4US5D

Crystal structure of apo-msno8
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
331
Chain Sequence
HHHHVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSADAAARLGLPYAYAHFITPDFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
total genus 115
structure length 331
sequence length 338
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5D00
1LUCA 1Z69A 1M41A 3FGCB 1BRLB 5LXEA 1NQKA 4J2PA 3SDOA 1XKJA 4US5D 3C8NA 3B9OA 1BSLA 5AECA 3B9NA 1YW1A 1LUCB 3RAOA 1TVLA 1RHCA 1F07A 2I7GA 3B4YA 5DQPA 4US5A 2B81A 1BRLA 3FGCA 1NFPA 1FVPA 1EZWA 4UWMA
chains in the Genus database with same CATH superfamily
3UEQA 1KXVA 2EQDA 4BS0A 4WY0A 2DGAA 4Z42C 3BCDA 2NQZA 3T42A 3SUUA 1J11A 2V63A 1X8CA 2HVMA 4A8RA 3TYEA 4P7LA 3CB8A 5A6SA 3LGGA 3SW6A 3RLUA 3KEHA 1R3YA 1N55A 3N12A 3O6YX 4UFKA 1TVLA 1XM3A 1TV3A 4FLQA 3U2EA 1GVRA 3T4CA 1A0DA 1ITCA 2WC4A 2ZTKA 3IRSA 4JTIA 5E1QA 3PNUA 4AF0A 3D6NA 1A50A 2HK1A 4QAWA 2UBPC 4HJFA 1XGDA 1O68A 5AKQA 5KINA 1F3EA 1VRXA 1FH9A 3ABQA 3W7LA 3AHTA 2F2HA 4AC1X 3GU9A 5I7GA 3E02A 4K6AA 4FHAA 2W67A 4ASTA 1I2NA 2FDSA 1VAHA 1TTQA 1W37A 4IP5A 2XSBA 3U3HA 4O18A 3ZO9A 2ZC1A 1UA3A 3EX1A 3NUKA 4E3VA 3P3BA 4YTQA 1W32A 3RO8A 1XIDA 4AHPA 2HQAA 2C13A 4J28A 3CEUA 1OIMA 1BXNA 4YTRA 3UG4A 1KBBA 3IANA 3DGRA 3TW7A 2P10A 2EG6A 4J3VA 1I75A 1B0IA 4P7QA 4GVFA 4QDPA 4NXKA 1SUXA 3WZ0E 1S5TA 1PYFA 5AC4A 3ZJ8A 3CT7A 1BPLB 2Z00A 1UD3A 4UTTA 4ZMGA 2WMIA 1QI2A 1H1ZA 4KWUA 3U4FA 4MM1A 2V69A 3SO7A 3GKFA 4LYRA 1WDRA 3EXRA 4GACA 3RX4A 4GZEA 4IT1A 1E15A 1OWQA 4BF5A 3AIEA 1M68A 4ZQPA 4XWUA 1OYBA 4GUGA 2G3MA 4LBUA 5AN7A 4YTSA 1MQPA 3LENA 3H4GA 1I9CB 1KC7A 3AWOA 1WZKA 5HA7A 3R25A 3D47A 3R5EA 2Y5SA 4F0HA 4TTGA 2YZ5A 3QMRA 3W72A 3P84A 4PL1A 1XLLA 3G1FA 3DKJA 1GUVA 1W3TA 1GVOA 3V16A 3KBNA 4AZIA 4PMNA 4C1KA 3F4DA 1UC5A 3EX2A 2V3DA 2Z1SA 3WLIA 3ALFA 3ES8A 3WD2A 3WDIA 3LNMA 3OU8A 4NZFA 3VZYA 4WF7A 2A21A 1SO3A 1W5MA 3ZMRA 1EL3A 4KBXA 1BG9A 3M16A 3C8NA 5E0KA 1OBAA 2X7VA 4C6KA 4CVUA 5HXMA 4XD6A 4GNJA 4A8IA 1V02A 3GRIA 2EPNA 3TKFA 4IWWA 3NQDA 4OJYA 1C9WA 3FK4A 3PAOA 1LROA 1UZ1A 3CEPA 1L6GA 1KO0A 4WLCA 3PTMA 4GZJA 1K6AA 1VLWA 3W53A 4L7ZA 2X30A 2YW4A 3STPA 5HQEA 4DM1A 2YSWA 1S5WA 1OT1A 3BJFA 1X97A 3PANA 4TV6A 2YL9A 3T2PA 3L4ZA 1E1EA 4DWDA 2O9OA 1FH8A 1V5XA 1Z8AA 1OM0A 1ZP3A 1MW0A 5EPDA 2FH8A 2FLIA 4OU1A 3BWWA 2GJPA 4JIIX 4B91A 3TJXA 3EGJA 3QN3A 3URQA 5F2IA 1X1OA 2D20A 1AODA 1HJUA 3TC7A 5KMYA 1E6XM 1WV2A 4OV9A 1FWTA 2VOMA 3CTTA 2Z28A 3AU6A 3SQMA 2ZC8A 2X16A 1V8EA 4BI5A 1X1ZA 3SUTA 2R14A 4B16A 2FZNA 2FPTA 2CCRA 3FNDA 3R94A 3RHGA 4DBSA 4BQ3A 3N25A 4XIAA 5HJYA 3N14A 2R1LA 1W1ZA 2RGMA 8XIAA 3BJTA 2J7BA 4DVOA 1XBXA 3NL3A 4BWLC 3W7IA 5LNUA 1B54A 1P0BA 2O7SA 5IBXC 2QXWA 1K8YA 4RCXA 3W29A 2ISVA 1ZAIA 3WQWA 3BANA 3MWAA 2R9RA 1KXQA 1SJAA 3N1AA 3NWRA 4QM1A 3FYPA 4HOZA 1W31A 4XTIA 1RP9A 3DHUA 4TMBA 4GWEA 3TCEA 2B0MA 3G3MA 1F76A 4KERA 1Y65A 4GFSA 3KCJA 2VP8A 2QT3A 4GZIA 2E25A 3KCLA 3TR2A 3EA3A 4HNCA 4XQ6A 4FK9A 1YTDA 1MZHA 5HR7A 1B3WA 1JAEA 1JZ5A 4WDUA 4O10A 3QV7A 2A7RA 3VTRA 3STCA 1YNQA 1W3HA 1XG4A 4J3ZA 4LY4A 1R9ZA 4EXAA 3VILA 2GFTA 4N0RA 4NY2A 1HL8A 3FEMA 5AYIA 1YXCA 1TIWA 1U22A 2WC7A 5EKYA 4AVFA 3AMDA 4GJ1A 4D6EA 1BSLA 1A80A 4ML4A 4DB7A 4HPXA 2CNCA 2QZRA 4O19A 2FPVA 5FF4A 1B90A 4AD5A 1BWKA 4ZO6A 1HJQA 1TPUA 2ZUSA 4FOJA 1ISWA 3OLDA 1GEQA 4Q8WA 3GM8A 5DMMA 2P53A 2OQYA 5G2HA 5I3GA 1M7OA 2YBUA 3OA5A 4P2VA 3M0IA 4HMNA 4Z1CA 2ASHA 3WJZA 1JIBA 1PCKA 4S3DA 3R43A 3W0KA 3SADA 4ZOCA 2ZKMX 3GQYA 1SW7A 3O3RA 5BWFA 3TYDA 4KGJA 2VEFA 3GHUA 4FF7A 1XF0A 4XKMA 2NQHA 1TWZA 3CQHA 2PDIA 1AJZA 4RX0A 2PODA 1P0NA 4OVXA 1VFFA 4C7GA 5L9FA 3VMOA 4J2PA 3EOSA 4NT0A 3AMCA 2ZBTA 3ABOA 1KGUA 1AZ2A 1JCLA 2J66A 3HA1A 3DOPA 2PTZA 1K9TA 3GG7A 2W0UA 1G69A 1UQYA 3W85A 3M64A 1EX1A 3IK2A 1LP6A 5I79A 4JYEA 2C1IA 2WPBA 4UZSA 1JCMP 3CHVA 3A5VA 1QOPA 3GWQA 3FLUA 3QSTA 3WENA 4JKMA 5PTDA 4CD6A 5GQBA 1GHSA 3VZZA 2XFRA 4HA1A 2X1IA 2CLHA 2QPXA 4B5SA 2GUBA 4EAYA 3SM0A 3Q37A 4WXYA 3VPLA 1XIFA 1H09A 3AHVA 4AVOA 3KRZA 5FJRA 3KDOA 3E74A 2OSYA 5GJMA 2WB5A 1DVJA 1XRTA 2CWXA 4DLMA 1LLOA 4L9YA 2OEJA 1RLDA 1EB3A 2IS7A 2V30A 4ZE4A 3E5BA 4WGHA 5CPMA 5E9AA 2Y61A 2GZXA 2RH9A 5C9RA 4MMWA 2DSWA 1E6PA 2GGEA 1UZDA 2XH4A 1K02A 2VQTA 2C3ZA 4DQWA 1HGYA 4IP4A 3WL1A 1NWTA 4HPGA 3KAOA 4ZO8A 1NU5A 5FESA 2CZ5A 3VCNA 4QSFA 3VOIA 1PPIA 2VFFA 1A5UA 1K7XA 3COTA 1HZYA 1DL3A 3GHRA 4JFUA 2W4XA 4JQ2A 1O1HA 4WSHA 1RALA 3UCQA 3WUBA 4K38A 3CK5A 3LDVA 1LZOA 3E1F1 3S1VA 5TIMA 3B04A 7ODCA 3M5XA 4HYWA 1TVNA 3F4VA 2CZDA 1KFCA 2VEGA 3W7DA 3BCFA 2W66A 4NJIA 4MPQA 3IV8A 2JK2A 2CERA 1PX4A 3CHFA 3UPWA 3SJNA 2HRWA 2ANUA 4AHQA 1N82A 1QO5A 2HVOA 2HTMA 3PB2A 4Z2HA 1JXJA 2RDWA 4O0KA 1OD0A 3M41A 5JUVA 1JD7A 2J47A 2KZHA 1YXDA 3M0XA 4NNAA 3N15A 4PCFA 3EWDA 3LD5A 4UTKA 4UTIA 1C7SA 1UD4A 4GY7A 1KM3A 1QI0A 1QPKA 2OKOA 3H53A 3EDDA 3CL8A 3WDRA 2DIKA 3RM9A 1EZ2A 3KS6A 1QFEA 3QR0A 5FF0A 4AZCA 3IGXA 4ERGA 3LCLA 1OCNA 4EANA 5A6KA 3FV9A 3BLIA 3HTWA 3NL2A 4WOQA 3B9NA 5TAOA 4D6IA 2YKKA 3IK4A 1KXTA 2PDUA 5I3IA 3FY1A 5LZLA 1VBGA 4YU1A 1R8LA 3QGAC 1SZFA 1XGEA 3UR7A 3CMGA 