4US5D

Crystal structure of apo-msno8
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
331
Chain Sequence
HHHHVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSADAAARLGLPYAYAHFITPDFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
molecule tags Oxidoreductase
total genus 115
structure length 331
sequence length 338
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5D00
3FGCA 3RAOA 1BSLA 1XKJA 1F07A 1EZWA 1Z69A 5DQPA 4UWMA 5AECA 4US5D 1TVLA 3B4YA 3B9NA 3SDOA 2B81A 3C8NA 1YW1A 4US5A 3B9OA 1RHCA 1NFPA 5LXEA 1LUCB 1BRLB 1FVPA 1NQKA 3FGCB 2I7GA 4J2PA 1LUCA 1M41A 1BRLA
chains in the Genus database with same CATH superfamily
3S6DA 4U2YA 9RUBA 2AGKA 1D7FA 4Q22A 3PC0A 2YBTA 3BAJA 3KOZA 1ZJBA 1D2KA 2GFTA 2DIEA 4JYDA 2PF0A 4XZIA 2YA0A 4H9MA 5A8OA 3NQEA 4CCZA 3STPA 1GVEA 1B5TA 1JPHA 4FNPA 1UJQA 4W4QA 1DOSA 5TAOA 2HEJA 3KS6A 2Y85A 1SYTA 4KEVA 3WDRA 4MKVA 1R87A 4D9PA 3L67A 4Q4KA 1YBQB 3QFWA 4KWUA 5A2CA 2VCAA 1UJPA 2VT0A 5HBFA 1A0DA 1P5BA 4Y8FA 3I3EA 2D2GA 5LNWA 3UJ2A 1G1YA 4OWGA 2J78A 3SDOA 2PURA 1DXEA 4FALA 1CLKA 2E25A 4W87A 4ZQCA 1HP4A 4W8BA 3CQHA 4IIDA 5D2TA 3T0CA 1YNQA 2CZVA 3OQEA 2X2YA 2PCEA 2WLZA 3LN3A 5D09A 1VH7A 4MGGA 1OEPA 2WCSA 3QV8A 3LXAA 3R58A 1BVWA 3T55A 3CZEA 2V3FA 2WCGA 1RCQA 1R5YA 2A6NA 4H7VA 1EIBA 2PGRA 1A80A 2ACRA 3HMJG 1FDZA 3QHNA 2AAMA 3ITCA 1FHVA 5HUPA 5I78A 4GVHA 1ONWA 1X6NA 2FIQA 3MUY1 4OV9A 4S3JA 3W76A 1E6NA 2IQ0A 3A12A 1H5YA 1PYMA 3VINA 4OQVA 1EB3A 4AY8A 3IJ9A 4JIIX 1VCVA 3GHTA 7XIMA 3GNPA 3TLLA 1R2RA 3RU8X 1YDVA 3UVIA 3R79A 3WH6A 4PB5A 3MHFA 4JY9A 1R3WA 1OFAA 1GVRA 1LBFA 1WAUA 4WDXA 4W5UA 5ABFB 4WF7A 4ZB0A 1NARA 1W54A 3OGVA 5D9PA 4DQWA 2VVNA 3M47A 4YMZA 1HQTA 2ZX5A 2VFFA 2J8TA 2D0HA 4QG8A 5HMEA 5FJTA 4H9TA 4MAZA 2ATMA 4CN6A 5CKSA 5DBTA 1UP2A 5IFTA 2W66A 4Y96A 3N2MA 1ZB5A 4J27A 1ML1A 1J5SA 2VOMA 1HN1A 4AWTA 3RLGA 3IAQA 3TR2A 2QCMA 2VEGA 4KWOA 4N6FA 5F2IA 3WL1A 5IDIA 2WQDA 1OG6A 4IJBA 3DGRA 3SCWA 4D8ZA 4FNSA 3GHUA 3SCSA 4QLJA 1GQJA 3S6OA 4V15A 2CC0A 2XH0A 4QDWA 4CUCA 4GZEA 1F6PA 3ZMRA 3W7JA 3QZAA 3QPYA 4FXRA 3WO8A 1G7VA 2P5NA 5LIUX 1ZBCA 2EG8A 3GH7A 3S9YA 1L6FA 3N2XA 2J66A 4JIEA 1XLBA 3ABRA 4I7WA 2WYSA 3T0DA 4UTTA 2QF8A 3LCFA 4R7JA 3AZSA 1ZAIA 3WDHA 1OVDA 2PC4A 1GJPA 2QCDB 3KHJA 3A9IA 4NRSA 3RILA 3L12A 4CD6A 4BJHA 1XDMA 3UU0A 1QI0A 1Q8AA 4PODA 3WKZA 4HD5A 1V02A 3HBLA 3MSRA 3VNJA 2Y0FA 3EGJA 4PL1A 1E0VA 1NH6A 5LZLA 2QJIA 2YDRA 5LSMA 3W7NA 5I3IA 5D8WA 4AX6A 1LF1A 1O6IA 1K4HA 3EKGA 4PRRA 4OBSA 1JCJA 4A8LA 2CZEA 2VKZG 1KV5A 1TUXA 3VCNA 4AEFA 4F9JA 4TX8A 3WLRA 2VFIA 1RJQA 4O52A 4PTXA 1PZ0A 1W37A 2C3ZA 1A5MC 3A5FA 3STEA 1UD6A 5D2WA 4A3UA 5AHMA 3T0BA 2PA6A 4HT3A 1T6MA 3Q94A 4AWEA 2WOQA 5DFAA 3UP8A 1OCBA 4HSNA 2OFJA 1M68A 1Q4NX 2P0IA 