZ7A 3G1VA 1OB0A 1SJAA 3V35A 3C3NA 3W1UA 1UD3A 1JZ5A 3QFEA 2BOGX 3VNKA 4CEXC 5HQMA 2A3BA 4RZ5A 1K9TA 3GTHA 3WDIA 3HGRA 1QO5A 1UD6A 5I7GA 1F6KA 3SCNA 3R5EA 4ZO8A 4C7FA 1EYWA 3NM3A 3BCFA 4GXMA 1WKEA 3GAYA 2GWGA 3WL0A 1W9UA 4UQEA 3ZLGA 4EF8A 5I24A 4FEZA 4GH1A 3AXKA 2WSYA 2PLJA 3R25A 3KX6A 1VLWA 4MDPA 2XFFA 1QW8A 4R7JA 4DF2A 3U7VA 4HT3A 4MWAC 4O0ZA 3CAWA 3WMCA 4GBDA 3HJZA 3OLGA 4DI8A 5LNSA 4PEEA 3ATZA 2CNCA 3BW2A 1EHAA 5BXPA 4I9TA 4D6EA 1PX3A 3FJ6A 3MUZ1 1Y7VA 4Y9NA 2V30A 3BOXA 3UXKA 3EMQA 4JTIA 1F07A 1EUAA 1M3UA 2G41A 5I06A 4L4LA 3URQA 1S2WA 2PDCA 2GQAA 3S8HA 2O9PA 3VIFA 2O56A 4C6CA 1MFVA 1BWLA 4F40A 3UYCA 2FHFA 3UJFA 3UF9A 1XI3A 4DJDC 4H7ZA 1TTJA 2JBMA 1TG7A 2WJDA 4G6CA 5F2MA 1SR0A 4PUKA 1EDTA 4ZOBA 4I9AA 1EDGA 3THQA 1U30A 5I6SA 1ISYA 3FDGA 4JDYA 4AXKA 3QZ6A 1QTWA 1OVDA 4P61A 2G3MA 1LL6A 3N19B 1X7IA 3N2XA 4IZGA 5CC6A 3W00A 3EWCA 4JIIX 1W8GA 3DKJA 4C6DA 2DIKA 2W5FA 5C9RA 2F6KA 2QUNA 3UY7A 3SY5A 1KNWA 3EDFA 3ZWSA 4YVXA 3NOYA 2HRWA 5LGZA 3LZ3A 1TUXA 4PUDA 2DSKA 1IZCA 5C54A 3HGJA 3RLGA 2H8XA 3ABSA 5HUPA 2XN0A 5FJOA 1WXJA 2E8ZA 3PUDA 3CMJA 3FJLA 1DORA 1UG6A 4Q3MA 1X1OA 4GE8A 4KRZA 4R7WA 2FPYA 1H7NA 2CBUA 2CKSA 1DJNA 3HG4A 1KFLA 2CLOA 3BG9A 1KBLA 5E9AA 1GTEA 1XIEA 2GUBA 2P0IA 4ZQCA 1UHVA 2FGZA 1VCFA 2HMCA 4JIQA 4UR7A 3URAA 3WDRA 5CSRA 4QQUA 4W88A 4GI4A 1TFVA 1GEHA 2ZKMX 5J5DA 4JTFA 1YE6A 2O9TA 2OWWA 5DBUA 5U4NA 1AW1A 3WNOA 1UQYA 1L2QA 2VYOA 3S6OA 2VDGA 1NSJA 4X0NA 1GCYA 1NP2A 1UD5A 1TCDA 3TZNA 3EWUA 3PB0A 3WQPA 1I1XA 1TPDA 1P0BA 3O16A 3UVIA 4LUJA 3OYXA 1UIPA 4HOWA 2I56A 2GGEA 1J93A 1EWEA 1MRAA 4GJ1A 3R10A 3PY2A 3ITLA 2JALA 4XZBA 3W7OA 3VKAA 1QNQA 5I03A 5DRIA 1UR8A 2GSHA 1ONXA 1CZ1A 1R3QA 1OK4A 2V5JA 4YYCA 3MBDA 3W7JA 3OZMA 1XGEA 1JZ6A 3CHVA 2C8NA 4GQRA 5KZEA 3PFRA 3ITCA 4S3JA 2P8CA 1XXXA 3CZEA 3F7JA 4PYSA 2YBVA 1M03A 4LUSB 1OY0A 