2Z1SA

Beta-glucosidase b from paenibacillus polymyxa complexed with cellotetraose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords Beta-glucosidase B
total genus 164
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2007-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2z1sA00
3RIKA 3IAPA 2E0PA 3ZIZA 3D3AA 4QFUA 1U30A 5BXSA 3LPOA 3LPGA 4JFWA 1OD8A 1UHVA 1S46A 1OB0A 2HVMA 2RGMA 8CGTA 2XJ7A 1DWGM 3UG4A 5IFTA 3NUKA 1HF6A 1CIUA 1B30A 2JFEX 5E70A 2V38A 4MNJA 1W9XA 1H0IA 3AZTA 4FLOA 3W38A 2QMKA 1V03A 1JZ7A 1V3IA 1KR0A 3SUTA 3WENA 1OSEA 1UKTA 4GO9A 1BPLB 2V3EA 1IZJA 1I75A 1ZU8A 1H49A 2VZVA 3BMVA 5JUVA 1NWUA 1FH8A 1GONA 1U2YA 2D1ZA 3BSHA 4UCFA 2X1IA 1OD0A 4JIEA 2DH2A 1MQRA 3DHUA 3MSDA 2FGZA 3I3DA 4ZE5A 4D71A 4B9YA 2XYLA 4OBSA 1B3XA 1BGAA 1NM9A 4P7NA 1UUQA 1FHDA 5EFFA 2WVSA 4CGTA 5A1AA 2WANA 2PF0A 2X8RA 2DT1A 1HJWA 3QHOA 5A6BD 2WSPA 4PMRA 4PMYA 1CXHA 4H7VA 1UKPA 1OIFA 1KXQA 4H8VA 4AZCA 4GQQA 4LQ1A 4LYPA 4BQ5A 5LA1A 3BGAA 4RE4A 3ZT5A 1V6WA 2TAAA 3CHEA 3W28A 5LA0A 1H0GA 2J8FA 2CERA 2ZUTA 2VX6A 3VIMA 5CG0A 2AAAA 1ITXA 2DEPA 3T09A 4U5KA 1XSKA 5JIPA 1CGWA 3BC9A 2WHMA 3EMCA 4ZFMA 3SURA 4AIEA 2ZE0A 1H5VA 2OYLA 1ZJAA 3VGGA 3T2PA 4GI8A 4CCDA 4J3UA 3ZR5A 2FH8A 3WH9A 1PBGA 3AHZA 2X05A 4BQ4A 3VIHA 4S3KA 5BXPA 4UOJA 2Y24A 1OGSA 4DUXA 4QCEA 5A2AA 1CXEA 1LF1A 4P8WA 5DMYA 2VZOA 1J12A 1XYFA 2VX7A 2VCCA 4PN2A 4ACYA 1H41A 2FHBA 2VJXA 4DWSD 2NT0A 1TFVA 1VEMA 5HPOA 2D24A 2EPKX 1ISYA 3VILA 2D22A 1K6AA 1NWTA 5C8BB 1CECA 4E8CA 5M3WA 4UFMA 2WMGA 1PX3A 3NDZA 2W92A 2X0YA 4CCEA 2FDMA 2EQDA 2QMJA 1DWAM 3A47A 2WVTA 3KL3A 1KCLA 1VF8A 2E3ZA 3UR7A 4AY1A 2OSYA 5C70A 4PMVA 1SMDA 1FH9A 2UY3A 3OZPA 4PSRA 1NP2A 1MXDA 3CH9A 1EDTA 2O9RA 4CD5A 3U7BA 2MANA 3N18A 1CXIA 3S6TA 2VZSA 1ZBCA 3NYDA 4P8UA 1UD6A 3M6DA 3GNPA 1VAHA 1ISVA 1JZ5A 2X2YA 2G3IA 3GXFA 3ZR6A 2YKKA 7A3HA 4PTMA 3VD9A 1V0NA 2E9LA 1E6ZA 3CZJA 3NJ3A 1QI2A 2ZXBA 1VEPA 2W62A 2ZUUA 4KRTA 4TTUA 1JAKA 4YN5A 2DT3A 2G3NA 1W1YA 3BAXA 3WL0A 3SCUA 1KGWA 2UY2A 4BS0A 2D0GA 2VO5A 1C7SA 4BZYA 4QAWA 2BXYA 1E9LA 4HP5A 1VFFA 5DFAA 2XTKA 4W87A 1J9YA 2J7HA 2V5DA 1C3FA 1HP4A 3ALFA 2YBUA 4AZ6A 1MFVA 2A3CA 3TTOA 1MXGA 1K9DA 3RPMA 3L4ZA 1GPFA 1ODUA 4GZEA 1GOQA 3W25A 1XD0A 3WBAA 1CEOA 1JIBA 4UOQA 3N1AA 4V2XA 5F7UA 3WQWA 1E4NA 3MV11 3GNOA 2W61A 4KRUA 4W88A 1UQZA 4AZGA 5CPSA 3WD4A 2C7FA 1L8NA 1UR2A 2NT1A 4IUGA 4RL3A 4BQ2A 4J3XA 3IJ9A 5M17A 4HZ6A 3SCSA 2XGIA 1WAWA 1CBGA 2QF8A 1O7AA 3ZT7A 1WDSA 3PBGA 1E0VA 1XRVA 1E6PA 3FY1A 3AYRA 3WNKA 1CENA 1VIWA 5A2CA 4D6JA 2E8YA 1ODZA 2BNJA 1ZBKA 2J7FA 2OYMA 1A47A 1LQ0A 4J3SA 3FAXA 3TTSA 3NIYA 2WHLA 4U2YA 3IANA 2Y4SA 2EPNA 1C8YA 2GSJA 4OOUA 1M7XA 2VR4A 5GNYA 1OWQA 1VENA 5EB8A 3ZT6A 5BRQA 1EOKA 1UH3A 1HT6A 1Q6CA 2ZX9A 4GI6A 3NSNA 4CU7A 5CZKA 3W53A 1HKKA 3WUFA 5M5DA 1B3ZA 1QBBA 2FHCA 3EDEA 2ZWZA 1XH1A 1NQ6A 5HXMA 2W67A 2XIBA 3N12A 2QLYA 4Z2IA 2W4XA 1UH2A 4H2CA 3VUPA 1UR0A 1QW8A 3K8KA 2D2OA 5D4YA 3WUEA 1KXTA 1MFUA 1VRXA 4IISA 1BF2A 3GXIA 1BSIA 4JKKA 4AD2A 3LMYA 3ZMRA 3VU2A 4AD4A 4Q22A 3WD0A 3FNDA 5IFPA 1KXVA 2WBGA 1NOFA 1QI0A 1E55A 3AIRA 3N04A 3CHFA 4IPLA 4U5IA 4D6IA 4Z2KA 1CWYA 2CNCA 5A6LA 4ZENA 1FP9A 1OIMA 1HNYA 1W9DM 3U5UA 4R5EA 2WK2A 2YL9A 3BSGA 3VD7A 2YBTA 1QI5A 2VRQA 1AQHA 2VZUA 4PTWA 2WNWA 4V27A 4YHGA 3CUGA 1GOKA 5CPTA 1UR9A 3GH5A 3IAQA 2XG9A 4TVDA 3OG2A 3VKKA 4LYRA 2UY4A 2J47A 3O6AA 4Z2GA 1RP8A 2Y5EA 3RM9A 1GHRA 1ZBWA 2ZOXA 1E40A 4GZJA 2Z1KA 3W27A 1E6NA 1CLVA 4CN1A 3ZOAA 1EHNA 3AJ7A 1C90A 4LXFA 1XV8A 1D2KA 4KGLA 3MUAA 1WDQA 1J0YA 3MV01 3CHDA 3U57A 1E71M 5A2BA 2D23A 3AIVA 1GHSA 1GW1A 3AMKA 3DYPA 3FHQA 3W6LA 2EBNA 1E73M 4F66A 1PX8A 1UWUA 2CBIA 2FGLA 1KBBA 1W2PA 3DYMA 4IPNB 4MPKA 1E1FA 4URIA 3PTKA 2ZUWA 1EO7A 4KGJA 4DM1A 4X0NA 4WKAA 3WQVA 1IV8A 4DUVA 1BFNA 3SCRA 2YLLA 1KB3A 3ZQ9A 2PBOA 1UKSA 1TMQA 3AHXA 4W84A 3BLKA 3RDKA 3CUFA 2WCGA 5HBFA 2D3NA 1ESWA 2BVDA 1W32A 1R86A 1TUXA 2Y2WA 4W7WA 2YOCA 1EDGA 4CU8A 3SIMA 3WQ8A 1H09A 4YPJA 2WCAA 4CD8A 4D72A 3F5JA 1VFMA 2ZWYA 1CZ1A 2G3MA 1UWQA 1B1YA 3MMDA 4PEEA 3PZIA 3RJYA 1XYZA 3PZMA 3VM5A 2CETA 2PWGA 4PTXA 3L4WA 3BAWA 5D9MA 4AIOA 4LGXA 1UYQA 2ESCA 1JFXA 4Y7EA 1F4AA 4HPGA 4AXNA 5BWFA 2CBVA 4J3VA 2CKRA 4UZUA 4WKHA 3MSGA 4P7OA 1JD7A 4KH2A 5ECUA 2WC4A 5I6SA 1BVNP 4PMDA 1JAEA 3PZGA 1LL7A 4Z2JA 1EH9A 5A94A 3AXXA 1ISZA 4ACZB 2ZX5A 1B3WA 4PUDA 1OM0A 3WEOA 1MW0A 1AQMA 3VNYA 3VOCA 3CO4A 1QNRA 1QHOA 4HZ7A 3EYPA 2ZUMA 5A8OA 1MVYA 2WBKA 2ZICA 3N9KA 3HN3A 3VIIA 4EAMA 3K1DA 3MS8A 4ML4A 1PAMA 4DWSA 1KWKA 3OGRA 3CZKA 4TVCA 5EFDA 3WDQA 4F9JA 2WLYA 4UNIA 4LYQA 2BV9A 2EXOA 1BYBA 5I3DA 4TTGA 1JDAA 3AHTA 1E6SM 2J7BA 3O2LA 5JBDA 4D6CA 4H04A 1WZMA 1HVQA 3W4RA 1GOWA 3OGVA 4J27A 1WE5A 4HOZA 1H4PA 3I3BA 3E1F1 5I2UA 4CN6A 1JG9A 2WM0A 3PZOA 2IUZA 4AIUA 1ZBVA 3WF3A 1EGZA 2DSKA 5FIPA 4EE9A 1GNXA 1ECEA 3VD5A 2EEXA 1UG6A 1NOWA 1Q6FA 2VVSA 1UA7A 3QOMA 2CEQA 1VBUA 2VNCA 3KL5A 1Q4NX 1HKMA 4UQ9A 1OGGA 5CPQA 4ZXLA 3CLWA 4P8XA 4X9YA 2WHKA 4TX6A 6TAAA 2A3BA 4PSPA 3GBDA 1G5AA 3CGTA 4B3KA 2G3JA 3OIHA 3L4VA 4WSKA 2NW0A 3GH4A 3UG3A 5A69A 3SCOA 2XVLA 4WKFA 3WN6A 1ZB5A 4JCMA 