4CQ9A

Plasmodium falciparum dihydroorotate dehydrogenase (dhodh) in complex with idi-6253
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
372
structure length
367
Chain Sequence
FLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title In Vitro Resistance Selections for Plasmodium Falciparum Dihydroorotate Dehydrogenase Inhibitors Give Mutants with Multiple Point Mutations in the Drug-Binding Site and Altered Growth.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 137
structure length 367
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cq9A00
2PRMA 3M6YA 1PHWA 4MIMA 5D2VA 3WJSA 1R30A 2ISVA 2TMDA 4NU7A 3HGOA 3NYZA 1SSGA 2PC4A 4RV8A 4HHPA 3TAKA 3OIXA 5CSRA 3HGRA 4JTHA 2QDGA 4JTTA 4LY8A 5G4WA 4FXRA 1TIMA 1DL3A 1M5WA 3LCLA 2QKFA 4JDBA 1PCKA 5H2ZA 3DBPA 4GNJA 1TSIA 2C18A 2HS8A 4DO6A 1O5KA 4IOTA 3ZWSA 1ZALA 2PRLA 1XUUA 4UFKA 5F2MA 4O4WA 2H3BA 4QNEA 1VS1A 3M44A 1ONRA 3GVGA 1ME7A 1OYCA 3GK0A 2B7OA 1H7WA 3Q37A 3TCEA 1TCDA 1W5PA 2WOQA 2YW4A 1B9BA 2ZRZA 4ONVA 4RK8A 2E1DA 3L2IA 3A21A 3CIWA 1PHQA 2DZVA 1YYAA 2X30A 5BRBA 4BI7A 4I7VA 3PB0A 4OT7A 3OVPA 3G3MA 4OV9A 1J2WA 1UUOA 2TYSA 3SR7A 2RDTA 1LOQA 2V0TA 4JTKA 3W2JA 4OHQA 1F6KA 1S5TA 4OQVA 1H7OA 2CWNA 2VEKA 1SZGA 1W37A 3NPVA 1FBAA 4A29A 4NXSA 3NZ1A 1CW2A 3BGGA 2V2DA 3QPZA 2IQTA 3W1AA 4IWWA 1KBIA 3BW3A 4IUOA 2A7RA 4R34A 5LKYA 1T99A 3QSRA 1FXPA 1DOSA 2EHHA 3ABRA 3BO9A 3SJ3A 3U8GA 4POCA 3N34A 3IVUA 3LXBA 4WJEA 3R2GA 3KAOA 3W2NA 1U5JA 4FO4A 3LRKA 4BFAA 4K8EA 3S8HA 3C8FA 5AC8A 2NXGA 3S0CA 3PF3A 3W07A 2NXIA 5F4WA 2KZHA 5DY2A 3W74A 4CQAA 3SW6A 3W1TA 4DO4A 2QJGA 4M6PA 4NZJA 5HQEA 2CZFA 2EGZA 2VXNA 4IMFA 5BMXA 2Y62A 1UUMA 3M16A 3C2VA 2OCZA 3DI0A 1H62A 3LCFA 2WQPA 5LNRA 3MYOA 3LI1A 2Z1BA 4UUIA 4O11A 4HNNA 2VC6A 3HGJA 3TW7A 4QM1A 4HPXA 4ZMGA 1A5AA 4MJMA 3LTSA 4WY0F 4H6KA 4UTHA 5CKSA 1FXQA 3TMQA 1FQ0A 3W7OA 4HSOA 3PSVA 3T4CA 2R94A 3P82A 1UBSA 4DPPA 5BW6A 2WSYA 1A5CA 1R2RA 1XDLA 5F2GA 1O94A 3ELFA 2QR6A 3P8JA 5H91A 4KFPA 2OMAA 1SZNA 1XCFA 4CQ8A 5AYZA 3UWWA 3IGSA 2E5DA 4JIQA 3ZR4A 3G8EA 3G18A 3W7CA 2QJHA 3M7WA 3S42A 2WKJA 4R7JA 5HNRA 3O06A 2R91A 1RQBA 1H7RA 3PR2A 5CPNA 3ZWTA 4JS3A 3PG8A 3KVJA 3NPUA 1FWTA 1ICSA 2J27A 1I2QA 1Z42A 3S5NA 5KZDA 3FLUA 3QQ1A 3EKZA 1SW7A 4AAJA 4ADUA 3BG9A 3CB8A 3HMJG 3NL2A 5U4NA 4PTNA 1G4EA 1MEIA 2VENA 2CZEA 4O18A 5AHFA 3TNOA 2CLIA 3TSBA 3LCGA 1W54A 1SO3A 3W85A 1XC4A 3NXFA 1LBFA 3DHFA 2NWRA 4RJEA 1VCFA 1G7VA 1G4PA 4MFDA 4PODA 3TH6A 5LSMA 4FHAA 4MUZA 5I3KA 2Y63A 3W7KA 1I2PA 1JUBA 3PC0A 4TMCA 1VYSX 2CU0A 2Q8LA 1FDZA 2C19A 3B4UA 5FEZA 1F6PA 3TX9A 1DV7A 4R33A 2FLIA 4M6QA 4JXCA 3O63A 4K38A 4NJJA 3RMJA 1YADA 3LHVA 5F2LA 1OFQA 3PWAA 4FIRA 4RXFA 2DJLA 1N55A 4Q4KA 1W0MA 4R53A 1NF0A 4N2YA 1LRTA 3BV4A 3YPIA 4OGZA 4RXGA 4GXMA 3W87A 3NA8A 3HG3A 4YWIA 3G1AA 3UPWA 3L66A 4IMGA 3UY8A 2RDUA 2ZZ4A 1IGSA 3T55A 4PCFA 1GZGA 1WYIA 4MOZA 3NNTA 2Y6ZA 1HO4A 4UIOA 3U2OA 3O07A 1W31A 2ZRUA 3OG3A 2OJPA 1TRDA 4P2VA 4RCXA 3T78A 4XBSA 1F2JA 1OFRA 3C61A 1KV5A 1M7PA 1TQXA 1KTBA 1H1ZA 4AWSA 4ZQCA 3MO7A 4FNTA 2PCQA 5G1TA 3W7JA 1AMKA 4LS2A 4UTWA 2VFGA 3FYPA 1XXXA 3W1LA 1VQTA 1FCUA 2QJIA 1TPWA 2A7NA 1I8JA 1OFPA 2QCLA 3LTPA 3ATYA 4O14A 2JK2A 1L9WA 4O17A 2ATSA 4UTUA 4RZ6A 1GVFA 4WXZA 4ADTA 2A2IA 1AK5A 3G3DA 4UFLA 4LC8A 4QAIA 1DQXA 3RLVA 3W73A 4FNRA 1BTMA 2A4AA 4LNYA 1PL9A 5DY3A 5C55A 1YDOA 1F05A 2WO5A 5FESA 1X7FA 4TR9A 1JVNA 4JTFA 4E0CA 4U4MA 1WDWA 1QPRA 2ZRYA 3STGA 3HBLA 4BR1A 4AMAA 3G8RA 1FX6A 3N73A 2H8XA 1Q6OA 3EXTA 5I3GA 3GB6A 5KZMA 4UTWC 5K9XA 2DJXA 1WQ5A 1K8XA 2HS6A 3C2OA 3HPZA 4IMDA 4I7UA 4JTGA 4X2RA 5HMSA 3PBYA 3L21A 3CQ0A 1KM4A 4MZ1A 3MMTA 8TIMA 2ISWA 2V82A 2GUUA 4ZL1A 1TPEA 2X1SA 1PIIA 3W7LA 3L5MA 2C14A 3C4UA 1FWSA 4O53A 3HPSA 1JULA 3PBWA 3CHVA 1TPB1 1IF2A 3P84A 4UTLA 3S5ZA 4AHOA 3RFAA 3W1XA 3LERA 4AXKA 4W9TA 1KM5A 3PULA 4PFMA 4K37A 4JX6A 1QO5A 3UQNA 1D9EA 2Y70A 2W79A 2YZRA 4XKYA 3T44A 3NVTA 3W2MA 2JKEA 2BTMA 1W1ZA 3EWUA 4O19A 2F84A 2Z2UA 2YYUA 4S2BA 3L0KA 4UNKA 3TROA 2ZYFA 2A7PA 1QFEA 1RQEA 4GJ1A 2FDSA 3OHIA 4XTIA 4MKNA 1K8YA 1KA9F 1TREA 4I9AA 1X1ZA 1KLZA 4AWTA 1YTDA 1DQWA 2E6AA 2A0NA 1U83A 3W1UA 1TPVA 1EEPA 2YX0A 3GAYA 5BMWA 1ICPA 4D2JA 1DVJA 3LXCA 1YDVA 3BW4A 1J4EA 3QPYA 1I4NA 3W7QA 3IIPA 1YTEA 2AGKA 3W1RA 1OX4B 4LVBA 1FWWA 1GJPA 1SPQA 4UC5A 1B3OA 3IEBA 2PE4A 1P0NA 2ZTKA 3PY2A 1XI3A 3MUXA 4NJIA 5EYWA 3HPXA 3NQDA 3DFTA 5I3JA 3KXQA 1KM3A 2WNZA 3W83A 1JUEA 2GJNA 4TIMA 4HIBA 4UXDA 1QNVA 2J6XA 4FF7A 3O16A 4DF0A 3GDRA 3M43A 5CZSA 1GVSA 3LRLA 3E96A 3NQCA 4C1KA 3G24A 2CLKA 1MO0A 3GDLA 3NL6A 1JCNA 4PA8A 3CWNA 4HNVA 3TC6A 1QAPA 1HG3A 1X8FA 3R89A 1LM1A 1UB3A 4QISA 2XN1A 2HTMA 3S1VA 4Z1CA 3RLUA 4YXGA 3EX3A 4JGDA 1S5WA 3W2LA 1OX6A 4XBKA 2WNNA 3LDVA 3M41A 2X1UA 2YCEA 4AF0A 3L68A 1T8XA 3TUUA 4YCOA 3W1PA 5I3FA 2FIQA 1YTKA 4N02A 5F4SA 1A5BA 2E77A 2WSRA 2NUWA 2JGYA 3BGJA 3VFLA 1KFEA 2C6QA 5FEWA 2ZA2A 1OFBA 3M0ZA 1OFOA 3DFQA 3LLDA 1W3IA 3DH7A 5AHLA 1H5YA 1K03A 1FDJA 3LBCA 3TFXA 1THFD 3F03K 4OWGA 4WZHA 1KFLA 4N6EA 1B4KA 2WJZA 2C1HA 5D04C 1GYNA 1M6JA 1KFKA 2V81A 4AHQA 1KLYA 3TE9A 3TKFA 2YSWA 3AJXA 3OA3A 2RDWA 