3KVJA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with amino-benzoic acid inhibitor 105 at 1.94a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
363
Chain Sequence
b'GDERFYAHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title Discovery of novel inhibitors for DHODH via virtual screening and X-ray crystallographic structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 137
structure length 363
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kvjA00
4IJBA 1TCDA 2XN0A 3FYPA 1A5CA 5AN7A 4LNYA 4DQWA 3UY7A 3S1WA 1F6KA 4MY9A 1A5BA 3C8FA 3BW3A 1I2QA 2CZ5A 3ABRA 1FCQA 4LRTA 3TAKA 4JR5A 2I9EA 3UXDA 1UUMA 3P8IA 3CPRA 2BLEA 2W79A 3CEPA 1N7KA 1TPC1 4P2VA 1Q6RA 4FIQA 2VFFA 1TYGA 3P74A 1OFOA 1SW0A 2ZZ5A 1VHCA 2CZFA 4BWLA 1I8JA 4JTUA 3TJXA 3G0XA 2GQ8A 1QPQA 5AYZA 1XL9A 1QPOA 3TX9A 4TR9A 1EPXA 3W71A 4N02A 3LOTA 1CW2A 1VHNA 1EX5A 4O1AA 3P7YA 4PL2A 1VR6A 3LXBA 1JUBA 5F2GA 1SW7A 4LOCA 2YXGA 4WXZA 3C0JA 3GZ3A 3TC7A 4LVDA 3S42A 2NXHA 1KM6A 3LTYA 1G4EA 3M1ZA 3HGRA 3UXAA 4WX2A 4B5NA 3M9YA 1B57A 3QMRA 4E0CA 4W9TA 2FIQA 4LV4A 2CLHA 4K39A 3GAKA 4ZQMA 4YL2A 3TXVA 1XUUA 5CSSA 3A21A 1W31A 3GDRA 3WJXA 3UWYA 1OX4B 1V7YA 2A0NA 3UWUA 4QAIA 2J9XA 2ZZ3A 3OVPA 4O19A 1NF0A 3W7LA 4IQLA 4JX4A 1W37A 4FNQA 5D2YA 5T26A 3TQVA 1GTEA 3F03K 4EOUA 1ZCOA 1KLYA 1WQ5A 2RDWA 3QMSA 5AHNA 4FEZA 3PY2A 2Y7GA 1WXJA 1XKYA 3W1UA 4DELA 2VC6A 1FDYA 4XUGA 3L5MA 2JKPA 1BWLA 3DXIA 3LRKA 2ALDA 4JY9A 2DZSA 3W7QA 5LNWA 2YSWA 4IX0A 1W56A 3DHDA 1J5TA 3G1FA 4L4MA 4MYAA 5DCEA 4LU0A 3PBUA 1TRIA 2B7NA 2JGYA 4FNSA 5LHFA 3L68A 1OF8A 2WPBA 4UUIA 1DV7A 3DFPA 1WBHA 3NDOA 3M6YA 1KFJA 1T96A 3SECA 2OT0A 3W7OA 4A2RA 5F4SA 1JR1A 2QCMA 3P5ZA 1AG1O 3OG3A 1EIXA 4O57A 3G1XA 1TPH1 3F1QA 3LHYA 3S5OA 3S8HA 5ABTA 1B4EA 3SFKA 3O15A 4JGDA 1QPNA 4PC8A 1LDCA 1I2RA 2V82A 4Q33A 3W2MA 2E09A 1O4UA 2B7OA 3LBCA 3BLFA 1QO5A 3PUDA 1KFEA 1LRTA 1WX0A 1WYIA 3GR7A 3S5YA 2V2HA 4POCA 3FKKA 3TXZA 2R91A 5G4EA 4DF0A 3DH7A 3EKLA 4OU1A 3ABOA 1H7PA 4CNOA 4UR7A 3A5FA 1Q6OA 3VKJA 2X1SA 3QMTA 4LC6A 1QAPA 1EUNA 5IBXA 3O63A 5FF3A 3NEVA 2GVGA 3T55A 4JIPA 3B8DA 4FX7A 3FKRA 3NQDA 5K9DA 2CLIA 3BGJA 4GXMA 3EX6A 4O1DA 5TBOA 2VELA 4DBDA 2F7FA 2RDUA 2VEPA 1G4PA 5K7JA 3W72A 1F76A 1H60A 3FJLA 4CQAA 3QH2A 1HTIA 1W5NA 2D73A 5HWNA 4TMCA 5KSWA 1B4KA 5AHIA 1SZGA 1DL3A 1NF7A 3DAQA 3PC0A 3T40A 1TTPA 5K2ZA 1VLWA 2GQ9A 2J9ZA 5G5IA 1PCKA 1WOAA 4WZHA 4ICNA 1C9DA 1ME9A 1FUYA 1GWJA 4RZ6A 2ZYFA 2X1RA 3QQ0A 3CIWA 1FWTA 5E0KA 3UNDA 2QCEA 1OF6A 1X1OA 1I4NA 5EKYA 1VJIA 4FF7A 3M44A 3NPVA 3G24A 3PF3A 5D2VA 1X8FA 3GK0A 3HG4A 5EY5A 3I7QA 4U4MA 3TFCA 4CQ9A 3TUUA 2ZZ2A 2Y70A 3MP4A 3RF9A 1ICPA 2NWRA 4EF8A 1EWDA 1G4SA 1W8SA 1VGAA 2V2CA 4EWND 1SO4A 4PTNA 1FCBA 1ICSA 4X2RA 4Z1CA 2NV2A 3LB0A 4O52A 4LY8A 3W7DA 3GLCA 1YPFA 1SPQA 2FPTA 2ZTKA 2C3ZA 4YCPA 5D05A 5HQEA 3ZR4A 1VPXA 4O53A 4HNTA 1XC4A 4Q4KA 2GVJA 3LRMA 4O4VA 3NQMA 1AL8A 3TQKA 3M5VA 4LUJA 1K7FA 4QNEA 2V30A 5HMSA 1S5TA 3G22A 3PS7A 2ZDRA 4WJEA 3L66A 4N9CA 1FCVA 1HUVA 4RZ5A 3E12A 3M47A 2A7PA 4GE8A 4JYEA 3F4WA 4X9SA 5F1VA 2E5BA 1LZOA 2X1TA 3TAOA 2V2DA 3L0KA 4RV8A 4MFEA 4ZL1A 3L0GA 3N2XA 1F5ZA 1FX6A 2EKCA 5AHFA 3VCRA 2BSLA 3LV6A 1EP3A 4N4PA 4AHPA 1FWNA 3H55A 1ZAJA 3TSBA 5LGXA 3MW7A 4A29A 5D33A 5FF4A 1H7NA 4O54A 3CT7A 3Q58A 4GJ1A 4A2SA 1RVGA 1O60A 1THFD 2V9DA 3HBLA 1M7OA 1M7PA 1OVDA 1OFAA 3IVSA 3SSJA 3R2GA 4K8EA 5I3JA 3WK0A 3MWAA 4MKNA 4UFMA 1LP6A 4HSNA 4QIUA 4YXGA 4QJ1A 5BMXA 1IXOA 1LBLA 4FX8A 5D2XA 3HG5A 1KM1A 2ZZ6A 1TRDA 3B0VC 2EPHA 2J24A 3IVTA 1KFCA 3NXFA 4X22A 3N14A 4AH7A 4HPXA 4JYFA 4O1CA 1TB3A 3BVJA 2R14A 2V8ZA 1VCFA 3EWBX 1QMLA 4GRSA 1XDMA 3P8JA 4FNTA 3NQ2A 2QAFA 1I2OA 2C15A 3TFXA 3HG3A 5KITA 1K03A 2Z6IA 3W7RA 4ZZ9A 2EF9A 2KZHA 1FDJA 4ORMA 1KFLA 2ZA3A 1NSJA 3CC1A 7TIMA 3MP3A 1OX4A 2FLIA 5G1TA 5KINA 4FXRA 1Q6LA 1TV8A 1XI3A 1YDVA 2NXGA 4CQ8A 2ATMA 4UFIA 3JRKA 2CLMA 4HHPA 4MPQA 4IMCA 1H63A 2JK2A 3EKZA 4O4WA 4XTIA 1OFQA 4N2YA 4RJEA 3NPUA 2GPTA 3STGA 3UPWA 4PH6A 5I3KA 4E2BA 4GUIA 4Y6GA 3B0UX 1LTDA 3JR2A 4YWIA 1J4EA 4AB4A 1OYAA 4NJHA 4UTJA 3HF3A 1TJPA 4Y90A 3W75A 1DKWA 1EEPA 1MO0A 1GYNA 3SGZA 3IVUA 1GVFA 1KFKA 4Z0SA 2RDTA 4FNUA 3I6RA 2QCNA 1WOBA 2VEMA 1WAUA 5AC7A 2Q8ZA 2QR6A 2QUTA 3LX9A 4O17A 3LDVA 5MHBA 1W5MA 4A3UA 4LVGA 2A5HA 2CLFA 1LLWA 5DBTA 2YW4A 4UTWC 4CNNA 2B0MA 3ZS4A 2PRMA 5F2MA 3P61A 5D2TA 4DBEA 2GUUA 2Y85A 2VEIA 2QCCA 3SIZA 5L6UA 1RQHA 3WK1A 3GDTA 4BI5A 2WKJA 5HR6A 1F2JA 5F2LA 2ZFAA 3GIYA 4JN6A 3W1LA 3SJ3A 2XN2A 1M6JA 2TRSA 3SY5A 3N3MA 3TJLA 3KOFA 2BZNA 1LBFA 1J2WA 4Y9AA 4AF0B 3OVQA 4IXXA 3FFSA 3TV8A 2ISVA 5BMWA 2C6QA 3PBYA 4JIQA 3UWVA 1OJXA 8TIMA 1V5XA 1TIMA 4NJJA 5G1YA 4JYDA 3W2UA 1QWGA 3NVTA 2QCGA 4XTDA 2VFEA 2QCFA 1W5PA 1JRBA 2A4AA 3LI1A 3C56A 4HKPA 4CNPA 3IGSA 3MO7A 2B7QA 4NXSA 5CPLA 3I7SA 4LS0A 5D37A 1TV7A 1R2RA 1L6SA 1SFJA 1IXPA 3B0PA 1K8XA 2JKEA 4IMDA 1UUOA 5FF2A 1WA3A 5FEXA 2R94A 1W3IA 2E6DA 4DF1A 3MBFA 1O94A 1TPWA 1H50A 2E5DA 1F05A 4GNJA 1JCJA 3CLMA 4PA8A 4WQ6A 2NUWA 1JCMP 4Y96A 1DQXA 1OX6A 2V81A 3T44A 4IMEA 1K3UA 5DCDA 1XDLA 3NL3A 2H3DA 1T0OA 1SSDA 4NNAA 2C0AA 3HGOA 4ZVJA 3MI2A 