4MDOA 1Y7VA 1MYRA 3A4XA 4PMNA 3IJ7A 4XZWA 3WQ4A 1P6WA 2YL5A 3GM8A 1JYXA 3UETA 2YA2A 4AD0A 2CITA 3VMOA 3VGDA 2PWHA 2YIHA 3VNZA 3WBEA 5A6SA 3AYSA 1KBKA 2HISA 3F4VA 5KEZA 3CUHA 3THDA 4PCTA 1BTCA 1DEDA 2YL6A 3VX1A 2J7DA 5DF0A 1J0ZA 3BCDA 1BVZA 2A3HA 3WDRA 5GPRA 4J7RA 2GDVA 4H8UA 2F8QA 2YLAA 3K8LA 3VINA 2PI6A 1FFRA 1CNVA 3N11A 1J11A 4RE2A 1E0WA 1JXKA 4FK9A 2QPSA 1BQCA 1EIBA 4UFLA 4EK7A 5DT5A 1BGGA 3WF4A 5ABFA 1DHKA 4B16A 3B8SA 4JFTA 2V5CA 3PZNA 1RPKA 1J18A 1V0LA 1XSJA 3A3HA 4LX4A 1K9TA 1XCXA 1MQPA 4HA1A 1GZJA 3A4WA 3PZVA 5FKYA 4W5UA 1R7AA 4RE3A 4Z2HA 3AZSA 2D3LA 5IDIA 2DH3A 3PHAA 1CXFA 3BLPX 2J77A 4CCCA 4GZIA 1PX4A 1DWFM 2O9PA 4ZEPA 1H2JA 3ZSSA 1W1TA 2WVVA 3UG5A 2YA0A 5ABGA 5FD0A 3B9AA 2F61A 3TONA 1W9UA 2ZX6A 4M24A 3WNMA 3MO4A 2OYKA 1XD1A 4S3JA 1JNDA 1EQPA 2XVPA 3I3EA 3CUJA 2J62A 3MKKA 3KWXA 1V3HA 2WWCA 4Q7NA 2YDQA 2WHJA 1UWRA 4E8DA 3UESA 4AEFA 1JF5A 3GZAA 4QLLA 4WSJA 3RM4A 1EDQA 1TVNA 4IM4A 1US2A 4UQCA 1K9EA 2BHZA 1C93A 1VFUA 2JEQA 2WLZA 5BYWA 2WZIA 4HMDA 4TXEA 3WH8A 1JF6A 3OBAA 4FMVA 3WEZA 1OBAA 2QPUA 4U2ZA 3GTNA 1VJZA 2E9BA 2BY0A 5GQBA 1JYNA 1GOIA 2BHUA 4JCLA 1CGTA 1V02A 4V28A 1QI3A 3AMCA 3MANA 1VEOA 4UFHA 3VPLA 3WUBA 5JBEA 2XUCA 2ZUNA 4PMQA 2CCRA 1XSIA 3RILA 3AXHA 3AXIA 3TA9A 4WK9A 5EBAA 5JIWA 4JL1A 3OLEA 1BHGA 5EMYA 4JFUA 3WDJA 2VTFA 1HN1A 1UWTA 3SUVA 5D9NA 4DWSC 3RMEA 3SCVA 3SCNA 3PZTA 3BAIA 5KZ6A 1W3JA 5FOOA 4A3YA 1C7TA 1VJSA 1E3XA 4X0VA 3VIKA 4A4AA 2X09A 1XHGA 2FH6A 3OGSA 3M07A 4M81A 2BXZA 2VQTA 3BAYA 4MNKA 2VVNA 3ARXA 1E3ZA 3AQUA 1W2VA 2WMHA 4F8XA 2WC7A 1GOMA 5AYIA 5BXRA 2NSXA 2XWEA 2BVTA 4UQBA 4K68A 3WD1A 2DSWA 5A8MA 2PWFA 3WDHA 2XIIA 3A4AA 4AD5A 4BQ3A 2CBJA 3N15A 2OWXA 5BXTA 5A6AA 2W91A 5BCAA 3PZUA 4H41A 3ZJ6A 1G1YA 1QI4A 3N17A 2JE8A 3OLGA 1W3LA 5AYBA 5HDRA 1TE1A 2WW5A 4D1IA 2WCSA 1E70M 1HJXA 4MDPA 2GDUA 1JYWA 3VIPA 2DSVA 3WF1A 4AEEA 4AWEA 1EQCA 4NRSA 3ARUA 1KGXA 1IZKA 4GIAA 1J0HA 2ZX8A 4GI9A 1E0XA 4N42A 3WL1A 3AIQA 1LG2A 3WNNA 1HL8A 3AS1A 1MW3A 4UTFA 3ZO9A 4ZE4A 4W89A 4GQRA 2PWDA 3WD3A 2A3EA 4YHEA 4HU8A 1TR1A 1W3HA 4JAWA 3CBWA 1DTUA 2JIWA 4TOQA 5ABHA 1E6XM 4M82A 1B31A 1GOOA 4CVWA 3AISA 1B3VA 3EDKA 1V6UA 1V0MA 1J10A 1UKOA 1UD2A 5BRPA 5LYRA 4HMCA 4U3AA 1Q6DA 4W8AA 4HA3A 4B3LA 1WP6A 3WDPP 1WZKA 1HJUA 1N82A 4DM2A 4JFSA 2J7CA 1CPUA 5C71A 4PMUA 2ZX7A 2WWDA 4F79A 1QNOA 1C91A 4PTVA 1E5NA 3SCWA 2CHOA 4HOWA 2JIEA 2WMIA 2WKGA 4MNMA 5AY7A 1E6QM 2XVGA 3K46A 4W93A 3ZJKA 2WB5A 3L2LA 2BVYA 1DWJM 3VM7A 1V3JA 3WF2A 3QHMA 4EANA 1W1PA 3KZSA 3GH7A 1JXJA 1UD4A 4OJYA 3WIJA 3T0BA 1UD5A 1G01A 2C8NA 3CMGA 1CTNA 4C7DA 1TA3A 4NF7A 4M56A 1V0KA 5I24A 3WQ6A 2GVYA 1BG9A 1HJQA 1PIFA 2O92A 4P8VA 3AROA 5A6JA 1CGVA 1B90A 1ZL1A 2VX4A 3B9DA 4PMZA 3T2QA 1GQLA 3WNLA 4MAZA 2XSAA 2JF7A 1FFQA 1V3MA 4OOZA 3K4DA 1MW1A 3WF0A 5FL1A 5CLWA 1F4HA 3VD4A 1LWJA 2CBUA 2XFFA 1RD6A 3FW6A 4HOXA 3W82A 1LG1A 3AMGA 4MB5A 4JFVA 1G9HA 3OA5A 4W8LA 1K9FA 3W29A 4P7LA 4JHOA 3SUWA 3WSUA 1BYDA 3ARTA 2PB1A 3II1A 3VTRA 3FAWA 4HTYA 4ZXOA 1VBRA 3VIFA 2WSKA 1RP9A 1JZ8A 1CGUA 3CIVA 2OLHA 7CGTA 4HZ8A 1UWSA 4PBGA 2VCBA 3RJXA 3KE0A 3CHCA 1CDGA 3UEQA 2OSWA 1ZJBA 1EXPA 4ACZA 3AMLA 4MB3A 1HX0A 2VI0A 1ITCA 2XPKA 1YQ2A 4L4PA 4UZSA 1U33A 3WH5A 1LL6A 1BG4A 3GXMA 3WY1A 5CJ5A 1BLIA 1SMAA 1EA9C 1UZ4A 5CLTA 1X1NA 3W6MA 2XVNA 4AISA 4NRRA 3U7VA 3MUY1 2YL8A 1HKJA 1NWSA 1VFOA 1XH2A 4C7GA 1J01A 4AZHA 2PC8A 2XHYA 1C8XA 3LPFA 1WDPA 4U33A 4JKMA 4P7RA 2DT2A 2G4FA 5I23A 3L4TA 2J79A 1JDCA 4OKDA 1JFHA 5ABEA 2J75A 3T0DA 1TVPA 3TTYA 1M01A 3PZQA 3O9NA 2WYSA 5GNZA 1KWGA 1MWOA 8A3HA 1E43A 2V3GA 3L4YA 4MB1A 2VT0A 3B9EA 1UA3A 3LPPA 2DSUA 4BA0A 2CYGA 1HVXA 1J0KA 3WKZA 1UZ1A 3QR3A 5E6YA 1OT2A 2Z1SA 3MUIA 2WMFA 4MJ2A 1SR0A 4LPCA 3AIEA 1H1NA 1KGUA 3CUIA 4CN4A 3QOKA 1QBAA 3SCTA 4EKJA 3AIWA 1MW2A 1WB0A 2IXVA 5DEZA 2WMKA 1ISWA 1UR8A 3ECQA 3FHAA 3AOFA 3CTTA 3VX0A 4C7FA 1WO2A 1QHPA 4GO8A 3VMNA 1C8QA 4NI3A 5AC5A 1V08A 2VURA 2UY5A 2XM2A 3GNRA 4WLCA 4ATWA 3WNPA 1SFSA 4JZ5A 2PWEA 4FLSA 4CUCA 6CGTA 4AZ5A 3W37A 4BCEA 2WMJA 3DYOA 5E6ZA 4XX6A 3N13A 3TP4A 4QDMA 1W1VA 1V6YA 1TCMA 2VX5A 5FCZA 3BMWA 2ZXQA 3UR8A 1NARA 1A3HA 2EO7A 1TG7A 4PYSA 4W8BA 5BROA 1GCYA 4QLKA 4AD1A 4XZBA 2EPMX 4UQDA 1XGZA 1W9BM 3CPUA 1UR1A 4D6HA 1MQQA 1CYGA 3SUUA 4CU6A 3WFLA 1W3KA 2JF6A 1M04A 1X6NA 3HU7A 4AMCA 1E15A 1UH4A 2J25A 4W85A 1US3A 4D6EA 1HIZA 1DWIM 2C0HA 1UD8A 1HXJA 2PBGA 3SCPA 4OIFA 1GVIA 5DT7A 1W91A 2CHNA 5I78A 3CZEA 3WMCA 1B0IA 3AICA 3IJ8A 4TUFA 2BFGA 1SYTA 1NP0A 4W86A 3WEMA 1WDRA 2GFTA 3QGVA 2O9OA 2VMFA 4W5ZA 3AMDA 4XV0A 1B3YA 3WNOA 2ZXDA 3IK2A 2DPEA 3JUGA 3SCQA 2GJPA 3ARWA 1E4IA 2YDRA 2WXDM 3ARPA 2DDXA 5A8PA 1JYVA 1LL4A 3AHVA 2VUYA 1PJ9A 2YDSA 5E09A 1GORA 4D6GA 5A6MA 3WUGA 1EHAA 2UWFA 2XVKA 3EDFA 3DC0A 3M7SA 4Z2LA 1JI2A 3CZLA 3ALGA 3M46A 1JDDA 1UR4A 3GBEA 2WVVB 4QP0A 1BYCA 1E1EA 1XCWA 2XSBA 3WMSA 4AW7A 1KR1A 4PUEA 1PZ3A 2CKSA 4MNLA 1WCGA 3AIBA 4OBRA 1PZ2A 1HKIA 1KCKA 2DIEA 1QOXA 1ZS2A 4B9ZA 1RH9A 3VDHA 2XWDA 4AYSA 2JALA 2AMGA 3DECA 1V6XA 4MAVA 4B15A 3D5HA 5CGMA 1V3LA 1M03A 4PMXA 3HMCA 4L4OA 3W26A 1JI1A 4KMQA 2D20A 4OZOA 3ARRA 3BAJA 3G6MA 3UCQA 