2ZA3A 5CPMA 4FIQA 3F4NA 5IBXA 1L6YA 4O50A 1EUAA 2WV8A 3CTLA 1YLVA 2JKPA 4ALDA 1K7EA 5E1QA 5LNSA 2WPBA 4J9JA 1CI1A 4DF2A 5F1UA 2VEIA 5FEXA 1GG0A 5K3VA 4JTIA 1H51A 3NQGA 2BSLA 4MZ8A 1DKWA 3NGJA 1ME9A 3E02A 3HG2A 1J5TA 4FNPA 3STCA 4MJZA 1EP3A 3KOFA 4O52A 2NLIA 3EX4A 1LLWA 2JBMA 3W7EA 3G0SA 4WOQA 4WX2A 4UTTA 3LV6A 2G95A 5F4XA 3QQ0A 3MBDA 5G2WA 2V2CA 5FF3A 3IGUA 4YCPA 2PRHA 2V5LA 3GR7A 2FQIA 3KRSA 2B7NA 4MYXA 1EUNA 1JR1A 3P5YA 1XKYA 2BXVA 2QCCA 3TJXA 1WV2A 1DJNA 2NV2A 2Y88A 2TSYA 3IIXA 1I2NA 3MI6A 2OZ0A 3BARA 2DU2A 3NG3A 5EY5A 4DF1A 1TB3A 3NO5A 4NNCA 2V5BA 3BW2A 4NZFA 1S5VA 2W6RA 2YFNA 5IBXC 3DZ1A 4K7VA 4JIPA 2VFEA 1LRQA 1LRNA 2TRSA 3GR8A 3IIZA 1UASA 4WY0B 4NUWA 4RX0A 1MZHA 2OX1A 5TQLA 1GTHA 3PSWA 4Z0SA 1TV5A 2G96A 1OF8A 3R5EA 1QPNA 3TV8A 4MFEA 1VPXA 4TX9A 1G4TA 2VFDA 4ADSA 4UFMA 5HINA 4JTLA 4UTTC 3WK0A 5G2HA 3C3NA 1KTCA 3RU6A 1KW1A 3W7IA 3S9YA 3KFTA 3P67A 4QSHA 4GUIA 1I45A 1ZJIA 3GXNA 1DBTA 2DZSA 2E6FA 3NQAA 3TFCA 4O0ZA 1QMLA 3UPBA 3DFPA 3SY5A 4JYFA 4UCGA 1B4EA 3UXAA 5AN7A 3I7RA 2QCDA 2Y7DA 3B8DA 5F2IA 5K2ZA 1MEWA 2XFWA 3NQMA 3MI2A 1FUYA 1LLZA 4MY1A 1SU5A 1PS9A 3BG3A 3GXPA 1WXJA 3LCXA 4UTJA 3LOTA 5CPLA 1SFLA 4RZ4A 3G1HA 5FI8A 3QW3A 2YR1A 3CPRA 3TXVA 1KFCA 4QJ1A 2I14A 4JTSA 2ZFAA 4HPJA 4O4VA 1VHCA 3C52A 1TTJA 3WJYA 2AQWA 2J9ZA 3R13A 4E38A 2R8WA 3W9ZA 4GBUA 2GVLA 2BX7A 3L0GA 1VZWA 3P62A 2P10A 1W5MA 1TYGA 3GX9A 2C0AA 3GXTA 3TJLA 3M5VA 2BLEA 3LHUA 5C2XA 1Q6QA 2CLOA 1BKSA 3FJLA 1C29A 1QR7A 2GOUA 1P4CA 1IXQA 3RK8A 3MW7A 2J9YA 4UFHA 4O1AA 1TTIA 4DELA 4ZQPA 3KRUA 4CCDA 3SZ8A 2DZPA 3G1VA 4LC6A 3NQ8A 3SIZA 1AL7A 1W8SA 3DFOA 3GIYA 4DO5A 1H50A 4AVFA 5MHBA 1HFBA 1PVNA 3N2MA 4KWWA 3W2UA 4O15A 1GTEA 3NL3A 4IXHA 5I3IA 3B04A 1LTDA 1LDCA 1AW5A 1T96A 1OYBA 3PG9A 5LGZA 3SI9A 2J9XA 4AHPA 2CZDA 5TBOA 3LHTA 2NUYA 3TIMA 2H8ZA 5KITA 3O6CA 2CFFA 3SSJA 3IV3A 4AWUA 3GLCA 3P5ZA 3W76A 3C6CA 3S1UA 3LHWA 5DN1A 1KM2A 3IIVA 3W70A 1E51A 4IMEA 2FPVA 5LNUA 2DZXA 3NM3A 3CLMA 3G1FA 3QH2A 4IMCA 4MVAA 1G6CA 3EX6A 3DENA 3GKFA 3P81A 1R2SA 2C13A 2GVJA 2DZWA 4HT3A 4LV9A 1SW0A 3S1XA 3CEPA 1JCXA 3NDOA 3EXRA 5F1VA 3WJZA 1LCOA 2Y89A 2VFFA 4L4MA 2VFHA 3KVLA 4IX2A 4ICNA 1LORA 5K9DA 4A3UA 3GAKA 4LWWA 4Q33A 1N7KA 4LVAA 1VJIA 5DLCA 3WJWA 4CQ9A 4N9EA 3BVJA 1G67A 4DBEA 3MHUA 2A5HA 2QAFA 5DCEA 1JQXA 3H55A 2WSQA 4NX5A 1H1YA 5FF7A 3QMRA 3TU9A 1TMHA 1TPDA 3TMLA 1VYRA 3WFAA 5LNVA 1ZFJA 1JUKA 1SFJA 3S1WA 1UJPA 4Z08A 5KMYA 1OFDA 2BZNA 2C15A 1W3NA 3UWVA 1TQJA 3E12A 3USBA 3Q58A 3W1NA 2RKXA 3FKRA 3G22A 3AO0A 3N14A 5D2YA 1V7YA 2FB2A 1W5NA 1GPWA 4JYDA 3LHZA 2NXHA 2E09A 3G1SA 2QCEA 1K3UA 3NR0A 2YGYA 3THQA 3O6DA 2LLEA 5D09A 2YW3A 4LT9A 2EF9A 3M47A 1G4SA 3CEUA 3PM6A 4MY8A 3PB2A 2X1TA 4K8HA 4UMAA 2CLEA 4Y8FA 1L2UA 1R47A 1VHNA 4NNBA 2ZRXA 5D05A 5LZLA 1RD5A 2NX1A 4K36A 2VEMA 1XL9A 2J24A 5EKYA 2C3ZA 3S5YA 1OFAA 3M5YA 3G0XA 3JS3A 3CT7A 3P74A 3M9YA 3HG4A 2EKCA 2QF7A 1JCLA 3UD6A 3D0CA 4O0KA 5KSWA 3T40A 1SO5A 3BLEA 1ZENA 4JTEA 1I2RA 3TC7A 2NWSA 3FS2A 2Q3RA 4GUHA 2CLHA 2E6YA 4JR5A 3FIGA 1D3HA 1TTQA 3H53A 2NZLA 5D33A 2QUVA 5AOUA 1FWRA 4ZQMA 4ZQNA 4JICA 3LX9A 3HF3A 3DKLA 3RNDA 4NVTA 1KBJA 1IXPA 4O13A 3UZJA 4RZ5A 1ADOA 2A6NA 4DQWA 1H7PA 2FPYA 1QO2A 3B0PA 3GNNA 3W3OA 4TMBA 2DZUA 4RKAA 1HO1A 2RHGA 2JKAA 4KFNA 2V8ZA 2JGQA 4LW7A 1KV8A 5D2WA 1WX0A 1H63A 2J88A 5HUPA 4OBTA 4GFSA 4PL1A 5J5DA 1O5XA 4CNOA 2DORA 2H90A 3SFKA 2NUXA 4ZQRA 1MEHA 2QCHA 1TJPA 3VE9A 1SR9A 5EMUA 5IM51 1TPC1 1K7FA 4BI5A 1JRBA 4MLRA 5BOOA 3PUDA 1QPQA 4S1FA 1TTPA 4JTJA 1NVMA 4AEOA 3B05A 3DKJA 3GKAA 4ORMA 1Q45A 1F7BA 3R8RA 1R2TA 1GT8A 4A21A 1VR6A 2R14A 2GVGA 5G1YA 2FFCA 1GVOA 1IXNA 1KTNA 4CNNA 1BWLA 3FJ6A 1T0OA 3TQKA 5G2IA 3W75A 2E5BA 4LRTA 2H6RA 2FB3A 1A5SA 4DXVA 1K7XA 3BLFA 5AHEA 3UXDA 2X1RA 3KHJA 4JN6A 1GOXA 1F76A 1ZAIA 4JY9A 3GDTA 2ZZ6A 3EX1A 3I6RA 3C2FA 4GRSA 4QNWA 4P61A 4S2CA 4WQ6A 1PCWA 1R46A 3OVQA 3L65A 4Z1AA 4RLIA 3BG5A 3Q2DA 2B0MA 2ABBA 3CIXA 2YDAA 3LCHA 5HUOA 3DI1A 1LOLA 2Z6IA 3MHGA 2DZTA 3TAOA 4FX8A 1GG1A 3UWYA 4WXYA 2ZZ2A 5TIMA 2GJLA 3DU0A 3QFEA 4XZ9A 4EIVA 2Z0IA 3CC1A 5EPDA 3UWZA 3G1DA 5AYYA 4IX0A 1EP1A 3LI0A 4FNQA 2UV8G 4IXXA 3H54A 2QUUA 5C6MA 4BI6A 3VE7A 4HN4A 3VI2A 3QF0A 3IVTA 3N9RA 1OK4A 4Y9AA 3NQEA 3L5AA 3W84A 4MYAA 1K02A 4FX7A 1ME8A 3QW4B 1EP2A 3EXSA 5FF2A 3G1YA 3TSMA 3HGSA 1RV8A 3PAJA 5C54A 3L67A 3W7HA 4O28A 3BPWA 2W0UA 5E93A 3W1QA 1SO6A 4PC8A 1FY6A 1FCQA 1OX5A 1TPFA 3BLIA 4QITA 4FXSA 2QAPA 2B7PA 3GYEA 4EF8A 2ZA1A 5CG7A 3W23A 1ZHAA 3LCWA 4OE7A 2V9DA 3A5FA 1JQVA 1SSDA 1P0KA 4LRSA 1TO3A 4BWLC 4YL2A 1O60A 3W86A 3MP4A 3C2EA 1L6WA 1TV7A 6ALDA 3I65A 1FDYA 2VOMA 4PL2A 2YXGA 1GVRA 2WNQA 2NV1A 3P60A 3WJXA 2E6DA 1H61A 1VYPX 4Y6GA 2ZRVA 3MYPA 3GNDA 4XKYB 5KTLA 1WAUA 3F1QA 2EPHA 3PBVA 3DFSA 3MBFA 4M5PA 3INPA 2F7FA 1WA3A 4UFIA 4EF9A 5HR6A 4UR7A 1PV8A 3W2KA 4UTIA 1JCYA 1ZAJA 3GDMA 2C16A 4LV4A 1G7UA 3EEGA 3SECA 1JCMP 1SZFA 3PUOA 4A2SA 4M19A 3IRDA 3ABOA 1QOQA 4O10A 1HL2A 1LOSA 4JD4A 4BF9A 5CGQA 3NQFA 1JJKA 1HTIA 1PE1A 4N9BA 3E0IA 1C9DA 1ZY9A 4QQ3A 5CZ0A 1W5OA 2QCFA 4I7WA 1GEQA 3O15A 3QYQA 2ZZ5A 4Y90A 1AW1A 3LM7A 4LTSA 4NQ1A 3N9SA 2RH9A 5L9FA 1Y0EA 