3KVJA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with amino-benzoic acid inhibitor 105 at 1.94a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
363
Chain Sequence
GDERFYAHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title Discovery of novel inhibitors for DHODH via virtual screening and X-ray crystallographic structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 137
structure length 363
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kvjA00
4NUWA 3EX1A 4AEOA 2C6QA 3P7YA 3V75A 4UTKA 4O15A 3W1TA 1VYSX 3G24A 3MMTA 4S2CA 5I3IA 3GR7A 2CW6A 1QCWA 2E5DA 3LHWA 2V82A 3QJAA 3G0SA 3P84A 1LTDA 1WDWA 4ML9A 3QMSA 2Y7GA 5J5RA 1SO4A 1GZGA 2VXNA 5D32A 4MZYA 3M16A 3W1NA 1QPRA 2DZTA 1NSJA 1QO5A 3TJXA 2VEPA 4RCXA 1KFBA 3MP4A 5FF3A 4KWWA 3SI9A 2Z2UA 3IVTA 4XQ6A 1PV8A 3OIXA 4X9SA 2A7NA 3S9YA 4Y9AA 1QMLA 5K9DA 3P60A 4R7JA 3IEBA 3EWXA 1T8XA 1YDOA 1KTBA 1SSDA 3LOTA 2V2HA 3B0UX 5EY5A 4UTTC 2ZRZA 4MVAA 4TMBA 1A53A 3GXPA 3R8RA 4ZQOA 1B9BA 2BX7A 3M5YA 3EX4A 4MFDA 4UTIA 1OX4B 3OG3A 4LOCA 3B03A 1K8ZA 3EX6A 4IX0A 4JYDA 2UV8G 4DQWA 2GVJA 1OF8A 5K3VA 3LRLA 3HG4A 1Z48A 1OFOA 1KM1A 3KVMA 4L4MA 2QEZA 5AYYA 3RLUA 4A21A 1QAPA 3LCWA 4ADTA 4ZL1A 4AF0A 2HS8A 2V9DA 4K7VA 3MJYA 4A2SA 5LNVA 3UWUA 2Z6IA 3GLCA 5AHNA 4JICA 1LRTA 1ALDA 2QF7A 2ZRWA 5C6MA 3HG3A 5LHEA 5I3KA 4UFIA 3S5YA 1DV7A 3U8GA 4WY0F 1GG0A 3W7IA 3QC3A 2RKXA 3BVJA 4DELA 4JD4A 3LX9A 3E12A 2EKCA 3W1QA 2Y89A 1EX5A 1WAUA 1PHWA 3EXSA 1XKYA 1FCVA 1SSGA 2XN2A 2B4GA 6ALDA 3C6CA 2RH9A 4Z08A 1EB3A 3N9RA 3UWVA 1XBXA 3GAYA 3IIXA 1XFBA 3WJSA 1KBIA 3LM7A 3QMRA 4Q4KA 5F2IA 3O07A 3MHGA 3G1VA 2Y85A 1JULA 4KWVA 2QAPA 1IIHA 2ISWA 4UR7A 2PURA 4ADSA 3G3MA 5HR6A 1EEPA 1QOPA 3IGSA 3W2JA 3LXCA 3G1XA 3TW7A 3Q37A 2QUTA 3NQFA 5EBUA 3QEZA 7TIMA 1JUKA 4O50A 2ZFAA 2G95A 4QAIA 1AL7A 1OX5A 1S5WA 3NQVA 5FEPA 1XBVA 1NVMA 3LCFA 3HF3A 2ZZ4A 3LDVA 3B04A 1BWKA 1GYNA 4ZMGA 3TQVA 3CHVA 3M0ZA 4IUOA 3P5YA 4ORMA 4MIMA 5D03A 2XFWA 1TSIA 3M1ZA 1H7XA 2YFNA 3TC6A 5F2MA 3B0VC 1S5TA 3SECA 1LBMA 2QCMA 1B57A 2DORA 3BW3A 1SZNA 5D30A 4DBEA 2NX3A 4UTWA 3FJ6A 3C56A 1IXOA 5K4ZA 4J9JA 2E6FA 3SJ3A 1I2QA 3M47A 1SZEA 5F4XA 2FPYA 5IBXA 4RXGA 3FIGA 5F4WA 3KRUA 2CWNA 1LBFA 3A23A 2NUWA 3RNDA 1R46A 2PRLA 2J88A 1N7KA 3IVUA 1FWRA 1F7BA 3M44A 4O12A 3PSVA 4BWLC 5AYZA 4I7WA 5CG7A 4BI6A 3W3OA 3WFAA 4PODA 5FEXA 4PTNA 5LNSA 4K8HA 3P81A 1G7UA 1TPH1 3P8JA 5KZMA 2I9EA 5DELA 1XBZA 3MI6A 1UUMA 2QCDB 4FX8A 1KV8A 2ZZ1A 4HT3A 1H63A 3SZ8A 2D73A 2E5CA 4O0KA 3W7DA 1ME7A 1L9WA 3B06A 2VELA 3WJWA 1TV7A 1RD5A 3STFA 2NX9A 4WY0B 1Z42A 1LRNA 2JKPA 4NVTA 1HUVA 1KFLA 1QPQA 3BGJA 1K8XA 1AL8A 4M5PA 2GQAA 2A6LA 4G1KA 1GTHA 3WJYA 4TMCA 3TUUA 1J2WA 5HULA 3PR2A 1JCYA 3OHIA 4ADUA 5L9FA 1I2OA 3O1NA 3NZRA 3H54A 3FS2A 1GYLA 4O13A 4X2RA 3A9IA 1TV5A 4PA8A 3TMQA 1OX6A 3G22A 2GPTA 4IJBA 2X1UA 4KFNA 2W79A 2WPBA 3W2MA 1KLZA 1GG1A 4S2BA 4UFMA 4B5NA 3BARA 1VHNA 2QJHA 3G8EA 4NZFA 1L2UA 4FEZA 3TJLA 3RMJA 1XC4A 1F05A 2HMCA 3L66A 4RJEA 1WV2A 1FCQA 5DY2A 3C2RA 3W7PA 4A3UA 3S1XA 3GXTA 1DKWA 3UXAA 3FJLA 1SW7A 4Z1DA 4Y96A 5AYXA 3GKAA 1DQWA 4HNUA 4K36A 3S6DA 5K7JA 1AK5A 5HQEA 2NV2A 2QCFA 2Q8LA 3KX6A 4LV9A 3W1MA 4TU1A 1NF0A 5BRBA 4OU1A 1TO3A 3HGOA 1OFDA 2RFGA 3QQ1A 2YDAA 4O8RA 3PSWA 2GVGA 3TROA 1R30A 3LHZA 3QPYA 2H8XA 3CWNA 5G4WA 5KZDA 3STCA 3HGRA 3C52A 5D05A 4HPXA 2ZYFA 4LVAA 2TSYA 5AHEA 1KFJA 1EUAA 5DCEA 2C1HA 4UTJA 2EHHA 4HPJA 3UNDA 1ZAIA 3W74A 1OFAA 1F5ZA 3G1YA 3U2OA 3GKFA 3PB2A 4JTEA 2ZZ2A 3DI1A 2O7SA 4D2JA 4UTLA 4YLWA 1A50A 1W3NA 3IVSA 3TE9A 3W7OA 1OX4A 1I45A 4FX6M 5G4EA 1OYCA 1T96A 3Q94A 5CPMA 4ZQRA 1W56A 3FFSA 3N2MA 4AHOA 1OHLA 3P80A 4UTTA 1VZWA 3C0JA 4JS3A 3TK7A 1MEIA 1OYBA 2Q3RA 1HO1A 2CZDA 4Z1CA 2C19A 1ZNNA 1FDYA 4JTGA 5AHMA 1ZFJA 3THQA 4RV8A 1XL9A 1SZGA 1EP3A 8TIMA 3TW6A 3NQ8A 4RR4A 2OT1A 4CCDA 1IF2A 5J5DA 2BWGA 3A5FA 3WK0A 5LNWA 4MYXA 1KBJA 4N4PA 3TMLA 3N9SA 2V2DA 3R12A 4DPQA 4JIQA 4XBSA 3UPWA 2FFCA 3W1XA 1QDSA 1TRIA 3EEGA 4C1LA 4LRTA 3W83A 1K02A 5AN7A 5I3GA 3W7NA 5G1TA 3W23A 4YWIA 1A5BA 3EX2A 3W6YA 3KFTA 4UTUA 1DJNA 1GPWA 4CNPA 1AW5A 3H55A 3S1WA 1B4KA 1TCDA 1KFEA 2GQ9A 2YYUA 3W07A 3PG8A 3T78A 3MHFA 4X22A 3CLMA 2ZRVA 5D38A 3TNOA 3G18A 4JTLA 3KVJA 3DAQA 4QIUA 4KFPA 2X1TA 4MFEA 3KRZA 3EWWA 3A21A 5D09A 4N4QA 3TH6A 1YXCA 3DHFA 1O94A 2PRMA 1FXQA 4LRSA 3EB2A 3PBWA 5F2LA 2VFEA 3PWAA 2FIQA 5C5YA 3OBKA 4FNRA 4MYAA 3E9AA 5D33A 1D3GA 2RHGA 3IRDA 2ATSA 2FQIA 3NM3A 2Q8ZA 4QM1A 1OG0A 1VRDA 4HKPA 1H51A 1RVGA 1H7RA 4LV4A 4JN6A 4PEKA 3NDOA 2BTMA 2QCNA 3MBFA 1G67A 5AHIA 1KFCA 4UCGA 1VYPX 2E09A 5DLCA 4WD0A 4FNSA 3LGEA 3G3DA 3BLIA 4NT0A 4IMFA 2YPIA 3OVRA 5IM51 4WQ6A 1T0OA 1LZOA 2F7FA 3L0NA 3NXFA 4GRSA 5E0KA 3TAKA 3R13A 5KSWA 1W5OA 5I3HA 4HSOA 3NPWA 3S8HA 5BMXA 4FXSA 1Q6QA 1K7FA 4E38A 4MY1A 4DF0A 3G1DA 2RDUA 4LNYA 1KV5A 1DORA 4BFAA 2ZRXA 3C2VA 5E1QA 1FXPA 4FNQA 1TIMA 1R47A 4UFHA 3KXQA 1LOSA 1KM4A 3L0GA 4RLIA 3UWYA 1RV8A 4O0ZA 2OCZA 1ZAJA 2QCDA 3A5VA 3DHDA 4BWLA 5L6UA 4XTDA 3CPRA 1F73A 1ZCOA 4TO8A 3PBVA 4PFMA 1G4EA 3I7RA 4Q33A 4W9TA 3KHJA 2A21A 4BK9A 2FPTA 2X1RA 1JRCA 5CPLA 4H3DA 4WY0A 3O8AA 1I2RA 