3VIJA 5I5RA 1UWIA 2W66A 4GPNA 1G0CA 2VRJA 3MUZ1 1E56A 4M80A 4U3CA 4M1RA 1TA3B 5GNXA 4CD7A 1KQZA 1V6VA 4OUEA 2X0HA 5CQ1A 5DO8A 4ATDA 3DHPA 3AZRA 2ZUSA 1CLXA 3W24A 1LLOA 1JD9A 4DUWA 4PRWA 5D8ZA 3WH6A 1ISXA 3HJEA 3F5KA 4CKQA 2ZUVA 3NDYA 3POHA 3K4AA 3L2MA 2EPOA 2CPUA 4J3TA 2WMIB 2DGAA 4N0RA 3WH7A 1QW9A 1I1WA 1WZAA 1GQIA 1JNEA 3K8MA 1JZ3A 4QCFA 3RCNA 1OGBA 5IHSA 1V02E 4QLJA 3THCA 1WNOA 3NCOA 5A6KA 4UOZA 2GK1A 3TOPA 5E9AA 1NH6A 4XUYA 4MADA 3T08A 2VC9A 2CESA 1DWHM 2E9MA 1G94A 1JGIA 2AOSA 1GJUA 2G8ZA 1OINA 4U31A 2QV4A 1E4LA 2YA1A 4CD6A 1XC6A 2CIPA 2WC3A 4TX8A 3VMPA 2VRKA 3W0KA 1HJSA 1KQYA 1QHZA 1WZLA 3AS2A 3BAKA 2J7EA 3RM8A 1XH0A 1R7OA 3J7HA 3BCFA 5IXEA 1UD3A 2V3DA 1UQYA 5IHRA 2J7GA 3PZ9A 3U5YA 3UERA 5FL0A 2EPLX 1VB9A 1R85A 1NWRA 2XM1A 2GJXB 1GQKA 3BXWA 3PN8A 4AZIA 2BY3A 1GJWA 5A8NA 1JZ6A 1DP0A 4UFKA 3CZGA 3G6LA 4J28A 4J3WA 3QHNA 1E5JA 2VOTA 1H11A 1FH7A 1Z32X 2XFYA 1FOBA 1EOMA 4W7UA 1QNPA 4UQAA 5D9OA 4D6DA 3WELA 2OWCA 4H8HA 2E40A 4JHZA 4AZBA 2BHYA 1D3CA 4GXPA 3VGFA 5CGTA 1IT0A 9CGTA 4WJXA 3WQ5A 2OSXA 3WMBA 2OWWA 2VL4A 1WKYA 1KFWA 2W5FA 1Q6GA 3RO8A 5HPCA 1QNQA 1WPCA 3MMWA 1R87A 1CXLA 3GDBA 5CSUA 1GQJA 4CVUA 3VD3A 3ZM8A 3OZOA 2GUYA 1L0PA 4MJ4A 3NSMA 1TZ7A 2ZIDA 5A6BA 3OLDA 1X6LA 3VGEA 2B31A 4FLRA 2V3FA 3ARSA 1NOUA 5HOSA 2D0HA 4F9DA 3A6OA 3AI0A 1I1XA 4PMOA 3OB8A 1BYAA 3T0AA 2WPGA 6A3HA 2VQUA 3VGBA 3SUSA 1B9ZA 4M29A 1J0IA 2BY2A 2DIJA 2BS9A 3L4XA 3VDAA 2GJRA 4MTVA 4XB3A 2DQXA 1B2YA 3EBVA 2E4TA 2E8ZA 3WD2A 3KEHA 4R27A 4BF7A 1AMYA 3VDBA 7TAAA 3EDDA 1CXKA 4HMEA 1HP5A 2VZTA 3NSXA 2CXGA 3ZJ8A 4HA4A 1AQ0A 1CGXA 2XGBA 1HL9A 3WDIA 1GVYA 4PCSA 1O6IA 2VR5A 1PIGA 1FP8A 4W7VA 3FXYA 3VO0A 2YJQA 3POCA 4HPHA 3EMZA 2A3AA 5A3HA 2Q8XA 2JEPA 1PEZA 2J74A 2Y8VA 4MB4A 3T2OA 3APGA 4JL2A 5M03A 1OT1A 2O9TA 2W63A 3ZJ7A 1E6RA 2WAGA 4AZCB 3S2CA 3TTQA 1Q6EA 1W9PA 1J0JA 3VDCA 2BY1A 2J8GA 1C92A 5D8WA 5LA2A 1JZ2A 3ARVA 3CMJA 1FA2A 1HJVA 2WVUA 3ZSTA 4WIWA 4NSBA 5CSYA 5I0DA 1H3GA 5A8QA 3BH4A 1EO5A 2ZXAA 2GK1B 2RGLA 4AD3A 3ARQA 3W81A 2VCAA 2J78A 3GYCA 4AZ7A 5JBFA 2Y8KA 1BAGA 1JZ4A 4FF5A 1UKQA 3FN9A 1M53A 5CXPA 4P7QA 3VVGA 3VIGA 3SEPA 4E2OA 1JL8A 4AC1X 3EMQA 2WZHA 5D9PA 1UOKA 3EDJA 5E0CA 2WZEA 2QHAA 1E4MM 4D6FA 4D1JA 4GKLA 3OLIA 5HNNA 4GINA 3ARZA 1LWHA 4DWSB 1QPKA 1E72M 3ARYA 2EJ1A 1KXHA 3VIOA 1R8LA 1D7FA 1W9VA 4A3HA 4CD4A 5A95A 3PTMA 2FHFA 1PPIA 4NZCA 3L4UA 2GJXA 2DT0A 3MU7A 4UQEA 4JKLA 1LJYA 5E0FA 4TVUA 3WFZA 2G41A 2WKLA 5I79A 2F2HA 2XFRA 3AS3A 1V3KA 5ABFB 4HU0A 4E4PA 1GUVA 1YHTA 1QNSA 1OCQA 3AFBA 2D0FA 3GXDA 4WF7A 3KL0A 4ATLA 3AHYA 5AC4A 3MMUA 5I77A 3VGHA 3CZ8A 1QVBA 3AIUA 4UFIA 5TD4A 2IXUA 4KWUA 1CGYA 4FLQA 1FHLA 3AS0A 4M8UA 1AVAA 2DSZA 3F5LA 4UR9A 3PTQA 2J4GA 4UFJA
chains in the Genus database with same CATH superfamily
2ZFAA 1Y5XA 1OFQA 3FLUA 1MRQA 1UHVA 1S46A 1OB0A 3L2IA 4KT2A 2HVMA 1DWGM 3RRAA 1HF6A 1CIUA 3NQ2A 4UNLA 4DQWA 4JN8A 2V38A 4MNJA 3OHIA 1A5KC 2QAPA 1W9XA 3L66A 3LENA 1H0IA 3AZTA 1BSLA 3TYDA 3SB0A 4C6OA 1V03A 1SZGA 1QOPA 1JZ7A 3C61A 4A8RA 1KR0A 3WENA 1OSEA 1UKTA 4PL1A 3SJ3A 1IZJA 1ZU8A 2VZVA 4L6HA 1VJIA 3HA1A 3VFLA 1NWUA 3ERPA 1GONA 4Y8EA 3BSHA 4UCFA 2FVLA 2TSYA 1GYMA 2DW6A 1OD0A 3IEBA 4REQB 4JIEA 3MSDA 5K9CA 3STGA 1SFLA 5B7YA 4DO5A 4D71A 2XYLA 2PRHA 2OEMA 4ZMGA 1B3XA 4J40A 3NGJA 1KLYA 1KCXA 5LNUA 1T41A 4MLRA 1K02A 4RJEA 3W84A 2B7NA 1DV7A 2P53A 5A6BD 3QYSA 1W5NA 2WSPA 4H6RA 4PMYA 3LCLA 1KXQA 4H8VA 5BRBA 2FFCA 3FDGA 4LYPA 5LA1A 3BGAA 3CHEA 2OT1A 1IWPA 1XX1A 3MJMA 3PFMA 5LA0A 2V8ZA 3KTXA 1ITXA 2WQDA 4U5KA 1CGWA 3EMCA 3SURA 1VH7A 3MP5A 5AECA 4KEMA 2OYLA 4DPQA 3KS5A 4GI8A 2V81A 1HGYA 3VYLA 1PBGA 2W6RA 1SZRA 3W7LA 1HZYA 2P10A 4GH3A 4BQ4A 3ZS4A 2PDXA 4UOJA 2WQPA 3I6TA 3FYYA 3WX7A 2NVCA 2YFNA 4V33A 4C6DA 4PN2A 3RX3A 1H41A 4OHQA 4Q3MA 4M7SA 3GKFA 2NT0A 1VEMA 2GVLA 1ISYA 3W85A 1W5QA 1NWTA 4C5ZA 5C8BB 1CECA 4E8CA 1PB0A 3QFEA 5M3WA 3QQ1A 2Z24A 2FDMA 2EQDA 1DWAM 3A47A 1EYEA 3KL3A 1SFTA 1P0NA 2GGGA 4NX5A 4LSBA 3C0SA 3H22A 1NP2A 1KNWA 3OIXA 3MZ2A 1FDJA 3TV8A 3T42A 4HNLA 1YXCA 1CXIA 4JYDA 2F9RA 1O1ZA 3S6TA 3BQ5A 4JHMA 4PFHA 1VAHA 4E6MA 2X2YA 2F7FA 3ZR6A 3I7QA 4LEQA 4CLMA 5FJRA 2Q01A 4TTUA 2Z27A 1BVWA 2G3NA 4N4PA 1QUMA 4AH7A 3FK4A 3MW7A 4LAKA 1IT7A 2DJXA 2UY2A 4GJIA 7REQB 4F40A 1C7SA 3UJEA 3W2JA 3GHTA 3LB0A 3WLJA 2AL2B 4ADUA 2POZA 5DFAA 3TC7A 1YTEA 1J9YA 2J7HA 1Z42A 3VC6A 4I6KA 2V5DA 4HTBA 2QW5A 2P50A 1W8SA 3KBSA 4HU4A 2E25A 3L4ZA 4QTGA 4GZEA 1Z7AA 3SRHA 5CG7A 3SRFA 4S3CA 4YJ5A 4YL2A 1W1A1 1W5MA 1OX4A 3MV11 2GDQA 2W61A 2DUZA 4KRUA 1VYSX 3N14A 5KZDA 1OC5A 4BQ2A 4X3ZA 4IX2A 3IJ9A 3GU9A 4HZ6A 3SCSA 1XW8A 2AGKA 2H8ZA 2P88A 2QGYA 1CBGA 3DFTA 1EJRC 2QF8A 3KOWA 4PTDA 4G1KA 1FWRA 1E0VA 3C2RA 4M6PA 4UMBA 3PF3A 4QXIA 1YBQB 3CH0A 4C6IA 3BZGA 4H9TA 3UVIA 2FDSA 1ODZA 2OB3A 3MCMA 3FAXA 5HA7A 3TTSA 2A6NA 2NQZA 1O95A 2EPNA 2HE5A 4OOUA 1M7XA 2VR4A 3MY9A 4FNSA 4RR4A 1KFBA 4HJWA 2Z7KA 5EB8A 2RDUA 1S5NA 5HWJA 3V1PA 2ZX9A 1YKWA 3NSNA 5CZKA 3TW9A 4HHPA 4DHGA 1QK0A 4UTWA 3WUFA 3KOFA 1UP3A 1XKYA 2PGRA 4JX5A 4PRRA 1B3ZA 1KTBA 5M1TA 3CB3A 4FNPA 3HPSA 3EOOA 2GGIA 4Z2IA 1PHWA 3SGZA 