5C5YA 3U6WA 1O95A 4LS1A 2I9EA 5HWJA 1W56A 2FJKA 3KVKA 3LV5A 2BWGA 1X1OA 3EKLA 1LBLA 4H3DA 1DJQA 1Z41A 2ZZ3A 3V75A 1LP6A 3PUEA 4N9CA 3CM4A 1C8VA 2ABAA 3HJZA 5FF4A 4C1LA 4WUIA 1CX9A 1FCVA 1TPH1 1WBJA 5DCBA 3NOEA 2QCGA 3P8IA 1YPFA 2VFIA 2G5WA 3ATZA 3TA6A 5AB3A 2QUTA 4UTKA 1VLWA 5BNKA 3N19B 3EWWA 4FNUA 4IPJA 4IJBA 4JDYA 4AF0B 3STFA 2Y7EA 4UTMA 3O6YX 2QEZA 3OVRA 1M7OA 4M6VA 3QRHA 4HSNA 4MY9A 3VKJA 5D37A 4O8RA 1H60A 3NQ7A 5K7JA 4GWEA 4LS0A 1I2OA 3EX2A 1QPOA 1UCWA 4HKPA 2X16A 2QCNA 2AAMA 4U28A 1EIXA 1NSJA 1ML1A 3A22A 3Q94A 4ZVJA 2ZQ0A 2Y7FA 5LHFA 1XBZA 3NQ2A 2CLFA 1NF7A 4JY8A 5AHIA 1KM0A 3HG5A 4JEQA 4Y96A 3WK1A 4K6AA 2GQ9A 1BWKA 3W7NA 5FEPA 4LVDA 1ZCOA 3EWXA 1H7XA 4NJKA 2V30A 5FF0A 1EWEA 3LCIA 5CZJA 2GQ8A 4CLMA 1FCBA 2TPSA 2HSAA 1A53A 3W88A 3FFSA 3UNDA 1VRDA 3EWYA 4YMZA 2ZTJA 3JR2A 3E49A 3JRKA 3M5ZA 1YXYA 1GYLA 4XTDA 3FEMA 1IIGA 1ALDA 4L4LA 2XN0A 3HOJA 4PH6A 3L0NA 3N2XA 4MPQA 1LBMA 3UWQA 1KM6A 3SGUA 1OFEA 4ZZ9A 1OF6A 2VKZG 1ZNNA 4XWUA 3IGXA 1RQHA 1LROA 3OBKA 1BEUA 4FEZA 4XQ6A 5T26A 3FKKA 4O57A 3C56A 3QM3A 3NPWA 4GUFA 3TK7A 5DELA 1Q6LA 1JRCA 3NL5A 2A21A 1N8FA 2NX3A 1F5ZA 2ZDRA 5DXYA 1AW2A 3NQ6A 1QCWA 4ORIA 5HWMA 2OT0A 3W7RA 3K30A 2D73A 4YLWA 4WD0A 2E68A 4AH7A 1VCGA 1EB3A 2GPTA 3DFNA 4B5NA 4PEKA 1QWGA 4TO8A 1JCJA 3HQ1A 3CU2A 2A1YA 3UY7A 4NJGA 1WBHA 1QDSA 3B0UX 1RPXA 3LHYA 4FB7A 2YYTA 3KX6A 2VELA 2PURA 3W1MA 1KFJA 1QOPA 1ZAHA 5G5IA 4KFOA 3DAQA 4MZYA 3NAVA 4N9DA 4O1CA 4Q32A 1O4UA 1XBXA 3M5XA 4N6FA 4GE8A 2O7QA 3KVMA 5D32A 2RFGA 2FPTA 2QCDB 5CSSA 3EWZA 4XUGA 3O1NA 1RZMA 1YDNA 3LGEA 4G1KA 3R12A 5AHMA 1HUVA 3G0UA 4EOUA 3LB0A 5EBUA 3EWBX 1VC4A 3LXAA 4AB4A 3NZRA 3P80A 4TU1A 3ZFHA 3TSDA 4LVFA 1F73A 1RVGA 3S6DA 3HB9A 2X2GA 4UFJA 4NJHA 4NXKA 3UZ5A 1OVDA 3W22A 1W3TA 4DPQA 4EWND 1W5QA 5DBUA 1Q3NA 3TR2A 5LGXA 3W7GA 3TQVA 3DGRA 4FX6M 5A8GA 3LBMA 3QMTA 3W72A 1OX4A 5EL1A 4HNTA 4IPIA 3THAA 2P0OA 4Z0JA 3FOKA 5D02A 3WK2A 4GUJA 3RF9A 1EPXA 1SUXA 1FWNA 2ZBTA 3TXZA 5HR7A 4A2RA 1OK6A 1XDMA 4Z1BA 4LUIA 1B57A 3QZEA 2Q8ZA 3IIOA 2V2HA 2H3DA 2Z6JA 4LUJA 1YXDA 4KWVA 2NX9A 1G69A 1SW3A 1IIHA 5EA9A 1WOBA 5AC7A 4K7YA 1Z48A 1SQ7A 1OG0A 1YXCA 5D38A 3TW6A 3I7QA 1K8ZA 3UWUA 5I3HA 5K9CA 5D03A 1NEYA 3PBUA 2ATMA 1VGAA 1KM1A 1OYAA 1TJRA 3V1PA 5AYXA 1OABA 2G97A 3MP5A 4HNUA 3L9CA 2ISSA 4KKXA 3W7PA 1P1XA 2FTPA 3LLFA 4UR8A 1LYXA 4CNPA 2QDHA 3O05A 1H7NA 2CLMA 4M7TA 4JX4A 5AC6A 3MP3A 5J5RA 4CCEA 3A9IA 2Y61A 4MLJA 1SO4A 3QJAA 4LOCA 3WK3A 3GZ3A 3IVSA 1VLIA 4ZQOA 3QEZA 3MHFA 3B06A 3FA5A 3NQVA 3ANYA 4IQLA 3ABSA 3MJYA 2YFOA 3NPXA 3LRMA 1KFBA 3QSTA 4EVZA 1IXOA 2O7SA 2P1FA 4X3ZA 1MXSA 2I1OA 4X22A 3CWOX 3DXIA 4O54A 2B7QA 4O1DA 5CZTA 3MWAA 1NAL1 1VH7A 3FYOA 3VNDA 1AG1O 3S5OA 1XM3A 5LNWA 2YPIA 3P61A 2B4GA 3W6YA 3TDFA 3C0JA 4NX0A 4NT0A 4UMCA 3I68A 5D2TA 3MI3A 4O12A 5LHEA 1L6SA 2E5CA 4DBDA 5A5WA 1D3GA 3EB2A 3A24A 3NM1A 1DORA 1VCVA 2XN2A 3BK0A 1V5XA 2EAWA 2QCMA 4Z1DA 1XFBA 4M7SA 2OT1A 3B03A 3NEVA 4FNSA 4CCCA 5KZEA 1Q6RA 3M1ZA 4LVGA 3E9AA 2HMCA 5U7SA 4H4IA 1XBYA 4JX5A 1TV8A 3N3MA 5DBTA 2Y85A 6TIMA 1EWDA 3QMSA 3L5LA 1A50A 4DEFA 5KINA 4BWLA 5GVJA 3PS7A 3ZS4A 1X6UA 4WY0A 3ABQA 3A23A 3PVFA 3TQ0A 2ZZ1A 4K39A 4A22A 1EX5A 3T7VA 4LU0A 1XUZA 4ML9A 4JYEA 1OJXA 4OV4A 4GUGA 5E0KA 5G4EA 1XBVA 3G1XA 4NNAA 1GWJA 5D30A 3I7SA 4BK9A 4RR4A 2ZRWA 1LZOA 4GC4A 5K4ZA 4O1BA 2ZCGA 1TRIA 5HJLA 5K4XA 3HO8A 5CPOA 3HIJA 4IGHA 2A85A 1F74A 2CZ5A 3W71A 1NFBA 5L6UA 3P7YA 4N4QA 1TPUA 4E2BA 1S3HA 3SGZA 2ZZ7A 4QIUA 5ABTA 1YPIA 5HWNA 1ICQA 1SZEA 2CW6A 2A6LA 3GDKA 1AL8A 2Q3OA 4N4PA 5SWUA 3STEA 3F4WA 3B0VC 4UMBA 1Z44A 3UYCA 3OEXA 1GQNA 3W7DA 1P5BA 5DXXA 1OHLA 4UNLA 3KRZA 5DCDA 3O8AA 1EA0A 2VEPA 1MSSA 2ALDA 5AFDA 5HULA 4O16A 3A5VA 5D2XA 3W7MA 7TIMA 2DP3A 1RR2A 4JNMA 3QC3A 4E2DA 4JTUA 3DHDA 2CLLA 4X9SA 3VCRA 4OU1A 3LTYA 3C2RA 1GVQA 4WOZA 5AHNA 2GQAA 1DHPA 1WOAA 2Y7GA
chains in the Genus database with same CATH superfamily
3TN5A 2ZXAA 4Z2GA 3HFYA 1R30A 2VT0A 1XYFA 1SSGA 1TVLA 4GYKA 2QZRA 1XLHA 4ACYA 4RV8A 1R3TA 3V5CA 2EBNA 4JTHA 4FXRA 1TIMA 3NVDA 1FFQA 5BYWA 1UH4A 3TOYA 3RCNA 3OYXA 3HTWA 4I5UA 1K6AA 2H9AA 1TSIA 3GHRA 3BJTA 1BTCA 5B80A 4CVUA 1EPVA 1MDLA 3RU8X 1ZALA 5FL0A 3GVGA 2DFAA 1LG1A 3FYYA 4WR3A 2UWFA 4RK8A 1WPCA 2YW4A 2ZRZA 3BCJA 4PTDA 1PHQA 4H9ZA 1XIGA 3EYPA 4I7VA 1VEMA 2HXUA 1HIZA 5TAOA 4DNHA 1UUOA 2TYSA 3KBVA 2RDTA 1LOQA 2XTKA 4UOQA 3W2JA 4OHQA 3BLDA 3GBEA 2R1PA 3L4ZA 1E1EA 4PMOA 5C71A 4AWEA 1MDRA 3S2LA 2CWXA 1TWWA 2W4XA 4PMXA 3BGGA 2ZX6A 3QPZA 2CKRA 1KBIA 4C6MA 1W1PA 2DT1A 4OOZA 3VABA 2A7RA 5LKYA 3B8WA 2R24A 4HZ7A 3ABRA 4AXNA 4POCA 3N34A 2DGAA 1FA2A 3WY1A 1U5JA 1BHGA 1E6ZA 3MUCA 4GY7A 3S8HA 1FOBA 1OEPA 1F07A 3W07A 3H12A 2J7EA 2NXIA 2KZHA 1NM9A 3BXWA 3ITLA 4CQAA 2F8QA 3E6EA 3BJFA 1W2PA 4M6PA 4NZJA 5HQEA 1LWIA 3CZ8A 1NWUA 1POKA 1UQZA 5IDIA 2HVNA 3AROA 3LCFA 2WQPA 3LI1A 2YXXA 9CGTA 3PZVA 3LZ5A 4UUIA 2WANA 4HNNA 2WVVA 4FOUA 2WK2A 4NZCA 1VEOA 1DIEA 4ZMGA 4XVDA 4J7RA 3MZNA 4I9TA 1E0XA 3WF4A 5CKSA 3W37A 3VUSA 1WZMA 4YWSA 3MDUA 1VIZA 3T4CA 4HPNA 1V0KA 1FWFC 2R94A 1J0JA 1UPPA 2PWDA 3UVAA 2OG9A 4KWUA 4UZUA 3M07A 2YJQA 5E6YA 4WKAA 1U5HA 4W5ZA 