3GFXA 2NV2A 3NVTA 1B9BA 3BMWA 1UWUA 1Z3NA 4IIBA 3N4EA 3KLKA 1DJIA 1RHCA 2V9DA 2HBVA 1X97A 1JDAA 4DJFA 1OZQA 3NL5A 3QV6A 3R43A 3RYSA 4GYKA 1Q65A 2PE4A 5A69A 3QSTA 1V79A 4B5SA 3SUSA 1SZGA 1QRQA 1DQXA 3WUBA 3AIRA 1EF2A 5I3KA 4K68A 4BI7A 3R8RA 4P7RA 5EYWA 1YPIA 2DH3A 3S6TA 3TWBA 2XGZA 4JYEA 3LLFA 2VVNA 3RDKA 1O66A 1A3HA 3WMSA 1VYPX 4DNMA 2FVLA 1E6ZA 2XN1A 1AQ0A 1EEPA 3G1AA 3L2IA 4UMBA 4PTDA 1UMLA 4PCPA 3FGCB 2VFFA 4W84A 4HMDA 1R3WA 1P0EA 2OOFA 3WZ0E 4YHGA 1U1HA 3SQLA 2OEKA 1EP2A 3NL3A 5AYXA 3O6AA 2FTYA 2WZTA 2QPUA 2XFWA 3BVJA 4D71A 4FMVA 4LFYA 4UWMA 4O52A 4CEUC 3PG9A 5IHRA 4AD4A 1XPYA 1VFSA 1M7OA 1LWIA 1B1YA 2X2YA 3B97A 2VR5A 3LM3A 1BRLB 1XIDA 3NXLA 5K9DA 1ITUA 2V69A 3ANYA 4M3PA 1TWDA 3IIPA 1XIGA 1V6WA 3USZA 3SAZA 1C91A 1PPIA 3IV8A 3PUGA 3I3BA 3LCXA 3H2CA 3MW7A 1I2OA 1D7KA 1DIEA 2OLHA 1CX9A 4AZ7A 3R0DA 1F8IA 2BHUA 3KWSA 3TMLA 3S1XA 3VTRA 4IGMA 3E5BA 2X16A 1PIFA 1VFHA 4BK9A 3BAWA 2XIJA 2ZRZA 3SGUA 4D8LA 2HROA 1TVNA 1TR9A 2ISDA 3AFBA 2C3ZA 3MJMA 1GVEA 4MSSA 2PGEA 3VKBA 5A6AA 2G96A 2JK2A 1LG2A 1YLVA 1E6NA 3RPTA 3FYOA 4EXBA 1J18A 4AF0A 2ALRA 3P3BA 3TYDA 3GDMA 2QJJA 4H00A 1NTHA 2FZ8A 3KOYA 2PF0A 3DHPA 5FJUA 1H7OA 3M0LA 1TPEA 4CN4A 2F7FA 4GQQA 1AL8A 3QW3A 4DAIA 2Z24A 3E96A 1T5AA 4A2RA 2DT2A 1JI2A 1B0IA 5E93A 5HUOA 3I65A 3F1QA 4XD5A 2PBGA 4HU3A 1J6OA 1AH0A 5I09A 1RJRA 4L61A 3ABQA 2GSEA 3QW4B 1YNQA 2BOEX 1F7BA 2V67A 2HNEA 3Q4DA 5FA5A 4M6UA 3O9NA 1J8VA 3M46A 3GAKA 5FACA 1NJJA 2Y62A 3GHRA 4Q8WA 3VM5A 3TVAA 4PUEA 2HPMA 1YTEA 1EGVA 4HA0A 2GDVA 3MYPA 4C6BA 1XKYA 3BSHA 4Q8OA 4DX3A 1DWIM 1SZRA 4BZYA 3TA6A 4GNKB 4L64A 2NT1A 4HNOA 3UG4A 4IT1A 4PMUA 1SJCA 1OFDA 4UFKA 1M5WA 1UP0A 3LV6A 1UJQA 2SFPA 1QHZA 2JGYA 4CU6A 1A3WA 3VD7A 5HULA 1K8CA 1AQHA 4NNBA 4D6FA 4R7OA 1AVAA 2PDIA 1YXCA 2ZZ1A 3U9IA 3SFWA 4NT0A 5FJTA 3WUEA 4JKKA 3W84A 4QJ5B 1FWBC 