4G2DA

Crystal structure of the hyperthermophilic sulfolobus islandicus pll sislac
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
314
structure length
313
Chain Sequence
MRIPLVGKEPIEAEDMGFTLIHEHLRVFSEAVRYQWPHLYNEDEELRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEKVVKTTGINLVAGTGIYIYVDLPFYFLNRSIDEIADLFIHDIKEGIQATSNKAGFVIAADEPGITKDVEKVIRAAAITHKEAKVPIITHSNAHNNTGLEEQRILMEEGVDPGKILIGHLGDTDNTDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTLKLIKDGYSDRIMISHDYCCTIDWGTARPELKPKLAPRWSMALIFEDTIPFLKKNGVSEEVIDIIFKENPKKFFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aryldialkylphosphatase
publication title Structural and enzymatic characterization of the lactonase SisLac from Sulfolobus islandicus
pubmed doi rcsb
source organism Sulfolobus islandicus
total genus 102
structure length 313
sequence length 314
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4g2dA00
1A5KC 5E5CA 4IQJA 2OGJA 4IGNA 4MUPA 4R88A 1K6WA 3WZ0E 4B90A 1FWDC 1NDWA 4C6IA 3AUOA 4NP7A 2D2GA 3QY6A 4JOMA 4M51A 4QROA 1FKXA 2PGRA 1FWBC 1HZYA 1YIXA 2XIOA 4GBDA 3S4TA 1R9ZA 3IRSA 2HPMA 1I0BA 3F2DA 2FTWA 2O4QA 2OODA 4C6KA 3MSRA 4XD3A 1I0DA 3E38A 4GY1A 2HBXA 4GX8A 1EJRC 2Z4GA 2CZVA 5FSEC 3QGAC 1NDZA 3EGJA 3IGHX 1BF6A 1YNYA 4IF2A 1V7AA 3HM7A 4OFCA 2OQLA 2VC5A 2GZXA 3GRIA 4EPKA 4GZ7A 4C6BA 4TQTA 2AMXA 4AQLA 1FWHC 4ICMA 1EJSC 4ERAA 2E25A 1FWFC 2HPIA 1FKWA 2F6KA 1J5SA 2IMRA 4PE8A 2EG7A 1V4YA 4QS5A 4DI9A 3UBPC 1RJRA 2UZ9A 1YBQA 1M68A 3GIQA 1XRTA 1A5NC 2EG8A 4CNUA 1ONXA 3MVTA 1EJXC 1RAKA 2VHLA 2I9UA 4ERIA 3T1GA 2DVUA 1A5MC 4BY3A 3SFWA 1NFGA 4AC7C 3OVGA 2Z25A 1FWCC 3A3WA 3ISIX 3F2CA 3GG7A 1NDVA 5HMDA 2Z24A 2BB0A 4WHBA 1ADDA 4EPBC 3IARA 3GUWA 4KEVA 2R1KA 1XWYA 1V77A 4H01A 3SO7A 3V7PA 4C6QA 4IGMA 2WJEA 3MDWA 4DO7A 2OB3A 1NDYA 4E3TA 3TN4A 4NG3A 3E0FA 3QGKC 3GTIA 2DVXA 4WGXA 4J35A 4XAYA 2Z26A 1FWGC 3S2JA 4LAKA 3IPWA 4ZSUA 1FWEC 2W9MA 3QY7A 1KRCC 4C6DA 3CAKA 3NQBA 3RCMA 3CS2A 4H9YA 3URAA 2PGFA 4C6EA 4KETA 1PTAA 3LSBA 4GXWA 3AU6A 1EZ2A 4DIAA 4GYFA 3LU2A 4KF1A 4IFKB 3TNBA 3MDUA 4QS6A 4H9MA 1A4MA 3C86A 1E9YB 3ID7A 1FWJC 2VM8A 3RHGA 3GTHA 4GOAA 3LGDA 3UR5A 3G77A 3BE7A 4RDZA 3O0FA 1JGMA 3OJGA 4HJWA 4HK6A 4DZHA 4G7EB 5FSDC 4PCPA 4CQCA 3GU1A 4C5YA 4ZSTA 4C65A 4YIWA 2HNHA 4XD4A 4WVXA 3LGGA 2EG6A 2FFIA 1J6OA 4PBEA 1A5LC 1XRFA 1XGEA 4RDYA 1J6PA 4C6JA 3TN5A 2Z2AA 4DZIA 1M65A 4INFA 3URNA 2YXOA 5HMFA 1PB0A 3AU2A 1GKQA 3ITCA 2O4MA 4B3ZA 2WJDA 3E2VA 1V79A 1UMLA 4H00A 1UBPC 3OODA 3FDGA 4C6CA 4GY0A 3S2LA 2QT3A 1W1IE 3HPAA 3PNUA 1YMYA 1O12A 3PBMA 3UPMA 1EJWC 3ORWA 2FVMA 4LH8A 4EPDC 3MKVA 1M7JA 4LEFA 3E0LA 3ICJA 2GSEA 4LCRA 2FVKA 1QXLA 2YB4A 3MTWA 4C6NA 3WMLA 3UR2A 4CQBA 4HK5A 1EJUC 2Q09A 1S3TC 4RDVA 1RA0A 4RZBA 3F2BA 4XAGA 3LA4A 3MJMA 2DVTA 5A6TC 2RAGA 3LY0A 4C6PA 2Z28A 2E1WA 3WYZA 3KM8A 1V51A 4LANA 2Z27A 3CJPA 3URQA 4H9UA 4DNMA 2ICSA 3B0XA 2QPXA 1DPMA 1EYWA 4V1XA 4CNSA 4NI8A 3A3XA 3B40A 1KCXA 2GOKA 4CQDA 1A4LA 3F4DA 2A3LA 4J5NA 3NURA 3PANA 3B0YA 1R9XA 3TN6A 3MVIA 4IG2B 4PBFA 4IFRA 2GWGA 3FEQA 2R1NA 4LAMA 2P50A 2FTYA 5HMEA 4CEUC 1A5OC 4I6KA 4LCQA 2Z2BA 1E9ZB 4B91A 4BJHA 1EJTC 1VFLA 1KRAC 4F0SA 3EWCA 3A4JA 1J79A 1K70A 4R7WA 4V1YA 2VR2A 4XD6A 4Z42C 1PO9A 2ADAA 1FWIC 4HK7A 4IFKA 2P53A 1O5RA 1P1MA 1P6BA 3GU9A 4G2DA 3GU2A 4HA0A 2HBVA 4KIRA 4F0LA 4XAFA 4KESA 3S2NA 4LFYA 2UBPC 4R85A 3MPGA 4C6MA 2GWNA 3UF9A 2QS8A 4G7EA 3TN3A 4H9XA 1RK6A 3NEHA 1POKA 3IJ6A 3OOQA 1YRRA 2Y1HA 3JZEA 3LS9A 3S2MA 1EF2A 5AKQA 4LALA 1RJPA 3E3HA 3E74A 4QSFA 4GX9A 3RN6A 3HTWA 4QRNA 1WXZA 1WXYA 2Z7GA 3K5XA 2I5GA 2AQOA 2YB1A 1RA5A 4L6DA 2HQAA 3IV8A 5CH9A 3RYSA 4IH3A 2R1LA 4H9ZA 4GK8A 2BGNE 2Q01A 1ONWA 4GC3A 3DUGA 3FDKA 4KEZA 3LNPA 3URBA 3OU8A 2PUZA 4RE0A 4EP8C 1YBQB 1RK5A 4QTGA 4C6LA 1FWAC 4C5ZA 1GKPA 4CEXC 1PSCA 3O7UA 2VUNA 4H9TA 4C6OA 1QW7A 2Z00A 2KAUC 3R0DA 2VC7A 2Z29A 4H9VA 3K2GA 3DC8A 2QVNA 4KERA 4XD5A 4CNTA 3GTXA 4PCNA 2R1MA 4IFOA 3F4CA 4UB9A 4J2MA 2YZ5A 2G3FA 3IACA 3K4WA 1POJA 2PLMA 3PAOA 1KRMA 3GIPA 4DYKA 4B92A 3T81A 4C6FA 4DLMA 2OOFA 2D2HA 5LXXA 4XAZA 1UIOA 3PNZA 1IE7C 1RJQA 1K1DA 4C60A 1P6CA 1GKRA 3LSCA 2ZC1A 3DCPA 4ERGA 4GY7A 4KEUA 3GTFA 4IG2A 1R9YA 1ITUA 2WM1A 2R1PA 4BKNA 2ANUA 3D6NA 2D2JA 4LAOA 1ZZMA 4D8LA 4P5UA 3OQEA 3QY8A 1KRBC 3T8LA 3N2CA 2WJFA 1ITQA 5G4HC 4DLFA 3EWDA 4LCSA 4RDWA 2AQVA 2PAJA 4L9XA 4UBPC 4DI8A 1EJVC 1UIPA 4I6VA 4EPEC 4F0RA 4KQNA
chains in the Genus database with same CATH superfamily
