4B5NA

Crystal structure of oxidized shewanella yellow enzyme 4 (sye4)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
354
structure length
354
Chain Sequence
TIENTVNSVENLFDTYKLNDTITLKNRILMAPLTRCMADANLVPTDDMVAYYARRAEAGLIISEATIIRPDAQGYPNTPGIFTQAQIAGWRKVTDAVHANGGKIFVQLWHTGRVAHPHFFGGGDVLAPSAQKIEGSVPRMRELTYVTPKAVTVEDIQGLVRDYAKAAENVIEAGFDGVEIHGANGYLIDQFLHHDSNRRTDEYGGTPVNMSRFALEVVDAIIARIGHDRTGLRISPGAYFNMASDSRDRVVFDYLLPELEKRDLAFVHIGIFDDSIEFDYLGGTASSYVRAHYGKTLVGVGSYSAETASKAIAEDKFDLIAIGRPFIANPDYVAKVRNSEELVAYSDEMLASLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural dissection of Shewanella oneidensis old yellow enzyme 4 bound to a Meisenheimer complex and (nitro)phenolic ligands.
pubmed doi rcsb
source organism Shewanella oneidensis mr-1
molecule tags Oxidoreductase
molecule keywords OXIDOREDUCTASE, FMN-BINDING
total genus 141
structure length 354
sequence length 354
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4b5nA00
3T78A 3DHDA 1HUVA 3E12A 5C54A 3W22A 3KX6A 1YYAA 1JCJA 1WAUA 3LX9A 3MP5A 4MOZA 5C2XA 1VPXA 3LXBA 1K7EA 1Z44A 3Q94A 1QFEA 3EXTA 2B7PA 3LV5A 1X8FA 1TRIA 1SSGA 3GZ3A 1BTMA 4JDBA 2ZQ0A 1W8SA 2QJGA 3W7EA 4JTUA 1F2JA 4JTSA 5F2MA 1WOAA 1H7WA 4I9AA 1AW1A 3NZ1A 3EWYA 4LNYA 4DF0A 2DORA 1NF0A 2W6RA 2TPSA 4ZQMA 3DFTA 2QJIA 2DZPA 3NNTA 1ZJIA 3PUDA 3HGJA 3GNDA 1OJXA 1GPWA 4MJMA 2QCDA 5HWMA 3RLUA 2HS6A 1WA3A 4LVFA 3C2FA 1RVGA 3E02A 3PBUA 4Y8FA 1LZOA 3FYPA 3SI9A 1AK5A 3W7PA 2HSAA 3PF3A 2A7NA 3R5EA 3CLMA 2ZFAA 1VLIA 1PVNA 4RCXA 3G8EA 5I3JA 3DZ1A 1TPC1 4FNTA 4KWVA 5AHMA 4MLRA 3N9SA 4OBTA 4OQVA 2BLEA 5LNRA 4JTEA 2VOMA 3CIWA 2NLIA 3PUEA 2DJXA 2XFWA 4YLWA 4LT9A 4UTLA 6ALDA 1OX6A 1FCQA 3NL6A 4I7UA 5D32A 1K8YA 4DPQA 1H1ZA 3UQNA 2ZTJA 4WX2A 3G3DA 1HL2A 2OT0A 2UV8G 4JTJA 4FX8A 3DFQA 3MI3A 5EL1A 4UTTC 4M6QA 3W23A 3MI2A 2FPVA 4AB4A 3WJYA 1OF8A 2QJHA 2NXGA 1QOQA 3HO8A 3FLUA 4R53A 3FEMA 3TFXA 5D2XA 1LOQA 1W3TA 4Z08A 3GVGA 1DL3A 3HIJA 1WBHA 1Z42A 5TBOA 2AAMA 3TCEA 2DZXA 3PB2A 4MYAA 4JDYA 3I68A 1OFOA 4O16A 3M9YA 4AH7A 4S1FA 1T96A 1A50A 1PCWA 3KRUA 4G1KA 3E96A 5KITA 1LBLA 3H55A 1OFPA 4HKPA 2ZRVA 2Q3OA 2JKAA 3OVQA 3EX4A 1B4KA 4TMCA 4HSNA 2QUTA 1GZGA 1MEIA 4FX6M 3A5FA 2YCEA 3JS3A 3KFTA 4CNPA 3W2UA 1ML1A 3KOFA 4Z0JA 1YXYA 3R8RA 2VXNA 5MHBA 3NQGA 2WJZA 1LROA 2E5BA 2VFIA 3LCGA 3QSTA 2PURA 3PG9A 4IX0A 3DFOA 5CPNA 5CPLA 3UPBA 1SW7A 3UWYA 3W1LA 5E93A 3LBMA 3L0KA 2VFGA 3P82A 3L5MA 2PRMA 3GAKA 3W7OA 3PAJA 1BWLA 4BI5A 2JKEA 4WOZA 2FLIA 3LCLA 1GQNA 2YX0A 5A5WA 3P67A 1M7OA 3JRKA 4DPPA 1JCYA 1DBTA 3C2OA 2ISSA 4UFHA 4NNCA 4ORMA 3OBKA 4NT0A 1SQ7A 2EHHA 1W56A 1YDOA 5CSRA 2ISWA 2Z1BA 3O15A 4A22A 4TIMA 3JR2A 3Q37A 3DKLA 3W07A 2LLEA 4HT3A 3G8RA 5CGQA 4DO4A 3U6WA 2P1FA 1TTIA 2CWNA 1JUBA 4GJ1A 1K02A 4UTJA 4EF9A 3F1QA 1TREA 3UZ5A 4TR9A 1M7PA 1N7KA 3HGSA 2H8XA 2FQIA 4KFOA 2I1OA 3BLEA 3INPA 1GTHA 2WSRA 4WJEA 4A3UA 2ZZ4A 5EA9A 2GJLA 2P10A 3PG8A 3F4NA 4PEKA 2F7FA 3GKFA 3T55A 4UFMA 3LI0A 1KM3A 2ZYFA 3C56A 3CEPA 2ZRYA 3ANYA 2ATMA 5EPDA 2A85A 5U4NA 3PR2A 3TQVA 4O28A 2ABBA 3LCFA 4N4QA 1KBJA 2V9DA 3CTLA 4CLMA 1JVNA 4FIQA 3SW6A 1G7VA 2YR1A 1XXXA 3CB8A 3MHGA 3P5ZA 1N55A 3P80A 2C14A 3E49A 1R47A 4RZ6A 1ZENA 1S5WA 5CG7A 5IBXA 4JGDA 3UWUA 4FNSA 1VYRA 3HPZA 4N9CA 3LHTA 1AW2A 1NF7A 5DLCA 1UCWA 3IIVA 3LCHA 1YPFA 3H53A 3BPWA 5CZSA 2NWSA 5G4EA 1Q6OA 3W3OA 1OVDA 4DO6A 1ZALA 3HG2A 1UUOA 3TROA 4LUJA 4FB7A 5I3FA 1R46A 2YW4A 2RFGA 1GG1A 3HBLA 5G4WA 4RX0A 3BW4A 3DI0A 5T26A 2ZDRA 3TAOA 3W7RA 1SZEA 3DXIA 4Q32A 4MKNA 3A21A 2CZDA 2PE4A 3TSMA 2XN2A 3P5YA 4A29A 2C1HA 1GYLA 1LBFA 3UXDA 3L21A 3GNNA 2OMAA 1LP6A 2C0AA 4JTLA 4C1LA 1VCFA 4XTIA 5AHEA 4P2VA 4ICNA 1K3UA 1FWRA 1KM0A 3A5VA 3CM4A 5HINA 4UC5A 3I65A 1FQ0A 2KZHA 5DN1A 3FJ6A 5U7SA 2YPIA 3SGZA 3NQ2A 3W1XA 4KFPA 5SWUA 4QIUA 1SW3A 3BW2A 3C2EA 4UMBA 3W2MA 3DFSA 4FNRA 4N02A 3STCA 1G4PA 3NQVA 1XC4A 1TPH1 5G1YA 1LRQA 2WPBA 3IIPA 5E0KA 4JS3A 2ZRZA 4DF2A 1CI1A 1VH7A 1HO4A 2JK2A 4UFJA 4DEFA 1VQTA 2VELA 3DI1A 3R13A 4MJZA 3L2IA 3TMLA 3G1HA 3UWWA 3HG3A 1LORA 4I7WA 2QF7A 3A24A 4E38A 2GVJA 5LNUA 2YFNA 1Q6RA 4JR5A 1SFJA 2Z0IA 2ZRXA 5F2IA 4NX5A 1OK6A 2QUUA 2E5DA 1SZNA 1PIIA 2NX3A 4O54A 1H62A 4RV8A 3SECA 5FEPA 4X9SA 1UBSA 4IJBA 3S8HA 1IGSA 4GRSA 4L4LA 5AC6A 4WQ6A 4JXCA 1RPXA 4N2YA 3W76A 1QWGA 2QKFA 3LHUA 4RZ5A 2QCLA 2YGYA 5DCEA 4N4PA 1KV5A 3UWQA 4OU1A 4N6FA 2C18A 1SO4A 3NPUA 4LWWA 2E1DA 3DKJA 4HSOA 4O17A 1Q3NA 3Q2DA 1B3OA 3M6YA 2V2DA 3M44A 1OG0A 2QCGA 3S0CA 4C1KA 4GUGA 5FF3A 1J2WA 4BI6A 1YLVA 5HMSA 1YTEA 2YSWA 3TIMA 2YYTA 3UWZA 1EP1A 3L5AA 2JKPA 5D30A 1W54A 2Y7DA 3L67A 1VLWA 3HF3A 2VEMA 4O8RA 2DZTA 1P5BA 5K9CA 1OFRA 1Q45A 4NNAA 3MHUA 1SU5A 5G2WA 3MHFA 1H63A 2G97A 5IM51 3IIXA 1AL8A 1QPOA 2A0NA 3GXTA 1SR9A 3ZWTA 4LRSA 5I3HA 2CZEA 2QCCA 5K7JA 5CZJA 5IBXC 4Z1BA 3N19B 4J9JA 2B7QA 3PSWA 4NJHA 1VYPX 1QR7A 1JUKA 1DHPA 3M43A 4NJIA 3IVUA 2GQ8A 5EBUA 3W7KA 1FY6A 2G95A 4NXSA 1LLWA 4M6PA 5AYZA 3NQ8A 1XBZA 2YZRA 1EWEA 1KW1A 1YTDA 2A4AA 1T8XA 4XWUA 1W5NA 3ELFA 4FEZA 1AG1O 2DJLA 3GKAA 4S2CA 3B0UX 3C0JA 3TW7A 1EB3A 1OFQA 1L2UA 1FXQA 5F4WA 2V5BA 5EYWA 1L6SA 2FB2A 3NL2A 4JX4A 3TH6A 5KMYA 5AHIA 4LTSA 4JD4A 3QJAA 4AEOA 4FXSA 