1Q6QA 3USBA 2DZWA 4PCFA 3G1HA 2VENA 3UYCA 1FBAA 1PIIA 3HPSA 2GJLA 1FCUA 1D3HA 1VRDA 3FIGA 1UB3A 2BX7A 4AHOA 2DJLA 1G67A 3RLVA 3A5VA 4QITA 2P1FA 2WOQA 4O13A 2OZ0A 4TO8A 4QQ3A 2FPYA 1NEYA 4J9JA 1OFDA 4I9AA 5HUPA 3NM3A 4NJIA 5FF0A 2X2GA 3W7JA 1N55A 1TPFA 2C13A 4M6VA 5CZTA 3S1XA 3E9AA 5D04C 2A1YA 5DXXA 3NL6A 2Q8LA 3CIXA 4FB7A 1W5OA 1L9WA 3QW4B 2H8XA 1JQVA 4NJKA 3W1MA 5HJLA 2Y7DA 1N8FA 1R2SA 1AL7A 1DJQA 1TV5A 4JTHA 2ABAA 3OA3A 1YTKA 2WNNA 1ZENA 1H7OA 3GX9A 3RNDA 4BR1A 2ZA1A 1YLVA 2LLEA 4MZYA 1W54A 3DFTA 1NAL1 4JNMA 2ZBTA 2YX0A 3DKJA 3W7GA 4A21A 2IQTA 5HULA 2YFNA 2YW3A 3CM4A 2FB3A 4GWEA 3NZRA 4K37A 3GNDA 2YGYA 4H3DA 1RQEA 4OBTA 3OEXA 1LBMA 3C2VA 2G95A 1ZY9A 3LI0A 3LRLA 4DF2A 1XXXA 5LGZA 4UFHA 2YZRA 1NVMA 2NUYA 4ZMGA 1ZAIA 4OGZA 2NUXA 4OV4A 2PC4A 1LOLA 2E5CA 3R12A 4TX9A 2VFGA 4NX0A 4JD4A 4IXHA 3W2KA 3NYZA 5DLCA 1YXDA 5HNRA 3A22A 5AYXA 1ML1A 3LHVA 3I68A 3G3DA 2Y61A 2BWGA 3T4CA 4PEKA 3PWAA 1WV2A 4XBKA 1K8YA 3S1VA 4IOTA 4JTJA 3W1TA 5D38A 1GVRA 2BTMA 4WD0A 4LVFA 1TJRA 1K8ZA 1OFRA 1GVSA 1QFEA 1KW1A 3DFSA 4JS3A 4L4LA 1H7RA 2DU2A 2O7SA 4CCEA 5FEWA 1GZGA 3FYOA 2YYTA 4FO4A 5DELA 1P0KA 4WXYA 4M6QA 3TK7A 1C29A 4LTSA 3BPWA 1E51A 5A5WA 4Q32A 1ME7A 1GEQA 1SZEA 3OHIA 3C2EA 5E93A 3P5YA 1LLZA 2W0UA 3EWUA 4OV9A 1GYLA 2WJZA 3TMLA 4JTTA 3UD6A 3UWQA 3W23A 3L67A 2OCZA 2EGZA 3P81A 4DO5A 3LGEA 1P5BA 1QDSA 1ZHAA 1RPXA 2ZTJA 3RK8A 4OWGA 1KBIA 5HWJA 4UNKA 3GXNA 2ZRWA 3SR7A 4RK8A 2Z0IA 3W7MA 1BKSA 5EYWA 4LW7A 2Z6JA 3PVFA 1PS9A 3PUEA 4GC4A 2PRLA 4JDYA 4NX5A 2G96A 5H91A 3HPZA 3Q37A 3W2JA 3C61A 2NZLA 3BO9A 4UTWA 2VOMA 5C2XA 1QO2A 1IIGA 4Z0JA 5GVJA 3FA5A 5LNVA 1VC4A 1LORA 1JCXA 1CI1A 1HL2A 2YYUA 3EXSA 1DBTA 3W73A 3G3MA 2FFCA 1KM0A 3EXRA 3W2LA 4LUIA 1TTIA 4ZQOA 3DBPA 4AF0A 1U83A 3NA8A 1W3TA 2ABBA 5G2HA 3R13A 3CWNA 1W1ZA 4M5PA 3T7VA 1EP2A 2A7RA 1B9BA 1MZHA 2C16A 1H1ZA 2H6RA 3QJAA 4NXKA 3TR2A 4FNRA 4CCCA 1O5KA 5I3FA 2X1UA 2ZQ0A 4PODA 2WSRA 4C1KA 3DU0A 4XQ6A 2CZDA 2X16A 4UMBA 3BG9A 5HR7A 3C52A 1KM5A 1PHQA 1K7EA 1BEUA 2YR1A 1H61A 3L21A 3NGJA 1TQJA 4IMGA 4I7VA 1VZWA 3TSMA 1QNVA 1VYPX 2HMCA 1OFEA 3NR0A 5F1UA 4O1BA 1OFBA 4X3ZA 3G1YA 4N9BA 2OMAA 2QCDB 3PR2A 1OK4A 2CWNA 3DFOA 1QOPA 3M0ZA 3KRZA 2NLIA 2ZZ7A 3EWXA 3HQ1A 3VE7A 1HFBA 1VYRA 1Q45A 3MYPA 1GG0A 2A6NA 2PRHA 4RXFA 5LNRA 1IIHA 2Y89A 3NQEA 3PAJA 4OQVA 1JJKA 3PSVA 2GQAA 1A5SA 1XUZA 1KV5A 3M5YA 4AXKA 3RU6A 1ZFJA 3PULA 3M5ZA 3G1DA 4JDBA 5TIMA 3PB2A 3WJWA 3P82A 1KTBA 3HMJG 3E96A 3B4UA 1X1ZA 5K4XA 1F7BA 5HWMA 4RKAA 3S5ZA 2WV8A 3N73A 1ZJIA 2E1DA 4XZ9A 1VCVA 3LCGA 4YLWA 3L5AA 3PM6A 5H2ZA 4IMFA 5EMUA 4GBUA 3S1UA 1R30A 3LHTA 1TPDA 5D2WA 3P60A 1TREA 3FLUA 2CZEA 1GJPA 1XBYA 2DP3A 4EF9A 1LOQA 4Z1BA 3QSTA 3PBWA 3LCHA 4E38A 3IIXA 4HPJA 4GUFA 4K36A 3NQ8A 4UTIA 1FWSA 3LHUA 2A6LA 3FOKA 2Y62A 1EWEA 3W6YA 3CB8A 4N6EA 5AB3A 1SW3A 2E68A 3UWZA 1G69A 1H51A 3C4UA 4JX5A 5DY2A 1T99A 2E6AA 3WFAA 3C6CA 2EHHA 3W87A 4IUOA 5DBUA 3W9ZA 5FEPA 1EP1A 4LVBA 4IGHA 1KFBA 1KM4A 4KKXA 4AWTA 2CW6A 4IPJA 4U28A 4M19A 4ADUA 3UQNA 3IRDA 3ABSA 3MHUA 3ZFHA 4GUHA 4WOQA 1YDNA 3KRSA 3UZJA 3D0CA 1G6CA 4UR8A 4WUIA 1BTMA 4UFKA 5DN1A 3DFNA 3EWWA 4O14A 3O6YX 1MXSA 1OYBA 4LS2A 3OBKA 3MBDA 4UXDA 2X30A 2HSAA 3NZ1A 4NT0A 1YXYA 3RFAA 5KZEA 3QQ1A 2HTMA 2E6YA 1JUKA 1A53A 4AVFA 3LTSA 2B4GA 1KLZA 1F74A 1Z42A 4JTFA 1I45A 3R89A 1KM2A 5C5YA 1Z41A 3ABQA 3NO5A 2WNZA 4IPIA 3GNNA 4MJMA 5U4NA 1O5XA 3W1XA 3B06A 1SFLA 2P10A 2OT1A 3EXTA 3DI1A 2YPIA 1P1XA 3QRHA 3U6WA 3NQAA 2ZRUA 2QJIA 2C19A 4FNPA 3P80A 3O8AA 4OT7A 4KFOA 5LNUA 3O06A 1OABA 1VH7A 4ZQRA 1AW2A 3W1QA 4DPPA 2J88A 5D30A 1TTQA 2A85A 5CG7A 3SW6A 2CLKA 5EBUA 3ZWTA 1FXQA 2Z2UA 1R2TA 5G2WA 4MUZA 5D09A 2FB2A 3W1NA 1WDWA 5HINA 2VFDA 3AJXA 3W7IA 5DXYA 3KVKA 1FWRA 1GPWA 2FPVA 2DZPA 3G8RA 4QM1A 1RD5A 1SQ7A 1MSSA 5J5RA 4PL1A 4TU1A 3C2RA 2ISWA 5EL1A 5FF7A 4UFLA 3GB6A 3BLEA 1TPB1 1A50A 3HG2A 1ZNNA 4EIVA 2WNQA 4ZQPA 3NAVA 4CCDA 3DKLA 3LCLA 4FX6M 3W76A 3MP5A 4BK9A 2J27A 2RFGA 3TW7A 3LERA 3C3NA 2UV8G 5K9CA 3W22A 3NQ6A 3P84A 2WSQA 1IXNA 4JTSA 3GDLA 3ZWSA 1T8XA 2ZA2A 4HNVA 3TMQA 2QKFA 4M6PA 1TMHA 3TH6A 2AGKA 4O18A 4R53A 3THQA 3QW3A 3LCWA 4K7VA 3JS3A 3UZ5A 4A22A 3LCXA 4TIMA 2ZRYA 1VLIA 3IV3A 3MHFA 4QISA 2OJPA 3ANYA 4JEQA 4LT9A 4I7UA 3EX4A 1I2NA 4MFDA 2WSYA 1KTNA 3A9IA 3N2MA 1Z48A 2A21A 4EVZA 4IX2A 1IXQA 4I7WA 2A7NA 4RZ4A 4HNNA 3W84A 2DZTA 2H8ZA 3NQVA 3VE9A 1EB3A 3RMJA 4S2CA 5FESA 1G4TA 5KZMA 3BLIA 4XKYA 1D9EA 3L0NA 2TPSA 3E0IA 2F84A 3QYQA 2FJKA 2ZRVA 1F73A 1XBXA 3W83A 3B03A 3L9CA 4D2JA 4O15A 2NX3A 2YFOA 1S5VA 4O8RA 1ICQA 5LNSA 1SZNA 2W6RA 5K3VA 4M7SA 3TW6A 4P61A 3EB2A 3O1NA 2E6FA 4NZJA 1YADA 5CZSA 3TNOA 2O7QA 2QCDA 4WY0A 3TROA 1QOQA 3FS2A 1YDOA 4MLJA 1TPEA 3VFLA 3MJYA 1I2PA 1EUAA 4LC8A 1EA0A 2R8WA 4UTHA 5C6MA 4BFAA 3MHGA 3S9YA 3HOJA 6ALDA 4R7JA 1DVJA 1HO4A 3A23A 3W85A 2GJNA 3SGUA 3QSRA 4TMBA 3TKFA 3Q94A 3O05A 3LV5A 2VXNA 1JUEA 4HSOA 3U2OA 2QJHA 3M43A 4WY0F 2Y7FA 3V1PA 1PV8A 1OYCA 4NVTA 4RCXA 2NXIA 4R34A 3KVMA 3IIZA 3M5XA 5SWUA 2TMDA 3W7PA 4O16A 1W3NA 5CPNA 5AHLA 1X6UA 1L6WA 2VFHA 4DEFA 1MEIA 1ONRA 4MZ1A 1KA9F 2J9YA 1W5QA 1AW1A 3UPBA 4NNCA 5U7SA 