4CQ9A

Plasmodium falciparum dihydroorotate dehydrogenase (dhodh) in complex with idi-6253
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
372
structure length
367
Chain Sequence
FLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In Vitro Resistance Selections for Plasmodium Falciparum Dihydroorotate Dehydrogenase Inhibitors Give Mutants with Multiple Point Mutations in the Drug-Binding Site and Altered Growth.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
total genus 137
structure length 367
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cq9A00
3TSDA 5FF7A 3HQ1A 4YLWA 4RJEA 1KM1A 1W5QA 4HNNA 3NM1A 2ZQ0A 2V2HA 4AEOA 1L9WA 4HNTA 3NEVA 3NQGA 3EX1A 1FY6A 3ZR4A 2H8ZA 3MHFA 3CEPA 4YXGA 3EXSA 2CLLA 4MLRA 2TPSA 3KHJA 1IIGA 1AMKA 3BLEA 3W84A 2Y89A 3L0KA 1KFKA 1ZNNA 2CZDA 1KBIA 3HPZA 3LCWA 1DQWA 2PURA 2DJLA 3UWWA 4UFMA 2JGYA 4QJ1A 2ZA2A 4WX2A 4IPJA 1KFEA 4AAJA 5EY5A 5K4ZA 2OZ0A 4FO4A 3ABRA 3QEZA 3STFA 1W5NA 2YPIA 1WXJA 2I9EA 2V82A 5U7SA 2NX3A 1ICPA 1OX6A 2Y62A 4IPIA 2NUWA 2QF7A 5LNSA 4JTEA 4RZ4A 2VFFA 1R30A 4A2RA 1TV8A 3GVGA 1H7NA 1TV7A 4O0ZA 2GQ8A 3TC6A 2YZRA 3W7EA 5CKSA 2Y7DA 3NQFA 2A6NA 2I1OA 4PC8A 1TPEA 1JCYA 4K37A 3G0UA 2FDSA 1W0MA 1FXPA 4O1BA 4JTJA 4JY8A 4EWND 4RKAA 1F76A 4GE8A 3CLMA 3JR2A 4LT9A 3TQKA 1FWNA 1YPIA 3NOEA 3STEA 5LNRA 2QJHA 2Y6ZA 2ZTJA 3NQ8A 4JX5A 4O4VA 3BLIA 1KV5A 1Z48A 2J6XA 2VFEA 1GVQA 4GC4A 3LGEA 3Q94A 2VC6A 3CT7A 2QJGA 5LKYA 3IVSA 3W2MA 1FDYA 1OJXA 3W2LA 4JIQA 3MP3A 3W1UA 3A23A 4IQLA 2GVJA 2TSYA 4LVAA 3ABSA 1DBTA 4QQ3A 1P4CA 2WNNA 1R2SA 4K8HA 5KITA 3O6YX 4GUGA 1H7OA 1UUMA 1NF0A 4J9JA 4DO6A 1P1XA 1W5OA 3PY2A 1IXQA 4K38A 1RZMA 4ICNA 1GPWA 1DOSA 3CQ0A 5CSRA 1GZGA 3N3MA 5HINA 4IMDA 2VEIA 4M6PA 4PL2A 5BNKA 2Y88A 3GLCA 4YWIA 4HNUA 3UWYA 4R7JA 4E2DA 4LOCA 3NO5A 1K7XA 2EAWA 4UFKA 3HOJA 3W7KA 4A22A 1XDMA 3UD6A 3I65A 1W56A 1XDLA 1LBFA 2QCFA 4CQ9A 3UWUA 3RMJA 4UTHA 4Z08A 1XXXA 1H63A 3DKJA 2WQPA 5EKYA 3W23A 1TPC1 4UTMA 3ANYA 5IBXC 5T26A 1TO3A 1TJRA 2Y63A 3HMJG 1VHNA 3O8AA 3W9ZA 1MEWA 2PRLA 5L9FA 4PA8A 1KM2A 3UYCA 4TMCA 4NXKA 1MEHA 3ATYA 1PHQA 4ZVJA 3MHUA 5TQLA 4JTLA 4BI6A 3PVFA 3NG3A 4MYXA 4PL1A 1OYAA 2ZRVA 1LM1A 4NJGA 4UFHA 1TPVA 3CWOX 1F7BA 5I3KA 3MWAA 2YYTA 3N14A 5K2ZA 3L68A 1KLYA 4JTGA 3LX9A 3KFTA 1LBMA 1I2QA 1H62A 3NA8A 1D3GA 4P2VA 3PAJA 3UXDA 4ZQRA 1W31A 4UTJA 1GYLA 3S5ZA 3LLDA 3MI2A 3A24A 3DI0A 1OFDA 3C2FA 2E68A 4EF8A 3EB2A 4KWWA 1OFBA 2BWGA 2X1RA 4LRTA 3KRZA 3MHGA 5KSWA 3TW6A 3CWNA 2C3ZA 1TB3A 3W86A 3W1QA 4RXGA 3C2VA 1F74A 2YXGA 4CNPA 5DELA 3I7RA 4JGDA 4IMCA 5AHIA 4ZQNA 2E5DA 4O14A 1JUBA 4ML9A 3SIZA 5HULA 4NJHA 4K6AA 3HPXA 3TSMA 1VGAA 3TKFA 5HWMA 3JS3A 4Z0JA 1PVNA 5KMYA 3QH2A 1VC4A 1B57A 3DFQA 1F73A 3WK1A 3G1XA 3PB0A 2TYSA 3TROA 4KWVA 3W1RA 4FIRA 2DP3A 4ZMGA 4ORIA 3T40A 2ZRWA 4JYFA 3EWYA 1GJPA 3NQDA 1OABA 3DFSA 3SI9A 1LBLA 4TU1A 3LRMA 4M6QA 3ZWTA 4NXSA 1AG1O 3RFAA 3GNDA 4QNWA 1H1ZA 4K7VA 4GRSA 3NR0A 2YW3A 3NQVA 5AHMA 2J24A 3NPUA 4UTIA 2V0TA 3G1HA 3GAKA 5HWNA 2PE4A 1F6KA 1JUEA 4A29A 2ABBA 1QDSA 4FIQA 4RZ5A 2C19A 4LC8A 1GQNA 1LLZA 1Q45A 1RQEA 1G4TA 2W79A 2Y7FA 2DZSA 1E51A 4JIPA 4NJKA 3OHIA 3R13A 3OVQA 3LI0A 3R8RA 1TRDA 4L4LA 3E9AA 2RFGA 2FJKA 2EPHA 1OFAA 2QEZA 3LERA 1ML1A 3GDLA 5FEPA 4RLIA 5FF3A 3BG9A 3IIVA 1JCMP 3BGJA 3A21A 1KM0A 2BX7A 4GWEA 1ICQA 3QMSA 4WXZA 4IMEA 3TDFA 2VFIA 1FWWA 2QR6A 1OVDA 1TPUA 1N8FA 2NXGA 3M5YA 2DZWA 1I2PA 3O15A 1WV2A 1FDZA 2QCEA 3QRHA 1YYAA 3Q2DA 4NUWA 3KAOA 1HTIA 1GT8A 1KM3A 1MZHA 3PC0A 2CWNA 4GNJA 5H91A 2VKZG 1XUZA 1W5PA 5EL1A 3W88A 2NUXA 4IMFA 4DPPA 2FB2A 1QPNA 5K9DA 3L5LA 3LHUA 4GUJA 4FNQA 5A5WA 5HQEA 1K02A 3N2MA 2YFOA 1EA0A 5G5IA 4IJBA 4OWGA 3CTLA 4FXSA 3L2IA 4NNBA 1QOPA 3W75A 3VKJA 1B4KA 1IXNA 3WJXA 3W7RA 3E12A 4XBKA 3WK0A 4D2JA 4MVAA 2ZA3A 3VE7A 1QMLA 3TH6A 5J5DA 3L21A 1TMHA 3U8GA 3W85A 3MI6A 1DV7A 4FX7A 4R33A 3OVPA 4NJIA 4TO8A 4CLMA 4X9SA 2F7FA 5C5YA 3DBPA 4MFDA 3IV3A 2NXIA 4UXDA 4BI5A 4Y96A 4UTWC 3VFLA 1A5SA 4S2BA 4UFJA 1OYCA 4XTIA 1WDWA 3W7LA 3DH7A 4O1DA 3QSTA 4XBSA 2I14A 1G7VA 3W2KA 4O19A 3M43A 4R34A 2CLKA 3DENA 4U4MA 3W87A 3KX6A 1YXYA 4JTHA 4UTKA 1HFBA 3FIGA 1PHWA 4RCXA 1TIMA 2A7NA 2EGZA 5TIMA 3LTYA 1SZEA 2VEMA 2Y61A 1H1YA 4O1AA 4NX5A 1FWSA 1SFJA 4HHPA 1H7XA 3LBMA 1VLIA 5D2YA 1J4EA 2CLEA 2OX1A 5BMWA 3W1PA 2IQTA 1LRQA 2PC4A 1X1ZA 2GQAA 1QAPA 2AQWA 3O6CA 4E38A 3E96A 1ZFJA 5L6UA 1ZALA 2FPVA 4E0CA 3CIXA 3FLUA 1KTCA 4MJMA 2UV8G 1M7PA 3HF3A 1LCOA 2B7NA 3HGRA 4I9AA 1SO6A 3RLVA 3H55A 4O12A 1PIIA 2BTMA 4MFEA 3T78A 3LRLA 4XUGA 3STCA 3C2OA 4O4WA 3D0CA 4WY0A 3TXZA 3O05A 5I3HA 1K8YA 3B06A 3DFPA 4L4MA 2EF9A 2WNQA 3TX9A 1KFCA 2V8ZA 2YGYA 3DGRA 5HR7A 2QUUA 1M5WA 3N2XA 4HPXA 1KV8A 3GNNA 3S6DA 1KM4A 5ABTA 4M19A 4AMAA 3TCEA 5CGQA 3PG8A 2VXNA 5AC7A 4N6FA 3A5FA 3QQ0A 4UMBA 3NDOA 1Q6OA 1QWGA 3LCXA 4GUHA 1X6UA 1O94A 4AB4A 1LDCA 1KM5A 4I7UA 2JKEA 2GUUA 5DY3A 1NVMA 1XC4A 2H3BA 2Y70A 2FPYA 1EIXA 3L66A 5H2ZA 2X16A 4O0KA 4GXMA 2V2CA 4OT7A 3GKAA 3EWZA 1C8VA 6ALDA 4FXRA 3S8HA 3GAYA 4LV9A 1JCLA 5AN7A 3OG3A 4CCCA 3GDTA 4MY8A 1YADA 1IF2A 3BG5A 5CPOA 4WOZA 1JCXA 1TPFA 4AF0A 4LUJA 4DF0A 1VCFA 