2Z1SA

Beta-glucosidase b from paenibacillus polymyxa complexed with cellotetraose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-glucosidase B
publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
total genus 164
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2007-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2z1sA00
1X1NA 4AY1A 1IZJA 5A2CA 1ESWA 4J3SA 4BQ3A 1Q6GA 3EDKA 3WDQA 3CHEA 3VILA 3U5UA 3WF2A 3VIMA 4MNKA 4QAWA 3WQ5A 1B2YA 3ECQA 4B9ZA 3SIMA 1J9YA 1ISWA 1WCGA 2PB1A 4PMRA 3NIYA 2GJPA 4PMQA 1TVPA 4M24A 3MMWA 3OGVA 1ZB5A 3GH5A 1CPUA 3CHCA 1CWYA 1H2JA 4B3LA 4IPNB 1QPKA 1G0CA 2BFGA 3RO8A 1J0ZA 1F4HA 1RD6A 5GNYA 4DWSB 2G3NA 1PZ2A 1OGSA 2ZE0A 2W91A 5E70A 2B31A 2YBUA 1QHPA 1CZ1A 1D7FA 5F7UA 1H0IA 1QW8A 3CIVA 1H41A 3WEZA 1TCMA 2CHNA 1E5NA 2ZXQA 4D6HA 3NYDA 3OZPA 3A6OA 5AC5A 4MTVA 3ZJ7A 1EQCA 1B3ZA 3ZO9A 2BHYA 3SCVA 1ZL1A 3W38A 4A3HA 4AZBA 5ABGA 2G3JA 3WSUA 1WDSA 2O92A 2OYKA 3AYRA 3K8MA 1HJQA 3CUJA 3AS3A 3LPPA 1UD3A 4ML4A 1RH9A 4P7OA 2J47A 1GHRA 4F9JA 1L8NA 2G41A 4BQ2A 5IHRA 1W9DM 2J62A 4TX8A 3VGBA 3WNOA 4W88A 1M03A 2D24A 5I77A 4AMCA 4H7VA 2HISA 1V3MA 3U7BA 4U31A 4HMEA 5CZKA 5A95A 2HVMA 1HVQA 1GOKA 4WKAA 3N11A 2VRQA 1UWRA 4PMUA 1OINA 2DEPA 4W86A 3BAYA 3AZSA 1NM9A 4W5ZA 2DDXA 4TOQA 1WE5A 1OWQA 4CKQA 4GO9A 1V08A 2JEQA 3VMPA 1E6RA 4GKLA 1R85A 4Z2KA 4TVDA 4WK9A 1BG4A 1W3JA 1B31A 1ZBKA 4U5KA 1JZ5A 1JXJA 3W27A 3GXDA 4W7VA 3ZT7A 5M3WA 1QVBA 1E40A 1WKYA 2WHJA 3FN9A 2XM2A 4JKMA 3UERA 1HIZA 2CNCA 1B3XA 3LMYA 3IK2A 5BCAA 1LWHA 2E9MA 2DPEA 4ZE4A 1UQZA 3GDBA 4HA1A 2YDQA 3AIVA 5EMYA 1IZKA 2VX5A 3VNYA 1E43A 3VIFA 3PZVA 4P8XA 1EDQA 1E71M 2QLYA 2OWWA 4KGJA 4AXNA 2A3AA 3AIWA 3ZSTA 4NRRA 2GSJA 4JCMA 5E0FA 2XUCA 1MVYA 1V0LA 3BSHA 2VQUA 3ZMRA 2Q8XA 1C8YA 4J3WA 2CIPA 1FHDA 1V3LA 2VTFA 4P8UA 4KH2A 3VIOA 1EDTA 2O9PA 1KR0A 3NDZA 3L4WA 3SUSA 4QFUA 2WM0A 3PZGA 1GOWA 1GONA 1EOKA 3ZSSA 4CGTA 3ARUA 1V6YA 4CD8A 1H11A 3ZJ8A 4JZ5A 3RPMA 3J7HA 3MUAA 1E3XA 4MAVA 2CBIA 4UQEA 1J10A 2X0YA 3LPFA 1B3YA 3BCDA 4V2XA 4YHGA 1C7SA 3KWXA 4W8BA 1KWKA 3UETA 5A6AA 1WAWA 1XV8A 3LPOA 2E40A 3DECA 4D6FA 1JXKA 4ZXLA 3WDJA 4GXPA 4ZEPA 4GO8A 4TVCA 1KB3A 1GOIA 2XWEA 2BHZA 1XHGA 2ZUMA 1UWTA 3VVGA 2A3HA 4AZ6A 5C8BB 3CZJA 4HZ8A 2DSUA 4MNLA 3AS2A 2J7CA 2EQDA 2V5DA 4WSJA 2BVDA 1TG7A 2Y8VA 3F5LA 4LXFA 2J7FA 4W87A 3POHA 1E15A 4QP0A 1XH2A 2BHUA 2BV9A 1JZ8A 1OBAA 2QMKA 4FLOA 4UR9A 3N17A 5EFDA 4M81A 1EO5A 3UG3A 2ZX6A 2BY1A 3VU2A 1UOKA 2JEPA 4AZGA 1XSIA 2AAAA 2QMJA 2VR4A 3GH4A 2J25A 4L4PA 1PZ3A 1UR8A 4OZOA 1SMDA 1E4LA 1HF6A 4U5IA 3VM7A 1I1WA 2VX6A 4Z2JA 3OLEA 3KEHA 3GM8A 4UQCA 1WDQA 2X2YA 3PTKA 3WF0A 3M46A 4H2CA 4CVWA 1L0PA 3QOKA 3HN3A 1FP8A 2JF6A 2ZWYA 4KRTA 2DIEA 3WMBA 2X0HA 4ACZB 4Z2LA 2EJ1A 4CN4A 5BXSA 3VIKA 3OA5A 4UCFA 1CXHA 1XSJA 1JGIA 3B8SA 4BQ4A 4J3TA 1AQHA 1BYCA 1PPIA 4AIEA 3D5HA 2XFFA 3O2LA 3W0KA 2W67A 2XSAA 3L4XA 1JDCA 4WF7A 2EEXA 2X09A 4UOQA 1JZ3A 4LYRA 1W2VA 5HPOA 2JALA 2XGIA 1H09A 3GNRA 1OCQA 5CJ5A 1FFRA 1RP9A 5BXRA 2ZX9A 1QI3A 3RILA 2AOSA 3THCA 1HP4A 3CHFA 1VEPA 1GOOA 1VFFA 2O9TA 5HOSA 4AZ7A 3BGAA 3AJ7A 3WELA 2UY5A 2RGLA 1MFVA 2DT1A 4TX6A 2WXDM 1ISYA 4TUFA 2WSKA 3NSXA 1KXQA 1R7OA 2V38A 4DUVA 4BA0A 1V3KA 2WAGA 3SUTA 3PHAA 1DWHM 3WDHA 1GVYA 2C7FA 4XUYA 4JHZA 1BGAA 1UR0A 3L4VA 3VUPA 1PX4A 1OGGA 1XD0A 1W3HA 1FHLA 4PEEA 3UCQA 4C7FA 2VRJA 3AIUA 3U7VA 2J7EA 4TTGA 1OT2A 1VEMA 1G9HA 3AOFA 5AYBA 2WK2A 2ZOXA 1HKJA 4M29A 3TP4A 2VR5A 4KRUA 3AYSA 2FHBA 2WMIA 4PCTA 3AMGA 4EAMA 4PMYA 3ZR5A 1BG9A 1NP2A 1UD5A 3UR7A 3AS0A 1KFWA 4J27A 2PBGA 3F5KA 4DWSD 1OIFA 3VPLA 4HP5A 5A8OA 2OYLA 1BYDA 5BWFA 3VD9A 2E8YA 2J77A 4ATDA 1CGWA 4UFLA 5A1AA 5M17A 3JUGA 1ZU8A 3AQUA 5BXPA 1M04A 2WBKA 4PUDA 3AIRA 4ACZA 1Y7VA 4E4PA 3EYPA 3KL5A 4H41A 2FHFA 1Q4NX 2J8FA 1MW3A 5JIWA 3VDHA 4K68A 1R86A 4KWUA 2UY2A 3QHNA 2V3EA 4MPKA 2D1ZA 1J18A 4Q7NA 1D2KA 1J0JA 3VDCA 1QW9A 5D9MA 4R27A 1Q6FA 1W1TA 1E0WA 4W5UA 2XVLA 5IXEA 2VMFA 4W84A 4J3UA 3HU7A 4UFMA 1JF6A 1HVXA 4TXEA 1W9UA 2FGZA 1UKSA 3QR3A 3WUGA 3AIEA 2ZUTA 2FH6A 1E1FA 3N04A 5A6MA 5CSUA 3PN8A 1UG6A 2PWFA 3SCNA 1KBKA 3WQVA 4JAWA 5IFPA 5JBFA 4LX4A 1JG9A 1HL9A 1V6WA 4YHEA 3N15A 4MJ2A 3NSMA 3NSNA 1VRXA 2YDRA 2VOTA 4CD4A 4W89A 3EDEA 1JZ7A 4JCLA 1NOFA 1CTNA 4PRWA 1GOQA 4HTYA 1UH2A 3MV11 1JAKA 5D4YA 4LYQA 1HJUA 3OLGA 2VRKA 1K6AA 4IISA 2YL5A 3EDDA 1K9TA 3F4VA 2QF8A 4W85A 3WMSA 2G8ZA 3MMDA 2DH2A 4UOZA 1BTCA 1LLOA 4GQRA 3WN6A 4TVUA 3ZT5A 3ARVA 4M8UA 4Y7EA 1LQ0A 5FCZA 4R5EA 2XTKA 4AZIA 3I3BA 1CENA 4UNIA 2D3LA 1PX3A 4XZBA 4F66A 5A8PA 1QNSA 3GXFA 3ZOAA 1ZS2A 1V0MA 5JUVA 2XM1A 4QDMA 4MDPA 4OOUA 4D6JA 2PWEA 5ECUA 3BAIA 1E4IA 2ZUUA 2J8GA 3G6LA 3TA9A 3CBWA 2OSWA 2Y5EA 1QNQA 2WZEA 4UZUA 1GQKA 1OT1A 3AMLA 4MAZA 4E2OA 5JBDA 1WPCA 3ALFA 3RMEA 3EMCA 5HDRA 1KGWA 2VZSA 4PMNA 1EXPA 3NDYA 4M56A 1QHOA 5CSYA 1KGUA 3WH5A 3VGFA 3VDBA 1HXJA 2BXZA 2WW5A 1CGXA 3MUY1 4YPJA 3FHQA 5I6SA 4WKHA 4HZ6A 1PJ9A 3OGSA 1WNOA 1VFUA 2W63A 6CGTA 4OIFA 1M7XA 1HJWA 3PTMA 5DF0A 5CPQA 4OBRA 3PZOA 5E9AA 2E9BA 1CGUA 2F61A 3WBEA 2VI0A 5A94A 1J11A 1ISZA 4HA4A 1DTUA 3OG2A 2W5FA 3LPGA 4JKLA 5EBAA 2FH8A 