3GVRA 2ACSA 3N1AA 3T09A 1OT1A 3DERA 4UFIA 3BE7A 3CK5A 5I09A 2HRWA 3MSGA 4Z2LA 2BZNA 4KEZA 5LHEA 4I5RA 3T6CA 4FXFA 4XAGA 3KBMA 4HTYA 4X63A 4UCGA 3CL6A 3BLLA 5E70A 4PCSA 1AUSL 3H7RA 3TQPA 1KGWA 3BSGA 1TPUA 2XTKA 3UPMA 5JXQA 1E6QM 4QQ3A 1FUYA 4UFJA 1HUVA 2TSYA 3WDJA 4NI3A 1DBTA 1GJWA 2WBKA 1QATA 2GJPA 1US0A 4YU1A 3VFLA 3VDCA 5HXMA 3TYDA 3OBEA 4UCFA 2EBNA 3FJLA 3E5PA 3Q2DA 4OTKA 4JTJA 4CCCA 1GZ1A 1KBJA 3O8AA 1V0KA 4AD2A 2FFIA 3QZ6A 3KW3A 4XAYA 3ZFHA 2UY4A 1MQPA 1M53A 3ALFA 4GHRA 4PMOA 2NV9A 4DUVA 4O8RA 1QK0A 4TU1A 2WBGA 1FCUA 4HOZA 1TYGA 3GNNA 4NJIA 4OVXA 1HO1A 3AJXA 1FP8A 5FF3A 2NQLA 3VZZA 1C8YA 3WUBA 1DP0A 3LCXA 4UTWA 4UTMA 1XC6A 4H6RA 1JJKA 1GNXA 1MNSA 3AZRA 3WIJA 4FF7A 3ARYA 4HBKA 3LCIA 2QDDA 2V8ZA 3C0JA 1MQRA 1ZP3A 3HF3A 2PRHA 1XFCA 2RJHA 2XM2A 1I0DA 3EPNA 4M81A 4NNAA 4GD0A 4R88A 1IHIA 1D8CA 3A4JA 1W32A 2OODA 1VBGA 5I3HA 4IFKB 4NZ3A 2W27A 5F4XA 1HTIA 1X1NA 4TQTA 2OVLA 1ISWA 1BKHA 3N9RA 3RM8A 2J9XA 3I7SA 4RPPA 3LOTA 5EKYA 1D7KA 1A4LA 1EC7A 1IGWA 3FV9A 3QZEA 3L68A 3LCHA 2GUUA 3MS8A 5E0FA 1W8GA 3KBJA 1TRDA 4O4WA 2QDHA 3EMCA 3VGBA 1OFPA 2HS8A 1KQZA 5LNUA 5CLWA 4DUXA 4UFLA 4A6GA 4UQ9A 2BGNE 1ADDA 2VEFA 4CLMA 2XIQA 5DY3A 1DWGM 2X7WA 1THFD 2SFPA 2ZZ6A 2RUSA 1RV8A 1TCDA 3GXNA 1BYAA 3PB0A 3IIVA 2OQLA 1C91A 2J47A 1E71M 1OJXA 2OJPA 3U2EA 4I90A 4AY7A 2F38A 9CGTA 3C2YA 1PX4A 1E0TA 3HPXA 2UY5A 3KRUA 4MYAA 5CJMA 3N25A 1WDQA 1DIKA 4E6MA 2E1WA 4GY1A 4A3RA 3HZ3A 4JFWA 1U33A 1ITXA 3OBAA 3REQB 5LGZA 5CPOA 2VX6A 3OTRA 3H21A 4Z1CA 3UXKA 2J74A 1Q85A 4GVGA 3VX0A 2DZUA 3CZJA 8A3HA 1ECQA 3MYOA 1FWCC 1BXNA 1M7OA 3PJTA 4M6QA 1EBHA 2BTMA 4BCEA 3UD6A 2YXXA 3NVTA 4MYXA 1V02E 3O6YX 3CTLA 1JDFA 1EP1A 1CXEA 3E9AA 3LU2A 5G1MA 4Z08A 2VCBA 1PS9A 2CYGA 3ZLGA 2O9RA 3UG8A 5BXPA 2YW3A 1VCGA 4QJ4B 3IJ6A 3TU9A 4YVXA 3N4EA 3NURA 4I8YA 3CJPA 3SQLA 1TX2A 1W1A1 2WC7A 1ODZA 3AS1A 3QTGA 3CZ8A 4JS3A 3SJ3A 3AU6A 4F0MA 1RA0A 3T78A 4H9ZA 2OCZA 2IKIA 1HKWA 2WK2A 1L6GA 1IQ8A 4O1DA 3MKKA 1GT8A 1V51A 3WQEA 4NQ1A 2EJAA 3F4WA 2OZ0A 5AOUA 4N6EA 4HMDA 1SO6A 2ZZ5A 2ZZ7A 4MB1A 1VQTA 2Y70A 4PYSA 2J25A 2QPSA 2YIHA 4QGCA 4BWLC 1M65A 3M41A 3MA8A 5AHNA 4XZHA 3TNBA 1JULA 2C79A 3EZ4A 2PDUA 1TPDA 2CLHA 2RAGA 2WSPA 4MHBA 2INEA 5A8GA 4MOZA 3CT2A 3WLQA 3PZNA 1E4MM 3KM8A 4ZQPA 3TNOA 3MUIA 4Z1DA 2AKMA 4HZ7A 3T4WA 1P43A 3SI9A 3RXZA 4US6A 4PUUA 2QV4A 1OFRA 3LM7A 1E1FA 3QYQA 1XHGA 3PBVA 3IJQA 3P61A 3S9ZA 3BMVA 2EPMX 4AZ7A 1AH0A 1CBGA 1G5AA 3TTEA 1LQ0A 4AG0A 2E6AA 4JTRA 2E9BA 3EAUA 4YCPA 4Q8OA 1GVQA 3RF9A 4DXKA 3W75A 1EPVA 3KCJA 2DFAA 1E1CB 5FD0A 1F3XA 1TMQA 1EC9A 4O15A 4GI9A 4PCPA 3NOEA 4BK9A 2FTWA 2QMKA 4UOJA 1NQ6A 4GI6A 4LCRA 2J88A 1CENA 1VD6A 2XIBA 1T8QA 2JBMA 3NCOA 4GI8A 2Y5JA 3B9DA 3PZUA 3TN3A 3WZ0E 3S1XA 2DH2A 1T8XA 3CNYA 3OJGA 