2Y61A 3GNNA 2P1FA 3MP3A 2VKZG 5F1UA 2NLIA 1BWLA 4HIBA 5LKYA 1FDJA 4MUZA 2Q3OA 4NJHA 3HIJA 4ZQPA 5KINA 5CZ0A 4DBDA 1JUBA 3PBYA 3S5NA 1R2TA 4UMBA 3QW4B 1W54A 5E93A 1TJRA 5AB3A 5BNKA 1BEUA 1IIGA 3S0CA 2CLMA 5A8GA 3OVQA 3BG9A 3PAJA 3MP5A 1TPFA 1WBHA 4JX4A 1GT8A 3GDKA 3HG5A 4O14A 3JR2A 3KOFA 1SW0A 3V1PA 3W7RA 5TBOA 2Z6JA 5LZLA 3DI0A 4O1AA 3ATYA 3PUOA 3BG5A 3GDMA 1LLZA 5D02A 5KTLA 4N6EA 4DF1A 3BGGA 3IGXA 1OFBA 1UB3A 3NEVA 4NJGA 1W3TA 4ICNA 4N9CA 3B8DA 2R91A 3GB6A 4WOZA 1M7OA 3BG3A 3UPBA 3FKRA 4FNPA 1NAL1 1RZMA 5DCBA 3L0KA 3BW4A 4HNNA 4O4WA 2JGQA 2JGYA 2ZZ5A 4JYEA 1A5SA 1XM3A 3TIMA 4OWGA 4LS0A 1FWSA 1SZFA 4PC8A 3O15A 5DXYA 3LLDA 4A22A 2HSAA 5H2ZA 3HOJA 3I7SA 2QCCA 1P4CA 1JR1A 4FXRA 2EF9A 4R33A 1X1OA 2J9XA 4QNEA 4WJEA 1VS1A 2E1DA 4Z1BA 4U28A 1H1ZA 5D37A 4NXKA 3HBLA 1FX6A 4IPJA 4I7VA 1F6PA 3ATZA 2VFFA 3W7CA 2C14A 4IXHA 1KFKA 3W1AA 3UZ5A 2QCLA 2C3ZA 2DZSA 1SO5A 1H7NA 4LVBA 3GDTA 2H8ZA 3EXTA 4RZ4A 4UFLA 2BSLA 1ZALA 2FB3A 1LROA 1JVNA 1K3UA 1H1YA 3TU9A 3DKJA 1UUOA 5EMUA 3IIOA 1W5QA 4JTUA 4KKXA 3QW3A 5G2IA 3TXVA 1CW2A 1DL3A 3LV6A 2NX1A 3NQ7A 1FWTA 3DFPA 1K8YA 3ABSA 2ISSA 2EPHA 1VPXA 4FX7A 3NQAA 1WQ5A 1QWGA 1TQXA 2EGZA 1VGAA 1XUZA 3L2IA 4JDBA 3GXNA 4HHPA 4LVDA 4H6KA 1FWNA 3I6RA 1P5BA 4RKAA 3UY7A 1W3IA 1DQXA 3W85A 1K7XA 1P1XA 2BZNA 4M6VA 4OT7A 4UTMA 3L65A 3F4NA 4OE7A 3QH2A 3W1UA 1TPB1 2GOUA 1WYIA 5GVJA 1SO3A 2VFGA 2DP3A 1UJPA 3S1UA 3O16A 1EA0A 4ZQCA 2WSYA 5D2TA 5SWUA 4BF9A 4DF2A 2I14A 1WOBA 1J4EA 2A7RA 2R14A 5D2XA 2NUXA 1VCFA 2CU0A 3UY8A 3VNDA 3LLFA 3L5MA 1RQEA 5AFDA 4WX2A 3W71A 1HO4A 1A5AA 4GNJA 3UQNA 2CLKA 2NV1A 2A6NA 2YGYA 1WBJA 3PUEA 2R8WA 3OA3A 3TDFA 3C2EA 4HNTA 2RDWA 3LTYA 1TPWA 3AO0A 4MZ8A 3W72A 5BOOA 2NXGA 3LCIA 4OBTA 2LLEA 2EAWA 3LBCA 1HG3A 3TAOA 1YADA 2X16A 4K38A 3PY2A 3QRHA 2E68A 5D2YA 3MW7A 3NGJA 1JCNA 1BKSA 1LORA 2ZZ3A 4O57A 1V5XA 3MBDA 4LC8A 4RZ5A 2B7NA 2V0TA 4TIMA 2Y7EA 2ZCGA 4O18A 3H53A 3L5LA 3F03K 4MKNA 4BI5A 2ZA1A 3T44A 3N3MA 3BV4A 1XDMA 4FF7A 3B05A 4PL2A 4UMCA 1FBAA 4TR9A 3SFKA 3E0IA 4CNNA 4JTHA 3UXDA 3W1PA 3P82A 3UYCA 3W7MA 2QDHA 3W22A 1IXQA 1W0MA 1SR9A 4GWEA 2DZVA 2E77A 2OT0A 1OVDA 4DO6A 3Q58A 4JDYA 1ZY9A 4JTTA 3BK0A 3W2UA 4Z0SA 2WSRA 1FWWA 1M6JA 4JX5A 5HNRA 3W75A 3WJZA 3T4CA 3ELFA 4FO4A 2J6XA 4QISA 3HJZA 1FY6A 3USBA 4YCPA 4AHQA 5C54A 5KZEA 4O53A 2VFIA 2Z1BA 4MLJA 4X3ZA 3HPSA 3LXBA 4YCOA 5CZTA 1ME8A 3O6CA 3FOKA 4NX5A 4K6AA 1S5VA 4EVZA 2ZA3A 3W7QA 2W6RA 3CEPA 2Y7DA 3W7HA 3ABRA 2Y70A 3VE9A 4GUFA 4LU0A 1TMHA 1SFJA 5LNRA 1G4PA 1G4SA 3G1FA 4NJIA 3ZR4A 3CB8A 3EWUA 4OQVA 3TV8A 3L68A 3CU2A 3DXIA 1I8JA 1PS9A 1B4EA 3UWZA 1QFEA 4O1CA 2H3DA 1GTEA 3G0UA 3NQCA 1AG1O 3W7GA 3RLVA 3BLEA 1GVSA 3P5ZA 2QUVA 3ZFHA 5LNUA 3MI2A 4FIQA 2QCHA 3LHTA 1VR6A 4O19A 1QNVA 3CC1A 3CQ0A 3F1QA 3TR2A 5EYWA 3SIZA 2Y63A 1G7VA 2NXIA 2QR6A 5DXXA 4NXSA 4C1KA 1KTCA 3LHYA 2C13A 2YYTA 3L5AA 4GBUA 1VLIA 1KLYA 2FB2A 1ICSA 2WNZA 3WK2A 1EUNA 2FLIA 4MJZA 1B3OA 3KVLA 3N14A 1U5JA 2GVLA 1MSSA 4MY9A 4HN4A 1W31A 1LOQA 3M6YA 3BPWA 4XKYB 4OGZA 1V7YA 2CLEA 2FDSA 3P61A 1DJQA 1M7PA 2P10A 4WZHA 1VC4A 3PULA 2J24A 1KTNA 1THFD 3M5ZA 4XTIA 3CIXA 4NU7A 3W1RA 4MOZA 4AWSA 5T26A 2Y62A 1YDNA 3WJXA 4UTWC 2E6AA 2FTPA 2ZRYA 1MXSA 4I9AA 3PS7A 1LP6A 3I68A 4H4IA 4DEFA 3PM6A 3EWBX 1SW3A 3MI3A 3CEUA 2WSQA 2A85A 1YTEA 3GR8A 5FF0A 2TYSA 1H62A 4AHPA 1Q6LA 4JTIA 2JK2A 3C2FA 4UMAA 3T55A 5F2GA 4P2VA 4IMCA 2C18A 1JUEA 3NO5A 1HL2A 5HWJA 1N8FA 5EA9A 3EWZA 1TPEA 3W2NA 3JS3A 2NZLA 2WOQA 1KM0A 3E49A 2JKEA 2ZBTA 3TFCA 2YX0A 2V8ZA 1F6KA 1HTIA 4NZJA 1TPC1 2ZTJA 3G8RA 3STGA 1H7WA 5D04C 1PHQA 5AC7A 3CTLA 4WOQA 3LCXA 3UWQA 1JCJA 3W73A 5EPDA 1R2RA 3NPUA 3S5ZA 2ZZ6A 3DENA 4O28A 3ABOA 4JIPA 2WO5A 3NVTA 3QM3A 5AHLA 2OJPA 4XZ9A 1TTJA 1L6SA 3LXAA 1VH7A 6TIMA 5CZJA 3KRSA 1VHCA 3TCEA 4GUHA 1VLWA 1QPNA 4MPQA 1SQ7A 3NYZA 1TQJA 5U4NA 2CZ5A 4IMDA 3PUDA 3SW6A 4JTKA 3N2XA 1H61A 2ZQ0A 3FYOA 2NUYA 3NG3A 3NQGA 3DFOA 1ZJIA 4EOUA 2VEIA 3C4UA 1NF7A 5BMWA 3W1LA 4FIRA 2CLOA 5K9XA 2H6RA 1BTMA 4O11A 3KVKA 3AJXA 2I1OA 2OZ0A 2QKFA 4JXCA 5FESA 4NJKA 2QJGA 2WKJA 1D9EA 3HGSA 5FF2A 1U83A 3IIPA 4K7YA 1XXXA 4E2BA 4CLMA 3P74A 1F2JA 4IQLA 1XDLA 3TSDA 2A1YA 2YW3A 1WA3A 4CQ8A 3L21A 3GVGA 4EWND 5AC6A 1F74A 3NQ6A 5TQLA 3GAKA 4NJJA 2WNQA 2V81A 4NX0A 1OJXA 1PCWA 3GNDA 4LS2A 4JX6A 4OHQA 3IGUA 2QCEA 3C8FA 1GQNA 1P0NA 1YPIA 3M7WA 3STEA 1O60A 3HG2A 5LHFA 2ABBA 3I7QA 2ISVA 3M43A 4ZZ9A 2YZRA 4LUJA 3ANYA 5HWNA 4RXFA 1OK6A 3TSMA 3CT7A 3MYPA 3GYEA 3DH7A 2DJXA 2O7QA 4GE8A 2GUUA 2OMAA 3NL6A 1TTQA 3LCHA 4RK8A 4U4MA 3LTSA 2G97A 1EIXA 1TRDA 3IV3A 5U7SA 3SGUA 2WV8A 4MZ1A 1QO2A 3W7EA 1LOLA 3QSRA 5H91A 1Z44A 2V2CA 4IPIA 3P8IA 3L67A 1AW1A 4DO5A 1KM3A 2Y6ZA 1GVOA 5CGQA 5ABTA 5FF4A 2X2GA 4M19A 4FNUA 3W2LA 1OFPA 4LS1A 3SY5A 2YW4A 2DZUA 3T7VA 4CNOA 3NPVA 1TJPA 3HPXA 3R2GA 2YR1A 1IXNA 5HUOA 4JTFA 2A0NA 2DZXA 4R34A 3PB0A 4S1FA 3M41A 1HFBA 3QPZA 5DN1A 1TPDA 2V5BA 2CZFA 1Q45A 5CPOA 3W7KA 3W87A 5A5WA 3WK3A 1PCKA 3GDLA 3TXZA 3PC0A 1RPXA 1VCVA 3E02A 2R94A 1X7FA 3RU6A 1WXJA 1NFBA 5FEWA 1PL9A 4O4VA 1N55A 5MHBA 1MEHA 4TX9A 4IOTA 4ZQNA 2TRSA 1A5CA 1DBTA 2TPSA 4GFSA 1G4TA 3TX9A 