3KVJA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with amino-benzoic acid inhibitor 105 at 1.94a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
363
Chain Sequence
GDERFYAHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title Discovery of novel inhibitors for DHODH via virtual screening and X-ray crystallographic structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 137
structure length 363
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kvjA00
2DZPA 4O4WA 3NQ7A 3M0ZA 3S1UA 3NQMA 1H61A 3EWBX 4FNUA 5G2IA 4DBEA 3EKLA 4L4MA 4HT3A 2FPTA 1GVOA 1OFAA 3GAYA 5KZEA 5LGZA 4QNWA 3B03A 1QPNA 3UWUA 2B7QA 5CPMA 3W83A 4UTTA 1FCBA 4M6QA 3RLUA 3W9ZA 1OX4B 3W7NA 1L6SA 1EPXA 3W2MA 1G7UA 1PV8A 4I7UA 3W84A 4UTUA 4CQAA 4LW7A 3NM1A 1GVFA 1J2WA 3B0PA 3W88A 2A2IA 1LP6A 1FWTA 1DORA 1KA9F 3TROA 3LLFA 1W56A 3W23A 2J27A 5F2IA 5BMXA 1L6YA 1DOSA 3MHGA 3QQ0A 3TW6A 2VFHA 3N19B 3A21A 1PS9A 1KFJA 2E6FA 2WSRA 3OEXA 3W7KA 4HNUA 2QUUA 3R8RA 2YR1A 1SSDA 4OQVA 5HUPA 3KFTA 4DXVA 1TTJA 3QMTA 3GK0A 3M41A 3PBYA 4IWWA 4XTDA 4UMAA 3QRHA 4O15A 5HWJA 1HG3A 1I2RA 3VFLA 3A9IA 2A7RA 4O1AA 2UV8G 5D33A 1OYCA 2QCEA 3FFSA 4BFAA 1GJPA 1SR9A 2CLHA 3PSWA 4ADUA 1PHWA 3TXVA 2NXGA 2Z2UA 5F2GA 2A21A 3A5VA 3NVTA 4AMAA 4RXGA 2ZZ7A 3P61A 5C2XA 4HIBA 1EWDA 1LBLA 2H90A 5F4WA 3VKJA 3MWAA 4JTFA 2A0NA 3FIGA 2C19A 1UASA 2Y7GA 2C3ZA 5I3KA 5TQLA 5IM51 4CQ8A 1JR1A 1LZOA 2AAMA 1TSIA 3SZ8A 2RH9A 2ZZ1A 2DZUA 1JQXA 4DQWA 3S42A 3W22A 1PL9A 3LLDA 3QMSA 1H5YA 6ALDA 1Q6LA 2DJLA 4IMFA 4CCDA 3SGUA 1GOXA 1N7KA 2WV8A 3G8RA 3HOJA 3MW7A 3W7IA 1DL3A 4JS3A 4CNPA 4LUJA 5EY5A 4R33A 4WUIA 3W7HA 1DQXA 4BWLA 4IQLA 1PIIA 1B4KA 4Z0JA 1TPVA 3GR7A 2Y7EA 2VELA 1KM1A 4RR4A 4GE8A 3LXCA 1Q6QA 3S5ZA 2P0OA 4UTLA 4JDBA 3PUEA 1TQJA 5FF7A 1ICPA 4HSOA 3A5FA 4O54A 3I7QA 3EKZA 1KM2A 1OJXA 1P0NA 1Z48A 3NQ2A 4RZ6A 1HO4A 4S1FA 3W2JA 3Q2DA 3L67A 1XM3A 5F4XA 5F2MA 1CW2A 3ELFA 4NZFA 2CLIA 3HPXA 1W5OA 5LZLA 1RQHA 1NFBA 1FUYA 2GUUA 1GVRA 1ICQA 3NQ8A 3DHDA 2VXNA 2GQ8A 2V2CA 4ZQMA 3SECA 4LU0A 1O4UA 4AWTA 3WJWA 4UTJA 4PCFA 3EX3A 1V5XA 3GDRA 3OVRA 1DHPA 3GZ3A 2JBMA 4GFSA 5F2LA 4Z1BA 1TJRA 1L6WA 4UC5A 4UFHA 3G1YA 4ONVA 4WXZA 5AHIA 5FEPA 4LUIA 1FCVA 1IIGA 4RZ5A 2V2DA 2B7PA 1KFLA 5KITA 4YXGA 3PB0A 4JNMA 3LHYA 4Y96A 5FF3A 2NXIA 1K8YA 2PRLA 3GYEA 1AMKA 5HR7A 2G96A 1K8XA 1JUBA 2GVLA 1W3IA 1G4EA 1K7FA 3BLEA 1ZALA 1J4EA 3CM4A 5CGQA 4MJZA 3S1WA 5IBXC 3S5NA 3RMJA 1Q6RA 5HWMA 1XUZA 1O5XA 2OMAA 3PS7A 3W7DA 1W8SA 1A5BA 1QWGA 3G0SA 3UWQA 4J9JA 2FDSA 1U83A 3BLFA 3DENA 2YFOA 3HQ1A 4N2YA 3QM3A 2V30A 3TX9A 3SIZA 3WK1A 2V81A 5D2VA 2VFFA 5GVJA 4Z1AA 2P10A 2BZNA 1H60A 3C4UA 3G24A 4TIMA 3HGJA 1G4SA 5C54A 3S5OA 1EA0A 2C1HA 5DCEA 5AHFA 2V0TA 2Z6IA 1FXPA 5CPOA 1LBMA 1K7EA 1QDSA 2R91A 1XL9A 2GJNA 1LLWA 2TSYA 4H6KA 1ADOA 4JDYA 3PBWA 4GRSA 3A24A 1GG0A 5SWUA 3DFQA 1JCXA 5FEZA 4H3DA 1K3UA 3U8GA 5G5IA 4O53A 5BMWA 5BRBA 1QFEA 2QJIA 5EL1A 1SW0A 2C15A 3LTYA 1IXOA 3QW4B 3LXBA 3N3MA 5LNWA 4WQ6A 4QITA 3FOKA 1M7OA 5FF4A 2Y63A 1VH7A 3LHWA 5BOOA 3W2LA 4A3UA 3SJ3A 2Y6ZA 3HG3A 5I3FA 4ORIA 1KTNA 1C9DA 3CWNA 1EB3A 4UTIA 5AYZA 3RF9A 1TV5A 1F05A 4AH7A 4O17A 1I4NA 2J9YA 3LI0A 4LS1A 4ZL1A 2VFGA 5H2ZA 3W7RA 3L5LA 3W1RA 2IQTA 4O10A 1I2QA 1TJPA 2YPIA 3L0GA 4MVAA 5G2HA 3ZFHA 5EBUA 3LBMA 1R46A 3CHVA 5DBTA 1MO0A 1XBZA 4I9AA 2PE4A 2KZHA 5D30A 4ZQPA 3LOTA 1AG1O 4Z1CA 5U7SA 1VRDA 3M44A 4KWVA 3HGOA 1GYLA 1IXNA 2A5HA 4Z1DA 3TAOA 3N9SA 5DCBA 4CCEA 1GWJA 2VEKA 4O52A 1YTKA 1XDLA 3USBA 1B57A 2BSLA 2XN2A 1HTIA 2WKJA 2R94A 3SY5A 2WO5A 1MEHA 3W07A 4XZ9A 2E5CA 3CIWA 3LCHA 4C1LA 2QCFA 4OV9A 5D37A 2ZZ2A 4UTTC 4IX0A 3C2FA 1ML1A 5DY2A 3R13A 1LOSA 3KAOA 3NPWA 1M6JA 4AWSA 3OIXA 2FLIA 2ZYFA 4NUWA 5KINA 3HJZA 3GXPA 4IMEA 4HNVA 2HMCA 2JGQA 3MJYA 4FX6M 4QSHA 4XKYA 4RXFA 3TMLA 2NUXA 3TW7A 3B0VC 3RK8A 3DFTA 3R12A 4ZQCA 5G1TA 2WPBA 3S9YA 3LBCA 3JRKA 1EX5A 3TIMA 3BG9A 5H91A 3TSBA 1L2UA 2YSWA 5FF2A 2VENA 2DZTA 3NQAA 4K8HA 1QOQA 3WJXA 5K9DA 2Q8ZA 3NZRA 1LRQA 4UNKA 3IVUA 4DEFA 4OGZA 1IGSA 3QPZA 4AWUA 2VEMA 4IXHA 1U5JA 1PE1A 1GEQA 1Q6OA 3QEZA 2ZBTA 4ZVJA 2H8XA 4XTIA 4JX6A 1DQWA 4WOQA 5D2TA 2EKCA 2QCCA 3SW6A 2OT1A 3UQNA 1SZFA 5F1VA 4FXSA 2BLEA 1VLWA 3LV6A 4LV9A 3RNDA 1JUEA 2A6NA 3N2MA 2ZRWA 3ABQA 3F4WA 2CLKA 1GVQA 4IMDA 3W73A 1R2RA 4U28A 2VFDA 3IRDA 1KM0A 4IGHA 3IGSA 4O1DA 1ALDA 2YW4A 1W5MA 1KV8A 3MP4A 1H7OA 2GQ9A 2CLEA 5AYXA 3JR2A 3G3DA 3C61A 1VS1A 4QM1A 3W7OA 4FNRA 4O4VA 3T44A 1G4PA 4XKYB 3UXDA 3DBPA 4DF1A 1TV7A 1GZGA 1MZHA 1A5CA 3W85A 1VPXA 3NR0A 3OHIA 1K02A 3N73A 1F74A 1UUOA 3TQ0A 3MHUA 7TIMA 3MI2A 5D2WA 1Z41A 2NZLA 3MO7A 2A85A 2Z6JA 4N4QA 1KTBA 1FBAA 3HGSA 3M47A 4LRTA 1LROA 4UTMA 3B06A 5HQEA 3F1QA 4MOZA 2QCGA 3DFNA 2RDWA 3UWVA 1CI1A 2Y85A 3LB0A 4RLIA 4BWLC 1YPIA 2D73A 3EWWA 3EXSA 4W9TA 5E93A 3Q37A 4NU7A 4MKNA 2EHHA 1FWSA 3T4CA 3HG4A 4Q32A 1YDNA 3STFA 5EPDA 3Q94A 1P5BA 3WJSA 5KTLA 4O19A 5TIMA 1M5WA 3KXQA 4RV8A 4S2CA 2OCZA 5CZTA 1EP2A 2QCMA 5K4XA 4HSNA 4YCOA 1TO3A 5DCDA 2BTMA 1W5NA 1M7PA 4IX2A 5AB3A 2V82A 2WNNA 3PM6A 4WY0A 2JGYA 4M6PA 2ZTKA 4ZQNA 2ZDRA 2TRSA 3BO9A 4JTLA 1DJNA 1VZWA 1T99A 5BNKA 