3UT0A 2CWNA 3GRIA 8XIAA 3NSNA 2XM1A 5I3DA 3WJZA 4MWAD 3ZIZA 5AC5A 5A6BD 3VNYA 4J1OA 2X0SA 1OK6A 1V03A 1SSGA 1H51A 3AS2A 3POCA 1NSJA 3MYPA 2WPBA 3SUTA 2V69A 4V28A 3T05A 1T96A 1L8NA 5EY5A 4DRSA 3BK0A 2DW7A 2GQ3A 3FXYA 4MJ4A 4Y2WA 3OHIA 1E6SM 4S3KA 4AY1A 5EMKA 2A7RA 5AHEA 3UY8A 1KLZA 1KCXA 4HGXA 4P8XA 5H8MA 2VELA 4QTGA 1OC7A 5CPLA 5DQPA 1ECEA 4PCFA 3BO9A 4V2XA 1SZEA 1VRDA 1G7UA 1XG4A 3CU2A 1OC6A 1IT0A 1IXPA 1ZGDA 3WUGA 1GQNA 3KTSA 4MKSA 4WOQA 2NT1A 1W56A 2NX3A 1UKOA 1S2AA 4ZQOA 3W9ZA 3BQ5A 5DMMA 2NQHA 4YJ5A 1FDJA 1CLVA 1TV8A 2X16A 1AZ2A 3S2MA 2X0HA 3W0KA 2NSXA 4IUOA 5B7YA 4KIEA 3U0HA 3L4WA 2D0FA 4GI4A 1PIGA 3A21A 3P5ZA 1YDYA 2WNZA 3DOPA 3WX7A 3SN0A 4E2DA 2PGWA 2MNRA 5DF0A 1EC8A 1CI1A 3SZ8A 2BG5A 4HMNA 4JFUA 2PDMA 3K8MA 3NA8A 3TE9A 2PDXA 3UWWA 3FGCB 5JH1A 3QHOA 9XIMA 1HVXA 3HPZA 1PKLA 5L9FA 1S2CA 2QPXA 4W5ZA 3MO7A 3QV7A 2ZIDA 1BWVA 5GJPA 5BWAA 1H5VA 3W22A 3DBNA 3N6JA 4C7DA 2PGFA 4O10A 4EP8C 3G1AA 1W2VA 3AS3A 4H19A 4ATDA 3C0LA 1KFWA 4PBFA 1RCXB 1JXKA 1S3HA 1UR2A 2FYMA 3SRDA 4ZB5A 3NQFA 3ONBA 5FF0A 2JF7A 3SCTA 4MUPA 1GVOA 1KKRA 2Y8KA 1Q6RA 3EWZA 1TWZA 2VFEA 1P7TB 4QNEA 1AQHA 1DE5A 3RLVA 3FLUA 2CWXA 1BVZA 2F2KA 1SO5A 4DPPA 2PTYA 1ONRA 3CZLA 4MY8A 1JVNA 2PTDA 4XAPA 1VFLA 1RSCA 4TMCA 2TPSA 4PMQA 4B2DD 4K37A 4GYFA 5LA0A 4JICA 1TV7A 4Q8TA 2PWFA 3CS2A 1PEZA 1OFBA 1JPMA 3W6YA 3LGDA 1PUDA 6ENLA 1SO4A 4HHHA 4MJZA 1GQLA 2OKTA 5T26A 3CHDA 4KFOA 3WNLA 1NFPA 2NVAA 4GH3A 2ZTJA 1U1HA 1ME8A 2HQAA 1MXGA 2QJNA 4NI8A 3HPAA 1G69A 2ZE3A 1UG6A 3TCEA 4XQ6A 1DHKA 3MWAA 4Q4RA 2YXGA 4QSFA 5HNTA 1TA3B 3GU9A 1VRXA 5GNXA 3H26A 4IP7A 2Z1KA 3QN3A 4OE7A 2NLYA 3EEZA 3DC8A 3UBPC 4KGJA 1BQCA 4JIHA 5M5DA 4A3HA 1XM3A 3VM7A 2CIPA 4JTEA 4PBEA 2Q3OA 2FTYA 3LBCA 1R38A 5A3HA 3FY1A 2PPGA 4NRRA 1Q6OA 3QW4B 2Z1SA 3SUWA 3C52A 2QCNA 3RK8A 4QAIA 3BDKA 3AMCA 1QBBA 4CQ9A 2Z1WA 2UZ9A 4PRTA 1SPQA 1TSIA 4GUGA 1Q8JA 5FI8A 4BF9A 1JF5A 2VO5A 3M07A 4TIMA 2GLKA 3W00A 2QV5A 4J35A 1MUWA 1R86A 1T41A 3TH6A 5CPMA 2G96A 4UMAA 2I16A 4AZGA 1GEHA 2V3DA 1K6AA 3OHMB 2QIWA 5BXRA 5KMYA 3G3DA 4XD6A 1JPDX 4M56A 2I7GA 1V79A 5EYWA 4JNZA 2YKKA 4PUKA 4MSSA 2V67A 1XRVA 2EKGA 1XCFA 1S2WA 1G67A 5JBDA 1WUFA 1W3KA 4A29A 1AA1B 1E73M 5CG7A 1IEQA 1Q7ZA 5ABEA 3N73A 4AD5A 1R3YA 3THDA 2HBXA 4K3ZA 1W1VA 1UD8A 2P8BA 4W8AA 2WC3A 1E15A 3S42A 1XYAA 1NFBA 2AMGA 1ZS2A 4QG6A 4XD4A 2QCEA 3LYEA 2VENA 2DZVA 4ORIA 2PDGA 1OYCA 1FFRA 4CQAA 5I3JA 4JY8A 3CV7A 4ZR8A 2Z0IA 4ONVA 2FH6A 2A5HA 2DZBA 1E56A 1QNPA 2O92A 3GG8A 4BS0A 1UR1A 4J3UA 3FSTA 3A5VA 3IWPA 4UTFA 3IK4A 4DO5A 4A4AA 5EBUA 1XPGA 4WDWA 4BKNA 2ZZ3A 3LLDA 2DP3A 4OZOA 4V33A 4LEFA 1UD3A 1YBQA 3EWYA 3GDKA 4WHBA 4AWSA 1KCLA 4AMAA 1TJ1A 3M0XA 3ABQA 1JUBA 2PE4A 4O12A 4LV9A 3U48A 1XLFA 1ZUAX 2XGZA 3MTWA 5HWNA 