2YLAA 1XLMA 4JHMA 2J4GA 4LPCA 4Y2WA 1OYBA 3ITXA 2UZ9A 4JTAA 1QNPA 4DWSA 3UXAA 3STPA 7ENLA 5FF4A 3UWYA 1UASA 4QNWA 2CESA 1VHNA 4URIA 2WJFA 2VUNA 2W66A 3UA3A 3P93A 3W70A 1ZPTA 1IXPA 2FDSA 4IPJA 4AIUA 4AYGA 3PBUA 1UROA 3TW7A 4CQBA 3PPGA 5EB8A 5AB3A 2DFAA 4HKPA 4N42A 2XGIA 4JN7A 3EOUA 3QC0A 2ZVIA 3BC9A 2V2HA 3EDJA 3QV8A 1JRCA 4XB3A 4H3DA 3CEUA 2WMKA 3W38A 4H7VA 3MCMA 4C90A 3VE9A 2CKRA 3MJYA 3WLNA 1J10A 5PTDA 2NZLA 2VWSA 1E15A 4ZQOA 5IFPA 3ZFHA 1KGXA 3B8IA 4HSOA 3TX9A 3R58A 3NQAA 1FHVA 1DJHA 2J47A 3MDWA 2Y5SA 3PZVA 3B9OA 3W07A 1S2CA 5FEXA 4GZ7A 5C2XA 1J5SA 1MNZA 5REQB 1XSKA 1KBBA 4LUTB 1N55A 2J9YA 4FS9A 4YVPA 3AWOA 5AHLA 1JAEA 3NL2A 3ITTA 2HK1A 4RE2A 2ALDA 3S1UA 3N1AA 4JBRA 4RNJA 1OADA 4PBFA 1OYAA 3A4JA 3S47A 3ZS4A 1QPQA 2V2CA 4PMXA 3MI6A 4H19A 2Y61A 3LBMA 3RX2A 3AJXA 2CLFA 2I9UA 4MNKA 2WCGA 3IS4A 2VMFA 2VEFA 5HDRA 4ZFMA 3B3DA 3I6RA 3MUIA 2Z28A 3UWWA 1C93A 1MFUA 3HQOA 4UFIA 3TAOA 1A3XA 4A3QA 2GVEA 2QCLA 2D22A 4Z2HA 2PA6A 4GQGA 4MB5A 4ADUA 1TPFA 5FIPA 3FA5A 4LY4A 3W23A 4J3UA 1KM1A 2H9AA 2JIWA 1YXYA 3S5YA 3TROA 1GUVA 1M9HA 3LMYA 3QMRA 2E6DA 4U3CA 1ICPA 2DQWA 2WANA 1THFD 3VIJA 3CO8A 1DVJA 1R3YA 3VZYA 3O05A 1RA5A 1EC9A 2V5CA 1TX2A 4M6PA 1P7TA 2EPMX 4NILA 5LIWX 3OTRA 1W1PA 3E1F1 5JBEA 3GHSA 3VNJA 3OQ8A 5IOBA 1R2SA 2VZOA 2FB2A 4UFMA 1OG6A 2P76A 4O1BA 4LBUA 4EK7A 1MO0A 4G9PA 4V28A 2ATMA 3N4AA 1HP5A 2REQA 2X1SA 1CB7B 2R91A 2EPLX 2PWEA 4AMCA 4XUYA 2BXZA 2QCMA 4D8AA 1U5HA 3EWDA 1UD4A 4PA8A 3WEMA 2XM2A 5CPMA 1UD2A 3UWUA 5M03A 5LZLA 5KITA 2A5HA 2A4AA 4POCA 1KA9F 1HG3A 4XX6A 1R3TA 2Q3OA 4A8RA 2ZX9A 4I9JA 4TTGA 1FWFC 3G1XA 3XINA 4W93A 3RPMA 4N9DA 5FEWA 2QGHA 4B3KA 4Q4PA 4MOZA 4IQDA 1WDQA 4PUJA 1WOAA 3T0DA 3GG1A 1VEOA 4YN5A 3VD5A 3WLPA 2PTXA 4QLKA 4S2BA 3RLHA 2FPVA 3W2LA 3OZOA 2YW3A 2VOMA 2IXVA 1H09A 4H8HA 4W5ZA 1AMKA 1V51A 3TTQA 3IAPA 