4US5D

Crystal structure of apo-msno8
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
331
Chain Sequence
HHHHVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSADAAARLGLPYAYAHFITPDFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
molecule tags Oxidoreductase
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
total genus 115
structure length 331
sequence length 338
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5D00
3B9NA 4UWMA 1YW1A 4J2PA 1LUCA 4US5D 1M41A 3B4YA 1EZWA 3B9OA 5LXEA 4US5A 1RHCA 2B81A 3RAOA 1Z69A 1NQKA 1FVPA 1XKJA 1BRLB 1BRLA 3FGCB 3C8NA 3FGCA 1TVLA 3SDOA 1BSLA 1NFPA 2I7GA 1LUCB 5DQPA 5AECA 1F07A
chains in the Genus database with same CATH superfamily
3LZ5A 3EBVA 3NOYA 4JXCA 3VGFA 1TPWA 3L0GA 1A5SA 4OOZA 3PS7A 1KFCA 1EJ7L 5AN7A 1MI3A 3N34A 3FGCA 5L6UA 4L4OA 3UJSA 4CNSA 5GJPA 1QHOA 2PLCA 1B57A 4ZO8A 2FMNA 2RDUA 4FF7A 3VI2A 2OR2A 3VKBA 3U0HA 1JQVA 3P8JA 3QTGA 1GK8A 4TTUA 3N4FA 3A5VA 3STCA 2NLYA 1SVDA 3H23A 4TX6A 1XKJA 3CAQA 4ZXLA 3CQHA 1KQZA 1UP2A 4GCXA 3TAKA 2PSNA 3A9IA 5DRIA 2V3FA 4M80A 4BCEA 4A35A 3BZGA 3NZRA 3RITA 1HKMA 1S2WA 1DQWA 1HJSA 2PWGA 4U10A 2ZWYA 4QITA 3L23A 7TIMA 2FTWA 3DH7A 1CCWB 3EA3A 3SRKA 1UZ4A 3INPA 4KPLA 3K30A 3F2BA 1CXHA 1A5KC 3SY5A 4JTUA 3WY1A 2WCAA 3QMSA 1XKYA 1SO5A 1W8SA 4H9VA 4PZVA 1G01A 4P7RA 2YFOA 5D03A 2CC0A 1YPFA 3N04A 1DWFM 1EC9A 1XLDA 2WK2A 4US5A 4GIYA 2DSZA 5CGQA 3IUHA 5MKGA 3G0UA 5AC6A 4MB3A 2X2YA 4PL1A 1Z42A 2A0NA 3OODA 1S46A 4US6A 1F76A 3FGCB 2FLIA 4WRHA 1LUCB 4GACA 2JQXA 2NWRA 1FXPA 3ZJ8A 3WUGA 3ITVA 4LVBA 3ZIZA 5AC7A 4EPEC 4CCZA 1MUCA 4FK9A 1C8VA 4UTUA 1W54A 3EA2A 3IAPA 2QUNA 4H3DA 1GZ1A 4GC3A 2F6KA 1N8WA 4DLMA 1ZL1A 1C9DA 1LROA 3B9OA 5LXEA 4HCDA 3SUTA 3CEPA 5CLTA 3IEBA 3QY6A 3QMTA 1VQTA 1R30A 1BYBA 2ZCGA 4W87A 3ZWSA 1KBBA 1RLDA 3TYDA 5BCAA 3OA3A 1FBAA 4PEKA 4Q7BA 5GPRA 3GO2A 2VJXA 1LLZA 3GC4A 4JNMA 1K3UA 1PZ3A 3HPAA 3TVAA 1BRLA 2OKTA 1VJIA 1Q6DA 2Z7KA 5AHLA 1OVDA 3PZVA 2A7PA 4ROPA 3SB0A 1XLCA 1ZUAX 4LYQA 3LEPA 2WC7A 3A3HA 3S6DA 3MP3A 1A0CA 1XBZA 2FGBA 3DYOA 3MYPA 4H7VA 4R34A 1IEXA 3V16A 4AZGA 4KWSA 3VKKA 1W1A1 4MVAA 1WAUA 3GG0A 4GINA 3W9ZA 2V30A 4C91A 1L8NA 3HPSA 4GJIA 3T55A 4HOXA 1X1NA 3W6MA 1EL3A 1UQYA 1PZ0A 3AFBA 3DG3A 3LUTA 4ZOEA 3EOEA 1UQZA 8RUCA 1XRVA 3FAWA 4D6GA 4FXRA 3WBXA 3V1HA 5E0KA 3I7QA 3KDOA 3GR8A 3NO1A 4JX4A 2V5JA 3GIYA 5HOSA 3NQVA 2Z24A 4RDWA 4HMNA 2QCEA 1ICQA 2ASHA 3TKFA 1MNZA 1LDCA 1XLFA 1B3OA 1R46A 2OSXA 2YIHA 3NQ6A 3TQKA 2E1WA 4PR4A 1MWOA 1YMYA 1C92A 3MMDA 3QKZA 4R3UA 1F4HA 3GNNA 1XLAA 1B9BA 4LT9A 8XIMA 5D32A 1KM1A 4WEVX 3LI1A 1XI3A 1US0A 2VFEA 2NLIA 4RPQA 3FY1A 4HOWA 5FJOA 4GFIA 4PRWA 2BDQA 4HA4A 4C65A 4IL0A 1S2TA 1LL7A 2ZIDA 1NQ6A 3BLIA 4H4IA 2NT1A 1H51A 2EXOA 4PMOA 5JVLA 2F9RA 4YL2A 2QGHA 4KIRA 1PX4A 3H70A 2YX0A 4EE9A 2A3CA 3D6NA 4OBRA 3N73A 4PRRA 2BVDA 1KNWA 5CC3A 3KOWA 2NV2A 1YE4A 4I8YA 3V75A 1E0TA 4UXDA 1TCDA 4M7TA 3BCDA 1YTKA 3PSVA 1Y5WA 4HNCA 2OWWA 3R11A 4MFDA 1XUZA 5HMEA 4KWVA 5LHEA 1JZ6A 4GNKB 3BLFA 5T8GA 1JCYA 3BJTA 1ZJHA 3LCGA 3M0VA 4W7WA 2Y6ZA 4Q4RA 4NILA 3FDGA 4MKSA 3NQEA 2OGYA 5BXSA 4LB4A 1YXYA 2DUXA 4H9YA 4JTEA 1VFMA 1FWTA 1GVEA 2PODA 3U3HA 4H9ZA 3BOXA 3RPTA 1KR1A 5CH9A 3SQMA 3U2CA 1QASA 3EPNA 2XVNA 4FB7A 3WD2A 2X09A 3CGTA 1F8IA 3GBDA 2HVNA 1V77A 2ZZ6A 3ABSA 3BLDA 3DDMA 1ZAIA 4FNSA 4QNEA 3OGVA 5CPNA 4IMFA 1F3XA 3TW6A 3PP7A 3TZFA 3P8IA 4H7CA 3T07A 2FJKA 1EQCA 4GI9A 4NF7A 1Z6KA 2FTYA 3PZIA 1A4MA 4CEUC 1W9VA 1P7TB 3T40A 3UESA 5ABFB 4U2ZA 4A6GA 3WLIA 3QF0A 1TWSA 7ODCA 3B06A 4HCHA 4ACZB 2XIBA 4UTJA 1EP2A 4LALA 3SCSA 4A2SA 4DAIA 2D2JA 2BG5A 2DPEA 1VS1A 1QWKA 3NEHA 4LU0A 3EX3A 4JQ1A 3GKAA 2DVUA 4XVDA 3NAVA 3UQNA 2XWEA 3TSDA 5KZEA 4RE4A 5DMLA 1EIXA 1X1ZA 1F73A 2VR5A 2IUZA 3WNLA 1EFZA 1JD9A 4PMDA 4DF0A 1QXLA 3CLMA 3LPFA 3ZSTA 2ZUUA 1JAKA 4MY1A 4PB5A 3BARA 4JPGA 3RAOA 2QCDA 1FCBA 4DNMA 1FHDA 1AD1A 4F40A 1R9YA 2UY2A 1F61A 2DVTA 1IXPA 1R38A 4GISA 5DMYA 4A4AA 4NAEB 4LFYA 1H62A 3BICA 4IHCA 2VUYA 3AALA 4L1WA 3DHFA 2VZSA 4QJ3B 2Z29A 3URBA 3JS3A 2QQ6A 1NP0A 4W5UA 3W7RA 4KW2A 4NRRA 1LOSA 3M4HA 3WQVA 1B3XA 4LS1A 3TYAA 5A2BA 2QZRA 1ZNNA 3G3MA 1GW9A 2YBTA 4A8LA 3ABXA 3DHPA 1GOMA 3G0SA 3QV6A 4PMUA 4XAGA 3N6QA 5AHEA 1LWIA 1YKWA 2F7FA 4Q32A 4UB9A 4V15A 4GABA 4GH3A 4DYEA 4GHRA 2VX6A 1WXZA 1REQA 4AD3A 1XIGA 2CERA 2V69A 2EG7A 1S1RA 5T91A 2OX4A 2DORA 4CD4A 2VEMA 1GYNA 2YYTA 3CMGA 1W3KA 5I06A 4IJBA 3B0XA 1UD6A 1XSKA 2CITA 3GIQA 4F79A 3UZZA 5B7ZA 2FFCA 1SO3A 1EXPA 2DSKA 3CQ0A 4M1RA 4KRZA 4U3CA 3VOHA 2A6NA 1XGZA 1GVIA 4RDZA 4S3AA 3LN3A 1W5OA 2ZE0A 1EX5A 1JYXA 1XRTA 4UTWA 4J27A 3TC7A 4IP7A 1A4LA 2VD9A 1O5XA 4LYPA 1O1HA 5HJXA 3L12A 3RPDA 2R82A 5AHFA 2XIQA 4YYFA 3VU2A 3AYTA 1QPKA 3LV6A 4JR5A 4R7WA 2ZZ4A 1EB3A 3IGXA 4PE8A 3OZPA 3IV8A 2P0IA 1KM2A 2CETA 1GOWA 1R8LA 3O05A 1O94A 4DYKA 1VCVA 3UY7A 3AIQA 2Y8VA 1RPXA 3HN3A 4ADTA 2QCDB 1ZY9A 3COTA 4WD0A 3BG3A 4NIRA 4CN4A 3E0WA 2VXNA 3F4DA 2I5IA 3QZAA 3W2MA 1H7PA 2V68A 2GK1A 3LRMA 5A8PA 4GUGA 3S5SA 1FCVA 2PBGA 4N2YA 3EEGA 1D9EA 4IL2A 4AY7A 4AHPA 2X1UA 1IZCA 3NTYA 1IHIA 5AHMA 3HOJA 3B9NA 3VNKA 1XG3A 2VVSA 1BEUA 