3EBVA

Crystal structure of putative chitinase a from streptomyces coelicolor.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
SLKHAVTGYWQNFNNGATVQKISDVPSAYDIIAVAFADATTTPGAVTFNLDSAGLGGYTVDQFKADVRAKQAAGKKVIISVGGEKGTVSVNSSASATNFANSVYSVMREYGFDGVDIDLENGLNPTYMTQALRALSAKAGPDMILTMAPQTIDMQSTQGGYFQTALNVKDILTVVNMQYYNSGTMLGCDGKVYAQGTVDFLTALACIQLEGGLAPSQVGLGLPASTRAAGGGYVSPSVVNAALDCLTKATNCGSFKPSKTYPDLRGAMTWSTNWDATAGNAWSNSVGAHVHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Chinitase A
publication title Crystal structure of putative Chitinase A from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
total genus 99
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ebvA00
1JYNA 1ECEA 4R27A 1UH3A 2Z1KA 3OLEA 3OB8A 1TA3A 2DDXA 5HNNA 5BXRA 3B9AA 3KL0A 1HJWA 4JFTA 2QMJA 2VVSA 1M7XA 4ACZA 4HU8A 1K9DA 4KRTA 2O92A 1WZKA 2V3FA 4JCLA 2E9LA 2JF7A 3ARPA 4U31A 1LL6A 4GIAA 1R7OA 2CBUA 1NQ6A 1EQPA 1FFRA 2VC9A 5CGTA 2YJQA 5BXSA 4UCFA 2VRKA 3AOFA 3WD0A 4KWUA 4U3CA 1MW3A 3ZT7A 4V28A 4CVWA 2IXUA 2BY2A 1PIFA 4AZ6A 3AFBA 3RM8A 3IJ7A 2OYKA 3VD5A 3VIIA 2VT0A 4OIFA 3GNPA 5A6SA 3VGGA 1B31A 2GSJA 1X1NA 1H09A 3K4DA 1CGXA 4M82A 4PMDA 4AC1X 3LPOA 4L4PA 5BRPA 2XVGA 2FHBA 1HP5A 3PHAA 4E2OA 3PZMA 4W7WA 5CZKA 1B3WA 2W66A 5AC5A 3NJ3A 3O6AA 3CO4A 1TZ7A 1CXHA 4W8LA 3VGEA 1UUQA 3WDRA 2WLZA 1J0IA 3CHEA 1GJUA 2WMIB 3AIVA 2UY2A 1SYTA 3T0AA 3T2PA 3CMJA 1FP8A 3VMNA 3EDJA 1QNQA 5DT7A 1H49A 1HJQA 4EK7A 4OJYA 3F5KA 5C71A 4W87A 3FAWA 2W5FA 5DEZA 3M46A 4AD5A 2WHMA 5E09A 1XV8A 1XH2A 4A3HA 1XCWA 4KGLA 1HP4A 5D8WA 5JBFA 4GI8A 1LL4A 1QPKA 2X09A 1CGUA 3W28A 1GQKA 2XVNA 3N04A 8A3HA 5FCZA 3U57A 4B15A 7CGTA 2E0PA 2J7BA 1EOMA 2XFFA 4NRRA 5TD4A 1ZU8A 1EHNA 2VX7A 1W2PA 4XUYA 4JKKA 2W4XA 2F2HA 3DC0A 4UQ9A 4P8VA 5LA1A 1UWRA 1NWTA 5FOOA 1E56A 1H5VA 2CKRA 1IZKA 2PWDA 3WEOA 2XIIA 3EMQA 3W25A 1E4NA 1AMYA 3WFLA 3K8KA 3WSUA 3LMYA 2V38A 4M24A 4H8VA 2OWCA 3GBDA 3G6LA 4BQ3A 4H04A 4ZENA 2ZWYA 3MUIA 1XSIA 2BVTA 1D7FA 1JNDA 1J0HA 3TTQA 3ZMRA 3BLPX 1H0IA 3WF3A 2Y24A 1V3LA 3ARYA 2X1IA 3TP4A 3KE0A 4MADA 3D3AA 2VX4A 1V08A 3ALGA 1E40A 3TTOA 2XHYA 1DWAM 1PX3A 2ZIDA 4UOQA 4J3WA 3WELA 4JFSA 1MXDA 4HA4A 4Q7NA 3WQVA 3MU7A 3AS0A 1MFVA 2ZE0A 3PZQA 4WKFA 4X9YA 1JZ6A 2VNCA 3WUFA 3OGVA 1W1TA 3AI0A 2CHOA 3AS1A 4HP5A 3RIKA 3WFZA 1X6LA 2CIPA 1W9DM 3CIVA 3W24A 3SCSA 1HKKA 3NDZA 4XZBA 2O9TA 2NT1A 1EDTA 1V6UA 1GHSA 1CXFA 3RJYA 3SCPA 4CN6A 5HPCA 1WB0A 3GYCA 4LYRA 4AD4A 1H4PA 2PF0A 1H41A 2OSYA 3GH7A 1I1WA 5IFPA 2VO5A 1KCKA 1C90A 1K9EA 2WMHA 1LWHA 3FHQA 4JFWA 1FH9A 1WP6A 3WD4A 3L4ZA 5HPOA 1VJSA 4F8XA 3ARTA 1VFFA 4M1RA 5AYIA 3UG5A 3WDQA 4YPJA 4Z2LA 4DUVA 2WHKA 5LA2A 2D0GA 3RPMA 1XSKA 2EBNA 3DYPA 5A8NA 5BRQA 2WXDM 5EFDA 1B2YA 4AY1A 1Q6DA 1SMDA 3N12A 1RD6A 1VBRA 2OSXA 4GINA 3S6TA 1QHOA 2QF8A 1J18A 1BFNA 4UZSA 4WJXA 1C8XA 3SCVA 5D9NA 3L4VA 1ITXA 1F4AA 1WE5A 1W91A 3DYMA 2PC8A 2A3AA 1ISWA 4KMQA 3OGRA 3AIWA 1HKIA 1US2A 4MAVA 4W85A 3CBWA 4PTXA 2O9RA 1W3HA 1C8QA 1CXEA 4HU0A 5ECUA 3N17A 4MDPA 4JCMA 1UOKA 4LYQA 4FLSA 3UEQA 3WMBA 3AICA 4FLOA 1KFWA 3WKZA 1V6WA 1Q4NX 2J75A 1VFOA 1CWYA 3ZJ6A 3SCRA 1XSJA 3NUKA 6A3HA 4JAWA 2CNCA 3GZAA 2MANA 4AZCA 4JFVA 1B30A 3VIJA 3VTRA 2VQUA 4CD7A 4PSPA 5LA0A 1GOKA 3VIHA 4WKAA 3AMLA 3IJ9A 4GKLA 3PZIA 4TVCA 2J7CA 2ZXBA 1CXLA 3WDIA 3SCWA 1NOUA 1UR9A 3AS2A 3OLDA 5JBEA 3A3HA 1UR2A 5EB8A 1EDGA 3K46A 3WNNA 2ZX6A 2FH8A 4PCSA 3KZSA 4BF7A 3WNMA 1UR8A 3GH4A 2FHCA 1JZ2A 2FH6A 5ABFA 4J3VA 5A6KA 2GK1A 2X0YA 4QFUA 1V6XA 2WC7A 2JE8A 5HXMA 2D1ZA 1GOOA 4JL2A 4J3UA 2VR4A 3LPGA 2Q8XA 3GM8A 2GVYA 3BXWA 5FL1A 1ITCA 3I3DA 4P8XA 1E15A 3W27A 2BVYA 2OYLA 2YOCA 5DFAA 4OBRA 4P7NA 2IXVA 2DH3A 2WANA 1DWHM 4HOZA 2J74A 3TOPA 1QNPA 4HZ6A 1W32A 3AIUA 3HMCA 4B3KA 4ZE4A 4WK9A 4BCEA 3U5UA 1UD2A 1JF6A 3MSDA 1UH4A 1D2KA 1MQRA 1ZB5A 3MO4A 3SUTA 3N11A 3OZPA 2VR5A 3BMVA 1V03A 1QNOA 3VU2A 1NARA 4AZBA 3AYSA 2XPKA 3M6DA 1UHVA 2Z1SA 1MYRA 2BHYA 1G5AA 4Z2IA 4PMYA 2OWWA 1G1YA 1K9TA 3N15A 2J78A 4K68A 1B0IA 2J62A 5BXPA 5FKYA 2QV4A 3ZT5A 1KR1A 4OOZA 1G94A 3ARRA 3L4TA 5GPRA 1GPFA 4PYSA 1GW1A 2AAAA 1TVPA 1TA3B 4AMCA 2BVDA 1J01A 2W91A 1ESWA 2X05A 2PBOA 1SFSA 1JNEA 1MWOA 1W1PA 4JZ5A 1I1XA 4EANA 4ACZB 1JZ4A 2C0HA 1MXGA 3WF4A 4AIUA 1BVZA 1ISYA 1HNYA 3VM5A 1DWIM 3SUSA 2D3NA 1NOFA 3GBEA 3SCNA 4GXPA 2FGLA 1MW1A 1OT1A 2DT2A 3AHZA 3OGSA 1VFUA 2DGAA 5ABHA 3CHDA 1JDCA 1TFVA 4LX4A 4D72A 3VIFA 1WKYA 1UA7A 2YBTA 3AMDA 2JALA 4Q22A 2C7FA 2BHZA 4E8CA 5CSYA 4S3JA 4QLJA 1UR4A 1W9PA 2Y8KA 2D24A 1CLVA 1FHDA 2WVTA 3W53A 2J8FA 3CZGA 4RL3A 1C8YA 1AVAA 4UQDA 1E71M 1JZ5A 3GTNA 1U2YA 3SCOA 5BCAA 1QI4A 3JUGA 3T0BA 1E73M 2WMFA 1JYVA 2A3BA 3A4WA 5CLWA 1JDAA 2QPSA 3BGAA 1XYZA 3UESA 4FF5A 3S2CA 5A1AA 1DTUA 3AZRA 2GFTA 1JIBA 4X0NA 1SR0A 3THDA 5I77A 1BTCA 3BAYA 2WSPA 4PMXA 2VMFA 5E0FA 3VX1A 1BYCA 3ARSA 4TX6A 1GOIA 4U33A 5I3DA 3HU7A 1UD5A 4TVDA 4WLCA 2HISA 2ZUNA 5LYRA 4D6FA 2XG9A 5CJ5A 7A3HA 1P6WA 2VI0A 3BH4A 3WBAA 4UFLA 3WH9A 2RGLA 4U2ZA 1HF6A 4UFJA 5FIPA 2WPGA 2ZWZA 3WF2A 1R85A 1GQLA 3UG3A 1WAWA 1PX4A 1VIWA 3EDEA 5D8ZA 2WMGA 3E1F1 3W6LA 3GNRA 1E1FA 5A3HA 5DO8A 4A3YA 3CZJA 4PRWA 3VIGA 3AZSA 1V3IA 1V3MA 1E43A 