4GBUA 4UUIA 4JIPA 3NOEA 3TJLA 1YADA 3DFPA 3NQ6A 3PR2A 1QO5A 1H7PA 3TFCA 2PCQA 1JCLA 3G0UA 3LXAA 3NQCA 3L5MA 3LTPA 2R8WA 1WOAA 5CG7A 2BWGA 3LRKA 4XBSA 2I1OA 1GYNA 1P1XA 2E5DA 4JEQA 1SZEA 1WDWA 4AB4A 3VNDA 5D38A 2ZQ0A 3DH7A 1LRNA 4JYFA 4MZ8A 1JCYA 4JIQA 1NSJA 3BK0A 3MI3A 5D2XA 1OFOA 3CWOX 4FNTA 3PSVA 3N2XA 2ZA1A 3K30A 2OX1A 4LRSA 4FXRA 1SO5A 4NX5A 3R5EA 4E38A 4NZJA 2I9EA 5U4NA 5AN7A 4UFKA 4JGDA 2A7PA 4K36A 2QDGA 3IEBA 1JCNA 3P81A 3QW3A 5HINA 5LNRA 1OABA 1EUNA 5G1YA 3CT7A 4N4PA 5C5YA 3CC1A 5AHLA 2LLEA 1TQXA 1VYPX 3TC6A 3NNTA 2PRHA 2GOUA 4PL2A 5AHEA 2RHGA 1FWRA 4WY0B 4RKAA 2CFFA 1XDMA 3IIPA 3M5XA 4MFEA 5LNSA 1WBHA 1F7BA 3M5VA 4TU1A 1ME9A 1YPFA 2QKFA 4R53A 1KFEA 2X1UA 2YX0A 4JYDA 3NL6A 1YXYA 1WAUA 3LM7A 1KLYA 1B4EA 4A2SA 3LHTA 2H3BA 3MBDA 5LKYA 4PL1A 3IVTA 5K9CA 1G69A 5J5DA 2ZRZA 3OBKA 3M7WA 4UTWA 3LX9A 2CLMA 1VCFA 1QPRA 2QDHA 3W6YA 2A1YA 3DAQA 3F4NA 3R2GA 1EUAA 2DJXA 4Z0SA 3QFEA 3L9CA 4JN6A 3QZEA 3C8FA 2EF9A 3W7QA 4JX5A 2QCDA 2EAWA 4BR1A 1PVNA 3DGRA 2EGZA 4WY0F 2O7QA 1OFDA 3HF3A 4OBTA 1W37A 2ISVA 5I3JA 3DZ1A 3O07A 3G22A 4O8RA 4FIRA 1DV7A 4RJEA 1UBSA 2ZA3A 3IV3A 5D2YA 1JVNA 4I7WA 4K7YA 1KW1A 2ATMA 2TPSA 2ZRYA 3CU2A 5L9FA 1VC4A 3E12A 4FB7A 3BPWA 4AF0A 4O50A 1UJPA 3EWUA 3MUXA 3PB2A 3M9YA 5CSRA 2ISWA 1TYGA 5I3HA 1YYAA 3NYZA 3MBFA 4AXKA 5CPLA 3OA3A 4GUHA 3ATYA 1O60A 4N9CA 4AHPA 4WD0A 1JRBA 1MXSA 3KRUA 4AVFA 1LRTA 2NWRA 3L65A 1O5KA 3KVLA 3MMTA 1TMHA 2C14A 1X1ZA 1BKSA 3W1XA 4K37A 1I8JA 3CTLA 2DZXA 1DVJA 4AAJA 4ADTA 3TE9A 3W87A 2F7FA 1FCUA 5KZDA 1ZAHA 1XBYA 1P4CA 2QCDB 3M5YA 2J9XA 4HPXA 1MEWA 3FKKA 4FNSA 4GNJA 4JY9A 4LTSA 1J5TA 3PC0A 3NL5A 4JTGA 1BWKA 3V1PA 4DBDA 1TPC1 3QSTA 3EWZA 5CKSA 1KM5A 5D09A 1A5SA 3W86A 4KFNA 3GLCA 2CZFA 5K7JA 1SSGA 4RZ4A 1VHCA 4AF0B 3W7LA 1TRIA 3I7SA 5TBOA 1OYAA 1BWLA 1OF6A 3UWYA 3LCLA 3CEPA 4IMCA 4NJHA 3PUDA 3W7PA 3W1NA 3HIJA 3O16A 1AK5A 4WXYA 2A6LA 3TV8A 1WV2A 1LOLA 4E2DA 4HKPA 1S3HA 2CLFA 3NPXA 1H63A 3HPSA 3C2EA 1H1ZA 1V7YA 4FO4A 4FNQA 1XXXA 4LVAA 3B05A 1KTCA 2XN0A 2YGYA 3W75A 3O06A 4GWEA 3BLIA 3GR8A 4S2BA 1B9BA 5AOUA 5HMSA 3PY2A 2PRMA 3E0IA 3OG3A 4K7VA 1SZNA 3CIXA 3I6RA 4PODA 3HO8A 5HJLA 1G7VA 1FWWA 3EX2A 1THFD 2WNZA 3U2OA 1Y0EA 3MP5A 4M6VA 2HS8A 3GDMA 3OVQA 4AHQA 1W0MA 4XWUA 1JCMP 3YPIA 2YYUA 3DI0A 2VKZG 3M5ZA 1ZY9A 1VYRA 1WA3A 2C6QA 3LI1A 2FPVA 2Y62A 3PUOA 1VLIA 3ABSA 4UFMA 3LV5A 3N14A 3TKFA 5FEXA 2NUYA 2Q3OA 3IIXA 2QJHA 1XUUA 1KM4A 1YLVA 4Y9AA 4LVGA 5DLCA 1XBVA 3QPYA 3VE7A 2CLLA 3GIYA 2NLIA 5K9XA 3RLVA 4FX8A 4FF7A 3DKLA 3G0XA 4GUJA 1BTMA 2V9DA 1FCQA 2ZFAA 3LCXA 3W76A 3O15A 1GG1A 2A7NA 3BW4A 2RDUA 1TPDA 1H50A 4KFOA 2B7NA 4A22A 5HNRA 1OHLA 4O16A 3S5YA 4MYXA 1JRCA 1SW7A 1AL8A 1KM3A 2FB3A 4DF0A 2ZZ5A 2QEZA 2OT0A 2AQWA 1QNVA 5C55A 3NQFA 1JQVA 4IPIA 2NX3A 2CWNA 2Z1BA 3V75A 3GXTA 3SI9A 3NL2A 4MFDA 3A22A 3LCGA 3M6YA 1TTIA 4EOUA 4NJGA 1OK6A 3TJXA 3W1MA 4UTKA 3TQKA 3GNDA 5D32A 4NXKA 1ZFJA 4JTTA 2CZDA 3P62A 4E2BA 1UCWA 3TC7A 1H7XA 4R34A 3W2UA 3G18A 2E6YA 1QAPA 3DHFA 3GXNA 3BW2A 4PTNA 4EIVA 1FDJA 1F5ZA 3SFKA 3LCWA 4EF8A 4U4MA 1NEYA 3STGA 2R14A 1QR7A 3CQ0A 3P5YA 3NDOA 3CLMA 3C2VA 4HPJA 1BEUA 1DKWA 3LCFA 1YTDA 3LTSA 1AL7A 1GT8A 2ABAA 3I7RA 1OFEA 3DI1A 4G1KA 3NQEA 4KWWA 1EEPA 2NX1A 2QJGA 2YYTA 1K03A 4HNNA 1R2SA 3C2OA 3O6YX 3W7GA 3G1XA 1F73A 5KZMA 4NJJA 1ONRA 2Y7DA 4HHPA 3LDVA 3VE9A 2B0MA 1HFBA 3OVPA 1EP3A 3IIZA 1H62A 4PH6A 2X1SA 5F4SA 1VHNA 5CZ0A 5HR6A 4MY9A 1VCGA 3G1SA 3TR2A 5LHEA 3LHUA 4OWGA 2G97A 1W1ZA 2YDAA 3W7JA 3D0CA 2AGKA 1FDZA 5F1UA 4OV4A 4ZQRA 3BGGA 4UMBA 1TV8A 1YTEA 1TB3A 3FYPA 3WFAA 4LVFA 2GVJA 5DXXA 2W6RA 2E6AA 3QQ1A 4MUZA 4JICA 1TPUA 1RVGA 4JXCA 5J5RA 3C6CA 2ZRXA 2CU0A 2ABBA 1E51A 3KOFA 4LVBA 3STCA 3UPBA 4O28A 2O7SA 1PCKA 2DP3A 3FJ6A 4NNBA 1VYSX 1TPB1 3LHVA 5A5WA 1I2PA 4O57A 1LORA 3R89A 1WXJA 5AC6A 1EIXA 3E49A 4P61A 5KSWA 4O0KA 1FY6A 1CX9A 5D05A 4N9DA 5BW6A 4O12A 3ZWSA 3G1VA 2NV1A 1TPFA 4O13A 1TPH1 3NAVA 1SU5A 2JK2A 1X1OA 2VEIA 3FA5A 4LT9A 1WQ5A 3QSRA 3FYOA 4LC6A 4HNTA 2J88A 1F76A 3UWZA 1OFBA 3QJAA 3CB8A 3T55A 1D9EA 3P80A 1KLZA 1XCFA 2JKAA 3TSMA 2E5BA 4TMBA 3TXZA 3H53A 1WX0A 4N6EA 4K38A 3TCEA 1ZENA 2E09A 4IJBA 2EPHA 1RV8A 1GTEA 4O14A 2Y89A 3LHZA 4UR7A 3BG5A 3FLUA 1IXQA 1DBTA 5K4ZA 4DPQA 3ZR4A 3QF0A 3VCRA 3CEUA 4BI6A 1NF0A 1QPOA 1RPXA 3DKJA 1Z42A 3L0KA 4UR8A 1VGAA 4EF9A 1AW2A 2YCEA 1OX6A 4NX0A 2VEPA 1OG0A 3E02A 4MZ1A 1HO1A 3QMRA 3GX9A 1DJQA 1GQNA 1FWNA 3NPUA 1LLZA 5FF0A 2YW3A 4TR9A 2VFIA 3DFSA 3MHFA 3S6DA 1A53A 2QCLA 2ZZ3A 4LY8A 2BXVA 5LHFA 4JYEA 1W5QA 2WSYA 4ZQOA 5EA9A 3UYCA 1ZAJA 5HULA 1ME7A 3C56A 1PCWA 3A23A 4JTIA 4UFIA 4IUOA 2ZCGA 3P67A 1SO4A 3W3OA 3NPVA 1OVDA 4YMZA 3BW3A 3FEMA 3KHJA 3N34A 3GKFA 2HSAA 2ZRUA 3PAJA 1JUKA 3MYPA 1SO3A 3EWXA 2YFNA 3LRMA 4ICNA 3MP3A 4RCXA 1G4TA 2NV2A 2CZ5A 1SQ7A 1TRDA 3TK7A 1XKYA 1Z44A 3LCIA 5CSSA 2HTMA 1SPQA 1T8XA 2B4GA 3TH6A 3WK0A 5HWNA 5C6MA 4CNNA 3O8AA 3M1ZA 2QCNA 1TIMA 3GKAA 4ORMA 1UUMA 1JJKA 5EYWA 4MY1A 4BI5A 4BF9A 3S0CA 3NQVA 1WOBA 1YDVA 1G67A 4AEOA 1T0OA 3B0UX 2Y61A 1KBIA 2DORA 3WK2A 2W0UA 4M5PA 2A4AA 4WOZA 2WOQA 1NVMA 4ZZ9A 2ISSA 3LRLA 3TDFA 2FPYA 1TCDA 2W79A 5AYYA 