1B3WA 4E8DA 3TUUA 4HHMA 3CBWA 3LTYA 1WYIA 2C1IA 5HWNA 3V16A 1XYLA 2BVYA 3GU1A 2WJZA 1VS1A 2O9RA 1FUYA 1H50A 1VPXA 2Z1SA 1FWTA 4FLSA 4KETA 1WV2A 3SR7A 3EPOA 2OG9A 1PDZA 1A5MC 1PHWA 3SJNA 3AJ7A 2A21A 1ZNNA 3KBMA 3B8VA 4H9UA 4KEMA 2A3LA 4HN8A 2HISA 1CDGA 1GOMA 5AOUA 3EXTA 3MMWA 3CHFA 4TOQA 2VR4A 3V18A 1C9WA 1KB3A 2NQJA 2HZGA 4HU8A 1HVQA 1WZAA 2XU2A 4RR4A 4BHYA 2FFIA 2VZUA 1CWYA 1FH7A 3FJ4A 3RCMA 1PZ1A 3V36A 5LNUA 3CB8A 3PSVA 1XH0A 4K37A 4IP4A 1BTMA 2FPTA 3W1MA 4UIOA 3HA1A 4C7DA 3KWXA 3U5UA 3E5PA 3LU2A 2FZMA 2R9RA 3SRDA 2CLIA 5EMLA 5BW6A 1TIWA 4OVXA 4H4IA 3ES8A 2J9ZA 4F9JA 3W2NA 4FF7A 1ZAHA 4QSHA 1GORA 4I5RA 3L12A 4GUGA 2AGKA 3GVVA 3SBFA 3EYPA 4M19A 1CXIA 3W0KA 4GIRA 1MQPA 3A5VA 1UUOA 4UFHA 3LCHA 3M1ZA 2ACSA 3F4DA 5DN1A 2YBTA 4W8AA 3MUAA 3P5ZA 4BFAA 4ZE4A 5AZ1A 4YPJA 2BGSA 4LTSA 1OZMA 3TTSA 3QQ0A 1XBYA 4NAFB 5KETA 4IX0A 1O12A 2C7FA 2AL2B 1Q4NX 4NAEB 3VDCA 3CYVA 3F4VA 4AG0A 3EA2A 1JAKA 3VAVA 4CKQA 1FA2A 3QKEA 3DI0A 5LNWA 1TB3A 1OWQA 1Q63A 4ILSA 2F9RA 4YMZA 3M7SA 2OU4A 1XRFA 2PGRA 3IVSA 2YIHA 1IHIA 2BVWA 4BEUA 2QEZA 3APYA 5HATA 2H3DA 1SU5A 4A4AA 4N6EA 3QHMA 1LYXA 2GOUA 5F2GA 3TYEA 2CZEA 4YLWA 3W2MA 3G6LA 1W6TA 4KFOA 1JCNA 3EMCA 5SWUA 4XG1A 3T0BA 3PSWA 1V7YA 1TX0A 2ZUTA 5DMMA 3CUHA 1Q5MA 1JXKA 1XM3A 4IIDA 3LPFA 4HTYA 4F0RA 3FS2A 3QOKA 4YHEA 4UZSA 1LWHA 4F0SA 4M6VA 3H2OA 2OLSA 1PKNA 2CBIA 3GR7A 2ZUVA 4BF5A 3B0VC 5ENLA 4OU1A 2WHLA 3K46A 4LT9A 1EIBA 4N9EA 3PZUA 1L6YA 4PB3A 4JTGA 4ZCWA 2GK1B 3GXPA 3KVJA 4IJRA 1YMYA 2RHGA 1XLBA 2FIQA 3AQUA 1FBAA 3FX4A 3NVDA 4MUZA 3W7NA 3KM8A 1S38A 4DO4A 4V1XA 4ZR8A 3PJXA 1TPUA 3VD3A 3W1XA 4FHAA 2DPEA 3FSTA 1GQJA 1TTQA 1F76A 3GK0A 3NURA 1POKA 4GH3A 3P6LA 3RGTA 1ENUA 4L1GA 2JE8A 1DP0A 4LGXA 5CZKA 3S5OA 1QAPA 3KDNA 3OP2A 4TTUA 3HO8A 5CG7A 4RLIA 4FLRA 3QHNA 5M2FX 1AD4A 3DYPA 2F6UA 2Q3RA 1UR3M 4ACZA 