4CQ9A

Plasmodium falciparum dihydroorotate dehydrogenase (dhodh) in complex with idi-6253
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
372
structure length
367
Chain Sequence
b'FLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title In Vitro Resistance Selections for Plasmodium Falciparum Dihydroorotate Dehydrogenase Inhibitors Give Mutants with Multiple Point Mutations in the Drug-Binding Site and Altered Growth.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 137
structure length 367
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cq9A00
3ZWTA 4WX2A 2Z6JA 4GFSA 4OE7A 3L68A 5D30A 3TQ0A 2TRSA 1K7XA 1P5BA 2ISVA 4HIBA 3WJWA 3FKKA 3H55A 4XKYA 3TNOA 1UUMA 4O4VA 5EKYA 4DBEA 1XFBA 4POCA 5DBUA 3PM6A 4JX6A 4YMZA 3P61A 3W7NA 5D03A 4MFEA 2VFGA 1XM3A 2ATMA 3TUUA 1LRTA 1QAPA 4DO6A 1UUOA 3O6DA 4OGZA 4JTGA 4BF9A 3P67A 1H7RA 3QSRA 1AK5A 3MP4A 3IIVA 1RVGA 2E09A 2PE4A 1B3OA 4NJIA 3LOTA 3PWAA 3CTLA 1EIXA 4KWVA 5SWUA 3MWAA 3S6DA 3WJSA 4AH7A 1B4EA 1TPWA 2V5BA 3EX2A 3SY5A 4JEQA 3C2OA 3L66A 3STEA 3EWUA 1YDVA 1ME8A 1T96A 1OABA 2YGYA 4RZ5A 4PC8A 1Q45A 5CPOA 3MYPA 3HPXA 3PBWA 3S5OA 5BOOA 4FX7A 5D04C 2CZEA 3G1FA 5DY3A 3I68A 2G96A 1GVFA 1KBJA 1GEQA 5CG7A 3UWYA 4NX5A 2EPHA 4PODA 4FNSA 4LVDA 1A5CA 4Z1CA 4S2CA 2GVGA 1O5XA 4LV9A 4NX0A 1H7PA 1N7KA 2Y7EA 2CLEA 1KFKA 1GTHA 2V8ZA 2DZXA 2Q3OA 3T40A 3UWWA 5G1TA 3WJXA 3DHFA 1R47A 1TREA 3PULA 1F6PA 1GYLA 4O15A 5AFDA 4WY0A 3TFCA 2Y89A 1JUBA 1LBFA 1P0KA 4K6AA 4ICNA 4KKXA 3WK1A 3L0KA 4ADUA 1OK4A 1EPXA 2ATSA 4UTHA 3NQMA 5D32A 1KFLA 8TIMA 4KFNA 4JIQA 2GQ8A 1AMKA 3E9AA 1QPQA 4PFMA 3G18A 3NO5A 4QISA 3KHJA 1MEHA 4IX2A 5CZTA 2GPTA 2QUVA 4MJMA 4LUJA 5EPDA 1QO2A 5K7JA 1A5BA 3M1ZA 2E6DA 1VHNA 2VFEA 2O7SA 1XCFA 3CPRA 5E1QA 4A21A 2V2CA 5MHBA 4BI7A 1SW7A 1Z41A 3LV6A 3TW7A 4MLRA 2A2IA 1X7FA 3CWOX 3KRSA 2ISWA 1KV8A 3L21A 1W37A 3BG9A 1RQHA 4JTKA 6TIMA 3LCIA 4TR9A 5F1UA 1ZAJA 3W84A 3MBFA 3A24A 3LDVA 1DV7A 2QCMA 1LDCA 3BW3A 3QPZA 3K30A 3NZRA 1X1OA 2V9DA 3GXPA 3A9IA 1IXQA 1F74A 3EX6A 3S5YA 3S9YA 1VCFA 4O28A 1OYCA 1Z48A 4UNLA 5D05A 2PRHA 4PL1A 1DORA 1XL9A 3NG3A 3HGRA 1P0NA 3NQ8A 3ZWSA 3PC0A 1O4UA 2VENA 1W0MA 1VJIA 1FDJA 5FF0A 3UWQA 3NQGA 4E38A 3LXAA 4YL2A 2DORA 1U83A 1F7BA 5DBTA 4CCCA 2ZRZA 1EP1A 1FCQA 3G1VA 1OFDA 4L4MA 2CFFA 3F4NA 4LC6A 4OQVA 2Z0IA 3CIXA 1RQEA 1FDZA 3DFSA 4QJ1A 1MO0A 4LY8A 4AB4A 3LXCA 3W1AA 3P5YA 3LTPA 2RDTA 1XKYA 1SSGA 4A3UA 3R8RA 1GVRA 2I1OA 1C29A 3I65A 4M6QA 4A29A 4RX0A 2Y6ZA 2CLIA 4LVBA 3LHVA 3WK3A 5CPMA 1T8XA 1EUAA 3RLVA 5K4XA 2NX1A 3GDKA 4GUFA 3QZEA 3M9YA 2VEPA 1ONRA 2VFIA 5D2TA 4I7WA 1SSDA 1PHWA 3QYQA 4NXSA 2I14A 3S1VA 1SZEA 1ZY9A 2FDSA 1JCXA 2QCCA 4JX4A 3MUXA 4I7VA 2DZSA 1BEUA 2YW4A 3HGJA 4DEFA 1K02A 5K3VA 4XKYB 4MZ8A 3S0CA 1H51A 2FQIA 3GNNA 3W75A 4WJEA 4O52A 4JTSA 4RKAA 3PR2A 2Y62A 2VOMA 4OU1A 1U5JA 2G97A 4I9AA 3MP5A 3L5AA 4O53A 2ZZ2A 1PS9A 1UASA 2CLLA 5CZSA 2ABAA 1K03A 1HL2A 1TPDA 3BLIA 4HSOA 3PBYA 3DXIA 3W23A 1GYNA 2GQAA 2BWGA 4BWLA 4UFMA 1VR6A 2QJIA 1TSIA 2WOQA 4X9SA 3O8AA 4UFKA 2P1FA 4YCPA 1KFEA 4Z08A 4DPPA 1ZHAA 3M41A 4FNUA 1TPUA 4NT0A 1UB3A 5LNVA 3HG2A 4NNCA 2V30A 4LOCA 4D2JA 4WD0A 1AW2A 2V0TA 4PTNA 3HGOA 4MLJA 2PRMA 2D73A 4IGHA 3NQCA 5FF3A 1LBMA 2QR6A 2JK2A 2W6RA 4PL2A 5FF7A 3SI9A 2P10A 1EWDA 3LCLA 3I7SA 4UC5A 3BW4A 3RU6A 3A23A 2Q8LA 4NQ1A 5FF2A 3NXFA 1YXCA 1FWSA 3O1NA 5AB3A 3DHDA 1SPQA 4RZ6A 1LLZA 2B7QA 3IIPA 3GXNA 3T4CA 4AWUA 4JR5A 1DJQA 1MSSA 1W31A 3DI1A 1M6JA 1JCNA 3PUDA 1X8FA 2ZA1A 3VKJA 3GDLA 5A5WA 3UWVA 3W87A 4JY8A 3FA5A 1TPEA 2A6NA 2NV1A 2C3ZA 3B0UX 2R94A 5F2MA 3O07A 5I3GA 1GQNA 2OJPA 2ABBA 3LM7A 4MVAA 4K8EA 1OG0A 3P82A 3LRLA 1ML1A 5DXYA 2NLIA 2J24A 1KTBA 5KINA 2NUXA 3LCXA 3E12A 3NL2A 1UJPA 4JXCA 1SZFA 4M7SA 1EX5A 3NPVA 1FUYA 3GZ3A 3O06A 3HMJG 3LBCA 2CLMA 1QFEA 3GIYA 1SU5A 3T55A 3W7QA 3M6YA 2X30A 5D09A 3TV8A 1MZHA 2ZRWA 4CLMA 2ZZ5A 4UTTA 3LV5A 1WAUA 2B0MA 3P8IA 1F76A 2WPBA 1RQBA 4LVGA 2X1UA 3UZJA 1QO5A 3LI1A 1Z42A 3U2OA 4LS1A 2RKXA 3W72A 4RXFA 1LBLA 5EBUA 1RD5A 1EEPA 3M5VA 2NUWA 2QF7A 4NZFA 1W56A 1A53A 1PIIA 4P61A 1S5VA 2VFFA 2XN2A 1LCOA 2ZA2A 4S1FA 3ATZA 4UMCA 5ABTA 3GK0A 1N8FA 4WQ6A 3PBVA 1FCBA 4JTFA 3W7PA 3LHYA 3ABOA 1O5KA 5HJLA 4H4IA 3TR2A 2HMCA 3DGRA 1R2SA 2IQTA 2QDGA 1GTEA 4NNBA 3LCFA 4CCDA 4AF0A 5L9FA 5C2XA 2CU0A 5FEPA 2YDAA 4AAJA 4MYXA 4DBDA 4LNYA 2YYTA 7TIMA 3L9CA 4R7JA 3QJAA 4FIRA 5CGQA 2A4AA 4UNKA 5LZLA 4H6KA 2Z1BA 5IM51 4LVAA 4JYDA 3ELFA 5AC8A 1OFBA 2X16A 4GNJA 3STCA 1SO3A 1OJXA 2JGYA 3LXBA 3T44A 1NFBA 1ZALA 3DFNA 3R2GA 3KVKA 5CZJA 1VCGA 1LOLA 4IQLA 1TMHA 4JN6A 4WZHA 3BG3A 4A22A 2RFGA 4O1DA 1KLZA 2ZYFA 1TPFA 3SW6A 4M6VA 1TRDA 4HNUA 1I2PA 1ME9A 2RDWA 4UTWA 4ZQRA 4TU1A 3FYPA 1Q6QA 2EAWA 4NJKA 2XN1A 3W1TA 4O18A 4GRSA 3EEGA 3W2UA 2Y7GA 1W3NA 3GDMA 4IOTA 3UPBA 5A8GA 2OMAA 3C3NA 3BO9A 1GT8A 2VEKA 2NUYA 4GBUA 3A5VA 3C2VA 5HR6A 2H8XA 4EIVA 3D0CA 1V5XA 2J9ZA 2GVLA 1DVJA 5BMXA 1J5TA 1R2RA 1XC4A 2G95A 1H62A 4LV4A 1W54A 5C55A 5LNUA 3NAVA 3VFLA 1J4EA 1K7FA 1QOQA 1JCMP 1KM0A 2A0NA 1ZJIA 2NXHA 1EP3A 2QEZA 4FIQA 4LUIA 4E2BA 1VS1A 1FWTA 2HS6A 5DCDA 4RLIA 4YCOA 3EX3A 3B03A 4BWLC 