5DFAA 4W87A 4G7EA 4L80A 1BRLB 2XIJA 5C54A 1V03A 2VR5A 4PTDA 5CJMA 1Z32X 3MUY1 3O0KA 4W7UA 4WSKA 2E4TA 4KESA 4S3BA 3UJSA 4NYUA 1J0IA 2DH2A 1JEZA 3AIWA 2QF8A 1VYRA 1RZMA 4L64A 2E68A 3MWCA 4AX6A 2GGJA 2EF9A 2PI6A 4D9PA 4X60A 2Z6IA 1Z89A 1OD8A 1OX6A 3UVAA 2GSHA 1RVGA 2DT1A 3BH4A 1N2VA 1VF8A 1TQXA 1W17A 3GHTA 4RNHA 4U3AA 5D38A 1DJGA 3Q58A 3ITVA 1OFAA 1T8XA 3BTNA 3SSJA 4XZMX 1RVKA 1XFBA 3O15A 4IJCA 2R1KA 2WBGA 3FW6A 3R0DA 5KSWA 2ZX5A 3PZQA 1C7TA 2Y7FA 3GW3A 8RUCA 9XIMA 3RPTA 3BVJA 5C2GA 3RLHA 1GKQA 3N4AA 3DGBA 2BXYA 2V38A 1PAMA 3MCOA 4XSLA 2WM1A 1SFLA 4L1GA 4ZO7A 3GYEA 1TV5A 3UPBA 1JD9A 3CYVA 3Q94A 1XLFA 1F9CA 1KD0A 1R3TA 4CEXC 1DTUA 3F5JA 3DU0A 1XC6A 3GXMA 3GLCA 2XTKA 4DHGA 3WK3A 3FYOA 1TR9A 3BLLA 4Y9MA 1ZP4A 2KAUC 3VKCA 3BCJA 1UPPA 5IOBA 2CPUA 4YWSA 2YGYA 5AYZA 1JG9A 2PU1A 1VEMA 4C6CA 3ANYA 2GJNA 4DI8A 3Q67A 3L12A 1XH0A 1QWKA 3FHQA 5KZ6A 2WK2A 3ARZA 3MKCA 4W8AA 3WK1A 5I3HA 1GYLA 4H9MA 2XDFA 1RUSA 3WYZA 3VK5A 4YYCA 4C5YA 3I7SA 1M7JA 3W7PA 3UR2A 3M07A 1H7PA 4PZVA 3L21A 3RR1A 3B8UA 2TYSA 3A47A 1ZJIA 3W74A 3ORWA 1RY0A 5CC6A 2B7NA 4GLEA 1J79A 5KEZA 4NQ1A 1H2JA 1WDDA 4L61A 1JPIA 5GNXA 2ZICA 4GYFA 2BS9A 2CW6A 4U5KA 4WSJA 3NXLA 1GHRA 3MUAA 3ONBA 2CC0A 4KEMA 5BXTA 4D1JA 3HPSA 3NO1A 1PIIA 4HQVA 4WD0A 4XKYB 2YJQA 3SCUA 3TIMA 3LCHA 1ZJHA 3PFRA 4AAJA 1XYLA 1X7IA 4H6RA 3AYTA 1JQXA 3FX4A 2YIHA 4I6KA 2YBVA 4IIGA 2R91A 3GZ3A 5A8PA 1PBGA 3N2BA 2GOUA 4TIMA 3WLHA 1KM2A 2BHUA 2FHFA 1RJPA 3N13A 1DBTA 1GVFA 3M0LA 1DXIA 4JL1A 3KHJA 4CQDA 3NQAA 4W8LA 3S2JA 2IUZA 2Z0IA 3R8HA 5BRBA 3WL0A 4R9OA 3CH9A 4Y9NA 1XX1A 4ECLA 3F2CA 2ZWYA 4MFDA 2WVTA 2QV5A 4HTBA 1VCGA 1FDZA 1TVPA 4DZ5A 2W91A 5BOOA 4J3TA 1LG1A 2VWSA 3W1NA 2WVSA 2OB3A 1RA5A 3P93A 1FCVA 2C8NA 2R1NA 3UETA 1J93A 4MAVA 4D6HA 5GNZA 3ATYA 1C3FA 2PWHA 1OYAA 4UOQA 3ZJ7A 1E6ZA 3W3OA 4JDBA 1P4CA 3H2AA 4PUNA 3WMSA 3TMQA 3VGGA 2AMXA 5F4XA 3L23A 4AY7A 4FZIA 8XIMA 2WWCA 4MWAC 4RL3A 2CHNA 4HHHA 4CCDA 4LVBA 3THUA 1JYVA 4KEVA 2CITA 3GSMA 4KH2A 6XIAA 3WLRA 4ZL1A 3R0UA 1LF1A 1TZZA 2OCZA 3EOEA 1I2OA 1VGAA 3N3MA 1WPCA 4B5WA 1BD0A 2Y5EA 3BLEA 1DTNA 3IJQA 2CXGA 3UGVA 5EFDA 3UWQA 3V4BA 2QCHA 3FGCA 1DJIA 4LS1A 4WKFA 1I60A 1XLGA 1Q4WA 1EGVA 4NHVA 2Y6ZA 2R24A 4JBRA 2DFAA 1CB7B 4GKLA 1V51A 3ZVHB 3UCCA 1WUEA 2VYOA 4LS0A 3ZLFA 1VZWA 2B81A 3IV3A 3TROA 2DW7A 3GVGA 1T40A 4U31A 4HT3A 1EDTA 2OO6A 2IXUA 1I0DA 1E73M 3KFTA 2O7QA 2EG7A 3BGGA 4NSBA 3EOUA 4O1DA 4LFYA 1WZAA 3E0LA 3RILA 1EO7A 1XINA 4GYJA 2Y7DA 4UR8A 4JN7A 3SCOA 4AC7C 4O16A 3NO3A 5BXRA 1E1CB 4KF1A 2UY4A 3HM7A 5FACA 4UCGA 4ZOBA 1FVPA 3TZNA 1U30A 2G37A 2J9YA 5A8QA 2GDQA 1UA7A 4YXGA 4UTHA 3EEZA 3SQSA 5KTLA 3TAOA 1J96A 5FJIA 5BRPA 3FSTA 2WSPA 4UFIA 3T4WA 3QGKC 3MKVA 2VJXA 5LGXA 3NZQA 3KL0A 1Q7ZA 2VDGA 3VCRA 3G1HA 1HQTA 2BBFA 5F2GA 4AZ5A 4UTLA 3VD3A 4NVTA 5FF7A 2WZMA 4ZFCA 4KGLA 3LTSA 3WUEA 3LPPA 3N2MA 4KRZA 5HOSA 2PSNA 2FHCA 2C91A 3QLDA 1OC6A 2E6AA 3PG8A 2NQ5A 5C2CA 2VQUA 2GQAA 4PBGA 4PMUA 3WH8A 1AG1O 3WLQA 1GKRA 4H8VA 1JZ7A 3ZLGA 3CUXA 2YB1A 4XAZA 3MUZ1 1TCDA 2D73A 1QWGA 2YW3A 3ID7A 3DX5A 1FHLA 3D3FA 1VRDA 1ZJBA 3O1NA 4N42A 3N9SA 3GD6A 3THQA 4UTMA 4K36A 1CGUA 3IVSA 4B9ZA 5EMKA 1TPEA 1H0GA 4HA3A 2J6VA 3SB0A 4DZIA 4LV4A 3RPDA 1TJRA 2HSAA 2FJUB 1E6QM 2ISSA 4ZCWA 3TFXA 4M7SA 3UW6A 4HU0A 2WC3A 2OYKA 2G5WA 1XV8A 1KTCA 4EF8A 3LG3A 5EMUA 2NXIA 4KCVA 3TK7A 5C7HA 2CLPA 5C9UA 3MMUA 3II1A 4INFA 3L67A 3S5OA 4GIEA 3VOCA 3WNLA 3QZAA 1SO6A 5FEZA 4J27A 3STGA 3UZWA 3AO0A 3MUXA 3VAVA 1GQLA 2D0GA 1J18A 3SSZA 4WX2A 3PBGA 1NELA 4IXXA 5FEPA 1ZALA 1FQ0A 3RMEA 4HMEA 1JPMA 2GVLA 3G0SA 4JTFA 4YHEA 4M7TA 4GOAA 1QTWA 3IARA 4XO7A 5I23A 3SCTA 2XFWA 5K4ZA 3KVJA 1XH1A 2E9MA 1GORA 4S3AA 5F7UA 2Z2BA 3ARTA 1YTEA 1PDZA 2YDQA 4AVNA 4Q22A 1Z69A 4R5EA 2PMQA 2QJNA 4S23A 3TAKA 4FLSA 1Q65A 3B3DA 1HW6A 4ICCX 4C6IA 4L9ZA 2DSUA 4O54A 4W7WA 3W76A 2GQ8A 3K4DA 4B15A 2W61A 1S2UA 1IF2A 3BAJA 4RNFA 3NGJA 3F4NA 4IUGA 1QATA 4OTKA 4W9TA 5D03A 3T1GA 5LSMA 2ZDRA 1K03A 3PBUA 3G1AA 1I8JA 1QPNA 3SN1A 2QCMA 1Q66A 4U5IA 2NQJA 4X61A 3WNNA 1XLBA 3AIVA 3WN6A 6ALDA 3S46A 3TJIA 1RP8A 1Q4NX 2GSEA 1MWOA 2FJKA 2WOQA 3H2MA 5T26A 1K8CA 2VWTA 4IMDA 3AXXA 3WLNA 2ISWA 3VUPA 1TMQA 4FNSA 1EJWC 3R58A 3GVWA 3AMGA 2FVKA 3GG1A 2OSXA 4JY9A 1GQNA 4W88A 1B3YA 1Q8JA 3WQVA 1JZ3A 3TONA 4JFWA 2X1SA 2W3ZA 1WAWA 2OXNA 3S1XA 1QXLA 5DT7A 1PIGA 4Z08A 4M29A 4FS9A 1E4MM 1W3NA 4JQAA 3AXHA 3TH6A 2B4GA 3W2MA 5LIXX 1R85A 3ABSA 3ELFA 4GUIA 1W2VA 3ZR5A 3QY6A 3NR0A 4B5XA 3GVQA 1TRIA 1XLKA 3BZGA 1PEZA 3UBPC 4PN2A 3LA4A 2FH6A 3W1TA 3P8JA 1TJPA 2DSKA 3ABZA 3SY1A 4GX8A 1ONXA 1TPDA 2DT2A 4P8VA 5A6MA 1J01A 2CXEA 1MO0A 3KRUA 3S1WA 1RY8A 1ISYA 1GK8A 2D22A 4UTJA 4LVFA 6A3HA 3A3WA 3IIOA 1UHVA 4ATLA 1DIDA 4UQCA 5BZAA 2HDJA 2VD9A 5BXPA 5D2YA 5C0QA 1XLAA 1V3MA 2EPLX 3A64A 2Z1BA 2WJFA 2BY3A 2G3FA 4LEQA 2OX1A 3NYZA 2HMCA 3B0PA 3T2QA 3RN6A 4KWVA 3MMWA 1VP5A 4RW3A 2P76A 4M82A 3S5ZA 1BRLA 1XBZA 4MKNA 1Z44A 1DIEA 3QZ6A 3VIIA 2VFEA 1P6WA 1HUVA 1SSGA 1TR1A 2Y7EA 4IXHA 1VYPX 3HG4A 1EDQA 3EAUA 3WK0A 1VD6A 5JU6A 1O5QA 5FF2A 1XJBA 1NWUA 3WH5A 3GS6A 1L9WA 1GPWA 3UJFA 4O57A 4MYXA 3PZIA 4AZBA 