2GGGA 2NXGA 5E9XA 4RDYA 4AHPA 1GPWA 5JIPA 3H4XA 4Y90A 4MLJA 3LERA 5G1TA 1XPGA 5LA0A 3MHFA 3FYPA 4W8LA 4PL2A 1VJIA 4FNUA 3AHXA 1J0YA 3IGSA 3M44A 3XIMA 3REQA 4BI6A 2DZPA 3STCA 2Y85A 1S39A 5I3IA 1KFJA 4QS5A 1M7XA 4GRSA 2ZUWA 3LA4A 1XF0A 2B7NA 3OLEA 1BHGA 1FP8A 2Z2AA 3QR3A 4NIRA 3TYUA 2G97A 3O6DA 3NUKA 3M0HA 4H9XA 1YDVA 2X40A 5C9XA 2A85A 5JIWA 3GNXA 4ZFCA 1GJUA 1KCKA 1YNYA 3KL5A 1Z8AA 4WVXA 4WKHA 1E9LA 3TH6A 3HQ1A 1LBFA 4OBSA 3AHVA 3UCCA 1W3JA 2GJRA 3NQMA 1P0KA 1MQQA 1ZJHA 2TAAA 1JZ2A 3HM7A 4PCFA 4GC3A 3BLOA 4E2DA 1K8YA 1I0BA 4QEHA 2UV8G 5MKGB 1R46A 4RW5A 1XSIA 3G1RA 1K9FA 1N8IA 1QI5A 3CGTA 1VHCA 3GFYA 4GCAA 4AIOA 4K6AA 4O8RA 5L9FA 1EB3A 1S46A 2VFHA 4LAZA 1UWQA 3WLQA 1C9DA 2WMGA 5D2XA 2FMNA 3CK5A 4RNIA 4WY0B 7PTDA 5CLTA 4ECLA 4OV4A 4DO5A 2WVTA 2YL8A 2IQ0A 2WHMA 2J77A 1VFLA 5A8GA 3IIXA 5F2IA 1NH6A 3HGOA 4I90A 3EDEA 4ZO6A 5C2CA 4IMAA 2IKHA 4LAKA 4NJKA 4CCEA 3M0XA 1DKWA 3G0XA 1R47A 1TQXA 2XFYA 5G5IA 1RAKA 2E1WA 2E68A 4H9ZA 2XH4A 3KBVA 2PMQA 4O0KA 1XYBA 2QUMA 2WWCA 2WHKA 4UOQA 4GBUA 1W1TA 5KZMA 2V38A 4D1JA 3M43A 4ROQA 4MB3A 1UJPA 2C13A 1UCWA 1W3HA 4ZOEA 2GFTA 1JFXA 2PSNA 4NXKA 2Y70A 2QNEA 4HBKA 4ZBCA 2DZWA 2Z0IA 1J01A 4H9YA 3FFSA 4I5XA 4I8DA 3VXGA 5LIXX 3WH9A 1LL7A 5G1MA 4KERA 1WX0A 1OGBA 1CT5A 1OX4A 5LSMA 2VNCA 5CPNA 3IUIA 3U3HA 5A6BA 3MUY1 1MWOA 4PBEA 2GWNA 3S83A 1UW9A 2QCDB 2YDQA 1LQ2A 3PNUA 4AZCB 3LOTA 3KXQA 4CQDA 3MC5A 1XLCA 4JTTA 1XYFA 3DOPA 3SECA 1VP5A 4OJYA 4NRSA 1A5SA 1V0LA 3LSBA 3WLIA 1MQRA 1LL4A 1DHPA 1TE6A 1Q6LA 1E0UA 4AB4A 3POCA 1ZFJA 4W8BA 2WMIA 3LCIA 5F4XA 4E3VA 3ZR6A 1KTNA 3WSUA 1G4TA 2Y7FA 3SCWA 3FHAA 2V3GA 1R8LA 3B4YA 4XZLX 1LRNA 2XINA 4JR5A 3MHUA 3OVRA 1ZB5A 3CUJA 2C79A 1JZ7A 2VOTA 3KOZA 4IQLA 3LXAA 4CD7A 4DRSA 1YE4A 1MVYA 5EFFA 4H9MA 3CQHA 1R86A 2NQZA 3SEPA 3GHTA 1TVLA 4N9CA 1ZUAX 7REQA 5EBUA 4O11A 3WLOA 4F2TA 