4JEQA 3W76A 2YCEA 2YFOA 1H60A 2J9ZA 2GQ8A 3MHUA 4ALDA 1O95A 4O16A 4ZQMA 4O1BA 3MUXA 1JQVA 2BXVA 4ORIA 1YXYA 1YTDA 3EKZA 3L9CA 1LBLA 1YTKA 2CFFA 4GUGA 3GK0A 2JBMA 1YLVA 3EX3A 4K8EA 1NEYA 1QOQA 4UC5A 1H50A 3LRKA 1LCOA 2C15A 3MWAA 5F4SA 1JCMP 3E96A 3QMTA 1I4NA 4FB7A 3W7JA 3DFNA 3W9ZA 3DGRA 4O10A 4UIOA 4XWUA 5FEZA 1DHPA 1GOXA 2DZPA 3GDRA 4WXYA 1IXPA 5K9CA 4N6FA 2HS6A 4M6PA 3BLFA 4N2YA 5KITA 4N02A 3DFSA 2E6DA 1UBSA 2CZEA 1EWDA 1E51A 1W1ZA 5DCDA 3DU0A 3LI1A 4M7SA 2AAMA 1FCUA 1Z41A 5EL1A 3LTPA 3A22A 5CSSA 2CLFA 4AXKA 5FI8A 3Q2DA 3VI2A 4O52A 4XUGA 4JNMA 4QSHA 4GC4A 1FQ0A 2A4AA 1SUXA 1QPOA 1LYXA 4WUIA 4A29A 2HTMA 2CLIA 2C0AA 1UASA 4Y6GA 5D2WA 4ONVA 4DPPA 4GXMA 3N19B 4AMAA 3R5EA 4XKYA 3TSBA 3NM1A 4AB4A 2H3BA 5FF7A 4GUIA 4E0CA 3M5XA 1WX0A 2VEMA 4MY8A 3SR7A 2DU2A 1H7PA 5HR7A 2ZDRA 4Y90A 4UUIA 1R2SA 5HMSA 4PL1A 5BW6A 3W88A 3HGJA 4LC6A 3UZJA 3EWYA 1LLWA 3OEXA 1EP2A 1CX9A 3TA6A 1RQBA 2VC6A 4AVFA 2XN1A 3QSTA 1TB3A 3G1HA 1SO6A 2XN0A 3F4WA 3QYQA 1Q6OA 3NZ1A 3LERA 3PVFA 2ZA2A 1EP1A 1C9DA 1TV8A 3INPA 3LBMA 3NQDA 1YXDA 1O5KA 5C55A 3S1VA 3P67A 2QUUA 4LT9A 4LY8A 3UWWA 1OF6A 4PH6A 5DBUA 4CQ9A 1MZHA 4KFOA 1KM2A 4QQ3A 4WXZA 3VCRA 3A24A 3HPZA 3KAOA 2V5LA 2AGKA 3C61A 1GVQA 4GJ1A 4FHAA 4QITA 3C3NA 3O63A 1F76A 4MLRA 3NNTA 2B7QA 2H90A 3TQ0A 2B7PA 1S3HA 3FA5A 1JCLA 3TC7A 1W5NA 1OYAA 1H7OA 4EF8A 4LUIA 3NA8A 1SFLA 3IIZA 3NR0A 1ML1A 2AQWA 3JRKA 4JGDA 1AMKA 1TTIA 1XBYA 1TPVA 1LDCA 3VFLA 2CLHA 1LRQA 1J5TA 1AW2A 4JR5A 2QJIA 4LVGA 4YXGA 1ME9A 2ABAA 2TMDA 2QCGA 3G1AA 2ATMA 3QQ0A 4ZVJA 4AWTA 4RZ6A 1GVFA 4Y8FA 3O06A 2IQTA 4N9DA 3HB9A 4Z0JA 3LCGA 3FYPA 1PIIA 5K4XA 3O6YX 3B4UA 3DFQA 5LGZA 5HUPA 1H5YA 2ALDA 1W5MA 2ZRUA 1JCXA 1JQXA 4K37A 4AWUA 2OX1A 1ADOA 1ONRA 3K30A 3EKLA 3QZEA 4M7TA 4OV9A 4A2RA 1EPXA 3LCLA 1G69A 5I3JA 4P61A 3FEMA 4POCA 3S42A 2RDTA 1OABA 4AH7A 1TREA 2DJLA 2WQPA 3YPIA 5G1YA 4N9EA 2NXHA 1YPFA 3G0XA 4YL2A 1EWEA 1X8FA 3LI0A 4RX0A 1IGSA 1C29A 1YDVA 5TIMA 3GZ3A 1L6WA 1G6CA 1TYGA 1OFQA 4JY8A 2PRHA 2BLEA 4DO4A 4AF0B 3VKJA 4L4LA 4LVFA 4EIVA 2VOMA 5CSRA 3D0CA 5G2WA 2CLLA 4LW7A 4IWWA 2E6YA 2X30A 3W7LA 4DXVA 1PVNA 1JRBA 1FCBA 3B0PA 1XUUA 1Y0EA 1SPQA 5AHFA 4Z1AA 3I65A 2G5WA 3VE7A 4LTSA 4BI7A 1MEWA 4YMZA 3HMJG 4LWWA 1WOAA 5DBTA 2JKAA 4FNTA 1VCGA 4OV4A 3W70A 1GWJA 2C16A 4I7UA 3G1SA 5G5IA 3TKFA 1CI1A 4QNWA 3MYOA 3THAA 2B7OA 4E2DA 3NL5A 2G96A 1OFEA 3NL2A 2Z0IA 2X1SA 5HINA 4JTSA 2J27A 5F1VA 1ICPA 1DVJA 5D2VA 2WJZA 3PF3A 1W8SA 1C8VA 4IX2A 2PC4A 1T99A 3P62A 5K2ZA 1JJKA 1KA9F 3NOEA 1KM6A 2A2IA 1PE1A 3W84A 2ZZ7A 3BW2A 1SU5A 1TPUA 1Q3NA 2NWSA 3OVPA 3ZS4A 3PG9A 4Q32A 1OK4A 1ZAHA 2DZWA 1GVRA 1VYRA 3RK8A 2B0MA 2KZHA 1P0KA 3C2OA 3O05A 1O4UA 2VFDA 2VEKA 2Y88A 3W86A 1FUYA 2A5HA 3N73A 2YSWA 3NL3A 1XI3A 4QJ1A 1GJPA 3QF0A 2F84A 3ZWTA 1TTPA 2VFHA 3FKKA 5HJLA 5CZSA 5IBXC 4JTJA 3SGZA 1X6UA 5CKSA 3QFEA 4EF9A 1MO0A 3NQ2A 4GUJA 2QAFA 5LSMA 3T40A 2ZTKA 5DY3A 3RF9A 1Q6RA 2J9YA 4IMEA 4O54A 4IGHA 3M9YA 1ZHAA 4CCEA 3NQEA 3DKLA 4UFJA 5CPNA 3ZWSA 3LRMA 4NNAA 3EXRA 1RQHA 3U6WA 5G2HA 4AAJA 3M5VA 1RR2A 4JYFA 3DZ1A 3NAVA 3UD6A 3PBUA 5EKYA 1KW1A 4HNVA 1XCFA 1ICQA 4UNLA 5AC8A 2A7PA 1QR7A 1W5PA 3GIYA 3DFTA 3MO7A 4R53A 3CWOX 1L6YA 4IXXA 3HO8A 3LHUA 3TQKA 4UR8A 4M6QA 3LV5A 3LHVA 2QDGA 1D3HA 3CM4A 1VQTA 1K7EA 5KMYA 2PE4A 2V30A 3HQ1A 2GJLA 2NWRA 4UNKA 3S5OA 3TFXA 4CQAA 2P0OA 1W37A 3BO9A 1UCWA 5LGXA 3IIVA 1DOSA 5C2XA 4K39A 4UTHA 5HWMA 5I3FA 2E5BA 4N9BA 4XBKA 4HSNA 1VJIA 1LM1A 5AOUA 4CCCA 3SSJA 4NNBA 3CIWA 4MJMA 4JY9A 3RFAA 2FJKA 3DBPA 1FDZA 1KM5A 1X1ZA 4NNCA 1I2PA 1K03A 3W2KA 2YXGA 2VENA 4UFKA 2GJNA 1O5XA 4O1DA 4NQ1A 3O6DA 2FPVA 4IMGA 1GEQA 4BR1A 1OFRA 3ABQA 2Y7FA 1ZENA 3NQMA 1I2NA 3NPXA 3N34A 2W0UA 1YYAA 3R89A 3GX9A 2PCQA 3WK1A 4UXDA 1M5WA 2WNNA 4O17A 4PCFA 3LB0A 3FLUA
chains in the Genus database with same CATH superfamily
3LPOA 2OG9A 2C6QA 3QHMA 3T8QA 3P7YA 3G24A 3MMTA 3WUBA 3BJFA 5B7YA 2BDQA 3DC0A 3G0SA 4MTVA 1LTDA 5C9RA 5ABEA 4ML9A 4Q4RA 4AZGA 5C7HA 2IXVA 5DF0A 5BWAA 4P7QA 5G1MA 2OPJA 1E43A 1IGWA 2VXNA 4H9YA 2FGBA 4ZTYA 3AWNA 2OSXA 1QO5A 3TJXA 1KFBA 4L6DA 3MP4A 1UR0A 3WQ6A 4KETA 2Z2UA 3IVTA 4XQ6A 3POHA 4IJCA 1LLOA 3IEBA 1HIZA 3KBNA 1WXZA 5GJMA 2YL6A 4DY1A 3GTHA 4UTTC 2ZRZA 1EJRC 3GXPA 1B9BA 3VYLA 3EX4A 1OX4B 3S2LA 1UBPC 3ONCA 3EX6A 4IX0A 3VVGA 4HNLA 2UV8G 4RPQA 2GVJA 3QZ6A 1US0A 1M53A 3CZJA 3HG4A 2EXOA 1Q6EA 3GXIA 1OFOA 3GBDA 4WDXA 4P7NA 2I57A 4XO6A 3BLPX 1WKYA 4IQJA 4ADTA 2V9DA 2CESA 4M56A 3GLCA 4JPGA 5AHNA 2JQXA 3KL5A 4TVCA 3FHQA 4LY4A 5AY7A 3HG3A 5LHEA 3UESA 2FGZA 2HE8A 3KDOA 4C6KA 1Z89A 4QLLA 3A9BA 3ZLGA 1BSLA 1HXJA 1WDRA 3W7IA 3QC3A 3BVJA 4DELA 3LX9A 3E12A 2EKCA 4V28A 4FF5A 2UBPC 1PHWA 3EXSA 3RN6A 5IOBA 1FCVA 1POKA 1SSGA 2XN2A 4DBSA 1JPMA 3AIBA 1Z8AA 3C6CA 2PBGA 2WPGA 3N9RA 4HA0A 3URQA 1PWLA 2X05A 3N25A 2QPSA 3WJSA 1KBIA 5F2IA 1SVDA 2KX9A 3O07A 4W8LA 3MHGA 3G1VA 2Y85A 1JULA 5E6YA 2ISWA 4PMRA 2XHYA 2FH6A 3G1XA 3WLTA 4H83A 1ZS2A 3WY1A 3A12A 2W27A 2ZFAA 2G95A 1OX5A 4FS9A 4PMVA 3RM9A 8CGTA 4OJYA 5FEPA 2TAAA 4Y9PA 1XBVA 3XINA 5AC5A 4ZB2A 3DG3A 5JH2A 4GJJA 3B04A 3AHVA 1BWKA 2PLKA 3OGVA 1OEPA 2RJGA 