2Z1SA

Beta-glucosidase b from paenibacillus polymyxa complexed with cellotetraose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords Beta-glucosidase B
total genus 164
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2007-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2z1sA00
1HKMA 1K9TA 3VD5A 5A6AA 2Z1KA 4CN4A 3U7BA 1V03A 1XH0A 5D8WA 6TAAA 4PSPA 1WZMA 2YJQA 2QMJA 5DT7A 3AMKA 1JYXA 3F5KA 3N13A 2YL8A 4WKFA 2X8RA 3CHCA 2UY3A 3MU7A 3QHNA 2GJPA 1V3HA 1DWHM 1WDSA 4ATWA 3VDBA 3SCTA 2XWEA 4URIA 4D1IA 2C7FA 5HDRA 3U57A 3UG3A 4PCSA 4HOXA 1GCYA 2FH8A 1MW3A 1J9YA 4KWUA 2PWGA 2GUYA 3ZJ7A 4U5IA 3RILA 4JKMA 5JBFA 1CENA 4WLCA 2E9BA 3GDBA 1WB0A 3L4VA 3NUKA 1V6XA 1HKKA 2Y2WA 3MUZ1 3VIFA 5DF0A 2J7DA 4MDOA 1RP8A 3MUY1 3VMOA 1ECEA 5E09A 5EFDA 5A8MA 4AMCA 2EEXA 4TTGA 5HBFA 2PWHA 4ATLA 1VBUA 5CPSA 3WIJA 2WNWA 2EPOA 2O9PA 5CPQA 1AQHA 1YQ2A 3CUHA 1XC6A 2CITA 1XH1A 1BFNA 2CXGA 3BMVA 3WNLA 2ZX8A 1C8YA 1PAMA 1HP5A 1Q6GA 4KGLA 1W3HA 2DIEA 3PBGA 4H41A 2YKKA 1CTNA 3JUGA 4HTYA 4OIFA 5LA0A 3DYPA 3MKKA 2X2YA 1UKPA 1LLOA 3OGVA 1UHVA 2YOCA 4JKLA 2WC7A 4RL3A 2D22A 3MV11 3APGA 2PWDA 3AYRA 2ZUVA 3VD3A 5E6ZA 3PZOA 2IXUA 5AC5A 1PBGA 3WNOA 1GQKA 5M5DA 1FOBA 2WWDA 1XCXA 2XVGA 5E70A 8CGTA 3WD2A 4DWSB 4J3WA 1NP2A 1V6UA 4M56A 4IPLA 3AXHA 3PZ9A 3L4TA 1GHRA 1HL8A 4JFSA 4Q22A 1J12A 2PBGA 3WUGA 2WMJA 3WD3A 2CBUA 2D3NA 4AW7A 2WPGA 1TUXA 5I6SA 2VCBA 4CVWA 3PZMA 3PZTA 4W93A 1TZ7A 2J62A 4UR9A 1UKSA 1JZ6A 1GQJA 4UQ9A 1B3ZA 1UR9A 5FL1A 1CGWA 5A6JA 1UWSA 3WEMA 2WZHA 2V3DA 2AOSA 3LPOA 3II1A 4UOJA 1U30A 1QI3A 4MNLA 4M1RA 3HN3A 1KXVA 4JFUA 2VL4A 2WMGA 1ISXA 2A3HA 2JALA 1EOKA 3M7SA 1J0IA 3VGDA 3ZQ9A 3CUJA 3VIJA 3ARRA 4D6CA 4CVUA 1XYFA 1ESWA 5I77A 2D0FA 2OSWA 3EDKA 1V3IA 1D3CA 4EANA 2DH2A 2CKRA 2VX5A 3BLKA 3L2LA 1J01A 1UQYA 4PMVA 3EMQA 3O2LA 2QMKA 2ZXDA 4KRUA 1MXGA 3W0KA 1KCLA 1TE1A 4NSBA 3FN9A 1NOFA 3WQ8A 3ZIZA 4JCMA 5JUVA 1E72M 3ALGA 1Q4NX 3AS2A 3AIBA 1WP6A 3WH8A 5CXPA 4R27A 4M29A 3OLDA 2YBTA 3OLEA 3ZOAA 5A1AA 2G3JA 1UKQA 1FFQA 3CZKA 2DSVA 3PTQA 1WO2A 3VD4A 2WVVB 3NJ3A 5HPCA 5A8NA 1UH2A 4PUEA 3EBVA 3A4WA 1PZ2A 1QBBA 1GQLA 4YN5A 3T0AA 4B3LA 2MANA 5KEZA 4LX4A 3VKKA 1HJSA 3W25A 4AZ5A 3N11A 3TP4A 2JFEX 2GJRA 1E0XA 3PZNA 1EQPA 4JHZA 4AD1A 3KWXA 3FHQA 4HA1A 4AEEA 2YIHA 4HOZA 4GI6A 3T2OA 1EHNA 1UH3A 4P7QA 2EPLX 1HT6A 1WDQA 2ZWZA 1CDGA 3VGFA 5A2CA 3W82A 7CGTA 1ISZA 3AIEA 3VX0A 4P8UA 3M07A 4AISA 3O6AA 5LA2A 2WK2A 1O6IA 5HNNA 2JIWA 2VX4A 1XYZA 4X9YA 2F61A 2PWEA 1FHDA 3QOMA 5BRQA 4W8LA 2YL5A 3FHAA 1NP0A 1H49A 2EO7A 2GK1A 1B3XA 1E55A 1UUQA 1CXIA 1KGWA 2Y8VA 4QCEA 5D9PA 2WCSA 3RM8A 5ABFA 1QNPA 2VZVA 1QI0A 3WENA 4ZE4A 1OSEA 4XZBA 1VFOA 3K8KA 1XH2A 1JZ3A 2WMIB 4JFWA 4AZCB 4F8XA 2OYMA 1X1NA 3CUFA 3N04A 5D4YA 4Q7NA 1K9EA 4HP5A 4J28A 3MMWA 2WVVA 4MB3A 4DM2A 5IHRA 3AHVA 1PX3A 1W1PA 4D6EA 1WE5A 3ARZA 2VR5A 1BGAA 1KWKA 3ALFA 3KEHA 3S2CA 3WH7A 4PMDA 4MNJA 5A2AA 1HKJA 1RPKA 1SFSA 1E5JA 1B90A 1WCGA 1M03A 1CZ1A 1QPKA 2UWFA 3DHUA 2OWXA 1JXKA 3CO4A 5FCZA 2CPUA 3VGEA 1CXLA 4E8CA 1AQMA 1RP9A 4K68A 4QP0A 1HXJA 2ZXAA 1B30A 3AJ7A 1KBKA 3WY1A 2WCGA 1B3YA 3NSXA 3ZJ8A 4W86A 3HU7A 4H8HA 1CECA 5FD0A 3CIVA 1UWUA 4ZXOA 3T2PA 3BMWA 2VI0A 1VEMA 1KXTA 1BTCA 1J0ZA 4D6IA 1H41A 4FK9A 4GKLA 4PMUA 3UG4A 2UY5A 1EDGA 1ZJBA 3PZIA 1D2KA 2J7GA 1CPUA 2V5CA 3GZAA 5BYWA 2WBKA 3CH9A 4NRSA 4CD8A 1CGVA 1VEOA 3SCQA 1V02E 4KRTA 1CGTA 1JDDA 3DC0A 2J47A 4AIUA 3POCA 2DT3A 4AZCA 3MMUA 2UY2A 4HA3A 1W9XA 2NW0A 5A69A 3MSDA 4J3VA 3PTMA 4AZ7A 4B9YA 3UR8A 1I1WA 1LG1A 4UFIA 1E6RA 4YHEA 2YA0A 3T0DA 1C92A 1H3GA 1C7TA 1MW0A 4BZYA 3RO8A 1XD1A 4NF7A 1CLVA 4X0NA 1J0JA 4DWSC 4IUGA 3MMDA 4KMQA 4UQCA 3IK2A 3AYSA 3BCFA 3RIKA 2NSXA 1E4IA 1ITCA 3EDEA 3CMGA 2BXZA 2VZSA 2YL9A 4YPJA 4JFTA 2WSPA 1WNOA 2XHYA 1H0GA 1UD6A 3QHMA 4LGXA 1QNRA 4ACZA 1G9HA 1G1YA 4XX6A 4CKQA 4BQ5A 3A3HA 3AZTA 4M80A 4PMRA 2WKGA 1B9ZA 5BXRA 2XVKA 1CIUA 4PCTA 4Z2IA 3LPGA 2CIPA 1VRXA 1EA9C 1W3KA 3CHDA 5BRPA 4UFMA 3GXIA 2WVSA 2YDQA 3EDJA 1QI2A 2CESA 3CHEA 3UETA 1TA3B 3AMCA 4CCCA 3AI0A 3ZSSA 2J8FA 4J7RA 1E73M 3VD9A 1BSIA 5D8ZA 3OA5A 5CLWA 2DSKA 2G3IA 4CCDA 1UZ4A 4PUDA 3KL5A 2OLHA 1F4AA 1NWRA 5BXPA 1NH6A 4AD5A 2JIEA 2Y5EA 3DHPA 4TTUA 1LL7A 2J7HA 3G6MA 2ZICA 1KGUA 2ZX9A 2XGIA 5KZ6A 2EXOA 4V2XA 1E1FA 4MB1A 2WXDM 2WANA 1V6YA 4AD4A 2FHCA 4W89A 2OSXA 2VRQA 1FA2A 1UWTA 3GYCA 4GXPA 3L4ZA 2WHLA 1R7OA 1WPCA 3WELA 1LWHA 2CNCA 4UQDA 4F66A 1OGSA 3ZR5A 2E0PA 1E6QM 1UA7A 4BS0A 3M6DA 4ACZB 3OGRA 3BAYA 1WDPA 2CHNA 4Z2HA 5EBAA 1EHAA 4PMXA 4W5ZA 1V3LA 4BQ2A 1WDRA 4WKAA 2XFYA 4CD4A 6A3HA 1OWQA 3BC9A 1KB3A 1HX0A 4HPGA 1HP4A 1WZAA 2EQDA 4BQ3A 4P7RA 4EAMA 2A3AA 2XTKA 4U2ZA 4OUEA 4MB5A 2YL6A 3K46A 4D1JA 1SR0A 1LL4A 3D5HA 2D2OA 4CD7A 1E15A 5CGMA 4H8UA 3ZT6A 1UKOA 2WMKA 3W38A 1R85A 3VX1A 1TCMA 1JI2A 2RGLA 4MTVA 3SCRA 1KCKA 2PB1A 1ISYA 3BLPX 3ARVA 5GQBA 4W8AA 5GNXA 3W4RA 1E1EA 1EH9A 3WQWA 1JAKA 3WNKA 2J77A 1GOKA 1HJQA 1P6WA 1GVIA 2C0HA 2EPNA 4TVDA 2J75A 3VU2A 2NT0A 2OYLA 3AIRA 1GONA 1LL6A 2YDSA 3GH7A 2ESCA 3OZPA 2O9OA 4ACYA 5C8BB 1E3XA 3OB8A 1TFVA 4D6HA 4LXFA 1W91A 3CMJA 2WHJA 4W84A 1UKTA 