3EBVA

Crystal structure of putative chitinase a from streptomyces coelicolor.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
SLKHAVTGYWQNFNNGATVQKISDVPSAYDIIAVAFADATTTPGAVTFNLDSAGLGGYTVDQFKADVRAKQAAGKKVIISVGGEKGTVSVNSSASATNFANSVYSVMREYGFDGVDIDLENGLNPTYMTQALRALSAKAGPDMILTMAPQTIDMQSTQGGYFQTALNVKDILTVVNMQYYNSGTMLGCDGKVYAQGTVDFLTALACIQLEGGLAPSQVGLGLPASTRAAGGGYVSPSVVNAALDCLTKATNCGSFKPSKTYPDLRGAMTWSTNWDATAGNAWSNSVGAHVHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative Chitinase A from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Structural genomics, unknown function
molecule keywords Chinitase A
total genus 99
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ebvA00
1C8YA 4HA1A 2WPGA 4BCEA 1W9XA 4HP5A 2WLYA 1R86A 1V3KA 2VCCA 2ZX8A 1UH3A 1JDAA 4B9YA 5A6BD 2WK2A 1CGTA 2WBKA 1LG2A 1EXPA 2YOCA 3ARQA 5ABFB 4M82A 4UOJA 1GQLA 3MU7A 4CUCA 2GJXA 1DWIM 1V0NA 2XM1A 1H4PA 4GZIA 4B9ZA 2W92A 3A4XA 2D3LA 3AZSA 4V28A 2V3FA 1Z32X 3RJXA 3ZJ6A 5CSYA 3ARVA 2VX6A 1CPUA 4PMUA 3EBVA 1VJSA 2J7GA 2X0HA 4OKDA 2ZXBA 4A3YA 2WHKA 3L4WA 1V08A 3JUGA 1EQPA 2ZUMA 2VR4A 2G8ZA 1GOKA 1OBAA 4OOUA 1PIFA 2W66A 1JFHA 5BXRA 1E73M 3OGVA 2CKRA 3VIPA 4UOQA 4HZ7A 1E70M 1HNYA 3WNKA 4CCDA 1CLVA 1KGXA 3VGHA 1C8XA 2QMJA 3VGDA 2W5FA 3PZMA 2ZUSA 3QHNA 3CO4A 1GHSA 1CNVA 1P6WA 1E43A 1OB0A 1IV8A 1H5VA 4JAWA 2WZEA 2BS9A 1J12A 2XUCA 3WMSA 3F5JA 1R8LA 4IPLA 4M81A 2GK1B 3L4XA 5I2UA 4EKJA 3AIEA 1J18A 1UZ1A 3VTRA 4CD6A 1WZKA 3GH7A 4ML4A 2FH6A 4C7FA 1GOIA 3OIHA 4YN5A 2WZIA 4AWEA 3WH7A 1FH7A 3KZSA 3OB8A 1H3GA 4F66A 2CNCA 2VVSA 2GDUA 3WSUA 5BCAA 4UZUA 1JZ4A 5AC5A 4PRWA 1JYXA 3TTOA 1G94A 3GTNA 1E0VA 1W9DM 3NCOA 1RP9A 2WMGA 3GH4A 1NP2A 1JFXA 1GHRA 1WNOA 5E9AA 4ATLA 3ARRA 3SUUA 1I1XA 3AXXA 2WLZA 1C7SA 2JF7A 2VL4A 1XH2A 2O9PA 1QW8A 4IM4A 1J0ZA 2PF0A 3AFBA 1HJUA 1BYCA 3HMCA 2FDMA 3WH9A 1O6IA 2ZX6A 1VRXA 2WMFA 3N1AA 1OIFA 5A8MA 1XSJA 2QPUA 4QLKA 2F2HA 1UR4A 4AD4A 2W91A 1KCLA 1UKOA 2GFTA 4ACZA 1H41A 2MANA 5I0DA 2ZUWA 2XGBA 3DHUA 3WMBA 2XIBA 4QLJA 3M07A 2YKKA 5IHRA 1VFFA 2OLHA 2VZUA 1CXIA 3GM8A 1HX0A 3S2CA 1CXKA 1WO2A 3WF3A 1WPCA 1UG6A 3T0AA 1X1NA 1ZJAA 1V0MA 1Q6DA 2XFYA 4JKMA 1SMAA 1JD9A 1QI2A 1FFRA 2G4FA 3W6LA 1BPLB 1GONA 2WHLA 2D20A 1GOOA 1W3KA 4U2YA 2D24A 2XG9A 2CEQA 2ZX7A 1UQZA 5GNXA 1JYNA 1D3CA 3BLKA 3VKKA 1PX4A 1LWHA 1VB9A 1C3FA 4UR9A 4WSJA 1TG7A 4B16A 1PJ9A 4FLSA 3AISA 1E9LA 1VENA 4P8WA 3OBAA 1ISXA 4GO9A 2E9MA 4FF5A 4GKLA 1U2YA 4E8CA 4CU6A 2JEQA 2O92A 2QF8A 1XV8A 2JFEX 1B3WA 3L4ZA 1ZJBA 2J47A 3PZ9A 2EQDA 4MADA 4W8AA 3VINA 3N13A 1E1EA 4MNMA 3WD2A 1MXGA 3LMYA 4KRTA 1K6AA 4C7GA 4FK9A 2VT0A 3BMWA 3GXFA 1IT0A 1UH4A 3PHAA 3L4UA 3VIMA 4JHZA 2OSXA 3TONA 2OWCA 3PZUA 3VDAA 1JZ3A 4P8VA 5CSUA 1BG9A 1AQ0A 4LGXA 4AD3A 3TOPA 5I79A 1CECA 3AOFA 2J77A 4H04A 1XRVA 4OZOA 3MUAA 1JZ8A 4N42A 1VEOA 4HTYA 4U31A 5FL0A 3O9NA 4AZCA 2YL9A 3D3AA 1XH1A 4HZ8A 4U33A 3VIFA 3KL5A 3VX0A 1JD7A 1EH9A 4ZFMA 5A2AA 2WC4A 1WAWA 1ESWA 1SFSA 1NOUA 1TZ7A 5DT7A 2Q8XA 1W2VA 4AD2A 1BQCA 2EPLX 1OWQA 3MKKA 1B3YA 2JIEA 5A2BA 2V3EA 3CIVA 1H0GA 1XYZA 1VAHA 4MPKA 3CHDA 1B31A 3VNZA 3AZRA 3LPGA 2EPOA 3AICA 4DWSA 1GUVA 1HJVA 3OGRA 3WBAA 1DWHM 4DM2A 4UNIA 4TVDA 5CQ1A 1MFUA 1KXHA 1CDGA 1PIGA 2X0YA 2J78A 1E4MM 2OYLA 2WZHA 1RD6A 1J01A 4B3KA 2VMFA 3SCOA 1PAMA 1KBBA 3AHVA 1OGBA 2PI6A 4H7VA 4CCEA 3O2LA 4GXPA 3WDRA 4NI3A 1LL4A 1E6SM 2DSWA 2WKGA 3I3EA 4H8UA 1EHAA 2QLYA 1UD8A 3LPOA 4FMVA 1HVXA 2QMKA 5BXSA 2NT1A 2WVUA 1FH9A 2CIPA 1E1FA 1ZL1A 4AD1A 4U2ZA 1CENA 1NP0A 1UD4A 3RM8A 1KXVA 3AXIA 2VVNA 4CD4A 1E3ZA 2EPKX 1MW2A 2W61A 4PMXA 3WKZA 4UFHA 3FXYA 3AMDA 3FHAA 3RM4A 4H2CA 4BS0A 2D0GA 4L4PA 1XD1A 3WUFA 4PTXA 2DSUA 4ZENA 1DWJM 4CN4A 2X05A 4IPNB 1ITCA 1H1NA 4PUEA 6A3HA 3WF0A 3T2OA 3WD3A 2D23A 5E0CA 1U30A 3U7VA 2YBUA 3SCSA 1TR1A 1SR0A 4CD8A 3CZJA 4KRUA 3VGBA 3W4RA 1VF8A 2D3NA 5HDRA 4TVCA 3ZO9A 4CVWA 2XWDA 3AS2A 2J7EA 4TOQA 2VURA 4FLQA 2ZX5A 4DWSD 3U57A 2DH2A 4AMCA 3N12A 3WELA 4S3JA 1C7TA 5EBAA 3A4AA 1V0LA 4GIAA 2PBGA 3ZSSA 1PZ3A 3AIUA 3GNRA 1UWRA 3SCRA 3SUWA 3ZQ9A 2B31A 3MUY1 3MUZ1 2QV4A 4EK7A 1WB0A 7CGTA 4JFVA 5A6JA 4MB1A 3UR7A 1L0PA 2A3AA 1YHTA 4BF7A 3AS0A 4OJYA 3WD4A 3RPMA 5GQBA 2DT0A 3VU2A 3VD5A 5GNZA 4F8XA 4QCEA 3VDCA 2VCAA 1B90A 1QI3A 5D8WA 3WDIA 3CUGA 4D6CA 5D9NA 1BYBA 3QGVA 4HOZA 3RDKA 4WKHA 1QI5A 1Y7VA 5CLTA 1HP5A 3UETA 4D6JA 3VMNA 3VILA 1TVPA 3WUBA 3ALGA 4CVUA 5A6AA 3ZT7A 5IFTA 5E09A 4X0VA 3CTTA 1QNRA 2ZXQA 1R7AA 1FA2A 1HP4A 3AIRA 4UQ9A 2Y5EA 3HJEA 1WDSA 2IXVA 1H2JA 1BVZA 4W89A 2J7FA 3AHXA 3SCTA 4ZE4A 3WD1A 2CYGA 3VD7A 2VR5A 4PMDA 1LWJA 2PC8A 1C92A 3SEPA 4TX6A 4PCSA 4XB3A 1LLOA 2IXUA 3NJ3A 1J0KA 2D0HA 1KB3A 1IZKA 3ARPA 4AW7A 1E15A 2QPSA 4W88A 1DWAM 3CZEA 2ZUVA 3EDDA 4OOZA 1KWKA 2C8NA 2WYSA 3WF2A 3AIBA 3ARWA 2X2YA 1RP8A 4RL3A 2PB1A 1GVIA 3M7SA 4K68A 3W24A 1B3VA 4N0RA 4IUGA 2J8GA 4MTVA 4HOXA 4ZXLA 1Q6EA 3ARZA 1XHGA 4R27A 3WBEA 4W84A 5F7UA 4U5IA 3K8LA 3SIMA 5C8BB 1ISYA 1GVYA 3L2MA 5C71A 5BXTA 1E4IA 3G6LA 2VX7A 1CXEA 1FP9A 1V3MA 3WNPA 5HOSA 2DSKA 1J0IA 2CBJA 2J79A 2JALA 4DWSC 5A6MA 5I3DA 1CGVA 1NWTA 4M8UA 3A4WA 5D9OA 1BSIA 4AZ7A 2WNWA 2VZOA 4PBGA 1H09A 1XH0A 