1FKXA 2VL4A 3NGFA 3M1ZA 4H2CA 1HKKA 1NWSA 2QXWA 2YFNA 3VIIA 4DZAA 4DBWA 2XVGA 2F6UA 2OXNA 1HJVA 4LEFA 2QCMA 1B57A 2DORA 1ZJAA 1XLAA 3H24A 4DBEA 3WQPA 2NX3A 1EO5A 4UTWA 3C56A 5K4ZA 1YDYA 3GRIA 1I2QA 1KGUA 5F4XA 4IIGA 2FPYA 3KOYA 3U5UA 5PTDA 3FW6A 2WBKA 2EJ1A 3A23A 1SJCA 2NUWA 2NQZA 1R46A 2PDYA 3CYVA 1FWRA 5CC3A 4JTRA 4YJ5A 4IZGA 1AJ0A 1J18A 2P8CA 3WFAA 4NSBA 5JIWA 4Q4SA 4K8HA 2PGEA 4YHEA 3P81A 2DSWA 1G7UA 1TPH1 1TJ1A 2I9EA 4V2XA 7ENLA 1XBZA 4OOZA 2QCDB 4FX8A 1KV8A 2VEFA 4IIFA 2ZZ1A 3QY8A 2PGFA 2PWEA 2BHZA 4S3EA 3WD2A 3P0WA 2VJXA 3A6OA 1A0CA 3B06A 2GGIA 2WC7A 2NX9A 4GX8A 4WY0B 1KFLA 1O6IA 2G4FA 3BGJA 3PJXA 3WJYA 3WEZA 3TUUA 2PPGA 2D0HA 1EO7A 1XRFA 3TQPA 3NZRA 2OWWA 3H54A 1GYLA 3A9IA 3SCNA 3TMQA 4D6GA 3CZKA 3MA8A 1X6NA 4IL2A 1RK5A 1I1XA 2OOGA 2YDRA 4UFMA 3KLLA 2P5NA 3H4WA 2V5DA 1VHNA 1P6CA 4H9XA 1RBAA 3TC3A 1AQ0A 3OLIA 1XC4A 3L66A 3R79A 4HZ6A 4LAUA 4MGGA 1FCQA 3H70A 3TN5A 4A3UA 3SN4A 3GXTA 2Q8XA 5I24A 1SW7A 2YBVA 3TN3A 4K1GA 5DT5A 5AYXA 2ADAA 4K36A 3S6DA 4XD3A 3CXOA 1JF5A 2NV2A 3TN6A 3FCPA 3F4VA 1TO3A 1OFDA 2RFGA 3QQ1A 2YDAA 2XIMA 1B3WA 3E5BA 1YNQA 1UKQA 3LHZA 3STPA 3K1DA 2H8XA 4I5UA 3AALA 3CWNA 5KZDA 3HGRA 2IQDA 1GQIA 4IFKA 4KCTA 4H8HA 4HPXA 5H8MA 4RDZA 2ZYFA 5LIXX 2OKTA 3CWHA 5AYBA 1EUAA 3ARXA 4PUJA 2WC3A 2HVMA 3H7VA 4M80A 2Z7KA 5LXXA 5B7ZA 3RYSA 5M2FX 5FL1A 1W3LA 3G1YA 1WDQA 3U2OA 3GKFA 1UJQA 4A8IA 1PZ3A 1M9HA 2WNWA 2PDJA 5CBJA 1A0EA 2HNEA 3IVSA 2A79A 3ARZA 4MWAD 3LPFA 4FX6M 4PMQA 5G4EA 1OYCA 2C8NA 1H0IA 2A3LA 2J78A 3N2MA 4AHOA 3DFYA 4K1WA 4UTTA 3XIMA 1VZWA 4JS3A 4L6OA 1OYBA 3SCWA 4CD5A 5JVLA 1GKQA 2ZICA 2C19A 4JTGA 1FDYA 4LAKA 3RJXA 2CWXA 1UMLA 3NQ8A 3IJ9A 4I9JA 1FWBC 1IF2A 4ZO7A 1OT2A 2BWGA 3N17A 2GSJA 5LNWA 4MYXA 4N4PA 3AMGA 4X0VA 1PDYA 2W3ZA 1SJBA 1CGXA 3XISA 3M46A 3W83A 3TTOA 4MB1A 4CGTA 1UOKA 3TYUA 2OOFA 5HOSA 1GEHA 2DVXA 1JFHA 2AOSA 2OO6A 1VAHA 3K8LA 3KFTA 5CC7A 5C70A 4CNPA 2GWGA 3KBWA 1TCDA 2GQ9A 3LLXA 4NZ4A 3PG8A 4BF7A 4AY1A 3MHFA 5HNUA 1G0CA 3MZNA 5DMLA 4PBEA 4JTLA 3TEVA 1V7AA 4ICCX 4XAZA 4QIUA 2YIHA 3U4FA 5JQ9A 2PLJA 3WELA 1M3UA 1WDDA 2X1TA 2XUCA 4K68A 2XIIA 2WJFA 3EWWA 4KCVA 4MWAA 2H9AA 4LRSA 2VFEA 3PWAA 3OBKA 4GGHA 5A6JA 2V3DA 1EC9A 4ML4A 3GQYA 3H7UA 3I3BA 1QRQA 1LL6A 1X1NA 1ENUA 2BS9A 1PX3A 1GJWA 1GONA 3OZMA 4M1RA 3IK2A 3ZO9A 4HKPA 4LV4A 3MDUA 4PEKA 2QCNA 2D3LA 4GYFA 3KE0A 5E09A 4AZ7A 1E71M 4TVUA 3H2CA 4Q4QA 4FNSA 3LGEA 4EAYA 1SM9A 1E0VA 1RP8A 4NT0A 3COTA 1XKJA 3OVRA 1T0OA 3CV7A 5E0KA 4AD3A 2WZHA 4HSOA 1VPQA 4L1GA 3NPWA 3S8HA 4RNFA 1K7FA 4MY1A 1P0DA 4DF0A 4WJXA 4DI8A 4QAWA 3KXQA 3T4WA 1LOSA 3UWYA 5CBBA 2J25A 5CAHA 3LM3A 3DHDA 3T8LA 4OUEA 4ACYA 1F73A 4Z42C 2ISDA 2G41A 2IW0A 4WEVX 4W9TA 1K9FA 5C9ZA 2FPTA 4AX6A 1JZ6A 2PDLA 2X1RA 4J35A 4YTTA 5I06A 4KF1A 3VIMA 4PB4A 3O8AA 1V77A 2Z1SA 3GNNA 4WSKA 4XZIA 4HK6A 2PDFA 5E5CA 4DWDA 4ECLA 4DZHA 4MUZA 2Q3OA 3VILA 5CZ0A 4R88A 3QW4B 4JKMA 1OD8A 1DIEA 1QOXA 4ACZB 1AVAA 3BG9A 3MP5A 2Z28A 4QXIA 4NF7A 4JX4A 3GDKA 3HG5A 3VX0A 5DRIA 1TVNA 3KOFA 1BSIA 1VBRA 2B81A 5TBOA 3GHSA 4H6QA 2Z6JA 1JZ7A 5CPQA 3ATYA 3PUOA 3BG5A 5KTLA 3LSBA 3BLOA 3EOUA 4C6LA 1AMYA 1EPVA 4N9CA 3PTQA 1Y5XA 2WJDA 4H04A 3UPBA 3ZJKA 5CGTA 4HYWA 1NAL1 1KWKA 1A5SA 1TWSA 1XM3A 4LS0A 3OBAA 3NDYA 4YVVA 3CZLA 3ARRA 4I9TA 4U31A 1JZ2A 5C7VA 4PC8A 1ZZMA 2AL1A 1XIBA 3VD3A 1QI3A 2HSAA 2WHJA 1IEQA 4FXRA 2VR5A 4PUWA 4IGSA 4JKLA 4U28A 1H1ZA 4J2PA 5HXMA 3O7UA 4NXKA 1XYFA 2OYKA 4E3VA 2GUBA 5KETA 3AHXA 5J04A 1ODUA 3W7CA 3EMQA 1KFKA 4E4PA 2QCLA 4XB3A 1QI4A 4CD8A 2OU4A 3GDTA 4KT2A 4AIBA 1E40A 3EXTA 2YZ5A 5EFFA 1JYVA 3N11A 4U3AA 4M82A 3GH4A 1C91A 5HPCA 1ZALA 4ASTA 1H1YA 1FHUA 3DKJA 1TJ0A 1VIWA 3MCNA 1M1BA 4XAFA 1BYCA 2D2JA 1XC6A 1CW2A 5HMEA 4LAMA 3ARVA 3LBOA 3CV1A 4ZGYA 3IPWA 1W3JA 4JDBA 4H6KA 5D9NA 4ZCWA 3I6RA 2PDGA 1XIFA 1UD2A 1DQXA 4WCJA 1QHOA 2HJPA 4X60A 3W85A 1IT7A 4GIYA 3WFZA 2R6OA 3SAZA 3W1UA 1DTUA 2VFGA 1R87A 1UJPA 3S1UA 3O16A 4LAZA 2VQTA 2WSYA 2W4XA 5D2TA 3V16A 1BF6A 4E3TA 4R7WA 3OHMB 5A2CA 3MCMA 3B97A 4BF5A 3ZJ6A 2J7DA 2IS7A 1UZDA 5AFDA 4WX2A 4DJFC 3M64A 1A5AA 3UQNA 4HN8A 1WBJA 4J7RA 1E72M 1HKIA 4FLOA 2UY4A 4E5TA 1S5MA 5EMMA 3V0SA 2RDWA 2QV4A 1TPWA 4JFWA 4OBTA 2LLEA 4L9ZA 2BG5A 3S83A 1HG3A 2E8YA 3SIMA 3QRHA 1LORA 4O57A 3GIPA 4LC8A 2B7NA 3PFRA 5DANA 2F6XA 3VDGA 4GY7A 3H53A 3MUZ1 4BI5A 3OGSA 2ZC8A 2ZA1A 4LF1A 3N3MA 1CXLA 1U2YA 4FF7A 3VOCA 1DE5A 4UMCA 1FBAA 4TR9A 4CNNA 4G7EA 4JTHA 3I4EA 3W1PA 3P82A 2NQJA 2QDHA 3GSMA 4YPJA 3C0SA 4F9DA 1RY8A 4JDYA 2WLYA 3W2UA 1FWWA 5HNRA 4JQ3A 3B8IA 3W75A 3T4CA 3ELFA 3VD9A 2Z1XA 1M03A 5IXEA 3ZT7A 4HCLA 3UZZA 1KCKA 2VFIA 2VNCA 2FZ8A 3EEZA 3HPSA 3LXBA 3SRKA 4YCOA 1UD8A 4NX5A 4K6AA 3WX7A 2ZA3A 3BL3A 2OLSA 4FALA 1Y8BA 4XZHA 2XGBA 2Y7DA 3MVIA 4GUFA 4LU0A 4F48A 4H1ZA 1S3TC 3G1FA 4NJIA 4OQVA 2FZNA 5DT7A 1I8JA 1PAMA 9CGTA 4V15A 1QFEA 4KH2A 4O1CA 2H3DA 3VOJA 3QVQA 3GTXA 3G0UA 1AG1O 4JFTA 3RLVA 1J5SA 3BCJA 3UVIA 2QUVA 5BYWA 1EYEA 1QNVA 1G01A 2BY3A 3ZSSA 4PCSA 4YVPA 3BOFA 2Z00A 3MCOA 2CYGA 3CPUA 3TR2A 3V4BA 4AC1X 1EA9C 3BXWA 5EYWA 4B4FA 1BGGA 3RHGA 2OODA 1G7VA 2NXIA 5I78A 2YYTA 3WH9A 1DWAM 2V5JA 1VLIA 1FWCC 