3EBVA

Crystal structure of putative chitinase a from streptomyces coelicolor.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
SLKHAVTGYWQNFNNGATVQKISDVPSAYDIIAVAFADATTTPGAVTFNLDSAGLGGYTVDQFKADVRAKQAAGKKVIISVGGEKGTVSVNSSASATNFANSVYSVMREYGFDGVDIDLENGLNPTYMTQALRALSAKAGPDMILTMAPQTIDMQSTQGGYFQTALNVKDILTVVNMQYYNSGTMLGCDGKVYAQGTVDFLTALACIQLEGGLAPSQVGLGLPASTRAAGGGYVSPSVVNAALDCLTKATNCGSFKPSKTYPDLRGAMTWSTNWDATAGNAWSNSVGAHVHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative Chitinase A from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Structural genomics, unknown function
molecule keywords Chinitase A
total genus 99
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ebvA00
2ZXDA 4GZEA 2YL9A 1W3LA 2VL4A 2XWDA 3OGRA 1KXVA 1JZ5A 1OT2A 3PZUA 1DP0A 4PMYA 1UKOA 1HJSA 2X0YA 2V3DA 2J62A 3AHYA 4B16A 1IT0A 4D6DA 4Z2KA 2VCBA 3AI0A 1UG6A 3WUFA 1W1TA 2RGLA 3WUEA 1NWRA 3OBAA 1JYXA 3NSMA 2GJPA 3WQVA 2BFGA 3T2PA 5IXEA 4WIWA 1J9YA 1XSIA 2GDVA 1V03A 2XVNA 3SCVA 2PWDA 2VQTA 1CPUA 3L4VA 4Q7NA 1V0NA 2WAGA 4CVWA 1EHNA 1GJUA 1UD6A 2FDMA 1UD8A 3WD2A 4PTXA 2VZOA 3AZRA 3SCOA 4EK7A 1B3WA 3LPFA 1GOWA 1GOOA 2YA2A 3WNPA 4MB3A 1LLOA 2OWCA 4CGTA 1L0PA 5BROA 4AD4A 2J7HA 4BQ4A 4UOZA 2GK1A 3QHOA 3QR3A 2VOTA 5ABFA 3WH7A 1QW9A 3UG3A 1C8YA 2WHLA 3CHFA 2XHYA 1XH2A 1Q4NX 4R5EA 3WH5A 2O9TA 1PPIA 3I3DA 4NZCA 3VNZA 1GCYA 3WL1A 1I1WA 2BVYA 2CYGA 4HMDA 1RH9A 1CXHA 2XIBA 1E6XM 1MQPA 1OGSA 1SR0A 2DEPA 3EBVA 5D9MA 4D1JA 2GUYA 2W66A 2D3NA 2D23A 4KRTA 2E3ZA 1CXLA 4UQEA 1JFXA 3DHUA 4M1RA 3T0AA 3VIOA 1KWKA 4PMOA 2ZUVA 3GXDA 1H0GA 3W6LA 5DFAA 3AMLA 2BNJA 3VX0A 3OZOA 1XYFA 4HU0A 1FA2A 2VRJA 1JDCA 5D9PA 5I23A 2VZSA 2WMFA 2PWHA 5JBDA 4OJYA 4PMNA 4QDMA 2UY2A 4NRRA 1D2KA 1S46A 4P8WA 1JZ8A 4UTFA 2CHOA 2E9LA 3NCOA 1L8NA 1OSEA 1BVNP 3W24A 1VBUA 1UOKA 2A3EA 3M07A 1M04A 1LL4A 1KGXA 1OGBA 3SUWA 2ZXAA 2G3NA 5HPOA 1D3CA 4PUDA 3ARUA 5LA2A 2XVPA 1B3VA 3KEHA 1QI5A 4PMXA 1Q6CA 2ZUUA 1TZ7A 1HP5A 1E1FA 4HTYA 1JL8A 3U7VA 4BQ5A 4TVDA 5FD0A 3AXXA 1V6UA 1WNOA 2VRKA 3PZGA 3W26A 1UZ4A 3GXMA 1CENA 3AIUA 7CGTA 2VZTA 4PTWA 1HJXA 2OWXA 4U3CA 1H0IA 3UETA 2G3IA 1GOQA 5JBEA 2D24A 1ODUA 1EOMA 2Z1SA 3ZMRA 2XTKA 4W5UA 1C90A 1RP9A 2OSYA 4D1IA 4B15A 1DWHM 4JHOA 2DDXA 3K8LA 3AIRA 1HP4A 1HVXA 4PN2A 1BG9A 1YQ2A 3QGVA 1GQIA 3GBDA 4HOXA 5D9OA 4CD7A 5A1AA 1GPFA 1W2VA 1V6YA 1V6VA 2BXYA 3ZR6A 4DWSC 1BLIA 1OIMA 3FN9A 4D6JA 2WZIA 3VGBA 1WB0A 1QVBA 2GVYA 2X8RA 2EBNA 3K8KA 4W7VA 2WW5A 3GYCA 1UWRA 1PIFA 4HPGA 2WMHA 4JFSA 1GJWA 1UYQA 3ZO9A 3EDJA 1TA3A 2D0GA 4H04A 3VO0A 1KR0A 3L4TA 3VIMA 2BY0A 4TX8A 5A94A 1UR9A 3GM8A 1UH3A 4PBGA 3W4RA 3W0KA 1B30A 5GQBA 4PTMA 2EPMX 4HMEA 3L2LA 4TTUA 3POCA 1W91A 1NH6A 1GZJA 1E3ZA 1E4LA 1FFQA 1VEMA 1CGUA 1WDRA 4WKHA 3VD9A 1JAEA 5I78A 2GFTA 5ABFB 3MMWA 3B9DA 1NWTA 1D7FA 5I79A 3PTKA 4WLCA 4J27A 4DM1A 3WUGA 3N04A 1C7TA 3CHDA 1EDQA 1MW3A 4QCFA 4TUFA 3IANA 9CGTA 3ARRA 3T2OA 1UA7A 1GUVA 5AYBA 4H8VA 1DWGM 4XB3A 3ALFA 2X2YA 3T0BA 1DWIM 4GQRA 2ZX5A 3OIHA 1WE5A 3BSGA 3GBEA 4LYPA 1WDSA 2DSWA 3BLPX 4JIEA 3W6MA 1V0LA 5JUVA 4LX4A 4CU6A 3VD5A 1GQKA 1QHPA 3WD1A 4CN6A 2CBUA 1VIWA 3VIPA 3PBGA 4MB4A 5A3HA 1EH9A 3FNDA 1V08A 3AIVA 3RO8A 2EPLX 2ZUWA 1VFFA 3BAJA 4CCDA 4EANA 1NOWA 1E71M 5BXTA 5CXPA 2QLYA 3VGDA 4J3UA 4ZXOA 2BV9A 1NP2A 4UR9A 1VEPA 3TOPA 1OWQA 3HN3A 2D3LA 3IJ7A 2OLHA 4YHGA 1WDQA 2CHNA 4H2CA 4W88A 3WD3A 1NOFA 3WH6A 1C92A 1J12A 1ITCA 1KGUA 3WDJA 4H41A 1JYNA 2D1ZA 5CLWA 3VDBA 3TTSA 1H11A 1GOKA 2G3JA 5E6ZA 3VDAA 1MXDA 1VJZA 4ZEPA 3IJ9A 3ZJ7A 1GVYA 5HDRA 4U5KA 2VNCA 3SEPA 4KWUA 4WSJA 4AEFA 2ZX7A 3AS1A 4UFMA 1QHOA 4JZ5A 1LJYA 4PMUA 5CG0A 4JFTA 4BF7A 4LQ1A 3RM4A 4AY1A 1A47A 2JF6A 2WHKA 1G94A 1VBRA 3II1A 4JKMA 2VI0A 4M81A 2J7EA 1E0XA 3AIQA 4B9YA 3PZNA 4EAMA 3KWXA 1B31A 4A3YA 7A3HA 1H3GA 3AOFA 5TD4A 5BRPA 1EO5A 3PN8A 3K46A 5A69A 3SCRA 4OIFA 1W9DM 5GNYA 5E09A 4PYSA 1ZL1A 3AZSA 5A2AA 1R7AA 3F5KA 5CQ1A 2ESCA 3WDQA 3CZGA 1XCXA 2V3FA 2OYLA 3PZQA 1UR0A 4DWSD 1CXIA 3SUSA 2D2OA 5M3WA 1GHSA 4M24A 2DSVA 2Y8VA 3AIEA 1BGGA 3ZT5A 3BMVA 2Y8KA 3NDZA 1GQLA 2E9BA 3SURA 5IHRA 2WM0A 5A8NA 1H4PA 2EQDA 1PEZA 2BXZA 1ZBCA 2Z1KA 3A6OA 4AIEA 1SYTA 2W67A 1TCMA 4CN4A 3KL3A 1JGIA 2QHAA 1HT6A 4PMZA 2QMJA 1FH9A 2G4FA 1F4AA 4U31A 1ISVA 1HJWA 2CKSA 4ZFMA 1E9LA 2XM2A 1E6ZA 4XUYA 3L4WA 1YHTA 4CU8A 3VILA 4H7VA 3VPLA 1TFVA 1PX8A 1QI4A 4BS0A 3WFLA 2WVVA 1EO7A 2VZVA 4FLSA 3UESA 4D6EA 4W8BA 3WELA 1W1PA 2V3GA 4K68A 5HNNA 4AIOA 1FP9A 5M5DA 2E8YA 1B1YA 1X1NA 5C70A 1KCKA 4E8DA 5AC5A 2VQUA 1V3LA 4FLRA 1XH0A 4CUCA 1E73M 4XZBA 3TTOA 4L4OA 3WNOA 2WSPA 3RJXA 4AD3A 3WBEA 3WNNA 1W9PA 1ISZA 2Y5EA 1KQYA 4TVCA 2C0HA 3CZKA 1OBAA 2VT0A 1FH8A 3AYRA 3ECQA 3VVGA 1W3JA 2YJQA 4AZCB 3WH8A 1MWOA 2JE8A 2VX6A 3FXYA 1HKKA 2CBIA 4UQDA 3LPOA 3PZTA 1MFUA 2ZUMA 5LYRA 3AXHA 3ARXA 1MQRA 4AMCA 3MANA 3UR8A 1UA3A 2Y4SA 3N1AA 4ZE5A 5DMYA 4DUVA 2EEXA 2DSZA 2E0PA 3BXWA 2VCCA 2G41A 3CMGA 4PRWA 3JUGA 2XPKA 3PZMA 2WVVB 1ZJAA 3ZJKA 2WB5A 1GORA 3SCPA 4IISA 3I3BA 4QCEA 1ESWA 4W8AA 5CPTA 4W93A 2CIPA 1PIGA 3K8MA 1KBBA 4U3AA 2AAAA 4D71A 1PZ3A 1UKPA 4GI6A 1UKSA 3FY1A 2ZUTA 8A3HA 1K9EA 4JL2A 1QI2A 3LPGA 1JYWA 5E9AA 