2D2OA 2DY3A 5REQB 1BWVA 3AIWA 3LGEA 1MUMA 3AIVA 1EOKA 5C5YA 2ZDSA 1O12A 2OO6A 4LAZA 2OZ3A 3GAKA 3QZ6A 4ZEPA 4NZJA 4WJXA 3OYZA 1GHSA 4HZ7A 1JIBA 2IS7A 1YTEA 3RDKA 5HWJA 5AY7A 5ABHA 4CQCA 3RUBL 2PWVA 4QTGA 4WUIA 1UOZA 1GONA 1P6BA 4QFUA 1FOBA 4JN7A 5D02A 2J75A 2ZRYA 3AMCA 4C1NA 1C3FA 3U4AA 5CSSA 4FPSA 4Y9AA 2YA1A 4UFHA 4MNJA 3O1NA 2PU1A 5CPQA 1JXKA 4UFLA 5FSEC 2TYSA 2Y7DA 1C91A 3GX9A 3LPOA 1BXBA 3MSRA 4UFMA 5AYBA 1W1YA 3SW6A 4LY8A 4AG0A 3TC3A 2R8WA 3UWUA 4ZB2A 4A8IA 4DZHA 3V0UA 1KM4A 2QT3A 1HP4A 2XH0A 1OCQA 1BWKA 3DKJA 1TPEA 1SPQA 4DBEA 1IIGA 1LRQA 1CW2A 3AICA 1Q2SA 1I2RA 4UOJA 4E2VA 1FCUA 3V3WA 1TV7A 3EX4A 1KXHA 4U4MA 1NWSA 1ZBVA 5BROA 4AZ6A 2WC4A 1XWYA 3WQEA 4TMCA 2EEXA 1SW7A 3CO8A 3MU7A 2WSRA 3O6YX 3QY8A 3UEQA 1CGXA 5G1MA 1DIOA 3I6RA 3E5BA 1GVRA 1H11A 3S5NA 2IPJA 1HL9A 4LQ1A 1YEYA 3UR8A 4DJDA 4RZBA 1FTXA 3SIZA 3W85A 4JL2A 2JF6A 1XCWA 2ZX9A 4ZQMA 1XM3A 8A3HA 1JZ7A 3GVRA 4JDBA 4O12A 2XSBA 4ZQRA 1HJVA 4M0XA 3O2LA 5K9DA 3IVUA 3RX2A 4M5PA 1E4IA 2ZDRA 4KRUA 3KRSA 5HATA 3VGEA 2P8CA 2HCVA 4GE8A 4AYSA 3PFRA 3DFSA 4P8WA 4ZE4A 4FP1A 2J7FA 1IGWA 3VYLA 3DERA 3NO5A 4GIEA 1HX0A 4ML4A 1UYQA 1X98A 5XIAA 3ARTA 4R7OA 1TV8A 4AZ7A 3H21A 2JEPA 3NZ1A 3SQLA 1QPNA 5LHFA 1PIIA 3BAXA 1TV2A 3LMZA 1DQUA 4GYJA 1VRXA 2YB1A 1VIZA 1WQ5A 1LP6A 1B3WA 1OM0A 1T6MA 4F8XA 3TN6A 1TPB1 2QF8A 1R86A 4ICNA 2X0HA 3LU2A 3DOPA 2ZADA 5HNRA 1OZMA 2Y5EA 2YXGA 3W7LA 2ZRWA 3DKLA 3ICJA 3UPMA 2OVLA 1PV8A 3N11A 1DJIA 4HPHA 1XLEA 2QAPA 5HUPA 1EWDA 4O11A 1LOQA 1UZDA 4LC8A 3E2SA 1K70A 4YHEA 1XFCA 1WCGA 1XIFA 1XS2A 2GQAA 1SZNA 2OEJA 3ATYA 4JIRA 3T05A 3PK7A 3LPGA 1ZCOA 3A4XA 3FJ4A 4LW7A 5IHRA 5EGRA 3LENA 3B0UX 3PUEA 3VDBA 3W23A 1X96A 1DWGM 1RK5A 5CZTA 4AZCA 1MQPA 3R8GA 5DY2A 3UZXA 5CZJA 4UOZA 3AJXA 1XIIA 3C2EA 3EDEA 3BLOA 2P88A 2NX9A 3NNTA 2B7PA 4AZIA 1SSGA 1UIPA 3WFZA 4BEQA 1K7EA 4C6QA 4EVZA 1F8MA 3D5HA 5C70A 2VOTA 1WDQA 3B03A 2OJPA 1LF1A 4Z1YA 2A5HA 3QBUA 3EKZA 1BGGA 4QJ4B 3L7RA 3TP4A 1WDPA 2J77A 3BZJA 3JW7A 1UD4A 4IFRA 3W7EA 1RA5A 1AW1A 5FEWA 4DBDA 2W62A 1E0WA 3GXMA 4ZSUA 3PG8A 3KTSA 1T0OA 3C8FA 4B5TA 1PYMA 1KW1A 1B0IA 4QCFA 1UG6A 5D2TA 1W37A 1LOLA 3ZYZA 3FFSA 3EEZA 4Y6GA 3A22A 2HDJA 3G6LA 1LL4A 1CXKA 4YJ5A 4IMGA 1OADA 1V3JA 3HQPA 3NPVA 4DVOA 1DQXA 3L2LA 4H2HA 5D33A 5BXTA 3SGUA 1US3A 2GLKA 2DIKA 2Y4SA 3UY8A 3WSUA 5I6SA 1PUDA 1ODZA 2X30A 3APYA 3FAXA 4NAEA 4UUIA 1SFLA 4ES4A 2JEQA 3NGFA 3WLQA 2V63A 3R79A 1L0PA 3KBNA 3M1ZA 4JTAA 1JDFA 2VC7A 4JX5A 3EB3A 3KBVA 2OPJA 2QJJA 5FL0A 1SFJA 3GD6A 3N9SA 4PUDA 1P0BA 1YQ2A 3GM8A 2HZGA 3Q67A 1BVZA 2WV8A 3IJLA 2ZA3A 5TQLA 2YCLB 1KRAC 1GWJA 3PC0A 3DESA 1TVPA 1OY0A 3MBFA 2Y88A 3S9YA 4BZYA 5KZDA 4AIUA 1W91A 1XX1A 4TTGA 2VFHA 1L6YA 4HU0A 1P0EA 4E8DA 3GWQA 4IF2A 4MKVA 3TA9A 4JAWA 4OFCA 1P1MA 3NZPA 3OJGA 1R3TA 3WLKX 3WUEA 2O7SA 1T8QA 4MDOA 3N6HA 3P6LA 1AQ0A 3WK2A 4M6PA 4NL1A 4HNOA 1AK5A 2WSKA 2Y85A 3PPGA 1ENUA 2E0PA 2ZTKA 3VILA 4J2PA 1VBHA 1HO1A 1OFOA 5E0FA 3PWGA 2CZVA 3KM8A 1JZ2A 2DZPA 3RLGA 3I10A 2VUNA 4KCUA 3MV11 4QS5A 4HPXA 1XIHA 1S2UA 2A3EA 3STEA 4JHOA 5FESA 1XP3A 4DWDA 1FWWA 4O28A 3AUOA 1BYCA 2RJGA 1ISVA 2FTPA 1WKYA 5I3IA 4CU8A 1UWIA 2INZA 1GYMA 4FALA 3DIPA 2CLLA 3W74A 4NASA 3CAVA 2P3EA 3KHJA 1TMLA 2QV4A 2ACRA 3DCPA 3W07A 3O63A 4QE4A 2KZHA 2AQWA 3NYDA 4UMCA 4BQ3A 4QIUA 1K9EA 2E3ZA 4FLOA 1U5HA 3QLLA 2XVPA 1DJWA 2OELA 1QAPA 4GMEA 4QG8A 4S3BA 5G4WA 3AO0A 1BSLA 4AVFA 4F9DA 2DW6A 2Q01A 5HWNA 1P0DA 2OU4A 4WKFA 1CIUA 3LRKA 4Z2HA 3HV8A 3OG2A 4FNRA 2A7NA 3TCEA 5I23A 4OJYA 1H41A 3EWXA 3BSHA 4LEFA 4L6OA 3H53A 1Z41A 5BNKA 2Z25A 3AS2A 3P62A 2W6RA 1RJQA 3D46A 4I9JA 4JTIA 4L4LA 2RHGA 1BWLA 2WKGA 4JICA 1NWTA 4S1FA 5I07A 1QNVA 2BXZA 3G0XA 2DIJA 4TOQA 3N3MA 1E5NA 4QDWA 3FA4A 4YYCA 3AHTA 3G1SA 4ZB0A 4AWEA 4AC7C 1M65A 3EDDA 4UTHA 3RLVA 1G9HA 2O92A 2NV1A 4JTKA 2ZXDA 3TSMA 4GH1A 4W89A 3B0VC 4C1NB 1HKIA 3OQ8A 2O55A 4DJDD 1KD0A 2VYOA 1WXJA 2BHYA 5CJ5A 4ERAA 1UH3A 4P7QA 5JU6A 1TG7A 1D7FA 3CUIA 1DKWA 3I68A 2CNCA 2AAMA 2FHCA 1R9XA 1TTPA 1UWTA 4Y8FA 4JCLA 1Q5MA 6A3HA 3NXLA 2C7FA 1EUAA 2Q6ZA 4JKLA 4MWAB 3O8AA 3WJWA 2PD9A 1GGOA 5E5CA 1VFTA 4KH2A 5A6JA 4G7EB 3OA5A 4GO8A 5EMKA 2IKHA 4WKHA 4B5UA 4F2TA 1E1EA 4IJRA 4N9EA 1VHCA 1MEIA 1IGSA 1GKRA 4O0QA 3H7RA 4ZO9A 2ZZ3A 1HTIA 2J6VA 3ARZA 2BVWA 3T0BA 7REQB 3L2IA 5DCEA 5BXRA 4HHHA 1EJUC 7REQA 3QR0A 4IPIA 1WKFA 1M1BA 4ZO7A 5C9XA 1L6WA 2Y8UA 3F4WA 4A8RA 1TJRA 4OUIA 3NQ2A 4P7NA 3AHYA 1OYCA 1HFBA 3UYIA 2BTMA 3W73A 1R3WA 3M9YA 5CEWA 1ECEA 3VD9A 6ALDA 2WCSA 1LLOA 1P0NA 4NHVA 3LSBA 3TQPA 3SUVA 3EWDA 3WBWA 4LNYA 5K7JA 3CQKA 1OJXA 3GU1A 1SFSA 1DL3A 1W1ZA 2WO5A 4QEHA 3AXHA 1TWIA 1P1XA 2Z7GA 1G4EA 4GYKA 4O4VA 4R27A 3W86A 2ZC1A 1Q66A 2HXUA 4RCXA 5E6ZA 3LXAA 2J8GA 4BHYA 1ISZA 4REQB 3H54A 1JUBA 1WBHA 4PRTA 4HKPA 3WNMA 3OU8A 1ZBKA 2Y5JA 3DEQA 3E38A 1MFVA 3T0AA 5JMUA 4XZHA 4Q8VA 3RFAA 1E9LA 3T0TA 4XISA 1JZ3A 4KMQA 2ISVA 1JXJA 4YTRA 5JH2A 1TA3B 3T7VA 3M0YA 4OZOA 4HPNA 3S9ZA 4YTUA 4YWIA 2RH9A 3H26A 1SO4A 4UMBA 4B3ZA 4HTYA 3IUIA 5F2GA 2FZDA 4OUEA 2XVKA 3OBAA 3Q2DA 3A3WA 3PTDA 4ZVJA 4LRTA 3V5OA 4HU8A 1EO5A 3FVDA 4IQLA 1V6VA 3AQUA 5A6SA 1HZYA 1CLVA 4UZUA 