1ZBVA 4W7UA 2VQUA 1FH8A 4W5ZA 2WBGA 2G3JA 1B3XA 4EAMA 1PBGA 1R87A 3DYPA 2VRJA 4ATWA 5ABEA 3POCA 4WJXA 2PWFA 3PN8A 5CLWA 4MJ4A 4UQEA 4W7WA 4UQDA 3I3BA 3U7BA 3VGFA 3ZM8A 2VC9A 4HMEA 1W9BM 3N18A 3AI0A 2AMGA 4Y7EA 1JG9A 4CU7A 2J75A 1A3HA 5CGMA 1QVBA 1BYAA 4QLLA 3W28A 1QHOA 4QP0A 1GW1A 3TA9A 2YLLA 1QNQA 2A3BA 1ZS2A 2VX5A 1UD5A 1UHVA 4JL2A 3SCQA 3AS1A 2UY5A 4PYSA 4ACZB 2BXYA 2XYLA 1WKYA 1UZ4A 3IJ7A 2Y8VA 3ZMRA 4JIEA 2UY3A 1J0JA 1G5AA 1R7OA 3GZAA 5M17A 2ZX9A 3FN9A 1B1YA 5CPSA 4XZBA 4LYPA 3WEMA 1MQPA 3AIWA 3RIKA 1TVNA 1EDQA 4MAZA 1VEPA 4W7VA 4IISA 1JNDA 3O6AA 3IAPA 1MW1A 4ATDA 4LQ1A 2XHYA 1UWIA 3K4AA 4HPHA 5TD4A 5A1AA 2GK1A 2GJPA 4TUFA 2CBIA 3AS3A 4CU8A 1V3HA 1UKQA 2EPMX 5GPRA 3VD4A 2DH3A 3MV01 1QI0A 2E3ZA 4AXNA 3GBDA 4GQRA 1OT2A 3RJYA 1IZJA 3OLGA 3FNDA 1WE5A 4GI6A 1CTNA 2J8FA 2WAGA 2WB5A 4YHEA 1V02E 2E8YA 6CGTA 2E4TA 3PZTA 4PUDA 1W9PA 3WDQA 4TXEA 3BCDA 3CH9A 1KQYA 4D6EA 2CPUA 3N11A 3PZIA 4OUEA 4LYRA 1UKPA 1WZLA 3VD9A 3THDA 3CMJA 2EBNA 1CGWA 4PMQA 1G1YA 3DYOA 2DDXA 5KZ6A 4LYQA 1GOQA 5E70A 1CIUA 4Z2KA 1BTCA 4AYSA 1V6VA 3A3HA 4BQ4A 1US2A 1W91A 2Z1KA 4JCLA 1O7AA 1FP8A 5IFPA 2CXGA 2OYMA 3UG4A 1JXJA 1NOFA 5I78A 3F5LA 4BQ5A 3APGA 2FGLA 4MDOA 3OLEA 1ZB5A 2GJXB 1KGWA 1E6QM 3VDBA 4UFLA 3AHYA 1W3HA 2YBTA 2ZUNA 3CHCA 3WNMA 2AAAA 5M03A 3NDYA 2NSXA 4W93A 7TAAA 2XFRA 5EFDA 3K4DA 5DEZA 1AQHA 3LPFA 1BVNP 3VD3A 1SYTA 2FGZA 4UFMA 1TCMA 3KL3A 3UR8A 1HL8A 3DHPA 5IDIA 4QDMA 1K9EA 1MQRA 1VFOA 2PWDA 4NF7A 1FOBA 3POHA 4PMRA 5ABFA 1JXKA 5CPQA 2WMKA 3ZR6A 1W1TA 2CITA 2YL6A 1HXJA 3CUHA 5D9MA 3F4VA 1M7XA 2XPKA 4AD5A 1JZ5A 3OLDA 3QOMA 2WW5A 1XCXA 1FHLA 3IAQA 3AJ7A 1UR9A 5FCZA 3WNLA 2GDVA 5AC4A 4M24A 5ECUA 2WSKA 5CJ5A 4CCCA 2WWCA 3BH4A 1M03A 1CXFA 3AMGA 1NWRA 4GZJA 5DT5A 1MW3A 3WL0A 2EXOA 5A8PA 1UA3A 1XC6A 4LX4A 3MSDA 4J7RA 5D4YA 3ARUA 2WANA 4J3WA 1GOMA 2WMHA 4HA4A 1XSIA 4DUXA 5HPCA 2A3EA 2V5DA 2Y8KA 4KGLA 2X09A 4R5EA 4LXFA 1E0WA 3EDJA 1JZ2A 1V3IA 3W37A 2BY3A 3PZNA 1WDRA 9CGTA 3MO4A 1BFNA 1E4LA 1CZ1A 5I23A 2WWDA 2YIHA 1S46A 3E1F1 4Q22A 5BRPA 3AMCA 3B8SA 5FIPA 3BXWA 2D0FA 2XGIA 1TA3A 4TVUA 1C91A 1C8QA 3WY1A 3WDPP 1C93A 3W25A 1GPFA 3NSXA 1UR2A 3N9KA 5LYRA 3UESA 3W26A 1EO7A 1UWTA 1L8NA 1CBGA 3WUGA 2EPNA 3NYDA 1QNPA 4AC1X 1E3XA 5E0FA 3HN3A 1UA7A 3WNNA 2OSWA 1W9UA 4W86A 3W53A 2Z1SA 3U5UA 4FLRA 5BYWA 4QAWA 1BLIA 3T2QA 3WN6A 3BAIA 5M5DA 1QPKA 1C90A 3B9DA 3SCPA 1U33A 1KBKA 3QHOA 2RGMA 5CZKA 4D72A 2VUYA 1GQJA 3GBEA 3OZOA 1B2YA 1W3JA 4P8UA 2YA0A 4MB5A 4GQQA 1VJZA 3CHEA 2V3GA 1E72M 3WIJA 3ALFA 2E8ZA 2IUZA 4J3XA 3L4YA 1W1PA 1BHGA 1UUQA 3IJ9A 2FHBA 3PTMA 2YL8A 1V02A 4PEEA 1ZBWA 3FAWA 1FHDA 3ZOAA 4HZ6A 3PBGA 4H8VA 2WC3A 3T0DA 2YA2A 3SCUA 4J28A 4TTUA 4HMCA 4W8LA 3BSHA 7A3HA 3CZGA 5JBDA 1X6LA 3GNPA 3K8MA 3WUEA 2BVYA 4WIWA 2PWHA 4W85A 2VX4A 4ZXOA 2WCGA 4AIOA 2WVSA 4JFTA 5CXPA 4M80A 4TX8A 4AIEA 2BVTA 1V6YA 2QHAA 1JZ7A 2TAAA 3A6OA 1AVAA 2DQXA 1DHKA 3TTYA 2VQTA 3W81A 1HJWA 2NT0A 3TP4A 4Z2HA 4CKQA 1N82A 3WEZA 1JGIA 3AYRA 3F5KA 3VM5A 1ZU8A 4JL1A 2BY0A 1UR1A 3VO0A 2DSZA 2F8QA 2YJQA 3TTQA 3BAYA 4AZBA 1M53A 3GXIA 2OYKA 5ABGA 2UY4A 3WL1A 4FLOA 5A6LA 2GJRA 4ZEPA 4MDPA 4Z2JA 4AD0A 2G3MA 1EOKA 2GUYA 4PSPA 1TUXA 4AEEA 3WDHA 1QNSA 1JL8A 2CETA 2OSYA 3MUIA 3MSGA 2V38A 3RMEA 3WQVA 2XJ7A 1US3A 1UH2A 2CBVA 3THCA 3U5YA 1G0CA 3M6DA 4MNLA 2FHFA 2YL5A 5DF0A 1V3JA 1MW0A 2WVTA 2VTFA 4GO8A 5IHSA 3WFLA 1ODZA 2ZXDA 5HNNA 3W29A 3ARTA 1E71M 2J4GA 3CUIA 3NSMA 1ECEA 1LG1A 5HPOA 1NWUA 5EFFA 1JYWA 3KEHA 4UFIA 1NH6A 1PEZA 2CBUA 5DMYA 2BNJA 1NM9A 3BLPX 1W1YA 4GI9A 3RO8A 4H8HA 4CGTA 4UCFA 2DGAA 1UKSA 4U5KA 2D1ZA 1KGUA 4P7RA 1LL7A 5EB8A 1HKMA 2XWEA 2JF6A 2DEPA 4OBSA 1FFQA 1TA3B 1UD6A 5FD0A 4MB4A 2DSVA 1KR1A 2XIIA 2O9RA 1WDPA 4D6IA 3MANA 2AOSA 1CXHA 1OT1A 3VOCA 4JKKA 4RE2A 3QHMA 4UZSA 1XSKA 3OZPA 1KXQA 1UWUA 3L4TA 5GNYA 2WHJA 3G6MA 3T08A 2ZE0A 1I75A 1BYDA 3VPLA 4GPNA 3NSNA 1SMDA 1HVQA 1EO5A 1JF6A 3II1A 3MMUA 1J10A 2A3CA 4MNJA 3L2LA 4WKFA 3UG3A 4ZE5A 3WNOA 4QFUA 1EDGA 1PX3A 1WDQA 3DC0A 5LA1A 2EJ1A 1PX8A 2VNCA 4GINA 1D2KA 4BQ2A 5E6ZA 4CN6A 5A6SA 2PWGA 2E9BA 3WQ8A 3CBWA 4HPGA 1H0IA 3WD0A 1E6XM 3AHTA 1WZAA 1ISWA 4CN1A 1B0IA 3EDEA 4P7QA 2W62A 1CLXA 3WDJA 3VIKA 4UFKA 1E4NA 4Q7NA 5I24A 1HJXA 3UG5A 2ZICA 1HKKA 5A69A 1E0XA 5A95A 4XUYA 4AZGA 3CZKA 2VCBA 1UQYA 1X6NA 3PZQA 4W5UA 3CUJA 1LQ0A 3PTQA 1HF6A 1KWGA 3VIOA 1QNOA 2BVDA 3VIHA 4A3HA 1R85A 4J3SA 4X9YA 1HJSA 1E56A 1VFMA 1MWOA 1OD0A 3WENA 4PSRA 4WKAA 4XZWA 1QW9A 4U3CA 4TTGA 3NUKA 4MAVA 1GJWA 1MYRA 4F9DA 4NZCA 1V0KA 3W6MA 4NSBA 2DIJA 4F9JA 3VMPA 4MB3A 4P8XA 1E55A 1EOMA 2Y24A 1E6PA 1MXDA 1VBRA 1KQZA 4KMQA 5CGTA 1KXTA 1CGXA 4J3UA 4D6DA 5FKYA 5DO8A 4L4OA 2ZWYA 2XSAA 4UOZA 2BV9A 3FAXA 3FY1A 3WEOA 1F4AA 3WQ6A 3WH8A 3NDZA 5FOOA 1EGZA 1JI1A 1EA9C 1LF1A 3VMOA 4JZ5A 2J7HA 1PPIA 2VZTA 3VIJA 4LPCA 1JNEA 1CXLA 1K9DA 1E6ZA 2XM2A 4NRRA 4GI8A 3GDBA 2YDRA 4E8DA 5IXEA 1JAEA 4PN2A 4URIA 3BGAA 3T09A 1EDTA 4KH2A 4YPJA 3TTSA 2XSBA 1HKJA 3RM9A 3BAJA 4AZHA 3GH5A 3BSGA 1ODUA 2WHMA 4CD7A 3ZJ8A 4J3VA 1DEDA 2WMJA 1TFVA 5A6KA 1GZJA 3BAXA 1OGGA 3MS8A 3WMCA 4P7LA 3GXMA 4HOWA 1KR0A 4B15A 5LA0A 2G41A 1UWSA 2WVVB 2BHYA 2F61A 5JUVA 1WP6A 