3MHUA 4DO5A 3HPZA 3W7GA 1YXDA 3NQDA 4LRTA 3PY2A 1FBAA 3LHZA 1SW3A 1WOAA 4IMFA 3KVLA 5HUPA 2VC6A 2QCHA 3BV4A 3LBMA 3NQ7A 4EVZA 1XDLA 5AN7A 5LHEA 3BW2A 2C13A 4UMBA 3G0XA 2W0UA 3C52A 3CB8A 2VELA 2VEMA 3HF3A 1VGAA 2ZZ3A 3N3MA 2DU2A 3NVTA 1IIHA 3SECA 1G4TA 3INPA 4CCEA 3DFOA 4AVFA 3P60A 2B7PA 3IRDA 4NNAA 4TIMA 3I7QA 1O95A 3BLFA 1YTKA 3GDRA 1T99A 4Y96A 2WSYA 1H61A 3B8DA 2JKAA 1TQJA 4LS0A 5TIMA 3PS7A 1AL8A 3M5YA 3LHUA 5BNKA 4JTEA 3NEVA 1W8SA 3CIWA 3FEMA 3A5FA 3W1RA 3EWWA 3VI2A 1SFJA 2OCZA 1FY6A 1H7OA 4KWWA 5FESA 4N4PA 1AL7A 5HMSA 3NA8A 3F4WA 4ZQOA 3W22A 1AW5A 2V82A 3O15A 1H5YA 1F73A 1JJKA 5EMUA 1OF8A 3Q94A 2E68A 4IUOA 1EB3A 3I6RA 1G4SA 1HTIA 3R13A 2YPIA 3EKLA 1HFBA 2ZBTA 3STFA 5K4ZA 4C1KA 3IVSA 4DO4A 2NWSA 3EKZA 3DAQA 2V2HA 2ISSA 1KA9F 1KV5A 3BLEA 2GOUA 1TO3A 4UTIA 3JR2A 1ME7A 3F1QA 2E6AA 2E5DA 3KAOA 3HPSA 2QCLA 3O6YX 4K38A 1FDYA 1L6SA 3O05A 5DY2A 2TYSA 3OBKA 4ZQNA 1QMLA 1V7YA 1RR2A 1W5PA 3OVPA 2GQ9A 2ZRVA 5KZEA 5HNRA 3DZ1A 1XBZA 1DOSA 3G1SA 3W2NA 2ZRXA 1IF2A 1M7OA 3DI0A 3NQ6A 4LW7A 3IVUA 3E49A 4UTTC 1L6YA 3IVTA 4ZL1A 5AC6A 5AHEA 5J5DA 5K9DA 1WXJA 4XQ6A 3QH2A 4XBKA 3OEXA 4OWGA 2X2GA 5DELA 4JTLA 5F4XA 2YYUA 1LORA 5TBOA 3G0SA 3W6YA 2GVJA 3PUOA 2E6YA 1BWKA 4N4QA 1S3HA 3LRMA 3A22A 1H50A 3C61A 4JYEA 4RR4A 4MY8A 4Z0JA 3W2JA 1GG0A 3S1UA 4O1CA 5C6MA 4QIUA 3F03K 2EF9A 1A5AA 4Y9AA 4AF0B 3WK0A 2ZRYA 1I4NA 1MXSA 1TJRA 2QCDB 2CZDA 5G1YA 1JQVA 3RLUA 3UD6A 1TPB1 3E02A 2J6XA 4KFPA 4UR8A 1D3HA 4XUGA 4N9CA 3KXQA 5KITA 1GOXA 4PA8A 3RMJA 5K9CA 3W1MA 4EF9A 2QCNA 3MI6A 3BK0A 3N73A 2RDUA 3HG5A 2A7PA 4K36A 1EP2A 2VKZG 4Z1AA 3KRZA 4QNEA 2Q3RA 5D2VA 1TIMA 3GAKA 3C4UA 1A5SA 5G2IA 3U8GA 3TDFA 3MMTA 3QPYA 2Z2UA 4ADSA 2DZVA 1QPNA 1I2NA 4AWTA 4HSNA 3DH7A 5D2YA 4DF2A 3G24A 2JKPA 3E96A 3SGZA 4UTWC 4ZQMA 5FEXA 1TCDA 1W5QA 2QUUA 5C5YA 2ZZ4A 4DXVA 5HULA 1T0OA 1WDWA 1X6UA 3MYOA 5LNRA 5KMYA 2ZRUA 4HNNA 1OFOA 1TRIA 1YPFA 3NGJA 4AMAA 2HSAA 1KM6A 4M6PA 2GJLA 1YTDA 3QW3A 4BR1A 4IMDA 3OG3A 3L67A 4QQ3A 3QFEA 4GUHA 4O12A 3NNTA 4GWEA 4AHOA 2OZ0A 3L65A 4IWWA 3C2RA 1CI1A 4ORMA 4MY1A 1UBSA 1MEIA 3M44A 1JCJA 2CLFA 1FWWA 3TSDA 4GJ1A 1GVOA 1FCVA 3FIGA 3EWBX 3MHFA 2C6QA 5E93A 4LVFA 3MP3A 3W86A 3N34A 3SZ8A 4O57A 3W7KA 1JVNA 3RK8A 1CW2A 1X1ZA 4OT7A 3OVRA 3QQ0A 2YR1A 5LKYA 2E77A 5DCBA 2ZQ0A 2R8WA 2JBMA 4G1KA 2J9XA 1VLIA 3NDOA 3DFTA 3PSVA 1TPC1 1M7PA 1KFJA 1YYAA 3CEUA 3S8HA 3EXRA 1CX9A 1KBIA 3ABRA 3TAKA 4M5PA 3TK7A 1VC4A 4RV8A 4FX8A 3PG8A 4N9EA 1A50A 1IGSA 1ZAHA 3LTSA 1LZOA 3HJZA 3TFXA 1W1ZA 2TSYA 1PHQA 3U6WA 4TMCA 5G4WA 1RV8A 3ABQA 3UWZA 1DQXA 5AYXA 3M16A 1GPWA 2FB3A 4UMAA 4QSHA 4GE8A 1W5MA 2QAFA 2QJGA 3W83A 3QSTA 4N9BA 2H3BA 5H91A 1OFPA 1QCWA 2C14A 5K9XA 2ZCGA 1GZGA 1SZGA 1VH7A 4WOQA 4M7TA 4QM1A 3W7DA 5LNWA 1KTNA 2QCGA 3FLUA 1OFEA 1JRBA 3GLCA 1OF6A 4ZMGA 2CZFA 3SIZA 4UTUA 1YADA 3L2IA 1FWNA 2VXNA 4AEOA 4BI5A 1FX6A 1Q6OA 3P74A 5U4NA 1TJPA 1LOQA 1TB3A 3CEPA 4YXGA 1H1ZA 2AQWA 1SO4A 1BWLA 3C8FA 3S1XA 2C18A 4ORIA 2DJXA 3I7RA 3QC3A 1O94A 3LLDA 1W3IA 3MBDA 3EXTA 3W1NA 3KX6A 3GNDA 1JCYA 3PVFA 4O19A 2ZTJA 1YDNA 3W1LA 1OFRA 3L5MA 2A21A 4UTLA 3G1XA 3NM3A 3LX9A 2QCFA 3DFQA 4YLWA 1K8ZA 4OHQA 1K3UA 4O1BA 3FKRA 5D2XA 3IGXA 5FF4A 3MI3A 4GXMA 3JRKA 2Y85A 2FIQA 4LWWA 4XZ9A 2WQPA 3WK2A 1LROA 1WBHA 3HG3A 1XXXA 3TAOA 3W1XA 3NZ1A 4BK9A 5CPLA 5AYZA 1TTPA 4GUIA 3G1HA 4O10A 3HG4A 5L6UA 1DBTA 1TV8A 3O16A 4UFIA 4NJGA 4UR7A 4NXKA 2H90A 2XN0A 1KM2A 4JDBA 1W3TA 3W7IA 4EWND 4MIMA 1VHCA 1DL3A 2Z6IA 3IIZA 3UY8A 3WJZA 4K39A 2X1SA 3TCEA 3H53A 3W1QA 3EX1A 3DBPA 4PH6A 3BG5A 3QRHA 4X2RA 3KVMA 4LS2A 1OYAA 3EWZA 3R12A 4QITA 3G1YA 4CNPA 1TPVA 3L0GA 3LCGA 4GUGA 4ONVA 4JTIA 2QCDA 3G1AA 1O60A 3TA6A 3N2MA 5G2WA 3GYEA 4TMBA 3W7MA 5J5RA 2O7QA 2QJHA 1XBVA 1DKWA 2BZNA 4C1LA 4NJJA 1ZENA 3GKAA 3LCWA 3N2XA 5HR7A 2XFWA 4LRSA 1D3GA 1WX0A 3RF9A 1RPXA 3LRKA 5H2ZA 4O4WA 3R5EA 1IXPA 1S5WA 5D02A 2BTMA 3MI2A 2YX0A 5F4WA 1I2QA 5FI8A 3TXVA 3T78A 4FB7A 1EUNA 1H63A 1PL9A 1XBXA 4K37A 4S2BA 3Q37A 3KVJA 3QMSA 5I3KA 4FXSA 1QPOA 3NQVA 1JR1A 1TTJA 1H1YA 2CWNA 2YSWA 2V2DA 2NX3A 4UUIA 1ICSA 4XTIA 4FXRA 3P80A 3NPWA 3G3DA 3N9RA 3TXZA 4FNPA 1R2TA 4MZ1A 3IV3A 3TC6A 3HIJA 4CQ9A 5EL1A 5KTLA 3PF3A 5LGXA 1B4KA 1DHPA 1G4EA 5FEZA 3BPWA 1W5NA 4JTHA 1JUEA 4ZQPA 3LTYA 3LGEA 2H8ZA 2ZA3A 5CKSA 1YPIA 1B9BA 5G4EA 5LGZA 1KFBA 3MHGA 4IJBA 1VZWA 1ZCOA 5I3JA 2C15A 5CPNA 3W88A 1ZNNA 1Y0EA 4E0CA 1I45A 4FF7A 3R89A 3GX9A 2FB2A 4FNTA 4UTMA 3LERA 3G0UA 1XBYA 3GAYA 2E5BA 1QDSA 2UV8G 2YFNA 5IBXA 3ABSA 4MFDA 3TE9A 2V81A 4MY9A 3RNDA 5CZ0A 5F4SA 3M43A 3S1WA 4MUZA 3GR8A 4UCGA 3G3MA 1P1XA 5EYWA 3CU2A 3S5NA 3TC7A 2HTMA 5KSWA 4AXKA 4ZZ9A 5AHLA 2J88A 1W5OA 2PURA 1JUKA 3KFTA 4FEZA 2Y63A 1VLWA 4FX6M 5AHIA 4H3DA 4CQAA 5GVJA 4MYAA 3C0JA 4IMGA 4J9JA 4JTTA 5FEWA 4Z0SA 3NPUA 3S5ZA 2TPSA 4RCXA 3NL6A 2ZTKA 3SR7A 1XI3A 3EWXA 4UFLA 5HWNA 3N9SA 3ZR4A 1UCWA 1VYRA 3VE9A 2DZWA 3HO8A 1EWEA 5LHFA 3MJYA 3WJYA 3B06A 2X1RA 2G5WA 3LHTA 1JCLA 1FQ0A 3W7JA 4UFJA 3C56A 4JICA 4N6FA 1DJNA 3HOJA 3JS3A 1PCWA 1H7WA 1OVDA 3L0NA 4TO8A 3QMRA 4WXYA 1JULA 3PUEA 3W74A 3YPIA 3PB0A 1NSJA 3W7CA 3ATYA 1I2RA 1H7NA 4UTKA 1Q3NA 2CW6A 3NYZA 