3KS5A 5EB8A 4GVIA 5DY3A 2DVTA 1LWJA 3TJ4A 4A29A 4B3ZA 7PTDA 3WNPA 3TN5A 5I03A 2WPGA 1WO2A 3UYCA 1OIFA 3NG3A 3AQUA 2Z2AA 2CLEA 4NZ3A 3OGRA 4PBFA 4MDOA 5DRCA 5HUOA 4LS2A 2BVTA 4JDYA 2QDHA 3WCZA 4I7UA 3HGOA 3HPAA 2YLAA 3WBAA 3MA8A 4BCEA 1B2YA 1W1YA 2FB3A 1UR4A 1OFDA 3CASA 2E5DA 5DCBA 2JGYA 4AZ6A 1FDJA 4GY1A 4R88A 1EO5A 5GJNA 4R85A 1MDLA 1POKA 2EAWA 2HE5A 1ZCOA 3ECQA 5HNUA 3HQ1A 1AFSA 4DJDC 2G41A 3VXGA 2OFJA 2XZ7A 1K8ZA 5TNVA 3RR4A 3CQKA 1ISZA 3VKKA 3MO4A 2WNWA 1UCWA 3ZJ6A 3S6DA 1QDSA 3BLDA 3RITA 5H6HA 4PUDA 3O6AA 3GYCA 3UG8A 4REQB 3LCGA 3QFEA 4IH3A 4KIEA 3LCIA 1HG3A 1QI5A 3S8HA 4GE8A 4OBRA 1UKOA 3C2OA 1S5VA 2XU2A 3PR2A 1JI1A 4ZA0A 3UYIA 4W86A 2C19A 2C15A 1PYMA 1PS9A 2GGHA 4ZSUA 2I9UA 1SZEA 1RCOB 1IR2A 4WEVX 1F4AA 4AISA 1E4NA 4GRSA 4C7DA 4KS0A 1B3OA 3USZA 3BAIA 4IG2B 2YCKX 3IJLA 1D9EA 2F6XA 1PWMA 1RPKA 3DHPA 1J2WA 1DORA 1NDWA 2P0OA 5M3WA 3UWZA 3E2QA 1EJ7L 4GI4A 3GDBA 3BC9A 3BW4A 3AIBA 2J7DA 2ACSA 4MNKA 1CXIA 4XKYA 2XN0A 4ZOAA 4A3HA 3O2LA 5IDIA 1YDYA 3W84A 3VA8A 4QG6A 4UTWC 2UY5A 1DKWA 1TUFA 4CN1A 5D2WA 2Q3OA 3C56A 4FXFA 3TJLA 4XD5A 2VVSA 4S38A 4PRTA 4UTFA 4S3GA 4P61A 3OTRA 5ABEA 1KKRA 2C0AA 1WA3A 4IGSA 1E0XA 2XIBA 3CTLA 1HFBA 1VFOA 1VPYA 3PF3A 4J3UA 4GI9A 4UB9A 3TSBA 1XBYA 4M1BA 2BLEA 3BQ6A 3NQ7A 4DAIA 2Y89A 4FNUA 3OYXA 3M5ZA 1ZGDA 1L6SA 3WKZA 4NZ1A 3TDFA 1FFRA 5B7YA 4QJ5B 1CLVA 3B9OA 4PEEA 4F66A 3QJAA 4I90A 4UQBA 2OVLA 3VABA 2G0WA 4DPQA 5I3FA 4DELA 3TQ0A 3WLJA 3NQEA 3A4XA 1Z6KA 2B31A 2XHYA 3T55A 2OJPA 1JPHA 1PV8A 2AL2B 2NLIA 3VX1A 3WLPA 1H0IA 1O66A 1EX5A 3NPUA 4AWEA 1M3UA 1GVSA 1F6YA 2C1HA 4I6VA 3FVMA 3SGZA 1H3GA 2VFDA 3RDKA 3WF2A 1DWFM 4JTKA 5AOUA 2F84A 2ZX6A 2VI0A 2PTXA 1HKIA 4AIUA 4HHPA 4QDMA 2FYMA 2GVJA 1NSJA 4W84A 4XZIA 4X0VA 3VIGA 3MDWA 2WV8A 4QX4A 4IQDA 3IUDA 3M46A 5MKGB 5I3JA 3G5EA 5F2LA 2PRHA 3GC4A 4J2MA 2SFPA 4TX8A 1IYXA 2A3HA 5CBJA 1ZJAA 3W2KA 3U57A 1XLMA 1UH2A 3RM4A 1YADA 1Q6EA 3ZVHA 2J7HA 5CPNA 3YPIA 3CH0A 3IAPA 2O0TA 4ACYA 2VEPA 4LVAA 4K8GA 3DFPA 1H61A 1VBRA 1YEYA 1B4EA 3F5KA 3QY7A 4AU0A 1ZPTA 1Q6GA 4E4FA 4EPEC 5LNRA 4X2RA 1XIIA 2F61A 3QBUA 3BMXA 4GNKB 4HCHA 4QEEA 1LTDA 4CQCA 2V3FA 2DZSA 3CZEA 3GZAA 1R86A 1BYDA 1GYNA 4HK5A 3AXKA 4O1EA 5GNYA 3D46A 4ML9A 5HPOA 4LV9A 4N6FA 1H7NA 5DELA 3MV01 1G1YA 5DMLA 4E8CA 1LM1A 4KPLA 1CBGA 1PDYA 4GHRA 1E1CA 3BICA 4QROA 3W6MA 1JCXA 3OYZA 3LBCA 3OZMA 2I1OA 1BKSA 3U48A 2PDCA 4I5UA 2WAGA 4B4FA 2R6OA 1A5NC 1CLXA 1NJJA 1E4LA 4P8XA 1EJVC 4TVDA 4YCOA 2R1PA 3AYVA 3JVAA 3OPSA 5KETA 5LHFA 3HPFA 1THFD 2Q8LA 4C5ZA 3IIVA 3UWUA 2GLKA 1FXPA 3ITTA 4N7QA 3U5YA 3THAA 3VGHA 1W3LA 1DE6A 1O1ZA 4BR1A 2HZGA 5M17A 1RR2A 3TYZA 1Q5MA 1C92A 3W70A 2OOFA 2UY3A 4MJZA 1PIFA 1OQFA 1CX9A 1TA3B 2F9RA 3S1GA 4E38A 3VD7A 4QCEA 3HV8A 1KQZA 4GBUA 4HOXA 4I5RA 3W7QA 3P67A 3RCNA 4HZ6A 5I3DA 1RLCL 3V5OA 3RJYA 1GOOA 2ABAA 4E4UA 4CGTA 4AD2A 3KWSA 2AMGA 3E0FA 4U10A 3N6HA 4NYYA 4KIRA 1A5CA 1JCJA 3MZNA 5FAGA 3EPNA 4RE2A 4IM4A 4YNGA 3MCNA 1F6PA 4A3RA 2D2JA 4LX4A 5CXPA 1C90A 4ZZ9A 2WSKA 4O0QA 2QJGA 3CUJA 2DZTA 4RNJA 1W9DM 2DSVA 1UB3A 2Q8XA 4MFEA 3RXZA 4YL2A 5D33A 1IHIA 3BOLA 1CB2A 1JDAA 1R2RA 2JBMA 3MZ2A 4HGXA 1W1PA 2XH7A 3OVPA 3HO8A 1Y0EA 3T0TA 4JFVA 2XYLA 3OZOA 3UJEA 4Y9OA 3CU2A 4JOMA 3DKLA 3SUVA 3VNYA 2OEMA 4L6OA 3UD6A 3FKRA 4JYFA 3KOYA 1HF6A 1UMLA 1IWPA 4FNQA 5G1TA 1DWHM 3W7KA 3DC8A 2FTYA 3BLFA 3ZWSA 4GABA 3N19B 4IX2A 1UR3M 1XUUA 2Z7KA 3QMTA 1ZS2A 5E09A 5B7ZA 2BTMA 4DIAA 1F07A 4QS5A 5CLTA 2QLYA 4ZEPA 1FWBC 3PWAA 4BK9A 1GTEA 4KT2A 5FCZA 4O53A 1EHAA 3VE9A 4UBPC 4C7FA 2ZOXA 2PGFA 3U2ZA 1LRNA 3CUIA 3QSRA 2Z2UA 2WW5A 3U5UA 4GYKA 3LU2A 3WEMA 4JTSA 4Q4QA 1UIOA 2OG9A 2V67A 1XG3A 3VDGA 3A3XA 3E2SA 3GTXA 1IWAA 3O0FA 4IZGA 1FDYA 1I0BA 1AW5A 1JULA 5JH1A 1U5JA 3KXQA 4HYVA 3A24A 3UG3A 2RFGA 3LSBA 1VLIA 1LT7A 2XSXA 1E0UA 2P88A 1Q7QA 3MI3A 5FF3A 4IIBA 4JX6A 3WNOA 4EWND 2DSZA 1IQ8A 1U1JA 2D23A 3H2FA 2HXUA 4GJJA 2EG8A 2FMOA 4L6HA 4B3LA 5K9CA 5CAHA 1KR0A 4PCTA 2XPKA 2ZZ2A 4AB4A 2ZZ7A 3ZOAA 2Y1HA 3G77A 4JHZA 3MBDA 3WF3A 4JTGA 1QNPA 4LOCA 2A1YA 4B5TA 1UD2A 3E38A 1RJQA 2Y2WA 4LAKA 2GQ3A 1RBOB 4GXPA 4ADSA 4NG3A 1JL8A 2A79A 4PB3A 1QPOA 3FJ6A 4JHOA 3CL7A 4AZ7A 1XR2A 3DFQA 4NJHA 3QFWA 1EGMA 4CNUA 2HISA 1Q3NA 1I6NA 4EKJA 3V0SA 4U33A 2A0NA 2QF7A 4S39A 3QYSA 3K8KA 1JQVA 2QQ6A 3KW3A 4HZ7A 2QJIA 3WBXA 3DESA 4RDZA 1UKPA 4IIDA 1XDLA 3OVGA 2NSOA 2Q71A 2E09A 3B05A 4QP0A 3CPUA 2ZRUA 1A4LA 5H91A 5D32A 2ZUVA 4FO4A 1AMKA 3SRHA 4IFOA 2WCGA 4UUIA 1GOKA 1J5TA 1TV8A 3MQTA 4H8UA 2FZ8A 2VKZG 3W7EA 1SPQA 1NP0A 5JIWA 2D2GA 1TTPA 2DP3A 2PDXA 1QCWA 4CEUC 3LZ5A 3U4AA 1IXPA 5A2BA 1EEXA 4AFYA 3GNXA 4XZ9A 4D6DA 3O9NA 3DBPA 2GJXB 1TJ0A 3R13A 3OLIA 4GQBA 3V0TA 5CAKA 4NJGA 3NQBA 4ENLA 2OT0A 2E3ZA 1EWEA 3PP7A 3ARQA 1CPUA 4OE7A 3GHSA 5HMEA 4DWSB 1C93A 1IZCA 3W7JA 1N8IA 5HK4A 4Z2KA 5EBUA 3GO2A 3ARRA 1P48A 3EWZA 3UFYA 1X1NA 1MFUA 3W26A 2YFNA 1W5NA 2PP1A 3CZGA 4N6EA 1X7FA 4XD3A 3MW7A 5AHIA 1RCXB 4FNTA 4IPPA 4FA3A 2VDHA 4NUWA 1M5WA 1XKYA 5LHEA 1GJPA 1G4EA 4R7WA 3VI2A 2QIIA 4ES4A 2UWFA 3EXTA 3KZSA 4JFTA 4OUIA 4MY8A 1OFOA 1WNOA 3VX0A 3HZ3A 4CD4A 4UNIA 3QHMA 1E71M 4CD7A 4HYRA 