3ZSTA 3BAWA 1H49A 2JE8A 4M56A 3VNYA 3GXDA 4UQCA 1NQ6A 4D6FA 2OWXA 1OGSA 3L4VA 3KWXA 1JZ6A 4AZ5A 5C70A 5BWFA 1GJUA 1JAKA 1Q6FA 2WKLA 3WQ4A 1NOWA 3D5HA 3ZT6A 1ZBKA 2XVPA 4GZEA 4JFUA 3EMZA 1B30A 1DP0A 1LL6A 1D7FA 2YDQA 4WSKA 4P7NA 3AYSA 1J9YA 1XYFA 1JYVA 4D71A 4JHOA 5EMYA 4D6GA 3T0BA 1OD8A 4A4AA 3AIVA 3ZJ7A 3WQWA 2PBOA 2WCAA 1Q4NX 1E5NA 2BFGA 4YHGA 1ISZA 1GQKA 3WH6A 4KGJA 1K9FA 2E9LA 3RILA 1JF5A 1F4HA 4CD5A 4EE9A 4DUVA 5FL1A 3NIYA 3VGGA 3WFZA 5BROA 4C7DA 1OIMA 2HVMA 3W82A 4E4PA 3I3DA 2O9OA 1BAGA 1XGZA 1V6WA 4PTMA 1MVYA 3BCFA 1AQMA 4PTVA 2EEXA 2X1IA 2V3DA 5AYIA 4DM1A 3CLWA 2VJXA 2E0PA 2WVVA 5AYBA 1H11A 4U3AA 4PTWA 3SUVA 1QHZA 4M1RA 1EQCA 3KL0A 1TMQA 3MMWA 4D1JA 1V6UA 3ECQA 3SUTA 1CGUA 3WF4A 4V27A 2CCRA 4HU8A 1DWGM 2OWWA 3WQ5A 3ARSA 4PMOA 2X8RA 2UY2A 1TE1A 4V2XA 4XV0A 3FHQA 5KEZA 4Z2LA 1W3LA 5A8NA 3B9EA 1JDDA 3VIIA 1QI4A 5JIPA 5A2CA 8CGTA 1VBUA 2FHCA 3CMGA 2WC7A 4W8BA 2CHNA 4EANA 1DTUA 3EYPA 4BZYA 4F79A 3WH5A 5CPTA 2A3HA 1NARA 2O9TA 1PZ2A 1ITXA 5I5RA 4HA3A 2J74A 2DT3A 1EIBA 1GNXA 1NWSA 3CUFA 1K9TA 2PWEA 4AY1A 2BHUA 2CHOA 3IK2A 2JEPA 3VIGA 3ARXA 2VRKA 1A47A 4D1IA 4KWUA 1W32A 1GOWA 4S3KA 1G01A 3OLIA 5A3HA 3W38A 4RE3A 3OGSA 1LJYA 3AMKA 4ACYA 2NW0A 4HU0A 5E6YA 3VX1A 5I6SA 3UEQA 1V3LA 2C0HA 2VOTA 2WCSA 1BG4A 1CYGA 2J7DA 3SURA 3AROA 4JFWA 3K8KA 1V03A 5A8OA 4BA0A 3SUSA 3EDKA 1WZMA 3VVGA 2YA1A 4QCFA 3GYCA 4HMDA 3W27A 4DUWA 3N15A 3SCWA 4AZ6A 2ZIDA 3DYMA 3J7HA 3ARYA 1QBAA 2G3NA 3A47A 2CKSA 6TAAA 1J0HA 2DPEA 5HXMA 1CWYA 1CEOA 2BY1A 1ISVA 1CGYA 2DIEA 1B9ZA 3EMQA 2J25A 1KFWA 3OA5A 1UD3A 1OM0A 3T2PA 1XD0A 3PZOA 1HKIA 2YDSA 1QBBA 1JDCA 1J11A 2ZXAA 3OG2A 4AIUA 3EDFA 1OINA 2ESCA 1BGGA 2ZOXA 2VI0A 3ZIZA 1HJQA 1MQQA 3ZR5A 2W67A 4M29A 1M01A 3HU7A 3LPPA 1BGAA 1Q6GA 3SCNA 2WMIA 5CG0A 4WF7A 1UD2A 2GVYA 3EMCA 3N04A 4XX6A 4MJ2A 1UR8A 4AZIA 4PMYA 2C7FA 2WM0A 2WSPA 1VEMA 4OIFA 4AEFA 4X0NA 5JBFA 1I1WA 3AIQA 3SCVA 2VZSA 4PMZA 1JIBA 2ZWZA 3MV11 3W0KA 5JBEA 2D2OA 5LA2A 3VDHA 1UR0A 1HT6A 3CZ8A 1AMYA 1RPKA 1JI2A 1GCYA 1GQIA 1KCKA 3AHZA 2Y2WA 4OBRA 4UTFA 1W1VA 4WK9A 2YLAA 3ZJKA 3AQUA 4MNKA 1GORA 1G9HA 3M46A 1HN1A 1QOXA 1UWQA 3IJ8A 3QR3A 2HISA 3CGTA 3GNOA 1V6XA 4J3TA 4P7OA 1RH9A 2VO5A 4UFJA 2DT2A 2ZUTA 2BY2A 2JIWA 2WMIB 4H41A 1XCWA 3UCQA 1MFVA 2FH8A 2RGLA 4Z2GA 2J7BA 5BRQA 2XVGA 2VZVA 1DWFM 3VUPA 1OCQA 4JCMA 5A6BA 1OSEA 4AISA 2XVLA 5A94A 1WCGA 1E5JA 3AMLA 4E2OA 5I77A 3RCNA 5JIWA 1UOKA 2DT1A 1QHPA 2ZUUA 1YQ2A 2VRQA 4J27A 3VM7A 3FW6A 2J7CA 3AZTA 1UKTA 3CHFA 1W9VA 2E40A 5D8ZA 1HL9A 2J62A 3S6TA 8A3HA 5BXPA 3WF1A 5DFAA 3IANA 3MMDA 3QOKA 2WXDM 1E6NA 4Z2IA 3K1DA 4W87A 2UWFA 2CERA 5M3WA 1M04A 3PZVA 5D9PA 1Q6CA 1W2PA 1E40A 3BC9A 3CZLA 2V5CA 4UQAA 4WLCA 5ABHA 3PZGA 3PTKA 4D6HA 4PMVA 5AY7A 2GSJA 1B3ZA 1BF2A 1UYQA 2CESA 2XTKA 3CPUA 4PMNA 3B9AA 3VGEA 2XFFA 3ZT5A 2W63A 5A8QA 4JKLA 1HIZA 3AXHA 1E6RA 1ZBCA 4DWSB 1EHNA 2BHZA 2G3IA 3N17A 2W4XA 4AZCB 2BXZA 2EO7A 4RE4A 1VFUA 2D22A 3BAKA 3KE0A 4BQ3A 4JFSA 3BMVA 5HBFA 1J0YA 3DECA 4B3LA 3K46A 4PCTA 2XVKA 3UERA 4NRSA 1VIWA 4UQBA 2XVNA 2Y4SA
chains in the Genus database with same CATH superfamily
3ITYA 2WPGA 3BK0A 4HP5A 4QQ3A 3CMFA 3W7NA 2VCCA 1EJSC 1UH3A 3UXAA 4PR4A 1Q63A 2YOCA 3EWUA 3ARQA 4UOJA 3EOUA 3G77A 1XKYA 2GJXA 3BE7A 1ZNNA 3BPWA 3TAOA 2W92A 2D3LA 2E09A 4DHGA 2V3FA 3BCJA 4I8YA 4QX4A 5G2HA 4LAUA 3ARVA 1D7KA 2OEMA 5F2MA 1J6PA 1RAKA 4S3EA 3REQB 3RRXA 1WAUA 2PP3A 3GXTA 3LZ3A 4GQGA 2J7GA 3R2GA 4OKDA 1XFBA 1LQAA 4Q8NA 4PUWA 4ZFCA 1UIPA 3A5FA 1XL9A 1A4LA 3P60A 4Y2WA 4Y9AA 2EAWA 3JUGA 2ZUMA 2VR4A 2G8ZA 2PRLA 4NZ4A 1XLFA 4GKTA 4O8RA 4HZ7A 3V5FA 1HNYA 1CLVA 1J93A 1KGXA 1KFCA 3N2TA 3PSWA 3VGHA 2QMJA 2HBVA 3VGDA 4BJHA 2W5FA 2QXWA 1ZAJA 2QZRA 5I06A 3LBCA 1CNVA 4JQ2A 4Q4QA 4YU1A 4XKYA 1H5VA 1ITUA 2Z0IA 1VFLA 2BS9A 3GHTA 1BXCA 3WMSA 3VFLA 3BV7A 4M81A 3AWOA 4IPLA 1P1MA 1H51A 4S23A 4LUJA 1KFLA 4F3HA 3RAOA 3FKKA 3AIEA 4EKJA 2EF9A 3W1LA 3TWBA 1Q4WA 2FH6A 2VDIA 2P3ZA 3OIHA 3KZSA 3L0NA 2NSOA 2CNCA 4LUIA 2GVGA 2GDUA 1SJDA 3MP5A 3PULA 4XBKA 4HHMA 5AC5A 4PRWA 1E0TA 4C1NB 1JYXA 2BOGX 3NQBA 1E0VA 3QKEA 2WMGA 2GDQA 3O07A 4JQAA 3PP7A 5C0QA 4L64A 2GLKA 3ARRA 3U4FA 4PB5A 4O16A 4O10A 5GVJA 1I6NA 2JF7A 1IIGA 1KTBA 3AFBA 3QN3A 4IP5A 3OIXA 3CO8A 4MY8A 1VRXA 5F1VA 3W7MA 4H9TA 2W91A 5C6MA 1UKOA 5K3VA 3LV5A 4US5A 4ACZA 2PFHA 5I0DA 3E3HA 4WEVX 3WMBA 5IHRA 3VNMA 2OLHA 4XVDA 1S5MA 1L6WA 1CXIA 5CBJA 2OB3A 2A3LA 1UG6A 1GWJA 3PANA 3BARA 2XFYA 1JD9A 3VE9A 2G4FA 3W6LA 2CEQA 2ZX7A 3VZYA 2XN1A 4ZO6A 1Q2SA 1I2OA 2PGWA 1FHVA 2XIJA 4LEFA 3UWUA 1A5KC 1AMKA 5FACA 1PJ9A 1E9LA 4IXHA 4CNTA 1ISXA 3KBJA 4GO9A 3HFYA 5DY3A 2FZDA 1U2YA 2DV0A 2JEQA 2O92A 2QF8A 1IEVA 3LYEA 3VOJA 3QTGA 1B3WA 2EQDA 3WK2A 4GQBA 4W8AA 3VINA 2RDTA 2REQB 4H6EA 1TWZA 2BOFX 1XDLA 4Q6JA 1A5NC 1J6OA 1TX2A 3L4UA 3IIPA 2OSXA 1DJNA 3TVAA 1JZ3A 1SFTA 1WXJA 2J8TA 1XCFA 5CSUA 3VOIA 1AQ0A 4LGXA 1P0NA 3TOPA 5I79A 1UJPA 3OVRA 2J77A 1XRVA 1CB2A 1V93A 4U4MA 4RDWA 1NF7A 5I3JA 3MUAA 1JZ8A 4N42A 4ROPA 3FX4A 3BMXA 1XH1A 1DQUA 1FWWA 4N4QA 3BJSA 1WAWA 1YDVA 2EGZA 4AH7A 4GUJA 4HTBA 4LOCA 2I9EA 1BTMA 3MKKA 1TPDA 3CS2A 3IV8A 3W2UA 5FJOA 1TPC1 3A4JA 4C5YA 3LPGA 