2Z1SA

Beta-glucosidase b from paenibacillus polymyxa complexed with cellotetraose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords Beta-glucosidase B
total genus 164
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2007-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2z1sA00
1JG9A 1PIGA 3WBAA 2G3IA 3N18A 3DYOA 1BVNP 1C7TA 3AZRA 3MSDA 1W1PA 1V3HA 1TFVA 5IXEA 2UY2A 4HTYA 3GH4A 4BQ2A 5A6KA 1V02A 2QLYA 2VVNA 1PIFA 1E15A 2GDVA 1KFWA 3UETA 4TX8A 2WM0A 3GNRA 5AYIA 1CENA 1HJVA 2ZWZA 1ISXA 4LYQA 4MJ2A 4CCEA 4ZE5A 2GJXA 4W5ZA 1B3VA 1J10A 4CD4A 1E0XA 5ECUA 2YLAA 2WMIA 3GZAA 1EOKA 4NRRA 1OBAA 5LA0A 3UESA 2XIIA 3UCQA 1DWJM 4WJXA 1J0HA 3A6OA 4AD3A 4HMEA 1GHRA 5CLTA 4MNKA 4R27A 2VX7A 2JEQA 2TAAA 3A47A 1VIWA 2G41A 3FHQA 3T0DA 2X05A 3S2CA 4XZBA 1E1EA 1PAMA 1JDCA 2BHZA 4LGXA 3GNOA 7CGTA 2GSJA 5C70A 1ECEA 3AISA 3A4XA 2WMGA 4PMYA 1CNVA 1H49A 1E4NA 4AY1A 2ZUTA 2D22A 2VZVA 1D2KA 3NCOA 1UA3A 3MUY1 3NSMA 1WDSA 3OIHA 3W26A 4V28A 4AZ7A 1Z32X 3DYMA 1I1XA 4PSPA 3WF0A 5A6LA 2C7FA 4Z2JA 4RE2A 3W81A 3GTNA 2XM2A 4AIUA 2DIEA 4LQ1A 2J7DA 3WD4A 1UOKA 4GKLA 3WEZA 3U7BA 3AICA 1V3IA 3GXDA 1MW2A 3AS0A 1E73M 2IXUA 3ARWA 4Y7EA 4WLCA 1XRVA 1DTUA 4KWUA 4M24A 2GK1B 4CGTA 1ZBCA 1W91A 3POHA 4MB3A 1G01A 5E0FA 3TTYA 2EPKX 4ATLA 1UD4A 5DT7A 1OD0A 3PTKA 3UERA 3KWXA 2CNCA 3ZSSA 1HL8A 1KXVA 3AZTA 1GQLA 2F8QA 3W37A 2J79A 4FLSA 3GXIA 5I77A 4OZOA 1M53A 1CLVA 3T0AA 1FH9A 1CLXA 4GXPA 2EBNA 2E9BA 3VDBA 3WNLA 3AXHA 2JF7A 1MXGA 2XYLA 1QI2A 1TA3A 3KL5A 4D6DA 1UA7A 3FXYA 1ZBWA 1BGAA 1UKOA 1C8XA 3AFBA 5E6YA 2BY1A 1JZ5A 3QR3A 3ZJ6A 3CUFA 1KCKA 5EB8A 4ACYA 4JFSA 4WSJA 3CHFA 4AYSA 5HNNA 3WQWA 3PTMA 3WH6A 1EA9C 2WNWA 1JYNA 3WNMA 2WSPA 4MNMA 1ZBVA 1H0GA 4V27A 4HPHA 5D9OA 2VX6A 2O9TA 2JALA 1E6QM 1JI1A 4YN5A 1R8LA 4GQRA 2YBTA 4IISA 1OT1A 3IK2A 4PN2A 3AYRA 4AWEA 9CGTA 5IHSA 2PBGA 3MUZ1 2XIBA 4ZE4A 2WAGA 4YHEA 3LMYA 5TD4A 5GNXA 3B9EA 5M03A 1E55A 3EYPA 3BGAA 2X8RA 5EFFA 3L4TA 4FK9A 4L4PA 1WZAA 1XCXA 4PCTA 3MMDA 2JIEA 1CGTA 1IV8A 4QDMA 1JXKA 2C0HA 2WZIA 5FL1A 1RH9A 3WH5A 4WK9A 2ZUMA 2ZXAA 2O9PA 3CUHA 4RE4A 1W1TA 2PWDA 5LYRA 3AHTA 2WB5A 1W3KA 2AOSA 3VDHA 3CH9A 2HVMA 3DHPA 4WIWA 2CXGA 5AYBA 3I3BA 4AZ6A 1UR9A 2O9RA 2J8GA 1IT0A 1VEPA 2WVVB 1EQCA 4AXNA 1W9XA 2D3LA 2VOTA 2PWEA 4F9JA 3PZQA 4ACZB 3WUEA 1CXKA 1ODUA 3AZSA 3WUGA 4IPLA 2XM1A 4C7GA 3T0BA 2VQUA 3L4WA 1XV8A 1HP4A 4CD7A 4BQ3A 1BYBA 1SMDA 3L4YA 1KGUA 2UY5A 1KB3A 2ZXQA 4DWSD 4Q7NA 3SCQA 2NW0A 1HT6A 2WYSA 2EPLX 4UFJA 1J0KA 1GJWA 1N82A 2FH6A 1H4PA 1UQYA 2D1ZA 1ISVA 4CD8A 5DO8A 3L4VA 4UZSA 3VGEA 2CBUA 4GO8A 5M3WA 3JUGA 2BHYA 3MSGA 4A3HA 5FIPA 2E8ZA 1CDGA 1AMYA 4OOZA 2BV9A 3VD5A 2DT2A 2E9MA 3IAPA 1UWRA 4D6HA 4TX6A 2WMFA 1Q6EA 3VX1A 1V02E 3OB8A 4DWSC 1W3HA 2VX4A 4UFMA 1UHVA 3K8LA 2UY4A 3AHZA 2WVSA 2OYMA 4P8VA 3FN9A 1E6ZA 2CPUA 3CHCA 3KL3A 1UG6A 1P6WA 4F79A 2FHBA 4AZHA 4EKJA 2YA0A 3B9AA 4TVCA 1HKJA 1NH6A 1J0IA 4L4OA 3L4XA 3SCUA 2D20A 2G3MA 2QF8A 4DWSA 4N42A 3K1DA 3SCOA 4W85A 2E0PA 2CKSA 5AC5A 4WKHA 5CGTA 1SFSA 3W25A 1ESWA 5A8PA 4UFHA 2BY3A 1KQYA 4ZXLA 1VBRA 1ZB5A 1HF6A 3F5JA 4YPJA 4PTMA 4U5KA 2VRQA 3OLEA 4AEEA 1TVNA 5CSUA 3N1AA 3AS2A 1NOFA 3WF3A 3RM4A 3AXXA 2XFFA 3SCNA 1UD5A 3M6DA 1E0WA 2HISA 3RM9A 1J0ZA 2IUZA 1ODZA 4ZENA 5A8QA 2CBJA 1UD8A 3SCPA 2GFTA 3GH5A 3T2PA 3OG2A 1LWHA 2VO5A 3OGRA 1HKMA 4HU8A 5E9AA 3VILA 5I2UA 1MYRA 4K68A 4OBSA 2YKKA 4MDPA 2DGAA 1V6XA 4AMCA 1CXIA 5BXRA 2J62A 4GINA 3AIWA 1W9DM 1HJSA 1AQ0A 2B31A 3A3HA 1US2A 2OSWA 3MUIA 3B8SA 1OGBA 1ZS2A 3VIKA 1GQKA 1JI2A 2IXVA 1C92A 1JZ4A 2WCGA 1VEMA 1CWYA 2VR4A 1YHTA 1DWGM 1PX4A 4GZJA 3O9NA 4JFUA 4U2ZA 5A94A 4OOUA 4M1RA 2GK1A 1JAEA 2ZUVA 5JBEA 2V38A 4P7NA 1HNYA 1UZ1A 2Y2WA 3HMCA 2Y8KA 3GXFA 4AD0A 3VD4A 3WMCA 5A6BA 3QHOA 2QMKA 3O6AA 1K9DA 1BYAA 2ZUUA 1M7XA 3EDEA 4GIAA 3VDCA 2A3HA 1W1VA 3N12A 1CZ1A 4ATWA 3ZT7A 1JZ7A 3UEQA 4NRSA 1OGSA 1IZKA 1XD0A 1BQCA 2CHOA 3A4WA 1B3WA 3WNKA 1EIBA 2VL4A 2XVGA 1VB9A 4H8VA 5IDIA 4A4AA 5FCZA 2XTKA 1HJQA 3UG3A 3AQUA 4W93A 1V6YA 4B3KA 1B1YA 4PTVA 1H1NA 3F5LA 3SUVA 1DEDA 5JBDA 4FLOA 4UCFA 3L2MA 2BY0A 1V0KA 3KZSA 1WP6A 2DEPA 4ATDA 4J3VA 1WPCA 3SUTA 4P7OA 1W9PA 1VFFA 4J7RA 4AZCA 5JUVA 1NWTA 1X6NA 2EPOA 4D1IA 1F4HA 2GVYA 3QGVA 4CU7A 4CCDA 3F5KA 2OWWA 3NDZA 4PMUA 1AVAA 1GQJA 3WKZA 3IJ9A 3NYDA 3VTRA 2Z1KA 3WF4A 2WMKA 1UKPA 5E0CA 1UWQA 4IPNB 5LA1A 2WMIB 1UD3A 1OM0A 3MV01 2BY2A 1V3KA 1NP2A 1UR4A 1V6UA 2XFYA 3OZOA 4AZIA 2J74A 1ZL1A 1VJZA 2OWXA 1C3FA 1XCWA 1V3JA 1WDRA 2XWEA 3J7HA 3VGBA 3W4RA 3OA5A 4FLQA 2WMJA 3VINA 4PMNA 3WH9A 3N9KA 3LPOA 1UKTA 4UNIA 2CCRA 3CMGA 4PTWA 2CKRA 3W53A 3IAQA 5I23A 4Z2HA 5ABFB 1H0IA 4JAWA 4W8BA 4BQ5A 5KZ6A 1W3JA 1WZLA 1JZ2A 1U33A 4C7FA 4F66A 5I6SA 5ABGA 1E6XM 5A2AA 3VMPA 1UZ4A 3VNYA 2BHUA 3OGSA 4RL3A 4NZCA 1IZJA 1TCMA 2WC3A 4UQEA 2RGLA 2JIWA 1CBGA 1E6NA 2O9OA 1CIUA 3ARQA 2D24A 4U5IA 1MW1A 1LL6A 3AOFA 1QI3A 4MAVA 4M56A 2Y5EA 1OWQA 1QW8A 5CPSA 5EMYA 2XSAA 4CN4A 1OINA 4U2YA 4HOZA 3NSNA 4OJYA 3ZJ7A 3WMBA 3VIIA 1CEOA 3WD3A 3PZVA 3L2LA 4HA3A 2VC9A 3WBEA 3WDRA 3VIMA 1EQPA 3FW6A 4UOQA 1GORA 2ZWYA 4W84A 1W2VA 4BF7A 3CHDA 3MO4A 