2D0FA 1PAMA 1B1YA 1MYRA 3ARRA 2TAAA 3SCOA 3WDIA 3WEOA 1UWQA 5EFFA 2NW0A 4D71A 3SCWA 2XJ7A 5A6BD 4CCCA 2QPSA 4JFTA 3FAXA 3VIJA 1B30A 1J0IA 3K1DA 5IDIA 3WY1A 2CBJA 3BH4A 2X8RA 2X1IA 3ARSA 1C7TA 1PBGA 1UA7A 2EO7A 4AD1A 2CESA 4OOZA 4PSRA 1CLVA 4XV0A 1K9FA 4GQQA 6TAAA 2XYLA 2XFRA 2CCRA 3EMQA 2D0GA 4GPNA 3ALGA 5A69A 4A4AA 2BY3A 3GBEA 4LQ1A 3AHYA 4UTFA 4P8WA 1JFHA 2A3CA 1HN1A 2W66A 5DT7A 1TA3A 3W53A 3B9AA 3VNZA 2D2OA 2WKLA 3WD4A 3GTNA 4U2ZA 2F8QA 4EE9A 3SUVA 3AZTA 2DT3A 3PTQA 2WBGA 3AHZA 4TTUA 5HBFA 1JL8A 3WDPP 3CGTA 4B9YA 3RJXA 3B9EA 5I23A 4AD2A 1WDPA 2ZWZA 1V02E 2OYMA 3GYCA 1CLXA 4GI8A 3F5JA 4X0VA 5HPCA 3W6LA 3RCNA 2DSWA 4JFVA 4CCDA 2J4GA 2UY4A 2XVKA 4JIEA 5GQBA 1EA9C 4AYSA 2XVNA 3WH9A 5D8ZA 4Z2GA 5I24A 3A4XA 3M07A 1E4MM 2MANA 1UR2A 1LG2A 2VCAA 2G3MA 1LF1A 7CGTA 3VIHA 1TR1A 4E8DA 3CUFA 3VDAA 5CPTA 1JD9A 1LL4A 4PTMA 1CGTA 2GFTA 2O9OA 3BCFA 1X6NA 4PN2A 1NH6A 2VX4A 2V3DA 3ZT6A 3MO4A 2OSXA 1BQCA 3N18A 3N9KA 3RM8A 1V3HA 1GOMA 2BVTA 3IANA 2WVUA 2OLHA 3VGGA 2GK1B 3BMVA 1HKKA 5BROA 4P7QA 1OB0A 5AYIA 4HPGA 5A2AA 3ARZA 1XH0A 3I3DA 2YIHA 1JNDA 2WZHA 3K8KA 3ARQA 1NWUA 1U30A 1W3KA 4IPLA 2W92A 5M5DA 1V03A 3UR8A 4HU8A 1MQPA 2YLAA 1R87A 2D20A 1E70M 4V28A 3CZLA 3T0BA 2WHLA 3FAWA 2D3NA 4AW7A 3GNOA 4CCEA 1DEDA 2GVYA 2QPUA 2YKKA 4FLSA 2YA0A 1OM0A 5CLWA 1ZJAA 5D8WA 8CGTA 5BRQA 4N0RA 5I78A 2GJXB 1M53A 3RIKA 1CXIA 3DYPA 3L4TA 4IM4A 1WZMA 4J3XA 7A3HA 1UQYA 4HA3A 2O9RA 4URIA 4EKJA 5E6ZA 4U2YA 3T2PA 3AHTA 1KGXA 4FLRA 5HNNA 4WJXA 4ZE5A 4RE3A 2WVVB 1HJVA 3WD3A 3WQ4A 2J7DA 4WKFA 2YJQA 4Z2HA 3U57A 2VZOA 3ARYA 5JIPA 1EQPA 2OSYA 2ZUNA 2V3GA 3S6TA 1UKQA 1J0KA 1Z32X 1GVIA 2EXOA 3ARWA 4AZCA 2CITA 3WUFA 2VNCA 1MW0A 1QNOA 5D9PA 5FL0A 2WMIB 3AXHA 3N13A 3WUBA 2WHKA 1EO7A 2WLYA 2ZUWA 5DMYA 1JF5A 3FHAA 1V3IA 1ZBVA 1C93A 2A3BA 1EH9A 2V3FA 1GQIA 1C3FA 5C70A 1V0KA 2XHYA 1BYAA 3CUGA 4D6EA 3K4AA 3OLIA 4OKDA 5CLTA 1PIGA 2XGBA 3GXMA 2RGMA 1Q6DA 2CETA 2UWFA 4CVUA 3AMDA 1E6ZA 5IHSA 1E6NA 1HKIA 1W1VA 4W8AA 4P7LA 1JZ4A 4XX6A 2A3EA 1W1PA 4PUEA 1WZAA 3GBDA 3WQWA 3ARXA 3IJ7A 1HJSA 2GK1A 4PTWA 3SUWA 4AD3A 1PX8A 4HMDA 3AIBA 5LA0A 2BXYA 4D1IA 2C0HA 3CZEA 4GINA 1VIWA 4HZ7A 1GW1A 4UFHA 1ZJBA 3PZUA 1EHNA 2IXUA 4U3CA 4DUWA 2XPKA 3CHDA 1KQZA 2PC8A 2XVPA 1VBUA 4H8VA 4JL2A 1BF2A 3DYMA 3WF4A 3VTRA 4W93A 2ZXBA 1UH4A 3SEPA 1XH1A 1QBBA 2GJXA 4AISA 1EHAA 2CERA 4ZFMA 1W9PA 2CYGA 1ODUA 1JD7A 4M1RA 4NRSA 3VO0A 1E72M 2W61A 2DSKA 1TE1A 3T08A 2EPMX 1CXLA 4CD7A 1G5AA 2WCGA 2WVVA 2ZUVA 4MB5A 3MKKA 2OWXA 1EGZA 1NP0A 1EDGA 5A6KA 4UQAA 1XD1A 1J12A 5GNXA 3WQ8A 3MUZ1 4S3KA 3WFLA 1VJSA 1CBGA 1GNXA 3O9NA 3VGHA 1UWIA 1UKPA 2XFYA 3UG4A 4ZXOA 4GI9A 3GXIA 3MANA 2UY3A 4UFJA 2Y4SA 4XB3A 2WZIA 2W4XA 4EK7A 5BXTA 1FH9A 1UH3A 3GH7A 1W91A 4F9DA 2J7GA 4C7DA 3RM4A 1MW2A 1E56A 2VCCA 3QHMA 3BAKA 2CXGA 1WB0A 1A47A 2VZUA 3T0AA 3CZGA 1WO2A 4PMZA 1JZ2A 1YHTA 2J7BA 4L4OA 1G1YA 1VEOA 3PZIA 3WH6A 3W81A 1NOUA 5FOOA 1NWTA 3WD0A 3HJEA 2WVTA 1CDGA 3WMCA 1BVNP 1CIUA 1DWGM 1J01A 3AXIA 2VO5A 4M80A 2QHAA 3TTOA 1CYGA 5A6LA 1W9VA 1JI2A 4PMDA 3BSGA 2ZXDA 1NARA 1H1NA 2ZX5A 2F2HA 1ECEA 3M6DA 2PWDA 1SMAA 5I0DA 3VMNA 1JYXA 3E1F1 4JL1A 5I3DA 1CEOA 3VIIA 4LPCA 1E0XA 3ZR6A 4W7UA 1HKMA 3W24A 1KWGA 1JFXA 4FK9A 1IT0A 3W26A 1VFMA 1LWJA 1EOMA 3VMOA 2BNJA 4AD4A 5CPSA 3WF1A 2D23A 1UA3A 2Z1KA 4PBGA 3SUUA 1C8XA 1AQMA 2EPNA 2BVYA 3THDA 4NZCA 3T2QA 3QGVA 4D6CA 4JFUA 4UOJA 1NWSA 3W28A 4JHOA 3ZQ9A 3GNPA 3VX1A 2J75A 2J7HA 3ZM8A 5I5RA 3FXYA 3AMKA 5A3HA 2J78A 4ACYA 2CPUA 3FNDA 3L2LA 6A3HA 1V3JA 3POCA 5CG0A 2YOCA 1VBRA 1WZKA 3II1A 3A3HA 3OB8A 5ABHA 4CU8A 4H8HA 1MQRA 3D3AA 3DHUA 4N42A 2DT2A 1ZBCA 4X0NA 3SCPA 1UD8A 1TA3B 1NWRA 3KZSA 3VD5A 3EBVA 4B3KA 2VZTA 2EPOA 2WHMA 1O7AA 2XIIA 5E0CA 1W1YA 3VIPA 1E6QM 3MS8A 3BLKA 3K8LA 1QI0A 3O6AA 2X05A 2WMGA 3MU7A 1XYZA 4JFSA 2DGAA 2VVNA 2WVSA 1GORA 3WH7A 2PWHA 1UKOA 3AROA 1JDDA 2YA2A 4DUXA 1ITCA 1E1EA 3PZMA 3TOPA 4NSBA 4UFKA 3CUHA 3UG5A 2YL9A 1RPKA 2NT0A 4D6GA 1VJZA 1MQQA 3DHPA 4H04A 4J7RA 3TTYA 4H8UA 1OIMA 1H49A 2VZVA 3CZ8A 4FLQA 1J0HA 4MB4A 1DHKA 3ZJ6A 3SCSA 1B0IA 3BAXA 4D72A 5IFTA 1QI5A 1E5JA 2DQXA 2JF7A 3S2CA 4CU7A 4LYPA 2J79A 5DO8A 2VUYA 1OSEA 4QLKA 4PYSA 4C7GA 2JIWA 4MDOA 2WPGA 5ABFB 5JBEA 3NCOA 4S3JA 1UZ1A 3WL0A 2ZX8A 2DSZA 1AQ0A 2WC4A 3CTTA 1GQJA 4BS0A 1TVNA 3MUIA 3PZQA 2Y24A 4FF5A 1BLIA 5E6YA 1R8LA 3WNLA 3VKKA 1S46A 2YDSA 3L4UA 4QLLA 4M82A 1QNRA 4GZIA 3OIHA 1D3CA 3MMUA 1UUQA 2WSPA 5FKYA 2XVGA 3MV01 5D9OA 2OWCA 1AMYA 3L2MA 1QNPA 1OD0A 2NSXA 4B15A 1RP8A 3ZIZA 3K4DA 4OBSA 4DWSC 2CKSA 2VX7A 1BAGA 1XCWA 4WLCA 1MFUA 1K9DA 1QI4A 3AIQA 3WD1A 2AMGA 5A2BA 5FL1A 1E9LA 1K9EA 3CO4A 1PEZA 3VOCA 1UHVA 2J74A 2WMKA 2G3IA 1I75A 1JYVA 2E9LA 3AHXA 3AFBA 4OJYA 4FMVA 2E3ZA 1G01A 3WNPA 2ZICA 3AI0A 1CNVA 1E55A 1W2PA 5TD4A 3TTSA 1KBBA 5CXPA 4JKKA 1LL6A 4MNJA 5CGMA 1GJUA 3W37A 3FW6A 4HOZA 4AZCB 3KE0A 1WZLA 3T2OA 1R7AA 3KL3A 2ZUSA 4DM1A 5A8QA 1KXTA 1H5VA 4QCEA 1HJXA 2WC7A 2Y8KA 3NUKA 2WCAA 5ABEA 4GZEA 1P6WA 4QLJA 4NI3A 2IUZA 3WF3A 4AIOA 3HMCA 4IUGA 1I1XA 4X9YA 1E4NA 3VD3A 2VL4A 3K46A 1V0NA 2XG9A 4GIAA 2VJXA 4BZYA 1W9XA 2E8ZA 1JZ6A 1BPLB 