3MV01 3M6DA 1PJ9A 3W27A 2YL6A 1EDGA 1JAKA 2GJRA 4HZ6A 3OB8A 3AIWA 1R8LA 2VTFA 5D8ZA 3ARQA 3UG4A 3SUVA 1E55A 4WSKA 3PHAA 1NWUA 2ZIDA 1C7SA 3E1F1 2F61A 1JIBA 2GSJA 3ZJ6A 4J3WA 1HJQA 5I2UA 1UH2A 1XD1A 3NSXA 3K4DA 4HZ7A 1DEDA 1KCLA 3F5JA 3U5UA 3MSGA 5A8QA 3BGAA 1UD5A 2CETA 1J0HA 1PBGA 1NM9A 2CKRA 4DUWA 5GNZA 5HPCA 1IZJA 1Q6GA 3OGVA 2ZWZA 3O2LA 1OD0A 2GJXB 1V02A 2FGLA 3WDRA 4ACZB 5A6SA 4KRUA 3THDA 4MDPA 4PSRA 2JEPA 4EE9A 2E4TA 4CD6A 5GNXA 4R27A 4F79A 4ATDA 2C8NA 4AIUA 3VMNA 1UR4A 3ZSSA 1QPKA 3AISA 5CJ5A 4Z2JA 4JFWA 4AZ7A 2XIIA 1XHGA 5HBFA 3BAWA 2FGZA 3WQ8A 4P8VA 1V3HA 3D5HA 4J28A 1OIFA 2DIJA 3AJ7A 3UCQA 3OLIA 3WMBA 2UY5A 2W62A 5A2BA 3CUGA 3VDHA 2BY1A 4DM2A 1QNRA 2VUYA 2XFYA 2ZXQA 2AOSA 1PX3A 1KWGA 1HL8A 5BXRA 4P7OA 1LWJA 2WZHA 1N82A 3N13A 1C93A 3WH9A 4WJXA 2MANA 1QBBA 4CD8A 2JALA 2EPNA 3AHXA 2XG9A 1AQ0A 4UOQA 3SCWA 4NRSA 3EMZA 1E0WA 5BXSA 2WANA 1JZ6A 3IJ8A 4P7NA 1E6RA 1BPLB 2G3MA 4M80A 1MW0A 3M7SA 1EIBA 2CERA 1BYBA 3PZIA 1R7OA 5LA0A 1J10A 1JDAA 1UHVA 1V6WA 3ZJ8A 3VIKA 2VRQA 2G8ZA 4FMVA 1M01A 4CKQA 1C91A 2D22A 3WNKA 1XSKA 3F4VA 1CGWA 4Z2IA 2V3EA 4BZYA 3RCNA 4E2OA 4AC1X 1OGGA 2CPUA 1O6IA 4WKAA 1B3XA 3BCFA 1OD8A 3VIIA 2YBUA 1G01A 1UWQA 2J7BA 1EOKA 2VVSA 4D6GA 5D9NA 1HXJA 3N12A 4QLJA 4GO8A 1XRVA 1LF1A 3EMCA 1XGZA 4A3HA 2OSXA 4UFJA 4JKLA 2W63A 1JXKA 6CGTA 5KEZA 3AHTA 1WO2A 3GH4A 1ZS2A 3CH9A 4AZHA 4U33A 3WBAA 4V2XA 2GJXA 1BAGA 4MJ4A 2V5CA 3WF2A 1K6AA 2A3HA 3UR7A 1G0CA 4D72A 2OWWA 3AMDA 2YKKA 3WQWA 2O9PA 1UD4A 2CBJA 1UKQA 4S3JA 3TTQA 5A8OA 1EQPA 1HJUA 1JF6A 3WY1A 3NYDA 4OKDA 1GNXA 2CEQA 4UCFA 3VGGA 2WSKA 2DH3A 1B90A 3WL0A 5BWFA 3WKZA 3RILA 3AS0A 1CDGA 4Z2HA 2VX7A 3CZLA 1WP6A 2BVDA 2VMFA 1OT1A 3AQUA 2XFRA 4UNIA 1MYRA 1MW1A 2CCRA 2JF7A 3VNYA 2CNCA 4J3XA 4B3LA 4GZIA 2DT1A 3SCTA 1QBAA 2VO5A 4AD1A 1MFVA 3IAPA 1UWTA 3FHQA 2YOCA 4DWSB 4AZBA 2J77A 2UWFA 1G1YA 2XM1A 2J7GA 3WN6A 2A3AA 2ZWYA 4FK9A 3ZR5A 4F9JA 5BCAA 1JZ2A 4C7FA 1DWJM 2GK1B 4B3KA 1UWIA 4JAWA 3DYPA 3N9KA 2W91A 1J0KA 3VIJA 2XYLA 5FL1A 1BHGA 3KZSA 4GI9A 5BYWA 4LGXA 3W53A 3OLDA 2BY2A 1TVPA 2X1IA 1V0KA 1E5NA 1CECA 5E0FA 4X0VA 2ZX9A 1R85A 1HF6A 3K1DA 5C8BB 1UUQA 4B9ZA 3RMEA 4DWSA 3MUY1 4A4AA 1UR1A 5A8MA 5JIPA 4M56A 2PWFA 5M17A 2WC7A 4MB1A 3VIFA 1DHKA 1X6NA 2VZUA 1TA3B 4UFKA 2J8FA 3WDIA 2DSKA 2V5DA 1VFOA 3KL0A 1Y7VA 2WHJA 1WKYA 3I3EA 1CXKA 4MADA 1LL6A 1JYVA 2WPGA 4P7RA 1JI1A 3EDDA 1UZ1A 1M03A 5E6YA 5AC4A 1KR1A 3CZEA 2PB1A 1KGWA 1UD2A 3MO4A 4F8XA 3SIMA 3ARVA 3FAXA 2WKGA 1U33A 1ODZA 1HNYA 5CPSA 1KQZA 3M46A 3BAIA 3DHPA 5DO8A 1LL7A 4FLQA 3L2MA 4E4PA 1ZBKA 2E8ZA 4JL1A 4H8UA 3VU2A 3A4WA 1DTUA 2OYKA 4OOZA 2J74A 2XGBA 1M7XA 4RE4A 3BH4A 2DT3A 1J0ZA 2XFFA 3DYMA 3VTRA 2AMGA 1TE1A 3VIHA 4HOWA 1LG2A 5LA1A 1E6NA 4PCTA 2WMIB 3ZT6A 1EGZA 1MQQA 3AXIA 2J75A 1NOUA 2W4XA 3BSHA 2PBOA 5CZKA 2A3BA 5CSUA 1WZAA 3AYSA 4UZUA 1ZU8A 1BTCA 1BYCA 2VX5A 2DH2A 1QI0A 2DIEA 4W89A 4BQ2A 4MAZA 3WNLA 4U2ZA 3MUAA 4QFUA 3LPPA 1BSIA 1JFHA 4AD2A 2WBGA 3L4YA 1WCGA 4AZ5A 4U2YA 3WMSA 2J79A 1Q6EA 2YLAA 3THCA 4UQAA 1CZ1A 1U2YA 5EFDA 2Y2WA 1OINA 2QPUA 2PF0A 1CLVA 1LG1A 2OYMA 3L4UA 4MDOA 4M29A 1QNPA 3GH5A 3QHNA 5ECUA 3VKKA 2XWEA 3SCSA 2EJ1A 3G6MA 1MW2A 4AD5A 3GXIA 1VFUA 3MUZ1 1B9ZA 5A6KA 2YIHA 3VDCA 1NWSA 5EMYA 1NQ6A 1VF8A 2DSUA 3WQ6A 5A95A 2O9RA 4PUEA 4CD5A 4FLOA 1ZJBA 2A3CA 2CBVA 4W85A 1I1XA 4AZGA 1C8XA 4Z2LA 1HX0A 2CXGA 3W82A 4WF7A 3BCDA 1KXHA 4PMQA 1CYGA 3CUIA 2WMIA 5HXMA 3BAXA 3K4AA 3AIBA 2QV4A 4Z2GA 4KH2A 3VM7A 1JNEA 3BC9A 3B8SA 2WCAA 7TAAA 1QOXA 3VD7A 4RE3A 4KGLA 2QF8A 4D6CA 2WLYA 3T0DA 1ITXA 5F7UA 2VCAA 1PZ2A 1E15A 2D0FA 2WKLA 2JEQA 2YA0A 1JZ3A 2RGMA 3PTQA 1E6PA 4PMRA 3AHVA 2YA1A 1HN1A 2X05A 3TONA 1H09A 2ZOXA 1QHZA 5CGMA 4H8HA 4P7LA 1E4NA 1B3ZA 4YHEA 1SMAA 1AMYA 1BG4A 1TMQA 2ZX6A 3ARSA 4MJ2A 5D8WA 2XVKA 1RD6A 4W7WA 3CUHA 1BVZA 1BGAA 4QP0A 3RDKA 1EXPA 3VUPA 2EPKX 2BS9A 1EHAA 2WMJA 3POHA 3OGSA 3WQ5A 1BFNA 1FP8A 1TUXA 1UQZA 4MNMA 1EA9C 3WSUA 1VAHA 1JXJA 3LMYA 2O92A 3AROA 3KL5A 3RPMA 3AFBA 1I75A 2EXOA 2V38A 4RL3A 2J8GA 4AZ6A 2VJXA 3MMUA 2JFEX 3FHAA 1E72M 5A6JA 5AY7A 4MAVA 3BMWA 4W87A 3WD4A 3VGFA 3CTTA 2WXDM 4P8XA 1W9XA 3WEOA 1HJVA 2CESA 8CGTA 3U7BA 1K9FA 1GQJA 2YDRA 1V3JA 4GIAA 4PMDA 4LXFA 1J0JA 1BQCA 5JIWA 5JBFA 1HVQA 1OCQA 2WVTA 3AMCA 2IXUA 4J3TA 1W32A 5KZ6A 4C7DA 2UY4A 3GXFA 4LYQA 5A6BA 1V3MA 2DQXA 4WKFA 1Q6DA 3ZSTA 2WVUA 3WDHA 4AD0A 2EPOA 2PC8A 1ISWA 4FF5A 6A3HA 2W92A 5HOSA 4URIA 1CEOA 3W81A 1ZB5A 3CZJA 2XVLA 4AZIA 1ZBWA 4F66A 1EDTA 4TXEA 5CLTA 1V3KA 2DT2A 1E4IA 5IFPA 4V27A 2WC4A 3VD4A 2F8QA 1H49A 4UQ9A 2BHZA 6TAAA 1K9DA 3G6LA 3RM9A 1E56A 2QMKA 5I3DA 4W86A 3IAQA 4EKJA 4ATLA 4CVUA 1W1YA 2VC9A 2J47A 2YLLA 4GINA 1ECEA 3MU7A 5BXPA 1CBGA 1KXTA 1OB0A 1WDPA 1BYDA 3ARWA 4ACYA 1E6SM 1HL9A 1W9BM 4CD4A 1GOMA 1VFMA 3WF4A 3N11A 1XV8A 2J25A 3ZT7A 3OLGA 4MNLA 4L4PA 1B2YA 1LQ0A 3BAKA 2Q8XA 3F5LA 3VD3A 4PCSA 4AXNA 1NARA 2YL5A 2X09A 1W2PA 1QNSA 5CSYA 2XVGA 4GO9A 4DUXA 5A8PA 4ATWA 2J7CA 5I0DA 4W8LA 5ABGA 1FOBA 3SUTA 5I6SA 3VGHA 1CGXA 4GZJA 1W3KA 4GXPA 5CPQA 2NT1A 4HA4A 2BHUA 2BVTA 2XGIA 4JFVA 1WAWA 3SCNA 1B0IA 4Q22A 3MSDA 3WEZA 3TP4A 1GONA 1C8QA 1M53A 2VX4A 1QNOA 4ACZA 1QI3A 