3EPOA 3WBAA 1DWHM 5GJMA 4DM2A 4UNIA 3SRHA 3UCCA 3SDOA 1FDYA 2VD9A 2X0YA 2OYLA 4TQTA 3H2EA 4UMCA 1C29A 1J01A 3MCMA 1KBBA 1Q7ZA 4HCHA 4HSOA 3URNA 1SO6A 3V1PA 3UBPC 1I2RA 3NQ8A 2QGHA 5LGZA 4LT9A 4GXPA 3WDRA 1S2VA 4LAKA 1S2AA 1E1FA 3EB2A 4UR7A 3HURA 1NP0A 3V75A 2XIMA 3OPSA 4ZQMA 2FB3A 3S3GA 3O06A 4XAZA 2VVNA 4NP7A 4MYAA 3WKZA 4UFHA 4INFA 3A22A 1BWVA 1P0DA 4D2JA 4QJ1A 1YDYA 1XD1A 1FWBC 1TTJA 3LMZA 3W9ZA 4ZENA 2BX7A 1CI1A 4PULA 1ITCA 1H1NA 3W85A 3R94A 4PFMA 4PUEA 6A3HA 5ECVA 3W01A 3KTCA 1U30A 2YBUA 2V8ZA 4AF0A 3SCSA 1TR1A 1IYXA 4LU0A 3CZJA 2VENA 4CD8A 3VGBA 5E0KA 4MLRA 4CVWA 3T8LA 2XWDA 3K4WA 3AS2A 2J7EA 2ZZ3A 3M5ZA 3G0XA 2PE4A 1U1HA 4H1ZA 1XGEA 3ITVA 3P80A 4KIEA 1DHPA 3MHGA 3AYVA 2DW6A 3WCZA 4NX5A 1DVJA 1OK4A 3PY2A 4RZBA 3OHMB 4LUTA 4J4KA 1L0PA 2A21A 1XLJA 4Y96A 1R2SA 2QDEA 4IPIA 3M0JA 3FGCB 4BF7A 3AS0A 2NXIA 2D73A 2DT0A 3VU2A 5GNZA 1QATA 4MZ8A 1B90A 3WDIA 2WNQA 4D6CA 1ADDA 3NVDA 5FF3A 5EY5A 3QGVA 3GDKA 4WKHA 3Q45A 3FSUA 2VYOA 1R3YA 4LUTB 4YTSA 3W3OA 3WUBA 4Z08A 1PL9A 1QNRA 2ZXQA 4DF0A 3GFZA 1KFEA 2ZZ5A 1HP4A 1XQKA 4UQ9A 3FOKA 4ERGA 3W1AA 2ZZ2A 4Q4PA 2J7FA 3PF3A 2FTWA 3BDKA 1F74A 2QCLA 3OQEA 4ZE4A 2EG8A 1XIEA 4H9VA 3ITGA 1NELA 3ZVHA 2B7OA 4TX6A 4PCSA 2G37A 3NJ3A 1TQXA 2D0HA 3NQ2A 1C9DA 2ZC1A 2QPSA 4RW5A 4W88A 3C0LA 1X8FA 3CZEA 5I00A 1L2QA 5FJTA 2POZA 4LF1A 4RPQA 3WF2A 3ARWA 1YPIA 1RP8A 3T1GA 4RL3A 2PB1A 5DCBA 2BOEX 1GVIA 2QPXA 4K68A 2I17A 7PTDA 3TMQA 3BG5A 3NPWA 3ARZA 4W84A 3B0XA 1SSDA 2WSQA 3SIMA 4HYVA 4JHMA 1XLBA 4LY4A 1ISYA 1FHUA 1JVNA 1GVYA 5C71A 1E4IA 3G6LA 2VX7A 1CXEA 1C8VA 1V3MA 3A21A 4B5NA 3WNPA 2DSKA 1IHIA 2JALA 2OO0A 4DN1A 3NZGA 4DI8A 4AZ7A 1R6WA 3PFMA 3WYZA 2WV8A 5AB3A 4DBUA 1FH8A 4ILSA 3FA4A 1PB0A 2G3JA 4MLJA 3T44A 1PBGA 1DQXA 3P67A 4AWTA 3LXBA 3POCA 3LRLA 1B57A 4PBFA 4MJ4A 1VGAA 4UQDA 2QJHA 1EUAA 3OP2A 2BGNE 3PM6A 1JG9A 3MA8A 4LV9A 3QVQA 3B0VC 4QLLA 3ZWTA 2YLLA 3S5SA 1H61A 3KDOA 5CC7A 4JTEA 1ZS2A 2VX5A 3LCLA 1UHVA 3CB8A 1PKYA 4JTLA 2BXYA 5HANA 3GG8A 1WKYA 3BW2A 4UTMA 3LU2A 5M17A 4DJDA 4H3DA 3FN9A 1TPB1 3B05A 3MBFA 1XLDA 4OT7A 3BZGA 3WEMA 1JCLA 2PDPA 4YTRA 1MQPA 3DX5A 2WKJA 3AIWA 3MPGA 1EDQA 2NVDA 1KRAC 4IISA 4PTNA 4H6RA 4NZJA 1JNDA 2XSXA 3O6AA 1L6FA 4ATDA 4LQ1A 2XHYA 3K1GA 4ZTXA 3FYPA 1F5ZA 4ADTA 5TD4A 1A0EA 2GJPA 4IWWA 2BMBA 1UKQA 1KM6A 5GPRA 2DH3A 3CYVA 2NX9A 1U5VA 1T8XA 3M0KA 1GKPA 2DVUA 4GQRA 4J2MA 1NTHA 3RJYA 1IZJA 1N55A 3FNDA 1CTNA 3BVJA 1H7WA 3JZUA 1OHLA 1ZALA 3M41A 2GPTA 3GTIA 3GDRA 4FOJA 4PUDA 3SFWA 1IWPA 4TXEA 3R43A 3VKBA 3AO0A 3K5XA 3H7VA 4D6EA 2CPUA 4EACA 2FVMA 4EOUA 4A35A 4XQ6A 3THDA 4MKVA 2JKAA 3IV3A 3S1XA 3NO1A 4Z2KA 2I9UA 4AYSA 2GZXA 1W91A 2GGGA 3GKAA 4WJ8A 1O7AA 4DVOA 2OYMA 4GBDA 3NQFA 4DBDA 3PAOA 2P53A 4BQ5A 3DFSA 1KFJA 4PUNA 3T78A 2DJLA 3NL2A 4A05A 3CL6A 4DIAA 3AHYA 1V79A 2YBTA 4N7QA 1TWSA 4O19A 2AAAA 3QPYA 4I6VA 1DJHA 2HRWA 1R38A 4ZCWA 4ZOBA 2FGZA 3AUOA 1MUWA 1NVMA 4NJGA 2B7QA 5EYWA 1K9EA 1QMLA 3RR4A 2PWDA 4XISA 1DJYA 1FOBA 3CH0A 1KCZA 2BZNA 1JXKA 5ABFA 2H9AB 3A13A 4GVIA 5D9MA 4AD5A 4B92A 2PS2A 2WW5A 2RDXA 1FCQA 1K03A 4WXZA 1FHLA 3IAQA 4GZ7A 3AJ7A 1A50A 1SQ7A 3WNLA 5C2XA 3WQOA 4M24A 2YZ5A 1L6GA 3NGJA 1K4GA 5D03A 2WWCA 1M03A 3S1WA 3GAYA 2V63A 1EZ2A 5DT5A 1JDFA 2QJMA 3GVGA 5A8PA 5LHFA 4KWVA 4JPGA 4GGHA 1RZMA 3G0UA 3A9IA 1GOMA 3ARUA 3TUUA 4DUXA 2A3EA 2V5DA 2C14A 3W73A 2PDXA 2Y8KA 2J6XA 4HNTA 3SQSA 4HIBA 1E1CB 3NXLA 3M5YA 3P7YA 3S6OA 1Y0EA 3HGRA 5AECA 1WDRA 4NILA 1VS1A 2YIHA 1FX6A 5BRPA 3CQIA 3B8SA 3LGGA 1UROA 3ZZ1A 3DH7A 3GG0A 4R85A 3VNDA 1WXYA 4N9EA 4Y6GA 3U0HA 1GPFA 3NSXA 3OBEA 3W26A 3I7QA 1L8NA 3UVAA 4KKXA 1VHNA 3NA8A 2FZ9A 1QNPA 1E3XA 3T4WA 2DVXA 4AHQA 3IEBA 3WNNA 1X97A 2FZNA 2SFPA 4FNUA 3W53A 2Z1SA 3U5UA 4QAWA 3BLIA 4Y8EA 3BAIA 3SCPA 4CQ9A 2PDMA 1KBKA 2RGMA 3S1VA 1UR3M 1VBHA 3P61A 1WYIA 1GQJA 1TPEA 3GBEA 1OC7A 3OZOA 1MSSA 2BSLA 5AHIA 3L2IA 1VJZA 1XRSA 4LV4A 3P84A 5BOFA 5F2LA 2VFIA 3T05A 1O94A 5HMSA 1P43A 3PTMA 2FHBA 5BZAA 1V02A 1E51A 3FAWA 1FHDA 4HZ6A 3ZVHB 2WC3A 1GT8A 2QCEA 2YA2A 3QPEA 4IIEA 5F4WA 4J28A 2V6AA 2DY3A 4NU7A 2CLFA 2ZZ1A 1EJUC 3CZGA 4MY1A 2DZWA 4YVPA 5E93A 3QF0A 2UV8G 3GNPA 3WUEA 2VX4A 1EWEA 4ML9A 4MZYA 3G1DA 4M80A 2F7FA 4F48A 3ZS4A 3MZ2A 4C91A 1DHKA 1DJXA 4UTIA 3SRFA 2VM8A 4Z1CA 2GUUA 2NT0A 4KCVA 3MP3A 3MBDA 3WLIA 4KEZA 4JIIX 4JL1A 2B0MA 4QNWA 2BY0A 1W3NA 2DSZA 4GYFA 2YJQA 4CNOA 4NNAA 3HQOA 2PDYA 3EWYA 3GXIA 5K9DA 3TV8A 2UY4A 5AFDA 3ABRA 3AC0A 2EJAA 3TOYA 1X6UA 2FB2A 1E9YB 4R7WA 4DBSA 2DVTA 3IVSA 5AC7A 1YXCA 2QCDB 4X2PA 3LGEA 2GUYA 1A0CA 2ZTKA 5AN7A 2W79A 1QNVA 3CK5A 1CLKA 1QNSA 1JL8A 2OSYA 4FEZA 3WBYA 3MSGA 5FEZA 3KRBA 3WQVA 5DCDA 1Y5XA 3GE7A 1KBIA 4GUGA 2XJ7A 2YCIX 3THCA 1XLCA 4MNLA 5DF0A 1V3JA 2BASA 2WVTA 2VTFA 4JOMA 3E96A 5IHSA 5EMUA 1IQ8A 3UR5A 2ZXDA 4RZ6A 3W29A 4HSHA 3DDMA 4HNOA 3UZ5A 3ARTA 2J4GA 1MNZA 4GOAA 3NSMA 1ECEA 4FXJA 3H24A 4KCUA 4HK7A 2CW6A 1L9WA 4RK8A 5BOOA 1VCGA 3JRKA 1I9CB 7REQA 3TLLA 1HKMA 2YX0A 2XWEA 1FFQA 1US0A 3BURA 2DSVA 1KR1A 3KW3A 4OFCA 1F3WA 2V81A 1WDPA 2KAUC 4HVXA 4D6IA 4D8ZA 1OT1A 4RE2A 1O5QA 4ORMA 1WV2A 3PJUA 3MSYA 1E1CA 3OYZA 3QLDA 4U10A 2BGQA 2GQAA 1F07A 3KTSA 4PRRA 2ZE0A 1BF6A 