3ATZA 4AAJA 3M41A 4DBDA 4R7JA 2PRHA 3EWXA 1VZWA 3VE7A 3GB6A 4AXKA 1WXJA 3S1VA 4K36A 5H91A 2R8WA 4UFKA 1XCFA 3SJ3A 4AHOA 4ONVA 1G69A 2V8ZA 3SR7A 5DCBA 3LXCA 1V5XA 1IXNA 2WV8A 3RK8A 1QO2A 5LNVA 4QJ1A 3SY5A 5TQLA 2DZSA 2E68A 3STFA 2WO5A 1OFEA 1V7YA 3NQDA 2I9EA 3LDVA 1TV8A 4ML9A 4JTKA 1JUEA 3HGRA 3KVKA 2FPYA 2Z6JA 4GXMA 5LSMA 5AHNA 4Y9AA 1JQXA 2OZ0A 1LYXA 4QITA 1X1ZA 4LVBA 3FA5A 4YCPA 4NJKA 3PULA 3QPZA 3S5OA 5BNKA 4WXZA 2ISVA 3QMTA 3ZWSA 3C3NA 5KINA 1F7BA 3NVTA 3LHWA 4OGZA 5LGXA 4HNUA 2CLHA 2OX1A 3UPWA 2YXGA 1DV7A 2EAWA 3F4WA 3VNDA 4K39A 1OABA 5F1UA 2VEIA 4FX7A 5DBTA 3NQAA 2GQAA 2W79A 3SZ8A 5G2HA 4RK8A 4LV9A 1TJRA 3MJYA 1TTJA 3BG3A 1KV8A 4KWWA 3UYCA 4UTKA 1RR2A 4N9BA 3UXAA 3S1UA 2CLOA 1GYNA 3TU9A 2WNNA 4HNTA 3VCRA 2ZZ1A 3I7RA 1TCDA 2DU2A 3C6CA 1TQJA 3TA6A 3A22A 3PBYA 4GE8A 4HNVA 3UD6A 3EXSA 7TIMA 1KFBA 3NGJA 2NXHA 1I2QA 4JX5A 3IGUA 2Q8ZA 3O6YX 1XL9A 5K9XA 1NVMA 1PCKA 3W1TA 1IF2A 1XBVA 1FCVA 1XFBA 1JRBA 5K4ZA 4MY9A 3TK7A 5FF2A 1VHCA 4WY0F 2FTPA 2QAFA 3R12A 4QNEA 4UFIA 4UTMA 2ZTKA 3LLDA 3NPVA 3OG3A 2A5HA 3ATYA 3THAA 4Y96A 3IVSA 3M16A 3QSRA 4QSHA 3W86A 4R33A 3W6YA 3W1RA 3FFSA 3FKKA 1H50A 1VS1A 4BWLC 2OCZA 2QDHA 2NX9A 3MP3A 3UNDA 3S9YA 3EWUA 3R89A 5LNSA 3EEGA 2CLFA 2VFHA 3EB2A 1TPFA 3IEBA 1FDJA 3DAQA 3L68A 3LBCA 3NQMA 1FWNA 3HB9A 1TPUA 1JCMP 3W7LA 1Q6QA 1SO6A 4YL2A 2ZCGA 4O1CA 1XKYA 2TMDA 4AF0A 1OYBA 3NYZA 4ADTA 3BGGA 3C2VA 2EKCA 4Z1AA 4XBKA 3P8IA 3W74A 1ZCOA 1SO5A 4JIQA 3QFEA 3TSBA 4Q4KA 3MUXA 3STGA 1WX0A 5K4XA 1FWWA 4IQLA 3MMTA 1WBJA 3G1FA 3TC6A 3W7JA 1TTPA 3T40A 2E6AA 1B57A 3QQ0A 1EPXA 3LTPA 4ZQOA 1GTEA 3M0ZA 3P8JA 3BGJA 4FHAA 1GVOA 4ZQCA 3OEXA 3KRZA 3G18A 1VGAA 4O14A 5F4XA 1ALDA 1W5OA 4FNQA 3CEUA 1P4CA 1OFBA 2CZFA 1R2SA 3C61A 1LCOA 3MP4A 1YDVA 4UMCA 3G24A 1PV8A 3TXZA 4GUHA 2NZLA 4DF1A 4E2DA 3VKJA 3QH2A 1KM5A 5EKYA 3LRKA 1DQXA 3IVTA 3N2MA 4GFSA 1OX4B 1QNVA 3TFCA 5E1QA 5G1TA 2X30A 3C2RA 1VYSX 4NVTA 1X1OA 4IMFA 1F6PA 3W70A 3O1NA 4WXYA 2RHGA 3S5NA 1R2TA 1FCUA 2B7NA 1EX5A 1OF6A 2V5LA 4NX0A 1L9WA 4MZ1A 3LLFA 1VC4A 3T4CA 1EIXA 2WNQA 4JYEA 4LS0A 1L6WA 3B4UA 1WYIA 3C4UA 4OV4A 1WDWA 4LVGA 3EKZA 4UTTA 3PM6A 2GVGA 3GXPA 2ZZ7A 4PODA 4WY0A 1AMKA 1IXQA 2H8ZA 4BF9A 1X6UA 3NQFA 4YWIA 1KFJA 5HUPA 4UR8A 4P61A 2DZUA 2QDGA 3ABSA 1ICPA 1H1YA 4JNMA 1C9DA 4O18A 2BWGA 4XKYA 2ZZ6A 3FYOA 1LM1A 4U4MA 3TX9A 4O57A 5CSSA 4E2BA 4MLJA 4LOCA 1S5TA 3G1DA 4O11A 3RLVA 2X16A 2C15A 4PCFA 4FO4A 2BSLA 4RKAA 5FEZA 2R94A 3WK2A 3O8AA 1RQBA 4Q33A 1QPNA 3W7HA 3RF9A 2HS8A 3FS2A 3HPSA 4FNPA 3M7WA 2F84A 1DQWA 1Q6LA 5HJLA 5HQEA 4A2SA 3QYQA 2H3BA 3GDMA 3W84A 3S5ZA 4UIOA 1H7RA 5AN7A 3UY7A 3TQ0A 3ZR4A 3W1UA 4FIRA 5F1VA 4DBEA 1QPRA 2VEPA 5HUOA 1GVRA 1LOSA 5EY5A 4WOQA 5ABTA 1SZFA 3ZS4A 1MO0A 4NNBA 3TJXA 3W2JA 3W7DA 1BEUA 3LRLA 3EX1A 2J9ZA 1K7FA 3ABOA 3NG3A 1RD5A 3NPWA 2G5WA 3OVPA 1MSSA 3L5LA 3F03K 5DELA 1EP3A 2PRLA 3NOEA 1UJPA 3GDRA 2R91A 4IPJA 3THQA 3QPYA 1XBXA 1RZMA 3P62A 4IMGA 3W2NA 4OT7A 1EEPA 3BV4A 1B9BA 2O7SA 4B5NA 3MO7A 4PA8A 1I2NA 5A8GA 2R14A 1I4NA 3W87A 2A6LA 1AL7A 4UTUA 4UNLA 4ZQPA 3EX2A 4RXGA 1W31A 2OT1A 1ME9A 3CU2A 3LOTA 1H7OA 3KRSA 1VHNA 4PL1A 1SZGA 4TU1A 1KFKA 2QCHA 4OV9A 2CLLA 1Z48A 3W71A 5LZLA 4UTWC 4HIBA 3B0PA 2E6DA 3U2OA 3W72A 4NJJA 3W75A 1QCWA 4QISA 2ABAA 5FF7A 1QAPA 1SFLA 3O07A 3WK0A 1H7XA 2TYSA 2Y63A 3IGXA 3NM3A 4LC8A 3IIZA 1KBIA 1CW2A 3NA8A 1H7NA 3LGEA 3LCXA 4IMDA 4M7TA 4UCGA 3N2XA 4CCDA 4NXKA 1U83A 3WK3A 1FDZA 1H7PA 1OK4A 4DQWA 4UNKA 1EWDA 2IQTA 1QO5A 3QMSA 3SSJA 1I2PA 3IGSA 1J5TA 1OFDA 3M5XA 1QMLA 2DP3A 3KAOA 3W2KA 3HGOA 3CWNA 4HN4A 1DOSA 3N34A 1VCGA 5I3KA 4BWLA 1L6YA 5GVJA 1JQVA 1K8ZA 5HNRA 4N6EA 2VFFA 1T0OA 4HPXA 3W1PA 2X1RA 1TPDA 3G0XA 4QAIA 3NQ6A 2FFCA 4K7VA 2QUVA 3G0UA 4MFEA 1YXCA 3BLFA 3IIOA 3MWAA 3LCWA 3CIXA 5G5IA 2ZA3A 2C3ZA 3BLIA 2WOQA 3UWVA 1TPB1 1DKWA 1HTIA 2A6NA 1R30A 4HHPA 3ABQA 3C52A 2GVLA 2WKJA 5F2LA 3M5VA 1DJQA 1ZFJA 4PFMA 5HWNA 2HTMA 3UZJA 3GDTA 1R2RA 4ZZ9A 1O5KA 1SSDA 3LM7A 1TB3A 3GLCA 3O05A 4JN6A 2GPTA 1D3HA 3C8FA 1ME8A 4DO5A 2BXVA 3GX9A 3BG9A 4LVDA 4TMBA 1G6CA 4LVAA 4BFAA 1IIGA 5KSWA 2A1YA 2E77A 2CFFA 2QEZA 3PBVA 1KFEA 1G4TA 5KZDA 3LXAA 3QC3A 1E51A 4CNNA 1ZAHA 3EX3A 4FXRA 2V0TA 5D38A 1C8VA 2H3DA 3QZEA 3PUOA 2B7OA 3H54A 4XBSA 4XKYB 3S6DA 4Z1CA 2X1UA 3S5YA 4AHQA 3O63A 1H61A 3AO0A 3MYPA 5D2VA 1TQXA 3U8GA 1XUUA 2TRSA 5D02A 5CKSA 1KTBA 5D37A 4Y90A 5D05A 3B0VC 4TO8A 1FXPA 4IMCA 3QRHA 1GVSA 5AOUA 4IX2A 3NM1A 4POCA 3NEVA 4LU0A 1UASA 2FJKA 4JY9A 4JYDA 5LGZA 3A23A 4JICA 4LUIA 3GIYA 3O16A 1OFAA 4N9EA 1F73A 2ZZ5A 4LC6A 2ZBTA 1MEHA 3DU0A 3B05A 4K37A 5C5YA 3KVLA 4IGHA 2ZA2A 3DGRA 5H2ZA 4JTHA 4R34A 5DY2A 1W3NA 5BMWA 3S42A 2QCDB 2WQPA 4MZ8A 1LBMA 1ZAIA 3DFNA 3LHZA 5D2TA 2A7PA 2W0UA 3HOJA 1NFBA 3KVMA 3P60A 1F76A 3HPXA 3IRDA 3CWOX 1MEWA 3BVJA 1A5SA 3TUUA 1IXPA 1A5AA 3V1PA 1FBAA 4X2RA 4RJEA 3SGUA 5C6MA 1K03A 1JCXA 4ZVJA 1KTCA 1YTKA 2CW6A 4K6AA 1WOBA 1C29A 1PL9A 2Y62A 4AWTA 5I3GA 4IUOA 3WJZA 3P74A 2CLMA 4PL2A 3CC1A 2GOUA 2GJNA 2FB3A 5BW6A 3RFAA 1T99A 5AHFA 1KM1A 3NXFA 4JYFA 4H4IA 4NQ1A 2WSYA 3GR7A 5HR6A 3NAVA 1KA9F 1LRNA 4FF7A 4MIMA 4IWWA 5KZMA 1A5BA 1MZHA 3NPXA 1F74A 4JTTA 2ZZ2A 3DENA 4GWEA 3STEA 1EA0A 4O4VA 