3K8KA 2DY3A 1KFKA 2YR1A 2GGHA 3KTSA 4JNYA 3GXIA 1U1JA 3LMYA 2OOFA 3VU2A 4AD4A 2OXNA 4C6CA 4L56A 1E55A 3AIRA 3N04A 3ONCA 3P93A 1BWLA 4RCXA 3EB4A 2VFFA 4Z2KA 3STFA 5A6LA 2CNCA 4HMNA 1MO0A 3U5UA 1F6PA 2WK2A 3TR2A 1WQ5A 1YE4A 4JD4A 3CV7A 2OKTA 2VRQA 2HXUA 2YFOA 1AQHA 2VZUA 4HIBA 4KIEA 1T7LA 4GWEA 3SBFA 3CUGA 2PDIA 4FP1A 3S5YA 2B7PA 4IX0A 3VKKA 2PWUA 1OC7A 4LB3A 1RP8A 1VYPX 3R58A 5FSDC 1GHRA 3PNUA 4GZJA 4JQ4A 2HNHA 5T91A 4WOZA 1I60A 2QJGA 3MKVA 4ERIA 3D3FA 3V35A 1XV8A 2BLEA 4KGLA 1XJBA 3KUMA 3MV01 3FOKA 1W3NA 2EHHA 3CHDA 3TZFA 1E71M 3H26A 2D23A 3AIVA 1YNQA 1KRCC 1G7UA 3SQLA 3AMKA 3DYPA 3FHQA 3RITA 3W6LA 3OODA 5FF4A 1PX8A 2V82A 4ZQNA 1KKRA 2X16A 1W2PA 3DYMA 4IPNB 2HBVA 1XINA 4H19A 1ZJHA 4X0NA 3WQVA 1BFNA 1NQKA 3SCRA 5JH1A 4JIQA 3TE9A 4L4MA 2WNQA 4W84A 4OBTA 3CB8A 4R53A 3RDKA 3NQAA 4WSHA 3AU6A 2PU0A 2YOCA 1O68A 1ADOA 4E4FA 3QRHA 4BR1A 1RQHA 3WQ8A 1UOZA 3HQPA 2PLMA 4YPJA 4RW5A 5D09A 3I68A 3F5JA 1GZGA 3EOEA 2J13A 4QE1A 4GK8A 6PTDA 4DNMA 3EZ4A 1JFXA 4R7WA 4YVVA 4AXNA 2CBVA 3RN6A 4IJRA 4UZUA 4WKHA 3H23A 4IWWA 4P7OA 4A8LA 1BVNP 1JAEA 1X7FA 1LT8A 2PCQA 3PG9A 3GO2A 4GUIA 3AXXA 2JK2A 2PDYA 4ACZB 1SUXA 2FB3A 1O12A 3BGGA 1SJCA 3T9PA 3VOCA 3CO4A 3E0IA 4L9ZA 4N6EA 2ATSA 2ZUMA 4QIUA 3WQEA 3WJZA 4DJFC 1VBJA 3N4AA 4EAMA 2OT0A 4GC4A 4DZIA 3MS8A 4UB9A 4F9JA 3EOUA 4LYQA 3AYVA 4OU1A 3P0XA 1BYBA 3CPRA 4NY2A 3IARA 1E6SM 4ORMA 3UWVA 3ITCA 4XBSA 1A5SA 4K3ZA 4RK8A 3W2UA 3UZWA 5LIXX 2ZDRA 2YB4A 1QAPA 5I2UA 3MI3A 5HINA 3NQMA 1GTHA 1EGZA 1AW5A 3GW0A 2YCEA 4S3EA 3HOJA 3QTGA 1UG6A 2OZ3A 3QOMA 5D30A 1VBUA 3KL5A 3CUXA 3LV6A 4NZ5A 4A3UA 1VPXA 3IACA 4JTIA 4X9YA 5CZSA 3A5FA 4O50A 4PSPA 4XQ6A 4TX9A 1G5AA 5AOUA 4GQ0A 4B3KA 3OIHA 2VP8A 3WBXA 1SW3A 1Q66A 3SCOA 1EGVA 3GTIA 4WKFA 1PV8A 4FNRA 5EMKA 1ZB5A 1MYRA 3A22A 5MF5A 4UNKA 2AQOA 4GABA 4GFIA 4PODA 4AD0A 5EPDA 1Z89A 2CITA 3VMOA 2HRWA 3BPWA 1F3XA 3UT0A 5EYWA 3R13A 2PA6A 2HISA 3CIWA 1XF0A 3F4VA 3UXAA 1TZ9A 1DIKA 2UBPC 3PPHA 3EKZA 3THDA 1BTCA 4LBUA 4R7OA 2P8BA 5DF0A 1Z9AA 2VWSA 1EP2A 2A3HA 3ITXA 1IEIA 3WDRA 4J7RA 1TJPA 2H6RA 1Y65A 4HNOA 3DHDA 2F8QA 4GGHA 3K8LA 1UR3M 3HV8A 4O4WA 4HA0A 3RLHA 4JEQA 4FK9A 4MKSA 4YCOA 1J2BA 5DT5A 1BGGA 2E67A 5ABFA 4JFTA 3PZNA 1RPKA 1J18A 1XKJA 4QS6A 2B7QA 3A3HA 2XINA 1NVMA 3NL2A 3PZVA 1XLDA 4Z2HA 1TE6A 3AZSA 2D3LA 2DH3A 1R3QA 3SY5A 4IZGA 1PTAA 4E5TA 4I9TA 3O07A 3BOXA 2Z2BA 1X8CA 3N9RA 1O94A 4K6AA 2WVVA 3UG5A 3DX5A 3AALA 2F61A 1W9UA 4DLMA 4EP8C 3MO4A 1PCKA 2XVPA 3I3EA 3CAQA 3E49A 2ATMA 1PYFA 3KWXA 3M16A 4QQ3A 4Q7NA 1OVDA 3N34A 3HIJA 3RM4A 1L2UA 4X60A 1EDQA 4Q8TA 2JKPA 3UR2A 3HPAA 2C1HA 2H3BA 2PDLA 3SRKA 1LQAA 2VELA 3HM7A 2JEQA 5BYWA 3K13A 3SN1A 4HMDA 3TTEA 2ZTJA 3OBAA 4FMVA 5H8UA 3JZEA 1Q6QA 3NVTA 3GTNA 4RV8A 2E9BA 1TPH1 3NQCA 4Z1AA 4E8GA 3LSCA 4JCLA 2NSOA 4LU0A 3N4FA 4JY8A 4ZSUA 3WLPA 2G0WA 3WUBA 5JBEA 4JXCA 1PVNA 4ILSA 4MZ1A 3TYCA 1XSIA 1EJUC 1SU5A 2PGEA 3TN6A 2UZ9A 3AXHA 3TA9A 1T8XA 4H9XA 3OLEA 3TNOA 4I9AA 1GQNA 2VTFA 4US5A 1UWTA 3O8AA 4JN6A 4V1XA 5D9NA 1L6FA 2EJAA 3LTYA 1TQJA 2ZZ7A 1Q65A 5FOOA 2FZNA 4A3YA 1C7TA 1GG1A 3MMTA 3UZ5A 3SO7A 1KFJA 3NDOA 2FH6A 3OGSA 2OKOA 1FKXA 1XQKA 3S9ZA 4P5UA 3TA6A 3V0SA 5I3JA 3ARXA 2X30A 1E3ZA 4UTTC 3LN3A 4F8XA 2WC7A 1FY6A 2XWEA 9RUBA 2WO5A 4F2BA 4EACA 3WD1A 2R8WA 5A8MA 1EF3A 2YXGA 3N2OA 2I7GA 4R9OA 2CBJA 5BXTA 5A6AA 1VYRA 3LLDA 2CHRA 2Y5JA 4RDWA 3GTHA 2D2HA 4YU1A 1JCMP 3QQWA 3ZZ1A 2IQDA 1JR1A 3NQEA 1YXDA 2WCSA 4WOQA 3QW3A 1ZRQA 5F1UA 3W1XA 1PCWA 4FXFA 4J4KA 3VIPA 5LNVA 4LVGA 2PODA 4AEEA 3QC0A 3W76A 4NRSA 2OEJA 1OK4A 4GUGA 1IZKA 1VIZA 4PUKA 3WL1A 3CQJA 2OQHA 1LG2A 3OJGA 5M2FX 3ZO9A 5GJMA 2RAGA 2XH2A 3HPZA 1JPIA 3AO0A 4R34A 2PWDA 4HHLA 1JPHA 3BLDA 3K5XA 3CBWA 1IGWA 5ABHA 1NAL1 1E6XM 4M82A 4CVWA 3TXVA 3EDKA 1H61A 1V6UA 4QM1A 2NXGA 1DHPA 4HMCA 1NSJA 5FEPA 2GL5A 1P0EA 2EAWA 2B81A 3WDPP 5LXXA 1WZKA 1HJUA 2J7CA 1CPUA 2FMOA 1P4CA 3N2BA 3QSRA 1OG6A 4ZL1A 4IIHA 2J27A 1S5VA 2WMIA 4BHYA 4MNMA 1E6QM 4Z17A 2XVGA 3K46A 5BU9A 2WB5A 3OBKA 1O5XA 1XPYA 3W2LA 3WF2A 2DVXA 2OR2A 4JS3A 3CL7A 1IGSA 3PR2A 1EYWA 3GX9A 1LUCB 1JXJA 4OJYA 4DELA 3T0BA 1FWHC 1B5TA 1QT1A 2NV2A 2C8NA 2C3ZA 4NF7A 4M56A 3P7YA 1HJQA 2O92A 3OG3A 4P8VA 4AMAA 3BE7A 3H54A 1UIOA 3BLOA 2QJIA 4MYXA 1L6YA 1XUUA 3C5QA 2VX4A 3NM3A 3WYZA 4V1YA 1W37A 4D2JA 3DZ1A 4IFKB 3UR5A 1W3TA 3BTNA 3HPFA 4XK2A 4BK9A 3P74A 1LORA 3EWUA 4C1LA 3DIPA 3K4DA 5DRIA 4HHHA 3WF0A 2V68A 4O12A 1EGMA 1F4HA 4A22A 3VD4A 2R1MA 1LRQA 1LWJA 2CBUA 3LY0A 3UA3A 1H63A 1W31A 1XIFA 4A21A 3N6JA 3OA5A 3M0ZA 3TSDA 3EX6A 4YYCA 1WXJA 4BWLC 2V0TA 2GZXA 1BYDA 3ARTA 4R33A 3VTRA 3RF9A 4G7EB 4HTYA 3BK0A 1VBRA 5CC3A 1JZ8A 2OO0A 2OLHA 5DN1A 7CGTA 4YWIA 4DEFA 1CDGA 4GIEA 5F4XA 3O16A 5AVHA 5HUOA 4P2VA 3HQNA 4E2BA 4GBDA 1LL6A 1BG4A 4JTAA 3GXMA 3GG8A 4GXWA 1P0BA 3FA5A 1BLIA 1EA9C 1ML1A 1XIMA 1LLWA 3SY8A 2YL8A 3M7WA 3SIZA 4NI8A 1J01A 1C8XA 2PLKA 3RU6A 3TU9A 4JKMA 2DT2A 3EX2A 3L4TA 5I23A 1JDCA 1ME9A 1TVPA 3QR0A 5AHEA 3PZQA 3KVKA 4KS0A 8A3HA 3LPPA 5C6MA 1UZ1A 5E6YA 3W72A 1OT2A 2F84A 2Z1SA 2WMFA 1SR0A 4NJKA 4GUFA 1AA1B 3F4CA 1Q85A 3LMZA 3VUSA 1SSDA 3CUIA 1OX5A 