1TPUA 5C54A 2QDHA 1Y0EA 1GTHA 4N4QA 3STFA 5CZJA 5G4WA 1H5YA 3G1VA 3TE9A 4RR4A 3O6DA 3M16A 3S5NA 5CSRA 1DOSA 4FIRA 1M5WA 3CU2A 2XN1A 2QUVA 3MYOA 1JULA 4O10A 3PG8A 3W88A 5I3HA 1FWWA 3IIOA 3W2NA 1TQXA 3MI3A 3NPXA 4JY8A 3G0UA 2FTPA 4O50A 1C8VA 3M7WA 3PUOA 5D03A 3H54A 3W1PA 4NU7A 2ZZ1A 5EA9A 2FDSA 4O0KA 1UBSA 1G7VA 3W3OA 1ZAHA 4LVAA 2JKAA 1S3HA 4N6FA 3LTPA 4UNLA 3KHJA 3GR8A 5AC6A 1JVNA 5FI8A 4JICA 1RZMA 3G18A 1XCFA 3TSDA 4UTLA 1VYSX 5AHMA 3IGUA 5BNKA 1Z44A 2C18A 2VKZG 4MYXA 5BOOA 2I1OA 5KZDA 3BG3A 4UFJA 3H53A 4ZQCA 1O95A 4NQ1A 3BW4A 1R46A 1QR7A 3EWYA 1DQWA 4MLRA 4LS1A 4NNBA 5KTLA 1F6PA 4AWSA 3C2OA 3L5LA 3WJSA 3IIPA 3DI0A 1JQXA 4O28A 1LCOA 5G2IA 3NQFA 1XBZA 4UTTA 4IWWA 2RH9A 3I65A 2GVLA 4JXCA 4KWVA 3GAYA 3G0SA 5J5DA 4MJZA 1GOXA 4DPQA 1RV8A 2H90A 4LRSA 1TSIA 3P67A 4H4IA 1KBJA 1L2UA 4QNWA 2DORA 2BXVA 3KX6A 4G1KA 3W74A 2TYSA 4Z08A 2XFWA 3DZ1A 4CLMA 4JTEA 2VEKA 4MVAA 2ZZ4A 4HT3A 1L6YA 4K7YA 3BK0A 5A8GA 4BI6A 2HS8A 3UWWA 3W7NA 2Y63A 3EX3A 5BRBA 3LXAA 3IIVA 3GVGA 3VI2A 4UIOA 1FQ0A 1SO3A 1JCYA 1G7UA 4UTUA 3GKFA 3WK3A 3NM1A 2YDAA 3CTLA 1VS1A 2CFFA 2QAPA 2PE4A 5F2IA 1KM3A 5KMYA 1GG1A 3QC3A 3GXTA 3NOEA 4JTGA 1SU5A 3TA6A 1AMKA 2QEZA 4N9EA 1RQBA 3TC6A 3BARA 2QCLA 3I7RA 3WJZA 1FY6A 1UASA 2ZRXA 5F4XA 3E02A 3UY8A 4UMAA 3QPYA 2QUUA 2QF7A 2QCHA 2Y6ZA 4Z1DA 2WQPA 4MY8A 1LOSA 3W7EA 1JRCA 5TQLA 3HIJA 3K30A 1W0MA 4XKYB 3TQ0A 3ELFA 4NUWA 4XBSA 3TIMA 3G1AA 1LRNA 4HNUA 3EEGA 1PCWA 1UCWA 2FQIA 2PURA 3NL2A 4O0ZA 1D3GA 3S0CA 3BG5A 4BI7A 3KAOA 4BF9A 5CKSA 3EX2A 4AAJA 1DJNA 3DENA 4ZQNA 2EAWA 2E77A 1QPRA 3ATZA 3M41A 4AEOA 3GYEA 2ZCGA 4MZ8A 4WY0B 3THAA 4GUGA 1CX9A 3WJYA 2V5BA 1DHPA 2DZUA 3VNDA 5AFDA 4BWLC 3P62A 5BW6A 1SR9A 3LLDA 1OHLA 1PE1A 5AHEA 4K38A 4RLIA 1A5AA 1YPIA 4E2DA 2DJXA 1TO3A 1X7FA 1PHWA 1S5WA 3CWOX 5CZ0A 4O12A 1TPVA 4JTIA 2NX1A 2JBMA 2AAMA 2G5WA 2Q3RA 4Z1AA 4NZFA 4GFSA 2PCQA 5D32A 4QSHA 2OX1A 4ALDA 1SZFA 3LBMA 1JCLA 1ADOA 3QEZA 4WOZA 3STCA 2CLEA 2HS6A 2Y88A 1LROA 4OE7A 3W1RA 1Q3NA 1H62A 2JGQA 1LYXA 5K9XA 2QJGA 3HB9A 3QM3A 3STEA 1H7XA 5LZLA 1MEWA 1SO6A 3W7KA 2RHGA 3PBVA 5C55A 1SUXA 3BV4A 3EX1A 4R33A 4KWWA 2RKXA 1KTCA 4FXSA 4PFMA 3QF0A 5I3GA 2G97A 2CU0A 3FJ6A 5LKYA 4K8HA 2AQWA 1AW5A 3PSWA 2DZXA 3L2IA 5CPMA 3PG9A 3HJZA 5L9FA 3LCFA 1JCNA 5D02A 3HGSA 3L65A 3G8EA 1LRQA 3W7CA 5K4ZA 1VCGA 4S2BA 4M7TA 1ME8A 3MMTA 3KFTA 1NFBA 3QFEA 5IM51 5DCBA 5EPDA 1OK6A 4AWUA 2DZVA 3CQ0A 1VQTA 4RX0A 1K7XA 4JTKA 4JX6A 5CPOA 2V0TA 1H1YA 1H7WA 3PB0A 3BGGA 2C14A 4OHQA 3O07A 2NV1A 4ORIA 5E1QA 1DORA 1ZALA 1GT8A 3LLFA 3O16A 2Z1BA 2NWSA 1HG3A 2ATSA 2YCEA 2WO5A 1WBJA 3B04A 1K02A 3E49A 3W70A 4UTTC 1B3OA 4ADTA 1TTJA 4NJGA 4DO4A 6TIMA 4LV9A 3TCEA 3GKAA 3NG3A 3BW2A 4K6AA 3YPIA 4KFNA 5AOUA 3DFQA 1GQNA 3NQ7A 2TSYA 3OVRA 1RR2A 1FDZA 3N19B 1GVQA 3DHFA 2VFIA 2CLLA 1OFPA 3C2FA 3LHZA 5CGQA 2Q3OA 4UC5A 2H3BA 1GVOA 2NX9A 3SI9A 5IBXC 3GXPA 5AC8A 1PVNA 3LCIA 3Q2DA 1HO1A 1P4CA 3WK2A 4HN4A 3F4NA 3NL5A 3U8GA 4UTMA 3ATYA 4UCGA 3QPZA 4LWWA 4KFPA 1PL9A 1P0NA 3SZ8A 2I14A 4DO6A 3MI6A 3KVJA 3GDMA 1IF2A 3NQGA 2QDGA 3N9SA 3FEMA 5HUOA 2A2IA 4Y8FA 3LXCA 2CLOA 2ISSA 3LHWA 2J6XA 5LSMA 1YTEA 3KRUA 1OG0A 4DXVA 4YMZA 4O11A 1MEHA 5FEZA 4AHQA 3HPXA 4JTLA 2C1HA 3IEBA 4AMAA 4ADSA 3W07A 4FHAA 4ML9A 3S6DA 1FXPA 2ZRZA 1XFBA 3HGJA 3T78A 1OX5A 3MUXA 4UTKA 3NNTA 5I3IA 1SSGA 4MOZA 1YYAA 1ALDA 3W86A 1KV8A 1QCWA 2P0OA 3CHVA 3O6CA 3IGXA 4UMCA 3R8RA 1SO5A 3A24A 3V75A 2V5LA 4C1LA 2B7PA 4MY1A 1AK5A 1XBVA 1YXCA 2GOUA 5DY3A 3G1SA 3NPWA 1YTDA 3INPA 3N9RA 3QZEA 4MIMA 4S1FA 4H6KA 4GUJA 4RXGA 4N9DA 4ONVA 3GDKA 1UJPA 3W1AA 3B05A 3TU9A 1LM1A 3R5EA 1U5JA 4XWUA 3RLUA 2Y7EA 5F4WA 4YCOA 5LHEA 1BWKA 3OIXA 3KXQA 1R47A 3TDFA 5AYYA 1XM3A 3NQCA 3CEUA 3LM7A 3W7HA 3DGRA 3KVLA 1IGSA 4HIBA 3EWZA 3N34A 3AO0A 3HO8A
chains in the Genus database with same CATH superfamily
3WQCA 1E0VA 4LNYA 3AHXA 3UY7A 3MY9A 2HE8A 4MY9A 3XIMA 3BW3A 3P6LA 5CC3A 4LRTA 4GG9A 1WZKA 4K8GA 4W89A 3MV01 4Z42C 5DT7A 1PO9A 1R9ZA 2BLEA 3S2JA 1TPC1 3BJFA 1QBBA 4P2VA 1TYGA 3EBVA 3EEZA 3B0XA 2ZZ5A 2CZFA 2IKHA 3TJXA 3G0XA 1QPQA 3P0WA 3QVQA 3EKGA 3W71A 3UCDA 3LOTA 1VHNA 2XIIA 3LG3A 1YRRA 2OLAA 1JUBA 4LOCA 3IJ6A 4WXZA 3GZ3A 2SFPA 1EBGA 1HN1A 3NOYA 4JIIX 1G4EA 3UXAA 1BFNA 1C8QA 4WX2A 4B5NA 3TYEA 3W27A 1J93A 3QMRA 4HK5A 4YHGA 4ZA0A 4C6JA 3RJYA 4JTDA 4K39A 4ZQMA 3RX3A 2PLCA 5CSSA 3A21A 4U33A 5C70A 1V7YA 4QAIA 1UOZA 2ZZ3A 3OVPA 3ZT7A 1V51A 3M07A 4IQLA 1W37A 1J5SA 4A05A 1OQFA 1JFXA 1KLYA 1C91A 3WMSA 4AY8A 3IAPA 4FEZA 1WXJA 3W1UA 3T2OA 5HANA 3DXIA 1W56A 1UWSA 1CYGA 3G1FA 3RN6A 5C7VA 4MYAA 5DCEA 4LU0A 2PDIA 1JZ5A 2JGYA 1V8EA 4FNSA 5LHFA 2DW6A 4EK7A 1QRQA 1WBHA 3NDOA 1AH0A 2XH7A 3WQEA 1JXKA 1PTGA 3OODA 1JR1A 2Q01A 4MJ2A 4O57A 4QRNA 3T6CA 1TPH1 1OG6A 2X0SA 3L4XA 3C2YA 3S8HA 3BQ5A 1GOKA 2VOTA 2J7GA 1DWAM 1XH0A 4PC8A 3EYPA 4M56A 3ES7A 3BLFA 3MZ2A 2V2HA 1GUVA 2R91A 1CGUA 3ABOA 1H7PA 5I03A 1JZ8A 3VNJA 3FCPA 4UR7A 3ZQ9A 2QXWA 3W29A 3RX2A 2CBUA 1EUNA 3V5CA 3IWPA 5FF3A 3WY1A 3T55A 3OPSA 4FX7A 1DTNA 2A3AA 5DQPA 4O1DA 3RITA 4KERA 1IR1A 2RDUA 1H2JA 4JAWA 1UP3A 1G4PA 1H60A 3FJLA 5HA7A 1HTIA 1W5NA 4PEEA 3EOUA 