5I5RA 1AZ1A 1OINA 3H4GA 3CQKA 1T7LA 4B90A 2PPGA 3NQAA 4JPGA 1BGAA 4Y8EA 3KBVA 1NELA 1HX0A 1ZJIA 2D2GA 4LV4A 3ZJ6A 4JOMA 4GH3A 3M0VA 1A0EA 1AL8A 1W9UA 3O07A 3G1VA 2HBXA 1M53A 2Y70A 4MWAC 1H7XA 4GX8A 4E5TA 1A49A 1VPYA 3ZVHB 3GS6A 1BF6A 3VKDA 2HSAA 1RD5A 4L4PA 5KETA 4ORIA 3PZIA 1F8MA 1G1YA 4TQTA 2AMXA 1FWHC 2QJHA 4GA8A 3VNIA 4GYJA 3CTTA 3NOYA 1FWWA 4H7VA 2ZWYA 1R3VA 3P62A 1JZ8A 1LBMA 3GQYA 2BOFX 3MWAA 2J7BA 5A95A 2DW7A 4EF9A 4KWUA 1MUWA 1A5MC 3WQWA 2HE8A 1W3KA 2QDEA 2Z6IA 4D6CA 3SCVA 2I5QA 3G8EA 3GXFA 2CHNA 3GHRA 2PCEA 4DJFD 3FVDA 2XSAA 1QATA 4K37A 4CNOA 1JQXA 4GQRA 3SCOA 4EPBC 3SO7A 1YE6A 1UJPA 2CLLA 3S1WA 1K4GA 3LQGA 5I2UA 1KLYA 3VGEA 3UWVA 1R8LA 1IXNA 4FLSA 3QY7A 4YN5A 4B3LA 4DB7A 2YKKA 4C6DA 3VGDA 4CQ8A 1FVPA 2GVLA 4RZ6A 1KTBA 1AFSA 2PDLA 4DRSA 3LPPA 1R38A 2F8QA 1VKFA 3K46A 4A8IA 2VELA 3RLVA 3VMOA 3N3MA 3GDKA 4QQUA 4HPXA 1LUCB 1A4MA 1EFZA 2PDBA 3G1DA 3WDJA 3GTHA 3LGDA 5FEZA 1KTNA 2V63A 3TK7A 4RDZA 1VJIA 3RFAA 4DN1A 2WVVB 1HP4A 3P82A 5D02A 5DCEA 3AYTA 4X0VA 4OU1A 1DORA 4Q8UA 4ZQMA 2EG6A 5T9CE 1A5LC 4HNVA 1UWUA 1PHWA 3F4NA 1TJRA 5FA5A 4C1KA 1ZS2A 1N2VA 3NO1A 2O56A 1PB0A 5A2CA 3RJYA 3AU2A 1HJSA 5MKGB 1E6ZA 1F05A 2CLHA 1DTUA 1KCLA 1OFRA 2D73A 1V3JA 1GQIA 3UZYA 1LLZA 5EKYA 1W1IE 1XG3A 4QE5A 1DJYA 3ONBA 3PBMA 4LV9A 3SJ3A 3QQWA 5CBIA 4UZSA 1FWRA 3STEA 5DFAA 2ALDA 2OSWA 2VGFA 4L4MA 3DFPA 1YEYA 2AL2B 1W2PA 1VFHA 3WQOA 1GJUA 4PMNA 4RZ4A 1B9ZA 1EQPA 3TNOA 1CXEA 1V51A 1IV8A 3CJPA 1PDZA 1JZ4A 2WMJA 2G3MA 4GINA 1P0BA 2ICSA 4V1XA 1EYWA 4MLRA 1TPWA 4HHLA 4NZ1A 2WOQA 2YBUA 1TPB1 4CCEA 2VOMA 3AWNA 4QJ3B 2WMIB 4K38A 3L2MA 4UTJA 1OY0A 5DXXA 4HN4A 4UQ9A 2VQTA 4LYRA 5D33A 2DZBA 2REQB 1SUXA 3VD5A 4DQWA 4MSSA 3UJEA 2Q8LA 4B91A 3NCOA 3CUIA 1K9TA 3LTSA 1QHZA 2IXUA 1OC6A 2DT2A 2AGKA 2J6VA 3MZNA 4J3SA 5I09A 2RDXA 5HWNA 1JCJA 3CUHA 2ZRZA 2WWCA 3O6YX 2H9AA 3L4UA 8XIAA 3FX4A 5I00A 2WBGA 2DSKA 1T5AA 3IEBA 1A0DA 1QHOA 2E6DA 2F7FA 1YRRA 3UG5A 4HN8A 1RQHA 3S2MA 3PZQA 3FVMA 4UTFA 2Z7KA 5H91A 1Y5VA 2FZ8A 5JH1A 3VC5A 1UKQA 4HGXA 4DBEA 1JPMA 1DBTA 3C6CA 3PB0A 2AQOA 3CQ0A 5CPTA 1V3IA 4Y2WA 4UFIA 3TTQA 3IUDA 3MUCA 2BGNE 2PCQA 5E9XA 4GC3A 4QSHA 3WLPA 4IM4A 2CBVA 4PUKA 2F61A 4YVXA 1YBQB 4C6LA 2IUZA 3T2OA 1VCVA 1KXQA 3B03A 3DGBA 3U2CA 4W5UA 3VC6A 3R0DA 4S3BA 4S2BA 3WJXA 1F3XA 2VEMA 4XTIA 5BW6A 3B9OA 4H1ZA 3TWAA 1UZHA 2JE8A 1C7SA 3ECQA 1O1ZA 2BVYA 3K4WA 4IICA 1KRMA 5I7GA 2CHOA 1J2WA 3G1YA 3LUTA 4OVXA 3KLKA 4W88A 4P8WA 5AVHA 4XAZA 3W37A 3STCA 1EUNA 3ATYA 1DV7A 5I78A 3AMLA 4GNVA 3C0JA 3PPFA 4QNEA 1Q8JA 1Y5XA 4M82A 1HKMA 2HS6A 2PWDA 5I23A 5JUVA 4FIQA 4X63A 5HXMA 3APYA 3ZLHA 3IJQA 3W1NA 4IPLA 3Q67A 4AMAA 4AF0A 2DSVA 2EGZA 2YOCA 4E0CA 1UB3A 4N9DA 1WDSA 3ARVA 5EU9A 3K8LA 1UQZA 4OGZA 2D20A 4E2BA 4Y90A 1Q4WA 5AHFA 1A3XA 3CQJA 3N04A 3MUAA 2GK1A 4J27A 4NP7A 3NQVA 1NTHA 5I0DA 3Q45A 1YPXA 2YDSA 1DWGM 1YHTA 2WSQA 2D22A 3UJFA 3CUZA 9XIAA 2O9OA 3AS1A 1WCGA 2J78A 3B9DA 3I7QA 1EJRC 4GUFA 2OZ8A 3IIVA 3WQ5A 2UY2A 4MWAB 1SSDA 4ZGYA 4JTCA 2IQDA 1YPFA 7PTDA 1HG3A 4B5TA 3FYOA 5LHFA 3HQ1A 5AZ1A 5DANA 1EBHA 4J3WA 3LCHA 1R47A 1FWFC 2VYOA 1J0IA 1SVDA 2WHKA 1J5SA 2X8RA 3AI0A 1V4YA 3NL3A 3WQDA 2PC8A 4BS0A 1BHGA 3KBMA 5JBFA 1E0TA 1A5NC 2Q02A 4CNUA 2QCFA 1ZP4A 1RVGA 1TV5A 3RIKA 4GACA 4TVDA 5HPOA 2B7PA 3HG5A 4B5VA 3KOZA 2BFGA 1GWJA 1QBBA 2CHRA 5HMDA 2PDJA 3TU9A 3MP5A 2NV1A 4LW7A 3S5SA 2ZZ6A 3H70A 4GVFA 3TDFA 3ZVIA 2XH0A 1I6NA 1FWTA 1U1JA 3UPWA 1J0KA 2Z1XA 4GZIA 3S1UA 2X41A 3IIOA 1MQPA 2OR2A 1E6RA 3W7QA 2GLKA 4PCSA 4KEMA 3NL2A 3RX3A 3ZWTA 3CAKA 3LXBA 1HKVA 1RZMA 3CS2A 1KFEA 1PKNA 1L6FA 1OIMA 3ZIZA 5JQ9A 4XO6A 3IAPA 3V35A 5FJPA 3KEHA 1GG0A 3NSNA 1QFEA 1AMKA 1IHIA 2QYGA 3VKAA 4GO9A 1AW5A 3WELA 3H54A 1MQQA 3TJ4A 1JYWA 3AZRA 3SRKA 1E1CA 3P0XA 4HSNA 3OPSA 3QHOA 3WD0A 3AS2A 4JTGA 4B4FA 2IW0A 2AMGA 1LUCA 1GZJA 2OXNA 3L4XA 4DJDA 1GHRA 4ZTYA 3GDLA 1OCBA 5LSMA 1J11A 1XG4A 1TIMA 3PWIA 4D2JA 2WVVA 4WEVX 4GUIA 2XDFA 1DIOA 1EP3A 1XGEA 4PB4A 3WG6A 1LRNA 4RDYA 3WQ4A 4MJ4A 1KW1A 1T8QA 4NQ1A 5DMLA 1YX1A 1E56A 5CXPA 3PG8A 2VFFA 3TLLA 3NG3A 5XIMA 4I9AA 2VRKA 4MJZA 2NW0A 3OODA 3NQ8A 4UNKA 1NIUA 5MKGA 4DO5A 4HMNA 4XB3A 1EXBA 3GFYA 3IJLA 3I68A 2BY3A 2V38A 3II1A 3S47A 5MHBA 2UY3A 3WMLA 3FAWA 1EJUC 3P6LA 3QTGA 1XLEA 3B8SA 5TQLA 5BRQA 5HR7A 1UD3A 1VYSX 3URQA 1EC8A 3AIBA 5D9OA 1QK0A 2PP1A 3AZTA 1FP9A 1VFTA 3U57A 4RE3A 2EQDA 4JDYA 2J9YA 1Q6OA 3BK0A 3AO0A 3W38A 3OO2A 1WUEA 3M0JA 4AD4A 4TV6A 8RUCA 4C7GA 2WMIA 4LCQA 4M8UA 3E9AA 1OC7A 1V0NA 2VX6A 2AAMA 2GUYA 5FF3A 1ZNNA 4US5D 2REQA 2PTZA 2GVGA 2BOGX 3B05A 1UR0A 2E6YA 1H7PA 1OK4A 1TWZA 4HYRA 1GW9A 4A22A 1D8WA 3E96A 2G96A 3CIWA 3BARA 1TO3A 5D8ZA 3KOXA 3M16A 1QMLA 3U6WA 4H9XA 1POKA 3OOQA 4F40A 1G67A 3WSUA 1EPXA 1ICQA 1G01A 1XIBA 3G6MA 4AAJA 4GX9A 4A3HA 1V6XA 4JKLA 1C8QA 3W84A 3FKKA 1LZOA 3GNNA 1GOOA 3L4YA 2QQ6A 3T0DA 2YL5A 2I5GA 3L21A 3RAOA 2HQAA 3IV8A 4IUGA 2NXGA 3P81A 4J28A 4PEKA 2OFJA 2YDQA 1VHNA 1DWHM 3G1AA 4UTTA 1IWBA 2QIWA 4L61A 4GG9A 1WP6A 2KZHA 2GQ9A 4PODA 4UQAA 5TD4A 1UYQA 3O7UA 4O13A 4PFHA 4AXKA 1FCUA 3VIOA 3LPOA 4DJFC 2HS8A 3IGUA 3VOGA 3NYZA 3GTXA 2CC0A 1AL7A 3CQHA 5F4XA 1ONRA 4M19A 2PLMA 1U22A 4PH6A 3G1HA 2HRWA 3T81A 3F5LA 4C6FA 3SW6A 4QQ3A 4WRHA 4PB5A 4J7RA 3XINA 1PVNA 1LQ0A 4M29A 1UMYA 4UIOA 1RJQA 1YTEA 1VS1A 4D1JA 3KRSA 3TW6A 2CZ5A 4O0QA 1BVWA 1J01A 3M9YA 1CYGA 1UBSA 5EB8A 4JTFA 3QV6A 2ZZ1A 1EDTA 2VWTA 1DYSA 3JW7A 1VRXA 2HEJA 3EWDA 3DERA 3B0UX 2C91A 5REQB 2D2OA 3NQFA 2Z1SA 1E6XM 2G3JA 1GOIA 2YDAA 1YQ2A 3VDHA 5XIAA 3WQEA 4IGNA 1C3FA 1F6YA 1S2AA 3ARPA 1W3NA 4C6IA 3LCIA 2PWFA 2OLAA 4NAEB 4QROA 2BX7A 3SRFA 4XZBA 4JHOA 1I0BA 1WOAA 3VMNA 4C6KA 4XD3A 1AODA 3WKZA 4UQCA 3F4VA 1W9PA 7TIMA 1M3UA 2FFCA 2ZFAA 1R7AA 5CG0A 2XM1A 1IT0A 3QV8A 2FQIA 4NYUA 1V7YA 1I45A 2OQLA 4ACZA 5J5DA 5C8BB 3P74A 3CZKA 1YKWA 3UXKA 4MWAA 3CTLA 5G1MA 1K77A 4BI5A 1CEOA 3CV2A 1UH2A 4MNLA 4AZ7A 2VGIA 2YCLB 