5D09A 4WJEA 4OQVA 3E02A 4DQWA 5G1TA 4ZZ9A 1VH7A 1DKWA 4ZQOA 3EWBX 1YLVA 3HB9A 1QPQA 4UTWA 5CPNA 3BPWA 1KBJA 3C3NA 4FX8A 2CU0A 1Z41A 1TQJA 4GUFA 3QMRA 2ZA1A 3MYOA 1FWRA 2CFFA 4HN4A 5DY2A 2EKCA 2F84A 1VR6A 3W7NA 4AHOA 3FKRA 3KVMA 3G3DA 3NL6A 3NNTA 1JULA 3BW2A 4JDYA 4Q32A 1GTEA 4LVFA 3TMLA 4Y90A 3QFEA 1SO5A 4UFLA 4MZYA 1VS1A 2WPBA 1AK5A 3EWWA 1TQXA 2Y85A 1XFBA 1G67A 1I2NA 3IGXA 3IRDA 1DHPA 5DCDA 2VEKA 1RV8A 5J5RA 3MO7A 4NNCA 3M44A 2CZEA 5HR6A 4IXHA 2CLFA 5F4WA 3SSJA 3UXAA 1UB3A 3HGJA 4AWSA 2TRSA 2FB3A 4LS1A 5AB3A 4OV4A 3ZFHA 1S5VA 4Q4KA 3B8DA 4DELA 5D02A 1GTHA 3NQ7A 1WOAA 3T44A 2V5LA 3F03K 3I7SA 3TMQA 1KFBA 3SGUA 1JRBA 4KFNA 1SO3A 5KZMA 3L9CA 1GOXA 2HS8A 1L6YA 4DF2A 1CW2A 5G1YA 3NXFA 3S1VA 4OV9A 3LLFA 3M9YA 2XN1A 2AGKA 1T8XA 2YFNA 4LTSA 3EX4A 5AYXA 5G2IA 4Y8FA 5G4WA 1TTQA 4GFSA 1XL9A 3WFAA 2CLMA 3LXCA 3R5EA 1JQXA 5KTLA 2QDGA 3V75A 1HL2A 3G18A 2R91A 1P5BA 3NPXA 4A2SA 1A5BA 1LORA 3UPBA 3TFCA 4JD4A 3TFXA 1B9BA 1KTNA 3F1QA 3C52A 4GUIA 3LTPA 4QM1A 2Z0IA 3W1MA 3KVLA 1TTJA 3C2RA 4I7WA 3ATZA 4LVDA 1O95A 2YCEA 4HKPA 3ELFA 1NSJA 3M47A 4AF0B 1ZAHA 3QW4B 1VQTA 2QCNA 4NQ1A 1UBSA 3THQA 4X2RA 3QC3A 1EUNA 3C56A 3O07A 1JCJA 2DORA 4Z1AA 2B7QA 1TTPA 3STGA 1B3OA 3ZS4A 2ISSA 4YMZA 3LI1A 3F4WA 1TTIA 5DBUA 4C1LA 1BEUA 1DVJA 4NZFA 4ONVA 3O6DA 2J9YA 3LDVA 5D33A 4Z0SA 5K3VA 2A21A 3G3MA 3EKLA 3YPIA 3W7JA 4RXFA 1SZNA 4UMAA 3HIJA 2B0MA 1V5XA 3IVUA 3MYPA 4K7YA 5MHBA 3MP4A 4BK9A 3P5YA 2C14A 2E6YA 4DF1A 3KXQA 4AXKA 2ZZ1A 3TNOA 3TE9A 3G8RA 3UPWA 1P0KA 2V81A 3M5VA 5D05A 4CNOA 4N9CA 3Q37A 3LXBA 3M7WA 3WJZA 1T99A 4NNAA 3VCRA 4MLJA 5I3IA 2KZHA 3S1UA 3BW4A 1W37A 1W5MA 3W7CA 2Q8ZA 5LNUA 1SW3A 3LBCA 4FNUA 1L6SA 4UFIA 3TU9A 3ZWSA 1O5KA 2A1YA 1KFLA 3QYQA 1SPQA 4LUIA 4HSOA 4ZQMA 2QCDA 1G69A 3SFKA 2A4AA 2BLEA 3QMTA 3KVKA 5K7JA 4HPJA 5CSSA 2CLHA 1YDNA 3KRUA 4QITA 5AFDA 3LCHA 3NQEA 3TXVA 3IIOA 1W54A 2VFHA 4M7TA 3BV4A 4FF7A 4RV8A 3FEMA 3RF9A 1EP1A 4OBTA 1G7UA 5AOUA 4DPQA 2C0AA 3O06A 2GJNA 1ADOA 3TAOA 3USBA 1FX6A 5D2WA 1TV5A 1NEYA 4UUIA 3M0ZA 3N73A 3FJLA 5D2VA 2WSQA 3CHVA 3PUOA 4EVZA 2V2DA 2ZRZA 4FNRA 4MY1A 1DJQA 5CPLA 3DXIA 4BWLC 2ZCGA 5AHLA 1FXQA 4QSHA 4O53A 5E93A 3HG2A 2P1FA 1PV8A 2A7RA 5E0KA 3W73A 1ICSA 3W07A 1GYNA 4G1KA 5F1VA 1QNVA 1FCVA 3I7QA 3OBKA 3NM3A 4HNVA 4AWUA 1G4EA 3SGZA 5F4SA 1W1ZA 1CI1A 1OX4B 1WBHA 3E0IA 3Q58A 5D04C 3W1NA 2NX9A 3GDMA 3M1ZA 2QCCA 4JTKA 4M6VA 2J9XA 1M7OA 2QCLA 3B03A 3TJXA 2ZZ5A 4DBEA 3UY8A 4LWWA 3UNDA 3O16A 4WY0F 1F05A 2VENA 5I3GA 2ZZ2A 4ADTA 1I8JA 5KZDA 1O5XA 2FQIA 2GJLA 3B0VC 1W8SA 1YTEA 2QJIA 4MZ1A 3N19B 5HWJA 5F2MA 3G1AA 3IIPA 5K9XA 1LOSA 2QAFA 2XN2A 1L2UA 1OFPA 1TRIA 3L65A 3RLUA 5AC6A 1C29A 1NFBA 4Y9AA 1W3TA 2NLIA 2A6LA 4EF9A 5AYYA 4MOZA 1HG3A 1ME8A 1VCVA 4N9DA 4GBUA 1N55A 4DBDA 5EA9A 5BW6A 1P0NA 4MKNA 3UZJA 1WX0A 3TR2A 3O63A 4YCOA 4UTTA 4IMGA 4AH7A 4FNPA 4O18A 3W2JA 2QDHA 1R2TA 4W9TA 1RQBA 1L6WA 1LOLA 1LP6A 3LCIA 3W7GA 3A22A 1B4EA 2JBMA 3P81A 2Y7EA 4JN6A 3F4NA 1S5WA 2YDAA 3FYPA 3BARA 3GXTA 1PCKA 2RHGA 4O10A 1EUAA 1XCFA 3GXNA 1JUKA 4LVGA 3INPA 5HUOA 3A9IA 1HUVA 3S1XA 1XBXA 1H50A 1VHCA 3MUXA 1HO4A 4UMCA 3BW3A 1R47A 3L5AA 3NZ1A 2JKPA 3CIWA 1EPXA 5AC8A 1ZCOA 3NAVA 2V30A 2QCHA 1EB3A 4WY0B 1OYBA 2A85A 2V9DA 2H6RA 1JVNA 2O7QA 2WO5A 3P62A 1QCWA 1I4NA 1JQVA 3L5MA 3P5ZA 4XKYA 4KFPA 2H3DA 4TR9A 4HT3A 5EPDA 2BXVA 3L0GA 4WQ6A 4WZHA 5LNWA 3T4CA 2GVLA 1TJPA 3TW7A 4NT0A 1CX9A 4DEFA 1K03A 2FTPA 1F2JA 3PWAA 4ORMA 3W7QA 2CZFA 2ZRYA 1MXSA 2NWSA 1SQ7A 2QCMA 5SWUA 3A5VA 3B0PA 2R14A 3G1VA 2C6QA 2B7OA 3DFNA 5F2LA 4FX6M 1S3HA 1UASA 2DJXA 3KOFA 4IWWA 3W7IA 1DL3A 4A21A 1FCQA 1QOQA 4UCGA 1PS9A 2YSWA 3C8FA 3W74A 1ZAIA 2P10A 1QPOA 1A5AA 3AO0A 4EOUA 1YXDA 1ME7A 1WYIA 3I6RA 4YCPA 3PUEA 2FIQA 4MY9A 2CLOA 3PF3A 1YTKA 1GVRA 4X3ZA 3G1DA 1XBVA 2BSLA 2G5WA 2ATSA 3P80A 1BKSA 7TIMA 4IGHA 3PBWA 3GX9A 3LHVA 1OF8A 4TIMA 4QIUA 4NX0A 3UY7A 1LYXA 4JTIA 1DORA 1OHLA 1WAUA 3CB8A 3R2GA 1V7YA 5D30A 5AYZA 3SR7A 3PUDA 3W6YA 1SFLA 4RZ6A 3FKKA 4CQ8A 3CPRA 1OX5A 3BVJA 5DXXA 4XKYB 2WOQA 4BFAA 4JX6A 3PBUA 4PH6A 4ZQCA 3S5NA 4UTUA 1M6JA 4O15A 4JYDA 3N9SA 3DFTA 1ZENA 3VE9A 4MJZA 4N4QA 5CZ0A 1OF6A 1DJNA 2OCZA 4GJ1A 2C13A 3VNDA 3RK8A 2YYUA 4E2BA 1U5JA 2NV1A 3EX6A 2Z6IA 4WD0A 3W76A 5EYWA 3SY5A 3NPVA 1VRDA 5D2TA 5G4EA 3GK0A 1W3IA 4N9EA 3W3OA 3P67A 4O54A 3LHZA 1EWEA 3TAKA 1AW1A 1O4UA 3TSBA 1T0OA 1VYPX 2WV8A 4LC6A 1Z44A 2ISWA 3P61A 1ME9A 5FEXA 2NXHA 5AHEA 2B7PA 5LHEA 5F2IA 4OHQA 1S5TA 3R89A 4QNEA 1EWDA 1DQXA 3W7HA 5C6MA 3TQ0A 5LGZA 1N7KA 3S5YA 3H54A 3QM3A 4NVTA 3G0SA 4JEQA 1KA9F 1IIHA 1PCWA 4JXCA 2JK2A 5KZEA 3P8JA 3M6YA 5D03A 4JNMA 2ABAA 1K3UA 3LCFA 5LSMA 1AL8A 4XWUA 1UJPA 2TMDA 3GIYA 1XUUA 3LB0A 4JICA 5FF2A 3P8IA 2QCGA 1HO1A 1EX5A 1Y0EA 3GDKA 1SU5A 4JTFA 4O28A 5DXYA 1VYRA 4IUOA 3M5ZA 3G24A 2E1DA 1MEIA 5CZTA 1LZOA 3P84A 4H4IA 2Z1BA 2GQ9A 2VFDA 1QO5A 3CM4A 3LHYA 5DCBA 2PRMA 4WOQA 3G1FA 4JTTA 1UCWA 2E5CA 4O17A 5BRBA 5I3FA 1GG1A 2VFGA 3BO9A 3G8EA 3FYOA 1UUOA 1LOQA 3UWVA 3SZ8A 3UZ5A 5CPMA 3NQAA 1H7PA 1LRTA 1QPRA 2VOMA 4WUIA 1ZHAA 1SW7A 4JTUA 4KFOA 2DZXA 1QO2A 3NQCA 4NJJA 3NL2A 3FFSA 4RK8A 3OIXA 3K30A 3RU6A 1EEPA 3W1AA 