1UH4A 3WF4A 1UD3A 1DP0A 4DWSA 3ARPA 1J0YA 5GPRA 4Z2JA 3MV01 2GSJA 3WFLA 1C90A 1V3KA 4YHGA 1VBRA 2VTFA 2CBIA 2A3EA 3NIYA 4UQEA 4M82A 1JNDA 1BYAA 4AZHA 2OWWA 5DFAA 4J3XA 2OSYA 3WSUA 2VT0A 3VIMA 1W1YA 4WJXA 3SUSA 2E40A 3FY1A 5JIWA 4FLRA 4UCFA 3DYOA 1E70M 1JD9A 5AYIA 4P7OA 4UFKA 1UQZA 1KBBA 1LF1A 2BNJA 2BHZA 1FP8A 1PZ3A 1E6PA 1MQQA 2WHMA 4U2YA 3WD1A 2YLLA 4GIAA 2DT2A 2DT0A 3WDRA 4PTVA 3VIIA 2D1ZA 1BVZA 5E9AA 1E6NA 3BCDA 2W5FA 1B31A 1C8XA 1DWAM 3VIKA 1VENA 1W3JA 1ISWA 4OJYA 1V0NA 4RE4A 2XFRA 4FLQA 1W9DM 4WKHA 1QW9A 4BA0A 1BG4A 1AVAA 4P8WA 2WSKA 3AHZA 2WMHA 1HJUA 5CLTA 1GHSA 3WNNA 3OBAA 2DSUA 2FHBA 2FHFA 1DWGM 2GJXA 3POHA 1XSJA 3T0BA 1EO7A 4TX6A 3VNYA 3WEZA 3GXMA 3WQ4A 1KWGA 5CGTA 1E3ZA 3SUVA 4JAWA 1CGUA 2CHOA 3GM8A 5D9NA 1CNVA 3TA9A 3K1DA 2BY0A 1JFHA 1TR1A 5CQ1A 4GI9A 4H04A 4CN6A 4AD2A 1MQPA 2ZUWA 1JZ4A 2YDRA 3OLIA 3BGAA 4TOQA 1ZL1A 2J8GA 3UESA 3WFZA 2GFTA 4QLJA 3OG2A 2RGMA 1HL9A 1HJVA 5HXMA 3WH6A 3MUAA 4E4PA 2XG9A 4B3KA 3VM7A 1BG9A 2CCRA 1ODZA 4LYQA 1EO5A 1ZS2A 1EQCA 2XSBA 2WZEA 5EMYA 1FP9A 1V08A 5DT5A 5IFTA 3N15A 5M03A 4W85A 4AC1X 3ARQA 3K8MA 1G0CA 1VAHA 4HZ8A 1E6XM 2BV9A 2E9MA 2HISA 5CSYA 1B0IA 3GTNA 2VCCA 1CXFA 5AY7A 3BAIA 2Y4SA 4IPNB 5BXTA 3EDFA 3ZT5A 4GZJA 4EK7A 3CLWA 1XV8A 1GZJA 1U2YA 1X6NA 4U5KA 4XV0A 1X6LA 4ZEPA 1J0KA 1JG9A 5A6BA 2CEQA 3THDA 2E9LA 1OBAA 3CGTA 5M3WA 3AMDA 4FLOA 3BAJA 2W67A 3AHYA 3LPFA 2EJ1A 1J18A 4PMZA 3D3AA 4OBSA 4D6FA 3IANA 3WDQA 2E3ZA 3ARTA 2D23A 3RJYA 1IZKA 1UZ1A 5BROA 5JIPA 4ML4A 4D6JA 1UG6A 2XIBA 3MUIA 4IM4A 4ZE5A 2XFFA 2WMIA 4W8BA 3SCSA 2W91A 1OGBA 4HU8A 1QNOA 4U3CA 5LYRA 1E6SM 3AMGA 1XD0A 2QHAA 3WBEA 1ZB5A 3CZLA 2VURA 3TTSA 1CEOA 1H2JA 2VX6A 1ZJAA 4QFUA 3VDAA 3ZO9A 1K9FA 3WUEA 3SUUA 2ZUMA 1GOQA 1TA3A 2CETA 3N1AA 3AROA 4XB3A 2VMFA 4MNMA 3ZM8A 3WQ5A 1QVBA 1GJUA 1R8LA 3AISA 4Y7EA 3AS0A 4GQRA 1JYWA 1JYNA 1FH9A 3WNMA 1JXJA 3CTTA 1BPLB 1UYQA 2XVLA 3OLGA 3VMNA 4CUCA 5M17A 1K9DA 1GVYA 5IHSA 5CSUA 4A4AA 1JDAA 1VEPA 1ZBWA 3RMEA 3N12A 3NDZA 4JFVA 5D9OA 2WCAA 2VZTA 1PPIA 3FAWA 4E8DA 1JZ8A 1A3HA 4FMVA 2W4XA 4X0VA 3VTRA 4AYSA 1ODUA 2A3CA 1MXDA 2TAAA 5A8PA 3IJ7A 4PEEA 3SURA 2VCAA 3WMCA 1BF2A 1EDQA 4UQAA 1W3LA 4P8VA 2BVDA 5A6MA 1H5VA 3CZJA 2WWCA 1I75A 4CGTA 3KE0A 1HVQA 2X1IA 1MVYA 4GZEA 1BLIA 1GPFA 1DHKA 2JEQA 5EFFA 3VPLA 5CZKA 3ZT7A 4MAVA 4M81A 1OT2A 4A3HA 1XGZA 4QDMA 1UWRA 1JD7A 1L0PA 2VVNA 2GJXB 3AZSA 3CUIA 3AZRA 4HA4A 2XGBA 1V6VA 1HJWA 5I79A 2VO5A 5D9MA 3SCVA 3VIPA 2X0YA 2WMFA 1WKYA 2NT1A 5A6LA 1BGGA 1VFFA 5C71A 2CYGA 1BVNP 5ECUA 2XPKA 3U5UA 5C70A 1W9BM 5E0CA 3VIGA 3VOCA 3QGVA 1C91A 1KXQA 4GPNA 2GK1B 1GW1A 4LQ1A 2EBNA 3W37A 3K8LA 5DMYA 1JZ5A 2OWCA 1EDTA 4J3SA 4MJ2A 4W7WA 3CPUA 4AZIA 4JL1A 4UNIA 2XM1A 4GQQA 4F79A 5I0DA 5I3DA 4L4OA 3NSMA 1JI1A 3F5LA 1NM9A 1XSKA 1R86A 4W7UA 2ZXBA 3BH4A 1B3WA 1V6WA 1Q6CA 3CUGA 5A94A 2CBVA 1EGZA 1MW2A 5I23A 1JGIA 3B9EA 4UZSA 1HIZA 5A2BA 5AC4A 2J7FA 3A6OA 3S6TA 4L4PA 3SCWA 3WN6A 1Q6DA 3A47A 5GNZA 2WC3A 2W66A 2XWDA 4ZENA 2F8QA 2ZX7A 4U33A 4XUYA 3WL0A 1RH9A 4R5EA 1UWIA 2DIJA 1VJSA 4PMOA 1A47A 3SUTA 4ATDA 3MANA 2W63A 4HU0A 3E1F1 1RD6A 2VRJA 1QBAA 4DUVA 1SMDA 2V5DA 5CPTA 1B1YA 1IT0A 1ITXA 2VQTA 1SMAA 3W24A 3KL0A 2ZXQA 4FLSA 3AOFA 2G8ZA 2J79A 2D0GA 5ABGA 5BWFA 3PZGA 2VC9A 1XCWA 1QW8A 1CGXA 2W62A 4HZ6A 2DPEA 3PZQA 2QLYA 2WYSA 4KGJA 2DQXA 3W53A 2Y8KA 3I3BA 3DYMA 3SIMA 3WL1A 1SYTA 4Z2GA 1EXPA 4J3UA 1DWIM 2O9RA 2AAAA 4BF7A 1JZ7A 4Z2KA 5E6YA 4UQBA 1HVXA 3N17A 2PF0A 2BS9A 1W9VA 3QR3A 2FGLA 2WVTA 2X09A 1DEDA 3GXDA 2BY3A 2D3LA 1E56A 3T08A 3OZOA 3VILA 4C7FA 1KFWA 3VUPA 1E40A 4U31A 1W2VA 3SCNA 2O9TA 4NI3A 4PTWA 1H1NA 5ABEA 2X0HA 2YA1A 4MJ4A 3MS8A 3F5JA 3TTYA 3UEQA 1GOOA 3KZSA 2XUCA 3QOKA 1QHOA 4RE2A 4QLLA 4W7VA 1IV8A 2G4FA 3PN8A 3AIQA 4V27A 3EYPA 2VZUA 2FGZA 4JZ5A 1OD0A 4F9JA 1AMYA 2XJ7A 3ECQA 4PYSA 3VGHA 4DUXA 2WB5A 3WDIA 4AD3A 3ZSTA 2ZUUA 1NWUA 3WF3A 2J7BA 2V38A 4DM1A 2ZE0A 3UR7A 2BVYA 1W32A 2VVSA 1JL8A 2DT1A 4U3AA 3K4AA 1QNSA 5A6KA 1W9UA 4LPCA 3IAQA 2WHKA 3T09A 3VIOA 1D7FA 3UCQA 1GOWA 2B31A 2ZX6A 4AIOA 1QI5A 3AMLA 1W1VA 4N0RA 4W5UA 1J11A 3BXWA 1G01A 1UR1A 5LA1A 3SCOA 1DWJM 4BCEA 3WMBA 4DWSD 2W92A 2C8NA 3U5YA 1GOMA 3NYDA 3I3EA 5A3HA 1UD8A 2UY4A 8A3HA 5F7UA 3ARWA 4PTXA 4UFJA 4V28A 1BHGA 4CCEA 3GNPA 2HVMA 2V3FA 4AZ6A 3BAKA 1DTUA 3M46A 4HOWA 1G5AA 4JKKA 4PBGA 4TX8A 1B3VA 5A95A 1JFXA 3NCOA 3TOPA 5I24A 4JIEA 3VDHA 1BYCA 1KR0A 1JF5A 1NARA 1NWSA 1CYGA 1ZU8A 1E5NA 3VINA 4M8UA 1Q6FA 3WBAA 3CHFA 3VIHA 1IZJA 1OIMA 4J3TA 4UZUA 3VGBA 4LYRA 3RM9A 3EMCA 3FNDA 1V3JA 4F9DA 1NOWA 2EPMX 3W6MA 1C8QA 1EOMA 2CERA 1I1XA 3PTKA 2J78A 1DWFM 3AXXA 4MDPA 5I5RA 4RE3A 3CZEA 3VVGA 5EB8A 1MFUA 1VIWA 3VGGA 1CXEA 1C3FA 2WC4A 1US3A 1H11A 2J25A 4GO8A 6CGTA 3VNZA 1UOKA 2BY1A 1JAEA 1QHPA 3AICA 1M01A 3AS1A 4NZCA 4ZFMA 1FH8A 4QAWA 3ZMRA 4TUFA 4CU6A 3AIVA 2G3NA 1K6AA 1Z32X 3MSGA 2GDVA 2XIIA 2IUZA 2YLAA 4CD5A 3QHOA 1E0WA 5FOOA 2E8YA 2VNCA 3VO0A 1ZBCA 2D0HA 3NDYA 5E0FA 4D71A 1JYVA 1Y7VA 2YA2A 1W2PA 3VMPA 4OZOA 1TVPA 3ARYA 4B9ZA 3RJXA 2WKLA 1W9PA 1E0VA 4JL2A 3N18A 7TAAA 2JEPA 5IFPA 3EDDA 5A6BD 1H4PA 3N9KA 4H2CA 3WD0A 4GO9A 