1XCFA 2VDHA 1V6TA 3G8EA 3OW1A 1C91A 3G18A 1M7XA 3W7CA 2Q8XA 1WDRA 4G6CA 2WKJA 5HNRA 3NSXA 1RQBA 5M1TA 5CC5A 4E2OA 4L4OA 5D8WA 3FLUA 3BOFA 4J27A 1W1TA 5D4YA 1K9FA 2INEA 4L4PA 3JZUA 5U4NA 1MEIA 1EDTA 2VENA 2VR5A 2ZUSA 3OLGA 4O18A 3GU2A 4AG0A 3TNOA 1CT5A 3B9EA 1GVIA 1UKOA 1TX0A 1Q65A 1VPQA 4I5XA 4RJEA 1G7VA 3TN3A 1EF3A 4MFDA 4PODA 4RL3A 3S2JA 1A5LC 2XYLA 4E4UA 5LSMA 4MUZA 2Y63A 1VRXA 1JUBA 1YPXA 3PC0A 4ROQA 5C9ZA 1U5VA 5EMYA 2Q8LA 1J0KA 1G94A 4JXCA 4ZSUA 4D6JA 3AIUA 3GYCA 1YADA 1WUFA 4R53A 1SVDA 4GXPA 2PDLA 5LIWX 2Q01A 1LRTA 2NLYA 3L4WA 2I16A 4YWIA 2DDXA 3O0FA 1UD5A 1QHOA 3IJIA 4LANA 2RDUA 4F8XA 1UWRA 5DEZA 3WNMA 4PCFA 2J79A 3OBAA 4MOZA 4PB3A 2Y6ZA 3THUA 1IE7C 4UIOA 3U2OA 5C7VA 2OJPA 1OT2A 3RX2A 1TUXA 5HQMA 1KV5A 4X2PA 2XISA 4ENLA 4FNTA 2ZUVA 3W7JA 4LAZA 2RJHA 4UTWA 1LUCA 2IXVA 3W0KA 2PTWA 2IQ0A 3KL0A 1VQTA 1FCUA 2QJIA 1TPWA 1CIUA 1EZ2A 3EPNA 4UR9A 3VKDA 4LUTA 3APYA 3ATYA 2MUCA 2W63A 2XM2A 2YL8A 2BY3A 2O9PA 2DQWA 1BLIA 3WQWA 4QAIA 1VBUA 4FP1A 1CDGA 4JIHA 1W9BM 2YDRA 1NTHA 3SFWA 4XSMA 4E4PA 1X7FA 4U4MA 1WDWA 4OKDA 2I7GA 4BR1A 4JHZA 3N73A 4LXFA 3EXTA 3U2ZA 5I3GA 1AQ0A 1S3TC 3B4YA 2XSXA 1IEXA 5K9XA 2DJXA 3WL0A 2VEFA 2HVOA 3C2OA 3HPZA 4I7UA 3U4FA 2X0HA 4X2RA 3BC9A 5HMSA 3CQ0A 3FNDA 4P7LA 2ISWA 5EMMA 1IWAA 4ZL1A 2X1SA 3PNUA 3SN4A 1B0IA 4O53A 3HPSA 3PBWA 4DN1A 1IF2A 4NSBA 4Y7EA 4GQGA 4AHOA 1DXFA 2F6KA 4JQ3A 4W9TA 3PULA 1SMAA 3SUWA 1QO5A 2G4JA 4I8DA 2W79A 2D2OA 3EKGA 3T44A 2IPWA 3T2OA 2BTMA 3EWUA 2Q6ZA 3L0KA 2VGFA 3APGA 2VWTA 3OLEA 4GJ1A 2FDSA 1WUEA 3QXBA 1K6WA 1U30A 1TREA 3L4XA 1E15A 4I9AA 3S3GA 4IHCA 3FHAA 1KLZA 1XLJA 3E38A 4AWTA 3WLIA 1HJSA 2A0NA 3GXFA 3RPDA 1JI2A 2VR2A 4IIHA 2V5KA 3IUDA 4H00A 4QDMA 3E0WA 1S2AA 3S9ZA 1DVJA 3HN3A 3AHZA 2PODA 3W7QA 1XIHA 3WEMA 1YTEA 1V0NA 1XG3A 3IARA 3BJSA 2QIIA 3W1RA 4EAYA 2DW6A 4HPGA 3E2RA 4WSKA 2ZTKA 4QQUA 1WDDA 2DIJA 4GD0A 5DMLA 5EYWA 1A5KC 1KXQA 3HPXA 4OBRA 1XLKA 4CN1A 5I3JA 3W83A 2WNZA 1JUEA 2GJNA 5LYRA 2V69A 4FF7A 2DSWA 3M43A 1GVSA 3LS9A 5CQ1A 3G24A 4PCTA 2PLKA 3PFMA 4HNVA 4AW7A 3KWSA 5A69A 4GZ7A 2XN1A 4AD4A 4AQLA 5M03A 3EX3A 1S5WA 1OX6A 3WQ8A 2WNNA 3GU1A 3U5YA 4AF0A 1L0PA 3WBYA 3L68A 1NY1A 5EFFA 1TR1A 1Z32X 3TUUA 2CYGA 3Q65A 2PLMA 5XIMA 2E8ZA 3W1PA 2FIQA 1YTKA 2E77A 4XUYA 3GTFA 5C0QA 1UWTA 4KERA 1X6NA 5HNUA 1KFEA 2C6QA 2ZA2A 1GW9A 3JVAA 2E1WA 3K46A 1SMDA 1JXJA 3L2LA 1ONXA 3NJ3A 5AHLA 4AIUA 4Q7IA 1FDJA 4YJ5A 4DZ5A 1THFD 3J7HA 1D8CA 1K4HA 3RDKA 1GYNA 1EDGA 1KXHA 1KFKA 1NJJA 2V81A 1RBOB 1EC9A 3AJXA 4L1GA 5IBXA 4PCSA 4O50A 4M3PA 1DTNA 5E1QA 2DVXA 4QAWA 5F1UA 6XIMA 2VEIA 1TZ7A 3NQGA 4A35A 4D6EA 1F8IA 1ME9A 3E02A 1J5TA 2C7FA 4MJZA 1TZZA 4F2TA 3G0SA 2Z25A 5M2FX 4UTTA 3QQ0A 4ERAA 2PA6A 3S47A 3IGUA 3TNBA 1UWSA 2FQIA 4IP7A 2Z1KA 1JR1A 4H6EA 1OWQA 1GUVA 1JL8A 3FN9A 1VKFA 1PWLA 2NV2A 3CUIA 1VFHA 2O56A 1ONWA 5FA5A 2DVTA 2V5BA 3EOOA 1R9ZA 1UHVA 4NZFA 3DZ1A 4K7VA 2W9MA 1Q6DA 2PTZA 3CASA 4H8VA 2TRSA 3GR8A 3CPGA 4A8RA 1KWGA 1DPMA 4ILSA 3PSWA 1YE6A 1TV5A 3R5EA 2GDVA 3NO1A 1ZUAX 4K8GA 4ADSA 3PZMA 3WK0A 4W5UA 3VNYA 1KW1A 3W7IA 2BOFX 1UD2A 3P67A 4QSHA 2DZSA 1E0TA 1CZ1A 3UPBA 2AKZA 1M3UA 3WUGA 1E4MM 5AN7A 2WMGA 4R3UA 1Z89A 4IP5A 5DT5A 1TA3B 4ZBCA 5K2ZA 1MEWA 2XVNA 4MY1A 3LLXA 3GXPA 3BG3A 3R8GA 3OODA 1DWJM 5CPLA 3ZLGA 1CECA 3T1GA 3CPRA 1CB7B 3A6OA 4O1FA 3L4UA 3PTKA 3TXVA 4YVPA 1O5RA 4YN5A 1QXLA 4C6KA 4FXJA 3C52A 3WJYA 2AQWA 4E38A 3W9ZA 4HCLA 2W61A 4GBUA 4H7CA 3HJEA 3F7JA 1TYGA 3GX9A 1DTUA 2AMGA 2RAGA 1R8LA 3ARSA 3ES8A 3A4JA 4ERIA 1QR7A 4JQ2A 3GHUA 1IXQA 3BSGA 1CGUA 4H9MA 3KRUA 4OVXA 3MKKA 4L5ZA 1FWIC 2DZPA 4LC6A 1AL7A 5MF5A 1W8SA 1NWSA 4DO5A 1C8XA 3FVMA 2VP8A 1A4LA 3H2MA 4GYFA 3GW3A 3LEPA 1GTEA 3NL3A 4D6IA 4N0RA 6A3HA 2HK0A 1LDCA 4LF2A 3VIPA 2PF8A 5LGZA 1TVPA 2CZDA 3NQBA 5CSUA 1T40A 1OQFA 1XPGA 4NZ1A 2NUYA 3TIMA 3O6CA 1OZMA 3IV3A 5A6KA 2X8RA 4AEEA 1J6PA 4NY2A 4V1YA 4WHBA 2VOTA 4DWSB 3GVWA 5DN1A 1DJYA 1XSJA 3CH9A 4FLRA 4ES4A 3IIVA 3RPTA 2ZIDA 1XG4A 4LBRA 5LNUA 2FZBA 3NM3A 4FI4A 2C13A 2GVJA 4I5RA 5HA7A 2DZWA 4CNUA 7PTDA 4DJFC 1EOKA 1JCXA 4WDWA 4YYCA 3RMEA 3CYVA 1Y8BA 2VFHA 3KVLA 4X9YA 2NVDA 1E9YB 2SFPA 1YE4A 3CK5A 3GQYA 4Q33A 1DHKA 3EDEA 1U1UA 3LGDA 3BVJA 1G67A 4ZXOA 1UMLA 3H55A 2WSQA 3SGGA 3TU9A 1QATA 3ZLFA 3LSBA 5LNVA 1J96A 1JUKA 4W7VA 3LPGA 3VX0A 1UJPA 1OFDA 2BZNA 2W27A 4Y9NA 3WH9A 1O5QA 1W9UA 1SJBA 3QZAA 3USBA 3ITTA 3FKRA 1C93A 6CGTA 3N14A 2OODA 2W67A 3KLLA 3LHZA 3G1SA 3THDA 1K3UA 3WQVA 1UA3A 3NR0A 2YGYA 3CLWA 1HVQA 1KGXA 5D09A 4LT9A 2EF9A 3AMCA 3D3FA 1C8QA 2ZX9A 3AZRA 1YKWA 1F8MA 4Y8FA 1N2VA 3BE7A 3K8MA 3R11A 1VHNA 5D05A 5LZLA 1EZWA 1RD5A 1H1NA 1NARA 1UR4A 3VNMA 2J24A 4LAUA 1PTAA 7REQA 3M5YA 3S2CA 3LSCA 3MQTA 1K70A 3CT7A 2C71A 1SGJA 3P74A 2EKCA 2QF7A 1JCLA 1H2JA 5KSWA 3BLEA 3MC5A 3BAJA 2WZTA 4H2HA 1BF6A 1JIBA 4NAFA 3C0LA 3FS2A 1IV8A 2CNCA 2CLHA 2E6YA 1W9VA 3FIGA 1TTQA 3H53A 5E9XA 2QUVA 2MNRA 3RG6A 3KW3A 4MDOA 3U5UA 2XH0A 5AECA 4FA3A 3UZJA 3A3HA 1ADOA 4UQEA 1JNEA 4PMQA 5A8PA 3AS0A 3EA3A 4I6VA 3B0PA 1JD7A 1R3SA 5HMDA 3WLLA 2JKAA 2DH2A 4RNJA 4E8DA 5FOOA 1V3MA 1PZ0A 5M5DA 1Z7AA 1B30A 1UR3M 1H63A 2O92A 1OIFA 4OBTA 4PL1A 