1UWIA 4HMCA 4CCDA 1H11A 1E4LA 2CBJA 3ZJ8A 2WKLA 4Z2GA 2JEQA 4J7RA 4PUDA 1O6IA 4TTUA 4LQ1A 1DWJM 5A6MA 3AIRA 3WMCA 5A6BA 1HL8A 3FNDA 4AZHA 4F9DA 1ZJAA 2CXGA 2B31A 4EKJA 1J0KA 2V3DA 4LYPA 2DT3A 3KL5A 5IFTA 2A3CA 5A8MA 3KL3A 3BAIA 4AIOA 1MQPA 2BXYA 2VZTA 1ZBVA 3WUEA 2BV9A 2YA2A 3TTSA 3WENA 7TAAA 2QHAA 1GCYA 1KGWA 1QNSA 4GI9A 4KH2A 1YHTA 1TG7A 3AS3A 1IV8A 3IAQA 3N9KA 1VB9A 1CENA 1AQMA 3TONA 2J7DA 3GXIA 3RM4A 4E4PA 4AW7A 2UY4A 3NSXA 3WQ5A 5A2BA 1OD8A 4M8UA 1BYAA 3N1AA 3BSHA 1HL9A 1UZ4A 2EXOA 5CPQA 1B3ZA 1LF1A 1PZ3A 1VRXA 4NI3A 2FHFA 1OGBA 1JAKA 3N18A 1UA3A 4QDMA 3VKKA 4QLLA 3GXDA 4UNIA 2F61A 4MB4A 4XV0A 3T0DA 1IT0A 1VFMA 2YDRA 1C7SA 4OOUA 4JIEA 3WH5A 1CTNA 4PMQA 2GUYA 1QOXA 1M04A 1FH8A 5BROA 3HJEA 4BA0A 1OCQA 1EXPA 4UFKA 3CZKA 3VPLA 3ARXA 4XX6A 2D0FA 1EHAA 4M80A 2DSZA 4BQ2A 4UFMA 2WHJA 2C8NA 3ARUA 3AHYA 1E3XA 4ATDA 4HZ7A 5GQBA 4FLRA 3KEHA 1XD0A 2VX5A 3AROA 2W61A 3EDFA 4HA3A 4X0VA 5M5DA 3WQ8A 1J11A 4V2XA 1UD8A 2WYSA 1KBBA 3MUAA 1GOQA 2CEQA 3L2LA 1WDPA 4W88A 2WZHA 4MDOA 1FA2A 2VQTA 2YL6A 5E6ZA 4UQBA 4AD1A 4HTYA 1PAMA 4CN4A 2ZXDA 3WQWA 3CZEA 4M56A 5GNZA 1KGXA 1WZAA 2WCGA 2XM1A 4AIEA 1JZ3A 4PMRA 1WNOA 1LQ0A 1V3KA 3QHOA 3WEZA 5JBDA 4CU7A 1R8LA 1PIGA 4W5UA 1DEDA 4J27A 4AZCB 4N0RA 4DWSB 2XGBA 5I6SA 3BC9A 2XFRA 4DM1A 2WC4A 4Y7EA 2XVLA 3A6OA 5E6YA 4MNJA 2YLLA 3NYDA 1KXVA 5CG0A 3WBEA 4HPHA 2GDUA 1Q6EA 5DMYA 1UR0A 4AZ7A 4PN2A 1XH1A 3G6MA 4DUXA 1QNRA 1H2JA 3FHAA 1CGYA 5A8OA 2WWCA 1C3FA 4GI6A 1RH9A 1MVYA 2W62A 1W9BM 2EEXA 1H3GA 2ZUSA 5ABFB 1NWUA 2GK1B 2W67A 4GZJA 1ISVA 3SCTA 4MAZA 4UZUA 3PZVA 1E3ZA 2V3GA 5IXEA 1HIZA 2BNJA 2JIWA 4UQAA 4B9YA 2E9MA 3SEPA 2D23A 1JFHA 4JFUA 2QMKA 3QHNA 1EO5A 2DQXA 1FFQA 1G01A 1RP9A 4HPGA 3W26A 1V3HA 3BAWA 1GORA 1J10A 3IK2A 2WBGA 3BAXA 3CZLA 1KB3A 1E5NA 4PUEA 1KXQA 1JF5A 4E8DA 4D6IA 4D6JA 2YL5A 2WVSA 4MB5A 4LGXA 2NT0A 2G4FA 2G3JA 3VGDA 1XCXA 1CZ1A 1UKOA 1LLOA 4DM2A 1CECA 4TX8A 4BQ4A 2G3NA 1B9ZA 3ZR5A 1JZ8A 5M03A 3ARZA 2D2OA 2WLYA 1OINA 2E40A 3QOKA 1UYQA 1W3JA 4MJ4A 2F8QA 4D6CA 1TUXA 1BHGA 2DH2A 1UD6A 2ZOXA 1XHGA 4QCFA 3UG4A 1JG9A 3VMPA 2YKKA 3CUJA 3UCQA 3B9EA 2WVVA 1VJZA 1DWFM 2PWEA 2YDSA 1M01A 3HN3A 1QW9A 4H41A 3APGA 4UFHA 3GXMA 3L4YA 4DWSA 4BZYA 4JL1A 4CD6A 2X2YA 2YIHA 3ZT6A 3AQUA 3UR8A 2RGMA 3DHUA 3WNPA 5A2CA 1F4HA 1VAHA 2G3IA 4B3LA 4U5KA 3L2MA 3OIHA 5A69A 1JD7A 1IZJA 3VOCA 1V0LA 2JF6A 4D6EA 1HJVA 5D9MA 1I75A 1Q6CA 4BQ5A 1H1NA 1FHLA 2WAGA 4TOQA 2W92A 3WL0A 4W93A 3AIBA 1Q6GA 4CD4A 4HMDA 1E6XM 3VD4A 1NWRA 1ZS2A 3VNYA 3ZIZA 1XRVA 3U7BA 4P8WA 2GJXB 4GO9A 4H8UA 3DYOA 4OKDA 3AMGA 4RE3A 4MNLA 5A95A 1CGVA 3MUY1 1FH7A 1QBBA 3K4AA 1LG1A 1J9YA 1HVQA 5KZ6A 2J7FA 2ZX7A 5A8QA 4MNMA 3MANA 1OM0A 3A4AA 3VIKA 3T09A 5ABEA 2OWXA 3VD9A 4AWEA 4M29A 1VEPA 3EDKA 2EPNA 5A6LA 3F4VA 3AJ7A 4UQCA 1GUVA 9CGTA 1UKPA 3PZ9A 1UQZA 2DSKA 2BY0A 1DP0A 3SUVA 3AHVA 3BAKA 3MMWA 1E6RA 4H8HA 1GJWA 1TVNA 4TTGA 5E70A 5HOSA 2VJXA 2YDQA 1UG6A 4Z2JA 1BQCA 5IDIA 4H7VA 1V02A 3ZJKA 4B16A 1WZMA 2OLHA 3PN8A 3WDHA 3W29A 1UKQA 4AD3A 3OZOA 1MQQA 1AQHA 4Z2KA 3BCFA 2E9BA 1V3JA 4WSKA 1M53A 1RPKA 5I0DA 1EQCA 3POHA 5I5RA 4W86A 4FLQA 1UKTA 5I23A 5D9OA 5BYWA 1W2VA 3BAJA 2A3HA 1E72M 4YHGA 1CYGA 1RP8A 1E6PA 4PBGA 3CPUA 3EMZA 2AMGA 4D6DA 1BYBA 2VZVA 2XGIA 2G8ZA 1JAEA 1QW8A 5E0CA 3PTQA 3D5HA 4MB1A 5EBAA 1JL8A 1PPIA 1BGGA 4NF7A 3ZSTA 4UFIA 1R7AA 3ALFA 1GQIA 2GJXA 1E70M 4GZEA 4DUWA 3IANA 1MFUA 3CLWA 3GH5A 2YBUA 3QR3A 4JHZA 2CESA 5AYBA 1MW2A 2ZXAA 1Q6FA 3LPFA 1CGWA 3CH9A 2XVKA 3CUIA 1GQJA 4ZE5A 1W1VA 3WH8A 4PCTA 2DT0A 1U30A 2WKGA 1XC6A 4W8BA 1WO2A 3AHTA 3O9NA 2YL8A 1LL7A 4PMOA 3PZOA 1KXTA 3VIMA 4J3XA 1OSEA 4CD5A 4Z2HA 1OD0A 4P7LA 3VDHA 2PWHA 4AD2A 1E6QM 2BY1A 1ZBKA 4IPNB 3SURA 2BHUA 3WL1A 3PZGA 2CPUA 3NIYA 1B3YA 2WCAA 1X6NA 4GZIA 1KCLA 1KWKA 2JIEA 4IM4A 5CGMA 5CSUA 5HBFA 4FK9A 1W3LA 1E0VA 3SUWA 4NZCA 2XJ7A 1BLIA 2V5CA 4J3SA 5DF0A 1C92A 2XTKA 1E6SM 1E4MM 1Z32X 1HKMA 3OLIA 3WMSA 2XSBA 2PB1A 3GDBA 2E4TA 3UERA 4AISA 3W82A 2OSWA 5IHRA 3T2QA 2CCRA 3GNOA 5FD0A 1US3A 2PWGA 4B9ZA 4EAMA 5JIPA 3WY1A 1C93A 3WNKA 1JZ7A 1HN1A 1CGTA 2WSKA 1GOMA 4D6GA 2WWDA 2OYMA 2ZX5A 1ODUA 2CBVA 4ATLA 4RE4A 4S3KA 3VDAA 4R5EA 3VD3A 3VGHA 4JKLA 1HJSA 3WDJA 4FMVA 3A47A 5CPTA 4F79A 1V6YA 3AXIA 2J7EA 2VL4A 5CPSA 4D71A 5EMYA 1TR1A 5EFFA 2ZUVA 3VIPA 5C8BB 3CGTA 1TE1A 3RO8A 1CXKA 1LG2A 2J7HA 4HOWA 1K9FA 3CHFA 4MJ2A 4J28A 6TAAA 1BYDA 2WNWA 3LPPA 5CQ1A 3I3BA 4D1JA 1NWSA 4TVUA 1GHRA 4GPNA 1UD4A 2FDMA 3OLGA 2CYGA 5C70A 3VDBA 4CU6A 3WEMA 1EA9C 4ACYA 4AXNA 2YL9A 4KGJA 2XUCA 3FN9A 1VENA 2D22A 4ZFMA 1QI5A 1GOWA 4PMVA 1OB0A 2D3LA 2PWFA 4NSBA 1ODZA 1A47A 1R86A 2J77A 2ZUUA 2EPMX 2YA1A 3ZJ7A 3W4RA 2ZUWA 1V0KA 2E3ZA 1LJYA 3EMCA 3W0KA 1VF8A 1E5JA 5F7UA 2WB5A 1BGAA 1UZ1A 1VBUA 4P7QA 1KBKA 5A2AA 1XH0A 3BMWA 2DSWA 4EE9A 1BF2A 4MPKA 1L0PA 1ISZA 2J8GA 3ARVA 3T2OA 3SIMA 2CITA 2XSAA 3W37A 1L8NA 3QHMA 4TUFA 1EO7A 5I2UA 1OIFA 5A8PA 2EPLX 3POCA 3MV11 4RE2A 1QI0A 2XYLA 2Y2WA 3MS8A 3ZO9A 1W3KA 6CGTA 2GDVA 3UR7A 1E55A 5D9PA 1CDGA 2JEPA 1TMQA 4CD8A 2WCSA 4LXFA 4PEEA 3F5JA 2NSXA 3WQ4A 3QGVA 3PBGA 1W9VA 1OWQA 2G3MA 4IPLA 3M07A 3BCDA 4UR9A 1HX0A 4U2YA 1ZBCA 3W6MA 1E0XA 