1JF6A 3WD4A 2JF7A 3G6LA 5ABFB 4HMCA 4MNKA 5HOSA 2ZUNA 3DECA 1VFMA 1KQYA 3AIUA 3J7HA 1GORA 2D24A 2XVPA 1VJZA 1XRVA 2E4TA 3WDPP 2BHUA 3L4UA 2WM0A 3AXIA 1B2YA 4OOUA 1KXHA 3TTOA 2GDUA 1HKIA 3OGSA 1C7SA 3TTQA 1E4MM 4D72A 4M24A 3LMYA 1FHLA 1UD4A 1BYBA 3L4WA 3AHTA 1BYDA 4OOZA 4LYPA 1E43A 1F4HA 5A8QA 1OINA 2BXYA 1E9LA 1ISVA 1JNEA 4EKJA 1ZBKA 1NOUA 2Z1SA 3RPMA 3L4XA 2VQUA 3U7VA 3WDJA 3WUBA 2XSAA 1UD2A 3WQVA 3I3DA 3O9NA 2V3GA 2ZWYA 4HMEA 2QV4A 5I78A 2WVUA 1C93A 2CBJA 4S3KA 3WH5A 3W81A 3BAWA 1N82A 2X05A 4WSKA 1LG2A 2WAGA 2OYKA 4PRWA 3L4YA 4DUWA 1CXKA 4HPHA 4JCLA 1FH7A 3NSNA 1BAGA 1PX4A 3ARUA 1GJWA 2WLZA 3WF1A 3WH9A 1UR8A 1V0KA 4TVUA 3WEOA 2G41A 4J27A 2JF6A 2ZUTA 1US2A 3WNPA 3ZJ6A 4MADA 3UG5A 4WF7A 3PZVA 4ZXLA 2A3BA 2Y24A 1H0IA 2GVYA 5AYBA 1E4NA 3W28A 3B9AA 4W88A 2VX7A 1PEZA 1EIBA 1JIBA 3KL3A 3RM4A 3W27A 5HPOA 1FFRA 1V0LA 4UFLA 1AQ0A 4TVCA 1YHTA 3GH4A 4H7VA 1VFUA 4GINA 3RDKA 3GH5A 5ABHA 3FAXA 1V02A 2PBOA 2DGAA 4AEFA 4Z2LA 2CKSA 4KH2A 3ZR6A 2QF8A 5CG0A 2VUYA 3AIWA 1CWYA 2BHYA 3CZ8A 4W87A 2O92A 3CZGA 2VJXA 1VB9A 4PN2A 1WAWA 2V3EA 5IDIA 2QPUA 4C7DA 3K4DA 2D20A 1UR4A 2ZUSA 3GBDA 1E71M 3AS3A 4AY1A 4XZWA 4JHOA 2JE8A 3THCA 3W26A 4UTFA 2DH3A 4BQ4A 3T2QA 3WKZA 5BCAA 3AHXA 1OT1A 1XSIA 4MAZA 2F2HA 1OCQA 2QPSA 1CLXA 4H8VA 1NQ6A 1MQRA 5A6SA 4MB4A 4PTMA 2ZOXA 3A4AA 1CBGA 3MO4A 2WLYA 1VF8A 1M53A 3SCPA 3SUWA 7A3HA 1CXHA 2VZOA 3ARSA 3VM5A 5JBDA 2PI6A 5GNYA 1KGXA 4CU8A 4HMDA 4WSJA 3VDCA 3WUFA 4P7LA 1M04A 3GBEA 5BXSA 1UR2A 1OB0A 4S3JA 1MYRA 2EPKX 1PIFA 2DDXA 1UD5A 1CGYA 4OKDA 4P8XA 4AXNA 4D6GA 2J74A 2XVNA 1PX8A 4OBRA 4UOZA 1WZKA 2VRKA 2WZIA 1E6ZA 3GXFA 2DSZA 3HJEA 1MWOA 4B15A 1O7AA 4TXEA 3B8SA 5FL0A 3PHAA 1G94A 5I2UA 1JDCA 1KR1A 1LJYA 1S46A 9CGTA 3PZUA 4AZBA 3ZJKA 1V3MA 4PMNA 1Q6EA 2BVTA 4CN1A 3GNRA 1R7AA 1GQIA 2PC8A 1TG7A 4FF5A 3L2MA 2BY2A 1OD8A 4GI8A 1MW1A 2VR4A 3W29A 1OM0A 1QNQA 1UA3A 1JZ2A 3HMCA 3LPPA 4MPKA 5DO8A 4CU7A 1HN1A 3F4VA 1OGGA 3SEPA 3BSGA 2VOTA 4QLKA 4AZGA 1BQCA 1GUVA 1QOXA 2PWFA 1NWTA 3ARXA 2J4GA 4C7GA 5A8OA 5JBEA 4IISA 3IAPA 2WW5A 4WK9A 3CBWA 5DEZA 4N42A 5TD4A 4UOQA 3WQ6A 1W1TA 3FW6A 3AFBA 2BFGA 2WBGA 1KQZA 5FKYA 4E2OA 3FXYA 4B16A 4D6DA 4NRRA 1WZLA 3RCNA 1UR0A 4QCFA 2G3MA 4AD0A 2FH6A 3UERA 3IJ8A 3TONA 1TVNA 1QI4A 4EE9A 2E8ZA 1J10A 2Q8XA 4A3YA 1UWQA 3WF2A 1LQ0A 1HNYA 2J7EA 3AQUA 1LWJA 1PJ9A 2DSWA 4PSRA 3BAXA 2ZIDA 3WDHA 4P7NA 1GNXA 1M7XA 1PIGA 2AMGA 1V0MA 1XHGA 4AIEA 3BSHA 4WIWA 2IXVA 2FDMA 1U33A 1TMQA 5IXEA 1L8NA 1ZBVA 3B9DA 3WF0A 4CD6A 1HJXA 2W61A 1QHZA 2J7CA 2DEPA 2XM2A 1E4LA 3EMZA 1HF6A 4PMYA 2XYLA 2YBUA 4HZ7A 1H09A 3WMSA 3W6LA 4GZIA 1MFVA 3VD7A 3IJ9A 3A4XA 1GOIA 4AWEA 1OIFA 4PMQA 5FIPA 5CJ5A 1R87A 3SCUA 2ZX5A 3GNOA 4UFHA 3OIHA 1J0HA
chains in the Genus database with same CATH superfamily
3CTLA 1K9TA 3MZ2A 3E96A 5C2CA 3FLUA 2Z1KA 4CN4A 1YNPA 1AA1B 1XH0A 4K1WA 2TSYA 3DUGA 1WZMA 4PSPA 2RFGA 4KEMA 3AMKA 1TTIA 3NL2A 3RLHA 3N2MA 1DIEA 4QDPA 4QJ5B 2UY3A 2G97A 4BF5A 5MKGB 1EGMA 3W1QA 3VDBA 4AAJA 4URIA 3U57A 1I2RA 3TA6A 3NQ2A 5EBUA 4PUMA 4GFIA 3GXNA 5D2TA 3T8LA 2GUYA 4MZYA 4NAFA 3ZJ7A 3RILA 3MBFA 1V5XA 2PURA 2Y6ZA 3PPGA 4WRHA 3A3XA 4JKMA 4FA3A 3W2UA 1AW2A 3GDBA 3FS2A 1HKKA 4S23A 3MUZ1 1WYIA 3UPBA 5KZDA 1AZ1A 4KKXA 3F4DA 5HQMA 2J7DA 3VNMA 3CV7A 3BCJA 4LC8A 2QUNA 1ECEA 4MKSA 2I7GA 5HBFA 1YXDA 1VBUA 3CIWA 3B8VA 1GG1A 5FAJA 5FAGA 3SB0A 1AW1A 1BVWA 4YVXA 5AYYA 2YXXA 3KLKA 4UXDA 1XH1A 2V63A 2CXGA 3BMVA 3WNLA 3CAQA 1VBHA 1W3HA 3UZJA 4HSNA 5FF7A 2ZZ7A 3H55A 3PK7A 2ZVIA 2OT0A 1LLOA 3CWOX 2YOCA 7REQA 1LLZA 3AYRA 2ZUVA 3VD3A 1EJUC 5I3HA 2C14A 3CYVA 4H6KA 5I06A 3UWUA 2J9XA 1PBGA 1GQKA 5M5DA 2WWDA 5AN7A 1L6FA 4F2BA 3G1VA 1V6UA 4M56A 4IG2A 3RCYA 3PZ9A 1M9HA 3L4TA 4TIMA 2ZZ2A 4JFSA 4Q22A 1J12A 3TE9A 3BOFA 1AL7A 1UP0A 2BB0A 3ANVA 3M5XA 3PZTA 2J62A 3N2XA 1UKSA 1PWLA 5AVNA 3W1RA 1CGWA 5A6JA 1UWSA 1A5MC 4L1XA 3P3BA 1OZQA 1QI3A 3DX5A 4FALA 4UBPC 3HN3A 3H2EA 2AQWA 4Y9AA 1KXVA 3HM7A 1H5YA 2WMGA 5LIYX 3M7SA 1EOKA 4KEZA 1J0IA 1JDEA 3VGDA 1TWZA 3CUJA 3EA1A 4A3UA 4GUGA 3PG8A 1VBGA 4N9DA 4Z42C 3NAVA 3P74A 3DC8A 4IQJA 3IJLA 2DZSA 4QE5A 1DJHA 4CVUA 1XYFA 4LRSA 5CCZA 3M0MA 3PUDA 4EOUA 5AHMA 2V6AA 4EANA 4PFHA 4MPQA 1SFJA 4F48A 3O2LA 4KRUA 2BGSA 2FZDA 1TE1A 3W6YA 1G69A 4RW3A 3ZFHA 4JCMA 5JUVA 2J6VA 1E72M 3CEPA 3N19B 3WYZA 1JPMA 3AS2A 4L5ZA 1RALA 1OC7A 3ITCA 2YBTA 4M6UA 1S5VA 4ZL1A 4I5RA 1TTQA 1WDWA 1FXQA 3R79A 2HK1A 1W1A1 1VCGA 5F2LA 2NXHA 4FHAA 7ODCA 3ZXWA 1OFAA 3FKRA 1QPOA 2Q09A 3GYEA 3NJ3A 2OZTA 1UH2A 4NNAA 4PUEA 2Z1XA 3KM8A 1ML1A 4DAFA 1QBBA 3MHFA 4AZ5A 2ICSA 4HNCA 4YWSA 3THQA 3E2SA 3KWXA 2SFPA 3DFOA 3PAOA 4GI6A 3MYOA 3TKFA 5A2CA 2EPLX 2ZWZA 4G1NA 7CGTA 1ISZA 3AIEA 3M07A 4AISA 1H61A 2QJIA 5LA2A 2WK2A 4US5D 4TO8A 3PPHA 2VX4A 1XYZA 2F61A 1FHDA 5BRQA 1RVKA 4W8LA 1MZHA 3VOGA 2GVLA 3UZZA 1FDZA 5AC8A 1CB7B 1H49A 2GK1A 1B3XA 3VOHA 4A21A 2VR2A 1UUQA 1VYPX 2Y8VA 4GK8A 1HO4A 1NELA 2WCSA 3RM8A 2VZVA 1KD0A 4ZE4A 2ZZ6A 1ZY9A 4YJ5A 3TR2A 1SO3A 3UWWA 3PPFA 2V5LA 4PZVA 4IFRA 1X1NA 4Q7NA 4JNMA 4JQAA 2XINA 4C6DA 4HP5A 3MMWA 4FXRA 2O55A 2XIJA 4X60A 4NZ3A 4GGHA 3WH7A 1V77A 