5CAHA 2WHMA 2BFGA 2DORA 4K3ZA 2POTA 4ZQRA 1M01A 1K7FA 4WIWA 4C6DA 1JRBA 4AIOA 5FIPA 3PUDA 1QPQA 4JFTA 4S1FA 2PP1A 4S3GA 2OO0A 1Q5MA 1LT7A 3R8RA 2WBGA 4XAGA 3BAWA 1VR6A 2CBIA 2FFCA 4JFSA 1GVOA 3RR1A 3GWQA 4KEZA 4G8TA 5G2IA 3W75A 2OR2A 1EJVC 2H6RA 2YBTA 4DXVA 4JIEA 3ZSSA 3PZUA 3BLFA 5AHEA 3JUGA 3KHJA 1F76A 4JY9A 2ZZ6A 4REQA 3BLLA 4A4AA 5C9XA 4QJ3B 4L9ZA 2OOFA 4Q8TA 3Q2DA 2I5GA 6REQA 1X98A 2YDAA 4DIAA 1DYSA 5HUOA 3OG2A 3R1ZA 3I3BA 2OZTA 4FX8A 3NYDA 3UWYA 1HJVA 4M82A 4WXYA 1NQ6A 1WAWA 2QNEA 2Z0IA 3UWZA 5JVLA 2BHUA 2QDDA 3LU2A 3G1RA 3G1DA 1IYXA 1JYNA 3LI0A 3SM0A 4FNQA 4C91A 4GJIA 4UOZA 1I0DA 5RUBA 1ITXA 4BI6A 1IR2A 3QGVA 2UY4A 3W6MA 1GHRA 2BHYA 3MCMA 3NQEA 2F2HA 5HMFA 2ACRA 3QW4B 3T2PA 4NI3A 5FF2A 3HFTA 3HGSA 5C54A 3BPWA 1KB3A 1XCXA 4MUPA 2W0UA 1KRCC 1TX2A 1SO6A 4PC8A 3B8TA 1XRFA 3WDQA 4QITA 5AC5A 2QAPA 3NZQA 4S38A 2GDQA 4ACZB 2ZA1A 4RV3A 4F9DA 1ZHAA 4MAZA 4D1IA 2V9DA 3BQ5A 3VD5A 3ARYA 3ZT6A 4QE4A 4CQBA 4UZSA 4YTSA 3ARPA 3W86A 1WDQA 4PL2A 2VOMA 3A9BA 3F4CA 3I3EA 3AWNA 1TV3A 3NDYA 1RBLA 4B5SA 2ZADA 1VYPX 3S6TA 4AX7A 4Y6GA 2ZRVA 2I17A 3HURA 4Q8WA 4XKYB 1WAUA 3F1QA 4R88A 1EJXC 1XD1A 3PBVA 3H23A 1XHGA 1I6NA 3INPA 4NG3A 5HR6A 4UR7A 1PV8A 1JCYA 1WKFA 4NP7A 1JPHA 4PMDA 4J35A 2EPMX 1FWGC 4P8UA 3NCOA 1SZFA 3BZJA 1FWHC 3ECQA 2V5CA 1DWAM 3IRDA 3ABOA 3BMVA 1QOQA 4O10A 3MSGA 5HJYA 1KQZA 1OINA 3KDNA 3KWXA 3RN6A 1C9DA 4QEEA 5CZ0A 1W5OA 2QCFA 3O15A 3QYQA 3SCRA 3B9AA 3LM7A 4LTSA 5EBAA 4NQ1A 5CEWA 3WN6A 5L9FA 3UG5A 4B91A 4HHHA 3AYRA 4LS1A 2I9EA 4OJYA 4K68A 4B4FA 2FJKA 3S6OA 3LV5A 4DZIA 3WX7A 1CGXA 1Z41A 2ZZ3A 4L6HA 3V75A 1MUCA 3SN0A 1M7JA 2EPOA 2ABAA 4WUIA 1CX9A 1TPH1 1WBJA 3BSHA 2YIHA 5DCBA 3P8IA 1YPFA 2WMJA 2VFIA 4CCZA 2QUTA 4GX8A 3FGCB 2XGIA 3N19B 4RPQA 2XIQA 2J75A 3IWPA 4JDYA 3STFA 3JW7A 4UTMA 3MB9A 3OVRA 5C2CA 1M7OA 4HSNA 4MY9A 2HWGA 4GWEA 4LS0A 3EX2A 1UCWA 4HKPA 2X16A 3VAVA 4U28A 5B7YA 3TVAA 3Q94A 5T9CE 2PDNA 4LUSB 3AHTA 1XICA 2CLFA 3KTSA 3WZ0E 1NF7A 1S1RA 5AHIA 2Y8VA 2EO7A 1R7OA 2VCBA 4MJ2A 3WK1A 3IJQA 1QNQA 5HNNA 3K2GA 5FEPA 1RCOB 4YVVA 4WK9A 3LCIA 4MJ4A 2J66A 4IM4A 3HU7A 1A53A 1QNRA 3UNDA 3EWYA 4YMZA 4XD4A 4XTDA 1OBAA 4L80A 2PDPA 3U7VA 1QHPA 2XN0A 3HOJA 3EDKA 1LBMA 3SGUA 1OFEA 1EBHA 3WNLA 1ZNNA 4XWUA 1ODZA 4W93A 3WDIA 1CCWB 1BEUA 3EA2A 4FEZA 4GO9A 4MHBA 1K8CA 4H9UA 3MO4A 1LL7A 1HKMA 1W1YA 4QLJA 2QLYA 3TK7A 5DELA 1JRCA 4Y9MA 4XZNX 2A21A 2NX3A 4A8LA 1AW2A 1QCWA 3K30A 2Q71A 3F5LA 1VCGA 2VHLA 4PEKA 4JPGA 5A6AA 1BD0A 2A1YA 3UY7A 4QS6A 2QW5A 4PMYA 1QDSA 4IFOA 4B3LA 3LHYA 4FB7A 4V27A 5HOSA 5KETA 3N6QA 4AUBA 4XZBA 4HMEA 3W1MA 4S39A 1PX4A 4AY1A 4D8AA 4GCAA 1ZAHA 1WZAA 1J0HA 4KFOA 4MZYA 3NAVA 1HGYA 3WYZA 4KCTA 1K4GA 5HQLA 4UWMA 4Z2IA 5LIUX 2YB4A 4GFIA 1NDYA 2RFGA 2FPTA 2FVMA 2QCDB 1QNSA 4EPBC 1LJYA 1F3XA 4E4FA 2ZX5A 1W3KA 3SCQA 1H41A 5E70A 1RZMA 3SRKA 2GWGA 8A3HA 1XRSA 3LB0A 1MNZA 2HNEA 3TYZA 3ZFHA 1Z9AA 3AUJA 1RVGA 2OKOA 3S6DA 3HB9A 1QUMA 4NJHA 1W1VA 5D9PA 3UNTA 3UZ5A 4RE3A 4PB5A 4AISA 4EWND 4DPQA 3E74A 4DWDA 4NYUA 1Q3NA 1ODUA 3CUJA 3DGRA 3T0TA 1E3XA 4AX6A 4ICCX 4FX6M 5A8GA 3LBMA 3QMTA 2CESA 1WP6A 5FJRA 4HNTA 4IPIA 2P0OA 1GJWA 2YBUA 2P5NA 2XG9A 4ZB2A 3FSUA 5G1MA 4OBSA 1FWNA 2ZBTA 3TXZA 2JQXA 4R85A 2OGYA 5LA1A 4LPCA 4AD5A 5T9BG 4PBGA 1G1YA 3AU6A 2Z26A 2W3ZA 2QT3A 2V2HA 2Z6JA 4LUJA 1HX0A 1P7TB 3VNZA 1T41A 4A3RA 1PTGA 2A3CA 1IIHA 3TJ4A 1E6SM 4PTXA 5AC7A 4K7YA 3LM3A 5JBFA 1OG0A 1ECQA 3TW6A 3PBUA 7TAAA 1J0YA 3ZJKA 5E9AA 4DJDC 1E1FA 1OYAA 5AYXA 4Q8OA 1OABA 4LH8A 4HNUA 4HOZA 3L9CA 2ISSA 4KKXA 3W7PA 2FTPA 3LLFA 4CNPA 2PWHA 3W4RA 4UQ9A 3O05A 1H7NA 2CLMA 6TAAA 1VFMA 5GNYA 1UROA 5AC6A 3AXXA 4JL1A 2Y61A 4I3GA 3WK3A 2NVCA 3KM8A 1F9CA 5FJTA 5EMJA 1V7AA 4IQLA 3VDAA 3ABSA 3C8NA 2AGTA 3MJYA 4G7EB 1YMYA 1QVBA 3LD5A 3LRMA 1KFBA 3QSTA 2P1FA 4KS0A 4HU0A 2B7QA 3MWAA 1GQLA 4E3VA 1CLXA 5MKGB 1PZ1A 3K1GA 4QRNA 1Q7ZA 1M03A 1C3FA 4P8VA 1XLEA 1KGUA 3W6YA 1GQKA 1EO7A 1A47A 1TMQA 3LMZA 1V3LA 2R9RA 1TV4A 1PDZA 4KEUA 1RJRA 1V4YA 2BY2A 4O12A 3CT2A 5A5WA 4D1JA 3NM1A 1NOUA 3G5EA 4MWAD 4RDVA 8RUCA 5CC6A 5GNXA 1GVYA 2QCMA 4HYWA 3KBJA 4CCCA 2CXEA 1KBKA 3ZOAA 2HMCA 4LJ3A 4CEXC 4H4IA 1ITUA 2J74A 4UB9A 3N3MA 5EGRA 1DIKA 4ZOAA 4DEFA 2GGIA 5KINA 3PS7A 1L8PA 3G6LA 3ABQA 1XGDA 3TQ0A 3PVFA 4A22A 3T7VA 4AY7A 3O3RA 1OJXA 5E0KA 1XBVA 4HU8A 1GWJA 3I7SA 3LBOA 4RR4A 2ZRWA 3L4TA 5K4ZA 1HKIA 5A8NA 1Q63A 1B2YA 2VYOA 1BKHA 1Q6EA 3WQCA 4E2BA 4QSFA 3SGZA 1YPIA 5HWNA 3CQJA 1XIBA 1AL8A 2Q3OA 1TJ1A 3N4FA 3CPUA 2NQ5A 1E3ZA 3V0SA 3OEXA 4CU7A 1OHLA 4UNLA 3N4EA 3M0KA 1MSSA 2ALDA 2FH6A 3KBMA 1KCZA 4JNMA 4E2DA 4JTUA 3DHDA 3OVGA 2O9OA 1YHTA 1PYFA 2REQA 4OU1A 1ECEA 2VRKA 1PKYA 5AHNA 1HF6A 1WOAA 2BVWA 4ICMA 4GKLA 4NU7A 3NYZA 2VGBA 3GY1A 4MKSA 1Q4NX 4HHPA 3TAKA 3D6NA 5CSRA 3HGRA 2QDGA 4LY8A 4LYQA 3ZQ9A 1RA0A 3PUGA 3RCYA 2FKPA 5H2ZA 3IPWA 4E2VA 3GU9A 2F9RA 2IPFA 3OO2A 3ZWSA 3ERPA 2Z7GA 3IUIA 4J3SA 1XUUA 3RJYA 5E5CA 3OGSA 3V5OA 3M44A 2W5FA 4B5XA 3GK0A 2WOQA 1B9BA 1HP5A 3CIWA 1YYAA 3WDHA 2XVPA 3OVPA 4UBPC 3KZPA 3P6LA 4OQVA 1SZGA 1W37A 3NPVA 3WG6A 4A29A 1O6IA 4NXSA 3WF0A 1J11A 3QHOA 1V79A 3UZZA 2IQTA 4LGXA 3W1AA 4IWWA 4UTFA 