5BRBA 2J27A 4BR1A 4CNOA 3GYEA 3EKLA 2Y61A 1I2OA 1XBYA 1U5JA 1H51A 3W85A 1RQEA 3W2LA 4AWUA 3HG4A 5BOOA 4KFNA 3SIZA 3TQKA 3W7CA 3NO5A 1K7XA 5AB3A 1Y0EA 4GUFA 1S5VA 3P84A 4Z1DA 5K2ZA 3GDKA 1NEYA 3TW6A 5LHFA 1TPWA 1KTNA 3IV3A 5G2IA 2OJPA 1GT8A 3PSVA 1VCVA 4MY8A 3PS7A 3QEZA 4GNJA 4X22A 5BMXA 4O13A 4JX6A 5FF4A 1MXSA 3L0NA 4LRTA 1A5CA 1P0KA 1YXDA 4MFDA 5CPOA 1SPQA 1THFD 1I45A 1QDSA 3G0SA 2RDWA 3L65A 2BTMA 4IMEA 1O95A 4QM1A 4YMZA 4DELA 2EGZA 3K30A 3TMQA 2X2GA 5D33A 2NUYA 2NWRA 3W7IA 5AYYA 3NR0A 3NQEA 4CCCA 2Y7GA 2DZWA 2HMCA 4RXFA 5HWJA 1O60A 3LI1A 6TIMA 2AGKA 3W7MA 4MY1A 1DJNA 5AHLA 5CZTA 4ADSA 1JCLA 3KVJA 4IOTA 1G7UA 1G4EA 3TKFA 1SW0A 1W0MA 1GWJA 4AMAA 3W1QA 2V2HA 2QR6A 3LTYA 3GXNA 1DORA 2J9YA 2E6YA 4LV4A 3M1ZA 1RQHA 4EIVA 4MYXA 3HQ1A 4EVZA 1KFLA 1QPQA 4O53A 3O6CA 5KZEA 1ICSA 3FIGA 3P61A 3NDOA 2V30A 1H60A 1LRTA 4QQ3A 2G96A 3WJSA 3AJXA 2JGQA 2ZRWA 1M5WA 4YCOA 4JTFA 3HMJG 2VENA 4O19A 4K7YA 4RZ4A 3QW3A 4KKXA 1ZAJA 5DY3A 1I8JA 1KM2A 1H5YA 4N9DA 1TIMA 1ONRA 2DZVA 2BX7A 2VKZG 2J6XA 1OX5A 2PCQA 1XUZA 3PY2A 3G1SA 3I6RA 1TV7A 1KM6A 4QNWA 1N8FA 4O15A 3WK1A 1FCBA 4O0ZA 4OHQA 3W1NA 4EOUA 3RMJA 4IXXA 4BI7A 3USBA 4I7VA 1BWKA 4XTDA 1S3HA 3LCIA 4UTHA 2NXIA 3S1WA 4JEQA 3TC7A 4M7SA 2GQ9A 1NSJA 4NU7A 4K8EA 5DXYA 3MBFA 1W5MA 1JR1A 2Y6ZA 4ALDA 2NX1A 3UY8A 3PBWA 4W9TA 1D3GA 1O5XA 4CQ9A 1HFBA 3EX6A 4FNUA 1ME7A 4NUWA 1TV5A 3PB0A 8TIMA 3CPRA 5F2GA 3NZRA 4UFLA 2A7RA 2H90A 3G1VA 4O0KA 4M5PA 5D04C 3W1AA 2ZRUA 3P7YA 4NZFA 4AHPA 2V2CA 1B4EA 5HR7A 4UTIA 4WUIA 2A21A 1FUYA 1TTQA 3GAYA 4K8HA 4XUGA 3QM3A 4EF8A 2ATSA 4CCEA 2PC4A 3BARA 3DFPA 1J4EA 4PC8A 4JY8A 2QCNA 3B06A 3DH7A 3GK0A 3N3MA 1YADA 2Q3RA 3KHJA 4S2BA 5D2WA 1FX6A 3CHVA 4K38A 1TPVA 4NZJA 1PS9A 4Z0SA 2C6QA 1JRCA 3NL3A 1WV2A 1GJPA 1ZHAA 1EP2A 1AW5A 5LKYA 4MPQA 1W37A 2Y70A 3TDFA 2GUUA 3RU6A 4O1AA 2B0MA 4O1BA 5CPMA 1TSIA 3OVRA 4RR4A 2Z6IA 4YXGA 3N73A 5FF0A 1F6KA 2Z2UA 1D9EA 2C19A 4RLIA 3G1XA 3GDLA 1FWSA 1TO3A 2BZNA 1ZY9A 4ORIA 1LLZA 1SUXA 1TYGA 3FKRA 4BK9A 3B8DA 4ZQNA 3TXVA 4GC4A 5CZ0A 1GG0A 1Z41A 3LHVA 2J88A 2NV1A 2E09A 1LOLA 2FDSA 5AYXA 2AQWA 2XN1A 4WD0A 3VI2A 2X1TA 3OHIA 1OYAA 1OHLA 3OA3A 4Y6GA 2CZ5A 5KTLA 3EWZA 2Y7FA 2CLIA 1TMHA 3I7SA 4X3ZA 5J5RA 1BKSA 4UUIA 4MUZA 4CQAA 3V75A 3BO9A 3WJWA 1F5ZA 2Y85A 1ICQA 1A53A 1LTDA 1VRDA 5DCDA 3OIXA 2Q8LA 2CU0A 5TIMA 3WFAA 3LTSA 3W83A 1RV8A 2RKXA 3SFKA 1G4SA 1HO1A 2V82A 5DBUA 1KM4A 1I2RA 2J9XA 1JCNA 3EWBX 2ALDA 4XQ6A 3BW3A 1GVFA 3GR8A 3CQ0A 2NUWA 1XDMA 1OYCA 4EWND 3W9ZA 4WZHA 4AF0B 5D09A 3QMRA 4JIPA 3M5ZA 3TE9A 4CQ8A 1O4UA 3TNOA 1NAL1 1UB3A 1EUNA 4O4WA 1YDNA 3DHFA 4DXVA 3L9CA 2VFEA 5F4SA 3B04A 2A2IA 1M6JA 3G1AA 3PC0A 3PVFA 3QQ1A 3EXRA 5EMUA 2Y88A 3B03A 2YDAA 3TJLA 4NJGA 3M5YA 1X7FA 4GUIA 4O10A 4LW7A 1VJIA 3MI6A 1TPEA 2C16A 4OE7A 1SO3A 1HG3A 1W3IA 3A9IA 2RDUA 1KLZA 3I7QA 4MZYA 5L9FA 5J5DA 3YPIA 5LHEA 4M6VA 2WSQA 4O12A 1P1XA 4A2RA 5HULA 3T7VA 5D03A 5AC7A 2NUXA 5AFDA 1EUAA 4MVAA 4D2JA 4U28A 3D0CA 1WQ5A 1KFCA 2QAPA 4TX9A 5FEWA 2FPTA 4GBUA 1FWTA 3G1YA 3FOKA 3G3MA 5K3VA 1PE1A 4UXDA 3EWWA 4WY0B 3DBPA 3N14A 1GEQA 1UUMA 3BK0A 2JGYA 2JBMA 3MBDA 4JTIA 3PWAA 1IXOA 2O7QA 2NV2A 3VE9A 1W5QA 2RDTA 1W1ZA 1ADOA 1FDYA 3L66A 4JTGA 4PH6A 3O06A 4ZL1A 4H3DA 3CT7A 2WNZA 5I3IA 2EPHA 1TRDA 3M47A 2C13A 3LERA 1PHWA 2QCFA 2E5CA 3W88A 4LY8A 2RH9A 1XM3A 3LHYA 2ZA1A 3BG5A 1F05A 4PTNA 2YW3A 3S1XA 1IIHA 3ZFHA 4OWGA 4ADUA 5FI8A 3G22A 1DVJA 1YPIA 3W1MA 5FESA 3Q58A 1CX9A 1TJPA 5L6UA 1JJKA 4IPIA 2V81A 4UTWA 2VEKA 2VFDA 4O52A 3QW4B 1JULA 1K8XA 3LRMA 4XZ9A 1KLYA 3O6DA 4GUJA 2TSYA 4O1DA 2I14A 3RNDA 3W7NA 3KXQA 2Y89A 4AVFA 2VC6A 4L4MA 2CLEA 3VFLA 5D2YA 5K9DA 2YYUA 1GOXA 3TAKA 4LS1A 5LNWA 2QCEA 2CLKA 3E0IA 3ABRA 3NL5A 3W73A 2YFOA 3NQ7A 4IXHA 3TR2A 4E0CA 4H6KA 1W5PA 3T44A 3HJZA 3MYOA 5FEXA 4A21A 3L0GA 3LB0A 3W7QA 2X1SA 4ZMGA 1OX4A 3N9RA 3NQCA 2Y7EA 3W7GA 1P0NA 4O50A 1XI3A 2QCMA 5AC8A 3WJXA 2P0OA 2FIQA 2EF9A 2J24A 2ZZ3A 3TSDA 1LDCA 1XDLA 3R2GA 2E6FA 3P81A 3FJLA 4HNNA 3MW7A 3E9AA 4LS2A 1GVQA 2D73A 1G67A 1VR6A 2B4GA 4UMAA 3HG5A 2XN0A 1ZNNA 5DXXA 3TV8A 1PHQA 4HPJA 4AWSA 5C55A 3QF0A 4ZQRA 4UR7A 1QOPA 3LV6A 1O94A 2H6RA 4M19A
chains in the Genus database with same CATH superfamily
3T78A 2AQVA 4PYSA 3MU7A 4WF7A 3FY1A 3W22A 2UY2A 1IR2A 3FHAA 3LX9A 2E67A 1K7EA 3ES7A 3EA1A 3EXTA 4PEEA 3LV5A 1X8FA 3H7RA 1TRIA 4IPPA 3GZ3A 4ICCX 1ZQ5A 3IJLA 2ZQ0A 4R7OA 1XH1A 1WZMA 3W7EA 4K68A 3UJRA 4TXEA 4FP1A 5FJOA 4DF0A 4EX4A 2DORA 1NF0A 2GGGA 3F2BA 3MPGA 2XDFA 1RJPA 2XSXA 3HGJA 4GY7A 3GNDA 2JEQA 4MJMA 2QCDA 2HS6A 3S3GA 3I6TA 4WHBA 2FHBA 4QLLA 3E02A 3T4WA 3ZJ8A 3PBUA 1CT5A 3SI9A 4LNCA 2HSAA 3PF3A 4Q4RA 4W7VA 3CHCA 1K8CA 2ZFAA 3WLSA 4L7ZA 3UR7A 3LGDA 3VOJA 1HGYA 4A8IA 4KWVA 2A3CA 4NZ4A 1ZL1A 2G3JA 3N9SA 3W24A 4OQVA 3QKEA 3WD3A 4CD5A 3PBGA 2FZ9A 1S1PA 4YLWA 1SVDA 4UTLA 4Y2WA 2GFTA 4B2DD 3NL6A 1IZCA 4I7UA 1K6AA 5AECA 1K8YA 3DHPA 2DQXA 1H1ZA 1UD4A 3UQNA 4GZJA 1W1B1 4JTJA 3MI3A 3CUIA 4UTTC 2WMJA 3WH9A 4TOQA 3QXBA 1D2KA 2AKZA 2IKHA 3FLUA 4R53A 3SIMA 5XINA 3TFXA 3GVGA 1XIBA 1RHCA 3HIJA 1WBHA 2AAMA 2DZXA 1DXIA 4C7DA 4WK9A 4LH8A 4S1FA 4KT2A 4YTTA 4PBEA 4Z2JA 3KRUA 1B30A 1LBLA 5FAJA 1K77A 4HKPA 4DI8A 2WC4A 