1ICSA 2G3MA 2WNZA 3WK2A 2FLIA 1WE5A 1U5JA 2VRQA 1EJTC 2GVLA 3GY1A 1IEXA 1P48A 4L4PA 1LOQA 3M6YA 1E9YB 5JXQA 1V7YA 6TAAA 2XH0A 2FDSA 2FVKA 1XRVA 4BZYA 1VC4A 2J24A 1THFD 2JALA 1KC7A 3MWCA 4GMEA 4C6EA 3W1RA 2D22A 1AD4A 1UH3A 3HV9A 3OYXA 3WJXA 1UC5A 4J3ZA 4ES4A 4I9AA 3PS7A 3PPHA 4CCZA 4UCFA 3CEUA 3GR8A 3ZXWA 2XTKA 4JTIA 2I5QA 4PULA 3T05A 4P2VA 2YBTA 1JUEA 1NJJA 1HL2A 4ZOBA 1TPEA 1W1PA 2BOFX 3AOFA 3VOFA 3W2NA 2DT1A 3AIVA 1YEYA 2ZBTA 3G77A 4LUTB 2FJUB 3WD1A 1BXCA 1F6KA 1HTIA 4NZJA 1M68A 2ZTJA 1XSIA 5A94A 4AEFA 1BVWA 1VEOA 3DHUA 2DDXA 3W73A 3S5ZA 1KNWA 2ZZ6A 1YIXA 1AJ2A 3DENA 4XAYA 4L9YA 4JIPA 1O68A 3CMGA 2WO5A 3DECA 4CD7A 4WDUA 3QM3A 4JIHA 4XZ9A 1L6SA 2I5IA 3REQB 1OCBA 3ID7A 1B31A 3KRSA 1VHCA 3AIUA 1VLWA 1QPNA 4IMDA 1EOMA 3TVAA 2FKPA 1RJRA 2NUYA 3NQGA 3DFOA 1QI2A 4EOUA 4NZCA 1NF7A 1P6WA 1E56A 2YCIX 5K9XA 2VVSA 1IT0A 5FESA 4FI4A 4FK9A 3TN4A 2V63A 2VVNA 1U83A 1IEWA 3C2YA 1FH8A 4IQLA 1XDLA 2YW3A 3U7BA 1BQCA 1EH9A 3CQKA 5TQLA 4B4HA 2V81A 2Z29A 3A64A 2YA2A 1V51A 1DXIA 1YPIA 2PU0A 1YKWA 3I7QA 3M43A 2YZRA 2I56A 1JAKA 4RXFA 1OK6A 3TSMA 5REQB 1E0WA 5IFPA 1O66A 2O7QA 2GUUA 3LCHA 4N0RA 4XSLA 3F2BA 1Z69A 4U4MA 3LTSA 2QUNA 4XZWA 3CLWA 1EIXA 2VZUA 4UOZA 1LOLA 1GPFA 3ZR6A 2G0WA 1MYRA 1KM3A 5CGQA 5ABTA 4M19A 3DOPA 3W2LA 4QEHA 4HNCA 4C65A 3T7VA 2DZUA 1XIJA 3NPVA 4LQ1A 4J3XA 3HPXA 3R2GA 4QTGA 3D47A 1OIMA 2A0NA 2B31A 3VKBA 3MKCA 5IRPA 4W7UA 3W87A 1E6PA 1E9IA 2E9LA 1VB9A 3RU6A 1REQB 2BBFA 1PL9A 3KBVA 4O4VA 4D6CA 4TX9A 2REQB 1EJWC 1A5CA 3O0FA 1UZ4A 4TX8A 4Z2KA 4GFSA 1FWAC 1G4TA 3UCDA 1XPGA 4HD5A 4JEQA 1UYQA 3EA3A 2VZTA 1GHRA 3ZJ8A 1E4LA 2GQ8A 3RX2A 3MHUA 2FVLA 1U33A 2C71A 2D23A 4O16A 4B5TA 1B2YA 4ZQMA 2QVNA 1YXYA 1YTDA 2PU1A 2WSPA 4S3AA 3PWIA 3L7RA 2HE5A 1Q4NX 3GK0A 1I75A 2PA6A 2JBMA 2QUMA 1NEYA 3WQDA 2CC0A 2C15A 2QIIA 1JCMP 3UCQA 2BHUA 1I4NA 3W9ZA 1XRTA 4QRNA 4UIOA 1GOWA 1IXPA 5FKYA 4M6PA 3BLFA 3RO6A 3DFSA 4DAFA 4XVEA 1C8YA 1EWDA 2CZEA 2R82A 5DCDA 2NT0A 3DU0A 2EQDA 3LI1A 1WUEA 3A22A 3PJWA 5CSSA 3LD5A 5CAKA 3HM7A 3Q2DA 3VI2A 4PTMA 4JNMA 1P6BA 1HJQA 1NH6A 3KHDA 4UBPC 2PEVA 5FJUA 2J79A 1US3A 2HV5A 4Y6GA 3WD4A 4CD4A 1DJIA 4AB4A 5FF7A 3KZPA 3SO7A 2CXGA 4MY8A 3SR7A 3KTSA 1W1B1 2DU2A 3PNUA 4HVXA 3VCNA 1H7PA 5HR7A 1W9BM 1ZUAX 4Y90A 3UNTA 1R2SA 5HMSA 1UWTA 3UZJA 1A5MC 4AXNA 1GQLA 3URNA 2ZX7A 4AVFA 3ARPA 3QSTA 1R3SA 1Q6OA 5D9MA 1A80A 1JYXA 4BQ2A 4S3FA 3PPCA 4JN8A 4I3GA 1EP1A 3BH4A 4AIEA 3INPA 1E73M 1UUQA 1O5KA 1IWBA 3LNMA 1RJQA 4LT9A 2P3EA 4PH6A 5DBUA 4B92A 4KFOA 1KM2A 4QQ3A 2JEQA 2V5LA 4GJ1A 2GJRA 1FWEC 3AUJA 1MW0A 4JQ1A 3WN6A 2PF0A 3O63A 4MLRA 4KIEA 1HKJA 2GGJA 1ZCCA 3MY9A 4CU8A 2XVPA 1C8QA 1SFLA 3CL8A 1R5YA 4JGDA 4GVGA 3PZTA 1LRQA 1R86A 1H1NA 2QJIA 1ME9A 2ABAA 2TMDA 4XD4A 1RLCL 4KESA 4Y8FA 3O06A 4YTSA 4DWSD 3ZM8A 3W6MA 3A4WA 4UWMA 3HB9A 4W4QA 1PIIA 2O92A 5K4XA 3DFQA 1V03A 1PDZA 1VRXA 5HUPA 3BICA 2QDEA 3CH9A 3UZWA 4S3DA 4AWUA 3UPMA 2OX1A 2ZX6A 3K30A 1E6QM 3EKLA 4M7TA 1DEDA 1EPXA 2E4TA 4Q4MA 4A2RA 1WAWA 5E6ZA 5XIAA 4RE3A 2BVWA 4AH7A 2RDTA 1OABA 5IFTA 3R25A 1NP2A 1F3XA 4JL1A 1KRAC 3LI0A 2J75A 5GNXA 4GI6A 4PTXA 2WVUA 3G6MA 5TIMA 1YDVA 1L6WA 1G6CA 2DIJA 2VOMA 2PLCA 3AYSA 5CSRA 3D0CA 4HK5A 4LW7A 2XJ7A 3AMDA 5D9OA 2X30A 3W7LA 2BGSA 3KL3A 2GGEA 4MJ4A 5A6BD 1L8NA 1MEWA 4YMZA 3JZEA 1WOAA 4FNTA 1VCGA 5FL0A 1XP3A 3G1SA 3AC0A 3TKFA 1CI1A 3SCPA 1UR3M 4RNIA 4Z2HA 4JNYA 3NL5A 3WL1A 2EG8A 2Z0IA 2X1SA 5HINA 2WJZA 5A8QA 4J2MA 4S3BA 4UQEA 3H8AA 1C8VA 2PC4A 5E0FA 2R9RA 5K2ZA 4YTRA 4XG1A 3KWSA 4J4KA 1JJKA 1KA9F 1UW9A 2A2IA 3A3WA 1FFQA 4PMOA 1UP0A 2ZZ7A 1EGMA 4I5RA 1TPUA 1Q3NA 2VCAA 3DIPA 4HJWA 3ZS4A 2HPMA 2FYMA 2DZWA 1N8WA 3RK8A 2B0MA 3C2OA 1O4UA 2VFDA 2EG6A 3CAWA 3N73A 3NL3A 4QJ1A 2HXTA 1P0EA 3QF0A 4TVDA 1X8CA 2PTYA 3CZEA 3FKKA 4DJDC 3D3AA 5IBXC 4MAZA 1ISZA 3SGZA 1PZ1A 3VD4A 2GJXB 3ISIX 1ONEA 1CLKA 2PBOA 2XGZA 3T40A 3DG7A 5DY3A 1XFCA 4J27A 3GXDA 1ZHAA 4YTUA 5A6TC 3NQEA 3ZWSA 3BLDA 3LRMA 1MDRA 2G4JA 4S3KA 5A6BA 1RSCA 2FHFA 4AAJA 5A1AA 3WSUA 4RPPA 1KW1A 4HNVA 4JTAA 1V6UA 2AKMA 2ZUTA 4GO9A 3OA5A 3LHUA 1EHNA 3LV5A 3LA4A 1TE1A 2AAAA 1VQTA 3C0LA 1K7EA 4HHMA 5KMYA 1XG4A 3A47A 3ZLHA 2P0OA 3NUKA 1UCWA 4AYSA 5I03A 2NQ9A 3IIVA 4AZCA 4PMNA 4YU1A 2BOEX 3BCDA 4K39A 1MNZA 1Q13A 4UTHA 4D6HA 5I3FA 2E5BA 4XBKA 1TUFA 3KL0A 3Q65A 1VJIA 4AZHA 1J01A 3CIWA 1UR2A 2FJKA 1BFNA 3DBPA 1MQRA 3HV8A 1FDZA 2VUNA 4WR3A 1UR1A 2DH2A 3ZSTA 4NNCA 1K03A 2YXGA 1XSKA 1ITXA 4NQ1A 1IWPA 1F3WA 2V68A 1DJWA 3SUUA 2FPVA 4IMGA 4BR1A 2AL2A 3ABQA 2Y7FA 3EPMA 3N34A 4GJIA 4R27A 4RV3A 3R89A 4O1EA 4X9YA 4AVOA 4FP1A 4LAOA 3AMKA 2PTDA 3E2QA 1BGAA 3FLUA 4AEOA 3KZSA 2VX7A 4ZFCA 1UD5A 4Q8MA 4O15A 3ITCA 2PB1A 4S2CA 2I7GA 5I3IA 1UIOA 2CW6A 3ONBA 4WIWA 1QCWA 3LY0A 3LHWA 3QJAA 3W4RA 4KQNA 3P84A 1PZ2A 3QMSA 5EBAA 1D7KA 2ZXAA 3U7VA 1W1TA 4PRWA 4A3QA 2D69A 3CL6A 4HMEA 1ZLPA 3W1NA 1NSJA 1JEZA 4HSHA 4J40A 1ODZA 1OC6A 2VEPA 1ZGDA 2F6KA 4KWWA 4YTQA 4S3CA 4NY2A 5K9DA 1ESWA 3P60A 4R7JA 3EB3A 1T40A 1J93A 2W61A 3LOTA 3UR2A 4N42A 2GUYA 3HQPA 1FA2A 3UZXA 3H21A 4TMBA 3F2DA 4ZSTA 3R8RA 4ZQOA 3VUPA 2BX7A 3M5YA 5JIPA 1BPLB 3OG3A 3B03A 3P14A 4LCRA 