3KLLA 1QI3A 3HFYA 2H9AB 3BW3A 2Y63A 4HZ8A 1KFLA 5D30A 5AY7A 1LYXA 1BWVA 2GUYA 3NEHA 1A3WA 3M44A 4M0XA 1UUOA 1U2YA 2ATSA 2PP0A 4DUVA 2XWDA 3LLFA 3MMDA 2WZEA 2QJHA 4PUKA 3Q65A 4ZB0A 2HBXA 4GBDA 2A6NA 3ONCA 3ARWA 2POTA 3UR8A 3P5ZA 1ITXA 4LEFA 4GXWA 1L6WA 5BNKA 4G8TA 3GX9A 3CZJA 2QGYA 3EDEA 4HCDA 3AZSA 4GQGA 4L5ZA 1TCMA 2QCNA 3G2GA 2A3CA 4IPIA 1M41A 1CGVA 4NRSA 2W6RA 1BVWA 3H2OA 4AMAA 1EPXA 1R2TA 2NT0A 3KL3A 4REQA 3CZLA 3U2OA 5FD0A 4C6MA 3NL6A 4K68A 2FHBA 1TX0A 4MB4A 1IZKA 4GISA 1CZ1A 3MKKA 3PM6A 3ZFHA 4AWTA 3S5SA 3M47A 5JVLA 1QASA 3SCPA 5I09A 1DP0A 5K9DA 4Q4MA 3OQ8A 3TWAA 1OT2A 1S38A 2BDQA 1GYMA 4IG2A 4GQQA 2QCGA 3KTSA 1GZ1A 7TAAA 3BL3A 3GY1A 3OIXA 4J9JA 3NQGA 3LM7A 9XIAA 1J4EA 2J27A 4GPNA 4F48A 4YHGA 1LWIA 3N17A 1QJWA 1WQ5A 3DHDA 3PZGA 2NVCA 3ARPA 2XJ7A 3F4WA 2GGIA 1RBAA 2PB1A 2PDGA 3GG0A 3C4UA 3L9CA 1O60A 3OG3A 3NIYA 1Q2RA 1PTDA 3VD4A 4AY1A 1NQ6A 1ZLPA 4DYJA 2OYLA 4NJKA 4EWJA 2V5LA 2JKEA 5DBUA 1XYAA 3QW4B 4AX7A 1AQ0A 5ECUA 4DWSD 1XW8A 1K8XA 3TTSA 2OWXA 3UCDA 3W22A 1UH3A 4AUBA 3W87A 4R3UA 1GOXA 1Q13A 5HULA 1DE5A 4GIAA 1IXQA 3T07A 2QUMA 3KVLA 3N3TA 3QW3A 1EC9A 4GMEA 4GZ7A 5A94A 1E9IA 3LERA 1TWSA 3TLQA 4JNZA 3DYMA 4R7JA 5F4SA 1JZ6A 3BE7A 3KE0A 2WYSA 2PC4A 2VCBA 3U2CA 3W86A 2OELA 4DBDA 1NP2A 3RNDA 4WIWA 1CTNA 2AL2A 4H9UA 3FN9A 3IUIA 1W8SA 1JR1A 3CZKA 1TV2A 5F1UA 4FPSA 2VM8A 4J7RA 1RCQA 2QUTA 1XWYA 2HVNA 1MW3A 4P5UA 5TF0A 3H6OA 4V1YA 4UMAA 3MANA 2AAAA 3UXDA 1ZBWA 3AS3A 4AY8A 3FHAA 1PHQA 1A47A 3NZ1A 3R12A 3UNTA 1U5VA 4LSBA 3UT0A 5MKGA 3LCWA 5D9PA 4BF7A 3WJWA 2Z24A 3LQGA 1S5NA 4LB3A 1TZ7A 3NEVA 3O8AA 4LT9A 4M51A 4QFUA 3NO5A 4H1ZA 3GH5A 3EWXA 2QJMA 5KZEA 3ABRA 4O50A 2A2IA 2QVNA 3PJTA 1Y5VA 3KRSA 1E43A 4LAOA 3RAOA 1AQFA 1SW0A 1F8IA 2BVWA 4LF2A 4A3UA 2YCIX 1V7AA 4B3KA 1JZ8A 2XVLA 4DXKA 2VO5A 3WD3A 1HNYA 4KRUA 4KWWA 3GC2A 1CENA 4HPNA 2CYGA 3G24A 4Z2IA 3R8GA 3DFNA 1WKFA 5K2ZA 3QM3A 2E9BA 5LXEA 2X1UA 2YOCA 2Y8UA 3CGTA 2PP3A 4OKDA 4JTTA 1RBLA 3AAMA 3N2CA 5DF0A 5K7JA 1TPB1 1PZ3A 4WJEA 3CO4A 4PUUA 3W2JA 3MBFA 4K1WA 3N6JA 1EPVA 3KWXA 4MNJA 1REQB 3UZZA 3LLDA 1ZBCA 4Y90A 2WCAA 1SR9A 2OODA 4IP7A 3V5CA 1W1B1 4L4LA 2G50A 3F1QA 3AMLA 5I0DA 2J4GA 4LY8A 1US2A 3TOYA 2Y8VA 2A7PA 2INZA 1P6BA 3RPMA 1KTNA 3TQPA 3W02A 1BQCA 3K4WA 4M80A 1C91A 1FP9A 4J1OA 2JALA 4DJFD 1J0KA 1D3CA 4BKNA 1UBSA 3TTOA 2WMGA 4X63A 2X1RA 2DY3A 4LH8A 4XISA 3G3DA 1WAUA 2VGGA 1E6SM 1J6PA 1MW2A 1TA3A 4PC8A 3VOJA 1NVMA 1V6UA 5CC7A 3NDOA 4JIPA 2CIPA 3GFYA 5A6TC 1VFHA 3GNNA 3LXCA 2RDXA 2YPIA 3THCA 4CQBA 1OGSA 3TR9A 3NL5A 1JPDX 4D6JA 3EPMA 4XBJA 4JEQA 5FJJA 2PDKA 3BAWA 4HA0A 3IJDA 3PJWA 4O1CA 5JBEA 4UOZA 3TZFA 3BG9A 5TBOA 3I7RA 3L0NA 4O4WA 3ZJKA 4ZO9A 4AIOA 3D5HA 2XM1A 4HBKA 4JIQA 1J10A 3E0VA 1SQ7A 5E70A 2BSLA 1UWIA 2Q02A 3C3NA 4HNLA 3RK8A 3M0ZA 4AZCB 2A3LA 3AIRA 2RAGA 1HX0A 4MNLA 3SCNA 3CJPA 2FZDA 4JKKA 4BQ5A 2O9TA 2WZHA 3CQJA 2DZVA 3KBVA 4CUCA 4RXGA 4NRRA 2VX7A 5CC3A 3ABXA 1G4SA 2OZ3A 3TTEA 2DEPA 5CGTA 4H9YA 3NQVA 1A3HA 2WLZA 3BPWA 2C1GA 1V0MA 3NSNA 5CPOA 1XH2A 1ME9A 1CECA 3JR2A 3M7SA 4N4QA 4X22A 1NF0A 4N9EA 1OCJA 4Q4RA 1OZMA 1MUCA 4MWAE 3EWWA 3C2RA 1KR1A 2J9ZA 2WANA 3ENLA 4PULA 2PCEA 4YS1A 1KV5A 1ZAJA 3LPFA 4Z0SA 4LALA 1C8QA 3KBSA 6PTDA 4GUHA 2HWGA 4PMYA 4MJMA 1JCNA 4OHQA 3W1LA 1IT0A 2WJDA 2ZRXA 1JCYA 2PGWA 4DYKA 2YL6A 1YPIA 3EZ4A 4Y9AA 3L68A 4DF0A 2X40A 4MDPA 4WGXA 4JAWA 4KWOA 5AHEA 3E12A 4FNPA 3MY9A 3IGUA 1O7AA 1J9YA 3WD0A 3SDOA 1TO3A 1SU5A 3BLPX 3CHEA 5REQB 4CQ9A 1Z42A 3SY5A 4L4OA 1BKHA 5CZTA 4D71A 5ENLA 2QULA 3W9ZA 1ZUAX 5A95A 1QNOA 1NOWA 3LM3A 3BO9A 4JD4A 1YLVA 1LL7A 5K3VA 4MSSA 2DPEA 2AKMA 3CUZA 4E0CA 2NV9A 1L0PA 4ATDA 1BG4A 1HO4A 3HURA 4H6EA 4QSHA 2AOSA 3UF9A 4H7VA 2EJAA 4DN1A 5E5CA 3K30A 2DT3A 5FEWA 2Y4SA 4H2HA 3MHFA 1DYSA 4J5NA 4M6UA 1Q6OA 1GQIA 3SRDA 1K4GA 1XFCA 3Q45A 3RRXA 4QEHA 1WE5A 4ZB2A 4TOQA 3APYA 2P8CA 1XLHA 3L4UA 4AWSA 3W37A 1ECEA 3GDKA 2V6AA 1E5NA 4RK8A 5D37A 1VYSX 3M1ZA 3I4KA 1YMYA 5HQLA 2ZZ5A 1ZENA 4JTCA 1B31A 4L1WA 5CKSA 3BUVA 1VJIA 2XISA 3VIJA 4NP7A 4S3FA 2PDQA 1TSIA 1BGAA 1D8WA 2ZCGA 5A6JA 1TJ2A 5I3KA 4AZGA 4LNYA 1SJCA 3CAKA 3GUGA 5FJUA 1KFBA 4HP5A 3OBKA 1X98A 1EQPA 3M0MA 4ZXOA 1LOQA 1O5RA 2GJXA 4DJEC 2PDWA 2I16A 3EB3A 3LTPA 1TPC1 3GR8A 1W6TA 2H3DA 2WVVB 2VRQA 3CV2A 1UKQA 4DWSA 1CGXA 1F74A 1XBVA 4DI9A 1GPFA 3R0KA 3GDMA 1Q63A 2J24A 2ZRZA 3DFYA 2IQTA 2PTYA 2DUAA 5C8BB 3ZT7A 4F0KA 3BLOA 2X0YA 4Z17A 2Y5JA 1QK0A 3RU8X 2BFGA 2A4AA 4E8DA 2MUCA 3J7HA 4UQEA 2FGLA 3QH2A 3WMCA 1IEVA 3PULA 4RE0A 5AC7A 4MJ2A 3LGDA 1M03A 2PDLA 4WDXA 4QBXA 1BYAA 1BVNP 1W54A 1IEXA 3WLMA 2H9AA 4BJHA 1K6WA 5D8WA 4JTDA 3MSGA 3OOQA 2VZUA 1FWCC 2PA6A 3W1RA 3CWNA 4MB1A 5LNWA 2J75A 4TR9A 2J8GA 3QOMA 1E9YB 1VR6A 1CGYA 4IGHA 3TU9A 4ALDA 3PZNA 4HA4A 1UWRA 3BAXA 3STEA 2D69A 5FI8A 1AJ0A 2J78A 2VXNA 1QW7A 3W00A 2UZ9A 1E70M 3I10A 1MUWA 3WEOA 4CNNA 1PX8A 4ZSTA 1KRCC 3P82A 1LORA 1KCXA 2GGGA 4RDYA 2RDUA 3UA4A 2VGIA 3A12A 3CAQA 4ROPA 4CD5A 3WO8A 2I5IA 3NFUA 4HHMA 3FYYA 5G4WA 3FGCB 1CIUA 4G1KA 4HKPA 4ADTA 1WDQA 2G97A 4FX6M 1HIZA 5D2VA 3SN0A 5LNVA 4FXJA 1UWQA 3B4UA 4O11A 3WK2A 3MO7A 3LLXA 4A21A 4PR4A 