3ITXA 1PKMA 3EX4A 1Z3NA 3PZNA 4TMCA 3BLOA 4HSNA 2QUTA 1WXZA 1GZGA 1MEIA 2J79A 3AUJA 4FX6M 5LIKX 2HJPA 1AFSA 2YCEA 3JS3A 3KOXA 1J0JA 2XVPA 3DBNA 4Z0JA 1YXYA 3NSMA 2C79A 3R8RA 4WGHA 1LWIA 3SQSA 5MHBA 3NSNA 3QSTA 3TLQA 3PG9A 2XIIA 4IX0A 4Y9NA 1GVYA 3GVVA 1F4HA 2VO5A 3UPBA 1SW7A 4LSBA 4F3HA 3C2YA 2HDJA 5CC6A 2VFGA 3P82A 3FVMA 1IEIA 3ZR5A 4JTCA 1EJSC 4GZEA 4BI5A 4WOZA 4OOZA 1E40A 1GQNA 2YX0A 4GXPA 3JRKA 4GNKB 3CHFA 1F8IA 4H9YA 3ARVA 1W56A 1VFFA 1ZCCA 3S9ZA 3O15A 4ZO6A 3PNZA 1N82A 4A22A 1ODUA 1AJ2A 3W07A 3CUZA 1XYBA 2LLEA 3G8RA 4DO4A 1DP0A 2CWNA 1MXGA 4GJ1A 3PTMA 4UTJA 1PIGA 1OT2A 4AZHA 3UZ5A 1I0DA 1OGSA 3WQ4A 3INPA 1CBGA 5BXRA 1VFHA 3EBVA 1KGWA 1VFMA 3MCMA 1AH4A 4W8AA 1C8XA 1US3A 3F5KA 1EDGA 1E1EA 4UFMA 4PBFA 3THDA 2D22A 2ZYFA 3FAWA 3VYLA 3CEPA 5EPDA 3VKBA 2A85A 2BY2A 4NYYA 1T6MA 3NO3A 2ABBA 4N4QA 3FDGA 3R10A 4FIQA 3SW6A 1G7VA 3OHMB 3VDHA 1JI2A 5AZ1A 3S1GA 2O55A 4Q8OA 1R47A 1MDLA 2EPMX 3WD0A 5CG7A 2PF0A 4PMUA 3B9EA 3TYUA 3GYCA 1VYRA 4E8DA 3LHTA 1NF7A 4ERIA 1GHRA 1KRAC 3WDIA 2VUYA 3RITA 3OLDA 3SCTA 4D8LA 3VNLA 3H53A 3BPWA 5CZSA 2VI0A 2BFGA 4DO6A 3W4RA 1ZALA 1J79A 1JNDA 1ISYA 2RFGA 5HDRA 4Q4SA 4A3HA 1F07A 1X39A 2ZDRA 4GK8A 3TAOA 3W7RA 1XSJA 3HFYA 2CZDA 2V6AA 3AS1A 2E1WA 1YBQA 1QRQA 1GYLA 4IIHA 1QT1A 3N15A 3VNMA 4E8CA 3ZQ9A 2OMAA 1LP6A 1U5HA 4JTLA 4DWSB 1PWMA 4C1LA 4XTIA 4G6CA 4C6QA 4P2VA 5HPOA 3I3DA 1K3UA 1FWRA 1V3IA 1QHPA 4JHOA 2Z29A 3I65A 2KZHA 2G4JA 1VBUA 4IHCA 1CZ1A 1VPYA 3SGZA 1PTGA 3NQ2A 4ATWA 4BS0A 2WNWA 3BW2A 3W2MA 2DPEA 3FA4A 1CENA 1XLJA 4FR6A 1TPH1 5G1YA 1S5NA 3POHA 1LRQA 3S46A 4D6FA 5H8PA 2Z4GA 3AMDA 4FOKA 1FWJC 4ILSA 1CI1A 3WNPA 1HO4A 1Q13A 4PB5A 4DEFA 4DUWA 3RRXA 3DI1A 2OZ3A 1M7JA 3KEHA 3TMLA 4AZGA 1W91A 4E38A 2GVJA 3PTQA 1E9IA 4NZCA 1Q6RA 2X7VA 2VD9A 4AWEA 1SFJA 2Z0IA 2GL5A 2PA6A 4NX5A 5I02A 4KH2A 1JZ6A 3IJQA 4HU8A 2ASHA 2PDJA 2NX3A 5M03A 4O54A 4RV8A 4WSKA 1MW0A 4MWAB 4L4LA 4XZWA 4N2YA 1UWSA 4B90A 2NQ5A 4C1NB 4RZ5A 2QCLA 2W91A 3FA3A 2YGYA 4JKMA 4MHBA 1U30A 3U2ZA 1RH9A 4US5A 3RM4A 1K9DA 4ZB0A 4D6EA 4LWWA 1J10A 2PCEA 4NAEB 4O17A 3N13A 2SFPA 1HN1A 3S0CA 2PSNA 3L4VA 5CPSA 2V3FA 1QTWA 4BI6A 4GKTA 3QC0A 4DLMA 1YTEA 3EDKA 3AMGA 2JKPA 4P8UA 4AVOA 2ACRA 3UGVA 2Y7DA 3HF3A 2DZTA 4HU3A 3MHUA 3THCA 1SU5A 5G2WA 5HJYA 2R1MA 2G97A 4C6IA 6PTDA 3XINA 1BYCA 4IIDA 4F0RA 1MRAA 3L4WA 4QJ5B 2WM1A 1BVZA 3GU2A 5CZJA 2PLMA 5FJJA 3R6IA 4BJHA 1HKMA 2VCCA 3GBDA 1DXFA 4RPPA 3U0HA 1CGTA 1XV8A 1YPXA 1X97A 1R9XA 2DSZA 1WZLA 2VYOA 1TCMA 3TYDA 4NXSA 4M6PA 3RMEA 3LPGA 4BQ4A 1XBZA 3GHTA 5BRPA 1W1IE 1YTDA 3ELFA 2D3LA 1AG1O 1EGVA 4ML4A 4HMCA 4F66A 3A6OA 2C7FA 4CCZA 2V5BA 1H09A 2A79A 4LTSA 3UNTA 4AEOA 4FXSA 4PRTA 4AAJA 3RAOA 3VGHA 8CGTA 4BQ2A 2Z7GA 4UFKA 5A6JA 3ONCA 3QHOA 1XP3A 5C2CA 3WF1A 5C8BB 3SR7A 3PJXA 5GJPA 1MQRA 3ZIZA 4B91A 1QO2A 3ZM8A 3KTCA 3CUXA 4QJ1A 3SY5A 3ZVHB 4AIBA 2WO5A 3IV8A 4S3GA 4ML9A 4GVGA 5AC5A 1J12A 3KVKA 6REQA 3WDRA 2DUZA 5LSMA 4LCRA 4Y9AA 7CGTA 3GNOA 1XHGA 2F61A 4YCPA 1SMAA 1ECEA 2XFYA 4YTUA 3ZWSA 4GINA 3QY6A 3DFHA 4HNUA 3W29A 2FTYA 4PUNA 3BCJA 3FW6A 2YXGA 5CBJA 4CVWA 3VNDA 1OABA 3UVIA 3KCLA 1E6SM 2YL9A 5DBTA 2W79A 3N2OA 5G2HA 1TJRA 2ZC1A 4A3RA 1Q7ZA 4TVUA 4UZUA 2D2OA 1RR2A 3S1UA 3LUTA 1MFUA 4PE8A 3CO4A 2CLOA 1WKEA 4GIYA 5BU6A 4Q4QA 3TEVA 5T9CE 5A8MA 1E55A 2WMIB 1TCDA 1MFVA 3TA6A 4AZBA 3EXSA 2QZRA 2NXHA 1UR9A 2OWXA 5K4ZA 3AXHA 3ARPA 3TK7A 1W32A 1VHCA 3BWWA 5HBFA 5D4YA 2RUSA 2ZTKA 3LLDA 3NPVA 1Z7AA 3IANA 2J7EA 4QSHA 3W86A 1QBBA 3CZ8A 3FFSA 5AVHA 3T0DA 4QE5A 2FHFA 1JZ7A 4HVXA 2OCZA 1NWSA 3EWUA 5M2FX 4JPGA 3RO6A 5B80A 3VDAA 2BOFX 3DAQA 3NQMA 4HJWA 1TPUA 3GXIA 2E0PA 3WNMA 2TMDA 2OEMA 4V1XA 3C2VA 2DW7A 1JXKA 1AMYA 1FRBA 2IPJA 5DFAA 3MUXA 3VINA 3STGA 1WX0A 1C8QA 1E0XA 3WH8A 1XLEA 3DFYA 1TTPA 2OGYA 2CHOA 5H6HA 2I16A 1GTEA 3M0ZA 3P8JA 2W66A 5TAOA 1B31A 4OUIA 1U1JA 3E0LA 1W5OA 4K1WA 4FNQA 1TR1A 5I79A 3AHTA 1OFBA 3C61A 3MP4A 1PV8A 2BVYA 3ALFA 1CIUA 3QH2A 4KWOA 1HL8A 3IVTA 1QJWA 3N2MA 2J7GA 4GFSA 3ORWA 5E1QA 2WHKA 1MDRA 3C2RA 4S3DA 3WQCA 3MUAA 1X1OA 1TUFA 4J3UA 4PUDA 4KBXA 1XYLA 4W93A 4DBSA 2PDIA 4B9ZA 1FCUA 4QP0A 3MV11 1OF6A 3LNMA 2VCAA 4MZ1A 1VC4A 3NQBA 3T4CA 1EGZA 4BZYA 1EIXA 2DY3A 1J18A 2C1IA 3WBWA 4LS0A 3RJXA 4OUEA 4ZFCA 3REQB 2R6OA 4IL0A 1S3TC 3PM6A 1JDEA 6TAAA 3GXPA 2ZZ7A 1JGMA 5EMLA 4U2ZA 1X6UA 4I9MA 1E6PA 5HUPA 4UR8A 3TONA 1NQ6A 1VFTA 1Y5VA 4O18A 2BWGA 3LY0A 3N2TA 4C5YA 3FYOA 1WCGA 1ZU8A 2IQDA 5CSSA 4MLJA 2X16A 1C7TA 1A80A 1S2AA 1QPNA 1C93A 3W7HA 3LSBA 2H9AA 3FS2A 4ATLA 4WRHA 4YJ5A 4A3QA 1Q6LA 3WX7A 2G3NA 1XLHA 3S5ZA 4UIOA 4S38A 3UY7A 4QDPA 3BCDA 1NOUA 4QROA 3IRSA 3UR2A 3DG7A 3W37A 4DXKA 4D1IA 4J40A 1SZFA 4JIHA 5ABTA 1GKQA 1MO0A 4NNBA 1KRBC 4XX6A 4PUKA 4LB4A 3OVPA 5HK4A 1MSSA 1DWJM 3OA5A 3L5LA 7PTDA 2OLSA 1EP3A 3UJ2A 1KGUA 2R91A 1EA9C 4B4HA 1TX0A 1TWWA 3QPYA 4IL2A 1UD3A 4IMGA 3BV4A 2O7SA 2WMHA 2HV5A 3PFMA 5JIPA 2PZNA 2PDPA 2YA1A 4HQVA 4BF7A 3LYEA 4JKKA 4L5ZA 3PZOA 5A8GA 2PS2A 4XZBA 1I4NA 1TFVA 3MKCA 4RE0A 5IOBA 3QTPA 4RXGA 1W31A 3KOYA 3KL0A 1XQLA 3LOTA 3KRSA 4PL1A 3MDUA 1V02E 1SZGA 3FNDA 1KFKA 2QCHA 4NP7A 4OV9A 2CLLA 5D9MA 4FLSA 4LUSA 2GVEA 1QHZA 1OD8A 4QISA 2ABAA 5IDIA 1QAPA 2GOKA 3O07A 1O68A 