1JD7A 3EMQA 1VEOA 5ABHA 4MPKA 4IPLA 3J7HA 3T2QA 4CU7A 2WBKA 3EDKA 5D4YA 1CIUA 3L4ZA 4XX6A 4UFIA 1DWFM 3HMCA 3MMDA 1XYZA 2DGAA 5IDIA 4PEEA 2TAAA 3EDEA 1SFSA 4MB5A 2FHFA 1KXQA 1XCWA 2WWDA 1O7AA 3DYOA 4D6FA 3W38A 1TG7A 3WMCA 1FHDA 3AS3A 4M82A 3BAYA 1WZLA 3UERA 4TVUA 3GNRA 1RP8A 3RIKA 1V6XA 2C7FA 2PBGA 2D20A 1J01A 2JIEA 1UWSA 3NIYA 2NSXA 1WPCA 2ZX8A 4BA0A 1CGYA 1TVNA 3OG2A 2E9MA 3U5YA 1JNDA 5CGTA 1IV8A 1JI2A 1NP0A 4RE2A 5FKYA 3GNPA 3BLKA 1QW8A 1V0MA 3W37A 3ARYA 4KMQA 2VVNA 1VRXA 4OZOA 2D0HA 4IUGA 3PZVA 4GKLA 5BRQA 1OM0A 4NF7A 3AHZA 3O9NA 1CXEA 1UR2A 3T09A 3WD0A 4MNJA 1ISYA 3VINA 1WZMA 4ML4A 3UEQA 4YN5A 4NSBA 1J0IA 3AMKA 5IFTA 3DC0A 1CGTA 3NSNA 3B9EA 3WUBA 1IZKA 1X6LA 4U5IA 4AZCA 4CN1A 4BQ3A 5FL0A 3NUKA 4UQBA 2HVMA 1JZ7A 1GVIA 1V3IA 4JKKA 3QOMA 2ZICA 4QLLA 1E40A 2Y24A 5DT7A 1J18A 1W3HA 2PWGA 1F4HA 4QLKA 3EYPA 4HU8A 3AMGA 3VM5A 3L4XA 1JD9A 4C7GA 2WZEA 4HP5A 4UOJA 1FFRA 5E0CA 1UKTA 3N15A 4OBRA 2NW0A 4IPNB 4P7QA 3CHCA 4GI8A 4ZXLA 4AW7A 3MV11 4ZENA 3ZOAA 4YPJA 2NT0A 5GPRA 5EBAA 4KGJA 1FH7A 1A3HA 2OSWA 2IUZA 4W84A 4XZWA 4HA1A 2F2HA 3CLWA 3D3AA 3W25A 3CZ8A 1HKMA 2XSBA 2FHBA 3MUIA 1MVYA 3MS8A 3ARZA 1CXFA 1WZKA 3OZPA 4OOUA 3IK2A 2IXVA 5DF0A 4HPHA 2ZUNA 2YDSA 2ZXBA 3CO4A 1J0YA 2PI6A 5DT5A 1FHLA 1TR1A 3CUFA 3ARPA 5EB8A 3WENA 1GHRA 1UR8A 1E1EA 1EQCA 2XSAA 3O6AA 1MXGA 2JIWA 3CMJA 3GDBA 1PX4A 1CLXA 1KFWA 2WYSA 2O9OA 4LPCA 1G9HA 3DECA 1US2A 3QHMA 1C3FA 4ZE4A 2J7DA 4JFUA 4F9DA 1JZ4A 4UFHA 2GDUA 4E8CA 1GW1A 3WFZA 1UH4A 2W5FA 3ZQ9A 3A4XA 3GH7A 3MKKA 1XSJA 3FAWA 3GTNA 2J78A 1DWAM 5AYIA 1P6WA 3WF0A 4N42A 3APGA 3PTMA 3NDYA 4D6HA 1H41A 1J11A 2DT0A 2YBTA 2J7FA 3ZM8A 4LYRA 1UD3A 2XUCA 5I24A 1CTNA 1Z32X 3VGEA 5I5RA 2QPSA 3CHEA 4UZSA 1E70M 4J7RA 3A4AA 1ZBVA 4TOQA 1VJSA 1XC6A 3SCQA 1UWUA 1LWHA 4GPNA 1AQHA 3HJEA 2ZUSA 4CCEA 3VX1A 4D6IA 4TTGA 4AWEA 5M03A 3QOKA 1E6QM 2WHMA 4NI3A 2BY3A 3PZ9A 1HKIA 1BF2A 4MTVA 3N17A 5A2CA 4IM4A 3A47A 3FW6A 5DEZA 3WNMA 1W9VA 5A6MA 4W7UA 1HKJA 2FHCA 4S3KA 1R87A 3AZTA 2VURA 3RJYA 3GNOA 2WMKA 3A3HA 1BYAA 3WQ4A 2EO7A 3SCUA 4X9YA 3S6TA 2WNWA 1XH1A 5ABEA 1SMDA 1E0VA 4J3VA 2UY3A 4TX6A 4QAWA 4XV0A 3ALGA 4MNKA 1AQMA 5FOOA 1VB9A 4JHZA 3VMPA 5C71A 1JDDA 4CCCA 4PSPA 3OLEA 1H5VA 4J3SA 4HZ8A 2XJ7A 4UQCA 2YL8A 3WEMA 2WWCA 1HIZA 2YDQA 4OUEA 1KB3A 2X0HA 4JCLA 2PWEA 1CWYA 4PMVA 2ZE0A 3VOCA 3SUUA 5FIPA 1US3A 1ISXA 1R86A 2HISA 5A6LA 4JCMA 1RPKA 2WLZA 3VMOA 4GQQA 3TTYA 3CGTA 1CNVA 2W61A 3WDPP 1GOIA 3TA9A 1U30A 3AICA 1KBKA 3GZAA 4AISA 3UG5A 3B9AA 3KE0A 3T08A 2FH6A 1B3YA 3ARTA 3S2CA 3PZOA 2FH8A 1E43A 3ZIZA 4UFLA 3N18A 1JF5A 2CITA 4AEEA 2VR4A 5I77A 3CUJA 2WCGA 3EDFA 2DPEA 5EFFA 4V28A 4PTVA 1VENA 1E5JA 3RM8A 3CBWA 2WVSA 2BHYA 5E70A 1H1NA 3CIVA 1PAMA 3VIGA 3CPUA 4HOZA 2WC3A 4BCEA 2WMGA 3HU7A 3W29A 5A6AA 1XD0A 2J4GA 4AYSA 2VR5A 3NJ3A 1QNQA 4OBSA 4N0RA 4X0NA 3U57A 2B31A 5IHSA 1AVAA 2WCSA 1UQYA 3AS2A 3OA5A 3W28A 1H2JA 1Q6FA 2WK2A 4P8UA 5FCZA 4W5ZA 1K9TA 1E4MM 1JG9A 1W1VA 3WF3A 1W9UA 2E40A 3WF1A 5A6BD 4HA3A 4WK9A 1V02E 1G5AA 4M8UA 3WIJA 4HMCA 1CGVA 1E3XA 4Y7EA
chains in the Genus database with same CATH superfamily
5C55A 4GZEA 2NX1A 3NYZA 1F3WA 1W3LA 3TYCA 1ELSA 3PZUA 3PNUA 1DP0A 2VUNA 4PMYA 2DUZA 1K4HA 1UKOA 3CYJA 2X0YA 2V3DA 2J62A 3AHYA 4B16A 4D6DA 3G24A 2VD9A 5C6MA 1SGJA 1W1TA 2CLHA 5LGXA 2RGLA 2WNQA 4G5DA 4EPBC 3WUEA 4JN7A 4DJFC 2QDGA 4B5VA 3TC3A 3LS9A 4HIBA 4ZQOA 1Z9AA 2BFGA 3G77A 3AALA 1DJQA 2XVNA 2PWDA 2P3ZA 3ME3A 3L4VA 1EHNA 1GJUA 4Y8EA 5FEPA 2FDMA 4PTXA 4IMCA 4GISA 4PUUA 2OQLA 2CLPA 1B3WA 3LPFA 1GOWA 2FMOA 1O68A 4ZQRA 3R0DA 1EX5A 3FKRA 1F05A 2OWCA 5BMWA 2IS7A 3UXLA 3RXZA 5D33A 8TIMA 3G1XA 4ADUA 2J7HA 4Y9AA 3IIXA 3FSUA 3VKCA 3C5QA 1TELA 2WHLA 2A21A 1XH2A 1WX0A 4UIOA 4GRSA 1QATA 4IQEA 1PPIA 4JX5A 4NZCA 3VNZA 4DO4A 2PWVA 3DFOA 1I1WA 1W1B1 2BVYA 1IEWA 2CYGA 1XBVA 2G95A 3IGXA 3KOFA 2R91A 5F2IA 1RH9A 3QR0A 1QFEA 3G0UA 1QDSA 1W54A 2GUYA 4HYVA 4Y9PA 3L7RA 3GRIA 4WXZA 3GDKA 5LNVA 1JFXA 4XZNX 3T0AA 4GC3A 3B0UX 3N2OA 4I3GA 1GZGA 1XYMA 4PMOA 2XIOA 1H0GA 4DBDA 3F4NA 4ZQCA 3W6LA 3TYAA 2UZ9A 3S5NA 2VXNA 4A2RA 3CYVA 1FUYA 4UWMA 5CG7A 3STFA 4AIBA 5I23A 4S3EA 4XVEA 5JBDA 4PMNA 1D2KA 4NYUA 2FYMA 1S46A 4NJKA 1S2CA 2IQ0A 2HCVA 1C29A 3V0UA 2CHOA 2E9LA 5HJYA 3UW6A 1L8NA 3W24A 1VBUA 1KW1A 1KGXA 1MDRA 4G2DA 3VOIA 4X22A 2G97A 3JRKA 3EXSA 3LENA 5LA2A 2BDQA 4QDPA 1B3VA 3REQA 4PMXA 1TZ7A 3B97A 2GYIA 1E1FA 3IK4A 4L4LA 3M64A 1XLGA 1F61A 4QAIA 1CI1A 3L68A 3W26A 1JUBA 2ZQ0A 1UZ4A 2ACRA 4C1KA 1N2VA 1FWCC 3PUOA 1HJXA 4FZIA 3LTYA 2XH4A 2P5NA 2PSNA 4MUZA 3ZMRA 2XTKA 1A3WA 2IPGA 1RP9A 3ZYZA 4D1IA 2VDHA 1BG9A 1YQ2A 5EKYA 3GBDA 5D9OA 5A1AA 1GPFA 4MWAC 3LHZA 1W2VA 1V6YA 4DWSC 4JQ2A 4CNOA 1J4EA 2I9EA 5D30A 4D6JA 4YTSA 4BR1A 1I6NA 2X8RA 4LJ3A 4UNKA 2WW5A 3TIMA 1PIFA 3O6YX 3S1XA 2WMHA 4JFSA 1GJWA 1UYQA 1ZPTA 1A5AA 3L4TA 1XM3A 2BY0A 5A94A 2RUSA 1Z7AA 1PTDA 4HNOA 1FHVA 4C1LA 3HGOA 2XINA 4QG6A 3W4RA 5GQBA 3PR2A 1OADA 1W91A 3M9YA 1O1ZA 3P80A 1RK5A 2QXWA 3VD9A 1XF0A 3B9DA 3N2BA 4K1WA 4RLIA 4G7FA 4J27A 4DM1A 4D2JA 1JGMA 3QZ6A 3WUGA 2A5HA 1EDQA 3GLCA 2FPVA 3R1ZA 4HK5A 5B7YA 5DN1A 1UA7A 4DNMA 4LYKA 4XB3A 3ALFA 2X2YA 3WQGA 