2O9RA 3UP8A 1MNSA 3SUSA 2NWSA 3MQTA 3OZYA 4FZIA 4MUPA 3ZJ7A 1QOQA 3B8IA 1ITXA 1S3TC 4IQDA 1ME7A 4OGZA 2IKIA 4EP8C 1O7AA 4PCSA 1V6YA 4ZTXA 1Q7MA 1G6CA 2OYMA 2UY3A 3LTYA 3PM6A 3GAYA 1BXCA 3VNJA 2OGJA 4LANA 2C3ZA 4ZFMA 4CEXC 4UTTC 1E15A 1UJQA 4KGJA 1YIXA 2GGHA 4W8AA 1LL6A 1H0IA 2QJIA 1K7XA 5HULA 2V2CA 2NVAA 4QP0A 1PL9A 4GQQA 3WF2A 3PUGA 4PTXA 1UCWA 4Y2WA 1JZ4A 4K38A 4OOUA 3N18A 2HQAA 3ZFHA 2PTWA 3RNDA 4I5XA 3MUZ1 3CL6A 4XQ6A 2VZVA 3HB9A 3UF9A 5E0CA 4A22A 1MSSA 2ATMA 4WSJA 4AD5A 4FX8A 3AIBA 1OD0A 3HF3A 3HBLA 2V5BA 2VGFA 5I3GA 4YXGA 1J93A 2G37A 3MY9A 4MB5A 3TR2A 5LKYA 4ICCX 1FDYA 3TNOA 1UWUA 1IEWA 1TUXA 2QIIA 1F2JA 4MNKA 2V2HA 1TIWA 4Q4SA 2JF7A 2W91A 3BLKA 3M7SA 1NFGA 4JGDA 7XIMA 3Q65A 1VP5A 3TLQA 2XZ9A 4QLKA 3UXIA 1KBLA 3CV1A 1HGYA 1F6PA 1TMHA 1S5NA 3EWBX 1CXLA 3QPYA 4QBXA 4V1XA 1XC4A 3EMZA 3N1AA 4D6FA 1W32A 4YVPA 3ZMRA 1NJJA 1KLYA 1HT6A 4JY8A 3MHFA 3NDYA 2QVNA 1ZP3A 4JEQA 1VYRA 4GA8A 3TW7A 3G1DA 2B0MA 4XD5A 1G7UA 4CD8A 3GG1A 4Z2LA 1C7TA 3FJNA 1IEIA 4IPJA 2YB4A 5K2ZA 1SMDA 2LLEA 1SFTA 3PJWA 3HTWA 4Z1AA 1VBGA 2OSYA 5LGXA 4UQDA 4HA1A 4CU6A 1GPWA 3KBMA 1B2YA 1VR6A 2DSWA 3BV4A 3BQ6A 3BG5A 3W1PA 1N7KA 5DF0A 3FJ6A 1EPXA 2VELA 2X0SA 1VEPA 3CZLA 3S47A 4Q7NA 1H09A 4FR6A 3GFYA 3WO8A 3DXIA 1XIDA 2WJEA 1M03A 3CPUA 3IJ9A 3VXGA 4EX4A 2W3ZA 3ARYA 3A64A 1XLHA 3NA8A 4LAUA 1PTDA 2AGKA 1OFDA 2J27A 3TEVA 1KWKA 3GYEA 7PTDA 1TE6A 2REQA 2PB1A 2CLMA 3LPPA 5EYWA 1UA7A 4QE1A 4M6UA 4HMDA 3S46A 1OT2A 4CCEA 3BUVA 3IACA 2DSVA 2BNJA 4DQWA 3VE7A 4ATWA 1LJYA 2Z2AA 2OLSA 1D3GA 5A8MA 1KFLA 2VDHA 4M19A 2V67A 3ONBA 2C79A 1BKHA 2I56A 3G18A 4CNTA 4E2DA 2YL8A 5A3HA 4P8VA 3WQ4A 4GYFA 4HIBA 2VDGA 2HMCA 2Z1BA 5HNNA 1GTHA 3VOGA 2P10A 1BQGA 3RHGA 1DJYA 1JPIA 2EPOA 3TYEA 4DJFD 2HPMA 4B15A 1F6YA 3APTA 4G7FA 1VFSA 1NDZA 3O6CA 3AHXA 3NQMA 3F5KA 1V0MA 3OHMB 1EP3A 1JYVA 3GG8A 5KTLA 2DZSA 1VLWA 3MCOA 4NXSA 2CHNA 4F0KA 4O8RA 4UQBA 3IIZA 2XN0A 3C56A 4D6JA 1BGAA 3W72A 4BY3A 3ANUA 2JIEA 3G1YA 3XINA 4IMEA 4ZENA 2XU2A 1Y7VA 1DWAM 3VMNA 4GOAA 1JPMA 1NOUA 4W8LA 3CZJA 3Q94A 3NQ8A 2POTA 5MHBA 1YDVA 3MHUA 1XLIA 2WJZA 2D1ZA 4L80A 3ITXA 3UNDA 2V3EA 3KZSA 2XN2A 4EF9A 3LV5A 1J9YA 1E9YB 3P74A 3ZXWA 1E43A 3B8VA 1VFLA 4YTQA 3EKLA 1RR2A 4CNNA 3DHUA 4EXAA 2CIPA 4ADUA 3G5EA 3U9IA 3WF3A 3S1XA 3N29A 1G1YA 1ZPTA 1LWHA 4D71A 2PE4A 3GTIA 3WD4A 3SN0A 2I5QA 4Z2IA 5CXPA 3BL3A 2QJMA 5CPMA 1ADSA 2BVTA 5TAOA 2IQDA 3HGRA 5E93A 1TB3A 2J24A 2VQUA 2GUUA 2WPBA 3QLDA 4UFKA 3GYCA 3RX3A 3BJSA 3KL5A 3W7JA 2PFHA 3P81A 3QVQA 1K8CA 1MXGA 1PYFA 2E8ZA 3C0QA 5LNUA 2NQ9A 1OG6A 3CUFA 2A3HA 4ZODA 3EYPA 1IT0A 3P82A 4WJEA 3XIMA 3C3UA 1H7RA 3W70A 4MY8A 3RCMA 3WMCA 1K4GA 2Z1KA 4BF5A 2DZXA 4ZQCA 2FH8A 5CGTA 1TPC1 3T2OA 5G4EA 2ZWZA 3UZYA 3U2EA 1RJPA 1KGUA 1QK0A 4OBSA 1MDRA 3I4KA 2I1OA 3WJXA 1GJWA 2OZ8A 3HG5A 4JFVA 1M3UA 1AD4A 2WOQA 4C6PA 4B5NA 2D73A 2PDKA 1XGDA 3W1RA 5BOOA 2PWFA 1M7OA 4C1KA 3NO3A 2PRLA 4QISA 1JCXA 3FN9A 1S2VA 1A80A 3MBDA 1JUEA 1W8GA 1K02A 4RJEA 1TQJA 4XSMA 2OWCA 5D9MA 3MPGA 4AX6A 1KXTA 4DXKA 4LV9A 4Q8TA 4NNBA 3GVQA 4H7ZA 3EB4A 3YPIA 2HNHA 2OLAA 4HHLA 2QUUA 1ZJAA 1KCLA 3N14A 3WDHA 3QHNA 5DXYA 1UZHA 4YN5A 1V03A 4POCA 1HUVA 1I2QA 3GXDA 4V27A 2DVXA 4RX0A 2PTXA 4V28A 1UKOA 4MG4A 3GHRA 5A6BD 4ERIA 3WF0A 3AYRA 3W1NA 3PULA 1UUMA 3IPWA 4ONVA 1SZGA 4J2MA 4Y9OA 4PULA 2E5BA 3TJLA 4WDWA 3BMXA 3GR7A 4AUBA 1ODUA 4WR3A 3MSDA 3VIJA 5DO8A 3CZKA 2AL2B 3WEMA 2XFWA 1KFJA 3A4AA 1XW8A 1DWHM 3GDMA 1RY8A 3STPA 4GRSA 3SCPA 3CMJA 1TWDA 5I3JA 2WNNA 3R94A 1RZMA 1TPDA 2IMRA 4MZ1A 3LQGA 3QFWA 2V8ZA 4FX6M 3ZLHA 1O66A 1AJ0A 3GU9A 5BU9A 3L4WA 1X1OA 3VA8A 4Z0JA 5C9ZA 3EPMA 4GZ7A 2CWXA 1W1B1 3DI1A 3N13A 4GI6A 1WZMA 3S42A 4NP7A 2C0HA 2G41A 3GK0A 1BTMA 4O15A 5DRCA 3CHEA 4IIFA 2FGZA 4K8HA 2VEFA 2XFFA 3VX1A 3FX4A 1EEPA 1H5YA 4LBUA 4XZWA 1L6SA 3KRBA 3ARVA 4C6MA 3U8GA 4F2UA 4O0KA 3W6YA 1HIZA 4FLSA 3M43A 3GLCA 1DYSA 3PR2A 2ALDA 1TTQA 5I02A 3TAOA 1NOWA 1CEOA 5KSWA 4GQ0A 2PMQA 3W87A 3QW3A 1P6CA 2PDHA 1FWRA 2G8ZA 4IQJA 5LIYX 4FF5A 1RQHA 3B9AA 1WO2A 3SFWA 1K7FA 4PMYA 3M0XA 5AOUA 3R43A 1W2VA 4Q3MA 5LA2A 1FH7A 2Z28A 1SW3A 3KCOA 2ACQA 3N6JA 1UUQA 1DJXA 4MY9A 1OX4A 1V6WA 4ORIA 1YXDA 3HMCA 3MV01 3TTYA 4F0RA 2OKOA 1XICA 1OFAA 3ZVHB 2PZ0A 3K5XA 4MLJA 1VBUA 4RPPA 3TA6A 1REQB 1Q3NA 4XSLA 4U5KA 4XTDA 5XIMA 3SR7A 1PB0A 1NEYA 1AH3A 3SN1A 5CG7A 2IKJA 2TPSA 4L65A 1C8QA 2C1HA 5KINA 4QEEA 1Y8BA 2Y7GA 3LTPA 2HBVA 2VT0A 1XFBA 1H50A 2J8FA 3QFEA 3I3EA 1Q6EA 4KWOA 2C8NA 1FWSA 1AL8A 6ENLA 1EA0A 4DUXA 2PDCA 1V7AA 2YBVA 4KERA 3U7VA 1J18A 1YE6A 1LORA 4ACYA 2YW4A 2Y2WA 4NI8A 3CZEA 1XRSA 4RE3A 4E3VA 3UR7A 1HNYA 4AMAA 2E67A 4TXEA 4Y7EA 1KFWA 1ZJIA 2QXWA 1SO6A 5ABGA 1J0ZA 3NPUA 3S2JA 3AJ7A 1UASA 4DXVA 2YCLA 3E0IA 4RNHA 2SFPA 1U5VA 4O1CA 1GJUA 3CNYA 4XO6A 3B40A 1EF3A 4B5WA 2R1LA 5LYRA 4NZCA 2NVDA 4LCQA 3QKEA 4PA8A 1G7VA 3BC9A 1RH9A 4TX9A 1MYRA 2YSWA 4D8ZA 1LM1A 2GWNA 4HNVA 1XD0A 3S1VA 2GSEA 3V4BA 1Q65A 3BGAA 4JS3A 1MZRA 4LOCA 4B4HA 1S2AA 3E2VA 1XPYA 1JDEA 4WOZA 2WMKA 4ZMGA 4I7UA 3UWVA 1KTCA 5T26A 1LG1A 1TJ2A 4FOJA 2PTZA 1VPQA 3EB2A 1HO4A 3MI6A 4XZNX 2ZBTA 1A47A 2ESCA 3CZGA 4F0HA 4P5UA 3LRLA 