3IPWA 3TQVA 1T5AA 3N6JA 4YTUA 5XIMA 1HVQA 1JCTA 4O53A 3MMUA 1J10A 4MNJA 4O4WA 4WKFA 3UG3A 4QFUA 1EDGA 4EP8C 3WQDA 4YVXA 3DC0A 3N4EA 1ZZMA 1ZY9A 1EGMA 3KBNA 3U6WA 4CN6A 3G3MA 2BODX 3M0ZA 3WQ8A 2RHGA 5A6SA 3CBWA 5HQMA 4HPGA 4QJ3B 1H0IA 3C3NA 1E6XM 2GVJA 1LOSA 4K1WA 1B0IA 2Z26A 4ALDA 1CLXA 3E6EA 2DU2A 2VDHA 3ABXA 3VIKA 3WZ0E 3W72A 1RR2A 4Q7NA 3UG5A 1HKKA 4DZHA 1AD1A 4XUYA 4MIMA 1X8CA 4C6LA 1UQYA 3CHVA 1RQHA 2YCKX 3PZQA 4PCPA 1LQ0A 4BWLC 3KM8A 3VIOA 1VFHA 1QNOA 2BVDA 4M0XA 4J3SA 1HJSA 1E56A 2NV2A 1MWOA 4POCA 1OD0A 1LBMA 4PSRA 4WKAA 5L6UA 2ZC8A 5I3KA 1GJWA 4LF2A 5HR7A 3T0CA 4F9DA 3L21A 4NG3A 2YXGA 4F9JA 3LBOA 3E12A 3ITOA 1XLGA 4XTDA 4XAGA 4L6OA 1MXDA 1VBRA 2FPYA 2QIIA 3S5YA 4KMQA 5CGTA 1CGXA 2CC0A 1IR1A 2OZTA 3E74A 3MVIA 4J2PA 5JQ9A 3WEOA 3WH8A 1OY0A 3ANVA 3PNUA 3VMOA 1XIFA 5DRCA 2J7HA 2XU2A 2Q09A 4K38A 5KZMA 2VZTA 1AQFA 3CT7A 5F4XA 1BWLA 2J9ZA 2XIOA 3T7VA 3BLLA 1SW7A 1CXLA 3SW6A 2C3ZA 4O12A 3NGFA 3W7JA 1SZEA 4YTTA 2OCZA 2XH0A 4KWWA 1EDTA 2I16A 2V2DA 3TTSA 3LXCA 1EYEA 2B7PA 3RM9A 3IJLA 4UTWA 3G1FA 4FX8A 1JPMA 5C5YA 1X38A 2PDJA 4BR1A 4J3VA 5AOUA 1DTNA 3UJ2A 4UB9A 2HVNA 5LGXA 2BHYA 2F61A 5JUVA 1XM3A 1H49A 2JE8A 4IHCA 2QQ6A 3VNYA 3BQ5A 4N9DA 4HK6A 2QDGA 3NQVA 2CLHA 2V9DA 4JBRA 5AYXA 4D6FA 3L4VA 3QH2A 1JZ6A 1GKQA 1JCXA 4MZ1A 5BWFA 1JAKA 3XISA 1SM9A 4CQBA 3ZT6A 1GEQA 1M6JA 1LBLA 4MOZA 4GZEA 4JFUA 5ENLA 1B30A 1QW7A 4LNYA 5CPLA 1D7FA 2YDQA 4JIHA 3P8JA 4JTQA 4P7NA 3AYSA 5ABTA 1J9YA 4TV5A 1XYFA 3UY7A 3SN4A 1HO1A 5GJNA 4ZOCA 4D6GA 3STEA 2CZ5A 3W7LA 1B9BA 3M0XA 3F2DA 3AIVA 3MI3A 3ES7A 4C60A 1R2TA 5KSWA 3ABZA 4EXBA 3C52A 1E5NA 3P81A 2BFGA 4YHGA 1Q13A 1GQKA 3WH6A 3VNKA 3RILA 3BOFA 3C0JA 2E6FA 5BROA 2HVMA 3BWWA 3OW1A 3I3DA 1BAGA 1XGZA 2RAGA 1V6WA 1PS9A 4UMBA 3BCFA 4CEUC 2WZMA 2X1IA 4FXRA 3CLWA 3W2LA 2WVVA 3L67A 3GFXA 1H11A 3NNTA 4PTWA 3SUVA 4M1RA 4M6QA 1RJQA 2CLEA 4JDBA 3ECQA 3WBXA 3WF4A 3QC0A 1ECQA 2G5WA 3IJ6A 2BDQA 4HU8A 4C6PA 1YRRA 2Y89A 4I9MA 5L9FA 4IIDA 5CH9A 1EX5A 4PMOA 4BF9A 2AQWA 4Z2LA 5A8NA 1JDDA 2FLIA 4HN8A 3VIIA 1R47A 3JS3A 1VBUA 1FWTA 2A0NA 2OOGA 5KZEA 5LXXA 2GGIA 3E5PA 1KCXA 4XZIA 1PZ2A 4UNKA 1JRCA 3LBMA 1A5OC 1X7FA 3KCLA 3MYOA 3VOFA 2PWEA 3IK2A 3VIGA 3C2EA 3CNYA 4FZIA 1GEHA 1ZQ5A 3DG7A 4S3KA 1BRLA 4DYEA 2YW3A 3W38A 3OGSA 3KTXA 5K2ZA 1TJPA 4ZB5A 4ACYA 3QMSA 1TV8A 3VX1A 3HB9A 3Q58A 5I6SA 1V3LA 3LRKA 3TCSA 3W7HA 1MUMA 4MMWA 2J7DA 4JX5A 4CNSA 4WY0A 3O8AA 3IUHA 2CLOA 4IGNA 5G4HC 1XIGA 3TN6A 4YTQA 4DUWA 5MKGB 3CWHA 3OU8A 1SSGA 2ZIDA 3NEHA 2G3NA 3A47A 4JD4A 6TAAA 2JQXA 3IUDA 1P6CA 4K8GA 1KD0A 1W8GA 3OOQA 3JW7A 5HNRA 2DIEA 1B9ZA 4DXKA 1N8FA 4UTTA 3OA5A 4JIRA 2Q02A 3M43A 1JDCA 3OG2A 4AIUA 2VC5A 3CWOX 3ZYZA 1QRQA 1G7UA 3W74A 2VI0A 2PCQA 3B04A 4S3BA 4Z1DA 3U2EA 2W67A 3FGCA 1F73A 2WNZA 1SW3A 2ZVIA 4HZMA 3LPPA 4DBWA 5H91A 3UNDA 2Z27A 2X42A 2DZXA 2OGYA 3EMCA 1UR8A 2WM0A 2TPSA 2WSPA 2OU4A 4AEFA 2Z1VA 3KHJA 1JIBA 3S9ZA 4Y9MA 2Z6IA 2XN2A 5DMNA 1ZGDA 3DFYA 1AMYA 3VYLA 2EHHA 1GTEA 4B5SA 4DPPA 2E7FA 3C4UA 3AHZA 3H2OA 4OBRA 4UTFA 3QM3A 1TWDA 1JPIA 2J88A 4UTUA 5D30A 4RNJA 4HNUA 4ICNA 4I5UA 1UWQA 4N9BA 4TU1A 3GNOA 3KRZA 4NYYA 1RH9A 1G69A 1YTEA 3UR2A 1UIOA 3L7RA 1TV7A 1W37A 3ABOA 4H41A 4LALA 4B5UA 3UCQA 2RGLA 4Z2GA 2VZVA 4IIGA 2X1UA 4JCMA 1OSEA 3AMLA 4RDYA 4XAYA 3RCNA 1UOKA 3QTPA 2DT1A 2NVCA 3JZEA 4IF2A 1YKWA 2HNEA 1TV3A 4GC3A 4CNNA 1VFSA 3AZTA 1UKTA 1W9VA 4G7EA 3T4CA 3DIPA 3S6TA 2NX1A 1OX6A 3WF1A 1Q6RA 1OVDA 5DFAA 2J13A 1E6NA 4W87A 3WFAA 2UWFA 1L2UA 1M04A 3FSTA 1W2PA 3BC9A 4UQAA 3NWRA 4E0CA 4PMVA 4YVVA 1UYQA 4N6FA 2CESA 2WSYA 3ZT5A 2WM1A 4O1EA 4Y9OA 4JDYA 2HS8A 4IMFA 3C86A 1EHNA 1PHWA 1RD5A 3LCIA 1S5VA 1X7IA 2BXZA 2EO7A 2F6KA 3COTA 1VFUA 1OFDA 3BAKA 3MMTA 5G2IA 2FVKA 1J0YA 3DECA 4NZ5A 2I14A 4ADUA 3E9AA 3PR2A 2VELA 2X16A 2Y4SA 1C8YA 1TV4A 3CC1A 4BKNA 1W9XA 1M68A 4KEMA 2WLYA 5CKSA 4LAMA 5SWUA 1JDAA 4B9YA 1KLYA 2PLMA 5DLCA 4K8HA 3SB0A 3AJXA 3MU7A 3AU6A 4HCDA 2LLEA 1W1A1 4DF1A 1I8JA 3ABQA 4PUJA 3WJXA 3UGRA 3LHYA 4XO6A 3RJXA 2HWGA 3ZJ6A 5CSYA 3W7OA 1CPUA 3MT1A 5HINA 3SQLA 1XDJA 4NYUA 1UUOA 3R12A 1FWJC 4A3YA 2WHKA 4GMEA 5FF7A 3SQMA 3L4WA 1V08A 4NAEB 4QAIA 3UYIA 4F2BA 1KM0A 4LVAA 1YXDA 1TO3A 4JNMA 3WJWA 3M0YA 3I4KA 3VZXA 4XVEA 4CCDA 1AK5A 3B8TA 1KA9F 1C8XA 1HW6A 3UWQA 4HQVA 2VEGA 1GVFA 3LLXA 3R89A 1GHSA 4ZOAA 4ENLA 4GXMA 3CAWA 2QNEA 1JCNA 2WJDA 1J12A 3EPMA 3KUMA 3W2MA 5FF0A 3F5JA 2VFGA 4KRZA 4M6VA 3L4XA 4U28A 5I2UA 3LHTA 2PDGA 4D9PA 3W7IA 4O8AA 1WZKA 4ML4A 3BGJA 4HNVA 4DPQA 1GOIA 2WZIA 2VXNA 4PUKA 4PBEA 4YNGA 1DJIA 3NURA 2OEJA 3WSUA 5BCAA 5HWMA 5DELA 3STPA 4NX0A 2ZRXA 5BU6A 3BICA 1ENUA 1NU5A 4KWSA 3G2GA 4JTUA 3TQ0A 1W9DM 3EWZA 4IFKB 5HA7A 2D2GA 4YXGA 4RW3A 1B4EA 3G1SA 4FB7A 2ALRA 1EJTC 3SUUA 2NLIA 1I1XA 3AXXA 4DELA 2XFWA 5CEWA 4IM4A 3NZRA 4BK9A 4H19A 2PF0A 1HJUA 4IP7A 3HMCA 3L23A 2QIWA 2INFA 3WQFA 1O6IA 2WMFA 1MDRA 3N1AA 2GWGA 2ALDA 4L1GA 3DU0A 2HE8A 4NZ1A 4H4IA 1TPVA 1S2TA 4R7OA 4WDUA 2Z24A 3B8DA 1DL3A 2PF8A 1RXOB 2QT3A 2P76A 3DHUA 4Z1BA 2XIBA 4QLJA 5LIXX 1ELSA 1VFFA 1XC4A 1A5UA 2VZUA 5KETA 1AH3A 3GM8A 1PYMA 3TH6A 1ZRQA 1QTWA 1WPCA 4TIMA 2PSNA 4JKMA 1Q6DA 1QI2A 1BPLB 1GONA 3T07A 3W86A 