3T0BA 2OGJA 1DWIM 1GKQA 2VC5A 3L2IA 3BSGA 2PLCA 2VFFA 1NFPA 1ONRA 4JIEA 3W6MA 5GVJA 1GQKA 1QHPA 1IWPA 2CBUA 1RV8A 2I5IA 3VIPA 5A3HA 4LAMA 1Q66A 1S1RA 3AIVA 3RO8A 3GE7A 1VFFA 3BAJA 3GVWA 4OE7A 5CXPA 2QLYA 3VGDA 3B03A 2JGQA 3TOPA 2R82A 1EJXC 1UBPC 3ZLGA 2D3LA 4RX0A 2OLHA 3NQAA 1NOFA 2QNEA 3QMSA 1J12A 3WDJA 3FJ4A 3P82A 3TTSA 2FZ9A 3GG7A 4UMBA 3VDAA 1MXDA 1XIMA 3IJ9A 2Y5SA 2OZTA 3SEPA 4KWUA 4WSJA 4GUIA 4RXFA 3Q58A 3IWPA 4PODA 5G1MA 1QHOA 1K8XA 3TCSA 4JFTA 4LQ1A 3RM4A 1REQA 1TPH1 5J5DA 4AY7A 1G94A 3NO3A 1E0XA 3VKAA 4QBXA 3QC0A 4MM1A 4MYAA 2I17A 2PZNA 5TQLA 1B31A 4A3YA 2ICSA 3QZAA 2OGYA 5TD4A 5BRPA 2EPHA 4GGHA 2BOGX 3SCRA 4B5NA 1Q6RA 1ZL1A 1MDLA 3SN1A 2VGIA 5A2AA 3L5MA 1R7AA 2QV5A 4CNSA 2V3FA 4PBEA 1OY0A 3GIYA 3PZQA 3NL2A 4M24A 3ZT5A 1K3UA 3BMVA 4XTDA 4HNLA 1H60A 3P74A 2DQWA 1XIBA 2EQDA 1VPQA 2Z1KA 1GW9A 2OFJA 3C2VA 4QQ3A 1B54A 2DP3A 4CN4A 3OP2A 3OOQA 5KITA 1KBJA 1HT6A 4XAFA 3BG9A 1ISVA 5LNSA 3OVGA 1J2WA 2OPJA 1W56A 1LT7A 1XFBA 1LROA 2Z24A 1DIKA 1E6ZA 3L4WA 3VILA 2FZDA 4WVXA 1YDYA 1PX8A 3T81A 5AYXA 2WVVA 5C9XA 3WYZA 1A53A 4IX2A 4FLSA 3UESA 4D6EA 4W8BA 3VA8A 2OEMA 1GQNA 1B1YA 1X1NA 1KC7A 5C70A 1KCKA 5AC5A 3A24A 4CUCA 1TQXA 4KETA 1QJWA 4L4OA 1F6PA 3RJXA 1VQTA 4MWAB 1F3EA 1ZAIA 1KQYA 3CK5A 3CZKA 1FH8A 3VVGA 1W3JA 2YJQA 3EOSA 5F2LA 3UF9A 2VX6A 3FXYA 1HKKA 1RVKA 2CBIA 3LPOA 3PZTA 1VLIA 2V81A 4IF2A 1PHQA 5CAKA 3AXHA 1R3WA 3UZZA 2HS6A 1MQRA 4AMCA 3RGTA 3WK0A 3MANA 1UA3A 1K1DA 4EF8A 4DUVA 2NQJA 4UTIA 1AW2A 3DZ1A 1FWHC 1F6KA 3GHSA 3KDOA 1KFCA 2XPKA 1ZJAA 5D2YA 1BSLA 3E5BA 1FX6A 1S3HA 3SCPA 3GDMA 3GVGA 4YCOA 3B8WA 1VYPX 4W8AA 3MQTA 4W93A 4UTTA 2CIPA 2NQLA 5CCZA 4PL2A 4D71A 1UKPA 2R1MA 3HA1A 4GI6A 1FXQA 4H7CA 2ZUTA 3SY5A 5AC8A 4Q8OA 1QI2A 3QFWA 1JYWA 3THQA 4H83A 5E9AA 3M6DA 3BARA 4GJJA 2Z2BA 2GJRA 4GQBA 3GR8A 5D8ZA 3SUVA 4GVHA 3EOOA 4AC7C 3FGCB 3PHAA 4LUTB 2F61A 1JIBA 4N9BA 3SSZA 1VH7A 1LOQA 1EJRC 4IOTA 7PTDA 5I2UA 3UBPC 1UH2A 5HQMA 3R10A 1XD1A 1OF8A 3RN6A 3S9ZA 3NSXA 4BF9A 5G1TA 5FJUA 3P7YA 1DEDA 1KCLA 3F5JA 2XIMA 3W7PA 2E5CA 3EB4A 1NM9A 2ABBA 5HPCA 4L6HA 3OGVA 1ONWA 1V02A 2BX7A 1AMKA 3H2FA 4H1ZA 1UMYA 1KRAC 2NVDA 4EE9A 5F4WA 3Q65A 1ZY9A 4R27A 5LNUA 5CGQA 1SO3A 2NWSA 2OOFA 3F7JA 3AISA 3INPA 1NTHA 1KCZA 4H4IA 2EKGA 3SRFA 1JCTA 1RQEA 4LRSA 4JFWA 5HMFA 4GACA 2QDDA 4AZ7A 2RFGA 2XIIA 4WR3A 5HBFA 1QUMA 4QE1A 4GVIA 1REQB 3WQ8A 3QGKC 5U7SA 3N4EA 2CC0A 3DI0A 4J28A 2DIJA 3M43A 3DKLA 4XZ9A 2Q71A 3DN5A 1AZ1A 4DF2A 5EMUA 2GGHA 2W62A 3LLDA 5A2BA 2NXHA 3VDHA 2C79A 2IQTA 4NZ4A 4DM2A 3QPZA 4DX3A 2XFYA 2ZXQA 3DG7A 4YWSA 3UJFA 1PX3A 3V0TA 3EX1A 2WZHA 7TIMA 1C93A 1EGMA 3NQCA 4LU0A 2GVGA 2MANA 2INEA 4MHBA 3MWAA 5C54A 1EC7A 4JBRA 2JALA 2I14A 4UOQA 3MDUA 3SCWA 4JYDA 4MWAA 4DAIA 3IJ8A 2ADAA 4NP7A 4WDXA 2RAGA 3NVDA 5LA0A 4AU0A 3QBUA 2A4AA 3ABXA 3ZJ8A 1V6WA 3VIKA 4Q4MA 1M01A 2D22A 2D69A 1XSKA 1AG1O 4G7EA 8RUCA 4PB3A 3WJYA 2RJGA 1R3QA 4MZ1A 1MEIA 1OD8A 2YBUA 4DUOA 3M16A 4D6GA 4PUNA 2Z6JA 2PDNA 4ZMGA 5H91A 5BU9A 2ZA2A 4GO8A 4J2PA 4IMEA 3UXDA 3OVRA 4JTCA 1XGZA 1P5BA 4UFJA 2A3LA 3WLNA 1TJ1A 4NZ5A 1JXKA 5LIKX 3HURA 4XKYA 1ADSA 3AHTA 2PDLA 4F2TA 1SZGA 1ZS2A 4AZHA 1X8FA 5I09A 3SGZA 1K6AA 1YNPA 2RDTA 2PLJA 3BK0A 1ZALA 2OWWA 3AMDA 2YKKA 1AW5A 3PAJA 1XYAA 2HVOA 1A4MA 3TTQA 1PS9A 3WY1A 3NYDA 4YJ5A 4OKDA 4UCFA 4EWND 4GHRA 4ICMA 3GXPA 4AF0A 1B90A 3AS0A 1CDGA 1QR7A 5EYWA 3W75A 4Z2HA 1YDVA 3W23A 1O60A 4OTKA 4LF1A 4LVGA 2FPYA 1I8JA 3C0JA 2Y70A 2VMFA 3LGEA 1MW1A 3NQDA 3TW7A 4BHYA 5I3HA 1S2VA 1MUCA 1QAPA 3UJEA 3TXVA 1EIXA 1W0MA 2AQVA 1G1YA 3U6WA 3TSDA 4F9JA 1FCBA 4C7FA 3W9ZA 1P0EA 3N9KA 2CZ5A 1W31A 2Z0IA 4GXMA 4MSSA 3FCPA 3MP5A 1ZLPA 2NUWA 1TPDA 3OLDA 2IPJA 2OG9A 2L5HA 1KBLA 1TRIA 1F8MA 1YDOA 1TVPA 1OFPA 5J04A 1CECA 3REQB 3W70A 1T96A 4Q6JA 4X0VA 1R85A 1HF6A 4DJDD 3Q4DA 5C8BB 4H6EA 4A4AA 4M56A 2PWFA 2OVLA 1R0MA 4MB1A 1Q7MA 4H9XA 1X6NA 2VZUA 3O6CA 1UZHA 3A21A 2ZZ2A 2J8FA 4A22A 1JVNA 3DG6A 1ZSXA 1NVMA 3ITXA 3GC2A 3B0PA 3V5OA 1WKYA 1NQKA 2WPGA 3C0LA 3JVAA 2BTMA 4KCWA 4KFPA 4Z1AA 3E2VA 3JZEA 4DIAA 4WQ6A 3SIMA 2YBVA 1BWLA 3GKFA 3KBSA 1KTNA 4B3ZA 2Z7KA 2P76A 3W7IA 2W79A 2E67A 4QJ4B 4S3AA 1ZBKA 2QCDB 4H8UA 5T9BG 3NDOA 4ASTA 1J79A 2XGBA 2PDWA 4MMWA 3C2EA 4GNJA 1GVQA 3C8NA 1TE1A 4FOKA 1XC4A 5LA1A 3FOKA 3ABOA 1EGZA 4Y96A 2E09A 3H24A 2EG8A 1PO9A 1YKWA 3GR7A 5HNUA 3QMRA 4EIVA 2PUZA 3BSHA 4OVXA 2OX4A 2PBOA 1NDZA 4UUIA 3AYSA 4UZUA 3RCMA 1BTCA 4DJDA 1OEPA 2ISFA 1QI0A 4ZQPA 1X8CA 3STCA 4HYRA 4E0CA 2Z00A 1SZNA 4HJFA 3LZ5A 4AD2A 3VI2A 1WCGA 2FTWA 3WMSA 2J79A 4HMNA 4PGLA 2AL2B 2D2HA 2EG7A 1U22A 3M0JA 1YXCA 3M0KA 5AZ1A 1AH0A 1ALDA 3NO5A 4R9XA 1XG3A 3PPGA 4RDVA 3EWYA 2XFWA 3TWBA 4FI4A 3GH5A 4CNUA 4UXDA 2XWEA 2DW7A 2DIKA 3CB3A 3I68A 3MZ2A 3SY1A 3ZWTA 4AD5A 1VFUA 1MEHA 4ZB2A 3VDCA 3XISA 1NQ6A 1VF8A 5A95A 4PUEA 2PU0A 4CD5A 4W85A 2A3CA 3MYOA 3EGJA 4C60A 4Z2LA 4FNPA 4QEEA 1DJHA 4Q32A 5CPLA 1KBIA 2XH0A 1Q63A 1S39A 1EP2A 3H4XA 5K4XA 1K77A 4UR8A 1R6WA 3KBJA 1P0KA 1WKDA 1A49A 1NDVA 3EXTA 1QOXA 3VD7A 4TV5A 4RE3A 4A8RA 1A5MC 3BLDA 2VELA 5F7UA 1QOQA 3RNDA 1PZ2A 2FFCA 3WQEA 2QCCA 3EEZA 1GJPA 3AYTA 2HEJA 2JEQA 3A5VA 2RGMA 4EVZA 3PTQA 3ITLA 2ZOXA 