1UWSA 3K8LA 4AZGA 4U3AA 3AHXA 2A3EA 2VRJA 3AMCA 3PZTA 1OBAA 1XYFA 2QPUA 2VURA 1V0NA 1DWGM 4GO8A 3WNOA 5A6BD 3CTTA 4L4OA 5E9AA 5HDRA 4C7FA 1W9UA 4CVUA 3PTKA 4WIWA 1EDQA 1E1EA 4UTFA 3AIEA 4DWSC 3IJ8A 5AC4A 1J12A 2TAAA 1BG9A 4CU8A 1BG4A 1J0ZA 2VCCA 2WZEA 1FOBA 4CGTA 3WD3A 5I78A 4QAWA 3QOMA 3SUUA 1JYWA 3ZSSA 1QHPA 1H0GA 1LWJA 3AXXA 2WVVB 5AY7A 3AIQA 1JYXA 1CNVA 3II1A 4IISA 1O7AA 5GNXA 2QLYA 3AXHA 4CCEA 3AISA 4PTMA 3EBVA 3FAXA 1KGUA 4UOJA 3RM9A 3AMKA 4HOXA 2DIJA 1UKSA 1GONA 4QCEA 1V02E 3GXFA 2DSVA 2WK2A 1G0CA 2WW5A 4JKMA 1CBGA 2WMIA 4M81A 3SCQA 5CXPA 1BPLB 3W38A 4F9JA 3CHCA 1J0YA 1VEMA 3VDCA 1NH6A 3WUGA 5DT5A 2XVPA 3RMEA 1E4IA 1HJUA 2VTFA 4V27A 4TXEA 4PSRA 2PBGA 1KXHA 1HXJA 5I79A 1E6ZA 3PZNA 4ZEPA 1KR0A 3FY1A 1D3CA 4WKHA 2IUZA 2D20A 1QHZA 3K1DA 5ABGA 1B90A 3WF1A 2ESCA 2O9OA 4IUGA 1UH2A 2AOSA 4MNKA 3BLKA 2XFYA 3B9DA 1JDDA 4LPCA 3A4XA 1QI2A 1UWTA 2VZSA 2CERA 3WQ6A 1AQ0A 1QBAA 1JD9A 2VUYA 5JIWA 3WD2A 4U5IA 2HVMA 4KRUA 2ZXQA 1JFXA 1GNXA 1UWQA 3U5YA 5D4YA 3VUPA 3VINA 3L4WA 2WZIA 2BXZA 2WBKA 3KWXA 3VM7A 5FL0A 2ZUMA 1PX8A 5M17A 1W9XA 1M03A 2WC3A 4OZOA 2CBIA 3VGFA 4C7DA 3NSNA 5M3WA 1DHKA 3OG2A 1PZ2A 4WSJA 1SMAA 2W63A 4XZWA 4URIA 4GQRA 1G9HA 4PTVA 3MUZ1 3PTMA 4CUCA 4W7UA 1MW0A 1JGIA 4N42A 1XGZA 2UY5A 4HZ8A 1BAGA 2PI6A 4BS0A 3PZUA 4ML4A 4WF7A 2O9PA 3WDPP 2GJRA 3WN6A 1UD3A 2BY3A 3O2LA 4W89A 1OIMA 2WM0A 1GVIA 3ZQ9A 4P7RA 1E9LA 1HJXA 3BSGA 2E8ZA 1UQYA 1QVBA 3DHPA 4OBSA 3MSGA 2Y5EA 4AZIA 3THCA 4QLKA 4J3TA 1NP0A 1TCMA 2UY3A 1B3VA 3UETA 4D1IA 2XIBA 5JUVA 5A6JA 1C7TA 1VEOA 2WHLA 2YA0A 2EPOA 3W81A 1NOWA 3VNZA 3EYPA 1PEZA 1JI1A 1E0WA 1Y7VA 3TTYA 2ZX8A 3AYRA 3NDYA 1XD1A 4JHOA 3MMDA 3RCNA 3M7SA 4CN1A 4PMUA 4P7OA 3WH6A 1GVYA 1BSIA 3NSMA 1J0JA 2UWFA 1WCGA 2ZICA 3RILA 3CUGA 4W84A 2J79A 2EPKX 4ZXOA 2WMJA 3F5LA 4AYSA 3MV01 3ARQA 1ISXA 5A6AA 3VO0A 2EQDA 3WIJA 3I3EA 3NCOA 1HT6A 2G41A 3WUBA 1CLXA 2CETA 1B3XA 3DECA 4YHEA 4C7GA 4D6HA 3ZOAA 2WMKA 4MTVA 3VVGA 5GNYA 4HA1A 1UR1A 4GQQA 3VD7A 4AZ5A 2Y4SA 1HVXA 3VILA 1NP2A 1E6NA 4UQEA 2J4GA 4P8UA 2NW0A 4DWSD 1W1YA 3VX0A 1WDQA 1V6VA 1EH9A 1FP9A 1CIUA 1B1YA 2VCBA 1S46A 3K8MA 4QP0A 1CPUA 2D0HA 1UWUA 3CMGA 1GZJA 1HKJA 1OT2A 3ECQA 2VZOA 2VX6A 4OUEA 4ZXLA 4A4AA 4W8AA 1PJ9A 3OBAA 1QI3A 4CCCA 3RJXA 2YLAA 3J7HA 1WDSA 2E8YA 1A3HA 2ZUTA 2ZX9A 3ZM8A 2VZUA 1ZJBA 1WDRA 2BS9A 4W5ZA 4ATWA 5BXTA 3VGBA 3MMUA 3U7VA 4AD0A 4H2CA 4F66A 3L4UA 1BVNP 3IAPA 2DEPA 4HMEA 4AEFA 1V0MA 1WPCA 2VOTA 4PTWA 2VVNA 2J7GA 4PMZA 4PMNA 5CLTA 1K6AA 1U33A 3WD1A 2EJ1A 3CUFA 1KQZA 1ZL1A 3VIOA 1OGGA 2BFGA 3WH7A 3OA5A 2DPEA 5I24A 2CHNA 3VMOA 1PBGA 3ZR6A 1EOKA 2X0HA 3B8SA 1ZBWA 1WZLA 2J25A 2V5DA 1YQ2A 2WVUA 2Y8VA 1NM9A 3T08A 5A94A 1EGZA 2FGZA 2DIEA 2JFEX 3FXYA 4CKQA 1EIBA 2XM2A 1C91A 3WF0A 4NRSA 3WNLA 2DT1A 4UOZA 1OGSA 3TA9A 1KWGA 2VCAA 4MB3A 1CXIA 3EDDA 1KQYA 2GJPA 5IHSA 3AZTA 3CZ8A 2CKSA 2V3EA 3CUHA 5BWFA 1JXKA 2EO7A 3RDKA 1R87A 3L4XA 3FW6A 3MKKA 1N82A 2J47A 3N13A 2DSUA 5KEZA 4YN5A 1JI2A 4W7VA 4AEEA 1CEOA 2VRQA 2XWDA 2XWEA 3ARWA 4XB3A 8CGTA 3SCUA 2X8RA 1JXJA
chains in the Genus database with same CATH superfamily
3BZJA 4I5XA 1JYNA 2MUCA 4N7QA 3NTYA 5CCZA 1Q6OA 2CHRA 1TA3A 5HNNA 3TR2A 2DUAA 3NM3A 4HB7A 2VVSA 3F4WA 2RDXA 4H3DA 3IIXA 4F4RA 3CEUA 4GY7A 1LL6A 1P43A 2P1FA 1VHNA 3C2VA 4DNHA 4E2BA 4JQ4A 2VRKA 4JQ3A 1GQNA 1MW3A 1P0KA 2OEMA 2IXUA 2PMQA 1PIFA 4AZ6A 3B8WA 3IJ7A 2OYKA 2VT0A 3OODA 3VGGA 1B31A 2V2CA 3K4DA 2ZE3A 3LPOA 4L4PA 1Q66A 2SFPA 1EP1A 1HP5A 1IEXA 3W7KA 3F2BA 4E2OA 3PZMA 4W7WA 2E77A 1QPQA 4TO8A 3OP2A 2QUTA 2W66A 4GGHA 1S2WA 2OFJA 4TU1A 1TZ7A 2HJPA 1CXHA 4W8LA 2FPYA 1J0IA 2WMIB 3AIVA 1OX6A 3T2PA 3URNA 1FXQA 4AH7A 1H49A 4LNCA 4XK2A 2ZRYA 1TZ9A 1MXSA 3FAWA 2W5FA 4O1EA 5DEZA 4AD5A 3SRKA 3UR2A 1VIZA 3R8HA 3PY2A 2CZDA 3PFMA 3PC0A 4Q8UA 2HXTA 5JBFA 3QQWA 3H55A 4C1NA 1QPKA 1IQ8A 2X09A 2I5GA 5EMKA 3BOXA 1EP3A 1PZ0A 4HCHA 3U57A 4B15A 3UWWA 1XDLA 1EOMA 4PCNA 4V15A 4IMCA 1GEQA 3TK7A 1LOLA 3H2AA 1RA5A 3TW7A 3RYSA 3DC0A 5REQB 2CKRA 3A24A 2PWDA 4O19A 3WEOA 5H1WA 4UTIA 4PRTA 3K8KA 3GFYA 2OWCA 3GE7A 3C2FA 3Q37A 4HU3A 5CH9A 5LGXA 2EG7A 4IUOA 2ZWYA 2BVTA 3R11A 3BLPX 5I3FA 2RH9A 1H0IA 1TTIA 2Y24A 1FY6A 1RCOB 1VFHA 3KE0A 4MADA 2VX4A 3TH6A 1V08A 3L5AA 1E40A 1PX3A 3WELA 3M1ZA 2OX4A 3LBOA 1MXDA 4L61A 4PUMA 3WQVA 3MU7A 3O05A 4QM1A 4WKFA 3WUFA 4GCAA 1EJVC 3OGVA 3M0IA 3PWIA 3AI0A 1NY1A 3HV8A 3AS1A 2BTMA 2Z27A 5C6MA 4GFIA 3R58A 4FOUA 3LU2A 4JTLA 1W9DM 3CIVA 3RG6A 1PB0A 2Q6ZA 3SCSA 1P48A 1GHSA 6ALDA 4AVFA 1VZWA 4NZFA 3SCPA 1WB0A 3GYCA 5HATA 1I1WA 3LN3A 1QR7A 2VO5A 4PFHA 1C90A 2G5WA 5KMYA 1Y5WA 3T8LA 4O8AA 1LWHA 4S3BA 4PB3A 3WD4A 1SW7A 4IGNA 3UG5A 1TIMA 2MNRA 3W7QA 4FNRA 3UP8A 1XSKA 1I9CB 2WXDM 1B2YA 1FKWA 3ZVHA 2BOEX 5HK4A 3NVDA 3N12A 1B3OA 4A8RA 4HD5A 4LVDA 3BGGA 3HFTA 1A5BA 4B2DA 4WJXA 1EBGA 3PBUA 1F3XA 4B92A 1NQKA 1ITXA 1F4AA 4RPQA 1WE5A 3DYMA 3MHGA 3TTEA 4NQ1A 3UJEA 1TJ2A 4KMQA 4Z0JA 5CZJA 3AIWA 2F6KA 1US2A 3H24A 4Q4RA 2UBPC 4PTXA 2A1YA 4P61A 4S3EA 4MDPA 3KZPA 1OFEA 1ADSA 3EX2A 3KBSA 4TV6A 3SSJA 1ONEA 4QJ3B 3DIPA 1Q63A 3K4WA 4JFVA 1B30A 1XLKA 3VIJA 4B5NA 2VOMA 2NXGA 4GCXA 3L23A 5LA0A 3P61A 3VIHA 4ZA0A 4Q7IA 