4JN6A 3GO2A 1QPKA 4I3GA 5AKQA 4JTSA 2ZA1A 3R5EA 2HXTA 1F7BA 5FCZA 3EKGA 1EC7A 2CPUA 3VGEA 3NFUA 4NIRA 3FDKA 4KFNA 3LXAA 3UW6A 3AJ7A 4TU1A 3KFTA 2WCGA 1B3YA 5GJPA 1AK5A 1CECA 2ONEA 4ZXOA 3HIJA 1XLEA 1RY0A 4QG9A 3G24A 3UG4A 2DV0A 4C1NA 3AXMA 1TYGA 3UBPC 2WBKA 2OVLA 3CH9A 4XTIA 2OJPA 4KWSA 5CKSA 4YTTA 4NRSA 4E4UA 3KTCA 2PF8A 1LT7A 2PDIA 3S1WA 5HAOA 5LSMA 4AIUA 3POCA 4HA3A 1Q66A 2WPBA 3MSDA 3OTRA 4G1KA 3W7CA 3IIXA 1LG1A 3S5SA 1TPVA 4YHEA 5HNRA 1C92A 3C2VA 4NYUA 4LY8A 3K2GA 4Z0SA 1Q85A 2NVDA 3MA8A 3NL6A 4OTKA 1XWYA 2RH9A 4YTSA 4IUGA 5CJNA 4EF8A 4ICCX 3OQ8A 4S3GA 4JFTA 3WBWA 4LGXA 2KZHA 1JPDX 3PUGA 4QROA 3CH0A 4M80A 2WKGA 5CBBA 1CIUA 4PCTA 5TBOA 2CIPA 3QGAC 4HK5A 4ML9A 3GXIA 2YDQA 1QI2A 3HJZA 2G96A 3NZQA 3ZSSA 1P43A 5KMYA 5C2GA 4NAEA 5D8ZA 3GVRA 3KBJA 3N4AA 5CLWA 1UZ4A 4KCWA 2PEVA 4K8HA 2OLHA 1J2WA 3GVGA 1F4AA 3R58A 3UJSA 3NQEA 3GNDA 3T78A 3QC3A 3QH2A 2ZICA 3TZNA 4ZO7A 2Q3OA 1P7TB 2EXOA 2ISWA 4V2XA 1E1FA 2WXDM 4GYPA 1LT8A 2ZRWA 2VRQA 1DORA 4WVXA 2WHLA 2YXGA 4GJIA 5LNSA 4UQDA 4F66A 3BQ5A 1I2QA 1O1ZA 2DUZA 3OGRA 4G2DA 4BI6A 3BAYA 4CLMA 5EBAA 2BOGX 1O66A 1EHAA 5D37A 4AU0A 1FKWA 1TPC1 2AL2B 4ZVJA 1KRCC 2NSOA 4BQ2A 3EA3A 1WDRA 1JUKA 4WKAA 3OP2A 4AX6A 1W1IE 2VHLA 3BLOA 5H2ZA 3S42A 4BK9A 1S3TC 1WZAA 2EQDA 5IBXA 3P0XA 2VD8A 3MQTA 1BWLA 4B5SA 4W9TA 3D5HA 1W37A 4DO7A 2D2OA 3S5YA 1E15A 4W4QA 1M3UA 3SY5A 4DY1A 3VX1A 5T91A 2PPGA 1KCKA 1R2RA 3WQEA 3N25A 1ISYA 4NJHA 5FJRA 2FFCA 5LXEA 1NFGA 1EH9A 1VFTA 3MBDA 2HEJA 3PWGA 3WQWA 1JAKA 5C9XA 2H90A 4TVDA 3ANYA 2Z2BA 3LSCA 2TYSA 2A6NA 5HK4A 3KS6A 3SECA 3LDVA 3EWYA 3CUZA 1TFVA 3IRSA 3R43A 1KNWA 4LS1A 5I07A 4R88A 4RV3A 1UD3A 4ZMGA 3APTA 1TV5A 5BZAA 1J0YA 5DQPA 3T8QA 1V6TA 1V3KA 1VBRA 1RVGA 1A5CA 3B8TA 4UQEA 1BYAA 3VFCA 4NHVA 5DFAA 4IZGA 2OSYA 3BLLA 4J3XA 3STGA 3UD6A 1EC9A 1OF6A 4H01A 1W1YA 3KRZA 4FAMA 2P8CA 5J8LA 4MOZA 1KBBA 2YB1A 4PODA 4A2SA 3CS2A 1X8CA 3KHDA 1ZAHA 3KRBA 4GYPC 4U2YA 2YLLA 5F2GA 3TAKA 3WDRA 3P5YA 4PTVA 3B0VC 3VIIA 2D1ZA 4O11A 1GKPA 4UMAA 3WLIA 3H8AA 1SO5A 1TRDA 1KLZA 1F9CA 1TV2A 1X8FA 1E6NA 4QTGA 3R12A 2EHHA 4I8YA 3MVIA 3KOYA 3R25A 1JPKA 1W9DM 4WKHA 3E9AA 3DGRA 5HWMA 1PE1A 1AVAA 1L6GA 3T55A 1RHCA 1UP2A 2WMHA 1HJUA 1GOXA 3IUIA 5L6UA 2OQHA 1OFOA 2I9EA 2DSUA 3IK4A 3EOUA 4WZHA 3DZ1A 3KOWA 4UB9A 5H8MA 3T0BA 5AFDA 1NAL1 5D2YA 2NV1A 1F07A 4DBWA 2QZRA 2VUNA 3GXMA 3CB3A 1CGUA 2CHOA 4O1FA 5D9NA 1CNVA 3TC3A 3TA9A 3GHSA 1IXOA 3SQMA 1MMFA 1Q6QA 2ZUWA 4FX6M 2YDRA 3W1PA 3OLIA 4UTKA 2HTMA 2I5IA 4BEQA 3LX9A 3U4FA 2GFTA 3Q4DA 2AL2A 2PRMA 1KM1A 1HJVA 2B81A 3C0QA 4GY1A 2OZ3A 2XG9A 1FQ0A 3VKCA 2VEFA 3OBEA 2CCRA 3BDKA 3BG9A 5F2MA 3S2NA 1V08A 2V5KA 3N15A 5M03A 5K9DA 3HPXA 1E6XM 2OT1A 1FUYA 2BV9A 2E9MA 2HISA 3SR7A 2PS2A 5CSYA 1YDYA 7REQB 1KFKA 1CXFA 3MYPA 4NX5A 2OCZA 4ASTA 5AY7A 3BAIA 3LYEA 3V36A 5BXTA 3RLUA 3AALA 3TTEA 3VOIA 3WBXA 1C9WA 1VP5A 1PKMA 3M7WA 3VC6A 5DCBA 4P61A 3W1MA 4U5KA 4NKCA 4HJFA 5U7SA 3DHFA 1IEVA 2CEQA 1OBAA 1OX4B 4S3CA 1RJQA 3BAJA 3S2JA 5JU6A 2X40A 5J5DA 2H6RA 1ICPA 3D3AA 4OBSA 2PLKA 4D6FA 3IANA 1Q6RA 4ZR8A 3PTDA 2J8TA 1IZKA 4GUHA 4LC6A 4GI4A 2GVGA 1F8MA 2NLYA 1MNZA 3BZGA 2YW3A 3EX6A 3FVMA 3MUIA 3KTSA 4ZE5A 3DG3A 2Y0FA 1F2JA 3UVIA 4EXBA 1A5BA 5KZEA 3NVTA 3F2DA 4R7JA 1OGBA 2ON3A 3R0DA 4U3CA 2V69A 2INZA 3IVTA 3QQ1A 5HMSA 2QHAA 1W5QA 3OVQA 4FEZA 1LTDA 1JDFA 1ZB5A 3CZLA 2VURA 4IGHA 1CEOA 1KBIA 4O14A 3WUEA 2YR1A 4GOAA 4HYWA 3SUUA 2ZUMA 1EJSC 2J9YA 3U0HA 3N1AA 3W2KA 1WKDA 1QVBA 3AISA 3AS0A 1JYWA 1JYNA 1FH9A 4GNVA 2P88A 1REQA 2Z1BA 1E51A 1BPLB 4L9XA 3OLGA 4ENLA 4Z1YA 2GQAA 3CWHA 1KTBA 5M17A 1K9DA 5CSUA 4A4AA 1PZ0A 3IEBA 3B97A 2DZAA 3N12A 1WXYA 4JFVA 1ADSA 4E8DA 4QNWA 2W79A 1A3HA 4AYSA 3TROA 3WJYA 4JQ1A 1MXDA 1TPFA 2TAAA 3GVQA 3IJ7A 4JS3A 3BV7A 3ABXA 3P6LA 1BF2A 4N6EA 1RJRA 1KM5A 1W3LA 5TF0A 3CZJA 1R46A 4HK6A 3P0WA 4JTFA 4RUBA 1I75A 1PVNA 1GW9A 1MVYA 1BLIA 3NZGA 1X1ZA 3M41A 4XO6A 4IIGA 3IS4A 4F2UA 4A3HA 1OT2A 1SZRA 1XGZA 2C15A 5JH2A 1XBYA 3QR0A 3AZSA 3PBVA 1LOSA 2I1OA 2XGBA 1V6VA 2Z1WA 5U4NA 2QCMA 1OF8A 2OLAA 1WKYA 1DJGA 3H2MA 4LUIA 2CYGA 2XPKA 1J96A 5C70A 1DHPA 4O1CA 1EPXA 1Z69A 1C91A 3O6YX 4AMAA 4IFOA 2A6LA 3K8LA 3GC5A 5DMYA 1EDTA 3JW7A 2FKPA 4JYDA 3CPUA 4AZIA 2GL5A 4JL1A 4UNIA 2FFIA 1L8PA 3RX3A 2P0IA 4I6KA 3NSMA 2HJPA 1XSKA 2R9RA 1R86A 4AWSA 3DU0A 3AUOA 1XLKA 4ICNA 5HNTA 4LALA 1Q6CA 3P80A 4IPPA 2GWGA 1RA5A 2EG8A 1EGZA 2YZRA 5I23A 3TMQA 5AC4A 3KVKA 2J7FA 2RAGA 4L4PA 4JQ2A 2BVWA 5F2IA 4JBRA 1POKA 2W66A 3PWAA 4WGXA 4ONVA 3B4UA 3SM0A 4JOMA 3MY9A 4GY0A 5D05A 3UJEA 4LCSA 4J2PA 3LCIA 1UBSA 4HU0A 4LV4A 1RD6A 2VRJA 1IT0A 1T5AA 4HNVA 3KL0A 3FIGA 2ZXQA 3C3NA 2IPWA 3SY8A 3UZ5A 5C9UA 1VFSA 4HZ6A 1L9WA 2PE4A 3VZXA 2QLYA 3CV6A 1EIXA 3TXZA 2AAAA 5BU9A 3H2FA 1UJPA 3D3FA 5E6YA 2CLEA 1H50A 2QJNA 4G9PA 1W9VA 3QR3A 3W1AA 5CPLA 3GXDA 2BY3A 3BICA 2Z7KA 3OZOA 2ABBA 4C7FA 3HQNA 4QJ1A 4U31A 3VUPA 4CNNA 4C90A 4PULA 3SCNA 4PTWA 2H8XA 1H1NA 3WBYA 4C6FA 4RCXA 2ZZ5A 3UEQA 4DJDC 3KZSA 3S4TA 1LOLA 2DFAA 4K37A 2Q02A 2G4FA 3NXFA 4MWAD 3BGGA 4C1LA 2VZUA 5CBJA 1FVPA 5FJTA 3IJ6A 3VGHA 3N2TA 1T0OA 4XSLA 2OO0A 3ZSTA 