2PGWA 4P7LA 1E4NA 2Y0FA 3E96A 2AAMA 3LA4A 1BG4A 2PTWA 3GTFA 3ZLHA 3PS7A 4MJ2A 1TIWA 4MZ8A 5D8WA 5LGZA 3MWCA 1U5HA 3DGBA 2WPBA 2XN1A 1BGAA 1R30A 4QP0A 4MKVA 3EAUA 2BS9A 1EHAA 2CXEA 1FP8A 3R8HA 4PCPA 3IGSA 4F2UA 5D09A 1EA9C 1VAHA 3LMYA 3AROA 2W3ZA 1LQ2A 1EL3A 1EFZA 1SU5A 1E72M 3RX3A 4JTFA 3SW6A 4GIYA 3I7SA 3CTTA 8CGTA 1GVEA 1UJQA 3FYOA 2QJNA 4WDTA 4D8ZA 1J0JA 2CLEA 1BQCA 1XBZA 3AU2A 2I56A 2POTA 3UPMA 2IXUA 3UPWA 1XDJA 5IM51 4J3TA 3M44A 2FMNA 2GOUA 3E2QA 4P2VA 3GXFA 1ZENA 5HA7A 1F2JA 3PBWA 1Q6DA 2AL1A 3ZSTA 3F2BA 1Q5MA 2EPOA 1ISWA 1MUMA 2W92A 2W27A 4URIA 3W81A 1ZB5A 3CZJA 3SRHA 4AZIA 1ZBWA 3EWCA 4WXYA 4R85A 3PUDA 5IFPA 2ZZ1A 2QYGA 1DBTA 3FDKA 5EMLA 1E56A 4GNKB 4AVNA 3AXMA 5JH1A 4EKJA 2BMBA 2JQXA 2YLLA 1ZJHA 1CBGA 1KXTA 5I03A 1BYDA 3ARWA 2QCDA 3ABSA 4LTSA 4S38A 1V51A 1X7IA 4ECLA 3TJIA 3N11A 1JDEA 4O1FA 4I7WA 4L4PA 1EPVA 4IG2B 2O4QA 3VD3A 5HATA 1NARA 1FWAC 3WQCA 1W2PA 3W1MA 4DUXA 4L4MA 2PS2A 5A8PA 4FEZA 1D3HA 3IARA 9XIMA 1XLFA 2VFEA 3S6DA 3ES8A 2V2CA 1RD5A 3SUTA 2BOEX 3BLLA 3VGHA 4K6AA 2EKCA 4GXWA 4GMEA 2NT1A 4HA4A 2BHUA 1TV4A 3BOXA 2BODX 4O1EA 3KFTA 1B0IA 4Q22A 1QNOA 2HSAA 2FGBA 4MPKA 3RLUA 2VFDA 4B92A 1QU4A 2ISVA 4L9ZA 1CIUA 1DWFM 1PDYA 2DGAA 1ITUA 3EDEA 4MB5A 5H1WA 3USZA 3W1LA 4CLMA 1O7AA 1R2TA 1TG7A 3RPTA 1FHDA 4JQ1A 3W7MA 2PBGA 1M65A 4RNIA 4LUYA 1WPCA 3TAOA 1CGYA 4Y2WA 3VNKA 3NZQA 3PAOA 5KZDA 3OG3A 4RE2A 2O7SA 2RKXA 4Y9OA 3F1QA 5FF7A 2I5QA 3ID7A 4MF4A 1O4UA 3CAQA 4A8LA 3S6OA 2PDUA 4IUGA 3AHZA 3O9NA 1UR2A 3WD0A 3E2SA 1ISYA 3N9RA 3CXOA 2QUVA 3NPVA 3UEQA 3S83A 4YN5A 1DTNA 4NSBA 3HTWA 2NVCA 4TR9A 1DVJA 1RLCL 4ML9A 1ZRQA 3SSJA 2WSQA 1P7TB 3LU2A 2GQ8A 4H3DA 2QDHA 4BQ3A 4J4KA 1XWYA 2HBVA 4UQBA 1R47A 1JZ7A 5DMMA 5F4XA 1JEZA 4DJEA 5E1QA 1XIEA 3CWNA 1DJWA 2PEVA 1W3HA 2PWGA 3EYPA 2QGHA 3I6TA 4DBEA 1FWNA 3QJAA 1SPQA 2DZWA 5AZ0A 1XYLA 7REQB 1Q2RA 1EUNA 4S2BA 2PTZA 3TUUA 2NW0A 1XR2A 2C6QA 3CHCA 3FIGA 2G5WA 4GI8A 5CZJA 4ZXLA 1CB2A 4ZENA 1B9BA 1Q45A 2NT0A 2D73A 4KGJA 4H6KA 1FH7A 1OFQA 2OSWA 4W84A 1HZYA 3B4YA 3NEVA 3T40A 3CZ8A 3NXFA 3LHVA 4J3ZA 3HGRA 4UTWC 3ARZA 1CXFA 2C19A 3R4IA 2XIJA 3OZPA 2HMCA 4OOUA 4QEHA 1AJ0A 4MG4A 2IXVA 4HPHA 4NILA 4L61A 1WXZA 4NJIA 2PI6A 1FHLA 1TR1A 4RDZA 4YL2A 1I2NA 1IHIA 5G4HC 3H26A 3KHJA 3O6AA 3P8IA 3T0TA 2JIWA 3CMJA 1KFWA 2WYSA 1PYFA 3LBOA 3S9YA 3QHMA 1ZGDA 3TC6A 4BI6A 2NLIA 4F9DA 3UU0A 3UPBA 4JDBA 1V7AA 1RBLA 1L2UA 5C2XA 3GH7A 2A2IA 3MKKA 2ANUA 3UCCA 1OCBA 4L9YA 3WF0A 4N42A 3VOJA 1F74A 1TUFA 3UJSA 4PRTA 1H41A 1JCXA 3IGUA 3ZM8A 3R11A 1UD3A 5H8MA 1Z32X 3QGAC 3VGEA 2X1SA 2CWXA 4PUMA 1CT5A 1R38A 1XC6A 1UWUA 2P50A 1LWHA 2OXNA 4JYEA 5D04C 3VNLA 4ILSA 2EG6A 1JDFA 2AKZA 3OTRA 1M5WA 4AWEA 4NI3A 2P3EA 2HK1A 1RK6A 2J24A 4MTVA 1J6OA 5A2CA 4IJCA 1EJVC 5DEZA 4XKYB 4J1OA 4S3KA 4UTTC 2VURA 1DQUA 5LIXX 3A3HA 5BW6A 4DXKA 3WQ4A 4RNJA 2EO7A 1J8VA 1E0TA 3SCUA 3ZXWA 4C5YA 2IKIA 3NQ8A 4JIRA 4TMCA 2C18A 4S23A 1E0VA 3IJLA 4J3VA 4B5TA 3LV5A 4EWJA 5FOOA 4TX9A 4DY1A 4H19A 4CCCA 3QLDA 2X30A 4QJ3B 3T8LA 4EPKA 2F9RA 2YL8A 2WWCA 4GUHA 3WK3A 1HIZA 4DF1A 3FEMA 9RUBA 4OUEA 1YLVA 1IQ8A 3CASA 2GSEA 4PMVA 5FIPA 1K8ZA 1R86A 3PSWA 5A6LA 4HGXA 3VMOA 2VFIA 3GK0A 3CGTA 1FY6A 2XGZA 1CNVA 2H8ZA 3VCCA 1YXDA 2YFNA 4YVXA 3OYXA 3AICA 1KBKA 3O6DA 1QWKA 1U5VA 3M0MA 3T08A 3IUDA 3S2CA 4O12A 3ZIZA 2NXIA 1JF5A 1YEYA 2CITA 4AEEA 2VR4A 3B8IA 5I77A 5EFFA 4GWEA 4PTVA 3BV4A 3CBWA 4RDWA 4FX8A 1JJKA 1TQJA 5HQEA 2WMGA 1FWRA 3W29A 5A6AA 1TWZA 2VR5A 1XLCA 1QNQA 4DYKA 3A22A 1J5SA 2B31A 3SZ8A 3CO8A 2Y88A 1UQYA 3BJFA 1HW6A 4IZGA 4XAYA 3TJ4A 1Q6FA 4W5ZA 1E4MM 1R46A 2F84A 3RMJA 2RDWA 3WF1A 5I3KA 3HB9A 1G5AA 4ZO7A 3SM0A 2GVJA 3R94A 3PVFA 1BXCA 3EPNA 1XLJA 3WIJA 3ATYA 1FCQA 2AL2A 5FJOA 2HE8A 4FXSA 4QR6A 2YL9A 3DUGA 2VL4A 3N29A 2OU4A 1JZ5A 3DCPA 4MY9A 2GOKA 3QLLA 1P1MA 1IT0A 1WXJA 2VCBA 2HS8A 1UG6A 3PBVA 4XZHA 1ONXA 3BURA 1XLBA 1XBYA 3OBAA 1Z8AA 4XO7A 4GZ7A 1E9ZB 1I0DA 3P14A 1TV3A 1XSIA 4NNCA 4QJ1A 3SO7A 4FR1A 4L6OA 1P4CA 5HWNA 2OLAA 3EX2A 2WAGA 4I5UA 2CZDA 2YSWA 3DI1A 1UD6A 3PPHA 1UD8A 2VZOA 2NQ9A 1FCVA 5F1UA 1GOOA 4FIQA 3W7QA 4C6KA 4LSBA 2FVMA 1L0PA 5BROA 4V1XA 2QUTA 3LERA 4BQ4A 3IJIA 5ABFA 3ITVA 3PBMA 3CHFA 3GC5A 3KP0A 1Q4NX 5KTLA 3BZJA 2O9TA 4IJRA 1SSDA 4LUJA 3B40A 1GCYA 1DE5A 3BZGA 1RQHA 1FTXA 2QCGA 1R2RA 4HMDA 2XIBA 4NHVA 4IXXA 2DEPA 2ISWA 5D9MA 4D1JA 3SN4A 2W66A 1WKFA 2D3NA 1WBJA 4S3GA 3LCXA 2D23A 2E3ZA 4QGCA 3SECA 2XIQA 1KWKA 4PB4A 3GXDA 5KINA 4ZCWA 1VZWA 1L6SA 5DFAA 3KDNA 2HK0A 3U48A 3HM7A 3OZOA 4HU0A 2OEJA 4FO4A 1QO2A 3O05A 3L0GA 4QNEA 1MMFA 4FNSA 3BUVA 1JDCA 5D9PA 2O55A 1QK0A 4QDMA 4NNAA 4QROA 3TCEA 2OZ8A 3TYUA 5IOBA 4DVOA 5HMDA 1JZ8A 4QXIA 1VHNA 3GXNA 7XIMA 1MSSA 3W7EA 2QIWA 1OSEA 4LS1A 4AEOA 2PD5A 4PZVA 3LCHA 2A3EA 3M07A 1M04A 3SUWA 2ZTKA 2OODA 1IEQA 3GTHA 4GH1A 2G3NA 4H9VA 5HPOA 3NAVA 2HVNA 3W87A 1HP5A 1VFHA 1CCWB 1V79A 4X3ZA 3R8GA 4TVDA 1LRTA 3GU1A 4MPQA 3PZGA 5G1YA 1CENA 4PTWA 3USBA 3QRHA 3MT1A 4MOZA 1UP0A 2OWXA 3NG3A 4KWOA 4DBUA 4REQA 1D7KA 2FDSA 2G3IA 1K02A 1EOMA 4W5UA 1C90A 3E3HA 1N8FA 4GA8A 4B15A 4JHOA 3AIRA 3SGGA 1HP4A 2ZA3A 4PN2A 1K70A 3QGVA 3VNDA 2HBXA 3E0IA 4CD7A 1WOAA 2CZEA 4B5XA 2WZIA 