3T2PA 3WD3A 4DQWA 4B5SA 3E0LA 4B3LA 1H41A 4Q7IA 3N6JA 4CNTA 1VIZA 3WQ5A 3KVMA 4HU8A 8XIAA 2QEZA 4G1NA 5AYYA 3T0CA 4NI3A 4ZL1A 1L6GA 2V38A 3MJYA 4A2SA 2Z6IA 3V35A 4JQ4A 1F3EA 2ZRWA 1XF0A 3S5YA 1NELA 2YOCA 3U8GA 4OUIA 1W9DM 1GG0A 4U2ZA 4RNJA 4UQDA 4JD4A 3GFYA 3ECQA 3W1QA 2UY5A 3WENA 4HZMA 1DIKA 3IARA 4KEMA 5A8NA 1WAUA 2WYSA 2WMIA 3WBXA 1S46A 1FVPA 2ZXQA 2FTWA 2GGHA 3BLLA 3UWVA 3IIXA 1XFBA 3LM7A 4Q4KA 1F8IA 4P7LA 1LWJA 1LF1A 1IIHA 2PURA 1E3XA 3B9NA 4ZXOA 4A3HA 1EEPA 2G50A 5A8OA 3W2JA 2DT0A 4QROA 3TW7A 3NQFA 3UJRA 3C8NA 4ILSA 3QEZA 3T08A 3VGGA 3S5SA 1JUKA 1DPMA 5J8LA 4QAIA 1B3VA 2C1IA 4Q8WA 3NQVA 1NVMA 3LCFA 3HF3A 1QBBA 4GI9A 1OINA 1NY1A 3CHVA 3IAQA 3P5YA 1TSIA 2XU2A 3BMVA 4HPGA 1H7XA 3TC6A 4W7VA 3BAJA 4ATLA 2GL5A 3VGDA 2RJHA 3N04A 1SZNA 4PBGA 4BY3A 4HPHA 2E6FA 3OQ8A 3AS1A 1HF6A 1SZEA 4R9XA 4WK9A 3VZYA 4QS5A 3DN5A 3WLQA 5HNNA 5IBXA 3T09A 2DIEA 1XHGA 1U30A 3RNDA 2J88A 1V3JA 3IVUA 3VZXA 4HK7A 4AW7A 2ZUSA 4MNKA 4QLKA 4B5VA 1B3XA 4DHGA 4YHGA 2W9MA 5BOEA 1JZ4A 6ENLA 2VP8A 2O55A 2BGNE 1UUMA 2WVTA 4HT3A 1PIFA 2J8TA 2W5FA 2E5CA 4O0KA 1L9WA 1B90A 2NQ5A 3L4XA 4RNHA 5I2UA 3E2RA 1HUVA 4A3RA 2WWCA 4OECA 1AQFA 4M5PA 2A6LA 1R8LA 4B9YA 1W6TA 2XSXA 2HQAA 3SEPA 5HULA 1VFMA 1JCYA 3IAPA 3N4FA 2J4GA 2D0FA 1I2OA 3O1NA 4UTFA 3BAWA 3GHTA 9XIMA 4PA8A 4PTVA 1XIEA 3ZJ7A 5IDIA 2X1UA 4EWJA 3DYPA 1KLZA 3NDZA 1GG1A 4B5NA 3FJ4A 1I6NA 1ZPTA 3TJLA 1IWAA 4ERIA 1F05A 1C3FA 3WQVA 3W7PA 3C2RA 1Q4WA 3S1XA 3E0VA 2X40A 4ZFMA 5C9UA 2EPLX 1L6FA 3OO2A 3ARQA 1FP9A 1ZQ5A 5TNVA 5HQEA 2Q8LA 5JU6A 3PTMA 5BRBA 3FAWA 4GIRA 3IUHA 5D8ZA 1O1ZA 3CBWA 3K4WA 4B3ZA 5BU6A 3CQIA 3STCA 5D05A 1XYLA 4LVAA 1UD4A 2TSYA 1S39A 3CB3A 4UTJA 1EOKA 3GC4A 2E1WA 4HPJA 3VNLA 1CB7B 1YX1A 2D0GA 2BP1A 1OFAA 3ITLA 1UWSA 3HMCA 3DI1A 3JZUA 1K9EA 4D2JA 3QFWA 4YLWA 3TE9A 1OX4A 1I45A 2ZKMX 4H01A 3PUGA 1EXBA 1W56A 2R1PA 1Y7VA 3CHFA 3IUDA 3P80A 4E8DA 2OLAA 4J28A 2Q3RA 3ITTA 4Z1CA 2XWDA 3MUCA 4LJ3A 3VDCA 1XRSA 3MUY1 4OVXA 1V4YA 5TAOA 3L4YA 4E4UA 1DJGA 3FSTA 3TMLA 4NILA 1V3IA 2V2DA 3R12A 4JIQA 1E6RA 3B8UA 2FFCA 3V5FA 1TRIA 3EEGA 4C1LA 4LSBA 4LRTA 4GY1A 2UZ9A 3R58A 5AN7A 1HT6A 3L2LA 5I3GA 3AU6A 2E67A 2QS8A 1XLEA 2E25A 3WQ4A 1U5VA 5F7UA 4UTUA 3N2CA 2JFEX 2D2OA 1EBHA 4FOKA 2YYUA 4B5WA 3UXKA 5LYRA 3PBGA 3KVJA 3DAQA 4GVFA 2QDDA 1MWOA 2F9RA 4KFPA 3WO8A 2FMOA 4N4QA 3TH6A 4NAEB 2PDXA 2ZUUA 2PRMA 1FWDC 3EB2A 2J7FA 4EE9A 4JBRA 1GVYA 1DJYA 1D3GA 1UD3A 2RHGA 2PUZA 3IRDA 3FV9A 2PDQA 2ATSA 1PB0A 3TWBA 4C7GA 4CEUC 1V3KA 3KOWA 1VRDA 1H7RA 5KZ6A 1XLKA 1XCXA 3HTWA 3A13A 1KFCA 2E09A 2IPJA 2ZWYA 3NWRA 1VFFA 2YPIA 5IM51 4XKMA 3GVQA 3OZPA 4V27A 1LZOA 4TTUA 5KSWA 1W5OA 1E1FA 4QG6A 2HDJA 5BMXA 4FXSA 1VJSA 2ZADA 4C6CA 4E38A 3G1DA 2RDUA 4LNYA 1SYTA 4F0HA 1KGXA 4US5A 4Q4OA 3VNMA 3S47A 3F4DA 2EPMX 3SRDA 4Q8TA 4B5XA 4O0ZA 1ZAJA 2QCDA 1Y5WA 3CPRA 6A3HA 1G4EA 1WB0A 3KHJA 1TFVA 4Z2IA 4PSPA 4GO8A 1JL8A 1JRCA 4WY0A 2Y5JA 1V0MA 3PZMA 5C8BB 5AVHA 3MP3A 1CENA 3NTYA 1QASA 2NLIA 1MXDA 1BWLA 3EKGA 4NJHA 2WVSA 1Z6KA 5BRQA 3QN3A 5BNKA 1BEUA 1IIGA 4CN6A 3OVQA 1EXPA 2VMFA 2VR4A 4ZR8A 3AMCA 3U4AA 2CXEA 1GT8A 7A3HA 1WKDA 4O14A 4PBFA 2HVOA 1G94A 4XUYA 1SW0A 1YW1A 3HZ3A 2WVVA 1EJVC 3CV6A 5A3HA 3K4AA 1OFBA 2CHRA 3GG7A 4ICNA 4LUYA 4JIRA 4MNMA 4TXEA 3B8DA 3GB6A 3WF4A 7PTDA 3FY1A 5CPTA 2DUZA 3SQMA 2WKGA 4EXAA 2UWFA 3FKRA 4FNPA 3BZJA 3UZYA 4KERA 4EPKA 3P0XA 1W9PA 1WNOA 3O15A 3UA4A 4LH8A 2VC7A 5H2ZA 4E4FA 3EZ4A 1U1JA 3KEHA 2EF9A 4IJRA 3WQCA 1EQPA 4F3HA 1MW1A 4R33A 4WJEA 4KEVA 2E1DA 4Z1BA 3M4HA 1FX6A 5H6HA 2XGIA 2VFFA 3CUFA 2OTDA 5A8MA 1UHVA 2C3ZA 4U2YA 1J2BA 4LVBA 2H8ZA 4GPNA 5A6MA 1C93A 1JF6A 2FB3A 1LROA 1JVNA 1K3UA 1OCQA 3ITOA 1NFPA 1W5QA 3H6OA 4KKXA 1TMQA 1DL3A 3LV6A 3QLDA 3HU7A 2NX1A 2H9AB 1ZTVA 1K8YA 4FX7A 1LT8A 1WQ5A 3ARYA 3CUIA 1TQXA 2EGZA 4HHPA 4GIAA 2EBNA 3G1RA 3IRSA 3WNNA 2BZNA 4U10A 3F4NA 4OE7A 4L61A 4JQAA 3VKCA 2GOUA 5GVJA 1SO3A 2DP3A 4FLRA 4OKDA 3WLRA 1EA0A 3SCOA 5SWUA 5H8UA 1WOBA 1ITQA 1J4EA 1RJPA 4NI8A 3VZZA 5FJIA 4DNHA 1GCYA 3KCOA 1XLLA 5D2XA 4DN1A 2X1IA 1TWIA 3CIVA 2CU0A 3VNDA 3R8HA 1A3XA 3B9DA 3KS6A 4HZ8A 1DYSA 1XS2A 1HO4A 3GNRA 2HCVA 2CLKA 4OIFA 1R3YA 4JTCA 3PUEA 3DUGA 1F61A 3OA3A 3TDFA 3C2EA 4DNMA 3LTYA 4S38A 1Q6CA 3T2OA 1O12A 3TNBA 2YCLB 3W26A 1BG9A 7REQB 2EAWA 4ZE4A 3RDKA 3QZAA 1BAGA 3VIKA 1AFSA 2X16A 4E2VA 1J9YA 4MMWA 1JAEA 3MW7A 1BKSA 3UEQA 1RUSA 2ZZ3A 3MBDA 4HMDA 2HISA 1X96A 1FP8A 4AC7C 5C9XA 4TIMA 3R7MA 6PTDA 3AZSA 3QPEA 3WF3A 1UOZA 4MKNA 3RPDA 1LUCB 3OYZA 3VNZA 3WUEA 3BV4A 2FMNA 3KCJA 1WKEA 4L64A 3BWWA 1V02E 3E0IA 3UXDA 3FNDA 3V5CA 3W7MA 1SR9A 1SR0A 4GWEA 1J10A 2E77A 2OT0A 5LIUX 1FHVA 4DO6A 1WP6A 3FSUA 4JTTA 2DQWA 2O9PA 4JX5A 1NDVA 2OYMA 3LU2A 3W53A 3V5OA 4QISA 4Z2JA 3HJZA 2E0PA 1E4IA 3THUA 5KZEA 4PFHA 2Z26A 4O53A 2XFRA 2Z1BA 4Q22A 4LPCA 3O6CA 7XIMA 2Z1WA 3VMOA 1N82A 1TUXA 3CEPA 4C6FA 3ABRA 2R1LA 3QY6A 1TMHA 3FN9A 3ZR4A 1JDDA 3EWUA 4TUFA 3TV8A 3CU2A 3DXIA 2BVYA 1PS9A 4C90A 3NQCA 3AAMA 3W7GA 2XSAA 3BLEA 1ZL1A 1S2VA 1GVSA 5CG0A 2QCHA 3GHRA 3TTEA 4O19A 2VEGA 1Z9AA 4IMAA 1MQPA 3F1QA 3WNKA 1IV8A 5HPOA 1AJZA 4ACZA 4NXSA 5CJMA 5FIPA 4GBUA 1KLYA 