2WZHA 3R12A 1QOPA 1ME8A 1KKOA 3WDJA 3T4CA 3QQ0A 4PYSA 3O6AA 4E2BA 1UP3A 2FHFA 1V3KA 2BS9A 5HPCA 3QC3A 3WLOA 2DP3A 3DBPA 2BOFX 4UTTA 1C8XA 3LQLA 4QXIA 5J04A 1GQIA 1JD7A 2CKSA 1M7JA 3R7MA 5DEZA 2E6AA 1TYGA 3UG3A 2CLHA 3N2TA 4DWSC 2FFIA 3WQGA 4GNVA 1V6UA 1TUFA 3IGUA 3L5AA 3PHAA 2G3NA 4OTKA 3ZWTA 4H6KA 4LC6A 5CC6A 1U1JA 4WLCA 5DBUA 3KS5A 3MT1A 1K9DA 1TJ1A 3FHAA 3VIGA 2FDMA 2V5LA 3KL0A 3FKRA 3DFQA 2OOGA 2D69A 1E6NA 5AZ1A 2BSLA 1O4UA 4LVFA 1WP6A 1XLGA 4U5IA 3R8RA 3ARQA 3O15A 2QVHA 1OIMA 5C7HA 1P0KA 1X8FA 4AFYA 1VCFA 2FZ9A 3LK6A 3N19B 2PTDA 2WSPA 3A5FA 5M1TA 4A3HA 2O0TA 2XN1A 1G4TA 4JQ2A 4AWTA 4MDPA 1JDAA 3ZR5A 1RD6A 3KTCA 4XVEA 3TU9A 1F07A 4JTLA 2PAJA 3QR1A 2HE5A 2WMIA 2BXYA 1WDRA 5EU9A 3GVGA 1V5XA 1DHKA 3RO6A 3QV7A 5DANA 3QPZA 4B2DA 5DMNA 4HK7A 2E40A 4HU3A 3PZQA 4N7QA 1W2PA 1QOXA 3H2EA 1F7BA 5ECUA 4GFSA 4LAKA 1P6WA 4K7VA 3W1LA 5DELA 1OCJA 2PTYA 3VMOA 5F4XA 1GG1A 1M7XA 1S39A 4O19A 3LCWA 1RV8A 1XYLA 3WL1A 1W1PA 3CV6A 3NM1A 3EDFA 1Y0EA 1E6SM 4OKDA 2OEMA 3NG3A 1T96A 3GW3A 1CZ1A 1J5SA 3P5ZA 3TV8A 2D3LA 4LH8A 3DZ1A 3DFHA 2P8BA 1QRQA 3OQEA 1Z69A 1WUFA 1K8ZA 4B2DD 1UR2A 2Z1XA 5BWAA 1N8FA 3MUXA 3B8TA 5JBFA 2H9AB 3CJPA 3EPOA 4LUSA 4CCCA 5BRPA 1N2VA 2CZDA 4GKTA 3ABZA 3C5QA 3H7VA 2J88A 4LPCA 3I65A 4PH6A 4H6RA 3NIYA 1TELA 3KVKA 1W5PA 2X41A 2VMFA 5FKYA 1UWAA 3OVRA 1UC5A 3VZZA 1EX1A 4C6KA 3VUSA 1OYBA 3TYCA 2E8YA 3TN3A 1PKYA 1JR1A 1MW3A 5BOFA 3ZVIA 3B97A 5L9FA 1GVSA 4CQBA 3A4JA 1KA9F 2XWDA 2XVLA 1JQXA 1GQLA 3B04A 1A3WA 3UT0A 3WQ6A 3JU2A 4XAYA 4D8LA 3TWAA 1W17A 4GG9A 3B8UA 2G0WA 1B3VA 1YW1A 1JI1A 3EWCA 2DZUA 5HUOA 4HCLA 2F6XA 5H91A 1R9ZA 3CHVA 3W71A 1RQEA 6PTDA 1C9WA 1MW1A 3IK2A 4CLMA 3I6EA 3PJXA 3PTMA 4LB3A 1EPVA 3WK0A 2VP8A 4DM2A 1FHVA 4UR7A 4H8NA 5HR6A 3W7IA 4REQA 5EKYA 3HG3A 5EMYA 2GVYA 4WXYA 1M41A 5J5RA 1G4PA 4M1BA 3KVLA 3II1A 1RHCA 4PCNA 1FCQA 1TX2A 1MFUA 5JQ9A 3V35A 3FHQA 1UA3A 3NQFA 3IVSA 4JZ5A 3ALGA 4M3PA 3FXGA 4M51A 1YDOA 4UNKA 1TV5A 1NELA 2J6XA 1QR7A 5LNWA 1V3LA 1JF5A 1XCFA 4UCGA 1QW7A 1GZJA 3K8MA 1EUNA 2H3BA 2PDWA 5HXMA 3UA3A 4DXXA 4EAMA 5BWFA 1E40A 2V5KA 3H2MA 1IEVA 1J6PA 2NUWA 1XIEA 2BGSA 1BD0A 2DJXA 3IARA 1CENA 5MKGB 3UZWA 1OZQA 1CT5A 1U22A 3GDLA 5LIWX 2HVMA 3NDOA 3ITYA 5FAGA 2R1MA 3V5FA 4GY1A 2ZX7A 2OFJA 1PX3A 3V7PA 3E0VA 2F8QA 4LRSA 3SCOA 2OT1A 4MWAA 3SBFA 1HJWA 4QJ1A 4ZSTA 3G8RA 3W7HA 2ABAA 2PP1A 3BK0A 3WH6A 4XAZA 3LCIA 1SQ7A 3IAQA 4MM1A 4DO7A 4P2VA 4NG3A 5CQ1A 4LTSA 3PN8A 4MB1A 3T6CA 2VZOA 3C3NA 4PUJA 3STGA 4LNCA 2O7QA 2VFFA 2F2HA 3SCUA 1GKQA 3H2FA 3OBEA 2CESA 3T44A 4I8DA 2PGWA 1BVNP 3ZLGA 3PB0A 4N42A 2ZUVA 4TIMA 2WVVB 3UWZA 1AZ2A 3GTXA 3LI0A 4JY9A 4GGHA 5DCBA 2CLEA 1EA9C 2E6YA 1B4EA 1XL9A 3V18A 3BG9A 2DT3A 5FOOA 4GX9A 3VX0A 2ZTJA 1I60A 3GNXA 3RMJA 4YS1A 3W2UA 2PDQA 3GC2A 1TA3A 4Q4KA 2PP0A 3VMPA 4A3QA 2WMHA 3G1HA 3M44A 1YLVA 4U2YA 4AMCA 5EMJA 5DT5A 1FX6A 3KP0A 3M64A 2WNWA 3SQSA 3NSXA 4O13A 1R3QA 4IIEA 5K4XA 2Y8KA 4LVGA 3QR3A 1NFBA 3LZ3A 3WQWA 4Q6JA 3TXVA 4CQ8A 4FHAA 1I0BA 1H63A 1EJVC 4NUWA 1GOIA 1OCBA 1UWQA 4E38A 4AF0B 3SDOA 5D4YA 5BYWA 4JYFA 5J8LA 2H9AA 3Q58A 2O9OA 1QW9A 1OGSA 3KVJA 4ZXOA 2NX3A 5D8WA 3R0KA 4WSKA 2WC3A 4O53A 2GJPA 2X42A 4GJ1A 3SZ8A 5JH1A 1EYWA 4MAVA 5HNTA 3GTFA 2R1KA 3MP5A 3MSGA 1MRQA 1JUKA 5G4HC 2DZTA 3V5CA 1RBLA 3S2LA 4IICA 4KF1A 2BOGX 3BDKA 4WF7A 1JEZA 1UKPA 4MADA 1NP2A 3DG6A 2PUZA 4NZFA 4WDTA 3KX6A 2WWDA 3CPRA 5G5IA 1PCKA 1LQ2A 4IPLA 2F38A 1DIKA 5C7VA 3FYYA 3ATZA 1UMLA 4FOUA 2DZAA 3JVAA 1E5JA 3GVWA 5CBBA 3VCCA 4H8UA 4TR9A 2G3MA 5D8ZA 5BW6A 1J5TA 1Z48A 3REQA 3CUXA 4WDXA 2OEKA 4MUZA 1EJWC 4RXFA 4LAMA 3VGBA 3KHDA 2ISSA 3LHVA 3MP4A 2VCAA 3EX1A 2HV5A 1E4NA 5CLWA 2WZIA 1PCWA 3GHTA 3E5PA 2PDGA 4PB4A 5CZSA 2HEJA 5DFAA 1DJGA 4RK8A 3ZZ1A 1I1XA 2NZLA 3KDNA 4XZMX 2VRKA 5CC7A 1ZTVA 1EBHA 2ZUWA 1V8EA 3RU8X 4BR1A 4L56A 4XIAA 4HNLA 1R47A 4AQLA 2FZNA 2DZWA 1GVYA 3FEQA 2POZA 3W7OA 3MJYA 3VINA 1I2OA 4MWAC 9XIAA 3CBWA 1H61A 4U28A 4DLFA 1BPLB 2WQDA 4OIFA 1B54A 3RYSA 1OIFA 5T9CE 2PC4A 1RJRA 4EANA 5HA7A 1KQYA 4UTLA 1E1CA 2PDJA 2FQIA 3WQCA 2YXOA 1W1TA 1QK2A 2VEGA 4MNMA 1RUSA 3SY8A 4X63A 4FXFA 3MS8A 1K8YA 1KB3A 1OC5A 3RN6A 3VNZA 1R7OA 1KWGA 4M29A 5IBXC 3H22A 4ILSA 4XAFA 4RE2A 4FIQA 4UTKA 1MZHA 1EJXC 2PDPA 5T9BG 1E1CB 1HL8A 2CBIA 4H9XA 1Z9AA 1UR9A 3VNMA 3RCNA 3UWYA 2GVEA 3OVQA 2PI6A 3IJDA 3G1AA 2RUSA 4HPGA 2NVCA 2WSQA 3S5ZA 4R33A 3FOKA 3LY0A 3M0JA 1XC6A 4Q8PA 3BQ5A 3WX7A 4BWLC 4S3GA 1PBGA 1E9IA 1SZRA 2UY4A 1LYXA 2QCLA 3LLFA 3NL5A 3S1GA 1FY6A 4CGTA 4PUKA 5TNVA 1BAGA 2BOEX 3KW3A 3TC6A 4INFA 4Q4OA 3TWBA 4QR6A 3GH5A 1J0JA 2PDFA 2EG8A 2RAGA 3UGVA 2TRSA 3T9PA 1EF2A 4IISA 4GNJA 4H1ZA 4G1KA 2E77A 4BI7A 4FXSA 5BU6A 3LHWA 3Q45A 5EBAA 3C2RA 1EGMA 5FIPA 3Q4DA 5BMXA 3W1QA 1Q6FA 1JCMP 3G6MA 3ME3A 1ZAHA 3IIPA 3PB2A 1KCKA 2INFA 1J79A 3VM5A 3PVFA 4GYPC 3EKGA 3NVTA 3I7SA 4DIAA 2AGTA 1VIWA 4PMZA 2BY1A 5KETA 1NARA 3T2QA 4AD2A 1Z89A 2X40A 1W6TA 5A8OA 2PDUA 4MYAA 1W9UA 3CZ8A 3U2OA 5GNYA 2EJ1A 1OF8A 3KP1A 5A8NA 1F74A 3JR2A 2UV8G 1SGJA 2BHZA 3UR5A 1W5NA 2DJLA 2AL1A 2ZXAA 1KM5A 3TDFA 3WLLA 2J7GA 2GWGA 3BW3A 3N9RA 4HNUA 1G94A 4GUFA 4A21A 5C6MA 2CU0A 4I7WA 