1QVBA 3NL5A 2GVYA 4JIIX 1RJRA 2KAUC 3K8KA 5BOEA 3GYCA 2ZVIA 1UWRA 4K7YA 5EL1A 3PY2A 3ZO9A 1TA3A 4Z17A 1KR0A 3VIMA 4TX8A 1SVDA 1UR9A 1ZCOA 3N4AA 3VOGA 3GM8A 1NF0A 3SJNA 3B9OA 4NASA 1B30A 3BO9A 4PTMA 4HMEA 1AFSA 4Z42C 4CQ9A 3LI0A 1MO0A 3ABRA 1VIZA 3C8FA 1E4LA 4JOMA 1FFQA 4CQBA 4QG8A 5DX7A 4WKHA 2VKZG 5I78A 1I0BA 2GWNA 3MMWA 3PTKA 4DAFA 4JTRA 1JCMP 1JCNA 3N04A 3CHDA 4TUFA 4KIEA 3KOYA 3ARRA 2QJHA 1M7OA 2IMRA 4JGDA 1WQ5A 4TMBA 1GUVA 4H8VA 4L6DA 1BRLA 1O94A 4KFNA 1E1CA 4L56A 5AN7A 3PNZA 1ZHAA 1XXXA 1WDSA 2A79A 3O16A 3EEGA 4GI4A 3TOYA 3MUCA 3B8DA 3WD1A 4E3VA 2F6UA 2Y89A 1P6BA 4Z1CA 3R8RA 1EH9A 3CMFA 2EPLX 2ZUWA 4LH8A 3E5PA 4ZTYA 4CCDA 1NOWA 1AQFA 1E71M 1V8EA 5BXTA 2ISDA 1XBXA 4J3UA 4ZXOA 1NP2A 4UR9A 3P0XA 1LT8A 2E6DA 1OWQA 4W88A 1C92A 4GQ0A 4YYCA 3HPFA 4JNMA 1TWWA 1TB3A 2D1ZA 3H4GA 2YW3A 3L9CA 2WM1A 3UFYA 1H11A 1M6JA 4NQ1A 1RBAA 1DIEA 1VJZA 4ZEPA 2OO6A 4HKPA 4U5KA 3AXKA 4S3BA 2ZX7A 4DZAA 4MGGA 4JZ5A 4UCGA 2GGIA 1X98A 4YNGA 5JQ9A 2J9ZA 3N9SA 1A47A 4JKMA 5HINA 2VI0A 2PCQA 3PB2A 4UTKA 4B9YA 3PZNA 3GAKA 5BMXA 3JW7A 7A3HA 3L12A 5B80A 4JTUA 2REQA 1YTDA 4Q4PA 4V1YA 3PN8A 5A69A 5EY5A 1L6FA 3WLHA 1IXQA 1RCQA 1M7PA 4HB7A 3WDQA 2ZKMX 5FSDC 4E4FA 2OYLA 5PTDA 1E1CB 5A5WA 3SB0A 1KLYA 1UR0A 1CXIA 4TU1A 2AQWA 5M3WA 1GHSA 2DSVA 3UWYA 2Y8VA 1BGGA 2H8XA 1KD0A 1UP2A 3SURA 3M41A 2WM0A 5A8NA 3KBWA 1PEZA 1KO0A 1ZBCA 2Z28A 1TCMA 5MF5A 4F0MA 1UUMA 5M1TA 2PP1A 2UBPC 2HNHA 5DXXA 1F8IA 4R88A 3TJXA 3P84A 1FDYA 1PCKA 3OEXA 3IV8A 3HG4A 1XIGA 3P81A 4CU8A 4H7VA 3A13A 4EXAA 3CEUA 1QI4A 3NWRA 4WSHA 3WFLA 3WBXA 1QW7A 1EO7A 1W5MA 5G2IA 1AW1A 3WELA 1OFBA 5AECA 3LG3A 4GYJA 2D2GA 4FNUA 4NG3A 3FJNA 3N2XA 3UGRA 1DJIA 8XIMA 1O1HA 1HO4A 2W9MA 2PDKA 2ZDRA 4AD3A 2V63A 1W9PA 3HPSA 1UIPA 2WV8A 4AZCB 5F2GA 3K2GA 5LXEA 4Q4KA 1QOPA 5LYRA 1HKVA 3W7NA 4LCRA 5HK4A 4CQ8A 4C6NA 5HWJA 2Y4SA 4ZE5A 4RPQA 5L6UA 3BXWA 2E0PA 4DXVA 2ZRZA 1C9DA 3S2NA 1F73A 4PRWA 2YYTA 4X61A 3A23A 2GLKA 1M3UA 5BZAA 2WB5A 3W1PA 3CV6A 4MVAA 3CIXA 4ICCX 2HZGA 3I3BA 4IISA 4MJZA 4QCEA 1ESWA 3K8MA 4U3AA 4HN4A 1UKSA 4WHBA 5G4WA 3TK7A 4O11A 8A3HA 3LUTA 3DFYA 1PXGA 3LPGA 3SBFA 3LN3A 2YDAA 1R3RA 2QIIA 4HNNA 3DFHA 1JAKA 4HZ6A 3CTLA 3OB8A 3OZMA 3AIWA 5IBXA 3M0YA 4MWAE 4M19A 4XVDA 4WSKA 3TKFA 3UWWA 4RPPA 4LBRA 2GSJA 3PUEA 4ZFCA 4LB4A 3LX9A 3K4DA 4DZ5A 2QS8A 4J2MA 2C3ZA 3FDGA 5FI8A 5A8QA 2CETA 2R8WA 3QQ0A 1IZJA 1Q6GA 3AYVA 2ZWZA 3O2LA 5LHFA 2GJXB 4L7ZA 4KRUA 4LAOA 3THDA 3MJYA 4WGXA 3L21A 1ZCCA 5K9CA 1QPOA 3BL3A 3Q45A 1EXBA 3I65A 3E38A 5E93A 4GFIA 3G1VA 3HFTA 3W1NA 1X1ZA 1H7RA 5HULA 2QEZA 3HPZA 5CH9A 4N2YA 3JZUA 1S2TA 2G50A 1PSCA 1QPKA 1RAKA 4HK7A 4Z2JA 1X96A 1XHGA 3U4AA 2VHLA 4FB7A 2V9DA 1EGVA 3CWOX 3FGCA 1KM5A 3OVQA 1AL8A 4LVDA 5M2FX 5AOUA 4AWSA 3KRUA 2A7PA 2BY1A 4FNTA 1ZFJA 3LGGA 4NVTA 4HD5A 4O1AA 2RDUA 3H8AA 1Y5XA 3RUBL 3W7LA 1Y0EA 3QY6A 3ONBA 3N13A 2OMAA 4HYWA 3WH9A 1QBBA 4CD8A 3AHXA 1AQ0A 1PDZA 3W7KA 4A29A 4F0SA 3EMZA 1E0WA 2WANA 1JZ6A 4P7NA 1E6RA 2JKPA 4GD0A 3BG5A 3WLMA 3MJMA 2G3MA 2Z29A 4M80A 1WUFA 1EIBA 3PZIA 1R7OA 1KRBC 4FSAA 2ACSA 3L67A 2Y6ZA 3R12A 2RJHA 3H54A 1UHVA 4WJEA 3OYZA 1E0UA 3WNKA 4MJMA 3F4VA 4Z2IA 1FWSA 1C8VA 3HG3A 4AC1X 4H6RA 1O6IA 4WKAA 3GZ3A 1B3XA 4I6VA 1AODA 1OFOA 4JTLA 2VVSA 1HXJA 4QLJA 5DCDA 1LF1A 1Z6KA 4A3HA 4JKLA 3VDGA 5CC5A 1NEYA 5I7GA 4ZSTA 3WBAA 2IQDA 4MJ4A 3BCJA 1W8SA 2V5CA 5J5RA 2BP1A 2OQHA 4IMDA 3DIPA 3E49A 1F6YA 3MKCA 2O9PA 3VAVA 3W88A 3O0FA 1PV8A 2CBJA 1UKQA 3EKLA 4S3JA 3VCNA 3KBMA 1JF6A 2Y7FA 1N7KA 2CEQA 1Q65A 3Q2DA 3RX2A 3UYCA 4DJFD 3NQVA 3WKZA 2JGYA 3KZPA 3ZS4A 2I16A 4RW3A 2VX7A 2GJLA 4CNTA 3PANA 2BVDA 4BEQA 5LNRA 4F4RA 4J3XA 1IR2A 4GZIA 2PDPA 3SCTA 1Q8AA 1IIHA 3ANVA 4AD1A 1MFVA 5EMJA 4DWSB 4AZBA 2DORA 3RO6A 1JZ2A 3V0SA 4B3KA 1UWIA 3NXLA 3WZ0E 2XN0A 4A3RA 2XYLA 3EKZA 2C1GA 1XIIA 3E74A 3KZSA 3N3MA 2WNNA 4GUGA 2NQ5A 1AZ2A 1OQFA 5DMNA 1A80A 2WJFA 2POZA 5E0FA 1ICQA 3RMEA 1PB0A 2PCEA 1UR1A 3DENA 5JIPA 4GUJA 3L5AA 4GBUA 2VENA 4QNWA 5M17A 3RFAA 3GVVA 1DHKA 4GK8A 5FF3A 4AX6A 4DWDA 4AX7A 4UFKA 2PRHA 1YXYA 1VFOA 3KL0A 3G5EA 3WK1A 4XBJA 2WHJA 1JYVA 3EDDA 4KWWA 1UZ1A 1M03A 4M0XA 2AMXA 2PB1A 4J35A 3GTXA 4F8XA 3VCRA 1VHCA 3BLOA 3GIPA 4XBKA 5AB3A 1GVFA 1Q85A 1LP6A 1U33A 1HNYA 5CPSA 1KQZA 4YWIA 3W2KA 1MI3A 1I45A 3F4DA 3BAIA 3DHPA 2E8ZA 1HUVA 4JL1A 4HA0A 3VU2A 4IFKB 1GPWA 2GQAA 1GEHA 2OYKA 3EWBX 4QJ5B 3KTSA 3BH4A 2O7QA 5LIUX 3OODA 1GEQA 2WZMA 2AMGA 1YTKA 3D46A 4L80A 1TRDA 1OZMA 1E6NA 2Z1BA 3CQ0A 1H51A 5XINA 4IFOA 3H2EA 5H2ZA 3PC0A 4IQDA 4GVGA 2RH9A 2FTPA 4GGBA 4O14A 2W4XA 2PDQA 4NJGA 3NA8A 4DBSA 5CZKA 3CQKA 1D8CA 5CSUA 1WZAA 1AUSL 1OK4A 1ZU8A 4NZ1A 1K7XA 1BYCA 2DH2A 9XIAA 5CKSA 4O57A 2DIEA 4W89A 3T05A 4BQ2A 4GIEA 3E0LA 4QFUA 3LPPA 1JFHA 4AYGA 3WX7A 2WBGA 1D9EA 3L4YA 4AZ5A 1QO5A 4LY4A 4UQAA 1U2YA 3NM1A 2FZBA 1XI3A 2QPUA 3TTEA 3VC5A 1CLVA 3R58A 3L4UA 4M29A 4REQB 4ZODA 4HNUA 2R14A 3FA5A 3QHNA 1UUOA 1YTEA 3VKKA 2NLYA 3LY0A 1MW2A 3MW7A 1WOBA 3GR4A 3CHVA 3MUZ1 4PTNA 4W9TA 1M41A 4C6QA 2O9RA 1ZJBA 4AZGA 1XYBA 4O1CA 1HX0A 1TREA 2CXGA 3A3XA 3LXCA 4HVXA 3GHTA 3BCDA 4PMQA 4DPQA 1SO4A 2WMIA 1TR9A 4N4PA 3SJ3A 4X9SA 4G8TA 1SW7A 4TO8A 5FJIA 