1PHQA 1H51A 2X1RA 1X8FA 1KM6A 3DFOA 3O6CA 5E1QA 1LTDA 5HUOA 4B5NA 4UFLA 2TYSA 2CZEA 3WJZA 1S5WA 4DO5A 4TO8A 5CZJA 3WK3A 1B3OA 1OFPA 3W2NA 3BVJA 3C3NA 2V5LA 3HBLA 3WJYA 3UY7A 4IPJA 4LVDA 1I2NA 1LM1A 5G2WA 4TMCA 1ME8A 2VFEA 4MIMA 3IIOA 4K39A 3IGXA 5CZSA 1GVSA 5AHMA 2X2GA 2QCHA 4Q33A 1IF2A 1KFCA 3BGJA 3LGEA 2Z0IA 1D3GA 2Q8LA 3ZS4A 4JX4A 1L9WA 4WJEA 2ZZ6A 5FI8A 3ATZA 2XFWA 3L68A 2QF7A 4ML9A 1Q45A 3KVJA 3S8HA 3HG5A 1EWEA 3B4UA 3Q58A 4GXMA 1QO2A 4ZMGA 3TSDA 1R47A 1JULA 3AO0A 3DU0A 4NVTA 5K3VA 3KRZA 2H8ZA 3GVGA 4X9SA 4DF2A 2OZ0A 1XC4A 2E68A 3HGRA 4RK8A 4UIOA 3H54A 4L4LA 4OT7A 3GAKA 4MLRA 3UPWA 5CPNA 1ZHAA 3RU6A 4A29A 3NZ1A 6TIMA 4JTJA 1ZCOA 2NXHA 3G1HA 4EWND 4XUGA 3TMQA 1TREA 4I7VA 4QJ1A 3ZWTA 5DBUA 3NQGA 3SR7A 4ADSA 2HS6A 1MSSA 3STEA 2C13A 4O1CA 3ABOA 2CW6A 1MEIA 5T26A 4DELA 1RZMA 4MYAA 3N9RA 1A50A 1NF7A 1F2JA 2FB2A 2JKEA 5LGXA 4MY8A 1P0KA 2NUWA 3W1PA 4HN4A 1K7XA 3BARA 1R2TA 3KVKA 4O0ZA 2P1FA 3GDKA 4M19A 3GDTA 4GC4A 5KMYA 2ZA2A 2FQIA 1H7RA 2ZTJA 3TFXA 3TNOA 3W1TA 3L21A 2DZSA 3W74A 4BI7A 3RFAA 1RD5A 4MJMA 4GUGA 1GTHA 2Y7FA 2E6DA 2CLOA 3NA8A 5D03A 1SFLA 1IIHA 3CPRA 2ZRVA 3G3MA 4M7SA 5A8GA 1W54A 1EP1A 2ZZ4A 2DZVA 3T40A 2TMDA 3F03K 1VCVA 4YWIA 2F84A 3O1NA 4CCCA 3TUUA 2FTPA 1TTPA 3W7EA 2PC4A 2GJLA 5FESA 4FX7A 2QUTA 5DY3A 4DO4A 2V8ZA 5E0KA 2QR6A 1C8VA 3G1AA 4QAIA 4MZYA 4IOTA 4K6AA 3TA6A 3W1UA 2E77A 4EVZA 8TIMA 1RQEA 3W2KA 3P8JA 1VR6A 4FIQA 3TU9A 3NXFA 4UFJA 1AW5A 5DELA 3KRSA 4Z08A 1W3TA 3C52A 2ATSA 4QISA 4UCGA 4DO6A 3MYOA 1ICSA 2BX7A 3FJLA 3C0JA 3W1LA 1VJIA 2WQPA 1FXQA 4LS0A 2G5WA 2RDTA 3P74A 3NM3A 1FDYA 2XN1A 1N55A 3EWYA 3GNNA 4UTHA 3BG3A 3I65A 2WNQA 1SO6A 2J6XA 1YXDA 2H3DA 4UNLA 4X2RA 4FHAA 1YDOA 5FEWA 2Y70A 3E96A 4TX9A 3IIVA 3L5AA 1WBJA 1F6KA 1LCOA 1HUVA 3GB6A 3HG2A 1LOQA 1N8FA 1OYBA 5ABTA 3VI2A 5DN1A 4KFPA 4NJKA 3ABRA 4QQ3A 3W72A 4YCPA 1QPQA 4MLJA 1NAL1 1ZJIA 4LC8A 1TPWA 1OFRA 4Q4KA 2QAPA 3T78A 3UXAA 2DZWA 4FNPA 4E0CA 2RKXA 3P8IA 4C1KA 4JTKA 3W70A 1GPWA 3SSJA 4LOCA 1R30A 3O6DA 1SW3A 4JTHA 3ANYA 2DU2A 3P84A 4WX2A 4D2JA 1S5TA 1LDCA 1O95A 2GQAA 2J24A 3KX6A 2NX9A 3PBUA 3S1XA 2Q3RA 4R7JA 4XBKA 1KFKA 4CLMA 1OF8A 4UMCA 3IVSA 1RR2A 3EX4A 4P2VA 1H7NA 2X1TA 3U6WA 1UB3A 3P60A 1XI3A 1S5VA 3S1VA 2C18A 1IXPA 2G95A 1A5AA 4QIUA 1SFJA 5G4WA 1ZNNA 3QH2A 1W3NA 2B7OA 2WJZA 1KFBA 2FJKA 1HL2A 3EEGA 1ZAIA 4FEZA 2C0AA 1OX5A 5D04C 4NQ1A 1YXCA 3C2RA 3THQA 4JD4A 4OU1A 1WYIA 4RX0A 1LYXA 1QOPA 4IXXA 3UY8A 5AHNA 3TQVA 3QC3A 2PURA 4YL2A 4QNEA 3UWWA 4BK9A 3DXIA 3I68A 1X6UA 1OFQA 1TPEA 2WSQA 4LNYA 1W5PA 4IMGA 2JKPA 1TTQA 4AHOA 4CQ9A 5DXYA 3T7VA 3G1DA 2RFGA 2YZRA 2V5BA 1SZGA 5IBXA 1G6CA 1T96A 3M43A 4POCA 4ALDA 1RQBA 3L66A 3EXRA 4JR5A 5AC7A 4NXSA 5EMUA 4K8EA 1XFBA 2FFCA 5MHBA 2NWSA 3B04A 3BV4A 3G8EA 1I45A 3W71A 3H55A 3AJXA 3P82A 4JTSA 3PULA 2QAFA 1C29A 3NEVA 3TAKA 3W1AA 1F6PA 4Y6GA 3EX1A 3FS2A 1K8ZA 3GDLA 3PG8A 3P5ZA 1KV5A 4XQ6A 1FX6A 4Y90A 2YXGA 3NO5A 1W31A 3NGJA 4KKXA 3EX6A 5G4EA 4UXDA 3B8DA 4PEKA 1JCJA 5EKYA 4UTWC 3LERA 4WZHA 4YLWA 2C16A 4O11A 3W1QA 1LBFA 3EXTA 4A2RA 4CNOA 1XBXA 5I3IA 2VC6A 4N9BA 4Y8FA 2OJPA 4JTEA 4NT0A 4PFMA 3G1FA 2GVGA 5LNVA 1QMLA 4OE7A 4H4IA 4X3ZA 1FQ0A 2VOMA 3UZ5A 1SUXA 2V2HA 3MI6A 4LV4A 5AFDA 5D02A 3PWAA 4LS2A 3HPZA 2J9ZA 3P7YA 3NQDA 3PBVA 2ALDA 2X30A 3UNDA 4MPQA 3UD6A 3HB9A 2QUVA 3EB2A 5L6UA 1O94A 3PG9A 2H6RA 2I14A 4X22A 4PC8A 4A21A 3HMJG 4DPPA 3M16A 3E9AA 3L0NA 1OX4A 3SGZA 4GUIA 4O18A 1AW1A 4NJIA 4GJ1A 2X16A 3NL3A 3THAA 1D3HA 3IGUA 3PF3A 4PA8A 4JY8A 3W7CA 3L2IA 4NNCA 2E1DA 3O63A 4M7TA 3PVFA 1I2OA 5I3GA 5LNUA 4N02A 5AC8A 5K2ZA 3NG3A 1OK4A 3KVMA 4N9EA 1QCWA 4OHQA 3W7MA 1H1YA 4NNAA 4LWWA 2FIQA 4O1BA 1X7FA 4JTUA 4GUFA 3JS3A 3UZJA 3FKRA 1Q3NA 3QYQA 4N6FA 1H7WA 5LSMA 3INPA 2Y88A 3O05A 2GPTA 1KBJA 1VQTA
chains in the Genus database with same CATH superfamily
3WX7A 1GQJA 1QPKA 2DZPA 4O4WA 3M0ZA 4GYFA 2R1LA 2WMKA 1DXFA 2HK0A 5HQMA 3EKLA 4L4MA 1GVOA 1CIUA 3II1A 2X42A 3W83A 2CHNA 4UTTA 2O0TA 3M0XA 3W9ZA 1OX4B 1EPXA 1M03A 3H23A 1G7UA 3ABZA 4LW7A 4HCDA 4R9XA 4O1EA 3APTA 3B0PA 3W88A 4E3TA 3AXXA 1DE6A 2OQLA 3FA3A 4K1WA 1W56A 3MCMA 3PHAA 5F2IA 5FJPA 2QYGA 2OKOA 5A6AA 4U5KA 3LNMA 3RPTA 3A21A 1PS9A 4RPPA 2YL8A 4JIIX 1KBLA 1DXEA 4KCWA 4GJJA 4S3GA 3W7KA 4HNUA 5JH2A 2YR1A 4OQVA 5HUPA 3ONBA 3KFTA 4ZFCA 4Q8QA 1UWUA 3OU8A 4DHGA 3QRHA 3EMZA 4TX6A 1I2RA 2ZUMA 4HA4A 3VFLA 2DT2A 2PDLA 3BOXA 1OYCA 4IIGA 3AYSA 4BFAA 1SR9A 2OU4A 3PSWA 1DPMA 5GQBA 4IL2A 2NXGA 2Z2UA 4J3WA 1RY8A 4RNJA 1QW9A 6PTDA 3MWAA 4JTFA 5EGRA 1OEPA 2P5NA 3CBWA 4IICA 1EJRC 3GWQA 5IM51 4CQ8A 5A1AA 2AAMA 3GVVA 2AL2A 3GIQA 4AIUA 3SSZA 3P6LA 2RH9A 2DZUA 4LF1A 1WZAA 3RRAA 3S42A 4WHBA 3W22A 1PL9A 4YHGA 1H5YA 1K77A 1Q6LA 1N7KA 4HBKA 4DAIA 3GW0A 3A9BA 3WQ8A 5HPOA 1V3LA 1UD2A 4LUJA 4PRRA 5EY5A 3GXFA 3AICA 3WKZA 4HA1A 4HGXA 3RLGA 3UA3A 1CNVA 3PBMA 3W82A 4BWLA 2EPNA 1O68A 3B9EA 1PIIA 2Y7EA 2G3IA 1OZMA 4JFTA 2VWTA 1JZ4A 4UTLA 1TQJA 5FF7A 4V2XA 1SVDA 5E9AA 1JPDX 4JHZA 4DWSC 4O54A 3I7QA 1EL3A 3EKZA 1OJXA 1P0NA 1Z48A 4DJEC 1HO4A 1TJ2A 3B8VA 4S1FA 1S2VA 1XM3A 5F4XA 1CW2A 4NZFA 3THUA 4IIHA 3HPXA 5LZLA 3RX3A 5JIPA 