2WLZA 4U3CA 3CZJA 4D6EA 4NSBA 4WKAA 4S3JA 5A95A 2W91A 2WHMA 3AMDA 1PBGA 1A47A 3QHMA 3K8KA 4LYRA 1Q6FA 6CGTA 2J25A 2V3FA 3ZJKA 3W24A 2X2YA 3CBWA 3FY1A 4W88A 3NSXA 2OSXA 2ZUNA 4DUVA 4B3LA 1H11A 2VX5A 4W7WA 3CZGA 1QHPA 2A3CA 7TAAA 1UYQA 4J3SA 1GZJA 3AIEA 4M80A 1R85A 2YL5A 3VIGA 2VUYA 3BAXA 1GONA 2G3NA 4WSKA 5CQ1A 1EDQA 2WHLA 3IJ7A 4CU6A 3OLIA 4PUEA 3AHVA 2WC4A 1DWHM 4IUGA 1XGZA 4ZEPA 4JKMA 3AS1A 2BS9A 4AISA 2DSKA 2QPSA 2E4TA 5A6BD 1CGYA 3UG4A 3GBEA 1V0NA 1QI5A 3VNZA 4JFTA 2XVKA 1JZ6A 3WQ6A 1B3XA 1HN1A 4Z2KA 1G94A 3SUSA 5BRQA 4H7VA 5DEZA 3ZR6A 2Y4SA 4UQDA 2PB1A 1AQMA 2ZXDA 1Q6DA 2DH2A 3VMNA 4U31A 1MXDA 4JHZA 3PN8A 4UQBA 3VUPA 4ACZA 2VRJA 2G3JA 3NJ3A 3CZKA 4AZBA 2G8ZA 4IM4A 3TONA 5DFAA 2EJ1A 2YA1A 1ZJBA 1NWRA 5CGMA 1FH7A 3U5YA 4P7QA 2GJXB 3PZ9A 1KGWA 2WZHA 4TTUA 5HBFA 4BS0A 4CN1A 1Q6GA 2ZIDA 1NARA 2PWHA 1HP5A 3LPPA 4FLRA 4MTVA 4UOJA 3ZT5A 1WE5A 3MUAA 1CGUA 3EBVA 1B31A 4CVWA 4AZGA 4M82A 3EDJA 4MJ4A 4V2XA 4AD5A 3K4AA 4AD2A 1UR8A 1JIBA 2A3EA 4PEEA 1MVYA 2E3ZA 1E4LA 2XHYA 4LPCA 1GVYA 5GPRA 2X09A 3WQ4A 3CUJA 1EO5A 4W8LA 3EDFA 2DT3A 1VFOA 1X1NA 4Z2GA 1W1YA 3NDYA 1QNRA 1WO2A 1NOWA 4ZXOA 4QAWA 5CLWA 3VIJA 1G9HA 1TVPA 2VI0A 1M03A 3POCA 5M5DA 4LYPA 3RJYA 3T08A 2YDRA 1GW1A 1E4IA 2E40A 3VIFA 1E71M 4F9DA 1RP8A 2J4GA 3ZT6A 2FGLA 1WZMA 1GOKA 1UD6A 2YL8A 1G0CA 4CKQA 1GOQA 3N04A 2OLHA 2WMHA 4PMQA 1CXFA 3WNNA 1KWGA 3PZOA 3W0KA 3II1A 2OYLA 1OT2A 3BH4A 2QV4A 2BVTA 3MU7A 1GCYA 2PBOA 2PWFA 4AW7A 4MNJA 3HN3A 4OUEA 5D8ZA 4QCEA 2VVSA 4OKDA 3SCTA 4GPNA 1C7SA 2BNJA 1JDDA 1K9EA 4D1JA 3PZMA 2EQDA 4JHOA 1VBUA 1E56A 2FHFA 1ISZA 1GOOA 4H04A 3CLWA 5CSYA 2CERA 5FOOA 3A4AA 3WMSA 4TTGA 4TUFA 2G4FA 3W29A 2ZXBA 5A6AA 1E70M 3VO0A 3U5UA 5BYWA 3ZJ8A 3BAWA 5ABEA 1MQRA 3SUWA 3EMQA 4FMVA 1C8YA 2WK2A 2W63A 4HZ6A 1C90A 1PX3A 3AI0A 4U3AA 5HOSA 1Q4NX 5FL0A 1UUQA 2J7EA 3ARTA 4AC1X 5BROA 3L4UA 3T2OA 4X9YA 1FH8A 1W32A 1J12A 2CESA 1J18A 3SCVA 1KCLA 2GJPA 2YIHA 4E4PA 2WANA 5BCAA 1JYVA 3UR8A 1MFUA 5I3DA 1B30A 5I79A 3I3DA 1JNDA 3T09A 4UFLA 4J3TA 3AMGA 1HVQA 4UQCA 4DWSB 1GJUA 4H8UA 1E5JA 4JCMA 4D6GA 2D2OA 1BSIA 4RE3A 4TXEA 4AIOA 4AZ5A 4AZCB 3N15A 5AC4A 1VFMA 3VX0A 1V0MA 1ISWA 4PBGA 2XPKA 2VZUA 2J7CA 4J3WA 3WF2A 2WWCA 4UZUA 1VENA 3AYSA 1ZBKA 1TG7A 1XH1A 3THCA 3OZPA 3PHAA 3W6MA 3DYPA 1B3ZA 3GYCA 3RCNA 1KXTA 1JNEA 1E1FA 2Q8XA 2CETA 4UR9A 1LG2A 4B16A 2J7HA 5M17A 3AMLA 1GHSA 3AMKA 3EDKA 5A8OA 4M81A 3N17A 1OB0A 2A3AA 3G6MA 1VFUA 5JIWA 2D0HA 1OGGA 2MANA 3VDAA 1E40A 3WNPA 3WUFA 3BLKA 3APGA 2EEXA 4GO9A 4JL2A 1XSKA 3BAYA 3MMWA 2WXDM 4TVDA 1BF2A 3WQVA 2J7BA 1QBAA 1FA2A 4J28A 4ML4A 1SR0A 3VKKA 1J0YA 1E6RA 1JZ3A 1QI4A 4JFWA 3VU2A 1DWFM 1GVIA 3ZO9A 5BWFA 4JIEA 1U2YA 4J27A 3BC9A 1D3CA 3QHNA 2JF6A 3BSGA 1QI0A 2UWFA 1H09A 1SMAA 2WVVA 2WVTA 3MS8A 8CGTA 1EXPA 4OIFA 2V5DA 4JL1A 1JXJA 3AIVA 3WIJA 3S6TA 4D71A 3RM8A 3QOKA 1K6AA 1E4MM 3PBGA 4AD1A 3WUBA 3SEPA 2ZICA 1B2YA 1FFQA 2Y8VA 1ISYA 4MAZA 3ARYA 2D3NA 1JGIA 4CD5A 6TAAA 3ZSTA 1BAGA 1BG4A 3AS3A 2VZTA 3U7VA 4PMXA 1XYFA 3O2LA 1KWKA 2VCCA 1QNSA 4P8UA 1DHKA 3DHUA 4PMRA 2WC7A 4D6JA 2D23A 5CJ5A 2X0YA 3WD0A 3WFZA 3G6LA 5HXMA 4MB1A 5BXTA 3FHAA 1W2PA 3UG5A 3D3AA 1EOMA 3OBAA 3B9DA 2WKGA 2CHNA 1UKSA 2NSXA 1LLOA 4KRUA 3ARRA 4HOXA 2ZE0A 3NIYA 2BVYA 3CUGA 1PZ2A 2C8NA 4PRWA 3FAXA 3BCDA 4D6IA 4NF7A 1M04A 8A3HA 1KXHA 1C8QA 3N13A 2EO7A 1KBBA 3WEMA 4P7LA 3ZMRA 2WKLA 2VCAA 5C71A 3ZM8A 1NQ6A 1Y7VA 3ALFA 3ARUA 1HJXA 1CGWA 4DUXA 4CCCA 1WZKA 1LG1A 3RIKA 2OSYA 7A3HA 3BAIA 3K4DA 4CD6A 3RMEA 5HPOA 4WF7A 1YQ2A 4D72A 1HX0A 1PEZA 3VGHA 2VCBA 4H2CA 5EBAA 1NWSA 4PTXA 1G1YA 1M01A 5D8WA 5A6SA 1BTCA 1SYTA 1UQZA 3VGGA 4X0VA 4XUYA 4HZ8A 4URIA 4PMZA 3BLPX 1E3XA 1BPLB 2WWDA 1C93A 2QHAA 2F2HA 2O92A 2GJRA 2WCAA 1CGXA 2J75A 5LA2A 2CBIA 1JF5A 4YHGA 2XGBA 4B9YA 2WCSA 4UFIA 3WH7A 3W6LA 3GNPA 1H3GA 4WKFA 1RPKA 1I1WA 1QNOA 3PZTA 1GOWA 1X6LA 2QMJA 3BMVA 1WB0A 5A6JA 3OGVA 4TOQA 1WKYA 4LX4A 1VRXA 4MB5A 5IFPA 1JFHA 4W86A 3CPUA 2RGMA 3GXMA 1MFVA 5DT5A 1GQIA 1XH2A 2BVDA 3DECA 2EPMX 3CZ8A 3GH7A 1XSJA 3ARPA 5ABFA 3AIUA 4JCLA 1R87A 1ZU8A 3AHXA 2VJXA 2X1IA 4AEFA 2WPGA 1TUXA 3LPFA 1CPUA 2VRKA 1GPFA 2VQTA 3VM7A 2AAAA 4JZ5A 1MQPA 5I24A 3ARZA 4EE9A 1I75A 4J3UA 1FP9A 4MNLA 1J01A 4HA1A 1E6SM 3ZOAA 3WD1A 2XSBA 3VD9A 1L0PA 4PMOA 4M8UA 3K8MA 3AIBA 3TP4A 4AD4A 1JDAA 4C7DA 2W66A 4PCSA 4HPGA 2UY3A 5A6MA 1LF1A 3RPMA 3VIHA 3E1F1 4MPKA 3WDIA 1ITCA 3CHEA 2XWDA 3VGDA 5BRPA 2W4XA 4GI6A 1G5AA 1MQQA 3VMOA 4HU0A 1S46A 4JFVA 3LPGA 1E72M 4MADA 1JF6A 1BYCA 4GI9A 2WZEA 3ARSA 4D6CA 2ZUWA 1WNOA 1H5VA 2PWGA 1R7AA 1NM9A 3WD2A 2DQXA 4H41A 3ZIZA 5BXPA 3BAKA 4PYSA 5A1AA 5I5RA 4GQQA 1GOMA 2JEPA 4QLJA 4DM1A 2BXYA 2XUCA 4Q22A 2FH8A 2EXOA 2ZOXA 1BFNA 1FP8A 2PC8A 3VD7A 1GOIA 1W9BM 3WDJA 1WDQA 4P7RA 1AQHA 4GZIA 3WELA 3FNDA 1MW0A 3TTSA 1UH3A 2XGIA 1UWTA 1V3LA 2YDQA 2W67A 4HP5A 3PTQA 2EPNA 2J8FA 2XVLA 3WL1A 5A2BA 2W62A 1BLIA 3ALGA 2W5FA 1E43A 2E8YA 5FD0A 3WSUA 1PPIA 1V0LA 1UR2A 1J0JA 1NP0A 1PJ9A 4KMQA 3BSHA 4R5EA 1QNQA 5CXPA 3AMCA 3GM8A 4W87A 2XG9A 3EMZA 3RILA 1EO7A 5CZKA 5D9PA 2XJ7A 1LL4A 1UH4A 3WDHA 4W7UA 2WLYA 3WENA 2VZSA 4CVUA 3WEOA 