4Z2GA 1QPNA 3BQ5A 1NIUA 3ITOA 1JNEA 1DJNA 2WCAA 4YVPA 3VC6A 3TJLA 2WLYA 1ITXA 2VCAA 3QMTA 3W1TA 1VCGA 5C7VA 3BV7A 4FNRA 1E15A 2WKLA 3QVQA 1H7OA 2YA0A 4RZBA 2FZ8A 2Y85A 1SW0A 1HN1A 2YA1A 3AHVA 2X05A 1DIOA 1H09A 1QHZA 3EKGA 4H8HA 2DU2A 1B3ZA 2OTDA 1UW9A 4QG9A 4YHEA 4I5XA 4N9DA 3SR7A 1TMQA 2ZX6A 1PKYA 3ARSA 4E5TA 3AUOA 1RD6A 4PB5A 1Q7QA 4X2RA 3UNDA 4TIMA 4YS1A 3UXKA 3SADA 2WMJA 1XINA 3W7GA 3DH7A 4MNMA 3V5FA 2O92A 3E2RA 3SDOA 2ALRA 1S2UA 3AFBA 1I75A 2EXOA 3NOYA 2WQPA 2J8GA 4AZ6A 2PDFA 1RA0A 3PJUA 3FHAA 1O5XA 5HUOA 4MAVA 4W87A 2IPFA 1K7FA 2OELA 4LUIA 2NSOA 1I2RA 4P8XA 3WEOA 1PWMA 1HJVA 3NQ2A 2WKJA 4DZIA 3GG8A 1DHPA 4H9ZA 3SN0A 2H6RA 2H3DA 1YBQB 3P2VA 4XIAA 2GDQA 1OCQA 4K8GA 3TQVA 1XLLA 3WQDA 2QKFA 4WOZA 3FS2A 1UPMB 1XW8A 4UB9A 1IR1A 3DFTA 5BWAA 3GU9A 3CLMA 4JIQA 4AD0A 2PC8A 4FF5A 2ZADA 1NELA 5HOSA 5AVHA 3O15A 2XVLA 2DY3A 1R9ZA 1IGWA 4RR4A 2O4MA 4LAKA 4TXEA 4G6CA 1V3KA 3NQMA 2DT2A 1E4IA 4V27A 2WC4A 1UROA 2XU2A 3JU2A 4NKCA 3VD4A 2F8QA 2NVAA 3EPOA 4W86A 3IAQA 4JX4A 4WX2A 4HSHA 2IPWA 1ECEA 3MU7A 1T8XA 4XBSA 1OB0A 1WDPA 4MKNA 3VE7A 3SIZA 1YPXA 3TN6A 2PP0A 1DXEA 1OFRA 3WF4A 1UC5A 1XV8A 3ZT7A 3U0HA 1EJSC 1OC5A 1ZAHA 4HU4A 3TNBA 1VJIA 3ZLFA 3F5LA 1ME7A 4PCSA 2TRSA 4LCQA 3P5ZA 2E1DA 1U83A 3C3NA 1PE1A 2OT0A 3NQEA 4AMAA 3XINA 4ATWA 2Q3OA 2CHRA 2QCFA 1XG4A 2J7CA 1NFGA 1P48A 4NAFA 1PHWA 4KBXA 4IICA 2JK2A 5FF2A 1Q6OA 3DU0A 2HRWA 3D47A 4ZOBA 1CGXA 4QITA 1W3KA 2QQ6A 4GXPA 1XKYA 3GO2A 2BVTA 4O52A 3SCNA 1S5TA 3WEZA 2Y5JA 3B0YA 4Q8WA 1W1A1 1MXSA 3ZFHA 3PWGA 1JD7A 1TPFA 2DFAA 1SSGA 2PODA 3PG9A 4WZHA 1PUDA 3EDKA 1IXPA 4XX6A 4HT3A 3B8UA 4UFIA 4UC5A 5IDIA 1L2QA 2R1NA 4PEEA 2TAAA 5D05A 3O63A 2V68A 4D6FA 3BAYA 3RPDA 6XIAA 4IPPA 4IG2A 2HE5A 1R3VA 3UERA 1RP8A 1V6XA 4XIMA 3R0UA 4K1GA 1J01A 2JIEA 2ZX8A 4O15A 1TPUA 1VFLA 4BA0A 2ZDSA 2NV9A 2E9MA 5MKGA 5CGTA 3DKJA 1JI2A 1R9YA 1ZP3A 3N34A 4XKMA 1ZTVA 3LTSA 3W37A 4LUTA 3ARYA 1K03A 3N6JA 4KMQA 1VPXA 2P88A 4GVFA 4OZOA 5F4SA 2A1YA 3MP3A 4ENLA 3PZVA 5K9DA 1OM0A 2ZC8A 4X60A 4E2DA 1EYWA 1WZMA 3RR4A 3ATZA 3M1ZA 1J0IA 3AMKA 5IFTA 5FJPA 3C4UA 3DC0A 3MUXA 3NSNA 4A3QA 4HCDA 1G4TA 5REQB 2R1KA 3WUBA 2V5KA 1IZKA 4S39A 4U5IA 1ONEA 4AZCA 3A64A 3MZNA 5FL0A 2OEKA 2XH7A 3LBMA 2G96A 2HVMA 1LZOA 3RHGA 3WMLA 5C7HA 2ZICA 3CV1A 1TV2A 2BLEA 4QLLA 2V5LA 5D32A 5DT7A 2YCJA 3PB0A 4QM1A 4IMFA 3NZ1A 3AMGA 4F0RA 2I1OA 5C9ZA 4QIUA 3W7HA 2WQDA 4HP5A 5KETA 4I6KA 2YCEA 1UKTA 1Y5VA 1YIXA 4K36A 3CAVA 2C14A 3H23A 3LV6A 4P7QA 4IPJA 4UMAA 3M0XA 1BD0A 2C1HA 2HPMA 1B4EA 4PUWA 3MV11 5EBAA 4I9TA 2RHGA 4RZ6A 1SFLA 3NL3A 4XZWA 4HA1A 5CPOA 2F2HA 1Z3NA 3D3AA 4AXKA 3MUIA 1MVYA 4NZFA 3E6EA 1G4EA 1QXLA 3H4WA 5IRPA 3CH0A 3VUSA 3VZZA 3WG6A 3ISIX 1XUUA 2OZ0A 2ZUNA 1FWFC 2AQOA 6ENLA 2H3BA 4XSLA 5H8UA 5DT5A 2B81A 3ARPA 5EB8A 3WENA 3RF9A 1E1EA 1DIDA 4ES4A 2INZA 4ONVA 3L65A 2B0MA 3VOFA 3AO0A 2O9OA 1TX0A 1O5KA 3CAWA 1JRBA 4ZOAA 4Z0SA 1QT1A 1US2A 4NXKA 3TX9A 2PDGA 4JFUA 1W5PA 1H50A 4Z08A 1GW1A 3N3TA 1UH4A 2ZRYA 3EOLA 2BSLA 3IS4A 1FBAA 1FCUA 5CBBA 4YCPA 3FAWA 4DYEA 2ZRXA 1P6WA 4FALA 4LWWA 4OV9A 4FIRA 3TYZA 3QKZA 3NDYA 4JY9A 2R6OA 4D6HA 1XRTA 2C16A 2DT0A 4Y9MA 1LBMA 1YW1A 3NVTA 4KFOA 1X6UA 2QW5A 1LUCB 4IIFA 2Z2AA 3E9AA 5I5RA 4KEUA 3KXQA 3MPGA 1ME8A 1UMLA 3UY8A 5MKGB 3QN3A 1J93A 2YCLA 1YRRA 4IUOA 3SCQA 3QEZA 4X2PA 2MUCA 4AHOA 3KHDA 4N7QA 4TTGA 5M03A 1E6QM 2WHMA 2BY3A 1HKIA 4IGMA 3N17A 2Q09A 3FW6A 4WY0A 2YCKX 3PFMA 1KKOA 3HOJA 2FHCA 3A3WA 3SRKA 4CEUC 4KCUA 4PEKA 1R87A 3T4CA 3QM3A 2GUUA 5D03A 1AL7A 3QH2A 5G5IA 3S6TA 2WNWA 1XH1A 3TXZA 1SMDA 4QAWA 4UMCA 3ALGA 2ZC1A 3E0VA 3W71A 1H7NA 1Q4WA 2OR2A 2PRLA 4JTAA 3UYIA 4TV6A 4PSPA 3OLEA 1DOSA 4HZ8A 2AGTA 2XJ7A 3HV9A 1Z42A 3FKKA 4BWLA 2QJMA 1EJWC 2ATMA 3ONCA 2G4JA 1ZP4A 3KVJA 1KB3A 3K1GA 2PWEA 2GQ9A 1CWYA 3VOCA 2ZE0A 3SY8A 4O16A 4LBSA 1EBGA 3G0XA 2HDJA 5FACA 2TODA 2HISA 4UTJA 4ZB5A 1RPKA 2WLZA 1GKPA 4JCMA 3NEHA 4JTGA 4OUIA 2DZVA 4KT2A 3GZAA 4R53A 3TYDA 3QFEA 3LXBA 3PZOA 2OKOA 4UFLA 1EB3A 2DPEA 4V28A 2FZNA 2P8BA 1VENA 1E5JA 3RM8A 4ZQMA 4ZOCA 5E70A 1H1NA 1S5NA 3DFQA 1ZNNA 4BCEA 3QXBA 3HU7A 1XD0A 1IT7A 3AWOA 2H90A 4MKSA 3NJ3A 2ZZ3A 3R13A 4OBSA 4N0RA 1FRBA 5IHSA 3UJRA 4IFRA 1SR9A 1NU5A 2JKAA 4NJHA 1TZZA 3AS2A 3OA5A 3W1RA 2FVLA 1XQLA 4BWLC 4JN6A 1G6CA 1H2JA 2QULA 5FCZA 4DLMA 1W9UA 4Y90A 3BGGA 1S5WA 5A6BD 1L6GA 4M8UA 2BVWA 1BKHA 3KBNA 1D8WA 2ZXDA 3H2AA 4HQVA 2XWDA 1TPB1 3IIPA 1KXVA 1HFBA 3RRAA 5B7ZA 3QKEA 3QF0A 3KVMA 1HJSA 2P53A 2ZCGA 1HGWA 3HQOA 4Z2KA 1WA3A 3AI0A 1BRLB 1POJA 1PZ1A 1GOXA 4IP7A 1ZZMA 1I60A 3NOEA 2GJPA 3T55A 3T2PA 5AYYA 1V03A 3SCVA 4O50A 5CBJA 2DZXA 1CPUA 3AWNA 2DJLA 4DNHA 4Q7NA 4C91A 4CVWA 1H5YA 2X7VA 2Y7GA 2Y61A 2VFGA 3SCOA 4EK7A 1IF2A 4E4UA 3WNPA 4MB3A 3S5OA 1GVOA 3FSTA 1H7PA 4CGTA 1IEXA 1TV8A 4AD4A 1TIMA 3IVSA 4DLFA 4UOZA 4GY0A 2PDYA 4NAEA 2VP8A 2GK1A 2VOTA 4GUFA 4ROPA 1QW9A 3PJWA 1C8YA 2WO5A 1UOZA 1UZDA 3VZXA 3WH5A 1W5NA 3I3DA 3AJXA 1FWDC 3LCLA 4BF5A 1RCOB 3WL1A 3ZWSA 1IE7C 2PGRA 2I7GA 1JPKA 4B4HA 3O3RA 4C6MA 3QC3A 4QE5A 4S1FA 1CXHA 1PKMA 5CBIA 1MQPA 1KV8A 1SR0A 5D38A 3EBVA 2V67A 2CU0A 3BQ6A 3QV6A 4ROQA 2EF9A 2ON3A 5ECVA 4JQ4A 3WJZA 4HZMA 1JULA 4I90A 