4MY1A 3WLRA 2ACSA 2FZNA 2V38A 2PD5A 4I6VA 1PL9A 1EEPA 4U3AA 2QNEA 3P61A 1R47A 2WHKA 5DELA 4DIAA 1F3EA 3C8NA 4IUOA 4LAOA 2X7VA 1FTXA 1DWJM 3WK2A 3JR2A 3NYDA 3N3TA 5F7UA 2QKFA 3ARWA 5C7HA 4PTXA 3OQEA 3NO5A 4UFJA 4V28A 4IGMA 4HHHA 3GNPA 2W0UA 2V3FA 4AZ6A 3BAKA 4O57A 1P6CA 4QAIA 3M16A 3TK7A 1EBHA 1B3VA 5A95A 3ITGA 4AQLA 4F2TA 3TOPA 1I2NA 2R94A 3OG3A 5I24A 4JIEA 3I68A 4FOJA 4LCRA 1XLJA 1CYGA 3SJNA 3ITVA 1XYAA 3LOTA 4OVXA 3HGJA 4M8UA 3MJYA 5XIAA 1VRDA 1OIMA 4Q8PA 4J3TA 6TIMA 1T8XA 3VGBA 3RM9A 3KW3A 3LBMA 4LNYA 2DZXA 3IIPA 1QWGA 1VPXA 1KW1A 1XIDA 4BJHA 3TQPA 4IWWA 1EOMA 1I2OA 5K3VA 3H23A 2J78A 3L0NA 3EA2A 2JK2A 4GH3A 4MDPA 5I5RA 4RE3A 3A9BA 5EB8A 1EGVA 1C3FA 3TYBA 4AHOA 3UP8A 1J79A 4PTNA 3E2VA 3VNZA 3N4EA 2R1MA 1IWPA 4NZCA 3C56A 2NXGA 1RCXB 3C0SA 4EXAA 1P0NA 2Y61A 2IUZA 2YLAA 4DXXA 2BP1A 1LRTA 3PFRA 2C71A 1H7OA 1NIUA 1E0WA 3OZYA 1FX6A 5HJXA 3VNIA 1QATA 1HW6A 3WLMA 1DQXA 3VO0A 2D0HA 1RSCA 4KWVA 4D71A 5F4WA 4DZ5A 1Y7VA 2YA2A 1W2PA 3VMPA 3A3WA 4OZOA 1TVPA 3HOJA 1W9PA 3LCFA 5CC5A 2WJZA 3NO1A 3B4YA 2JEPA 4YWIA 3WD0A 3B8DA 1KTNA 2PTWA 2ZQ0A 5ABFB 3Q2DA 1THFD 3LQLA 4HMCA 4MNKA 3FYOA 2ZUNA 2H8ZA 3N6JA 4F0MA 3NNTA 3AIUA 3J7HA 1K6WA 1XFCA 2ZDSA 3IV3A 4L9YA 4ICMA 1Z48A 4LAKA 2PWUA 5E1QA 2F6XA 1B2YA 1XLDA 1KXHA 4G8TA 1HKIA 4D72A 5DCEA 4OWGA 1E0UA 4PH6A 3S0CA 3NPWA 1JVNA 4IIDA 2ABAA 4G7EB 1BYBA 3EXTA 3L4WA 3GB6A 2P3EA 1D3GA 4LYPA 1E43A 4NASA 3UNTA 2BXYA 1JNEA 3TW9A 4C6LA 3I7SA 1NOUA 3RPMA 4DQWA 3LZ5A 3KCOA 1QOQA 3KCLA 4AHPA 4O12A 4N7QA 1EEXA 1Z7AA 2V3GA 3A13A 1H1ZA 4XZIA 5C55A 3GIQA 1C93A 1N82A 1LG2A 3T44A 1QMLA 3CM4A 4JTEA 1XICA 8RUCA 4DUWA 4HPHA 4JCLA 3W72A 1BAGA 3AXKA 3WF1A 1UR8A 1V0KA 1A3WA 1JUEA 4TVUA 3WEOA 2RJGA 3DERA 4Y9MA 4XSMA 2G41A 1WXJA 1US2A 2OKOA 4QS5A 1AQFA 3JRKA 4ZXLA 1H0IA 2KX9A 2GVYA 3WLTA 1PXGA 3LEPA 2BG5A 5K9CA 3NQBA 3KL3A 3TDFA 4GQGA 5HPOA 1DKWA 3MCOA 1VQTA 2HNEA 2DVXA 4TVCA 4OECA 4H7VA 4FXJA 2GJLA 5HJYA 3GH5A 1UUMA 3TYAA 3M0XA 4AEFA 1JCMP 3ZR6A 4G5DA 1T8QA 2PTXA 2QF8A 1PDYA 2VUYA 1IZCA 1V7YA 3TCSA 5HMFA 4C91A 3K5XA 1SJBA 1SFTA 4W87A 3CZ8A 3NA8A 4B4HA 4GIYA 3LHWA 2VJXA 1BF6A 4ZO9A 2V3EA 3ZLFA 4BEUA 4GNJA 2XZ9A 3WLJA 1E71M 1PTDA 3TH6A 2DZVA 4QQUA 1ZJIA 2JBMA 3IPWA 3GSMA 1EJXC 1UPMB 5EMJA 2FMOA 1O1HA 3TV8A 1OCQA 1KCZA 1D8WA 2OODA 1S5MA 1NQ6A 4IFKB 4N6FA 2ISDA 1BKSA 4WY0A 3LG3A 5TIMA 2VZOA 4B2DD 1AW5A 2EF9A 5GNYA 3LV5A 3SIZA 2PDYA 3DH7A 3ITTA 4HMDA 3TN5A 4L4MA 1M04A 4E3TA 1OHLA 3GBEA 2VOMA 4S3JA 2DUXA 2QDGA 4IX2A 2VEGA 1CGYA 3QV7A 4OKDA 2BASA 4L1WA 2J74A 2XVNA 2YW4A 4O4VA 2WZTA 3LRLA 3HJEA 3LBCA 4TXEA 3B8SA 2Z1VA 4LS2A 1A5LC 3U6WA 4AIBA 3PHAA 1G94A 5I2UA 1JDCA 1LJYA 4AZBA 3A24A 2XU2A 3EEZA 1R7AA 3O05A 3L2MA 1MW1A 3MCMA 3EEGA 2YCKX 1DIKA 3QGKC 3HMCA 2VENA 4XIMA 4DI8A 4LRTA 1KM2A 3RLVA 3BPWA 3BL3A 1S38A 2VOTA 4HN8A 3ZLHA 1QOXA 3LXCA 4JICA 1NWTA 4UTJA 3LNPA 4C7GA 4K2SA 5A8OA 3PJXA 4RLIA 3DN5A 3QN3A 5JBEA 2PDGA 1YPFA 5TQLA 1VIZA 5DEZA 1GVFA 1W1TA 3OJGA 3AFBA 1FCUA 2WBGA 5FF0A 1OJXA 4XBKA 4E2OA 3GDMA 1WZLA 4LBUA 3RCNA 1JPIA 4QJ3B 1PO9A 3IJ8A 4RPPA 1TVNA 3GW3A 4UTMA 4CNTA 1R3WA 4LUJA 3AQUA 4S2CA 2PUZA 4PSRA 1OFRA 2ZIDA 4P7NA 1M7XA 1JRBA 1J6PA 4WIWA 2IXVA 4LAZA 4PMJA 2A4AA 3T7VA 4RK8A 5HR6A 1U33A 4ZO6A 1TMQA 4N02A 2NV9A 1L8NA 3WF0A 3FGCB 1BQGA 1HJXA 2QJGA 1J5TA 2YBUA 4ZBCA 8XIAA 4XZLX 3W6LA 4GZIA 1NFPA 1GTEA 1M68A 3TC7A 4JQ4A 1OIFA 1KRAC 1IWBA 2OQYA 4WJEA 1ME7A 2PTYA 2W27A 3CXOA 4UFHA 1Q6LA 3OIHA 3NQFA 1S2AA 3MMTA 3MVTA 3OYXA 1HKMA 3LERA 5A6AA 3U7BA 3C52A 1V03A 6TAAA 4GIRA 4YTRA 3N13A 1R2SA 2YL8A 4Q32A 3ABZA 2IQ0A 3MU7A 2XSXA 4ATWA 3SCTA 3W75A 2C13A 1TJ0A 4D1IA 5HDRA 3WJWA 1WX0A 4FNUA 1HO1A 4PCSA 2FH8A 2YPIA 1ZHAA 3O16A 4KCVA 4U5IA 3WZ0E 4KFPA 4PE8A 3KOXA 4LB3A 3LHUA 3GE7A 2E9BA 3NQAA 4S2BA 3L4VA 1OC5A 3NUKA 5LIKX 3AU2A 4IL0A 3TFXA 4JIIX 5DF0A 3NPUA 1OFEA 1EA0A 3B9OA 4HPJA 4MDOA 1RP8A 4QM1A 3VMOA 2OXNA 2QEZA 5EFDA 3NZRA 3OHIA 2EEXA 3B8UA 2EPOA 4JDYA 3RCMA 1R2TA 2O9PA 4HMNA 3M5VA 3A22A 2CLLA 4HJWA 3FJLA 3N34A 1BFNA 5CPNA 3S9ZA 4XWUA 2ZX8A 1PAMA 1HP5A 3LTPA 1IEQA 2VFFA 4H41A 4HTYA 1JCYA 4E3VA 3QY7A 5LA0A 4HSHA 3DYPA 1S5NA 1UKPA 3OGVA 1UHVA 2NXIA 4JKLA 2WC7A 4RL3A 1I45A 2PTDA 1TWIA 3MV11 4IP5A 1FY6A 5AC5A 3GY1A 4ROPA 4OU1A 4MUPA 4NZ4A 3UA3A 3WNOA 3CV1A 1FOBA 1F8IA 2DW7A 2CZDA 4J3WA 1ICSA 2D2GA 1NFBA 3AXHA 5K4ZA 4LBRA 3B04A 4ZO8A 2RHGA 2REQA 3QR1A 1XFBA 2CBUA 4QJ4B 4AW7A 2WPGA 4H4IA 3O0FA 3UXAA 1JCJA 5KZMA 1TZ7A 1JZ6A 5I3KA 4UQ9A 2E68A 1Y5VA 1ZGDA 5KETA 2WZHA 3LPOA 4ADUA 2HROA 3P5ZA 1TV3A 4JFUA 3OHMB 2YCLA 4FIQA 4JTIA 3MDUA 3W9ZA 3DDMA 4UMBA 4DF0A 4JQ3A 3U48A 1Q7MA 2DJXA 3SSJA 1A49A 2D0FA 4LUSB 1PV8A 3CT7A 4O15A 3NURA 3BG5A 4A35A 2DH2A 3BLKA 3VCRA 4RNIA 3NM3A 4PMVA 4C6JA 3LTYA 3EMQA 3CAWA 3MUXA 4O16A 1TJPA 1MXGA 3QZEA 4PL2A 3PS7A 1QTWA 1REQB 1V7AA 4GVIA 3WH8A 1WP6A 4MG4A 4M29A 3U2CA 3UJFA 3LCHA 2OZ0A 5A1AA 3CASA 4GJJA 2G3JA 4XVEA 2ZZ4A 1UKQA 2X41A 5CZSA 3FEMA 3W07A 3L67A 2DSVA 2WNNA 3P84A 3W23A 1GYMA 5E9XA 4RV8A 3VD4A 1GVSA 4KS0A 3EBVA 4Z08A 2Z2UA 3GKAA 3UXKA 3EWZA 4HNTA 1PZ2A 1GQLA 1K4HA 3PFMA 2MANA 3U2ZA 4NI8A 5KEZA 3CT2A 