2D24A 4L7ZA 3I7SA 5K7JA 3TC7A 1UQZA 5GNXA 1JYNA 4LC8A 3BLKA 1ONXA 5KMYA 1PX4A 3W1NA 1LWHA 5HUPA 1C3FA 4UR9A 4WSJA 1TG7A 3FJ4A 3H2FA 3TMLA 4B16A 3R4IA 1OFBA 4S2CA 2E9MA 4JTFA 5IBXC 4GKLA 3GIPA 4E8CA 4CU6A 1LT7A 4AVNA 2NX3A 2VR2A 1ZJBA 3PZ9A 3UFYA 2ISFA 2OZ0A 4FS9A 4G1NA 2ZZ4A 1E1EA 4I90A 3WD2A 3LMYA 3IRDA 4C7GA 3BMWA 4B91A 3PHAA 1KM5A 5HATA 4JHZA 3KX6A 3PZUA 1HUVA 2VEIA 3VDAA 3Q67A 1M7OA 1Q8AA 3ELFA 2E1WA 1BG9A 5JVLA 1CECA 3U4AA 4DZAA 1VH7A 5FL0A 4U31A 2JGYA 1M7JA 3MDWA 2IKJA 3O9NA 4LBSA 3RR1A 3D3AA 3ORWA 3FJNA 3BLEA 4ES4A 3R7MA 3KL5A 1AODA 2ISDA 1QO5A 3DEQA 1NOUA 2OMAA 3CJPA 5DT7A 1FBAA 1S2UA 3SRDA 1BQCA 1OWQA 2A6NA 2JIEA 2QJNA 3CIVA 2YYTA 2ZZ7A 4GRSA 5BNKA 3VKDA 1H0GA 1VAHA 1HGWA 3CHDA 4GJJA 3W1XA 4CQAA 3RLGA 3GYEA 4DWSA 3OGRA 2FZBA 3ES8A 1FY6A 4TVDA 4XBSA 2C19A 5HWNA 4F4RA 5EKYA 1KXHA 5K9XA 1PIGA 3OA3A 2J78A 1XBZA 3WLNA 3O0FA 3FV9A 3CQHA 2CFFA 1OGBA 2F6XA 3CQ0A 4EVZA 4H8NA 3OVPA 1K02A 4PE8A 1E6SM 2DSWA 2ZE3A 1JUEA 4WXYA 4Q8TA 1EHAA 2QLYA 1HVXA 3TSBA 2QMKA 2D2HA 2C13A 1R3WA 3W7KA 4IFRA 1ITQA 4O52A 5KZDA 3WLHA 1RA5A 3HQNA 3UZXA 3TC6A 1W3IA 1UD4A 3AXIA 1DE5A 4A8RA 1E3ZA 1MW2A 4X3ZA 2W61A 3S2NA 4PMXA 3DFOA 3LN3A 4LTSA 3AMDA 3N25A 4H2CA 4GH3A 1PE1A 3GLCA 4L4PA 3MY9A 1RCXB 4QE5A 3USZA 3CU2A 5A6TC 1HO4A 1X96A 4IPNB 3OTRA 2OQYA 4UUIA 3WD3A 1QOQA 5E0CA 4HNNA 3ENLA 2NLYA 4YS1A 1EEPA 3THAA 4IX0A 5HDRA 4TVCA 4ZQPA 2PD5A 4QSFA 1OADA 1S2WA 5EU9A 3U57A 2DH2A 4AMCA 3N12A 3UPMA 3BOXA 4S3JA 1C7TA 5FJPA 3I6RA 3IACA 3DCPA 3IIVA 4IMCA 3DC8A 1G67A 1B54A 2PBGA 3ZSSA 3AIUA 1Q65A 2Z1XA 3GNRA 4M1BA 2VGGA 3ZQ9A 3MUY1 1TUFA 2QV4A 4JNYA 1WB0A 4JFVA 2IKHA 1ZJHA 2FZ8A 2R1MA 5A6JA 1TX0A 5DX7A 2A3AA 4ZTYA 2H3BA 3CUZA 5GQBA 4F8XA 2VCAA 3O16A 1QI3A 4C6FA 4QROA 1XX1A 3HM7A 4C6KA 1Z44A 3HV8A 4DJFC 4KFOA 3PJWA 4HOZA 1XYMA 5DQPA 1G4TA 3GWQA 5CLTA 1JDEA 1NY1A 3TC3A 4Y9PA 4D6JA 4NXKA 2E77A 1HKWA 4OWGA 1S1RA 1R3QA 5LNSA 1RK6A 2Y5EA 3HJEA 3EXSA 2RDUA 1H2JA 1BVZA 1KM4A 3QXBA 4W89A 3FEMA 4J5NA 1Y8BA 3PPHA 3HJZA 1F3TA 2WOQA 2O7SA 4L5ZA 4DX3A 2YYUA 5CPMA 4C65A 2CYGA 1DKWA 3VD7A 4BEUA 1IEWA 1YE6A 4RNIA 1ZLPA 1C92A 3EX4A 3HIJA 1FWRA 1QPNA 2AL2A 4A8LA 4H7CA 1YADA 1DWAM 2HE5A 3EDDA 4OOZA 5CAHA 3KOFA 1PO9A 3MCNA 3W75A 4JTHA 2X2YA 4QXIA 4HPXA 3OO2A 4F0HA 3IGXA 1TTQA 5F1UA 3M7SA 1B3VA 2O7QA 3LI1A 4N0RA 1HG3A 4L9ZA 4IUGA 3KAOA 1XGDA 1W8SA 4GE8A 2HPMA 1XHGA 4R27A 3U9IA 4U5IA 3K8LA 3GVRA 1Z3NA 3BG3A 1XICA 1S39A 1E9IA 1W6TA 4G6CA 1KW1A 1ADSA 5HOSA 1U22A 1Q5MA 4JYFA 5A6MA 1CGVA 4M8UA 3A4WA 1BSIA 4PBGA 3P74A 4I5RA 1XH0A 1ZBVA 3LDVA 1I45A 3TA6A 1B3XA 1MZHA 4EAMA 1R87A 1VD6A 1L6SA 3WQEA 4ATWA 4UCGA 4WJXA 3QMRA 3PN8A 4UIOA 1KBJA 4O11A 3PPFA 3AU2A 4N9CA 1VBGA 3ZM8A 4HMEA 3N18A 2NQJA 2AMGA 4QS6A 1OFPA 3MYPA 3QSTA 1A3HA 1BEUA 1TKKA 5CBBA 4B2DD 1FWHC 4QP0A 1V8EA 4GQ0A 2NV1A 4ZB0A 3TR9A 1MDLA 2NUYA 3HQ1A 4RXFA 1IXPA 1R9ZA 1UD5A 4JL2A 3AS1A 5AC6A 3ERPA 4PYSA 6XIMA 4ACZB 2ISWA 3KVKA 3EWBX 5E9XA 3RCYA 3SZ8A 2Z29A 1R7OA 3GZAA 4R9XA 2ZX9A 4XZHA 4JTAA 1SU5A 5C9ZA 1X1ZA 1D8WA 1O12A 1TVNA 1U1JA 2W0UA 4RV8A 2IPWA 1Z41A 3LNMA 3IAPA 3VAVA 2A85A 1UWIA 3K4AA 4HPHA 6XIAA 3RLHA 2GK1A 2CBIA 3R11A 1YE4A 4CU8A 2VUNA 2FMNA 2YFNA 2EPMX 3WLJA 4WDXA 3VD4A 3PS7A 5C9WA 1IR2A 1QI0A 3FXGA 1H1ZA 4HGXA 1AH4A 4L1WA 4JTIA 2Y7EA 1OT2A 4XO7A 4UTHA 3E0FA 4GUIA 4JY8A 1A5BA 5HNTA 3GXPA 4GWEA 3FS2A 4GI6A 3KZPA 3RRAA 1N8WA 1DYSA 3SN0A 2WB5A 2XZ9A 2TSYA 2E8YA 6CGTA 2E4TA 2FYMA 2Y5JA 4F0MA 7XIMA 2NXGA 1AL7A 3OZYA 1LRNA 4LY8A 5IDZA 1T99A 1UKPA 4GI4A 4WRHA 3CMJA 4NAFB 2DDXA 4KS0A 5KZ6A 4IL2A 5DY2A 4LYQA 1GOQA 3RGTA 4AU0A 4MF4A 2KX9A 3A3HA 1US2A 4AFYA 3O6YX 4TO8A 2CXGA 4P5UA 1W1ZA 1NOFA 3EB4A 4GIRA 3F5LA 2HVOA 2FGLA 1TV5A 2PP1A 4MDOA 4J35A 3O0KA 1RPXA 1KGWA 4JX4A 4CLMA 1SJCA 3M4HA 3PSVA 2ZUNA 4XUGA 4XZ9A 3SSZA 3K13A 3ATYA 5M03A 4F0LA 2NSXA 4A21A 3DG3A 3EWCA 2PDLA 3K4DA 5FI8A 2C1HA 1AQHA 3S2LA 4LCQA 3RNDA 9XIMA 1M3UA 3UR8A 4M19A 3BW3A 3DHPA 5IDIA 1TJRA 3Q37A 3PBMA 1XLHA 2YL6A 1GZ1A 1M7XA 3OLDA 4YL2A 3M1ZA 3W71A 3EKLA 1K6WA 3S42A 5FCZA 4HHHA 4S3FA 4JEJA 4LRSA 4AWSA 2WSKA 5CJ5A 4JQ3A 2QDHA 2YB1A 1CXFA 3AMGA 1NWRA 1H5YA 4TMCA 2PDCA 2EXOA 4E8GA 1UA3A 3S8HA 1XC6A 4LX4A 1R2RA 4E3VA 2CZDA 3QYSA 5D4YA 2WANA 3R13A 3TU9A 4GYPA 1XSIA 5HPCA 1XS2A 3QPZA 1JCJA 3L5LA 2X09A 3MWAA 1OF8A 3AALA 2WQDA 4E3TA 3H23A 5DANA 9RUBA 1V3IA 3UXIA 2QV5A 1QPOA 2BY3A 3PZNA 4C1KA 9CGTA 1FXQA 3PK7A 5EBUA 1BFNA 1CZ1A 5I23A 4FSAA 2OKTA 4Q22A 4HYWA 1TZZA 5FIPA 5I07A 1P7TA 2H6RA 1D3GA 2XGIA 1RHCA 4TVUA 1C91A 3THQA 3WY1A 4X22A 4S3AA 3WDPP 3W25A 3N9KA 5LYRA 1EO7A 1UWTA 2EPNA 4AC1X 1R0MA 5E0FA 1AFSA 1EGVA 1XR2A 2OSWA 1W9UA 3P6LA 5H8UA 1EEXA 1EJWC 4L1XA 3KDNA 5BYWA 1BLIA 3S4TA 3T2QA 3WN6A 2QUMA 1DQWA 2AL2B 1GVSA 1QPKA 3B9DA 5DXYA 1HFBA 1U33A 5CZKA 2BLEA 4WD0A 2Y61A 4KESA 1P6BA 1W5MA 4D72A 5CBIA 3VI2A 4I7WA 3P82A 4UC5A 2YA0A 2QS8A 3TLQA 3BANA 4CNPA 4GABA 2GQ9A 3B03A 3RFAA 3TK7A 3BZJA 2E8ZA 2WJEA 2IW0A 1W1PA 2A4AA 2YL8A 3M6YA 3PBGA 4H8VA 4L65A 3TX9A 3LM3A 3V35A 4W8LA 2NUWA 4LUSA 1KM2A 3GTXA 1DXEA 2PWHA 4W85A 3NM1A 2WCGA 1PYFA 5CXPA 1TRIA 4TX8A 5CZTA 4AIEA 2BVTA 1V6YA 1ONRA 2DQXA 1MXSA 3TTYA 4LBRA 