2ISDA 5HWNA 4INFA 4C6OA 4TMCA 1B4KA 1O66A 3WLSA 3KBMA 1SZGA 1VJSA 1TTPA 4Q4QA 3QLLA 5LYRA 4JQ1A 3QHNA 5G5IA 2FVKA 1PCKA 5DX7A 1MRAA 4ICNA 1C9DA 1S46A 3S9ZA 4RZ6A 3QQ0A 1QNOA 3QKEA 1FWTA 2QCEA 4L1GA 5EKYA 4G1NA 3M44A 3G24A 3PF3A 1UR2A 1X8FA 3GK0A 4BY3A 3MP4A 3RF9A 3PAOA 3SUWA 1EWDA 4GHRA 1W8SA 3UZYA 4A3QA 2QGYA 4EWND 2DT0A 3UNTA 1XV8A 1TMLA 4Z1YA 1R38A 2QUMA 4Z1CA 2QV5A 2NV2A 3ME3A 4WEVX 3W7DA 1XW8A 2ZIDA 4P7RA 3V0TA 2ZICA 5D05A 5M3WA 1XC4A 4L1XA 4ICMA 3EWDA 4XZMX 4O4VA 4PRTA 2JFEX 4J7RA 5A6BD 4LUJA 4ZB0A 4B16A 3N2OA 4L61A 2PSNA 4WJEA 1HUVA 4RZ5A 3M47A 3AU6A 2UY4A 2Z1VA 2PODA 5CC7A 1LZOA 3B8TA 4MFEA 3L0GA 1FX6A 3VCRA 1HGWA 3LV6A 1EP3A 4M1BA 4MM1A 3KBSA 3ITCA 3L4TA 3MW7A 2HISA 5AKQA 1O60A 2CLPA 4DYEA 3REQB 1M7OA 4QGCA 4MTVA 4UFMA 4FI4A 4F79A 3RG6A 3KTXA 1JYNA 2P8CA 2XUCA 5D2XA 1X6LA 2ZZ6A 2EPHA 3AIEA 3IVTA 3NXFA 2HVNA 3N14A 3EA3A 1FWEC 4PB3A 3CV7A 3WBYA 3BVJA 4FSAA 1P43A 3EWBX 4CVWA 4X0NA 1PKNA 4FNTA 4FA3A 2E9LA 3NQ2A 3DYOA 2CXGA 2PLKA 3TJIA 2PDCA 1K03A 1UYQA 4ORMA 3BOXA 5D9MA 3DFHA 4GZ7A 2DUXA 1OX4A 3ZVHA 1HJQA 4KW2A 2VNCA 3WH8A 1VEPA 3QC0A 1UD4A 2ATMA 1ELSA 4OVXA 3JRKA 2CLMA 4HHPA 3PANA 3HFTA 1H63A 1KD0A 5IRPA 1MRQA 1TR1A 1MW3A 1PDZA 3STGA 3UPWA 4C5YA 4A8NA 3U7BA 2V5CA 2X40A 4FOJA 2BS9A 2GGIA 4YWIA 1OYAA 3VOIA 3HF3A 3W75A 4Y90A 4B92A 2XTKA 2R82A 5FACA 1PX8A 1GVFA 1V3JA 4NI3A 4C6FA 2RDTA 4AZCA 4HYRA 1WOBA 2Q8ZA 1GOWA 3LX9A 1BVWA 4PUWA 3LPOA 1PKMA 1MQPA 3IJLA 2CHNA 5HBFA 1UKOA 4V15A 3HMCA 1WPCA 4JFTA 4WDTA 2OSWA 2A5HA 1XYFA 1LLWA 1K8CA 1JDCA 4H9YA 1HKVA 2PRMA 2VEIA 2BOGX 2GGGA 3V18A 3MCNA 1EBHA 5L6UA 1EDQA 3E2SA 5HR6A 3GIYA 4Y2WA 1UD2A 2PF8A 4W87A 1XHGA 4AD2A 1DXFA 4R88A 2WZTA 4ECLA 1LBFA 1NDVA 1EHNA 4Y9AA 1BRLB 7PTDA 3TV8A 1AVAA 2DVUA 2BHYA 1ZBWA 2WZHA 4CCZA 3ARUA 4JIQA 3BLDA 1V4YA 4LQ1A 4DJEA 2ZWZA 1E0TA 4NJJA 1M03A 4PUJA 3DDMA 1F3WA 3PJUA 3WLNA 4XTDA 2QCFA 4HPGA 4NY2A 1W5PA 5HOSA 1JRBA 2E0PA 3LI1A 4JN7A 1UWQA 3T81A 3MO7A 4S3GA 1C92A 1RUSA 5D37A 3VOGA 3R25A 1IXPA 1E4MM 2NQZA 1X98A 3ITYA 2JKEA 3WH5A 4JTQA 4FR1A 5FEXA 1QXLA 3RLHA 5DMMA 1SZRA 2CC0A 4DF1A 3MBFA 1O94A 2E5DA 1ZP4A 3NEHA 2GL5A 2E9MA 3CLMA 3E0VA 4UOJA 3L4VA 3VA8A 1TVLA 1K3UA 3R6IA 3NL3A 4GD0A 1SSDA 1V77A 4Z2GA 3MI2A 3LA4A 1Q6QA 4H83A 3SEPA 1I0BA 1PIIA 3RAOA 1D3HA 3ITTA 3URBA 4AHOA 4JQ3A 1G67A 3RLVA 1WO2A 4QITA 2WOQA 1PZ3A 4TO8A 1IZJA 2FZ8A 4I9AA 2OTDA 3W7JA 1N55A 3AROA 4J3XA 4TV5A 3GVWA 1OT1A 3NL6A 2YCKX 4UZSA 1L9WA 1JQVA 4NJKA 3IJ8A 3SADA 2WNNA 2F61A 4I5XA 1A0CA 1NARA 3LLXA 2ZBTA 2IQTA 2YW3A 1UW9A 1VBUA 1RQEA 4H3DA 4LUTB 3OEXA 3C2VA 2G95A 4Q8QA 2ZE3A 3VOHA 4GX8A 3LRLA 4JTAA 4C5ZA 1Z9AA 1XRVA 4GIYA 1EGZA 3H26A 5GJMA 5LGZA 2VGFA 3WLPA 2NUYA 4ZR8A 4PMJA 2VR5A 1YW1A 5LIUX 2NUXA 4V1XA 4LF2A 1R3TA 1IT8A 4B4HA 4ZO8A 2VFGA 5FL0A 1ZUAX 1V0KA 1XPYA 1BKHA 1HKMA 3W2KA 2PD9A 1GCYA 2FGLA 4C6KA 3O3RA 3I68A 5B80A 3COTA 4D9PA 3UG3A 3PWAA 4J3VA 4XBKA 1ZRQA 3KLLA 4JTJA 3ICJA 3OP2A 3GZAA 3CV1A 2WKLA 1QHZA 3CH9A 3WLLA 1KW1A 4JS3A 3S3GA 4CCEA 1A5KC 4ZTXA 3GUWA 4PZVA 3ARYA 5BRPA 1XCWA 3DOPA 4M6QA 1C29A 5A5WA 1EJTC 2XWEA 3JVAA 5I00A 1UD5A 3AMCA 3P5YA 2W0UA 3AXMA 1MQRA 1LLOA 3S2NA 4MPKA 3OW1A 4IICA 3L67A 3TYCA 2OKOA 4L6HA 1NY1A 1V3HA 2DY3A 3F5KA 3AIWA 2Z1SA 3CO4A 1OB0A 3V36A 1QDSA 4WJ8A 1ZHAA 5FJTA 3IUDA 4YHEA 4M24A 4UNKA 3GXNA 1WAWA 4W86A 3IJQA 2J7EA 5EYWA 2XSAA 3V1HA 1E5JA 3FA3A 1R7OA 2BMBA 4JDYA 2OVLA 4H2CA 5G4HC 1A5OC 4FOUA 2NZLA 1XLAA 3R8HA 1IIGA 3KEHA 3N12A 3T07A 2E8ZA 5GVJA 4DUVA 5LNVA 4MF4A 1LORA 3WD4A 3EXSA 1J12A 2IXVA 1KM0A 1XGZA 4L9YA 2VUNA 4AF0A 2OKTA 3CWNA 2QNEA 4GKLA 1E15A 1W1ZA 4EXQA 1M65A 1EP2A 1VJZA 1EJWC 2F38A 2GJPA 1IQ8A 5H8PA 1Q2SA 1DIKA 3QJAA 4NXKA 3IANA 1ISYA 3R4IA 1SMDA 3DG6A 3WO8A 4FNRA 3ID7A 1DQUA 2XDFA 1Q2RA 2E9BA 5I3FA 4IFRA 2X1UA 4G7EB 4C1KA 4XZIA 3S9IA 5CH9A 3AHZA 5HR7A 1XIDA 1XQLA 1PHQA 5HMFA 2DUAA 2YR1A 3NGJA 4IMGA 4IM4A 4AD0A 1TQJA 3R10A 1EA9C 1E6RA 1OFBA 2RGLA 1XLHA 3G1YA 3LGDA 4N9BA 4E3VA 2QCDB 3DFOA 1TG7A 1QOPA 2ZZ7A 1CT5A 1DIDA 3EWXA 4H9XA 3HQ1A 1Q45A 4FF5A 2JF6A 3MYPA 2D23A 2I57A 4RXFA 2RDXA 1IIHA 2OX4A 4DJED 1LQ2A 3AS1A 3M5YA 3EA2A 1US0A 3PULA 3B8VA 4JKKA 4JDBA 5TIMA 4ACZB 4Z2HA 1J0HA 3LMYA 3WQDA 5K4XA 1LL6A 3VZXA 4RKAA 4DXXA 3N73A 3AALA 4Q6XA 4L1WA 2I5QA 3LY0A 5H2ZA 3PM6A 1BPLB 3B9OA 4F0MA 3VC6A 3GH5A 5EMUA 1EFZA 3S1UA 1EF3A 5D2WA 4PCNA 2CZEA 1KRCC 4HMNA 5CLTA 3QSTA 3PBWA 1MUCA 3EPNA 2WMJA 4HPJA 9CGTA 3PP7A 4UTIA 1FWSA 1RK5A 3LHUA 2GYIA 4B2DA 4GC3A 3CV6A 1WZMA 1BXNA 2ZUUA 4H7CA 4N6EA 2A3HA 4RE2A 1BAGA 1CLXA 4JX5A 4B91A 2IW0A 4M8UA 4IUOA 5DBUA 3W9ZA 3RR1A 1EP1A 4LVBA 1CLVA 1KM4A 1PEZA 2PDMA 4I3GA 3ZFHA 1YDNA 3UZJA 4WUIA 4UR8A 4AC1X 3TR9A 1Q8AA 1KKRA 4RDVA 3EOLA 5CPTA 2P53A 3VZYA 4AMCA 2VDGA 4UXDA 4B9ZA 5KZEA 1XYLA 3QR3A 4AIBA 3DIPA 4GI6A 4IQDA 2V6AA 1T41A 4JTFA 3R89A 1TZ7A 3SN1A 4KF1A 2DSZA 3AHTA 3W1XA 2BXYA 3B06A 3UR5A 2P10A 1Q7MA 2OT1A 3EOOA 1B3YA 4JIHA 1RJQA 1GVEA 1UQYA 2ZRUA 1H3GA 2QJIA 4FNPA 3P80A 1OABA 4ZQRA 4QJ5B 2XU2A 1AW2A 1ISVA 2J88A 5D30A 3GNRA 1FXQA 1B9ZA 3UGRA 3KCOA 4OJYA 5D09A 1UZ1A 4QDWA 1WDWA 1O68A 2VFDA 3UJRA 3VM5A 2PWVA 4FALA 