1PDZA 3O7UA 1WB0A 6XIMA 1RD5A 5HUPA 5H1WA 3A13A 2AMXA 1ISWA 3FHAA 3VAVA 1VFTA 3G77A 4RZ6A 1WO2A 1XLFA 3VMNA 3NXFA 4B91A 2NQ9A 3JZUA 4O1AA 4WDWA 4X2PA 4UTMA 2UY5A 2XM2A 5HMSA 1YNPA 2ZRWA 1R46A 1WOBA 4CUCA 6CGTA 9XIMA 2X1RA 4OT7A 2NWRA 3H2FA 4IIFA 1W1VA 1OZMA 1V6YA 4O16A 1BD0A 2A3LA 2IS7A 3TWBA 2ZXQA 4Z1CA 3KBVA 1NARA 2O7SA 1OK6A 1DXFA 4I7UA 3ONBA 1A3HA 4PYSA 3LYEA 3IIOA 4IQEA 1W9BM 1UR1A 5I09A 3WFLA 3WK2A 1E15A 4S3AA 2O55A 3MCOA 1KCZA 4A8NA 1DWIM 5KZMA 3H53A 1UD8A 3WLSA 3OVGA 2HPMA 1E9YB 3SQSA 3AICA 3S1UA 4M51A 2BFGA 1SYTA 5K2ZA 2I1OA 2VXNA 3VXGA 3O63A 3AMDA 3WNOA 4OQVA 4ZOEA 4XAGA 3SCQA 2GJPA 2WXDM 3IGXA 3GIQA 5PTDA 4H6EA 4ZB5A 4Y9AA 2W79A 2C6QA 4C6KA 5E09A 4XAPA 1GORA 4D6GA 4WEVX 1EHAA 2G96A 5SWUA 1Z48A 3ALGA 1SW7A 2G97A 3TQKA 4ZZ9A 3M46A 3TN5A 1LTDA 3VA8A 3NVDA 3L0KA 3CXOA 4PRTA 1KR1A 1AK5A 3WLIA 7REQA 4XO6A 5DRCA 2PURA 3NGFA 4MNLA 3S1WA 3AIBA 3BWWA 3O05A 3DBPA 4OBRA 4IPPA 2QKFA 1EJWC 2DIEA 4C5YA 1G7VA 4YIWA 1EWDA 5FF7A 2PE4A 2JALA 3GC2A 3TMQA 4MAVA 3D5HA 1M03A 4PMXA 3E2VA 4JOMA 5MHBA 4L4OA 4H01A 4DJDD 1XFBA 3UCQA 1OYBA 4IIEA 4FNUA 3TJIA 3CUZA 3UJRA 3MP4A 4Q8PA 1DJYA 3LS9A 1KFEA 4M80A 4U3CA 1QRQA 1TA3B 5GNXA 4CD7A 3VOHA 3CEUA 1KM3A 3GVWA 3KWSA 2X0HA 4OUEA 5FEWA 1YDYA 5CQ1A 1PXGA 3U9IA 2VEMA 1JD9A 1RA5A 3V0UA 4DUWA 4JTTA 1SZNA 4NJJA 3F5KA 3DGRA 1Y5WA 4JDBA 1HKVA 5D2XA 1NF0A 1VP5A 2IKGA 3PY2A 4XZHA 2CPUA 3V18A 1JCXA 1IIHA 3VKCA 4LAMA 3NXLA 1GQIA 2D69A 4MZ8A 4QCFA 2YCLB 1OGBA 5IHSA 4QLJA 3G1HA 1WNOA 2X41A 2CWXA 1R2TA 2GK1A 4BEUA 1NH6A 4QG8A 3D0CA 3LHUA 3T08A 4BY3A 1LOQA 2AOSA 4ZODA 2VGBA 1AW2A 1OFAA 3KRUA 1XC6A 2NLYA 2A5HA 2RJHA 1WZLA 3AS2A 1XH0A 3TCSA 4IUOA 2PD5A 1F3WA 1PTDA 5HATA 3QC3A 3MO7A 2ISDA 4LF2A 3WLLA 1M3UA 2PDWA 3W1RA 2XM1A 3NZRA 1KM0A 3BXWA 2Y61A 4PH6A 1FWGC 1GJWA 3KCLA 1DP0A 1QWGA 3KVJA 3M0IA 5CC6A 1E5JA 2VOTA 3S5ZA 3ZXWA 1FWDC 1VCGA 5D9OA 3NQGA 2JGQA 4UQAA 4I8DA 3P60A 3EWCA 3ITVA 1U22A 1M7JA 1HQTA 4XVEA 1BRLB 2PDBA 1D3CA 3NPUA 4FXRA 1K4GA 3WQ5A 4YLWA 3WMBA 2OWWA 1TYGA 3VZZA 3WJWA 4F4RA 2W5FA 2HE8A 1Q6GA 4L64A 4UMCA 3PC0A 4O1FA 2Q8ZA 1R87A 1CXLA 1GQJA 5DELA 3L5LA 4CVUA 1WA3A 1WAUA 4O1BA 3TSMA 3LOTA 3W7RA 4XBJA 2C13A 3WBWA 1R3WA 5A6BA 5KINA 3OLDA 4FLRA 3RLUA 1NOUA 3NPWA 2DZWA 2EKCA 4PMOA 1HFBA 3T0AA 6A3HA 3RX2A 3KCOA 2F6XA 4Y96A 1GT8A 4RLIA 2DZAA 1RY8A 3L4XA 4IP5A 1EIXA 4NUWA 3ES7A 2C91A 2E5BA 2C16A 4AHQA 2XSXA 2UV8G 4LCQA 4HT3A 4XD5A 3T0CA 3DUGA 3W7GA 2JKEA 3EDDA 1HP5A 3NSXA 3OZMA 3Q94A 4HA4A 3T78A 3LCXA 2IQ0A 1IYXA 3DH7A 3NZ1A 1BKHA 3WDIA 4H2HA 1O6IA 3PM6A 5ABTA 3FXYA 2BOEX 2YDAA 3VABA 3TYAA 4FAMA 1M65A 1WV2A 1KA9F 4MMWA 3S5SA 4E3TA 4MY1A 4O8AA 3IK4A 1T0OA 3ZJ7A 3E38A 4FOJA 3VK5A 1ZJIA 5DX7A 1F76A 5AHIA 2I14A 3AC0A 5D8WA 1OFOA 1SO6A 3CMJA 2WVUA 4KCTA 2B0MA 4O8RA 5BNKA 1W8GA 1H3GA 2FPYA 3UA4A 3EEZA 2GK1B 1O5RA 3P80A 3NAVA 2BZNA 2DZUA 3TLQA 4O14A 3ARQA 3V0TA 5G4EA 3B8VA 4MUPA 1UKQA 1XYLA 2FGBA 2JGYA 5A6TC 4P7QA 3SEPA 3SZ8A 3KHJA 4AC1X 4PGLA 1REQB 2WZHA 2CXEA 5KZEA 3FJ4A 1I9CB 2WZEA 2W0UA 2QHAA 4OVXA 1OEPA 1YADA 1OFEA 3OLIA 4GINA 2WSRA 3ARZA 5FESA 1QPKA 4IJBA 3VIOA 1RV8A 2Z1XA 2NQLA 3H2OA 3PTMA 1XUZA 3TYBA 1X6UA 1I4NA 5E0FA 5DQPA 4ICCX 4TVUA 3TDFA 2WKLA 5I79A 4L5ZA 2F2HA 3Q2DA 3T55A 1V3KA 5ECVA 3M4HA 3HV9A 3PFRA 3AFBA 2D0FA 3A21A 3UGVA 5AC4A 5I77A 3VGHA 3O6DA 1XG4A 1T99A 2E7FA 4LUSB 5TD4A 2WSYA 4UR7A 1G69A 1UZHA 3SFWA 2DSZA 2I5GA 1ZP4A 4UFJA 1YEYA 2E0PA 3BLEA 4JTJA 3D3AA 1SZEA 1JUEA 3LPGA 1OD8A 1UJQA 3WLQA 2QCLA 2GVJA 2XJ7A 3UG4A 4EPDC 3P0WA 2JFEX 3QR1A 1IR1A 1C9DA 4NNCA 2DJLA 2A6LA 4BWLA 4FLOA 4DO6A 1AG1O 5K4XA 4GRSA 5AYXA 3G0SA 1PL9A 3ICJA 4HK5A 4O15A 1BPLB 1H49A 4E2VA 4ERAA 2QDHA 1FH8A 1JVNA 3NA8A 1U2YA 2X1IA 2QUUA 3O0FA 1FWJC 1O66A 3T4WA 3WK1A 4ZE5A 1SFJA 1DE6A 1PSCA 1O5KA 3STCA 4P7NA 4QR6A 1M5WA 1HO4A 1FHDA 4US6A 3QV6A 4GUHA 4IPIA 4KPLA 4ZFCA 3E12A 2WVSA 2A7RA 4Y2WA 1TPC1 1FKWA 3E2SA 1PHQA 4KWSA 3A9BA 1LP6A 4G8TA 2QNEA 1CXHA 4H7VA 5EMUA 3PUDA 4GQQA 4LQ1A 4J1OA 4RE4A 3ZT5A 1V6WA 3W28A 1US0A 2J8FA 3WZ0E 2VX6A 2AAAA 1D3HA 2R9RA 2DEPA 3B8DA 3T09A 1LT7A 4AIEA 4I7WA 1H5VA 3TYZA 1ZJAA 2ABBA 3T2PA 1U83A 2ON3A 3M5YA 3AHZA 1I6NA 3GE7A 2X05A 3QY7A 5BXPA 1IEXA 3TYEA 1CXEA 4P8WA 5DMYA 1ZZMA 3KLKA 3B0VC 3MBFA 2VZOA 4IXHA 3SW6A 1P6BA 2VX7A 2VCCA 4GQBA 1MI3A 1OFBA 5LIUX 2VJXA 1DJXA 3W6YA 2ZADA 3RYSA 3B06A 4JQ3A 3FEMA 2OODA 3VILA 1K6AA 2Y5SA 1J4EA 4GQGA 1TPUA 2VEKA 3GU1A 2X0YA 4CCEA 3E5PA 1FWFC 4J2PA 5G2IA 2C15A 3H2MA 1TTJA 4AY1A 3PWGA 3CAVA 2J8TA 3BDKA 1SMDA 1SM9A 4MVAA 1VZWA 1PS9A 1FWEC 1KC7A 3CH9A 1EDTA 1TCDA 4WDTA 4Z0JA 3XIMA 3MI6A 4P8UA 1UD6A 2R1PA 3M6DA 4BI5A 1SPQA 1ISVA 1KM6A 2G95A 2YKKA 2IPFA 1V0NA 2E9LA 1E6ZA 3NJ3A 4Z08A 1EUNA 2W62A 4I3GA 4YNGA 2DZVA 3EAUA 4GNJA 5LZLA 4RDYA 1W1YA 4JTDA 3DOPA 1KGWA 3TXZA 4EX4A 1FWBC 1TPEA 3TVAA 3IJ6A 1E9LA 3UJSA 1VFFA 2ZZ6A 4W87A 4U28A 5EU9A 1GYNA 1V8EA 5F4SA 5JH2A 1C3FA 1HP4A 3STEA 3DFNA 5BW6A 1MFVA 2A3CA 3TTOA 2HROA 1R5YA 1FXQA 4FX6M 3W3OA 3KS6A 1GPFA 1ODUA 4V15A 3WFAA 4QAIA 1CEOA 1JIBA 3N1AA 4HSHA 1IF2A 3M0LA 4QSHA 2Y89A 3PULA 4W88A 1UQZA 1ONRA 1IQ8A 5G2WA 4J3XA 5M17A 