2TYSA 1OG6A 2Q8XA 1PZ0A 3IIZA 3NA8A 3LGEA 3A13A 3LCXA 4S3FA 1FP9A 4NXKA 3GNXA 1VEMA 3VXGA 1TKKA 4LAOA 2PDBA 1HW6A 3CIVA 4DQWA 3R8GA 2IPFA 2V3EA 5IHSA 2IQTA 3N3TA 4EXQA 1LT8A 3KWSA 1LQ2A 1ZPTA 3LD5A 1GKPA 3SSJA 3IGSA 4EP8C 1VJSA 4PFHA 2DP3A 5CPTA 4XSMA 1XLAA 1SZRA 1C9WA 5I3KA 3P2VA 4MNJA 1FFRA 2NQ9A 1L6YA 2YBUA 3RX2A 1T5AA 1TPDA 1SR0A 2PODA 3NQ6A 2FFCA 1ZSXA 2QUVA 2ZUTA 1YXCA 3MWAA 2BGQA 3CIXA 2ZA3A 4H8VA 3W6MA 1QASA 2FVKA 3ABQA 4ZOCA 3GUGA 2WLZA 2HTMA 3GDTA 1BTCA 5JU6A 1JYVA 1JIBA 3GLCA 4NIRA 4BF5A 4OTKA 4HOXA 4YU1A 3L2MA 2BXVA 4DN1A 2A1YA 3VZZA 1KFEA 3NEHA 4G7EB 4E4FA 4Q4OA 1E51A 3ARZA 3EX3A 4FXRA 2PDFA 2H3DA 1RCQA 3H54A 1GOOA 3SADA 1TZ7A 3M64A 3HZ3A 1ZJBA 4RE4A 1QI0A 5A6TC 3B9DA 2EPNA 4YN5A 2G50A 1XUUA 1XPYA 3EGJA 5CKSA 1KTBA 4UOZA 1JDCA 4UB9A 1MZRA 3OIHA 4M6UA 5ENLA 3DCPA 4IMCA 3U9IA 3WQVA 1AZ1A 1QXLA 4POCA 3NEVA 4LU0A 1WZAA 1HJWA 1UASA 1KKOA 3E5BA 2VJXA 3A23A 4GH3A 4J3XA 3O16A 4H9TA 1OFAA 5BRQA 1WZKA 3GNRA 2YBTA 4QBXA 2CHRA 4K37A 4Z2GA 5C5YA 2D20A 3CZEA 4YNGA 2W92A 4KEMA 4R34A 2WQPA 3DFNA 3LHZA 3M0IA 2A7PA 2W0UA 4H9UA 4QSFA 4S3AA 1WUFA 3KVMA 1F76A 3CWOX 1MEWA 1V6YA 4I5RA 3GG7A 2VDGA 2E9LA 3L23A 1H3GA 3V0SA 1REQA 2GUYA 4RJEA 4F40A 2PEVA 5JBFA 1KTCA 1C29A 3LBOA 2PDWA 1FHDA 2YLLA 1IYXA 2YCIX 4DYJA 1IGWA 2FB3A 3AYRA 1KM1A 4YS1A 1YNQA 1KA9F 3H2FA 4JTTA 3DENA 3N6HA 4B5XA 2PTWA 2XWDA 5BRBA 5JMUA 2CITA 2J27A 3OW1A 1I2OA 7REQA 1H51A 4C6BA 4ZENA 5IFTA 3G2GA 4GPNA 5AB3A 1XINA 1EQCA 2ZUUA 3HV8A 3P84A 4Z1DA 5K2ZA 1NEYA 3MKVA 3Q45A 1VEOA 5G2IA 4K1GA 1V3KA 4X22A 3VMPA 4O13A 4WKFA 3L0NA 2J8GA 4UTFA 3S2LA 2GJPA 3TYEA 3WUBA 3VKDA 1R85A 1MI3A 2BXZA 4X61A 3EA3A 4RUBA 1I45A 2RDWA 2D2GA 3VUPA 3L65A 2HISA 3WH7A 2EGZA 2BGSA 3TMQA 4IH3A 4RDWA 3VNIA 1Q8JA 2DZWA 3VDGA 4QHRA 5HWJA 3LI1A 6TIMA 3W7MA 5AHLA 3HV9A 4W7WA 1GJWA 3KVJA 4IOTA 4MUPA 1G4EA 2X0SA 1KC7A 3LNPA 1GWJA 3ABZA 2V2HA 1H1NA 3GXNA 1DORA 2J9YA 4GGBA 3CHDA 3OZMA 1L8NA 4IM4A 4H2CA 4O53A 5KZEA 1ICSA 2A3BA 3P61A 4W89A 2V30A 3HFTA 1H60A 1LRTA 3WJSA 1HJSA 1V0NA 3AJXA 4AZIA 3FK4A 3GQYA 1H5VA 2GSJA 5DY3A 4WSHA 3OTRA 2PDUA 3F4DA 4XSLA 2J6XA 1EYWA 3RRAA 1V02A 1DTNA 3G1SA 1WAWA 4LUSB 1RY0A 1FP8A 4QNWA 1N8FA 2J8TA 4O0ZA 1TVLA 3OLGA 4GKLA 3RX3A 4RPQA 2Z00A 4EOUA 4UQCA 1J2BA 4BI7A 1M9HA 4YWSA 4R9OA 1S3HA 1B90A 1E73M 1UZ1A 2GQ9A 1BD0A 3CUGA 5D8ZA 1PIFA 2ZVRA 3MBFA 4LAUA 4ALDA 2ZKMX 4V27A 1OWQA 1E72M 2A3LA 2DZBA 1XLIA 2ACQA 1CXFA 4XAZA 3MVTA 4CGTA 2Z1XA 1XC6A 2HBXA 1PB0A 1XISA 3KP0A 4WVXA 1V79A 2JF7A 1IWBA 1Q6GA 4DJFC 4NZFA 2V2CA 4NZ3A 2A3AA 1FUYA 3GAYA 4XUGA 2POTA 4GACA 1GCYA 2PC4A 3DFPA 1H11A 1HNYA 4ERAA 1YADA 3LZ3A 3AMLA 4D71A 1CYGA 2BODX 3CGTA 3QKZA 4K38A 4I9TA 2GSEA 2W9MA 2C6QA 2J62A 2J78A 1GJPA 2OU4A 3K4WA 3OLEA 5LKYA 4MPQA 1UKPA 4GO9A 2Y70A 3PK7A 3TDFA 4HMEA 1MRQA 3WBAA 4O1AA 2B0MA 2OO6A 1RK5A 2Z6IA 2VZVA 1VRXA 1LG2A 2C19A 4RLIA 3T42A 1Z89A 2E8YA 3B0XA 2GJXB 1E4LA 4ORIA 3WDPP 1SUXA 4BK9A 4ZQNA 3KL5A 4GC4A 5CZ0A 1GG0A 3VX0A 2E09A 2FDSA 4KRUA 5LA2A 1GVEA 3OHIA 1OYAA 2WBKA 3AIWA 1UQYA 4Y6GA 1FHUA 3QPEA 3EWZA 6XIAA 2FMNA 1TMHA 1WDDA 3GSMA 3URNA 1GORA 4UUIA 1EDTA 4DJFA 2REQA 1QWKA 2WCSA 1WP6A 1ICQA 1NM9A 1DIDA 5FKYA 2YL8A 3S6OA 5DCDA 2YIHA 1SJBA 2FKPA 1XIFA 4JCLA 2RKXA 4LYPA 3AHVA 4A8LA 1HO1A 2V82A 3IJ6A 1VBGA 3BL3A 4WGXA 3GR8A 3CQ0A 1JD9A 3AIQA 1ZJHA 3QV8A 2WMIA 5D09A 1I60A 3TCSA 4ZOEA 3TNOA 2OKOA 3LN3A 2V63A 3K1DA 2YCLB 3ZSTA 1UWUA 3T6CA 1YDNA 1BKHA 5IHRA 5I77A 1QHOA 5DMLA 3GW3A 1M6JA 1UR1A 3LPPA 5EMUA 4KEUA 3KCJA 4PTVA 1US0A 4NJGA 3M5YA 5LYRA 4D72A 1LJYA 1V0KA 3CNYA 3MI6A 3OODA 2C16A 2YDQA 2AL2A 3MUZ1 1OBAA 3A9IA 3V5CA 2W63A 4M6VA 4KMQA 5I5RA 1S2TA 4A2RA 4TVDA 4XK2A 5JH2A 4D2JA 3EMZA 4CNTA 3QGKC 4L9ZA 4N7QA 1BYDA 1KFCA 4TX9A 4H8NA 4ZODA 1B3VA 4CU8A 3G3MA 4FA3A 4UXDA 1RVKA 1PBGA 4MB5A 4ZOAA 3GFYA 2XH2A 3WUGA 1RY8A 2INEA 2JGYA 3LPOA 2O7QA 2NVDA 3VE9A 2CBJA 1FDYA 3L66A 2IKGA 3O06A 3XISA 3CT7A 1R3VA 2AGTA 3V0TA 1HKKA 4C6LA 3LA4A 4LY8A 1AQ0A 3S9IA 5BXTA 3S1XA 2VURA 1IIHA 1OB0A 1FWGC 4OWGA 4DHGA 5FI8A 3HQOA 1A0CA 3DG3A 3W1MA 3LEPA 2Y5EA 4HZ8A 3BAYA 1QOXA 1UYQA 5H8MA 3N2BA 4H19A 3QW4B 4XZ9A 1KLYA 5AZ0A 4GUJA 3VD9A 5JBEA 2I14A 1KGXA 2INFA 4DUXA 4PBGA 2VC6A 4JFTA 1TWSA 1AODA 4GNVA 1L6FA 4WDWA 3RM9A 2CLKA 4LX4A 5DO8A 4EXBA 2V68A 4IXHA 3E2RA 3TR2A 1W1PA 4UQ9A 3ONBA 4UOJA 3MYOA 2O4QA 4A21A 5I3DA 4ZTXA 3VIMA 3W7QA 4XZIA 4MPKA 3N9RA 1P0NA 1XI3A 1HQTA 5AC8A 2V5DA 4NI3A 3WJXA 3RM8A 2P0OA 3R0KA 3WNLA 1PYFA 1XLKA 1Y5WA 3K8MA 1GPFA 4Q3MA 1GVQA 3SQLA 2D73A 2XN0A 3DN5A 4DLFA 4ZQRA 2OELA 2FHCA 1EF3A 2H6RA 3MUCA 4F2TA 4Q4PA 3DHDA 4GCAA 1JCJA 2G0WA 2Y1HA 4MOZA 3OVGA 1F8MA 1XGZA 1QFEA 4UQDA 2G3IA 4GIRA 4DB7A 1EJUC 3ARRA 2XU2A 4IJCA 5DMMA 1O7AA 4JDBA 2DVUA 3BLLA 4QS6A 1Z69A 3TN3A 9CGTA 5FCZA 1W8SA 2QJGA 4JTUA 1F2JA 2J66A 4R9XA 3WBEA 5DT5A 3CV2A 3KLKA 1H7WA 2P88A 3E1F1 1AW1A 1XX1A 4GABA 4QR6A 4DUVA 3DFTA 2QJIA 5CAHA 3SURA 2J7CA 3WNKA 4C91A 2PDXA 5HWMA 5FSEC 2YA2A 2BOGX 3DC8A 1JPIA 4LVFA 1RVGA 4P7LA 3DERA 4Y8FA 4H1ZA 2PTZA 2A7NA 2WC7A 5C9WA 1PVNA 2FZ8A 3GM8A 5I3JA 3T09A 2Z26A 4MLRA 3EWCA 4IG2A 2VX5A 4OBTA 3VMOA 4F2UA 3QGAC 4JEJA 4PTXA 2XFWA 4J3VA 2X1IA 3WLNA 1OX6A 4H7VA 5D32A 