3N15A 2JALA 4A2SA 3M43A 3H2OA 2PFHA 2ANUA 3MP3A 1F74A 1VYPX 3GTIA 2BY0A 4D1JA 3OLIA 5FJJA 4ZO7A 3LHWA 3W2LA 2OPJA 3AIVA 4I6VA 4G56A 1AH3A 1V6XA 3WFLA 1RBOB 6REQB 2QVNA 3VNDA 4DJFD 1MVYA 3G0XA 2CBIA 1WNOA 3RU6A 1VJIA 2W91A 1XP3A 1BF6A 4GXPA 5A95A 3F4NA 3WJSA 1PWLA 3NGFA 3U7VA 1JR1A 3HQPA 2VFDA 4PMUA 1UROA 5A94A 4RK8A 5I3FA 2EQDA 1O12A 3AICA 3OZPA 3PSWA 1PCKA 2W62A 1LDCA 3GG1A 4QR6A 4CNSA 3GR4A 1EWEA 1ONEA 5DCDA 3MMWA 3CAWA 3MP5A 1HJXA 2HISA 3F5LA 2QJGA 3NIYA 2NUYA 2A85A 4J7RA 2VC5A 2WW5A 4TMBA 1AW5A 2F8QA 4HJWA 1JZ6A 2C91A 2F9RA 4EPBC 4D6CA 5F7UA 1RLDA 3HG2A 4IMDA 3PBGA 4IX0A 3N4AA 4YIWA 4L65A 5AC7A 2YGYA 3PS7A 4B3KA 3E2SA 2RDTA 3HFYA 4LUSB 1JIBA 1KM1A 1AW1A 3WQCA 2R9RA 2FKPA 1TRIA 3GZAA 1ZHAA 3IGSA 3EDJA 4S3AA 3VD3A 1HF6A 2BNJA 1HVQA 1UR9A 4WKAA 1F8MA 2XVGA 5DT5A 3UWEA 5FF7A 3BAWA 3B97A 1R3SA 4WR3A 4MY1A 1WKEA 1WPCA 2AL2A 3PSVA 4WRHA 1ZJHA 4DJDA 3I6EA 1W0MA 1LWJA 4EPDC 1TE1A 1E4LA 3IGHX 1GHSA 2ZRZA 2O4MA 3TC3A 4YTRA 2WMGA 5D2XA 5AHFA 4DAIA 1EBGA 3JR2A 1T40A 3IANA 3NPXA 4KH2A 3UESA 3GLCA 3NQAA 4GUHA 1Y8BA 2IQDA 2YCKX 2WHLA 4HU8A 2FGBA 1WBJA 2BHZA 4H6EA 1OSEA 3IIPA 4UQEA 3RIKA 1OT2A 2WMKA 1C9DA 3ZJKA 1PZ1A 3BARA 1JCNA 2WHJA 3GU1A 3AMDA 3YPIA 2Z6IA 2DT3A 1M7XA 3GC2A 1X7IA 2Y8UA 1H61A 3HJZA 5D38A 3T8QA 4AIEA 5BMWA 1OFOA 4NJKA 3ITTA 3A22A 2Z26A 3LS9A 4ZQMA 2BVWA 3C86A 3M4HA 4Q8NA 1EUNA 3BMWA 3H4XA 4Z1YA 2FZ8A 2ODOA 3NEVA 4XZBA 4CNUA 1NWRA 3TTOA 3VIGA 2VFGA 3NXFA 2A3AA 4U28A 2OMAA 4DY1A 2WXDM 2QDEA 3UVAA 2YBUA 5EU9A 3BGGA 1P48A 3WD0A 3VU2A 3DIPA 1SR9A 1Y5XA 4D2JA 1DORA 1IV8A 1OFDA 1Q63A 3GXIA 4N7QA 4FPSA 5HPCA 4IMEA 4QISA 4QIUA 1QNRA 4LOCA 3PUDA 1CB7B 2XSAA 1BYCA 5FL1A 3EKLA 2Y8VA 3CV6A 1BSLA 4KWSA 1YPIA 2QULA 1PZ3A 1SFLA 3QV6A 5I5RA 2CLIA 4JTCA 3UPBA 1X39A 3VVGA 4ZENA 2FPVA 3V0UA 1OX5A 3E6EA 3PK7A 2XWEA 4IFOA 1GG1A 2XN1A 1WXZA 2ZRVA 4PB4A 3TC7A 3C3NA 4ICCX 4U5IA 2FMNA 3NQGA 3U2ZA 5LIKX 2GQ9A 2ZICA 1FCQA 3EYPA 1OX6A 4L1GA 1S38A 5AFDA 3NQMA 3BZJA 1AVAA 4CU8A 3OZOA 3OA3A 4DZIA 1BQGA 3D6NA 2NXHA 4LFYA 3UA3A 4WXYA 3W01A 2ZUSA 3PM6A 4JTTA 3HM7A 2X41A 3H22A 4ECLA 3KOFA 2YR1A 2R1PA 5FSEC 1VHNA 4NNCA 3TKFA 3MBDA 1E6XM 4HPXA 1W5QA 3O6DA 3E96A 3W6LA 2Y7GA 2GL5A 3IIOA 3WNNA 5A6SA 3UA4A 4DWDA 4Z1BA 2B4GA 3CV2A 4LWWA 2Z2AA 1H0IA 3EX3A 4K38A 5K7JA 3CIXA 5AYBA 2OSWA 4JKMA 5G1YA 2HPIA 1B3VA 1EP3A 4JTSA 3KBVA 4AXKA 3B0VC 5FEPA 3L2IA 3N3MA 3I68A 3PPGA 1K03A 2PDCA 4YPJA 3PWGA 4MZ1A 3ZWTA 4ADSA 4E8GA 3C4UA 2XINA 4GABA 4WJEA 4ZE4A 3WFZA 5E1QA 1KXVA 2YBVA 1G01A 4HNUA 3V75A 2CHNA 3GNDA 1WXYA 5BOOA 2CLEA 2H3DA 3MDUA 2ZVIA 2GJXA 2JIWA 3V1HA 3AIUA 4EWND 2VUNA 3DG6A 4P7OA 5CC5A 3AFBA 2QS8A 5A8PA 4I9TA 2HVMA 4DJEC 4H6KA 4URIA 4OOZA 4Z0JA 1GYMA 2VZSA 3N9KA 2NV2A 1PV8A 1AODA 4UQCA 5JVLA 1VFFA 