3IAQA 5DEZA 4CU6A 2JIEA 1KCLA 1H3GA 1C90A 1TMQA 3WNMA 3OBAA 3WH8A 3CPUA 2D22A 2BY0A 5ABFA 1E73M 4DWSA 3OZOA 2EPLX 3I3EA 5DT5A 4E8CA 3CMGA 3WL1A 1TUXA 4KMQA 1V6UA 1ISVA 2WWCA 3FY1A 4AD0A 2QV4A 3WKZA 1FH8A 1UYQA 1FA2A 3W4RA 1FH7A 4UZSA 2DH3A 2FGLA 4PTVA 4J28A 5FD0A 2JE8A 4GZJA 1JYNA 4CD5A 1DP0A 3MSGA 1W9BM 1IV8A 2C8NA 2VURA 1GUVA 7TAAA 3EMZA 3VGDA 4MB1A 8A3HA 1UKTA 2VQTA 9CGTA 3W29A 3AMCA 4EANA 1NQ6A 3WDRA 4P7RA 3A4AA 4RL3A 1PIFA 1CXKA 3BAWA 3WQ6A 5A6JA 4WSKA 2WWDA 4D6IA 3WD2A 3RDKA 1TFVA 3ARTA 1KXVA 1GQLA 2WYSA 3AS1A 1JYWA 3T09A 3TONA 5LA1A 1CGVA 1VF8A 5A8MA 4AIUA 3AHVA 1E6PA 4LGXA 1TZ7A 2XWDA 4OUEA 4CN1A 3VGEA 1QBAA 1LL7A 3UEQA 3AZRA 3U5YA 1EIBA 4MJ4A 2DIJA 5CQ1A 4AZHA 1ISXA 1QHZA 1ITXA 1GHSA 1VFOA 2PF0A 2CHOA 4B16A 4YN5A 3TTQA 2YBTA 1V6VA 3UESA 3WNKA 4AC1X 1XRVA 3AICA 1W32A 3B9DA 3KL0A 2E4TA 3M7SA 1G94A 1UD2A 3SURA 2EPKX 3AXXA 1B90A 4MNMA 1XC6A 1JDAA 3VD4A 1UWUA 1FP9A 1JIBA 1Q6CA 4F8XA 2GJRA 1FOBA 1US2A 5I79A 4D6DA 2GDVA 1KR1A 4HOXA 1QOXA 2CKRA 1N82A 5KZ6A 3NJ3A 3N12A 5EB8A 1B9ZA 1V6XA 1WP6A 1GCYA 4P8VA 2NT1A 2PWGA 5BYWA 5CGTA 5KEZA 2VCBA 5E09A 4GI6A 4PMOA 1M01A 3EDJA 1H0GA 2WMFA 1UZ4A 4HU0A 3OLDA 3A47A 1CGYA 2WMHA 3SCQA 1Q6EA 4BQ5A 1ODZA 3A4WA 2D0HA 2WMJA 1XGZA 4KGLA 3VINA 4PMXA 1UR9A 1MW1A 2JFEX 3SCRA 4MB3A 1GJWA 1OGBA 3PZ9A 3GZAA 1J0YA 3G6MA 5LYRA 1KXHA 3WENA 3IAPA 3T0DA 2WANA 4PMVA 3RM9A 3SCTA 2G4FA 3MSDA 2ZX7A 3WEMA 2YA1A 1W3LA 4BCEA 5A8NA 1WDRA 1V02A 1KQYA 1B3WA 1HL8A 1H4PA 2ESCA 4PCSA 5AC4A 3ARPA 2ZXAA 2PBOA 3L4YA 1BGGA 2CBUA 1XYFA 1GZJA 2DSVA 2XIBA 1JNEA 3RJYA 3QHOA 4HMCA 3BC9A 4UQ9A 4BF7A 4U3AA 1HX0A 2BY2A 5A6SA 3VX0A 2Z1SA 1VENA 1CXEA 1SR0A 1DWAM 5A6BA 3IJ9A 4HOWA 3WUEA 4CD6A 5LA2A 1MXGA 3QOMA 1E6SM 2VVSA 3APGA 1CECA 1BFNA 5DFAA 4V27A 3WBAA 1LJYA 2GUYA 2ZIDA 4CN6A 3WFZA 5GPRA 1US3A 1GPFA 3W6MA 1E0VA 4MADA 2WLZA 1ZBWA 1OD8A 4F79A 3BLPX 4XZWA 3VD7A 4AD5A 1DWIM 1XCXA 1HT6A 1XSKA 2V5CA 3PBGA 5GNZA 4JFWA 4PTXA 3CLWA 3IJ8A 4AEEA 1E6XM 2YL6A 3SCUA 2CBVA 2WCSA 2GDUA 1BSIA 3OGRA 1AVAA 2YLLA 4NF7A 4U33A 4WIWA 5M03A 4ATLA 4J3VA 2XSBA 4AEFA 3BXWA 1JI1A 4P7NA 2YL8A 1C8QA 5FIPA 2WNWA 4A3YA 1B3VA 1O6IA 3DC0A 5C71A 4D1JA 1KCKA 1U33A 1SFSA 3EDFA 3PZNA 1BVZA 1UD4A 4UFIA 2E0PA 1VAHA 1U2YA 1DWFM 2CEQA 1MWOA 1HP5A 1UR1A 2IXVA 4HPHA 4RE4A 4ATWA 4UQBA 2PI6A 3W25A 4AWEA 1NOWA 2BS9A 1YQ2A 4PSPA 1MXDA 2EBNA 1UD6A 4RE2A 1JAEA 4W8LA 1F4AA 3WNNA 4AZ5A 2WB5A 3VM5A 3BMWA 2VC9A 5D9NA 1UWSA 1BYBA 1C91A 1HNYA 2WKGA 3CUIA 1X6LA 4Z2IA 5BRPA 4Q22A 2FDMA 5HXMA 4CUCA 5AY7A 3BAJA 3N1AA 3CZKA 3PZTA 5I2UA 1FFQA 2WC3A 3ZJKA 3CH9A 2Y2WA 4ZENA 1E3ZA 3L4ZA 4UQDA 4QCFA 3W82A 1CXFA 1A3HA 1DWJM 2W62A 3WIJA 1SYTA 1VB9A 3VIGA 2VT0A 3AISA 3CMJA 3DYOA 1UR4A 1LG1A 2FHCA 1BHGA 4DM2A 2DT0A 1QI2A 4W7WA 1C92A
chains in the Genus database with same CATH superfamily
4Q32A 4L6HA 1JVNA 4DBUA 2RUSA 4ZBCA 4WXYA 4AY1A 2H3DA 4QG6A 5A2CA 5AHLA 1ZP4A 5KETA 1YPIA 4H9TA 4KFPA 5D04C 3VIMA 4MNKA 5DX7A 3WQ5A 4OHQA 3ECQA 1Z9AA 3S1VA 1ISWA 4PTNA 2ACRA 3O3RA 1OC5A 4HB7A 4XVDA 3NIYA 4QE1A 2YCJA 5K4ZA 4DRSA 1EPXA 3W7CA 3FJNA 1H2JA 2PF8A 3Q67A 5AFDA 2GL5A 3IIZA 5GNYA 1K8YA 4DWSB 3HQNA 3CUXA 1OGSA 2B31A 1GTEA 1QHPA 4IQJA 1D7FA 1TWWA 2NX9A 1XLCA 4LVBA 1TCMA 4G7EA 2CHNA 4R7WA 4HJWA 1E5NA 2ZXQA 3NYDA 2X1TA 3ZJ7A 1EQCA 3VC6A 2BHYA 3IGHX 3W38A 4A3HA 2YYUA 2G3JA 2Z25A 1DXEA 1HJQA 3KBJA 4QR6A 3AS3A 4Q3MA 3DFPA 1RH9A 1DYSA 3HMJG 1E1CA 1VHCA 5IDZA 1GHRA 1SZEA 3THUA 4BQ2A 5DY3A 3T0TA 3DIPA 4W88A 4HHMA 1RA5A 1BXBA 5I77A 4H7VA 1KTNA 4W9TA 1BRLB 1K4HA 3AALA 3BQ6A 4U31A 4HMEA 3QFEA 2ODOA 1GOKA 1P4CA 1AFSA 3VOJA 2BDQA 4PMUA 3C56A 3GTXA 4AVOA 2DEPA 1LRQA 4IP4A 1PZ0A 4ZO6A 4TOQA 4KEZA 4KIRA 3A22A 1KBJA 1BG4A 2C79A 4AU0A 4M19A 4OFCA 1JZ5A 2VFEA 5FJTA 1KW1A 1WKYA 4EPBC 2XM2A 4DJFD 4AY8A 1POKA 2A6LA 1B3XA 4A8NA 4H6KA 5FF4A 4ZO8A 4RV3A 3RR4A 1X97A 3GDBA 2YDQA 3P93A 4NJKA 3N6JA 1AJ0A 3O06A 4QTGA 4QNEA 1E43A 4I9AA 3PZVA 4YCPA 4MWAA 1EDQA 1E71M 1AH4A 3AIWA 2ZTKA 1IZCA 3TDFA 1MVYA 5DY2A 1V0LA 3BSHA 1XKYA 3N19B 4J3WA 4REQB 1GZ1A 2BLEA 3ABZA 3R43A 1V3LA 4X2RA 3ZFHA 4KH2A 3LI1A 1XUZA 3L4WA 3SUSA 4O17A 1JPHA 2NSOA 3ATYA 5DLCA 1GOWA 4A21A 1X96A 1VLWA 1CB7B 1YIXA 3F4DA 3OVRA 5FSDC 1RBAA 3IRSA 1E3XA 4UQEA 3LPFA 3LHUA 3BCDA 4GXMA 3UWYA 1ZGDA 1C7SA 4W8BA 1G4EA 1QWKA 3B8UA 3EX4A 2PDBA 1YE6A 4PB4A 4GXPA 3SDOA 2FZ9A 2HK1A 3RMJA 3VZXA 1ECQA 1REQB 1XHGA 1UWTA 2A3HA 5C8BB 3CZJA 1TWDA 4MNLA 2DSUA 1IYXA 2V5BA 3AS2A 3RN6A 2EQDA 5C55A 2Y1HA 5LNSA 2GGHA 4P61A 1TG7A 4LC8A 4LH8A 3GG8A 3N2XA 5L9FA 2BHUA 2BV9A 4QRNA 1OBAA 1A3XA 4ZVJA 3RITA 3UG3A 1SJAA 2FZDA 4AZGA 3MWAA 2AAAA 2QMJA 2VR4A 3DI1A 4NAEB 4B4HA 5KSWA 5G2HA 1S5WA 3QMSA 1SMDA 1OY0A 1TR9A 3ANUA 1DQXA 2RDTA 5EMKA 3OLEA 4HNCA 3NTYA 4H2CA 3TYUA 2OT1A 3DUGA 1L0PA 2V2HA 5AB3A 1H62A 1POJA 2DIEA 2I5IA 2GPTA 1B54A 2X0HA 4ACZB 3CL8A 4Z2LA 4CN4A 2PDCA 4CNNA 1JULA 3RGTA 2X2GA 4DY1A 3BSMA 3BLEA 1CXHA 3L5AA 4HBKA 3WJZA 4BQ4A 3G8RA 3QV6A 1M7PA 3D5HA 2XFFA 3STFA 5HAOA 3QYQA 1DJXA 1M7JA 1KLZA 2PWVA 3TH6A 2JKEA 2X09A 4LYRA 4XIAA 4PCFA 1P7TA 2VEPA 1OCQA 3TU9A 3PANA 2ZX9A 3G8EA 1QI3A 3C2YA 