3DKLA 1HJSA 4IMCA 3T42A 3TP4A 2JFEX 2X1UA 3GQYA 1ZLPA 4JHZA 4AD1A 1Y65A 3QLDA 4AUBA 3FHQA 2DZWA 4AEEA 4PFMA 2Z6JA 4JTKA 1HT6A 1WDQA 1CDGA 1M5WA 4MMWA 4QHRA 3SN1A 2B0MA 1TIMA 4L7ZA 1O6IA 2VD9A 4RDWA 4EPBC 1LZOA 3COTA 2YL5A 3FHAA 3HTWA 1N55A 1NP0A 2C1GA 1GK8A 2V81A 1E55A 1Q3NA 1CXIA 4Q8TA 2Q8LA 3GXTA 4MY8A 4GUJA 3K8KA 3NGFA 3U3HA 3H24A 1Q2SA 1XH2A 3UYIA 4MSSA 2CZEA 3PB0A 3N04A 5D4YA 5H8PA 5C9WA 1K8YA 3ZYZA 2ATSA 1K9EA 3CK5A 4OGZA 2WVVA 2JGYA 4DM2A 1KV8A 4KBXA 4D6EA 1SW7A 3ARZA 1XBXA 3S2CA 3DFYA 4PMDA 3VAVA 4MNJA 4EPDC 4IHCA 1SFSA 2INEA 1E5JA 1B90A 1WCGA 3IV8A 1M03A 3W3OA 3S2LA 2DU2A 2HXUA 1TWSA 1QR7A 1FDYA 1CXLA 3W70A 4E8CA 3KVJA 1RP9A 5REQB 1V51A 3MWCA 2ZXAA 1B30A 1QAPA 4ZQRA 5J04A 3HU7A 4X2PA 1UWUA 1XS2A 2VI0A 1VEMA 2PDWA 5HINA 1BTCA 1XL9A 4FNQA 1H41A 4PMUA 2PDXA 3H4XA 3QJAA 2UY5A 2NQZA 3G2GA 1IYXA 2IMRA 4I9MA 3O6DA 1J6OA 2XH7A 1DVJA 1I0BA 3I65A 1G6CA 3KTXA 2CC0A 1V02E 3PY2A 1JDDA 3LI0A 4L6OA 3ES7A 3FJNA 1F6PA 4K8EA 1W9XA 2NW0A 5A69A 4CEUC 4AZ7A 1JQVA 4QISA 4E5TA 1DQWA 4UFIA 3TQVA 1TPUA 1E6RA 3GD6A 3T0DA 1XXXA 3MHUA 4L6HA 4REQA 3EWUA 3WK3A 3K1GA 3RHGA 4PB4A 5C5YA 3C3UA 5IM51 4L61A 1ZRQA 4JHMA 3IK2A 3IGHX 1R3VA 3RIKA 4Y90A 1ITCA 1GG0A 3QC0A 3CMGA 3NQCA 2YL9A 4YPJA 1US0A 1WNOA 2XHYA 4GVGA 3S1UA 3WLKX 3QHMA 4O18A 4ACZA 3LTSA 4CKQA 4BQ5A 4DZAA 2GUBA 1B9ZA 1U83A 5BXRA 4Z2IA 2OGJA 3EOOA 3LPGA 1R6WA 3E02A 2JKAA 1NVMA 2OLSA 3CHDA 5BRPA 3UETA 3CHEA 3AMCA 1TPEA 1A4LA 1V8EA 4J7RA 2GDQA 4E2VA 3VD9A 4R34A 4PL1A 3G1AA 2E5DA 2DSKA 2OPJA 4CCDA 3N6QA 4PUDA 1OG6A 3BK0A 5BXPA 1LBFA 3LCLA 3DHPA 1Q7QA 3CL7A 3FA5A 1KBLA 4KCTA 5TNVA 2XGIA 5KZ6A 3JS3A 3M5YA 3H4WA 2FZ8A 3P93A 3LD5A 3IGUA 1YNQA 4AD4A 3W7RA 1FA2A 4GXPA 1R7OA 1WPCA 3WELA 4YU1A 2FYMA 3KWSA 3PVFA 1E6QM 4BS0A 4LUTB 2VYOA 4KQNA 4H8NA 4P5UA 4LBSA 1EB3A 5GJMA 1WDPA 2CHNA 4J1OA 3MW7A 3R1ZA 1XIHA 1FWJC 2IPFA 4D8ZA 4MYXA 2NVCA 3I10A 1U1JA 1MZRA 2VC6A 2KAUC 2PSNA 2GSEA 3BC9A 1KB3A 1HX0A 5MF5A 3EOEA 4BQ3A 4YYCA 2A3AA 2XTKA 3STFA 4OUEA 3S46A 1VPYA 5LZLA 1SR0A 2C0AA 1XGDA 5C2XA 4DF1A 4RDVA 3W1UA 1UKOA 2OFJA 4EF9A 5MHBA 3L5AA 3EKLA 1R85A 3QVQA 3GXPA 1AD4A 2R1LA 3C2FA 3FJ4A 5D30A 3SCRA 5HWJA 3BLPX 3EGJA 4CNOA 4W8AA 3ATYA 2BLEA 3EB2A 2NUXA 5GNXA 3SZ8A 2VDHA 4DJED 1E1EA 2I14A 1MXSA 1XF0A 2BX7A 4LJ3A 4US6A 2J75A 4LWWA 2OYLA 1GONA 1LL6A 5I09A 3NZ1A 3OZPA 5J5RA 2C1IA 3LGDA 3DBNA 4PTDA 2OGYA 4V33A 3OB8A 4Z1DA 4FX7A 4OV9A 4D6HA 4LV9A 4KIRA 4RZ5A 4W84A 3WLHA 4C5ZA 3FYYA 2PDHA 2HNHA 1XYCA 3WF4A 4FP1A 1DP0A 2X1SA 4DWSA 1TELA 2XISA 1XKJA 3ARPA 4Y8FA 2HS6A 3MV01 4FOKA 2ANUA 3WFLA 4ZA0A 2QV5A 1C8VA 5FA5A 5DMLA 2CWXA 2OWWA 5PTDA 4WD0A 4K39A 4IMGA 3LRMA 4GX9A 3S83A 2VT0A 4WOZA 3VIMA 2QCCA 3SUSA 1KBJA 1O95A 4A6GA 4UCFA 4GWEA 1E70M 1DL3A 1TZZA 1UQZA 2ZC8A 5CZJA 4YLWA 1LF1A 1LBLA 3S2MA 2WHMA 1MUMA 1GQNA 1UZDA 1BVZA 5D2XA 3HQPA 4GCAA 1B31A 1DWAM 4PCPA 1EWEA 4XKYA 1O68A 1N8FA 2XFRA 4FLQA 2QCDB 1QW9A 4I7VA 3URBA 1BG4A 4P8WA 2WSKA 4HNUA 4KPLA 4IQDA 3WNNA 4G56A 2FTYA 4IH3A 2Z6IA 1QU4A 1JRCA 3PB2A 3POHA 2CW6A 4QSFA 1XSJA 4S1FA 4ZCWA 3VNYA 3WEZA 3SUVA 3SAZA 4MHBA 2PLCA 1JFHA 3H7UA 4IIBA 2I16A 5CQ1A 1Y5WA 4BI5A 4DWDA 1QK2A 3JZEA 1YTEA 2B7OA 3QPEA 2MUCA 1O4UA 3BGAA 1AMKA 3DFHA 1V93A 4LNCA 3E2QA 1UC4A 5I3IA 1OCBA 3KDNA 4C6EA 3SQSA 4B3KA 1OYBA 3QM3A 2PP0A 1ZS2A 1EQCA 1NDVA 2XSBA 2WZEA 3A4JA 5EMYA 5DT5A 4PRTA 2E7FA 5IFTA 4W85A 4AC1X 3ARQA 3K8MA 5F4XA 1G0CA 1XCFA 5CGQA 2P53A 3MT1A 1TPB1 4IMEA 1B0IA 1DE5A 3DI0A 1XQLA 3G1DA 3K4WA 2ACRA 1VKFA 1WUFA 3F1QA 2XIOA 3SY1A 3TUUA 3ZT5A 4GZJA 3CLWA 3H2NA 1O5XA 1XV8A 2E5BA 1U2YA 1YADA 1X6NA 1TPWA 3NYZA 1JG9A 4KCUA 2PDJA 3THDA 4XD3A 2O7SA 4FLOA 1FKXA 1J18A 3UWYA 4NAEB 1XRTA 2ZRYA 2E3ZA 3F2BA 3WQFA 3SGUA 2Y5SA 1D8CA 3RJYA 1UZ1A 4JD4A 4DYJA 2GJNA 4UUIA 4D6JA 3ME3A 2XIBA 4HGXA 1IXQA 3R8RA 2P0OA 2XFFA 2G37A 2Z2AA 1PKLA 4ZOBA 4W8BA 1XLGA 3AO0A 3TWAA 1K8CA 3TJXA 1E6SM 3VE7A 1XD0A 2F7FA 4Q4MA 3QQ0A 3WBEA 1S2TA 3TTSA 1MEIA 4LEFA 2VX6A 2PODA 1EJ7L 4QFUA 1I4NA 3VDAA 3ZO9A 5G4WA 3PF3A 4E2DA 4ZQNA 1GOQA 1M7PA 1TA3A 3GTFA 2GVJA 1PB0A 2RKXA 1OG0A 3ZM8A 3WQ5A 1G4PA 2ZTKA 3S1XA 2Y7FA 3AAMA 3WFAA 3W1NA 1JXJA 3CTTA 1B9BA 4GYKA 1DOSA 4ALDA 3V35A 3IGSA 4IOTA 3SBFA 3PR2A 1JDAA 4MVAA 1LROA 1ZBWA 1H7NA 2WCAA 1PPIA 3IVSA 1K7FA 3U4AA 1RLCL 5HQLA 3U9IA 2QUUA 1ODUA 1A0DA 4UNLA 5G1YA 3RUBL 3H53A 4PEEA 4HCDA 3SURA 2IKHA 4E8GA 4WDWA 5LXXA 4P8VA 2Y70A 2FJUB 5CAKA 1QO2A 2Y89A 3LI1A 3QMRA 2X1IA 4EIVA 2IKIA 3DGBA 3UCCA 3VPLA 1QPRA 3G0UA 4S3DA 5CZKA 4AF0B 2QS8A 4MAVA 3TU9A 3HO8A 4M81A 2FGBA 3G8RA 1O5RA 1L0PA 2VVNA 5HULA 1GJPA 5DMNA 1HJWA 2VGFA 5D9MA 2X0YA 2WMFA 3QMSA 1LORA 2NT1A 5A6LA 4LANA 2BOEX 5C71A 3UYCA 1BVNP 5T26A 5ECUA 1LCOA 4Q4QA 1S2WA 3U5UA 4WHBA 5E0CA 3VOCA 1M1BA 4HNOA 4DRSA 3KBNA 2VC7A 4GPNA 3VE9A 1FWSA 3W37A 1SJAA 3R13A 1HG3A 3K30A 1MI3A 2FZMA 2OWCA 4RX0A 1AJZA 3UFYA 2YBVA 3ZWTA 5G4HC 2XM1A 1L6WA 3QSRA 3RYSA 4F79A 1F3TA 1XPYA 1DJYA 1JEZA 5I3DA 4L4OA 1JI1A 4LU0A 1H7XA 1XIIA 1KFCA 2OEMA 3BOXA 3G8EA 3D47A 4PEKA 1B3WA 3HG5A 3TZFA 3UNDA 5A94A 3H6OA 1TQJA 1XIFA 3KBWA 1TWDA 1JGIA 4UZSA 2CLIA 5C54A 5A2BA 