3AMLA 4GKLA 1QWGA 6REQB 1CXLA 4L80A 4GD0A 3AS2A 3OLDA 1UR2A 5EB8A 1E0UA 4NUWA 2ZX6A 2FH8A 3W7IA 4HPJA 3WNMA 1XBVA 2FHCA 2FIQA 4LUYA 4J3VA 3QW4B 3GC4A 4ZQOA 1S1RA 2V63A 2WC7A 4M1BA 3S5YA 2D1ZA 1GOOA 3TFCA 3UGVA 4JL2A 3GDKA 4J3UA 3VUSA 4FNPA 1ITCA 2IS7A 4P8XA 3UJSA 5I02A 3O7UA 3AXMA 5J5DA 3V5OA 4FP1A 1Z7AA 5IDZA 4GUGA 4MZYA 3LHTA 2WANA 5CC5A 2OB3A 5C7HA 3UQNA 4HZ6A 5C0QA 3NPWA 4LVAA 4ALDA 4K8EA 4ZE4A 4RW5A 2I7GA 2TPSA 2BSLA 1UH4A 4QDPA 3LENA 4OFCA 3SN0A 5ABTA 3N11A 3E0WA 4RZ5A 2H9AB 3N2MA 1F6KA 1V03A 1IXOA 3EWBX 3DERA 5G1YA 4FOJA 2XPKA 4G9PA 2OOFA 1J5TA 1UHVA 2Z1SA 1H60A 2BHYA 4Z2IA 2HS8A 4N9DA 1DE5A 1G1YA 2PDLA 4DQWA 1W3IA 4GYJA 2G97A 3UFYA 2J62A 3PBMA 2VC7A 3KCOA 3PAOA 4ICCX 4RDYA 4O4WA 1QO5A 3OVQA 3HBLA 1QJWA 3FEMA 3CV1A 4XWUA 2GSEA 2B7OA 1IYXA 4XIAA 2Z7GA 2BVDA 2W91A 4Y9OA 4JZ5A 2Y89A 3VKBA 3N19B 1I1XA 4ACZB 2NQZA 3FJNA 2G95A 3QC0A 4MWAE 2XH4A 5FJRA 2WZTA 2I16A 3SUSA 2FLIA 2H90A 4S3FA 3UZ5A 3WG6A 2O7SA 2E6YA 3CAVA 1JDCA 3CHDA 4LX4A 5MKGA 3OQEA 1QXLA 4REQB 3S2NA 3I7QA 3SM0A 2JALA 2AGKA 2C7FA 4HHMA 4E8CA 4XZNX 4X63A 5HULA 4DBWA 1KTBA 3UT0A 4QLJA 3M47A 3H70A 4ZR8A 4FNUA 1TPB1 4NJJA 1W9PA 4PZVA 3APTA 3W53A 2P8BA 4DLMA 2R6OA 3CZGA 2VEPA 1E71M 2QZRA 1VFLA 5BCAA 4LUTB 5HNRA 3VFCA 2F9RA 1R3TA 1BWVA 5CLWA 1EWDA 1XI3A 1K4HA 3TAKA 3QN3A 4JY8A 4C6OA 1UJQA 1XYZA 4DF2A 1PL9A 2DUXA 3S2CA 1EUAA 1DTUA 1JIBA 1SR0A 4HCDA 4PMJA 3BAYA 1ONWA 2VMFA 3BJFA 2VD9A 4DJEA 4B5VA 4KCVA 3HOJA 4TX6A 1M7JA 4U33A 3S5NA 1J6PA 3HM7A 5I3DA 4QSHA 4Y8EA 2HISA 4IQDA 3SJNA 2C18A 2CZFA 7A3HA 2VI0A 3BH4A 3UNDA 1HF6A 4O0QA 7XIMA 3MP4A 1W5QA 1F3WA 3B03A 3UG3A 1PX4A 1C29A 4HNNA 5F2LA 1EXBA 2Z2BA 5F4WA 1GG1A 2Q3OA 1KKOA 3W6LA 1XIHA 2C13A 1FWTA 4NU7A 3CZJA 4GIYA 1XISA 3LTSA 1T5AA 3RX2A 1T6MA 3SGGA 3AZSA 3HG2A 4GISA 3BPWA 2YW4A 1H11A 3LRMA 2JEQA 1ZZMA 4MG4A 3G1YA 3V0TA 3QEZA 4H6EA 5C9RA 2B31A 1F61A 1L6GA 4I7UA 2ISWA 1J0KA 1J2WA 3SRHA 2GGIA 4DXKA 3LCIA 4LYPA 2A5HA 1L6WA 3KL5A 2A3CA 2EHHA 1FCQA 2NSOA 5K2ZA 3KL3A 3DFTA 3BAIA 5AYYA 2NZLA 2BXYA 1EPVA 1VHCA 3Q67A 3EXTA 3BW2A 4LC8A 3TTSA 3W87A 5BZAA 1IE7C 4H9TA 1GYLA 2F2KA 3GHRA 1KGWA 5DRIA 3LCHA 4GI9A 1F8IA 4O15A 1IV8A 3IAQA 4LUIA 4GKTA 1YBQA 3RFAA 4R9XA 3RM4A 3TWAA 4AW7A 3NSXA 1KKRA 1OD8A 4WGXA 4M8UA 4LBUA 3NQ2A 5CPQA 2OO6A 1B3ZA 3MW7A 2POTA 1RHCA 1K8YA 2ZRUA 1VRXA 3VKDA 2FHFA 3W23A 3N3TA 4MWAA 4ECLA 3NZPA 4JGDA 1QW7A 3VKKA 4QLLA 3G1VA 4UNIA 2F61A 4WDWA 2ZZ3A 1OQFA 3EXSA 1UJPA 4IQEA 4DELA 1ZRQA 1IT0A 1D9EA 3E2QA 1C7SA 1AJ2A 4OOUA 4JIEA 3S8HA 3ID7A 2I9EA 1UB3A 4PMQA 1IT8A 2XU2A 4O50A 3HFYA 4I9AA 1BTMA 1EX1A 2INZA 3HJEA 4BA0A 4UFKA 3CMFA 3T55A 3VPLA 2NUXA 4TMBA 1BXCA 2QQ6A 2D0FA 3AYTA 2GQAA 2DSZA 5G4EA 3V3WA 4BQ2A 4GRSA 2WHJA 2C8NA 3ARUA 3AHYA 2CWNA 2QKFA 3GAKA 2TYSA 2P3ZA 5GQBA 1DORA 3KEHA 4BWLC 2VX5A 2OX1A 1M41A 4HHHA 1PXGA 5FF0A 2PZ0A 3WQ8A 1J11A 4HCLA 3M0VA 3MUAA 4EPKA 1WDPA 1ITUA 3TUUA 4W88A 4EXBA 1KRCC 2WZHA 4UQBA 4AD1A 3B05A 4W9TA 3EAUA 1IR2A 3WQWA 4D2JA 1UROA 5GNZA 1WZAA 2XM1A 2WCGA 1QTWA 1Y5VA 1ZALA 2PDYA 4AIEA 4Q8PA 2WNNA 5JH2A 8XIAA 1PIGA 4W5UA 4J27A 5DBTA 4N0RA 2E1WA 4IXXA 4P2VA 2EKGA 4DWSB 1KBJA 2HBVA 5I6SA 3BC9A 4IMAA 3ZZ1A 4CLMA 3A6OA 3FYYA 3CWOX 2ADAA 3GUWA 5CG0A 3NYDA 3FLUA 3ES7A 5DMYA 2X7VA 1UR0A 3JRKA 3REQA 3LX9A 4IP7A 3TYAA 1IEWA 4DUXA 1JDFA 4IPIA 3AC0A 3V36A 1W9BM 1VGAA 4YTTA 3GVVA 3SCTA 3PZVA 5D2VA 1WAUA 1HIZA 3GTFA 3DH7A 4JEQA 1XFBA 1D7KA 1O94A 3L5LA 3DFSA 3MPGA 5JU6A 3W26A 4PC8A 1R30A 3URQA 2OXNA 3MB9A 4B5SA 2Z25A 4UNKA 1L2UA 4PUEA 4LY4A 4WDUA 3S2JA 2NT0A 2G4FA 2G3JA 4O1DA 1XCXA 1F6PA 5AZ0A 4AWUA 2NLYA 4TX8A 2W0UA 4BQ4A 2RDWA 2QCCA 3ARZA 4Q6XA 4HBKA 1ITQA 4IGSA 1NFBA 1EGMA 4GVGA 1OYCA 4D6CA 1TUXA 2DH2A 5GJPA 3WQOA 2XH2A 1X7IA 4QCFA 4IGHA 3B9EA 3AYVA 2Q8LA 2YDSA 4XKYA 4HJWA 1VCFA 5B80A 4CD6A 2X2YA 5FA5A 3I7RA 3IWPA 2RGMA 3PNUA 3NQGA 1L2QA 3WNPA 3JZEA 1YE6A 4IFKA 1DXEA 1VAHA 2G3IA 3W1XA 2BVWA 2QJNA 3I4KA 1P0EA 5BMWA 3U4FA 1SO3A 2PDXA 3MO7A 4BQ5A 4F48A 3C0QA 1QASA 1H1NA 1FHLA 3UZZA 3TN4A 3N9SA 1EIXA 3ITCA 3L9CA 1E6XM 1KV5A 4EPBC 1M1BA 3ZIZA 4UTWC 3FYPA 1XLHA 4RE3A 3LLXA 5HUOA 2ODOA 3ITXA 3MUY1 2V30A 1TWIA 1P7TB 4LAKA 3H53A 5FEPA 1J9YA 1YTEA 1YXYA 3HQNA 2J7FA 3TZFA 3OZYA 5A8QA 4O17A 3G77A 3B04A 3A4AA 4AWEA 1XG3A 4EPEC 1W6TA 2EPNA 3KCLA 3RR1A 2FZ8A 1DKWA 3KRSA 2DVTA 4UQCA 1WXZA 2BDQA 4GBDA 1GUVA 4ZQCA 3CAWA 1EA0A 1PDYA 1VBHA 3PZ9A 1VFSA 4YTRA 1KRMA 2E6DA 3SY5A 4INFA 4E3TA 1KRBC 1H63A 1E1CB 4EACA 2ALRA 2VJXA 2YDQA 3TXZA 1TPH1 4K7VA 3ZJKA 1WZMA 3WDHA 4AD3A 1AQHA 3BCFA 4WSKA 4WDXA 1A4LA 4R9OA 3XINA 1UKTA 4J4KA 3WQFA 2F6UA 5BYWA 2QJIA 3CYJA 3BAJA 1BEUA 4CNOA 1CYGA 1KFJA 1E6PA 3FEQA 4MY8A 4D6DA 3EX1A 1I2OA 1NDVA 4K7YA 1VLWA 3O6CA 1KA9F 1QW8A 3PF3A 1JL8A 1X98A 4IMGA 3NXLA 4J40A 3SZ8A 1YMYA 3ALFA 3CV6A 2FMNA 5K4XA 2D2HA 3IANA 3GDRA 3DX5A 3GH5A 3QR3A 4L1WA 5CC6A 5AYBA 1MW2A 4Y6GA 4PTNA 1W1IE 3OPSA 4FPSA 2Y8UA 1YTDA 1GQJA 4LJ3A 3GQYA 3WH8A 3VKCA 3RAOA 2WKGA 3G22A 1XC6A 2NWSA 3NQ7A 3KHJA 4OV9A 5F2MA 4CNTA 3VIMA 4UTJA 4NHVA 1IGSA 4JTFA 1ONXA 3NPVA 4I8YA 5CKSA 4P7LA 2NX3A 4ICMA 2BY1A 1ZBKA 4Y8FA 3PZGA 2GGEA 1YE4A 2HV5A 2Y63A 2CPUA 1RQEA 3BW3A 