4UTLA 2X30A 2ZBTA 4DO4A 4LS2A 4CCEA 1AW2A 1SSGA 4IX2A 1VZWA 2EHHA 5CG7A 1RPXA 1ZAJA 3OEXA 2BZNA 3GYEA 5D38A 3QZEA 1EP3A 3C61A 4LY8A 3PG9A 3HPSA 5K4XA 3NQ2A 3QW3A 1GVSA 1A53A 1U83A 3W72A 2E77A 4ZQPA 3EXRA 4N6EA 2NV2A 1AW5A 4LV4A 5EMUA 4BF9A 1OFRA 3BK0A 3FS2A 3HG5A 2J88A 3PSWA 5HUPA 3PULA 2QAPA 3SECA 2DZPA 3IIXA 2PRHA 2DZTA 2WNZA 2GOUA 4UNLA 2ZDRA 5FF4A 1ALDA 1W3NA 1G6CA 4N9BA 5F1UA 4HSNA 3G0XA 1KTBA 1WA3A 3TQVA 1J2WA 2DZVA 3C4UA 3NQMA 4MPQA 2HTMA 1MO0A 1XBYA 4JDBA 3NQ6A 4JY9A 3LV6A 2NWRA 1G4PA 2ZZ7A 3PR2A 3LCLA 4AHPA 3M5XA 1X7FA 3P74A 4JR5A 3GR8A 1RQHA 1RVGA 4UR7A 1K8ZA 3MI3A 4QAIA 2QKFA 1LTDA 4ADUA 1PE1A 3T55A 3TC7A 1PL9A 4MIMA 3NZRA 3PSVA 1WOBA 1X8FA 2WSRA 2ATMA 4X22A 4CNNA 4IX0A 4BR1A 4JS3A 1H61A 4AHQA 1R46A 3FOKA 2LLEA 2HS6A 3CC1A 3S0CA 1XBZA 4JYEA 1K8XA 3DKLA 4N02A 2ISVA 1Q6QA 2WJZA 3LCGA 3S5OA 1FUYA 3CU2A 2QUVA 1MSSA 2YX0A 4ALDA 1YXCA 2Q3OA 1O60A 1A5CA 1SO4A 5I3JA 3EXTA 2A7PA 2GVGA 4OE7A 4R53A 1QFEA 2OT1A 5LNVA 4LU0A 3TUUA 3W7DA 3W2UA 1EP2A 1YTDA 1FQ0A 3G22A 1KM6A 1BWLA 4CQAA 5U4NA 1WQ5A 3G1SA 3PM6A 5AHNA 2NX1A 3TA6A 3THAA 5TBOA 4LRSA 3PB2A 3BG3A 4TX9A 4XTDA 1H7WA 1TREA 3EX3A 1BWKA 2OT0A 1OFEA 1I2RA 2GPTA 4WXYA 4FB7A 5GVJA 3S1WA 1ZJIA 3N9RA 4LVBA 1SR9A 2OMAA 4QISA 1FWTA 3IVTA 3GZ3A 4O8RA 1Q6LA 3WK2A 1TPWA 2E5BA 3E49A 1XM3A 3M41A 1KLZA 2RH9A 2D73A 3W2NA 1I2OA 8TIMA 3W71A 5FF0A 4NU7A 3EWXA 1OFQA 3DHDA 2YW4A 2OJPA 1R2RA 4P61A 2V5BA 1LROA 3ABOA 3EEGA 1VLWA 4RX0A 5AHFA 4JX4A 2ZRUA 1TPDA 2G95A 3TJLA 3U2OA 5DLCA 4XQ6A 1QR7A 1SUXA 2VEPA 3U6WA 2FPTA 2JKAA 3DAQA 1GVOA 2CW6A 4B5NA 2A0NA 3QPYA 1VYSX 4MZ8A 3N34A 4JTSA 5BOOA 4IXXA 1GVFA 3KVJA 2R94A 5FEZA 4O50A 3UWQA 2QUTA 1NAL1 3OA3A 3PBVA 2FFCA 2C16A 4U28A 1OG0A 5C54A 5LGXA 3LTSA 2NUYA 2VELA 1X1OA 4Z1CA 1NF7A 5F4XA 3UWZA 2W6RA 1TPB1 5DBTA 3P60A 1SSDA 4FHAA 2YR1A 2X1SA 1D9EA 1SZFA 3LM7A 2RDTA 3MW7A 4YL2A 3HGSA 5IM51 1IXPA 1TPH1 3DZ1A 3H53A 2NZLA 3L0NA 1FCUA 4ZL1A 2Q8LA 5C55A 1C9DA 3IGSA 6TIMA 1IXOA 2XN0A 3QSRA 4UC5A 3LRKA 3B0UX 3FJ6A 1ONRA 3WJWA 3W83A 1OK6A 4N2YA 3DFOA 3EKZA 3GDRA 5EBUA 2A2IA 1KW1A 2RKXA 5CZSA 2B4GA 2ZRXA 3TV8A 1I45A 5FEWA 1SZGA 2J9ZA 1TSIA 4O52A 4DO5A 2RDWA 4MYAA 4AWTA 4OGZA 2P0OA 1YDVA 4MUZA 3GR7A 1J5TA 4A3UA 3UQNA 2ZZ6A 5DN1A 5CZJA 3ABQA 3W1TA 5IBXA 1JR1A 3B04A 5HNRA 1OX4A 1VPXA 4FNTA 4UIOA 2HMCA 1GWJA 1Z42A 3R12A 3S9YA 2C18A 2Y7GA 3W7MA 1LLWA 2X1UA 3W22A 2H8XA 2E6FA 4O57A 1K7EA 5LHFA 5C2XA 4PTNA 1SW0A 2ZFAA 4LS0A 4HIBA 2H90A 1KFJA 2J27A 3LHWA 4O1CA 3MBFA 4K8EA 2Q3RA 1GG0A 1H60A 2E6DA 2C1HA 4LNYA 3S42A 5HJLA 3C2EA 4H3DA 5FI8A 1JRCA 1LRNA 3M16A 3QF0A 4NZJA 4LW7A 3DI1A 4RR4A 4PODA 2HSAA 3FA5A 2DZUA 4Q33A 2ZZ4A 5FESA 3W7PA 4N4PA 3QPZA 4S1FA 3RNDA 1BTMA 1H51A 1Q3NA 1H7RA 3EX2A 4M7SA 3VI2A 2FLIA 4M5PA 3DHFA 2X1TA 4BI7A 2E6AA 2QCDB 4UNKA 3GB6A 1OK4A 1RR2A 3EWUA 4ADSA 4POCA 1XI3A 1FBAA 3O1NA 3MBDA 4KKXA 1G4SA 2AAMA 4PFMA 3W1XA 4PEKA 3QQ1A 2ALDA 3HG4A 3IEBA 5BMXA 4Z1BA 4S2CA 2WSYA 3PBYA 1AL7A 2O7SA 2XFWA 5DCEA 1XKYA 1VCGA 1GEQA 3QJAA 4IOTA 3WK3A 3NPWA 4C1KA 1OFOA 1FDJA 2Z2UA 3GKFA 2WKJA 3DU0A 4K36A 2G97A 2ZYFA 2DU2A 5E1QA 4FEZA 3GXPA 5HMSA 1H5YA 1Q6RA 3HJZA 5D37A 4EIVA 3P7YA 1VJIA 4O11A 3NGJA 1TCDA 1WBJA 3IIZA 2A5HA 3W70A 2G96A 4CCDA 2RDUA 3G1YA 1FCBA 3BGGA 3MJYA 4AVFA 1F6PA 3T7VA 1IGSA 3V1PA 3HO8A 4TMBA 1YDOA 3SJ3A 2R8WA 3C6CA 1ZY9A 2ZTKA 3P82A 3IGUA 2X2GA 4I7VA 4K39A 3SW6A 4OU1A 1TYGA 3C0JA 5K9CA 1RD5A 2E09A 5D2XA 3HG3A 3MMTA 3TIMA 3MP5A 4Y6GA 3B05A 2CZ5A 3CEUA 2C15A 4Z1DA 1A50A 3HBLA 3NYZA 2ZZ3A 4UR8A 1D3HA 1THFD 2Z6JA 1F5ZA 3TK7A 5LZLA 3B4UA 4FNSA 3OVRA 4PCFA 2CLIA 5G2HA 1YPFA 4O13A 3LHTA 3JRKA 3BLFA 3NL3A 1K7FA 5A8GA 5D32A 3AJXA 3NL5A 1JCNA 3LV5A 1T96A 3WJSA 4UTTC 3L67A 1JJKA 5F2GA 3HGOA 3LOTA 3NVTA 4O16A 5KINA 2JGQA 2PCQA 4DXVA 3I68A 5G2WA 3WJYA 2W0UA 4BWLA 3KRSA 4XZ9A 3LXAA 3W1LA 4H6KA 3W7OA 3PS7A
chains in the Genus database with same CATH superfamily
1G9HA 2PTWA 1OZMA 2FGZA 4G7FA 4YLWA 1W5QA 3NEVA 1VIWA 2QDDA 3ZYZA 3QY7A 3DFYA 1UD4A 2TPSA 3PBGA 2ZX9A 3ARTA 2Y89A 3CGTA 2Y24A 3FHAA 3VGFA 4B5SA 2AL2B 3LCWA 3OGSA 2PURA 2PF0A 1XGEA 3AIEA 2NVDA 4QJ1A 3BOLA 4IPJA 5A69A 4AAJA 3SIMA 4ZEPA 5EMJA 4YJ5A 3P2VA 1PKNA 1QBAA 2OZ0A 1Q5MA 4FO4A 3TYDA 2FZDA 4IT1A 2CHRA 2NX3A 3SUVA 1I75A 1OX6A 2Y62A 1SGJA 5I07A 2WANA 1TKKA 4HCHA 4RZ4A 1TWWA 1ITXA 3TWBA 3GVGA 3ZOAA 3VNYA 4O0ZA 3I3EA 4A6GA 4C90A 3W7EA 4Q4RA 1EC7A 2PDFA 1E4IA 4W8LA 4QX4A 3DHUA 5PTDA 3TQPA 4GHRA 4E2OA 2GGHA 1P1MA 3CLMA 3JR2A 1W1TA 2QJHA 4EPDC 2ZTJA 1GOKA 3SADA 3BLIA 1Z48A 3VKKA 3C5QA 3CAVA 1LQ2A 3OVGA 3AYRA 2GOKA 5LKYA 3IVSA 3W2MA 5DFAA 1OJXA 3A23A 4NRRA 2QUMA 1KWKA 3ABSA 2WNNA 4PUDA 4AMCA 3CHCA 3WLMA 1C93A 1NF0A 1UUMA 3MB9A 1YKWA 2J4GA 5CC5A 1EJXC 1W5OA 4PMZA 3PY2A 1L6FA 1RZMA 4ICNA 3WLLA 1DOSA 3CQ0A 3CQIA 2DQWA 1B3VA 4ERIA 1EKOA 2GGEA 1YRRA 4HMDA 4IMDA 1ZLPA 3FW6A 4PL2A 2Y88A 1SJCA 4RPQA 1GZ1A 4R7JA 1A0EA 2YL6A 4EX4A 3NO5A 4QJ5B 1K7XA 2EAWA 4R88A 3W7KA 3H4GA 1XDMA 3W4RA 3UD6A 1DIEA 2EPNA 2ZUVA 3OOQA 3VOIA 1TV3A 3UWUA 3WX7A 4KETA 4P8VA 2Q01A 4W5UA 3DKJA 3LNMA 2DSWA 3W6LA 5LIYX 1TPC1 3WUEA 4DNMA 4ZE4A 4WRHA 5IBXC 3P0XA 5T26A 