2JIWA 2XIBA 5EMKA 1IT8A 3SCUA 2QW5A 1B3OA 3KVLA 2WM0A 4NAFB 1K1DA 4MY9A 5HATA 4HN4A 5ABFB 5IDZA 3QXBA 3BPWA 4YNGA 2FVMA 2I9UA 2DIKA 3WBEA 2P10A 4WZHA 1KTNA 3M5ZA 4Q6XA 4DUWA 3CIXA 1M65A 1YQ2A 5A2AA 2QMJA 1PX4A 4HNOA 4UTWC 2ZC1A 2VM8A 3MMWA 6CGTA 2FTPA 3B9AA 1XCWA 3I68A 3GUGA 1ZP3A 1VBJA 3D5HA 1SW3A 4C5ZA 2WSQA 5FF0A 2CKRA 4JIIX 2NVCA 3BURA 4GACA 4MF4A 4UMAA 3WIJA 4DJED 3T55A 1BG4A 4GKLA 4IMCA 2C18A 5HWJA 1N8FA 3ITGA 1AODA 1GK8A 2WHKA 4IPNB 3M0YA 2NZLA 1ZB5A 2IQ0A 1ISVA 3TFCA 2YX0A 2V8ZA 3P6LA 2YLAA 3VPLA 4PZVA 3G8RA 3M0XA 4EPEC 3STGA 4GQGA 1H7WA 2IUZA 4NG3A 2PFHA 3CTLA 5BOFA 3LCXA 1XYMA 4XV0A 4IM4A 1UQZA 2QJJA 4H9TA 1KFWA 3ZZ1A 4ENLA 2OQHA 5FCZA 4LUSB 6REQB 3GDBA 1MRAA 3NIYA 2OJPA 2PZNA 5AHLA 6TIMA 5FSEC 5CZJA 1ZRQA 2O9OA 3E5PA 3UG3A 4AWEA 1TQJA 3ITXA 5U4NA 2CZ5A 5CPSA 3UXLA 3SW6A 3N2XA 3VDBA 4H2HA 2ZQ0A 4REQB 2E9MA 1RALA 2VEIA 3WLMA 3C4UA 3LPGA 3BE7A 4FIRA 3SJNA 4QDPA 1US2A 3UCCA 4O11A 3AJXA 1JXJA 2OZ0A 2QKFA 3HN3A 4NJKA 2QJGA 1XICA 2WKJA 2Z1KA 4U5IA 4IP4A 3AYTA 5RUBA 4K7YA 2WHLA 4ZBCA 3SCQA 3VGFA 3L21A 1D8WA 4EWND 5AC6A 1F74A 1R0MA 3NQ6A 3LYEA 3GAKA 1N2VA 2WNQA 3T0TA 4H8NA 3NZQA 1OJXA 1PCWA 2DSZA 1NM9A 3EDEA 1P0NA 3M7WA 4IIEA 2YDSA 3UXIA 2ISVA 1TWZA 2E7FA 3ANYA 4LUJA 1H4PA 4Q3MA 3ZT6A 3GYEA 3DH7A 2BY2A 1TTQA 1CECA 4D9PA 3Q45A 5MF5A 1TRDA 4MZ1A 1QO2A 4PMZA 3W7EA 1V6WA 3MPGA 4CU6A 1VEMA 2ASHA 2OLHA 3CUZA 3IV8A 2Y6ZA 2HROA 1L8PA 4EANA 1ISXA 4HCDA 1H49A 3BDKA 2XPKA 1QW8A 2YR1A 4IL0A 1IXNA 4EXQA 2DZXA 2ZIDA 3QPZA 1HFBA 3ZOAA 3TOYA 1BD0A 3V0TA 3HJEA 2PCEA 4HYVA 4U33A 2R94A 4NP7A 2OZTA 3TW9A 1B5TA 3IUIA 1QW7A 3ENLA 1QXLA 5FEWA 3PAOA 3AU2A 1PTAA 1HKMA 1UD6A 3RLHA 3LQLA 4IOTA 4ZQNA 1DBTA 4CVWA 4JFVA 3TX9A 5I7GA 3B0XA 2WMGA 3WLPA 1KXVA 1H60A 2J9ZA 4C5YA 3AUOA 4ALDA 2G37A 3S2MA 3IJQA 4O1BA 3MUXA 3L9CA 4GD0A 3W37A 2CFFA 1KCZA 1QK2A 1DWIM 4CKQA 2V67A 5HNTA 4UC5A 5CXPA 4CN1A 3LRKA 4UZSA 4EAMA 3CNYA 4ERAA 1O5QA 2NT1A 3W7JA 3DFNA 4LYKA 4L80A 1DHPA 4LALA 1GOXA 4KIRA 2HS6A 3VM5A 5A2BA 2E6DA 1UBSA 2C1GA 1QHZA 4K2SA 2Y5EA 4M7SA 1Q5MA 1JCTA 2NVDA 4AXKA 2UY2A 1OY0A 5DFAA 1A4LA 1YNPA 4XUGA 4GHRA 4GC4A 2A4AA 1JPIA 3LN3A 1QPOA 4MWAC 4WUIA 4A29A 2DSKA 2HTMA 4OFCA 1O7AA 1PZ0A 2PD9A 5D2WA 4ONVA 3N19B 1U1HA 3R5EA 3S4TA 2YL8A 3GTNA 4G5DA 3RPMA 1JNEA 1WX0A 3WEOA 3ALGA 3UJ2A 2ZDRA 4LYPA 1HJXA 1DWFM 3EMCA 1M04A 4LC6A 5DEZA 3PJUA 2CBVA 4Q6JA 6XIAA 4J3VA 1EP2A 1E9LA 4HMNA 3ICJA 4JQ2A 1ITCA 1K6AA 5ENLA 2XN1A 4A6GA 1TB3A 3F4WA 4GZIA 2IPFA 3QYQA 3WBAA 1E0TA 3LERA 4UOQA 1QBAA 1J8VA 3GZAA 2WBGA 3LBMA 2RDXA 1XIIA 4LY8A 3UWWA 3S2CA 5BU9A 3NSMA 4LUTA 3VNYA 3VCRA 4WXZA 3KAOA 3VABA 3C61A 4QITA 3GNXA 1F3TA 4YIWA 1TA3B 2O56A 1BYDA 3LPPA 3NNTA 2B7QA 5LIWX 4B15A 1NDYA 4L1XA 3TQ0A 1S3HA 3SQSA 3BAKA 4WRHA 3TC7A 1W5NA 4TQTA 2F2KA 4FA3A 3NR0A 3REQA 2AQWA 1XBYA 4A8RA 3VFLA 1J5TA 1AW2A 2BY1A 1CGUA 4OOUA 4ZVJA 3VFCA 2PTXA 4RZ6A 4WSHA 1IEIA 4YS1A 1PEZA 2J7EA 3LCGA 5CGMA 4M6UA 5FACA 2V5CA 3QTPA 2ALDA 1W5MA 1BKHA 1GW1A 1CWYA 3AQUA 3N2BA 2POTA 1ADOA 1QUMA 4AIOA 1YE4A 3QZEA 4HBKA 4OV9A 3QR0A 1NQ6A 4JNZA 2ONEA 4ATDA 1IHIA 3LQGA 3UA3A 3YPIA 5G1YA 1Y5VA 3OB8A 1X8FA 4WKAA 3TYDA 1JZ8A 4MKSA 5MKGB 3USZA 1TIWA 2PRHA 3ARSA 2BLEA 2EPNA 4AF0B 5REQA 4EIVA 3SUWA 4IHCA 2PSNA 4XZNX 1PVNA 1NTHA 3BCFA 1JRBA 1JG9A 3EWDA 2AQOA 1AZ2A 3BANA 3N4AA 1QWKA 4Z1AA 4GNVA 3IJ6A 1B54A 4LTSA 3VE7A 4BI7A 2WZIA 3RM8A 3CPGA 4OV4A 3W70A 1BRLB 2DUAA 3TJIA 2C16A 3GHUA 2VDGA 5G5IA 4IP7A 2J13A 3KCLA 2ESCA 4QNWA 1E55A 3MSYA 2G96A 3NL2A 3VCCA 5F1VA 1ICPA 3WMCA 5D2VA 1KXQA 2BVDA 5FSDC 3PF3A 4IX2A 4Q8QA 2GZXA 1DQUA 1KM6A 1REQA 1I9CB 4XISA 3DG6A 3GC5A 4PMDA 3L23A 4FSAA 4GISA 2REQA 3SDOA 3GW3A 3M6DA 4OZOA 2Z4GA 2A5HA 1XI3A 3M0MA 3EDKA 1UIPA 1GJPA 4W88A 1TTPA 5HJLA 5CSUA 5I79A 1X6UA 2QNEA 5CKSA 1EDTA 2ICSA 4C6IA 2J8FA 1MO0A 1XPYA 2ZE3A 1TELA 2PGRA 4V33A 4GQQA 2ZTKA 3RF9A 1Q6RA 2ZXDA 4QDWA 2ALRA 2DV0A 4CUCA 3UYIA 4F40A 3R4IA 4RE0A 3IJ8A 2YB4A 2IKHA 3QHNA 5BZAA 3H23A 4GXPA 4GY0A 3EXRA 3SURA 2W63A 3LK6A 3M5VA 1QK0A 5E9AA 1XQLA 2A7PA 1QR7A 3DFTA 2WXDM 3PZGA 1L6YA 4H6EA 3HO8A 2XIOA 3Q67A 1BYBA 4QX4A 1XLFA 3WUGA 1D3HA 3CM4A 4QR6A 1WXYA 5HBFA 2V30A 3HQ1A 3CTTA 2D2GA 4UNKA 3TFXA 2Y8VA 1W37A 3PZUA 3BO9A 5LGXA 4U5KA 1DJZA 3BLKA 4B90A 4B16A 1VP5A 3BAIA 1E1CB 3P3BA 4JCLA 1JDFA 4HSNA 5AOUA 1LM1A 3CT2A 4AD1A 2OWXA 2VGBA 3SSJA 1SFTA 2DT3A 2QQ6A 5C2GA 1Z32X 3L4VA 2VT0A 3N6QA 3OW1A 2AGTA 3WFLA 2VENA 4HQVA 1IZKA 2GJNA 1TMLA 3GH7A 1OFRA 2GSHA 1ZENA 4AZIA 1I2NA 3WLNA 2DY3A 1XG3A 3NPXA 1AA1B 4A4AA 1YYAA 3JUGA 2R1MA 5FD0A 3EDJA 2WNNA 3HQNA 2XVNA 3OLGA 1D2KA 1XLJA 3MS8A 1GVIA 1XH1A 3A3XA 2QPXA 3F7JA 1SJAA 1HVXA 1VYSX 3POCA 2Q02A 2VTFA 4XD5A 1XLMA 2E5DA 3OVGA 4EPBC 5BCAA 4WHBA 3TOPA 5J5RA 1VFTA 1SGJA 2JF6A 4MM1A 1NIUA 1PXGA 3GXMA 3VGBA 1QPRA 2R1KA 4RCXA 3SI9A 1KWGA 2J62A 1PV8A 3OIXA 3A4AA 3S9YA 4Y9AA 1QMLA 3L4ZA 3A4XA 1OB0A 1YDOA 1KTBA 1SSDA 2V2HA 1ECEA 2BMBA 4QJ4B 4MVAA 1A53A 4PCTA 2QIWA 1TV3A 1JD7A 1V0KA 3THDA 1AH0A 3T9PA 4DUXA 4IGNA 2GVEA 3RJYA 1K8ZA 3WF2A 4KGLA 1QHPA 1OF8A 3B0YA 5K3VA 4RDVA 1T6MA 3LRLA 3SN0A 1Z48A 2OZ8A 4F8XA 2OVLA 1KM1A 