2GJXB 2FPVA 3FAWA 1RALA 4QTGA 4PL1A 4TU1A 1CECA 1CENA 4UFLA 2VVNA 4PRRA 1A50A 2A3LA 1GNXA 5EFFA 4EIVA 1QK2A 3LCLA 1PTDA 2ZKMX 3VUPA 3PPFA 3LERA 3DG7A 2QS8A 2UV8G 1A4MA 5K9CA 1QBAA 3P84A 4JTSA 2ZA2A 4UOQA 1RVKA 4HNVA 1EZWA 3KOWA 2QKFA 4QE5A 4J3TA 1UP2A 4B90A 4TTGA 3JS3A 3PZGA 3E0LA 3AOFA 1VLIA 3IV3A 1U30A 2W4XA 3BCDA 3UJFA 4TQTA 1VBRA 4I7UA 3OLDA 4GOAA 1CZ1A 4MFDA 4D6GA 4KT2A 1JF5A 3EGJA 4PMYA 3N2MA 3MVTA 1Z48A 3A4AA 3BGAA 4HTYA 1IXQA 3WNLA 5A2BA 3SRHA 2DZAA 4XZWA 4HNNA 3TN4A 2DZTA 2CNCA 3ARZA 4KRTA 1QTWA 3OLEA 3UG4A 2QVNA 3NQVA 4ZE5A 4J3UA 2F9RA 1D9EA 1PTAA 3E0IA 2F84A 3QYQA 4L9ZA 1F73A 1XBXA 1Z32X 3E6EA 4IQJA 4C91A 4AYSA 4OBSA 3GQYA 1S5VA 1Z89A 1FWIC 1CPUA 4HNCA 4P61A 2PC8A 3EB2A 1VFHA 2E6FA 3TNOA 3GVVA 4U5IA 4WY0A 3FS2A 1TPEA 3VFLA 1J0IA 1E1CA 1T8QA 4AISA 1DWJM 1N2VA 1QVBA 5C6MA 3MHGA 3A3XA 4DLMA 3WF2A 2GJNA 1XDJA 1GW9A 4HSOA 1JUEA 2FHFA 4NZ1A 1WUFA 3HQNA 1PIGA 4RCXA 4P7QA 4J4KA 3IIZA 4QFUA 2HRWA 3RDKA 4DHGA 4O16A 2CBJA 1KGWA 4W8LA 1EL3A 4CNUA 1L6WA 1TVNA 1MEIA 1UZHA 1ONRA 2J9YA 4LAKA 4F2UA 1PIFA 3H2NA 2V69A 2GVEA 1DWGM 3S83A 2QDHA 5BOFA 3BUVA 3VIGA 3LPFA 1XH2A 4G9PA 5HJXA 1VAHA 2FGBA 4RR4A 3O6DA 4L56A 2BVYA 5A6LA 4OKDA 4S3AA 4FIRA 3WD1A 2XN1A 3WD0A 1JULA 4IIBA 3AU2A 2NLYA 3W88A 1RBLA 5I3HA 1FWWA 4MWAB 4DYKA 4W4QA 4ZODA 4CEUC 3NPXA 3R58A 3B9AA 3TQPA 4QCFA 3PUOA 4JBRA 1ZTVA 5JU6A 1QJWA 3R1ZA 2FDSA 3TOPA 3WMLA 3PNUA 3ZSSA 4IL0A 3ZJ7A 4LVAA 4PMZA 2JIWA 3GTNA 1S3HA 1HP5A 4AZ5A 4JICA 2D24A 4UTLA 3OLIA 3WNOA 2G3FA 3TJ4A 3IGUA 8XIMA 1E6QM 2C18A 2Q09A 3WX7A 4B5XA 1GW1A 1C8XA 3BW4A 1QR7A 1V3LA 1VFTA 4LS1A 2QJMA 4I8DA 1BSIA 4S3KA 5KETA 4B2DD 1OD0A 4BHYA 3NQFA 1ISXA 3E1F1 4PE8A 1AJ0A 4IWWA 4QP0A 2RH9A 3MSYA 2GVLA 3VGBA 1XIFA 3GSMA 3DYPA 4B5TA 4ZCWA 1F61A 1KQZA 4MMWA 1TWSA 4MB1A 4H4IA 5LA2A 3VGEA 3VVGA 5CG0A 4QNWA 2WVVB 2BXVA 3KL3A 3KX6A 5CBBA 2VEKA 3KTCA 4IJCA 3ERPA 4HT3A 4K7YA 5A8GA 3UWWA 3GHSA 1XQKA 3RX4A 3LXAA 3IIVA 2AQVA 3GVGA 3FAXA 3VI2A 5A8PA 1FQ0A 5IOBA 1JCYA 4DO7A 3W4RA 3GKFA 3VD5A 3WK3A 1FKXA 2YDAA 1VS1A 2CFFA 2D2OA 2PDXA 4XZHA 4JTGA 3GHUA 3W02A 3TC6A 3BARA 2DH2A 4N42A 2X09A 5F4XA 1U1UA 3UY8A 2EG6A 2OLHA 2QF7A 3TNBA 2WQPA 3Q67A 4MY8A 1LG2A 4C6IA 3L23A 3KW3A 1UIOA 1US3A 2PDUA 3FV9A 1FTXA 4XKYB 3V0UA 3ELFA 1LRNA 4HNUA 2Y24A 3EEGA 4W85A 4NZ3A 4O0ZA 2WNWA 1M01A 3EDJA 3E0FA 1LWIA 5EMYA 3XISA 5GJNA 2VC5A 1QPRA 4GZIA 5TNVA 4AEOA 3M0XA 5E9AA 2BBFA 2DVXA 1A4LA 3MPGA 2QJNA 3ZVIA 3T42A 2BHUA 3P62A 1BXBA 3NSMA 1ZBVA 4GLEA 2HVOA 3P93A 2J7BA 4K38A 3ZMRA 1A5AA 2BGQA 1PWMA 1X7FA 2R24A 2FDMA 3MDWA 4B5WA 2Y8UA 4JTIA 4QG9A 2NX1A 2Q3RA 4Z1AA 2PCQA 5D32A 2HK0A 3H2AA 2OX1A 4ALDA 1SZFA 2QMJA 1CGYA 1YBQA 1ADOA 5LIKX 3H4XA 4WOZA 2E3ZA 4NKCA 3WDRA 3GVRA 4ERGA 1W1VA 4OE7A 3OZOA 1QNPA 3GXDA 2WBKA 2WHMA 4Z2LA 4HK7A 3HU7A 3QM3A 4Q4SA 3MUY1 3WL0A 4X61A 1I75A 3PBVA 3A9BA 5C55A 1SUXA 3VD9A 2RKXA 3QF0A 1TWDA 2CU0A 4H6QA 4HZ7A 1XIEA 1VRXA 3E5BA 3RUBL 4LJ3A 3PSWA 5CPMA 3UGVA 3F7JA 2DPEA 3GVQA 1V08A 1FWJC 4JIRA 5L9FA 4WJXA 3WQ6A 1VCGA 6REQB 1ME8A 3K2GA 3TOYA 3U5UA 1E4IA 4GCXA 2P0IA 3QFEA 2ON3A 4DJFD 2JF7A 3N11A 2ADAA 1TFVA 3KE0A 4ATDA 1FH9A 4LUSB 5FA5A 4JTKA 1H1YA 3PB0A 1R87A 3BGGA 3O07A 2NV1A 4ORIA 5E1QA 1N8WA 5JMUA 3O16A 4D6JA 2Z1BA 1ZU8A 2NWSA 1V6YA 1WBJA 1MDLA 2VZOA 1QOXA 1REQB 1TTJA 5FKYA 4LV9A 5MF5A 2Z2AA 1F6YA 4HMDA 3NG3A 4KCWA 1M1BA 2YJQA 4KS0A 3GBEA 5AOUA 5LXEA 3DFQA 4NAEA 4E6MA 1DE5A 1RR2A 3N19B 1GVQA 4QROA 3SUVA 1JCTA 1L0PA 3HFYA 3Q4DA 1GYMA 2GJRA 1H09A 1OFPA 1DEDA 1XGEA 5E6YA 3LHZA 1KC7A 3AYSA 3SI9A 4ZSUA 5D9OA 4UWMA 2PTDA 3F4NA 3NL5A 1DJGA 5BXRA 4DO6A 3MI6A 5LIWX 2WC7A 3SN4A 3VDAA 3HZ3A 3NQGA 3W37A 3LXCA 3PK7A 2WZIA 5LSMA 3RCYA 1TJ0A 4GIEA 5HQLA 3K8KA 3ZM8A 2EG8A 2CKRA 1MXGA 4QQUA 1BTCA 1JAEA 4GQRA 1CCWB 1XFBA 1IEVA 3T78A 4KQNA 1NWUA 1TV4A 2QQ6A 4LFYA 2OEJA 5A3HA 1V0NA 3CHVA 3GNPA 5TD4A 3C0SA 1SO5A 3KLKA 4AUBA 3A24A 2B7PA 1WZAA 2HNHA 1XYMA 1XBVA 5DY3A 1YTDA 2J4GA 2POZA 1W9UA 3VIJA 2E8YA 1JPIA 4N9DA 1HJSA 2J75A 3W1AA 1E70M 3SGGA 2O9TA 1U5JA 1PJ9A 2WMKA 2D1ZA 4HVXA 3S2CA 1QK0A 3SO7A 3CEUA 4GO9A 1YDYA 2BV9A 3VD7A 4AVNA 3AO0A 1FH8A 1NOUA 3HO8A 4D1IA 2XN0A 3FYPA 4L4PA 5AN7A 4H8UA 1PWLA 3S1WA 2QF8A 4O1EA 1A5BA 1K4GA 3TW9A 1FCQA 1YNQA 2GVYA 1XLCA 1JG9A 2GQ3A 1UUMA 3OYZA 3P8IA 1BHGA 3CPRA 3HV8A 3UCQA 3W81A 2W79A 3PWGA 1Z8AA 2JEPA 4A8IA 1FHLA 4HMCA 4CU8A 1HJXA 3VNLA 3RRAA 3P74A 1OFOA 1KBKA 3ANVA 2I56A 4DWSC 1TA3A 1XL9A 3S47A 1QPOA 3V7PA 4TR9A 1EPXA 4L5ZA 4N02A 1CW2A 3IPWA 4B5VA 2XSXA 4R7WA 3IRSA 3LXBA 4MNKA 4EPEC 5BYWA 4LVDA 4Q3MA 3M1ZA 3HGRA 2DIJA 4HJFA 1Y8BA 2FIQA 4LV4A 1DJYA 2CLHA 3TXVA 1EC9A 2KAUC 3GDRA 3WJXA 3N6HA 3SDOA 4WSHA 5H8UA 3GRIA 3UWUA 4S23A 2BY2A 3ARTA 3PZNA 4JX4A 4YYCA 2PGWA 3F03K 2CBIA 4I9TA 4KGLA 2HXUA 2HPMA 2J78A 2Y7GA 2INZA 1VFOA 1XKYA 5A6MA 4DELA 4XUGA 2JKPA 4ZOCA 4JY9A 3W7QA 5LNWA 2WVSA 5DMNA 3DHDA 1XIHA 2PTXA 3PBUA 3DGBA 2ZWYA 4RE0A 3ZLFA 4HPNA 1DV7A 3DFPA 2J77A 4HOXA 5E70A 3M6YA 4RNFA 1Q4NX 2BOFX 1T96A 3SECA 1YKWA 4A2RA 3KBNA 2Y2WA 1UHVA 5C2CA 3G1XA 2OPJA 1ZJBA 3A3WA 3VKKA 4JFWA 4JGDA 3LENA 1QPNA 3AHYA 1XCXA 3T2PA 3W2MA 2E09A 3CAVA 