2D2HA 1E0WA 1EDQA 3GG7A 3CZKA 3BDKA 1FXPA 3I6TA 2EHHA 1PSCA 3BO9A 3M0VA 3SJ3A 3IVUA 4JN8A 3LXBA 4WJEA 1JZ2A 1ZLPA 3R2GA 4FO4A 3LRKA 3A4XA 5A8QA 4GINA 3PF3A 3F5KA 4GABA 3WLOA 3WUFA 3SW6A 3W1TA 4DO4A 2QJGA 1MW0A 1BQCA 2EGZA 5I3DA 2VXNA 4LAMA 5BMXA 2JFEX 3M16A 3C2VA 3DI0A 3S9IA 3WMLA 2X05A 5LNRA 2NQHA 2OFJA 4LUYA 4D9PA 4R27A 2ZUTA 2HJPA 4MG4A 4WGHA 2BBFA 3HGJA 3TW7A 3AWOA 1EYWA 2Y8UA 3VIGA 4RDYA 3PN8A 1OB0A 5H6HA 1A5AA 1GORA 4HPHA 1KKOA 3H6OA 3W7OA 2AAAA 1U2YA 3PJTA 4NAEA 4DPPA 5BW6A 2WSYA 3U9IA 2E25A 2VJXA 4FR1A 1XGEA 4GC3A 4PMVA 4AZGA 3Q4DA 2QR6A 2DSKA 2PDHA 1ZBKA 4KFPA 7ODCA 1J5SA 4HA4A 2ZE3A 4CQ8A 5AYZA 2UZ9A 2WHJA 2BNJA 1RK5A 3ZR4A 2ZUMA 3M7WA 1WKEA 1H7RA 5DANA 3ZWTA 3NPUA 1F6YA 2AMXA 2WVUA 2PDQA 5CH9A 1CXFA 2XFFA 3QQ1A 2PI6A 1GK8A 2DIEA 3HMJG 4PTNA 4MNLA 1G4EA 3UYIA 4A3QA 2CZEA 4Q7NA 5AHFA 3CS2A 3LNMA 1Q13A 3TSBA 3GO2A 1W54A 3W85A 1POJA 3U2CA 4ZSTA 2UY2A 2NWRA 4ZO6A 1VCFA 3RX3A 3BUVA 5I3KA 3CB3A 3W7KA 1WZKA 2GFTA 2O9RA 4TUFA 2BVTA 2OEMA 2CU0A 1YW1A 3PAOA 2C19A 2XGZA 3EMCA 4AZHA 4H8HA 2DSVA 1F6PA 3TX9A 3VD9A 5I24A 4R33A 5C7HA 4XX6A 4NILA 1Y7VA 3RUBL 2DT3A 3VVGA 1GJUA 4NRSA 2L5HA 2WZIA 3BAYA 5F2LA 1OFQA 3PWAA 4RXFA 4FMVA 5ECVA 3T8QA 1KCLA 2YZ5A 1R3YA 4KRUA 4FOJA 2XIMA 3AMKA 4G1NA 3BV4A 3MTWA 4OGZA 3BLOA 4RXGA 3W87A 2VD8A 3UPMA 4I9JA 1QASA 3WQGA 1S2UA 1W9XA 1X8CA 2ZZ4A 3F2CA 1IGSA 3L7RA 4JCLA 3WNPA 1WYIA 3OA5A 2F6XA 3B8UA 1HO4A 1PUDA 2WZMA 2JEPA 1W31A 2ZRUA 4P2VA 3T78A 1TRDA 4RCXA 3QGKC 1Q4WA 4DJDA 4HTBA 1F2JA 2VDIA 1M7PA 1TQXA 1H1ZA 3WELA 3MSRA 2ZXDA 3TWAA 1C9WA 2GVYA 3AMLA 2IKIA 3LPPA 4MB5A 1X7IA 1X38A 2PDIA 1U22A 4QEHA 4M56A 3T6CA 4Z2JA 1P43A 4DNMA 1CYGA 3W1LA 1YX1A 1W32A 4HA3A 2D69A 1XH0A 2ZE0A 2QCLA 4M81A 2JK2A 5DRCA 1CEOA 3DYPA 3SCUA 4RZ6A 4ADTA 1AK5A 3G3DA 4KRTA 1XX1A 3KUMA 3G77A 2BOEX 3OQEA 1MZRA 1QI5A 3WSUA 1BTMA 4JTAA 4LNYA 2R82A 2WO5A 5FESA 3T0CA 3I4KA 4TR9A 4CEUC 3DDMA 2ZRYA 5PTDA 1XWYA 4AMAA 4QFUA 3ITCA 2H8XA 1Q6OA 3M4HA 2XIIA 2QIWA 4AZBA 3LQGA 2HQAA 1R9YA 3P2VA 1K8XA 1Z8AA 1EBGA 4Q4SA 4H7ZA 4MZ1A 3MMTA 4S23A 1PZ3A 3B8IA 3ME3A 2C14A 1V02E 1JULA 3CHVA 4CQCA 1TPB1 3BICA 3HPFA 3RFAA 3T09A 2PC8A 2PDBA 1EF2A 3LERA 2XVLA 3ZT7A 5ABFA 3VX1A 1S38A 4K37A 1D9EA 2PZNA 2Y70A 4GIAA 4XG1A 1AQHA 4GLEA 5I0DA 4ZOEA 3W2MA 2WJDA 3BLPX 4O19A 3VO0A 4J28A 4LQ1A 3FXYA 3KCOA 3KBNA 4US6A 4INFA 1A5MC 3DUGA 2ZYFA 1SR0A 4CU6A 3N1AA 5IFTA 4AZCA 2DUAA 4ZB5A 3WFLA 3OHIA 4XTIA 3TR9A 4MKNA 2EPNA 3OLDA 4D8LA 1K9TA 4IL0A 1E72M 2E6AA 3DG7A 1TPVA 3VMOA 1GOKA 4GY1A 3U4AA 2EQDA 3BW4A 1I4NA 3A64A 4GVHA 3UG3A 1B3YA 2AGKA 1OX4B 4LVBA 1GJPA 1SPQA 1KC7A 1O12A 1D2KA 1BG9A 2HVMA 3UF9A 5JU6A 1XI3A 3QGAC 2D0GA 3ONCA 3MUXA 4NJIA 4AIEA 1CGWA 3DFTA 2XVGA 3KXQA 1KM3A 3MUIA 4K1WA 4TIMA 4UXDA 4KW2A 5GJNA 1RJQA 4R9OA 5CZSA 3VD4A 3LRLA 1PIGA 1MUWA 2CLKA 4Q4MA 2FZ8A 1JCNA 3CWNA 3DHUA 1HG3A 3R89A 5GQBA 3W53A 1UB3A 4ZFCA 3TTOA 3LDVA 3M41A 3DIPA 2IKHA 1HZYA 3OOQA 1REQA 2R1KA 1V6WA 4CD6A 1XLAA 3H2AA 4N02A 1PX3A 3CHCA 2NUWA 2JGYA 2BMBA 1OFBA 3CMFA 5JIWA 3N18A 4HYRA 1JF6A 2XHYA 1H5YA 1V3HA 3WNNA 2YLLA 3GH5A 2OSYA 3LBCA 1JYXA 3U3HA 3F03K 1HL9A 1KFLA 4PEEA 4N6EA 1B4KA 2WJZA 3ARUA 4DY1A 4AHQA 3N17A 1YBQA 2G0WA 3TE9A 2WMIB 4FF5A 5CPMA 4FIQA 4ZOCA 5E09A 3VFCA 1MFUA 1EUAA 3CTLA 4ALDA 2JKPA 2P3EA 1A5UA 1CI1A 5FEXA 1GG0A 2GLKA 2ZC1A 5K3VA 1I1WA 3MZ2A 2BSLA 2OWXA 3MY9A 1LL4A 1P1MA 1U1HA 4XIMA 5CBIA 4CD4A 4O52A 1GOWA 2X1IA 3W7EA 4PUWA 2BVDA 3LV6A 3WBXA 2G95A 1OM0A 5F4XA 5G2WA 4DAFA 2CIPA 2V2CA 5T91A 5FF3A 3MMUA 2PRHA 2BASA 2OSWA 4U3CA 2BXVA 4QG9A 4KWOA 1WV2A 2OVLA 1RPKA 1DJNA 1RAKA 2TSYA 2VC5A 1W2VA 5C2GA 3NO5A 1TWZA 4NNCA 3UCCA 3DN5A 1S5VA 4I6KA 1E6XM 3VIFA 3NGFA 4JIPA 3SRFA 3DBNA 1LRNA 4HU3A 2G41A 2PCEA 4F9JA 3TLLA 1A0DA 4NUWA 2WCSA 1GTHA 5J8LA 1OF8A 1TWIA 2VURA 1VPXA 2OQYA 1U1JA 5CPTA 5E0CA 2XH4A 4TXEA 3ZJ7A 3C3NA 3RU6A 3S9YA 3ABXA 1MQQA 3KFTA 1O7AA 4S3BA 1DBTA 2E6FA 1VFOA 3CAKA 4Q8PA 4GBDA 1IEVA 3SY5A 1CTNA 5A6BD 4UCGA 1B4EA 3UXAA 2YCLA 5FJUA 3SCOA 4TV5A 2Y7DA 3B8DA 2XFWA 1I60A 2B81A 5FKYA 3LOTA 3URQA 5I07A 5CC7A 3QW3A 2YR1A 3OJGA 4W4QA 3VGFA 2I14A 2ZFAA 4U33A 1DWFM 3WNKA 1VHCA 5LIXX 1TTJA 1BVZA 2E4TA 3B0XA 1BYBA 1A4MA 4IG2B 2AL2A 1VZWA 3P62A 2P10A 4DUVA 4B90A 2A3LA 4MADA 4JQ1A 3W02A 2VQTA 5C9WA 3H24A 3LHUA 4HA0A 5C2XA 1Q6QA 2INZA 3NOYA 1C29A 2PD9A 4WDXA 3RK8A 2FGZA 3MW7A 4UFHA 4O1AA 4DELA 2P8CA 1XF0A 3SZ8A 7XIMA 3N12A 4M8UA 3G1VA 1OZQA 1R3RA 3A3WA 1H09A 3DFOA 2YB1A 3ARTA 2H9AB 1H50A 4AVFA 4H83A 5MHBA 3T8LA 1BRLA 3ZMRA 4IXHA 3ALFA 1T96A 1FKWA 1OYBA 3PG9A 3SI9A 2G50A 2J9XA 1E6NA 5E6ZA 3UBPC 1MVYA 5A95A 3H21A 3SSJA 4AWUA 3GLCA 3MCNA 3WQ5A 3P5ZA 1P0BA 3W76A 3LY0A 3WLMA 3WLSA 4NL1A 2E28A 4U10A 3W70A 4B5TA 2NT1A 3OGRA 3N11A 2EPLX 5HPOA 3QTGA 4KCVA 4AZ5A 4BHYA 3QH2A 3CLMA 4JNYA 4IMCA 1G6CA 3MT1A 3P81A 3WMCA 4F2UA 4HT3A 2AQOA 1SW0A 2W62A 4C6OA 3S1XA 2NT0A 3H7RA 3EXRA 4HOWA 2DW7A 4GH3A 2G8ZA 2Y89A 2VFFA 1IEQA 4IX2A 1ZS2A 4LWWA 1JZ6A 3N2TA 4N9EA 5ECUA 4HJFA 3H2EA 2GYIA 2WC3A 3O0KA 4NX5A 4BF7A 3RM4A 3QMRA 3VKBA 1DE5A 4G9PA 3ZZ1A 3WFAA 4LF1A 1ZBVA 3W27A 3H70A 1EC8A 4ZO7A 3S1WA 5I06A 4I90A 3UWVA 