1M41A 3TYUA 5CPNA 5PTDA 4Q32A 1IZKA 4M8UA 1E70M 1IEVA 2E5DA 2WSQA 4IT1A 2VEMA 4EKJA 2PDKA 2OR2A 3C2EA 1NF0A 2NQJA 2INFA 3RX4A 1ZENA 4RX0A 3DHPA 5CC3A 4HA1A 3KWXA 1MEHA 2WSKA 4N9DA 2ALDA 3IGUA 1HW6A 1V3HA 4PMZA 3WLPA 4JYFA 5HATA 3SRHA 3CUJA 2DU2A 1OX4B 1Q6LA 1W3LA 4E3TA 3AIEA 3UZWA 1KGUA 1J11A 3W38A 3AALA 1YYAA 4QJ1A 4WOZA 4AHPA 3TZNA 5FJIA 5BXSA 1R2TA 2W4XA 2Z1BA 1YEYA 1XBVA 3QXBA 4IM4A 3BGJA 4JNMA 3SFWA 1PKNA 3B9EA 3OBKA 1Z6KA 3R13A 1RQHA 6A3HA 3N14A 3TTSA 1ME7A 4AEEA 4PMXA 4QROA 4CD5A 3KWSA 3W1RA 3LG3A 1YPFA 3NPWA 2RGLA 1ZCCA 4QJ3B 3VC6A 2OELA 1I6NA 5J5RA 1JDCA 4IUGA 4E4PA 4M24A 4K8HA 4PGLA 1FTXA 2ZUUA 4HZ8A 5I03A 1PL9A 4YCOA 5HMSA 3EOEA 4XD3A 1PIIA 1POJA 3P81A 1VFSA 5FAGA 4HHLA 4F3HA 2WZTA 3GXDA 3LENA 2ACQA 1W9PA 1CNVA 4IIEA 3TQVA 5DY2A 3QFEA 3LCLA 4D72A 3GDMA 4WD0A 3LLXA 4ZO6A 1ZP4A 3TYBA 3DG7A 3H2AA 3RCMA 1BYDA 3H23A 5ECVA 3DYPA 5HWJA 3DFQA 2VQTA 4Y6GA 2WB5A 1ZBKA 3HB9A 1ISZA 3VTRA 5C55A 7REQA 4JX5A 4LCSA 1OZMA 3DI0A 3OQ8A 3R25A 2YYTA 3QPZA 1XYCA 3QMTA 3UETA 7ENLA 2VX5A 1J0KA 3MC5A 5HDRA 4AH7A 1UWTA 5D8ZA 4NZ4A 3R89A 3DZ1A 4QCFA 1EJVC 2XG9A 3P2VA 1PYFA 3SECA 1E6PA 1VLIA 3BJSA 1PBGA 3CUZA 4FOUA 1P6BA 3MHGA 1DVJA 4IP4A 1KGXA 1JFXA 1NF7A 4GJJA 4Q8WA 4W86A 5FJOA 3P5YA 3L4UA 3HPFA 2ZZ1A 3ARXA 3NSXA 3FHQA 4FIQA 2F6UA 3GDTA 3HA1A 3PZOA 3UEQA 4BEQA 1LP6A 4Q4SA 4E8DA 2WZHA 2O55A 3UY7A 3FA4A 5IHRA 4V1XA 1H60A 2AOSA 4WSKA 3J7HA 1X38A 2Y61A 4HOWA 3W3OA 2HK0A 2JE8A 5H8UA 1UWSA 3IV3A 4XKYA 4NX0A 2PODA 1V8EA 3WQ5A 3MI2A 3LBMA 2OO6A 7A3HA 3UZ5A 1V93A 5A6LA 3CPRA 3IARA 2E0PA 4MZYA 4J5NA 1EHAA 3MUCA 1ICQA 4S1FA 2QLYA 1N2VA 1CYGA 3S2JA 2VD8A 5FIPA 3POHA 2DT2A 4H7CA 4O16A 2Q09A 3WLTA 1DWIM 1E5NA 3CEUA 2IS7A 4KRUA 5JIWA 3IIZA 1E9IA 3LBOA 4KWVA 3NYZA 4HHMA 4A2RA 4B9YA 3R7MA 5FF2A 4N42A 2F6XA 3AI0A 1PTDA 1LM1A 1U83A 1QWGA 4NUWA 1EGZA 4FMVA 4O1EA 1LL7A 3QR0A 1LG1A 3PZQA 3EX2A 3MP4A 1REQA 1CTNA 3EOOA 1KTBA 1VPYA 1R46A 4XZNX 4IG2A 4UTJA 3THUA 2E1DA 5FJUA 5D2VA 5HMDA 3GTXA 3CO4A 1US2A 2G3IA 4G1NA 5E9AA 2GUBA 4EXAA 7CGTA 5AKQA 2YZRA 4RJEA 2FMOA 2P3ZA 1JYWA 3W2UA 2DH3A 4YYFA 3ZLHA 1Z42A 3PULA 3QR1A 2J27A 5CH9A 4CKQA 4WSHA 3ZT7A 2BP1A 1VJSA 3CPGA 1CZ1A 4GNVA 1TV4A 3HG5A 1QO5A 3ARPA 1D8WA 2D69A 5A6JA 5M03A 2G4FA 1IEIA 2IUZA 1G4TA 5FJPA 4WK9A 4JTGA 3EB2A 3NQ6A 1FOBA 4LUTA 4Q8VA 1A53A 4JNYA 2GGEA 5I2UA 2VGGA 4UQBA 3CQKA 5GVJA 2B31A 3WY1A 3PPCA 3FDKA 5XIMA 2J7GA 1SGJA 1B3ZA 2NZLA 1RXOB 1S5MA 2HBVA 2QR6A 4DIAA 2R94A 1W6TA 2WVVB 2O9TA 4C6NA 2JEPA 3O06A 3VNIA 2G4JA 1IIHA 2VUYA 4A22A 4KT2A 1HL9A 3K5XA 4UTTC 4C65A 2B7NA 5IM51 3S1VA 4CD4A 2A3BA 1GZJA 3VCRA 4CNOA 5D03A 5DO8A 4DELA 3FGCA 3W29A 1XW8A 3WEMA 2WCAA 3E0IA 4JCMA 2CLOA 4XZLX 3BVJA 3QSTA 4AXNA 3GG7A 3ZT6A 3VIHA 3L4XA 4ROPA 3PZ9A 3RDKA 