2PCEA 3MDWA 4LW7A 2JBMA 2JIEA 4IM4A 4O12A 4L65A 2J27A 1FCVA 2V82A 3HPAA 4CNSA 1E0VA 2ISDA 4F2TA 5LIXX 3KVMA 4NZCA 2XJ7A 3DG6A 3GHSA 1E4MM 1C9DA 3DZ1A 2PB1A 1TQXA 2CCRA 3GNOA 1H1ZA 4HQVA 1K6WA 3VCRA 3E12A 3QV9A 5HQMA 2PPGA 2VD8A 4U10A 3TC6A 4D6GA 2WWDA 2OYMA 3O1NA 3O07A 2ZX5A 8TIMA 3UXIA 3STCA 1ODUA 2CBVA 3H2CA 4NZ1A 1KRAC 3VGHA 3M0ZA 1HJSA 3WDJA 3CEPA 3UXKA 4FMVA 2WV8A 4ZL1A 1S5TA 4B91A 2L5HA 1PHQA 1T8QA 4ZFCA 3W72A 2VL4A 4ZQMA 5CPSA 4D71A 3QPYA 3V1PA 5BOFA 3RO8A 1KFBA 2J7HA 1I0BA 3VDGA 3PR2A 1A5NC 4DXVA 3TDFA 1BYDA 1P0NA 3NQAA 4Q4SA 4ZTYA 4H83A 2C71A 3ABZA 2NUWA 2YL9A 1XGEA 2PWUA 4ZFMA 1QI5A 3QY7A 2W3ZA 1A47A 3FVDA 3ZJ7A 3W0KA 3EMCA 1UIPA 1VF8A 3HQOA 5F7UA 2WB5A 1BGAA 3TQ0A 3KVLA 1VBUA 4P7QA 2RJGA 2VEFA 3BMWA 1BF2A 3CJPA 2HROA 1HGYA 3WJSA 3SIMA 3B8TA 2XSAA 1OADA 1L8NA 3IJLA 1R3QA 2PP3A 3M64A 5A8PA 2EPLX 7PTDA 2KX9A 2J6VA 5TIMA 1OG0A 3KBVA 4ZOAA 1TYGA 1Q8AA 2JEPA 3O0FA 3W74A 3W75A 4L1XA 3WQ4A 3M44A 3PBGA 3CQKA 2E5CA 2VGBA 3M07A 3QZ6A 3A12A 5CZSA 1HX0A 1M6JA 4E5TA 3W6MA 1TPC1 4C65A 1XQLA 3CK5A 1ICQA 3AMCA 1OBAA 2QPUA 5G1TA 1DWGM 1HGWA 3EOEA 3OG3A 4WIWA 2Z24A 3N6JA 4Y90A 1E9ZB 3DU0A 4DWSC 4YL2A 4JQ2A 5AC4A 1PWLA 4L56A 1GVFA 1BG4A 3QKEA 3QFWA 3OVPA 3SUUA 1OG6A 1QHPA 2VYOA 1IEIA 1LWJA 3AXXA 2WVVB 4IISA 3TA6A 1QPOA 5GNXA 2FTPA 4HVXA 4H00A 2Z6IA 3EBVA 3FAXA 3AMKA 3PJXA 1FWSA 1QDSA 1UKSA 3GXFA 3H22A 1H62A 3TXVA 2WW5A 2C91A 3MCNA 4M81A 3ATYA 3SCQA 3HB9A 1JVNA 1J0YA 4O11A 4LAUA 2XVPA 2VTFA 3P80A 5CSSA 1QOQA 3CT7A 4PSRA 3U2ZA 1TZZA 2O7QA 2YZ5A 1TJPA 1V79A 4XZIA 3O6YX 1T8XA 3G8RA 4LVGA 3A22A 5AHIA 1GTEA 1QHZA 3WF1A 2ESCA 3V5FA 2AOSA 4MNKA 3BG5A 1JDDA 3B0UX 4N6EA 2VZSA 4FXSA 3WQ6A 3M9YA 1QBAA 4DO5A 4OGZA 3LG3A 4F0MA 3WD2A 1G4SA 2HVMA 2WJDA 2VELA 1GKRA 4H7CA 1UWQA 2I5QA 5D4YA 3SY1A 3VINA 3L4WA 4B5UA 2WZIA 3RHGA 4F0LA 3VM7A 4FAMA 3C2OA 5E1QA 1VPXA 4K1WA 1ENUA 3C3UA 1RSCA 3NSNA 2P0OA 2JGYA 3MUXA 1ZLPA 7REQB 1GJPA 4GQRA 1G9HA 3PTMA 2ZC8A 4GC4A 1JGIA 1G4TA 1QAPA 5BMXA 2UY5A 4LCQA 2QNEA 3C0LA 4WF7A 4I7WA 3WDPP 1UD3A 3NQEA 3F4CA 4GJIA 4NIRA 2HEJA 1YRRA 1TMLA 4ONVA 1FWGC 1V8EA 3GIQA 1QVBA 3DHPA 1NDWA 3CB3A 2Y5EA 4E3VA 3QM3A 3UETA 9XIAA 5JUVA 4V1YA 1C7TA 2WHLA 5E0KA 4ICNA 4NAEA 4ROQA 1J2BA 1NOWA 2P5NA 3TVAA 3TKFA 2Y7FA 2TRSA 5HJXA 3AYRA 4JHOA 3C2EA 2J6XA 1JPDX 5T26A 3MWAA 1XG4A 5DMNA 1A0DA 3PAJA 3SQLA 1K77A 1MEWA 2VEMA 3CUGA 1KM1A 4ZXOA 2WMJA 3H4GA 4DRSA 3ARQA 1ISXA 3ANYA 2G41A 4G7FA 4YHEA 1Z44A 4Z08A 3DG7A 3DHFA 1XS2A 5U7SA 1QRQA 4GQQA 3UXAA 3SSZA 3LCLA 5CZTA 3VILA 4FXFA 1NP2A 4YLWA 4DWSD 3IPWA 2OLSA 3VX0A 1WUFA 5LNVA 4JTKA 1B1YA 1SVDA 4BEUA 4IGMA 4M5PA 1XLLA 3BLEA 3KM8A 4ZCWA 1UWUA 1GZJA 1HKJA 3M4HA 3H6OA 3W01A 3JR2A 5FESA 3B06A 5RUBA 4KETA 1PJ9A 2FKPA 1QI3A 3RRAA 1KTCA 3RJXA 4CCCA 2ZX9A 2QCGA 1WDRA 1V5XA 1TVLA 2X1UA 2Z26A 1DJNA 4HNCA 2VWSA 3CNYA 4HMEA 3WBXA 4IFRA 2A3LA 4R85A 3W7RA 2PDQA 2ZYFA 1SJAA 3SBFA 1C9WA 4PTWA 5G2HA 3MUCA 3CAKA 4PMZA 4PMNA 3KLKA 1OK6A 1K6AA 1U33A 1DBTA 1UBSA 3BO9A 4FF7A 4I8DA 3TNOA 1OGGA 1S3HA 2BFGA 2OGJA 3VNLA 1S38A 5JXQA 3TLLA 3AJXA 4WRHA 3OA5A 4WOQA 1NFPA 4WVXA 2CHNA 1US0A 3ZR6A 3W1TA 4QIUA 1ZBWA 1WZLA 1QMLA 2Q01A 3OZMA 3L0KA 1F73A 3FXYA 4CKQA 2PC4A 3PANA 4AY8A 3PUEA 2VCAA 5EMJA 4MB3A 1CXIA 3OHMB 1KQYA 4IMDA 2PAJA 4KFNA 3ZLFA 3AZTA 2ZDRA 3CUHA 3TYEA 3L4XA 2YGYA 3T4WA 3LV5A 4JX6A 3GVWA 1ZCCA 3N9RA 4W7VA 1DJXA 1P4CA 4JTUA 5LNSA 3QYQA 1P6BA 5AZ1A 1JPKA 2AL2B 2VDHA 3OHIA 4XB3A 8CGTA 1H51A 3SCUA 3WH5A 2ZKMX 1A5MC 1UH3A 2VHLA 3ITLA 5BXRA 3B9AA 1U5VA 1OF8A 5A8GA 3W7PA 4JFTA 4O1FA 3O15A 5E93A 1A3XA 5IRPA 2PDCA 1S2AA 4HU8A 2PZNA 3BJTA 1NAL1 4NXKA 3KRZA 1WZKA 1AD4A 2XZ9A 3ARPA 4JOMA 3CYVA 3GKAA 2CBUA 4QHRA 3NURA 2VC9A 1R9YA 4H6QA 4JX4A 3CQIA 1GVOA 4U3CA 1OFBA 3ZR4A 5F4XA 1BWLA 2BY2A 1GVRA 3E2VA 2NVAA 4KCWA 4OIFA 3EWWA 1Q6RA 3WBWA 2FDSA 3ZWSA 4EAYA 4ERIA 4GZ7A 4M82A 3QW3A 1O5KA 4RCXA 5BRPA 1GW9A 2FHBA 3RN6A 2CWXA 4NJGA 5CZKA 3VOHA 2VEGA 3WCZA 1K03A 2R94A 1W37A 3CO4A 4XBJA 1F6YA 3W7GA 2WLZA 3CHEA 1CX9A 3STPA 3OOQA 1UPMB 3ICJA 3HGSA 3DBNA 3O3RA 1IHIA 1IXQA 4JN7A 2P0IA 4EK7A 2PSNA 4CNUA 4W87A 5DXXA 3OBKA 4FXRA 2WHMA 3PUGA 1IIHA 1FWAC 3EA1A 3SQSA 4A3HA 1XX1A 4NAFB 1XCWA 3NR0A 4H9XA 3UPBA 4JNYA 1HG3A 1HP4A 1DL3A 4ZSUA 1JCNA 5EYWA 4JNMA 1HO1A 3MC5A 3TQVA 1GQKA 5FCZA 2DVXA 5CGQA 2E09A 2E0PA 4NRRA 2BODX 1AZ1A 4XUYA 2HWGA 3WFAA 3JVAA 1M7PA 4LB4A 3HPFA 5XIAA 2F2HA 4P8VA 5FOOA 1E56A 3L7RA 2Z1XA 2XIIA 3EMQA 1W3TA 3WFLA 1Q13A 5HWJA 1UIOA 4H8VA 1A80A 1TTQA 2FFCA 4NASA 1SZRA 1RR2A 4HSHA 3MUIA 1D7FA 1EX5A 3GFXA 3R8RA 1J0HA 3LLFA 3RU8X 3WF3A 1V3LA 2X1IA 4Z42C 3UJ2A 4L6HA 1PO9A 3L65A 2AKMA 2REQB 3ALGA 4RNHA 4ZBCA 3VKAA 4OV4A 1DWAM 5MF5A 4GOAA 5G2IA 4JFSA 4RX0A 3P0WA 4F0SA 4IX2A 3AXKA 1JZ6A 2PU0A 2VNCA 4LFYA 2CHOA 4RK8A 4HP5A 3RIKA 3WFZA 3RMJA 3LNMA 1X6LA 2CIPA 3QMSA 3LHZA 3W24A 1HKKA 3NDZA 4GY1A 4XZBA 2O9TA 1EDTA 1V6UA 4IFOA 3BQ5A 1RA0A 1TR9A 3RJYA 4C6KA 4CN6A 1OX4B 4LYRA 4AD4A 2FTWA 2IQ0A 3GH7A 4WJEA 1G4PA 4DXXA 1K9EA 3I65A 2OZ8A 2GQ8A 1QUMA 4DJDC 4JFWA 1XDMA 4M6PA 1VJSA 3GSMA 3UR5A 3VNDA 1Q7MA 2NV2A 4F8XA 4HZMA 4M1RA 3GC5A 4DUVA 5LA2A 2D0GA 3DYPA 5A8NA 4YVPA 3QXBA 