3TW6A 3SJ3A 3KOFA 5AHFA 2CLKA 1RZMA 4Z1BA 3V1PA 3NL3A 3BVJA 3OA3A 4ZVJA 3SSJA 4BI6A 1OX4A 3P7YA 4N02A 5BMWA 4Q33A 4O54A 4GC4A 2FPVA 3QQ1A 1N55A 2FPTA 2YZRA 4IXHA 4NJHA 1NF7A 5E0KA 2V5LA 4R34A 2NWRA 1TYGA 1SO6A 3LI0A 3N14A 2ALDA 2OX1A 1PV8A 4HHPA 4ALDA 3AJXA 1VRDA 3B0PA 4JS3A 3TH6A 1XUZA 3W70A 3M5ZA 2J9YA 4JNMA 1ICPA 3W7OA 1L2UA 5HWJA 3TSMA 2FJKA 5AHMA 1ZFJA 5I3IA 2VFDA 3N19B 4X22A 4FHAA 4LU0A 2BXVA 5BW6A 2WSQA 3O63A 3EB2A 4EF8A 4O1AA 4CNNA 5LSMA 3PB2A 1QOPA 1D9EA 3NPXA 2J27A 1FCUA 4U4MA 4JGDA 2YW3A 2PC4A 3LCHA 1KM1A 2F7FA 1Q6LA 4A2RA 2E5CA 2DZPA 1LM1A 3VNDA 1VCVA 1SO5A 4DQWA 5HINA 1NVMA 2NV2A 4O13A 4OBTA 1MEWA 1Z44A 1VYPX 4WY0F 2EKCA 4FNRA 3TROA 1GG1A 2BX7A 3GVGA 3H54A 3WFAA 4O0ZA 4RXGA 4IMEA 2FFCA 2WSRA 4NVTA 4DPQA 1PE1A 3TKFA 3C2EA 4HN4A 4O16A 1TV7A 4R53A 5C54A 5HWMA 1F2JA 2RHGA 2DZUA 3TQVA 3CLMA 3W71A 4JDYA 1L9WA 4NZJA 1E51A 1G67A 1LTDA 1NAL1 1G4PA 4O50A 3DU0A 4N9DA 1WYIA 3BGGA 2FTPA 3NM1A 4BFAA 1YTEA 1KLYA 4FO4A 1QWGA 3QM3A 3Q58A 1BKSA 2ZZ6A 4K8HA 5HUOA 4LTSA 2WNNA 3G8RA 3W2LA 1TQXA 3W3OA 3OVQA 4WUIA 2VEIA 3L5LA 1LLWA 5LNSA 3G8EA 3UWUA 1ALDA 2QDHA 2WO5A 5D37A 5G2HA 2WJZA 3W1PA 1AW1A 2F84A 3NOEA 4Z1DA 3HBLA 1FWRA 1WQ5A 1OK6A 4Q4KA 3NQEA 3FS2A 3TSBA 4LT9A 3W07A 4CNOA 1PCKA 4IMCA 5AYYA 1F6KA 4DF0A 3PAJA 5HQEA 3E0IA 4K7YA 5K2ZA 1SZNA 1YXYA 3THAA 3DFPA 3W85A 4O17A 1KM4A 4Y8FA 1KW1A 5IBXC 4QNWA 1P4CA 1F05A 2CLOA 3HB9A 5CSSA 3NR0A 4JY9A 2A7NA 1LRNA 3C2FA 3B04A 3W9ZA 3SFKA 1G69A 4RZ4A 1SW0A 3PSWA 2A1YA 3OHIA 4WXZA 1QR7A 2YFOA 1KM3A 4ADTA 1FXQA 2RH9A 4NU7A 1K8XA 3A21A 4ZQCA 3OIXA 1IXOA 2LLEA 2QAPA 4MJZA 1LOSA 2Y7FA 2ZZ1A 4AHPA 5I3FA 3USBA 3UZ5A 5F1VA 3G1DA 3SGUA 1LYXA 2GJNA 3W73A 4WOZA 2B4GA 3BARA 3DKLA 3NL5A 3Q2DA 1ZAIA 4ML9A 3DENA 2Q8ZA 4AWSA 2Y88A 4HPXA 4DF1A 4IXXA 3GXTA 3NQ2A 2A85A 5F2LA 2QCEA 5AHNA 1F5ZA 2PRLA 2ZDRA 3FOKA 1R30A 4JX5A 4E2DA 3NQFA 1VPXA 4PCFA 3MW7A 1GVSA 5TQLA 1HG3A 2OT0A 1H60A 2JKEA 1OFAA 1NF0A 4MPQA 1TV5A 2Y7DA 4UTJA 4HKPA 3P62A 4Q32A 3P5ZA 5I3HA 4HT3A 3W2KA 2WNZA 3TMQA 2TMDA 4UFHA 3EXSA 3LB0A 1BTMA 3C6CA 4RJEA 1I8JA 2I9EA 4JYFA 5BRBA 3HGSA 3TJLA 3NQAA 5U7SA 1C8VA 3LHWA 4Y90A 5D38A 3M5XA 2B7NA 2DZTA 2E1DA 3W7LA 4HNTA 1OX4B 2P0OA 2WNQA 3M7WA 3W7HA 1OX6A 3M47A 1H7XA 2C1HA 3W2MA 5CSRA 5DCEA 4P2VA 3TU9A 1TTIA 1B57A 4FNQA 5EA9A 3G22A 3GDTA 4JTJA 3TX9A 2EHHA 4X3ZA 3VCRA 1JQXA 1SQ7A 3AO0A 3W76A 1OYBA 1M5WA 2FLIA 4N6EA 1JRCA 3UXDA 2R91A 4WY0B 4CQ8A 4PEKA 1EA0A 3CHVA 4RK8A 1G7UA 1DQWA 3TJXA 2ZZ7A 1SR9A 2WKJA 1K7EA 4R33A 4XBSA 2B7OA 1TPH1 4O14A 3VE7A 3W7EA 5F2IA 1HO4A 5DLCA 3FFSA 3QF0A 1GJPA 3FJ6A 2CZ5A 1HO1A 3ZS4A 4NUWA 3P81A 2VFHA 1XUUA 2NX9A 2C16A 1LRQA 3IGUA 3IIOA 3PBUA 1IXNA 3ZFHA 4QAIA 3IIXA 4KFOA 4IPIA 4MKNA 5AOUA 3O6CA 4W9TA 1IIGA 1L6WA 2KZHA 4JIPA 4M19A 1K8YA 3TQKA 2AAMA 2JGQA 3HQ1A 2W79A 2H3DA 1FXPA 1WOBA 3B05A 5DN1A 2YCEA 4N2YA 3STGA 1GWJA 2NXGA 4IX0A 3RFAA 5AC7A 3W7RA 3GR7A 3QEZA 2C0AA 2BSLA 2HS8A 1VQTA 4O0KA 4JTUA 2A6LA 3MO7A 3B4UA 1OX5A 4OV9A 4AHQA 2Y70A 2GUUA 1OFQA 4K7VA 1QNVA 5EY5A 4A2SA 2E6FA 2Y61A 3GKFA 2ZFAA 5G5IA 1S5TA 1SFLA 1I2OA 1TTQA 1LP6A 3GB6A 4XWUA 3CC1A 4JD4A 2YXGA 1YLVA 3BGJA 4MOZA 5F2GA 2EGZA 3CWNA 3UPWA 5DXXA 4XTDA 4LC8A 3UNDA 2DJLA 2QKFA 4UIOA 3DKJA 3V75A 1C9DA 3KRUA 1PVNA 1KM5A 3M0ZA 3CM4A 2H6RA 1AG1O 5KZDA 3CT7A 2QUTA 4U28A 3CQ0A 2C19A 5T26A 4HPJA 2PCQA 4L4LA 2AGKA 2X1TA 3THQA 1Q6RA 1WV2A 3P8JA 4YWIA 3IEBA 1G7VA 3QMTA 1OHLA 1XDMA 2BLEA 3ANYA 4I7UA 3TMLA 4DELA 6ALDA 4O11A 3B0VC 2A7RA 4OV4A 3UXAA 1J2WA 5KZMA 4TX9A 3UY7A 1SUXA 1WA3A 1KTCA 3QW4B 5D33A 4EOUA 4MZYA 3EWYA 2R14A 4O8RA 3T7VA 3W1UA 3FYOA 4HNVA 3S42A 2NZLA 4Y6GA 1THFD 1YDOA 1ICQA 1WBJA 3LLFA 2FPYA 1KFCA 2WV8A 4UXDA 3TIMA 2OT1A 3EX4A 4B5NA 4GUJA 3UQNA 3UYCA 3FJLA 1VYSX 2A5HA 1NEYA 1GVQA 4IPJA 1QPRA 3PG9A 1G6CA 2NXIA 1ADOA 5D2WA 3P84A 3IGSA 1HUVA 1R46A 2DP3A 2CLHA
chains in the Genus database with same CATH superfamily
3W6MA 5HOSA 3H4GA 4S39A 3ZWTA 1JGIA 4WX2A 4R88A 1JXKA 1VJZA 1EBGA 2REQA 5I7GA 4UOJA 3T42A 4IQEA 2ISVA 3GW3A 3FKKA 2QPSA 1VIWA 4XKYA 1UUMA 3TNOA 1V4YA 5DBUA 3PM6A 1O5QA 3GXDA 1WCGA 4MMWA 2VFGA 1XM3A 2YB1A 1LRTA 2HCVA 4CQBA 3ME3A 3RX2A 4PRTA 3MP4A 3IIVA 2XM2A 4I8YA 4NJIA 4IPLA 4HA4A 3LOTA 1EIXA 4M3PA 4HA1A 2Z7GA 5SWUA 3S6DA 1UR1A 3S2CA 2V5BA 3EX2A 3SY5A 3C2OA 2WCAA 1RCOB 1A5KC 3STEA 3EWUA 5A6BA 2YGYA 3D5HA 4L61A 2OKTA 2D2GA 3PBWA 3S5OA 3TTQA 4MTVA 2CZEA 3TLLA 4X0VA 5DY3A 3L23A 1GVFA 1KGXA 2EPHA 4LVDA 1A5CA 3SIMA 4JL1A 3OLDA 4S2CA 2GVGA 1E15A 1O5XA 5C9WA 3GHSA 1H7PA 1C92A 2E3ZA 2PTWA 2WAGA 1H1NA 4LNCA 1GTHA 2V8ZA 1Z89A 3UWWA 3DHFA 1TREA 4ZTYA 4O15A 1KQYA 1JPIA 2Y89A 1JUBA 4HMCA 1P7TA 5E6ZA 1P0KA 3WK1A 5DMMA 1QI0A 3OBEA 3NQMA 3TYAA 1KFLA 2OLHA 8TIMA 4Z2GA 1GW1A 2VURA 4KFNA 2GQ8A 3C8NA 3CYJA 8CGTA 3QVQA 4QISA 2Z26A 3RILA 4IX2A 4UZUA 3LM3A 4TTGA 5C9XA 3O3RA 1CNVA 1V02A 4F79A 2QUVA 3QC0A 4LUJA 5BWFA 1R7AA 5EPDA 1ISXA 5CLTA 2E6DA 2CHOA 1XCFA 3VCNA 4FOKA 4A21A 4BI7A 3NSXA 1Z41A 1I6NA 1Q13A 4ERIA 1NWRA 1RJPA 1TZ7A 1X7FA 3BOXA 2H9AB 1SFSA 3AHTA 2MNRA 5F1UA 4LB4A 1KCXA 1ZAJA 3MBFA 2EPNA 3A24A 1QUMA 1BYBA 1RD6A 3NZRA 5HDRA 1X1OA 4UQEA 