4FR6A 2PDFA 3GSMA 4N9DA 1WDSA 3PBGA 1XRVA 5HANA 3FY1A 3LK6A 4XD6A 1NJJA 3NM1A 4N6FA 1VIWA 5A2CA 2BNJA 2QIWA 4TMBA 2OYMA 1LQ0A 4DF0A 1AFSA 3NIYA 2WHLA 3CAKA 4UTTA 3W7NA 1QO5A 4NT0A 1VENA 3T6CA 3RO6A 3LD5A 4ZQCA 3JVAA 5BRQA 1MUWA 3JR2A 4GI6A 4RZ4A 4CU7A 3WO8A 4AC7C 2VGGA 3PUOA 1HKKA 1R3YA 5M5DA 1LQ2A 1UMLA 2PAJA 5DBTA 4AHPA 3EDEA 2ZWZA 5HXMA 3W88A 5KTLA 4LAZA 4B2DA 3IS4A 5AVNA 3G8RA 4IISA 1MFUA 1BF2A 1K7EA 4XAYA 3E6EA 4RZBA 3ZMRA 1I0BA 4GY0A 1JUKA 4Q22A 5IFPA 1KXVA 2WBGA 1NOFA 2PDKA 1EX1A 4QROA 3CHFA 1KV5A 3F4NA 4D6IA 1ICPA 4JTRA 1HNYA 3WLOA 1K1DA 3N6HA 5EBUA 1TMLA 3AUJA 2WNWA 1QASA 1S5TA 5C9WA 1GOKA 4XTIA 2RH9A 4XSLA 3W71A 1UR9A 3GH5A 3TCEA 2XG9A 3FJNA 4Z2GA 3FGCA 3G5EA 1YPXA 2R82A 4FR1A 2ZC1A 4CQAA 5G1TA 3GFXA 2Z1KA 4JEJA 1EEPA 1IWAA 4XWUA 2DV0A 3ZOAA 3C56A 3MHFA 4NZ1A 3DESA 4LXFA 2RDXA 1D2KA 1TELA 3U57A 5A2BA 2CLLA 1N8FA 4S38A 1DIDA 1OFRA 3ABOA 3VNIA 3B8UA 1RPXA 1NF7A 1LBFA 3C86A 3M0XA 3FS2A 3FVDA 4M19A 3U3HA 2ZUWA 5FEXA 4WKAA 1IV8A 3A9IA 4DUVA 3YPIA 2FZDA 1B57A 1KB3A 3ZQ9A 1ZFJA 1TMQA 3AHXA 5FF0A 4C1NB 3M0MA 1H5YA 4HCHA 2DZTA 3CUFA 4L6DA 4CNOA 1FWSA 3MWCA 3SIMA 3UWZA 2R24A 5L6UA 3RU8X 1RQEA 1GEHA 2G3MA 4X22A 4IGNA 2OJPA 2X1SA 4UIOA 1IR2A 3DU0A 1XBYA 3UZJA 3IRSA 3VM5A 2CETA 4PTXA 3L4WA 3BAWA 5D9MA 4WHBA 2ESCA 4QNEA 1F4AA 4HPGA 5BWFA 3RRXA 2CKRA 3MSGA 1JD7A 5I6SA 4PMDA 2A4AA 4CNSA 5A94A 5HNUA 3E0FA 3UPBA 4GYJA 2VEFA 2ZX5A 1OF8A 4FXJA 1MW0A 1AQMA 3VNYA 4WD0A 2XZ7A 3UP8A 1MNSA 3GKAA 2Z00A 3KBNA 4ZOCA 5A8OA 3CU2A 3HN3A 5C9UA 1GZ1A 2E6FA 3K1DA 4ML4A 4YWSA 4DWSA 4RDZA 2GSHA 3CZKA 3PJWA 4TVCA 3R11A 3WDQA 1XIHA 2WLYA 2BV9A 2CLOA 3VCNA 3RCMA 3NWRA 3AHTA 2J7BA 3B9NA 4D6CA 1HVQA 4DJEC 1NDYA 1WXZA 3VZYA 3UBPC 1TJ1A 5I06A 1H4PA 3WQOA 5AHNA 5TQLA 1J6OA 3OYZA 5DY3A 2OPJA 1NEYA 2WM0A 1KRBC 1IEQA 2IUZA 2VUNA 1ZBVA 4LCSA 4ZCWA 1Q7QA 4I5RA 1ECEA 4Q4MA 2EEXA 2PDUA 4IOTA 3H7VA 1Q4NX 4UQ9A 3LXCA 3FKKA 2DVTA 1GG0A 5MKGB 4LBSA 4XAFA 4FX8A 3ABQA 3V1HA 2QUMA 1XLJA 2PUZA 5HK4A 3A4JA 3GH4A 3GNXA 5A69A 2HVNA 3WN6A 4HCLA 2YCJA 3T8LA 3IJ7A 2I57A 3DEQA 4XZWA 2Q3RA 3KDOA 3UETA 3VGDA 3FGCB 2PWHA 3U48A 2CLIA 2YIHA 1AL7A 4H9YA 1VHNA 3WBEA 3KTCA 3AYSA 1GPWA 4ES4A 1NTHA 1F8IA 3B40A 4HZMA 3CUHA 3VX1A 4JYFA 4GYPC 1TMHA 3LG3A 4K7VA 1J0ZA 4Q6XA 1EB3A 4C1NA 4AFYA 3USZA 2HTMA 1K8XA 3I10A 2GDVA 4IG2B 2NV1A 4QSFA 3VINA 3W1PA 4KFNA 1CNVA 1UZDA 4RE2A 3HFYA 1E0WA 2AQWA 3WF4A 2O4MA 1L6WA 3CIXA 5DMNA 1C9WA 1GZJA 5I3IA 4Q4RA 5FKYA 4W5UA 1CB2A 1R7AA 4LNCA 2VM8A 2ZRVA 5IDIA 4NASA 4K1GA 1T96A 3C0JA 4QITA 3V5FA 1IZCA 1NFBA 5HMDA 4KFPA 4CCCA 4I5XA 1FRBA 2I9UA 4ZEPA 3ZSSA 2O0TA 5ABGA 1VRDA 1XLIA 2AKMA 4LALA 3IUIA 2ZX6A 4IIDA 4UTWC 2V30A 1EQPA 4ZQPA 3CMFA 3MKKA 2XN2A 3EOLA 3I6EA 4JYEA 3NZQA 3F2CA 2YDQA 2YCKX 3UESA 1TWZA 3B3DA 1JF5A 2WV8A 4Q33A 4QLLA 3WQGA 3GC5A 3TKFA 3GNNA 4AYGA 4UQCA 3MBDA 2QIIA 1E0TA 2BHZA 1C93A 1K3UA 1GWJA 3WLKX 3GWQA 2AGTA 4TXEA 4Q4OA 5D2VA 3WH8A 1H7XA 1JF6A 3WEZA 3EWWA 4U2ZA 3TH6A 3URBA 1VJZA 3N25A 2A0NA 1S38A 1GOIA 1KRAC 3IPWA 3T44A 1TWDA 1QI3A 5XIMA 1F8MA 4UFHA 1WKFA 3VPLA 5G2HA 1PTGA 4ONVA 2QS8A 2OQYA 2XUCA 3LRMA 3KDNA 2GYIA 2V2DA 2CCRA 3RILA 3D47A 2HS6A 4IFKA 5EMYA 3SGUA 4H7ZA 3WDJA 1Q63A 2MNRA 3PBVA 4DXVA 2V5LA 3RMEA 2PU1A 1XS2A 3SCVA 2E5DA 4Q4KA 1VJSA 2X09A 1VBGA 2NXHA 3U6WA 3EWZA 3S2LA 4E0CA 1KM1A 3BAYA 1VC4A 1KKOA 4MNKA 4LCRA 2WMHA 2TPSA 5BMXA 4XAZA 2OTDA 2NSXA 2JBMA 5G4WA 1R6WA 4KEUA 4UQBA 4H6KA 2DSWA 1A5AA 1LRTA 3H12A 3M0VA 3A4AA 4AD5A 4BQ3A 4H41A 3ZJ6A 1G1YA 3HGJA 4MY8A 1AH0A 3N17A 1W3LA 2ZKMX 5AYBA 5HDRA 3L21A 1ONEA 2WW5A 3M0HA 1I2OA 2HPIA 2L5HA 4AY7A 2QCDB 3NOEA 2DSVA 2QJJA 5CZJA 5FF3A 3H2AA 2WNNA 1EZ2A 1KGXA 3GTXA 1P0KA 4GIAA 1G67A 3LTSA 4GI9A 4N42A 3AIQA 3EEGA 1MW3A 4PCPA 5DCBA 4N4QA 4UTFA 4ZE4A 4W89A 3B4UA 3S8HA 1YMYA 3EA3A 3G1XA 2OX4A 4IHCA 1TR1A 3BANA 3KZPA 1DTUA 2Y7DA 1GOOA 2F6UA 1KBIA 1HG3A 1V0MA 4DZ5A 5BRPA 5LYRA 4U3AA 1Q6DA 5DLCA 2QCEA 1K8YA 3N9SA 4Y8FA 3VDGA 3RPDA 4L1WA 4OUIA 2ZX7A 5AHLA 3E0VA 3KBJA 4OTKA 2WWDA 1UC4A 2PDQA 3HURA 4PTVA 1E5NA 5AY7A 3QXBA 4NAFB 3GDLA 1E9IA 1OCJA 1FCBA 1JCJA 2VD8A 1V3JA 1LOLA 2E09A 4RKAA 2PLJA 3T40A 3LHTA 4EANA 3W7JA 2FTYA 3KZSA 3ABRA 3QN3A 3M47A 4XZLX 4MPQA 3VKBA 1CTNA 3MQTA 1XRTA 1V0KA 2G37A 5I24A 2GVYA 3PVFA 2EG6A 3AROA 4XIMA 1B90A 1UMYA 3GDTA 3F2BA 2Y8UA 4PMZA 3T2QA 3P6LA 1HTIA 3D6NA 2JF7A 1FFQA 2GGJA 3URNA 4OOZA 2DUXA 1TO3A 1P1XA 3PP7A 2XFFA 3SN4A 3FW6A 4CEXC 3CQKA 3AMGA 3S1VA 4JFVA 1K9FA 2E6DA 4MYAA 3AUOA 1GTEA 3GAKA 1TRDA 1Q2RA 4H83A 4O52A 1OABA 2PB1A 3LM3A 4ZXOA 3GFYA 2WSKA 1I2RA 3IJIA 1TZZA 4HZ8A 2VCBA 3KE0A 2V67A 2P0OA 1ZJBA 3B0YA 3AMLA 1TPB1 3TSBA 1HX0A 3TR9A 4NAEB 2PPGA 2VI0A 1T6MA 2XPKA 3N73A 1U33A 4YTRA 3WY1A 5CJ5A 3TYUA 1R2SA 4YYFA 1PO9A 1X39A 1WUEA 3G1VA 1KBLA 1M68A 3N2XA 1FTXA 4GY1A 1F9CA 3PS7A 5HQMA 5EGRA 2FQIA 3G1DA 5TF0A 1NWSA 1MMFA 4OECA 4HSOA 4C7GA 2I16A 2PC8A 5KSWA 3RCYA 4C6JA 1S2VA 3VNJA 5HMFA 4U33A 4P7RA 2OGYA 2G4FA 4TR9A 4OKDA 4XVDA 3BW4A 4LUSA 3TTYA 4DLFA 1UP0A 4S3GA 1PIIA 1RQBA 3URQA 1KWGA 3NL5A 4FS9A 2BOGX 1JGMA 2V3GA 3L4YA 3LV5A 4MWAE 4AWUA 3CPGA 4GNKB 1J0KA 