4KCTA 1F2JA 3KOYA 1HJWA 4GC4A 3AAMA 1FWGC 2ZRZA 4MGGA 4L6HA 1N82A 3TYDA 3NQCA 3L0GA 2NQHA 1ZU8A 2BB0A 1UR1A 4MYXA 1PWMA 3BAYA 4W9TA 1QCWA 2OYKA 5H8PA 5ABGA 4S2BA 1UASA 3QGAC 3G8EA 4MY9A 3VC5A 2OX1A 2PDWA 3CQKA 4XBJA 2GJRA 3PBWA 4MDPA 4JIPA 4AD0A 2RJGA 4GX8A 1T41A 3GHSA 1VYRA 2NXHA 1VRDA 1XP3A 1TUXA 4PSPA 3MUIA 2PTDA 2V38A 1P48A 5FEXA 2HS6A 1US3A 3U5YA 4GXWA 2FHFA 4FNPA 3OZMA 4CQDA 1TIMA 3WFLA 1ODZA 4Y90A 3CWNA 4HBKA 4RDVA 1E71M 2YDAA 2J9YA 5HPOA 5EFFA 2C91A 4UFIA 4XIAA 2BNJA 3W7RA 1BKHA 4JNZA 3NTYA 4DJDD 2PDBA 4H8HA 4CGTA 1WA3A 4U5KA 1A5LC 2JK2A 3HA1A 2HXTA 4KEUA 2JBMA 1S3TC 5HMFA 1KKRA 3DZ1A 5CPNA 1KM3A 4HNLA 3A12A 1TB3A 1CX9A 4B90A 1IIHA 3MANA 2AOSA 4UZSA 3D0CA 2ODOA 1AJ0A 3STGA 1PCKA 1KXQA 5HNUA 4JTSA 1H7OA 1UWUA 1GYMA 1RJRA 4GLEA 4US6A 4R7JA 4IQDA 1GZGA 1SVDA 3WNOA 5LIUX 2V5KA 3L9CA 3R25A 1RBAA 4ZE5A 1PTDA 1WDQA 4FIQA 4TX9A 1EBHA 1PX8A 2VNCA 2PWGA 4I8DA 4GJIA 4ZZ9A 3GUWA 1ISWA 1Q8JA 4P7QA 2W62A 1AW1A 3VFCA 4GK8A 1P5BA 1K1DA 2AMXA 3UJSA 4UFKA 1E4NA 2ZICA 2QJGA 1E0XA 5A69A 3CZKA 4IIFA 1LDCA 1TPFA 3R5EA 5T26A 4C6OA 4W5UA 1NFGA 1HF6A 4S1FA 5MHBA 2ADAA 3VIHA 4A3HA 1TPH1 1R85A 4X9YA 1VFMA 1OQFA 5MKGA 4XSLA 2R94A 4ERAA 2R1KA 4XZWA 4U3CA 4TTGA 3IARA 3GHUA 2AL1A 4AHOA 1FWEC 1MYRA 1V0KA 3UXKA 1RJPA 1XF0A 6TIMA 1E55A 5I3IA 1YNPA 4FI4A 3TR2A 2VWTA 4LNCA 4MHBA 1F6YA 4O18A 4ECLA 1TCDA 5FKYA 1ZCOA 4Z1AA 4L4OA 2XSAA 3SSJA 1XIIA 3QV7A 3N19B 3WQ6A 1NFPA 3C61A 3SGGA 3QV6A 1BXBA 3STFA 2QVNA 3PPGA 4MWAD 4C6QA 4S38A 1M5WA 1XPGA 5C7HA 5C9UA 3Q4DA 2XM2A 4GI8A 4E8DA 1GGOA 3U48A 1SO3A 4URIA 2VFFA 3NQEA 2C6QA 1HKJA 2V5LA 4AZHA 1FCUA 2PTYA 4MWAB 3FJ6A 3UWEA 2WMJA 1GZJA 3BAXA 3LHUA 3FFSA 4GGBA 3E0WA 4P7LA 4HOWA 1KR0A 1WX0A 4B15A 4N2YA 1KTCA 2WVVB 1WP6A 3MWCA 4HB7A 4AX7A 4H9XA 3LLDA 1M1BA 2A7PA 2E28A 4O1FA 4JGDA 1OGSA 5D02A 5BOEA 2ZQ0A 1VPQA 1GJUA 3TJ4A 1Q6FA 2OVLA 2HBXA 4IICA 1FWIC 1HL2A 1Y5VA 1ZBKA 4NUWA 3UJRA 2W9MA 4OV4A 1V6TA 1SUXA 1DP0A 3RX3A 3ZLFA 5AZ1A 4RNFA 3LOTA 3EZ4A 4IG2B 1ZAHA 2IKIA 2NV9A 5EMYA 4R9OA 3E2SA 1B4KA 1QU4A 2VEFA 3ZJ7A 1Z89A 2PBOA 1YPXA 1EUNA 3P62A 4N4PA 1ICPA 1FUYA 1OJXA 5AHEA 1OFAA 3G22A 4GA8A 4FX7A 1K9FA 2P8CA 1Z6KA 4G7FA 4CD5A 4ERIA 4EE9A 1FXPA 2V0TA 3NFUA 4I3GA 3HO8A 1ZAIA 2A2IA 2NQ9A 2EPHA 4PTMA 3DBPA 3BTNA 1MVYA 1RLDA 3MUCA 1EC9A 4DB7A 3I10A 3TNBA 2MNRA 2YCLB 4XAPA 1X98A 3QSRA 2E0PA 4GIEA 4FXFA 1QHZA 1EQCA 4FNTA 3HPFA 1QASA 4F0KA 2QJJA 4P2VA 2POTA 4FF7A 5FJRA 3W7CA 2BWGA 1XG4A 1DWGM 5T91A 3GR8A 3ARSA 1OFQA 1XLMA 4MSSA 1TE6A 1SZNA 2X8RA 3WLQA 4IJRA 1TE1A 4EWJA 3W7GA 1T7LA 4IQJA 3C8FA 5KEZA 7REQB 1GYLA 3B9EA 1QI4A 5JIPA 2B7NA 8CGTA 2FHCA 2C71A 3VK5A 1H1YA 1KBLA 3MTWA 1BXNA 3WH5A 1QR7A 5CPTA 1NARA 1ITXA 4R88A 4X9SA 4XD6A 3HBLA 3TYUA 1XYLA 2PODA 1GNXA 3R0DA 2A6LA 1NWSA 3CUFA 5JXQA 3QC3A 2YB4A 3LTYA 4AY1A 2BHUA 1XIBA 2JEPA 3WJZA 3L0KA 4KWUA 3MVTA 1W32A 5G1TA 4YLWA 1A3WA 1PHQA 1LJYA 1F6PA 4Q4OA 2ZRVA 5E6YA 5FJIA 1EF2A 2WCSA 4PEKA 1CYGA 5D2TA 3UZWA 3SURA 3TFCA 1BVWA 3IIXA 3P2VA 4JFWA 3QW4B 1KRBC 3K8KA 3NQGA 4XKMA 2CLLA 3SUSA 3EDKA 2E1DA 3VVGA 4QCFA 4IX2A 3GYCA 4FNSA 4JTRA 4DJEC 4HMDA 2X30A 3W27A 3N15A 1RCQA 1G4EA 4AZ6A 3DYMA 3OEXA 3J7HA 3ARYA 1VLWA 2DPEA 3LGDA 4KBXA 1BWKA 1CWYA 3CXOA 1DBTA 1A5CA 4JN6A 4NNCA 1ISVA 5G1YA 2DZTA 1CGYA 5EMMA 3TW9A 4G5DA 1KFWA 3MHUA 1OM0A 5FA5A 3T2PA 1XD0A 2VD8A 3BLFA 3E2QA 4GFIA 1Q85A 3NL3A 2ZXAA 3NO5A 1OINA 3LSBA 2ESCA 1QK0A 4LVGA 3N2OA 3PWAA 2L5HA 1BKSA 1ZSXA 3ZIZA 3ZR5A 2FFCA 1J2BA 4BFAA 1UC4A 3UA3A 4Q8VA 1BGAA 1Q6GA 3V0UA 4OV9A 1O1HA 3UJEA 4XX6A 2OG9A 4WSHA 1D9EA 5JH2A 4AY7A 3QEZA 4OIFA 2FPTA 5LZLA 4A2SA 1J5SA 4X0NA 3GW0A 1I1WA 2VZSA 4PMZA 2ZWZA 3MV11 2VGIA 4WQ6A 2D2OA 2OT1A 1UR0A 1HT6A 3TJLA 3CZ8A 3EB3A 1JI2A 3UGVA 1GCYA 1GVOA 5D2XA 4FIRA 2R82A 2Y2WA 2XN0A 4WK9A 2YLAA 1H62A 4MNKA 1GORA 2P8BA 3EA3A 5BMXA 4FPSA 1UBSA 3V1HA 4NJKA 1QOXA 4Q4SA 4NIRA 1VJIA 3IJ8A 3L12A 2DZBA 2HISA 3LCWA 3VKAA 1V6XA 3GK0A 5AYYA 4E4UA 3EX6A 4UFJA 4AX6A 4IMGA 3S1GA 4XWUA 4QITA 2WMIB 3BSMA 4N6EA 4O0ZA 1PZ1A 4BEQA 1EPXA 2J7BA 5BRQA 3E0LA 2BBFA 1DWFM 3IJDA 4GNKB 3VUPA 1DORA 4GUHA 5BW6A 1TSIA 4AISA 5A94A 1WCGA 2HNHA 1QHPA 3O6DA 3HPAA 5K4XA 4J27A 3FW6A 1K77A 2J7CA 2G97A 2E40A 3T8QA 3HMJG 3NEVA 4OBTA 4ZO7A 3IANA 3QV9A 3QOKA 3UYCA 2Q3RA 3K1DA 2V2CA 3IGSA 4HCLA 1J2WA 4PMJA 4IMDA 4DRSA 5ABHA 3PZGA 2V5JA 4QQUA 3W6YA 3VC6A 3S46A 2GSJA 1B3ZA 1BF2A 4YWSA 2XTKA 1OFEA 3PTDA 3V16A 3G1YA 2XFFA 2HTMA 3UQNA 2W63A 1HIZA 2HJPA 1VPXA 1LYXA 2BHZA 3FVDA 2OELA 4WX2A 5B7ZA 4AZCB 2W4XA 3HPXA 2A7NA 4DLFA 3KE0A 1XXXA 4F2TA 4UTWC 3H26A 2AGKA 4B3LA 1MEIA 3W70A 3K46A 2XVKA 1ZP3A 1TJ2A 5H1WA 4V15A 2XH2A 1I0BA 1T0OA 2PWUA 4HA1A 3TQKA 4K2SA 4EF9A 2ZX8A 1TMHA 4IPJA 5A6BD 2WK2A 2OEKA 2PDIA 1EXPA 2PD9A 4MM1A 1GQLA 2E5CA 4DYKA 4FALA 1DV7A 3KOXA 1DWIM 3QRHA 4B9ZA 3A4XA 3W87A 1BD0A 1S3HA 3AZSA 3SADA 4V28A 3W1RA 3TE9A 3NL6A 3NZ1A 1EXBA 1WUFA 3CB3A 3A3XA 3LXAA 2NQZA 5K4ZA 3EBVA 5I09A 6ALDA 1PVNA 4MWAC 2GQ8A 2X0HA 4MUPA 2TRSA 1IEXA 4GNJA 3NPVA 4AUBA 2AAMA 3LTPA 3KRSA 1EQPA 3IJIA 2CZVA 5MF5A 1PIFA 2W66A 1JFHA 8RUCA 1THFD 1E73M 3BJFA 3I7RA 3OGVA 3THUA 2ISVA 4QM1A 1E70M 1K70A 2YZRA 5FJUA 3TYZA 