3GLCA 3O1NA 1PTDA 3THCA 3G22A 1VEPA 2DW7A 1VFFA 4JTAA 4IMFA 3AJ7A 3F4WA 2DT1A 2WXDM 4TUFA 3SW6A 3NSXA 4QBXA 1R7OA 4BA0A 3SUTA 3DCPA 1IR2A 1C29A 1V5XA 2C7FA 1BGAA 2Y5JA 5FI8A 3BZGA 5LNRA 3AIUA 2Z00A 4QG8A 3QC3A 1A4LA 1VEMA 4LEQA 4M3PA 3TSMA 1W54A 4C6JA 3AOFA 4D9PA 1HKJA 4M29A 5F4SA 2PDWA 4WJ8A 1DJGA 3COTA 3AMGA 3LCIA 4FZIA 4CNUA 1BG9A 1UD5A 3UR7A 2IKJA 1TWZA 4QISA 1R46A 2IW0A 1AJ2A 4J27A 2BMBA 1A5CA 4XD4A 2PLJA 4IGMA 1Y5XA 1IXQA 3JZUA 1BYDA 3T55A 1DQUA 2NUXA 2F2KA 4GNKB 2XINA 3C61A 3AQUA 3KRSA 1IIGA 4L1WA 1M04A 2WBKA 2A7RA 3W07A 1IGWA 4QNWA 1NFGA 5G4WA 2B81A 3GC4A 3LLFA 3IEBA 2UY2A 3H22A 3EXSA 4JEJA 3N9SA 1J18A 3W7HA 1S5TA 1Q6FA 1W1TA 4W5UA 4DJFA 2XVLA 3MHUA 4LUTA 4W84A 1EJTC 4J3UA 2RDWA 1HVXA 4IZGA 2FGZA 3C2VA 1HUVA 3PM6A 3S46A 1A5UA 4G7EB 4ZA0A 1M1BA 2FH6A 4HU4A 3PN8A 4GJIA 1A5NC 4QJ3B 1A5SA 2Z1WA 1QXLA 4DLFA 3CL7A 3NR0A 1S2CA 5IFPA 1JG9A 1HL9A 1R9XA 4IFOA 1VRXA 3LS9A 4BY3A 4CD4A 4W89A 3EDEA 4PB3A 3EWCA 2X16A 4IWWA 1CTNA 3OZMA 3T7VA 3NQGA 3MV11 3CEPA 1RQEA 1HJUA 3OLGA 3W2NA 2VRKA 1K6AA 3GHRA 1KRCC 1K9TA 1KKRA 2Z2BA 4L7ZA 1LLOA 4UMCA 3NNTA 3U2CA 3ITLA 1RY8A 4FALA 2XTKA 4AZIA 3WLIA 3A5FA 3GYEA 3QEZA 4UNIA 3UG8A 3KX6A 3U48A 2QIWA 5PTDA 1V0MA 1KM1A 1CLKA 4Q6JA 4OOUA 2PWEA 5F2IA 4ZQOA 3HQOA 2WSQA 2X30A 3EWDA 1QNQA 3L12A 3OHMB 2Z26A 3AMLA 4MAZA 5JBDA 4KWSA 1WPCA 3GVGA 1FWFC 2QGYA 4ZOAA 5CBBA 2V5JA 1P1XA 4O8RA 3QJAA 4Q4PA 4Y9AA 3WH5A 4O0ZA 1HXJA 2HS6A 2BXZA 2PLCA 4MZ1A 4YPJA 4GGBA 4LCQA 4WKHA 4QX4A 1PJ9A 4UTWC 1VFUA 3LV5A 1M7XA 1HJWA 3EWXA 3BICA 4R53A 4N2YA 1CGUA 4NJIA 3WBEA 3H4WA 3DU0A 2PRMA 2FVLA 2OMAA 3BVJA 1J11A 1ISZA 2E1WA 3EB2A 2TMDA 2YPIA 1MYRA 1KC7A 2ZKMX 3URAA 3BOXA 1U83A 3AYVA 4LCSA 2NW0A 3MJMA 5A6BD 4JFTA 3PFMA 3FAXA 2E09A 6XIAA 1J0IA 3EEGA 3K1DA 3SGGA 2NXGA 1B3OA 3P0WA 2X8RA 2X1IA 5LSMA 3ARSA 1BVWA 1PBGA 2EO7A 3V7PA 1T41A 1E51A 3PBUA 4XV0A 3DESA 4GQQA 3UZYA 2XFRA 2RJGA 2X41A 2WQPA 2V0TA 4B5SA 2E6YA 2J8TA 3V18A 2WOQA 3ALGA 5A69A 1WDWA 5I07A 4DBWA 3A23A 4ZR8A 3GBEA 4JTEA 4LQ1A 3C86A 2VWTA 4P8WA 1JFHA 4X60A 4BJHA 2W66A 1B57A 4X2PA 3W7EA 1YXCA 1ZUAX 4RDZA 6XIMA 1AW1A 5CSRA 4E0CA 3WD4A 3GTNA 1PKMA 3CT7A 1TWSA 4L64A 1TPVA 3PTQA 2BSLA 1GYMA 1GVOA 1KM5A 4ASTA 3TQPA 3B9EA 1RY0A 2OYMA 5BOEA 4DO6A 3KOYA 3SZ8A 4HPNA 2XVKA 4JIEA 1EA9C 4AYSA 2XVNA 3WH9A 1OVDA 1Z69A 4RJEA 3QY7A 4JTFA 2C14A 3LCXA 5J04A 1PVNA 2DU2A 3UJ2A 3T05A 4EWJA 4LS2A 2VCAA 2G3MA 2VP8A 4PB5A 2G4JA 1HKWA 3CQ0A 3RXZA 3DKJA 3ITXA 4US5D 1SJBA 4UIOA 4TV5A 4PN2A 1S1RA 2PDFA 1ONXA 3RM8A 4MF4A 4EPKA 2OLHA 2PTYA 3W1QA 1LORA 2MNRA 3G1VA 1OX5A 4HPGA 3ARZA 1EEXA 2Z24A 2ZZ1A 1XBYA 3ENLA 1GTHA 2F6KA 1V03A 4HU8A 1MQPA 2Q3RA 3G1HA 4C5YA 1R87A 4BWLA 1WUFA 1VPYA 4V28A 2D3NA 3DFTA 4DJED 4MY1A 2GVEA 3EOEA 5D8WA 1M53A 3RIKA 4NXSA 2KAUC 3F2CA 3L4TA 4IM4A 5D09A 2CZ5A 7A3HA 4HA3A 1LYXA 3DGRA 1E9YB 5G1MA 3MQTA 2PLMA 5K9CA 4ZE5A 1HGYA 4RE3A 4ZQNA 1XKJA 3L2IA 1JEZA 3BLDA 3WLTA 4UR7A 2A1YA 5HINA 3OTRA 2VZOA 3H24A 1EQPA 2OSYA 4E2VA 3TN3A 3H12A 1GGOA 1J0KA 4L6DA 2QCMA 1H5YA 4B5VA 4AUBA 2CITA 2VNCA 2YBVA 4FX7A 1G4TA 3AXHA 2HS8A 2WHKA 5DMLA 1NU5A 1FDZA 2ZZ6A 2ZUWA 4Z1YA 2FMNA 3K13A 3T6CA 1EH9A 1XYLA 2NLYA 3MA8A 4NJGA 1C3FA 3OYXA 1V0KA 5FEZA 1BYAA 1RJQA 2HROA 5CLTA 2VC6A 3HV9A 3K1GA 4M5PA 4KIEA 3L23A 2WSYA 3CEUA 2E5BA 1DHPA 5AYXA 1HKIA 1W1VA 4Q4OA 4XX6A 1VZWA 3E9AA 1WZAA 3WQWA 3DBPA 4YJ5A 1VYSX 1GVFA 3P3BA 3LD5A 4K7VA 5BWAA 4LUTB 2GK1A 3E0FA 3IVUA 4AD3A 4IFKB 3LSCA 1IEWA 5LA0A 1H1YA 3PJUA 1SZGA 2CLMA 3YPIA 1S1PA 1TJ1A 4H83A 4GINA 4HCLA 3NQMA 1S38A 2UZ9A 3LERA 2XPKA 4JTKA 5AKQA 1VBUA 4NQ1A 3TROA 5TQLA 1SR9A 3WF4A 1BF2A 1GG1A 3VTRA 1UROA 1QBBA 1ZHAA 1TJ2A 4NRSA 1K3UA 1E72M 2W61A 1TE1A 3M5VA 3OQEA 3T1GA 3E5PA 2WCGA 4JNMA 3MKKA 4GVHA 2OWXA 1EGZA 1LQ2A 3W73A 3WLNA 2PMQA 1XD1A 5GNXA 2QGHA 1VJSA 5TIMA 7TIMA 1W6TA 2XIQA 3R1ZA 3WLJA 1LOQA 2LLEA 1UKPA 3UG4A 3NEVA 3N3TA 3VDGA 4A29A 4ZODA 4ZXOA 1DJZA 3GXIA 5D2VA 3BW2A 1A0CA 1TB3A 1EX5A 2PTZA 4S3FA 4XB3A 5DXXA 3HQPA 1S5NA 3O6DA 4IPIA 1W91A 3M7WA 1VYRA 2VCCA 1ZCOA 4DO4A 2VEKA 2QUVA 2VZUA 1XYBA 1A5OC 3ZWSA 1FXQA 1F5ZA 3PSWA 1VEOA 3PZIA 5FOOA 5TF0A 5K9XA 3KXQA 3HF3A 1UMLA 4LAOA 1CDGA 1DWGM 4IMDA 4XAYA 4QSHA 1O5QA 2PPGA 5A6LA 1W9VA 4PMDA 5T8GA 4RPPA 5HWJA 3H21A 1XIHA 1ECEA 1IT7A 3M6DA 4H9UA 1SMAA 2VDHA 1JYXA 2RKXA 3E1F1 4JL1A 1CEOA 1SUXA 3HG5A 3FSUA 3MP5A 3MUXA 1EWEA 1ZY9A 1YXDA 1JFXA 1X38A 4FK9A 1VFMA 3QVQA 3VMOA 1UA3A 2EG7A 1C8XA 4O50A 3DKLA 3QKZA 1BD0A 1LCOA 1VBGA 3TQVA 5L6UA 1K4GA 1GPWA 4UOJA 2FJUB 3H7RA 4O10A 1UBPC 1QR7A 2E6DA 2OO6A 3W01A 2PSNA 1J6PA 4MWAE 1A5KC 5I7GA 3LK6A 4MKSA 1A5LC 5B7YA 2J7HA 3BARA 5I5RA 1R38A 1I6NA 3AMKA 3FXYA 4UWMA 6A3HA 1L6WA 3POCA 5CG0A 2OTDA 3B97A 3OB8A 4Q4MA 5J8LA 4KFOA 3UPBA 2VEGA 4RZBA 5CEWA 1MQRA 3N4AA 2DT2A 1V4YA 4O15A 4X0NA 1W8GA 1A53A 1MXSA 2TRSA 1EKOA 3P7YA 3TN6A 3RX2A 1YDYA 4FI4A 2WHMA 1O7AA 2D2JA 5E0CA 1HO4A 4O0QA 1RQBA 3NQFA 3EOSA 1E6QM 3W2JA 3BLKA 1LUCA 3VA8A 3B3DA 4GVGA 1XYZA 3MU7A 4JFSA 3WH7A 4FNQA 5REQA 2FZNA 1E1EA 2DUZA 4MYAA 4NSBA 3UG5A 1QT1A 1XIIA 2PP3A 3VXGA 2IQTA 4B90A 1TO3A 5AHIA 1H49A 2AQOA 4X61A 1ITUA 