4UQEA 4UTHA 1JQVA 3DHUA 4M1RA 2GUBA 4EPEC 4G9PA 3O06A 3NPWA 4XZLX 4GKTA 2V30A 4KQNA 3GUWA 3AMLA 2BNJA 4LC6A 1XYFA 1FA2A 3TDFA 3GQYA 1KM6A 2VRJA 2C91A 3NTYA 3M0IA 2WMFA 2PWHA 4OJYA 1DORA 2UY2A 4NRRA 4NZ3A 3GKAA 2HPIA 5CC7A 3DHDA 4NUWA 3MBDA 1GZ1A 4P8WA 4UTFA 3P6LA 2YZRA 1TV5A 4JTHA 3NCOA 2E6YA 1BVNP 4S3FA 4ZB0A 4PC8A 4D9PA 1Q8JA 3RAOA 5JU6A 1LL4A 3TEVA 4XQ6A 3MYPA 4I5RA 4IPIA 5HMSA 3W1UA 2QJIA 3GIQA 1Q6CA 2ZUUA 2BASA 1O5QA 3SGUA 3LGDA 3AXXA 1V6UA 1WNOA 1XLKA 3G0SA 2VRKA 4PFHA 4QDWA 3RCYA 3GXMA 1Q6LA 2VZTA 4M6VA 3CS2A 1FKWA 4U3CA 5LZLA 4TQTA 1H0IA 3B0XA 3UETA 1GOQA 3UZXA 4F3HA 1ODUA 1VKFA 2B7NA 2Z1SA 5DY3A 3UWEA 2V8ZA 2PZ0A 2OSYA 3DXIA 2DDXA 1EC9A 1HVXA 3DFNA 3QYSA 3LXAA 4QS6A 4HOXA 1Q13A 2ZZ4A 3HJZA 2BXYA 2YYUA 1V6VA 1NF7A 1TJPA 1EF3A 3B05A 3KP1A 1IXNA 1WB0A 3T6CA 4GG9A 4LVFA 2ODOA 2EBNA 4ADSA 2ZZ7A 3EDJA 1OFEA 4IHCA 4GYPC 4RCXA 5CC6A 5HAOA 4MLRA 4LALA 3MCOA 3PM6A 5LHEA 3W0KA 4O1BA 1KM4A 4O0ZA 3POCA 4AFYA 2OQYA 4MLJA 1GZJA 4F0HA 1E3ZA 4M6QA 3Q37A 2PDBA 4QHRA 1WDRA 3P62A 5ABFB 4H9TA 3BICA 3MY9A 5I79A 1BF6A 4PRRA 3DFPA 3CT7A 1DJXA 1YMYA 4XTIA 1VFTA 3W3OA 1A5NC 4QCFA 3S2JA 3H21A 1GGOA 3BW4A 5AYBA 1DWGM 5LIWX 3N4FA 2ZX5A 3MHFA 5DANA 2EAWA 3OIHA 2YPIA 1WE5A 3GSMA 1PCWA 3CV7A 4LYPA 1V0LA 3VK5A 3TN3A 4DJED 4PCNA 3VD5A 4N6EA 3QV9A 1JRCA 3ANUA 3RK8A 4LC8A 3PBGA 4MB4A 1V08A 4OQVA 3S1GA 3O1NA 4EANA 4FS9A 4I8DA 2PFHA 2BV9A 4A8NA 1RY0A 1AD1A 3M47A 1VEPA 2FB2A 3HN3A 2X2GA 4YHGA 5EU9A 3BLIA 1ITCA 3OVPA 4H41A 1JYNA 2Z25A 5CLWA 3TE9A 3NGJA 2G3JA 3D3FA 4HSNA 3ZJ7A 5XIMA 1SJBA 3BW2A 1UR3M 4NYYA 4AEFA 5LIYX 1DJYA 3AS1A 4FXJA 4UFMA 4HCLA 1R3YA 4PMUA 4AUBA 4FF7A 5CG0A 4N4QA 2PP3A 4UR7A 4IIDA 4AY1A 2JF6A 1ENUA 4O8AA 2DZPA 1OF6A 4KKXA 4M81A 2J7EA 3BWWA 3LZ3A 3IJDA 4GNVA 2NV2A 3KWXA 3WLOA 3V1PA 4Q4OA 3P0WA 5C0QA 5E5CA 3AOFA 3CQIA 3NQGA 4GBDA 1Z41A 3K46A 4Q8NA 4OIFA 1W9DM 5ENLA 5JMUA 2I9UA 4MFDA 4PYSA 3AZSA 4NIRA 2E28A 5TIMA 4HJWA 1EJ7L 5CQ1A 3W1XA 3CZGA 4CQDA 1XCXA 5REQA 4K2SA 3CEPA 3SUSA 3VYLA 2ATSA 4XD5A 3M7WA 3AIEA 2R94A 2VEGA 2CLKA 2Y8KA 3NDZA 1GQLA 2E9BA 1H4PA 2X1UA 3U2EA 2CZFA 3TV8A 2BXZA 3EA1A 1SYTA 3WBWA 3KL3A 5DMLA 3QPEA 2QVHA 3WLJA 4PMZA 2QMJA 3HQNA 1FH9A 1F4AA 1HJWA 4Z1YA 4ZO8A 3NQFA 1QRQA 4ZFMA 1ICPA 1TYGA 2Z2UA 4C6IA 2ACUA 1X97A 2PMQA 2QUUA 3G8RA 1FWEC 1LRNA 3H2MA 4XUYA 3U9IA 3C86A 4LF2A 4S3CA 5SWUA 4G1KA 2BGNE 3WJXA 4BS0A 1RY8A 1JUEA 4Q8VA 5DBTA 5CZ0A 1T40A 3A12A 4K68A 3LI1A 3EWWA 5HNNA 1FP9A 2HWGA 3NPUA 3FVDA 3GTIA 1P43A 1V3LA 1E73M 1TSIA 4XZBA 4Q6XA 3TTOA 3BLEA 3S47A 3R79A 2WSPA 2Z27A 5IBXC 1ITQA 1ISZA 4U10A 3TZNA 2E6AA 4LW7A 1T5AA 4B91A 4TVCA 2C0HA 4INFA 3AYRA 3ECQA 1VLWA 3HF3A 3S5SA 4UQDA 2PTXA 4GQGA 1MFUA 2VWTA 3QV8A 3B8VA 4ZO6A 3LRLA 4IL0A 1XRSA 3OA3A 3ARXA 3M6YA 4ZBCA 4C90A 3GD6A 2GPTA 3TVAA 3N1AA 5DMYA 3IVTA 3R6IA 2EEXA 2DSZA 4HPXA 3ITTA 2VCCA 2G41A 3C2OA 3S1VA 4OGZA 3JUGA 2WVVB 1XICA 1SO6A 3W73A 3A4JA 4Q4SA 1W3TA 5CPTA 4DO7A 6REQA 1MNZA 1KBBA 1MZRA 1LWIA 5GJPA 3CU2A 2AAAA 4US5A 1KKRA 1K9EA 4JL2A 1OFDA 4JEJA 3MV01 1EF2A 1PJ9A 3B3DA 3W27A 2Q6ZA 5EPDA 3FEQA 4PR4A 3BVJA 5T26A 3S4TA 1ICSA 3ARQA 3UG4A 4WY0F 1SO5A 2DZUA 2F6XA 1TMLA 4IQLA 2V82A 2F38A 4IMGA 5T8GA 1VRDA 1C7SA 3E1F1 4JR5A 3LLFA 1A5CA 2PTYA 1R3SA 4J3WA 3XIMA 1HGYA 4JPGA 3PULA 2PDXA 1KRCC 4LEFA 3L5LA 2BOFX 3N2TA 3ITYA 1UD5A 4EOUA 4NY2A 2VC7A 1J0HA 2CKRA 2X41A 5GNZA 2FGLA 1ADOA 4WRHA 4ACZB 4DHGA 2Y8UA 3MCMA 3BTNA 4DELA 2JEPA 2E4TA 1RZMA 5DQPA 5GNXA 2QAFA 4IMAA 4F79A 4HHHA 4N6FA 3CL8A 4ATDA 3VMNA 1UR4A 4ZA0A 4C6EA 3ZSSA 3A9BA 5CJ5A 3COTA 3SQSA 2FGZA 3FA4A 3STGA 4P8VA 1LBLA 3IRSA 1H7XA 4ORIA 4PE8A 3D5HA 1GVSA 3GB6A 3AJ7A 4I7VA 4U28A 3WMBA 3N2CA 1FQ0A 1V6TA 4LNYA 2BBFA 3CUGA 3ES7A 1JQXA 1R9XA 3GUGA 3KOWA 2WJEA 1TWIA 2PGEA 2AOSA 4IP4A 1OCJA 5BXRA 1YE4A 4P7OA 1LWJA 3S46A 3RU8X 1V5XA 3LCFA 3KCLA 1EEPA 4HNCA 4WJXA 1QNVA 1B57A 2EPNA 3LHTA 1Z69A 4N9CA 1BPLB 4RXGA 4ERGA 2C13A 3M7SA 2CERA 1J10A 3LQGA 1JDAA 3G3DA 2G8ZA 4FMVA 4CKQA 1C91A 4RE0A 2VWSA 1CGWA 2J66A 4Y8FA 2V3EA 4BZYA 4E2OA 3GDTA 1OGGA 4MY1A 2CPUA 3CB8A 2Q01A 3VIIA 3MKVA 1G01A 4XO6A 4NL1A 5D9NA 6XIMA 3N12A 1XRVA 3EMCA 2OSXA 2XISA 6CGTA 3FVMA 1MNSA 1ZUAX 3GH4A 3K5XA 1Q6QA 3CH9A 4YYFA 3CQHA 4V2XA 1EUAA 1BAGA 2A3HA 1DJGA 4FHAA 4O53A 4D72A 2QJGA 5DRCA 3CT2A 2EGZA 2X1RA 1M9HA 4NT0A 1NDYA 2Q02A 1GNXA 3SQLA 1PYMA 2WSKA 2DH3A 5BWFA 1W1ZA 2HROA 3RILA 3CAKA 3M5YA 4LOCA 5AVNA 2CFFA 3ORWA 1GYLA 1WP6A 3MHUA 1OT1A 3AQUA 4GJIA 4L5ZA 2PE4A 2X0SA 5HJXA 4I9JA 3VNYA 4IQJA 4B3LA 2F7FA 1QBAA 4KS0A 2VO5A 5A6TC 3IAPA 1UWTA 1VR6A 3FHQA 2YOCA 3W1AA 2J77A 2G3FA 5FA5A 1XDMA 2XM1A 2J7GA 3WN6A 2A3AA 2ZWYA 1NY1A 1TWDA 3ZR5A 4AF0B 3QY8A 4NJJA 2PF8A 5D2VA 1DWJM 2GK1B 3G8EA 7ODCA 3W2MA 3P3BA 2CZVA 4RUBA 5FL1A 5H6HA 1R5YA 1BHGA 3WQPA 4GI9A 4LGXA 4AVFA 3W53A 3WLLA 2BY2A 3TYEA 1V0KA 3BG3A 5EGRA 1E5NA 1Y8BA 4K7VA 2J88A 1T8QA 3K1DA 2PDCA 1UUQA 1W5QA 3MUY1 5A8MA 3W2NA 2WC7A 2CWNA 3MMTA 4G56A 4EXQA 1TA3B 2GWGA 3WDIA 1E9IA 2F6KA 3VOHA 2WSRA 3U2ZA 1F3TA 2TYSA 3N6QA 1Y7VA 4XSMA 1IEIA 1CXKA 1LL6A 3NQ6A 1JI1A 1RALA 3OBEA 3PPFA 2ZFAA 2H9AB 4K37A 1UD2A 3MO4A 1JCYA 3ARVA 3FAXA 2WKGA 4DJFA 3TN5A 4LUSA