3TYCA 4DZAA 4Q3MA 1HKVA 3E12A 3W1NA 2RKXA 2WVVB 2GWNA 4EANA 1ZRQA 3AIWA 3ENLA 3SB0A 5BOFA 1V7YA 2FB2A 3GH7A 3WLJA 5CZKA 5I77A 2QCEA 4S3AA 3THQA 2HRWA 2YL6A 4E8GA 2FZMA 4LYKA 1V3KA 4DVOA 3CEUA 3PB2A 4K8HA 3UWEA 4G56A 3F4DA 1GQJA 3M64A 4NNBA 3V0UA 1AODA 2ZRXA 5ENLA 3N13A 3XINA 1XL9A 1N8WA 2C3ZA 1CXHA 2VCAA 3M9YA 5CBBA 1Q7QA 2GGHA 3D0CA 4DYKA 3PZOA 3UJSA 4F40A 4F0SA 1SO5A 2E3ZA 4JTEA 3FV9A 3H7UA 2QJMA 1XV8A 3WF2A 5A2BA 1R85A 1VEPA 1SJDA 4BY3A 4S3FA 3O2LA 5AOUA 1JPIA 4ZQNA 4YNGA 1R87A 1N82A 3WD0A 1I9CB 1W1A1 3RNDA 1KBJA 1IXPA 1XYZA 3B8VA 4O13A 3UGRA 2A6NA 1UZ1A 3V5FA 3DEQA 1H7PA 3OBEA 1XFCA 1YRRA 2OELA 5D9MA 3KP0A 3VYLA 1H0GA 1D8WA 2C79A 1ZZMA 4TMBA 1KRBC 4XKMA 3CMGA 3N3TA 2Z2AA 3VU2A 1JEZA 4KFNA 2V8ZA 1NELA 1WO2A 1WX0A 1J0ZA 2C1IA 1W3JA 2HDJA 4GFSA 1O5XA 3IUHA 4CNOA 1X1NA 2QULA 3SFKA 1RP8A 1S2VA 2IXUA 2QCHA 1WZLA 1TJPA 4JAWA 1SR9A 4BI5A 4LAOA 3WDRA 4D8ZA 4JTJA 2VGGA 1HKWA 3WKZA 2VM8A 2QHAA 3B05A 3GKAA 4E8CA 3I10A 4ORMA 1RXOB 3NWRA 3VKCA 1R2TA 1GT8A 2R14A 2GVGA 2RGMA 4CNNA 3FJ6A 3WBAA 3BAIA 1YEYA 3ONBA 2VQUA 1OY0A 3COTA 3GG1A 4HCHA 1Q66A 1K7XA 3LMYA 4LY4A 5DMMA 3BURA 4FLSA 4JN6A 1GOXA 4GA8A 2PDUA 4HA1A 1E6PA 4GRSA 4QNWA 4B5WA 4P7QA 5CGMA 4S2CA 3WD4A 2ZX8A 1R46A 3E0LA 3L65A 3JU2A 4RLIA 2XU2A 3F4VA 2HEJA 3BOXA 1LUCB 4WDUA 4PMNA 4HK6A 3LCHA 1FHVA 3GBDA 3W00A 4GOAA 1WKYA 4LUTB 4J3UA 2YBVA 3QFEA 5A8OA 4EIVA 1P6WA 4DI8A 3TW9A 3VOHA 2FYMA 3OHMB 3AYVA 3IK2A 3W6LA 4HN4A 3VI2A 1JNDA 2OSXA 3RM9A 1H5VA 3L5AA 2ANUA 4PBEA 3UW6A 1CLVA 3FHQA 1JZ3A 1P0EA 1Q6GA 1EP2A 3EXSA 2YDSA 2ZKMX 3TSMA 1XYMA 3O7UA 4TVCA 3L67A 2XIJA 3W7HA 1DE6A 3EBVA 2HK1A 4IUGA 2VVSA 1FCQA 2KX9A 2J6VA 4FXSA 1F3EA 2QMKA 5CG7A 3W23A 4BA0A 3QY8A 3LCWA 1E9IA 2I9UA 3A5FA 4B2DD 2PLCA 3CL6A 4CQDA 4BWLC 1O60A 3BGAA 3W81A 1RH9A 3SRHA 2VTFA 3C2EA 4H04A 1UC5A 1L6WA 4GQQA 4PUDA 4KESA 5BXPA 1FDYA 1E4LA 2WNQA 2NV1A 1R3VA 5IOBA 2E6DA 2GOKA 6ENLA 4BKNA 5KTLA 2FMNA 1S2TA 4DWSD 2C0HA 1PPIA 3KDOA 3C86A 1WA3A 3EDFA 4QE5A 2ZICA 3W2KA 1JDAA 4UTIA 3GDMA 4PSPA 4KCWA 4PB4A 2BG5A 1V02A 1XP3A 1JCMP 1IWBA 3PUOA 1VBHA 5A6TC 4M19A 2GVEA 3G2GA 3GRIA 1HL2A 3CWHA 1LOSA 4JD4A 1HQTA 4IQJA 1QWKA 4NHVA 4QQ3A 5A3HA 2WWCA 1EJ7L 1PBGA 4P8WA 1FH9A 1VAHA 3CV2A 2ZZ5A 1NH6A 3K5XA 1HKKA 2NSXA 3NEHA 4A3YA 1FHUA 1EJRC 4GI6A 5C5YA 3WLRA 4RDZA 4MF4A 4FAMA 2BGSA 1O95A 2Y1HA 4FLQA 3PBGA 3KVKA 3AC0A 1X1OA 3FA3A 1DJQA 4JQ4A 4DXKA 3U0HA 3HJZA 1C8VA 2CHRA 3TP4A 2PBOA 4CNTA 1KQYA 2O9TA 2ACUA 4AC7C 2G5WA 1CGTA 3GE7A 1QW9A 3RLGA 5AB3A 4D6DA 1T5AA 1VLWA 3SQMA 4H8UA 2XZ9A 1EJWC 4AF0B 1UWAA 4QLLA 2Y7EA 3O6YX 4IICA 3VIJA 1M65A 5FAJA 1KFWA 1MI3A 3QRHA 1H60A 4PUNA 4QG6A 5K7JA 2NQ9A 3WLTA 2AKMA 1OCBA 2BP1A 3DX5A 1XRTA 1FWBC 2J4GA 1I2OA 3EOUA 3CGTA 2IUZA 1MWOA 4C6NA 5I03A 1EIXA 1GHSA 2DUXA 3A22A 4ZVJA 3VD7A 2Y7FA 5LHFA 1XBZA 3NQ2A 4B5UA 1KM0A 3HG5A 3QQWA 2YA2A 1A5NC 1AA1B 3EB3A 3SUTA 2PEVA 2CHOA 2J7HA 4LVDA 2DV0A 2V30A 4IGMA 1EWEA 3H2OA 1XIFA 4CLMA 5FACA 3WO8A 2HSAA 2YL5A 3CQKA 1AH4A 1J9YA 3QPEA 3DHPA 2RDXA 3JR2A 3M5ZA 4AEFA 1IIGA 2JF6A 2UBPC 1BG4A 1PZ2A 4L4LA 3VDHA 4QXIA 2AQVA 1IZKA 3CV6A 3NUKA 3GFXA 3L0NA 2PDCA 1NDZA 3M7SA 3SCSA 1OF6A 3AICA 3IGXA 1UR2A 1GGOA 1LROA 4AD0A 4XQ6A 5T26A 1DXEA 4HK7A 3C56A 3PFRA 4PUMA 3NPWA 4ML4A 3SUVA 4RNFA 5D9NA 2OKTA 3SCTA 3CO8A 3UETA 1F5ZA 1S2CA 5DXYA 3NQ6A 4PULA 4ECLA 4ORIA 4Q4OA 5HWMA 2OT0A 4A8NA 2QMJA 3B9DA 3KBWA 5D9OA 2G3MA 4WD0A 1V93A 3ITVA 1RP9A 4XVEA 1JCJA 3HQ1A 3CU2A 3V16A 1HT6A 5T8GA 3UJ2A 1TZ9A 1D7FA 4NJGA 1RPXA 4WDTA 2YYTA 3KX6A 2RUSA 2PURA 3B0YA 3UG4A 1QOPA 2QQ6A 3GFYA 2ONEA 4GIYA 4O1CA 4Q32A 3IS4A 3DYOA 3GD6A 4JKKA 4IQEA 2QJNA 4GYPC 5IHRA 3P14A 3EWZA 3O1NA 4MNJA 4MTVA 1HUVA 3EWBX 4I9MA 3QZ6A 3LXAA 3MV01 3ZR6A 3P80A 4MWAE 1OC7A 2FGBA 4PUEA 2HE8A 2E9BA 3NO3A 4G5DA 4S3EA 2WC7A 2WWDA 4Y9OA 2X2GA 3SN1A 3EPMA 4UFJA 1FTXA 4WRHA 5I6SA 1BYDA 3W22A 1QK0A 1W5QA 3W38A 5LA0A 4N7QA 2OO6A 1RUSA 5LGXA 3W7GA 3TQVA 2PBGA 4UCFA 1PXGA 3CUZA 1VFUA 5D02A 2WJFA 3WK2A 3RF9A 1VFSA 3HPAA 4F0MA 4QTGA 1XDMA 4Z1BA 2YA1A 3QZEA 2EPKX 2JALA 1AQMA 3AXMA 1S39A 4W85A 2F61A 1J6OA 1ENUA 1XPYA 2CC0A 1A0EA 4RW5A 3PZQA 1K77A 1G69A 1SW3A 1ZGDA 3RRAA 2OGJA 1KXTA 5I3HA 5K9CA 5D03A 4X0NA 4FK9A 4L56A 4C6EA 1MFVA 3WDPP 1JPDX 2PFHA 2G97A 2VD9A 3PPHA 4PTMA 4Q8QA 2CPUA 1E0UA 3ZVIA 2X41A 1KCKA 4CCEA 2NV9A 3QJAA 4W87A 2CKSA 2J7CA 1W9PA 2V67A 3GZ3A 2V5DA 1VLIA 5REQA 4ZQOA 3MHFA 3B06A 3FA5A 4Q8MA 3NQVA 3ANYA 3PZTA 1E5JA 2Q09A 3UGVA 2O7SA 5CJNA 3N9KA 4BQ2A 9XIMA 3GXMA 4ERGA 3MUY1 4O1DA 4JIRA 1JDDA 1VH7A 3LQLA 4M1RA 3FYOA 1PO9A 2YPIA 1ADSA 1FHDA 3TDFA 4GK8A 3C0JA 3AS2A 4PCPA 4UMCA 5ABGA 1H4PA 4HSHA 2E5CA 4DBDA 4DAIA 1D3GA 3EB2A 3A24A 1DORA 1VCVA 4B3KA 1UIPA 1SJAA 2XN2A 1S2WA 1BVNP 3BZGA 4AU0A 4Z1DA 1XFBA 3ARZA 3B03A 4JFWA 2WLYA 4QROA 5KZEA 1Q6RA 3M1ZA 4IISA 4KH2A 5EB8A 5U7SA 1XBYA 1KRMA 1TV8A 3AHXA 1OT1A 4NRRA 3QMSA 3L5LA 1A50A 5TNVA 3V1HA 3S1GA 4BWLA 3ZS4A 1AZ1A 5A2AA 1EHAA 4WY0A 7REQB 4K39A 3WD3A 1KBLA 3AS1A 4OV4A 7A3HA 2Z24A 4GVFA 3N6JA 3G1XA 5CC3A 2QGHA 4NAFB 5I7GA 4QDPA 2WZHA 5K4XA 3HO8A 5CPOA 4XO6A 3HIJA 1UD3A 4IGHA 4RNHA 2A85A 1E56A 1F74A 1TFVA 