5REQA 3WK3A 3Q58A 4MYAA 2TMDA 1RD6A 4LF1A 1XIEA 2OSXA 2PEVA 3FKKA 3S6TA 1QHOA 5LIWX 2DW6A 1PYMA 1SJBA 1BFNA 4UZSA 3RRXA 3SCVA 4BK9A 4DO4A 3L4VA 5B7ZA 1W91A 2Q8ZA 3I6RA 2A3AA 1ISWA 3V5CA 3E0VA 3W1UA 3NZQA 1I0DA 3OGRA 3R13A 3P60A 1EZWA 1HKIA 4DZ5A 1R0MA 4BWLA 1C8QA 3QJAA 5G1MA 4J1OA 1UOKA 1SGJA 3UEQA 3B8UA 4FHAA 5FEZA 1CWYA 1FRBA 1KCZA 4LYKA 3MYOA 2MANA 2B0MA 3BG9A 1LT8A 3M41A 2VQUA 5BOOA 4PSPA 5T91A 5HUPA 3VE9A 3PZIA 3ZYZA 4ZZ9A 2J7CA 2J24A 3WDIA 3DBPA 3KTXA 3S3GA 3OIXA 1YTKA 3WNNA 4RDZA 3U3HA 4BF7A 1SUXA 1UR8A 1MSSA 1JZ2A 1KM0A 2DU2A 4H9MA 2OEKA 5A6KA 2GK1A 3EEGA 1V6XA 3QR0A 2ON3A 3GRIA 2JE8A 3WO8A 1SPQA 2IKJA 2Q8XA 3IRDA 2GVYA 3BXWA 3GAYA 5BWAA 1TIWA 3EOSA 3HJZA 1E9YB 2HE5A 3LXCA 1V51A 1XP3A 4WR3A 1NVMA 4KWVA 3TCSA 3SY8A 3GY1A 4Q3MA 1BXBA 4R33A 1G6CA 4EPDC 3TOPA 1QNPA 4GG9A 1W32A 4QQUA 4O16A 3AIUA 3JU2A 2P76A 1LT7A 1WBJA 3MSDA 2ZC1A 3MO4A 4US6A 1B9BA 1EJXC 4Y9PA 2QUNA 3GXPA 2D73A 1RJPA 1DV7A 2FZBA 1XYCA 4JTSA 2OR2A 5I06A 1TCDA 5CPLA 1G5AA 4BI5A 2PA6A 2OWWA 4K68A 4DIAA 5BXPA 4L9XA 3TYBA 2QV4A 1JRBA 1UP3A 2YCLB 3GTHA 1SJDA 4OOZA 4BF9A 5JMUA 2PUZA 3W76A 3LM3A 5C7VA 5GPRA 2Y0FA 1GPFA 4PYSA 1GW1A 1TA3B 4N2YA 3CB8A 1X7FA 5G5IA 3M0XA 4KT2A 6REQA 3O8AA 1JNEA 1MWOA 1W1PA 1AK5A 4EANA 1R2SA 1H50A 1MXGA 4AIUA 1EC9A 1MZHA 1BVZA 1ISYA 2CLPA 5I03A 3CL6A 2X2GA 3CL8A 4LRSA 2DT2A 3OGSA 4AVNA 1VFUA 1TFVA 4U4MA 3GVQA 2GOKA 4GVFA 1WKYA 2YBTA 2P8CA 4Q22A 4XVDA 3DGRA 3RUBL 4S3JA 5FJJA 2WNZA 3Q2DA 4UTWA 3U2EA 4L9ZA 2ANUA 2WVTA 1VYRA 3UBPC 2J8FA 3DC8A 4MKSA 3W1AA 4RL3A 1TV2A 3NYZA 4DJDD 4UQDA 3H23A 3CQHA 3GTNA 4ZOEA 3USBA 3S9IA 1A5UA 3W9ZA 2WMFA 3MHUA 3WJWA 2A3BA 1YXCA 1T99A 3A4WA 1JDAA 4LBRA 2QPSA 6ENLA 3UESA 3QGAC 3KOWA 2H9AA 4ZMGA 2V5BA 1DIEA 2GFTA 3W85A 5I77A 2WSPA 4LRTA 3IIPA 4PMXA 3TJIA 4AUBA 1BYCA 3B8IA 3CV7A 4XISA 2Q09A 1A3WA 2ZRZA 2Z1BA 2ZUNA 2QDEA 1MEIA 5EA9A 1D3HA 4EXQA 3AU2A 5K9CA 4UFJA 5FIPA 1T41A 2WPGA 2ZWZA 3WF2A 3GIPA 1VIWA 3LSCA 1XIFA 3E1F1 3VOIA 4OU1A 3WJXA 3GNRA 4RZ4A 1E1FA 4Q8MA 1M68A 3GW0A 2F38A 4GJJA 4RXFA 2C14A 1XYLA 1E43A 1EYWA 3GDTA 3EEZA 4JPGA 4CCDA 1B4KA 3DGBA 1E4LA 2CBJA 3ZJ8A 4J7RA 1O6IA 3W7LA 4LQ1A 3WMCA 4I7VA 1HL8A 4AZHA 4Q32A 2CXGA 4REQA 1AH0A 5D38A 2GL5A 4XO7A 3KP1A 2VKZG 5AC7A 5HR7A 3FYOA 1E0TA 2FPVA 1XLFA 4AIOA 1ZSXA 3KDNA 4HJFA 4H4IA 2VZTA 1RQBA 3LRLA 2BV9A 2TODA 1Z48A 3ITTA 4KESA 2ZA3A 2YA2A 1W8SA 3B0XA 3WENA 1CT5A 1KTNA 3NO1A 4QROA 2PGWA 1YKWA 3AS3A 3N9KA 1XKYA 2J7DA 3GXIA 1S2CA 2BOFX 3ABQA 2UY4A 2A6LA 1HL9A 5HANA 4ZQRA 4PFMA 4DJED 2EXOA 1VBGA 4LH8A 2CZEA 4NI3A 5I7GA 1WXYA 1JAKA 3VC6A 3N18A 4MYXA 3P7YA 1UA3A 4QDMA 3E9AA 2OG9A 4MB4A 3UWVA 2V2HA 3T0DA 1YPXA 2QR6A 4RR4A 2GQ9A 2ZVRA 1WOBA 1OCQA 1OVDA 1RALA 1EXPA 4PULA 1EYEA 3T0TA 2ONEA 3GNNA 3VXGA 4HU4A 3NNTA 2DFAA 3C0SA 1IWBA 3ZVHB 4M80A 2Z2AA 4UFMA 4L4LA 2QGYA 1E3XA 1RVKA 1VFTA 3W86A 4HZ7A 3B9OA 3W2LA 4KCTA 4M3PA 4XD3A 1V4YA 2QUUA 2YCKX 3AROA 4KPLA 3W7NA 5M5DA 3T42A 3WLOA 3W88A 4JTQA 1KBBA 3N25A 3GNDA 1R9ZA 1GOQA 2CEQA 3L2LA 3INPA 1DJWA 1LM1A 5I3GA 1DVJA 1FA2A 1XIBA 2IPFA 1YDOA 1PAMA 1ME9A 4CN4A 2ZXDA 3CZEA 4M56A 1KGXA 4PMRA 1V3KA 2OGYA 1R8LA 2Z0IA 3DHDA 4H9UA 1XKJA 1DEDA 3WLSA 1FWHC 3SECA 4NNCA 1S5WA 1EJWC 3UZXA 3QSRA 2XGBA 1NDYA 2XFRA 2WC4A 1H7OA 3VAVA 1U1UA 4QEHA 4MNJA 2RDTA 4HNTA 3C4UA 1AH4A 3W73A 4QISA 4HPHA 4HHPA 4RNFA 4K3ZA 3MBFA 1XH1A 2QULA 3VCNA 4O18A 1IXPA 4MWAD 1LORA 3FHAA 2GLKA 4ZOBA 3FOKA 4GI6A 4QBXA 4WQ6A 1TX0A 2EEXA 2DVUA 3TJ4A 2W67A 4UZUA 1DTNA 2XISA 3S46A 2V3GA 5IXEA 2PLCA 2BNJA 1XWYA 3NO5A 4B9YA 2PTXA 3MSRA 3SEPA 5H2ZA 1JFHA 3NM1A 2DQXA 3IJIA 1FHVA 1RP9A 2VXNA 3KBJA 3MZNA 2IPGA 4ADSA 3SN4A 3SFKA 3E96A 2WBGA 3I10A 4LV9A 1REQA 1OABA 3R10A 1KB3A 4AEOA 1KXQA 1JF5A 4E8DA 4D6IA 4R3UA 2WVSA 4YYCA 4QG9A 4LGXA 1PKYA 1CZ1A 1UKOA 4DM2A 5FJIA 1CECA 3DFYA 2G3NA 3P6LA 3W83A 2WLYA 1OINA 4O0ZA 4MJZA 4NP7A 3LOTA 1W3JA 3UD6A 2ZZ5A 2ZOXA 1XHGA 1JG9A 3CUJA 3QFEA 1SO6A 2VFFA 3BOFA 4BR1A 6PTDA 3U2OA 1BWKA 3GG8A 3PULA 3DKLA 2Y6ZA 5AECA 1XC4A 3GXMA 3L4YA 4DWSA 2YIHA 3L0GA 3AQUA 3DHUA 3GG7A 3MKVA 4B3LA 2R1MA 1J93A 1MMFA 4D8LA 4ASTA 2BGQA 3L2MA 5AN7A 3H12A 1UCWA 4D6EA 4GMEA 1I75A 3PM6A 1LRQA 1K3UA 3PWGA 3UXLA 3KUMA 2HVNA 3WL0A 3UU0A 1Q6GA 4KF1A 4H9YA 3PTDA 2HDJA 1ZS2A 1XW8A 4QJ5B 3M0MA 4P8WA 2GJXB 3ATZA 4H8UA 3DYOA 4UMBA 4OKDA 1P6CA 1ZHAA 4MNLA 4AHOA 3P93A 3ABRA 1CGVA 4NJKA 4YVVA 4FNTA 2I5IA 1LLWA 4S38A 4CQ9A 3K4AA 5JVLA 2DZAA 1LG1A 1RUSA 2QCMA 3LGDA 4JIRA 5KZ6A 1NF0A 3OVRA 3KXQA 2QYGA 3MANA 1PIIA 2QIWA 4AX7A 3S6OA 4ZODA 3VD9A 4M29A 4LC6A 2QJJA 3EDKA 5A6LA 1R9XA 3CT2A 3F4VA 3AJ7A 3N4EA 5JH1A 9CGTA 3MDUA 4QITA 3W7CA 1FBAA 1KBIA 3WQPA 1UQZA 1VC4A 4QS6A 3A5VA 3AHVA 4W4QA 3MMWA 2WQDA 3NGJA 1GJWA 4H8HA 4TTGA 4YNGA 4Z2JA 3U2CA 1BQCA 4AU0A 1EPXA 2F6XA 4H7VA 1V02A 1KO0A 1UKQA 3U8GA 4KKXA 2CXEA 1MQQA 4HSNA 5KETA 3BJSA 2E9BA 1RPKA 2JKEA 5D9OA 3W70A 4KEZA 4G6CA 4LUJA 3C3NA 3SFWA 1VP5A 2A3HA 1E72M 3H4WA 1RP8A 2ZRXA 4PBGA 3EMZA 2XINA 3U48A 1RJQA 2VZVA 3NAVA 1K7EA 1X6UA 1SSDA 3M43A 5E0CA 3LM7A 3D5HA 4US5D 4GGBA 4RW3A 1A5SA 3W3OA 1BGGA 2GUUA 4NF7A 4PBFA 3R12A 4UFIA 1Z42A 4L5ZA 5HR6A 1TB3A 5HMFA 3GW3A 4OUIA 4EF8A 