3GXPA 4HSHA 1F74A 1HKVA 4UNLA 3HGRA 3V0SA 1P0NA 4M1BA 3PC0A 2VENA 2QMKA 3UWQA 3R0KA 3CTTA 3EDJA 2NLYA 5T9CE 4GCAA 5I03A 1V93A 2CFFA 3QOKA 4AC1X 3ENLA 4UQ9A 3WBWA 3G1RA 4GISA 3EOSA 1WZKA 3F7JA 3LK6A 2VZSA 6ENLA 1YMYA 3W1AA 1QI3A 1VPQA 4E2OA 2I1OA 4A29A 1UMLA 2WZMA 1XSJA 4RX0A 4M0XA 1ZJAA 3TJIA 3LHVA 1CXIA 1CBGA 4ZXLA 3WK3A 4IPPA 5CPMA 1EUAA 2NX1A 1UD5A 1WP6A 1JFXA 2VEPA 4IIHA 7ODCA 1XLDA 1ONRA 3WFZA 3GFZA 1NQ6A 1SSDA 3KP1A 3PP7A 4OOUA 3WCZA 3EDEA 3WKZA 2D24A 2YOCA 1BD0A 4NXSA 1HKMA 4KIEA 1NWSA 3AHZA 4JX4A 2BGSA 2PF8A 5K3VA 2FQIA 2HK0A 3SN1A 4WJEA 4RKAA 4O1FA 3WQOA 2Y62A 4OU1A 4ZFCA 4I9AA 4WR3A 1N82A 3H2EA 1R5YA 4MWAD 4O53A 2XFYA 1R3TA 1K03A 1HL2A 3PBYA 3DXIA 1E6RA 5LA0A 4ZODA 4WJXA 4FSAA 5HATA 2BWGA 5H6HA 1SM9A 1BTCA 3O8AA 2OELA 1F3TA 4YCPA 1KFEA 2HVOA 2VCAA 1S2VA 2NVAA 1TPUA 4FNUA 3CUXA 1UR0A 3B9OA 3R6IA 4HYRA 5HBFA 4X0NA 5LNVA 2CESA 3HG2A 1REQA 4CD5A 2G4FA 1PO9A 4WD0A 4F2UA 4YYCA 3HGOA 4MLJA 2D73A 2OG9A 2QXWA 4IGHA 5FF3A 4MJ2A 4PL2A 5FF7A 3WY1A 3SI9A 4CNUA 2ZDSA 5I6SA 1GW9A 5FAGA 4W86A 3BW4A 3RU6A 4JEJA 2Q8LA 4EWJA 3D3AA 3DG7A 1GHRA 3U3HA 1PYMA 3GD6A 4IG2B 5ABGA 3O1NA 3WLIA 5AB3A 1B3YA 1HIZA 4QJ3B 4GY0A 5JH2A 3GXNA 3N25A 1T5AA 3U7VA 3SRHA 4AD3A 1AZ2A 1JCNA 3SADA 3NEHA 3WLLA 2DSZA 4PMRA 4FAMA 2G41A 4S3DA 3WQVA 2NSXA 2IXUA 2R94A 1GQNA 1W17A 1TA3A 3LM7A 1Q6DA 3GY1A 3A4XA 3VC5A 1OG0A 3NSMA 1CGYA 2JFEX 2NLIA 2GVYA 2J24A 3LCXA 2DQWA 3E12A 2J6VA 3GNRA 3HMJG 3O06A 1QFEA 2XGZA 3GIYA 3VIKA 1MZHA 1EQPA 4IIEA 2B0MA 1CDGA 5JIPA 3A3HA 1JDDA 4XZHA 1RQBA 2NT1A 1TWSA 4H01A 2V3FA 1JYXA 1BYDA 3CL7A 1JD7A 2Z2BA 1QNPA 3U2OA 4HPGA 4QP0A 2RKXA 4BQ3A 5EBUA 1LBLA 1RD5A 3ARTA 1EEPA 3M5VA 1W56A 4C6BA 2VFFA 2ZA2A 1LCOA 4HPHA 5ABTA 1ZBKA 1B9ZA 1P48A 3QOMA 4CGTA 1XYBA 1UP3A 5HJLA 5LIKX 3DHPA 1GTEA 1DE6A 2X2YA 2V6AA 5I77A 1W3KA 5C2XA 3ITTA 4GXWA 4QJ5B 4MYXA 4ERGA 4DBDA 5E09A 2NQZA 1OGSA 2TAAA 1FH8A 3FEQA 2A4AA 5LZLA 1TUFA 1U33A 4H6KA 1KXHA 2Z1BA 4ZA0A 3SCOA 4HYWA 3LGDA 3OP2A 1XLFA 4LFYA 4DZHA 3Q65A 4AXNA 3R2GA 2NQ9A 1LOLA 1TMHA 4N42A 1MXGA 5J8LA 3IJ7A 4GBDA 5CJNA 1I2PA 1DWIM 4AUBA 4TU1A 4QCEA 4TVCA 5KEZA 1BVWA 3LPOA 2PA6A 2XN1A 1ZGDA 3SRFA 2GGEA 4O18A 1W3NA 3GDMA 2QJMA 3H6OA 3MZNA 4RE2A 1GT8A 4GFIA 2NUYA 1S5MA 3A5VA 2PU1A 3XINA 4JZ5A 1DVJA 3U57A 1UA3A 1FP9A 3GNXA 1H62A 1W54A 4HJFA 5C55A 1S2TA 4FLRA 1KM0A 4JPGA 2QEZA 1EQCA 4NY2A 2O9OA 5FAJA 4AY8A 1VS1A 1FWTA 4US5D 5DCDA 3TZFA 3B03A 1ZUAX 3N9KA 4P7NA 4DO5A 1YXDA 3NQDA 1UROA 4LRTA 3E74A 3LHZA 1M1BA 5HUPA 2VC6A 3AU2A 3CL6A 2DIEA 3TNBA 5LHEA 3BW2A 2C13A 3CB8A 4MKSA 1GKRA 3CO8A 1FFRA 2VZUA 1KWKA 1IIHA 3ALGA 1NM9A 1G4TA 4CCEA 3DFOA 4AVFA 3P60A 2B7PA 1E1EA 1QNOA 4TIMA 3HQOA 1O95A 3GDRA 2WSYA 2AMGA 2JKAA 1TQJA 5DRCA 2V5JA 3ARUA 2PF0A 5AECA 2Y5SA 3T05A 2AKMA 1C3FA 3M5YA 1QWKA 3NEVA 2XGBA 5LYRA 3CIWA 1FWBC 1Y8BA 2GJXA 3W1RA 5A6AA 4KWWA 5FESA 2Q09A 3NA8A 3F4WA 4ZQOA 5FJUA 5AC5A 2Y24A 2C1IA 3M0XA 2V82A 1JJKA 2VC9A 2E68A 2QGYA 2VM8A 1GORA 2V3DA 5LIWX 3B8SA 2EQDA 3NCOA 3QHOA 4C1KA 2E7FA 1T40A 1C9WA 4INFA 4DO4A 3EKZA 2G37A 4HQVA 4XAPA 1KA9F 3BLEA 2YCLB 2GOUA 4XX6A 4G2DA 1NDZA 3JR2A 1ZJBA 3T0DA 1XINA 3HPSA 4GQRA 1EOMA 2GZXA 3OVPA 2GQ9A 2ZRVA 3PNZA 1FH9A 2J7DA 2W4XA 1PUDA 4U3CA 3BTNA 3N4EA 1L6YA 4QJ4B 1R0MA 3N29A 4ZL1A 3UJFA 2E0PA 1F61A 3KCJA 5DF0A 4Z2HA 3WUEA 1K9FA 3QH2A 1O66A 1TV2A 2Z2AA 1PZ2A 3OEXA 4OWGA 2Y8KA 3KWSA 3P6LA 5DELA 3P14A 1UWIA 1IEWA 3IWPA 1OEPA 3G0SA 1GOKA 2ZC8A 1BXBA 3PUOA 3LRMA 4L1WA 3A22A 3PJXA 3PBMA 3W53A 4P8WA 1CGXA 3HMCA 2PMQA 2F6UA 4YVXA 1GG0A 5E5CA 3W2JA 1KQZA 4QEHA 1US3A 4AF0B 7XIMA 1MXSA 3W25A 1JQVA 4K2SA 3RLUA 3UD6A 1I75A 3E02A 4UR8A 1D3HA 3RRXA 3KXQA 5KITA 1GOXA 1HP5A 3T8QA 4MF4A 5K9CA 4EF9A 3BSGA 3MI6A 3B40A 4QGCA 4QROA 2F8QA 3CAVA 1GHSA 3AC0A 4QG9A 1EXPA 3BAJA 2A79A 4IF2A 4Z1AA 1ZBCA 3VABA 1TIMA 3NTYA 5M2FX 1O12A 1A5SA 2A3BA 5G2IA 1R9ZA 3MMTA 6XIMA 3OZPA 4HSNA 1Q5MA 2WM1A 2D3NA 5A6MA 1PX4A 4F48A 4G8TA 4DF2A 4AEFA 3G24A 2JKPA 3E96A 3SGZA 2PDXA 4TX6A 3T2PA 4QE1A 4F66A 3GG0A 1W5QA 2QUUA 4AQLA 4GQ0A 2ZZ4A 5HULA 1X6UA 4J3WA 4DJEA 2ZRUA 4HNNA 1YPFA 3NGJA 4AMAA 2GJLA 1IT0A 1IWAA 3ZMRA 2OQHA 4WLCA 1XLIA 2W3ZA 4IL2A 3TN3A 1EPVA 4EPDC 4QQ3A 2XUCA 3QFEA 4GUHA 4O12A 4GWEA 1HF6A 4AHOA 3H22A 1A5OC 5A6SA 1RPKA 3AIVA 3DHUA 1RY8A 4QFUA 3QY6A 3VM5A 4KRUA 3N12A 3UVAA 1FWWA 3ANVA 5HQLA 3S2MA 1B3XA 2WMJA 2P3ZA 3GXMA 4FK9A 1X1ZA 3OVRA 3QQ0A 5EFFA 4BF7A 2D2HA 2YR1A 5LKYA 1Q7ZA 1GOIA 3TCSA 1DWHM 2BODX 3E2QA 1JAEA 4YS1A 3H7RA 4LPCA 4R7WA 2I16A 3ARVA 2CBUA 4AD0A 4DI9A 2AKZA 2BHYA 4QCFA 1YYAA 1CX9A 3WMBA 5HNUA 4M5PA 4DYKA 4DZIA 1V0KA 3TYZA 1UC4A 2BOGX 3TFXA 5IRPA 1QNSA 4EE9A 4PB4A 3PZVA 1RV8A 4J3ZA 1XC6A 3UWZA 1HN1A 5AYXA 2PDPA 4D6GA 4QSHA 3S5SA 1XRVA 3QSTA 2VNCA 1OFPA 2C14A 3L4YA 2E1WA 3PPGA 1XX1A 1SZGA 4QM1A 3V16A 1FA2A 2FTWA 5LNWA 2WPGA 2QCGA 4H2HA 2ZXDA 3TTOA 4IUGA 5BRQA 1BQGA 1JRBA 3GLCA 1BGGA 2BG5A 3ZM8A 4UTUA 1YADA 4J1OA 2VXNA 1X8CA 3CQKA 1P0EA 4FI4A 2HK1A 3TYUA 3MVIA 2FFIA 4RL3A 1W2PA 4EXQA 2FHCA 4RZBA 4Z2LA 3VINA 1BWLA 3C8FA 4MWAE 2ZUVA 3RM4A 2DJXA 4OVXA 3EXTA 3W1NA 4KETA 1JCYA 4AW7A 4WIWA 4PMUA 1Z9AA 2OZTA 3WH5A 