1DV7A 4TIMA 3F4NA 4J40A 4GRSA 4D72A 3AWOA 4H6EA 4CU7A 2TSYA 4PTDA 1U1UA 2WPGA 5JBEA 3G0XA 1UZ1A 3VNJA 3CTTA 8RUCA 4LB4A 1TVNA 5DRIA 2BASA 1RUSA 3PZQA 2Y24A 4MZ8A 3M0YA 4GGHA 1R8LA 2YDSA 1MDLA 3MYPA 3L4UA 3PWAA 3M0XA 1DBTA 2QJGA 2KX9A 5FKYA 5D9OA 3K4WA 2OWCA 2QJHA 4S3EA 3U2EA 1K7FA 1RJRA 2NSXA 4L61A 3BJSA 1RLDA 5AZ0A 3NQCA 4LAKA 5TNVA 2WNNA 1AH3A 1ENUA 3WD1A 1MDRA 5JH1A 5A2BA 3CO4A 3CIWA 1PEZA 4PFMA 4W4QA 1I75A 3M4HA 2YGYA 4OVXA 2E3ZA 4DZAA 1E55A 1W2PA 3ABSA 5FAJA 1PHQA 4RR4A 5CXPA 2QDGA 5T9BG 4RDYA 4A3RA 4JKKA 5I00A 1PO9A 3LCGA 1OFEA 5CGMA 3WCZA 1GJUA 4EXBA 5EPDA 1JCNA 3FW6A 4DPPA 3ATZA 1PIIA 5KZEA 5C5YA 4D8ZA 2HZGA 3DZ1A 1NJJA 1M9HA 4FHAA 3S47A 2ZZ3A 4JS3A 1HW6A 2OQYA 3TNOA 3OBEA 5ABEA 2WCAA 4K2SA 5LGZA 1FCQA 4QLJA 2ON3A 2NX3A 3HMCA 1XLGA 3WLRA 4BZYA 3HB9A 4LYKA 1W9XA 4Z0SA 1JZ6A 2VGIA 3KTCA 3UBPC 4D8LA 1R3VA 4GJ1A 3SN4A 4CU6A 2FIQA 1R3WA 3VKBA 1TMQA 1C90A 3D46A 3OBAA 3M0IA 3WH8A 5XIAA 2DZVA 3CPUA 3LHTA 1DJWA 1AW5A 1Y5VA 2CZDA 2CLEA 5DT5A 2GYIA 3CMGA 4GQGA 1TUXA 4KMQA 3ITOA 3FY1A 4M7SA 3V1HA 2QV4A 3WKZA 1FH8A 3FX4A 4ZSTA 3O15A 2O7SA 1UYQA 3ZVHA 5I3JA 1FA2A 5HQLA 2VGBA 4LY8A 5FJOA 3MKVA 2VYOA 4IP5A 4JQ2A 3EKZA 2GJNA 3CLMA 3E12A 3ZR4A 2BZNA 2Y62A 2C8NA 2WJDA 3IVSA 3W29A 1XISA 3JU2A 3M41A 2CXEA 3WDRA 3NZRA 4JN6A 4IMAA 3VCRA 4AEOA 2CC0A 3BAWA 2PDGA 2WWDA 4G7FA 4PA8A 1VLIA 4RX0A 1B4EA 5J5RA 2VEFA 2WYSA 3VE9A 2J9ZA 4C6FA 4NU7A 2A5HA 2V67A 3MO7A 2C71A 2VD8A 3TONA 1XQLA 5CAHA 4AIUA 2ZC8A 3U0HA 4H7CA 3P80A 3VGEA 3S9YA 2O4MA 3U5YA 2HVNA 1EIBA 2DIJA 4AZHA 3UJSA 1YNYA 1ITXA 1GHSA 4LJ3A 1ADDA 2B0MA 4YN5A 3VAVA 3TTQA 2YBTA 4CEUC 1R3RA 2FVKA 3TW6A 3AAMA 3KL0A 2E4TA 3SURA 3M9YA 2V5LA 3WK0A 3N34A 3TC7A 3L21A 4RXFA 2V63A 3HJZA 4F8XA 3DG6A 4D6DA 3UQNA 2GDVA 3GHSA 1JUKA 2P8BA 3IUIA 2PDNA 2CKRA 3MP3A 4P8VA 1BTMA 4YTSA 2NT1A 3CB8A 3V4BA 4DBDA 1RK6A 3GKFA 4ZTYA 3W7KA 5CGTA 5KEZA 3R4IA 4GI6A 3MTWA 1H0GA 1UZ4A 2GVLA 4Y9MA 3WYZA 3QN3A 5D03A 5M1TA 1EYWA 3HBLA 4P2VA 1Q6EA 3TYCA 1ODZA 3QV9A 3TN4A 3WQFA 1YADA 3B0PA 4IOTA 1MW1A 5BMWA 1OGBA 3PZ9A 1J0YA 3TFXA 5LYRA 1KXHA 4HHHA 3VK5A 3T0DA 1FCBA 4PMVA 3SN1A 3QQ0A 1S2UA 4I5RA 2XZ9A 1TV4A 4AB4A 3IS4A 2YA1A 4PR4A 1FTXA 1HL8A 3NQ2A 1BGGA 3L66A 2PCQA 4DBSA 4BI7A 1XYFA 1GZJA 4JY8A 2DSVA 5HMFA 1Q2SA 2GSHA 2XIBA 3RJYA 5TAOA 4IP7A 3NG3A 4UQ9A 3T4CA 4Z17A 1SO3A 1HX0A 2Z1SA 1SR0A 1H7RA 1OZQA 3NVDA 3IJ9A 5HA7A 3S0CA 4H4IA 3DX5A 2ZVRA 4MPQA 3W72A 2VVSA 3APGA 3GR4A 4V27A 4HTBA 3SRDA 4GYKA 3W7LA 3OVQA 2WJFA 1A50A 1GPFA 3N29A 2YCIX 1FWGC 3ANYA 2OZ0A 4IJCA 4FEZA 4MADA 1O95A 3VD7A 3C8NA 4AD5A 1KA9F 1DWIM 2GGIA 1HT6A 1LUCB 5AHNA 2DZPA 4PTXA 5XIMA 5REQB 2CBVA 1P0NA 5AOUA 1DJYA 1TPB1 3FVDA 2PDIA 5A8GA 3OGRA 4A6GA 4HPJA 4U33A 4DJEC 5FJIA 4ATLA 2HVOA 1DIOA 5EGRA 1I9CB 3AWNA 3LTPA 2FQIA 4DF1A 2PCEA 1B3VA 3BLIA 4JBRA 3P5ZA 3PZNA 1UD4A 3WK3A 3R13A 3I68A 2E0PA 3W7JA 2R91A 1DWFM 3MVIA 4Y6GA 1UR1A 1HP5A 4ATWA 3L65A 4CNOA 4AWEA 3EAUA 3KS6A 3UF9A 4RV8A 3GFXA 4PSPA 2EBNA 2QDDA 4RE2A 1XS2A 4M1BA 3TR9A 3WNNA 4XISA 2R1LA 3BMWA 3M64A 5D9NA 1X7FA 4GXWA 1C91A 3CUIA 4Z2IA 2V2CA 4DIAA 1ZNNA 3BCJA 2J13A 4RXGA 5FACA 1FFQA 4JICA 4LF2A 4NNBA 4ZB0A 4AWUA 3ZJKA 1ADSA 4ZENA 1E3ZA 4IGSA 4ERAA 2W62A 3WIJA 4MY8A 4CQ8A 3W7PA 4DM2A 1OK4A 4QS5A 2QDHA 3LGDA 2E5CA 4LCRA 3NURA 4K3ZA 4BK9A 2E77A 1IZJA 2OVLA 1WDDA 4J3SA 4H2HA 1Q6GA 4I8DA 1QK0A 3EDKA 5CBJA 3P82A 1IIHA 4NYUA 4HNVA 1KD0A 2Z2UA 4E4UA 1WV2A 3B9NA 1R2RA 4YCOA 4CQCA 4ZCWA 4E6MA 3SQMA 2PB1A 4PZVA 1NDYA 4FF7A 4ICCX 2QCFA 3BPWA 3KDNA 1TVPA 3PC0A 3VE7A 3T42A 3SSJA 1FY6A 5E9XA 3EKLA 3QY8A 2ALDA 1YMYA 3B40A 3LCLA 2FGBA 4J2PA 1Q13A 2BFGA 1MZRA 2PDQA 2HBXA 2YB4A 3RPTA 5BOFA 2VFIA 2G3NA 1PZ2A 2ZE0A 3R6IA 3KTXA 5FSEC 4O1BA 2BBFA 1CZ1A 3ZLGA 2ATSA 3TYAA 3IUDA 1HO1A 4FOJA 5F7UA 4HYVA 3OJGA 3NL2A 3N6HA 1KO0A 4EACA 3K2GA 1Z48A 5AC5A 4PH6A 3QTPA 1DTNA 3ZO9A 4GY7A 3SCVA 1I60A 4MIMA 4AZBA 2G5WA 5ABGA 4Z1BA 5FF3A 2OYKA 2QR6A 3K8MA 2NQHA 4P7OA 3FA3A 5C2CA 2J47A 1YLVA 2F7FA 3E2VA 3O0KA 5HQEA 4HT3A 1OG0A 4F9JA 1L8NA 2YDAA 4GJJA 2GQ3A 1H50A 5IHRA 1W9DM 4X3ZA 5A5WA 1U1JA 3EA2A 4Y9OA 1M03A 1XLFA 3KW3A 2HISA 3U7BA 4XBKA 5A95A 2HVMA 1UP0A 4F0LA 3UT0A 2G37A 3EX3A 5D2YA 3SADA 1QO2A 3MW7A 6PTDA 1OC7A 3BAYA 2DDXA 4L65A 1OWQA 3EPMA 4CKQA 1GK8A 4DWDA 1E6RA 4Z2KA 1R85A 3BLLA 7XIMA 4WK9A 1KBLA 3E3HA 1WQ5A 1B31A 3HG4A 3GXDA 3H8AA 4UTKA 3R10A 5I3GA 1DJHA 1EEPA 5DELA 4O57A 1WXZA 1OCNA 2DZSA 3V3WA 3VNDA 1IT8A 3LMYA 2VGGA 2FZBA 1VCVA 1WKEA 7REQA 4ZE4A 1UQZA 4HA1A 3SN0A 4LUSB 1UBSA 4L9XA 1HG3A 3S42A 2BOEX 3ITGA 3VIFA 3W7OA 3TC6A 3CHVA 2OWWA 1KCXA 3R94A 3ZSTA 2GSJA 2XUCA 2VQUA 4JTJA 1VH7A 2DORA 1Q3NA 1FHDA 2VTFA 4P8UA 4UTLA 3RFAA 3VIOA 3LHWA 3K30A 1KR0A 3NGJA 3KBSA 2R24A 4NYYA 4V1XA 4IHCA 2OQLA 3LCHA 2EG8A 1GONA 3OU8A 1GKPA 4CGTA 5LHFA 4QQUA 4CD8A 3R8GA 4J9JA 3FFSA 4GQBA 1YTKA 3RPMA 3MUAA 1Q2RA 2CBIA 2YCLA 2X0YA 2R1KA 2ZE3A 2IPGA 2DZBA 3KWXA 2J9YA 2PRHA 3OOQA 3LPOA 2V30A 4PL1A 2E40A 1ONRA 3DECA 1OFOA 3G1RA 3CV2A 2ATMA 4R34A 4JIPA 4ZEPA 4GO8A 4TVCA 1GOIA 2XWEA 1RBOB 3GUGA 2NUWA 3RAOA 4HHLA 2ZZ5A 2V5DA 4WSJA 4XD3A 3XINA 2BVDA 2Y8VA 