1EUNA 3B9NA 2CESA 5D32A 1W54A 2ZXAA 3BSMA 1I2RA 1JRCA 1CGWA 2XVKA 4FALA 1U30A 3NZGA 4W8BA 4XAPA 3O9NA 1BVWA 1EF2A 2QCLA 1XPYA 3S42A 4PMOA 3R79A 4J3XA 1OSEA 4C6IA 3QTPA 4H19A 2ZTJA 3P82A 1DIOA 4IPNB 5M2FX 3WL1A 3LB0A 2WCAA 5EMLA 1KCLA 1KWKA 4YWSA 1F3EA 3TE9A 5HBFA 4FK9A 4YXGA 3D46A 1YBQB 1F74A 1GYMA 1W3LA 1JCMP 3S5SA 2ZRWA 1VPYA 1BLIA 1O1ZA 4J3SA 2XTKA 1Z32X 4N02A 3ABXA 1A53A 3GDBA 3TOYA 5IHRA 1TV4A 3T2QA 1D8WA 1NDZA 1Q65A 1US3A 2DZVA 3GU2A 1ZJHA 3NOEA 3WY1A 1JQVA 1L6SA 1HQTA 1K8ZA 4OWGA 2EJAA 3TYCA 1DXIA 3EXRA 4HYWA 3QGKC 1UR3M 4RE4A 4S3KA 3URAA 3CQJA 4R5EA 2WKJA 4FA3A 3GKFA 4K36A 5FAJA 5CPTA 4F79A 1V6YA 2VGIA 2OQYA 3KP0A 3LI0A 2J9XA 1TR1A 5EFFA 1NU5A 1TE1A 4ZB0A 4HOWA 3CHFA 4Y2WA 4C6BA 2WSRA 3QV8A 4I9JA 3LPPA 4D1JA 4MZ8A 1GHRA 3CU2A 4QRNA 3GD6A 4IH3A 3VOFA 4E2VA 3VDBA 3WEMA 1RK5A 2XUCA 1VENA 2FGBA 5CBIA 2NQ5A 2P3EA 4PMVA 3DI1A 1OB0A 4BY3A 4RPPA 3HF3A 1KFCA 2ZUUA 4Z1CA 3W4RA 2ZUWA 1V0KA 2E3ZA 5AHMA 4IP5A 5F1UA 4O13A 1R3WA 1UZ1A 4DI9A 4DBEA 3UY8A 5A2AA 1XH0A 4EE9A 4MPKA 3A21A 3NL2A 2J8GA 2V0TA 1SU5A 4PRRA 4RNIA 3UZYA 4TUFA 1YDVA 2QCFA 3WJYA 5I2UA 3POCA 1H1YA 3M5XA 3MV11 3A5FA 1QI0A 4C91A 1YYAA 4CCZA 3UR7A 1JUKA 5CAHA 1W0MA 1TMQA 3MYPA 2WCSA 3F5JA 4XZLX 4IPLA 2FPTA 4UR9A 3W1NA 2J9YA 4IT1A 4DHGA 3N2TA 3K8LA 3GFZA 3AHXA 2A3EA 3PZTA 1PCKA 4JYDA 2VURA 3VC5A 5A6BD 3CTTA 4GNVA 1J8VA 3E2SA 3BLFA 4C7FA 2A4AA 4CVUA 3PTKA 3RO6A 4R88A 1I8JA 1E1EA 4E4UA 4K8HA 4UTMA 1FTXA 3GG0A 3IJ8A 2IQDA 5EPDA 2E6FA 2PGEA 1J0ZA 2XSXA 2VCCA 4WHBA 2W6RA 4TQTA 4KCUA 1S39A 3GWQA 1JYWA 3ZSSA 3F2DA 3AUJA 1O68A 3VOJA 1XIIA 3E38A 1PKLA 3AIQA 1JYXA 1X8CA 4XKYB 5I09A 4C6NA 1AL7A 4RV3A 2QLYA 3AXHA 4CCEA 1O60A 4PTMA 4IFKB 4I3GA 4DZIA 1WXJA 1UP2A 4HOXA 3RM9A 2DIJA 3V0SA 3B40A 1SO4A 2Z4GA 5HNUA 1FWWA 1MO0A 3U4AA 2EF9A 3NVTA 5D05A 3DFPA 4F9JA 1XM3A 3QH2A 1F9CA 4WY0F 1GK8A 1VEMA 3VDCA 1Q6QA 3D6NA 1NH6A 1ICSA 2G96A 1HJUA 4TXEA 3BANA 3G8EA 3G1HA 3RLUA 3TYDA 2E1DA 2QVNA 2EPHA 2NXHA 4ZEPA 2G0WA 1YDNA 1ME7A 3OJGA 4WKHA 4OQVA 1A5AA 2D20A 5ABGA 4UR7A 3UA4A 2GGJA 2O9OA 4O1CA 2B4GA 4LPCA 3P8JA 4ZB5A 5DY3A 4YIWA 3L66A 4U5IA 1GVEA 4MFDA 2PDKA 3STFA 2P50A 4Y96A 3QQ0A 1AL8A 3ME3A 3DUGA 4FSAA 3K5XA 2BXZA 1ALDA 2WBKA 5FF3A 1XIMA 5M17A 1Q85A 1WA3A 3W1PA 3TSBA 3CIWA 1XLMA 3KWSA 1FXPA 3SRDA 5FF7A 2F7FA 3IARA 2PDMA 2JQXA 1XYAA 3EA2A 4DF0A 3V7PA 2X7WA 2PCQA 1SFTA 4URIA 1WKEA 4FR6A 4CUCA 3N14A 4IG2A 2DY3A 3W7HA 2NQHA 5CJMA 3LCXA 4HZ8A 2ALDA 4BS0A 2O9PA 4FOKA 1PYFA 2ZVIA 2BY3A 3O2LA 1UMYA 4W89A 1DJHA 3C2YA 3QMRA 3ZQ9A 5D30A 4C1LA 4XD5A 3BSGA 2QPXA 4OBSA 3B3DA 3AALA 3THCA 2VDGA 3DKJA 4QLKA 4I6KA 4J3TA 1NP0A 5HMDA 2UY3A 1B3VA 2V68A 3LGEA 1A5OC 3A9BA 4D9PA 2YA0A 1ICPA 1XL9A 2A21A 4AAJA 3EYPA 2R1PA 3NA8A 4IMFA 1JI1A 4DI8A 1SM9A 1E0WA 1Y7VA 2ZX8A 3NDYA 1D8CA 3MMDA 4S3CA 3RCNA 4C6FA 3M7SA 3RX3A 4PMUA 2J66A 1JEZA 3N2BA 2UWFA 1ONRA 3EOUA 5CPNA 1TJ0A 4W84A 2EPKX 3VABA 3U9IA 3DDMA 3GYEA 3CUXA 3MV01 4DJDA 2EQDA 4R53A 4JN6A 3WIJA 3PPCA 3QVQA 4WOZA 3DECA 2PTYA 2UV8G 1OFPA 2IKIA 3A3XA 4KWOA 1N8FA 4LSBA 1UR1A 2CU0A 4AZ5A 3G1SA 3O6DA 7REQA 1NEYA 2QT3A 1WDQA 1V6VA 3PK7A 1FP9A 4C5YA 2VCBA 4A05A 1T0OA 4Q8QA 2YPIA 3P14A 4IIEA 4QP0A 3CMGA 3UJFA 3VFLA 3LERA 4ZXLA 4XAFA 4XUGA 4W8AA 3OBAA 4QJ1A 2YLAA 3J7HA 3OYXA 2ZUTA 3ZM8A 2VZUA 3PWAA 3VKJA 4ATWA 4C1KA 3MMUA 3P81A 2ZZ4A 4H2CA 1KM4A 4FX8A 1THFD 2YR1A 3IAPA 1AW1A 1LZOA 2AQVA 2GSHA 1XLBA 2IQTA 1F8MA 3IV3A 3BURA 3T9PA 3FDKA 2VOTA 2FB2A 4GQGA 3B0PA 4ZGYA 5A5WA 2BZNA 2R1NA 4NXSA 4KERA 3VIOA 3PJTA 1I2QA 1XICA 4LAOA 2ASHA 5I24A 3V4BA 3H2FA 1A5CA 3VMOA 1PBGA 3S1UA 2PURA 1EOKA 2X0HA 1OEPA 3B8SA 5GJNA 2E6AA 4JYEA 2RJHA 1TUFA 4O52A 1YQ2A 1DXFA 2Y8VA 4JX5A 4GX9A 2FZ9A 4GIRA 3B8DA 3T08A 1RCXB 2JFEX 3WF0A 3DN5A 4JTRA 3WNLA 2RKXA 4UTLA 3KDOA 1XIDA 1OGSA 1KWGA 3O06A 5LGZA 3V18A 5IHSA 2PODA 5BWFA 1QU4A 1JXKA 4ROPA 3PVFA 1R87A 2NX9A 1TREA 4GQBA 3NQFA 3MCMA 3EA3A 1JI2A 4AEEA 3H7UA 1CEOA 3A23A 1K8XA 4JXCA 3GO2A 1OHLA 4ENLA 1TTJA 1RBOB 2WJEA 1PSCA 2FVLA 5FEWA 4R27A 4IPPA 1I4NA 2Z1KA 2V5JA 3S4TA 3OB8A 1B54A 4TV5A 2ZZ6A 4HHLA 1S2VA 1GTHA 2FVMA 2A7NA 4J9JA 3KL0A 2A0NA 3TX9A 1YEYA 4A6GA 1M7XA 2PGFA 4JTGA 1K9DA 4KRTA 1TTPA 1OJXA 4JCLA 2E9LA 2JF7A 4U31A 1WV2A 4AG0A 2OU4A 3STGA 4YWIA 1NQ6A 5CGTA 5C5YA 5BXSA 1VQTA 5D02A 3ZT7A 3QTGA 5D37A 4CVWA 4IJBA 3FX4A 3DOPA 3AFBA 3RM8A 3G1DA 2E5DA 3TN6A 2GSJA 1X1NA 4LVFA 5C9UA 4CEXC 4PMDA 4AC1X 2HPMA 2XVGA 1R3SA 3PBVA 1MUMA 2Y5JA 3A64A 4X2PA 2G37A 1J5SA 1LCOA 1B3WA 1SQ7A 3BICA 4WXYA 2CLOA 3VGEA 4JTEA 1YIXA 2O55A 4WX2A 4WD0A 1SYTA 3CMJA 1FP8A 4QG6A 4N9BA 3VMNA 1B5TA 1IWPA 1QNQA 3IV8A 3TJXA 2JK2A 5DT7A 4LOCA 1HJQA 5BNKA 2BG5A 5G2WA 2YBVA 3ITGA 3F5KA 4AHQA 1YDYA 3M46A 2WJFA 4HA0A 3EKZA 5E09A 2PTDA 1XV8A 1UWAA 3SIZA 2DV0A 3FCPA 1O5QA 1XUZA 4B4HA 4Q6JA 2AL2A 5L9FA 3GDLA 5D8WA 4PR4A 3N73A 4FZIA 1CGUA 3W28A 2XVNA 2B7QA 3N04A 8A3HA 2XFFA 5TD4A 1ZU8A 2VX7A 3LA4A 5LKYA 1OK4A 4M6VA 4JKKA 3A4JA 2WSQA 3W7MA 2Y88A 5HQLA 4JTJA 5FEXA 3HPXA 4MLJA 4MF4A 2PDHA 3WSUA 1LTDA 1HFBA 4KFOA 1WDDA 3P62A 3JS3A 2PDPA 4E38A 1GPWA 2CLMA 3L0NA 4H04A 3HMJG 2P10A 1SO5A 4GXWA 1JNDA 1ADDA 1OZMA 1Q2SA 2VGGA 4JNZA 