4AU0A 3BAKA 1VHNA 4DJEA 2YCIX 3CIVA 4L6OA 5CGTA 1MEWA 5L9FA 1IEQA 4PA8A 3SSZA 1EJ7L 3UYCA 3CO4A 2VMFA 2GFTA 3QV7A 1P6BA 1S1PA 3PFMA 3EKGA 4ZVJA 4CEXC 5TQLA 4GI8A 3B0YA 3CT2A 1OYAA 2F6KA 1LM1A 4OZOA 3FXGA 1WAWA 3GRIA 4I9TA 1R7AA 2HISA 1HJVA 3AROA 5BZAA 3NVDA 1EHAA 3NA8A 3PAJA 4Y2WA 4DAIA 2KAUC 3S5ZA 2GUBA 1GW1A 4XVEA 3VOFA 3DI0A 3HFYA 3SDOA 3MKCA 1OFBA 4LRTA 1U30A 4PMDA 3CWNA 2C3ZA 4IIGA 4WK9A 4IM4A 2R82A 4A35A 4H7VA 2MUCA 1OC6A 1JUBA 4ML9A 1EX1A 4PTDA 3TSMA 3TKFA 4Z0JA 1QK0A 1BKHA 1VC4A 3THUA 4PCPA 1GUVA 1H0GA 1U33A 4F9DA 2XH0A 2TYSA 3SAZA 5M3WA 3BJTA 5C70A 1UWIA 2QDEA 3DFSA 4PUKA 4TU1A 2DH2A 3ZWTA 4U33A 4GRSA 3NR0A 4LUTB 1UZ1A 5HXMA 3NQVA 3EB3A 3NDYA 3NPUA 1OGGA 3ZLGA 2V0TA 4C6EA 1PTDA 2PBGA 4FIQA 4IUGA 2HXUA 5ABFB 1G4TA 1W1IE 2W79A 2DZSA 2Y7FA 2P0IA 2IPGA 1B31A 4QEEA 3OVQA 1XIEA 3LI0A 4Z42C 2D3LA 1AD4A 2FJKA 2NQHA 1V0LA 3FJ4A 2QEZA 5I24A 3LERA 1ML1A 1B3ZA 1SMAA 4B15A 2PDBA 3BG9A 1V6VA 3LPOA 3DDMA 1K6WA 1X38A 4WSHA 3CPUA 2ZC8A 4LALA 3CWHA 4DXXA 2QR6A 1S2WA 2HJPA 1US2A 3M5YA 4HPHA 2EXOA 3NSMA 2QCEA 4QG8A 4GPNA 1Z32X 3SN4A 1Y5VA 1GT8A 3SY1A 1MZHA 5A3HA 3PWIA 4JIEA 1XUZA 1W5PA 2NUXA 4NZ4A 4QRNA 4IISA 5K9DA 4R7OA 4JTRA 4G7EA 5E09A 1KFWA 4GUJA 1PKYA 4HZMA 6XIMA 4OWGA 4C1NA 2PDXA 5BOEA 2CZVA 1B1YA 1CGTA 3M4HA 1QOPA 1E6PA 3WK0A 4M82A 4MVAA 2ZA3A 3TH6A 2XTKA 4Q7BA 3MI6A 1BGAA 4F2TA 4R33A 3OVPA 2O9OA 1S2CA 4X9SA 2F7FA 3URBA 4MFDA 1UH3A 3CUZA 1V8EA 2PP3A 4UXDA 1DXFA 2PFHA 3IJIA 3EZ4A 3M6DA 2HVNA 4XTIA 3W7LA 3DH7A 4O1DA 2D0HA 2CLKA 3IGHX 2UBPC 4QP0A 3KX6A 4PN2A 1UR3M 1RHCA 4V28A 4JTHA 3WNLA 1QATA 3BH4A 2QGYA 4MWAE 1SZEA 3SURA 4AEFA 5FAJA 4W89A 1SFJA 1NFPA 2NVCA 3N6HA 1J4EA 3I3DA 1NP0A 1EFZA 5I78A 3LY0A 4ZTXA 2PC4A 1X1ZA 4MWAB 5FJPA 3O6CA 3E96A 2I5QA 3GC4A 1XPGA 3AZTA 4ECLA 3HF3A 1LCOA 1Z89A 3LBOA 5CC3A 3L4UA 3HGRA 1BHGA 4O12A 3T9PA 4MFEA 4XUGA 1XG4A 1AFSA 3C2OA 4H00A 1K8YA 1KFCA 2HQAA 4XZIA 3OYZA 4G5DA 3WLNA 3K8KA 5T8GA 1TWDA 2FJUB 4RE3A 4HPXA 1KV8A 3S6DA 1KM4A 3NIYA 3ZT5A 3EOLA 5CGQA 3WQGA 1PDYA 4NRSA 3PG8A 4BQ2A 1J11A 3QR1A 1VBHA 2R24A 1Q6OA 4K1WA 4GUHA 1O94A 5BCAA 4I7UA 2JKEA 2OEMA 2WM0A 1OIMA 5T9BG 3BDKA 4CU8A 2GVEA 1KRAC 2H3BA 2FPYA 2QZRA 1EIXA 5H2ZA 1US0A 3B9EA 1XICA 2P88A 2O4QA 4O0KA 4GXMA 2WZTA 6ALDA 4FXRA 2Y8KA 3GAYA 3GE7A 4LV9A 5AN7A 2QIWA 1MW0A 3EDJA 3WLIA 5CJ5A 1GVYA 3BG5A 3N17A 1JCXA 1TPFA 4OIFA 4AF0A 1E6NA 4CN4A 4DF0A 3UG5A 4MWAD 1W9UA 5D09A 1DXIA 3E02A 5G1TA 3ZVHB 1DPMA 4ZQOA 3WLOA 4UTWA 5BYWA 1HP4A 5A6BD 3C3NA 1EGZA 4G6CA 1OINA 1Z41A 2DT3A 4Y9NA 3T1GA 1FWRA 3ORWA 4HN4A 5DY2A 2NV9A 2A79A 1VR6A 1JCTA 3FKRA 3KVMA 3G3DA 3WF3A 8XIMA 3IUDA 5I7GA 3TMLA 3TLLA 4MNJA 3QOMA 4Y90A 4C6LA 2Y5SA 3PJUA 3SN0A 2J8FA 1MDLA 1XFBA 1DHPA 5DCDA 1VFUA 2PA6A 4TVUA 3M44A 3L4VA 4IXHA 2CLFA 4LFYA 2QPXA 3SSJA 1UB3A 2Z2AA 4QXIA 1S5VA 3B8DA 4L5ZA 4DELA 1E70M 5D02A 1GTHA 3NQ7A 1WOAA 3T44A 4FSAA 3SGUA 2OLHA 4DF2A 3VZYA 4GINA 4OV9A 4AY7A 2XN1A 2AGKA 1T8XA 2NQ5A 3EX4A 1RP8A 5G2IA 1RK6A 3TTYA 7ENLA 2CLMA 3LXCA 2BY3A 3MDUA 3R5EA 1DIOA 1RBOB 3ITGA 1W6TA 1M1BA 1HL2A 2OLAA 3BOFA 1O7AA 3SO7A 1J5SA 1UKOA 1A5BA 2IQ0A 3CV6A 3TFCA 1E1CA 1H3GA 3F1QA 3LTPA 3HN3A 4YN5A 2VO5A 3KVLA 1RY0A 3C2RA 4I7WA 3ATZA 3GU1A 4YU1A 4HU8A 3ELFA 3M47A 4AF0B 1ZAHA 1EUNA 1KQZA 3LUTA 3ARVA 1UH4A 2HDJA 4X2PA 1K4HA 3UJEA 4GY0A 3ZS4A 2Y4SA 3CUJA 4AWEA 3LDVA 4Z0SA 1XYFA 2HVOA 3EKLA 5C71A 4UBPC 4RXFA 1U1UA 2B0MA 4H2HA 2OKTA 4GZEA 3RGTA 3CL7A 4K7YA 5MHBA 3MP4A 4BK9A 3P5YA 4C1NB 3NCOA 3A3HA 1Y65A 2ZZ1A 1CENA 2DVUA 3TNOA 2FH6A 3TE9A 3VGGA 3Q45A 3ANUA 2G4FA 3E0LA 3R0UA 4AD2A 5I3IA 3CUIA 3BW4A 1W37A 5A8QA 5C2GA 3W7CA 2Q8ZA 2IKHA 1L6SA 1NFGA 2WZHA 1IGWA 3VINA 3TU9A 1GK8A 1O5KA 1F61A 1KFLA 1SPQA 3QYQA 2BHYA 3LS9A 4I9MA 3HM7A 3SFKA 3KBWA 1WP6A 3QMTA 5BU6A 4J5NA 5K7JA 3UU0A 3LPGA 4S3BA 3TXVA 3IIOA 4IQEA 1W54A 1UIOA 2V6AA 2WVVA 3NJ3A 4LX4A 3R10A 1G7UA 4WIWA 4H41A 1Y5XA 2HRWA 3W00A 4DPQA 5I03A 2C0AA 1GKPA 1ADOA 2J66A 1L2QA 4NI3A 3RPTA 1NDYA 1OCNA 2GDUA 5C9UA 5H8PA 2QJJA 4H04A 5EU9A 4UUIA 4HOXA 5D2VA 3CHVA 3PUOA 3D47A 1U1JA 4Q7IA 4MY1A 3PZNA 2V63A 3DXIA 4M29A 5AHLA 3MTWA 4QSHA 2ACSA 3GH7A 1D3CA 1VFLA 5E0KA 2OSWA 1QNVA 1FCVA 3I7QA 3QV8A 4B3LA 3NM3A 1OX4B 3E0IA 2YDQA 1VJSA 3W1NA 3GDMA 3M1ZA 2BFGA 2QCCA 3MS8A 5AVNA 3LNPA 2WC3A 1A47A 3B03A 3WDQA 3BV7A 2ZZ5A 4OUEA 3RLHA 2VL4A 4B5WA 3MVTA 2VENA 4M1RA 5IFTA 2E9LA 2PD5A 1G5AA 3GW3A 5KZDA 1O5XA 2FQIA 1DIDA 1W8SA 1P43A 2CXGA 1TV4A 5K9XA 2XN2A 4J27A 1L2UA 4B5UA 3WIJA 3SFWA 5A94A 3OO2A 3NGFA 1D8CA 4H7CA 2XZ9A 1W3TA 4ZENA 2A6LA 1EBGA 1EJTC 1VCVA 2QJMA 1N55A 5BW6A 4MKNA 1QNQA 2OZ3A 3O63A 1FHUA 4UTTA 2FHFA 4AH7A 2OEKA 3V5FA 1HJSA 3LCIA 3W7GA 3SUUA 2JBMA 1WDSA 3F4NA 3EPMA 2YDAA 3IJ7A 3SUTA 1PCKA 2RHGA 4X0NA 1FWCC 3VOJA 1JZ6A 2YOCA 5FJUA 2EJ1A 3GXNA 2Z00A 4LVGA 1LWJA 2JIEA 1Z69A 3A9IA 1K4GA 3OHMB 1HUVA 2PWEA 4JQ4A 4PSRA 1R7OA 1XBXA 1LL6A 2CBJA 4DJFA 4M6UA 1W9VA 3BW3A 1EPXA 3DERA 3CV1A 3ME3A 1A5LC 2QCHA 3GHRA 4F66A 3KBMA 2XH4A 2V9DA 1C7SA 1JFXA 4QLLA 3VPLA 1JNEA 1JQVA 3L5MA 3N2BA 4Z17A 2HROA 5EPDA 2BXVA 4LBRA 1DJYA 4LEQA 4Z2GA 2FTPA 3PWAA 4ORMA 2ZRYA 4KEUA 2XFFA 3S47A 4ZO6A 