4LXFA 4W87A 1QJWA 1E15A 3R0KA 4HIBA 1H7NA 1JZ8A 3GSMA 3O7UA 4Q4QA 3N17A 4F0RA 5EFDA 3LGEA 4NZ5A 3V0SA 2VGFA 4XSLA 3VU2A 2JEPA 4HSNA 1XPYA 3GH4A 1I2PA 8XIMA 3TZFA 1F05A 1KRMA 1PZ3A 2PDUA 3F1QA 4EIVA 1E4LA 2G0WA 4U5IA 2QUMA 5DN1A 3VM7A 1I1WA 1AUSL 5EMLA 4UQCA 1KV8A 3HM7A 1YDOA 1D3HA 1F6YA 4JTIA 2ZRXA 4N4QA 3LHVA 2JF6A 4KRTA 3C0LA 3WMBA 3E74A 1NQKA 9XIMA 5FESA 4JX6A 3WK2A 2XN0A 5BXSA 5D05A 4ML9A 3UA4A 2GVGA 4UCFA 1EP1A 1JGIA 5HUOA 4J3TA 4JNYA 1AQHA 1BYCA 5DCEA 4KKXA 1R2TA 1F3EA 1PPIA 4AIEA 5C9XA 2XSAA 3P8JA 4O1AA 3FCPA 2WNQA 3L4XA 1JDCA 3L0GA 2EEXA 4MVAA 1JZ3A 1W2VA 2WO5A 5HPOA 3IK4A 4O53A 2XGIA 1H09A 3QPEA 3GNRA 3LXBA 3S5SA 1XIGA 5BXRA 4Q33A 1JR1A 3RG6A 3CHFA 1GOOA 2O9TA 2A85A 5HOSA 3C0SA 3A3WA 1TV7A 1J8VA 1MFVA 3KHDA 1L2UA 4TX6A 4BKNA 4UCGA 2WSKA 3XIMA 3G0UA 2R8WA 1PTAA 4ZQRA 1V3KA 2KZHA 3HOJA 3FYPA 2Z7KA 1KTBA 2VDIA 4C6MA 1DWHM 1GKRA 1PX4A 3GU9A 4EPDC 3ZYZA 4IL0A 3U8GA 3W1TA 4PEEA 4WSHA 3UCQA 2REQA 4C7FA 2VRJA 3U7VA 5ENLA 2D2GA 1VRDA 3ZWTA 1TIWA 5C2GA 2GUBA 4RNFA 4H6QA 1QWGA 2QW5A 3SSZA 3UCCA 3AYSA 3KVKA 4JHMA 2PZ0A 2XN1A 4M51A 1UW9A 3ES8A 3AS0A 1KFWA 4DWSD 3T4WA 1FCUA 1OIFA 5A8OA 1ELSA 2OYLA 4GK8A 5BWFA 1T8QA 4ATDA 3SRKA 1JCMP 4R85A 4WRHA 5M17A 3ES7A 4PUDA 3AIRA 3IGXA 1KM2A 4E4PA 3EYPA 1O68A 4RLIA 2J8FA 3A21A 4IUOA 1X8FA 4GD0A 1FKXA 2FZ8A 3NOYA 1S39A 3QHNA 3S6DA 5C0QA 2DY3A 4BR1A 4G8TA 5KTLA 5T26A 2YX0A 5D2WA 4MPKA 1GQNA 1EBGA 1D2KA 1NSJA 4KW2A 3QRHA 1QW9A 2QNEA 3UZXA 1HFBA 2HNEA 2G95A 3I6EA 3HU7A 4E3TA 1JF6A 1W9UA 1U5JA 2BODX 3AIEA 2ZUTA 4D8AA 1QASA 1E1FA 3CO8A 2BXVA 4ZQPA 4Q8WA 4ALDA 1SSGA 4JAWA 4MZYA 4LX4A 1K8CA 1YX1A 2WV8A 4MJ2A 4PBFA 3NSMA 4XVEA 2YDRA 1Q6RA 1QW7A 2VOTA 2Q09A 3TJ4A 1MZHA 3BE7A 3BZJA 2OLAA 2I9EA 3FDGA 5D4YA 3F4VA 2QF8A 2PWUA 1T7LA 3EWUA 4J3ZA 1XLLA 4YL2A 3EWYA 3WN6A 1QFEA 4TVUA 4UUIA 3ZT5A 5FCZA 3NQAA 5FEPA 4IIFA 1EPVA 3GNNA 2D3LA 1UUOA 2A7PA 4DUOA 3TJIA 4F66A 2VEIA 2A6NA 3GXFA 3PAOA 1ZS2A 4K38A 3V5FA 2I57A 2ZCGA 1RVGA 3VNKA 3MI6A 5ECUA 1YTDA 3N2BA 3UNTA 2SFPA 2J8GA 3G6LA 3RF9A 3S9ZA 5AHEA 5LNWA 3E0VA 1OT1A 1X1OA 4DF0A 4E2OA 1J5TA 4AWTA 1MMFA 1TV3A 3ZLHA 3RMEA 3T44A 5KZDA 3WG6A 5HDRA 2CLHA 3EOUA 3W22A 1QO5A 1W0MA 1CGXA 1UPPA 2DUXA 4UTTA 2VD9A 2W79A 3WO8A 5I6SA 4F2BA 1K7EA 4MUZA 1LT7A 3OGSA 4NZJA 3FOKA 6CGTA 1KFEA 3U4FA 3U3HA 3PTMA 3EOOA 3P81A 4IQLA 2VUNA 5LIKX 3C3UA 2VI0A 4O14A 1RALA 5A94A 4GUIA 2D0FA 1HTIA 3I7SA 3Q45A 1XLKA 3ARRA 2TAAA 2Y89A 3CTLA 2NV1A 4LUYA 5EFFA 2HSAA 4G56A 3SCWA 3C6CA 3QV7A 3H7UA 4G1KA 3LA4A 4A2RA 4YTUA 1RQHA 4R3UA 2YCEA 4GY1A 4KFNA 1IEQA 2O55A 1B30A 2Z7GA 2QIIA 2CBJA 3WY1A 3KLKA 1G7UA 5LIUX 3B04A 1UA7A 1OFPA 1TMHA 1M7OA 3MCOA 5DRCA 1K9FA 6TAAA 1IWBA 2XYLA 5HMDA 2CCRA 3F2BA 3CB3A 2D0GA 4GPNA 3FEMA 4K6AA 3UU0A 1E0TA 1TZZA 4A4AA 5CJNA 1O5RA 3AHYA 3F7JA 2Q71A 3G3DA 1ZCCA 4ZQMA 1HN1A 2PGFA 5G1YA 1FWIC 1FDJA 4J4KA 1NELA 1TA3A 3W53A 4X22A 3VNZA 1LWIA 2WKLA 4EE9A 2X42A 4JDYA 2BGNE 2HXUA 4ILSA 2WBGA 3CAVA 1KRBC 4TTUA 1MEIA 1JL8A 4LNYA 3WDPP 1PS9A 3I4EA 2P5NA 1YEYA 4HHPA 2VFDA 1ALDA 5I23A 4CQAA 1JQVA 4GI8A 5HPCA 2Q8LA 3RCNA 2DSWA 3GVQA 5CPNA 4JFVA 3ERPA 4CCDA 2J4GA 2UY4A 1Z6KA 1OK6A 1IWAA 3WQPA 1LLZA 1E4MM 3E96A 1N8WA 1UR2A 5AHMA 5C54A 4DJDA 3NZPA 4I5UA 3SFWA 7CGTA 3PG9A 3VIHA 2Z6JA 1TR1A 4CEXC 2QCEA 3CAQA 3TR2A 1R2SA 3A3XA 5FJPA 2GFTA 3SBFA 4LS1A 4I6KA 3BCFA 4LV4A 2VX4A 3URBA 3H53A 1XM3A 2OSXA 1BQCA 1JUBA 4J5NA 1V3HA 1GOMA 3USBA 1OB0A 3N2CA 4HK6A 1XH0A 3I3DA 3PWIA 3K8KA 4IPLA 5M5DA 3GXTA 4QGCA 1XPGA 2YLAA 3LBCA 3OBKA 2WHLA 4HNTA 3FAWA 4BEQA 3WJSA 4AW7A 3GNOA 3EA3A 1H7XA 2GVYA 3GFZA 2YKKA 1ZZMA 2JGQA 5F2LA 2GWGA 4C6CA 5CLWA 1ZJAA 2GSEA 2Z1BA 2GJXB 1SFJA 2CZFA 3WJYA 3EGJA 1XDJA 3W71A 2QEZA 3SFKA 4J3XA 1UQYA 2ACSA 2O9RA 1MEHA 4URIA 2P3EA 2I7GA 1EZ2A 3VOIA 4XAZA 5HNNA 4GI4A 3HG2A 2WVVB 2R94A 2BP1A 1HJVA 3RPDA 2REQB 4QE5A 4Z2HA 3U57A 3CYJA 2XN2A 3ARYA 5JIPA 2RFGA 3CH0A 1K7XA 2G97A 1GVIA 1GEQA 3SM0A 4AZCA 5I3KA 1NAL1 4PFHA 2V82A 4TQTA 5U7SA 5FL0A 2OOGA 3WUBA 7ENLA 1OYBA 3FHAA 1VHNA 3NPUA 1V3IA 1EZWA 4G5DA 2A3BA 1D9EA 1GQIA 2XIJA 1RV8A 3NL5A 1JCLA 2VFGA 4D6EA 1EJSC 3TYEA 4R33A 1F6PA 3UY8A 3B9OA 2RGMA 1Q6DA 2AL2B 2CETA 1QATA 1E6ZA 2HK0A 2ACUA 3CJPA 2A3EA 3SJ3A 4PUEA 3VABA 1NEYA 4PL2A 5HR6A 3N2OA 3VKJA 4OTKA 4FXJA 4HMDA 3AIBA 3TCSA 3TSDA 3CZEA 5IBXA 3PTDA 1UWAA 1VIWA 4HZ7A 4C6NA 1C8VA 2QV5A 1F3WA 1GW1A 3W2KA 3CHDA 1GT8A 3TTEA 4ONVA 4DEFA 1W56A 5IM51 3DYMA 4A35A 4JN7A 4TX9A 1EBHA 2HQAA 4ERGA 3L67A 4ECLA 1ZQ5A 3B8WA 5HNTA 5CJMA 7PTDA 3CQJA 3AYTA 3I6TA 3KP1A 4KEUA 2YW3A 2QZRA 2EPMX 3E0WA 4FXSA 2ZUVA 2J27A 4HYWA 1SZNA 3SECA 1EDGA 4AH7A 1ZPTA 1GYLA 1J12A 1RA0A 1WX0A 2OR2A 4PEKA 4IIDA 3RYSA 3UPMA 3GZ3A 2XFYA 4DVOA 3UD6A 3VZZA 4C1NA 1NFPA 2Y4SA 1CI1A 3A13A 4QJ5B 4EK7A 2IQ0A 5BXTA 4G6CA 4MWAD 4RCXA 1UH3A 1ICQA 3GH7A 4C7DA 3SGUA 1VPQA 4ZTXA 3RM4A 4ZMGA 3RX4A 4GX9A 4YTRA 3G24A 3KLLA 4LVAA 2DVTA 1WB0A 1A47A 1SO6A 1ZFJA 1VCFA 3F03K 1ZALA 4YIWA 3BG9A 4GBUA 3UGRA 2ABBA 4AHOA 4YXGA 4JN8A 1S3HA 2NWSA 1BVNP 2C1HA 3FA4A 2P0OA 2ZXDA 4ZZ9A 2O56A 2Q3OA 2ZX5A 2F2HA 3TOYA 1CX9A 1F74A 4F2TA 2PWDA 4MHBA 5G2WA 