1ZLPA 4JTHA 3FDKA 2C6QA 1POJA 1V6TA 3AS1A 4GIRA 4AF0A 2GGEA 1L6GA 5D9PA 4RW3A 3L2MA 2ZKMX 3BLPX 3EX2A 3AISA 7CGTA 4GI4A 4DJEA 3BWWA 3B0PA 2BP1A 4KEUA 2HBXA 1SR9A 2V6AA 7A3HA 1NDWA 1E3ZA 2CLOA 3F1QA 3NL6A 3E0LA 2R9RA 2YDAA 3OO2A 2WWCA 2E1DA 5RUBA 3DFNA 1FWHC 3BW2A 1ZU8A 3ZO9A 3CHFA 3OLEA 5CZKA 3S2MA 2J7DA 5EMMA 5EMLA 1JL8A 1R6WA 3IJ8A 4KCVA 2D0HA 2WJFA 3GFZA 2OQYA 1HN1A 1B3YA 3PUOA 3TCSA 2PWHA 4ZBCA 1AMYA 1OHLA 3NSNA 4S38A 1XLBA 4LV4A 3W26A 1WKDA 4AXNA 1V4YA 1GVOA 3IGSA 4IT1A 3THDA 4D6EA 5CAKA 4JHMA 4ZO6A 4QS6A 2QAFA 4EPDC 3VZXA 3RJXA 4H9TA 4MAZA 3P80A 4DJFC 5U7SA 4RL3A 2AOSA 2QCGA 5LGZA 3CXOA 1XYZA 1VD6A 4B3KA 1PDZA 4MNLA 5J5DA 2DH2A 3WKZA 3ERPA 2EO7A 1E6RA 1V08A 3OBKA 3EDKA 1ZAJA 1QI4A 3WBAA 4HK6A 1Q85A 3CS2A 2RGLA 4EPBC 4HBKA 4LXFA 1SJDA 2GOKA 5DN1A 2QDGA 2AL2A 2A2IA 3WEZA 5GNZA 1PEZA 5FD0A 2C71A 3I4EA 2WM0A 4GO9A 1UB3A 1KXQA 4EIVA 3GS6A 2UBPC 2IPFA 1XBVA 4KEMA 2AMXA 4EAYA 2YCKX 4DZAA 5H1WA 2HROA 2J7BA 3GXTA 3ZLFA 3GQYA 5D37A 5CG0A 3MUAA 1ELSA 2VWTA 5CPOA 1UPPA 2EPMX 1OK6A 2Y0FA 2GVGA 4FNPA 1OBAA 4DUWA 1X6NA 2VZTA 2PZNA 2ZICA 3HMJG 3B05A 1S5MA 5M2FX 1S38A 3KLLA 4JTQA 4TMBA 1LLWA 3N9KA 4PMRA 4UNLA 1YRRA 1XF0A 1HP5A 5I3FA 3OG3A 4NSBA 2VVNA 3DENA 2PGRA 1UMYA 3RM4A 4MMWA 3VABA 3GY1A 1V3HA 3VC6A 2IPWA 3GE7A 3K46A 4HYRA 5HDRA 5A1AA 2PGEA 2FPVA 4W86A 2GDQA 1DJZA 3QSTA 4M81A 3TK7A 3MVTA 1Q2RA 4PFHA 2BZNA 4WY0F 3PZUA 3KBJA 3C4UA 3TOPA 3VD4A 1JYNA 3SN4A 3VO0A 1GJPA 3GIPA 2D20A 4FNQA 2WMFA 4HMEA 5AC8A 1W1IE 1FP8A 5HR7A 3GDBA 1U1HA 4H2CA 2FVKA 3M5ZA 2W4XA 3JUGA 3MW7A 4QX4A 3UCQA 3MUIA 3OOQA 2YDSA 2QPXA 3ARWA 5D09A 3AI0A 4E4FA 2W61A 2XYLA 2W63A 3H7UA 2P76A 1TMQA 1RP9A 2QF7A 4K68A 1AQHA 1UOKA 1GUVA 2ZX6A 3VGGA 2QW5A 3NZGA 4IH3A 5C0QA 4JFUA 3CQIA 1E0VA 4L1XA 3WMLA 1TWZA 4AIEA 1AW5A 3B3DA 3GXPA 2JALA 3AROA 5CPTA 2ZUNA 2OQHA 3RRXA 2C0AA 2FVLA 3O0KA 5DQPA 1V3MA 1YBQA 3NEVA 1ZBCA 5HQMA 1W3JA 5H8MA 4M6QA 3TQ0A 1RY0A 4PL2A 3VKDA 3CH9A 3MMWA 3N17A 4GZIA 4H00A 4IMAA 3VD3A 1R2RA 3WL0A 4GIAA 4PTWA 1JPKA 4V33A 2XIJA 4UTWC 4TUFA 3OB8A 1B4KA 1GQKA 4M24A 5ABEA 3MI2A 4XG1A 3MUY1 5CCZA 2DQWA 2OTDA 4NJGA 4GPNA 2GGGA 4PBGA 1KBJA 3PUDA 5IRPA 5HQLA 4UBPC 3NQDA 4JN6A 4C5ZA 3F4CA 3USZA 1AMKA 1TV3A 1CB7B 4JEJA 4AD1A 5LSMA 4LBRA 4ENLA 3SECA 3PZTA 2E68A 4LBSA 4DO4A 3BXWA 3M7WA 5HAOA 3U2ZA 3PNZA 1E51A 4CN6A 2PLJA 2VRJA 1DEDA 2HSAA 4AHOA 1X8CA 4FLRA 2P50A 2QHAA 5D2YA 1GVFA 1JNDA 2VR4A 4NX5A 3E12A 1PS9A 1OC6A 3UA4A 1XDMA 3AYVA 4F4RA 2AAAA 1O1ZA 1W5QA 3OZMA 2XFYA 2DZBA 4AZHA 1DIDA 1B1YA 1EP1A 4DWSD 4KFPA 3LBMA 1FWAC 9RUBA 2BMBA 1E4LA 3NXFA 2I57A 1O95A 1CGWA 4RE0A 4S23A 2FZ8A 3UR2A 3CL8A 3P14A 5G2IA 3DU0A 5HMSA 2ZZ1A 3BCFA 3HJEA 1EZWA 4O17A 5D2WA 3S83A 2YL5A 3VD7A 1PPIA 3WLTA 5FEXA 4HQVA 4LWWA 1WDWA 3NPXA 4MGGA 2Y63A 1O5QA 1F5ZA 3C2YA 3GDKA 1GOQA 2Q8XA 1K77A 2YDQA 3LDVA 2WJDA 2ODOA 4KFNA 4B90A 1EZ2A 4PC8A 1RBAA 1DXFA 1GQJA 1GNXA 2YR1A 3CT7A 1UKSA 1XYCA 4CKQA 1TSIA 3HGSA 3WQFA 2J47A 3R2GA 3AMKA 2AKZA 4LUYA 3CAKA 4L1GA 1TJPA 1ZHAA 4FA3A 1ME9A 3BGJA 2QS8A 4CNUA 4Y9NA 3URAA 1UZ1A 4WHBA 5GQBA 4PEEA 3T08A 5GJMA 4A05A 5FEPA 4DZIA 2VRQA 1ITUA 1PZ2A 4ZA0A 4CD7A 2FZMA 2GGIA 2E6FA 2W0UA 3OW1A 3VUPA 4HNTA 4H83A 4P61A 4F66A 3G1FA 1G67A 4NZ3A 1FFQA 3FYOA 1EBGA 1ML1A 4J9JA 3T42A 3OEXA 3WK1A 4HPJA 1X7IA 4IXXA 4O0ZA 1KO0A 1FVPA 1GTEA 3IUDA 2PDXA 1FWDC 3LNMA 1XIJA 3KZPA 2NQJA 1NVMA 3NZQA 1QW8A 5JIWA 1IXQA 3KVMA 5AYYA 1FWBC 3FVMA 1MXSA 1RSCA 1JFHA 4ROQA 1Z7AA 3CUJA 4G9PA 3HIJA 2OZ0A 3LM7A 3SSZA 4N4QA 4FOKA 2OOFA 3HA1A 4O1AA 3MSYA 5FJJA 4OVXA 4CNOA 3KWXA 3WD3A 1CECA 2WBKA 2YBUA 2PA6A 3MO7A 4HHPA 1IT7A 3WEOA 3WUBA 3WQ5A 3FCPA 4JTFA 1W9DM 4O1EA 1C7SA 3VDGA 1VLIA 5D04C 3OGRA 4F9JA 4RUBA 4IGNA 3GNRA 4DEFA 2A3AA 3OIXA 2NX1A 3W1MA 5A95A 1NY1A 4N02A 1VPYA 1EDQA 2WVVA 1DXIA 1JDCA 1MEWA 1YNQA 3R0UA 3MZNA 5EA9A 5TIMA 5E9AA 3GUWA 3MDWA 2XGZA 5I79A 2ADAA 1KFKA 3C2OA 3N2CA 1A3XA 5I5RA 3BPWA 4R5EA 4BF7A 3ABQA 2EKGA 3BLEA 4L61A 2PF8A 3TYBA 1KRCC 3MWAA 1WAWA 2XIMA 4NJIA 3RXZA 5IBXA 3PBWA 5DXXA 2XHYA 1CNVA 3QV9A 1J96A 2GUYA 2WHKA 1X6LA 3VTRA 1CGTA 1RD5A 5I7GA 2BWGA 2GQ9A 3CHCA 1B5TA 4N9DA 1HL2A 1WPCA 1LBFA 3E9AA 4M7SA 4LSBA 4JTRA 4JYEA 4PCTA 2X2GA 4K7YA 4QG6A 2C18A 3KOFA 4ECLA 1RCXB 2XUCA 4HOZA 3MDUA 1O5RA 2XIOA 3NSMA 4DPQA 1TPUA 2Z2BA 5AYIA 2GZXA 3VIHA 4LY4A 3PPCA 3RG6A 3L65A 3IRSA 2XGIA 3WD1A 4B5VA 4D72A 1XDJA 4I7VA 5IOBA 3GXFA 3G1RA 4DBWA 5K4ZA 3VIKA 2XVGA 3A24A 3QHOA 3FXYA 4UQ9A 3THUA 3UJ2A 4AEEA 3O0FA 4C6CA 2P53A 4DBUA 4IOTA 4W5ZA 4QDMA 4Q7IA 1GW1A 4IMDA 3URQA 4BWLA 1JF6A 1MO0A 1QBAA 3ECQA 4WGXA 4KFOA 4NJKA 1QFEA 3KBSA 5IFPA 2VI0A 4TV6A 2GJNA 1PHQA 4FXJA 1C90A 4OV4A 3ZT5A 1PSCA 3F4NA 1RQBA 5SWUA 3TTQA 3U4FA 4B5XA 2BY0A 1HJXA 1OCNA 4PMXA 4UCFA 4RNJA 3HGOA 2C1IA 2YCEA 2BASA 3CHDA 3PJUA 2NQLA 1JNEA 2WHMA 3O07A 1KC7A 2I14A 3LHTA 3B9EA 1I8JA 4MJ2A 3QMRA 3W81A 3LNPA 5KITA 2HPIA 1NWRA 3L21A 1BSIA 4I6KA 3DX5A 2VCBA 3SIMA 5M03A 3FYPA 2PURA 3WNPA 4E8GA 3SADA 1J11A 2CWNA 2W92A 2YZ5A 4NU7A 1MQRA 2IQTA 1IWPA 4NNAA 4NYUA 4EWND 1XYFA 3ISIX 3TTOA 3N4EA 1QO2A 3RR1A 5EBUA 4S3CA 4XWUA 1VEMA 1HGWA 4FS9A 2Q71A 3HPZA 