2FYMA 6PTDA 2R14A 2C6QA 4IIDA 3OBEA 1AH3A 1WZAA 1QNRA 1XC6A 4E3VA 1E0XA 1W1VA 3ZLFA 1BRLB 1XCXA 2JFEX 2YSWA 3AI0A 3GG0A 1UMLA 1ZAIA 3JW7A 4LY4A 2EQDA 3UT0A 2EPKX 3PUGA 4DN1A 3W0KA 1ME7A 4NILA 3PUEA 3H2OA 3V7PA 1EEXA 3KL3A 2ZVIA 3G1DA 3EA2A 2BSLA 2G5WA 2ATSA 1BKSA 4H8VA 4IGHA 1TV2A 1E71M 1XIDA 3W37A 4QIUA 3B8IA 3TJIA 1WB0A 3R2GA 2FMOA 2PF8A 2OKOA 5D30A 4PMYA 2J7BA 3N2TA 2FZMA 1JPIA 1XLIA 3PUDA 4DZIA 1SFLA 1AZ1A 4CQ8A 1MZRA 1Q65A 3ARUA 1OX5A 3WD1A 4L65A 5DXXA 3S6TA 4J3TA 2FZ9A 4JX6A 4PH6A 3H2EA 4GO8A 4UTUA 4C91A 1FWFC 2XSXA 1ZENA 2Z29A 3UETA 3XIMA 1B90A 1BQCA 4E8GA 5CZ0A 1EOMA 1DJNA 3RM8A 3AWOA 4FLOA 2X0YA 3VNDA 1CT5A 1IZKA 3FHQA 1JZ8A 3RJXA 4ZB0A 5EYWA 4Q8VA 5E0FA 3H22A 4ZE5A 4INFA 5D2TA 5G4EA 4N9EA 3QZ6A 1OD0A 3P67A 4PMQA 4KIEA 4H9TA 3H2FA 1OM0A 2VGGA 4LC6A 2ANUA 2PTXA 2WKGA 3P61A 5A6SA 4X0VA 3AXMA 3ONBA 4NAEB 3ZJ8A 3IJDA 1UWQA 5LIUX 3R89A 1B54A 3QR3A 4AISA 5BROA 2CKRA 1K9FA 3H54A 3QM3A 4NVTA 3IJ6A 4JEQA 3KHDA 5CXPA 4CGTA 1PCWA 2JK2A 5KZEA 1ZUAX 3M6YA 3U5YA 3ISIX 3LENA 3SCRA 3VC6A 3PP7A 1PWMA 4KESA 1SU5A 1XYAA 4O28A 1VYRA 4MADA 5B7ZA 5TF0A 1NWRA 1LZOA 3P84A 4TTGA 2Z1BA 2GQ9A 4REQB 1J96A 1TE1A 4A8NA 2PRMA 3L7RA 4KMQA 3VM7A 4JTTA 4O17A 5I3FA 1HJUA 2ZADA 2PLJA 3FYOA 3UWVA 3L4YA 1OGSA 1O12A 1P0BA 3MANA 2VOMA 4WUIA 3DFHA 5EMYA 1ZHAA 4GISA 4HK5A 3URQA 4WKAA 5AZ0A 3NL2A 3FFSA 4HN8A 3W38A 2BS9A 3K30A 3RU6A 3AU6A 3W1AA 4HNCA 4UTLA 2X30A 1UD5A 3VILA 1ZB5A 2EHHA 3ZJ7A 4A4AA 3BLDA 1IWBA 4L1GA 3GG8A 1ZAJA 3GYCA 3OEXA 2BZNA 5D38A 3OP2A 2L5HA 3S1GA 3C61A 1DJXA 1H11A 4WKFA 5K4XA 3AMGA 3NQ2A 3QW3A 1V3MA 3R4IA 5LXXA 1S1RA 1RBAA 3ITXA 1QI0A 3W72A 2E77A 4ZQPA 4JNYA 2WBKA 3WBAA 4GVHA 4MPKA 5IRPA 1I6NA 4BF9A 5HAOA 3HG5A 4Q8WA 4CQBA 3DIPA 3PULA 4J3WA 3EWCA 2DZPA 3FCPA 4ZXOA 4DO7A 5CZKA 2OGJA 1ALDA 3MT1A 1G6CA 5F1UA 1AQ0A 3G0XA 1WA3A 1X39A 1J2WA 2D23A 5GPRA 3KEHA 4MPQA 3LV6A 4MUPA 3N3TA 1JPDX 1XIIA 4MJ4A 1CGUA 2WWCA 3PR2A 2VX7A 2XH2A 4AHPA 3M5XA 1E55A 4JR5A 3GR8A 1RQHA 4UR7A 3CXOA 4BJHA 2QKFA 2CYGA 2CIPA 4MB4A 3VNIA 1X8FA 4X22A 4IX0A 4U2YA 3FA4A 3IWPA 3FOKA 3KS6A 2HS6A 5J04A 4F8XA 3DKLA 2YL9A 3LCGA 3S5OA 4A05A 5CPSA 1JD7A 4PBFA 1MSSA 1YXCA 1HT6A 2X8RA 2Q3OA 4HZ7A 4FK9A 3GG1A 2QQ6A 1T8QA 3GBDA 3W25A 5CJNA 1QRQA 4XAPA 1TA3B 3W2UA 3FA3A 1OSEA 4GI9A 3G22A 1KM6A 1CLXA 1S3TC 5DMMA 4CQAA 2NX1A 4HQVA 3TA6A 4LCQA 3PB2A 1TREA 2BGNE 3QBUA 1KBLA 4RL3A 2OLSA 5GVJA 2DSUA 3N9RA 3GY1A 3QKZA 3WDIA 1T7LA 1WXZA 3SQMA 2VQUA 1Q6LA 3E3HA 3WK2A 4L6HA 1JDAA 2Z7KA 4D6DA 4I5RA 3VCNA 3APTA 8TIMA 3E2QA 3W71A 5FF0A 2QT3A 4HYRA 5A6JA 5I2UA 2O55A 2OJPA 1BFNA 3G6MA 4Q6XA 1MXDA 3WLJA 2V38A 5AHFA 4DYKA 2GJRA 1UMYA 3PNUA 5IDZA 3W01A 3T2OA 5DLCA 4XQ6A 2FPTA 3DAQA 5DF0A 1GVOA 1B0IA 1VYSX 3ID7A 5FCZA 3PJWA 1OBAA 2Y8VA 3FVDA 5BOOA 1ZSXA 1XGZA 3KVJA 1XLGA 2QUTA 3PBVA 2FFCA 2C16A 4HHHA 1OG0A 4U28A 3VD9A 5C54A 3LTSA 2DSZA 3TCSA 4IFKA 1X1OA 3WMBA 1VKFA 3UWZA 4FI4A 4WCJA 2FTWA 2YDSA 1ZPTA 4ZO9A 1KCKA 3GFYA 2VWSA 3PJXA 1VFMA 5EBAA 4QROA 3MY9A 1E6RA 1C9DA 6TIMA 3LRKA 4CEUC 3VIIA 1JZ2A 1KR1A 2V5JA 4F2UA 4Q8PA 1KW1A 2X40A 2RUSA 1E43A 4H9XA 1OB0A 2ZRXA 2ZUWA 1SMDA 3TV8A 1CYGA 3V5CA 4AVNA 5FEWA 5FIPA 1JIBA 3E0WA 4O52A 1TSIA 3U4FA 3RPDA 3KM8A 4J3ZA 4ILSA 4JHZA 4MUZA 3GR7A 3RR4A 2ZZ6A 3MMWA 5A95A 5CZJA 1REQA 4CU6A 1Q6FA 1V6TA 2WZIA 3B4YA 3ARWA 3M0MA 1XWYA 2Y7GA 1LT8A 1QT1A 3W7MA 4BKNA 2X1UA 4ML4A 4J3UA 3K1DA 4M3PA 2HNHA 4LS0A 5E70A 1XJBA 2ZUNA 4H8HA 2C0HA 3GNRA 4O1CA 4GVGA 5JXQA 1UWSA 2Q3RA 1GG0A 2PP1A 4FALA 3M0HA 3AZRA 2WWDA 4LANA 4B4FA 2PP0A 1HZYA 4W86A 1LRNA 3U7BA 4D1JA 3QF0A 1XFCA 4NZJA 2CXEA 3PNZA 5C7HA 3N25A 2HSAA 3PZMA 1WUFA 1J0KA 1H7RA 1KCZA 1JDEA 4IPPA 3T08A 3VI2A 3VOGA 4M5PA 4F2BA 1ZU8A 1MW1A 3VKCA 1FWJC 2PGWA 5DT5A 1XLLA 2VURA 3SJNA 3GB6A 1TR9A 1FBAA 3O1NA 4KKXA 1PAMA 3MCNA 3BLLA 4CQDA 2VC9A 4HA3A 4OOZA 4Z1BA 4ERAA 2WSYA 3IAQA 1F3WA 4WSJA 3PBYA 5HNNA 4RUBA 5DCEA 3QJAA 1V77A 1ZTVA 3WK3A 3NPWA 4Q8OA 3AXIA 1JDFA 2BB0A 1VD6A 1DJZA 4RE2A 4BF5A 5FL0A 4C1KA 2Z2UA 3DU0A 1GQLA 3AHZA 3ZR6A 4FEZA 1ITUA 3IUIA 1H5YA 3IPWA 2P5NA 3PPHA 5IDIA 3UJSA 2MANA 2W92A 2NT1A 4RV3A 4O11A 1TCDA 3RCYA 4V15A 2X7WA 3WQWA 2RDUA 1Z7AA 3BGGA 3MJYA 6CGTA 3U9IA 3T7VA 3H2NA 2F2KA 2WC7A 1W2PA 2WAGA 1GOQA 2R8WA 3CB3A 4NZ3A 4ICMA 2BXYA 5M2FX 1NOUA 2GUYA 1PWLA 5JU6A 1E5JA 3CO8A 3MP5A 1J79A 1BVNP 2C15A 2OQYA 3HV8A 1VF8A 1PSCA 3BTNA 1RBLA 3SGGA 2PDKA 5LZLA 4PCFA 1CLKA 3VMPA 2G3MA 2OO0A 3LN3A 4H7ZA 1Y8BA 2GGJA 3BLFA 4P8WA 1K7FA 2ICSA 3LV5A 2OSXA 3TYCA 3M0YA 2JIWA 3VMNA 3MSDA 1VEPA 4ZB5A 2QIIA 1EDQA 5G2WA 3KRSA 2X2YA 3SY8A 2CETA 3W7OA 3PS7A 4A3YA 4UZSA 5FF7A 2V3DA 1J93A 4MDOA 1PZ2A 2VYOA 4HNNA 3NM1A 2ZQ0A 4AEOA 1L9WA 4F48A 5D8WA 1FY6A 3ZR4A 4ACZA 3EXSA 3BOXA 1AMKA 4XV0A 1KFKA 2PLKA 3HPZA 3C86A 2FZ8A 3DESA 3F4DA 1LQAA 4E2VA 3UWWA 1WDRA 3CYJA 4ZB2A 2JGYA 1J0ZA 3VDAA 2ZA2A 4WX2A 1DWJM 3WD2A 3WBYA 2VJXA 4HOZA 2CKSA 3OW1A 3SBFA 3STFA 1KRCC 4DM1A 3NOYA 3FV9A 5U7SA 1YEYA 2FKPA 4LB3A 2YIHA 3AC0A 4XX6A 1G0CA 4IPIA 5LNSA 4TTUA 4XSMA 2V3GA 1SR0A 4DWDA 1XF0A 2OWXA 2DFAA 3G0UA 2FDSA 4CKQA 4JTJA 2W4XA 4EWND 3TYAA 1F76A 4GE8A 7CGTA 3VC5A 4RW3A 3RX4A 