3ONCA 1XQLA 4M56A 3N13A 3GHSA 4LYQA 3PTMA 1YXYA 2JIWA 4MOZA 4E8GA 1TSIA 1KO0A 3VNMA 1Z9AA 4QHRA 4A2RA 4DUWA 2INFA 4U31A 3FA3A 3MO7A 4XK2A 3TYBA 3D3AA 5GQBA 4AD1A 3GHUA 3PF3A 3UERA 2A6NA 5JXQA 3QKEA 3I4KA 4D6EA 2WJEA 4XBKA 1W5MA 3M5XA 5H8PA 1J10A 4O1AA 1HNYA 2PDHA 1A3HA 4XAYA 1FWGC 4PRTA 4LAKA 2NVDA 3CMFA 1EEXA 3IGSA 3NQBA 3VNLA 5TNVA 1NQ6A 4N02A 4C6EA 4L4OA 3A64A 3AMDA 4Y9MA 1GJWA 5CSRA 1VEMA 4TVUA 1HKIA 4X61A 4JTQA 5C7HA 4NKCA 3G0SA 3MZ2A 3G1XA 1VYRA 3GNRA 3GVRA 4TMCA 4JQAA 3TSBA 2I7GA 3N9SA 1F4AA 4W4QA 4QCEA 2HVOA 3ALGA 4W9TA 3BE7A 5CSUA 4S3FA 1UH3A 2PMQA 3VCCA 2WV8A 4L1XA 1HL2A 3EX4A 4JL2A 1EGVA 2YGYA 1ZBKA 2DV0A 4P8VA 3QV9A 3ZJ7A 1PX8A 4AZIA 2OYMA 3HQNA 3LGGA 2FFIA 2V81A 5FF7A 1TPH1 4H8HA 2ZZ5A 1VPQA 4DBUA 1Z69A 3H53A 2JFEX 1GEHA 1XFCA 4BCEA 2IQ0A 1G9HA 4Z1YA 2NVCA 4Y8FA 1KFJA 4LAUA 4TO8A 3WMBA 4K2SA 1Z7AA 6ALDA 2E9MA 1BKSA 1V3MA 1XF0A 3RLHA 3K30A 4JAWA 3W07A 4ADTA 3SZ8A 3OYXA 1SJAA 4NILA 2GSEA 4NRRA 1K7EA 2VL4A 2VFIA 3MBFA 4M6VA 3MTWA 1AA1B 2RJHA 4RZBA 1RA0A 1Z89A 4G6CA 1EOMA 2X0SA 4LUSB 3NO5A 1VZWA 2TPSA 2Y6ZA 1ZJAA 3K4AA 3ZT6A 5FIPA 3IS4A 4FOKA 2DQXA 1PDYA 3ABOA 5I77A 5LNSA 2V3DA 2PDMA 3B97A 2C79A 2GOKA 3NYDA 4IT1A 1U2YA 3NURA 1ZBCA 2H8XA 3VK5A 3MMUA 4W8AA 2WXDM 4PBFA 3USZA 4IFRA 2B31A 2PWHA 3QSRA 1W5OA 4WJXA 1X39A 4N6EA 4I7WA 4HNTA 1E9ZB 4RPQA 3SJNA 5AB3A 1UH4A 1OFOA 3BJTA 1N55A 5AN7A 1O5QA 1BLIA 3SR7A 3W2KA 4DYJA 1AQMA 3PJUA 1J2BA 3NPXA 3S42A 4NZCA 4GMEA 3T42A 4B4HA 2F2HA 5LHEA 4UMCA 3W81A 4C6MA 5A6KA 1Q4NX 4NVTA 2CLPA 3BJSA 4YS1A 3WENA 4AHQA 1BRLB 3VTRA 2QDGA 3CB3A 1XM3A 3B9AA 1RP8A 1OSEA 4LB4A 4LEQA 2V5KA 3DFHA 4UTWC 1CENA 1RUSA 3VUPA 4WX2A 3WJWA 5T91A 3BLDA 2R6OA 2Y85A 1W6TA 4AUBA 1HJXA 2XSBA 2ZX7A 1QT1A 1IWPA 4R9OA 5CZ0A 4H9ZA 2PLCA 4RW3A 3D47A 4MADA 1NP0A 3UG3A 3DG7A 1GVFA 3M47A 3OU8A 3W27A 1JNDA 5E0CA 1RK5A 1P0DA 5F2IA 2XJ7A 4JIPA 4NXKA 5J8LA 4PCFA 2V5JA 2ZZ3A 3KCLA 2A4AA 1B4EA 1NF7A 3QV7A 1EGZA 1OCQA 2VUYA 3W28A 4ADUA 1FH7A 2G37A 5IHSA 4HNUA 5HOSA 4H6EA 4UFHA 3GDTA 4NXSA 2DJXA 3TAKA 3WDRA 3GNXA 1GK8A 4FXFA 3LTPA 3JRKA 3EX1A 4GI8A 4ZA0A 5HJLA 2E5DA 3VD7A 3W1LA 1LG1A 4GY7A 4AWEA 3SGUA 1R9YA 1X97A 4TUFA 4ZL1A 4Z0JA 1E0UA 4GO8A 2BS9A 4P5UA 3W70A 2WPBA 3OW1A 3OQEA 1KRBC 3NGJA 4S3GA 4IIDA 3SY5A 5G4HC 1KM4A 1TWIA 4LCSA 4FAMA 5JIPA 3EA1A 1PKMA 3NUKA 3S8HA 1RBOB 4A3QA 2C6QA 4PMJA 1UIPA 3NM3A 4KQNA 4CD7A 1H5YA 5B7YA 1P43A 3FHQA 3GDRA 2OGJA 3HG2A 5C70A 5REQA 1FA2A 5BWAA 3GVWA 1PAMA 4O54A 4GJ1A 3Q2DA 1ZBWA 3MMDA 4N9EA 2CERA 4D8ZA 3T0BA 4NAEA 3W26A 4XZWA 4XISA 2WMHA 5MF5A 3E38A 1SO4A 3HMJG 1PZ1A 5CQ1A 4DF1A 3UG8A 3WUGA 2DUXA 4POCA 4MNJA 3K8MA 2QZRA 2DT0A 1WKYA 4N9CA 3W4RA 3QOKA 5C2XA 1ZPTA 3TOPA 1H2JA 4ICCX 3VX0A 1S2UA 4PE8A 3HGJA 2JK2A 2G4JA 1E6NA 3EKGA 1GTHA 2ZTKA 1B1YA 3E5PA 3UBPC 1W1ZA 3APTA 3W1TA 1UHVA 3LV6A 5B80A 3EMQA 1Q7MA 3M5YA 2EG8A 1X7IA 2WCGA 2Z1WA 5DMYA 1OABA 4ZOCA 4Q22A 2E8YA 3OVGA 1BWLA 1H60A 1LT8A 2BLEA 4MGGA 3BLOA 2XVPA 2A7PA 1NDVA 3WIJA 5KMYA 2VZUA 3DIPA 3ZO9A 3W72A 1Z32X 3UXLA 1NM9A 1QI3A 4H01A 3TEVA 2GJNA 3V7PA 4UTLA 2WNZA 3PC0A 4EXAA 3UG4A 5D05A 4LYKA 2DVXA 3K8KA 4MZYA 2QXWA 1A5UA 2DPEA 3FW6A 1Q2SA 1EF3A 3WD3A 3K1DA 5FKYA 2G3IA 3MP4A 3L67A 4RPPA 1JPDX 4U10A 5G4EA 2XIMA 2VZSA 3LU2A 1QW9A 3GG0A 4UCGA 1TVLA 4UMBA 1VJZA 4MLJA 2ZXBA 4O0ZA 1ITCA 1V6TA 1XBXA 3UR5A 3O06A 1ZCCA 2IKHA 4PTNA 3TP4A 3LPGA 4W85A 1WDWA 3HG4A 4GIEA 3OGRA 1GOXA 4ZXOA 4RCXA 3DHFA 4AX7A 4BFAA 3VU2A 3FK4A 1H1YA 3TYAA 3CHFA 4KFOA 3DGRA 3LNMA 1F3TA 1SO5A 2AL1A 3O1NA 3TMLA 2YXOA 4QR6A 4RUBA 2E68A 1TUFA 3UD6A 1NWRA 1R0MA 2OZTA 3E12A 3DFNA 3IV3A 3IIPA 1HIZA 3VKKA 2CLKA 3TOYA 2QGHA 6XIMA 2QT3A 2WK2A 3JR2A 3CV1A 2RDWA 3IRDA 5DLCA 4LH8A 5D9MA 4FEZA 1KBJA 4B16A 4LNCA 4E4PA 4O4VA 1SW7A 4X22A 3FXYA 3AHXA 1UKOA 2RH9A 4WOZA 4S39A 3W1PA 3HQPA 4JQ3A 1X96A 3RX2A 2AOSA 1CGWA 4JN6A 3VNJA 5F2LA 2Z28A 3A22A 3RJXA 1RQEA 2VFGA 1SZRA 2DUAA 1REQB 1SFLA 3LN3A 2VVSA 4HPHA 4S3AA 3B0XA 1UWIA 4CNSA 4CQDA 4J5NA 3VINA 1IYXA 1Q7QA 1WB0A 3LHZA 3CT7A 4KKXA 3AIUA 2WHLA 2Y62A 4FX7A 1KA9F 4TTUA 1FQ0A 1XLLA 2E6AA 4A3YA 1O60A 2VWSA 3GC2A 1JNEA 2A7RA 1V08A 2NT0A 1TQXA 2JF6A 1VFLA 3PJXA 3BTNA 3EA3A 3WNMA 2O0TA 3GHTA 4AVFA 4D9PA 2Z1KA 3LM3A 5HK4A 4A2SA 4PUJA 3TUUA 1XFBA 2XIBA 2YLLA 3GU9A 4AZCA 3OIXA 3QLDA 1SZGA 1W8GA 2VDIA 4KIRA 5DY2A 1NARA 4I8DA 2H3BA 2ZUUA 1ISXA 4MB1A 4Y9AA 4KESA 2FGLA 3AUJA 4OIFA 3W7MA 2DZTA 1JUKA 5CPNA 5J04A 4IPNB 1SO3A 4UR9A 5IOBA 4JD4A 4PUMA 2PBOA 2ZXAA 5C9ZA 1QOXA 2ZKMX 4ES4A 1JULA 1BRLA 3ANVA 4QSFA 3KOFA 2QCNA 4H6RA 2PDPA 4EIVA 2C71A 2PRHA 3W1MA 3HA1A 1H7OA 1QDSA 3U2ZA 1CGYA 2R1LA 1VBRA 1XIGA 4IIFA 4HZ6A 2ZZ4A 4JQ2A 4KEZA 4MM1A 1HO4A 1T8XA 3ARXA 4W8LA 1WKEA 5E09A 1MSSA 4HHPA 2PUZA 4LJ3A 5D2XA 3ZQ9A 4M5PA 1QRQA 1BTCA 4IIGA 4HB7A 3RMJA 2ZC8A 1QW7A 3WF4A 2OG9A 4GHRA 2ZDRA 3EB2A 4H9VA 3DEQA 4QE4A 4CVWA 3H24A 4TV5A 1DJXA 4IFOA 5FF2A 4P61A 1RBAA 3CAWA 3GIPA 1EP2A 3QMSA 1I2RA 4O12A 3L4TA 3ZXWA 4C1NB 2E8ZA 1QO2A 1UQYA 3T05A 2FKPA 3DYMA 2CKRA 3CHDA 2FZ9A 5M3WA 1P6CA 1XSKA 3CK5A 4KEUA 3GTFA 4IG2A 2HISA 1ITUA 4LXFA 1GOMA 5H8UA 3TAOA 1PPIA 5D9PA 2ISFA 1XRSA 3QHNA 5LNRA 2Y8VA 3AIWA 4RDWA 2CBJA 1YW1A 1M04A 1EWEA 