2WLYA 1RLCL 1J11A 3W1LA 3ZR6A 3P93A 1B3ZA 4B2DD 4C7FA 1OFRA 3VILA 1XF0A 3LX9A 3DFQA 3W4RA 5D2XA 2VEGA 2ZICA 4H83A 3VZZA 3JRKA 2Y85A 3WEZA 3H7VA 4LWWA 1OCJA 4CN4A 1L6FA 3WK2A 3TAOA 3CPUA 1RBLA 1TTPA 1MFUA 3HG4A 5L6UA 1IR2A 1TV8A 1DBTA 1I0BA 3O16A 4J3XA 4HNLA 4W7UA 3VKDA 1ZBWA 1VFSA 4YPJA 3CT2A 4Z2KA 3BOFA 1VHCA 3UY8A 4K39A 1DJGA 4WJ8A 3EA2A 3AROA 5EMLA 1EEXA 3H53A 3GE7A 4DWSA 3QRHA 4X2RA 1FH7A 4LS2A 1VF8A 4GYPA 4QITA 1TPVA 1HW6A 3L0GA 5CAHA 1VFHA 4ONVA 4JTIA 4N0RA 2QCDA 5G2WA 3OVGA 5HA7A 3ZLHA 4L64A 2OR2A 3AZRA 1Q63A 4W7VA 3ZVHB 4NJJA 3WNLA 4DJEC 3LNPA 2VCBA 3LCWA 3TZNA 5HR7A 5CG0A 1WX0A 3SQSA 4GY1A 4RNFA 3LRKA 1IXPA 4TV6A 2INZA 1MFVA 4FB7A 1EUNA 4S2BA 4KEVA 1M03A 3O0FA 2W9MA 1E1CB 4LAMA 1JR1A 3SUUA 4N7QA 1H1YA 2YSWA 2CKSA 1CZ1A 1WZLA 4WDXA 3WQPA 3RCMA 4YJ5A 4KIRA 3G3DA 4C6EA 1IEQA 2IKJA 2PZ0A 4FNPA 3TC6A 3HIJA 5I23A 1TWWA 1V6YA 1B4KA 1DHPA 1G4EA 1XIMA 4UNIA 1QBAA 1R9YA 4ZQPA 3LTYA 3WD1A 3GVVA 3MMUA 2ZUUA 1ITCA 3MHGA 1XISA 3QBUA 3L2LA 4UB9A 3W88A 2HQAA 4Y9PA 3RM8A 4D72A 3UG4A 3R89A 3CH9A 4JNYA 2FB2A 4FNTA 2WVVB 1RH9A 3LERA 4UTMA 1X1NA 1XBYA 4YIWA 1QJWA 2E5BA 3BZGA 2DFAA 3B9AA 3ITCA 1UR3M 3MT1A 4NASA 2OYKA 3C2YA 3M43A 3WQ4A 3IGHX 1E0WA 4UCGA 2JIWA 2OEKA 3A4AA 3BMVA 3TC7A 4GZIA 2HTMA 4HP5A 4ZZ9A 4OJYA 4PB5A 4QQUA 3B0YA 3EMZA 4KRZA 1R3SA 3KFTA 4FEZA 4NRRA 3E1F1 4MPKA 4H3DA 3A3XA 4JTTA 4J2PA 4Z0SA 3MDUA 1KB3A 4UWMA 4RCXA 4PMYA 4UOZA 1JZ4A 2ZTKA 1ZU8A 3AZSA 3EWXA 2YA1A 3WQ8A 3BJTA 4I9JA 2BB0A 4HBKA 3POHA 1C7TA 2NQ5A 3Q67A 3ZR4A 4ZB0A 2P76A 3MS8A 2DZWA 3RR1A 5DQPA 3ECQA 3K1DA 4HK6A 1Y7VA 4LCSA 1W3HA 5LHFA 1VEMA 2XH0A 3M7SA 1UH2A 5BWAA 2G5WA 1JCLA 1M7XA 4UFJA 1DJNA 3JS3A 1H7WA 2FTYA 5I00A 3QQWA 4DBSA 5CZKA 1JULA 3PUEA 3YPIA 4I6KA 4UTKA 2P50A 1MVYA 2XVKA 3NYZA 3KOFA 3ZJ8A 4GHRA 5GQBA 2CLKA 4XAGA 4WKAA 1RZMA 4Z1BA 3NL3A 2HWGA 4TX8A 3AMGA 3SSJA 3M0KA 1OX4A 3P7YA 4N02A 4Q33A 3LBOA 3MMDA 2FPVA 1N55A 2YZRA 4NJHA 1NF7A 1RBOB 2HROA 4R34A 1IT7A 1SO6A 1DJWA 2OX1A 1B2YA 1UKSA 3FV9A 3AJXA 4ALDA 2OQLA 3M5ZA 4ZTXA 2J9YA 1AJ0A 2FJKA 4IZGA 5I3IA 3GNOA 3IJIA 3FJNA 4LU0A 4DJFA 5BW6A 2WSQA 3HPAA 1FWCC 3I3EA 4O1AA 2IUZA 4DWSC 3NPXA 5HPCA 2J27A 3LMYA 1FCUA 4U4MA 4GYPC 4WKHA 5HJXA 2PC4A 2F7FA 2DW7A 1Q6LA 1YE6A 2PDJA 4PMJA 1JDAA 1VCVA 3WH9A 1E1FA 1VYPX 4WY0F 3OBAA 2EKCA 3R0DA 5CBBA 3M0JA 2X0HA 2BX7A 4H1ZA 1P0BA 3SRKA 2WYSA 3I4KA 1UQZA 4NVTA 3UJSA 2J75A 3H2AA 2WMGA 4O16A 5HWMA 1F2JA 2RHGA 3TQVA 3CLMA 3AFBA 1X98A 4PUUA 5M3WA 3VXGA 4F9JA 4HVXA 4PTVA 4N9DA 1WYIA 3BGGA 4BFAA 1KLYA 4FO4A 2W67A 2CIPA 3Q58A 5MKGB 1BVZA 4K8HA 2YCJA 4LTSA 3SCNA 2VJXA 3L5LA 3CL8A 3OZYA 4C65A 5LNSA 5IOBA 3B8TA 1ALDA 2QDHA 4KS0A 4Q4SA 3W1PA 2F84A 1CXKA 4Z1DA 3HBLA 1FWRA 4F4RA 1WQ5A 2EPLX 4PFHA 4HOZA 3FS2A 3ZYZA 2P0IA 1Q7QA 1QT1A 4DHGA 3ZOAA 4IMCA 4I8DA 3DFYA 2X42A 3NO3A 4NZ1A 3E0IA 1CGTA 4IIFA 3R8GA 4CVUA 2YDQA 3FA3A 4X2PA 4PRRA 3PWIA 3DFPA 2GGIA 1KM4A 4Y8FA 3WQGA 1V8EA 4ES4A 5B80A 4QNWA 3MSGA 1Q6GA 1UD3A 1UWQA 3U4AA 2VGBA 2UY4A 5XIAA 1AD4A 3B04A 3RX3A 1EJTC 1G69A 3AHVA 1SW0A 3MQTA 2XZ7A 4XZIA 3OHMB 4MNJA 2RGLA 2RH9A 3CUHA 2PWEA 5AC4A 1WKEA 1XICA 4ZQCA 3OIXA 4LXFA 1IXOA 2LLEA 1UJQA 1LOSA 2HNEA 2Y7FA 2ZZ1A 4IFOA 3VUSA 3HJEA 4AHPA 5I3FA 4JN7A 1JCTA 1V77A 1LYXA 1VBRA 3W28A 4YTTA 4WOZA 2B4GA 3DKLA 3KWXA 1F6YA 4AWSA 3DENA 1DEDA 2Y88A 3VGGA 4PE8A 2O4MA 2G3NA 4GYKA 5AHNA 1BXCA 3ARRA 5FIPA 4E4UA 1S39A 4L6DA 3NQFA 4GYFA 1GCYA 1DHKA 1H60A 2CPUA 1OFAA 1SJAA 4MPQA 1BAGA 2O0TA 4CQCA 5I78A 4HKPA 2PD5A 2WHMA 4E4FA 3WH8A 4OFCA 3CH0A 1YKWA 3V0TA 2IS7A 4C91A 5A6BD 1TKKA 2ICSA 4Y9OA 2TMDA 4UFHA 3PJUA 3EXSA 1BTMA 3C6CA 3EYPA 4EXBA 1I8JA 3RU8X 5BRBA 1PTAA 3TJLA 3NQAA 5T91A 5U7SA 1C8VA 2B7NA 2BGQA 2DZTA 3FK4A 1MNZA 4TXEA 1H7XA 1LF1A 5M03A 1E5JA 3W2MA 3BICA 4P2VA 1YNQA 3G22A 1GPFA 1JYNA 2AQVA 2DV0A 4Z17A 3W76A 2FLIA 4LB3A 4N6EA 1KD0A 1UPPA 2C8NA 2W62A 1P7TB 4RK8A 3T09A 1DQWA 4DJFC 3TJXA 1J6OA 4ZOAA 4GX8A 4U2YA 3VE7A 1HO4A 4ACZB 3FJ6A 4JCLA 4D9PA 1JAKA 1T6MA 1XUUA 2A3AA 1SYTA 1LRQA 1IXNA 4QAIA 4MKNA 4KFOA 4GJJA 1RA5A 1PDZA 4OKDA 1JNDA 4B5XA 3F2BA 1OZQA 1J0YA 4RDWA 5IXEA 1FXPA 1WOBA 4U3AA 4QDMA 4AISA 5DN1A 4N2YA 1GWJA 4BQ5A 4IX0A 4RNJA 3ZO9A 3GR7A 3QEZA 3VZXA 4F0LA 2V67A 3B8IA 2GDQA 6XIAA 2HS8A 4ACYA 2VEFA 4JTUA 1UKQA 2Z27A 1ZQ5A 1FP8A 5A8MA 4AMCA 4JAWA 5I3DA 1FHLA 1QNVA 4WDUA 2UZ9A 2PAJA 1RCXB 4GIEA 2F6KA 1SFLA 1I2OA 4F8XA 1LP6A 3GB6A 4UQCA 3DOPA 3CC1A 6PTDA 2FGBA 2YXGA 5F2GA 2H9AA 1GOQA 4L1XA 1ECEA 1JF6A 2DJLA 2EG6A 5D9PA 1C9DA 2J62A 3KRUA 3WD3A 4OECA 2H6RA 1AG1O 5T26A 4HPJA 2PCQA 1KBKA 1FWDC 2X1TA 1Q6RA 3J7HA 4YWIA 1Q8JA 5FOOA 5FA5A 4DZAA 1OHLA 4QLLA 1F4HA 4J27A 6ALDA 4O11A 3E5BA 5KZMA 4TX9A 4GCXA 5FSDC 3QW4B 2J66A 4MZYA 3QV9A 2Q6ZA 4O8RA 3W1UA 3UR7A 3FYOA 3UXIA 4Y6GA 1TV3A 1WBJA 1XYAA 5HNTA 2WV8A 3S4TA 4UXDA 4CU6A 1VYSX 2A5HA 3STPA 3SQLA 3DFHA 3ID7A 4IPJA 4GO9A 1DWJM 5HMDA 5HJYA 5D2WA 1W9XA 2DP3A 2CLHA 1FWAC 3W00A 2IKGA 2Z6JA 3H2CA 3QLLA 5D30A 1P5BA 4HIBA 3VD3A 3DYPA 2HPMA 1F3XA 5C7HA 2DT0A 3QKEA 1ISYA 4YMZA 1JGMA 3WDQA 5HXMA 1QW7A 4B3LA 4H8NA 5I09A 4EPKA 1NY1A 4B5SA 4DO6A 2VD8A 4JTGA 2YL5A 3ORWA 1H7RA 4LGXA 