4H6QA 4NAFA 4MVAA 1LLZA 3PZMA 2ZUSA 3QHNA 3CO4A 1N8IA 1OX4B 4HU4A 2QYGA 1YDOA 5EPDA 1IV8A 3LCHA 2QVHA 3TW6A 1LZOA 4JAWA 2WZEA 1R9XA 3A9BA 2XUCA 4E38A 3HGOA 3B0YA 1R8LA 1RQBA 2GK1B 3I6TA 3GU2A 1UZHA 1UZ1A 2R14A 3VTRA 3PAJA 4CD6A 4GCAA 5I3GA 1JJKA 2E6YA 4C7FA 4YN5A 4AWEA 1FH7A 3OB8A 1H3GA 2VVSA 1EP2A 3MP4A 1JZ4A 1UP0A 5CZSA 2OR2A 1G94A 2B81A 4IFKA 4IIBA 3GTNA 1Q6LA 2A1YA 3NCOA 1RP9A 3NAVA 3TN4A 2X1RA 4C1NA 1NP2A 1JFXA 1GHRA 4IJBA 2E6DA 3LI0A 3EWDA 2ON3A 4G56A 1MNSA 1XH2A 4Z0JA 2FPVA 4KIRA 2O9PA 2PA6A 3MI6A 1O1ZA 1NDZA 1BYCA 2FDMA 3WH9A 1DXIA 2ZX6A 5DMLA 1OIFA 2QPUA 4QLKA 1RVKA 1KCLA 1SZFA 1GYNA 2YW4A 2PDQA 4K36A 3V18A 4PFHA 2MANA 4MWAA 1FWNA 2XGBA 4RLIA 1G4PA 1IT8A 3M07A 5LSMA 3IGUA 4AQLA 5LNRA 1T96A 1UPMB 1YLVA 4GFSA 4IGSA 1HX0A 2Y5SA 3S2CA 1EKOA 3HPZA 1WO2A 1XIMA 3WF3A 3T0AA 5A8GA 1EIXA 1JQVA 3FK4A 3GG7A 1ZJAA 3UNTA 2ACSA 1FFRA 3UVIA 2IS7A 2D20A 1GOOA 4U2YA 3LS9A 3HGJA 5D04C 3SJNA 3ISIX 3DESA 3KCOA 3SFKA 1VB9A 2EG7A 4FLSA 3AISA 1VENA 3QLLA 1PKMA 1O60A 2ICSA 4FF5A 4DO7A 4GD0A 3FYYA 3ZWSA 4DJFA 2JFEX 2XINA 4MJMA 4MADA 2V2HA 3N13A 3VUSA 4YYFA 1WBJA 1K6AA 3ZXWA 5BU9A 1IT0A 5B80A 3ITCA 3VIMA 3PB0A 2OWCA 3RITA 1EYWA 4AVOA 4AD3A 1TWIA 4AWUA 3B8UA 3C2VA 4H04A 5D38A 3WMLA 1XYCA 4WZHA 2HROA 2TMDA 1VEOA 3H6OA 1REQA 2Y7DA 4AZCA 2YL9A 1LBFA 4HJWA 2O0TA 1LTDA 3VIFA 3P5ZA 3VX0A 1JD7A 5DBUA 2PWVA 1EH9A 1VPYA 2Q8LA 2WC4A 3BUVA 1SFSA 3C5QA 1IEIA 1TZ7A 1XLEA 2Q8XA 1W2VA 1AJZA 4AD2A 2ZADA 5D32A 1PV8A 1B3YA 1XUZA 2V3EA 3W1PA 3ITTA 3B8IA 2R9RA 3WLTA 4IQEA 3ZFHA 3NQAA 3FCPA 1JEZA 1S2CA 4IXXA 1HJVA 1VC4A 2PTXA 5CQ1A 1MFUA 2E5DA 3UZZA 1W54A 2YGYA 1K8XA 1E4MM 4I9JA 1AZ1A 1RD6A 4O1DA 4LANA 2VMFA 3M44A 4LB4A 3AHVA 3PUGA 5TAOA 2PI6A 1ZJIA 3CV1A 4H7VA 4CCEA 3O2LA 1J79A 1XLIA 3N6QA 1LL4A 3SBFA 3CV6A 3DI1A 3SJ3A 2WKGA 3I3EA 3W88A 3P93A 3OHIA 3BLDA 2Y70A 1UD8A 3S47A 2Z2UA 3LPOA 1J4EA 4PODA 3L5AA 3TFXA 2WVUA 1FH9A 3FVMA 5FF4A 2CIPA 4Y9NA 1CENA 5C9RA 4MKNA 3CPRA 1KXVA 2OO6A 5CJNA 5TF0A 3IIZA 4CD4A 1FWSA 3FHAA 3RM4A 4QJ4B 2XZ7A 1PWLA 2VC6A 2D0GA 3N9SA 2OQHA 3WUFA 3TZFA 4PTXA 2DSUA 1UCWA 2UBPC 3RYSA 1UPPA 1Q45A 3U2OA 3MKVA 2Y85A 3NXFA 3WF0A 3T2OA 1XBVA 3MI2A 1EF3A 2D23A 1YTDA 1PDYA 1SR0A 1YBQB 2C1GA 4KRUA 4L4LA 3P8IA 3LERA 3W4RA 1U5HA 1VF8A 3ZO9A 1JPHA 3LENA 2ZX5A 1JUKA 4RR4A 2GVLA 5EBAA 1XYAA 2HEJA 4I5XA 3A4AA 4GIAA 5D2VA 1PZ3A 3USBA 1FCVA 3SCRA 3SUWA 2Z00A 2B31A 4IL0A 3NDOA 4MJZA 4MB1A 3UR7A 1EJ7L 3STCA 1YHTA 4PUUA 1W1IE 4OJYA 3RPMA 3XINA 3CYJA 3VD5A 4QCEA 3VDCA 1OYAA 5D8WA 3V7PA 2X2GA 4UTKA 3CUGA 4DJED 1BYBA 4H9MA 3RDKA 4I7VA 1O5RA 4XZNX 1DPMA 1Y7VA 3EOOA 3UETA 3VILA 3B8WA 1TVPA 5A6AA 3M0HA 5E09A 4X0VA 1R7AA 2H9AA 1W0MA 5CSRA 3VABA 2QCFA 1WDSA 2IXVA 4EPKA 3HFTA 1WBHA 1PUDA 1I2NA 4MKSA 3SCTA 3HTWA 2OLSA 3WD1A 2VR5A 1WOBA 3HG2A 2AQOA 1ZHAA 3SEPA 4E2VA 1AW5A 4MFDA 4XB3A 1LLOA 1F61A 2IXUA 3NZQA 1ICSA 4AF0B 2BXVA 3B4UA 1KB3A 1V51A 2REQA 2J9XA 2P50A 3ARPA 4AW7A 1E15A 1KFBA 1FWAC 1SR9A 1K7FA 1A80A 1KWKA 2C8NA 3DBNA 2GGEA 1FTXA 2WSRA 3IGHX 1K3UA 4GVGA 1UJQA 2D2JA 6PTDA 1AG1O 2IPJA 3LK6A 4HOXA 3UWYA 4C6BA 1Q6EA 3GRIA 3WBEA 5F7UA 1X39A 4IIHA 3Q2DA 5C8BB 2CXEA 3UJFA 4CCZA 5BXTA 4FR6A 2ZDRA 1FP9A 4IMEA 4GHRA 2CBJA 2J79A 3U3HA 3W7EA 5I3DA 3DKLA 1QK2A 2YCLA 1NWTA 1Q6OA 5D9OA 1SFLA 2WNWA 3NQ7A 1H09A 3H2AA 4QS5A 3E0VA 3QZAA 4DZ5A 4FHAA 4KW2A 5T9BG 1QXLA 3MSRA 2VRJA 4L6DA 5ABEA 4LUYA 1OCBA 2PWFA 4IOTA 3UWVA 4W7WA 3I3BA 3VGFA 2WZTA 1W9BM 4R53A 1RBOB 4DYJA 2AKMA 2Y62A 4Q33A 1QWGA 2XH7A 4PGLA 3URBA 1UW9A 5IBXA 3TA9A 2RKXA 4OVXA 1SZGA 3HG5A 2DZAA 3GS6A 4GNVA 3SCQA 3NQMA 2UY5A 3LX9A 4M3PA 3IVTA 3UW6A 1NQKA 1UZ4A 4OHQA 1KRCC 2UY3A 3GDMA 3ICJA 4E4FA 3LZ5A 3LQLA 5G2WA 2Z7GA 1WOAA 2XH4A 5H2ZA 2P0IA 2HDJA 5T8GA 3H2CA 3TSMA 3QQ1A 5AHLA 1OC5A 1O5KA 2PLCA 3CEPA 3RIKA 4MAZA 1SO4A 3UPBA 3NVTA 3C2YA 2A7RA 4RUBA 1M41A 3S2JA 2ZBTA 3VCRA 3IS4A 1V3HA 1KKOA 4AG0A 2P1FA 4CQ8A 4BI7A 2QULA 4S39A 4AXNA 4XKYB 2DUXA 3TXVA 3N3MA 1V4YA 3GD6A 1NIUA 3OLGA 2OPJA 2F84A 5AVNA 2J8FA 4C6CA 1FVPA 5FEPA 4DAFA 1R3TA 1XWYA 1GK8A 3WDQA 4QTGA 1KFKA 3BCDA 1KQYA 4TMBA 4NY2A 3S9IA 3W2NA 4HD5A 3N11A 3RLVA 4OUEA 3EEZA 1FCBA 4WJEA 5AHFA 1RQEA 1WZLA 4M6UA 2EBNA 1Q2RA 4LC6A 1Z9AA 2Y0FA 4PMQA 1G1YA 3DYOA 3SN1A 3D47A 2ABBA 1JQXA 4FOUA 3Q94A 4WDWA 1CIUA 4FR1A 5TNVA 2EG6A 1V6VA 4JCLA 1VR6A 5LHEA 2J66A 2FMOA 3A5VA 2RH9A 3UG4A 1JXJA 1GPWA 4HHPA 3APGA 5LNVA 1ZB5A 2PLKA 4UR8A 1W3HA 1QT1A 3CHCA 3R79A 1EWDA 1TJ1A 4HSNA 5EFDA 4XSMA 4EX4A 2ABAA 3F1QA 1W31A 3QV8A 3LPFA 3C56A 3FYOA 4UFMA 5KINA 3ZR4A 1HL8A 1WDDA 4QDMA 3FA3A 3LV6A 6REQB 3N29A 4ZBCA 4NF7A 1MZRA 1XIHA 1R9YA 4IQLA 4C1LA 1DIDA 4LS0A 1W1TA 1EA0A 1FDZA 2CITA 3F4VA 2XPKA 4O1CA 2BG5A 3EEGA 4J1OA 1JZ5A 3I65A 3QOMA 4GJ1A 1XCXA 3MDUA 4JICA 5FSDC 1UR9A 2GDVA 2GVEA 2DUZA 1UWAA 2XISA 1FKXA 2QUUA 3VCCA 5F2GA 4AEOA 4CCCA 3WQPA 4O1AA 3JR2A 4I7UA 4GZJA 1MW3A 4IGHA 3WL0A 1XLAA 1O68A 2I5GA 1UP3A 3MSDA 4J7RA 2WMHA 4HA4A 4G7EB 1YYAA 4GCXA 4KGLA 3D6NA 3T0TA 3V5CA 3EDJA 1JZ2A 3DUGA 3VOHA 2DFAA 3GQYA 4LEQA 3W37A 2HV5A 1ALDA 3DFQA 1S46A 3E1F1 3AMCA 1LM1A 2D0FA 3H2NA 1VYPX 2G3FA 2OGJA 2Z2AA 3FDKA 4DJDC 3UESA 1Y65A 2C79A 3KS5A