1POJA 1H4PA 3LCXA 2ZE0A 5JIPA 2QCEA 4DUOA 5J04A 1ICPA 1LBLA 3AIQA 3MP3A 1CXFA 1RJRA 4DRSA 2CESA 5CGQA 1YE6A 4UTTC 3VIPA 1IGWA 3FKKA 4DF2A 3M5YA 2PUZA 2GUUA 1R47A 2YLLA 4KKXA 3MB9A 2NLYA 4W8BA 4TUFA 4LYQA 1ZBKA 1T99A 3G1SA 1U83A 3HJZA 4HU3A 2DVUA 2AGKA 2WSRA 1EGZA 1O5XA 3EKLA 1BEUA 3T0AA 1AA1B 1Y7VA 2BGSA 3TUUA 1VFTA 4LAUA 1UWSA 3RX3A 3C2VA 4F0MA 5DRIA 4OQVA 1VHCA 2PC8A 1AD4A 3N4FA 4S3KA 4NJJA 4BI7A 1SZRA 1R9YA 1EC7A 2GDUA 1Q2SA 4AD0A 4L1XA 3KCOA 4GVGA 2GPTA 4MOZA 3AJXA 4DJFA 1V0KA 1OEPA 4GUJA 3SUSA 2X09A 1GJWA 4LCQA 5TQLA 4DBWA 4DZHA 3A6OA 3CAVA 1UROA 4GQRA 4KCTA 4G7FA 4ZOEA 4GH1A 2DZUA 4ZQNA 1UUMA 4D8AA 4OUEA 1KM4A 1LQ0A 4O1AA 1IE7C 2X41A 4NU7A 2PTWA 4CLMA 2XZ9A 4A2RA 3OEXA 3USBA 1KCKA 1UR8A 5AYYA 4MB5A 4PMJA 5HJLA 4RJEA 3NZGA 4CU7A 3VO0A 1KKOA 1C8VA 4QJ1A 4TXEA 3CUFA 2Z6JA 2E1DA 4N9DA 2YXOA 2O56A 2ZUUA 3W7NA 3DI0A 2FB2A 3IWPA 1LJYA 2IXVA 2WLYA 3WQDA 1GTHA 3OZPA 3KM8A 2VCCA 3BLKA 1JGMA 2ZXAA 1UR2A 4IIEA 3N4EA 2ZTJA 2BV9A 1ZL1A 3S9YA 2PURA 4P8WA 4PUMA 4BA0A 5E93A 2QYGA 2X2GA 3W7HA 3W4RA 1AH4A 3GR4A 4N02A 3LY0A 4LUYA 4W5UA 3OJGA 1VKFA 3W07A 3FAXA 3VIMA 4P7NA 3TYAA 2YZRA 4O1BA 4S1FA 2ZE3A 3H54A 4IPLA 2NQLA 1PTGA 4EXBA 3EXSA 2HK0A 4HNVA 1EFZA 1JUBA 4C6DA 3T08A 4QG9A 3LUTA 4O1FA 1SYTA 1UP0A 4C65A 2P0IA 2QCCA 5A1AA 1O94A 3E2RA 2YA1A 4MLJA 4Q33A 3ES7A 2YL5A 3ME3A 1PL9A 2J7FA 3L7RA 4D8LA 3T09A 1CGTA 3MC5A 4E3TA 1EUAA 3UNDA 3S5YA 3GDLA 5H1WA 1HVQA 6TAAA 3PPCA 4FAMA 4PTVA 3R8RA 4DO4A 4XX6A 1H1NA 2GOKA 2BXZA 1ELSA 1P6CA 5AZ1A 3SY8A 3UXIA 1REQA 1S2AA 4W89A 3ITLA 3BAKA 5CGMA 4QLKA 1R38A 4I3GA 1N7KA 2Q8ZA 4RE3A 1CGWA 3M0VA 2ZZ4A 4UNKA 1OC7A 4H3DA 4PL2A 3VINA 3IVTA 3QXBA 1DIKA 4NZJA 4GFIA 1NARA 3L2MA 5CC5A 3GXTA 1ONWA 1TE1A 3KTXA 4XO6A 4PCNA 2WBKA 1G67A 2CEQA 5C9WA 3DENA 5FSDC 1B9BA 2VGBA 4Q8VA 1K7EA 4JY8A 3H22A 3R6IA 5BMXA 4U2YA 4C6JA 4QXIA 2QMJA 4O12A 1J0YA 5J8LA 2ISDA 1XIMA 4IIFA 3TA9A 5HATA 5KZMA 1A5OC 1H63A 3WDJA 4GYPC 3L2IA 1BTCA 4G5DA 1WKYA 4Y8EA 2HS8A 3MS8A 3G1VA 3EA1A 5HANA 3ITCA 4Q6XA 2E8ZA 2ZZ3A 5JQ9A 4KWSA 3LK6A 1DXFA 4XAGA 2DV0A 3TE9A 5G4EA 3RCMA 1XLIA 3HFTA 3MYOA 3O06A 3RU6A 1RK5A 1TPVA 3DI1A 4CNOA 4DXXA 4Z2JA 8CGTA 4F2BA 3TLLA 4H7CA 1F4HA 2QNEA 4BEQA 4R27A 1LL6A 1QBBA 2O92A 5DN1A 1WKDA 2FZMA 4Z1AA 3IIXA 4U2ZA 4IFKB 1MNZA 4W5ZA 1QOXA 5LIYX 3M9YA 1H62A 3WDHA 3MUIA 1V3LA 3RLVA 2YCEA 3TQKA 4JXCA 3VIKA 1HKMA 2OYMA 5I00A 2OKTA 1BSIA 4PBEA 4WKAA 1XPYA 4FP1A 3KBMA 2J9XA 2JEPA 3NPVA 5M1TA 2JF7A 4PA8A 3C2EA 1H7RA 1VS1A 3CL6A 3UESA 4RPQA 1IXNA 3W1MA 1TTJA 3N9RA 4OECA 5H2ZA 2OLSA 4HSOA 2CBIA 1G0CA 1W1TA 4EX4A 3AXIA 3L5AA 4AEEA 1YDVA 5CZJA 3KX6A 3IACA 4PEKA 3UXLA 3MSDA 5EBAA 1UBPC 1W56A 1PKYA 3GFZA 1VCFA 1CW2A 1FH7A 3TVAA 5EMJA 3QVQA 2Z4GA 2O9PA 5AYXA 5CCZA 1OY0A 2PWUA 1CI1A 3DDMA 4Q4KA 3O16A 4GKTA 5G5IA 3NQMA 2HPIA 1PJ9A 1GZJA 2FMNA 4IQJA 3CS2A 4GO8A 2OZ0A 3P80A 4Q7IA 5BYWA 1EHNA 1FY6A 3AICA 3W38A 5FIPA 3LBMA 5HMDA 1LWHA 1R9XA 4RZ6A 2H8XA 4FNRA 3QF0A 3V35A 3NSMA 4QNWA 4Z0JA 1QPQA 3EDJA 2VRJA 5D09A 3E96A 1XSJA 5REQA 1VBHA 4MKVA 1GT8A 3EOLA 3MTWA 4QLJA 1IV8A 4US5D 4FLRA 1F73A 1FWSA 1GG0A 1X6UA 4Z1YA 3INPA 3G1YA 4FR1A 1T6MA 4JTQA 1EUNA 3WQEA 1AH3A 1W0MA 7ENLA 2OQLA 2G3NA 5A6BD 1A5AA 4QG8A 1SMAA 1D7FA 2BG5A 3M0HA 4LCRA 1IXOA 2YB4A 3LCFA 3T6CA 1W3JA 4MF4A 4UFHA 1S2TA 4PMOA 2OWCA 1FWDC 2PLMA 3JRKA 4E2VA 3SI9A 3T8LA 3W2NA 4EK7A 4I9TA 2AGTA 5C7VA 1HO1A 2D2HA 1UKSA 4FX7A 5CPSA 4WQ6A 1RXOB 4CCCA 1QT1A 3LI0A 4UQDA 5DQPA 5JH2A 3V5FA 1XICA 3V18A 4WOZA 4ZQRA 3XISA 2PDMA 2PAJA 2WMHA 4CNPA 1ME7A 3ARUA 4MZ8A 1RD6A 1CEOA 4D72A 4FB7A 4S2BA 8A3HA 1DIOA 3GDTA 3WLSA 1TB3A 2ZZ6A 3QQ0A 4Y7EA 2FVLA 1JZ2A 1XQLA 5A8OA 1RQEA 2V5JA 2Q01A 5C9ZA 5DCEA 4POCA 1PE1A 3GVVA 1L2UA 4Z2LA 1EIXA 1EC8A 4A2SA 5L6UA 2RJHA 3MT1A 1KM1A 4DPPA 5BRQA 1Q6LA 2VEKA 3GTHA 5K9XA 4HOWA 1P5BA 2NUYA 1A5BA 3AS1A 2WVVA 3VD5A 3ZT5A 1M7XA 4U3CA 2V81A 4NL1A 1E51A 2Y85A 5CPLA 5E6ZA 1ICSA 3LI1A 3BSHA 1DHKA 1XUZA 2WMFA 1E5JA 3L65A 4XAYA 1XRFA 3THDA 2A6LA 3HGRA 5DLCA 2OZ8A 2GJLA 1OK4A 1I2PA 3GW0A 1XDJA 1F8MA 3WG6A 3GNPA 4AZHA 4QISA 4PSRA 4I9MA 3E2VA 3NURA 2BODX 2CLOA 2QV4A 5HAOA 3UERA 2XIQA 1PZ0A 3APTA 3MSYA 4X0NA 3VYLA 1QVBA 1S2WA 3PS7A 4H19A 2UV8G 2INFA 3B9AA 4ZQCA 3P61A 2BHYA 2X7WA 4K7VA 4IX0A 4S3CA 1O12A 4H00A 2E67A 2WSYA 5AHFA 5FOOA 3AHYA 3W28A 4PCPA 2JF6A 2ZVIA 4LUJA 5LA2A 5C6MA 1WX0A 1JYXA 1US0A 4DF1A 3K8LA 4CCEA 4IMEA 1K9FA 4JTHA 4WRHA 4KCWA 2HE8A 3OBEA 2C7FA 2DZPA 2IW0A 3HOJA 2PD5A 4UZUA 1KBKA 4RZ5A 3DXIA 5BU9A 1AD1A 3LHTA 3W73A 1K9DA 1SJBA 5GVJA 3KTCA 1UPMB 2ACRA 4OBTA 1CYGA 3DAQA 2EJ1A 2BP1A 3VGEA 3JZEA 3SCVA 2WCSA 4JTAA 2BZNA 2FZ9A 5A8MA 3R89A 2QJJA 2VFHA 1BTMA 1XSKA 1XCWA 3VMPA 1OG6A 2ZUTA 3H21A 1H7XA 1KWKA 5IFTA 2O4QA 4LWWA 2P1FA 3M43A 3N2XA 4MB3A 4Q8NA 3KOFA 4MTVA 3IVUA 3OODA 1SFJA 1WZLA 2VEMA 4Y6GA 1DQWA 2BMBA 4C6PA 2ZRVA 4M24A 1YNPA 4WKHA 5H8UA 4CD8A 3S2MA 1GCYA 2VZSA 5FJOA 1DWGM 1GVYA 3U9IA 1JVNA 3MP5A 3E6EA 1H5YA 3G22A 2GQ9A 2A3EA 4QJ4B 4LRSA 3LNPA 3WBWA 5CZKA 3I3EA 3R4IA 3RM8A 3K1DA 4UNLA 1EJXC 2WMJA 2J8FA 3C0SA 3N34A 4EXQA 1XIHA 2PWEA 1P1XA 1UD8A 2XIIA 3O6CA 1H7WA 