1XYAA 1VD6A 3MO7A 5CSYA 2O7QA 5FJIA 2DVXA 2J7HA 2OZ3A 2QKFA 4R88A 5BZAA 1EJ7L 4XO7A 2ZQ0A 1MW0A 1UH3A 1NDWA 2Z26A 1F61A 1L6SA 3W1LA 3ZT7A 4GYFA 4HSNA 4NG3A 1YTDA 2VL4A 1EA0A 1NWTA 5HR7A 5LIKX 1UP3A 3GW0A 3AIVA 3TN3A 4QLJA 4LW7A 3RN6A 3VDHA 5BROA 2Q01A 1AQMA 2QVHA 3PTKA 1LLWA 3PZ9A 3GH4A 2W9MA 4PFHA 3P2VA 1FWRA 2BOFX 1C8XA 5C9ZA 2R1LA 3LI1A 2TODA 5GNZA 2GJNA 1M68A 3B06A 3D0CA 1FX6A 4FOUA 3I3EA 2C6QA 1FFRA 3AU2A 3LNPA 4CNUA 4CQ9A 4NRRA 1YKWA 2F61A 3EAUA 3SUWA 3OG2A 1J2WA 1UWAA 1MNSA 2EQDA 4JL1A 2PDNA 2WPBA 2G3JA 1JG9A 4QTGA 3GVQA 3MKCA 3TP4A 5HA7A 3W82A 4MG4A 3T8LA 4GIYA 2EHHA 2IPWA 3HZ3A 3PTMA 1XCFA 2PLKA 4A05A 1A4LA 3WH8A 3N17A 4CUCA 4B2DD 3CIWA 4H8NA 4WLCA 4HNNA 3VCCA 1JDFA 3DG7A 1ADDA 2JKAA 2J8TA 3NSNA 1X6UA 3RITA 2EO7A 3N29A 1G94A 3OB8A 5CC3A 2X7VA 3ZR5A 1C8YA 1T40A 4DPQA 1W3TA 1EQCA 4JTQA 2FZBA 2DUAA 1LP6A 5DLCA 1E0WA 3QV7A 1TMHA 4IMFA 3THAA 4E4FA 1IEQA 3F2BA 1KD0A 4PEKA 5BU6A 1JQXA 1IXNA 5DMNA 1X1NA 1KXHA 1EIXA 4QG9A 1EFZA 4LV9A 4DXXA 4UTMA 3EBVA 2P88A 1MDLA 4XVEA 3D3FA 4A8LA 1MW3A 2DVUA 1SVDA 2PWVA 1TRIA 1YPXA 3LG3A 4KEUA 3DGBA 3VYLA 2BS9A 4GY7A 2P5NA 2X2GA 3S46A 1VBRA 2Y89A 3M5VA 2QDDA 4AZBA 1XWYA 2E67A 2YCIX 2TSYA 3M5YA 5TIMA 1W9PA 4BY3A 1LLZA 1DQUA 2QXWA 3BUVA 3I6EA 4J1OA 2R94A 1WZMA 2J8GA 5I2UA 5LHFA 4B91A 2HQAA 2GUYA 2C14A 4AFYA 1R9ZA 2J8FA 4PCNA 3G0UA 4UR9A 3DZ1A 5K7JA 1MI3A 3WF2A 4I5UA 3RJXA 4LNYA 3P0WA 2VCAA 4MMWA 1W9VA 4DVOA 2XIQA 3KBJA 4Y6GA 1V3MA 4DQWA 3TSDA 2PDMA 4P7LA 2CFFA 4ZENA 1B54A 1JXJA 1B4EA 4ONVA 3SUUA 1FHLA 2W63A 1E40A 5A6TC 1UPPA 3GB6A 1TCMA 5A6LA 2OKOA 2R1PA 1KV5A 3BH4A 2VD9A 2VRKA 4U5IA 4NL1A 3IACA 1GQNA 1NOWA 1AA1B 1W3IA 4JTUA 1KRBC 2CZDA 2JF6A 3TNOA 1OC7A 3N2MA 1TELA 2PWUA 1R3VA 4ICMA 3GYCA 3ZIZA 5K4ZA 4JKMA 3BDKA 4XZ9A 3G18A 3WK0A 2PDJA 3LRLA 1G7VA 1W1A1 2VC7A 4FK9A 4UC5A 4G7EB 1EJSC 