3BJSA 1OADA 1K4HA 3KBJA 1QO5A 5DFAA 5ENLA 3AIBA 1WYIA 2QIWA 2GUBA 4POCA 1WZLA 1G5AA 3TXZA 3DERA 1GHSA 2PLJA 5G4EA 4DF0A 3DH7A 3EKLA 4D6DA 4LB3A 2YDSA 4CNOA 5M1TA 1X1NA 2ZUVA 3A5FA 2WCGA 1Q6OA 7A3HA 3VKJA 1EOMA 3AC0A 4LC6A 3AUOA 3WBEA 5IDIA 4IFKB 3L4ZA 3KOXA 3O63A 4JNZA 3WQPA 3B8DA 3UT0A 1F4AA 4AU0A 2QIIA 3BGJA 5TBOA 2VELA 4DBDA 4KWSA 3RPTA 2F7FA 4Z2JA 4YWSA 4KEZA 2HDJA 9XIMA 1NM9A 4CQAA 1JYVA 4XB3A 2D73A 4GQBA 4OUIA 3R11A 2H9AA 2E25A 3ZLGA 1OEPA 5AHIA 1P7TA 1PSCA 2O9PA 1ISZA 2J9ZA 5I3DA 1ME9A 3WF4A 1GWJA 1MZRA 2ZYFA 4UQ9A 2CCRA 1S39A 4XD5A 5E0KA 3HPAA 2PEVA 4XISA 2XIJA 4M6UA 1I4NA 1VJIA 4FF7A 2WBGA 3HG4A 5EY5A 2WVTA 2FMOA 1R5YA 4U4MA 4ZTYA 2ZZ2A 4XG1A 2Y70A 3H2FA 1Y5XA 5CXPA 3PZUA 4CD5A 4EF8A 1G4SA 4NG3A 4EX4A 3ITXA 2PDLA 4PTNA 1ICSA 2V68A 4X2RA 4Z2IA 1ECEA 4B4FA 4Z17A 1RCOB 3LB0A 4LY8A 3SCWA 3GLCA 1YPFA 3AUJA 1HKIA 3CAWA 4YCPA 5HQEA 3N15A 4O53A 3MO4A 4HNTA 2GVJA 3LRMA 4PBFA 1CNVA 2PWFA 4XD3A 3RLGA 4E2OA 3WEZA 3RIKA 3M5VA 1K7FA 3UFYA 2DDXA 3CNYA 4M29A 4TX6A 3L66A 1MW0A 1X38A 2A7PA 4JYEA 4X9SA 4ZB5A 2E5BA 1H0GA 3PUGA 3CT2A 1F5ZA 3UXIA 1N82A 3HA1A 4N4PA 1ZLPA 4AHPA 2AAAA 3ITLA 4QS5A 3SB0A 2FTYA 2DSUA 2XVPA 3TSBA 5LGXA 5EGRA 4A29A 4O54A 2OLSA 1RVGA 1THFD 1OVDA 3IVSA 4WRHA 3R2GA 2WPGA 3N4AA 5I3JA 3WK0A 3MWAA 2HPIA 4BQ4A 4DWSA 3WLTA 4YXGA 4QJ1A 5BMXA 4V2XA 4FX8A 2UZ9A 1KM1A 3O2LA 3B0VC 3PTMA 4R5EA 3ARWA 1LUCB 4YIWA 1XG3A 1LWHA 5ABFA 4YJ5A 4HPXA 3UJ2A 4GVFA 8A3HA 3OZYA 1TB3A 1QHPA 2V8ZA 1QMLA 4NYUA 4GRSA 1W1A1 2OYKA 4XAFA 3U3HA 3W7RA 1ZL1A 2EF9A 2KZHA 3R0KA 3NSXA 3V35A 1A5LC 1XIMA 2OSYA 3CC1A 3ITOA 4U2YA 3A3HA 3IACA 1KRMA 5KINA 2YXXA 5M03A 2EPMX 1YDVA 4QEEA 5M17A 1CXHA 3LQLA 4MPQA 1WXYA 4IMCA 5JBEA 2X7WA 1OY0A 2JK2A 1PZ2A 4QLJA 4XTIA 2FYMA 2XGBA 4RJEA 3NPUA 2GPTA 4JTCA 4W7UA 4DNMA 2VDIA 2PGRA 4GINA 4Y6GA 3JR2A 3KBVA 4AB4A 4UTJA 3VIOA 1EEPA 4LCQA 3IVUA 2VD9A 4WKAA 4GBDA 2QCNA 1DJIA 4G7FA 4REQB 2VEMA 1WAUA 4NILA 2C71A 1JZ4A 1PKLA 2QUTA 4IMAA 4O17A 1QI2A 2YL5A 5MHBA 1W1TA 5A6AA 1V3KA 3GXFA 5HK4A 1QNQA 2PBGA 1S2TA 4LVGA 4PBEA 2DEPA 3VINA 3NDZA 1UC4A 5D2TA 4DBEA 2GUUA 2QCCA 1KWKA 3KDOA 3P0XA 2OWXA 2C7FA 5BCAA 2ZFAA 4JN6A 3SJ3A 1M6JA 5BWFA 1UKTA 3TJLA 3N3MA 3GHRA 1H5VA 2ZADA 1QWKA 3OVQA 1QW9A 4IXXA 2VEGA 3FFSA 1W9PA 7TAAA 3R8GA 3WQGA 1XLJA 3PBYA 2W5FA 3WZ0E 3GC5A 4LAOA 4KRUA 5G1YA 3W2UA 1QWGA 1IEQA 2QCGA 2D22A 2VFEA 3EWCA 3S4TA 3C56A 3IGSA 2B7QA 2XJ7A 1VP5A 4NXSA 4CVUA 1YNYA 3HPFA 3I7SA 4LS0A 1WB0A 1TV7A 1ONXA 1L6SA 3TTYA 2XFYA 1OSEA 1SFJA 4QDPA 1NTHA 3BAIA 2CYGA 3B0PA 4RNJA 4E4PA 4E5TA 1Q4WA 3SQSA 3AWOA 3CUJA 4C7GA 1KO0A 1TPWA 1F05A 3VGDA 1PBGA 2POTA 4WQ6A 3GH7A 2NUWA 3UCCA 3U4AA 3F4DA 3CZEA 1AH4A 5DCDA 4F0LA 4E4FA 2H3DA 3LNMA 3HGOA 4ZVJA 4NRSA 4ERAA 4PCFA 3W82A 3G1HA 1L6FA 3TYZA 3UYCA 7REQB 1FBAA 3HPSA 4RW3A 2V63A 1GKQA 1FCUA 1B90A 1V79A 2P1FA 3QY8A 4O13A 2ZUWA 4QQ3A 4J9JA 1OFDA 1Q5MA 1TPFA 1CTNA 2DZBA 3S1XA 4B3KA 5D04C 2A1YA 5DXXA 1ONEA 2WC3A 1W9BM 5I2UA 4JNYA 3W1MA 4DM1A 2Y7DA 1O1HA 3QKZA 3WLRA 2IPFA 4JTHA 3EB3A 4Z2KA 3UZWA 1QW8A 1EGMA 4JHMA 4BR1A 3GE7A 4M3PA 1YLVA 5JVLA 2XGZA 3DKJA 3PZQA 3W7GA 3ARRA 3BSMA 2VC9A 4Q8OA 4IP5A 2D69A 2FB3A 4GWEA 3NZRA 3H23A 4PB4A 5T9CE 2XIMA 4LUYA 1XLFA 3THCA 2FZ9A 5C8BB 4DF2A 2FKPA 1XXXA 1XSKA 1US2A 2I5IA 4UFHA 1WDPA 2YZRA 5FJIA 4RDWA 4ZMGA 1K70A 1ZAIA 2WWCA 4OV4A 4PUNA 2VJXA 1LOLA 3R12A 4TX9A 4NX0A 3KWSA 2PWGA 3MKCA 3RM8A 2P8BA 4EACA 3OJGA 3RM9A 1AZ1A 1LT7A 1ML1A 3M0JA 3ORWA 1R3RA 4LY4A 3DECA 2Y61A 1RBOB 3C0QA 3T4CA 4PEKA 4AZCB 1QI3A 1O12A 1K8YA 4IOTA 3W1TA 5D38A 1NFPA 4WD0A 2B81A 4GXPA 1TJRA 1TV3A 1WDRA 4PUDA 1OFRA 5CEWA 2PU1A 4DUOA 3T0AA 3DFSA 5CCZA 2O7SA 1GZGA 1K77A 3FYOA 1E43A 5DELA 4WXYA 4DWSD 4V33A 5C0QA 4QDMA 1RLCL 1A5NC 4ERIA 1GEQA 1ZJHA 4NZ5A 3G6LA 4E8DA 4WKFA 1CLKA 2WJZA 1UP0A 1TELA 3ZJKA 1GQJA 2ZC1A 4B5UA 4GY0A 3CZKA 4JCMA 1GVIA 2EGZA 1UR3M 1K9FA 3BZJA 2CPUA 1WKYA 1RPXA 5HWJA 4CD8A 1B3XA 4DZHA 2Z0IA 5E5CA 1BKSA 2OOFA 2EXOA 5A8OA 4JQ4A 1PS9A 3PUEA 2PRLA 2WSKA 4NX5A 3MUZ1 2GSEA 3EDKA 3H8AA 5H91A 4D8ZA 3Q37A 2PDPA 3E2RA 4GQGA 4XO6A 1UD3A 1QO2A 3T9PA 4GFIA 2YYUA 4J40A 5CC5A 1DBTA 2VWSA 2BB0A 3EXRA 1NJJA 4LUIA 4ZQOA 1VB9A 4QLKA 3IJDA 1BRLA 1U83A 1PXGA 5G2HA 5CC6A 3R13A 4B5SA 3C3UA 2ZX9A 2R1NA 3NVDA 5D9NA 1XYBA 3VC5A 2BASA 4ZFMA 2H6RA 3QY6A 3M0IA 3QPEA 4V28A 4EPKA 1UWUA 1ODUA 3CB3A 2DIEA 4PODA 2WSRA 1AJZA 3BG9A 5A94A 3C52A 1KM5A 2GFTA 1BEUA 3L21A 5A8QA 4I7VA 1HL9A 1OGSA 1V0MA 4H9VA 4X9YA 2OU4A 2HMCA 4HZMA 4H6EA 4O1BA 4X3ZA 2V5JA 3QV7A 2OEKA 3VKBA 2P76A 4DNHA 3PR2A 1L2QA 1S2AA 4JL2A 1PZ0A 1HFBA 4BS0A 4IG2A 2A6NA 3BH4A 5CJMA 3TCSA 4YTQA 1J79A 3VAVA 1MYRA 2YIHA 3MA8A 3RPDA 4OQVA 1U2YA 1JJKA 2VCBA 1A5SA 1W2PA 4XV0A 3RU6A 2WWDA 1X39A 1PZ1A 4JPGA 4KESA 3G77A 3PN8A 3HMJG 3E0WA 4GYFA 4NZ4A 4BQ2A 3MUAA 2PD5A 2I7GA 3BLLA 4F9DA 3G6MA 1VCVA 1CIUA 2ICSA 1EYEA 3W6MA 4IMFA 4N0RA 1CEOA 1U5VA 2DFAA 3CLWA 5C71A 1TREA 3FLUA 5HMDA 3SCOA 1TCMA 2DP3A 3LCHA 1OGGA 3IIXA 2YA0A 2BGNE 1TV2A 1J8VA 4K36A 2A6LA 3FOKA 1BYAA 2Y62A 3K4AA 1EWEA 3AMLA 2G41A 3MVIA 3UU0A 3E2QA 3UEQA 5EU9A 2IKJA 4I6VA 3ITVA 1G69A 4LNCA 4AZ6A 3WFAA 