5LGZA 1UP3A 1E3XA 3GH4A 5I6SA 1QPRA 1D3HA 3KDNA 3Q2DA 5JBDA 1UWUA 2DH3A 2DW6A 5CQ1A 1Q6QA 2J74A 4Y8FA 2YDSA 5D05A 4UIOA 1M53A 2PD9A 3LX9A 4I8YA 3E0WA 4N9CA 4YPJA 1DQUA 1EP3A 4PUJA 5D04C 4Q4SA 3NZRA 1YW1A 3A22A 2I57A 4FR6A 4JIRA 7REQA 5G1YA 3VOHA 5AC8A 2O4MA 3B0XA 3GIQA 3KP1A 3B9EA 3PPFA 4RXFA 1B3ZA 3IEBA 2PF0A 3EWYA 5J5DA 4H6KA 1KM6A 2E5BA 2O9RA 1NH6A 3PG9A 1AVAA 1LG2A 5A6AA 1X6LA 1YTKA 1DWIM 5FEXA 4PUEA 3K5XA 3IUHA 2BHZA 2BOEX 4LQ1A 1F2JA 2NX9A 3EA2A 4XV0A 4MWAB 1ZNNA 1DJYA 1L8NA 2PDJA 2VZOA 3BGJA 2VFIA 1MEHA 4PRRA 1P43A 3MI2A 2IKJA 3URBA 4E2DA 2DT0A 1Q6FA 3WQPA 3C86A 2VCAA 1GJUA 2VX4A 5ABTA 1O6IA 1AL8A 1V4YA 1LDCA 2QUVA 4XVDA 4K1GA 1P0KA 4CNSA 2WMKA 1OFQA 3A4WA 1GNXA 1WDSA 1F7BA 2J7EA 4PMRA 2FGZA 2Z27A 3EWBX 2VGFA 3ARVA 5FAJA 2BY0A 3GAYA 1ME8A 4F3HA 4PSPA 4CQAA 3ZZ1A 4YLWA 3DCPA 1HL9A 3IJ7A 1UR1A 4ZBCA 4YVXA 3I68A 4C6QA 3D0CA 4RUBA 5A2AA 1SO5A 1LUCB 2WHKA 2POZA 4B92A 2FTPA 3L66A 3FOKA 3H7RA 4FALA 2QPUA 4J35A 5A2CA 4JTEA 4A4AA 3RIKA 4ZB5A 1BXBA 2OTDA 1MZRA 2VFGA 4BWLA 4E8GA 1IIGA 4HU4A 1GVQA 2F38A 2EPKX 5IBXA 2BY1A 3P2VA 3IPWA 3A13A 1MFVA 2IKHA 4D6CA 3L4TA 4OV4A 3UQNA 4W7VA 5CSUA 2Z1VA 2C14A 4JYDA 2OO0A 3PUOA 1B57A 3L0KA 1JI2A 2X0SA 2DORA 2WHLA 3PUDA 5CSRA 2VDIA 4LVDA 1Y8BA 4JQ3A 3ZWTA 3RLGA 2HNHA 2PS2A 3VIHA 4LUSB 5XIMA 1CLKA 1K77A 3PJXA 3WJYA 3QRHA 1YDOA 3OLGA 3NAVA 4B5VA 4JNMA 3ATZA 2WHJA 1H49A 4NZ5A 2QR6A 3H2CA 4JPGA 3DN5A 2NUXA 1XKJA 4XK2A 1EJUC 2AL1A 2WJZA 3LHZA 3ANUA 3S2CA 4HSHA 4US5A 1YIXA 4M8UA 2D1ZA 3LHVA 4ATWA 2VUNA 4C6BA 3K2GA 1CXHA 2CLFA 3JZUA 1UIPA 1TKKA 2QPSA 1OGGA 3ARYA 3CAWA 2J7GA 4LUTB 2XIOA 3JW7A 1KQYA 2Z1WA 2KX9A 3C2YA 1PHWA 5CJNA 4EPKA 5A6BA 3B0UX 4I7VA 2QCLA 3DERA 5DO8A 1XD1A 2D0FA 3LV6A 3QR3A 1GWJA 4K37A 2VX6A 2AQWA 3AISA 4Q8PA 2OWWA 4KQNA 1UASA 2ZX9A 4KFOA 1KCLA 1ESWA 3PZVA 3P7YA 3CXOA 3Q4DA 4M56A 3EWCA 3TYCA 4QLLA 1F3XA 5HQMA 2E6YA 3NYDA 5I07A 3GNOA 4FF5A 2C0HA 4MWAD 3P62A 2J79A 4HCLA 3WX7A 3QV6A 2ZA3A 3PK7A 1PSCA 3UPMA 4TX6A 4ADUA 1XGZA 3AC0A 4DY1A 2QCFA 3WELA 3W24A 4KFNA 3BOXA 3V36A 4U4MA 3ZS4A 1Q6DA 2IQ0A 3MJYA 4HB7A 1S2VA 2F6KA 3JU2A 4C6EA 1VPXA 4IFKA 5ABFB 2HV5A 2VZVA 1V3IA 5SWUA 4PMXA 1E40A 3B8WA 4XD4A 4A3QA 2W79A 2WVUA 1O5KA 3KOZA 3OLEA 1F05A 3CV7A 1LL4A 1KFEA 2EBNA 4BQ2A 1W9VA 3AS0A 3WNMA 1L2QA 1JDCA 1BVZA 5I24A 3V1PA 4LW7A 3TTQA 3UZJA 2I56A 1N8WA 3XINA 1Z3NA 3MJMA 1FWEC 2DUXA 4QQUA 1UD6A 4TV5A 1CT5A 5BCAA 3B97A 5BU6A 2EHHA 1OFRA 4RLIA 3WFZA 2ABBA 4KFPA 1TELA 4K2SA 2VX5A 1XPGA 3BJSA 1FWAC 4FX8A 3L4WA 4QITA 3M0YA 4F4RA 5BWAA 4QHRA 3UZXA 4AIBA 2YFOA 2D24A 4IIHA 2W92A 1PKLA 3GXDA 3ZVIA 2JQXA 2PBGA 1GOIA 3ALGA 1BGGA 3TWBA 4V2XA 5B80A 1TRDA 2QVHA 2E28A 4OGZA 4Z1DA 3VOFA 1QNVA 4LAMA 3UWWA 1QNQA 2TAAA 4MVAA 5EL1A 4PTWA 3QPZA 5D02A 3WH6A 3DH7A 2YX0A 5IM51 4Q4OA 3W88A 3FFSA 3CPGA 1EJRC 3G1XA 2IKIA 1SM9A 3S4TA 4QE1A 1UKTA 3SRKA 1NOUA 1R3WA 3H12A 3GUWA 3DFSA 4B90A 1RQBA 3DYPA 2CU0A 4AMCA 4DZAA 1WOBA 3K13A 3U7VA 3MHGA 2DVXA 3ZR4A 4GYPA 3EMCA 1B3XA 3H70A 4DM2A 3TP4A 1W9XA 5T8GA 1JFHA 4MNMA 3HMJG 3EX4A 4EF9A 5J5RA 4MUZA 2BASA 3E0IA 3OZYA 3P0WA 3A23A 1YRRA 1PKNA 3NPWA 4C1NB 1QU4A 1A49A 2ZX8A 2I9EA 3NDZA 3VFLA 4NX5A 3WJSA 2UY2A 1TWWA 2A3AA 2NV1A 1OYCA 3GFXA 4IJRA 1F6KA 3W81A 4MY1A 4Y9PA 3FVDA 3RO6A 1AUSL 1R2SA 1HKVA 3N2OA 3IJIA 1J0ZA 1S3HA 4KEZA 1VBUA 4TVCA 2ZXBA 3SR7A 1GONA 4H41A 2V5KA 2PZNA 4D1IA 4HVXA 2OPJA 1EXPA 3MHUA 3C0JA 3W83A 4HHLA 2Q3RA 1LT8A 2E6FA 3FA5A 4IPNB 3B8DA 2W63A 4K8HA 1DJQA 3NTYA 4XZBA 2INEA 3WQ5A 3G18A 1RSCA 3CMFA 5CSYA 3S5NA 4AW7A 3GU1A 5I02A 1NFPA 2BX7A 2XFFA 3H24A 3TYBA 5CBIA 1B4KA 2FQIA 4YN5A 1PWLA 1NQKA 1IEQA 3WMLA 3VCCA 2PEVA 1IZJA 3SUWA 4ILSA 3LHWA 1BXCA 1ZAHA 2BVYA 5IHSA 4G1NA 3N29A 3A4AA 1TG7A 2NXGA 1O95A 2VVNA 4ICNA 5FL1A 4DBUA 3F2BA 3FSUA 4KMQA 4JX5A 3B06A 3I65A 5AHLA 1GG1A 4DYEA 3H7VA 4ZVJA 2CZEA 7XIMA 3QPEA 4ACZB 2MNRA 3T05A 3UWEA 3RYSA 1Z7AA 3F03K 1ZHAA 3CB3A 3OQEA 1GQKA 3QV9A 1V6XA 4TMCA 1O4UA 2ESCA 3WQOA 3HPZA 3QHNA 4ZODA 2CKRA 4S2CA 1P7TB 3H2EA 4ZFMA 3AFBA 4YCPA 4DO6A 4BQ4A 4LGXA 2VZTA 1V08A 5G2WA 1FCBA 3K4AA 1VIZA 1PCWA 1Y5WA 1VBJA 4RNIA 3W7MA 3LRLA 4WJ8A 4UTUA 1XLDA 4EACA 2B7QA 1DWJM 1V3JA 1Q7MA 1TYGA 2WKLA 1JJKA 4F2UA 5HBFA 1QMLA 3RRAA 3VNDA 4L56A 2GL5A 3G8EA 2WHMA 3N04A 2XSAA 3OG2A 2R94A 1OCQA 3LS9A 3LEPA 3SCSA 2OGYA 4PFHA 3ANVA 4NAEB 3LMZA 4AEFA 5CJ5A 1G4PA 4H9XA 2YBTA 1QHZA 4MIMA 5G2IA 1VJZA 2ZYFA 1SSDA 4O0ZA 1BHGA 2B7OA 2G96A 4HZMA 3GU2A 4ROQA 3EX6A 2NVAA 5BW6A 4DEFA 1XDMA 2ICSA 3REQB 1KNWA 1S3TC 2V82A 5D9MA 1UP2A 4H9VA 1KGWA 3S6TA 5M2FX 2PLKA 3L4YA 3PBVA 3ZLHA 1JDDA 3EKGA 4PMQA 3M7WA 3TQVA 1S1PA 2ACUA 4A05A 4ERIA 3S2NA 3U8GA 4NF7A 2VELA 1YYAA 2P5NA 1G01A 2D2OA 2V2DA 3P81A 1NWSA 1JYNA 1T5AA 1KXHA 2CLMA 1QUMA 1OFPA 3PTQA 3K8MA 1A5MC 3CNYA 1OZQA 1V6VA 4GJIA 1HP4A 3CBWA 4I5XA 4HMDA 4GI6A 2TMDA 2YXGA 2HXTA 3BAYA 3CQIA 1F3WA 4I9AA 3WFAA 4AD3A 1UOKA 4R34A 3ZR6A 4GC4A 4O13A 4F0LA 3NA8A 5AECA 3DFHA 1XRVA 4S3JA 1W3IA 1FCQA 1XRSA 1WBJA 1RV8A 4US6A 4AEOA 1UD5A 1W1VA 3WEZA 1AH0A 3B8IA 1QI4A 1MRAA 3G1DA 2EEXA 2QCDB 2QAPA 3AI0A 1HN1A 1JZ4A 4ZXLA 1XI3A 4JQ4A 3BZJA 