4LT9A 3S5SA 2FFIA 4J2MA 4C5ZA 3R8GA 3AS0A 2XVKA 2E8YA 2Y5EA 1F8IA 4KCTA 2BGSA 3GIPA 2WHMA 2VFEA 4GA8A 3U2CA 1GVQA 1HKKA 1EDGA 2XIIA 3CT7A 2GL5A 4HCDA 2D2HA 4I8YA 3RHGA 1FDYA 2HBXA 1CNVA 4HMCA 3MP3A 4JIQA 4IQLA 3KTSA 2OYMA 4LVAA 1DBTA 1XIBA 1P4CA 1MMFA 3AJ7A 4GUGA 2VEGA 3BJSA 3AYVA 1TVPA 3AALA 1UHVA 3S83A 3N3MA 5AKQA 1IEXA 3CUFA 5BNKA 1UYQA 4XD6A 1Q6DA 3AIUA 3M0XA 3SQSA 4DWSD 3UWYA 1ECQA 3NO3A 1HVXA 4E2DA 3ABXA 2O4MA 1VB9A 3WL1A 1MUWA 3I65A 1W56A 2IXUA 3RLGA 3WD4A 3FAXA 1DWIM 2J77A 1XISA 3RMJA 5D9PA 2EPOA 4F0HA 3M0IA 4QCEA 1H63A 1O1HA 2ZKMX 1EJRC 1TO3A 4GX9A 1DXEA 2PRLA 3BGAA 4W5ZA 1KM2A 3O2LA 4TMCA 3S9IA 3GBEA 2P53A 2WM1A 3MHUA 3T81A 4Q8QA 4C7FA 2RDXA 2AKMA 5I79A 1K6AA 1TELA 2PMQA 4NJGA 1C90A 1F7BA 1ZS2A 5I3KA 2YYTA 3N14A 1W3KA 1WZMA 4IFOA 3UF9A 1KLYA 4BF7A 1FWEC 1A3XA 1GOWA 5B80A 3IJQA 3VIOA 2XIJA 1NU5A 3MSGA 3OZMA 4ES4A 2E28A 3N04A 4CNSA 3AHYA 1GYLA 1R3TA 1XYBA 3TW9A 3A24A 1GVEA 3WD0A 4US5A 1OFDA 3BC9A 1XSIA 2E68A 3M07A 4YHEA 2X1RA 4OVXA 3TW6A 3EOOA 3VUPA 3H2CA 4PTXA 3UGRA 4HGXA 3RITA 3THDA 5D8ZA 1L8NA 1CZ1A 1CBGA 2YXGA 3ZR5A 2EPMX 3I7RA 4JGDA 4QFUA 2E5DA 3TZFA 4KRUA 5I02A 3SIZA 2E4TA 3JS3A 4V27A 1PVNA 3WZ0E 7PTDA 4FA3A 3B8WA 1B57A 2NW0A 1F73A 3DOPA 4JFUA 2CCRA 3N18A 3WK1A 3S6OA 3BURA 4A3QA 3UCCA 4KWVA 3O0FA 3W1RA 2DP3A 3DX5A 1OABA 1CDGA 2YKKA 3BCJA 1JF5A 1LBLA 4GG9A 1BD0A 4AD4A 3N2CA 4M6QA 1MW3A 1FKWA 3CLWA 3H8AA 2AMGA 3GNDA 1H1ZA 4K7VA 3MSYA 4GNKB 2YW3A 3WO8A 5AHMA 2J24A 3A4AA 2Q6ZA 3HPAA 1MI3A 2V3EA 4AFYA 1P7TA 4LC8A 1LLZA 1KRMA 1Q45A 3DC0A 4V1XA 2BDQA 1Q13A 1M7XA 4XZLX 4NJKA 1V3HA 3OHIA 2UZ9A 3R8RA 3PZIA 1TRDA 3RO8A 4FXFA 1GCYA 4AQLA 4C6NA 3PBMA 3IJ9A 3DN5A 5FSEC 1QWKA 1UA3A 5FEPA 5FF3A 1JCMP 3A21A 1CXEA 2BX7A 4PRTA 2XIMA 3MWCA 3QMSA 4YVXA 3HU7A 2W66A 4EK7A 1FWWA 3SRDA 1OVDA 2NXGA 3R8HA 2VEFA 3E38A 1UR4A 4H1ZA 5BXRA 2CWNA 5H91A 1DJHA 2VC5A 4BA0A 3W88A 4IMFA 4NZ1A 2W63A 3T6CA 4FNQA 4QDWA 5ABEA 4W93A 4F40A 2I9UA 4IJBA 2PLCA 1BXCA 4EXAA 3CTLA 3L2IA 1JF6A 4NNBA 3AOFA 1B4KA 1IXNA 4PMUA 3E12A 4XBKA 2OXNA 3AMKA 1QMLA 1PIGA 4QDPA 1A3WA 4LUTA 4XO7A 3T0BA 2EO7A 5DRCA 3IV3A 1IEIA 2NXIA 2A3AA 3W53A 4UFJA 1OYCA 1B9ZA 2D0GA 4PTWA 4WDTA 1K9TA 1X97A 3V36A 1WDWA 4MAZA 5JMUA 3QSTA 4XBSA 4Z2HA 3W2KA 1M3UA 4O19A 3M43A 4R34A 1OC7A 1GORA 3WQ4A 3W87A 3LLXA 1J6PA 5JVLA 1HFBA 2YBTA 1MFVA 1TWZA 2XUCA 3CV2A 4EP8C 1PHWA 1VEOA 3MDWA 4RCXA 2GDQA 2EGZA 3VOCA 3LTYA 2VEMA 1H1YA 3AXHA 4HMEA 3LBMA 4PB4A 4W84A 2OX1A 2XGZA 3W1PA 9XIAA 2DQXA 3HQOA 5HQMA 2GQAA 3PZTA 4LXFA 4BCEA 4JIHA 1PZ0A 3OLEA 3COTA 4GACA 1KTCA 1NTHA 4BQ3A 3PZUA 2Z1KA 3GTHA 4I9AA 3RLVA 3H55A 1PIIA 3T78A 3LRLA 3STCA 4O4WA 3TXZA 3O05A 3HJEA 4KS0A 4Q8TA 2EF9A 2F38A 1ADSA 3PANA 3VD4A 4NF7A 1CGWA 1X6LA 5T91A 1F9CA 5ABTA 1TVNA 3NO1A 4M19A 3TCEA 1DTUA 5HANA 3WQCA 4MHBA 4GO9A 1WUEA 4Y9OA 5AC7A 2NQLA 5REQB 4N6FA 3A5FA 1BGGA 2QYGA 5E0CA 1QWGA 4B90A 1X6UA 3WBXA 1OCBA 5I0DA 1FWDC 5DY3A 3GVWA 2X16A 1AQMA 2GSEA 3RO6A 2V68A 3WQVA 5CLWA 3GFXA 5DRIA 5KZ6A 2J7EA 4AZCA 2D2OA 3L4WA 4DIAA 4WOZA 4PCNA 4LUJA 1XRVA 2R1PA 4GKTA 1B30A 2AL2A 1VCFA 4OUIA 2OZTA 2QPUA 3WLTA 5GQBA 2PDCA 3UJ2A 1DKWA 3GWQA 1EOKA 5LA2A 2DZAA 2CU0A 3SB0A 4GUFA 4DBUA 3H26A 2CFFA 1HKIA 4XZHA 2F6XA 3NL6A 3NNTA 4B91A 1JULA 3BW2A 4XIAA 3VGBA 2HK1A 5HPOA 4X9YA 4W8AA 3QFEA 1LJYA 4UFLA 3QLLA 1VS1A 2WJDA 2X41A 2WPBA 2IXVA 3EWWA 1RV8A 4H9ZA 4NNCA 4C6QA 1RA0A 4L1WA 3SRFA 5F4WA 4KCVA 1X7IA 3HGJA 4AWSA 4LS1A 1NH6A 2HBVA 3LMZA 3UXLA 2AQOA 2ZUTA 1JZ5A 3I7SA 2A3BA 3TMQA 4FOKA 1JRBA 4C6BA 1OG6A 3DG3A 5KZMA 3AMDA 5G1YA 2PWVA 3WH5A 3M9YA 3N29A 1S2TA 4LTSA 5AYXA 1TTQA 4GFSA 3TC3A 2VZVA 3QXBA 3T0AA 4L9XA 3SCWA 4IPNB 2Y2WA 4A2SA 3IV8A 1LORA 4LEFA 4JD4A 5H8UA 4PCTA 3CH0A 3B8TA 1B9BA 1KTNA 4RNJA 4QM1A 2Z0IA 1V0KA 1ZBCA 3IK4A 5GNZA 4HKPA 5LIKX 4JFVA 1VFSA 3N12A 3SRHA 3V5OA 3QW4B 4NQ1A 2PCEA 3MA8A 1IT0A 1UBSA 3VNKA 3QC3A 3O07A 2DORA 1QNOA 5CH9A 1A5UA 2C71A 2ISSA 3UZZA 1BEUA 4NZFA 4ONVA 3O6DA 1Q7MA 1VEMA 1QASA 2ZICA 3BAXA 1EC9A 2A21A 3EB4A 1G01A 4XAZA 4MMWA 4XB3A 2VZOA 3V1HA 2RGMA 4UMAA 1V5XA 5AZ1A 1XHGA 3WMSA 3IVUA 3PZOA 4L4OA 3S9ZA 3UXKA 4ZCWA 3G8RA 1P0KA 1O6IA 3F4VA 2Z1SA 1EZ2A 4N9CA 3Q37A 3LXBA 3Q65A 4RDVA 3WJZA 3JUGA 3S1UA 3UEQA 2DUZA 1BQGA 4DZ5A 3D6NA 1SW3A 3LBCA 4FNUA 1KXVA 4UFIA 4B5VA 2JE8A 1UWRA 2PTDA 2ON3A 4ZQMA 2QF8A 4O1FA 2BLEA 1N82A 3VDGA 3R7MA 3KVKA 4L80A 3VIJA 4EXBA 5CQ1A 3KRUA 4QITA 5M5DA 2Z1VA 2AMXA 2J7DA 2ACQA 4L7ZA 1XLBA 2GSHA 4JQ1A 4RV8A 3RF9A 4HA1A 3QY6A 4OBTA 2P3ZA 1TFVA 3O06A 1AZ2A 2P3EA 3TAOA 2I5IA 1KGUA 4QHRA 3TTSA 2V67A 1YPXA 1FX6A 1JZ7A 3EDEA 5D2WA 1TV5A 2GVYA 3HURA 3QHOA 4DWSA 2FHCA 4D8LA 2WSQA 4EVZA 4K1GA 1E1FA 1NY1A 1MNSA 3M7SA 1E9ZB 2WQDA 2HPMA 4AY1A 5E93A 6REQA 3EA1A 1PV8A 2A7RA 3TTOA 2HZGA 2VRJA 4I5XA 4LAKA 1ZJAA 3WMLA 4TOQA 1G4EA 4F0RA 4IGNA 3TVAA 3Q58A 3WUBA 2NX9A 3QPEA 3GUWA 4BHYA 2GZXA 3TJXA 3KZPA 1GJUA 4LWWA 4J1OA 4AXNA 1GOOA 4P7RA 4DJEC 4ADTA 2DV0A 2GJLA 4CN6A 3N19B 3G1AA 1LOSA 4YTRA 4TQTA 2IKJA 4QG6A 2OEJA 1C29A 3BMVA 2E1WA 1ONEA 4CVUA 3H21A 3N13A 2D1ZA 4MOZA 3LD5A 4NP7A 4W7VA 1CXFA 4GBUA 7XIMA 1WX0A 3E5BA 4JTDA 4H2CA 1QHZA 3RR1A 