2ZRXA 4UMBA 3N6HA 3GHSA 5E6YA 1AQFA 3IJ7A 1FQ0A 3ABXA 3THCA 2WVUA 4GQ0A 4HPNA 1KBLA 3S3GA 1YTEA 1LTDA 4YWSA 2DVUA 1UC5A 2Q01A 2P0OA 1XR2A 3NQ2A 3AISA 1KKOA 4CCDA 2YX0A 4QG9A 5ABHA 1AQMA 1F5ZA 2Z27A 1H50A 4MFEA 3TA6A 3ZR4A 1ICSA 4U3CA 1M3UA 3HQNA 1W3TA 3P84A 4I5XA 2PU0A 1KBIA 3KP1A 1VB9A 3CB3A 3SEPA 4JX4A 4QXIA 4B2DA 3WQOA 3RAOA 1K8ZA 1WDWA 3E0WA 1DE6A 3PP7A 2A7NA 1O5XA 4L80A 3GW0A 2RGMA 2WM0A 2I56A 3LXBA 2D2JA 1RK6A 3S9IA 3DYOA 2Z24A 4AIBA 4IIBA 4C6OA 1XIEA 2DUZA 1VFOA 3NAVA 1JD7A 5FESA 3HGRA 4JKLA 5C7VA 3L9CA 2BFGA 1IWBA 3N29A 1LG2A 4X0VA 1TA3A 2OZTA 2CESA 3GYEA 2C6QA 4U31A 2ATSA 2QZRA 3I4EA 2QMJA 4AAJA 4HU3A 4L9YA 3MV11 2WMHA 2G5WA 4DO6A 3IRSA 2POTA 3M64A 3USZA 4L1XA 3HQOA 1VEMA 4AZIA 2GJRA 2W5FA 4RNJA 3TYEA 5HQMA 1I75A 2X2GA 4C6EA 5HJLA 4AF0B 4P8WA 2Y62A 3WLHA 4L9ZA 3UJSA 2GYIA 4PFHA 3APYA 1R8LA 4RXGA 1PTAA 3OODA 3C2RA 4D6GA 1XLMA 4FB7A 2PP1A 4BI7A 3AMLA 4UTWC 4A8NA 1GKQA 1K9DA 4XSLA 2QJMA 3V16A 3ARUA 5D37A 2PTZA 3DYMA 3JUGA 1Q4WA 3HGOA 3VOCA 4O0KA 1DYSA 4H83A 3TYCA 3NPUA 1KTNA 2X0YA 4MVAA 4TX6A 3OG3A 2GDQA 3USBA 3AUJA 2W61A 4WQ6A 5JQ9A 3UXIA 3EWCA 2C13A 3SGZA 3AHXA 4ZFMA 1ZZMA 1Z7AA 1C8QA 2WMFA 4C6FA 1OADA 4AHOA 3LERA 3CV1A 2VGBA 4MJMA 1V0NA 4OUEA 3W1UA 1A47A 1Z44A 3UG3A 4RDVA 2P1FA 3VDBA 1AH4A 1ZBVA 1Y0EA 1TZZA 1JDDA 1PKMA 1OGBA 2VD9A 4IMAA 1DIDA 3H4GA 3KLLA 1MI3A 4N2YA 4C90A 2OO0A 2FFCA 3TXZA 1HJWA 3V3WA 5AECA 3WQGA 5KSWA 3W6MA 3G18A 4GE8A 3VNLA 3BV7A 3MKVA 5C0QA 3N4FA 3CEPA 1F9CA 1WA3A 1Y5WA 1RPKA 2Y2WA 3FN9A 4GY0A 4M51A 3BTNA 2P53A 2VI0A 1TUFA 4Q7IA 3HPSA 3AYVA 4CEXC 1F76A 3TJLA 1CGUA 2HVOA 3QRHA 4L4OA 1Y65A 1YXDA 3FCPA 3NO3A 3CTTA 4GY7A 1S46A 1FVPA 3G5EA 4Q8MA 2HV5A 3K1GA 3EWXA 4FNUA 1TTQA 3VIJA 3N2OA 1HT6A 1Y7VA 4H8HA 3W28A 3RN6A 3P0WA 3GXFA 5FA5A 1YTKA 2V3EA 2OGJA 2DPEA 4DF2A 3UWZA 3BCFA 3ES7A 4K7YA 3TN6A 3KTXA 4R33A 4IQLA 4WVXA 4NHVA 1LL4A 5L6UA 1HX0A 1TTJA 4E4UA 3B03A 2REQB 3IV8A 3CAVA 2ZC1A 3ITXA 3V35A 3M5YA 4PZVA 1ZL1A 1R3VA 2JIEA 3N11A 3H12A 1PCWA 4CVUA 3HOJA 2RDWA 5D32A 4LCQA 4RV8A 3GVVA 6REQA 5M1TA 4XUYA 5JH2A 2D20A 4DJFA 3S1UA 5H2ZA 4F66A 4R5EA 1EFZA 2VQUA 1J6PA 3NNTA 1PDZA 3HQ1A 3URAA 4DI9A 4EACA 4LBSA 3TV8A 3SCPA 1NELA 5A6MA 5A69A 5G4EA 3A4AA 4GLEA 1SSDA 4YS1A 4C6MA 1ADSA 2NWSA 3P14A 1L2UA 1M6JA 3QF0A 3U3HA 2E6DA 2QPUA 8CGTA 3AO0A 4QBXA 1GOIA 3OU8A 3SRFA 3WF0A 2ZZ4A 3SUUA 1E43A 3IK2A 4AU0A 3SN1A 3L4TA 1XLCA 2YA2A 2BSLA 1M7PA 4FNRA 5AN7A 4D6EA 2WPGA 2QEZA 2YCJA 3WNKA 2IPWA 4D6HA 1IGSA 1KXQA 1AL8A 1XG3A 1EOMA 4DO4A 2YB4A 4LAOA 3SUSA 1RH9A 1MFUA 3F4DA 4JEJA 4NZFA 4HCDA 1OGGA 1ICPA 1YXCA 4LUSA 4ACYA 1QMLA 5I77A 1OCNA 1C29A 1YNPA 4HA3A 1XLJA 1CXIA 4LB3A 4DZHA 3ZJ7A 4GUJA 3R12A 4ZMGA 1KBKA 4BHYA 1NAL1 3CQ0A 3NVDA 3PZTA 3NQVA 3RCYA 3E2RA 