1XC6A 1V03A 3KE0A 3SCWA 4GI8A 4KRTA 1BYDA 1PX8A 3I3EA 1KGXA 2J78A 1XHGA 4MDOA 3M07A 4HOWA 1OIMA 1CXHA 2XVPA 3IANA 1TE1A 3EMCA 1CYGA 5A2CA 3MMUA 1HKKA 2AMGA 5E6ZA 1UR0A 4E8DA 4UTFA 4PMVA 3AJ7A 2CITA 2D0FA 1CGVA 4BZYA 3WDQA 1J11A 1KQZA 3WQ8A 3QOMA 1B90A 1OSEA 5F7UA 1V3MA 4BA0A 1WCGA 1QW9A 4AIEA 1JD9A 2JFEX 2FGZA 3CZEA 4QLKA 1BVZA 1HIZA 1W9UA 2V3GA 3CUIA 1U30A 1WAWA 2DDXA 3BXWA 2DT1A 4D6FA 4A3YA 3WQ5A 1EHAA 1GNXA 1CXEA 1UD2A 3WNOA 1JL8A 3VM5A 3U57A 3M7SA 1CXLA 2XVNA 5IHRA 3CGTA 1OIFA 3OLGA 1Q6CA 5CG0A 2YDSA 4UFKA 2Z1SA 1O7AA 2GDUA 3BCFA 5GQBA 3VGFA 2WBGA 3CMJA 2BFGA 2FHCA 3WN6A 6A3HA 1WDPA 3EDDA 1ZJAA 2DPEA 1E9LA 2VR5A 1KBKA 1PZ3A 3PZIA 3RJXA 3FAWA 3HU7A 3AIRA 5I0DA 1HJWA 1MW3A 5E09A 5DMYA 2YA2A 4KGJA 4KGLA 1EGZA 1OCQA 4S3KA 3M46A 2WW5A 5GNYA 3VPLA 1HVXA 4JKLA 1KXQA 4E2OA 3ZR5A 5DF0A 5EFDA 1JAKA 4U33A 3WDPP 2FDMA 1UH2A 5A69A 3WY1A 2CBVA 3BAJA 4PUDA 1KR0A 1TMQA 1D7FA 1QPKA 2V3DA 1H2JA 1XSIA 2GUYA 2PF0A 3WL0A 3GBDA 2NT0A 5D4YA 3DC0A 1EDGA 1OD8A 5FKYA 5CPQA 3VIOA 3CIVA 4PMDA 4P8XA 4HMCA 4FF5A 1UKQA 2ZX9A 1CECA 2E9LA 4N0RA 4UQ9A 4W7VA 2ZX8A 4F8XA 1V08A 2VURA 1K9TA 4Z2IA 1NOUA 5IFTA 4XV0A 3OLDA 3BMWA 5A3HA 1XYZA 2CYGA 3CZLA 2ZUSA 1RD6A 3TTQA 1EH9A 1VAHA 3K46A 4CU8A 5HPCA 4P8WA 5GNZA 4NI3A 1K9FA 3N11A 3CO4A 1HJUA 1H41A 4GZEA 5E70A 1EDTA 5BXSA 3VOCA 4W89A 1E5NA 4OBRA 2DH3A 1UR1A 2ZX5A 3MV11 2J77A 1HXJA 5JBFA 1A3HA 2VNCA 1US3A 2PI6A 5I78A 1EHNA 3AROA 1B0IA 1JYWA 4UQAA 2DSVA 3KL0A 4PSRA 1LWJA 5D9NA 2NT1A 4EAMA 1VJSA 2OYKA 1TZ7A 2D0GA 4W5UA 5KEZA 3KEHA 1B9ZA 2YOCA 2ZX7A 5ABHA 2ZX6A 4TVUA 2W61A 3W82A 3ECQA 1V6VA 5JIPA 1XD1A 4H8HA 4HA4A 3AXIA 2DSZA 5D9MA 4ZFMA 2VT0A 2V3EA 2DIJA 3UR7A 4B9ZA 4J3XA 1JD7A 3GDBA 2YL6A 1DWIM 1R86A 3IJ8A 4M29A 3WF1A 4MB4A 3L4ZA 1HL9A 3AHYA 4HZ7A 1QOXA 1VEOA 3ARXA 3MANA 2OWCA 4X0NA 3VIPA 1BHGA 2CIPA 3TOPA 2F61A 4W8AA 2DSUA 2VTFA 1JFXA 2YJQA 1V6WA 1JYXA 1HKIA 1BGGA 1LL7A 1L8NA 4XB3A 2VMFA 2XFRA 3VVGA 1UWIA 2ESCA 3VD3A 2WSKA 1C91A 3SCRA 3MKKA 1DP0A 1LJYA 1QBBA 5C8BB 1E6PA 1O6IA 4HMDA 1DWAM 1JZ8A 3D5HA 1TA3B 1UWSA 1NWUA 1FHDA 1F4AA 4XZWA 1UWUA 3SIMA 1R7OA 1W3LA 4LXFA 3PZGA 2WVUA 1KR1A 1W9VA 1E3ZA 1RP9A 3W28A 3HJEA 4EK7A 1FOBA 2QPUA 3TTOA 3ZQ9A 3WH8A 1GUVA 4KH2A 2WBKA 3SCSA 3W27A 1CTNA 4XX6A 2V5CA 2Y24A 1QHOA 4CUCA 2BXZA 4BCEA 2WHKA 2JE8A 1TR1A 3RO8A 3WFLA 3CTTA 4QCFA 4JKKA 5CPTA 1QHZA 4UOZA 2J47A 3TA9A 5A8MA 4QFUA 4DM2A 4DUWA 2DSWA 1LQ0A 4QP0A 4E8CA 3T2QA 2VZOA 1E0VA 1B3YA 3F4VA 5A8NA 3PZUA 3SUUA 2YL9A 2YLLA 1FFRA 3SURA 4Z2LA 1ITXA 1QVBA 2J7GA 3PZNA 3RDKA 1FHLA 2J7FA 4EANA 1XH0A 4CN6A 1MWOA 2DT0A 3THDA 5AY7A 2YBUA 1BG9A 2CEQA 2WHJA 4QLLA 2A3BA 2W92A 4BQ4A 3NUKA 3W38A 5HDRA 2X0HA 3AIQA 1J9YA 3ARVA 1VF8A 4B15A 1QNPA
chains in the Genus database with same CATH superfamily
1PIGA 3WBAA 3N18A 1CW2A 3S9ZA 1C7TA 3MSDA 2GSEA 4GHRA 2YX0A 1TTQA 4XBKA 1V02A 1XRTA 3FKRA 4Y9NA 5A6KA 5HMEA 3G1RA 1PIFA 1C9DA 2WM0A 4HYRA 2OLSA 1ME7A 1CENA 1ISXA 3NM1A 1XLFA 3P0XA 3LNPA 3ZWTA 2C3ZA 3GC2A 4CD4A 5ECUA 5KZDA 4QDPA 4CNNA 2WMIA 1RQHA 4B5NA 4HCDA 5C5YA 3TW9A 3DHFA 3GUGA 3UESA 3M0IA 4QG9A 2JGYA 5H6HA 4Y9OA 4HMEA 1TV7A 5DMMA 3DEQA 3MCNA 3T4WA 3A47A 1VIWA 1SSDA 4GA8A 2X05A 4UB9A 1PZ0A 4HPXA 2YZ5A 1FHVA 1E1EA 1A80A 5AZ1A 2BHZA 4PH6A 3GNOA 3CJPA 1XGDA 3EWZA 1CNVA 4JTRA 3TDFA 2POZA 3HB9A 5DLCA 1WKFA 2D22A 3NCOA 3UR2A 2R82A 1W3NA 3GKFA 3MUY1 2C16A 3TW7A 5LNVA 4S3BA 3UXAA 4ZOAA 4V28A 2G3FA 1Z32X 3E74A 3KRUA 1S2CA 2LLEA 4C6LA 1LLWA 4Z2JA 4XD3A 2DIEA 4ASTA 3NQ7A 4PUMA 1FXPA 4Q8QA 1UOKA 5F1UA 3U7BA 4UC5A 3W83A 3GXDA 1E73M 4XZIA 3GR7A 4ZSTA 4WLCA 4JXCA 1DTUA 3NL6A 4HQVA 4L61A 2GK1B 1ZBCA 2VFIA 3OHMB 1X8FA 4DJDA 5E0FA 3TTYA 1C9WA 1VBHA 4ATLA 3B06A 2HS6A 1RVKA 1OD0A 3AJXA 3PTKA 2C18A 1TX0A 1M5WA 3KWXA 3LSBA 4TQTA 1XBYA 3ZSSA 1HL8A 3B9NA 3PWIA 3W37A 2TRSA 4LOCA 3GXIA 5I77A 5FJRA 4IG2B 3T0AA 1CLXA 1XISA 2EBNA 4H6KA 3WNLA 4C65A 2BB0A 5T26A 2V5LA 1SZRA 3GB6A 2JF7A 1TRDA 2H8ZA 4GJ1A 4GYFA 1UA7A 4X22A 5CZ0A 1CCWB 4GJJA 1UKOA 1C8XA 1KKRA 1E9ZB 3ZJ6A 4ACYA 1DQXA 4QRNA 1MDLA 3CIXA 3IIOA 2PRLA 4U28A 1EA9C 4RZBA 4FXFA 3UNTA 3OTRA 4YTSA 2QUMA 3TVAA 1ENUA 5D9OA 2G5WA 3U4FA 4M51A 1ICQA 2O9TA 3AWNA 1YTDA 3ABRA 5LZLA 2JALA 1XLGA 1R8LA 4GQRA 4IISA 3ITTA 4IFKB 4PN2A 4Q8NA 3HOJA 3TNOA 4AWEA 9CGTA 5IHSA 2NQLA 1QOPA 3MUZ1 2XIBA 4ZE4A 2WAGA 1QU4A 3NM3A 5M03A 3HPAA 4MJZA 3UPBA 4L4PA 4H7CA 3RPDA 4PCTA 3MMDA 3CQIA 3N25A 3NQBA 4ZB2A 2PWDA 3EOEA 1ZJIA 3L5LA 3GHTA 1JEZA 2QZRA 4NL1A 4QR6A 2Z2BA 3RHGA 4NJJA 4Z0SA 3DFSA 4YLWA 2OG9A 3MQTA 3NL5A 2J8GA 1LRTA 4IIFA 3URAA 3B8UA 3PZQA 2XDFA 4ACZB 3WUEA 4LJ3A 1ODUA 3WUGA 4IPLA 2ZZ4A 1OFQA 4G6CA 3N14A 1R47A 4I9AA 2VEGA 4WVXA 5G1TA 4BQ3A 3APYA 4JTKA 4LY8A 1J79A 3WK0A 4WJEA 1DIDA 5AVNA 4DWSD 1H61A 1RCXB 2NW0A 4F0LA 1HT6A 2EPLX 1KM2A 1UZDA 1SFJA 2FDSA 4B4HA 1J0KA 1N82A 1LT7A 3BG9A 1KLYA 3B8IA 1K1DA 3IRDA 5DO8A 4UZSA 3VGEA 5HR7A 4F3HA 3M5XA 3WX7A 3MSGA 1XC4A 4Q8WA 2NX3A 5FIPA 4O1AA 3MHUA 3VD5A 3R5EA 1I0BA 2DT2A 3IAPA 4I6KA 4IL2A 4Z1YA 4TX6A 4EP8C 5REQA 3OB8A 4QEEA 4L65A 1E9YB 3EPNA 2G96A 3K8LA 1PYMA 3AHZA 4NX5A 3I7QA 2G37A 1FY6A 