2IS7A 3W2JA 3EAUA 1A5MC 1R2TA 2QDHA 1RQBA 4L6DA 1L6WA 1LP6A 4YTSA 3P81A 4LSBA 3NWRA 1TMQA 5I6SA 4ZODA 3BARA 4S3CA 3PPGA 1MQPA 1EUAA 2IW0A 2PWHA 5B7YA 1XCFA 4LH8A 1JUKA 3INPA 4NZ5A 3R79A 3FN9A 1VHCA 2VX5A 3MUXA 1HO4A 5F7UA 1R47A 3CIWA 4D8ZA 5AC8A 2CEQA 2DIJA 4C6FA 3NAVA 2V30A 1J0IA 1LUCA 5HOSA 1CXHA 3LYEA 5RUBA 4ZSTA 2QJNA 3T2QA 2H6RA 1JVNA 2WO5A 1HKWA 3P62A 3GHTA 3M46A 4Q4OA 3H12A 1VBRA 4RNHA 4AG0A 2PAJA 4WZHA 4U2ZA 5LNWA 4JTCA 5XIMA 3ARPA 4UB9A 2ZDSA 4QEHA 3UZXA 3W7QA 2CZFA 4WDUA 1US3A 1MXSA 2NWSA 3OBAA 1SQ7A 1F3TA 5SWUA 2CC0A 3B0PA 1RJRA 1GJWA 1DQUA 2WW5A 3C2YA 1XYLA 2B7OA 4FX6M 2E9MA 4A21A 4D6JA 1FCQA 2X7VA 3IJ8A 1PS9A 5CAKA 4W4QA 3UVIA 5CG0A 1AMYA 3P0WA 4KBXA 1A5AA 3AO0A 1KWGA 1YXDA 5CBJA 3WFZA 2QHAA 1GVRA 4X3ZA 3A3XA 1E0TA 4L56A 3P80A 5LIWX 3PBWA 3B9DA 3GX9A 1WCGA 2VVNA 1YX1A 3LHVA 4LUYA 4GQQA 1LYXA 1JL8A 2ZOXA 2PGEA 3T4WA 3W82A 1DORA 1Q6CA 1WAUA 4UCFA 1JI1A 3FSTA 4C7DA 4JTAA 1QPKA 3EA3A 3KCJA 3W6YA 2QVHA 3WQFA 3FKKA 3CPRA 3BVJA 2C1IA 3CJPA 4XKYB 2WOQA 3U2EA 4DX3A 5C7VA 3GO2A 3GR4A 4ZQCA 5IOBA 2PDQA 2V5CA 4ZOEA 4LF1A 4JYDA 3VDHA 3DFTA 3VE9A 4MJZA 4N4QA 1OF6A 3UA4A 4F0SA 2C13A 4YWSA 1D2KA 2YYUA 4E2BA 4B92A 3WH9A 5DEZA 1U5JA 2NV1A 1QHOA 3EX6A 3ITCA 1A5NC 2VX4A 1QHPA 3E2SA 3NPVA 4Z2LA 3V3WA 3WH7A 4PBEA 1E56A 3FX4A 3SN1A 2XPKA 5JIPA 3LHZA 3TAKA 4C7GA 3KDOA 1AW1A 3WNOA 1VYPX 4DWSB 2WV8A 3B9AA 4K2SA 3THCA 1VENA 5EMKA 1ME9A 5FEXA 4DHGA 2B7PA 5F2IA 3HMCA 1S2UA 3AIQA 4I6KA 4XKMA 4GCAA 1TX2A 1EWDA 5EGRA 3W7HA 3WLSA 1UZHA 3OQEA 3G0SA 1FFRA 3CH9A 2XINA 3FEQA 1GKRA 1IIHA 2R9RA 1TX0A 3ARZA 3V16A 4S3FA 3ZJ6A 1AL8A 3A4WA 4XWUA 1UJPA 3HZ3A 5FF2A 3P8IA 1QVBA 2GDVA 2CLPA 1OT2A 3RDKA 4JKLA 2C91A 4GKLA 2DZBA 2WCAA 3CAKA 3DYPA 2E1DA 1MEIA 5CZTA 1AVAA 3SUSA 3UERA 4Q4PA 4L1XA 4QBXA 2ISDA 3UYIA 4AZHA 5HMDA 4AZ6A 3FXYA 3VM5A 2JEQA 1WPCA 1IR2A 4S3AA 1K77A 1UWAA 3VNLA 3IANA 2VFGA 4D1IA 3AMLA 4GI4A 1UUOA 1LOQA 3BAWA 3UZ5A 1WDQA 2G3JA 5CBBA 5D9OA 1LLOA 3WNPA 1GNXA 1AA1B 1YNQA 4WEVX 4JTUA 1UIPA 4KFOA 3W6MA 3GD6A 3NQCA 5C2CA 1S2VA 4DJFC 2OYLA 1EEPA 3VDCA 4DO4A 1U1HA 5HATA 3ZQ9A 1SSGA 4IG2A 5CLTA 3EGJA 1VZWA 1FVPA 1UP2A 1RPXA 3BANA 3GYEA 4IP4A 2G3NA 1L8PA 2RJHA 4ASTA 1TVLA 3HPSA 4FS9A 3QGAC 2R1KA 4MB3A 3C0QA 1U83A 2JEPA 1E1EA 2OX4A 1NWTA 3EXRA 1RJQA 4XD5A 5EMUA 1J0YA 5H1WA 2DT2A 5MKGA 3CBWA 5E5CA 3WMCA 3MQTA 4ATLA 3SECA 3MSRA 1VBUA 3S2CA 3STPA 1MQRA 5T9CE 2WNZA 1RSCA 2HE5A 2ZDRA 4A8IA 1W3NA 4N9BA 1LWIA 3UR5A 1KTBA 4GIYA 3TQVA 2DZVA 1XBYA 3A6OA 4GFIA 1G4PA 3KBSA 1Q85A 2DUXA 1PTGA 3ZT7A 1XW8A 1XLJA 3CZKA 1R9ZA 4H83A 3P74A 3CMGA 4K3ZA 4YVPA 4UQCA 3GU9A 1PE1A 2OZ8A 2GGIA 3VIHA 4LAUA 5ABFA 1LL7A 1PL9A 3VD3A 2WSRA 2ATMA 3EDKA 4CNNA 4EANA 2GGGA 1RCQA 1QW8A 4JS3A 4AHQA 4HD5A 4KGJA 4PEEA 4CVWA 1N8WA 3GXIA 1Q6QA 5AYIA 3CU2A 2QUVA 4JL1A 4F9JA 2Z25A 2Z1WA 4N0RA 2A7PA 2GVGA 3BE7A 2OVLA 1M9HA 3NSXA 2BVTA 2XG9A 3MMDA 3AS1A 3VGDA 3WQDA 4GQRA 2VCCA 4GQ0A 2ZX6A 1YTDA 1UWTA 1R9YA 5HA7A 3G1SA 4IJRA 5AHNA 3CPGA 5A2AA 3A4XA 4TX9A 1H7WA 2R6OA 1V79A 1DE5A 4CD4A 3N4EA 1BWKA 3WDHA 1EF3A 4FLRA 2GPTA 4WXYA 1T5AA 4LVBA 1QJWA 2OMAA 4QISA 3IVTA 4UQ9A 4DJDD 4Y9MA 3E49A 1XM3A 4R9XA 3JVAA 1UD2A 3A9BA 1KLZA 1UROA 1JZ4A 3XINA 4NU7A 3DHDA 2ZVRA 5H8MA 4P61A 1MYRA 4DZHA 1B3WA 3LZ5A 1LROA 4RX0A 3EEGA 1FHVA 1VLWA 1YNYA 3FGCB 5I09A 1HW6A 3P3BA 1W9DM 3VX0A 4FZIA 3U2OA 1QR7A 2VEPA 3U6WA 1V6YA 2JKAA 2CW6A 4QLKA 1YE4A 2A0NA 3QPYA 2WHKA 3N34A 2XH7A 4PRRA 5E9XA 4I8DA 3WF1A 4JTSA 2HNEA 3IUHA 2E8ZA 2WCGA 1GVFA 2R94A 4GNVA 7REQA 3UWQA 4W7WA 4WR3A 2PDYA 2VELA 3GQYA 5F4XA 2W6RA 4GXWA 1CB7B 3W02A 2YR1A 1D9EA 1SZFA 4ZTYA 2PDMA 1XYCA 1MUMA 2BODX 2YA2A 1IQ8A 2ZE3A 1RY8A 2PU0A 4AD3A 1H41A 1FCUA 4ZL1A 2Q8LA 5C55A 3IGSA 1V93A 1K9EA 3QSRA 2NQJA 3B0UX 3RCNA 3U0HA 1ONRA 3W83A 4XVDA 5EBUA 2A2IA 4GJJA 2WMIA 1CXIA 1D8WA 4GCXA 1H5VA 2P8BA 2J9ZA 1UWUA 3CUXA 2V69A 2P0OA 1YDVA 1I9CB 2ISFA 1LT7A 3R25A 4A3UA 5DN1A 4GYJA 3W1TA 3P14A 1FKXA 5HNRA 2YL5A 4IQJA 4UIOA 4P7NA 1GWJA 3R12A 1JDDA 2D3NA 3UR8A 3QTGA 4I90A 1XRTA 3UG8A 3IARA 4R85A 1JYNA 4HSHA 3LHWA 1LQ0A 3CZLA 5LXEA 3B40A 2OODA 3S42A 4J40A 3WUFA 3GTXA 4JKKA 4AIUA 4H8UA 3FGCA 2INFA 3H23A 3QHNA 2VC7A 4PODA 2WVVB 3FA5A 2XVNA 4IPLA 3BSGA 2ZZ4A 5FESA 3W7PA 3HQNA 3QPZA 2VR5A 3W28A 1H51A 1PBGA 1NDWA 3EX2A 3WEOA 2E6AA 2FVMA 4JQAA 4UNKA 3UJFA 4XAFA 3EWUA 1XI3A 1GYMA 3MBDA 1G4SA 4PFMA 1AQHA 4D71A 3QQ1A 5BMXA 3L2LA 1TMLA 4S2CA 1WNOA 1NP2A 1FRBA 5C8BB 1AL7A 2O7SA 4D6CA 1GEQA 2PSNA 4KEZA 2OO6A 4DJED 1ENUA 1XH2A 1OFOA 2JQXA 3ES7A 1X96A 3LMYA 1UJQA 2G97A 4URIA 5MKGB 1VFTA 1R87A 3HJZA 2ZXDA 3XISA 1BF6A 4TV5A 3RU8X 3CUHA 4HJWA 1WBJA 3IIZA 2G96A 4CCDA 1YMYA 1FCBA 5LA0A 4XZBA 1AJ2A 3NXLA 1PIFA 3RPMA 1F6PA 1NWSA 3HO8A 4TMBA 1CGYA 3C6CA 4ZSUA 5A1AA 2G4JA 1PKMA 2QXWA 2X2GA 4PMOA 1XD0A 2HWGA 4I7VA 4K39A 3ICJA 1V3LA 3C0JA 5K9CA 3REQB 4R7WA 3LSBA 1EJWC 1L6GA 5E6YA 4TVCA 4PULA 1UD6A 2OSYA 3B05A 4C65A 3CEUA 3EWDA 3ZM8A 3NEHA 1D3HA 2I57A 2Z6JA 3B4UA 4FNSA 3BUVA 4O13A 3RYSA 5ECUA 3VNJA 3NL3A 4IMAA 3AJXA 5BXPA 1JCNA 3WJSA 5ENLA 4C6CA 3L67A 1JJKA 5ABGA 3LOTA 1EPVA 2VNCA 4O16A 2X42A 3GVRA 2PCQA 3CNYA 1JPHA 4E8CA 