1N8IA 3BAWA 5HINA 4I90A 4JTCA 4ZE5A 1M53A 1KXVA 1ICPA 2E09A 3XISA 3GHUA 2VQTA 4R88A 4X2PA 5CJMA 3B0YA 4Q8QA 3RILA 1YPXA 3U48A 4RDYA 3VVGA 3AS0A 1I75A 1POKA 3F2DA 3AYSA 4PUNA 1OB0A 2O9PA 4MZ8A 4YCPA 4GVGA 3UVIA 1BYDA 3N4AA 1E70M 3F5JA 2DUAA 4HU4A 3ABOA 3GZ3A 4DJEC 1A50A 1R3VA 1E6QM 2CZ5A 5D2XA 1H5VA 1YDYA 3PF3A 1KGXA 4J3WA 1M68A 2Z1VA 3WH5A 3ORWA 2B31A 3AOFA 3WN6A 4FO4A 4F0MA 2WLYA 1OYAA 4IJCA 1BG4A 2R1NA 4J3SA 3CWNA 2CLIA 3LYEA 3M6DA 4QQUA 3CIWA 4LGXA 4B9YA 3W37A 2D2GA 4H04A 3NPWA 2FB3A 1EGVA 3T09A 1GVQA 1M5WA 2CXEA 4O1FA 3K4WA 3MCNA 3WLPA 4GVIA 1A0DA 1IV8A 1AG1O 3KUMA 2DIEA 3S4TA 1S2CA 3CMFA 2XDFA 4Z2JA 2ATSA 1PJ9A 1EJRC 2PWUA 3TXZA 4JFSA 1EQPA 2RFGA 3APGA 3WLJA 1AA1B 1VFOA 2YW3A 1Z8AA 1LQ0A 1J6OA 2E9LA 4X22A 4IWWA 4XZ9A 1UBPC 4MFEA 3TJXA 4A3RA 3ARRA 4Z1DA 3PWAA 2ZUSA 3T78A 2OYKA 2R1PA 3TONA 1P48A 3CWHA 3TNBA 4BI5A 2PBOA 2PDYA 2CBVA 4JX6A 5D2VA 2EPNA 1T99A 2DFAA 1A49A 3WK3A 4YPJA 3HQOA 4ZZ9A 3P61A 3QOKA 3VOFA 4L5ZA 2OODA 5G2WA 4KESA 4LUTB 4PUEA 3EOOA 3LB0A 3KBWA 3KOYA 5IXEA 3POHA 4XTIA 1DOSA 2YCJA 1US2A 4P8XA 3WQDA 4NNCA 1TREA 2GDVA 4BEUA 2C91A 3WIJA 1QTWA 1QHZA 3P0XA 4DM1A 1ONRA 3GBEA 1J0KA 3F4VA 4LVDA 4JIQA 1OEPA 4AY8A 2WXDM 4M6VA 1B9ZA 1XV8A 1I9CB 4WVXA 3IJIA 4AWUA 3S9IA 1O60A 1X39A 3CU2A 2FPTA 3NGJA 4PODA 2ZX5A 2WLZA 4NZ4A 4ZTYA 2A85A 3WG6A 1T40A 5LIXX 3SI9A 1YX1A 3PSWA 2XSAA 7TAAA 4EWJA 1EKOA 1F9CA 3UNTA 3TLLA 4YMZA 1XYBA 2NUXA 1VBRA 2WVUA 3WDQA 2F84A 1TJ0A 3SUUA 3RLHA 2CW6A 2FMOA 3A6OA 2FJUB 3WDPP 3GTHA 3LSCA 3KLKA 2X05A 4NT0A 4WZHA 1NH6A 1T8XA 4A2RA 2ZA2A 2X1IA 2V0TA 4RNFA 1S3HA 2IW0A 1Q13A 3I3DA 1HG3A 3NQBA 4U31A 2VGBA 4ALDA 3B8WA 1TQXA 4IIHA 2VEKA 3VDHA 1DIEA 4DZ5A 1IWBA 1LCOA 1H60A 2YYUA 2Y62A 4HJFA 1NOFA 2WMGA 3F03K 2X1SA 2GJLA 3NUKA 2Z2UA 2WMIB 4NYYA 4D1IA 5HJYA 3MC5A 4DNHA 4E8CA 3L9CA 5FJIA 1EJTC 3T8LA 3VIFA 3BH4A 3P0WA 3GW0A 1BLIA 4IP5A 2R6OA 2QEZA 1FDZA 3CC1A 5HMFA 2WVSA 4WK9A 1IR1A 2J13A 1JI2A 3R0DA 2IXUA 4J3XA 5I3KA 1S1PA 5CZ0A 3W83A 4F48A 3GNOA 2X0YA 1XYAA 2C16A 2PLKA 5MF5A 1FKWA 4AWSA 4LUTA 4HHMA 1ONXA 1CYGA 1Q63A 4CCDA 1S5TA 1DORA 1W56A 3H2OA 5BMWA 1I2PA 4LX4A 3WZ0E 3SY1A 1YNYA 1FWCC 4N9BA 3AZSA 3VM7A 4QQ3A 1W0MA 4IIGA 1OSEA 3UWQA 4FR1A 2Q8ZA 4HMCA 3F2CA 4AVNA 4AX7A 3T0CA 4AAJA 1V79A 1V0LA 3VGHA 2AKMA 2ZFAA 4H6EA 2EPHA 1CGUA 3SRDA 1A5BA 4B92A 1PWMA 3EWYA 2B7NA 5ABTA 4ZGYA 4EF8A 1EEXA 3THQA 5CPLA 4B16A 2I16A 3U5UA 1BYAA 3H2CA 1GZGA 5I24A 4GK8A 4Z08A 1QU4A 4GLEA 3W0KA 2HJPA 1QPQA 5D38A 3DG7A 3UW6A 4X9YA 3WJYA 1XH2A 3W2KA 3QEZA 3CO4A 3QM3A 2CKRA 8XIAA 2W27A 3WMSA 2F6UA 2FHBA 3VKCA 2X1TA 3SRHA 4HTBA 3W02A 4Q8OA 4Q22A 2WCGA 1KBIA 1E55A 1V0KA 2UWFA 2IPGA 1OWQA 3M0LA 1W31A 4IG2A 4ZL1A 4LVAA 4V1YA 2CBJA 2A79A 3JZUA 1MVYA 2PDNA 3UFYA 3LBCA 1JULA 1R7AA 5I03A 4PSPA 4TVDA 1D3HA 2YDRA 1L8PA 3QQWA 6TAAA 4F0LA 3CUGA 4KIEA 2VFGA 3LCXA 4PCPA 1CXIA 3QRHA 4B4FA 1FWNA 3VOIA 1W3TA 2TMDA 1QNSA 2VC5A 2QLYA 1SU5A 3S8HA 4D6IA 3DFYA 4G7EA 2DGAA 1BVWA 4LS0A 3QHMA 2V3GA 1X6UA 3TMQA 4DN1A 5C9WA 4K8EA 3TR9A 1V6XA 2J7EA 4XBSA 5IDZA 2FZBA 5EL1A 4A8NA 3WJSA 4XD6A 5I78A 2VGGA 5H8PA 1XSJA 3OLGA 1WNOA 1T41A 3I3BA 4L7ZA 3EMQA 1UR3M 4F3HA 4ZB5A 1QT1A 3IJ6A 3POCA 3VAVA 3CIVA 1VAHA 4RKAA 3A12A 2X7VA 1CDGA 5E09A 2QNEA 1E71M 1HVQA 1W3LA 3K1GA 4BKNA 1DBTA 3SCRA 4XB3A 3BE7A 4L64A 2WNZA 4QAWA 4D2JA 4O10A 1KFBA 3QXBA 2PP3A 1XJBA 3H12A 4YVXA 4DRSA 1IEQA 3WH8A 1XLJA 3WH7A 3GH4A 4JKMA 4IG2B 1W3HA 4K8GA 3DYMA 2ZUTA 3SJ3A 3GXNA 4XD3A 3M6YA 2PWDA 1I6NA 2PRHA 3W00A 2BXVA 1J8VA 1EYEA 1CGVA 4URIA 4D6HA 3RU6A 2J79A 3L4VA 1RXOB 1QDSA 3O06A 4UR9A 1XLMA 4EACA 4QG9A 3CLWA 3D3FA 3W1TA 4DELA 2WW5A 3A23A 4HT3A 3D3AA 2ACSA 3BSMA 1EWEA 4I6VA 3K2GA 3W7NA 4UTIA 2VM8A 4PSRA 2OO0A 5EB8A 3QYQA 3TJ4A 3QH2A 4KEVA 1CLKA 1GHRA 3ZT7A 3IIVA 4MIMA 3AC0A 2HE8A 2XTKA 1ZB5A 1IR2A 1BTCA 3W38A 2ICSA 3VIMA 1K4HA 1CXEA 1U30A 1XLLA 3KRUA 2ZE3A 1Z44A 4IX0A 4WGHA 4OHQA 3WBEA 1DPMA 1GCYA 4FMVA 5LXXA 2Q09A 4OE7A 4ATDA 1I2NA 3W22A 1ZCCA 4AISA 4WOQA 2Y70A 3E74A 4KCTA 2Y7EA 2UZ9A 5HPOA 2JGYA 3S6OA 4J4KA 3H4XA 4E6MA 3IS4A 5AB3A 3W24A 1LUCA 4P8UA 3PFMA 3HURA 1A5MC 2Z00A 3G2GA 2NXHA 3AZRA 4J1OA 4WY0B 3C0SA 4RV8A 1R3YA 2GFTA 1U33A 3L68A 2NSOA 2QULA 4JBRA 1OX5A 1H1YA 4QGCA 1R0MA 1G0CA 3TYUA 3JRKA 1MW0A 4KWWA 1JRCA 1K6WA 3EA1A 4ZQNA 1X97A 3S5YA 3E96A 2PDBA 1VPXA 1M6JA 1C29A 4CQ9A 2DZVA 2VC6A 2QCFA 3VNDA 2QJGA 1IQ8A 1VFHA 4FIRA 1TV4A 3BO9A 3ZR6A 2I9EA 5CSRA 4UIOA 3LCLA 2XH2A 1UHVA 3PWIA 4PMVA 1CX9A 4KWUA 2V3DA 4DUVA 4QSFA 1XDLA 3PBYA 1E6ZA 3R89A 5F2MA 1K6AA 2A1YA 3HGJA 1CB2A 2MUCA 1A5AA 5JIPA 5REQA 1NAL1 3NQAA 1GORA 5FI8A 1M9HA 3QYSA 5TBOA 1QPOA 1Q6QA 3KRZA 1JPHA 1DWIM 2ZRUA 3MUCA 3DC8A 3WLRA 3BMVA 4I9AA 3WNKA 3MI3A 4Q33A 1PO9A 5E6YA 2JFEX 2X1RA 4O57A 1K1DA 3ZQ9A 3ZSSA 7ENLA 4ACZA 3UG8A 1QWGA 3BAIA 2GSHA 4NZ5A 3SCQA 4E3TA 3FLUA 4G6CA 4GBDA 1OG0A 2ZYFA 1EJSC 4IMCA 2CHOA 3AHVA 4P7OA 5DT7A 2C14A 4EKJA 5IM51 5CC5A 1H7XA 3OVPA 2GJXA 2WMJA 3UETA 4CN1A 1ALDA 5PTDA 3MVIA 3AAMA 4Z17A 4ERGA 1PDYA 3GC5A 1I1WA 4GXPA 1Q6OA 3RPMA 5JBDA 1M01A 4N6EA 3RMEA 5DCDA 1KV5A 1Q7QA 3UJEA 4LEQA 4FNTA 4DO5A 4YTSA 1IE7C 