2FVKA 4JXCA 2R14A 3NR0A 1P1XA 3SCWA 1L6YA 3A47A 5GNZA 1KC7A 2Z26A 3P60A 2A5HA 3FV9A 4ZENA 3CQIA 2F8QA 1UWIA 2D2HA 3VNLA 4Q33A 5AC7A 4F4RA 4PMOA 1A47A 4XAGA 2G3FA 3SUTA 3EWDA 5I3FA 3MANA 4LSBA 1UMLA 1K03A 4PB5A 3BUVA 3RX4A 2VM8A 5T9BG 4WDTA 4DUVA 1SMDA 5CPTA 1ITXA 2NX9A 4FLSA 2PDUA 3Q37A 3GG7A 4AH7A 2J79A 3GR8A 1RA0A 1QW8A 1XCWA 1OEPA 3LCWA 1OADA 2PGRA 3LMZA 1G4EA 2WYSA 4KGJA 2R24A 4O1DA 3GDTA 2DQXA 1FRBA 3SIMA 4HU3A 4XISA 4X63A 2QVHA 2O9RA 4M6PA 3B06A 4H7ZA 3N17A 1YPXA 1XLAA 2X09A 3DESA 3REQB 1W56A 2D3LA 1E56A 3TNOA 3VILA 5G4EA 2O9TA 4NI3A 1GEQA 3BURA 3HMJG 1AJ2A 3OZMA 1UR3M 3TTYA 4IMDA 1SW0A 4MWAB 4W7VA 1IV8A 3W76A 1E9IA 4C6QA 3SFWA 2ZRZA 2O0TA 2FGZA 3FJ6A 1OD0A 3BARA 3NGJA 5HNUA 4F9JA 1AMYA 1TX0A 4PYSA 4QR6A 2WB5A 3G22A 1ZJHA 3TYDA 4AD3A 1NWUA 3WF3A 3B40A 4DM1A 2ZE0A 3UR7A 2BVYA 3GR7A 1SU5A 2QR6A 3HFTA 1W32A 1JL8A 2DT1A 1K77A 1L2QA 4E38A 2QPXA 1XLMA 3KHJA 3W1LA 1YRRA 3T09A 1D7FA 3UCQA 2ALDA 2B31A 2Q3RA 1QI5A 3S5ZA 1E0TA 2FVMA 1R9YA 4PA8A 1J11A 3BXWA 1G01A 1UR1A 3E12A 2W92A 4ZTXA 2QUTA 3U5YA 3VUSA 3P81A 3I3EA 3PP7A 4GYJA 1QO5A 5A3HA 2PFHA 4QSHA 2DVTA 4NY2A 1JJKA 2OEJA 3M46A 1VBJA 4H6RA 4GUFA 1A5AA 5BNKA 1GKRA 1ONWA 2VXNA 3B03A 2DQWA 2PA6A 1E5NA 2R82A 2PP3A 4DEFA 3UA4A 4X61A 3RG6A 3IJIA 1MEHA 1Q6FA 3CAKA 3WBAA 5LIUX 1Q65A 4LYRA 2POTA 4O17A 5D03A 7XIMA 3VZYA 2PZ0A 1YW1A 4V1YA 4F9DA 1NOWA 1VJIA 3PTKA 2CLPA 2OO6A 5EY5A 3P67A 1BRLB 3CZEA 4JGDA 1MFUA 4C6IA 3MO7A 1H11A 4NL1A 4BWLC 1QHPA 1LDCA 4ZOEA 3V7PA 3TLLA 1QCWA 1M01A 4UR7A 4QAWA 4X9SA 3UWQA 1LM1A 4B2DA 2ZBTA 2G3NA 2RDTA 5HMDA 3TIMA 2PTZA 4GQ0A 2GDVA 2XIIA 1TRIA 3QYQA 4XQ6A 4CD5A 3T1GA 3QHOA 1VD6A 2E8YA 1IEIA 1O5QA 2IKJA 3G5EA 5CSRA 1ZNNA 1GYNA 4JEJA 3JZUA 3PAJA 3PJUA 4QG6A 1JYVA 4ZODA 3EZ4A 2QQ6A 4LFYA 1KM3A 2RUSA 3PJWA 2X1RA 3USZA 3OVGA 1EF2A 2X2GA 1TMLA 3WX7A 3EPOA 1DJQA 3NQMA 3OO2A 3PNZA 1AFSA 1JF6A 3OODA 4D8LA 2QT3A 3NPVA 1VFMA 1W5PA 5RUBA 1GORA 1ZPTA 2XVPA 1VJZA 5CC3A 2CLOA 3W86A 4H19A 1D7KA 1SJCA 1XINA 5FEZA 1GZ1A 3DFPA 3SSZA 1LQAA 1KV5A 4PUKA 4OOUA 3TTOA 3TTQA 1FHLA 1UD4A 2XFWA 2Q6ZA 3H21A 1E1CB 2A7PA 4JDBA 1T41A 1SM9A 1BYDA 5A8QA 3WCZA 1E9LA 2FIQA 1ISVA 2Z1SA 3UWEA 3L4XA 2QDHA 1H51A 2VQUA 1TREA 3WUBA 2XSAA 4O1BA 5C6MA 3NM1A 3URQA 4A2RA 4S3KA 3WH5A 1X1OA 4HBKA 2OYKA 1FH7A 3NSNA 3QBUA 3WH9A 5B80A 3H2OA 3PBUA 1HL2A 1YTDA 4A3QA 2JF6A 3LGEA 3U8GA 3WNPA 4O13A 2GVEA 4MADA 3UG5A 1X97A 2Y24A 4XBJA 4GLEA 3W28A 3B9AA 4POCA 3MKVA 3W27A 5FESA 4UFLA 2A2IA 3DBPA 3GH4A 1VFUA 3SI9A 4F0LA 1S2VA 3RDKA 3EAUA 1XYLA 5ABHA 1V02A 2DGAA 4QQ3A 3FKKA 1DJZA 3Q94A 5CG0A 3FYPA 3T40A 3PULA 4C6MA 1Q7ZA 3O15A 2BHYA 1VB9A 4PN2A 4C7DA 2ALRA 3K4DA 1UR4A 4UTWA 4DJEA 1ZCOA 1W5OA 3AS3A 4H9XA 4XZWA 4JHOA 3P7YA 3BSMA 3THCA 3W26A 3KAOA 4ADSA 2D69A 5FSEC 1YKWA 1ICQA 2DH3A 1R3YA 2YFOA 4MKVA 4BQ4A 3LCXA 4BY3A 5I00A 2Z29A 4JTRA 5C9RA 3CL8A 3V5CA 1XSIA 4MAZA 4F3HA 1ZP4A 2YDAA 5A6SA 5DBUA 2ZOXA 3MO4A 3BG3A 1VF8A 3MKCA 1NF7A 1GVEA 3SUWA 7A3HA 1CXHA 2EJAA 4QS6A 5E93A 5BOFA 3B0UX 1MUWA 1R3SA 4R7WA 1TO3A 3SJ3A 5AHEA 4WSJA 3N73A 1Q63A 3VDCA 2Y8UA 1LWIA 1UR2A 1OB0A 1MYRA 3MZNA 2AGTA 2HQAA 2J88A 1XBVA 3W7QA 1X38A 3FX4A 4JYEA 4OBRA 5M2FX 2WZIA 3UWVA 4B15A 2VEIA 1G7UA 2HZGA 1QPQA 1KR1A 9CGTA 5IDZA 2POZA 1DTNA 1A4MA 4PMNA 4TR9A 2FZBA 2BVTA 4CN1A 1SW3A 3T6CA 1R9ZA 3IIOA 2BY2A 4GI8A 2Z0IA 4R7OA 2VR4A 2INFA 3P62A 1OM0A 3C5QA 3LPPA 3UGVA 3I6TA 3F4VA 3V1PA 4J3ZA 3SEPA 3GIPA 3E6EA 3CPGA 5CBIA 5BU6A 4KIEA 4AVOA 1FWAC 2PWFA 3M0JA 2ZA2A 3ARXA 3QFEA 4YCPA 5FF3A 4Q6JA 4WK9A 1W6TA 4I9AA 5TD4A 3C61A 3RRXA 3PC0A 2BODX 4LT9A 2Y63A 1H7PA 1KQZA 3IARA 3FXYA 2VELA 3SO7A 3V3WA 2ZRVA 3UERA 3H12A 3TONA 2C6QA 1NTHA 3B0PA 1J10A 3IJDA 4WOQA 3WF2A 2J7EA 4YS1A 1LWJA 1PJ9A 2DSWA 4MIMA 3HV8A 1F6KA 4GKTA 3E0WA 2V67A 5REQA 1GNXA 1XHGA 3BSHA 3E49A 2FPYA 1LUCB 2WJFA 2A0NA 5DRIA 3W2JA 3B9DA 1ZBVA 4CD6A 8XIMA 2W61A 1F76A 1YNYA 4L65A 3B8WA 1J5SA 3AUJA 1EUAA 3VD7A 3GTHA 1WBHA 4AWEA 4ZB0A 1RQBA 5FIPA 2ZX5A 1J0HA 4XAFA 4FF7A 1Z8AA 3DI1A 4XAPA 3OIXA 1HKWA 3PWIA 2YJQA 4QXIA 5DT7A 1OVDA 1K3UA 3A12A 3M5ZA 1JYXA 1MSSA 4WKFA 3ITLA 4PUWA 1V3HA 1LBMA 1XQKA 1WDSA 1ZAIA 2XWEA 4V1XA 4JY9A 1FWHC 2JQXA 2C7FA 4JTHA 1H63A 3IIZA 1Z44A 3CC1A 1JCNA 3O63A 3UG3A 1GCYA 1J9YA 3F03K 4HKPA 4KWUA 2TODA 1SGJA 2QIWA 5BWAA 1O60A 2A1YA 3GU1A 2CHRA 5JBFA 1CENA 1MO0A 4WLCA 3WK1A 6REQA 1F3WA 4MY9A 4XTDA 1TJRA 3ABQA 1WB0A 1V6XA 2Y2WA 2OTDA 1FWIC 3MP4A 1A5UA 3MUY1 4BFAA 1DBTA 4GJ1A 2B7PA 3W2MA 2PLMA 5A8MA 3RR4A 4FOUA 4ATLA 2AQVA 3ABRA 5CPSA 1YLVA 3WIJA 1K02A 5CPQA 5FJIA 1YQ2A 4FR6A 1XC6A 4WEVX 3INPA 5LNWA 3MI2A 3BLIA 4JIPA 1C8YA 1OY0A 3VZZA 4GYFA 1JUBA 1Q6GA 4KGLA 5LNRA 2DIEA 1J2BA 3IVUA 5HJLA 2YKKA 1CTNA 3JUGA 3TYCA 2GQ3A 3BVJA 5FJOA 2QF7A 2I56A 1Q4WA 4DLMA 5EMKA 3MKKA 2X2YA 3HURA 4XZ9A 3H26A 4WJ8A 4QBXA 3GAKA 1U5HA 5CEWA 3APGA 3QY8A 1ME9A 4EPKA 3PZOA 2IXUA 1TR9A 3LENA 5FEXA 4WY0F 1RZMA 5K4XA 5E70A 3WD2A 2P76A 1NP2A 4DWSB 2HVOA 2YCJA 4IPLA 1OCJA 3BOLA 3L21A 4R9XA 3WUGA 1XX1A 2YSWA 2IKGA 2D3NA 4UTUA 5I6SA 4CVWA 3WQPA 1QT1A 3W7DA 1TSIA 4N9EA 1PCKA 1AZ2A 1GVQA 4C1KA 3IIVA 1GQJA 1GZGA 