1NFBA 2NVDA 2GUUA 3S9IA 2IPGA 3WF3A 1H3GA 3WF2A 2GQ8A 2YLAA 3SECA 5I09A 4UTJA 1V5XA 3GDRA 3OVRA 1DHPA 2G41A 1S2UA 2JBMA 3RAOA 4J40A 4ONVA 2YXOA 5FEPA 1EXPA 1K6WA 5I7GA 4RZ5A 3OA5A 2J75A 3CZJA 3PB0A 1XIGA 2VC5A 1OB0A 3BANA 1JYXA 1K8YA 3GYEA 4P7NA 4HP5A 5C9RA 3BAXA 1JUBA 3BCDA 1NP2A 4MJZA 2WSKA 1TR9A 5IBXC 3R79A 1Q6RA 2Y8KA 3VD4A 3I10A 4KPLA 3W7DA 1QWGA 5HJYA 4H8HA 2ZE0A 2YB1A 5LIKX 4J9JA 4XIAA 3Q65A 1AQ0A 2YFOA 4N2YA 2V30A 3TX9A 4QXIA 1DJXA 1LWJA 3L12A 4QG6A 3V4BA 1H60A 2XGZA 2PBGA 1EA0A 2Y5SA 4C6CA 5DCEA 2C0HA 3S1GA 1LQ2A 4LSBA 2VR2A 3WN6A 1QDSA 2R91A 1BAGA 1XL9A 2GJNA 4H6KA 2QF8A 4JDYA 4DRSA 5GNYA 1GG0A 2YLLA 2ICSA 4PCNA 1JDEA 3RM8A 1JCXA 3XISA 4H3DA 1K3UA 1US3A 1O6IA 5G5IA 3V18A 2CWXA 3IJ8A 3BJSA 3LTYA 1IXOA 3MZ2A 1IHIA 1KXVA 4QROA 2V3FA 2VL4A 5A2BA 1N2VA 3OW1A 1J0IA 4RUBA 3W2LA 4A3UA 1BKHA 3TTYA 1E40A 4BF7A 4B5UA 1EGZA 2AMXA 3IRSA 3RU8X 3W26A 3VCNA 1F05A 3V0TA 4NHVA 4NASA 1B5TA 3A4JA 3LI0A 2VFGA 3A4XA 3DUGA 3GU2A 3W1RA 3NSMA 1XIDA 1TJPA 2YPIA 3L0GA 4EAMA 2BG5A 3UZWA 5AZ0A 2EPOA 3FDKA 1R46A 4ENLA 4M29A 1JF6A 4Q3MA 3AHVA 4ZQPA 2RGLA 4Z1CA 4JTRA 4LCSA 1VRDA 3M44A 4KWVA 2PTYA 2PODA 4ACYA 1JZ3A 3DECA 4M56A 2BP1A 2PTZA 4Z1DA 4JL1A 3IACA 5I02A 3GH7A 4FR1A 1UWIA 1WXYA 3V0SA 2XN2A 1HTIA 1QASA 1PX8A 4KWOA 2PDKA 1CWYA 3LCHA 3QV6A 3VC6A 3KBWA 3DESA 3WH5A 1J12A 3C8NA 3NPWA 1DJGA 4AWSA 3OJGA 4GJIA 5T8GA 5KINA 2YCKX 3CQHA 2XGBA 3HJZA 3ES8A 3GXPA 1J01A 3TW7A 1XH1A 3M0HA 5G1TA 2WPBA 3S9YA 1FA2A 2UY2A 2VJXA 3TIMA 3BG9A 3M0IA 5GJPA 5H91A 3PJXA 3AIVA 2YSWA 1M65A 2E9MA 4K8HA 2IXVA 1FWDC 2Y24A 2JQXA 4AIEA 4GQGA 4HNCA 1EF3A 2PWVA 2QJNA 3BDKA 3N13A 4NAEA 4OGZA 1WKYA 2VEMA 1E6XM 3QTGA 1RH9A 2H8XA 4C6KA 2ZUWA 1EOKA 1DQWA 4B16A 4WOQA 4WSKA 4C6QA 2OT1A 1JF5A 3KTSA 5F1VA 1CCWB 1VLWA 4QDWA 4DWDA 4LBRA 2ZRWA 3I4EA 4AVOA 4IMDA 1C91A 4U28A 4IGHA 3UR7A 2YW4A 3VKBA 5LIXX 3MP4A 4QM1A 1ONEA 3W7OA 4FNRA 1SJCA 1ISZA 1G4PA 4DNHA 1GKPA 4DF1A 1GQKA 2OODA 1BSIA 5A69A 1Z69A 2GJRA 1J93A 1K02A 2VWSA 3N73A 2VD8A 3RR4A 3PZNA 3ARRA 5D2WA 2XFRA 3ZSTA 4PULA 1KTBA 4JNYA 1FBAA 3HGSA 3NFUA 4UTMA 4P8VA 3B06A 2HNHA 3H22A 3O0KA 4NAEB 3GNRA 5EMJA 4JHMA 3UWVA 5HMEA 1X38A 2DFAA 2FHCA 3GTFA 4MKNA 2F2HA 1KB3A 3HG4A 4Q32A 4JTAA 4OJYA 2WBGA 4QEHA 3MVTA 4S2CA 2QCMA 1HKMA 4HSNA 4E2OA 2FJUB 1WZMA 1DWIM 2C71A 1JL8A 4K1GA 5AB3A 3PM6A 3QOKA 4WY0A 4Y9OA 2PB1A 3GUWA 3AUOA 2WNWA 3BMWA 2ZDRA 4ERIA 4GBUA 4HSHA 2J6VA 2HVMA 3NOEA 3TJLA 1RSCA 2INFA 2UBPC 1NFGA 1QO5A 2J79A 1H7PA 3TFCA 1JCLA 3CK5A 2YA0A 2ZUNA 1GYNA 4JEQA 1ENUA 2BV9A 1SZEA 6TAAA 2QIWA 5REQA 1XG4A 4F66A 3EDKA 3CZLA 3MI3A 4UB9A 3OGVA 3W24A 3N2XA 4HYRA 3OYZA 4ATLA 1TKKA 4IZGA 1NP0A 3R5EA 4Q4PA 2A7PA 4NL1A 2NQZA 2UY4A 1PAMA 1JCNA 3QW3A 5M2FX 3UCDA 1PBGA 3WCZA 1EUNA 3CC1A 5AHLA 2W62A 1FWRA 5I5RA 1ZGDA 4WY0B 2HV5A 1OM0A 1XDMA 3VIJA 3SN1A 4TU1A 1KNWA 4R53A 1KFEA 3EA1A 4C6DA 4JYDA 4TUFA 1YXYA 4UZUA 4EE9A 3MBDA 3ORWA 4US5D 1MI3A 1Y5WA 1R9YA 4PSRA 4O1FA 3WLPA 4ICCX 1LG1A 1WB0A 1UH4A 1VCFA 1XH0A 1QPRA 1PSCA 2VX6A 4S3CA 5REQB 3VIMA 3LUTA 1FWEC 3MCOA 3F4NA 1HKJA 3WLNA 4C6NA 3QFEA 3L9CA 4JN6A 3C8FA 4TVDA 4GQBA 5IFTA 1PVNA 3VIKA 2O7QA 3HF3A 3ZVIA 4OBTA 1LF1A 1ZCCA 4CCZA 4RDVA 4O8RA 5BXPA 5D2YA 3ZJ6A 2G3NA 4I7WA 1EDQA 4UQCA 3AZTA 4Q8NA 1E9IA 3EWUA 1YEYA 3WDHA 4GZ7A 3M9YA 2EG8A 3LSCA 3TN3A 5CPLA 2ZC1A 2OOFA 4GUHA 4LAOA 3SO7A 4L5ZA 3RN6A 1MXSA 2OELA 5C8BB 4HZ6A 2D2GA 4J3SA 4TQTA 3U5UA 3KVLA 3MMTA 2HROA 3GDBA 3WFLA 3J7HA 1TMHA 4W8LA 4HOZA 1BKSA 3VDGA 3A64A 3CTLA 2IPWA 5LA0A 2VVSA 4JFSA 1V3KA 3E0LA 4AAJA 2QGHA 1AZ2A 3TE9A 3HFTA 2OFJA 3A3XA 2XSBA 1UJQA 3LNPA 1IE7C 1D3CA 1WXZA 1MEWA 1UZ1A 3FKKA 4JY9A 4LTSA 4GX9A 5FKYA 1BWKA 4GVGA 3TJ4A 2OWXA 3PANA 4F0MA 5CKSA 1KM5A 2WHLA 5D09A 1SJAA 3GLCA 2CZFA 5MKGA 3LMZA 3F4VA 3RPMA 4J3TA 1UD5A 3COTA 1N82A 3VOIA 3WQWA 4C1NA 2XIIA 4H01A 3PUDA 4GYKA 4DYJA 2OVLA 3HIJA 1Q13A 5XIAA 1AH3A 1RVKA 1Z9AA 4PMXA 1WV2A 3EMCA 1MNZA 3PFMA 4LANA 3RM9A 4LVAA 1DJZA 2YGYA 3GG1A 1V3JA 1VP5A 3W75A 8XIMA 3CASA 3E1F1 5FAJA 3UR8A 5HMSA 1W32A 3PY2A 4U3AA 2XINA 3I6RA 3IJDA 1F3TA 4I5XA 1B30A 2D2JA 3U2OA 1THFD 2WNZA 3N2CA 1J18A 4HK5A 4M6VA 1CGTA 2DEPA 2HISA 3GDMA 3OVQA 3RX4A 4AHQA 3F4DA 3AFBA 1HJXA 4XWUA 1JDDA 2EPMX 2C6QA 5MKGB 3WLMA 4KW2A 2JF7A 3LV5A 4S3JA 3NVDA 1EQCA 1I60A 3IIXA 3CV2A 4DJFD 4C1NB 1UKSA 3B9NA 2G37A 4H6QA 1RK6A 1YLVA 3RO8A 5DLCA 1XBVA 2QPUA 4HHMA 4MMWA 4R9OA 3SADA 4KIRA 2A3LA 3RLVA 1TR1A 4FX8A 2I16A 4L7ZA 3BWWA 4QRNA 2WK2A 3VDAA 3CXOA 2ZFAA 1GOMA 3VKDA 1ZJHA 1DIEA 5DX7A 5HA7A 1GKRA 4A22A 3QVQA 1OHLA 1X6NA 1JRCA 1SW7A 4DF0A 1KM3A 1SJDA 4PMZA 2CWNA 4JFWA 3GXTA 4PB5A 1K9TA 3A22A 4XAPA 3AXIA 2OX4A 5CGTA 4EOUA 4IF2A 4QE1A 1OK6A 4L1XA 3TQKA 3GNDA 2WB5A 3CQKA 2J74A 3P62A 3UZYA 2XM2A 1KCKA 1H7XA 4JTDA 3AHYA 5C9XA 1E1CA 2PP3A 3V36A 2E6YA 1HJVA 1XSJA 4PN2A 1GZJA 4EIVA 3SFKA 5JVLA 4U4MA 1NEYA 3VKAA 3STGA 3CQ0A 1PWLA 4AW7A 5FJOA 2Z1SA 3C2VA 3N29A 1NWTA 2OEKA 1GT8A 2ABAA 3I7RA 1OFEA 2I17A 2QJGA 1CLKA 1V6YA 1E0UA 3LA4A 1WCGA 1NOWA 1YX1A 3LN3A 1PX4A 3G1XA 1F73A 4C6FA 4HHPA 1HFBA 1FWCC 5HATA 2FVLA 5CZ0A 5HR6A 1VCGA 5LHEA 4OWGA 3A6OA 1W1ZA 