4LC6A 1CLKA 1BWKA 3AIEA 4NKCA 1KGUA 3N2TA 3NPXA 1XG3A 3PSVA 3CT2A 4EKJA 5LNRA 4U10A 3FIGA 2J24A 1EEXA 3W86A 5DEZA 3GW3A 2WMKA 1LYXA 1DIEA 1UR8A 2AKZA 5GVJA 1P7TA 3KFTA 4B5NA 1K7FA 5ENLA 4MG4A 1QHPA 4GO8A 1JJKA 1V08A 2VURA 4PR4A 1Z44A 4NNBA 4HVXA 3GNRA 2REQA 3RLGA 1SFSA 4FLSA 3TQVA 4Y9PA 3W37A 4BCEA 2WMJA 5E6ZA 2BGNE 2VC6A 3N13A 1MDRA 5I03A 3UG8A 3TNBA 2VX5A 5FCZA 3S9YA 3DG3A 3BMWA 3T4CA 3UR8A 4EPEC 1TIWA 2EO7A 1TG7A 1Z3NA 1GCYA 4QLKA 4MWAA 1VQTA 3GTFA 4UQDA 3NQ8A 4ZGYA 1GW9A 3CPUA 3Q65A 3SUUA 1A5UA 4R85A 1X6NA 1Q6LA 1AZ2A 2J25A 3BG9A 4G1NA 4ZBCA 4W85A 5G4HC 4HQVA 4JTGA 1POKA 1HXJA 3SCPA 1B9BA 1GVIA 2C1IA 4GI4A 1XFCA 5I78A 1W5OA 3WMCA 3KHDA 1B0IA 3IJ8A 1TTIA 1V77A 1NP0A 4W86A 3W7EA 4GLEA 3TUUA 5C2XA 4LT9A 3JUGA 1EF2A 4AX6A 3ARPA 2DDXA 2VGFA 3QKEA 3AHVA 2VUYA 4LEFA 1PJ9A 2YDSA 1XLCA 3WLRA 4AQLA 5A6MA 2OLSA 2XVKA 2BDQA 3P8JA 4Q8VA 1JI2A 3CZLA 4KESA 4A2RA 4FXSA 4KCWA 1A80A 4O0QA 5CAHA 1NDWA 2Q6ZA 2QUTA 4R3UA 4EPKA 3WMSA 4AW7A 4PUEA 3BUVA 3FYPA 2MUCA 3QFWA 1QATA 1TV3A 1TJ2A 1A49A 1WCGA 1IXPA 4IQLA 1H7PA 3E74A 1KO0A 1RH9A 3ME3A 2AAMA 2XWDA 3LLFA 3VDHA 1XR2A 1V6XA 2PRLA 4KWOA 3PJXA 4F0KA 2Z6JA 3OBEA 4YTTA 4A29A 1XISA 1UWIA 2W66A 4ZQMA 4GPNA 2NQJA 4Z1YA 5TBOA 2VENA 3TAOA 1FCQA 4QS5A 5DXXA 2XH0A 1V6VA 3BLLA 3HTWA 2DFAA 3DHPA 3SQMA 2ZUSA 4AWTA 4PRWA 4D8LA 4UCGA 3NZPA 4FEZA 3ZVHA 1H7OA 3HJEA 4MWAC 1NFPA 5C7VA 1XGDA 3MB9A 3FJLA 2ZUVA 4LB4A 3Q4DA 3B4YA 3K4AA 3WQDA 4TIMA 3D46A 1XP3A 2J6XA 1MZHA 3LBOA 2FYMA 3P84A 1NFGA 4Z0SA 4ZSTA 1QR7A 4M5PA 4Q4SA 1I1WA 3EGJA 4KERA 1JNEA 1OG0A 3EXTA 1JZ3A 3DGBA 1KM4A 3F4WA 1A5MC 1XC4A 1EL3A 5A6KA 4UOZA 2PCEA 3LBCA 1EJVC 1OY0A 4XUYA 3HQOA 2CESA 2Y88A 4Q8MA 2REQB 1XXXA 1E1CB 4O1DA 5HWMA 1GJUA 3IIXA 1E4LA 2YA1A 3LZ3A 4H8NA 1EBHA 2BSLA 5IOBA 3UNDA 1KQYA 1QHZA 4K38A 1A4LA 1P43A 2CZFA 3RM8A 5CKSA 1R7OA 2CZ5A 2B4GA 1UQYA 1TR9A 3LHYA 5FL0A 3N29A 1ZNNA 4JTEA 4NZFA 3ITLA 2HK1A 3IUHA 4DXXA 1Z8AA 5A8NA 4GVHA 1UPPA 3JRKA 1FWWA 4J3WA 1H11A 2ACQA 1JCNA 1TJRA 3CS2A 2XFYA 1FOBA 4W7UA 1NU5A 3FX4A 4D6DA 3W02A 3NQ6A 3T0TA 5AB3A 1B3OA 4MGGA 4AZBA 1ZCOA 3BQ6A 4IT1A 5BOEA 5CGTA 4C6MA 1IT0A 9CGTA 1WDDA 4S2CA 2VL4A 1L6SA 1KFWA 2OOGA 5MKGA 1K03A 3EX3A 3RO8A 2FJKA 3KOZA 5I00A 2YXXA 2ALDA 3KOYA 4MIMA 3R8RA 2HCVA 1TX0A 5LGZA 4B5WA 3KP0A 4Q7BA 4GCXA 7ODCA 4AVFA 2EF9A 3OZOA 3L5AA 4MJ4A 4R7JA 1XI3A 2HSAA 2ZIDA 3STPA 4AAJA 2B31A 5AFDA 4JQ2A 2AL2A 5CCZA 3KP1A 4F9DA 3G1AA 5I3HA 4DB7A 1X98A 1I1XA 3OB8A 1BYAA 4FZIA 4AG0A 4LV9A 2WPGA 3FVMA 3R0DA 5D2TA 5REQB 6TIMA 2VQUA 1YNYA 3RUBL 3CM4A 4C6PA 2BY2A 3MP3A 4DRSA 3GQYA 5TAOA 4WXZA 4F0SA 2OELA 3WCZA 2DQXA 4R27A 1J2WA 3E2RA 3B9OA 2GOUA 4BF7A 2NX9A 4X63A 1CXKA 4HMEA 2C0AA 2CXGA 3ZJ8A 1F61A 4X2RA 4C91A 3CQ0A 2XGBA 1TWWA 1HL9A 2NVAA 4IMEA 1TUFA 1DXIA 3KAOA 2VR5A 1PIGA 3B97A 1QTWA 4JIPA 3ZWSA 1K8ZA 3UWYA 3ITGA 1WKEA 2VDHA 3ZWTA 1ZLPA 3HGSA 3C0QA 4MB4A 3T2OA 4LWWA 5HJYA 3UJ2A 4JL2A 2GUBA 2GVEA 1OT1A 2W63A 4UWMA 1V6TA 2WAGA 4LJ3A 4WGXA 2NV9A 3QY6A 4DBWA 1Q6EA 1W9PA 3KRBA 4C6EA 1XQLA 2BY1A 1MZRA 1C92A 2OFJA 1A5CA 3ARVA 1HJVA 3DENA 2VDIA 4HGXA 2RFGA 1J96A 2C14A 5CSYA 5I0DA 3TQ0A 4I6VA 4MKVA 5A8QA 1EO5A 1PZ0A 2PDMA 2ZXAA 1XLHA 3RR1A 3TAKA 4GMEA 1TTQA 3SECA 2J9XA 5B80A 4TQTA 4IL2A 3W81A 3CYJA 4BKNA 3CTLA 5JBFA 4AZ7A 1BAGA 4WVXA 1JZ4A 5CXPA 4FNQA 5C5YA 1BQGA 2Y1HA 5D9PA 3EDJA 1QPNA 4EWND 4GKLA 2C71A 1ZCCA 2ADAA 3LNMA 1E72M 2EJ1A 1MEHA 3IVSA 4L1XA 1D7FA 1W9VA 3SAZA 3INPA 1PPIA 3MU7A 3GU2A 7XIMA 1LJYA 2FPVA 4F3HA 2V63A 1JULA 2G41A 4PBEA 2QUVA 5ABFB 4HU0A 1GUVA 4FPSA 4LOCA 2ZZ3A 3S0CA 2QUNA 1QNSA 4AIBA 3GXDA 4ATLA 4CQCA 1X7IA 1XIDA 3AHYA 1QWKA 5LHFA 3A24A 3AIUA 2BGSA 3O06A 4PB5A 4NXKA 1NIUA 4IMGA 4KWUA 1CGYA 1FHLA 3AS0A 4M8UA 1AVAA 3PTQA 2J4GA 1A5BA 1SJAA 3F2DA 2ICSA 3LPOA 1QJWA 3BGJA 2EKGA 2RGMA 2SFPA 3OU8A 8CGTA 2FZMA 1AJ0A 2PDJA 3LI0A 1DJHA 4HJFA 2QEZA 2VFHA 1FWIC 1ZGDA 3B8IA 2PTWA 1QOQA 3W38A 3S4TA 4K39A 3LGGA 5CSSA 1JEZA 4GC3A 4CEUC 3GR8A 3K30A 3L0NA 1YTKA 2DZXA 1V3IA 1F6YA 1SO4A 3ZVHB 1I75A 3VNDA 5D2WA 5JUVA 4K2SA 4NP7A 2D1ZA 4M6QA 3RGTA 2Z1VA 3GHSA 3M1ZA 3NNTA 3TK7A 2RUSA 2DH2A 1HO1A 3UD6A 2E1WA 4ADTA 3H2EA 1JDEA 2QQ6A 2FGZA 4TV6A 1GOXA 4B9YA 5JVLA 4GGBA 4OBSA 1BGAA 1PE1A 3BG5A 3W22A 3PUGA 3CV1A 4Y9OA 2ZE3A 1ZAIA 1LLZA 4IMCA 1KM2A 1JPDX 1HJWA 5EL1A 3QHOA 4NX0A 2QZRA 3G0UA 1JDFA 5FAGA 1OIFA 3ITTA 4AZCA 4S3FA 2CC0A 1UIPA 3M64A 5FJOA 1X38A 4NQ1A 3BLIA 3UCDA 1H0GA 2ZUTA 4KIRA 2EPHA 1XSKA 4H9UA 2ZA3A 1W5PA 3BC9A 1H1YA 2P0IA 2QCHA 3W7IA 4L1GA 1ZQ5A 2ZE0A 1W1ZA 3WLHA 3M9YA 3ZYZA 4C60A 2FH8A 4J35A 3VIHA 4S3KA 1W3IA 2VD9A 1OGSA 2W9MA 2Z1WA 1ICSA 1LF1A 1TV4A 2V6AA 4LUTA 4BI6A 1XLMA 4ACYA 2FHBA 3SADA 2E28A 2CLKA 4DWSD 3PAOA 3QW4B 3O6YX 5HPOA 4PUNA 2POTA 2D24A 2EPKX 3F1QA 4MFEA 1NELA 4UFMA 3GVQA 4DO4A 1PX3A 3NDZA 2W92A 2QR6A 5BMWA 2QMJA 3G3MA 4RZ5A 2WVTA 4DAFA 5HNRA 4I9MA 4DI8A 1JPMA 3UR7A 1V51A 3OVRA 2OSYA 3P5ZA 1FH9A 3EWXA 3EA1A 3R8HA 2O9RA 1YXYA 4CD5A 3U7BA 5LGXA 1GVRA 3ABXA 4MSSA 2MANA 4GJJA 3CWHA 1RALA 2VZSA 1ZBCA 2INZA 3NYDA 3GNPA 2G3IA 4KRZA 3GXFA 3QTPA 3M6YA 2RDTA 1QI2A 1VEPA 2QV5A 2A7PA 1JAKA 