4Q4KA 3FGCB 4IQJA 4R88A 4BWLA 4MKVA 2I16A 1LBLA 4GQQA 4JTDA 2DGAA 1TE6A 4Z1BA 1R9ZA 4BK9A 3BPWA 4QDMA 4GZJA 3H2EA 5LA0A 4MB3A 4MYAA 2CZVA 1SMAA 3QM3A 4MY1A 1NDZA 4UR8A 1ECEA 5EBAA 2PWGA 2J6XA 5DCDA 2GZXA 4AMCA 2NLYA 4WUIA 2YCEA 4AEEA 4DF0A 1LL7A 4JFVA 4ERAA 4CKQA 3VFLA 1DWFM 1PEZA 1TE1A 5A8OA 4J3ZA 3BAXA 4LY4A 2OPJA 3W82A 4AEFA 5LXEA 2BMBA 3TWBA 3THQA 5IXEA 3TTEA 1KGUA 3TA9A 4EX4A 4GGHA 2I9UA 3OLEA 3I3DA 2CLEA 2NXIA 3P2VA 1TV4A 1VJSA 2GJXA 3FLUA 1DWIM 2Z25A 3VDBA 3GZAA 4NT0A 1LRQA 2W91A 4K3ZA 3STFA 4NJKA 3W7KA 5AY7A 1RCOB 4KCVA 1UD6A 4I3GA 1JRCA 3EZ4A 4HSOA 1Q6DA 3L65A 1LF1A 1Q45A 3BZJA 3TYEA 4TX6A 2R1KA 1V0MA 4C1LA 4C6QA 1EP1A 5FAGA 3EWWA 4NG3A 3GAYA 1XSIA 4P2VA 3VIMA 1DOSA 2VXNA 4HVXA 2YR1A 5EMMA 2Z26A 4DX3A 3WJSA 3M7SA 4ZSUA 2V2DA 2W9MA 3KCJA 3B0VC 3UGVA 4ZVJA 5HNTA 2Z1BA 1V5XA 3AXKA 1WYIA 4H9YA 4TOQA 1S2VA 4K7VA 3EYPA 2O55A 2OX1A 4EF8A 2A1YA 1J0ZA 4AY8A 1E5JA 3CO8A 4IFKB 1I2OA 2C15A 2VEKA 1PZ0A 5D2WA 4MPQA 4WIWA 3VDGA 4NJJA 3CEUA 2ZX9A 1A5AA 2HNEA 4MNMA 3PZUA 4HCLA 4IISA 4JKMA 4HA4A 3MT1A 4CQCA 4DJDD 3GU1A 3PUOA 3SIZA 4YVVA 3W7GA 3PZOA 3SEPA 1WE5A 1BPLB 3GLCA 1VBJA 1OX4B 1J6OA 2OSYA 1C9DA 1J6PA 1CTNA 4O1CA 3UZJA 2Z2AA 3NFUA 4HHHA 1A47A 1XYFA 4JTLA 1UWTA 3SCQA 3EMCA 4CVUA 2ZA1A 3FA4A 4NY2A 1D3CA 1UR9A 3KP1A 5K9XA 1FTXA 1EC9A 3UPMA 1O68A 4TVCA 1PJ9A 2G50A 4EPDC 1S2CA 4B3KA 4DVOA 3B8UA 3H55A 4WY0B 5DO8A 1V6UA 3EKZA 1RXOB 4IMAA 2ZUNA 2C18A 2YB4A 4WF7A 3SDOA 3DZ1A 1SSGA 4QP0A 5TF0A 4K8GA 7ODCA 3LA4A 5AC4A 1ITXA 1YE4A 2J8FA 4MHBA 5IBXC 3FXGA 1JQVA 2G5WA 3AXXA 4O1BA 4DHGA 5A6JA 4S3KA 1O66A 4OZOA 4RW5A 2PDCA 4WLCA 3RLUA 1MVYA 1MO0A 4YTSA 2FLIA 2OYLA 1SQ7A 5HNRA 4IMEA 5HATA 3TN6A 1WKFA 2A3CA 5G1YA 1BSLA 3T7VA 2PZ0A 3UCCA 4JN8A 1W1PA 2ZVRA 4LUJA 4F9DA 3O15A 3M0XA 1JZ3A 3M1ZA 3W1XA 5EBUA 2QJIA 3BAKA 3L0KA 4HK7A 1ZAHA 4AWUA 4OOUA 5D32A 1P1MA 4ILSA 1SZEA 4YU1A 2VENA 1F2JA 2V3EA 1H62A 2J88A 3NPVA 2BVWA 1PYMA 3UF9A 2DZPA 5BRPA 4ZQNA 5FF0A 3L23A 2RJGA 4IMGA 4LNYA 5EMKA 2NQLA 1XI3A 3A13A 3NDYA 1B90A 3W1AA 1JPIA 3RPMA 4PYSA 1WXZA 1EJ7L 3T4CA 1LYXA 4LVGA 3ANYA 1JI1A 4BI7A 3EDEA 4MUZA 3CV6A 3IVUA 5ABFB 3MV01 4UTWA 3U9IA 3KOYA 3TFXA 1R30A 1W9XA 2XN2A 2F6XA 4YCPA 4IJRA 4GFIA 3WQFA 3SN1A 1UASA 5JVLA 4MDOA 3LI1A 5D30A 3SQLA 1VFSA 2XM2A 3LX9A 3DKLA 4XVDA 1M41A 2ODOA 3SSZA 3A3HA 4I7VA 5D37A 3GY1A 2QIIA 4CLMA 1IXPA 3RNDA 2C8NA 2GSHA 2D1ZA 4J2MA 1L2QA 3AMGA 1OBAA 3BJFA 1HTIA 1QAPA 1OGGA 4M24A 1KBBA 3MB9A 3SCRA 3L4ZA 4MZ1A 1HJQA 2CLOA 5I3IA 3BWWA 3KZSA 4WJEA 3DCPA 1H4PA 1E40A 4GPNA 3WNLA 1XLKA 2IKIA 4DZ5A 4O0KA 3S2CA 1O7AA 1XYMA 4L7ZA 3QY8A 3CEPA 2W92A 5CAKA 3N2OA 4KCTA 2X7VA 1S3HA 3NSMA 4AVOA 4GH1A 1LROA 2PDNA 3P84A 3XISA 3QPEA 4AW7A 1TV3A 1S2WA 1O5KA 3R94A 4AYGA 4I9MA 2J7HA 3KDOA 2GOUA 2VURA 3LTYA 3FGCA 4FOUA 4FPSA 3WLTA 1XIDA 1QVBA 1XL9A 2WKGA 3S1XA 3UNTA 1Q85A 4FXJA 1FKXA 1RPKA 3LGEA 3UETA 1FWBC 1HZYA 2YCIX 3LEPA 3WLSA 3OBEA 3GBDA 4IIEA 3O3RA 3FN9A 3KHDA 4A8LA 3W85A 3STGA 2MUCA 3LRKA 1GZ1A 1Q6EA 1RHCA 3TXVA 4QLJA 3UESA 2XZ7A 2BHZA 1LJYA 4O1DA 2Q8XA 1LOQA 3AHVA 1XP3A 1CB7B 4F2UA 2QJGA 1YDYA 2X30A 1K3UA 1RVKA 4O11A 4MWAD 4FHAA 3PTKA 4JHZA 3AYRA 3WY1A 1E71M 4FX8A 2HPIA 2HK0A 5CZTA 5CSSA 2NX9A 3PJWA 4CD6A 4PCTA 3TVAA 4A8NA 4V28A 4XBJA 2W27A 5HR6A 1EJXC 3M0LA 2VHLA 5TBOA 1RQBA 3GR8A 2X1RA 1AZ2A 4IL0A 4N42A 2XVNA 1GGOA 2VFEA 4PTMA 1UROA 4XO7A 2X0HA 1CWYA 4HMDA 3PSVA 3VIFA 2PDIA 4AZ5A 1S38A 1ZSXA 5AC6A 2AKZA 1UWAA 4OWGA 1G0CA 4HD5A 1K4HA 2FB2A 3E0FA 3OZYA 1AMYA 3G3DA 5I3FA 1MW0A 1SM9A 3UA4A 3PBVA 4GVGA 1UC4A 2ZXQA 1DXFA 2C19A 2ZOXA 2WMFA 2CLFA 4FNQA 3C2VA 1HKJA 3FJNA 3PUDA 2E40A 3SECA 4M80A 1RCQA 4P8XA 1L6WA 3W73A 2AKMA 1GQKA 5ABGA 3RK8A 4AHPA 2TMDA 3O9NA 3TQ0A 1KC7A 4KF1A 4H41A 3TNBA 3V75A 3QMTA 5F1UA 3DG6A 4XBSA 2YL8A 1NOFA 4N4PA 5D2TA 4DZHA 1JDDA 4PCPA 1F8IA 2BY0A 1PTDA 1EO5A 3BLFA 1BAGA 2NSOA 3HU7A 2SFPA 1XRFA 2RFGA 5EMJA 2PTDA 3DBPA 5A6MA 3BVJA 3UY7A 2ZUTA 1TV8A 4GIYA 4MY9A 3URNA 2H6RA 4FF5A 1QWKA 1A5SA 1EDGA 4JTJA 3BW2A 1W2VA 4H6KA 2PP3A 1RSCA 2EJAA 1E6SM 1RBLA 3R10A 3F03K 4JIEA 1OM0A 1XLJA 1YMYA 5CJNA 1BWVA 1PCKA 5AHLA 3E0LA 2L5HA 3BSMA 1JCYA 3ARSA 4FK9A 1QOQA 4M6PA 4O1FA 3VE7A 5FF4A 4RNIA 4J4KA 2YA2A 1MI3A 4WY0A 3V5OA 4GD0A 4RDVA 3W87A 2PFHA 5FESA 3WL1A 3HO8A 3NQCA 2POTA 3TIMA 3GNOA 1PBGA 3KM8A 4XX6A 4WSJA 4EWND 1E15A 1XRVA 4UMAA 3SCSA 4HNNA 3GDBA 3A3XA 3G1SA 1WA3A 2ZADA 2FDSA 4L6HA 4H6QA 4MYXA 4W7VA 3MC5A 2FHFA 1PTGA 2A2IA 3OZOA 1LORA 1VFOA 3CAQA 1JYXA 3WJYA 4LAMA 2FZMA 3U3HA 4K36A 3UU0A 1PZ3A 1LDCA 2WSYA 3AZSA 1V0KA 4NUWA 4W5ZA 4NI3A 1W1A1 4Z0SA 3UZ5A 4YLWA 3D3FA 4ADSA 1VCGA 2YXGA 3T44A 3BV4A 5GJNA 5K9CA 3GU2A 4HA0A 2YPIA 3RITA 2ISVA 2VEGA 5HJYA 4ATLA 3NPWA 5AECA 1JXJA 3T9PA 1VENA 4M3PA 4AEOA 1DTNA 1C8VA 3KUMA 4LALA 2OZ3A 2QR6A 5F2MA 3M0YA 1BYAA 3LOTA 1K9DA 1WXYA 4F2BA 1V0LA 1W3JA 1GOKA 2HDJA 1KCZA 5H2ZA 1Y5WA 3DUGA 3LCGA 4YTQA 1GOQA 1X6NA 3A24A 3QR3A 2YX0A 1FCQA 4RE0A 3QMRA 3H7VA 3JUGA 1QASA 3BLLA 3I3EA 1IGWA 2BVDA 3N4AA 1H3GA 1K8CA 2P5NA 4RLIA 3CL8A 4FSAA 3TW7A 3OQ8A 3W2MA 2XH7A 3A12A 3RU8X 4JBRA 3F4CA 1W9VA 4XSLA 1S5WA 4D1IA 3W2LA 1A5CA 2QHAA 3B8DA 1JFXA 3CUXA 4HSHA 4XIMA 1KKRA 3F5KA 