4MTVA 1TVLA 3W7JA 2XIBA 2XHYA 2FMNA 4UTFA 3PZMA 1XIHA 4AXNA 1CT5A 4UMBA 3WF0A 1YTEA 3OODA 3FYPA 4V33A 1E1CB 5DXXA 4JICA 2XUCA 3RXZA 3KP1A 4UOZA 5J5RA 4R7OA 3CAQA 3UNTA 4N7QA 1E51A 3STCA 3UPBA 3H6OA 2EG6A 4GCXA 2HCVA 5E70A 4A3HA 1VFOA 3FJ6A 3VGDA 4NNBA 2DSZA 3WQDA 1TPB1 4HYWA 4C90A 5DFAA 4GIEA 4GOAA 1R5YA 5KSWA 4O0KA 5JUVA 3NO1A 1UKTA 1L6GA 4BKNA 2W4XA 3VOCA 3QZ6A 2PDHA 4I9TA 3G1VA 3I3EA 2NV1A 3SRKA 4ZE5A 4XVDA 2JEPA 1SU5A 2IS7A 1TWSA 1PKLA 3AMKA 3CB8A 4E4UA 3B8UA 3P80A 1XCFA 3ARUA 2BFGA 1UR2A 4UQ9A 3TSMA 1EZ2A 3TXZA 3RCNA 1XFCA 1WX0A 3H53A 3BLDA 3TCEA 2E09A 2EPHA 3MA8A 1J11A 1FWGC 2PGEA 3BG5A 3FLUA 1IXQA 1DBTA 1QOXA 2Z00A 4HN8A 4XZNX 1BPLB 4CU6A 3CEUA 2X0SA 4BI6A 1QATA 1RJRA 3DKJA 4UR8A 1E9ZB 1L6FA 5A2CA 1MW2A 3E02A 4JCMA 1HO1A 2XM1A 4ZXLA 5I77A 5GNXA 2YW3A 2Q01A 3DFSA 1X96A 4KEMA 2ZZ3A 4LY8A 5LHFA 4YPJA 8XIAA 3LPPA 5HULA 1ME7A 2PP1A 3P0WA 3U9IA 3C56A 1PCWA 5GJNA 3A23A 4DLMA 3HV9A 3P67A 1SO4A 3NPVA 1OVDA 3VGFA 4GABA 3CQJA 4L9YA 3MSRA 3TLQA 3ITYA 3N9KA 3BV7A 3W00A 1AFSA 1E71M 4CNTA 1SO3A 3NEHA 3EWCA 2GDUA 3OGRA 2JALA 2NLYA 3BC9A 2VRKA 1FWAC 4QLJA 1XKYA 3LCIA 2O4MA 3T2QA 3K8KA 3FK4A 3WK0A 3M1ZA 2QCNA 3E6EA 4DX3A 3WMCA 2B81A 2P53A 5EYWA 3IJ9A 2WMIA 1ISXA 1BSLA 3OZOA 3WL0A 3JW7A 1RLCL 3B0UX 2W0UA 4M5PA 1NVMA 2PZNA 4S23A 1YDYA 4M24A 2W79A 1ZBCA 2GVYA 4GHRA 1X8FA 1AD4A 1KM6A 3VKCA 1W9XA 4HZ7A 5HUOA 4B5NA 3VGHA 5FSDC 3TTOA 2X7WA 5CZJA 4RNIA 2OSXA 2F6UA 3HBLA 4ZO6A 2C79A 5GJMA 5DMMA 4ZB0A 1PKNA 2IMRA 3SUVA 4LVDA 4MIMA 5CZSA 2CBJA 5AHMA 3NQBA 5BU6A 1KRBC 3NDZA 2QCHA 1LQ0A 3AAMA 1Q6GA 3VOGA 4NZCA 1V03A 2E40A 4Z2IA 3ZS4A 4JX4A 2GGGA 5CCZA 2WMIB 3RO6A 4KBXA 3WY1A 4ML9A 1Q45A 3KVJA 3URBA 3HG5A 3Q58A 4PBGA 1D7FA 5A6BA 3BE7A 1E4MM 2HPMA 5K3VA 2D3NA 2H8ZA 4DF2A 2E68A 1S5MA 3RCYA 3WQVA 1C7TA 3H54A 1JGMA 2HVOA 1PTDA 3BJFA 2INEA 4HU4A 4OBRA 2FZ9A 1CXIA 1MDLA 4EWND 4XUGA 3TMQA 4A3QA 4IPLA 3XINA 1US0A 5DBUA 5I2UA 5LXXA 3SR7A 4ADSA 1EJWC 1XRTA 1MSSA 3QR0A 5T26A 1JDCA 4JHOA 3F2BA 3IARA 4GKLA 4C6BA 4ZB5A 4JKLA 2FVKA 4AC7C 3KL3A 1IZJA 4O0ZA 1R2TA 2P1FA 4M19A 1UR1A 5KMYA 1FP9A 2ZA2A 6CGTA 1DJWA 2Z28A 2ZTJA 3W1TA 3L21A 3W74A 3KBJA 4BI7A 3RFAA 4M80A 4L4PA 1GTHA 1XYZA 5D03A 3CPRA 2ZRVA 3G3MA 3HPFA 3SDOA 4EP8C 3AWNA 2E7FA 4E8GA 3L2LA 1GORA 2TMDA 3UYIA 3GTXA 2F84A 4M81A 3TUUA 1TTPA 3W7EA 4DN1A 4FX7A 4JFVA 5DY3A 4IPPA 3OBAA 3LMYA 4MWAE 4PZVA 5E0KA 4QAIA 1EJUC 2VDHA 7TAAA 1Q65A 3U3HA 4AZBA 4EVZA 1RQEA 1Z8AA 3P8JA 3N4AA 1A0DA 1AW5A 5DELA 2HVNA 4QISA 4UCGA 2YL6A 1ICSA 1CENA 5FL1A 3TYZA 2XSAA 3RRXA 4AY7A 3N6JA 3BH4A 4PUDA 4LS0A 2NW0A 3P74A 3NM3A 2VX7A 3WZ0E 1TX0A 2IKIA 3ITTA 4W85A 4FHAA 4GCAA 5AC4A 4WR3A 3ITOA 2AOSA 4TX9A 3L5AA 2IQDA 3RJXA 1LCOA 5CG0A 3KBSA 4GMEA 1R3YA 4ZBCA 2WVVA 4C6JA 3VI2A 2BXZA 1XYMA 4NJKA 4AWEA 2E25A 4H6EA 3BLLA 3I3BA 4P7QA 1T40A 2XYLA 5H1WA 4IMAA 3SCQA 2OQHA 3T78A 1SFTA 3P8IA 4FR6A 3O6DA 4ICMA 4WX2A 4D2JA 1S5TA 5CJ5A 1P6BA 4AZ6A 3GC2A 3M0YA 4GACA 4AD2A 3OZPA 3S1XA 1GNXA 2Q3RA 3TVAA 4J3UA 4XBKA 4ZSTA 4OUEA 1OF8A 3IVSA 4GD0A 5I00A 3EX4A 1V6TA 3GC4A 3U6WA 1UB3A 1XYCA 1MDRA 1XI3A 2Y8VA 3AALA 5IRPA 4BQ2A 3S1VA 4GGBA 1MXGA 3V7PA 3WH7A 1UWSA 2WVUA 5G4WA 1QRQA 4IJRA 5HANA 2WVVB 1W1B1 4W86A 1O5QA 3WUFA 4CQBA 4B5TA 1OX5A 5C0QA 1YXCA 4JD4A 4RX0A 4DB7A 1HKVA 3KLLA 5AHNA 3TQVA 2PURA 3UWWA 4BK9A 4ATWA 1JPHA 3DG3A 2CBIA 2OLSA 1MRAA 1OFQA 4LNYA 2XIMA 3VU2A 4IMGA 2Z7KA 3T0DA 3T7VA 3KCOA 1SZGA 5IBXA 1DP0A 1G6CA 3M43A 4IP4A 1UPPA 5I06A 4LB4A 4GI8A 1XJBA 2J4GA 5MHBA 3BV4A 3G8EA 1I45A 1FHLA 5ABGA 1C29A 3CPGA 2FTWA 1F6PA 4Y6GA 4HMEA 1KV5A 3VX0A 4XQ6A 1V6UA 1FX6A 3CNYA 4Y90A 3NO5A 3ARZA 3VD3A 4KKXA 4UXDA 3BXWA 4JNZA 3WD2A 3VNJA 3V0UA 3MV01 3L4WA 1N8WA 4B3KA 4N9BA 4H9VA 4PTMA 4ZEPA 1AJ2A 3D46A 2VOMA 4H83A 2V2HA 3NURA 4MNMA 1CTNA 2XVPA 2HXTA 3P7YA 3NQDA 4HNLA 3VINA 2ALDA 1W17A 3UD6A 2QUVA 2V3EA 2H6RA 4IIBA 4PC8A 3HMJG 4DPPA 3M16A 1V93A 4QTGA 4GUIA 3U4AA 2XZ7A 2P8CA 1AW1A 4N42A 2DT0A 3NL3A 1LQAA 4J4KA 3IGUA 3PF3A 1Q4WA 2J7FA 2EXOA 1XLHA 3TN4A 1POJA 4HPGA 4PTVA 3L2IA 1I0BA 1BYCA 3KL5A 3FJ4A 1I2OA 2JIEA 4D8LA 1OK4A 3KVMA 1QCWA 1B9ZA 2DVTA 4J27A 1W3LA 3W7MA 1F3EA 1H1YA 1UWRA 4JTUA 4GUFA 2XSXA 3MTWA 3WNKA 1CGYA 2XVLA 2G8ZA 3AZRA 1KBJA 3NZGA 3DYMA 1EHAA 3NQMA 4FNUA 1AH4A 4XVEA 3KOYA 5G2IA 3WQCA 3NOYA 3WF4A 3MDUA 1J96A 2PWFA 3ERPA 3HPAA 2B7QA 5CPMA 1CXEA 3RLUA 2DH3A 4Z2KA 3KL0A 4V1YA 1OT1A 3W2MA 1R85A 3RITA 3VM5A 1QVBA 3NM1A 2P8BA 3WNOA 1J2WA 2HBXA 1LP6A 2FZ8A 1FWTA 1DORA 3MUY1 4KCTA 1KA9F 3TROA 3KHDA 4DM1A 3LLFA 3W23A 4UR9A 1UA7A 3MHGA 5FJUA 1B3XA 1EBGA 2VFHA 4ZB2A 3N19B 3VUPA 5FJTA 3BGAA 3IGHX 4F4RA 1PDZA 5HOSA 4AZGA 4DYEA 1HVQA 4DXVA 2ZDSA 3UJSA 3QMTA 2UY3A 3GK0A 3PBYA 1MUCA 5HWJA 2GYIA 1GVIA 3WH8A 1C8QA 1HG3A 3A9IA 1HL8A 4O1AA 3FN9A 1FHVA 1JAEA 1IWAA 1WPCA 5F2GA 1VEPA 4AMAA 3F2CA 4RXGA 4MWAC 5C2XA 1YPXA 1EWDA 4EK7A 3GBDA 1XLCA 2WMFA 3S46A 2OG9A 2BY3A 3H7UA 2C19A 5I3KA 4Z1YA 4GVFA 1EJXC 1ZPTA 2BGSA 3WLLA 1E4IA 1JR1A 1E55A 1TSIA 3GC5A 2C1GA 1XLGA 3TOPA 4KCVA 4INFA 4DQWA 3CUIA 1D2KA 3QMSA 2C91A 1R3TA 6ALDA 2DJLA 3VD9A 3FXYA 3LY0A 4IMFA 3R6IA 4CCDA 3SGUA 1GOXA 3HOJA 