4L4MA 3PZIA 3AFBA 4GKTA 1XLDA 1QAPA 3LCWA 4PUDA 2HS8A 3W24A 3VIGA 1ADSA 3UWUA 1PSCA 1KBKA 2ZDSA 4JICA 3AIRA 4BQ4A 1LRTA 1ALDA 2QF7A 3GWQA 3UR8A 2YLLA 4UFIA 1R9XA 4C6NA 2GWNA 4WY0F 4M24A 1EGVA 2X42A 2J7CA 4G2DA 2RKXA 5H1WA 1NP0A 2C79A 3ALFA 4X0NA 3CMJA 2Y89A 4PGLA 1XKYA 5LA2A 5GPRA 2RH9A 1VF8A 4Z08A 5E9XA 1C92A 1FWIC 2VQUA 4KEZA 3UG4A 3MZ2A 1ONWA 3RIKA 5D4YA 2PWGA 3RITA 4ADSA 3G3MA 1QOPA 3ARTA 3ZT5A 3LXCA 3MU7A 3Q37A 1PTDA 2RGLA 2X09A 1MFVA 2WK2A 7TIMA 3MUIA 5BXRA 1QNPA 1AH3A 4O50A 1G5AA 2D1ZA 1AL7A 3ARWA 3S9IA 2DUXA 4KGJA 3ERPA 1S5WA 2BVTA 3W0KA 2IKJA 1IE7C 3WDIA 2ZZ4A 1EKOA 1GQKA 1OGBA 3UU0A 2HZGA 3KUMA 5A8PA 4ZMGA 1LJYA 3TQVA 4BQ5A 3PFMA 4MIMA 2XFWA 4C91A 4GGBA 1HL8A 3WCZA 5F2MA 1BXNA 1S5TA 3B0VC 1RBLA 1V3LA 1LBMA 3BW3A 2XZ7A 1PYFA 4IG2B 2OZ3A 2BB0A 4XK2A 5G4HC 3M47A 3SJ3A 1V0LA 3R11A 3WMSA 3ZVIA 1CGYA 2VDHA 2X0SA 1AQMA 1IR1A 4WVXA 3TP4A 2QF8A 3FIGA 5F4WA 3KRUA 1K8CA 1N7KA 4ICMA 4CNSA 2QPUA 3SUSA 1C7TA 2O9TA 4O12A 4BWLC 5AYZA 2YXXA 5CG7A 3BV7A 3W3OA 4QDMA 4PODA 3PZNA 2J8GA 3D46A 2WANA 3DC8A 4CU7A 3APYA 1UPMB 3PZQA 1M7XA 2WCAA 1EYWA 3P8JA 5KZMA 5DELA 3MI6A 1CXHA 1L0PA 2XH4A 4RW3A 1TR9A 1FH9A 1S2CA 5AECA 2JF7A 4DVOA 3SZ8A 2D73A 2PWHA 1EBGA 1KO0A 1ME7A 3N18A 1P7TB 1TV7A 3STFA 1CXEA 5HAOA 1Z42A 4NVTA 4QG8A 4HZ7A 4LANA 4WLCA 1J0HA 1K8XA 4Q8PA 1J2WA 1Q6DA 4ADUA 2HRWA 3FS2A 1JPHA 4WDWA 4X2RA 1TV5A 4PUUA 1M01A 2J66A 2GPTA 1FHLA 4KFNA 2W79A 3R8GA 1F6YA 3OIHA 2WHMA 4HYRA 3BARA 5DMMA 5DO8A 4ZB5A 3N3TA 1EF2A 2OGYA 1AQHA 3ANVA 1L2UA 4KBXA 1NWUA 2DFAA 3RMJA 1GQJA 1X98A 1F9CA 4IISA 5JMUA 3GU1A 4RJEA 1WV2A 5DY2A 1EX1A 1UR9A 2FGLA 3FGCB 3QTGA 5AZ1A 1DKWA 2PP0A 4Z1DA 4NKCA 3GKAA 1RPKA 4H9VA 4M1BA 1AK5A 1DJXA 3KX6A 1CGTA 1R7AA 1NF0A 4XIMA 4OU1A 5HJXA 3UGVA 4O8RA 3TCSA 2MANA 1G9HA 4IQDA 1J79A 3N1AA 3ZVHB 3QPYA 5G4WA 1XYZA 2WM1A 4CQBA 1IZCA 2GK1B 1TJ2A 1TVLA 4F0SA 2A3CA 5AHEA 1KFJA 2YA1A 2PS2A 1CPUA 3AYVA 2YKKA 1RBOB 3EYPA 1KKOA 1Q7QA 4KCUA 3FAXA 3PB2A 3DYMA 1H11A 1KXTA 1FRBA 2ZZ2A 2O7SA 1XSJA 4UTLA 1A50A 1W3NA 3PWGA 3W7OA 3QGVA 1W9XA 2INFA 1VEPA 3Q94A 1SFSA 4ZQRA 3FFSA 1OM0A 1GVEA 4FAMA 3BOLA 1MI3A 1J12A 3DCPA 1HO1A 2CZDA 3THQA 1ZFJA 4MB5A 3CAQA 1XL9A 1SZGA 3UGRA 4RR4A 1VENA 4D6IA 1AZ1A 5J5DA 5GJPA 1OD0A 1C90A 1W3KA 3A5FA 3WK0A 1XW8A 4GFIA 1KBJA 3SCTA 3N9SA 3L4UA 2IKGA 3URBA 1HGWA 1U22A 4DPQA 1UR4A 5GQBA 2G8ZA 3TTQA 3UPWA 1MMFA 4ZA0A 2J7HA 5HA7A 1KD0A 5A6SA 1K02A 4PUEA 5CEWA 4MB3A 1BLIA 3W7NA 5G1TA 1A5BA 3EX2A 3W6YA 4J3UA 4KRUA 1AD1A 1H3GA 1GPWA 4GA8A 3S1WA 3SGGA 2J7BA 2VO5A 3W25A 4F0LA 4A05A 1Z3NA 3CLMA 2OELA 4WJ8A 1UKPA 1PUDA 4RW5A 5I02A 4QE1A 2QVHA 1ZP4A 3BQ5A 4AISA 1BVNP 3KRZA 3EA1A 4C1NB 5D09A 2YCKX 3MV01 1YXCA 3NZGA 3DHFA 1O94A 1FXQA 1UPPA 5F2LA 2OB3A 2YXOA 3SY8A 5C5YA 4FNRA 5C71A 1XH0A 3KP0A 1LQ0A 2FQIA 4HU0A 3NM3A 2Q8ZA 4QM1A 5AVNA 1VPYA 1H51A 1RVGA 4UQAA 4JL2A 3FDGA 3UR7A 4PMXA 1WUFA 4JN6A 2HBVA 3NDOA 2DSUA 3MBFA 3AIWA 1TR1A 4GYPA 1VYPX 4UCGA 3H22A 5C2CA 1ISYA 1RP9A 1JPDX 3ARUA 1KXHA 4W86A 1GKPA 2F7FA 3L0NA 3NXFA 4GRSA 5DX7A 3TAKA 1GGOA 3R13A 1A3WA 4IPLA 5I3HA 1CXIA 4W5ZA 1UWUA 1B3YA 3B3DA 4H7CA 3QBUA 1KV5A 1TX0A 1DORA 3MSDA 4BFAA 2ZRXA 2G3IA 3KOZA 1HL9A 1TIMA 4FNQA 2OSYA 3PJTA 3VNKA 1VJZA 5FOOA 5LA1A 1KM4A 1XIHA 2OCZA 4F0RA 3A5VA 4BWLA 3FX4A 3CHCA 3WQ8A 1ZCOA 4HP5A 3PBVA 3I7RA 3GG8A 2I17A 2PAJA 2A21A 4BK9A 8RUCA 3K4DA 4QCFA 4H3DA 4D8LA 2Y61A 4PR4A 2P1FA 1RAKA 4MPKA 2PTWA 1XDJA 3K2GA 5F1UA 2WKLA 1EF3A 2A3HA 3E2VA 3UR5A 3WNMA 4HIBA 3OQEA 3VGHA 5LKYA 1FDJA 4DRSA 4DWSC 4ZO9A 1XIMA 5KINA 5M03A 3O2LA 2AMXA 4DBDA 1JUBA 3PBYA 3S5NA 1R2TA 5AB3A 5E93A 4WKFA 1VBUA 4DBUA 5A8GA 1PO9A 2P50A 3FVMA 1QI0A 1TPFA 3V3WA 1UP3A 3N2OA 9RUBA 3JR2A 2QGYA 1WDSA 3V1PA 3W7RA 2GYIA 3RCNA 5LZLA 3S9ZA 1LLZA 5D02A 1B9ZA 1YNYA 4JKKA 4N6EA 3BGGA 3IGXA 1ZU8A 4NJGA 3C0QA 4AYGA 2PWFA 3AISA 4RE4A 4MADA 3MSGA 1KRBC 1M7OA 3BG3A 3OTRA 3QLLA 5DCBA 3L0KA 3BW4A 2JGQA 2JGYA 2XM1A 3AHYA 1X6LA 4EKJA 1X38A 3WL0A 2VGIA 3AZTA 1FWSA 3GBEA 2WJEA 1SZFA 3LLDA 1S2WA 3CZGA 1FWJC 3I7SA 1P4CA 1JR1A 1GORA 4B3KA 1X1OA 1VS1A 3BZGA 3SUTA 1NDWA 5AYIA 4W8AA 3HBLA 2G3NA 3KW3A 3IJLA 4IPJA 4I7VA 1UZ1A 3TYCA 1RA0A 4QP0A 3IGHX 4QFUA 1Q7ZA 2C14A 3UZ5A 2DZSA 1SO5A 1H7NA 1BWVA 1MZRA 1Q7MA 1W91A 2WLZA 1K70A 4O0QA 2X7WA 3BOXA 4IIBA 3TU9A 1UUOA 3IIOA 2VYOA 4KRTA 4JTUA 2XIQA 2DW7A 5G2IA 4C60A 3GM8A 4Y2WA 4BJHA 2WB5A 3MB9A 1HKWA 1FWTA 4FOJA 2ISSA 3BJTA 4HU3A 3NQAA 1PBGA 3TONA 5CQ1A 1FWNA 4J1OA 3TLLA 1I0BA 4RKAA 3UY7A 3AS2A 1HZYA 2HPIA 1D8CA 4OT7A 4UTMA 2DPEA 4BKNA 5XIMA 4I5XA 4WGXA 3MTWA 1V08A 4IT1A 4XAPA 4ZQCA 1TE6A 2QULA 4DF2A 3VC5A 4RDWA 6XIMA 4QG9A 1H09A 4XD6A 3I6EA 2IPWA 2EEXA 2R14A 2XINA 2NUXA 1VCFA 3CZ8A 4D6FA 4ZEPA 3UY8A 3L5MA 4F0MA 4LCSA 3W71A 2NV1A 1XYAA 2A6NA 1RA5A 3PBMA 3NVDA 3WG6A 4EXBA 3HPAA 5T9BG 4G7FA 2QHAA 5BOOA 3OGRA 1UWIA 4AU0A 2CZVA 4K38A 3PY2A 1DIDA 2VHLA 1XLGA 3NGJA 3JW7A 2WW5A 4RZ5A 3AJ7A 1JI1A 2Y7EA 4NAEA 4O18A 2EG7A 3RU8X 3F03K 1TCMA 3T44A 1R3RA 5ABGA 2XVLA 3CAVA 4PL2A 1LG1A 1CLXA 3HURA 3LUTA 3UYCA 3W22A 5XINA 4RDYA 2DZVA 1OVDA 5I00A 3Q58A 1ZY9A 1W1VA 4Z0SA 4S3JA 3WQOA 3WJZA 3NSXA