3RR4A 3H70A 3HURA 4L61A 2ZTJA 4JTDA 5BYWA 1HL2A 1GOWA 3DFQA 3KBVA 4DZHA 1GOKA 5CC5A 4AB4A 5FJUA 3R0UA 2NSOA 3EOLA 4WIWA 1OF8A 1QOQA 3GRIA 1GONA 1R7OA 3C86A 1W3TA 4Z08A 1J11A 1DL3A 3DOPA 2C0HA 1BG4A 3WLJA 3RLHA 5A69A 3N4AA 3PB2A 4JDYA 3I68A 1OFOA 4AH7A 1T96A 4KIRA 1RPKA 2FJUB 3H2CA 2PC8A 4W8BA 3H6OA 4PMXA 2Q3OA 3T2QA 4HK7A 1WPCA 1PZ1A 1B4KA 3MB9A 1HP5A 1SYTA 1KXTA 1X8CA 4PUWA 4M82A 3KFTA 4CNPA 3W2UA 1KXHA 8A3HA 5CXPA 1K9EA 2QYGA 3WLTA 3BOXA 4DJDA 5AKQA 5GQBA 5T91A 1RCOB 3NQGA 1LROA 1V7AA 2CXGA 2VFIA 3PZMA 2PURA 2AKMA 2GDVA 2O4MA 3DFOA 5CPLA 4UCFA 3UWYA 2WC3A 2PU1A 4PMDA 4AC7C 3AXXA 2C8NA 3GAKA 1EIBA 1V3LA 3OP2A 2FLIA 4GY1A 5BCAA 4C65A 5A5WA 4XD4A 4DPPA 5DRCA 3UZXA 4ZA0A 2Q09A 1K4HA 2ISSA 4NNCA 4ORMA 2WZTA 2XPKA 2EHHA 1YDOA 5CSRA 2Z1BA 2BGNE 2HPMA 3KOZA 2PP3A 1UD2A 1UD5A 3JR2A 3GG1A 4DRSA 3H4XA 4HT3A 2YXXA 5CGQA 3U6WA 4ZTYA 4HPNA 3F7JA 1K02A 5A8OA 4ZR8A 3F1QA 4TR9A 4JIRA 4KFOA 3SCOA 3R94A 4LB3A 5CCZA 2WSRA 1PTAA 5EA9A 3P14A 1OD0A 3GKFA 5C9RA 1RUSA 3LI0A 3C56A 2Z27A 2GJRA 2ATMA 2GWNA 4XD6A 1DJZA 3CQIA 2HWGA 3N6JA 5A6LA 5U4NA 4P7OA 1W1TA 3PR2A 4PMYA 4O28A 1KBJA 3CTLA 4C6OA 4ZOBA 1MYRA 3K8LA 1EOKA 3CB8A 3V16A 3WQ5A 5FL1A 3IAQA 4R88A 1WKDA 3E49A 3PZVA 4RZ6A 3B3DA 5IBXA 4L1GA 3UWUA 3N6QA 1WO2A 2F38A 4ZFMA 4Z2HA 5CQ1A 2Z28A 5DLCA 2WVUA 3FYYA 3IIVA 1IT8A 1R3YA 1XYFA 1IZJA 2BVWA 3CZGA 2NWSA 1Q6OA 3W3OA 1OVDA 4P7QA 1UUOA 3TROA 4MB3A 2RGMA 1GG1A 1CEOA 1F3WA 3HBLA 4RX0A 3BW4A 3DI0A 4CEXC 5T26A 1VFSA 3WFZA 3DXIA 4Q32A 3GFXA 3T07A 1ONEA 3QOMA 2YDSA 3TSMA 2XN2A 1KRMA 1A5OC 5JBDA 3GNNA 5AYIA 4E4UA 4W85A 1BAGA 2FH8A 1VCFA 1E1FA 3QHMA 4IQDA 1E5JA 3G5EA 1VF8A 4V15A 4MNKA 2OLHA 4TV6A 4KFPA 4E8GA 1NWRA 3ME3A 4EACA 5CAKA 4UMBA 2O9TA 2J7FA 4PUUA 3VKKA 3TW9A 5GNYA 1J96A 3UT0A 1V8EA 3SUUA 4U5KA 1V93A 2WPBA 2PDNA 3B8TA 2F6XA 4PCTA 2ZRZA 1HL9A 1E6RA 1CTNA 1JFXA 2Y5SA 5H1WA 3L2IA 2VL4A 3G1HA 2VR2A 1LORA 2QF7A 4D6HA 5ABFA 4ZSTA 3A24A 1LUCA 1GOMA 2YFNA 1JI1A 4JR5A 2ZVIA 1W3KA 2ZUNA 2PWUA 4FLOA 4JQ1A 3UJSA 1SZNA 3DECA 5H8UA 3QLLA 4C6EA 1UBSA 4IJBA 2O9PA 4QLKA 3WLKX 4UBPC 5AC6A 4WQ6A 4AD5A 2FVMA 4NKCA 2Y8UA 3FX4A 1R8LA 1KR1A 2E9BA 2DT0A 5CC3A 1TA3A 1M1BA 3T05A 3QVQA 2C18A 2WZHA 2NW0A 4S23A 1DWAM 1Q3NA 3RCNA 3RN6A 1PX8A 3BOLA 1V08A 2QCGA 3GHUA 4O8AA 4IISA 4GUGA 5FF3A 4KGLA 1M03A 3WBYA 3UWZA 1W54A 4AXNA 1T40A 4GFIA 2QJMA 1OFRA 1Q45A 1H63A 1KCZA 1JFHA 1AL8A 1CGVA 3ZWTA 4GGHA 5AVNA 1BWVA 5I3HA 3EA2A 2OSYA 1A3XA 3BJTA 1E6XM 3N19B 4G1NA 2CNCA 1FWAC 1GUVA 2HNEA 1GGOA 4XZNX 1VYPX 3VMNA 2O92A 1QR7A 3ARTA 2W62A 2XSBA 4NJIA 3IVUA 1GQKA 1DWFM 3W7KA 1FY6A 2G95A 1LLWA 4FLQA 4C60A 1KW1A 3WMCA 1TE1A 4S2CA 1XCXA 2DJLA 3B0UX 3KBJA 1HX0A 3TW7A 4DWSC 5F4WA 4CN1A 5A1AA 3NL2A 3TH6A 5KMYA 1PDZA 1TR9A 4B5SA 3QJAA 3SCRA 5E0CA 3PZ9A 5MKGB 4AIOA 5A6MA 2PRHA 5C7VA 1P43A 3WD2A 3VE7A 5A6KA 2E25A 4AXKA 1VB9A 1ISXA 1SM9A 5FSDC 1QU4A 1CXHA 2R8WA 4AD0A 2VVNA 2PDYA 3OLIA 1DJGA 4AHOA 4YVVA 1SFTA 1K70A 1JZ8A 4ONVA 2V8ZA 5DCBA 3RX4A 3U57A 2WV8A 1NFPA 3AWNA 3STFA 1OFEA 5BWAA 3NQDA 2BOEX 2PP0A 3S83A 2DVXA 1RA0A 1JUEA 2FPYA 4DWSD 1UJQA 3EB3A 4QITA 1OCJA 4JZ5A 2JEPA 4LVBA 4YYCA 2D0GA 5BNKA 5I6SA 3KLLA 1E6ZA 3ZJ6A 3C3NA 3C8NA 1ZB5A 1R3SA 1F7BA 1UWQA 3NVTA 3LHWA 1OY0A 4FLRA 5LGXA 2CLHA 4XG1A 2PDCA 4S3EA 2EAWA 2CXEA 3F4WA 4NYUA 4K39A 1JDFA 4LY4A 2WKLA 2GDUA 3RPTA 2GQAA 2OZTA 3M6DA 4RK8A 3V1HA 1RJRA 1TTJA 3BG3A 4LBUA 2PFHA 1ADDA 4KWWA 3UYCA 5J8LA 4N9BA 3UXAA 1UR3M 2P53A 1GYNA 3EPOA 3AZSA 2WNNA 4HNTA 1UHVA 3C6CA 4HYRA 4URIA 5ABEA 4HB7A 6CGTA 3PBYA 2PTXA 7TIMA 1FHLA 1C90A 3CHEA 4JX5A 4RNFA 4F0SA 3O6YX 1NVMA 2ZX9A 1UKTA 4JHZA 2WLYA 4MY9A 3BC9A 1XLFA 3KBNA 3FVDA 4UFIA 2XIJA 2A5HA 4P8VA 3UR5A 3KM8A 1KCXA 3THAA 4Y96A 1GQJA 3M16A 4XIMA 5C71A 4DJDC 3RUBL 3NFUA 3V5FA 1QI2A 3W1RA 4GQBA 3FKKA 1WKYA 1EHAA 1EPVA 5IRPA 2CLFA 2VFHA 3NZQA 3ZVIA 3IEBA 1NY1A 3K2GA 4HCLA 3SUTA 3HB9A 2PF8A 4Q4MA 2XGIA 1Q6QA 4YL2A 3EOEA 4WR3A 1OYBA 1XLLA 3NYZA 2D3NA 4Z1AA 4XBKA 3CB3A 3P8IA 3W74A 1Q8AA 1ZCOA 4JIQA 2WKGA 3M4HA 3GTHA 4PMJA 1UWRA 4QEEA 4IQLA 4PUMA 5CZKA 1V51A 3G1FA 1POKA 3RCMA 4I5UA 4ZO7A 3QGVA 4ERGA 3M07A 3CUJA 4YVPA 4ZQOA 1H41A 3BGJA 4NL1A 4FHAA 4K2SA 1VGAA 4X2PA 3IJ7A 5DQPA 2R1KA 3UG8A 3W25A 4DJEC 3B8IA 3G1RA 1HKVA 4H9VA 1R2SA 1UKQA 1LCOA 1UWTA 1YDVA 3SO7A 1OGGA 4F0MA 4GQ0A 3T2PA 3VKJA 4HHLA 4ZBCA 5EKYA 5FJIA 1DQXA 3PTDA 4WDUA 1HKWA 5G1TA 4GQQA 4NVTA 3W70A 1F6PA 1UWIA 1EJTC 1D3CA 2F6KA 4WXYA 4LYQA 1DEDA 3R8HA 3S5NA 3BSGA 2B7NA 4NX0A 4GI4A 2ADAA 1UIPA 3LLFA 2PWGA 3TYBA 1GZJA 4JYEA 1L6WA 2XHYA 1WYIA 1UPMB 1ZZMA 4EXAA 2GVGA 4PODA 4WY0A 1AMKA 1IXQA 2WJDA 1S46A 5REQB 4PN2A 4YWIA 1JAEA 3CLWA 3EDEA 2DZUA 2QDGA 3U7BA 3ABSA 3OGSA 1ICPA 2Y24A 1C9DA 4IIGA 5HAOA 4U10A 1LM1A 5F7UA 1V4YA 1ZBKA 4LOCA 4QCEA 4AU0A 5I07A 3RLVA 4KW2A 4H7ZA 1QNQA 1CXKA 4JIEA 2OEKA 2BSLA 5FEZA 1QW7A 3WK2A 2ZICA 1RQBA 2GWGA 4Q33A 2OWWA 2UY3A 2HS8A 3KZSA 1W1VA 5HJLA 2JE8A 4LYKA 3NURA 3QYQA 4KCUA 2H3BA 3GDMA 1XICA 3W84A 1H7RA 1NP0A 3ZLHA 4LUYA 5F1VA 3L4XA 3WKZA 1QPRA 2VEPA 3GE7A 3WH5A 3AJ7A 2OVLA 5HUOA 3FN9A 1GVRA 5EY5A 3QZAA 2XFRA 2CCRA 4MDPA 3TTSA 1QW8A 4W7UA 2P5NA 2WW5A 1A47A 3F03K 3SEPA 4PTDA 4CQDA 4OT7A 4B5NA 