4ATWA 1V02A 2DY3A 3ZSSA 3IUHA 1GVSA 3WLKX 2YW3A 1JG9A 3BGAA 1K1DA 1C7TA 3BURA 1KM6A 4HPJA 2CFFA 1CNVA 2A3HA 2O9TA 2F2KA 5AHNA 8CGTA 2R1PA 4UTMA 1TRIA 2J9XA 2D2JA 5FJJA 3TXZA 3BMWA 2GYIA 3ARQA 1XV8A 4WQ6A 2QCGA 2OYKA 2WHJA 2FH8A 1UUOA 4H7CA 4EXQA 5FACA 2JF7A 2V0TA 4YHEA 8TIMA 2RDUA 1FCVA 3LBCA 1TMLA 2BSLA 4X9SA 1A5KC 3NTYA 2G95A 1QNQA 4UQEA 4DJDC 3UJRA 5AHEA 4GVHA 4BR1A 2C0AA 5DQPA 4WK9A 4R7JA 2YSWA 1SJDA 3C4UA 3LD5A 3MSDA 1OF8A 3E1F1 2Y5JA 4J3UA 5F2GA 2W63A 1SFJA 2Z4GA 3ZJKA 5FSEC 2QUTA 3ATZA 1WO2A 4B15A 4OFCA 3VIPA 1VIWA 2VC5A 1MW2A 1MFUA 1FDYA 1IQ8A 1WZAA 1ECQA 7TAAA 4GABA 1J18A 3Q4DA 3AROA 4AXNA 3ABXA 3VNDA 1UWSA 1W3IA 2ZBTA 1P1XA 3E6EA 1F5ZA 3NQDA 3DOPA 4OUIA 3LM7A 2BHUA 5CEWA 3GB6A 3OBKA 2O92A 2OGYA 3U0HA 3TYDA 5ABTA 3KW3A 2YL9A 2OWCA 3BGGA 2A3BA 4F0KA 3TTOA 2YL6A 1S5NA 3AIRA 3WH6A 2WNWA 3MDWA 2ABBA 3ENLA 5AOUA 3UR7A 1AK5A 2NUXA 4E3TA 3VILA 3IIXA 2OQYA 4LF2A 3PULA 4Q7IA 3OLDA 1O4UA 3GWQA 3ZLGA 1Y7VA 2JBMA 3IPWA 3TA6A 1KRCC 4DPPA 2D0FA 1OFDA 2QPUA 3AALA 4HCDA 1A80A 1Y65A 4IZGA 4MAVA 1LBFA 1IEQA 3LSBA 1OFAA 4ZQRA 1G4PA 2ACQA 3MDUA 2EF9A 4XZHA 3IIZA 1F4HA 4G1NA 1E9YB 3WLQA 2H9AB 3ID7A 4AH7A 1CLKA 1OWQA 3S5NA 2IPFA 3LHWA 3U4FA 1JGMA 3UVAA 4XZNX 1JD7A 5AYZA 3H7RA 1F74A 4LSBA 3CMGA 3SCTA 3KTCA 3ZWSA 2VFHA 3H22A 3QEZA 1JF5A 1G7VA 4ML4A 2DQWA 4EKJA 2WQDA 4DZIA 2MANA 1S1RA 1NOWA 2PD9A 1W3TA 4WKAA 4GUHA 2GVJA 4JN7A 2BVTA 1S5MA 1XXXA 1CXIA 4UTTC 1FHLA 3NEVA 4AIEA 3A4WA 2Y24A 3CWNA 1HP5A 1KM5A 2ZRXA 3WLMA 3PNUA 5BU9A 5D9NA 1BQGA 1R2RA 1SU5A 5CLWA 3ME3A 1V6WA 3W9ZA 2V6AA 4U3CA 4C7DA 2I17A 5K4ZA 1CZ1A 7CGTA 3BMXA 4HK5A 3NIYA 4A3UA 3L12A 1XGZA 2DVTA 3CZLA 2EKGA 3LBOA 3CWOX 3KL5A 1UJQA 3TYUA 3OLIA 3E2SA 4LANA 3BV7A 4MPKA 2J9ZA 1L0PA 4YWSA 2QPXA 4NI8A 5LIXX 1GVOA 3C61A 5AFDA 5FEPA 3O05A 5I3KA 3UW6A 1KGXA 3MVIA 3LLXA 1QW8A 2ZUVA 3FEQA 1XYZA 4CEUC 1R6WA 1U30A 2PRLA 2R91A 3W7RA 5BXPA 4QG9A 3QKZA 5EPDA 2PF8A 4AF0B 1P48A 1ZU8A 3A4JA 1ZLPA 4KBXA 6REQB 3L5MA 1LT7A 4RE4A 4A8RA 4GWEA 4XD6A 4DY1A 3W7CA 1PO9A 1FWIC 2ZZ7A 1WOBA 5DBTA 1SMDA 2BV9A 4WSHA 1E51A 2PF0A 4DXVA 4JNMA 2UBPC 4IXXA 2ZE3A 2E1DA 3OA5A 1WDRA 2EXOA 3UJSA 4BQ2A 1Z48A 1JPKA 4O8RA 2OQHA 4ZODA 1JR1A 3NVTA 5JH2A 4X3ZA 3NQMA 3F7JA 3N34A 3VIHA 4JR5A 2GQAA 3BCJA 4M81A 4JYEA 3C2YA 1TZ9A 3E3HA 2EO7A 4QNWA 4NJGA 2O9PA 2WZMA 1JCMP 4GBUA 1TWDA 1XDLA 3Q58A 4MY8A 1R85A 4FMVA 3W75A 1JIBA 4QGCA 3ES8A 4L6DA 2XFWA 4PMRA 3RYSA 2O9RA 4BF9A 2YCJA 4UFKA 1ONWA 3VD4A 4H8NA 1UP2A 5A8NA 5M03A 1ME9A 4IQEA 1ML1A 3FDKA 3R1ZA 2HXTA 3ARUA 2UV8G 2PGWA 4QTGA 1IWAA 3AQUA 2R14A 4B9YA 1PSCA 3MKCA 1ODZA 3QPYA 1W8SA 3PP7A 2E09A 3CHVA 4RNFA 1MUMA 1TVPA 4ZOEA 1BXBA 1X1NA 2WQPA 4NAFB 3PBYA 2IKGA 3PBUA 4UFMA 1US0A 4AZGA 2B7NA 1BQCA 5A6AA 3TYCA 4GUGA 4HOXA 5IRPA 1RH9A 3HB9A 2PU1A 1W1B1 3I7RA 3OB8A 2R82A 3SI9A 1LWIA 1S5VA 4LAOA 5HJXA 5CZJA 1XISA 5ECUA 1IT8A 4WOQA 3W7EA 2X16A 3WDIA 5GJPA 5HWJA 2AQVA 3DAQA 5DT5A 3H2NA 4IL2A 4ZO6A 4DI8A 3BCFA 3KVLA 2BOEX 3QGVA 3QFEA 1E1CB 1CX9A 1K6WA 2ATSA 1UPPA 3LHTA 1PIFA 3R58A 3H6OA 3CYJA 5DMMA 3T40A 3MW7A 3GXDA 4E6MA 3V0SA 3QY6A 3NGFA 3GC4A 3HFTA 1OFBA 3UYCA 2NUWA 3UXDA 4I8YA 3JU2A 5I02A 5CZKA 3MQTA 2GGEA 3GH4A 5C2CA 1GVQA 4RNHA 1NFBA 1HO1A 3S5ZA 2R94A 4AB4A 2UY4A 3WBAA 2EPOA 2ZA2A 4BQ4A 3ES7A 4TR9A 1O6IA 4IPPA 4F4RA 1L6SA 3M0ZA 4Q4OA 3WK0A 3OGVA 1TYGA 2H8ZA 4Y9PA 2QMJA 4E3VA 4MNKA 4ONVA 1FWSA 1DQUA 2VI0A 1GG1A 3B4YA 3MVTA 3QLLA 4I7UA 3T8QA 3IJ9A 1C8YA 3T1GA 5F7UA 2IXVA 1NFGA 3BG3A 3ZM8A 4H19A 3ZR5A 1ALDA 1I1WA 1M01A 1WZMA 5KZDA 2OLSA 5J5RA 1R5YA 4Z2IA 4JGDA 3EA2A 2XH4A 4DBDA 1VIZA 2BTMA 4GYPA 3QW4B 1V02E 3SY1A 4FI4A 5AYYA 3QGKC 3S0CA 4E2DA 1YNPA 4WGXA 1UR8A 1FH8A 4MAZA 2PLKA 3L5LA 4FLQA 5BOFA 3BOLA 3WD2A 4AZ6A 4KT2A 4M7SA 2PWVA 3N18A 4DUOA 3AJ7A 4HZ7A 3QHMA 3B3DA 1NEYA 4O53A 1UWRA 4LF1A 4GYFA 1VHCA 3FA5A 4PMVA 3GVVA 2CXEA 3SRDA 4HT3A 3FAXA 4GCXA 4NNCA 1UD8A 3N4FA 1MMFA 5IM51 3O0FA 3MCOA 5FSDC 3NNTA 3QQ1A 1QTWA 3IVSA 4C5YA 1F07A 3USBA 1B31A 1BVZA 1VEPA 1EO7A 1IT7A 4GJIA 1JL8A 2VP8A 3DYPA 1D9EA 1XX1A 2NLIA 3KZPA 1AD1A 2B0MA 3Q37A 4INFA 2BY1A 1ZJBA 1RLDA 3ITCA 4LBUA 3EOSA 1KBIA 3Q65A 3E2VA 4KS0A 4H00A 3NJ3A 2PODA 2HVNA 3INPA 1S39A 3HPAA 3TCSA 1EJWC 5EA9A 4LEFA 2IS7A 3HIJA 1LL6A 4H2CA 1ISWA 3SFKA 4CD8A 4YNGA 2G0WA 1OD8A 5ENLA 4C6NA 4F79A 4CQBA 4O17A 5G2WA 3TJLA 1MRAA 1YPIA 2RAGA 3W7IA 2V5LA 1VF8A 1XPYA 1NP2A 1VD6A 4O28A 1OIFA 1ZHAA 5HAOA 2NT1A 3R0UA 2GFTA 4E4UA 5A6BA 4HTBA 3B0YA 2XTKA 4UTHA 5H1WA 5GNXA 1PV8A 3RCNA 4I6KA 2CLMA 3S9ZA 1GORA 2OEJA 1DWJM 2X05A 3MUIA 4F0SA 2QV4A 2D23A 2XFRA 3N3TA 3P67A 3RGTA 2XPKA 2XU2A 2PB1A 3CL7A 2CCRA 2VZOA 4G2DA 6REQA 3H21A 2VX7A 4OTKA 5BYWA 2WJZA 3VOIA 2J8TA 2TODA 1DEDA 4R9XA 1UA7A 4R85A 1DWAM 2VEIA 2V2CA 5A94A 4N9BA 1CCWB 2VZVA 2Y5EA 3S83A 4FNUA 3GUGA 5LYRA 3JZEA 4MTVA 1EF2A 3BAWA 2ZRYA 3K4DA 3N2MA 5FOOA 2FHCA 3RRXA 2P10A 3DENA 1WV2A 5CAHA 3V16A 1LLOA 4ACZB 3LYEA 2YBVA 4KGJA 4NU7A 3K13A 3SCNA 2ISDA 4DAFA 2POZA 2DT1A 2E28A 3PBWA 4URIA 3LCFA 5I6SA 2TAAA 4C7FA 5DT7A 1M7OA 4P7NA 3LZ5A 2WANA 3TR9A 3P5YA 3PTDA 3ZR4A 4HZMA 4H9TA 1JXKA 2NQZA 1XCXA 4IJBA 1QI5A 4W87A 2KAUC 2O7QA 4JCLA 4Q3MA 1BYDA 2GDUA 1K8XA 1JRBA 