4WGXA 5KEZA 2Q02A 1J11A 4DBUA 4GACA 1XLEA 2R1KA 4W93A 3QGVA 1EO7A 4AWTA 4F66A 4IPJA 4QE4A 1UOKA 4PR4A 1D7FA 5HMEA 3MHUA 4YTSA 3T8QA 1TUFA 3OBAA 4PTVA 3CASA 3KRSA 3CUXA 1UKPA 1G6CA 1BTMA 2RJHA 5DN1A 4AC7C 3DFNA 3O6YX 1A80A 2OQLA 4J28A 1SGJA 1R9YA 4NT0A 3S2MA 3QHMA 1OCQA 1L8PA 1EZ2A 1KLZA 3I3BA 2WNZA 3FDGA 4MJMA 4US6A 1SFLA 3EXTA 3FA4A 3DI1A 1J0JA 2QDDA 2YPIA 3QRHA 1TIWA 3U6WA 4ZGYA 2AQOA 2C19A 4HA3A 1VH7A 3FJ4A 3W1QA 1DPMA 2CLKA 5EBUA 1Z69A 3VK5A 3WNPA 2Z2UA 2GGHA 4MUZA 3IK2A 5I7GA 4U10A 3KVKA 1FWRA 2DZPA 3G8RA 2F2KA 3KOZA 4QM1A 1RD5A 1SQ7A 3FK4A 1MSSA 5J5RA 3C2RA 2ISWA 2YL6A 4KWOA 3MC5A 3MSGA 4FX6M 3W76A 4QS6A 2J27A 3N3TA 3TW7A 3JUGA 3CWHA 2NQHA 3DC0A 3W22A 3NQ6A 2WSQA 2FH6A 1HGYA 3WQFA 3WDIA 3CIVA 4R53A 3QW3A 1J0ZA 2NW0A 1NP0A 2CBVA 4A22A 1RJPA 3LCXA 3WDPP 4TIMA 3VO0A 3CUHA 5B7ZA 2ZRYA 3URAA 4IPPA 2AL2A 3MHFA 2WMFA 2OJPA 1E9IA 4LT9A 4GYJA 4C60A 4P8WA 3QZ6A 2IKIA 2PP0A 1KTNA 3A9IA 3GY1A 3CS2A 1PPIA 2PDYA 4AZHA 3A4XA 2A7NA 4RZ4A 5EMMA 4LAUA 2BP1A 3UR8A 1B1YA 2H8ZA 4J27A 4WDUA 3QGKC 1G4TA 3CHFA 5KZMA 3AXXA 1VIWA 3UJEA 3BLIA 3VKDA 3D3FA 1GQIA 4C6QA 2CZVA 2ZRVA 4RZBA 2X7VA 2IPGA 1EJSC 4G7EA 4O15A 4ZB2A 5CSUA 1EJXC 3IUHA 4AX6A 4O8RA 5B7YA 5LNSA 3TW6A 4HOWA 1TR9A 3O1NA 4NZJA 3BV7A 3E3HA 4PMOA 5HJYA 2PDFA 2QCDA 4FXFA 1YDOA 1SYTA 3I4EA 3VD4A 3PJWA 4C1NB 3N04A 1EUAA 2R8WA 4CQBA 3HOJA 2INFA 4KEVA 3W85A 3SGUA 3QSRA 4F0RA 4H7ZA 3Q94A 1UBPC 2VXNA 3LV5A 3U2OA 5J8LA 1HT6A 2W62A 2Y7FA 4UTFA 4C7DA 3KVMA 3M0HA 4IPNB 4DJDC 5AZ1A 3W7PA 4ACZA 4HN8A 5CPNA 2UBPC 3JU2A 3CQKA 3FVMA 1X6UA 3HQOA 1GEHA 3L4WA 1AW1A 3UPBA 2INEA 1K6WA 5REQA 1TPUA 2CITA 1RHCA 1JPHA 3STFA 1H5YA 2QGHA 1IEWA 4QJ4B 5C2GA 2IQ0A 1M5WA 4H9TA 3CU2A 1P48A 2QUVA 1KXVA 2BFGA 2NVCA 4XBJA 2J25A 4Q7IA 1TQXA 4GY7A 1SVDA 4BEUA 4JY8A 4J2PA 2FTPA 4NI8A 4O50A 1ZZMA 3H54A 5JXQA 3CGTA 4IH3A 4O0KA 4LH8A 3SCRA 2WLZA 4URIA 2JKAA 2QULA 1BF6A 2X1IA 4N6FA 3LTPA 4MDPA 3SIMA 3KHJA 3SUSA 3G18A 1S5MA 2HJPA 3O0KA 4F4RA 1CXEA 4AXNA 3UETA 3EDFA 4MYXA 4B3LA 2AGTA 3WQVA 3WLIA 1JFHA 2ZVIA 3WJSA 1EIBA 2QPSA 4R9OA 3NYDA 5G2IA 1EQCA 1BYBA 1RXOB 2G3MA 1EJUC 1XBZA 4WGHA 4NZCA 3I65A 2PDGA 1MW1A 3T08A 4MB4A 3VX1A 4KWVA 3GAYA 1J6OA 5J5DA 4C6NA 2IMRA 1GOXA 2H90A 4M51A 3AMDA 5LIYX 3BZGA 3M0MA 4Z08A 4CGTA 1P0DA 5AZ0A 3DZ1A 4JTEA 4IPLA 4K68A 2ZZ4A 3GFXA 3BK0A 1KR1A 4G2DA 5FD0A 1WDDA 2B31A 2Y63A 1LT8A 1Q7QA 1AQMA 5BRBA 4HCHA 1KGUA 1PAMA 4IGSA 2C1GA 1QNRA 4Q8PA 1BWVA 4UIOA 2GJXA 4WCJA 3EDEA 3UPMA 3K8MA 4S39A 3VIIA 1GG1A 2WJDA 3O7UA 1J18A 3I7RA 3WJZA 5FL1A 3E02A 1JI2A 4MWAE 2YB4A 3UF9A 4UMAA 2QUUA 1TX0A 4Z1DA 1UR0A 4QCEA 1OCJA 5TQLA 4YTRA 3CBWA 4LANA 3TQ0A 4ZXLA 3TIMA 4F0SA 4HHHA 1C9WA 1UCWA 3NL2A 4PMNA 3TYUA 3DCPA 3PBGA 3S0CA 1I60A 1R3SA 3KAOA 1GQLA 3GG8A 3DENA 2EAWA 2E77A 3NTYA 3SRKA 5D8WA 3ATZA 3MB9A 3M41A 3BMXA 3LEPA 4EAYA 3MWCA 4MZ8A 4B15A 4XIAA 1J9YA 4WY0B 3THAA 2PZNA 4NAFB 5JUVA 1DJWA 1W32A 1KGXA 3H7UA 1PX3A 3GNXA 4QXIA 2ONEA 3WFZA 4UOZA 2VX4A 1PE1A 2AMGA 3VPLA 3VFCA 4UCFA 1ITQA 3OIHA 4E2DA 1XLDA 3VTRA 2ZX5A 1S5WA 3B0YA 5XIMA 4AZGA 1HKKA 1HNYA 1TPVA 4H00A 3N2TA 4MAZA 2G5WA 1FWCC 4ZSTA 5ECVA 2OGJA 1EDTA 2XM1A 3BOFA 3LBMA 1JCLA 4OFCA 3BSGA 3QEZA 2OEMA 2Y88A 4HA0A 4H9ZA 1YPXA 3W1RA 2JGQA 1LYXA 4ZOBA 4XAZA 4IF2A 3BMWA 3QZAA 4IGMA 5LZLA 3GG1A 1IEXA 3OBEA 1F8MA 1B0IA 3BV4A 3EX1A 2PMQA 1KTCA 4PFMA 5I3GA 4GI8A 2G97A 1SJBA 5LKYA 4HZ8A 3N18A 4UQCA 1AW5A 1A3WA 1DWHM 2DZXA 3L2IA 4DB7A 4DJDA 4J3WA 3U2CA 3L65A 5K4ZA 2XG9A 3Q65A 1XSIA 2GK1B 1UPMB 3TVAA 4DI8A 1TE1A 1OK6A 5TF0A 4U3CA 1GOQA 3CQ0A 3TYAA 3RXZA 5HDRA 5FOOA 4JX6A 5CPOA 1H7WA 3OG2A 1UD8A 4OHQA 4HPHA 3LLFA 3MUCA 3BLOA 1O7AA 1HG3A 3T8LA 3HM7A 2YCEA 4S3EA 4MB3A 4O1FA 1G1YA 3B04A 3BMVA 4UTTC 4NJGA 5AYBA 4DO4A 4DYJA 3CL8A 3TCEA 1R3QA 1FWAC 3LSCA 1D8CA 1G01A 4HU3A 2W92A 4K6AA 2WYSA 3NQ7A 4PTXA 1YQ2A 1F3XA 3DHFA 4C6BA 5JBFA 2Q3OA 4UC5A 2NX9A 3IK4A 3GXPA 1PVNA 3LCIA 4CD6A 4HN4A 1XINA 4LWWA 2FZMA 3EA1A 3GDMA 2CWXA 2A2IA 4XSLA 2O9OA 1JZ3A 3S6OA 3LHWA 4S3CA 2Z00A 2BHZA 1PDYA 1OG0A 2HBXA 2D3LA 3BC9A 1MEHA 2EO7A 1KXTA 5FEZA 3I10A 3HPXA 3IEBA 4ADSA 1U1HA 1CDGA 3UBPC 1FXPA 3HGJA 3MUXA 1X97A 3AS2A 1E0XA 4PMUA 5EBAA 2CERA 1KV8A 3LBOA 4FK9A 2P0OA 2WANA 4UMCA 3R8RA 4C1LA 1JI1A 1AK5A 3UYIA 2GOUA 5JH1A 3QZEA 4S1FA 4H6KA 2NVAA 4GUJA 4ONVA 3TU9A 1V03A 4PUUA 1W9DM 3RLUA 2Y7EA 2BOEX 2WB5A 1XLKA 5T9BG 2F6UA 5BWAA 1R47A 3B97A 1XM3A 3NQCA 3ZT5A 4EXAA 3L2MA 3WLOA 3W7HA 1M04A 1IGSA 3V16A 4C6PA 5A6JA 2PDNA 1VFUA 4EKJA 4IJBA 1A5CA 3AQUA 1V6XA 1OD8A 4DQWA 4YVVA 3ABXA 1KBLA 2E67A 4YTUA 1JD7A 4C7FA 5HNTA 3H6OA 2CZ5A 2HXTA 9RUBA 3ABRA 2WJFA 1R3WA 4EAMA 3THDA 3SBFA 1XIIA 2QPXA 3LK6A 1CXFA 5TAOA 1UMLA 1Q6RA 3RILA 1HJWA 4FIQA 1WUEA 5CLWA 4HTBA 4OBRA 2DV0A 4ICCX 3LPPA 4Q8VA 2NT0A 1VHCA 3W0KA 1I8JA 4HHMA 4JTUA 2NV9A 4BQ3A 2AL1A 2GWGA 3GTXA 1JF6A 2PGFA 2DUZA 3LS9A 2Z4GA 1EX5A 4O1AA 1T6MA 3R94A 3WDQA 2OOGA 4AY1A 2PDKA 5F2GA 1KQYA 2YXGA 3C0JA 3T05A 1JIBA 3S42A 2NXHA 3AZTA 4L64A 1UKQA 1OCNA 4AEEA 3WLKX 4YL2A 2NQLA 1DJHA 3UWYA 2XVLA 3PBMA 2HV5A 4WVXA 1OINA 3BSHA 2BG5A 3QXBA 1NF0A 2V5KA 4FNQA 5T26A 1GTEA 5C9RA 