2O9RA 3REQA 1W9PA 2A6LA 1AL7A 1C92A 4ZQPA 1I75A 1M04A 2OT1A 1Q2RA 2X41A 5HNNA 3RPMA 1VHNA 2HE8A 1NH6A 3LM3A 3HA1A 4ROPA 1N8IA 1MMFA 1DYSA 5LZLA 2E6DA 1A5NC 4NJJA 1J8VA 3WQ8A 3WBXA 1EO7A 1SFLA 1PWLA 2Y63A 4AYSA 3PUGA 4LC8A 1KBIA 2GK1B 1XGEA 4M7TA 1Q63A 4CCDA 4A6GA 4LF1A 4W4QA 1U22A 2WHMA 1H7PA 2XH7A 3OGVA 1OK4A 4NRRA 2Y4SA 3CMFA 4WDXA 3S2MA 1GQLA 3PFRA 1UD8A 3CL7A 3HGOA 4UWMA 1UROA 1DOSA 3N34A 1VCGA 1J0HA 1HJXA 3DUGA 4AUBA 1K8ZA 4X0VA 5HNRA 1T0OA 5DMYA 4RW5A 1QNPA 3MMWA 4QAIA 1FTXA 4MFEA 5LIUX 1NDZA 4PR4A 3IIOA 3LCWA 1AZ2A 2HRWA 2PUZA 1DKWA 3THUA 4MF4A 3C52A 3VZXA 3M5VA 1ZFJA 3UZJA 3QV7A 4ZZ9A 2PWVA 4MMWA 1O5KA 1UA7A 4WEVX 5DF0A 3WH6A 1PX3A 1Y7VA 3T1GA 1UZ4A 1A49A 3DG6A 2CBIA 3I10A 1JF6A 1TJ2A 4PMQA 1D3HA 1ME8A 3FSTA 4LVDA 4DAFA 4PSRA 4A3YA 2PGRA 3VIPA 3S6TA 2E77A 4DM2A 5KZDA 2E7FA 4JQ4A 2WSPA 4D6JA 3PBMA 3S6DA 4Z1CA 2VRJA 3BV7A 4OFCA 2X1UA 3S5YA 1AQHA 3USZA 5D2VA 1TQXA 4GVIA 3U8GA 2TRSA 5D02A 1HVXA 4Q8NA 5IDZA 1FXPA 1GVSA 1EKOA 5LGZA 4JY9A 4AD4A 1EJ7L 2A3HA 3AIEA 4JICA 4QAWA 1WKFA 3QTGA 4LC6A 1MEHA 3ITYA 1FWFC 4L4OA 3S42A 4MZ8A 1ZAIA 1ZUAX 3AXMA 3PPHA 2BV9A 2ZUVA 3A64A 3P60A 3H4GA 3HPXA 2GUBA 1KR0A 3TUUA 1A5SA 1E4MM 3CH0A 4ACZB 4MJ2A 1A5AA 4K3ZA 8RUCA 1XH2A 2I17A 2PDGA 2DSUA 4X2RA 1XYAA 1JCXA 3VOFA 4K6AA 1R9YA 5ABGA 3WJZA 3CC1A 3RIKA 1Q6EA 4JYFA 4H4IA 4NQ1A 3VKAA 5HR6A 3NAVA 3HMCA 1LRNA 4MIMA 1A4LA 1A5BA 1MZHA 4M80A 4XISA 3GXFA 3DHUA 4O4VA 3WY1A 2WQDA 4BR1A 2X0HA 3GYEA 3DYPA 1RQEA 4FOUA 1R38A 3LGGA 3N1AA 4QGCA 3TQKA 2JIWA 2CIPA 3CH9A 1IEQA 1S5VA 3GDKA 1ONWA 3TW6A 4F0LA 5LHFA 3TOYA 3IV3A 4UQBA 1NTHA 1NJJA 4WDTA 3PSVA 4JL1A 3POCA 1KQZA 1W3LA 2VZTA 3NTYA 2VQTA 3P0XA 1P0KA 1J93A 1YXDA 4DBWA 5CPOA 1KCKA 1QDSA 1CGUA 2F2HA 4GH1A 2EO7A 5D8WA 4IMEA 2EEXA 1V3HA 2NUYA 2NWRA 3W7IA 1DWHM 3UERA 3ARWA 4IMAA 4C6CA 4PSPA 2ZWZA 3UCCA 4QCFA 3VNKA 4ADSA 3VOGA 3QR3A 1JCLA 2VDIA 1Z32X 2XIQA 4AMAA 1UOKA 4BA0A 2QR6A 3LTYA 5IXEA 1NU5A 2ZOXA 4LV4A 1E3ZA 5EMYA 1Z8AA 2GGEA 4MYXA 1EF2A 3K4AA 1QPQA 3GDBA 2CBUA 1PTDA 3AHYA 2ISFA 5FD0A 3NDOA 3GTFA 4QX4A 4QEHA 2G96A 1M5WA 4YCOA 1HT6A 2NVAA 2VENA 4O19A 4RZ4A 3T8QA 3VIKA 1CWYA 1E0WA 2WWDA 2P3ZA 1H0GA 1ZAJA 1RD6A 1I8JA 4LUTB 1OCQA 3E74A 4N9DA 3VD4A 1V6WA 1TIMA 3ZLGA 5ECUA 3W28A 1OX5A 1M53A 1TV7A 3OG2A 4HK5A 4CUCA 3CV7A 4O15A 3VABA 3WK1A 1FCBA 4XAPA 4W86A 4JOMA 3R11A 4IXXA 1RCXB 3LCIA 1JZ2A 4JEQA 2RJGA 3BTNA 5DXYA 2JQXA 4MTVA 5CSYA 2VWSA 1W5MA 2NX1A 2VD8A 4W9TA 3QQWA 5HNTA 4PCSA 4QE1A 3RLGA 4HZMA 3EX6A 1ME7A 4HZ7A 2XTKA 4UFLA 2A7RA 3EEZA 3G1VA 2BXYA 3H2MA 1XIHA 3MUIA 3W02A 2VGFA 9RUBA 2ZRUA 3P7YA 1B4EA 3B8UA 2V5JA 2A21A 3IARA 4XKMA 2ATSA 5GJNA 4CCEA 1JYWA 3BARA 1J4EA 2XVNA 4PC8A 1DQUA 2W3ZA 3DH7A 1RLCL 3MC5A 2PMQA 3N3MA 3AXIA 3U7VA 1TJ0A 4S2BA 5D2WA 1E0TA 4U3AA 2D0FA 2PU0A 2GK1A 3CHVA 2VRKA 1U1HA 1TPVA 4HCHA 3M0JA 4X60A 4NZJA 3TLLA 2ZUWA 3ZYZA 1ZHAA 2XISA 1EP2A 3TNBA 1AW5A 4PMVA 4FF5A 1W37A 4YYFA 3GC2A 3AU6A 1N8WA 4GG9A 1YMYA 4GLEA 4DYEA 5CPMA 3OOQA 1TZZA 2PWFA 2ZIDA 3LPFA 3N73A 2VX7A 4FZIA 1D9EA 4C6MA 3G77A 3GDLA 2HVOA 1FWSA 1UUQA 4NZ5A 1TO3A 1ZY9A 4MJ4A 4E5TA 3QY7A 4I3GA 3FKRA 3MCOA 1M41A 2WVVB 1V77A 1M3UA 3ZR6A 1BF2A 1KWGA 2O0TA 1LOLA 4WD0A 2X1TA 1FWCC 2FZBA 2CZ5A 5KTLA 1EXPA 4TX8A 1B3XA 2Y7FA 1XLBA 4J5NA 5KZ6A 1B9ZA 4X3ZA 5J5RA 4WCJA 4CQAA 2PBGA 3AICA 2NT0A 1PUDA 5FACA 4MAVA 3T0TA 2QULA 4EE9A 3OIXA 1NDWA 4H7CA 3W83A 1RV8A 3C5QA 1I2RA 2J9XA 1JCNA 2ALDA 2OODA 4PMRA 1GVFA 1XDMA 3SN4A 2QMJA 3IUDA 3S47A 1IWAA 1UR0A 3QMRA 4JIPA 3M5ZA 3TE9A 4CQ8A 1O4UA 1NAL1 4ZB5A 3TR9A 1EUNA 4S3BA 1EJRC 5F4SA 1UIOA 1KO0A 3OPSA 4G2DA 1OGBA 2WWCA 4S3CA 2A2IA 4AISA 1UOZA 3R58A 3QQ1A 3PHAA 2WVSA 2YBVA 3GS6A 4X9YA 2Y88A 3B03A 2ZE3A 5ABHA 2YDAA 4R85A 3TJLA 3M0XA 2HEJA 4D9PA 4I6VA 2CZVA 1TE6A 1UW9A 1PX4A 1VJIA 3B97A 1TPEA 1W3IA 3RR1A 1FWIC 1KLZA 1YE6A 2VZSA 5L9FA 5J5DA 4HA4A 1P1XA 2XWEA 5HULA 3T7VA 5AC7A 4Z2LA 1J6PA 2NUXA 3AAMA 5CLWA 1EUAA 1LF1A 4U28A 5HQLA 4GQRA 2QVHA 2X42A 1ZS2A 4Q8MA 4F0KA 3TJIA 2PWEA 4GBUA 4NAFB 2J8FA 1DJHA 3G1YA 3UG5A 2OB3A 2WSKA 1RBOB 3KTXA 4DJDD 1DHKA 3EWWA 4OJYA 3DBPA 1UUMA 3BK0A 2BVTA 3MBDA 4JTIA 1FH7A 2VC7A 1E9ZB 2NV2A 5FJRA 2RDTA 1W1ZA 4EAYA 1MW2A 1LL7A 3W27A 1MW1A 3WL1A 3ARQA 5I06A 3BGAA 5I3IA 2EPHA 3M47A 2C13A 1PHWA 2QCFA 3W88A 1BRLA 1XM3A 3LHYA 2ZA1A 4PTNA 3A4AA 2YW3A 3ZFHA 3RCYA 5I09A 3WQGA 4DX3A 1S2CA 3K46A 5C7HA 4IPIA 2VOTA 3CQKA 2VFDA 2DDXA 3N9KA 1K8XA 3LRMA 1K4GA 2BNJA 3SUSA 3SCWA 1LL4A 4O1DA 3RNDA 3E2QA 3KXQA 2Y89A 4FXFA 4AVFA 2V67A 2CLEA 2JF6A 5D2YA 5A2CA 2YYUA 5E0FA 1XS2A 3TAKA 3LS9A 2QCEA 3ABRA 4U3CA 4B9YA 4H6KA 3U5UA 4LAMA 3T44A 3HJZA 3WF0A 4AC1X 1J0YA 2CHNA 1JDAA 4HTBA 1OX4A 3BAKA 2QUNA 2QCMA 4PRWA 4BEUA 3MUY1 2FIQA 2EF9A 3UW6A 2J24A 4HA0A 3TSDA 1LDCA 3CAVA 3TVAA 3SRFA 2E6FA 1YRRA 4IPNB 4LS2A 5DXXA 3HG5A 3CAQA 1ZNNA 1Q2SA 1PHQA 2PD5A 4BQ3A 4IG2B 1O94A 3SQMA 2VVSA 3SCQA 3VIFA 5JIWA 1HUVA 1YYAA 4XAGA 4JN8A 1WAUA 2WVVA 5CH9A 1W6TA 4L4PA 4QRNA 5C2XA 1VPXA 1Z44A 4RL3A 1SSGA 1I1WA 4EPEC 3U48A 2FMOA 3CL6A 3PZQA 4JTSA 5I78A 1HF6A 1WOAA 5F2MA 4RZBA 2VDHA 1ONXA 3NZ1A 4I9AA 4OKDA 1LL6A 2VGIA 4LNYA 2W6RA 4S39A 4OECA 3PUDA 4L1WA 2EBNA 4ZE4A 1POJA 2XM2A 3VO0A 1OJXA 