4Z1BA 3NYZA 5DBUA 2OOGA 1AH0A 1GYNA 4C6NA 2OJPA 2A2IA 2FHBA 3CWHA 4NYUA 4AZHA 2QJJA 3B9AA 4TVCA 1NH6A 4L4OA 3L4XA 1KBIA 2D20A 2QF8A 4K39A 3LTSA 3LI1A 5CGTA 2YYUA 4K8EA 5CPMA 5CZSA 2BY3A 2RFGA 4FA3A 1KQYA 1NF7A 1BF6A 4RDYA 3F5JA 1A5BA 4U5KA 4LANA 3OLEA 3IUIA 1QXLA 3VE7A 1IXOA 4NYYA 4V1YA 3AS2A 1NOFA 5CH9A 5T8GA 3RPTA 4JX4A 3GR4A 3RM9A 5A8QA 2EG7A 3TXVA 4HU8A 2GQ9A 5BU9A 3RF9A 4L80A 4OBSA 3S2LA 2DGAA 1X1OA 1CXIA 3NEHA 1XLMA 3WJXA 4GINA 4IWWA 4WHBA 1ZTVA 4G8TA 1OGBA 4PZVA 4AX7A 3NPXA 4XIAA 1C92A 5IBXC 2DJLA 2WCGA 4B92A 2VR4A 5J5RA 3JR2A 4FNPA 4BHYA 2RJGA 4O52A 4C1NB 4U2ZA 4OOUA 3H7VA 5CC3A 3KFTA 2KAUC 3ITLA 5JBEA 4P7NA 1HNYA 1UZ1A 3M0XA 4AD0A 1F61A 3MVTA 3W87A 5CSSA 4A2SA 2OGYA 1VFHA 1BYAA 1PHWA 1EX1A 2A3HA 2CC0A 3N12A 2VEKA 4NT0A 1Q6QA 4NRSA 3QJAA 2DZBA 2OT1A 3R13A 3USBA 5LIUX 4L9XA 2XVGA 4LEFA 3LMZA 4A4AA 1W17A 3UVIA 4GX9A 2XTKA 5FCZA 3AQUA 3V7PA 3RCYA 1VD6A 2BZNA 3P82A 3SUVA 4FLOA 5C2GA 3L2MA 4JTCA 1F8IA 2PTZA 4LBUA 1LUCB 4BI7A 2OKTA 2DY3A 1LCOA 3T4CA 3SRKA 2EPOA 5C2XA 1J5SA 3DUGA 3QGVA 4I3GA 4J40A 4WOQA 1AVAA 2VHLA 2Q3RA 2WMKA 4IFOA 1XLAA 5AHLA 5C9ZA 1OM0A 4QISA 1NP2A 3H12A 1EJVC 1OCBA 2GPTA 1XP3A 3OZOA 2J74A 3FKKA 1KFKA 4MWAA 3NAVA 2VR2A 3QPEA 1XCWA 1WDRA 3S3GA 3J7HA 1B4KA 3VGBA 4GLEA 4FLQA 4LAUA 3XIMA 4PMNA 4F0KA 3N9KA 4ZZ9A 4A6GA 4UNIA 4PTWA 3QR1A 4ZQOA 1JZ2A 1F3WA 3MBFA 5I6SA 3SQMA 3ITOA 3VMPA 4OWGA 3W73A 3W1LA 2BHUA 3OGSA 1JRCA 4I9JA 4M1BA 1TCMA 4XQ6A 2RGLA 2CLLA 2C19A 1CBGA 1E6NA 2O9OA 4PUWA 2QR6A 3EXSA 3LQGA 4Y90A 3R11A 4E2DA 2Y5EA 1QW8A 3AYVA 4HSHA 4C5ZA 3PAOA 3PG9A 4CQDA 4ERIA 3HV9A 4C6OA 1R9ZA 3I65A 1U5HA 1R9XA 3C86A 1F3TA 2VC9A 4AVOA 2KZHA 4JTHA 1EQPA 3FW6A 4FNTA 3KTCA 4JTEA 5H8UA 5DY2A 4IOTA 4KWVA 1W2VA 3OEXA 3CHDA 4ROPA 1AL8A 2WLZA 3C3NA 3CM4A 4D8ZA 3ELFA 4GQ0A 4IZGA 4EPDC 4O28A 2Y88A 3AMDA 1PBGA 3LSCA 4JX6A 1A47A 4LYRA 2PD9A 4CLMA 4GUGA 1DJWA 3CBWA 3FY1A 1YTEA 4XAFA 1GYMA 2OSXA 3O6DA 4GFIA 4DUVA 3UXKA 2NSOA 3CZGA 4F2BA 2A3CA 3K13A 3T7VA 1UYQA 1FX6A 1R6WA 3XINA 4H4IA 2B7PA 2YL5A 4CEXC 3CH0A 2VFFA 2WNQA 1WXZA 2G3NA 3QLLA 2WHLA 1JCLA 3OG3A 2YXXA 4I7UA 2IQ0A 2WC4A 1DWHM 1TQJA 2JQXA 1A5LC 3ME3A 4EWJA 1JCJA 2DSKA 2Z2UA 2B4GA 2P10A 4H9TA 4JFTA 2XVKA 1JZ6A 1B3XA 2QKFA 4Q7IA 3LXAA 3ZR6A 1I2NA 3KTXA 3V35A 3GXTA 4N6FA 4UQBA 2O4QA 2RKXA 2VRJA 1H50A 1X98A 2G3JA 4OFCA 1AQFA 3CZKA 1SJCA 5DRIA 4DIAA 1NDZA 5D2WA 3W76A 1UASA 2ZRZA 2VOMA 1KGWA 3GTHA 5HBFA 4ENLA 2ZIDA 1HP5A 3LPPA 5D2YA 2O7QA 3GHRA 3APTA 4CVWA 1UJQA 4AD2A 4OUIA 2HV5A 2E3ZA 4LPCA 1GVYA 4IICA 1TYGA 2G97A 1NDWA 5FSEC 2ZDRA 2X09A 1N7KA 3NDOA 1FWDC 3S9IA 4MUPA 1OFDA 1IEQA 1H7WA 2PDYA 2V5BA 3PPGA 4G1NA 4MY9A 5KZEA 1X1NA 3GO2A 2IPWA 4A8LA 4Z2GA 5DRCA 1T99A 2ZZ5A 1YPFA 5C0QA 5HMSA 1NOWA 5K2ZA 2WM1A 1G9HA 2GUUA 4LYPA 2YDRA 1JCTA 1E4IA 1K02A 1FQ0A 5I06A 3VIFA 3VKJA 2J4GA 3LRLA 5EA9A 5DQPA 1WZMA 2WOQA 1GOKA 4CKQA 3PJXA 3TWAA 3THQA 2PGWA 3KLKA 3SB0A 4G2DA 2YFNA 5JVLA 3I7SA 3WNNA 1Q6RA 1XXXA 1W5PA 3W0KA 2HXTA 4Q4PA 3ANYA 4C6PA 4AEOA 5FEXA 3HN3A 4OUEA 5MF5A 5D8ZA 4GPNA 2Q8LA 1K9EA 1JDDA 3H24A 4P2VA 3PZMA 2EQDA 1D7KA 1FDJA 1VBUA 4OGZA 2MNRA 4E2BA 1DYSA 3M47A 4H04A 3H70A 3A4AA 4MUZA 2ZXBA 3N9SA 5ABTA 4HCHA 2PD5A 3VO0A 1TIWA 3C8FA 2VWSA 3EMQA 3KP1A 4FMVA 4RZ6A 2WK2A 3TFCA 2QAPA 2ISWA 2B7OA 3HM7A 1EPXA 2J7EA 1LRQA 2PA6A 4DI9A 1POJA 2VDIA 1QNVA 2Z2AA 4C6QA 4DVOA 2E6DA 4X9YA 1YE4A 5CCZA 2WSRA 4EACA 2CESA 1XQLA 1J18A 2QUVA 2GJPA 2WANA 4LUTA 3QF0A 1KM6A 2PDGA 4AAJA 2GDQA 2I9UA 1JNDA 2ZFAA 3B0VC 5AVHA 4UQCA 3H55A 4DWSB 1RLDA 1E5JA 4D6GA 1QJWA 3EWUA 3QZEA 3OW1A 1DE5A 2PLCA 2F6KA 2CZDA 1VFMA 1ISWA 2WWCA 3CS2A 1PKYA 5CAHA 1TG7A 1OK4A 1XLDA 3W6MA 3GU9A 3RCMA 1VGAA 3RCNA 3EGJA 1A0DA 1LG2A 1W56A 1LOSA 3BSMA 1I2QA 3EDKA 1A4MA 5I3IA 3P14A 4M81A 4FB7A 2A3AA 4R7OA 1DIEA 3G6MA 1XS2A 1QPNA 4QJ4B 3K30A 3FOKA 5CKSA 3WUFA 3BLKA 3O7UA 2QEZA 4JYFA 2Y7GA 4IP5A 4JL2A 4K7VA 4TVDA 1NFGA 3WQVA 1ZLPA 1SR0A 2FFIA 1XLJA 1XIHA 3VKKA 4DO4A 3B05A 3VU2A 5BWFA 4JIEA 1IWAA 3BC9A 1D3CA 1D8CA 3QHNA 3JZUA 2A21A 3THUA 3MS8A 1ML1A 4OIFA 4JYEA 4FX7A 2V2HA 1T8QA 3AIVA 1TQXA 3ES8A 3RM8A 1K6AA 2ZICA 1FFQA 2ISVA 1IZCA 3NPWA 4FAMA 2TMDA 3EXTA 2OZ8A 1KTNA 4XVDA 2E1DA 4O10A 4PMXA 2VCCA 4P8UA 4MKSA 3LCGA 5D2TA 1Q4WA 2J8TA 4LTSA 1ITUA 1FCBA 2Q71A 5BXTA 2Z1VA 4R9OA 5HA7A 3UGVA 2NUWA 3ABZA 4ERAA 2YYTA 2PDFA 4MIMA 1LLOA 2DW7A 2ZE0A 6ENLA 2BVYA 4DAIA 1PZ2A 1GTHA 3FAXA 1M04A 8A3HA 5CG7A 1KXHA 1C8QA 3N13A 2BODX 2C13A 4QGCA 3WEMA 1KBBA 2R6OA 3ZMRA 2VCAA 1IEIA 3P5YA 4OHQA 4S2BA 2BBFA 3ARUA 3G0SA 1SU5A 1HJXA 6XIMA 3LI0A 4V1XA 3SGZA 1X6UA 4Y6GA 3G5EA 1EUAA 5BOEA 1LG1A 3RIKA 1A3WA 2OSYA 1KRAC 4I6VA 3RMEA 3M0KA 3VZYA 4E5TA 4WF7A 3TCEA 3VGHA 2VCBA 4H2CA 3HG5A 4PTXA 1M01A 1UQZA 1W0MA 4XUYA 5HJYA 1W6TA 2W3ZA 2INEA 4UBPC 4IIEA 1BPLB 1KCXA 4F48A 3IVUA 2O92A 2REQA 2WCAA 2J75A 5LA2A 1TWSA 1B5TA 2XGBA 4B9YA 1DKWA 3W6LA 4LS1A 1RPKA 3LA4A 4JQ1A 4O1CA 3E12A 1FWHC 3NXLA 5F4XA 3BMVA 4O14A 3OGVA 4DJEA 1WKYA 4LX4A 4LVGA 4YJ5A 5IFPA 7REQA 2RGMA 5DT5A 1GQIA 4LEQA 3GH7A 4JD4A 2XN2A 5ABFA 4KIRA 3E5PA 4F2TA 1E0TA 1FHUA 4DXKA 3C0LA 2WPGA 1CPUA 