4JIRA 2QVNA 2VC9A 1XH2A 3EB3A 1MNSA 2HZGA 3C0QA 4JTKA 2YZ5A 3C52A 5KZEA 1OVDA 1PWLA 4DYKA 3CGTA 3WQ6A 5A8GA 3C0LA 2VR4A 4NAFA 4KRZA 2NQ9A 1B3XA 4GZEA 3WQ8A 4J3VA 4K7YA 4WXYA 5TAOA 3A9BA 4MMWA 4L9ZA 3O8AA 2BWGA 1GPWA 4B5XA 3ZR6A 4QG6A 4XWUA 2JIEA 4MJMA 1UR4A 1KWGA 1HVQA 3BZGA 3PBGA 3FCPA 1YADA 1E1FA 3OEXA 3T2QA 2PAJA 4OBSA 3UZZA 4LS2A 1KXVA 4M0XA 4G8TA 5E5CA 1V3KA 1W1VA 1IEXA 1SZNA 2E4TA 1DJIA 2OOGA 3UWEA 2VKZG 4PUWA 2J27A 1CGTA 1YIXA 2JQXA 2Q8ZA 3LV5A 3PFRA 3F2DA 2FTWA 2O4QA 2QCMA 3BG5A 5E0KA 1FFQA 1SZFA 1FDZA 3KL0A 2J77A 2GDQA 3IVTA 2PRMA 1NY1A 1RV8A 1LQAA 2Y7EA 3QN3A 1MRQA 3R89A 6CGTA 3UEQA 3CIXA 1B54A 9CGTA 1JDFA 1UR2A 1FKWA 4XIAA 2IMRA 2A85A 3FJLA 3LLFA 2XHYA 5CBJA 4G9PA 4PMYA 3OVQA 4JNYA 2Y4SA 1W91A 4FNSA 1QNOA 5BZAA 3BQ5A 1RAKA 4E4FA 4ZTXA 3DI1A 1RALA 1JUEA 4JY8A 1HJVA 1ZQ5A 4ZO9A 1EA0A 3KXQA 4Q8VA 2CIPA 5KEZA 2C1IA 4DM1A 3GUWA 2QCCA 3E5BA 1E4IA 6TIMA 2OB3A 5H6HA 3A4XA 3WH8A 3NQ7A 4U3AA 1ZB5A 4TTGA 3TN4A 6TAAA 1T99A 1XPGA 3GTIA 4YTRA 1M7XA 4JFWA 3NPUA 2EKCA 1FWEC 4OHQA 5BXRA 3GK0A 4PRRA 3NAVA 4JL1A 4D6DA 4G7FA 4NNBA 3ELFA 1EQCA 2J7FA 4GKLA 1R87A 1MEIA 3ABZA 2P76A 4L1WA 1SYTA 2QPSA 3U8GA 4LOCA 3WLLA 1EZWA 5C5YA 2G4FA 3SQMA 5CJ5A 4ML9A 3QZEA 1W56A 1K7FA 1VAHA 3NZRA 5AC5A 4L6OA 1C91A 5PTDA 1W5PA 2WLZA 1ME7A 3HOJA 3EX3A 1S2TA 4YYFA 4JYDA 4IHCA 3KX6A 4C6JA 4ORMA 2Q3OA 4CU6A 4WSKA 4JQ4A 1XLGA 1DXIA 2R9RA 4LVFA 3T78A 3RPDA 3RM8A 3R4IA 4HPNA 1D8CA 5GJMA 3W22A 3AFBA 3EOUA 4O50A 3A21A 3VUSA 4WKFA 2XVLA 5L6UA 1OT1A 1TTJA 3N15A 4I9TA 3TYZA 1TJ0A 1TPFA 1B0IA 3VVGA 4KWVA 3UWYA 1TUXA 4ZR8A 2XGZA 1BTMA 5XINA 3VM5A 4QJ5B 1OYBA 2FPVA 2Z0IA 3RX4A 2OEMA 4TX9A 1XKYA 4LQ1A 3F2BA 4XAGA 3LY0A 3HPZA 3CL6A 1B30A 3R0KA 4Y7EA 3WYZA 5I03A 3W7JA 2ZX5A 3P3BA 4N0RA 5AHMA 3TKFA 6XIAA 1XCFA 3EOLA 1V03A 3EEZA 3PN8A 3V18A 1CB2A 5BXTA 3EMZA 1DPMA 2WZEA 1Q13A 3EWXA 2DDXA 5FEWA 3WBEA 1OX6A 3SRHA 1MXGA 3C8FA 2GGGA 4V15A 4QEHA 1HL8A 1K6AA 3AYVA 4YTTA 1TFVA 2W5FA 4G56A 4ZE4A 2R1NA 3DU0A 5HMEA 8A3HA 1R3WA 4Y96A 1XW8A 1LWJA 4DNHA 4V33A 4BJHA 3TJXA 3W7NA 1E0XA 3N2BA 2X0YA 1XUUA 3WNPA 1TJPA 3FKRA 1K70A 4R7WA 4BWLC 3AC0A 1FDJA 2VR2A 4KCWA 2ZRWA 5CC7A 3FJ6A 3DHDA 1O5RA 2YA1A 4MIMA 1LLWA 4LC8A 3VZYA 1JEZA 4AY7A 2ZE0A 2R8WA 3MA8A 4HMEA 3CM4A 1QPNA 4UTKA 3KTXA 3IJ6A 2X1IA 3CU2A 2JKPA 3GTNA 4PMDA 1FX6A 2QUUA 1OZMA 5EMLA 1R3RA 2ONEA 2P3EA 3SM0A 4D6HA 3IJ7A 3OP2A 3OVPA 4PSRA 4GQ0A 1ZL1A 3QQ0A 1BXNA 1GONA 4LVDA 3FSTA 2AQWA 1HKKA 2PDUA 2VO5A 2W66A 4GGBA 2DSWA 2Q01A 5CC5A 3MU7A 4HYWA 4RXGA 4GUJA 4G5DA 3B9EA 3R13A 3TZFA 1QJWA 3B8VA 2I5IA 2XH2A 1EYEA 1XD0A 4J9JA 5K2ZA 1EX5A 1NU5A 3R7MA 4YXGA 2ASHA 3S46A 1OB0A 4PUDA 1KM1A 4NRSA 4XQ6A 3LPFA 4OOZA 4I90A 1VB9A 3P61A 4HU0A 2W0UA 5BWFA 1KTCA 3B0PA 1XDJA 3PSWA 2ZX6A 3KBNA 4DYEA 3PHAA 5CGTA 4UNIA 2CZDA 1F73A 3RPTA 1C90A 1Q65A 4AD3A 1E9LA 2QDHA 4DLMA 1W17A 2V5CA 2OOFA 1PZ2A 1CXKA 3AAMA 4GXPA 3W6YA 9RUBA 4GE8A 4KIEA 1TV7A 4N6FA 5HMSA 3EWUA 2FTPA 3D6NA 4W89A 4IWWA 4UXDA 2WJFA 3M6YA 2NXHA 2HCVA 1ZRQA 3V1PA 1B5TA 2C7FA 1XH0A 3CAVA 1EXPA 1FP8A 1F9CA 2PS2A 3P93A 1N82A 2Q6ZA 4YTUA 4FALA 3E0VA 3S5YA 1JZ7A 3QXBA 3SB0A 4BHYA 3L0GA 1T6MA 4HIBA 3VOFA 3GXTA 4WKHA 3MP3A 3RM9A 3UWUA 1I2PA 3H7UA 3V5FA 4LT9A 4JTAA 3CZJA 1PYFA 1Z3NA 2OWXA 1AH4A 4AD0A 4RL3A 2X2GA 5IDZA 3V3WA 2W67A 1V7AA 3HM7A 3ITOA 1VP5A 1SR0A 2FGBA 3VD9A 4O14A 5BMXA 5M1TA 7A3HA 3UXIA 4ZFCA 2INEA 1ADOA 4GZ7A 3SY8A 3SCUA 1DJNA 1YDNA 2OT0A 3N6QA 1F3EA 3PUEA 4P7LA 1GQJA 1QUMA 5G2IA 3M5ZA 2X1UA 3E2QA 1E6QM 1FHVA 5EYWA 1TPUA 1XQKA 3BDKA 3C3UA 1GYNA 4CQAA 4AC7C 3W6MA 1OCJA 3CUFA 1DIEA 3B9NA 1JZ6A 3ISIX 4Q4QA 1C92A 4WHBA 1WDQA 2GGJA 2CZEA 4JTHA 3IARA 1VPXA 4UFJA 1XLBA 3UJ2A 4DO7A 4ZFMA 3G0UA 4B9ZA 5KINA 3ITGA 5I79A 5A1AA 3U5UA 4REQB 2VNCA 4KW2A 2OU4A 3RRAA 1VBUA 1H0IA 2FZNA 1WDPA 1J0YA 3FIGA 2QJJA 4YMZA 3FEMA 2V3GA 5E6YA 5LGZA 3ITTA 1IR2A 4O8AA 4QISA 3UWQA 4E38A 1PTAA 1XSJA 1TQJA 4PA8A 3CPUA 2BGSA 3W01A 4TX8A 1KQYA 4AZCB 2GQ8A 4MJ2A 2Q71A 1KR0A 3N14A 4WDTA 5I3HA 5AYIA 2VCCA 4HCHA 1IZCA 2HWGA 5FL1A 1QPRA 5CZSA 2GSJA 1UG6A 4NSBA 4D6GA 3W7DA 2FVLA 1M6JA 4R53A 4JTIA 4DWSB 2PD5A 4UQDA 1H7WA 1V93A 1VRDA 1N8WA 3KVMA 3WQVA 1M65A 1THFD 5D4YA 3JS3A 5HMFA 1TMQA 3CASA 2J4GA 2HJPA 3WLHA 4NNAA 2FYMA 1O94A 1RR2A 3VMPA 5C7VA 2PDQA 1TJ2A 1G5AA 2OCZA 2ACSA 3LZ3A 2IPWA 1O12A 4S23A 2NQHA 4DF2A 1DKWA 4U2YA 3H4XA 4B5NA 3T2PA 2RUSA 4CN6A 5CCZA 1CI1A 4C91A 2BGQA 2H3DA 3IJIA 2DP3A 3TC6A 3MJMA 1V6VA 3QZAA 2PWEA 1KD0A 2E1WA 4AIUA 3L2LA 5M2FX 4CU8A 1ICSA 3PAJA 1DJGA 3WMCA 1IZKA 3NWRA 2D3NA 1P6WA 3NA8A 3ITVA 4G1KA 3KS6A 5D38A 3GD6A 2OZ0A 2XN1A 4IG2B 1I1XA 3H8AA 4MVAA 4P7RA 2GL5A 1Q2RA 2PLJA 2BXZA 2WW5A 1AUSL 4KGLA 4JDBA 4YCOA 3L66A 1KNWA 4WD0A 3GYCA 3W02A 3RLGA 4Z42C 3OVRA 2UWFA 4ZMGA 3ARTA 3CMJA 1TPDA 3NZGA 3M44A 4CQ9A 4OV4A 1WQ5A 3OZMA 4G7EA 5DRIA 5AYXA 1H5VA 3QVQA 3XIMA 4HA3A 1JDEA 3NQ2A 3HJZA 2VCAA 4HP5A 1XCWA 1W31A 4QAIA 5CLTA 1GHSA 1B3VA 3S3GA 5LNWA 2V9DA 1QPKA 1LOSA 1GZGA 1K8YA 2QAFA 1TKKA 1H63A 3WQGA 1ZBVA 1ZTVA 1Q6QA 3ZT5A 4OV9A 1AH3A 4V2XA 4IH3A 1DQXA 3RCYA 4IIBA 1TR1A 3PZNA 4BF5A 2WC7A 2C1HA 4EE9A 4ZE5A 3LCWA 5CBBA 4OBRA 1KV8A 1P0EA 1VFUA 3N2XA 4XZ9A 1NVMA 