3ARYA 4YJ5A 3TP4A 4XD4A 4AX6A 5K9XA 4HK7A 3VOGA 4DNMA 2OZ0A 2XHYA 2ZIDA 3IIZA 4J3WA 1XUUA 3L68A 5H6HA 1TRDA 4Q7NA 3AS0A 1XYBA 2DZXA 3YPIA 4DPPA 5K7JA 1OFOA 3WX7A 1W1TA 2OKTA 1EB3A 4HN4A 3A13A 4X22A 4DB7A 1Q4WA 4ZO7A 4MOZA 3RNDA 3N3MA 2PDNA 5FSEC 1CXFA 2ABBA 4MUZA 3FA3A 5HPCA 1H4PA 2PF0A 2BMBA 3R89A 1TKKA 1X1OA 4LS1A 4NAEB 3Q4DA 2JKAA 2OTDA 4DBUA 5IFPA 1KCKA 5FJTA 4PODA 5AHEA 2FMOA 5HPOA 4DO6A 2V5KA 1U22A 1IEQA 4Q4OA 3RPMA 2DZUA 2X40A 5BRQA 4LWWA 4IIBA 1SMDA 3CLMA 3VCCA 1VBRA 4GINA 2E28A 2Z28A 1LLZA 3H2NA 1J18A 4KWSA 3NL5A 5DQPA 1C8XA 4Q8WA 3LCWA 3NXFA 5D9NA 3G24A 3VZZA 5I3JA 5C2GA 3ITOA 3G3MA 4NNAA 1TPEA 4MAVA 1ML1A 3BZGA 4IWWA 1M5WA 4I5RA 1W3HA 3VZXA 4HU0A 3N17A 4JCMA 2H3BA 4LYQA 4FLSA 3WMBA 3D0CA 5C9ZA 3AICA 1GG0A 1YW1A 3G2GA 3WKZA 1V6WA 2REQA 3M7WA 3QPEA 1VFOA 4IXHA 3ZJ6A 1DJQA 3SCRA 6A3HA 4JAWA 3KOYA 4AZCA 3BTNA 3WMLA 1CI1A 1W5NA 2WJZA 4CD7A 1L6YA 2QGHA 3VNJA 2HNEA 1RZMA 4ML9A 1X97A 1GOKA 2YYUA 3CIXA 3S6DA 4WKAA 3ZFHA 3IJ9A 1XRTA 1IT7A 3IS4A 1QK0A 2BWGA 3T78A 4TVCA 2X1RA 2ZXBA 3R94A 1UR9A 4IOTA 3A3HA 3I6EA 3GHTA 3K46A 4DYKA 2IW0A 4US5A 4GYKA 3KZSA 5G4HC 1OX4A 3GH4A 3UWUA 4YMZA 2FH6A 5ABFA 2H8ZA 1MZRA 4KW2A 2XFWA 4DJFC 2YYTA 4QFUA 4KEVA 3MI3A 2R14A 5HXMA 2INFA 3VNKA 4C6CA 1KCXA 3GM8A 4XAGA 1J6OA 3LQGA 4LTSA 1Y0EA 5FL1A 3G5EA 3W27A 2A7RA 2BVYA 5D2WA 2OYLA 3MBDA 1TWDA 3E3HA 2OOGA 1ZAJA 3M0HA 3ISIX 3L21A 1OFRA 4O0KA 1PHWA 1D3GA 4CNPA 4HOZA 1Q7QA 3TN3A 2J74A 4WJ8A 1YX1A 1DQWA 4XIMA 3L2IA 4B3KA 3L5MA 4BCEA 1EZ2A 3U5UA 1UD2A 1KM2A 4FNSA 1I60A 2QS8A 1S5MA 4B90A 2A85A 2VENA 3NDOA 2ZDSA 1VJIA 1ZB5A 3SUTA 4PGLA 2QEZA 2Y7EA 2VR5A 2H6RA 1ECQA 4WDTA 7ENLA 4FB7A 1QNOA 4BI7A 1NARA 4AZBA 2OT1A 2QJGA 5D33A 3ZS4A 1KFLA 1KC7A 3GS6A 1UZDA 2OKOA 2DORA 1V7AA 1R46A 3ITYA 2XZ7A 3N15A 2J78A 3ANVA 4Q8OA 3GR4A 1FWBC 4PL2A 1NSJA 4O54A 2HXUA 4YTQA 1QPNA 3HURA 4HK5A 2D69A 4XTDA 1VD6A 2AAAA 1TVPA 5LIYX 1GZGA 1POKA 4PB5A 4UB9A 4MJMA 1J01A 4UTKA 2PBOA 1SFSA 3V1HA 4DAIA 4IIDA 4GFSA 1JZ4A 2DZWA 3PFRA 1AA1B 1HNYA 2PE4A 2ACRA 3VM5A 2WOQA 1DWIM 1NOFA 3GBEA 2VFGA 2FGLA 4NNBA 4O53A 1M9HA 3D3FA 4D72A 3I68A 1DJZA 3H8AA 4UWMA 2QCDA 3GVRA 1S3TC 1UR4A 2Y8KA 3TQKA 2D24A 1CLVA 3BWWA 4JTDA 2HVOA 1MI3A 3L12A 1C8YA 1AVAA 1JZ5A 1BD0A 1U2YA 3H7VA 3SCOA 5C2CA 1QI4A 1LOQA 3MA8A 4JQAA 3IGHX 3UYCA 1E73M 3MSYA 3RITA 5JQ9A 2OODA 3CTLA 3N4FA 5LHEA 5KITA 1WUEA 3FS2A 4F2BA 5A1AA 3AZRA 3ZWTA 3CWHA 5I3KA 3THDA 4NX5A 1BTCA 2BP1A 3W1QA 2V8ZA 5AC8A 2QJHA 1GOIA 2FVKA 1TX2A 4I5UA 1WQ5A 5DY2A 3HU7A 3BMXA 2YCLA 4WLCA 5LYRA 4D6FA 2XG9A 3BGJA 3WBAA 5FF4A 4UFLA 2R1LA 3DESA 3WH9A 4DF1A 3SRFA 4MKVA 3NL6A 4B4FA 4QTGA 1R85A 1WAWA 1X1ZA 4UIOA 1H61A 3LI1A 2AAMA 4RE0A 5C9XA 1GVSA 4K2SA 3K2GA 5A3HA 5DO8A 4A3YA 4NG3A 1V3MA 4MLRA 1UWIA 2YCEA 4HMCA 4Z2GA 4GABA 3EKLA 3LY0A 1FUYA 4TTUA 1U83A 5A6MA 3THUA 3AIRA 3K13A 5A6BA 4ILSA 3FNDA 4F9DA 4GY0A 4C6PA 1ZJAA 1ZCOA 5K9DA 4C6DA 2W9MA 4S23A 3STEA 2V3DA 4GUJA 2DT3A 4DJFD 1LUCB 1QCWA 4JIQA 4JTCA 4QR6A 1JCYA 3E5PA 1MQPA 4UR8A 1RLCL 4X60A 1KD0A 1M7OA 4DBSA 1Y65A 4A2RA 7TAAA 2QHAA 2CW6A 4GJ1A 2XN1A 1QNSA 3SADA 4A8LA 4LY8A 1YHTA 1TG7A 1CENA 1AQMA 3EPMA 1EJ7L 4N6FA 3P2VA 4WSHA 3WQ5A 4WY0B 1BYAA 3N1AA 1UZ4A 2PS2A 1F76A 3WLNA 4IMEA 4Z1DA 1LF1A 1PZ3A 4Y9AA 3M0KA 1JR1A 1OGBA 3THAA 3PB0A 4FO4A 2FJUB 4AF0B 4RZBA 1EBHA 1J4EA 4GYFA 4TR9A 4XV0A 5GVJA 1OYAA 2OPJA 1VFMA 2YDRA 3ABOA 1T40A 1CTNA 1O5RA 2PDWA 5DCBA 1OFDA 1QOXA 4JBRA 1MDLA 4B5WA 3QF0A 2QDHA 1IGWA 1LBFA 1N8IA 2V67A 4XX6A 1W17A 1EHAA 4MY1A 4V33A 3JZUA 1FVPA 4LUSB 2PDGA 3KRBA 1XD0A 3A3WA 4M7TA 2W61A 4S3AA 3W02A 4HA3A 4X0VA 3PJWA 4ADTA 3RR4A 2YDAA 1FCUA 1HL2A 2WYSA 4YTUA 4RJEA 5HWNA 3FSUA 4MZ1A 4GUFA 4MDOA 2YL6A 4GNKB 4LS0A 1R3VA 5BRBA 2C6QA 1EL3A 1UC4A 3GTIA 4CQDA 2DIKA 3BVJA 3LS9A 3RXZA 1RLDA 2BB0A 1MUWA 1WNOA 3QHOA 3WEZA 2NVCA 2GYIA 3OEXA 4N9EA 3WQGA 5JBDA 4CU7A 2YCIX 1YPFA 2HCVA 3NPXA 2EAWA 2QDGA 1XGDA 1R2RA 2PRLA 4LBSA 1J79A 1LYXA 4DM1A 3WK1A 4Y7EA 3MKCA 1KNWA 2XVLA 4RNJA 5E6YA 2YLLA 1KXVA 3WBEA 2Y61A 2GDUA 2PRMA 1GZ1A 4AZ7A 3F1QA 2HPIA 3E0IA 1TJRA 4PN2A 1CLKA 3G6MA 1QNRA 1H2JA 3G1RA 4X61A 1CGYA 1FWIC 2WWCA 3W22A 1C3FA 1RH9A 4HYRA 3VYLA 2ZUSA 1H3GA 6XIMA 2GK1B 4IIHA 4MAZA 4DLFA 1E3ZA 5J04A 2FZMA 4KQNA 2JIWA 1JULA 4UQAA 2E9MA 1EJUC 1TPWA 2OCZA 3ENLA 3QHNA 1EO5A 2O4QA 3XISA 1FFQA 1G01A 1GWJA 3BUVA 4GC3A 3C56A 1OZQA 3BOLA 3H2MA 5FJUA 3BAWA 4L6OA 3V75A 4JTIA 3GXTA 1J10A 3UWZA 4IF2A 4GVIA 3G3DA 3CZLA 1PTGA 2YZRA 1EJRC 3MY9A 1E5NA 3P84A 4G7EB 4C6EA 2YL5A 4JHMA 4MB5A 3MMTA 3VGDA 3TW6A 1LLOA 2ACQA 3TW9A 1FQ0A 1B9ZA 3ZR5A 2B7PA 5M03A 2D2OA 3W84A 3C8FA 3PP7A 2F8QA 1BHGA 3GR7A 1UD6A 3WQCA 3WLLA 3VMPA 4ZQPA 2YKKA 4KIEA 3BQ6A 1PKMA 1VJZA 2PWEA 1M01A 3HN3A 1QW9A 5DCEA 3ZT6A 3GG1A 5A2CA 1YADA 4C6JA 3OIHA 1R6WA 1JD7A 1IZJA 3VOCA 5A69A 3M5ZA 1HJVA 3C2RA 1Q6CA 1ZY9A 2HQAA 1XBXA 4W93A 3LZ3A 3VD4A 3LHVA 1NWRA 4BI6A 1YXDA 3U7BA 1ELSA 4GO9A 4UBPC 1WBHA 3VK5A 3AMGA 4GK8A 4XBSA 1FH7A 3PPGA 1TO3A 1QBBA 5HINA 1W5PA 3N2XA 1ZFJA 1HVQA 4Z1YA 5D09A 2ZX7A 4E6MA 3PB2A 4KIRA 3T09A 2OWXA 3NEVA 3EWXA 5EKYA 1TMHA 2G4JA 1HZYA 2GDQA 1VYPX 1DOSA 4R34A 4O1BA 3LBCA 2DUZA 2DSKA 1PWMA