4FF5A 4ERAA 1UD4A 3FS2A 2XN2A 1LLOA 1TE6A 3ITOA 2F61A 3KVMA 4GFIA 3RMJA 1HKIA 1LORA 5CLTA 2IPGA 4RLIA 1DJHA 1W91A 4F2UA 1EX1A 3C0SA 3NPVA 4BFAA 1EJUC 4GK8A 5B7ZA 1NQKA 3W24A 2R91A 1ZY9A 1H62A 1UOZA 1FH9A 1DXIA 3PTKA 3RO8A 1BGGA 1XRSA 2X1RA 3RX2A 3K8KA 1AJ2A 3O7UA 3UGRA 4HYRA 1VLWA 4PA8A 2O56A 3HN3A 3A6OA 4TO8A 1DQUA 2XU2A 1RY0A 2IXUA 2EO7A 3R0UA 5HJXA 1BRLB 2YL9A 4HOXA 3Q65A 1OF8A 1F8IA 3CAQA 5GJMA 1TV2A 3O9NA 3B3DA 1ZALA 5FJRA 4RPQA 1EH9A 3WLIA 1CDGA 3UZYA 3TVAA 2FJKA 3I6TA 2CU0A 3SY1A 4J3TA 1E1EA 4DEFA 3VA8A 3N13A 2RKXA 1XYMA 4G5DA 2ALRA 5A6AA 3PWAA 3WNMA 4B9ZA 2ZX6A 3W1MA 3MVTA 1V3KA 3TTQA 2X30A 4WLCA 1JQXA 1C92A 4LC6A 4AWUA 3LQLA 4DWSA 3PF3A 4WJ8A 1BG4A 4YXGA 2ZYFA 3BLOA 1VYSX 1OCQA 5AZ0A 4PMNA 3C6CA 4LY8A 5I02A 5FAJA 1RA5A 1Z8AA 1QPQA 1TPH1 2JKPA 1Z32X 2A6LA 4FOJA 5DLCA 4UQDA 1SUXA 4IQDA 2J7BA 3H55A 4ZQRA 1D3HA 4PUNA 3VDGA 5DRIA 4DJED 4L4MA 2ISFA 4IMFA 4WKHA 3N6QA 4Y8EA 3M0HA 4MPKA 1XIMA 4ZZ9A 1R9ZA 3SCUA 3W72A 2CPUA 2XPKA 5I7GA 3JZUA 4JAWA 2I14A 4H01A 3WD3A 2A2IA 2J62A 1X7FA 1L0PA 3VNKA 1VR6A 2FPTA 3PZVA 1R7OA 1FWNA 2WNNA 1TPB1 1FWWA 4J3SA 3GY1A 3T4CA 2TAAA 2ZXQA 4GH1A 2PBGA 4Q8QA 2ISDA 3CHEA 3BCJA 1DXFA 2QCGA 1RY8A 2BBFA 3ZR6A 1FWEC 5BOEA 1Y5VA 1J10A 4ES4A 2OX1A 1UD5A 1NFGA 1Q66A 4ZSUA 1UCWA 2GJLA 5HJYA 5E09A 3GO2A 4M6UA 3P62A 5DX7A 5AYZA 1RCOB 1MSSA 1XLLA 4LRSA 5A2AA 3CUHA 5TIMA 2P8CA 2HXUA 4GYKA 1GQKA 3QOKA 1AK5A 2GQ8A 2Y7FA 1UKTA 2B81A 2YOCA 4Y9MA 4W88A 2HNHA 3CUIA 5E6ZA 1UUMA 1MYRA 3L5AA 4G2DA 2FHCA 3WEOA 2P88A 3ICJA 1KNWA 3VAVA 2ZWYA 1QAPA 4GA8A 1JGIA 3QKEA 4B5NA 3S1WA 3IS4A 4UFHA 4EE9A 1HJSA 1IF2A 1B3XA 3VC5A 1VBHA 4HK5A 1S5VA 3XIMA 1O66A 1F2JA 2PLJA 3VD9A 3WD1A 3ZR5A 2IKHA 1HL8A 1UKPA 3T08A 4XBJA 1OG0A 3AMGA 4REQA 4KS0A 4P7LA 1EIXA 1R9XA 2PZ0A 3URNA 1DWAM 1FP9A 4G7EA 4NSBA 3TR9A 3N34A 3T2OA 4CQDA 3KVJA 2CNCA 3T8LA 3AHZA 2WZMA 4DYKA 2DY3A 2OKOA 5KETA 3UPWA 1ELSA 2D73A 3MI3A 4E2BA 4F4RA 2Q8ZA 3AXHA 4A05A 2P50A 1C3FA 2DIJA 1V6YA 4D8LA 3SUVA 4JQ4A 1RPXA 1H7OA 2BGSA 4C6BA 1TPFA 3QGKC 3W07A 4C6KA 5LNSA 1XUUA 3V5OA 4GGBA 3I6RA 1G4SA 4H00A 2WV8A 2XFFA 2E9MA 4NF7A 3L2MA 3E02A 3VILA 1K3UA 1PHQA 4GINA 2W63A 4FZIA 3G1DA 1MRAA 4NT0A 3OLEA 1DJNA 3W74A 2ZFAA 1DJWA 2FPYA 4A21A 2ZUMA 1AMKA 2ZDRA 4HNVA 4IWWA 3AYRA 2ZUVA 3V5FA 2GWNA 3VIMA 3KOYA 3H2CA 3CAKA 1NWUA 2R24A 3ZZ1A 4D6DA 3CIWA 2BX7A 2OYLA 4LAUA 4POCA 5JBEA 1JUKA 2BVTA 3E38A 3THAA 2HPMA 3S83A 4EX4A 4O54A 4IIHA 4L6HA 3O2LA 4IHCA 3DFPA 3GM8A 3KBSA 4NASA 1SW3A 2FDMA 4E38A 4YNGA 3GNRA 4L5ZA 1UD2A 1F61A 4L1WA 3OLDA 2QQ6A 5TD4A 1F4HA 1IR1A 3T7VA 2YL5A 2AMXA 5GNZA 1UWAA 3FJ4A 4UBPC 1GK8A 3AXKA 4YWIA 3K1DA 3DH7A 4M7SA 1J2WA 4Z42C 4WDUA 1JCLA 5CBBA 3TAKA 4XBKA 1WZLA 5GNYA 2VZTA 2PWDA 4Q6JA 1ZCOA 2GWGA 3FA5A 4H1ZA 