4Q7BA 1J5SA 1I1XA 1KFWA 2IKGA 2CLKA 2OX4A 2VR4A 1TPH1 5AHMA 5HR6A 2OGJA 3KHDA 3TXZA 3ZYZA 1H60A 1BQGA 1WKEA 1ZCCA 3CUHA 4GCXA 1U5HA 1MMFA 4WY0F 1VFLA 1L6YA 3RF9A 2JEQA 1OSEA 8TIMA 3UXAA 1LLZA 3FA4A 3H55A 2ZRYA 3LHUA 4JEJA 5DEZA 3AMKA 1FHDA 3L5LA 2GYIA 4MWAA 4BF9A 4UCFA 2I14A 2WQPA 3AYSA 5AYBA 1R5YA 5A69A 4HPJA 3QMSA 5I78A 2CHRA 3FA3A 4FIQA 3HQNA 3FJ4A 4X9YA 2ZFAA 1BYCA 4IMCA 3WBEA 3E9AA 4E6MA 2YCJA 1Y5XA 1QHOA 2ZXDA 1ZB5A 1M6JA 3TSDA 4DJDD 5I77A 1SO4A 3URNA 1IEWA 4WR3A 2FZBA 1B3VA 1EOKA 3PFMA 3H4WA 1KTBA 4OOUA 5HDRA 1KM0A 1EBHA 2EGZA 4LTSA 1P0DA 5HNNA 1WZMA 4S3EA 4G56A 4H9ZA 4J3WA 3ARSA 2GK1B 5K4XA 1NFBA 2R1MA 3TN6A 4LXFA 2G95A 1BAGA 3L2LA 4UQAA 4XB3A 3W6LA 1LUCA 4LJ3A 1TFVA 2ODOA 5C5YA 1VJSA 4PE8A 1E3ZA 4AHOA 2V2CA 2G3JA 1YDNA 1NDVA 1NF7A 2Y24A 3SFKA 1NM9A 3TXVA 1W5OA 3DZ1A 1BLIA 3POCA 1UJPA 3B9DA 3GG8A 2DUZA 4MY9A 2CLIA 4TTUA 3GNDA 1R30A 4H04A 2QGHA 4MJ4A 2V5DA 2ZXQA 3CV1A 4ERAA 1DXEA 1ZBVA 3LRMA 3L4XA 4X2PA 4QRNA 5EY5A 4JIHA 2V0TA 3RMJA 4F0SA 1V6YA 4GIRA 2GWNA 4ZQMA 4G9PA 3T78A 3H26A 1G7VA 3AHXA 3SCQA 4LUSA 1NTHA 4IMAA 3IIPA 3UA3A 1IT8A 1FUYA 4M6QA 3TNOA 2H8ZA 4HNOA 2EPOA 4Q4PA 4WVXA 3QHOA 2FVMA 3CLWA 3VMNA 1IR1A 3LBOA 1PKMA 2DZAA 7TIMA 2XFYA 3PAJA 3WY1A 3VC5A 2OQHA 3W7GA 3VGFA 3M0KA 4XIMA 4C90A 3WDPP 1M01A 1ZZMA 1VPQA 3H23A 2RHGA 2ZIDA 1XS2A 2YCLB 4LUTA 5XIAA 2XVPA 2CBUA 3IGSA 4IGNA 1NAL1 3AHZA 4RZBA 4HNTA 1JYWA 3WIJA 1W1A1 1I2RA 1XXXA 5I5RA 1XCFA 2WNQA 5U7SA 1EA0A 4QE4A 5GPRA 2F8QA 4DX3A 3BURA 3BARA 1FOBA 3UR5A 4NILA 2GSJA 1OGBA 4CKQA 3WF0A 1VEPA 1RA0A 5C55A 1OX4B 1XYCA 1LOSA 4PCSA 4HD5A 2QDGA 1U1HA 1MYRA 1YX1A 4P8UA 2AQVA 4AWUA 3GXIA 2QS8A 1MW1A 3QR1A 4H2CA 1XHGA 3WLOA 1R3QA 4NNBA 4C6OA 4B5UA 3CYJA 1MQRA 4MUPA 3RFAA 1DJZA 4WZHA 1PVNA 3P6LA 5CZ0A 4GCAA 3ZSSA 1E6NA 1TMHA 2H3BA 1SR0A 3WSUA 2P3ZA 1W1IE 2IPJA 4FIRA 5ABFA 3VKBA 5LXXA 3S47A 3GR7A 3ITXA 3P5YA 1JFXA 1ZSXA 1LQ2A 4JTUA 1G9HA 5I06A 3FXYA 3S0CA 4QS6A 3CWOX 2X2YA 5EFFA 3WQGA 4DLFA 3KLKA 1HJXA 3B0YA 3QYQA 2PWGA 1HKJA 2JKAA 5XINA 4OT7A 3SZ8A 1OVDA 3IJ9A 2HBVA 1A0CA 3WD4A 3TN4A 2E9LA 4RW5A 3UWVA 4ZGYA 1XIJA 3SFWA 3W71A 3GBDA 3CMJA 4WJXA 4PYSA 2E8YA 4ZR8A 1H1YA 3M4HA 4HMCA 4K7YA 4BI6A 1BF6A 3TW9A 4JQ1A 3QQWA 4B2DD 5LIWX 1K4HA 4GO9A 4RDWA 1ML1A 3G0XA 4Z2GA 3O07A 4LAZA 3G1RA 3AJ7A 3OVQA 2RDTA 3NCOA 1WUFA 4ZTYA 3CHDA 1V02E 1Q85A 1U1UA 4EIVA 1Q8AA 3RJXA 2XGZA 3EWUA 2QUNA 2ALDA 1QR7A 4AXKA 4L4MA 1W9UA 3APGA 5HWNA 3MPGA 3SN4A 3OVRA 3I7QA 3ZSTA 2DZBA 4GC3A 2V8ZA 3STFA 3AUOA 3C0QA 5D2TA 4PMDA 1DJWA 3NQCA 4Q8TA 3W7RA 4EP8C 3LSCA 1QNRA 2PRMA 4GGBA 2G4FA 1KB3A 1LOLA 3EEGA 1IT7A 3CIWA 3U6WA 1ECQA 2PDNA 2Z29A 5HUPA 4EPBC 2Q09A 3SIMA 4H8HA 1FWNA 3QKZA 2B7PA 2WKGA 3L0GA 4EAMA 4RPPA 2WKJA 4UWMA 3A9IA 4QAIA 4NZCA 3M6YA 3S1UA 2DDXA 3KBJA 5LA1A 2Y0FA 3M6DA 3OB8A 3VM7A 3BOFA 3VDAA 2I5QA 3TMLA 4BEUA 3CO8A 1NDZA 3FDKA 4AD1A 1W8GA 3HJEA 3WLKX 4GK8A 1PZ1A 1TQJA 3MV11 2J6XA 4GGHA 4PMZA 4IMFA 4C1NA 3IS4A 2HJPA 2XINA 3IJ6A 2R8WA 2HEJA 1IWBA 3G8RA 1TV4A 2REQB 1OHLA 1SJDA 1UZ4A 5DBTA 1XC4A 2C16A 3VKJA 4IMGA 3NVDA 1EDGA 1E72M 2IPWA 2ONEA 1F61A 3BV4A 3PSWA 1VB9A 4RKAA 2DIJA 2OLHA 2ZQ0A 1JF5A 2ZUMA 2BVDA 1WB0A 3DECA 1EA9C 2HNEA 3PBMA 4HNUA 4GQ0A 2IPGA 3OHMB 4UC5A 5HJXA 5IXEA 1H51A 5CZSA 3WBYA 1XLJA 3LPGA 2V3GA 1ITUA 3H7UA 1PUDA 1IGSA 3PZOA 4W4QA 2Y70A 4PB5A 1EKOA 3CT2A 1KLZA 2DZXA 1FWRA 4IICA 3H4XA 1SW3A 2PDHA 3O05A 3E5PA 1TV7A 3BMVA 4F79A 1JUEA 3W1QA 3OA3A 4LU0A 3TC6A 3TCSA 5M03A 1LBFA 2D0HA 2Z25A 4DBEA 1R7OA 3BQ5A 3F4CA 3GAKA 1YPFA 1FWJC 4V15A 4PFMA 1E1FA 3P0XA 3ZM8A 2XIMA 3U7BA 5JBFA 4J4KA 2QW5A 4OZOA 2ZA2A 1CNVA 2VOTA 4ACZA 4C6FA 1WDPA 1A5KC 4URIA 1Q6CA 1MXDA 2JKPA 4PB4A 4ORIA 3WLTA 4G2DA 5C70A 1OADA 5F2MA 1ONRA 2Y88A 3QOKA 4O8RA 1Q45A 3SAZA 3SEPA 4AG0A 2ZUNA 4PH6A 5HINA 1P7TA 2FFIA 3UU0A 4Q8QA 1UYQA 4IF2A 3W82A 5IRPA 3QC0A 4DO7A 1EZWA 5EU9A 1HXJA 1AQMA 2XG9A 3W75A 4JN8A 4AD4A 4IISA 1IEIA 1OC5A 3WLLA 3IJ8A 3OIHA 3LZ3A 3AIUA 1HP5A 2JE8A 1CWYA 3HPXA 1VFUA 1FHVA 3SJ3A 3SBFA 3O7UA 4C6LA 1C29A 1XLCA 4C1LA 4R33A 3VKAA 5H8PA 4DJDA 2HROA 5CPQA 2QDEA 1YBQB 1OF6A 3LRKA 4P7OA 3W1AA 4CN6A 4JZ5A 1HKWA 3PZMA 1TE6A 1KGXA 3RCYA 1R7AA 1X8FA 4NAEA 3BSMA 1JGIA 5CPTA 1US3A 6ENLA 4WK9A 1E55A 5C71A 1BYBA 4JCLA 3T0CA 1HTIA 2X8RA 3EB2A 3VM5A 4XZNX 3CWHA 4IL0A 2TPSA 3MCMA 1VFMA 3QZEA 4ZQOA 2AKZA 3AS2A 2ZA1A 3VDCA 3ZQ9A 4MPKA 1WBHA 3AROA 5AVNA 3FDGA 4YVVA 1KFKA 2O55A 2YA0A 3REQA 2Y8KA 4I9JA 2GVYA 3GIYA 4MADA 2AQOA 3HV9A 3UGRA 3LPOA 1XIGA 1JAKA 1CXKA 1E6RA 1FWHC 3LHYA 5MHBA 3I3BA 5CLWA 1XD0A 1M7PA 4R9XA 3C61A 4JTLA 1FKWA 4R53A 4AYGA 2PDPA 1R3RA 3MVTA 3SCRA 2C6QA 4U28A 2XH2A 3NPXA 2QDDA 4G6CA 1V7YA 5U4NA 4UMBA 4CU8A 2H6RA 3TOPA 4GXMA 4L6DA 4LNCA 1SFSA 1KW1A 3W6YA 4GINA 4UTWA 3EBVA 4PTNA 3R7MA 1EYEA 1P0EA 4O28A 1HVXA 2J7CA 3V1HA 4O15A 5AVHA 9CGTA 2OSWA 1HJVA 1XP3A 3F7JA 1HJSA 1CXLA 4FSAA 3SGUA 3PTKA 4UMCA 3VNLA 2FIQA 4J40A 4XAFA 7CGTA 3LGEA 1OABA 4GA8A 4YTUA 4NI8A 2QCDA 4XZHA 3WQ8A 2ZADA 1ZU8A 4GVHA 1E56A 3TX9A 3VNIA 1T41A 3VKDA 1H5VA 1VHNA 1GEHA 1J8VA 1V77A 1D7KA 1R6WA 3WF1A 4J3SA 3ERPA 4DUWA 3C8FA 3WMBA 3OP2A 