1GPWA 3DDMA 3RLUA 3ZMRA 3ZJ7A 4AG0A 2DSVA 4P8WA 3FYPA 3ITTA 2NLYA 3W7PA 3F2DA 2GGIA 1R7AA 3R5EA 1Q4NX 1EDQA 5XIAA 4RCXA 4US5D 4Z42C 1XIEA 4S3KA 4FNTA 4CEUC 5AHMA 4E4PA 2BLEA 3CV6A 5I23A 2CPUA 4JTEA 2NLIA 3PUEA 3WD4A 4LT9A 1EEXA 4ZXOA 6ALDA 4L80A 1FCQA 1KKRA 4DPQA 1KD0A 4NILA 4WX2A 4L65A 4R7WA 3MS8A 2YL6A 5AYBA 5EL1A 2NV9A 3MI2A 1M65A 1UC4A 2FPVA 1R3RA 1OIFA 7A3HA 2QJHA 2NXGA 1Z6KA 4C90A 1EXBA 3HO8A 3FEMA 2Q01A 5TD4A 5D2XA 4CNSA 1LOQA 5MKGA 4XVEA 1BQCA 2VHLA 1Z42A 2BHUA 5TBOA 1KBBA 4GJJA 4O16A 1A50A 2IW0A 4NAFA 4WKAA 2PDMA 4MWAD 4G1KA 5KITA 1TV2A 3FDKA 2ZRVA 3MT1A 2AMGA 2NQZA 3OVQA 3SSZA 3IK2A 3SBFA 3WEOA 2Y8KA 4R3UA 1R87A 3GG8A 4MADA 3KOFA 4JQ2A 3NO1A 3Q67A 4J3TA 5EU9A 1Q7QA 2WJZA 2E5BA 1J0KA 3WLIA 5C9UA 5CPNA 3T0CA 2D0HA 3W1LA 4MWAE 1EL3A 1K1DA 3LBMA 2PLCA 1Q6DA 2VGBA 3MCNA 3W7OA 2WYSA 3MJMA 3PAJA 4AD3A 1BWLA 2JKEA 3LCLA 3B4YA 3ARXA 3WIJA 1M7OA 1DBTA 3N18A 3C2OA 3ITOA 4LGXA 3VGDA 1P7TA 4UFHA 4D8ZA 2ISWA 2QDEA 2BDQA 2V5KA 1IV8A 4TIMA 3FGCB 4L9XA 5XIMA 3CK5A 4LUTA 1HKIA 1TX2A 3PANA 2J25A 1N2VA 2OGJA 3BOFA 2P1FA 4JIIX 3SCUA 1TTIA 1JUBA 4XD3A 2ONEA 4REQA 4B5WA 4GIAA 3A12A 1TREA 1M7PA 3HGSA 1GKRA 2H8XA 2FQIA 2QIWA 1GTHA 4DZAA 3VC5A 4J27A 4BQ5A 5G4HC 2PAJA 2DV0A 1X38A 3T9PA 2VEGA 4DWSA 4TTGA 3IACA 1YQ2A 2P10A 3F4NA 2UZ9A 4PEKA 2F7FA 3A4JA 2OOGA 1KM3A 2ZRYA 3ANYA 3VIOA 4KWUA 3UP8A 3ITGA 1ZP3A 1Y5XA 3AHZA 1OADA 1XD1A 4JNYA 2OOFA 2V9DA 2BBFA 3M7SA 2YR1A 1XXXA 2PB1A 4ROQA 1N55A 3P80A 2C14A 3FV9A 2VC9A 1ZENA 3JZUA 3PZUA 1S5WA 3OO2A 4JGDA 3CQJA 1UMYA 3HPZA 2OO0A 4HSHA 1S39A 3UBPC 1X1NA 2I9UA 4IFOA 1YPFA 3MDWA 4Q6JA 2Z24A 2QJJA 1WE5A 4GZ7A 5IFPA 1ITUA 4MB4A 1PJ9A 2X09A 3EOSA 4LUJA 4FB7A 4GYKA 4G5DA 5I3FA 1KCLA 2QVNA 1WDPA 1GVIA 2J6VA 3TN4A 5KEZA 1SZEA 3COTA 3W53A 3QYSA 3EWDA 3O0FA 3MV01 1E3XA 2NSXA 3L21A 3VOCA 2QUMA 4FAMA 3ZO9A 3GVQA 3WQOA 1UA3A 2C0AA 4AEFA 4A35A 3CTTA 1T7LA 2Z2BA 4OVXA 5AHEA 3SUVA 3IK4A 4ICNA 1VJZA 1KM0A 3A5VA 3CM4A 5HNUA 3L4ZA 2YPIA 2X0YA 3PN8A 4HMNA 3W1XA 4FXJA 5SWUA 1CNVA 4QIUA 1SW3A 7ENLA 2EJAA 1IT0A 4FNRA 3WELA 1R86A 3BAXA 4N02A 3STCA 4H8UA 3GWQA 2IKJA 1XC4A 1NFGA 2W4XA 1CCWB 2EG7A 3IIPA 5E0KA 4KRZA 4JS3A 4QQUA 4LQ1A 4CN6A 4MWAC 1VH7A 4UFJA 3BURA 1VQTA 2VELA 3LMYA 1Q65A 1HGWA 1CXEA 3R13A 4MJZA 4C6PA 3BQ5A 3GTIA 4O0QA 4GVHA 1SFSA 3JU2A 4B5VA 5LNUA 4P7NA 3SRDA 4GY0A 4M51A 1TG7A 4I90A 3ICJA 4IIBA 2ZRXA 5F2IA 1V0MA 1OK6A 1GHSA 3MZNA 4J7RA 1PIIA 1HJVA 4H6EA 5FEPA 4NSBA 4BY3A 3KE0A 1DJWA 4X9SA 4EPBC 3VNZA 3S8HA 4H01A 3MMUA 3RO8A 4IPLA 3TTEA 3WENA 2R9RA 1RPXA 1QWGA 2BVDA 3M0LA 4AZCA 1JNEA 1IHIA 4N4PA 1KV5A 3UWQA 4OU1A 2E1DA 3DKJA 4HSOA 2V3GA 3Q2DA 3E5PA 1UH3A 4Y9OA 4I8DA 3M44A 5J04A 3VFCA 1YLVA 4KPLA 5CBIA 2YSWA 2OSWA 1MVYA 3MA8A 2YYTA 1EP1A 3L5AA 3BQ6A 4ZEPA 3M0KA 4N42A 3GH5A 1TWDA 1P5BA 1B1YA 4ZB2A 3UETA 5K9CA 1E43A 1RAKA 3TYCA 2Z7KA 5IM51 3NJ3A 2ZWYA 2QPSA 2E40A 1QI4A 3IIXA 2ACUA 3R25A 2A0NA 4ZO8A 1PPIA 4LRSA 1B2YA 5FJPA 4GX8A 3APGA 2QCCA 3QN3A 5K7JA 5IBXC 1Y8BA 1TV3A 2YOCA 1VP5A 4XO6A 4J9JA 3D3FA 2BY1A 3PSWA 2QPUA 2W61A 4G56A 4CVUA 1XSKA 4BKNA 1DHPA 4HPGA 2GQ8A 5EBUA 3V4BA 4C1NA 2DUXA 1T8XA 4XWUA 1W5NA 4FEZA 3GKAA 1QBAA 4B3LA 3C0JA 3UZYA 1L2UA 2R24A 5EYWA 1L6SA 2FB2A 4JX4A 5AHIA 2HCVA 2IXUA 2G4FA 4JD4A 1EC9A 2RJHA 3ATZA 1U2YA 2G3FA 4DBDA 1E1CB 3KL3A 3EWXA 3V7PA 4ATDA 3QBUA 3GB6A 3AU2A 4WSJA 1Z9AA 1WXJA 3S1VA 1ZBVA 4KESA 5E70A 3U2EA 4QFUA 1JXJA 4UNIA 4C7GA 1XCFA 2BY3A 1PEZA 3SJNA 4EWJA 2IMRA 2R82A 4HU4A 3LXCA 1J6OA 1V5XA 3RK8A 3WSUA 4QG9A 5LNVA 1R3WA 2DZSA 5BZAA 1IE7C 2E68A 4H41A 1XWYA 1CGXA 3MQTA 2I9EA 1TV8A 3UWEA 4JTKA 4TQTA 3HGRA 2Z6JA 5AHNA 2OZ0A 1ODZA 5A8QA 2JALA 1X1ZA 3KW3A 1OSEA 4UOQA 1JPDX 3FA5A 4NJKA 3PULA 3QPZA 2FFIA 3S5OA 4WXZA 2ZC8A 2GJXA 2ISVA 1W9VA 3APTA 4K8GA 4OGZA 3TZNA 2QJNA 1DWGM 2R1PA 4Q7IA 2O9OA 3EPMA 4YIWA 1BQGA 1LG1A 1TZ9A 4FX7A 4J35A 2D23A 3OB8A 3OZYA 4PULA 1S2UA 4LV9A 3V5OA 3ABXA 3MJYA 2WHLA 4V1YA 1KV8A 4UTKA 2Y8VA 4H9ZA 2G8ZA 5DX7A 1VKFA 3UZWA 1W17A 3V36A 2GVYA 3TU9A 3HM7A 4DNMA 3E0WA 4ZGYA 2BB0A 3MANA 3VCRA 2ZZ1A 3RDKA 1WDRA 4GE8A 2NQJA 3EKGA 4CU6A 1BSLA 2I5IA 4HNVA 2WBGA 1I2QA 5BU9A 5K9XA 1PCKA 5EMKA 1XFBA 2WJEA 5FF2A 1FKWA 2JFEX 3WMBA 3WMSA 2DIEA 3MTWA 2QAFA 4QNEA 5A2AA 3P3BA 3ATYA 2DT3A 3WQDA 1CLXA 4PUJA 4LBRA 4L56A 4CD7A 1OT1A 4A05A 3OYXA 3B40A 4NAEA 5I03A 3W6YA 2HK1A 1ZLPA 1H50A 1VS1A 4ACYA 4BWLC 1XH0A 2QDHA 2NX9A 3Q4DA 5T8GA 2WJFA 5LNSA 4AD1A 4MB1A 1TPFA 3VM7A 3VCCA 1FDJA 3LBCA 1FWNA 2VX6A 4JTQA 1JCMP 3W7LA 1O1ZA 1SO6A 2OX4A 4U2YA 4O1CA 2PDHA 4RE3A 4ADTA 1DIEA 1E6NA 2EKCA 4HNLA 1RP9A 3BAJA 1J0IA 3RJYA 1SO5A 3QFEA 3TSBA 3UA4A 1TIWA 2CESA 1FWWA 1GYMA 3MMTA 3B9NA 3TC6A 2E6AA 3QQ0A 1EPXA 3LTPA 2X7WA 1J01A 1GVOA 3OEXA 3KRZA 3G18A 1ALDA 2FGZA 3T0AA 3CEUA 4LYRA 1P4CA 2CZFA 4DJED 3HQNA 5G1MA 3TXZA 3B8VA 3TYZA 3TP4A 2VR5A 4GUHA 1TMQA 2NZLA 4DF1A 4E2DA 5LA0A 1D8CA 3LRKA 1EGMA 3SY8A 1QNVA 3TFCA 3AIUA 2X30A 4YHEA 1VYSX 1LT7A 3EDDA 4IMFA 1ISVA 5FOOA 4NZ1A 3E0VA 2XZ7A 4JCMA 5A8NA 1VBHA 1PKNA 4U5IA 1R2TA 2V5LA 4WJ8A 1XRSA 4R5EA 3P0WA 1G5AA 4MNLA 2WNQA 2XJ7A 2G41A 4A8NA 3ES8A 2BHYA 1OQFA 4OV4A 3GG0A 3WN6A 4Q7BA 4LVGA 2YLAA 3EKZA 1EBGA 4GIEA 5TF0A 1OIMA