4H83A 4W93A 2FGZA 1SJBA 2R24A 4IMDA 4IGHA 3TE9A 1TB3A 2W61A 3WCZA 3PPHA 4JHMA 1Q6CA 2GJXB 4UCFA 2VRJA 1OGBA 4XD5A 2X2YA 4GI9A 5LIYX 4M6UA 2FJUB 2OO0A 5D2VA 2FB3A 4UB9A 1KLZA 3VKJA 2BG5A 2PTWA 3GKFA 2G3FA 3CLMA 3MSYA 1C29A 1XBYA 2XUCA 4RX0A 2WLYA 4Z1AA 4NL1A 1G69A 1QNSA 3EXTA 4Q8PA 3BMVA 1PKLA 3BANA 3KAOA 4B5SA 3JZUA 1I2NA 1AW1A 5C9WA 4ERGA 2VT0A 1HQTA 3FJ4A 5FCZA 2OTDA 2ANUA 4IOTA 2WMKA 1MW3A 4M1BA 3A6OA 3VM7A 3HZ3A 1JGIA 5DN1A 2CZFA 4IPIA 5T8GA 3IK4A 5B7ZA 4MUPA 3GO2A 2WBKA 3WNKA 3RU6A 2OKOA 2ACRA 2OVLA 3THCA 4D6JA 3W7LA 3SCPA 2BXYA 3AS3A 2EPLX 3NR0A 3UR8A 2ZRVA 5DX7A 3PS7A 5A8PA 1UCWA 4DJEA 1G4EA 3DHUA 2OODA 2BASA 5BCAA 4HHMA 1JCLA 2YW4A 3I10A 4XG1A 1W5QA 3LK6A 3OIHA 2WCSA 4M6QA 3NM1A 3T0AA 1PWMA 2DZAA 4KWOA 1W9BM 4JIHA 1KV5A 5E93A 1T96A 1E3XA 3TCEA 4FA3A 1PX3A 2INZA 1XD1A 1T41A 3UA3A 1K7XA 2EG7A 4DI9A 3MANA 4AIBA 3KWXA 1XICA 3A5VA 5L9FA 1GT8A 3KCOA 3NSXA 3UVIA 3VNYA 2CPUA 3B8WA 3IANA 4PUUA 3CT2A 3A47A 3MMTA 3I65A 3G3MA 3G5EA 4JFUA 4R33A 1OF6A 4F9JA 2V30A 5KITA 1Y8BA 3NDOA 1J8VA 4DBSA 4R27A 1TZZA 3VI2A 1WAUA 2Z24A 3MS8A 2YZRA 1TTIA 3DESA 2I56A 4WXZA 1OC5A 3KVJA 3WN6A 1EL3A 1OG6A 4HNOA 3U4AA 3WF1A 4H04A 4CUCA 5HUOA 4XV0A 4XUGA 3AHYA 1H09A 4L5ZA 5SWUA 3S5OA 2JKEA 1MW1A 2GGHA 1XIHA 4O4WA 2VX4A 2V82A 2WKLA 1YTDA 4IJCA 3I4EA 4REQA 2ABAA 3KRUA 3URAA 4KETA 2VGBA 3MHFA 4DWDA 3THAA 1UZ4A 3AU6A 3P80A 1EHAA 1U1HA 1KCKA 2VEFA 2XWEA 4H9MA 1E70M 1LWHA 3C86A 2XIJA 3QW3A 1FWJC 2D69A 4GNKB 4NYYA 1S46A 4NZ4A 4HJWA 4HK6A 3CHCA 3DYOA 3IUIA 4DO6A 4HU8A 4Z2HA 4XZLX 4FF7A 4AHOA 3GFXA 2YBTA 3WLIA 4AWTA 1VBGA 4GI4A 2C3ZA 4JS3A 2WVTA 2WCAA 3GKAA 4Q4SA 3R8RA 5BRBA 2DJLA 4LX4A 1FCBA 1TV2A 4DWSA 2XZ9A 4EXBA 4OUEA 3ZVHA 1J12A 2QDDA 2HE5A 4IIHA 3FFSA 4MKSA 3GW0A 4BI6A 5I07A 3CC1A 4MZ8A 3BW4A 3BC9A 3V4BA 3FV9A 3VZXA 4N7QA 3MKVA 4XAPA 3B4UA 4JFSA 2WPGA 3MKKA 4WY0F 3CB8A 2FVKA 2YYUA 3SGZA 4Q8OA 5C6MA 1OADA 3MJYA 5BNKA 5I24A 1MXDA 3EX6A 4JX6A 4Z1DA 1XBZA 3GR4A 1O95A 5EMYA 5LIKX 3VGHA 1DL3A 1XLCA 3M0IA 1X98A 3KBJA 1J96A 3TLQA 2RDTA 1E0WA 3LENA 3GIYA 1UR1A 4HU3A 1U5VA 2QW5A 5A6BD 2J8GA 1CBGA 1QNRA 2GJLA 1UKTA 2Z2UA 1TX2A 3VIIA 3ZYZA 4X60A 3WNOA 2FTYA 1QU4A 1SO6A 5G2HA 4E8CA 2CXGA 2Z2BA 1GVEA 1HW6A 2FPYA 4HZ8A 4K8EA 5EGRA 2A5HA 1J79A 1UOZA 1AW2A 1TZ7A 4PSPA 1JDCA 4A29A 1NH6A 5CPQA 1X6UA 4L56A 1P6BA 3HURA 2IPJA 1X7FA 3QPZA 3VIKA 3VZZA 1T40A 4IX2A 3ZZ1A 1TX0A 5RUBA 3NDZA 1CT5A 1CXFA 2GWNA 4PTDA 1J9YA 3KTSA 1Q66A 1NFPA 2Y7GA 3EXSA 4ECLA 1EHNA 1H41A 1LG2A 1UUMA 3L0NA 3M43A 1RJPA 4J3XA 1UOKA 1G6CA 3MUZ1 4GNJA 1KFBA 2OMAA 3V0TA 1H51A 4I5XA 2YB1A 3DH7A 2V5DA 3WH5A 1VGAA 3MUXA 4QJ4B 1X6LA 4IQLA 3R43A 3G1FA 2QCDB 3RF9A 1V3HA 3SUWA 3HPSA 1BFNA 1E55A 3URBA 1ONEA 3R5EA 4RKAA 1GKPA 5FD0A 4PL2A 3V1HA 3G6LA 1PL9A 2ZUMA 3L4WA 3EPOA 4A4AA 2Z00A 1FWNA 3BSHA 4LBSA 4HNCA 3K2GA 1PUDA 1F76A 3DC8A 3M4HA 5A8QA 2DH3A 4U4MA 1JCNA 2AL2A 2Y89A 4YPJA 1GNXA 2ZIDA 3MI6A 2V2HA 4U2ZA 5IHRA 1N8IA 3ERPA 5K7JA 1IE7C 1UD5A 1DJHA 4AY1A 4PN2A 3VPLA 2VFDA 3VDAA 1AQ0A 1LP6A 1XLAA 4YYCA 4D6IA 3QTPA 3GVQA 1M1BA 2ZUWA 3VNZA 2EEXA 4BKNA 2QCHA 2XVGA 3T09A 1ZP3A 3GVGA 3PFMA 4MF4A 3PTQA 3AXMA 3M0MA 4PC8A 4K8HA 4P7QA 1ITQA 4DM2A 4S3JA 2A79A 1EUAA 4QAWA 1V6YA 1XIIA 4BA0A 1AJ0A 2GJRA 4H7ZA 4LVBA 4AX6A 3BLKA 2WZIA 4F0RA 3J7HA 1U83A 4GFSA 5HWMA 2CNCA 2XISA 1M7PA 2YYTA 3BAJA 1D3HA 3I3BA 1NDWA 5HNUA 3WLJA 3AUOA 2PWUA 3VKBA 1WKDA 1CECA 3T08A 2J66A 3WJZA 5CPLA 1B2YA 3CPGA 4F48A 2JALA 4CNPA 2DZXA 3HG3A 1GUVA 2XWDA 4UZUA 3WFAA 2DIJA 1IF2A 3EGJA 1T0OA 1WDDA 3IGHX 1MQRA 2ZZ2A 1OCNA 1BF2A 4CN4A 3W24A 4PGLA 4MG4A 3NZQA 2NVAA 3BAIA 3MI3A 3OGSA 4NJIA 4AQLA 1EJSC 2E25A 1PCWA 1QO5A 3GH7A 2FZBA 4EANA 1HGWA 3WK2A 3NXLA 1YLVA 1XLFA 5F4WA 1YBQA 3GIQA 2UY5A 3SQSA 3M6DA 3TQVA 1YNQA 3LDVA 4U5IA 1BWKA 3SFWA 2VR5A 1YTKA 1XDMA 3MYPA 1B3YA 3F2CA 4EK7A 1XIMA 2WMGA 3BW3A 3VAVA 4S1FA 4S3DA 1DIDA 2P0IA 2NV9A 3TR2A 4XKMA 3VFCA 1OG0A 4XZMX 2HXUA 3NQGA 1W37A 4Q8WA 1VEOA 3KP0A 3HGSA 3EAUA 3W6LA 2XIQA 5F1VA 1SW3A 5EY5A 1B3OA 5HNNA 5G4WA 1HF6A 2QF7A 2D24A 3B04A 5GPRA 4PULA 1EBGA 3TTSA 3W2UA 2V5BA 1SGJA 4LS0A 3LMYA 1PKYA 1IEVA 3WK3A 1TWWA 3JVAA 3MYOA 4QS6A 3TV8A 1RY8A 3DECA 4ZOBA 3L2IA 3E02A 1FFRA 4AVNA 1GOWA 3L7RA 1VFFA 1HL9A 1E1EA 2PC4A 4AWSA 1P5BA 3WEMA 3LB0A 3AXIA 4ZSTA 3PZTA 1CGVA 3EDDA 2C0HA 3EWZA 4O1EA 1GVIA 1US3A 4FLRA 2EHHA 4IMCA 2P3ZA 1A0CA 3G8RA 4ZB5A 3TN5A 2RGLA 4UOZA 3S9IA 3ABRA 3W74A 2O4MA 4GISA 3PZMA 2WJDA 3LQLA 4L64A 3CBWA 1OFEA 4HQVA 5H8MA 1F6KA 2GVEA 2XGIA 1Q6RA 2Y5SA 3GX9A 3WLOA 4A35A 1LL4A 1M03A 3WUBA 5JBEA 2ZYFA 4US6A 4LUIA 1M7JA 1XYCA 3IJ8A 4LPCA 1KM2A 1E0VA 4QEEA 3WNNA 3LRMA 3UYIA 3DFQA 3LXAA 1SW0A 3NZPA 3AICA 2Q09A 3WF3A 4B2DA 3HJEA 4FNPA 1EOKA 4B5UA 3KOWA 1UP0A 3L68A 4NZ3A 1Q5MA 5K9DA 4Z08A 5ECVA 5I3JA 4AZHA 2A0NA 1H50A 3SUSA 3LRLA 1KCXA 3M46A 2HMCA 1CGXA 4I5UA 2QCLA 1KM3A 2J7GA 5CGQA 1H7RA 5C9RA 4A6GA 4JICA 1Q8AA 3VDCA 4EVZA 1BXCA 3VCRA 1BYCA 3WD1A 3GNDA 5CGMA 3TTYA 3UCQA 2A6LA 1UW9A 2EPHA 2P50A 3TH6A 2OLHA 1KBKA 1FUYA 1W0MA 1V8EA 4Q4RA 3SAZA 3IGXA 1EJTC 3SBFA 1CPUA 3EDKA 5I06A 1P4CA 4JEJA 3P8JA 2FIQA 4OECA 1MDLA 1L8NA 1EIBA 3NL6A 4AU0A 1TREA 4RNJA 3DKJA 4F0LA 1OFPA 2E7FA 