2CBJA 4MZ1A 4MLRA 1M65A 3M0JA 1UWAA 2G8ZA 3GTFA 1DJHA 2J88A 3E49A 3PZ9A 4MKSA 4D6GA 1FP8A 1MSSA 1ITQA 4WXZA 2JGQA 4H8NA 1JPKA 1H7OA 1T8QA 5LIKX 3PZUA 4HN4A 4RDVA 4Y96A 3NXFA 5DXXA 3WF4A 4F2TA 2R82A 4MGGA 1MI3A 4RV8A 3KBWA 1OFEA 2XVKA 2WNNA 1TTIA 1RQHA 3HBLA 3VGBA 4ZTXA 3MU7A 1ADSA 4QR6A 3WQCA 5D4YA 3IIZA 4A35A 3UJRA 5LYRA 3ICJA 3P14A 4GD0A 5FJTA 2PGRA 2H90A 5FL0A 2PF8A 2W9MA 4XUYA 3M5VA 4LCSA 4TVUA 5GJPA 1R46A 3S83A 1RK6A 3EDFA 2WZIA 3HF3A 3AZRA 3GE7A 5AC5A 4KRTA 2GK1A 3WQFA 2QEZA 3WQ4A 5F4WA 3B4YA 3I6TA 2L5HA 4B2DA 4WDWA 2EPHA 3I3DA 3R11A 4DNMA 2WWDA 3RGTA 3PHAA 1MUMA 3ISIX 5D2XA 5C9XA 1QRQA 4GUFA 4NZ4A 3AALA 4JX4A 2PPGA 1HJWA 2VC5A 3JS3A 4GY0A 4AH7A 1EH9A 1PB0A 1FX6A 1TUXA 4A8LA 4O52A 4A8NA 1R0MA 5EGRA 3BXWA 2BOGX 1HKKA 5EA9A 1AL7A 1JDEA 4QCFA 1E0TA 3DG3A 3DUGA 1I1WA 1HT6A 1A4MA 3GH7A 5E0FA 3C5QA 3OGVA 5FA5A 5BXSA 1V79A 1V93A 4M3PA 2AAMA 3DHFA 3C3UA 4IPJA 2VURA 3AOFA 1JRCA 2PBOA 2MANA 4LC6A 2DJXA 3PUGA 2DIEA 1TPWA 2CZVA 3UY8A 2PDFA 4XUGA 4WUIA 1ODUA 3W7CA 2OZTA 5DANA 3PPHA 2NWSA 3VD9A 3XIMA 4AXNA 2W62A 5A8NA 3DYOA 4A3YA 3NGFA 5ABHA 4HPHA 1X96A 4IQLA 4AQLA 3W25A 1CXEA 4JCMA 3NQ6A 2V3EA 4GIYA 4XG1A 3CZ8A 1B1YA 3QEZA 2YCLA 3OW1A 2WXDM 2CBVA 1TX2A 1T7LA 2VC6A 3K46A 5BMWA 4RR4A 5JMUA 2OOGA 1UW9A 2ZRWA 1OJXA 2LLEA 1MVYA 2PDYA 4O4VA 4F9DA 3IGHX 2XWEA 4MYAA 3S2LA 3BDKA 3S9IA 1LQAA 3KVKA 3RX2A 1HGWA 4M6VA 3MMTA 4NAFB 4JFSA 1OX4A 4IL2A 5AFDA 5HNRA 1JRBA 1P1MA 1I45A 3R10A 4C6NA 1B5TA 3HG3A 1QHPA 4QTGA 2XGIA 1F5ZA 1NFGA 1TWDA 4RV3A 4Q8UA 4JTJA 1TJ1A 4OWGA 4E2OA 4CNTA 3EOOA 3LQLA 1PX3A 3CHCA 4M5PA 2P50A 4MG4A 1RPXA 2E6DA 3VNMA 1FXQA 4ORMA 1EWDA 1AQHA 4JHMA 1GOQA 1VENA 5TD4A 3KUMA 4H4IA 4XBSA 4LRTA 2PZ0A 3LV5A 4UR7A 4M1RA 3KVMA 1VH7A 1OG0A 5JXQA 5HMSA 4F0RA 3EYPA 1OINA 1YPXA 3GDRA 1UWTA 3JUGA 1RH9A 1SVDA 3LN3A 1A0EA 3CV6A 2V5BA 1GZGA 4NI3A 1FWFC 3S9ZA 2OU4A 3DIPA 4FI4A 2J25A 3T0BA 3PB0A 3T0DA 4E5TA 1UOZA 1WP6A 4UXDA 3CC1A 2XN2A 2PGEA 4H83A 3B03A 2CHOA 2RJGA 3URAA 4EPDC 1YXYA 5AZ0A 4K8EA 1FRBA 3NQ8A 1M1BA 1F3TA 1WXYA 2J62A 2ON3A 1N8FA 2XN1A 2FTWA 3QKEA 1YQ2A 2EXOA 3H8AA 4KW2A 1NWRA 5BROA 4V33A 5AHNA 4QGCA 2YDAA 3QC3A 2EKGA 1FTXA 1V3KA 3HG5A 1VIWA 3PN8A 4PODA 1SGJA 1V0NA 2VMFA 2RGLA 4MHBA 2BOFX 2WQDA 4X3ZA 4N9BA 3GVRA 3QTGA 5DMYA 1LCOA 1NDYA 3N2TA 2CLLA 1GGOA 2QHAA 1QAPA 5MF5A 1FCUA 3OHIA 1W9PA 2FFCA 1KLYA 3HU7A 2QKFA 2V9DA 3LB0A 2PU0A 4IJBA 1KCZA 1E0WA 4JGDA 1W91A 2OEKA 3ITGA 5I2UA 2BNJA 5EMLA 5DXYA 4LB4A 3S3GA 3AUJA 4I7WA 3W1XA 1GKPA 3LXAA 3FEQA 3DG7A 1X39A 1UH4A 3V75A 1OFBA 3PBWA 1C9DA 1FKXA 2TRSA 4DXVA 1ALDA 1TIMA 3GK0A 4Q8OA 2PE4A 2PWFA 4YVPA 1GOMA 3WUGA 4XVEA 1XYZA 1LRTA 3B8TA 2REQA 3KOXA 1UZHA 4LYPA 3ITYA 1KBJA 1AMYA 6REQB 1AJ2A 3EMZA 3GXFA 5CBBA 3TYUA 2EPMX 3PJUA 1I4NA 1UG6A 1MNSA 2FGBA 1ZQ5A 3TN3A 2WO5A 1W2PA 3OGSA 3A4JA 4LUIA 3PY2A 4FOUA 3QQ1A 5F1VA 4UFJA 1T0OA 2BGNE 4OIFA 3QLLA 4JN6A 4CU6A 1D8CA 4QIUA 4GH3A 4UR9A 3A21A 1J0JA 3CIVA 3BMWA 5CG0A 4D2JA 2EKCA 2DZWA 4RE4A 4P7RA 3TV8A 1NEYA 3N6QA 2VEIA 2NUWA 3AU2A 2ZDSA 4HIBA 3I4EA 1NIUA 4E4PA 2J77A 4H7ZA 1H41A 5CH9A 4EVZA 2QUUA 5DT5A 3VVGA 4IOTA 1PXGA 1EF2A 2V68A 3VOGA 3WQ6A 3T2OA 1UC4A 4DWSC 4UQ9A 1KFJA 1OK6A 1B9ZA 4A22A 1UUQA 1WXZA 2NX3A 3KOWA 2NW0A 5A6LA 3TW6A 3MVIA 3MUCA 2WM0A 5G4HC 3G6LA 3VZXA 3V3WA 1JUKA 4WY0B 3DEQA 4IGMA 3EPOA 4PUWA 2CWNA 3N73A 3EKZA 7REQB 5DMNA 3S6OA 3F2DA 2E0PA 3TEVA 3HGJA 3GTNA 3NM3A 1KBIA 4XZLX 6CGTA 2VTFA 3ZIZA 2VC7A 3VGDA 2X42A 2NXHA 2NWRA 1XYBA 2XM2A 1Z41A 1MRQA 1X6NA 1QW9A 1YKWA 2X0HA 3HMCA 2DQXA 5CEWA 1XISA 3NSXA 5LA0A 2E77A 3GBEA 4X9SA 3PWGA 4C60A 3VDBA 2V5CA 1G5AA 1BFNA 1OB0A 4W93A 2NVDA 2E5CA 4AF0B 1L8PA 3C0LA 4QQ3A 3GB6A 4F40A 2J8TA 2RUSA 5RUBA 1YBQA 4KEUA 2D3LA 1C8YA 5ECVA 2NSXA 1CCWB 3NOEA 4OFCA 2CETA 1DHPA 3MP4A 3T40A 1SFTA 4EOUA 1SZGA 1S2CA 2NX1A 1QO2A 4A6GA 4M19A 1DV7A 1A53A 2ISFA 5IHRA 3EB4A 4FXSA 4BHYA 4YYFA 1ADDA 3KZPA 1E4IA 4QJ3B 4LF1A 2A85A 2V2HA 5AB3A 1DOSA 3SCWA 3WH7A 4BZYA 4UFMA 1D2KA 1XYFA 1K70A 4V28A 4K39A 3SGGA 2ATMA 3L5MA 3NOYA 1YNYA 1V6WA 4MZYA 1AZ1A 2Z1XA 2WMIB 1UJQA 5KITA 4M81A 1NOFA 1A5LC 3OBAA 4XAPA 3VU2A 2GDVA 3GNRA 1RAKA 5H8MA 1TWIA 3P60A 1J12A 4QNEA 5D9OA 2P3EA 4D8ZA 1WOAA 2F2KA 1MDRA 1TREA 1YE4A 4KCUA 4CCZA 1MXSA 1JNDA 1GOWA 4H6QA 2YL8A 4Y2WA 1GW9A 5EMMA 6TIMA 2VNCA 4B4HA 4DJED 5A3HA 3E3HA 1QW8A 2VT0A 4QE5A 4WHBA 1H11A 4LC8A 5A8GA 3UJ2A 2G4JA 3VC6A 2YYUA 3FAWA 3UP8A 3A5FA 1KRMA 3SQLA 4Q8MA 1R3VA 2IPFA 4F9JA 3DC0A 3N18A 1PTAA 3F5LA 1J6OA 4GG9A 3QY8A 4DJFC 5AC6A 2PFHA 4XSMA 1AK5A 3AYRA 3KL5A 2ALRA 4IUOA 4K3ZA 4O17A 2X1TA 4LPCA 3A3HA 1JCTA 5CSSA 2ACQA 2OLAA 3ARXA 3PBYA 4AIEA 3BSGA 2BGQA 2I5GA 4TO8A 3UVIA 3HGSA 1VFSA 1TMLA 3CM4A 1U33A 4GX9A 3T7VA 2HCVA 3VIFA 1KM5A 2C18A 2DJLA 1FHUA 3PSVA 5ABGA 4E2BA 2YA2A 4IQEA 4HU8A 4C91A 4L65A 1IIHA 2W5FA 3AWNA 3FJLA 4GI8A 1W3KA 3UWYA 1KRBC 3CUGA 4RZ4A 5IFPA 3WDQA 4NNCA 1JNEA 3FXGA 3O63A 4JIEA 2XUCA 3C2FA 1V0LA 2C79A 2F7FA 1DPMA 4HNNA 4JS3A 1QBAA 1FA2A 5HPCA 1E9ZB 3GXPA 1X38A 4IHCA 1WCGA 1M04A 4NXSA 2ZWZA 4OBSA 2E7FA 4UOJA 4EE9A 1I2QA 4GNVA 3W27A 1FFQA 3LTYA 7A3HA 3T9PA 4ICMA