1PIFA 2V5DA 4KGLA 3GU1A 2PE4A 4JIHA 5CGTA 4KWVA 1JZ5A 3MWAA 3ES7A 4HPNA 4JEQA 3L66A 2HISA 1T96A 5JXQA 2INFA 1OD0A 2PLCA 2V3EA 4Q8TA 1CPUA 3OU8A 4LAZA 3LA4A 1UD6A 3CZGA 1K9TA 1CB2A 4EPBC 2G96A 1CGVA 3VNZA 1O5RA 4Z1CA 1TA3B 1G0CA 4YU1A 4NX0A 1N7KA 4IICA 1VBGA 1VBJA 1UD8A 1KFKA 2VVSA 3T40A 5G1TA 3MUAA 3PHAA 4PTXA 4Q8WA 4WDTA 1F6PA 3BOLA 4WY0A 3LQLA 3SJNA 3U5UA 3KDOA 4ICNA 4AX7A 4LCQA 4XIMA 3IAPA 3AYVA 2Y5JA 1F4AA 3GR4A 3RYSA 3WYZA 4UTHA 5D32A 2YLAA 2HNHA 2WBKA 4J40A 5E6YA 3E9AA 3L4XA 1QPQA 4PFMA 4C6DA 1UZ1A 3KHJA 1KGUA 1ESWA 4KEZA 4Y9NA 2ODOA 4C7DA 2WVTA 5CZTA 1QO2A 1XLMA 2EO7A 2DT3A 2ZVRA 1A5BA 3VGEA 2OWWA 3CPRA 5EMKA 5MHBA 1PTDA 1DWGM 2VP8A 4MLRA 2YB4A 2OX4A 5C8BB 1JYVA 2V69A 2O55A 3BG9A 3UT0A 3F2CA 3W84A 3LDVA 1DV7A 4ZO9A 3VIOA 1AQMA 3MSYA 3SBFA 3UP8A 5AYBA 2V9DA 1HJVA 1J6PA 1IXQA 1E6XM 5D05A 2PRHA 4PL1A 1DORA 1XL9A 3NG3A 2WXDM 4US6A 3WLRA 1O4UA 2RJHA 1W0MA 4JTCA 4E38A 2DORA 4QAWA 4QE4A 1OINA 3BGAA 1OFDA 4L4MA 5AYIA 1W6TA 3F4NA 4LC6A 2DVXA 1FDZA 1MO0A 1EF2A 4AB4A 3LXCA 1UWRA 1SSGA 3R8RA 2NV9A 1GVRA 1C29A 4M51A 1CGWA 4M6QA 1LL7A 2NSOA 3D46A 5CC7A 1XGZA 2Y6ZA 2CLIA 5K4XA 2PDGA 2POTA 2WHKA 3M9YA 3L7RA 5D2TA 2VR4A 4I7WA 2CKRA 4NG3A 4RE4A 3UPMA 3GC4A 4Q4PA 1SZEA 1ZY9A 3AICA 2QCCA 3MUXA 2YW4A 2EPOA 3HGJA 4MHBA 3S0CA 1H51A 2R1NA 3GNNA 3W75A 4O52A 2BGNE 4A8RA 2G97A 5BXPA 3L5AA 4IIGA 3U9IA 1DJYA 4HZMA 1XH0A 4GVIA 5HK4A 2ABAA 4RDZA 1W1TA 4C6PA 2GGJA 1TPDA 4JTRA 3TEVA 4UR9A 1GYNA 4M24A 1GOMA 4PMNA 2GQAA 2VX4A 1SGJA 4KCWA 1VR6A 2QJIA 2VZVA 3N2BA 4KT2A 3U4FA 3MJMA 3IJ8A 4DPPA 1OGBA 1ZHAA 3GNPA 1Q8AA 4GI9A 1UB3A 2XSBA 4NNCA 1XRFA 3HU7A 1PKYA 4ENLA 4H2CA 1GVYA 1ODZA 2V0TA 4YN5A 3CAQA 3MKVA 1V6WA 1SVDA 4NQ1A 2PWGA 4NZ3A 5I06A 1MI3A 4A3RA 5A2BA 5GJNA 4ERAA 1FWSA 4RZ6A 1E0VA 2B7QA 3SCQA 4C6LA 4PTDA 1KRAC 3T4CA 4AWUA 4JR5A 4PBGA 5KETA 3QZ6A 2XYLA 2GLKA 3RUBL 3PUDA 1ITQA 1QNQA 3GIQA 4WK9A 2C0HA 1TJ2A 4NAFB 2NV1A 3CMFA 2IKIA 5F2MA 2GDUA 5I3GA 2OJPA 3JVAA 2YCLA 2WB5A 4MVAA 1B90A 5I0DA 3CMGA 3JU2A 1NFPA 4IIDA 5KINA 3WBAA 1WE5A 3NL2A 1SZFA 1EX5A 3GZ3A 1KRBC 1OCNA 4Q6XA 4G9PA 1SU5A 4MKVA 1ZBVA 3W7QA 5D09A 1QW9A 4CLMA 2ZZ5A 4UTTA 4J7RA 3R79A 1F76A 3UZJA 1XGDA 1QO5A 3LI1A 1J5SA 3QYSA 5ABFB 4PSPA 1UD2A 3GVWA 4NZFA 4P61A 1S5VA 3V35A 3VMOA 3GFXA 3GK0A 1N8FA 4DIAA 2YDRA 2YBUA 5FCZA 5CJ5A 1E71M 2WSKA 4M80A 3UEQA 2YKKA 4CEUC 1O5KA 3VYLA 4LUSA 2HMCA 1KBLA 2PZNA 1HKIA 2E8ZA 4CD4A 3ONBA 4CCDA 1UD4A 4HB7A 2P8BA 4AF0A 2WK2A 5L9FA 1B5TA 3W26A 3ZLGA 1JZ7A 2VDHA 2YYTA 3VC6A 4FIRA 1MW0A 1U30A 3NURA 3PANA 4D6CA 5DO8A 1BKHA 1V02E 4DJED 1IV8A 5AC8A 3ZZ1A 5REQB 1SO3A 1S5NA 4MNMA 6TAAA 1EGVA 2JGYA 3LXBA 3PZ9A 3KVKA 3URAA 1BF6A 4A22A 3BSMA 2RFGA 1JDFA 3UVIA 1UMYA 1TPFA 3CQHA 4M6VA 2OQYA 3N04A 3UG3A 2HVNA 1MZRA 2PDQA 3L4WA 2ZE3A 3FYPA 1MRAA 3DERA 3WLHA 3OZMA 3M64A 3WUGA 1OGGA 3KTXA 2P53A 2Y7GA 3W2UA 5A94A 1Q6CA 3C3NA 1W32A 3BO9A 4Q3MA 2VEKA 4GBUA 4Z1YA 2PDHA 4DUOA 5HR6A 2OOFA 4EIVA 4CD6A 3D0CA 2ZWYA 2GVLA 3WN6A 1DTUA 1XC4A 4ICCX 4PULA 5LNUA 2BMBA 3NAVA 4GKTA 1EP3A 4FIQA 3HA1A 1GKPA 2Q02A 2O9TA 2X1IA 3EX3A 3MHUA 1V0MA 4IMFA 1OG6A 2QCHA 4EVZA 1AH3A 1E6ZA 4PUKA 5AN7A 3GG1A 2W0UA 3HF3A 1ODUA 1VGAA 1XW8A 2ZZ3A 5TAOA 3NVTA 3QR1A 2F2HA 1OT1A 4NNAA 3I7QA 3BLFA 4Y96A 1H61A 3PZGA 4L7ZA 4LS0A 5TIMA 3PS7A 1AL8A 4AU0A 3DECA 2Z1VA 4EKJA 3FEMA 3EWWA 4F0MA 1SFJA 1H7OA 1QBBA 4N4PA 1AL7A 1UR8A 5HMSA 1U5VA 4RPQA 3O15A 3N4FA 3MSRA 5EMUA 1OF8A 4IUOA 1EB3A 3I6RA 3XIMA 9XIMA 3R13A 4F9DA 1XIHA 1HFBA 4YTSA 1XIGA 1K1DA 4M1RA 2NWSA 3OIHA 3LD5A 4D8ZA 3L12A 4M82A 2V2HA 4DUVA 3VOJA 1UW9A 2ZUMA 1ME7A 3F1QA 2I5GA 3LMZA 4K38A 3OBKA 4BZYA 1VRXA 4GGBA 1QMLA 1AQHA 2OEJA 2YBTA 4S3CA 4ROPA 4GQGA 5KZEA 1XBZA 4HU0A 1DOSA 3G1SA 4RDVA 4XZNX 1IF2A 1M7OA 5FJIA 2PWFA 4UTTC 4XK2A 5CC5A 5AHEA 5J5DA 5K9DA 4CD8A 4DB7A 3ARZA 5PTDA 2BY2A 4DY1A 5HAOA 4DYEA 2AGTA 3PJWA 2E67A 1MXDA 1BWKA 4N4QA 1S3HA 2CBJA 3GO2A 5CBJA 4L80A 4DWSB 3CZEA 4MY8A 4Z0JA 3GC5A 1Z32X 5E0CA 4O1CA 1HKWA 5C6MA 1A5AA 1DIDA 1I1XA 3WK0A 1I4NA 2QCDB 2CZDA 1XIBA 4R5EA 3MUY1 1ONXA 1NTHA 1ZTVA 3AMDA 3PPFA 1QU4A 2F2KA 4GH1A 1PKMA 4CVWA 2PGRA 3ARSA 4NSBA 4FA3A 3AIBA 2AQOA 3E3HA 1EC8A 5D4YA 2J7EA 2A7PA 1JPDX 4K36A 2PBOA 1K9DA 4C7GA 2Q3RA 3IS4A 4PMQA 3RM9A 3C4UA 2J4GA 3QPYA 4E8GA 1QPNA 1J0ZA 1R9XA 5D2YA 2NVDA 3WFLA 4U2ZA 3W01A 1QOXA 4PYSA 1S2AA 1N8WA 3T0TA 1TCDA 4MB3A 1WDWA 3RIKA 3MYOA 3AU6A 5C9UA 5LNRA 2DPEA 1OFOA 3HFTA 4O0QA 4JHOA 2WCSA 5HMEA 1KM6A 4M6PA 3QW3A 1HVXA 4BR1A 1KXQA 2ACSA 4IMDA 3KL5A 2J7GA 3L67A 4W4QA 1B3VA 3NNTA 3CPGA 4LF1A 3L65A 3OLGA 1E1CA 3SUVA 2BFGA 1EDTA 4YTQA 1ZLPA 1OQFA 5GNYA 1HXJA 3SRDA 1JCJA 2CLFA 1D3CA 3EWBX 1LQ2A 4I5RA 4LVFA 4P8UA 3N34A 3SZ8A 3W7KA 1M01A 3TOPA 1QI5A 3WLJA 3QKZA 2XG9A 1UWUA 5DCBA 3WUBA 1XV8A 3WQWA 2JBMA 4G1KA 1J0KA 2J9XA 3DFTA 3PSVA 3ITOA 3LEPA 2WVVA 3S8HA 3EXRA 3HV8A 2WJEA 1EL3A 1VC4A 4RV8A 2ONEA 3SCWA 4N9EA 1XKJA 2Y8VA 2CEQA 1ZAHA 3LTSA 1LZOA 3HJZA 2OO6A 3W37A 2TSYA 4WEVX 1PHQA 3TYDA 1EGZA 5G4WA 3MDWA 1RAKA 1W9UA 1NFGA 4IP5A 1W5MA 3VUPA 4AVNA 4XD6A 2OWCA 2H3BA 3AXHA 4PEEA 3DG6A 5H91A 8XIAA 4H8HA 1TWZA 4D6IA 1PB0A 1FWEC 4GLEA 