3PM6A 4Z2JA 1G4TA 1KBLA 5HDRA 1EPVA 1HUVA 2WC3A 5DEZA 1DE6A 4J3TA 3VCNA 3OA3A 4JQ1A 3G24A 2G41A 3F5JA 3U48A 3LXCA 2OO6A 4NJHA 2Z7GA 2E3ZA 3G22A 3K5XA 3EOOA 1WUFA 1Z44A 4CGTA 5E6ZA 2X1SA 3AYSA 5AVNA 2WNQA 3G1RA 2WYSA 3ZMRA 3TMQA 3TC7A 1IGSA 1OHLA 3QC0A 3EDFA 1DJQA 2QCDA 2A3AA 1N8FA 2FMNA 3CIVA 3PY2A 4CEXC 3FYPA 3R11A 5HQEA 4WDXA 3VXGA 3LHUA 4C6OA 1MXSA 2EJ1A 3WF0A 3VGGA 1E9IA 2PDXA 1XIJA 4LY8A 3OZPA 2FH6A 4H8UA 1UKSA 2E9LA 2VD9A 1MWOA 3B8IA 3SN4A 1L9WA 4FIRA 4JIIX 4PCNA 1NAL1 2R1MA 1JFHA 3PWAA 4GYPC 1JAKA 4HYVA 1DIKA 1QI2A 3IACA 5FI8A 1H1NA 2G8ZA 1US2A 1WNOA 1U33A 1JF6A 5DF0A 1TG7A 2WSRA 4LU0A 4BEUA 3N2TA 4C60A 3UY8A 1WBHA 4Z17A 1GKRA 4KCUA 4WGHA 1S1PA 4BQ3A 2WM1A 3W00A 4D8LA 3ARYA 2YXXA 1UC5A 4FLOA 3BQ6A 2BP1A 3TSMA 3D5HA 4ZO7A 1PIGA 1HN1A 4I6VA 3AISA 4FX6M 1FH9A 5D04C 2VD8A 4O52A 1RLCL 1RCXB 2ZVIA 4UOQA 1TPVA 2TSYA 1Q6GA 2PTXA 3R8HA 3H26A 4MDPA 4BEQA 2QV5A 1U5HA 4FNTA 5DXYA 5GNYA 4GQGA 4Q8MA 1V3LA 2PBGA 4Q7NA 5C71A 1IXQA 3EX2A 2VX5A 3OHIA 4E8DA 1I0DA 1DVJA 2V68A 5AHIA 2PA6A 3QGAC 4NX5A 1K02A 4KRTA 1YNYA 2GUBA 4JTUA 3AHTA 1PIIA 3HF3A 4ZEPA 3BGJA 1G7UA 3DG3A 3ANUA 3HV8A 4ICMA 2XG9A 1BG9A 2DW6A 2X7WA 2WHMA 2W3ZA 2X1TA 2W6RA 2CWNA 3EPNA 4IGSA 3BUVA 2VDGA 1NF0A 1ZY9A 2DIKA 4U28A 1L2UA 1M68A 2Y7FA 5A6SA 1PE1A 4FS9A 4ERIA 3W83A 5BOEA 5HUPA 3AIEA 4AC1X 3AIQA 1J0HA 2ZTJA 3GG7A 3OG3A 4JYFA 4GRSA 1NOUA 4MB5A 4PBGA 4ALDA 2B7OA 1V77A 1U5JA 1TPC1 1JI2A 1GW1A 2WVUA 3GAKA 3RMEA 3A9IA 1B4KA 1BEUA 1R3SA 1YDVA 5AC8A 1JD9A 3ARWA 4S3CA 2ZQ0A 3QYQA 4AYSA 1OX5A 5HULA 1KFWA 4ZCWA 4JIQA 1EKOA 2PZNA 2LLEA 2I1OA 2PGFA 4FNRA 5A2BA 2HVMA 1Q3NA 1ISZA 4AIOA 2DH2A 1MFVA 3EDJA 4QCFA 2Q3RA 1W1YA 4DIAA 1J0JA 3LHVA 4NHVA 3FYYA 2PTYA 4S38A 1VQTA 4S2CA 5DMNA 5FAJA 2NQ5A 2YDRA 3QC3A 4GOAA 3H2OA 4I5RA 1FOBA 2CEQA 5FJTA 2BHYA 3VYLA 1NQKA 5HQLA 3CH0A 2DZUA 3H4WA 1EC7A 3K1GA 5D8WA 1IIGA 5DY3A 3WO8A 2VCBA 1QK2A 2YJQA 5DBUA 3GXPA 1XS2A 3UZWA 5CSYA 4JNZA 4TIMA 2GVYA 3BO9A 1ESWA 2XINA 3GR7A 3B06A 1K03A 4LAZA 2NX1A 4ZXLA 3LHYA 3N9RA 5LKYA 2ZICA 2EPNA 1P0NA 2J47A 1K8ZA 1W54A 3KRBA 3S2LA 3W25A 3W1QA 3KL3A 3QR1A 4HOWA 3VOHA 2CITA 1Z42A 2YCLA 1ZJHA 3BLIA 1TVNA 2IPGA 3N6JA 4P8UA 2QGYA 4PMXA 2E5CA 3R2GA 2HTMA 2P88A 1CLVA 1CXHA 2VJXA 5G5IA 4MB4A 1RD6A 4AD5A 3W71A 3S6OA 1E5NA 3NVDA 1MDRA 3H2CA 3HPFA 3W3OA 1CXLA 4GIAA 4H9UA 5FL0A 3OBAA 1FXQA 5LNVA 1LTDA 4L4LA 3KVKA 2WB5A 5HINA 3F4DA 2X42A 3MCNA 5M5DA 2CESA 3HGOA 3TFCA 2QEZA 4RV3A 3YPIA 5BOOA 3EPMA 1TMHA 5IFPA 2WSPA 3RDKA 2A7NA 3WBWA 2WAGA 1TWSA 4RXFA 4QXIA 2E77A 4BQ5A 3KDNA 1BGGA 4V1YA 4HOZA 3LCXA 1W3LA 4UC5A 3W29A 5ABHA 3H2FA 3L9CA 3VOJA 2QUVA 2P53A 2YFOA 2PEVA 4XAFA 4N2YA 1PHQA 1OGSA 4LFYA 2I9EA 4A05A 2CYGA 1GVRA 4L9YA 2DIEA 4JTSA 3TONA 4LRSA 4O15A 1ISVA 2OJPA 4P7OA 5M17A 3LS9A 3MSGA 3GG8A 5AKQA 3VKCA 2NQJA 1D7KA 4QRNA 3C8NA 4MWAE 3CO4A 4OJYA 3LG3A 2W62A 4H8VA 3VO0A 1RA5A 3PUGA 2W79A 3REQB 2YFNA 3G2GA 3AMCA 3O63A 4MKNA 1B3ZA 1H7NA 1TR9A 1EH9A 4LTSA 3GXNA 1SPQA 4XTDA 4LGXA 2GJPA 4R34A 1EA9C 3AIVA 4GI6A 3CUJA 3WBYA 4C5ZA 5KZMA 4B5WA 1YDOA 2VUNA 4JX5A 2PDKA 1L8PA 2QNEA 3VIJA 4QLKA 3QYSA 3PPGA 3HBLA 1BKHA 2CKSA 4TXEA 3RR1A 2JEPA 1FBAA 2VTFA 3O0KA 3CLWA 4LUSA 3GXMA 1R7OA 5I3GA 4ENLA 2FHBA 2PU0A 4R5EA 4O18A 2D2HA 5LXXA 3BOXA 1VLWA 4AISA 5EMUA 1WZLA 3ZT7A 3E0IA 4GVIA 4QJ1A 5CG7A 4HNLA 3M7WA 2ZC1A 4ROQA 2ZDSA 1UZ1A 5BROA 3PG9A 4PUEA 4HMCA 2GDVA 1MZHA 4KFPA 2WM0A 3CZEA 1DP0A 3SADA 4ZBCA 2XSXA 1CW2A 3ZS4A 4DZAA 3HQOA 4EPEC 3P14A 1NSJA 3W86A 1JZ5A 1IZJA 3IAQA 3TSDA 3M0KA 2ACUA 4UWMA 5LIWX 2QF8A 1HFBA 4GKTA 2DORA 3DFOA 3QOMA 1WXJA 3EBVA 4Y6GA 4DJED 2QVHA 2RKXA 2CU0A 3MSRA 1A5BA 4PEEA 2ATMA 2C14A 1VC4A 4RE2A 5A3HA 2GGIA 3I7SA 3N12A 2WKJA 1C8XA 4PFMA 1BG4A 3GRIA 3L5AA 2FJKA 3U7BA 3PJTA 2ISSA 3MBDA 3ZFHA 1LM1A 4DXXA 1ZALA 5LNUA 3GC5A 1GTEA 2ISWA 3W76A 2NUYA 3AS0A 4XSMA 4QS5A 1X1OA 4XKYB 5CC3A 1GEQA 1RJRA 1KWKA 1OK6A 1X8FA 3QRHA 3CYVA 2NZLA 3WEOA 1QR7A 2F9RA 4GLEA 1E73M 2DVUA 3LERA 2NV2A 3PR2A 3M64A 1ENUA 2PP0A 3M41A 3CXOA 1SFSA 5HQMA 4KMQA 3OLGA 4DJFA 2WZTA 1EEPA 2OT1A 3UWWA 5GVJA 3QFWA 1OQFA 1UD2A 2V67A 4ASTA 1X8CA 2JGQA 1XWYA 1UPMB 2ZWZA 1XGDA 3MUY1 4WCJA 1MUCA 4NF7A 4AZBA 1VBHA 3R79A 3DDMA 3P5ZA 4X2PA 3KFTA 4LRTA 4LB3A 4FOJA 2BDQA 1L6GA 1HT6A 4FP1A 3WMSA 1KB3A 2FZDA 1KFCA 4W86A 3GYEA 1TPEA 4GIRA 1DQWA 4Z2LA 3GW3A 1TA3B 2J13A 3GH5A 1LQ2A 1HJWA 5A2AA 3SN0A 4AD2A 1QPQA 2HROA 1J93A 3BH4A 2B7QA 4Q8NA 3RHGA 4HPGA 4EWJA 1KFKA 2PDFA 3OJGA 3FHAA 4A3RA 1H49A 4K39A 4PMZA 2XGBA 5D2YA 2QUMA 3MHGA 2C1GA 3NO3A 3V5CA 4XVEA 2ESCA 4WVXA 3F4WA 3EB4A 3V0UA 4DWSD 3UQNA 4IP7A 4HA1A 1MYRA 1AQFA 1BD0A 1LOLA 4CU7A 1EX1A 3BG9A 4NZFA 2OEKA 3UCDA 6PTDA 2E67A 4PR4A 2CBUA 1XJBA 3FDGA 3C2OA 3S1VA 4KPLA 4LUYA 1UR3M 1GYLA 4PTVA 3CH9A 1I8JA 1NJJA 2NSXA 3WD4A 1DJWA 8XIMA 3NQEA 3ICJA 4R7OA 5C55A 1WPCA 4U5KA 1ISYA 4Q7BA 3KBWA 4LS1A 3HFYA 3PZVA 1K9EA 1Z41A 4W8BA 1S3TC 4ZQOA 4DPQA 5A6TC 4Y9NA 4C6PA 2GQ3A 1BSIA 3SUVA 3N11A 2VGGA 4F8XA 4MFDA 2VRQA 1TRDA 1IEWA 2H90A 2OX4A 2O7SA 4HKPA 3BLEA 4DNMA 2D0HA 4FZIA 3B40A 3NZ1A 4K6AA 1ZFJA 1F7BA 4EAMA 3N9KA 2ZCGA 4JEQA 4Q6JA 1JZ2A 2GWGA 4W7WA 1ADSA 3PPCA 2E5BA 5JBDA 3HN3A 1U1UA 3B8TA