4JY9A 1O6IA 4W7WA 3EWXA 1QNVA 3E0WA 5TAOA 1MW1A 3GDRA 3NQ8A 3QKZA 3W01A 4US5A 4C6QA 5D37A 3C0JA 4DXVA 1OFQA 1HF6A 3GXFA 1QK0A 2VFGA 4H6KA 1PTDA 2WKGA 4HNTA 3WQDA 2QDHA 5I3DA 2F2KA 1B3OA 1QPKA 5GNXA 2X0SA 4Q8UA 2ZIDA 5CJNA 2OT1A 3T7VA 3RG6A 2D2GA 1AW5A 3MQTA 3W7MA 1G67A 1E1CA 4RXFA 1RLDA 3HTWA 5HNUA 1AJZA 2IPJA 1US2A 1R30A 3SM0A 3G2GA 2NSXA 3C2VA 1VBJA 3WNLA 3OEXA 3W1PA 4V15A 3H55A 3GVRA 4JY8A 4F8XA 3O15A 1XH2A 5IHSA 2PLCA 2WSRA 2XSBA 1UUQA 4GWEA 3QY8A 1E43A 2Z27A 1Q13A 3BZGA 5EA9A 1C92A 1QR7A 4DJEA 1YIXA 1S2AA 1PYFA 1KTCA 2WBKA 3C4UA 5AVHA 2P0OA 1EJWC 2YL6A 2BHZA 5CGQA 5C8BB 3KTCA 2EJ1A 3BANA 3U2CA 4EPKA 1U2YA 3N11A 3K4WA 4JYDA 3OA5A 4TIMA 4OUIA 1GVYA 3DHDA 1Y0EA 5T26A 3F5KA 2OQHA 4TMCA 1PV8A 4HYWA 2DORA 4XBKA 3LB0A 4UR8A 3ITGA 3CJPA 1SFJA 3O8AA 1G69A 1AH4A 3KP0A 3CYJA 4MPQA 4R9XA 1E9ZB 3AMCA 4C1LA 1HKIA 2EG7A 1U33A 3LZ5A 1H7XA 1GGOA 3W85A 3AYRA 4KMQA 4U31A 3F5JA 4REQA 3GVGA 4IX2A 5I02A 3NAVA 4QIUA 1YDOA 5H8UA 3RFAA 1XP3A 1JGMA 4H1ZA 4WD0A 2Z2BA 1PTGA 4IIFA 1QI3A 3GG8A 2J78A 2B81A 2VTFA 4XZHA 3ZT6A 4PUNA 4AF0B 2CW6A 3P62A 4JTDA 2ZRVA 1SQ7A 3S9ZA 1DJGA 3M41A 2FJKA 1EZ2A 1NDVA 1O1HA 1KLZA 1TZ9A 1O68A 2BY2A 1JYNA 4L9ZA 2WO5A 3NDYA 2VT0A 3ZSTA 2VR2A 1GG0A 2R14A 1OFEA 1DE5A 5IFTA 2A6LA 2FB3A 1JEZA 1IEXA 3TTEA 2XPKA 5A2AA 3MHGA 3MWCA 3LCLA 4IISA 2P50A 3LTSA 5BMXA 5CPLA 4N4PA 3V5OA 5IRPA 3OLDA 2OX4A 3QBUA 3HV9A 5REQA 3WK3A 3N13A 3R79A 4GVFA 5D33A 3KCOA 1UYQA 4INFA 4ZB0A 4W89A 3ZWTA 4NF7A 2XDFA 3MI2A 1GHRA 3HMJG 1AH3A 2QR6A 1V3IA 4G1NA 1UH4A 4B4FA 5AHIA 4O1CA 4AUBA 2CIPA 1PJ9A 3RR1A 1A49A 1ZJAA 5LXXA 3S1VA 3GLCA 4GXPA 3VNMA 5AVNA 1OFPA 4O50A 3NQBA 1BTCA 4ZQPA 1KXTA 1NY1A 3QPEA 2V3EA 1LBLA 5E0CA 4XSLA 3AS1A 1JYXA 1PUDA 3PBYA 3W81A 4OECA 1W54A 3NO1A 3CXOA 1I2PA 3O07A 5LYRA 6TIMA 2OO0A 3VINA 1J11A 1S3HA 1CXHA 1W8SA 3PBMA 4DI9A <