3VMNA 1PYFA 4B2DA 5FJUA 3IV8A 4F0KA 3L5LA 3NEHA 1S5VA 1QK2A 1Y8BA 1UMYA 4GYFA 1IT0A 1W1B1 2OT0A 5CPSA 2D23A 2VXNA 4J35A 1GKQA 4PBGA 1JDFA 4M7TA 2OZ8A 4Q8QA 3RUBL 2EPNA 3THDA 4CNSA 2AGKA 3Q4DA 3WZ0E 4Q7BA 4D6CA 1EWDA 4WDUA 1FWCC 4QITA 3W28A 1QUMA 3ZQ9A 4S1FA 1MRQA 3KOXA 3E0IA 3WLHA 2P3ZA 3DEQA 3GNPA 3S2NA 4EF8A 1HKVA 3E2QA 4I7UA 2J75A 5A3HA 5LKYA 4ACYA 3L5MA 3L2LA 3SRFA 4Y90A 3LI0A 1VBRA 3II1A 1OQFA 1TJ0A 3A3HA 3AC0A 3H54A 2POZA 3GG1A 3OIXA 3D3AA 3DHUA 3EEZA 4N42A 4RW3A 1L6YA 1R3YA 3BGGA 2R82A 3W7MA 1TA3B 3VD5A 1QOPA 3EBVA 3M0KA 4B3KA 2VZTA 2EPOA 3GIYA 5KINA 2YXOA 2XFWA 1THFD 3K8LA 1QI0A 5C2XA 5BW6A 2PWHA 3KAOA 5I06A 3AROA 1JDDA 4LEFA 2YA2A 5LXXA 2NV9A 1ITCA 4O13A 3MSRA 2NZLA 3V75A 3CUHA 3A64A 2YL9A 1RPKA 2AKMA 4LW7A 3TTYA 1W37A 1B4KA 1V77A 2ZDSA 1LDCA 4LF1A 4H8UA 4UTIA 1Q6LA 1P48A 1W17A 4FNTA 4FLQA 1DHKA 5SWUA 1KTCA 4RDVA 5H1WA 1B0IA 2XU2A 5FF0A 1E5JA 1O66A 4QLKA 1OSEA 1GG0A 4C7GA 4MDOA 5ABFB 3NCOA 4S3JA 3WL0A 4XZMX 2DSZA 3ZLFA 5DXYA 1FWNA 1ZSXA 3W1AA 3MZ2A 3ITVA 4FF5A 1BLIA 3C8FA 5E6YA 5KZMA 3VKKA 1S46A 4H01A 3W88A 3SQSA 4M82A 3H7VA 1QNRA 1IEVA 4GZIA 1D3CA 3MMUA 1R5YA 1UUQA 4HN8A 5FJJA 2Y8UA 2G96A 4IFRA 3L2MA 5LZLA 1QNPA 1OD0A 2Y5SA 2RDXA 3ZIZA 2DVXA 1WKDA 3K4DA 4DWSC 1BAGA 3WBXA 2BGQA 1EUNA 2Z27A 3AIQA 3LNPA 3VOCA 1UHVA 5K2ZA 4S3GA 2G3IA 3WFAA 1JYVA 4WY0A 4OJYA 3N9RA 4JYFA 3UXKA 3WNPA 3IIVA 1DL3A 2P50A 5TD4A 1DOSA 3TTSA 3BLFA 3FIGA 4XG1A 2FKPA 1MUWA 1O94A 1T0OA 4AZCB 5A8QA 2QVNA 4NUWA 2XDFA 4B5NA 1BSLA 1LP6A 1HJXA 4GZEA 1P6WA 2IUZA 3WF3A 1Y5WA 4AIOA 2ACQA 3R12A 1I1XA 4X9YA 4F0SA 1XLEA 2VL4A 3K46A 1V0NA 2XG9A 2VJXA 3VKDA 3WQOA 2QJNA 3W75A 2ICSA 5EYWA 2E8ZA 2QCHA 1BPLB 1G6CA 2WZTA 1X98A 4XK2A 1H3GA 3EX2A 4DI8A 4GIEA 3GNDA 1ME9A 2XGZA 3LQLA 3TJXA 1E73M 1I2NA 1ITQA 3OZOA 3H26A 1V93A 1V6UA 1ISVA 2WWCA 1GVRA 1S2TA 4AD0A 3NQ7A 1R0MA 3MB9A 3KVLA 2OEJA 3INPA 2A2IA 4C6OA 4UBPC 1FH7A 4OBTA 4UZSA 2DH3A 4PTVA 4J28A 3I7QA 4FS9A 5AHFA 3R0DA 2JE8A 4GZJA 4ZB2A 5AC7A 3MSGA 3QLLA 4QHRA 1TYGA 3GAKA 4C6LA 3SQLA 1S3TC 2VURA 2DFAA 1GUVA 4NVTA 4MB1A 3GUWA 2E6FA 1XR2A 4PBEA 4P7RA 4BHYA 1DE6A 3HGOA 5M2FX 4RL3A 2PEVA 2I9UA 5HULA 5A6JA 4TV6A 4IJRA 3TQKA 1Q5MA 1EC7A 3WD2A 2B7PA 3ARTA 1KXVA 1NVMA 1TV8A 3QSRA 5G4HC 4H19A 2YFOA 4JTQA 4F48A 4N6FA 1KM6A 1MNZA 4O16A 1CGVA 3P8IA 5A8MA 3C2FA 4LGXA 2XWDA 3KHJA 4CN1A 3GVWA 3AUOA 1LL7A 2JK2A 1F73A 4MJ4A 1O1ZA 1W1IE 3UXAA 4C1NB 1A4MA 1XRTA 2PF0A 5MKGA 4PCPA 4B16A 2PTXA 6ENLA 1YKWA 3T0CA 2NWRA 3UESA 4WDTA 1W32A 4B5WA 3MBDA 3CV1A 1MI3A 3M7SA 1UD2A 1GEHA 3WLPA 2EPKX 3AXXA 1B90A 3ANVA 3M0LA 3DFHA 1SZRA 1JIBA 3ID7A 3W83A 2X0SA 4GY0A 1J2WA 1FOBA 4M0XA 1US2A 5HMSA 4N9EA 1KR1A 1QOXA 5KZ6A 5EB8A 1B9ZA 1WP6A 1GCYA 3NVTA 5LHEA 2PWGA 3VFLA 1V7YA 3V35A 4E2DA 1US0A 3SR7A 4PMOA 3TSBA 1NDWA 1TRIA 4HU0A 1ZP3A 3SCQA 3L68A 3MUCA 3A4WA 2D0HA 2IS7A 1LZOA 2WMJA 3TYZA 2PP0A 4KGLA 3VINA 4PMXA 3FS2A 1UR9A 3SCRA 2W6RA 1WA3A 4LRSA 3RHGA 4JIRA 1X7IA 4IQEA 3RLUA 3HPSA 2ZX7A 5G1TA 3GXNA 3FXGA 1WDRA 1V02A 2CLFA 1B3WA 5AC4A 1TPWA 2ZXAA 3L4YA 3KBNA 2DZTA 2CBUA 2QULA 4MGGA 4C6BA 4HMCA 3BC9A 3P5YA 2HJPA 4IL2A 2VC7A 3VX0A 1VENA 3JRKA 5DQPA 3B05A 1VKFA 4NAFA 1H1ZA 1XIFA 4OWGA 4GYPC 4C6QA 3KVJA 3FYOA 4ZB5A 1KBIA 3WQEA 3QOMA 5D30A 3EWBX 3PUDA 3T07A 1OCBA 1CECA 3WBAA 4C90A 4EWND 3HURA 1F8IA 5GPRA 3IGSA 3MBFA 3W6MA 1OD8A 3K5XA 3BLPX 3I10A 1IGSA 4GKTA 1XSKA 3PBGA 4JFWA 3CLWA 3VI2A 3IJ8A 3NQVA 3PP7A 4MG4A 2EJAA 1HGWA 3SCUA 2NX1A 2WCSA 1TPC1 1AA1B 3PBMA 1BSIA 3LCWA 3P14A 2HRWA 4NF7A 1FWJC 1FHVA 4H9YA 5M03A 1K8XA 3B4UA 3BXWA 1O12A 2BB0A 4OU1A 4P7NA 4LVDA 1O60A 1H61A 3BWWA 2FFIA 1AD1A 1UC5A 5FIPA 1TPDA 2WNWA 3LGGA 4WGHA 2NQLA 3JS3A 2VFFA 3MT1A 4LBSA 3L9CA 3CT2A 1U33A 5U4NA 5IRPA 1BVZA 2PDPA 1VAHA 2ZZ2A 4JQ3A 2IXVA 3RCYA 5AVNA 1IE7C 1Q63A 1QDSA 1DJQA 1NOWA 4Q4SA 1MXDA 3BV7A 3NQDA 1OFQA 1JAEA 3CL6A 4BEUA 5F4WA 1F4AA 2QKFA 3M0VA 2WB5A 4ENLA 1BYBA 1I2OA 4O54A 2WKGA 4WZHA 4BFAA 4IX2A 4Q22A 4ZGYA 5HXMA 1VR6A 3SJNA 4XBSA 1E1CB 5CPMA 1PDYA 2UV8G 3CZKA 2PAJA 4IF2A 2HDJA 3CH9A 4QCFA 3QGAC 1YPXA 1DWJM 4AMAA 3FJ6A 3VIGA 4ORIA 4C1LA 1TWIA 2VT0A 3N3MA 3GG0A 3QF0A 3DYOA 1UR4A 1RBLA 3QC0A 3NPXA 3B06A 4W7WA 3PJTA 3HGSA 2XIOA 3LM3A 1Z44A 1BKHA 3W6YA 1J5SA 3WDQA 1KM4A 3ITTA 3CHEA 3VILA 4XTDA 4UXDA 1V51A 4GVIA 4QAWA 3NM3A 1W3NA 3SIMA 3P0XA 3PG8A 1J9YA 2GQ8A 3RRXA 3G1YA 3A9BA 4F40A 3O6YX 2C18A 3IJ6A 3CC1A 4DNHA 2OEKA 4LRTA 1XDMA 1T6MA 2GJPA 4PMQA 4OV9A 4R88A 4ZOCA 4AF0A 1MRAA 3MMWA 3OGVA 1VBHA 4AX7A 2QUTA 1CWYA 2MUCA 4RZ5A 1G0CA 1F4HA 2CFFA 3NO3A 3CPRA 1RD6A 1YDNA 3LXAA 4MWAB 4HNNA 4NG3A 2W91A 2YBUA 3EXRA 5CZTA 1OFBA 3V5OA 4DXXA 4HKPA 3ME3A 1ZAJA 2QJIA 4MJMA 1H41A 3WEZA 4P5UA 2F38A 3W1LA 5K9DA 1B3ZA 3GDKA 1MUMA 4JIIX 3WLMA 2EHHA 4S39A 4N02A 1XL9A 2VWSA 1RCQA 2DZWA 4NJJA 1UPMB 1JCJA 3WSUA 2O92A 2FYMA 4JD4A 3AYRA 3VOFA 4G9PA 4MWAC 3CUJA 1W1ZA 1YDVA 3LPPA 4ML4A 4F3HA 4DXKA 3R2GA 3NA8A 3VGBA 3WNOA 1EGVA 2PDKA 1EUAA 1ZTVA 1V3MA 4WOZA 3PAJA 1QCWA 1HVQA 1XYCA 4B91A 3RO6A 4GISA 1LROA 4WKAA 1BQGA 4PGLA 2VRQA 1UWRA 3KRZA 3PWGA 1OINA 3OG3A 3UVAA 4W86A 3AZSA 3UJFA 1NM9A 2NQ9A 3TC3A 