4YN5A 1H60A 1YPIA 2PC4A 5HAOA 3BAXA 3WL0A 4IL0A 2D0GA 1H51A 1Q6RA 5K7JA 1Q2SA 3L12A 2EGZA 4S39A 2BXYA 3BW3A 2XTKA 3GUGA 1AJZA 1UB3A 3MWAA 2G5WA 2YBUA 4AZ6A 4JIIX 3K4WA 4IMFA 1MXGA 3DI0A 5D03A 3RPMA 2YXOA 4L9XA 5D32A 4DJED 1XD0A 3WBAA 3LCGA 3CL6A 3OHMB 1WYIA 3WQWA 1E4NA 3GNOA 4LF1A 4XZMX 4AZGA 3WD4A 2C7FA 4EXQA 2NT1A 4IIBA 4GY7A 3BSMA 4RNJA 3HG3A 2WJEA 4G6CA 3CC1A 2XGIA 1WKDA 1WAWA 4M0XA 1F3EA 4C6NA 3R8GA 3HG4A 1E6PA 3NEVA 3AYRA 4PCNA 3U2ZA 3HG2A 4GNVA 1PUDA 3QEZA 4GCAA 2E8YA 4LY8A 1TREA 1ZBKA 2J7FA 3PJTA 1A47A 3ATZA 3NO5A 2OMAA 3EB2A 4U2YA 3IANA 2Y4SA 3HJZA 5E93A 3S5NA 2GSJA 4IIGA 1QMLA 5GNYA 2VFDA 4HPNA 5D33A 1OWQA 3W00A 5XINA 3ZT6A 1RVGA 2IMRA 1UH3A 1HT6A 1Q6CA 2PF8A 3GG1A 3CO8A 4Q8NA 3W53A 3NURA 4LUIA 1SO3A 5LIWX 1QBBA 3MI2A 4HSNA 1N2VA 1XH1A 3ID7A 2W67A 2XIBA 2XIQA 1QCWA 3W83A 4GA8A 4JQ1A 1MUMA 2DORA 2BODX 3NQDA 2W4XA 2YBVA 1UH2A 3P67A 4H2CA 5BWAA 1UR0A 3I4KA 2R94A 5D4YA 4Q8WA 4F0RA 3UXIA 1BSIA 4FF7A 1SO5A 4UTJA 3FNDA 2Z2UA 2D73A 1QI0A 2BTMA 4ECLA 2VFGA 2DW7A 2HEJA 4NZJA 2O7QA 3CJPA 4IPLA 4U5IA 1FP9A 4R5EA 2NUXA 4DNHA 4XKYA 2YL9A 3BSGA 3SI9A 3VD7A 1W6TA 3UW6A 3MYPA 3R2GA 1QI5A 4S3DA 2FVKA 5EMJA 2PZ0A 4PTWA 4V27A 4YHGA 5DXYA 3VKAA 3IVUA 5L9FA 3S42A 5C9XA 1BF6A 4EOUA 4TVDA 3OG2A 5DY2A 4LYRA 2XH4A 2J47A 3O6AA 2Y5EA 4PTNA 3RM9A 1ZBWA 3LRLA 3B0UX 1M1BA 1B54A 2ZZ5A 4NYUA 1E6NA 2CZDA 3ABZA 1EHNA 3GYEA 3MUAA 1WDQA 1J0YA 4PMJA 4Y90A 2D2JA 4AEOA 4Y9NA 3EPNA 4E38A 3P14A 2BGQA 5CJMA 5C7HA 5H8MA 4F66A 1UWUA 2CBIA 2FGLA 1E1CA 2QT3A 5HNTA 4F0LA 3KRZA 2ALRA 4DJDC 4UUIA 1Z69A 4MPKA 1E1FA 4LUTB 4O17A 1A5LC 4K8GA 1K4HA 3PTKA 4KGJA 3UWEA 4DM1A 3HBLA 2RKXA 2GUUA 3CYVA 2YLLA 5EKYA 1X8FA 3SSJA 2NQHA 2G3FA 5CBJA 4GZ7A 3UY8A 2D3NA 3LSBA 1ESWA 1TUXA 1MXSA 5J5DA 3KCJA 4JTSA 3MKCA 3O0KA 3DFYA 1M6JA 1EDGA 4CU8A 4ML9A 1S2WA 2HXTA 1VCVA 4YTSA 3AXKA 2WCAA 4CD8A 4D72A 2Q09A 3TEVA 1UWQA 3MTWA 3DXIA 1B1YA 1XDJA 1YRRA 4PEEA 4QISA 4DPPA 3PZMA 1JRBA 3P62A 2PWGA 5HR6A 4AIOA 3MC5A 4LGXA 2ONEA 3GIPA 1RK5A 1S5MA 1R38A 3IWPA 5ECUA 3EWYA 4KH2A 3CWNA 3GDMA 3PZGA 4EF8A 1EH9A 3FA4A 4YVPA 1OF6A 3P3BA 1ISZA 3W7CA 3VNKA 1B3WA 3WEOA 5CPOA 1XYMA 2CLHA 3O1NA 4MM1A 4DBSA 4HZ7A 3EYPA 2GSEA 4JDYA 3NQ7A 2CU0A 1GVOA 3LNPA 2WBKA 2ZICA 3V4BA 3VIIA 4JR5A 1OHLA 4ZR8A 4GVIA 1KWKA 3OGRA 5EFDA 3N2CA 1WDWA 3UZXA 2EXOA 4IG2A 5I3DA 4TTGA 4C90A 1QPRA 3O2LA 5JBDA 2WKJA 4H04A 4FNTA 3W4RA 1GOWA 3OGVA 4PUJA 4J27A 1WE5A 2QPXA 3DAQA 2G50A 3E1F1 3DHFA 4QG9A 3ANYA 1JG9A 3EOSA 3PK7A 4BI7A 3PZOA 4O13A 2HMCA 4AIUA 3WF3A 3QYQA 2ZA1A 1VLIA 3MPGA 4EE9A 1GNXA 5CZTA 1P1MA 3PB0A 3CT7A 4ZTYA 4OV9A 1Q6FA 2XZ9A 1UA7A 3BO9A 4E4UA 2V5JA 4QJ4B 3WLTA 5CPQA 3CLWA 2ZQ0A 4P8XA 2WHKA 4TX6A 2J6VA 1OX6A 4N2YA 3CGTA 2PRMA 3W2MA 3IJDA 4WSKA 2XIMA 2HZGA 4MWAB 2NUWA 2CW6A 2XVLA 4J2MA 5AHFA 1MNZA 3A4XA 1IXQA 1WUFA 1R0MA 5J8LA 3WQ4A 4JTHA 3GM8A 1JYXA 2PLCA 3RMJA 3W87A 2O4QA 1OADA 4O10A 1ZENA 3MYOA 4B5XA 3N3MA 4M3PA 1A0EA 4GIYA 5J04A 1KBKA 2XFWA 3Q37A 4WDUA 3MCNA 4KBXA 3ELFA 4N02A 5KEZA 4LANA 2QVHA 2BOFX 1A3WA 3KRSA 1PKYA 1FCUA 5U7SA 4PCTA 1DEDA 1GVFA 2HS8A 1LRNA 1SSGA 1RCXB 2PEVA 2HJPA 3BCDA 1JQVA 4GYKA 8TIMA 5D02A 4H8UA 2YLAA 2PI6A 5B7ZA 2Q71A 1FFRA 3N11A 1DJNA 1YLVA 3I65A 5FJJA 1JXKA 1EIBA 4UFLA 4EK7A 4Y9MA 1IT8A 5BU6A 2VEGA 1DHKA 3BMXA 3CEPA 4B16A 6REQA 2V5CA 1CB7B 1V0LA 3LXAA 1XSJA 2VFEA 4FA3A 4QDPA 1MQPA 1DVJA 3ISIX 3H4XA 4O54A 3APYA 2WSQA 4GX8A 1LBMA 3TJ4A 3BLPX 2J77A 3G1SA 3A5VA 4GZIA 1PX4A 1AD4A 2O9PA 1ZUAX 4B5SA 3OTRA 3IV3A 4GX9A 2YA0A 5FD0A 3DG7A 2R1LA 5D38A 1XD1A 4S3JA 1CT5A 1JNDA 3B0PA 2QDDA 3MJYA 1V3HA 3ORWA 1EJTC 3P2VA 2WHJA 2ZRXA 4XTDA 3E2QA 4EF9A 3TW6A 4WSJA 3R94A 4YXGA 6ALDA 4QJ3B 1TVNA 4HHMA 1OFDA 4A3RA 3U4AA 1QK2A 1N8IA 5T8GA 1DBTA 1VFUA 1Y0EA 3DDMA 1F6KA 2WZIA 4ALDA 4MFDA 1IXNA 3CHVA 1OQFA 3REQB 1OBAA 2QPUA 2BY0A 5GQBA 1DJGA 2BHUA 2GOKA 4PBFA 3AMCA 3PPFA 3MANA 4MHBA 2OLAA 3HF3A 4HK6A 4BF9A 2ZUNA 2X0SA 4PMQA 4S1FA 4R9XA 1AH4A 1S2AA 3VCRA 4HK7A 3AXIA 3NEHA 4JX4A 4POCA 4WK9A 5EBAA 2OZTA 4LVBA 5JIWA 2ACSA 1BHGA 1T40A 4Z1DA 3GDKA 3SUVA 3UZYA 3QSTA 1H62A 1FHUA 5TIMA 4DWSC 1YDOA 3BAIA 1W3JA 4A35A 1XLLA 1NDVA 3GIYA 1UCWA 2ODOA 3VIKA 5CC7A 2X1UA 1XHGA 3M07A 4M81A 3R79A 1SQ7A 2BXZA 1AD1A 4G9PA 3VCCA 2CWNA 4WR3A 1UUOA 4EAYA 1HUVA 5CAKA 4U4MA 4HNUA 3AQUA 5AYIA 3S1XA 4O4VA 1FBAA 1O1HA 4K68A 4PEKA 4RPQA 4MUZA 4YTUA 3UYCA 1EFZA 4IMAA 3N15A 2OWXA 3LTPA 2W91A 5BCAA 4BJHA 3M0JA 3HG5A 3QGAC 3TJLA 3W2KA 2WNZA 1ZALA 1Q8AA 3IIPA 3M5VA 5I3FA 4XIAA 2I9EA 5FJIA 3W1AA 1VCFA 3BV4A 1R3RA 4AY8A 1TE1A 1MDLA 3SSZA 1E70M 3BOLA 1J5TA 5AYYA 2GDUA 1WOAA 5IDZA 3WF1A 1H7NA 3T8QA 4AWEA 1JPKA 3GZ3A 3W9ZA 1ZP3A 3ARUA 4IQDA 4MOZA 5CPMA 1J0HA 1YDNA 2ZX8A 1E0XA 3LGDA 5GJPA 3GAYA 3P82A 1GEQA 2ISWA 3WNNA 1HL8A 3AS1A 1XIGA 4GG9A 4FSAA 4YHEA 2FFIA 3PWIA 4F0MA 1W3HA 4JAWA 2FPTA 3IRDA 4TOQA 2E77A 3FSUA 1PDYA 5CJNA 1B3VA 3E96A 4LAOA 1M7PA 2GVGA 2DZPA 1UD2A 1S2TA 2ABAA 4HA3A 4QG6A 3QMTA 4B3LA 4GIRA 1AMKA 3V7PA 4MY9A 4DM2A 4JFSA 5C71A 1RCOB 1AUSL 4NYYA 1Q6OA 2FZ8A 1U5VA 2WZTA 4F79A 4LYKA 1C91A 3BJFA 3B0XA 4ZA0A 4F2UA 1FCVA 3SJNA 1PKNA<