3W7DA 4C5YA 3BLPX 2JQXA 3RRAA 1IYXA 1XP3A 3SY1A 2CZFA 3SIZA 1A3HA 4ICMA 3L2IA 3TN5A 1J10A 3FXGA 1Q6OA 3P74A 4NI8A 1TB3A 3T4WA 3CHCA 1P6CA 1OY0A 1BHGA 1W1A1 3S1XA 2XISA 1O94A 3WMLA 3QPEA 2OO0A 4R3UA 3GNDA 4MNKA 2CLPA 4O19A 4FR1A 1UC5A 3ZQ9A 1R3YA 1DIEA 3AZTA 1HL9A 2A21A 3ZJKA 2WZIA 3G1XA 4IPNB 2QCFA 1B3WA 3L4ZA 4YLWA 4H9UA 1K8ZA 3ZR5A 2XM1A 4B3ZA 4Q6JA 4R7OA 1DJIA 4IQDA 2UY3A 4X63A 2WQPA 4GOAA 3HG3A 3W1XA 3GBDA 4BK9A 5CPLA 3VNKA 4GUIA 3G1HA 4HYVA 1POKA 3URBA 4NJGA 2FYMA 4GNVA 4NXKA 2H90A 2QQ6A 3UXKA 3WNKA 1K4HA 1UZHA 1W1B1 3PN8A 3VNMA 4EWND 3EDDA 2Z6IA 3VVGA 3EX1A 3V5CA 3WEOA 4HA0A 2OSYA 2PFHA 2FGLA 3BANA 3R12A 2C79A 4GUGA 1XCXA 3O6AA 1XYZA 3TA6A 2MANA 2O7QA 3GFYA 7CGTA 4FLSA 4U31A 3E0FA 4DX3A 1ZJHA 1D3GA 1TMLA 3RF9A 1RPXA 2FZ8A 5H2ZA 4QHRA 3RCNA 1UH3A 2BTMA 2FHFA 2G3FA 3MI2A 5FI8A 7A3HA 3PTKA 3R43A 2J8TA 3UYIA 1H63A 3WF3A 1IR1A 4MB5A 2B31A 3Q37A 1MNSA 3QMSA 1QPOA 4L5ZA 5H8UA 1E5NA 2E4TA 5BXTA 1EJWC 3APTA 4XO7A 1ICSA 5MKGA 4KWOA 4XTIA 4FXRA 4D71A 3AUOA 3HURA 3M0MA 1YBQB 3S2JA 4CQ9A 5EL1A 1MUMA 1H4PA 4KMQA 3T0CA 4DUWA 2IXVA 2P3EA 5FEZA 2YJQA 1W5NA 3BPWA 4JTHA 3KBMA 4ZE4A 1JUEA 2BXZA 1J0IA 3VGDA 1YPIA 1B9BA 5LGZA 1KFBA 3NJ3A 1BVNP 5I3JA 1IT8A 2XFRA 1XLJA 4NZCA 3UG5A 1ZNNA 3AIQA 1V3IA 1Y0EA 4AZBA 4FF7A 4ZXOA 5CPQA 3K8LA 1E9LA 4GA8A 3G0UA 3NDZA 3AAMA 2C7FA 3FSTA 2YFNA 5IBXA 3DYOA 1V6VA 2Q8XA 5CZ0A 4K68A 3GR8A 3G3MA 5J04A 4U5IA 2BVYA 5EYWA 3PBGA 1KCLA 3CU2A 3TN4A 4AXKA 4BHYA 5FJTA 4MWAA 1RP8A 2IMRA 3CUZA 2VTFA 2PURA 1DYSA 2Y1HA 4HTBA 5BXRA 1IEVA 5AHIA 2HEJA 3C0JA 4IMGA 2E40A 4AVOA 3KE0A 2CHNA 2TPSA 4HNCA 5H8MA 4LUYA 4PBFA 3VM7A 5CSYA 3G6LA 2J79A 3VE9A 5AVHA 2HV5A 3WJYA 3B06A 4QG6A 2X1RA 1HGWA 3VOIA 4ATDA 3W7JA 3BAYA 1EO7A 4N6FA 2Y5EA 1ISVA 1OVDA 3L0NA 4NI3A 3NO1A 4R85A 4ZE5A 2EPMX 1UKPA 1LT7A 4WXYA 1GKQA 1V7AA 1WKYA 3W74A 3PB0A 1IQ8A 4G5DA 3W7CA 2CW6A 3TW6A 3SJ3A 3GYCA 3K8MA 5AHFA 3BLOA 4F3HA 3BVJA 2Z4GA 1ISZA 4O54A 4CN6A 4IXHA 3IK2A 5E0KA 4QBXA 6REQB 1TYGA 3LI0A 2XIIA 4JS3A 1VRDA 3B0PA 5CPSA 2VDGA 3VD4A 5HWJA 1TVNA 3TSMA 4Q7NA 3MC5A 3OLEA 1PYFA 1E72M 2Y4SA 5C2GA 4FHAA 2EJAA 1QNRA 2UY2A 3A9BA 3UCCA 3T08A 3UCDA 4DNMA 1TR9A 3EEZA 1L2QA 2XVGA 1J9YA 1EGMA 1QOPA 3KTSA 3NFUA 4ACZA 1TVPA 1G1YA 3WMSA 2VOTA 1P43A 1LM1A 3GTHA 4DQWA 2WC7A 1GJUA 2NV2A 1AQ0A 3VA8A 3PZNA 3R7MA 4S3AA 3AI0A 2ESCA 3GDBA 2HBXA 3TROA 2DUXA 2V63A 3GHUA 1GG1A 3GVGA 3H54A 3GM8A 3ES8A 1AJZA 4IMEA 2WSRA 2V5CA 2EG8A 3USZA 5C54A 1XRTA 3REQB 1KC7A 4HCLA 2QULA 2D0FA 1LTDA 1G4PA 4LYPA 4B5WA 3CV6A 3DC8A 2GWGA 2FTPA 4AZGA 1D8WA 1YTEA 1QXLA 4JFWA 5HUOA 1B1YA 3F5JA 1TQXA 5MF5A 3OVQA 3WD2A 4WUIA 3M46A 4B4FA 1LLWA 5G2HA 2J74A 5A8PA 2FZMA 3WLKX 3AIUA 1CGUA 3NOEA 1XLGA 4HZ8A 4H9YA 3TSBA 4IP7A 3W07A 1UIOA 4QX4A 3WQCA 1PCKA 5EU9A 1GQIA 2YL8A 4HJWA 5AYYA 3WD4A 3BMXA 3O2LA 4DF0A 1E6SM 1XS2A 5K2ZA 1PBGA 1FHDA 1JEZA 3MUZ1 4PSRA 3W85A 2ZADA 1KW1A 5IBXC 4FALA 2G3JA 1P4CA 2A7NA 1DPMA 1DQUA 1Y5VA 3PZQA 3W9ZA 2O4QA 1AQFA 1PKNA 4RZ4A 1UR9A 4KRTA 1BPLB 2A1YA 2OSXA 1XIEA 1QR7A 4PGLA 5E9AA 3N1AA 4XUYA 4MWAC 4NU7A 3BSHA 1JPKA 2VUNA 2XZ9A 1K8XA 2GUBA 7PTDA 2QAPA 4MJZA 3EKGA 3UZ5A 3RX4A 1P1MA 1QI4A 4WHBA 2GJNA 2QVHA 2GDVA 3BARA 3NL5A 4JFVA 3Q2DA 1EDGA 4DJDD 4ML9A 1QK2A 4Q7IA 1MUCA 1JIBA 2OKOA 3FY1A 3GXTA 3LN3A 4S3BA 1ZZMA 4C6OA 1AH4A 2FMNA 4W88A 1FWIC 4E2DA 3PTMA 5DRIA 2E25A 1MQPA 4A3QA 2OT0A 2JKEA 2AAAA 3SAZA 1TV5A 1HGYA 3MY9A 5BROA 3B9NA 3C86A 5F7UA 3W2KA 2WNZA 1HZYA 1JD9A 1GYMA 2XSAA 3LB0A 3VOHA 4RJEA 1KXVA 2I9EA 4JYFA 5FD0A 3MCOA 3HGSA 3GU9A 3O0KA 3LHWA 4CQDA 3NOYA 2WJFA 3M5XA 4CEXC 4L4OA 4H00A 2E1DA 1ADSA 4HNTA 2P0OA 2WNQA 3W7HA 3MUCA 4NKCA 4QLJA 4PBEA 4GO8A 2WMHA 3CO4A 3MO4A 5CSRA 1CIUA 3FGCB 1S38A 1TTIA 1HJUA 3PZUA 3GDTA 3CUFA 2I5IA 2GGHA 4J35A 3P0XA 1RK5A 3VCRA 5EGRA 1SQ7A 1E56A 3AO0A 5LXXA 1OYBA 1M5WA 4Q8NA 4WY0B 2VWTA 4P7QA 1TX2A 3WLPA 3CHVA 3KBNA 1UR2A 2XVLA 4PR4A 2ZZ7A 2FZNA 4R27A 1PZ3A 1CCWB 2R6OA 3RCYA 1XLLA 4XBSA 5FJJA 5TD4A 3SCVA 1OC7A 1XLEA 4AIEA 3T2QA 3FFSA 2FKPA 3AS0A 3W02A 5C2CA 1EJ7L 3H2OA 1F3WA 1BYCA 1HO1A 3S1GA 4NUWA 3P81A 5HQMA 2VFHA 1TFVA 3M07A 1V6XA 4C6MA 2NX9A 2C16A 3SCTA 3PBUA 3OLIA 2WHLA 2O92A 4MADA 3O6CA 3P3BA 3WLSA 3QGAC 4JIPA 1K8YA 3TQKA 4EK7A 3HQ1A 1VB9A 3UJRA 4L56A 3KOWA 4W8AA 2HBVA 5AC7A 3EAUA 3V4BA 1TV4A 2C0AA 2HZGA 4H9ZA 4DM2A 3VOFA 1VQTA 3KLKA 4O0KA 3MO7A 3N2CA 4S3FA 4OV9A 4ZGYA 1JF5A 4AIOA 2POZA 4AHQA 2Y70A 3WLOA 2GUUA 3EOOA 1OFQA 1TUXA 5I07A 3FN9A 3KHDA 4ROQA 5EY5A 4IGSA 3SQMA 4IFKB 2E6FA 3GKFA 2HRWA 3TW9A 5G5IA 1WUFA 1TTQA 1FRBA 4ZCWA 4JD4A 3N4AA 1VENA 2DIKA 2PTXA 3R8HA 1YLVA 2EGZA 5DXXA 2BXYA 4JKMA 1HL8A 5D8WA 1X96A 5KZDA 4NL1A 4H7CA 5D9OA 3CT7A 2QUTA 3WQDA 4FLOA 2BHUA 3THQA 4JTDA 3WD0A 1NU5A 3K4WA 4D6JA 1G7VA 3QMTA 3EOLA 3A6OA 2PLMA 1B54A 4OV4A 4LF2A 4E5TA 1UKOA 1BGAA 3ALFA 5C9ZA 2VWSA 3GG7A 3UY7A 1WA3A 5D33A 3OQEA 3EWYA 4GZ7A 4S23A 2NZLA 1THFD 2PDCA 4HU3A 3LLFA 3VTRA 2VGFA 3TIMA 1QATA 4KCUA 4XZWA 3K8KA 4DYJA 2ZC1A 2KAUC 2B81A 3H8AA 3CB3A 1QPRA 1E3ZA 3GU2A 3B8VA 1EH9A 1K4GA 1CXLA 5D9NA 4MNLA 1ADOA 4IP4A 3GTXA 2VGGA 4QLKA 1HUVA 1LJYA 1B30A 2F9RA 3N6QA 4KCTA 4AD4A 