1ADOA 3A22A 2VRKA 4OU1A 3PG8A 5EMMA 1BRLA 2XH7A 4HK6A 3H26A 1OFAA 1DJIA 4GY7A 1P6CA 1I75A 3WQGA 1FP9A 1O95A 4Z08A 1E6SM 1P6BA 4DX3A 3H7UA 4PMOA 1XLEA 4KPLA 1AA1B 2VC6A 3TP4A 4MZ8A 4QNEA 3PUOA 1Q8JA 2V63A 1GKPA 3VIHA 1DBTA 3E1F1 5I09A 3WDIA 2NUXA 2AKZA 3RX2A 1M65A 2ALDA 3CHEA 5BRPA 2W4XA 2HDJA 2ZTJA 1DHPA 3AO0A 1MEIA 5U7SA 3VMOA 5I7GA 4Q8UA 3LPGA 1E72M 3TLLA 4INFA 1VHNA 1ZPTA 1KFEA 4JY8A 4D6CA 1X8CA 5HJXA 2JGQA 3W1UA 6REQB 1VHCA 1R7AA 3WD2A 1ZSXA 4ICCX 1TMHA 1LROA 3GE7A 3EA3A 3SSZA 2R8WA 4GQQA 4LAMA 1GOMA 4QLJA 4DM1A 4Q22A 1JPMA 3W7GA 1JCNA 2ZOXA 1BFNA 3RK8A 1GOIA 3LV5A 1TTPA 2PDBA 3EX6A 4GZIA 3WELA 3FNDA 1MW0A 3RX4A 1V3LA 1JPHA 3V3WA 5LGZA 1UIPA 5I07A 2XVLA 3NQMA 1CI1A 1R0MA 3WL1A 5A2BA 3H53A 1BLIA 3G8RA 3UJ2A 1PIIA 5C7VA 2J9YA 4WDTA 1PPIA 1GT8A 1EFZA 4LUYA 1V0LA 3L65A 1UR2A 2RDWA 3W22A 4KCTA 3WFAA 3O16A 4DAFA 3UZ5A 5CXPA 3AMCA 5T91A 7PTDA 3VC5A 3EMZA 4PCPA 3KVLA 2G0WA 5D9PA 3TAOA 3L66A 2QJMA 5D05A 2WLYA 1OC6A 3CYJA 4YVXA 1L6SA 3N3MA 4CVUA 1V03A 4KRTA 1BEUA 4L4MA 4ZB0A 2B0MA 1PX8A 1PXGA 4HNTA 3NQ2A 1H7XA 4GXMA 3M07A 4K36A 1ZUAX 4HOWA 1OIMA 2EKGA 1JCYA 3IANA 4O53A 1TE1A 1F9CA 2ZC8A 5DXYA 3R10A 1O12A 2CITA 4R3UA 4RV3A 5BRBA 2PGRA 4M6PA 3BL3A 5F7UA 1QW9A 1F73A 1JD9A 1SO3A 4QLKA 2DZSA 3TYAA 1HIZA 1W9UA 3GUWA 5FJJA 1U30A 4FOKA 3IK4A 1KM5A 1GNXA 3V0SA 3WNOA 1S2AA 1NF0A 3EEZA 1JL8A 1CXLA 5IHRA 1N2VA 5CG0A 4HTBA 5JU6A 5GQBA 1XIEA 1JCXA 4E4UA 1TE6A 4EXBA 1ZJAA 4LC8A 3FS2A 1KBKA 3PZIA 3HU7A 5I0DA 3TN6A 3BTNA 5DCBA 2BMBA 2VDGA 2DZUA 3M46A 3M0ZA 3OYZA 4G7EA 1V4YA 1GKRA 3P8IA 4KWOA 3YPIA 3CWOX 4IMCA 1FWFC 3G1VA 4U33A 3WDPP 2F38A 5A69A 4HN8A 3SDOA 3PFMA 1TCDA 2V3DA 3I6TA 2GUYA 2PF0A 4KS0A 3WL0A 2VP8A 3PJTA 3UF9A 2ZE3A 3HQPA 3HO8A 4PMDA 4FF5A 1UKQA 2ZX9A 4N0RA 2P0IA 2J6XA 5FAGA 3H2NA 1K9TA 2QNEA 3TJ4A 2Z26A 1SFTA 2Y5JA 4S3EA 3BMWA 4XAZA 2FB2A 5IRPA 4AWSA 3WZ0E 4DZIA 4NI3A 2VD8A 4M5PA 5TNVA 1VC4A 4JNZA 1ZP4A 4JQAA 1EDTA 3LU2A 3VOCA 1E5NA 1O68A 1V8EA 5HUOA 3GU1A 3BUVA 4FI4A 2ZX5A 2NWRA 3MV11 4EAYA 5FAJA 4RK8A 1EB3A 1US3A 5D03A 1EHNA 3T6CA 4WUIA 2FTWA 4PSRA 5D9NA 2NT1A 4YL2A 3UA4A 2NVCA 1E51A 3S42A 5KEZA 1B9ZA 3QSTA 2YOCA 5EMJA 1ADDA 4Z1DA 3RYSA 3E6EA 4H6EA 2Z29A 3KBJA 1V6VA 1XD1A 1PTGA 4O54A 1JVNA 2OEMA 3PS7A 3OBKA 3THAA 3GDBA 4QG8A 3IJ8A 3KZPA 3WF1A 3L7RA 1JUKA 3S5OA 3L4ZA 1SJBA 3P81A 1ZHAA 2PDWA 4X0NA 2CIPA 3LCIA 1U1UA 4ZTYA 3V5FA 3A21A 4DHGA 1AD4A 3G3MA 1L6GA 1K77A 1AG1O 4Z1AA 4AH7A 4C6JA 2XFRA 3OVQA 4IIGA 4LB4A 1WDWA 3VD3A 3WLOA 3BG5A 2QUTA 3MKKA 5AECA 4O8AA 1K6WA 2OEKA 3G24A 5GJPA 1MXSA 1TA3B 1NWUA 1FHDA 5G1MA 3SIMA 1R7OA 4LUSB 3NZQA 1W9VA 2DUZA 4F0HA 2H3BA 1K03A 3VOFA 2QPUA 1IYXA 4TMBA 3W27A 3LK6A 3HTWA 3N2XA 4K1WA 4BCEA 1EP2A 1ME8A 2WHKA 4HSOA 3AAMA 4LUJA 3WFLA 1QPOA 3WQPA 1XWYA 2Z1WA 1UUOA 2C71A 2ISDA 1H7OA 3R8RA 2FFCA 4QFUA 4WDWA 2VUNA 2Y1HA 2Y8UA 4FIRA 2ICSA 2CZEA 1KO0A 2Z4GA 3OZMA 2AQWA 3CQHA 3KBMA 3F4VA 3W2MA 1I60A 4Z2LA 3JS3A 4DY1A 1FHLA 4CN6A 3FYPA 1MWOA 4ALDA 2DT0A 3THDA 1V51A 2YBUA 2EPHA 4E3VA 3E3HA 3UCDA 2WHJA 3FGCB 1A5NC 2W92A 4NKCA 4LUIA 2WSYA 3W38A 5HDRA 3GFZA 3AIQA 2NXIA 1QNPA 3IVTA 4EWND 5F4WA 1S5NA 2CLIA 1BVNP 5IXEA 3IACA 2FKPA 4GH1A 4BQ2A 2VVNA 1DJNA 2F9RA 3FCPA 1KFWA 4K38A 4TX8A 3C61A 2PTDA 1HJVA 4KCUA 2ZWZA 4LCRA 4S1FA 7ENLA 1R3SA 3DFTA 3DGRA 4GUIA 1OF6A 1Q63A 1E0XA 2YLAA 1EOKA 1A3XA 3KAOA 3OVPA 3BLFA 4WJXA 3A6OA 4GNKB 4LY4A 3QY6A 4MWAB 2F7FA 1GHRA 2BGSA 2E6FA 1FWTA 1NSJA 2VX7A 1AL7A 2QIWA 2RDUA 3FHQA 3TYUA 3T0DA 1P48A 2ALRA 3S2CA 3N4FA 2GZXA 4HJWA 5HAOA 4P61A 4O4VA 4RCXA 2ANUA 1PHQA 4PMYA 1XW8A 1H49A 3CV1A 1E4NA 4GKTA 4AY1A 3KRSA 1OC5A 2VZVA 1D2KA 3NSMA 5AFDA 1YNPA 1WDSA 3W26A 4LS2A 3DYMA 1I1XA 4L4LA 5A6LA 5AN7A 2C7FA 1GQNA 2Y61A 1XM3A 4RE2A 3GTNA 4AWTA 5M1TA 2XM2A 4AIUA 4PE8A 2J7DA 3WD4A 1PS9A 3C3UA 4KW2A 4RW5A 2X30A 2X1TA 4N6EA 5TQLA 1EJRC 5B7ZA 3QQ1A 1YDNA 2QCCA 3EZ4A 3NO3A 1OADA 3MP4A 3NG3A 4KWUA 4M24A 3ZFHA 3IUDA 1W91A 3DFNA 4MB3A 3BOLA 2AL2A 4JTGA 1UD4A 2R1PA 5DT7A 1MUCA 2PTXA 5EL1A 3TH6A 3H4WA 3BWWA 4RV8A 2J88A 1QTWA 1GQLA 3VOJA 3CAVA 1PVNA 2J79A 1J8VA 2E6AA 4OZOA 1CLVA 1FH9A 4GXPA 3QW4B 3UY7A 4UR8A 2R1KA 4FOUA 2A7NA 2QF7A 3HG3A 2XYLA 1QI2A 1TA3A 4D6DA 1OHLA 1NIUA 2PCQA 3IGSA 3SBFA 1F6YA 3CUFA 2GUBA 2WJEA 2PDKA 4AYSA 5G4EA 1YBQB 1K8XA 1W3TA 1JYNA 1NAL1 3WNMA 2AMXA 4V27A 2JKPA 4HPHA 1MUWA 3BURA 4K2SA 2A7PA 2PRMA 1NY1A 5DCDA 3UNDA 3DI1A 3LHUA 3TR9A 3U8GA 2R1LA 2W9MA 1J6OA 4ZOBA 2VELA 4GZ7A 5GNXA 1OCJA 1RA0A 1E55A 4DJFC 2H9AB 4QIUA 2HCVA 3OODA 3VDGA 1BKSA 1WZAA 1XCXA 2JIEA 3N2CA 2KX9A 1AW1A 1IV8A 1JXKA 2C0HA 2C6QA 1WA3A 2WZIA 4QDMA 5FL1A 3E2SA 4NAEA 4WDXA 2O9PA 3HPSA 4RE4A 3UWEA 2CWNA 3AHTA 3VNJA 1UROA 1EGVA 2WB5A 1O5QA 3OVRA 1DQUA 2HVMA 1E1CA 3GDLA 1AJ2A 1YYAA 3GDKA 1UBSA 2CXGA 5AYBA 2O9RA 3W6YA 2WVVB 3DFYA 1FUYA 1XDJA 4J35A 2PWEA 1CXKA 2OODA 2HPMA 3AZSA 1OX4B 1TPDA 1OX5A 3QBUA 3ABQA 1BYBA 3BMXA 4GFSA 4Q7NA 1U1JA 3G22A 3N3TA 3G2GA 4ZTXA 2FH6A 3G8EA 2Z28A 1UQYA 2D1ZA 5M3WA 4HIBA 2FVLA 3JUGA 4WRHA 4I8DA 3JRKA 1S5MA 2QUUA 2E8ZA 1CDGA 1UWRA 1QK2A 2WMFA 3BV7A 5FJUA 4UTTA 3VX1A 2FB3A 2IKGA 3SI9A 3S46A 