1J2BA 3TWBA 1NWRA 2RDWA 5AHNA 4RE3A 3PY2A 3N6JA 1FVPA 3WMBA 3KHDA 1ZB5A 2VC6A 3L5MA 1QASA 1BWLA 5CBJA 3NZGA 4EXBA 1XC6A 5HNUA 3RCNA 3S1GA 6XIMA 4KH2A 1J0YA 1TRIA 2B7NA 1JDDA 3L68A 4EPBC 2WPBA 3HV9A 4UQAA 4B9YA 3DYMA 1KFJA 1J0KA 1AD1A 2VT0A 2ZE0A 3W7OA 1MMFA 1S38A 2F6XA 5F4SA 5IFPA 2QCMA 3P5ZA 3OG3A 1EIXA 3UR2A 2G4FA 4JL1A 3T2QA 3S5OA 5E09A 5ABTA 3SFKA 1BG9A 2X05A 2YXOA 3QTPA 6ENLA 2DIKA 1JDFA 1I2RA 4Q33A 4Q4RA 4BA0A 4DUWA 1O4UA 2B7OA 3LBCA 3O0FA 1FKWA 3DHPA 1POKA 2QJJA 4DJDD 3E2VA 3GR7A 3S5YA 1BGAA 3M0VA 2ZX7A 3FKKA 5BU9A 3SURA 3K8LA 1DJXA 4OU1A 2EPNA 2WHKA 3PFMA 3ANUA 3QMTA 4LX4A 1QAPA 4F48A 4HU4A 3I3DA 1XLBA 2PWUA 2XWDA 1OZMA 1V02A 2ALRA 2V3GA 3NQDA 5K9DA 2CLIA 5C9WA 4HGXA 3AHVA 5FAGA 3TLLA 4DBSA 2I5GA 3KL0A 4P5UA 4LBRA 4CQDA 3WCZA 4X63A 3F4CA 1Q13A 4RL3A 4AX7A 5KSWA 2F8QA 2WW5A 3PC0A 2GQ9A 2DVTA 3P3BA 1V3MA 3CMFA 2EG7A 2D0HA 1FUYA 1ZJAA 2W66A 4FP1A 2OG9A 5XIAA 2X1RA 1FFRA 5BZAA 3NQBA 1EXPA 1OF6A 3WUEA 5CPQA 3S2LA 1ADSA 3AIUA 3H12A 3I7QA 3TFCA 3TUUA 1ICPA 1DJZA 3II1A 3OTRA 2ZX8A 2V2CA 3H7VA 3WNKA 3F2DA 2XH4A 1Q7ZA 3GS6A 3TN3A 2FMNA 4O52A 3O9NA 1JDEA 4ZBCA 2YBVA 2Y1HA 3UZXA 2C3ZA 5AYIA 5IDZA 3ZR4A 1VPXA 3RPMA 3GTHA 4HCLA 1TA3B 4IGNA 3LMZA 3OZMA 1A49A 3NQMA 1AL8A 1E9YB 2WMHA 3VUSA 5D4YA 4IL2A 2V30A 1LF1A 3G22A 1G9HA 2VZTA 1Z3NA 3BL3A 2CHRA 4N9CA 1FCVA 2F6KA 4ENLA 3PHAA 1R9XA 4GE8A 3M6DA 3F4WA 1RY8A 3TLQA 2V2DA 3L0KA 4ZL1A 1RBAA 1RD6A 1W1IE 1E3XA 1IWPA 2D0GA 3N9KA 3WUBA 1XKJA 1HVQA 5FF4A 1H7NA 3CT7A 3Q58A 4A2SA 2J8FA 1C7SA 3NZQA 1M7PA 1OFAA 1HX0A 4O8AA 2WJEA 1LP6A 4HSNA 4QIUA 2Q71A 1IXOA 1LBLA 1TRDA 1W3JA 4NASA 1V6WA 3WELA 4N7QA 1NDZA 4D72A 1LQ0A 4X22A 4AH7A 3VMOA 4JYFA 4O1CA 2GLKA 4D1JA 3ARQA 1XWYA 3VM7A 1VCFA 4PMRA 1XDMA 3P8JA 1O1ZA 4ZEPA 3A47A 4DIAA 2C15A 3B9EA 3TFXA 1E6NA 3HG3A 3OU8A 5KITA 4JKMA 3PNZA 1JD9A 2ZVRA 1ODZA 2V3FA 1VFFA 3PPHA 1NSJA 4ILSA 2FLIA 1M68A 2D2JA 4NYYA 3CYJA 4FXRA 3DUGA 1TV8A 1XI3A 2QHAA 1OCBA 2NXGA 1KCLA 3L4UA 1F3TA 4UFIA 4H9MA 1DXEA 4EWJA 3M64A 3M0KA 4AEFA 4IFOA 3TC3A 1JNEA 4O4WA 2ANUA 1OFQA 4N2YA 1EOKA 5I3KA 4GABA 4KEMA 4E2BA 2OZTA 1LTDA 1J4EA 2VP8A 2PWEA 4NJHA 4V1YA 3TTQA 2O0TA 1XFCA 1MO0A 1DP0A 1GYNA 3SGZA 4D8AA 4PMDA 1GKRA 1AA1B 4Z0SA 3CO8A 2YBUA 4FNUA 3TN5A 3I6RA 3AMKA 3ARVA 1V6VA 2ASHA 3F2BA 5AC7A 5A1AA 2TAAA 3WF0A 2E1WA 1BSLA 1HJUA 4PCSA 1W5MA 5EMJA 3IGHX 3ZXWA 2VDHA 2CLFA 1UPPA 2YW4A 2BXZA 2JALA 3KP1A 4CNNA 2B0MA 5F2MA 3P61A 1XS2A 2Y85A 3LSBA 3VDGA 1P7TB 1XPGA 3H2CA 3OGSA 3WMCA 3VCNA 1EF2A 3SIZA 3MJMA 3WK1A 3GDTA 4BI5A 4DXKA 2WKJA 5I23A 4S38A 1F2JA 4YVXA 3W1LA 2QT3A 2Z28A 3SY5A 5A6BA 1QUMA 1W1YA 1SJAA 5J04A 5I79A 2C6QA 2NSOA 5A8NA 1KBBA 1V5XA 8TIMA 3PZMA 4BCEA 4JYDA 3NVTA 5I24A 3AXHA 3IJ9A 5C9UA 2NQ9A 1ZPTA 4CNPA 3FHQA 2ZOXA 1BYCA 2O92A 4LXFA 2VO5A 3I4KA 2QMKA 1R2RA 2WHLA 1WXZA 2VEFA 4FS9A 1K8XA 2ZDSA 4ZO6A 2ZX6A 1WA3A 3AYRA 2E6DA 1H50A 5ABEA 4E2VA 1JCJA 3GM8A 3WLJA 4PA8A 4XAPA 4D71A 1DQXA 1UQZA 4IMEA 1FWDC 2G0WA 3CK5A 4PTMA 1R3VA 2J6VA 4LYQA 2C0AA 1JNDA 3USBA 2DZWA 2VCAA 5FSEC 2WVUA 1RCXB 1VRDA 2CEQA 2BX7A 4LCSA 3FJNA 3I6EA 2YLAA 4MHBA 2PGEA 3UVIA 1CBGA 2REQA 4DWSB 1UR4A 3D47A 5HUPA 3NM3A 4NJIA 3H21A 5FF0A 4LALA 2C13A 5CZTA 4O0QA 5GPRA 3E9AA 1E9LA 3H22A 5ABFB 1W5OA 3ARXA 2H8XA 3VD3A 1WDQA 1N8FA 1R2SA 1P1MA 1NIUA 1AL7A 2VGIA 1DJQA 2UY3A 1EXBA 1TV5A 3FHAA 3SRDA 2ABAA 2G8ZA 4JIEA 1YTKA 5CAHA 1ZENA 1H7OA 3GX9A 2ZA1A 1AMYA 2LLEA 3MCMA 3DFTA 4JNMA 5EMKA 3DC8A 5FJOA 5HULA 2YFNA 4IIDA 4K37A 2RAGA 2YGYA 1LL7A 3FSUA 4OBTA 2C0HA 4MGGA 3FDKA 1W2VA 3ZO9A 3QFWA 4ZE4A 1BLIA 2HEJA 4FZIA 4HB7A 3WDJA 4GI9A 3RHGA 1FH7A 2PWHA 2E5CA 2VR2A 1LUCA 2OB3A 3UWEA 1SJCA 2Z26A 3OZPA 3NYZA 1Q6CA 1S5NA 3SUUA 3U2ZA 3MMUA 5HNRA 3A22A 5AYXA 3UXLA 1FHVA 1MUMA 4DAIA 2QDEA 3LHVA 3OQEA 4PB5A 3G3DA 1EC8A 2BWGA 4TOQA 3S1VA 3W25A 4AFYA 2BTMA 1AUSL 3NFUA 1K8ZA 1QI4A 4BQ5A 3KOYA 3IJIA 1GVSA 1QFEA 2PZ0A 1H7RA 4YU1A 1TKKA 4ZO9A 4XX6A 3WG6A 1EYWA 2ZUNA 3BLKA 1E51A 4UNIA 3H24A 2V3DA 4GIAA 1WP6A 4C6CA 3EWUA 4OV9A 1MFVA 3C8NA 4BZYA 3UD6A 3UWQA 3GG7A 1GOIA 1M41A 4H41A 4NSBA 3P81A 2PDHA 3PTQA 4REQA 4DO5A 3LGEA 1P5BA 1HKJA 7ENLA 3VIPA 4DJEC 3C86A 1L8NA 4PUKA 1KBIA 1RPKA 4C65A 2ZRWA 3SR7A 3LU2A 1UWTA 2XIQA 5T91A 1EQPA 2Z6JA 1UD6A 3AI0A 1NU5A 4GMEA 1NWTA 4GC4A 2OODA 5EMLA 3WD3A 1OC7A 4HZ6A 2G96A 4OZOA 3T0DA 3W2JA 3N13A 3C61A 3GW3A 3BO9A 2VOMA 5C2XA 1DIEA 2GGEA 4L6OA 4Z0JA 2VX5A 1VC4A 4JQAA 1JCXA 1HL2A 4LCRA 4LPCA 4CU7A 1IZKA 1HF6A 3WQOA 1M3UA 3G3MA 2FFCA 1QU4A 2NQJA 3W2LA 1TJ2A 1TTIA 3BXWA 3DBPA 1W3TA 2ABBA 1BYDA 3QTGA 2VQUA 2A7RA 1MZHA 3TR2A 1WKDA 1HQTA 3QBUA 1OIFA 4AZBA 4XQ6A 2CZDA 3SCPA 1E6ZA 4KCUA 2YCLB 4XKMA 1EH9A 1VZWA 1QNVA 1VYPX 2J62A 3EOSA 1OFEA 3NR0A 5F1UA 4NIRA 1ZGDA 3EZ4A 3LZ5A 1V6TA 1I9CB 3VE7A 3L2LA 4W8BA 3NSNA 1VYRA 2X41A 1VIZA 1GG0A 1G0CA 2XGIA 5DMYA 4DWDA 2PRHA 4W7VA 3H2EA 3PSVA 2GQAA 3B9NA 1CGXA 4GNVA 1XUZA 5BXSA 1KV5A 2JE8A 3AS0A 4AXKA 1FWBC 1ZFJA 3OOQA 4GCAA 3M5ZA 3G1DA 3VOJA 3PB2A 3WJWA 1KTBA 5LA0A 3OVGA 3E96A 3B4UA 2G3IA 1YE4A 1F7BA 4RNHA 3VCCA 3TZFA 7REQA 3S5ZA 2E1DA 4L80A 3LCGA 3R79A 4YLWA 1JDAA 3L5AA 3VZZA 2P5NA 4GBU<