4I90A 4QE4A 2YZ5A 1FWTA 3P67A 4GO9A 1V08A 2JEQA 5IOBA 3VMPA 3D6NA 4I5XA 4ADUA 3GC2A 1W3JA 4CQBA 4HVXA 3PUOA 2V69A 4DN1A 3ZT7A 4W7VA 1QVBA 2AKZA 3HQ1A 1TMLA 1FWWA 3G1AA 5DANA 3GB6A 1HIZA 2P1FA 2NQ5A 3AXKA 3IK2A 2E9MA 1KM3A 3O6CA 2DPEA 4E5TA 3AIVA 1Z3NA 2OLSA 3M44A 5EMYA 2VX5A 3AU6A 4S2BA 4P8XA 2QLYA 4KGJA 2Z29A 3T8QA 1H7WA 1XLHA 1GVEA 3WBYA 4NRRA 2JKAA 4JCMA 5E0FA 1M3UA 3H2OA 1MSSA 3G18A 3ZMRA 2Q8XA 1FKWA 3GDMA 4OQVA 7ODCA 3APYA 1EDTA 2O9PA 3NDZA 3CQIA 4QFUA 2NVDA 3STPA 1NF0A 2WM0A 2G50A 1R9YA 1EOKA 3ZSSA 1OCJA 3BURA 3ARUA 4TMCA 1V6YA 3TUUA 3QPYA 1FWBC 4HYRA 1GVQA 1ZENA 4E2BA 3J7HA 1P7TB 1T5AA 4MAVA 1J10A 2DZAA 4YHGA 5FJRA 1XRSA 4Q8MA 3UETA 5A6AA 5LIXX 2TYSA 1XV8A 3GU2A 1XC4A 4D6FA 2WJZA 4ZXLA 3WDJA 3M0ZA 4GNJA 5J5DA 2ZUMA 3WJWA 3VVGA 5HWNA 3VCNA 4AZ6A 4HZ8A 1UP3A 1W5OA 1XLAA 2J7CA 3C0QA 3LLXA 4YTTA 3W76A 4CQDA 4DNMA 2J7FA 3POHA 2OGYA 3STCA 2Z1XA 1P0DA 4XZHA 2X1SA 1XP3A 4QP0A 1VIZA 1VQTA 2C1IA 4UR9A 1EF2A 4M81A 3LRKA 4L9YA 3TW9A 2ZX6A 1O1HA 2BY1A 4KWWA 1UOKA 4WEVX 1XF0A 4GFIA 3DXIA 1DJNA 3RCMA 4EF9A 4OZOA 4WX2A 1QPRA 4WY0F 1HF6A 4EAYA 4Z2JA 4C1KA 3KEHA 4I9TA 1WDQA 3R7MA 3WF0A 3M46A 1OX6A 1KRAC 4CVWA 4MM1A 4MFEA 3HN3A 1UOZA 3TWBA 1J2BA 3MP4A 2IPWA 2PLKA 4K36A 1N55A 1TKKA 1PHWA 1UR3M 3OA5A 3S2LA 3NOEA 1XSJA 1XBXA 2P10A 4V33A 3UR5A 3B8IA 1O5XA 1XG3A 3C52A 4JR5A 1FUYA 5CG7A 3W0KA 2B7QA 2W67A 2VKZG 2DZUA 3LM7A 4WF7A 3W1RA 4UOQA 3W87A 1W5MA 5C9RA 2JALA 2P0IA 4B92A 2HE5A 1R9ZA 3S3GA 3VNLA 3DFQA 1HP4A 1ADOA 2GLKA 3GQYA 4AZ7A 3BGAA 3WELA 2RGLA 2Y88A 5CC7A 1KXQA 4INFA 4UNLA 3U6WA 4DJFC 4L56A 1C9WA 1OF8A 5JU6A 2PE4A 3MVTA 3PSVA 1XD0A 1SZFA 2YYTA 5AYYA 1W3HA 1QMLA 3TIMA 3CAWA 4GUHA 2J7EA 4LBUA 4LAZA 4TTGA 1Z89A 3PBYA 3VFCA 1EF3A 2QUUA 3G1DA 2WK2A 3THAA 3TP4A 5XINA 1Y0EA 2PP1A 3G2GA 3OA3A 2B7OA 2VR5A 3D0CA 4KRUA 2W27A 2FHBA 5DCBA 3ZR5A 1SW0A 4LS0A 3LYEA 4AAJA 4O8AA 4FXRA 3LXCA 1Q7MA 2DP3A 5H8UA 2PBGA 3PNZA 3VD9A 3DBNA 3H4XA 1PYMA 5BXPA 1TCDA 2EAWA 4ACZA 1Y7VA 3KL5A 4H41A 2FHFA 1MW3A 3FDKA 3AU2A 4GZ7A 1R86A 4AF0B 4HNUA 3FA5A 2V3EA 5AECA 5F2MA 3S4TA 1IQ8A 1EX1A 3S83A 2D69A 4DXVA 2D1ZA 1QU4A 3M16A 4Q7NA 1J0JA 3NAVA 4O0KA 6REQA 5D9MA 4R27A 1E0WA 5IXEA 4DZ5A 2V81A 3CU2A 2OCZA 1PWLA 5CC5A 1UKSA 3QR3A 5HNRA 5B80A 4HK7A 2C13A 5CSUA 1UG6A 2PWFA 3SCNA 1KBKA 5HATA 1U5VA 3WQVA 3DG3A 4FOKA 1V6WA 1YPFA 4YHEA 4IXXA 3N15A 4YMZA 3NSNA 4CNPA 2F9RA 4IMCA 3GWQA 4Z0JA 5FA5A 1NOFA 4HTYA 1UH2A 3EDDA 3OHIA 4W85A 3WMSA 1ICPA 2G8ZA 5B7ZA 3OW1A 2DH2A 2FVMA 4UOZA 4GQRA 4M8UA 1TVLA 2RJHA 2OPJA 2PU1A 3I3BA 4NX5A 2JBMA 1CENA 3H55A 5I09A 4HD5A 2H8ZA 1PX3A 4XZBA 1QNSA 4B5XA 4WCJA 3ZOAA 4WVXA 3G1XA 5JUVA 4AVNA 3UZZA 4DO7A 4MMWA 1P43A 1E4IA 3NO5A 2ZUUA 4QXIA 3CBWA 1RXOB 3FVMA 4LANA 4MOZA 2AL1A 4V15A 1GQKA 4GNVA 4DB7A 2FMOA 1IR1A 2RH9A 3CMFA 1AMKA 5H8PA 3QMRA 1ME8A 2VZSA 4M6PA 4PMNA 1QHOA 3VGFA 4JIHA 2IKHA 2WW5A 3QLDA 1K02A 3FHQA 4QDWA 1BWVA 4FIRA 3L7RA 4OIFA 1R6WA 4IIEA 2R1MA 4PRTA 5CPQA 1V7AA 4OBRA 3PZOA 5E9AA 2E9BA 2RHGA 4RNIA 1PUDA 3LDVA 4KCVA 5K7JA 3F4CA 4HA4A 1DTUA 3OG2A 1GWJA 2W5FA 3LPGA 5CGQA 2ISVA 1PAMA 1B1YA 4ZSUA 3WDIA 5DCDA 4RNJA 1AZ1A 4D71A 3SIZA 1JGMA 2XJ7A 3PR2A 4CCCA 3QFWA 4LWWA 3EKGA 1QTWA 3VIJA 2D73A 3FJ4A 3E5BA 1PWMA 2YR1A 3BH4A 4XIMA 1DKWA 1C7TA 4F4RA 1P0EA 2CESA 2ISDA 4PSRA 4OOZA 3W86A 2FTWA 4NILA 2ZZ4A 3CNYA 4C5ZA 3EMQA 4FNSA 3HZ3A 4HGXA 1KCZA 3N4EA 4K37A 4QQ3A 1OADA 3MPGA 4Z08A 1K77A 2BY3A 3JW7A 2DZXA 5T9CE 2A3CA 4JGDA 4XKYA 5DT7A 4AHQA 4JIQA 4JTDA 4BWLC 3B9AA 2O0TA 2DQWA 3CWHA 4UTWA 2F8QA 3SUVA 4JTRA 2CHRA 4KS0A 1EGMA 2ISSA 3AHZA 3M43A 1H7PA 1FWAC 3BG3A 3CGTA 3U2OA 4A8LA 4B9YA 4MYXA 3R8HA 2ZVIA 1Q45A 1WDPA 2ZWZA 1V02E 3GYCA 4IIBA 1CLXA 1OX4A 3F5JA 4X0VA 4XO6A 2HBVA 4BF5A 1BWLA 3KOWA 2EG6A 5FEXA 2J24A 1Q7ZA 4DYJA 2CLPA 5HJXA 3S1UA 4GUFA 2OXNA 4Q8TA 2NUYA 3A4XA 1WOBA 2YXXA 1F76A 5EBUA 3PFRA 1LF1A 5I02A 1NY1A 4E8DA 3VDAA 2H3BA 1CGTA 3O63A 3APTA 3EPOA 3TA6A 1X6NA 1NH6A 2V3DA 3ZT6A 3MO4A 4IMGA 1P0BA 3N9KA 2GGJA 3IANA 3VGGA 2GK1B 3BMVA 5BROA 4P7QA 3LLDA 4XD5A 3MJYA 5A2AA 1Z42A 3HV8A 1H7OA 1XYMA 3DHFA 3ARQA 1U30A 1W5NA 5CPLA 3H4GA 1XDLA 3PK7A 2W92A 4AIBA 4ES4A 3BQ5A 1YYAA 3IJLA 1F8MA 1K1DA 3G1FA 2D20A 1E70M 4AXKA 3T0BA 3MSYA 4L4MA 4LTSA 4A3QA 4CCEA 3E49A 2QPUA 3M5XA 2YA0A 3GTHA 1OM0A 1DJIA 4NT0A 8CGTA 4HK5A 1Q6QA 1F3TA 1Q65A 4ZOEA 1CXIA 2H90A 3WLQA 1J6OA 3DYPA 1FWSA 1WZMA 2AMXA 3STGA 3H2NA 4IMEA 5E6ZA 4U2YA 3T2PA 4MLJA 1KGXA 4WJXA 1R3SA 3AUJA 1G4PA 2PGWA 1R3QA 4N6EA 1BEUA 3WQ4A 4WKFA 2XH7A 3C2RA 2ZUNA 1TRDA 1UKQA 3FKKA 1Z32X 4GH1A 2BTMA 3W1MA 3SGZA 3HFYA 3OZYA 1MW0A 1QNOA 4I6VA 3F2DA 1KLYA 4PRRA 1IEIA 4JEQA 4RKAA 4WQ6A 4IQDA 5E0KA 1EO7A 5C7VA 2X7WA 2WLYA 5DMYA 1JF5A 3HA1A 1C93A 3G77A 4UNKA 2XHYA 1PE1A 4F0MA 3K4AA 3DENA 2NLIA 3VZYA 3W1UA 3GXMA 4ADTA 1LLWA 4O52A 3MY9A 2CW6A 2UWFA 3AMDA 4CVUA 3FKRA 2PGRA 4W8AA 4P7LA 1JZ4A 1GVSA 1KFKA 3CPGA 1W1PA 1YXYA 1VC4A 6REQB 3ARXA 1HJSA 3T40A 3S5ZA 3W7RA 4GUJA 3SUWA 4NY2A 2QJMA 2YB1A 4IGHA 4RZ4A 1TJRA 2R14A 5CPOA 3PZUA 1EHNA 2IXUA 4U3CA 1DE5A 4DUWA 1KQZA 2XVPA 4ZO7A 3ZXWA 1ONWA 4W93A 3W85A 1UH4A 4UTJA 3G0SA