4PR4A 1NFBA 4N4QA 3UEQA 1TPUA 4NYYA 1S3HA 2ZZ7A 3KTCA 2Z4GA 4ZGYA 3S2NA 2A6LA 4N4PA 5SWUA 5FSDC 1JZ5A 4C90A 2YXOA 1GQNA 3MMWA 1H11A 1P5BA 4HN8A 5DMYA 1UQYA 3E2SA 3A5VA 4HNLA 4V28A 3KS6A 4D6CA 3W7MA 4GI4A 5LA2A 1RR2A 1BWVA 4MNMA 7CGTA 4GNVA 3LTYA 3C2RA 2X7WA 2PPGA 5JIPA 2PDKA 2Y7GA 4MWAC 2NQZA 4P8XA 3M6YA 1PHWA 4MIMA 3WJSA 2ISVA 3HGOA 4P5UA 2PC4A 2JEQA 3IJLA 1LWJA 5G4WA 3LCLA 2QKFA 1J18A 3DBPA 3BAXA 4GNJA 2PB1A 1EQCA 2C18A 2RJGA 2FHBA 1ITQA 3EOLA 4DO6A 4BF5A 3P0WA 4GZIA 1QPKA 4UFKA 5ABEA 1JG9A 2H3BA 4P7OA 1D7KA 1MXDA 1ME7A 3MU7A 4REQB 3B3DA 2B7OA 4F3HA 3TCEA 1JZ7A 3KL3A 5CXPA 1TCDA 1W5PA 4ONVA 4WKFA 3MS8A 2E1DA 1T8QA 3L2IA 4YU1A 1R0MA 4H9VA 1ZPTA 2V38A 5BRBA 3XIMA 3PB0A 1G9HA 3SY8A 4OV9A 1J2WA 6REQB 4C6FA 4JHOA 4BQ5A 3VC5A 4IQDA 4ZXLA 2QDEA 1C8YA 1F6KA 1H7OA 2CWNA 4WJXA 3PZIA 1E9LA 1QK2A 4P7RA 3NZ1A 1CW2A 1B1YA 4X60A 4H41A 3NZPA 3THCA 3PTQA 5CJMA 3AXKA 3C0QA 4IIGA 4IUOA 3GTIA 4R34A 1KD0A 2WNWA 1T99A 3QSRA 1DOSA 2EKGA 4LYPA 3CAVA 4BFAA 3MVIA 2UY3A 4K8EA 3C8FA 5AC8A 2NXGA 3S0CA 2QV4A 5F4WA 3W74A 4HBKA 2P53A 4MSSA 3WEOA 2I56A 4Q8NA 4IMFA 2Y62A 1UUMA 1OCNA 1H62A 1QBBA 4JBRA 3W25A 3WF3A 2WM1A 2Z1BA 3LK6A 4O11A 4UNIA 4Z1YA 3V3WA 2OX4A 1X96A 1ZU8A 2J7DA 1BVWA 3OLIA 5ABHA 4GG9A 3DCPA 1JDCA 4Q4PA 2V3EA 3LTSA 4WY0F 4H6KA 4UTHA 3L2MA 1CGYA 1FXQA 2IMRA 4QE1A 1FQ0A 2VUYA 1VFLA 2CEQA 4JHMA 3WLPA 2D0HA 2VR4A 1UBSA 4ZEPA 5XIAA 5F2GA 2QPXA 1DP0A 1B90A 4GY0A 3GS6A 3ARXA 3FVDA 3IGSA 2QJHA 4J2MA 2D20A 2R91A 5DF0A 1ZTVA 3PR2A 5CPNA 4JS3A 1VJZA 2J27A 2PDXA 4GYPA 1V6VA 1I2QA 5HDRA 5KZDA 1OADA 1EGMA 3C0SA 4ADUA 3T0BA 3CB8A 3NL2A 1CENA 5LIKX 4DBUA 2CLIA 2V3DA 3PTMA 3DHFA 1QNPA 1IT0A 1G4PA 2DT2A 4DUOA 4J1OA 3UJEA 3KE0A 3QC0A 2NSOA 4TMCA 1VYSX 4ZODA 2XGBA 2PDWA 4XZIA 3U57A 1N8IA 3B4UA 4KEVA 3VILA 1VFTA 4NASA 1DV7A 2FLIA 4YS1A 4M6QA 3RMJA 4US5D 1OD0A 2PSNA 3N29A 3TJIA 1XSKA 3QHNA 4FIRA 2DJLA 1NFGA 4Q4KA 2NW0A 1W0MA 3MA8A 1I75A 1IEIA 3PZNA 2XVKA 4KF1A 4PUUA 2IW0A 4GMEA 3NA8A 3HG3A 1AD4A 3Q45A 1JFHA 2FHCA 3L66A 3UPWA 3D46A 4IMGA 4URIA 3TTSA 1UPMB 3T55A 1V0LA 4EPDC 4LBSA 4LALA 3TCSA 2F38A 1GZGA 1XLLA 1LQ2A 1JYWA 3NNTA 4DX3A 1FWAC 1W17A 5A1AA 4ROPA 1OFRA 1QI2A 4L6OA 1FP8A 2Z1VA 3VGHA 4ZQCA 3PJUA 5G1TA 5I2UA 1AMKA 5AYIA 4IIBA 4DJED 2HISA 2PDJA 1XXXA 2HZGA 3AIEA 4C1NA 5C9UA 1I8JA 3GIPA 1IT7A 3OB8A 1OC6A 4MMWA 3CUFA 1W3HA 5BU6A 3VGGA 4U31A 3SUSA 2A2IA 3CUXA 3T0DA 2DZBA 4UFLA 3NIYA 2WMFA 2D2JA 4HNOA 3RLVA 3W73A 4RE2A 4FNRA 1RHCA 2OLHA 2A4AA 1PL9A 3TN6A 1YDOA 3V4BA 1FWCC 1OCQA 2Z1XA 4WKHA 4LNCA 3ZVHA 5AVHA 2A3EA 3UFYA 3L23A 4JTFA 1QPRA 1XYCA 3R8HA 3HBLA 3MUZ1 2J47A 3G8RA 1FX6A 2PGFA 1TR9A 3QR0A 3NSMA 3LUTA 1DJIA 4GJJA 5KZMA 2J13A 4UTWC 3A13A 2W66A 1JZ4A 3A47A 4IMDA 4U3AA 3FCPA 5HJXA 1GZJA 3AQUA 1M68A 4HMCA 2RGLA 1KM4A 4W7UA 2V82A 4H19A 3UERA 3W7LA 3L5MA 3C4UA 1ISYA 1FWSA 3EGJA 1RLDA 3UR2A 4LBUA 2OQHA 2VCCA 3S5ZA 2ALRA 3PPFA 3W1XA 3TONA 3PHAA 3QYSA 3SAZA 1KM5A 4XBJA 1J79A 4JX6A 3UQNA 3NVTA 4GX9A 2JKEA 3EB4A 3VDCA 1A3WA 1PB0A 2F84A 2DSUA 3EPOA 4UNKA 2A7PA 3CUHA 3AIBA 3CZJA 5JQ9A 1JZ8A 4FPSA 1K8YA 1KA9F 2XH7A 3KCJA 3E5BA 3U48A 3WBEA 3ZXWA 1YTDA 1DQWA 4Q6XA 1U83A 3AXIA 4R9XA 5C70A 1EEPA 3W26A 3FX4A 3ANVA 1US2A 4GKTA 2VZTA 2ON3A 1UOKA 1ICPA 3CZGA 4D2JA 1YDVA 3QPYA 1J4EA 3IIPA 1E5NA 1XQKA 3VA8A 1ZBWA 2P0IA 3VIIA 4Z42C 4UC5A 3V36A 3AZTA 1RLCL 1E0VA 3PY2A 3H2NA 4H9YA 4KWSA 3AIRA 3TTEA 2WSPA 5FJJA 1R38A 3S2MA 1BQGA 2D22A 2GJRA 4HIBA 4WSJA 1QNVA 2J6XA 3AU2A 4MWAA 3KOXA 2XZ7A 4DF0A 3GDRA 1QW7A 3E96A 1MO0A 2VRJA 3CV7A 3GHSA 3K4AA 2AOSA 5FJPA 5CGTA 1JXKA 5DMNA 1ESWA 3LPOA 1FH8A 4Z1CA 3RLUA 4IL2A 3QFWA 4JGDA 1GOOA 4GH1A 2E8YA 3DOPA 1XJBA 2OU4A 2X1UA 2YCEA 2PP3A 3HZ3A 3VGBA 5HPCA 3S5SA 1T8XA 1VF8A 4EK7A 3POCA 4J40A 3SCVA 4YCOA 5I3FA 3I4EA 2OQLA 3E0FA 1A5BA 4L65A 4XAZA 3P3BA 4RZBA 3VFLA 5FEWA 5DFAA 3BCDA 3QV7A 2WYSA 1OFOA 3DFQA 3SSZA 3M0XA 1JAEA 3DH7A 1EO5A 4EPKA 3K1DA 3VOIA 3WLKX 3TFXA 4WZHA 4GHRA 2PTYA 2C1HA 2HCVA 1F3WA 3LPFA 4L1XA 5CLTA 1KLYA 3OA3A 1KR1A 2RDWA 2ZA3A 1L6YA 5GNZA 2WV8A 1YLVA 2HXTA 4WEVX 4J9JA 3V0TA 3MCOA 4JTIA 1NWTA 4AYSA 1H51A 3SUUA 2W92A 4MZ8A 2X2YA 1DKWA 1F4AA 1I0BA 2VRQA 3GNPA 1T7LA 4FNPA 3STCA 3KOFA 1TWSA 1SM9A 3EX4A 2A3AA 3HV9A 2FVKA 5HAOA 3ITGA 4WX2A 3RPMA 3PJXA 2EEXA 3EOSA 4YCPA 2EJ1A 2V5LA 1XLCA 3GR7A 3KRSA 4GIRA 2B7NA 1JGMA 2BGNE 1EUNA 1XKYA 4IZGA 4IIDA 2FFIA 3SCPA 2QCCA 3TJXA 4HZ8A 5H1WA 1O68A 3UJFA 4J4KA 3MI6A 4EXBA 4Q7BA 1PTDA 1SYTA 2OZ0A 4F79A 2DU2A 3PK7A 3NG3A 3KZSA 1TB3A 3GUWA 4H7VA 1GKPA 3AZSA 5IBXC 4TOQA 1EA9C 2V3FA 3WD2A 1IWPA 1E73M 1IEWA 4FZIA 1EYEA 1LRQA 3IIZA 4UOJA 1UASA 4GZEA 1NDVA 1DXIA 4RX0A 1H0IA 1MZHA 3PTDA 4H9XA 1QPNA 4MFEA 2GSHA 3QKZA 1JYVA 1G4TA 1MRAA 3T07A 1G01A 5HINA 4UTTC 1EJTC 3E0VA 3VOCA 3SCWA 2ODOA 2OEJA 4GUIA 2VO5A 3GXNA 2YL9A 4O0ZA 4NKCA 2GK1A 1QMLA 1A49A 4DM1A 1ZL1A 4R7WA 1TG7A 2O0TA 5F2IA 2VMFA 3V35A 3UT0A 2BDQA 4GGHA 1FUYA 1LLZA 1PKMA 4DHGA 1UR8A 1SFLA 4RZ4A 3G1HA 4YTRA 4C6CA 1KNWA 4H9TA 1OIMA 2JIEA 4QJ1A 4JTSA 4HPJA 4O4VA 3ZIZA 3CTTA 4NF7A 3KS5A 2D2GA 2Z28A 3R13A 3WQFA 3WUBA 2R8WA 2REQB 1NP2A 2BX7A 3L0GA 4MDPA 1CXLA 1K9EA