3CUXA 3KDNA 3W7IA 1E0VA 1F4HA 1VRXA 2PF0A 4YJ5A 3VNLA 3DN5A 3PFRA 4C5ZA 4ATDA 3OOQA 1DQXA 4CD8A 4XB3A 5I24A 3UBPC 2CPUA 1CXFA 2CZVA 4Z0JA 3SUWA 2QPXA 1KM1A 4GE8A 3LXCA 2F8QA 4IH3A 3T2OA 1IZKA 3PUEA 3MU7A 1WKDA 2ACSA 1JZ6A 3WLSA 1UA3A 3SB0A 2CESA 1ODUA 3VIGA 3H12A 3W2JA 5LA1A 1BHGA 1EC9A 3ELFA 3HMCA 3KCLA 5EB8A 1FUYA 3O9NA 1GVRA 3NQ8A 1PYFA 3WUGA 4F2BA 1XGZA 3REQA 2ZX9A 4AWTA 4PCFA 1RJPA 3EX3A 2Z1KA 1C90A 3S6TA 3CB3A 3KP0A 5AHIA 3G1YA 1FCVA 1IIGA 2V2DA 4ACZA 4YXGA 2O4QA 3W29A 3CV6A 1J79A 2NXIA 1GUVA 1AMKA 3IAPA 2OLAA 2G96A 4K68A 2VRJA 2GVLA 5G4HC 1G4EA 1K7FA 3QR3A 1Q2SA 1ZALA 4FI4A 5CGQA 3S1WA 1ZUAX 2WZIA 1VF8A 1G1YA 1UH3A 3C0SA 5HWMA 5CLWA 1BVZA 2OMAA 4KESA 3EDJA 4C7FA 1UD3A 3UP8A 3QM3A 2W63A 1HIZA 3SIZA 3F5LA 4WGXA 1DJYA 3CS2A 4CVUA 5GVJA 3JZUA 3C4UA 1IZCA 2Z2BA 4TIMA 1V02E 2O9OA 5C54A 3S5OA 1Q4NX 3REQB 5E5CA 5AHFA 2GGEA 2Z26A 2V0TA 3VC5A 5CPOA 4L6DA 1T6MA 2ZX6A 2TSYA 2J25A 1XISA 1TZ9A 3WFZA 4ACZB 5SWUA 1L2QA 4IT1A 4DWSD 3POCA 5FEZA 4DJED 3U8GA 1W1IE 1LJYA 4PMRA 2CHOA 3OLDA 4O53A 5BMWA 3N2BA 5BRBA 5JBDA 2QJIA 3VNYA 1SW0A 2C15A 3EAUA 3K1GA 3N3MA 2PDJA 4WQ6A 4YNGA 4EWJA 4FP1A 1M7OA 5FF4A 2Y63A 1B3ZA 5BOOA 3IWPA 4Y7EA 2Y6ZA 3ES7A 3PZUA 3CHDA 2ODOA 3CWNA 1A5MC 5D9NA 2X0HA 2FGLA 1XLFA 4UTIA 4ILSA 2DZBA 4AH7A 1MQPA 4LS1A 4ZL1A 3EOLA 2QMJA 3N6QA 4KEZA 1BD0A 4H9YA 5G2HA 3E0VA 4A8IA 1ITUA 2H9AA 1H41A 3HA1A 2KZHA 3UZXA 1AG1O 7REQA 1GYLA 3EGJA 4L56A 3VYLA 2VGFA 4D6FA 2YZ5A 4GXWA 3N9SA 2D2HA 5DANA 4UQAA 1YTKA 2PU1A 3IJ6A 5LIWX 4PMVA 4UQEA 3GNOA 2WKJA 4AISA 2GSJA 1MEHA 3BUVA 3PJWA 4OV9A 1JZ2A 4W8BA 5HAOA 3SCVA 3VILA 3POHA 3E2QA 3R13A 1E15A 2X41A 1LWHA 3OIXA 4CQCA 3D6NA 2PDWA 4F0HA 3VM7A 1ESWA 2HMCA 2JGQA 4QSHA 1OGGA 4J3VA 3R12A 3LBCA 3JRKA 1EX5A 3OBEA 1U1HA 3TSBA 4JIRA 1MUMA 2VENA 3TYUA 3ARXA 2H9AB 2PU0A 4RE4A 3V5CA 2E9LA 1BXCA 5DEZA 1QOQA 3WJXA 2WZMA 2HNEA 4AEFA 3LQGA 3NZRA 2EPKX 1S3TC 7REQB 2PDYA 2QVHA 3HURA 3QPZA 1U22A 4IXHA 1U5JA 3TN5A 1PE1A 2W66A 3LZ5A 4PR4A 3BCJA 3SN0A 2EKCA 3WLQA 2P3ZA 2V3DA 3UQNA 1CPUA 1SZFA 1A0CA 4FXSA 3U48A 2BLEA 4REQB 1JUEA 1TUFA 2CLKA 2QQ6A 1GVQA 2WC3A 3W73A 1R2RA 3N4FA 3IRDA 3SN4A 3T05A 3IGSA 5CBBA 2EJAA 1UWAA 1W5MA 1HT6A 2OGJA 2GQ9A 1TZ7A 1GHSA 1IWBA 1MFVA 3G3DA 5BYWA 2WQDA 3SQMA 3OLEA 4O4VA 2NSXA 2TAAA 3BQ6A 3UXDA 1TV7A 1NDVA 1GZGA 4E4FA 1A5CA 2OEJA 1KD0A 1VPXA 4MB5A 2V6AA 4A35A 4AZ5A 5I78A 1K9EA 1ZLPA 3RJYA 2WWDA 4DJDA 7TIMA 3MI2A 3SEPA 5XINA 1Z41A 3DEQA 1TWWA 3VZXA 2YB4A 5AYBA 3AIBA 3M47A 4LRTA 1LROA 3WQEA 3UR5A 4L6HA 2QCGA 5I23A 2Y85A 3H2NA 2Q6ZA 4AYSA 3Q37A 5RUBA 3PTDA 1FWSA 3T4CA 2AAAA 1GJUA 2ZWZA 1BRLA 1T41A 3WJSA 1EYWA 5TIMA 3V1HA 3ANUA 3KXQA 3CUFA 2OCZA 3BL3A 3IANA 4YCOA 4DZ5A 4D8AA 1UH2A 5DCDA 2BTMA 4WLCA 4GBDA 3UJEA 2WNNA 3P3BA 1KC7A 4KEUA 4ZQNA 4GLEA 4BEUA 4WJ8A 3RDKA 1VZWA 1T99A 1L8PA 3TOYA 1H1NA 1V77A 1YADA 5JBEA 1HVXA 3PR2A 3L5MA 5CG7A 1P1XA 3LPFA 1WDWA 2XGIA 5D38A 3MMWA 3DH7A 1IV8A 2WVSA 4MZ8A 4DAFA 1IYXA 1S2TA 3CQIA 4I8YA 4YN5A 3GTNA 4MUPA 4FNTA 1QU4A 3PSVA 3BLKA 3PBGA 3K30A 2OX1A 3WF1A 2PUZA 2J13A 4FXRA 4NX5A 1SO5A 1E70M 5U4NA 3G6LA 2PDCA 1RALA 4LYKA 2VTFA 4GIRA 1BRLB 4K36A 3P81A 1OIMA 3E2SA 1VPQA 5G1YA 2LLEA 4JQ2A 3LQLA 1G9HA 1TQXA 1VYPX 1W9PA 4A8LA 3NNTA 2PRHA 2RHGA 2OZ8A 2QV5A 3OP2A 4FS9A 3M5XA 4MFEA 5LNSA 2IPFA 1CXHA 3M5VA 4PMDA 1ME9A 2X1UA 2YX0A 1DWGM 3NL6A 3LM7A 1KLYA 4NZ5A 3H2MA 2FZMA 4A2SA 3N2TA 3LHTA 5TAOA 2ISFA 1MWOA 5K9CA 5J5DA 1PKMA 2Z4GA 2Y5JA 4E8CA 3S5SA 4UTWA 5IHSA 3WUEA 3LX9A 1PDYA 1UMYA 4GVHA 4L65A 5IFPA 3TW9A 3BTNA 3TZFA 1EUAA 2DJXA 3LPGA 5CQ1A 3WQGA 2JF6A 2EF9A 1TCMA 5BRQA 1J0KA 5CBIA 2GSEA 2PGWA 3MJMA 3K4WA 1T7LA 3G22A 2QHAA 4TTUA 1XIEA 4RJEA 1UBSA 3V35A 2ZA3A 1F07A 3LU2A 4J5NA 2BHUA 3D5HA 3RGTA 1XF0A 3QKEA 4AF0A 1UJPA 1LWIA 3H4WA 2PLJA 4X0VA 1YYAA 3NYZA 1I6NA 4IJCA 4XISA 3WQOA 1XYBA 3WO8A 1BGAA 3N1AA 2YCLA 4N9CA 2YA1A 3KRUA 2SFPA 4AVFA 3AS0A 1LRTA 3L65A 4W89A 3VPLA 1O5KA 4F8XA 2YCIX 2C14A 1X1ZA 3MVIA 1QW7A 4K37A 1I8JA 2DZXA 1DVJA 5EU9A 2G50A 1FCUA 4HD5A 4F79A 1XBYA 1E6RA 4HPXA 2DUAA 4XAFA 4HOXA 1GOKA 2D1ZA 1A49A 2NSOA 4JTGA 4H9TA 1JXJA 3CYVA 2O9RA 4ZE4A 4XO7A 1NARA 3EWZA 4GXPA 3QHNA 3ITCA 3SY1A 4GY1A 4KFNA 4E3VA 4QP0A 4AF0B 3W7LA 1MMFA 1VIWA 4NIRA 2PWEA 1BWLA 1Q8AA 1OF6A 3A4AA 2ZOXA 3W7PA 4CD7A 1RHCA 3QFWA 4W93A 1AK5A 2YCLB 3L7RA 4WXYA 1FP8A 1DWAM 1O1ZA 4G1NA 3EB3A 1LOLA 4D6EA 1KGWA 5A94A 3HPSA 1FH7A 4FO4A 2QS8A 2BY1A 3T0BA 2XN0A 1VPYA 3GR8A 4S2BA 2NVCA 1B9BA 1JFHA 3F5KA 3E0IA 1SZNA 1KWGA 3ZT7A 1FHDA 4PODA 1XLMA 4HMNA 4K2SA 1KR0A 3HO8A 3HZ3A 2I56A 5HK4A 1W0MA 3QGAC 1MNSA 4UOQA 2XIJA 4I5UA 2VKZG 3M5ZA 3T0TA 1H2JA 3I3DA 3LI1A 3DGBA 1UR4A 2Y62A 4CN1A 3PUOA 1C8XA 2FKPA 4YU1A 4UFMA 1CBGA 1R3RA 5HNTA 5FEXA 3ZT5A 1G01A 1EX1A 3SCWA 4QE5A 4PCPA 2QJHA 1XUUA 1GK8A 2IKJA 2VT0A 1KM4A 2C8NA 4ZFMA 9RUBA 3CUGA 1ISVA 3QPYA 1X7IA 2RJHA 4S3DA 4IFOA 5K9XA 4FOJA 3VD7A 4GUJA 1KBBA 2BOGX 3LCXA 4Q7IA 1V3HA 2QXWA 1Z6KA 2A7NA 2VI0A 2RDUA 1SR0A 3QBUA 3PPHA 1E72M 4CD6A 3OIHA 5HNRA 4Q8UA 4O16A 4QDPA 1S2WA 1AL8A 2FB3A 2ZZ5A 2QEZA 1UPMB 1F8MA 2ZUSA 2AQWA 3NQFA 1XWYA 4IPIA 5IHRA 2NX3A 2Z1BA 2CKRA 