1F2JA 4UFMA 1UHVA 4NJIA 3FN9A 1BD0A 4P5UA 1SJDA 2CPUA 3KL3A 3VNLA 4LAZA 3GWQA 3QV8A 1RBOB 2YA0A 1SW0A 5F2MA 3SCUA 2CZVA 3STCA 1QFEA 1YDOA 2E0PA 2CKSA 1SFSA 4R33A 1C8VA 5A8PA 1DVJA 1XUZA 3SO7A 4ZXLA 2GOKA 1AH4A 1ZB5A 1HF6A 3MHFA 1VYPX 4YPJA 2POTA 1Y65A 3N1AA 3HMJG 4E8GA 1UD5A 3M6DA 1KCZA 4AUBA 4PC8A 4ZENA 3KCLA 1VKFA 4M19A 5EPDA 2RAGA 3GH5A 1LWHA 1HKMA 1XQKA 5E9AA 3KVJA 3H21A 5KTLA 5I2UA 5C54A 3W7HA 4S3FA 1LBMA 1Z7AA 3R7MA 5BXRA 3PUEA 2J62A 2Z25A 2IPJA 3KUMA 1W9DM 1HGYA 1AQ0A 2B31A 1US2A 1D3GA 2OSWA 1ZS2A 2DORA 4DLFA 3K1GA 2PGEA 1JZ4A 3IRSA 1OX6A 1H63A 2AGKA 3TE9A 4JDBA 1CWYA 3TYDA 4DF1A 1YHTA 1A50A 4GZJA 1N8FA 3T0TA 3CIWA 3R0UA 1W1B1 5TF0A 4HT3A 2GK1A 1JAEA 4B2DD 3N4EA 4IX2A 1RQBA 3HMCA 3MKCA 1GYLA 4IGHA 3SN0A 3VD4A 5D30A 4LNYA 5A6BA 2QMKA 3ABSA 3HJZA 2ZUUA 2PP1A 3H2EA 3OU8A 4DF2A 4H1ZA 4M6VA 1KKOA 1XJBA 3T07A 1QW7A 3OPSA 4AFYA 1SUXA 2IS7A 1B3WA 1IGSA 1EIBA 4LAKA 4RNJA 4IL0A 4W93A 1GWJA 2P3ZA 2PPGA 1B1YA 3DFQA 3STPA 1DEDA 4H9MA 7REQB 5FF7A 2BY0A 2E28A 4Q4OA 2Q8ZA 1GPWA 4HHMA 1WP6A 4ATDA 5I3GA 3CQKA 1WPCA 4A3QA 3M0HA 4P7OA 1VFFA 5CEWA 4AZCA 5J04A 1NWTA 2FMOA 1UIOA 2YCLB 4D1IA 4EPKA 4FNUA 3Q58A 2WZTA 3L5MA 2GVYA 4CU7A 3F5KA 2OWWA 3NDZA 2V6AA 4PMUA 4RW3A 5CAKA 1SPQA 3WKZA 3NYDA 3VTRA 3WF4A 3MJMA 4DJED 1UKPA 1UWQA 2V9DA 4IPNB 4GYPA 5LA1A 1QK0A 1UD3A 4IP4A 1QRQA 1V3KA 1WBHA 4AQLA 3IJIA 2J24A 2XFYA 3MZNA 4R88A 1ZL1A 2QV5A 4G1KA 3V5CA 3TQ0A 3OA5A 3EWYA 4YWSA 3T05A 3EWWA 2OU4A 1XICA 2AAMA 3VABA 1IXQA 3BV4A 3VKDA 1O5RA 4CQAA 4NQ1A 1U33A 4Y2WA 4FNSA 1G6CA 4CNOA 3C0QA 3VNYA 3ATYA 2V5KA 2I9EA 1XBVA 1IZJA 2CLEA 4UQEA 4MVAA 3GVVA 3LERA 4WGXA 3GC5A 1PDYA 3ARQA 3LBMA 4U5IA 3E0FA 1LL6A 1K70A 2WO5A 4M56A 3VKAA 4JTAA 4FXJA 2QVHA 3U2CA 3MPGA 1XFBA 5D2VA 1OINA 2GGGA 4HOZA 3BPWA 2VEPA 3ZJ7A 4I5UA 2DP3A 2Y62A 3LGDA 4JN7A 2I7GA 1CEOA 3PZVA 2PTYA 4G7EB 3IARA 3CUZA 4J2PA 3VIMA 1I45A 1SGJA 3MO4A 4NNCA 2IKIA 3UWWA 2OPJA 4X63A 1Z42A 4NSBA 4WKAA 3M5VA 2W91A 4AF0A 1OABA 1IQ8A 1Q6FA 1W1ZA 2B81A 4HD5A 2X2YA 4W88A 3TIMA 4L1GA 3BZGA 1H11A 4YCOA 1Y8BA 3URNA 5C9WA 2HRWA 2C0AA 5HINA 1GZJA 4Y9PA 3AIEA 3O8AA 1G4TA 2PDCA 4WSKA 1P0KA 4JPGA 1I2PA 3DHDA 3IJ7A 3OLIA 3LQLA 3AHVA 1R3RA 1XGZA 2GVEA 3DH7A 3AS1A 4C91A 4AISA 2QPSA 1KC7A 1RCOB 3UG4A 4KWSA 1QI5A 5G2IA 3VNZA 2BASA 2Q3OA 1HN1A 2QGYA 4C60A 1IIGA 3PSWA 4Z1CA 2I5QA 1BWVA 4JTUA 5HQEA 4UQDA 2PB1A 1MXDA 3F7JA 4XAGA 3SRHA 3G1XA 4JIIX 3W7IA 3NJ3A 2EJ1A 3O6CA 1ZJBA 1NWRA 5CGMA 1PCWA 4P7QA 2GJXB 3CO8A 1WKDA 3W84A 2WZHA 4TTUA 3E38A 2WZMA 3DKJA 4CN1A 2XN0A 2PWHA 4ICMA 4MTVA 4UOJA 1WE5A 1CGUA 2QCMA 4XAPA 4V2XA 3OO2A 1KW1A 1BTMA 2IPGA 1JIBA 1MVYA 3GC4A 2XHYA 3GAYA 2C1HA 2FZ9A 2QCDB 2FPVA 3CXOA 5GPRA 4C5YA 4PBFA 2DVXA 3V1HA 1EO5A 2QUNA 3RAOA 3P6LA 3LHWA 4ORIA 1WDDA 1W1YA 4B90A 2YBVA 1QNRA 3BANA 1KFLA 2ADAA 3SY8A 3VNMA 4QAWA 1VS1A 3VIJA 1XIFA 1M03A 4UCGA 4A35A 5XIMA 1IEVA 2R14A 3MC5A 1ME9A 2Z1XA 3TYBA 3SZ8A 4IGNA 4RNFA 1UD6A 2YL8A 1G0CA 1GOQA 3TWBA 1OYAA 2PDPA 1FWGC 1PV8A 3VFCA 4Q3MA 3W7KA 1CXFA 4I8YA 3B3DA 3IGXA 4Q8MA 4M3PA 2QV4A 1YE6A 5HQLA 1GCYA 4AW7A 2GQAA 4UR7A 5CC7A 1A53A 3SCTA 2VVSA 1C7SA 5BOFA 1DJYA 4D1JA 3A3XA 1HQTA 3KOWA 1JJKA 1TELA 3IWPA 3TJLA 3ZS4A 2ZTKA 1ISZA 4IJBA 3CLWA 3WJYA 1EC9A 4HK7A 2ACUA 2G4FA 4IQLA 3Q4DA 1JUEA 3EB3A 1QO2A 3BAWA 1KFBA 3N2OA 1YADA 3FDKA 3DBNA 1W3IA 2W63A 4U3AA 3RLUA 5HOSA 1Q4NX 1UUQA 1Z48A 1HG3A 4Q6XA 5BROA 4WJ8A 1S5TA 3T2OA 1GG1A 1NDYA 4ERGA 3C5QA 3A12A 5DY3A 2CU0A 1KCLA 3JU2A 3QW3A 4QSFA 3LM3A 3U48A 3UR8A 1MFUA 1TPVA 1K8CA 8TIMA 3A4JA 5AC7A 3T09A 4X60A 4UFLA 3AMGA 3DERA 3N2BA 1VYSX 4PMJA 4H8UA 3SAZA 4JCMA 2DIKA 3TK7A 2P50A 4RE3A 3WQEA 3DFHA 4AZ5A 3RLVA 2QJHA 2QDGA 2J7CA 4UZUA 4DBUA 1ZBKA 3GXPA 3THCA 2IMRA 1KXTA 1JNEA 1E1FA 4QROA 2I5GA 2J7HA 5M17A 3AMLA 4Q8PA 4C6CA 1GHSA 3AMKA 3E9AA 4IIHA 3U2OA 3MCOA 4Q7BA 4KETA 3TQPA 1D3HA 1TR9A 4GUHA 1VLIA 1VFUA 2ZZ7A 4PL1A 3A5VA 1OGGA 3CV6A 2MANA 1BVWA 2Z6IA 3AC0A 3WNPA 4M6QA 3APGA 3VK5A 4JQ3A 2WXDM 1OFPA 4XBSA 3FJLA 4J28A 2P8BA 4GG9A 3KXQA 1J0YA 2X41A 1XF0A 1QI4A 1GVIA 3ZO9A 1MMFA 4J27A 2UWFA 1H09A 4C1NA 2WVVA 3HPZA 3MP5A 1RY8A 2I57A 3NQAA 4D71A 1E4MM 1THFD 1ISYA 2ZVRA 3ARYA 3R25A 4CD5A 1XYAA 1BAGA 1BG4A 2OZ3A 2YW4A 3AS3A 4IXXA 1X7IA 5J5DA 3STEA 4D2JA 1XYFA 3O2LA 1KWKA 1T0OA 4K8HA 3G3DA 4PMRA 2WC7A 4D6JA 1FXQA 5BWAA 3GLCA 2X0YA 5I00A 1GW9A 4NZJA 3WFZA 4N02A 2VKZG 3JW7A 1E1CB 2QXWA 1W2PA 2E5BA 3UG5A 3OBAA 4HNCA 3B9DA 1SO5A 2CHNA 4O13A 2NSXA 3S83A 4AMAA 2A1YA 1P0NA 3NIYA 2RDXA 5L6UA 2C8NA 3SJNA 3BCDA 1WV2A 3LD5A 4NF7A 2VGIA 3MDWA 3V0TA 4D6IA 1JRBA 2WKLA 3RRAA 3W7CA 3HA1A 1O5XA 1WQ5A 1GVQA 3ALFA 1OG6A 1F3EA 3VE9A 2GJNA 3EOUA 1RJRA 1FWCC 3CPGA 3SECA 5EKYA 1RR2A 1Q7QA 3RXZA 4H01A 3STGA 3W2UA 3K4DA 3S2MA 3EOOA 2QVNA 2NLIA 3R58A 4D72A 2NWSA 2CW6A 5DMLA 1NWSA 1Q2SA 1BRLB 3CT2A 5D8WA 1BTCA 5HWJA 4X0VA 1R3QA 2YW3A 4GNVA 3QRHA 3RRXA 1BQGA 1C93A 3TYCA 3DAQA 1BWLA 1Z9AA 2FTYA 4US6A 1JF5A 1L2UA 4YHGA 2PCEA 4ILSA 4UFIA 3WH7A 5I3FA 3OYXA 1JDEA 5K4ZA 3W85A 4IQDA 3V0UA 1I1WA 1RBAA 4NUWA 1WAUA 1MNZA 3PZTA 4A8NA 2QMJA 1WB0A 2TYSA 5A6JA 4GIEA 4TOQA 2QGHA 