4H9YA 4W88A 3RAOA 1PB0A 1N2VA 4XZ9A 1UZ4A 3W1LA 4H6KA 3PZ9A 4TX8A 1E6SM 3TSDA 3HQ1A 4NIRA 1E6ZA 3H4WA 3W26A 3NQGA 3EX1A 2H8ZA 3CEPA 4KGLA 2HPIA 2QPSA 3AYSA 4MLRA 3KHJA 4O8AA 3VU2A 3U5UA 1ZNNA 4H01A 1JPKA 1DQWA 2XVLA 2DJLA 1EYWA 2BASA 4UFMA 2FDMA 1L0PA 4RNFA 5BWAA 4LBSA 3UWEA 1HJWA 5K4ZA 3VFCA 2G0WA 3QEZA 3TJ4A 4G8TA 4UQBA 1ICPA 3UXIA 5A6AA 2VI0A 4JTEA 4PMVA 3VIPA 4KRTA 2VFFA 5HJXA 1R30A 1TV8A 1H7NA 4F0LA 2C8NA 2YDRA 2GQ8A 4KT2A 5GNXA 3TC6A 2YZRA 5CKSA 2I1OA 4PC8A 4ZXLA 1TPEA 1JCYA 4K37A 4GZIA 1W0MA 1FXPA 1QI3A 4RKAA 2NQZA 4QQUA 3TQKA 3UR2A 1JXJA 1OCJA 3AFBA 3LPPA 3NOEA 5LNRA 1DP0A 2YLAA 1UKQA 3AIWA 4LF2A 3NQ8A 4JX5A 1NDVA 2J6XA 1FP8A 5HMFA 4GC4A 3Q94A 1TZ9A 1NOFA 4BQ4A 2QJGA 1WDPA 4AIBA 5FKYA 3W2LA 2TSYA 3GDBA 4H9VA 4MSSA 5KITA 4ZOAA 3O6YX 1XLAA 4S38A 2I56A 2WKLA 4J9JA 4Z2KA 3ZJKA 4JHOA 1W32A 2ZE0A 2YA1A 4EPEC 4K38A 3PPFA 1KKRA 3O6AA 4GMEA 4HBKA 4S3DA 4NI8A 4EKJA 1V6UA 2XIOA 3CHEA 4IFKB 1OC5A 4Q4MA 4YHGA 1Y7VA 4WLCA 3GVQA 2VEIA 4M6PA 3GLCA 2PLMA 2BY2A 4TXEA 1UQZA 3E2VA 4HNUA 7ODCA 4IGSA 2G41A 3AMCA 4W7UA 1AH0A 2OFJA 5FA5A 4LUSA 3WQEA 3VDBA 1ZP3A 1UUQA 1LBFA 2PTYA 4UTHA 4HJFA 2PUZA 1XSJA 4DZAA 3EDDA 2DPEA 1TJRA 5GJPA 3AAMA 3O8AA 1F3EA 4U10A 1R3YA 1ONWA 4UNIA 4NXKA 3PTDA 1MEHA 4L64A 4B4HA 4JTLA 4MJ2A 4BI6A 3PVFA 1HKJA 4MYXA 4U3AA 3D5HA 4AZGA 4HMNA 1ZBKA 1JYWA 4UFHA 3CWOX 1S39A 4AYSA 3MWAA 3URAA 5A8NA 2VDHA 2ZXBA 2XHYA 4AVOA 4JTGA 3WH8A 3LX9A 1LBMA 1W2VA 1H62A 4P2VA 2BOGX 3CMJA 3DECA 3UXDA 4ZQRA 2DGAA 2BY0A 1E4MM 3QN3A 1W31A 4P7LA 1TUFA 4DLFA 3WDPP 1TA3A 1XRSA 1EXPA 3C0LA 3K4AA 3POCA 3MV01 2QS8A 2WMFA 3MHGA 5JIWA 5KSWA 4Z2JA 3PN8A 5XINA 1TB3A 3A47A 3W86A 2I16A 1XLDA 5EFFA 1BG4A 4ZO7A 1J01A 4IMCA 2W5FA 5AHIA 4O14A 3QR0A 3I10A 5HULA 2HXTA 4K6AA 4UQDA 3CZEA 1VGAA 7A3HA 2R1MA 4ZGYA 5CJMA 3BLKA 2GYIA 1A3HA 4ATWA 3G1XA 1P48A 2I5GA 3VZZA 3TROA 3G5EA 4B9YA 3QV6A 3RCMA 5JBDA 3T40A 2ZRWA 4JYFA 3EWYA 1GJPA 3AHTA 2O9TA 3SI9A 4E4UA 3WELA 4NXSA 3RFAA 4NASA 4C6IA 3VD7A 1XX1A 3SM0A 1PX8A 4UTIA 1WKFA 2J7FA 4QJ4B 5HWNA 1UC4A 2PE4A 1LL4A 1JUEA 4A29A 4QDMA 3WUGA 4KCUA 4RZ5A 2C19A 1GPFA 1GQNA 2G37A 5TAOA 4JIPA 5LA1A 3R13A 1BYAA 1UD3A 1UW9A 3PTKA 3OB8A 2VVSA 3T0TA 1PPIA 1XIFA 3ZMRA 1O1ZA 5M03A 4UZUA 5ECVA 1IWAA 3KWXA 4DUOA 1TCMA 3I4KA 3ANVA 3VO0A 3IIVA 3BGJA 1CCWB 1ISZA 1KC7A 3GUGA 4U5IA 4GWEA 1YNPA 1ICQA 3TZNA 2XWDA 4WXZA 4IMEA 3TDFA 4NYYA 2YXOA 1TPUA 3BICA 4I9JA 4WJ8A 2DZWA 3O15A 1WV2A 1FDZA 3QRHA 3Q2DA 4Q6JA 4NUWA 3KAOA 1HTIA 3OG2A 2QMJA 2YA0A 1KM3A 1G1YA 3PC0A 4GNJA 1JAEA 1A5OC 3EDFA 1H0IA 2EBNA 3F4CA 3VIFA 2WLYA 3L5LA 1YW1A 1VBJA 2PTZA 3LHUA 4M0XA 1MWOA 5HQEA 1K02A 3N2MA 2YFOA 4KERA 5G5IA 1RLCL 2IMRA 1XIJA 3RRAA 3DCPA 1OEPA 4D2JA 2VD9A 3L21A 1DV7A 3H6OA 4FX7A 4TO8A 4AC1X 2G50A 4Q8UA 4I3GA 4CD7A 2AQVA 2B81A 2F8QA 4GZJA 4HNLA 3U4AA 4U3CA 4BZYA 4UTWC 1A5SA 1YHTA 1ZQ5A 1RUSA 4KEMA 4LPCA 1JD9A 2I14A 2QULA 3M64A 1BPLB 1XYZA 3DENA 4U4MA 1YXYA 2JF7A 4DYEA 1CXKA 4XZWA 1E4LA 1DIKA 2OR2A 5TIMA 2TAAA 1ONXA 2VWTA 4O1AA 3F2BA 1FWSA 4HHPA 2WMJA 1HKVA 1VLIA 2CLEA 5BMWA 2IQTA 1LRQA 1B3YA 1QAPA 3VNMA 4RDZA 4E38A 2UY2A 1ZFJA 5L6UA 1ZALA 2FPVA 3FNDA 3FLUA 4B2DA 4MJMA 1M7PA 1XH1A 3WLPA 1PZ3A 5I3HA 3B06A 4L4MA 2WNQA 3TX9A 3DGRA 4NHVA 3K46A 2QUUA 1CEOA 2XGIA 3APGA 4E4PA 1M5WA 3N2XA 3H7UA 2PWGA 2WXDM 1RJPA 1J8VA 2P8CA 1GONA 1PX4A 1OADA 3S4TA 2GSJA 3QQ0A 1A80A 2VX6A 3RX3A 4AZCB 2J25A 1KM5A 1NVMA 1XC4A 3L66A 2V2CA 5EFDA 3EWZA 1C8VA 1TJ2A 3S8HA 1W3JA 3OG3A 4CCCA 1OWQA 4M8UA 3GDTA 3M0JA 4MY8A 1YADA 4J2PA 5CPOA 4CD6A 1ADDA 4QGCA 2QUNA 3SCPA 4Z2IA 4WJEA 1ELSA 4DQWA 1FA2A 4PUUA 3EWBX 1YLVA 1CB2A 1QPQA 4F0MA 2VR4A 2XZ7A 1XIGA 1KBJA 4FX8A 1TQJA 1XCWA 3IAPA 3MYOA 4GX8A 2WNWA 2EKCA 2F84A 3W7NA 2D69A 4ZFCA 4AHOA 1CWYA 3ZVIA 3DGBA 2ZWZA 4LVFA 2VOTA 5C9WA 2FGBA 1SO5A 1V7AA 4MZYA 1TJ0A 3F5JA 3VCCA 3L4XA 4PTVA 3VIKA 5JBFA 2Y85A 1G67A 1JYVA 3IRDA 2J7GA 5J5RA 1A5KC 3MO7A 4QS5A 1ISXA 2QV5A 2E25A 5A8MA 5GJNA 3GTIA 3EMCA 2PEVA 4K68A 2DSKA 3UXAA 1O68A 5AB3A 1E9YB 1JFHA 3WKZA 3ZFHA 4Q4KA 3BLPX 3LPFA 4FAMA 3VVGA 3R1ZA 4WDWA 1MRQA 2NVAA 2V5LA 3F03K 1KFBA 1MUCA 1JNDA 1E0WA 1SO3A 3M0VA 4DI8A 1O5QA 5AC4A 4AIOA 1CW2A 3WQ8A 2PWUA 4PUJA 3VZXA 3NXFA 1IWPA 3S1VA 2F9RA 1XV8A 2CNCA 3LLFA 1NDZA 4OJYA 4Y8FA 3CZJA 1BYBA 2PDIA 4LCSA 1KB3A 3GXDA 5FJJA 1LWHA 4D6EA 1JQXA 3V75A 2RAGA 2X1IA 3G18A 1KRBC 3NPXA 4EAMA 3UPBA 4B3KA 1UR1A 3W1MA 2WCSA 1TTJA 3KTCA 1O95A 3AXXA 1U5HA 2H9AB 3TYBA 1NSJA 4H6QA 2QCNA 3C56A 3AIRA 1JCJA 2WZMA 1E3XA 4Z1AA 1GW9A 2B7QA 3ARRA 3STGA 4MWAA 2IPJA 4HVXA 3LI1A 3F4WA 1TTIA 2HK0A 1RD6A 3AS3A 3PZVA 4I6VA 6A3HA 4H6EA 3G3MA 3CZ8A 3AISA 3W7JA 3K2GA 1SZNA 3HIJA 4MB1A 3PTQA 3II1A 3RUBL 2PB1A 4TVDA 3TWAA 4D6GA 2E6YA 3ARXA 2DW7A 3CMFA 5HJYA 4W85A 3UPWA 3KOWA 1ZJBA 4D6FA 2V81A 2XM2A 3M5VA 3UG4A 2PZ0A 3V0TA 3M7WA 3JU2A 1HJQA 2KZHA 4DVOA 3UG3A 3ZSTA 1V3IA 1UR8A 1YBQA 5LNUA 4UR9A 1FWGC 4MNMA 4J3SA 4C60A 3ZWSA 8A3HA 1GHSA 4HSOA 2QCDA 2A4AA 1UP3A 4Y9PA 1YDNA 2ZXQA 5DT7A 2BVWA 4LAOA 3NQEA 2Z28A 2A3HA 2VFHA 3BV4A 1ODZA 3FEMA 1EP1A 1V02A 3TONA 1ZZMA 3USBA 1JI2A 3L23A 1MW2A 2BBFA 1T40A 3L4ZA 1NEYA 1XS2A 3M0ZA