4MFDA 3M6YA 1W9DM 3U5YA 4PMJA 1JAKA 4NJGA 2GJXA 6XIAA 3TJXA 3W1MA 4Z42C 4NXKA 2E3ZA 4JTTA 1XRSA 2CZDA 4E2BA 3RILA 1XYLA 3MMDA 3CO4A 2NQJA 2PD5A 1U5VA 2E4TA 2D23A 3W2UA 1ITCA 1XYAA 3GXNA 2YXXA 4PTNA 3BW2A 4EKJA 1XSIA 2PDGA 3UERA 1QR7A 3STPA 4IIEA 4UBPC 5M03A 3MSGA 4HPJA 3HM7A 1WKEA 4V15A 4ZCWA 3C86A 3N6HA 3WBEA 1Q6FA 4KWWA 1EEPA 1GEHA 4Z17A 3FJNA 2QT3A 4C6MA 3IK2A 1AQMA 5FJIA 4BQ5A 2J47A 1ONRA 2Y7DA 3VE9A 3WLRA 3OVPA 1SMDA 1H62A 1RUSA 1VHNA 2GJXB 2YDAA 4C6OA 4MGGA 1KRAC 4QG8A 4RW3A 3U7BA 1YE6A 3VGGA 3D0CA 2AGKA 5BZAA 5CC6A 5F1UA 2J7BA 4OV4A 4ZQRA 1Y7VA 4BF5A 4RDYA 2HPIA 1UQZA 3S2CA 4CQDA 2J7CA 1PUDA 3QQ1A 3G5EA 3AWOA 5CLTA 2OYLA 3FHQA 3DFHA 3ENLA 4HU0A 3KOFA 3WENA 3MKCA 4O28A 5BXSA 2O7SA 1CGWA 5DT5A 1VJSA 3LHVA 1I2PA 4O57A 5AYIA 3R89A 2OGYA 4ZO7A 4P61A 3M6DA 5EMLA 1ISYA 2WC4A 1MW0A 4LYQA 2PPGA 1XCXA 3WH6A 3EB4A 3NTYA 4O12A 4U2ZA 3ECQA 4XO6A 3A12A 1VBJA 3SM0A 1FWFC 2VC9A 1HJUA 2BB0A 1R86A 1TPH1 3WD0A 1EEXA 1X1OA 1E6QM 2CKSA 2VEIA 3QSRA 3U2EA 2W61A 4GZIA 1F76A 5XIMA 1XRFA 1HGWA 3BMXA 4JKMA 4N6EA 4K38A 1OADA 1ZENA 4FF5A 4IJBA 1RV8A 2DSWA 4O14A 4U33A 5TD4A 3ZR6A 3A3HA 3WUBA 4DPQA 1S1PA 3QF0A 3VCRA 3T0AA 1A4LA 1NF0A 1QPOA 3UGVA 3PJTA 3L0KA 1VGAA 4KT2A 3OZMA 2YBVA 2EG7A 4I6KA 4TX8A 1OG0A 2VDGA 1MQRA 4ZENA 3QMRA 1FWNA 2PGRA 3WEMA 1QXLA 3BAJA 4DUVA 3CMJA 5FF0A 4TR9A 1XH2A 2VFIA 3S6DA 2QCLA 2BXVA 1I75A 3B9AA 1UR0A 4XSMA 5J8LA 2E67A 4ZQOA 1O12A 3UYCA 1ZAJA 3VGBA 2AKMA 3KUMA 1DWFM 1Q5MA 4JTIA 1A5LC 4H9UA 3W3OA 1NH6A 1WZKA 3FEMA 1KBKA 5BU9A 2HWGA 1AODA 4C6LA 1ZRQA 3SIMA 2V38A 2IKGA 4LAUA 2ZRUA 3PAJA 4LYPA 1JUKA 3TQPA 1OZQA 3EWXA 3SRFA 3LRMA 3R7MA 4I9MA 2W3ZA 1OD8A 2A3CA 1SQ7A 1TWIA 3W6LA 5CSSA 1MYRA 4QEEA 1SPQA 1T8XA 2B4GA 5TF0A 2C1IA 2CLPA 5A8QA 3WLOA 3UG4A 1TIMA 1GQIA 4C60A 1JJKA 1FH9A 4MY1A 1QNOA 2YL5A 1A5KC 4MB4A 5A6BD 3MO4A 1VB9A 3WDIA 1G67A 2DORA 3URNA 4L6OA 4H04A 4WOZA 1UUQA 2IUZA 4GY0A 4ZZ9A 2ISSA 2FPYA 1TCDA 1PHQA 1UIPA 3QPEA 3DFOA 4DM2A 4ASTA 3R0KA 1RPKA 3NZPA 3WJZA 1S5WA 4DO5A 1TIWA 3GM8A 3WD1A 3WK3A 1V6VA 1B3OA 3W2NA 1OG6A 1CYGA 2V5LA 3CH0A 2D0HA 4IPJA 1RBOB 2HE8A 3WEZA 5G2WA 3IGXA 1GVSA 1I1WA 3EOEA 1E9YB 1IF2A 1FWJC 3WNPA 1W9UA 2Q8LA 4ES4A 2ZZ6A 1MFUA 4EPDC 1M41A 3ATZA 3OLGA 2C7FA 2XFWA 3L68A 2QF7A 4GPNA 4W4QA 4K8GA 3GU9A 3SCTA 3WD4A 1QO2A 4ZMGA 3TSDA 4N0RA 3T2PA 3DU0A 3K8MA 3CGTA 3ZR5A 3KRZA 3GS6A 3ITXA 4RV3A 1S38A 2IXUA 2OZ0A 2WPGA 2WSPA 2ZC8A 3MWCA 4H6RA 1J0YA 5T91A 5HBFA 4US5A 4AX6A 4YVPA 4NKCA 5C7VA 3NYDA 4JTJA 2NXHA 3G1HA 4FLRA 3WQ6A 2FZNA 3EA2A 3NQGA 2VR4A 1VFFA 2HS6A 1TJ1A 4KERA 1HF6A 3ABOA 3M0KA 1EH9A 4C65A 4DELA 2BVTA 3PZOA 4MYAA 3GHUA 4IP5A 4Q4OA 2FB2A 5LGXA 3UJRA 3G77A 3QGVA 4S39A 3M07A 1RK5A 2AL2B 4IISA 5FACA 4KETA 3GDTA 3RX2A 4R3UA 4UWMA 1GCYA 2FQIA 1UD4A 2DZSA 4MJMA 2WMHA 2Y7FA 2E6DA 3NA8A 4BA0A 4M7SA 4Y8EA 1W54A 1EP1A 2QMKA 2WW5A 3T40A 4HPHA 3F03K 1U2YA 1U1JA 4YWIA 3H8AA 3LENA 3O1NA 4CCCA 3BAYA 3EOSA 1JI2A 3S2NA 2EJ1A 4DO4A 4WKAA 1C8VA 2NT0A 3CYJA 2Z24A 3TA6A 1K1DA 2E77A 8TIMA 4OKDA 3V5OA 4FIQA 4HNOA 3NXFA 3KRSA 4I5RA 1W3TA 1ZL1A 4GI9A 1W1A1 3FJLA 2A3BA 3UJ2A 3W1LA 1VJIA 4CD5A 4B4FA 5H8UA 2G5WA 2RDTA 3EWYA 3MB9A 5JH1A 2PDQA 3I65A 2J6XA 1YXDA 4B92A 4DZAA 4UNLA 4F9DA 1HL9A 3E2VA 1DE5A 1YDOA 3VAVA 1NOFA 5FEWA 1WDQA 4XZHA 3CUJA 2Y70A 3UG5A 3KW3A 3TYDA 1X39A 2BS9A 3IIVA 5DRCA 2Z2AA 1Z3NA 3GU1A 1LOQA 2DIJA 1N8FA 1X1NA 5T9BG 1OYBA 1CGVA 4KFPA 3WH9A 1R3QA 3AISA 3W72A 3I4KA 1UP2A 1WE5A 4PB4A 4AZ7A 3AIQA 1OBAA 1NAL1 1H5VA 3EDDA 1XLBA 2OTDA 3NSXA 4GYPA 1W1YA 4X2PA 2QAPA 1GW9A 4W5UA 4E0CA 3VMOA 1TX2A 3VX1A 4H8UA 3GFXA 4LOCA 4Z2HA 4JQAA 2DU2A 1ELSA 4ZA0A 3SAZA 5HMDA 1O95A 2BBFA 3EDFA 4RE2A 2PWHA 1KGUA 2DY3A 1KFKA 4CLMA 4LQ1A 1UG6A 2Z1VA 3K46A 4IUGA 4P2VA 1AQHA 2J7EA 1KXHA 5A6KA 3RM4A 2WKLA 4DJFA 4HU8A 3OGSA 2C18A 1IXPA 2G95A 1A5AA 3ARPA 1FOBA 2F9RA 5FD0A 3QH2A 1IT0A 2B7OA 2WJZA 5B7YA 1EDGA 2WHKA 2IQ0A 1TV3A 3ZXWA 2F61A 1HL2A 4HK7A 3C2RA 1HNYA 1W8GA 2PEVA 4OFCA 1WYIA 2GZXA 1MRQA 4IXXA 3A4WA 3UY8A 4QS6A 3QC3A 3QHMA 1IQ8A 3DXIA 1P1MA 3FSTA 4HTBA 1BFNA 1J0HA 3T1GA 1X6UA 1GYMA 1Y8BA 1W5PA 4FMVA 1UWQA 4NI3A 4Y2WA 1R6WA 4LCRA 5DXYA 2PA6A 2RFGA 2YZRA 2V5BA 3SBFA 1OCJA 3OTRA 4H8NA 1UW9A 4MF4A 2O9PA 3BAIA 1UROA 3ZO9A 3QR1A 1EFZA 1MW1A 1RXOB 1L0PA 2NWSA 3B04A 1TE1A 3W71A 3AJXA 4DUOA 3P82A 2BOFX 4WDTA 4DO7A 2FYMA 3EX1A 3H2EA 1O7AA 1K8ZA 3FS2A 3GDLA 3PG8A 1MVYA 4DXXA 1GQLA 1PX3A 5BCAA 2QDDA 1FHUA 2O9TA 4ZO8A 4D6DA 3LERA 4YLWA 4CNOA 2C16A 4O11A 4A2RA 1LBFA 3EXTA 1CXLA 3NZQA 8CGTA 1QT1A 4WSJA 4X63A 3PZTA 1VBHA 2VC6A 4Y8FA 3ITLA 3BJTA 3GD6A 3TTEA 4E8DA 2AKZA 4PFMA 2PCEA 4OE7A 1XS2A 1NFPA 3G6MA 3UZ5A 1ONWA 4W87A 4FXFA 4LV4A 4IL0A 5AFDA 1VENA 2ZIDA 5D02A 1YKWA 4LNCA 1JIBA 2REQA 2X30A 1F3WA 4ZOAA 3HB9A 1H0GA 3SY8A 3M64A 5CJMA 4BHYA 4CNUA 3CZEA 3SGZA 3QGKC 3K13A 3UETA 4GG9A 4NJIA 4G56A 1EO5A 2X16A 3UXIA 4QGCA 4HHHA 4PA8A 4YYFA 1Y5VA 2E9BA 3EOUA 4NNCA 3NXLA 3O63A 4M7TA 3VOFA 1E1EA 4N02A 5AC8A 5K2ZA 3NG3A 3MMUA 2XG9A 2ZWYA 1UKPA 4LWWA 2UZ9A 4IP7A 3FKRA 4URIA 4ROPA 2JFEX 2YDQA 1H7WA 5C7HA 2ON3A 4CVWA 5LSMA 1EA9C 3BQ5A 3GTIA 1PJ9A 3NQ7A 