1VFFA 1OQFA 2E5DA 2JBMA 1R2SA 1ONWA 3EWWA 2XH4A 3R13A 1UD8A 5TD4A 4K1GA 1TE1A 3AUJA 3UGRA 1O68A 3BANA 4S3JA 3HQNA 3D0CA 3G24A 2H3DA 4KGLA 2X7WA 2G97A 1H1ZA 2WHJA 3QN3A 2A3BA 3TROA 1ESWA 1TVNA 2EHHA 1AQMA 1F3WA 1OFPA 4GZEA 5CPSA 2V5DA 5M3WA 5LIKX 2RGMA 2FDSA 1VEOA 3VD5A 4GI8A 3W7PA 6XIAA 2EGZA 1R3RA 3HO8A 3LD5A 4FI4A 1NTHA 3ID7A 3NQGA 3NVDA 4K37A 1HKWA 2QDHA 4WKAA 3VE9A 2R14A 1WB0A 4KETA 1WOAA 3EWZA 2RJHA 3PANA 3EOSA 3TIMA 4JN8A 2WM1A 4Y96A 4AZCB 3H6OA 2V38A 1TCMA 4UQEA 2J8TA 3M0ZA 2GSJA 1H3GA 1BF2A 1KV8A 1SYTA 1NU5A 4ZR8A 3R58A 5D05A 4W9TA 4LUJA 3FW6A 2YZRA 5FA5A 3VKAA 1QNPA 5EMUA 4NX0A 5G1YA 3LCFA 3TOYA 3FA3A 3OLIA 4C6IA 1F4AA 2ACUA 1H1NA 3FIGA 4HZMA 4HP5A 4JIEA 1KFEA 2RDWA 4B3LA 1TTIA 4MTVA 3GNDA 2D0FA 3OVGA 4M82A 3W7KA 4CD5A 1HKKA 3KCLA 4GZJA 1CTNA 1VGAA 3IJQA 1CBGA 2OZTA 2WZMA 1J0YA 3TN4A 3E2QA 2D0GA 2A21A 1Q7ZA 4YIWA 3K8LA 4KT2A 1UP0A 1W9XA 4W93A 1W3NA 2A7RA 3QC0A 2X8RA 3PJTA 3SSJA 3CB8A 3G3DA 2PCQA 1UROA 3UXAA 3BOFA 5FF0A 4LF2A 1HKVA 3ONCA 4JFTA 1J2WA 4C6NA 3EMCA 1W1VA 1JCTA 3AU6A 3MKCA 4BK9A 3UU0A 2YJQA 1VCGA 3NQ7A 1P7TA 5HK4A 3BSGA 1TIMA 1KRBC 3GXIA 4JYDA 1U1UA 1A5CA 1KR0A 3S2CA 3IJ7A 4MZYA 4C1LA 5C2CA 2OMAA 4H9MA 3DFPA 3H8AA 1OFBA 3IVTA 2OSWA 3VZYA 2CLFA 4UQCA 4D1JA 3M07A 3GHSA 3KAOA 3ZJKA 2Z1SA 2WAGA 1PIGA 2HNEA 2QJNA 1VH7A 3S1UA 2YA0A 3N12A 1HJQA 2JE8A 5C54A 4N9CA 3ZVHA 3EX6A 4QNWA 2QDEA 1UH2A 3LS9A 2X16A 1H7OA 3G1XA 1NDVA 1IZKA 1RK6A 3EGJA 2C15A 1AZ1A 1CGYA 2J25A 4W85A 3LLXA 3NDZA 3GU2A 1UR8A 3W75A 2E9BA 1OABA 3M5XA 2DH3A 3OHIA 3ZM8A 2A6LA 3Q37A 2VFDA 1FH9A 1EHNA 3FV9A 1LRNA 4CD6A 3L4XA 4PTNA 3K13A 3N15A 4LCRA 1V3IA 3NL2A 5F2IA 2NV9A 3EAUA 4J5NA 2CFFA 5LNVA 2OQLA 5FJPA 4Z2KA 1WBJA 1A5NC 4DI8A 2ZZ5A 1TRDA 3U57A 2FB2A 3BVJA 1CI1A 1Q6GA 2P1FA 2VC9A 1MXDA 4WIWA 3TW9A 4IXHA 2GJXB 3S6TA 1EDGA 5F2LA 2BBFA 5EFDA 2QUTA 2VX5A 3PBMA 4XUGA 3DUGA 4GQGA 2DU2A 1KM0A 1D8CA 3ITLA 3MWCA 2BGQA 1KBKA 4UOQA 4V2XA 1WXYA 1PZ1A 1OC7A 3BGGA 4A3UA 2NQHA 2CXGA 2OB3A 3WNNA 2NT0A 4WDUA 4Q8MA 2WPGA 4W8BA 3R8HA 1SW0A 4W84A 4HVXA 4IGHA 4NVTA 4P7LA 4Q4QA 3UCDA 4YLWA 4CVWA 1SJCA 4JKKA 4J3ZA 5HJLA 4IM4A 5AVHA 6REQA 2J66A 4LF1A 3ANYA 4C6BA 5HNUA 2PS2A 3LERA 1XGEA 1FWEC 1U2YA 2WNQA 3LXBA 3KOXA 3G22A 1NF0A 3NL3A 3K1DA 2WQPA 4DY1A 4C5YA 1A5LC 3MA8A 4AEOA 1OGBA 3WLSA 1Q6CA 1E73M 1HQTA 3IIXA 4DF2A 4HN8A 2QIWA 4LYKA 3P7YA 1B31A 5CBIA 2WKLA 5AECA 5ECVA 2V9DA 4QDPA 2NXIA 3JZEA 1KM6A 3MB9A 8TIMA 2GVJA 2AQVA 3PBVA 3DC0A 3OYXA 2DEPA 3NWRA 4EPKA 3LGDA 4JNZA 1PKNA 2PPGA 3I7RA 4RZ5A 4BQ5A 4NY2A 4O54A 1M7PA 4Q4MA 2J4GA 1OF6A 3M0MA 4R53A 3UJFA 2ZZ2A 5HANA 5A6LA 1P43A 2G4JA 1NFPA 3PAJA 3WLHA 2IKGA 3LLDA 1SJBA 2C19A 3RM8A 1XHGA 4XV0A 5IDIA 3STFA 4PMNA 4PFMA 4X2RA 3H4WA 2Z26A 2Q3RA 3ELFA 3WFLA 1RALA 2NUYA 4M8UA 5EFFA 4C7GA 4L9XA 3THAA 2HRWA 3WLMA 2MANA 4NZ1A 2BGNE 3FA5A 1YADA 5BXPA 2CZFA 1QUMA 2QPUA 4E4PA 4DWSB 1YBQB 5F4SA 3P60A 4QLJA 2E7FA 4Z42C 5TF0A 2VTFA 3MMUA 4BFAA 3VNLA 4X9SA 1DXEA 4H9UA 4WCJA 3S3GA 2XJ7A 1DP0A 4C6JA 5C9RA 3PBGA 1X38A 4S3DA 1XUUA 3MTWA 3N2BA 3D47A 1H0GA 4GUJA 3LCHA 4MKNA 2DSUA 3VPLA 1XLKA 4XUYA 3B4YA 3H4GA 1EGZA 4H41A 3E0FA 4JTGA 1K9TA 5LZLA 2HS6A 5DBTA 2E9MA 1QNRA 1OFQA 1NIUA 2D24A 3RLUA 1J2BA 3P3BA 2J9ZA 4C60A 1ITQA 3VNYA 4OECA 4S3FA 2WKJA 2ZX8A 2E5CA 1EHAA 1SM9A 3WQ8A 3BJFA 2G3IA 1QI0A 1UC4A 4BI6A 5A8QA 1GQNA 3E02A 2OYLA 2FPYA 3T1GA 2BB0A 4ASTA 3IRDA 4XKMA 3FS2A 4AYGA 4C6DA 5M5DA 4JIIX 4IFKA 2BY3A 5AC5A 5E9XA 4PGLA 1B90A 3VK5A 4RXGA 4UQAA 2EBNA 2ZXBA 1S5VA 3RM9A 1O5KA 3DGBA 3LMYA 3MHGA 2BFGA 3MMTA 5FF7A 3TYZA 1UD2A 1LG2A 2GL5A 3R6IA 3UJRA 2WB5A 4RV3A 1VYSX 4NAFA 4DWSA 1VHNA 2ZC8A 4DYJA 2VKZG 4S3KA 3FK4A 3NOEA 3GFXA 5GNXA 2Z6IA 5AYZA 2VGIA 1WZKA 3SFKA 3EOUA 2D3NA 1TO3A 3OTRA 3W2LA 5C2XA 1TPH1 4HD5A 1GT8A 4L6HA 5FJTA 3FSTA 1ITCA 5IHSA 1RLCL 1GG0A 4RW5A 1L6FA 1F6KA 1NM9A 1DJQA 3NR0A 2JKEA 4A3YA 3V36A 5A2AA 3ZT6A 3A3XA 5FJUA 5I77A 1DTUA 5XINA 4UTMA 5EY5A 2P3ZA 1OD8A 5F4WA 2YFNA 1A5UA 1ONEA 4W7VA 2RKXA 2I9UA 2CZEA 2J78A 2FGLA 3PG9A 3UERA 3KEHA 5I2UA 1JVNA 3V1PA 1A0EA 3AS3A 1JFXA 1UIOA 3LM3A 2ZRVA 1ISYA 1DWJM 1RPKA 1TZ9A 4UFJA 1PAMA 4AXKA 3UBPC 3T4WA 3J7HA 4ZQPA 1ZRQA 3SCVA 4HYWA 1C93A 2P5NA 3GVVA 3M5VA 3R4IA 2ANUA 4LUIA 1DJNA 2QUMA 3AWOA 4XZIA 2YA2A 4PCFA 3OGSA 1IXNA 3C6CA 1E0UA 3L5LA 1UKQA 2DW7A 1V51A 2BX7A 2NSXA 3T0DA 1HW6A 3RO8A 3SM0A 5FEZA 2QUVA 3RR4A 2QCHA 2J9XA 4HGXA 4O8AA 1PTAA 4MHBA 4DPPA 1GKPA 3UZ5A 1FDJA 3E2RA 3DN5A 4KCWA 2P0OA 4PN2A 4EXBA 2Y5SA 1ZSXA 4MWAE 1FFRA 4GYPA 4O1DA 4Z0SA 2D23A 4OWGA 1FKXA 3TTSA 2YOCA 5GJNA 5BRBA 1Q8JA 3L4UA 4JQ3A 1CWYA 2DT1A 4Y9MA 1E72M 3P67A 3TE9A 3M0KA 4A29A 2PCEA 1UPMB 1ICSA 4IX2A 3TZNA 2BY2A 2BHUA 1XH1A 1KRMA 3QSRA 2WYSA 4X0NA 3SCNA 1TR9A 1AH0A 3KOZA 3W2NA 1EC7A 4JOMA 3OIHA 1DE6A 3A47A 4HB7A 5A94A 5A6AA 3CTLA 3L5MA 1FH8A 1M04A 2PLMA 5KMYA 1MRAA 3CQJA 4PB3A 5AZ0A 4C90A 4IUOA 4O1BA 1JG9A 1W5MA 4Z1CA 1UR4A 1QNOA 3VIOA 1PXGA 5E70A 1AJZA 3LHZA 3DFOA 3R5EA 4GWEA 4XIMA 5FF3A 1ZP4A 2ZZ7A 3AZTA 4LYRA 1PKMA 1R3SA 1WV2A 3KTXA 1YTDA 3W3OA 4UR8A 3LHUA 1F3EA 1MQQA 3CUHA 5CKSA 3FKKA 3C2FA 2OX1A 3WQOA 4IFOA 3CYVA 2V5CA 