2E68A 4JOMA 5PTDA 4MB5A 1JFHA 3GG8A 3TV8A 3ZLFA 4W86A 1HKVA 3IJDA 3UW6A 3CPUA 1Y5XA 4NZ5A 5IM51 3DECA 3S9YA 3CZ8A 3ARPA 3R8HA 3KP0A 3AHXA 3PR2A 1XKYA 1XBZA 2VJXA 4Q32A 1TUXA 2PS2A 4NG3A 2CLHA 4OBTA 4L5ZA 4S3DA 2EG8A 3BE7A 1IHIA 2NVAA 3R8GA 1V77A 3W7JA 2AAAA 2A5HA 2GSHA 4J9JA 1MQPA 5I24A 4JTFA 3ARZA 2PP0A 4J3UA 4BF5A 4HU3A 4HA1A 3PBWA 1TJ2A 4G7FA 3ZOAA 4HN4A 4M8UA 1H60A 5FI8A 4AD4A 1IE7C 1ZRQA 4HPGA 2UY3A 1LF1A 3LGEA 4MPKA 2E6YA 5G5IA 3M0JA 5HQMA 1UPPA 4D8AA 1M7OA 3H4GA 4GD0A 3I6EA 1HTIA 3TQKA 4BKNA 3MBDA 4MADA 3IJLA 3PJUA 5CPOA 4B5UA 3SN1A 4WSHA 4GOAA 2ZUWA 1WNOA 4JEQA 1YNQA 1H5VA 3EB4A 3P2VA 3MKVA 7XIMA 4H41A 5BXPA 4NX0A 1L6WA 3VKBA 4YS1A 3KX6A 2FPYA 4RE0A 1TPUA 5G1YA 2EXOA 2PC4A 4GX8A 4KF1A 2QCFA 3PF3A 2PC8A 3VD7A 3UYIA 1J5TA 4P7RA 3HPXA 4O17A 3GRIA 3A5FA 2PTWA 1UH3A 2XGIA 2C1GA 3HGSA 2YDQA 3QYQA 1EZ2A 3HPFA 3PTQA 5LKYA 1M9HA 2EPNA 5L9FA 2EJAA 1ONWA 4US5A 2W62A 3ALGA 1E43A 1TB3A 4QEHA 4B5WA 5FD0A 1CLKA 2Z24A 2OCZA 5TBOA 1J0JA 1NP0A 4KMQA 3BSHA 4R5EA 1L2QA 2QJIA 3EA1A 3GM8A 1XFCA 4REQA 3RILA 5CZKA 2G4JA 1IEXA 4PEKA 1OYCA 1UH4A 3E49A 3WDHA 2VZSA 4ZO7A 3SCWA 4GI8A 1X96A 4IJRA 1TWDA 2DQWA 3CQJA 4F40A 1Q3NA 2OTDA 2JK2A 3EPMA 2BDQA 1KGXA 2J78A 1XHGA 5HULA 3T8QA 3QC0A 3SN4A 4QM1A 5EMUA 5A2CA 3ANUA 2AMGA 2EKCA 3S5SA 3DC8A 3QLDA 3S1XA 4S2CA 2Z6JA 2GOUA 4QE5A 1KLZA 1PZ1A 1CGVA 2A7RA 2D0FA 2BOEX 4ICNA 2X7VA 3W7QA 4DYKA 1J11A 1KQZA 1WCGA 3GDTA 2F6XA 2JFEX 3CZEA 1BVZA 9RUBA 1HL2A 3LRMA 3LV6A 3B0YA 2DDXA 5F2GA 4BJHA 2QT3A 4REQB 3KBVA 3EWDA 4JIRA 1EJWC 1Q45A 2QIIA 3LXBA 2YSWA 3VM5A 3U57A 1EZWA 1F76A 3WLPA 5FF2A 2HS8A 3O63A 2OKOA 1VJIA 3OLGA 1Q6CA 4UFKA 3M6YA 2Z1SA 1O7AA 4NNBA 3W75A 3P7YA 1K7EA 3CMJA 2BFGA 4KEMA 3V5OA 4K7YA 2VFGA 3EDDA 4AY8A 4DJFA 1OX4A 1E9LA 1JQXA 5HMFA 3AIRA 3ORWA 4GVFA 1SW3A 1U5VA 1X1ZA 2H8XA 1UP3A 2WW5A 3VPLA 4NJKA 1HVXA 1SZEA 2RDTA 4JKLA 3TKFA 4RXGA 1M1BA 4M7TA 1NU5A 4DQWA 3L68A 2CLPA 4PFMA 4D8LA 2FDMA 3CQ0A 3KLLA 5FACA 3FX4A 3UFYA 2CBVA 3R12A 3C2RA 1KR0A 4O0KA 1D7FA 1QPKA 2BTMA 4AY7A 4GCAA 4AVFA 3RITA 3PY2A 1Y5WA 2BG5A 5C6MA 1FKWA 4FNRA 3NVDA 3A24A 3CIVA 3P3BA 4F2UA 3L0KA 4HMCA 3BW3A 6XIAA 3P8JA 5AZ0A 4FX6M 2VURA 3BICA 3WYZA 4GJIA 3OLDA 3CZLA 2ZUSA 1VRDA 2NUYA 3LCXA 1RD6A 1W8SA 1FWAC 2CLOA 5HPCA 3EX3A 3W01A 4NP7A 3KCOA 2V81A 3L2IA 3ZLHA 3SRFA 2I16A 3UJEA 1US0A 1H41A 4IMAA 3MI2A 4W89A 3H2OA 4FX8A 4HVXA 1J4EA 4IPJA 1GG0A 3U6WA 1UR1A 2VFEA 2YB1A 3GIPA 1HXJA 5JBFA 1RY0A 1FTXA 4IHCA 4ECLA 2PI6A 3N73A 1B9BA 5AHIA 3KL0A 4EAMA 2D0GA 1XIBA 4FIQA 5KMYA 3NGFA 4V15A 3QMRA 4QJ5B 1FDYA 2ZX6A 2PF8A 1Q6LA 3LN3A 4TVUA 4LVFA 3TYEA 1QASA 5CBJA 4MY8A 2GLKA 2VT0A 2RH9A 2DIJA 4B9ZA 3HBLA 3ZWSA 5FEWA 3T44A 1JD7A 2YL6A 3FA3A 4H6RA 3LY0A 4M29A 4J1OA 2Y7DA 3WMLA 1KA9F 2PLJA 4DO6A 4RDVA 1SZNA 4HZ7A 3MANA 3VIPA 2BP1A 4GGBA 4NJHA 1DJGA 4W8AA 2DSUA 4KRZA 3S0CA 3WLLA 2VTFA 3RUBL 3M43A 5FJOA 4C6MA 1MI3A 2AQVA 1DJQA 3OOQA 1V6WA 1FRBA 1JYXA 1FWNA 4HSNA 3UWQA 3P5ZA 3EWCA 4XB3A 2VMFA 4HHPA 2PDQA 4NHVA 3GIQA 1GJPA 1C91A 4JEJA 4RX0A 3SCRA 5M2FX 1LJYA 3SQLA 5C8BB 3GW0A 1O6IA 1XGEA 1JZ8A 4J2MA 3KDOA 3D5HA 1UWSA 1UWAA 3SGUA 4JN6A 3NA8A 1F74A 1N8IA 4LXFA 3GTXA 4HGXA 3NQ6A 1E3ZA 1BSLA 4K3ZA 3HJEA 2X7WA 3B97A 3ZQ9A 3TSMA 3EB2A 2VGFA 3WH8A 5C9XA 1GUVA 4XX6A 2V5CA 4QITA 3L0NA 4GYKA 3RU6A 4QCFA 4JIHA 1QHZA 3ISIX 2OB3A 3PWAA 3TLQA 5FF0A 2AKMA 1VFSA 2A85A 4DUWA 3EEGA 4WY0B 3S5ZA 4R53A 4M6UA 2VZOA 2H90A 3WJZA 1FFRA 1EX5A 4POCA 4F0RA 1O94A 2J7GA 3AUJA 5LIWX 4Q4KA 1G4PA 1NTHA 5AY7A 3LOTA 1KRBC 3N29A 3UXDA 2ZRWA 4XSMA 5CBBA 3PNZA 3B03A 4ZBCA 3VOGA 4DJEC 2X40A 1J9YA 1EXBA 3OP2A 3BW2A 1M6JA 1JG9A 2G3IA 1H1ZA 1S2TA 1WOAA 4QNWA 4LB3A 1W54A 3AZRA 1V3HA 1LTDA 2UY2A 3LCLA 4O15A 3GH4A 3DFOA 3FSUA 2HSAA 3WLSA 3MZ2A 4XD5A 2QLYA 1ZGDA 3GIYA 1E15A 2DZWA 3GNRA 4KERA 2PP3A 4FXRA 2J9XA 4MJ2A 4CCEA 4ZE5A 2GJXA 3DIPA 4X3ZA 3H22A 4W5ZA 3ZYZA 1XINA 3UA3A 3CT7A 1B54A 1NJJA 3LLDA 5AHEA 4JHMA 4IQJA 4NRRA 5AC8A 2NX1A 1OBAA 4NZFA 5LA0A 1P7TA 3UCQA 1DWJM 2WV8A 4AD3A 4LVDA 1R3TA 5T9CE 2UV8G 5CLTA 3UJRA 4R27A 1VPYA 1GKQA 3WLRA 2VC7A 3W7OA 1LBLA 4OECA 4XZBA 1PKNA 2HK1A 4GQGA 2L5HA 7CGTA 1RPXA 2GSJA 4UTKA 2NV1A 3GG0A 1EEXA 3ID7A 5HATA 2ZUTA 4QTGA 2XH4A 3K2GA 3QH2A 5CJMA 3W7EA 3TJIA 3S6OA 3BDKA 3N9RA 4UNLA 4MM1A 1NVMA 3E2RA 1QOQA 1I9CB 4HPNA 3M64A 1RJQA 4RLIA 4H8NA 4MZ1A 4CQCA 3B4YA 4LQ1A 4JTTA 4WD0A 1IIHA 4GKLA 3WEZA 3HQOA 5BW6A 3ITVA 1V3IA 4FS9A 4LS0A 1K8ZA 3ARWA 4H7ZA 2QCNA 3M9YA 1XRVA 3S1GA 1F07A 3EOLA 3UU0A 4CGTA 5FA5A 3MT1A 4WY0F 3POHA 1LUCA 1OY0A 4H9YA 3IVSA 5D04C 2O55A 2EPKX 5BZAA 3UERA 1MEWA 4MWAD 3QFEA 4TO8A 1KFCA 1TV5A 3AZTA 2O7SA 1Z44A 1O66A 5LNRA 3GNNA 2OOFA 2QULA 4ZOEA 4RZ5A 1BXNA 1QPQA 3CL8A 3PTDA 6ALDA 2DW6A 1A4LA 3AXHA 1E0UA 3B40A 5EYWA 1MXGA 4JTJA 4MGGA 1DV7A 2FLIA 3FXYA 1ZBWA 4KKXA 1BGAA 1LQAA 5I3KA 1HO1A 3QR3A 1KCKA 3RR4A 3WCZA 4JFSA 4A22A 2QCDA 4WSJA 2HE5A 4B5TA 1QAPA 1JPIA 5HNNA 4CQ8A 3PTMA 4GVIA 3R94A 3WH6A 4O16A 2WNWA 3EX1A 4DBEA 2DZAA 2D2HA 2WSPA 1H0GA 1SZFA 4WDUA 4AIBA 2YGYA 1L9WA 3L9CA 4HMNA 2X1UA 3PK7A 5LGXA 3B4UA 4HK5A 3B0UX 1B57A 1JI1A 1F8MA 2YBTA 3W23A 