3QYSA 2V63A 3IJIA 1H61A 1T8QA 1JNDA 1REQA 3GHSA 3GXIA 3WQPA 4DBEA 4HT3A 2FPTA 3VTRA 3GAYA 5LGZA 4QNWA 2XPKA 4JAWA 3B03A 4JBRA 3IS4A 3UWUA 3W01A 2G4FA 4KRUA 1QI4A 1FCBA 3TYAA 4M6QA 1POKA 3W7NA 1LUCA 2DIEA 3CT2A 3AXMA 1L6SA 1R9XA 5IDZA 5CSUA 1PV8A 4AMCA 3W84A 3THDA 4GQRA 4CQAA 3VNZA 3B8IA 4PGLA 1GVFA 4GIYA 3MDWA 4NF7A 2A2IA 4XD6A 2PP0A 3HU7A 1CXKA 2ACRA 5BMXA 4MB1A 3TW6A 4NSBA 1KFJA 4HU3A 1VIZA 4YYCA 4CN6A 3ZOAA 3OEXA 1RCOB 2QUUA 1TTJA 2XIQA 4MDPA 3M41A 4IWWA 4XTDA 1ADSA 4UMAA 1TVNA 4O15A 1REQB 4R85A 2A7RA 2UV8G 1KQZA 2VM8A 2V68A 3SUUA 2QCEA 2WM1A 1PO9A 1GJPA 4HZMA 1WAWA 1HKKA 1PHWA 1G0CA 1X97A 3TXVA 3A5VA 3NVTA 3RCMA 1LUCB 3P61A 3K4DA 4QQUA 5F4WA 3VKJA 1XV8A 4Z2GA 2X1IA 1BG9A 4HA3A 2Z1XA 3FIGA 1RP8A 4XZLX 3L2MA 3ICJA 5TQLA 3U0HA 3D3AA 1LZOA 4XX6A 2QULA 2ZZ1A 1JQXA 1XLJA 2VP8A 4KGJA 3LLDA 3LYEA 1IEVA 3ME3A 2PTWA 2WV8A 3G8RA 3CUHA 1DL3A 4JS3A 3BSHA 4AUBA 4PSPA 2VX5A 2QZRA 3DHPA 4WUIA 4OOUA 3W0KA 2CNCA 4IQLA 3PN8A 2DIKA 3P2VA 2VELA 4RR4A 4L9XA 4EX4A 3RHGA 1Q6QA 4JDBA 4H9XA 4KEVA 4WRHA 3VK5A 1UR9A 3PJUA 4JPGA 3NQ2A 4RZ6A 4WIWA 4A8NA 4EXAA 1LG2A 4A8RA 1A47A 2XZ9A 3HQOA 3Q2DA 3L67A 4PCSA 4J3ZA 5F2MA 3W27A 1QWKA 1ODZA 1E4LA 2CLIA 2TODA 5HDRA 2GVEA 2YJQA 5EMYA 1VKFA 1T5AA 1ICQA 2V2CA 1YNPA 1E43A 4B2DD 1O4UA 1LL7A 3WJWA 3OQEA 2OLHA 3ARTA 3MY9A 2DDXA 5F2LA 4Z1BA 1L6WA 1NWUA 4LUIA 5ENLA 1KFLA 5KITA 3MT1A 1E1FA 3LBOA 4JZ5A 4L1GA 4CUCA 4Y96A 5FF3A 2BVWA 2PRLA 2XTKA 4HB7A 4MWAD 2BXYA 3KS5A 1G5AA 1O1HA 4PMYA 1W3IA 5C70A 1QW8A 3SJNA 3BLEA 2J8TA 5A8OA 2V67A 1J4EA 1KCXA 3VGEA 5C2CA 2OB3A 3RMJA 5D9MA 1E5JA 3U2ZA 5AY7A 1H09A 1XUZA 9CGTA 4OECA 3UG3A 1OC5A 1W8SA 1JFXA 3WELA 3G0SA 1XR2A 3UWQA 1QNRA 1GHRA 4JCLA 3H21A 2FDSA 1U83A 3BLFA 1BYBA 3WBAA 3WK1A 1OCNA 1XQKA 3VIHA 1P0EA 2V81A 4DUXA 3RLHA 2BZNA 3CTTA 2PAJA 4WDWA 3KZPA 3G24A 2GJPA 4XZMX 3TYEA 2C1HA 5T9CE 4QJ5B 1LLOA 3QLLA 1TV4A 2Z6IA 3WLJA 3CZ8A 1K7EA 1R3VA 1LLWA 4D6IA 2OEMA 3M4HA 4EACA 1EJTC 3PBWA 1NELA 3A24A 4NAFA 3T9PA 4E2VA 3T8QA 3CZGA 4JQ3A 1YNYA 5I0DA 1XLKA 4GFIA 4UCFA 2OR2A 4LX4A 1QFEA 2XH7A 5EL1A 5FA5A 3LXBA 3GFZA 4QLLA 3R0DA 5J04A 4AEEA 5LNWA 3LG3A 3WYZA 4QITA 3FOKA 4ZTYA 1Z7AA 3QQWA 4BZYA 2WZEA 1AJZA 4PUNA 4R5EA 3LHWA 3H2CA 4ORIA 2QIIA 2ACUA 3MSYA 3MUAA 4RZBA 1C9DA 3BOFA 3L4YA 3S6OA 4X61A 3RF9A 1TV5A 2GQ3A 4O17A 1I4NA 2J9YA 4DNMA 5H2ZA 4JEJA 3W7RA 3V16A 1NU5A 3L5LA 2IQTA 5HNUA 1I2QA 2D69A 1NJJA 4Q6XA 1HP4A 2GGJA 3LBMA 3CHVA 1XGEA 4WVXA 3DG6A 4MB3A 1W6TA 4I9AA 2PE4A 4NAFB 3B40A 4S3BA 4BQ4A 5D8ZA 4XIMA 2P3EA 1XIIA 3HGOA 1DIOA 1IXNA 3FAXA 2XWDA 1TWDA 2A5HA 4F0RA 3TAOA 4JOMA 5DCBA 4CCEA 1GWJA 2VEKA 4O52A 2O55A 3USBA 5DMNA 4TXEA 1SJBA 4M3PA 2WO5A 3W07A 4X60A 4XZ9A 3RYSA 4C1LA 1YHTA 2QCFA 5D37A 2ZZ2A 4IX0A 5DY2A 1DIDA 1QNQA 4Q7NA 1LOSA 2DPEA 3KAOA 1M6JA 4B90A 2CC0A 2FLIA 2OKTA 3SUTA 1AUSL 4HNVA 3H70A 4XKYA 4AD3A 2PSNA 3B4YA 3B0VC 3RK8A 4ZQCA 4PMQA 1CGXA 4Q8TA 3UXLA 1L2UA 2DZTA 4ZSUA 2DGAA 2Q8ZA 3WQ5A 4IGSA 2JIWA 2QV4A 3TTSA 3V3WA 4NY2A 1LRQA 4UNKA 1C92A 1LT7A 1V51A 4AWUA 4F0LA 4OUIA 1GEQA 1Q6OA 4ZVJA 5CC5A 3PAOA 2QCCA 2ISDA 3EEZA 3URAA 3S9ZA 2YBTA 4LV9A 3RNDA 3WLTA 3N2MA 2R24A 2GK1A 3ABQA 3PTKA 2AGTA 5D4YA 1KM0A 4GZEA 1H7OA 1F4AA 2CLEA 5AYXA 3JR2A 1MW3A 5D8WA 3C61A 2INZA 3T44A 4XKYB 4LGXA 4DBUA 2W9MA 3PWIA 2I7GA 2VEGA 4L80A 3OHIA 4LJ3A 2ZXBA 1F74A 2GFTA 5E09A 1UUOA 3MHUA 1R8LA 3WMSA 3KWXA 4JKKA 2CBUA 2NZLA 2A85A 2GUBA 3VA8A 3UG8A 1QHOA 2PDBA 3F1QA 2VMFA 3L4VA 3PP7A 4KS0A 4M51A 3N12A 4HQVA 1W1TA 1CI1A 1EJSC 4RLIA 1NY1A 1YPIA 3EXSA 4IFKA 3RPDA 5E93A 1EDTA 3SGGA 4NU7A 2EHHA 1ZS2A 1YDNA 1Q7QA 2GK1B 3UA4A 4B3LA 4O19A 3FVDA 1M5WA 4P7RA 3AI0A 4RV8A 3UVAA 4DXKA 2R82A 5CZTA 1EP2A 5CEWA 2PBOA 4M6UA 1A3XA 4PEEA 1OQFA 1M7PA 4IX2A 7CGTA 2V82A 2XVGA 5A2AA 2TRSA 3BO9A 1DJNA 1P0DA 4UUIA 4MKVA 4QFUA 4E4PA 3DFPA 3UU0A 1UR3M 3VIFA 5BOFA 3NQCA 2DQWA 3CIVA 2BODX 3LTPA 4V1XA 3T4WA 1WOAA 3AJ7A 3UR2A 3WMBA 7PTDA 2E5DA 1Z32X 3BURA 4YTSA 3QHOA 3VNDA 2ZQ0A 1B3YA 4JYFA 2FGZA 3K8LA 1JCYA 4JIQA 2A3AA 2OYMA 4AQLA 4U2YA 3L23A 3LK6A 4IFKB 4W7VA 5EBAA 2ZA1A 4LRSA 4E38A 1X6LA 3GTHA 4UFKA 4S3FA 3P0XA 3T0CA 4A6GA 1ZZMA 4CU8A 1A5OC 1NWRA 3IEBA 4KGLA 5LNRA 1F3XA 3A47A 4XZBA 2OSYA 3CT7A 4P8UA 3TC6A 1A3WA 4PL2A 5AHEA 3FCPA 2CFFA 4YTTA 1J6OA 3IIPA 2PLKA 2VUYA 1WBHA 1F7BA 4LBUA 1YPFA 5LIYX 1WAUA 1S46A 1ZBVA 1B4EA 3C0QA 2BHYA 2H3BA 3WBWA 4PL1A 4KIEA 3IVTA 4PUMA 1R7OA 1G69A 3G1RA 3OBKA 3WNLA 3VIIA 1R0MA 4AIBA 2CLMA 1V6XA 2DV0A 2QDHA 1WUEA 2A1YA 3DAQA 2F6XA 3S4TA 3R2GA 5H6HA 1RY0A 5KETA 3QZEA 3C3UA 1JD7A 2Y8UA 3W7QA 4JX5A 2QCDA 2EAWA 4BR1A 3FY1A 2DW7A 1M04A 1XC6A 1AJ0A 4Q22A 2XFYA 3DGRA 3PWGA 4WY0F 2VGBA 4JFUA 2W27A 1PWMA 1OFDA 1W37A 2ISVA 4AY1A 5I3JA 3O07A 1QHPA 4KQNA 4OVXA 3IV3A 4C6EA 4IFRA 1QI3A 4K7YA 2TPSA 3CU2A 5L9FA 2DUZA 4FLSA 3O0FA 2J7GA 3PB2A 4BQ3A 1TYGA 5HJXA 5IDIA 3GHRA 4XD4A 3IJ7A 3OA3A 3ATYA 1O60A 3E0WA 4QCEA 4WD0A 1JRBA 2VQUA 3OHMB 4A05A 1D8WA 3ZQ9A 1UHVA 4PUWA 3TN6A 4IQJA 2PI6A 2CHRA 3TTQA 3TYCA 2F7FA 3E5BA 1HQTA 3WQFA 1I9CB 5KZDA 1ZAHA 2VUNA 2QCDB 4GNJA 3GSMA 3EYPA 3PC0A 2VZUA 4B5VA 2PWUA 3GVQA 2OZTA 3AHTA 3U7VA 1UOKA