4OE7A 3L68A 3TQ0A 2TRSA 4BEQA 3P2VA 1XFBA 4DBEA 4IFRA 4D1JA 1ONWA 3R25A 2BASA 2FZDA 5D03A 2XHYA 4MFEA 2Q71A 3B9EA 5AZ0A 2ATMA 2BHZA 3TUUA 2R1LA 2J77A 1UUOA 4OGZA 3AHYA 4IM4A 1A0DA 5HANA 5EMJA 1D8CA 3CTLA 2DVUA 3VD5A 3PFRA 3OZOA 2BY0A 1TJ1A 1TPWA 3PFMA 4AH7A 2VRKA 4P7OA 4TQTA 1YDVA 2CXGA 4TOQA 1HKKA 2PLJA 4RZ5A 2YXXA 1GVEA 3MYPA 1CT5A 1ZP3A 1C8YA 3KP0A 1FWJC 5BOOA 3AXKA 1F8IA 5D04C 4JFTA 1Y5WA 3G1FA 1ZP4A 3C0LA 1H5VA 1KBJA 1GEQA 1X6LA 3FA4A 3NZPA 5CG7A 3UWYA 3CK5A 1XHGA 2W61A 4PODA 2YXOA 3SCPA 1J0HA 5BYWA 1UYQA 3I4EA 1WXYA 4LV9A 1I60A 1PAMA 1YIXA 2CLEA 4BCEA 1POJA 2Q3OA 3QXBA 1VIZA 3AALA 1R47A 5A3HA 2WZHA 5IDZA 1GYLA 5AFDA 4B2DA 4K6AA 1OK4A 1EPXA 3THUA 4NAFA 3ITXA 2ASHA 2DT2A 3W82A 3VGFA 1AMKA 1FWGC 4L9YA 3MV11 4GQQA 1X7IA 4S38A 5K7JA 2A3LA 3H21A 2VFEA 1CXHA 1NP2A 1K6AA 5E1QA 1C90A 4LUSB 2V2CA 1SW7A 5D9MA 3SURA 2I17A 3WENA 2WVSA 2Z1SA 4A8LA 2A2IA 2OGYA 3AQUA 3KRSA 3L21A 1KV8A 2CBVA 1TELA 3AHXA 3LCIA 3BUVA 3ZVIA 4AZHA 4D6HA 1EYWA 5ABFA 1LDCA 3VZYA 3K30A 1CLKA 2X05A 3A9IA 3ABZA 4V1XA 4HNOA 3S5YA 3PNUA 1OYCA 2CWXA 3UZZA 1JNEA 4B91A 3LXAA 4YL2A 2WJDA 3UZWA 1U83A 1F7BA 4ZB5A 1NDYA 1ZPTA 2C91A 4CCCA 1S1PA 3G1VA 4V27A 1XYLA 4H6RA 4OQVA 2Z0IA 4PMOA 5IHSA 3CIXA 1RQEA 4J3TA 3DFSA 5IHRA 4LY8A 4G56A 4FMVA 2CNCA 4WCJA 4EAYA 2RDTA 1XKYA 4DUXA 2R9RA 1RA0A 2UWFA 5REQA 1GNXA 3TYCA 3ANUA 3V5OA 3APGA 2VRJA 3VIPA 4CUCA 3RLVA 4K1GA 3GDKA 3QZEA 2DSVA 2W5FA 3T07A 4IGMA 1B31A 2ZX6A 2ZOXA 2PPGA 1EJXC 2PU0A 1E9ZB 5H8PA 2I14A 2PWHA 2PDKA 4LBSA 1BEUA 3VX0A 4DEFA 1K02A 3TC3A 3ARQA 1K9EA 1E40A 3EZ4A 2VOMA 1U5JA 4LAUA 3W27A 1GUVA 1PS9A 2QV4A 2ALRA 3E2RA 2FVKA 2CLLA 3NIYA 4HOWA 1ITUA 1EYEA 5A69A 1W9DM 3BLIA 4HSOA 4GZEA 1DXIA 4BWLA 1TSIA 3S6OA 4KF1A 4X9SA 4D8AA 2P1FA 4JIEA 4F0SA 1PKLA 1S2UA 3TR9A 4GI4A 3M41A 3ZXWA 2WM0A 1EZWA 1IZKA 4Q8MA 4GINA 1YRRA 3W81A 4AFYA 2R1PA 2OWXA 1H2JA 1Y65A 4Q7BA 4D2JA 5DMYA 1AW2A 2HVMA 4B9ZA 2PRMA 3QTPA 3NQCA 1S2CA 2IQDA 1LBMA 3RLHA 2JK2A 3Q45A 4XZBA 1EWDA 1O7AA 3I7SA 1W1IE 2ON3A 3PUGA 2XGIA 3CV2A 5FF2A 3NXFA 1XQKA 4WRHA 4H8VA 1T7LA 1U2YA 1YHTA 3F5LA 2HXUA 3IIPA 4U5KA 4I6VA 4PUJA 1DJQA 1MSSA 4CU8A 1M6JA 4YVVA 3QHNA 1X8FA 2VZTA 2ZA1A 3VKJA 3W87A 4HGXA 4JY8A 3WL1A 1TPEA 2A6NA 1RVKA 1Z69A 3A3WA 3VD9A 2C3ZA 3EDFA 4I90A 1XH2A 1KKRA 3WQEA 2Z1KA 4FOJA 2ABBA 3EOUA 1KBBA 4ZFMA 3FAWA 4K8EA 4GNKB 4KEMA 2BOEX 1ML1A 2NUXA 5BU9A 1UJPA 4GIYA 4TTUA 3T55A 3M6YA 2X30A 3BH4A 2ZRWA 3LV5A 5A95A 3P8IA 1UP0A 4LVGA 4L4PA 4PUWA 1GVIA 4RE3A 2VX7A 1Z42A 2MUCA 4LS1A 3OW1A 3W72A 2NUWA 1QRQA 1OCQA 3LYEA 3KBSA 5CC6A 4S1FA 3ATZA 4UMCA 4P7LA 1MMFA 4GG9A 5DANA 4WQ6A 4PMXA 1WZMA 4LBRA 1N2VA 3R1ZA 2X09A 5A1AA 1JG9A 4JTFA 3W7PA 3TJ4A 2D1ZA 1XPYA 3LHYA 1SFTA 4H4IA 3TR2A 3DGRA 1GQLA 2QDGA 2PTZA 4NNBA 3LCFA 1E4LA 3DBNA 2YDAA 3N15A 4J3SA 3K4AA 4BQ4A 2XJ7A 4GI8A 3EPMA 3ZJ6A 4LCRA 3BQ6A 5DEZA 4JFUA 3URQA 5CGQA 3GWQA 4KWUA 2JF6A 2PODA 1E0XA 3AXIA 3OA5A 4LVAA 2OVLA 1XLHA 4JYDA 1OFBA 2X16A 1LUCB 2E9MA 1LL4A 1OJXA 3MUIA 1WKDA 3T44A 1NFBA 3DFNA 5CZJA 1VCGA 4IQLA 3NUKA 4MUPA 4WZHA 2DW6A 2DVTA 1KLZA 3SW6A 4DRSA 1E4NA 4HNUA 1I0DA 2RDWA 4ZQRA 3CWHA 1MDLA 1XIFA 1Q6QA 5JU6A 4NJKA 2QJNA 4IOTA 1EHNA 2OMAA 2WW5A 3C2VA 4NZ5A 2H8XA 3E2SA 1V5XA 4ZSUA 2J9ZA 1KXTA 5BMXA 1B0IA 1R2RA 3VGHA 4CKQA 3N18A 1Q85A 4LV4A 1W1PA 4MM1A 1J4EA 3WDRA 2A0NA 1ZJIA 3WG6A 2NXHA 4QSFA 4ZOCA 1E43A 5CCZA 1W1VA 2HS6A 4W5ZA 3EPOA 4XIAA 4BWLC 1IZCA 1WB0A 3CHDA 1MW1A 3PZTA 3PY2A 1FBAA 2O9RA 1SW3A 3KVLA 3SUTA 3BV4A 3NQ7A 4J5NA 4C6KA 4A3YA 4UMBA 3G0XA 1TIWA 1SJDA 4W8BA 2DU2A 1BYAA 1E6PA 2R1KA 3BZJA 4HZ6A 4JQ3A 3PZMA 3KZSA 1A5NC 3IRDA 4H9VA 1YTKA 1T99A 2ZXQA 5XIMA 3DYMA 3I3BA 2NW0A 4KERA 3IJ6A 1F07A 1J12A 1EJSC 3LHUA 5BNKA 4JTEA 3AIWA 1OADA 1RALA 5CLWA 1W8SA 3A5FA 2DQXA 1FY6A 2QV5A 2CC0A 2O56A 2PI6A 3W22A 2PTDA 1F73A 3F4CA 2IPJA 4AZ7A 1G4SA 1HTIA 2YPIA 3AS2A 4PUDA 5I24A 2EG7A 3MKCA 4RW3A 2ZBTA 1H0GA 3STFA 5K4ZA 2PDFA 5CGMA 1EJVC 4C6NA 3V18A 2BDQA 1EIBA 2X0YA 3WH7A 3GIPA 1TX0A 3TTYA 1KV5A 2JEQA 2DSKA 2XH2A 2HE5A 1IEIA 2E6AA 4QDPA 4WSKA 1OIFA 5T9BG 3KAOA 3E0WA 3O6YX 2D22A 3O05A 2TYSA 1JI1A 1KNWA 2VO5A 1RR2A 1W5PA 2ZUSA 2XWDA 5HNRA 4P8VA 3DZ1A 1BG4A 1V0NA 1XG3A 1T8QA 3T1GA 5RUBA 3DI0A 1D2KA 5CH9A 5DX7A 4LW7A 4LQ1A 3E49A 2PLKA 1XWYA 4BY3A 3H2FA 1U1JA 5AC6A 1TCMA 1FHUA 3SN0A 1JFHA 4JTLA 2AOSA 2DDXA 3LPFA 5AVNA 1TWIA 4GK8A 5TBOA 2GVJA 4RDYA 3OOQA 4D6FA 3SB0A 1HJQA 4XSLA 1H50A 2ZUTA 4C6IA 4JYEA 2C71A 4RR4A 2ZXBA 1EJRC 2GFTA 3IJDA 4GIRA 1TVLA 3TWAA 3KBJA 4AIUA 2ZRYA 4REQB 3WZ0E 3VIFA 4GVFA 4XAYA 1SR0A 3RMJA 3W1MA 5H1WA 2QCNA 3WNOA 2QDDA 2X7VA 4FZIA 3N73A 4UTFA 3IANA 2RDUA 3HG5A 1S46A 2VKZG 3KRZA 3KTCA 4QNEA 4F40A 1JZ2A 3CHFA 4DAFA 2I56A 3PTDA 5ENLA 1FWFC 3WQ6A 4QEEA 4ADSA 2DZVA 3IAQA 4AWTA 1AODA 4OOZA 3ZT6A 3SY8A 3LQGA 3AIRA 4PN2A 2EJ1A 1LL6A 3WNNA 1WKFA 4JTQA 1KR1A 3SO7A 5KMYA 1TRIA 5AKQA 2HSAA 2PTYA 4XVDA 1Q66A 2QW5A 2VQUA 1GQKA 1WUEA 4QXIA 3U48A 2OZ0A 1HVQA 2YCIX 3PAOA 1CI1A 2IPWA 4MY1A 4H9TA 1SJBA 2XH7A 2GK1B 1DTNA 1MEIA 4H9XA 1G94A 2EBNA 3KDNA 3TSDA 4GJ1A 1GVOA 3FIGA 4OIFA 3MHFA 4QS6A 1YBQA 1L6GA 5E93A 4C5ZA 4NHVA 4HHMA 3MP3A