1L6SA 2GOKA 2ATMA 3HG2A 1A5OC 3WEMA 4FSAA 4DJEC 1WA3A 1H1YA 1U30A 1W0MA 3TN4A 3BANA 2ODOA 3GK0A 2VL4A 3IUHA 2YZ5A 1XJBA 2BZNA 4K7YA 5GVJA 3VIJA 3ARRA 1Y5XA 4C5YA 2OR2A 1R38A 3LNMA 4D8AA 4EP8C 1ESWA 3QTPA 5I77A 2OSWA 1D3CA 1YX1A 2CKRA 3OYZA 1UQYA 2R1NA 3WJXA 3TVAA 1PYFA 2ZXDA 1KCLA 1PKNA 2E67A 1NOFA 3FN9A 4WQ6A 3WQ8A 3ZIZA 4CEXC 3BZJA 3ALGA 4JNZA 1PS9A 5L9FA 5CXPA 4L6DA 4R27A 3OLDA 5KSWA 3FA4A 3OLEA 3CAVA 4G7FA 4ZB2A 3ZOAA 4IGNA 3DCPA 3LS9A 3TJIA 4C6NA 4PBEA 1MNSA 4DBUA 2X16A 5BMWA 3PTQA 3W7OA 4DZHA 4GVHA 2PDLA 2V82A 2WVVB 3RGTA 3SW6A 5HPCA 4LCQA 4DAIA 1ZALA 3A4WA 1NEYA 3VYLA 2V2HA 3NDOA 4OQVA 3T0AA 5AHIA 4ZZ9A 1XIBA 3VKKA 3N11A 2GJRA 3PZNA 1LRQA 1M7OA 1HGWA 4MM1A 4I9TA 3G1RA 2QULA 5XINA 1B4KA 3IGXA 3Q67A 3F2CA 4B5XA 2YIHA 2QXWA 3HZ3A 3LLDA 3T2OA 1EHNA 3O07A 2QDEA 2BBFA 3DG6A 3VGFA 4AF0A 3HPSA 1TV7A 1W8SA 3VX0A 4P8UA 1TB3A 3W1XA 3O6AA 2PDNA 4K8GA 1YTKA 2JIWA 4M7TA 4MYAA 2PWEA 4WDUA 2NQJA 4GCXA 3TSBA 1QK0A 4US5A 2EO7A 4NX0A 1IF2A 1KGWA 2NWRA 5D9PA 5ABFA 1QNPA 3EWXA 1QI0A 3WENA 4XZBA 4H1ZA 3LM7A 2QJMA 3F7JA 1JZ3A 2WMIB 4AZCB 3CUFA 3ZVHB 1DXIA 2OB3A 4Y96A 2VGGA 4DO4A 1RY8A 3UGRA 1JCTA 1XYMA 3URAA 4J4KA 5IHRA 4RR4A 1PX3A 1Y8BA 1W1PA 4OV4A 1KKRA 1O94A 1BGAA 3KP0A 3KEHA 3I4EA 1HKJA 1RPKA 4NXKA 3KP1A 1CZ1A 3UCDA 3DHUA 2OWXA 1XG3A 1T99A 3R7MA 3GTXA 1U5JA 3NVDA 5JMUA 3NL3A 3M9YA 2E25A 4K68A 1DV7A 1XRFA 3WY1A 3ZJ8A 2GGEA 4QITA 4ZOCA 4IG2B 2WO5A 3C0JA 3CIVA 3T2PA 4O28A 3M1ZA 4QEHA 3UPWA 1J0ZA 3A23A 4Q4RA 1EDGA 2V8ZA 3DFTA 3PZIA 1D2KA 1CPUA 4DN1A 4GNKB 4IMFA 4IGSA 1CGVA 4KRTA 1CGTA 3DC0A 3CJPA 4AZCA 1VPQA 4FNTA 3MMUA 4UTTC 1U1HA 4MUZA 3N9SA 1YEYA 4RXGA 4GACA 3URNA 3UR8A 3L5MA 4GVFA 2YA0A 3G3MA 2FVLA 1H3GA 1ZSXA 4BZYA 3RO8A 1XD1A 1E9YB 4NF7A 3BE7A 3L0GA 3M0LA 3NO3A 3MMDA 2QCGA 2DY3A 3AYSA 3BCFA 3HPAA 4HHLA 1YDNA 3AC0A 4M6VA 1E4IA 4IQLA 4FNSA 4L1GA 4N2YA 1VLIA 2WSPA 3SFKA 1H0GA 1UD6A 3QSTA 5XIMA 1QNRA 1G9HA 5DCDA 1G1YA 1VCVA 4XX6A 4PMRA 3W73A 4LUSA 1BSLA 5IRPA 2XVKA 1T40A 4CCZA 2QUVA 2PU1A 1VRXA 3LU2A 5GJNA 1W3KA 2GSHA 4MFEA 1XDLA 2WVSA 2NQLA 3VABA 1TA3B 2YCIX 4CCCA 3GG1A 2J8FA 4I5UA 1FCBA 1UWAA 3SADA 4UTHA 1E73M 4IP4A 4L64A 3QFWA 1N8IA 1BSIA 3NOYA 1DIDA 3OA5A 3G3DA 2J9ZA 3KL5A 2F2KA 3C0LA 3H7VA 3FSTA 1NH6A 4AD5A 2JIEA 4INFA 4TTUA 1KM6A 1IEWA 2J7HA 1RCQA 3NEHA 5ABTA 1SZNA 1KGUA 4HPXA 1EPVA 3KOFA 5HWNA 3RXZA 2P8BA 4MB1A 1H7WA 1LP6A 2OSXA 1PHWA 4JTCA 1UWTA 3L4ZA 3HGRA 3EPNA 1LWHA 3UPMA 2CNCA 1OGSA 3ZR5A 4TV6A 4DNHA 4F0KA 3M6DA 1M41A 4HNNA 4YYFA 1RBLA 4RZBA 3LSBA 4LAMA 4Z2HA 1OX6A 1KM4A 1M65A 1MUCA 4PMXA 1R3RA 2GQ8A 3PANA 1P0DA 3ISIX 1V3LA 2XFYA 4CD4A 1EJRC 2ZKMX 3TN6A 2PLJA 4IIEA 2E77A 1WAUA 3LZ3A 3O7UA 4U2ZA 1U5VA 3U2OA 3W02A 2H9AA 2YL6A 4D1JA 3SN4A 5FJJA 4LF2A 4E0CA 1UP3A 2C79A 4C65A 1HZYA 2Y7EA 4H8UA 3ZT6A 3UG8A 1PKYA 3CB8A 4MZ8A 2WMKA 4F0SA 1DPMA 4UTTA 2RGLA 3NG3A 2HMCA 3M0KA 3UXLA 1UIOA 1K7XA 1XKYA 2HPIA 3VKBA 3ARVA 3BW4A 2HS8A 1CI1A 4CQAA 1IXNA 4Z17A 3W4RA 2BOFX 3WNKA 5FJUA 2J77A 1DJWA 1LRNA 4QEEA 1P6WA 1GVIA 4TMCA 2C0HA 2EPNA 3BJFA 3CHVA 4FB7A 2IPJA 2NT0A 1H7RA 3AIRA 4C60A 2YDSA 3W85A 3N9RA 5H8UA 2O9OA 3SRFA 5C8BB 1Z9AA 4X22A 1RUSA 2OELA 1UKTA 4KEVA 1UH4A 3UR5A 5F1VA 1VGAA 5FEPA 2WQPA 3VA8A 5GPRA 4Z2JA 1TMHA 2GSJA 4NT0A 2AMXA 1C90A 5DBTA 4YHGA 3TR9A 2VTFA 4M1BA 3E0IA 4XD6A 3V0UA 2CBIA 5I02A 2TPSA 3GDRA 3QRHA 2VP8A 4NILA 2X0SA 3WSUA 3S47A 2WSQA 1HTIA 1JULA 5JIWA 3O06A 5D09A 4Y9OA 2NQHA 3DYOA 1JD9A 4UFKA 1B5TA 2BNJA 2BHZA 1FP8A 1E6PA 4H9YA 4REQB 3WD1A 5B7YA 2DT0A 5AC6A 2ACUA 3ABOA 3N6HA 5E9AA 2BXVA 4H9VA 1FBAA 3RFAA 2W5FA 1C8XA 1W3JA 1ISWA 1XRSA 3MJMA 5G1TA 1HKVA 1S2CA 1N7KA 4O8RA 2PDKA 5AB3A 2E09A 2O7QA 3UXIA 5G2HA 3V5OA 4IPIA 1S5TA 2FHBA 3TNBA 4OHQA 3FOKA 2J24A 4O54A 1A0CA 3H7RA 1NQKA 5D32A 3N14A 4E4FA 3BJTA 3GTIA 1V4YA 1KWGA 5CGTA 1E3ZA 4JAWA 5LIXX 3MB9A 3N2BA 3D0CA 4RPQA 4IXXA 3L7RA 3NQ6A 4GY7A 4YIWA 2R1PA 4GI9A 4H04A 1LYXA 4AD2A 1MQPA 4MJZA 1KO0A 1UIPA 4ZSTA 2Z4GA 5JH1A 1ZL1A 2PD9A 2J8GA 3UESA 4TX9A 3WFZA 4QLJA 4N4PA 2GLKA 3OG2A 1HL9A 4U28A 4DO5A 3ZWSA 3QEZA 5HXMA 1L2UA 3MUAA 4V15A 4HD5A 3VM7A 3BW2A 3EXSA 3ITOA 1ODZA 4LYQA 1WKFA 2X1TA 1KA9F 1UZHA 4HYRA 4KESA 4Q8QA 1DYSA 4H9MA 4NVTA 2X42A 4AYGA 1QUMA 3GTNA 1PZ1A 2VCCA 5FACA 1EYWA 1SJDA 3DKJA 4NJKA 1GYLA 2Y4SA 4IPNB 4J5NA 3KDOA 4EK7A 1TJ2A 3N3MA 3OPSA 4H7CA 3E0FA 4XV0A 2TMDA 4JN7A 1CB2A 4ZEPA 3F4WA 4EPEC 4QRNA 1ZTVA 2E9LA 5M3WA 2Z7GA 2WSYA 5EYWA 2W67A 3LPFA 1OQFA 3IRDA 3ARTA 2WOQA 3ELFA 4AVNA 5T9CE 4E6MA 5BROA 5JIPA 1UG6A 4J35A 2BGNE 1TUFA 1P0EA 1F5ZA 4J40A 2E6AA 2Z24A 1H60A 1OFPA 3KRUA 4UMCA 1QNOA 4DXKA 3QZAA 5CH9A 3VNJA 3KBMA 2ZVRA 2HE8A 3M0YA 2ZCGA 1DJXA 1XG4A 3LXBA 2R91A 1K8XA 3DHDA 4IIHA 3AU6A 1XIMA 6REQB 1K9FA 4O1AA 2Z00A 6PTDA 4LTSA 2BGQA 5LIWX 3EB4A 3AROA 1KCXA 2VMFA 4HYVA 4MNMA 4XB3A 4DJFD 4YXGA 1R8LA 2BDQA 2PMQA 1IHIA 3MCNA 3WNMA 1MDLA 3VDGA 1UYQA 2XVLA 3T0TA 1GVYA 5IHSA 2G95A 3RAOA 4IL2A 5H1WA 3RMEA 4F0HA 3NDZA 5D9OA 2VZTA 4RJEA 3FAWA 3HGOA 2CZ5A 4L56A 4FMVA 2W4XA 4X0VA 3WK0A 2PP1A 4GQBA 3QV8A 3ONCA 3ES8A 2VCAA 4JPGA 1EDQA 4UQAA 1DXEA 2VDIA 3L66A 3L9CA<