3MO4A 1UWRA 3N3TA 1WDSA 3IV3A 3SO7A 1V02A 1UW9A 2GUBA 1TZZA 2VEPA 3CPGA 3WNOA 4H6QA 3LOTA 4X61A 2VD8A 3VFLA 4K36A 3CWOX 1K9FA 4H01A 2WBGA 4XX6A 1Q4NX 3OZOA 3UPBA 3L4YA 1BKSA 4YHGA 2XIIA 4TQTA 3CYJA 4XBJA 4IUGA 4BS0A 2NQ5A 4S2BA 1H49A 4L9ZA 3S2NA 2V81A 1G5AA 4C6EA 1A53A 5B80A 4KRTA 4GUIA 2J9YA 1W9PA 2E28A 2YGYA 4N6FA 1I45A 1KKRA 4KQNA 5I3DA 3UD6A 3C52A 3VIPA 4J35A 1BRLB 4FX7A 1AJ2A 1H7NA 3VC5A 3WF4A 2D2HA 3LXCA 4XAPA 2W66A 5CAHA 3ITGA 1XR2A 4D6DA 4OU1A 4M56A 5KZMA 1QHPA 2ZVRA 1H4PA 3UG4A 4W88A 5DX7A 2YXXA 3UG5A 3C8NA 2B7OA 1Q6LA 1KTBA 3AXIA 2B4GA 3RIKA 1TWWA 3M41A 3S5OA 4IGMA 4MF4A 1HKJA 1OFEA 2G3FA 1XCXA 1PKLA 3DAQA 4ICMA 2VDIA 4PUUA 1EO7A 1RVKA 2PDLA 3AIUA 4L4MA 1Y5VA 5AKQA 1W9BM 1KLZA 3IANA 4ZFCA 3IK4A 1QJWA 3EDJA 3VNIA 3F7JA 1U83A 1ZALA 2FH6A 3KFTA 5A6TC 4KBXA 1AQFA 4U3AA 4XZLX 4XKYA 4LCSA 1NF7A 4PTDA 1IF2A 1R5YA 1Y5XA 3R25A 4DX3A 1PIFA 2J7HA 4YNGA 1GPFA 1HXJA 3MYOA 1BXNA 5EPDA 1FA2A 3C86A 4Y8EA 2CBUA 3BV7A 2B81A 4MJZA 1FRBA 5K9XA 3C2VA 2KX9A 4HZ6A 1K03A 3LBOA 1QMLA 3P5YA 4PBFA 1JGIA 1JPDX 1IXOA 3UXDA 3WDIA 4J3VA 1BF6A 1VF8A 9CGTA 4EOUA 4US5D 3BTNA 4C7FA 1WA3A 1LTDA 3AMLA 2XM1A 3ARXA 3F5LA 3GG7A 4EK7A 3VIIA 4WJ8A 1VBJA 3P2VA 3QTPA 1H2JA 4HSOA 3E49A 5FL1A 5FAJA 1WKEA 4E5TA 2G95A 5U4NA 1F05A 1VJZA 3R10A 5FF4A 4DAFA 3ZR4A 4ZOBA 3B8SA 4C6OA 2Y7FA 2GVLA 3CUZA 3W84A 1TVLA 1VRDA 1FWJC 3GSMA 5CSYA 2G96A 1JRBA 4CQDA 2GOUA 4BQ4A 2YPIA 2HXTA 1VB9A 1XQKA 4ML9A 5A6KA 3AWNA 4CQAA 1LT7A 4HN4A 2GPTA 3UPWA 1B3ZA 3W27A 1EIBA 3CAWA 4KEZA 4RLIA 3BW4A 1OT1A 3CV7A 3BAYA 4CUCA 2VHLA 1FWIC 2ABBA 4BJHA 4J28A 3G77A 4YCOA 1D2KA 3SRFA 2OXNA 4EXQA 4AIBA 3A4WA 4JDYA 3UYCA 2QMKA 1OFRA 2JGQA 1UUOA 4N4PA 4MWAD 4U33A 5K3VA 1KGWA 5BRQA 2JKAA 3O6DA 1WUEA 3WELA 4AC1X 1E3XA 2C13A 1FHLA 5FCZA 2F2KA 1GEQA 1ZFJA 2G5WA 3VKJA 1VZWA 1XSIA 2O9TA 3M0HA 5C2GA 3CASA 2ZRXA 4HZ8A 4TU1A 4DJDC 2EF9A 3R1ZA 4WXZA 1JZ8A 4O50A 2PF0A 3ITTA 4MPQA 2PWEA 3H24A 3RK8A 4NXKA 3PPFA 4PBEA 4F0SA 1EDTA 4B91A 2FYMA 3HQ1A 2XINA 2KAUC 2REQB 5FSDC 2ZVIA 2QJHA 2DQXA 3K8KA 2B7QA 1SZFA 4G8TA 4Q4PA 3SEPA 1JGMA 4HK5A 1RCOB 3SUWA 3HPFA 4XKYB 3DFTA 4YWSA 3S0CA 4MLRA 2VR2A 3GTNA 4DHGA 1WZAA 2HISA 1E9ZB 2INEA 3ARPA 1AL7A 4QHRA 3W28A 1E1FA 3IWPA 4CVUA 2TSYA 2R91A 2PEVA 4FNUA 1W3IA 1H7WA 1D3CA 4AY1A 3W7CA 3VDAA 3TJIA 3ABRA 5DY3A 4RNIA 2OCZA 3NJ3A 2WANA 2A3LA 3FJLA 2V82A 4X0VA 4QJ5B 4J3TA 4JCMA 4BA0A 4UMAA 3W7QA 3L4ZA 5I3HA 5H6HA 1NQKA 2W5FA 1FHUA 3P93A 4LUSB 1UH4A 1R87A 4O14A 5D9OA 2WSYA 4X60A 3FEMA 1T5AA 1FUYA 4J3UA 2BLEA 3GDTA 2CLKA 1RBOB 8CGTA 1L2QA 3SCWA 5A6MA 4UNIA 1V0NA 2R94A 4GBUA 3WMBA 3SGGA 4O4WA 2VWSA 4IIDA 1AFSA 1DVJA 3LX9A 3TMLA 1A3HA 1WX0A 3DI0A 4PMJA 4R85A 1MW2A 3GKFA 3PAOA 4JNYA 1G69A 4BQ2A 1KTNA 3E1F1 4HA3A 2Q8LA 2CPUA 4GKLA 2ZXQA 3TQVA 4AZ5A 3QZEA 4CU7A 3N2XA 2YLAA 3O16A 4W7UA 4FEZA 2MNRA 1WZLA 1D7KA 3HFYA 4QSHA 3GDRA 1MUWA 3WCZA 4JD4A 4AHQA 3CT2A 2HS8A 3W1UA 4O52A 3HPXA 4D9PA 3T8QA 4XD4A 3L66A 1UWSA 5HQEA 1Q4WA 2XG9A 2XGBA 5HBFA 2EKCA 6XIMA 3B4UA 2WZEA 1OX6A 2I5GA 3A13A 1XIMA 3W2JA 2Y24A 3WD0A 5LNRA 1HJUA 1CPUA 2VL4A 1TTJA 1UD3A 1L2UA 2YL9A 3M46A 3LA4A 4Z2GA 3DGRA 4AW7A 3THCA 1R85A 1XBYA 1ZJBA 1BG9A 3H2NA 1LZOA 4JQ4A 3SCTA 4NJJA 1YNPA 3AMGA 1A5OC 3CB3A 2ON3A 2ZQ0A 1KCZA 2HWGA 2YKKA 4OBTA 2XPKA 3EWUA 3W82A 2RDXA 2Z27A 3PZNA 1EOMA 1ZENA 2GQ8A 4MPKA 1BQCA 1TRIA 2HK1A 5I0DA 4Y9PA 3PBUA 2CYGA 2QCMA 4AVOA 4S3EA 4NAFB 1XISA 3W7DA 3W53A 1VYPX 3QGVA 3PTQA 2Z6JA 1YDNA 3O9NA 4UZSA 1E6PA 4TVUA 2CEQA 4GCAA 3W76A 2Z4GA 4JFWA 2VEIA 2C1GA 1TR1A 3EOLA 4AIOA 5KEZA 4NI3A 4IQEA 5G2HA 5FACA 1J4EA 1JCJA 1JCNA 4LS2A 5AHIA 2DT0A 2NXGA 4AD0A 1QPRA 3NM3A 3LG3A 2QCCA 4WY0A 4AH7A 2PD5A 2W67A 3BLLA 3RGTA 3URNA 3AHZA 5AFDA 4E0CA 2D22A 1Q6RA 5CGMA 4OQVA 3WLNA 4ADSA 2FVMA 1VJSA 2PDIA 4GX8A 4G1NA 1D8WA 1V7YA 4AU0A 3VGDA 3C0LA 2HTMA 1TX0A 2VX7A 1N82A 3KE0A 2J62A 3DECA 3GUGA 3V0SA 4IP4A 2CHRA 2VENA 1WOBA 3CH0A 4GUHA 1LQAA 3ITOA 4J7RA 1J0IA 3A9BA 3W1XA 3W6LA 3AXXA 4AZBA 4WX2A 1TFVA 3GB6A 2QV5A 2DT2A 4GVHA 2TAAA 4UFIA 2I17A 5KZ6A 1WE5A 4IPPA 4D8AA 1XD1A 4C6LA 1QI5A 4K39A 4L4PA 4NKCA 3UVAA 3OPSA 3ZOAA 4GXWA 1E4MM 4G56A 2EQDA 5I09A 2FKPA 1Q8AA 1JAEA 4JQAA 3W1AA 4JTTA 3NFUA 1U5JA 3REQB 4GVFA 3QGKC 3W29A 3V0TA 4G2DA 3EXSA 1I4NA 3LGGA 3SAZA 2CLPA 1LWJA 1VENA 2Y89A 3L0NA 5BOEA 3QW4B 1DV7A 1UR0A 4L6DA 1Y65A 1XH0A 4ORMA 3QV8A 2E25A 4Q8NA 2PRMA 1XBXA 4IPNB 4JHZA 1RCQA 2Y1HA 1FWFC 3ARUA 1P5BA 5C71A 1L9WA 4K1WA 3W7GA 2PDMA 4E2OA 2OLHA 4YTTA 4ZQOA 3GR4A 5A5WA 4PTMA 2O56A 2VFIA 3MKKA 4TV5A 2IQ0A 3DBNA 5JXQA 3QY7A 1X7FA 4UWMA 4GQBA 3CL7A 4O16A 3UWEA 1OINA 1PE1A 3KCJA 3M5YA 3UZJA 4KKXA 5M17A 4QCEA 3WENA 1HVXA 4MYXA 1QI3A 1FP9A 1EC8A 1OX4B 2OWXA 2Y61A 1Q45A 3U5YA 1GEHA 3L67A 3TSBA 2V2DA 2W9MA 4K6AA 3N2OA 3TTEA 3MCMA 3TFCA 4TX8A 4GD0A 1JZ5A 3FNDA 4F2BA 1ZQ5A 1NWUA 2GK1B 4IFKB 4MSSA 3TFXA 1LRTA 4AB4A 3SURA 4R9XA 1WDDA 6CGTA 1IWAA 2H8ZA 1YXCA 3C61A 2GJRA 1PHWA 2XZ7A 1TKKA 1TPFA 2ISFA 4WQ6A 3VOJA 3CV2A 1ZBWA 4JL1A 2TODA 4MJ4A 3PPHA 1XPGA 2XFRA 1J12A 1ZZMA 2E4TA 3G8EA 5CSUA 5FJRA 4K2SA 3KXQA 1FWGC 1J0HA 1JDDA 2Z0IA 3W01A 3KL3A 3MJMA 1E0XA </