3WK2A 3IK2A 3O07A 3AYRA 1DXFA 2P53A 2H6RA 3CL6A 4IH3A 2YCKX 2PBGA 4L6OA 3TOYA 4QSHA 3C2EA 2Z7KA 5TD4A 1PWMA 3PPCA 4QQ3A 1UW9A 5EFFA 3W3OA 1JDFA 2PUZA 5LSMA 4FK9A 3I4EA 4A05A 5G2HA 3PM6A 4WK9A 3IIXA 1EA0A 3ABOA 4RKAA 1FCQA 1W1TA 3DN5A 5LYRA 1JUBA 4O1BA 3FJ6A 4WR3A 3ONBA 1FVPA 3QMSA 1UBPC 1W3KA 1AW5A 1Q7MA 3CH9A 3K4WA 1P1XA 4WIWA 5F1VA 4LVBA 3RMJA 3UT0A 3L67A 1LT8A 4AZ6A 1R3WA 1ELSA 3NOEA 1VEPA 2ODOA 4AXNA 3VKCA 2VOTA 2CXEA 5C2CA 4QS6A 3P61A 3BZJA 3GU2A 1EJ7L 3N6QA 3T0BA 3QR0A 2VQUA 4RNHA 4GK8A 4C6EA 2P0OA 4CD7A 2ZA1A 1TV3A 4UUIA 4R34A 3S5YA 1KB3A 1HZYA 4EOUA 1V7AA 4EPBC 3N6JA 5TIMA 2FVKA 1W8GA 3IJQA 4PRRA 1FWBC 4MWAC 4UFJA 1GJWA 1VQTA 2WNNA 2XIMA 2PDNA 4CD8A 3L4VA 5D32A 2CBUA 4GO8A 3PPFA 1T96A 3F03K 2BHYA 3DZ1A 3WLNA 5I3HA 1JQVA 3CC1A 1AMYA 2HE8A 2E9MA 5DANA 3NEVA 3WK3A 4D6HA 3CUXA 1Q6EA 4YYCA 1QATA 1V02E 3BJTA 4QXIA 3UY8A 2DVUA 4DWSC 3P62A 4YIWA 3U2EA 3ABXA 2UY4A 4KT2A 4GMEA 2QW5A 4R7JA 1E6ZA 3W72A 4UTTC 3UGRA 2V69A 1EJUC 4DELA 1RBLA 4C6BA 1GVSA 1J0IA 2OQYA 4S3CA 9XIMA 3C6CA 4N42A 4DWSA 4MWAE 3QY8A 3SCOA 4F4RA 5AC5A 2ZRUA 2IQDA 1TRIA 1ESWA 2GL5A 4UFHA 3LHTA 1H7PA 2GVLA 2R1NA 3SIZA 1OVDA 1TV8A 3BLEA 3DX5A 4PTMA 3S47A 4AEEA 2YCIX 3KOFA 4QAIA 3VFLA 1KM4A 3SCNA 1AK5A 2HISA 1OZMA 5MHBA 1J0ZA 4GRSA 3GR8A 2CBJA 1UD8A 3SCPA 2GFTA 3OG2A 2VO5A 3OGRA 1S2WA 4YVPA 3FA4A 4AVNA 3VILA 5HJLA 1QDSA 4DZHA 4K68A 4XO7A 1TWZA 1PB0A 4MDPA 4KEZA 2PMQA 2O4MA 4KBXA 1HJSA 3VCCA 3M16A 5HWNA 2JBMA 3WQFA 3R0DA 3O1NA 4IJCA 3MUIA 3B8SA 3VIKA 1GQKA 3IV3A 3G1HA 4I90A 4PL2A 1PX4A 1VIZA 3FIGA 3LDVA 3O9NA 4HNUA 4HHHA 2QYGA 5A94A 3T78A 1YLVA 3TC3A 4GWEA 2CLKA 2ZUVA 4NU7A 2XN1A 2V38A 2ZC1A 2Y2WA 5CPLA 3QXBA 3GXFA 3Q65A 4L64A 2YR1A 3P84A 3DCPA 3WMCA 2PURA 2ACSA 3GKAA 5C55A 3LTYA 3O6YX 1A5AA 1UP0A 3K5XA 1AW2A 1ZJHA 3ZT7A 1JZ7A 1Q2RA 3UCCA 3TW6A 4FNQA 3DBPA 1OGSA 1XD0A 4B5XA 3WNKA 2VL4A 3N2TA 1FCVA 4H8VA 5IDIA 2ZRXA 3BARA 3D3FA 1VCVA 3QV7A 3C52A 1H1NA 3F5LA 5JBDA 4UCFA 3GVGA 1V0KA 3FGCA 4ZO9A 5IDZA 3HG4A 4JICA 3QVQA 2DEPA 3SUTA 1ZFJA 3W7PA 3MTWA 2JKEA 3FYYA 4J7RA 1EKOA 1EJSC 5JUVA 1X6NA 2V2CA 2P1FA 2PDIA 4TMCA 1F4HA 3NQVA 1DXEA 3ERPA 3QV9A 4CCDA 5DX7A 5J8LA 1GQJA 4GUJA 2EG6A 4JX5A 3RN6A 1J96A 4HKPA 1RSCA 4GUFA 2UZ9A 4FO4A 3CWNA 3BJFA 1CX9A 4UMBA 3MV01 3FJNA 4C1LA 1UR4A 4QS5A 3M5YA 4B5SA 4GQBA 3OQEA 3ENLA 4UTHA 4AZIA 3FEQA 4OQVA 1VJZA 3CB8A 4X2PA 3W4RA 5AHFA 1UKTA 2CCRA 4LBRA 4DYEA 3CMGA 2XIJA 2CKRA 1VFTA 3W53A 2WKJA 5D09A 5ABFB 4W8BA 4H83A 3KW3A 4S38A 3TZFA 1Q6OA 4UTLA 4QJ1A 2OEJA 3E02A 4F66A 4NAEB 5ABGA 1E6XM 1R5YA 1H62A 2J66A 2PLMA 1X7FA 4NZCA 3F2BA 4LSBA 2WC3A 4PCFA 1PSCA 2BWGA 2SFPA 1CIUA 1AD1A 2P88A 2QJGA 1T5AA 1MW1A 3AOFA 3MP3A 1IEWA 1H1YA 3HGJA 4XBJA 5CPSA 1RQEA 4I9TA 5EMYA 4HA0A 4OV9A 5K9XA 4U2YA 3R79A 3W7MA 3NSNA 4E4FA 3WMBA 4LNCA 3HIJA 2FGBA 3L2LA 3GS6A 3WBEA 4ZCWA 3QPYA 3TSDA 2ABAA 4UOQA 4W84A 1OFEA 1VFLA 3CZJA 1V93A 3B0PA 4ZL1A 5LHFA 2D2GA 1H51A 5CBIA 4S3JA 3A9BA 2ACQA 5H8MA 2J25A 3KM8A 3PBYA 3W24A 4CNPA 3NSXA 4B3LA 4PULA 2GGEA 2VX5A 4W7WA 3HQ1A 7TAAA 3W1NA 4J3SA 4KESA 1R85A 3UVAA 1I0DA 4FF7A 1GONA 5DELA 3FEMA 1TTIA 4IGSA 1XBXA 4CU6A 5I02A 4PUEA 1WUEA 2FYMA 4IUGA 4ZEPA 2OX4A 3O15A 4JKMA 3UZXA 3NOYA 2E4TA 5A6BD 2VDHA 4XUGA 3GBEA 1V0NA 3V1PA 4Z2KA 4IMDA 4PB5A 3SW6A 1G94A 1LQ2A 1J6PA 2QDEA 5BRQA 3SUSA 3TU9A 2IQTA 4H7VA 3W00A 3BGGA 4Q8TA 3QY7A 1RV8A 3MVIA 2Y4SA 1AQMA 3VMNA 3ICJA 1XUUA 3PN8A 5E0KA 1P0EA 4IQEA 5DN1A 3QM3A 5REQB 1XG4A 3TCSA 3LZ5A 4IM4A 3TONA 1I2RA 3O05A 2YA1A 3CAKA 1FH7A 3QQWA 2D2JA 4HZMA 1ONRA 4BS0A 2WPBA 1NARA 4FLRA 1IT7A 3MUAA 3EBVA 2Y70A 1M41A 4AZGA 1KBLA 4GY0A 3EDJA 4MJ4A 3UXLA 3G1FA 1UR8A 2FZDA 2A3EA 4PEEA 1YTKA 1DTNA 1PTAA 1S3HA 4Q8OA 3C4UA 4CQBA 4O0ZA 3ES7A 2G95A 3M41A 1VFOA 4DNMA 1UC4A 3MWAA 4W4QA 3PB0A 3W7RA 1EC8A 1WO2A 4PBEA 3TMLA 4BWLA 4ZXOA 1RVGA 1PO9A 1TVPA 2ZBTA 5M5DA 1GW1A 2GJLA 4PODA 1ZAJA 4LF1A 1BKHA 2E77A 4F9DA 3ZT6A 1ALDA 2ZZ3A 1NFPA 3N04A 2BOGX 4WZHA 1B4EA 1RK5A 2OLHA 2FZNA 2Y7EA 3OZYA 5FJPA 1KWGA 4RDZA 2OYLA 1I2OA 1VCGA 3BH4A 4K1GA 3MU7A 2PBOA 2PWFA 4MNJA 2DZPA 2XZ7A 4YVVA 3C56A 4QCEA 4IT1A 2E7FA 3UWYA 2BNJA 4JHOA 3MY9A 1DXIA 1ZQ5A 4ADUA 2FHFA 1GOOA 3DDMA 3VOIA 5CSYA 1YIXA 5FOOA 1UUMA 2R24A 4LAOA 4TUFA 3W29A 3GNDA 5A6AA 1E70M 2A6NA 1ITQA 3SFKA 5AOUA 3U5UA 1A5KC 3ZVIA 5BYWA 2BLEA 4XD6A 4GVHA 3SUWA 2PDLA 1C8YA 4HZ6A 1C90A 2OMAA 3LBCA 4I7WA 4PR4A 4RPPA 1LYXA 1FCUA 5CSRA 3L4UA 2BX7A 4O1EA 3GAKA 4MY1A 2FZBA 1ZNNA 1J12A 2CHRA 3SCVA 4E4PA 3D6NA 1XPYA 3PJWA 5BCAA 1JYVA 2IPFA 1RJPA 1EL3A 2WJZA 4DPQA 1J2BA 3I3DA 3H2CA 1FBAA 2ZZ6A 4J3TA 1HVQA 1GJUA 2HK0A 4Y8FA 2YXGA 3O0KA 1JULA 2IKJA 5AC4A 2NX9A 4PBGA 2XPKA 1NFBA 3TNBA 3SR7A 2PDMA 3NWRA 1VENA 3AYSA 1XH1A 4G56A 5BU6A 3OZPA 4B5VA 2OX1A 5KINA 3GYCA 4O50A 3TN4A 2Q8XA 4UR9A 2ZCGA 4LUSA 5AKQA 1EIXA 5LNSA 4B16A 5CJNA 1DPMA 1K4HA 3CV7A 4WEVX 3TX9A 4E38A 3C2VA 3N17A 3QFWA 1OB0A 4JS3A 3BLDA 4LWWA 5H1WA 3E0IA 1N55A 2OQLA 5JIWA 1DL3A 1RHCA 2D0HA 1F7BA 1Q66A 1E40A 3VDAA 1OQFA 3HFTA 4L1XA 3LCFA 1BXBA 2EEXA 4G5DA 4WX2A 3BAYA 1BF2A 3W86A 2J7BA 1QBAA 4I7VA 2OGJA 4YMZA 4ML4A 8XIAA<