4FR6A 4JN8A 3GFXA 1UBPC 2QGYA 1V5XA 4BI5A 4PE8A 2R1KA 1IT7A 4GPNA 1FWRA 2A7PA 5AC6A 1WZAA 4WGXA 2YZ5A 1J8VA 5JU6A 4Z2JA 1DJQA 1QNSA 2NXGA 3TMLA 5AB3A 2YLLA 4GXWA 4ZQNA 3GR8A 3ZWSA 1Q7MA 3LTPA 3ITVA 3I7RA 2V0TA 3D5HA 2O7QA 3LSBA 3RR1A 4Q8UA 2DVXA 3ME3A 2GK1B 3HO8A 3ARSA 2D23A 3R0KA 4GIAA 3WQDA 2ZC8A 4R27A 3W7GA 5HINA 4HK6A 3M44A 4H9UA 1G9HA 2NV1A 4J3XA 1W17A 3IUIA 2CLLA 4IGSA 5F2LA 2C18A 4LX4A 5BYWA 5MKGB 4X3ZA 2Y24A 2XIJA 2X1TA 3MDWA 2ZBTA 3QYSA 4H2CA 1FH8A 1JPKA 2PDPA 1XI3A 3ZJ8A 4KWWA 3ID7A 2VFHA 3HG3A 2JFEX 4B15A 2V5DA 3KXQA 4XSMA 4LBUA 4CU6A 4GC3A 3MUXA 1HJQA 1EZ2A 2KAUC 4Q33A 1C93A 1WKDA 2VR2A 1X97A 3PZMA 3SCVA 2W0UA 2NX9A 3WDPP 3WLLA 2PDQA 1VEOA 4KRTA 2VOTA 4BF5A 4CGTA 5CAHA 1VENA 2ZXAA 1FKXA 4O14A 2AL2B 4YHEA 1QXLA 4DBUA 2YL8A 2XIIA 2PAJA 4MB3A 4MM1A 3RO6A 2WJZA 3Q37A 3HU7A 3C56A 1UR0A 4W9TA 2X40A 1EJXC 3UWUA 3N18A 2OXNA 3QV9A 1G4PA 3EDDA 1OYAA 4PSPA 2CLPA 2VEPA 5ECUA 3E0FA 2C14A 3T0TA 1RP8A 1UB3A 1W5OA 1OWQA 2J8FA 3CO8A 3TA9A 3ATZA 3L0NA 2R14A 1DJIA 4L7ZA 2C0HA 3GVQA 4DLMA 1GTHA 3B8TA 1AJ0A 2CLFA 3PJUA 1EZWA 3CMFA 1YX1A 4BQ2A 3VGGA 4KBXA 3BAIA 3H7UA 1W1IE 2Y63A 3SO7A 4QM1A 4FS9A 2PDJA 1L2QA 5TF0A 2EPKX 3LRMA 4PRWA 4W89A 4XX6A 1XISA 4TR9A 5K9DA 1UR4A 4DBWA 7TIMA 2VR5A 1BXCA 3TOYA 2J8GA 1IE7C 3O6CA 3ISIX 2OWXA 4MNMA 1HIZA 3LDVA 3NFUA 4AZHA 4C7GA 4C6LA 1I2PA 1QI3A 4DJDC 3W27A 2G37A 4H2HA 3TAOA 4ZTXA 3NL5A 2XHYA 4GKLA 1SQ7A 4X60A 1I1WA 5ABGA 2WVVA 4HA0A 2QGHA 5LA1A 4LH8A 4MAVA 2HNEA 1SJAA 4RUBA 1YPXA 1EXPA 4IXHA 3DFTA 4YTUA 3QQ0A 4IGNA 3W4RA 4E2OA 4AVOA 3K4AA 3AROA 4GC4A 4QP0A 3K13A 2GDUA 5CZJA 1VP5A 3DU0A 1TWIA 5FKYA 4O11A 4L4PA 3S46A 3OZMA 2CCRA 1AD4A 1XH1A 8TIMA 3CUFA 3NQ8A 1QK2A 4UTUA 4OKDA 4F2BA 3UERA 1XGZA 2XSBA 3V18A 3P7YA 4YTQA 1MMFA 2G3MA 1SMDA 1TQXA 4WIWA 2Y5EA 4MY9A 1XIIA 1C7SA 3UZJA 4H7ZA 3U4AA 3PNUA 5KZDA 4ZL1A 2VC6A 3C8FA 3NM3A 1WP6A 1XBYA 1RJPA 4OJYA 4JQAA 1GOWA 3VK5A 3C2OA 4KRZA 4HN4A 1I2RA 4F48A 3BOLA 4JKKA 3PBUA 4XVDA 3P74A 1QO2A 5TBOA 4NY2A 4O57A 3AS0A 2YYUA 4GUIA 2J79A 3NWRA 1JZ4A 3I3BA 1IZCA 1HKJA 1EOKA 2XYLA 4LVDA 5F2MA 3M1ZA 5SWUA 3CZGA 5IRPA 4Q4QA 2XIMA 2VZUA 3EWUA 2O9PA 4BI6A 1E9YB 5HNRA 2WVSA 3FW6A 4C7FA 4OFCA 5IOBA 1MFVA 3GZ3A 4GVIA 3M6YA 4R53A 1JXJA 3OB8A 5G4HC 3FOKA 3IJ8A 1SJCA 3S5YA 4I5UA 5F4WA 3TCSA 1XJBA 3GS6A 3WD4A 2FGZA 3UZXA 2V2DA 4NXSA 1BYBA 2RDUA 2VHLA 3GD6A 2OSXA 1AJZA 1UQZA 2GJXB 2MANA 1GEQA 1H7PA 1CGYA 3DCPA 3WQ4A 2WJDA 1W31A 3FEQA 1N8IA 4H9VA 4FLQA 2UY3A 2V38A 4FLRA 3TUUA 5B80A 3R94A 1SM9A 1KD0A 4B91A 3RJYA 2WSRA 1V6VA 3SJNA 1KC7A 1DKWA 1YMYA 4PCNA 3MY9A 4AF0A 2CKRA 1I8JA 4AFYA 3CB8A 4IGHA 1MEIA 3TP4A 2OWCA 4I9JA 2PD9A 4BF7A 1FWJC 4O28A 1NJJA 3BZGA 1MWOA 4B90A 1Q6DA 4N0RA 1VFHA 3EPOA 1ZLPA 2G95A 1FHDA 3BLKA 1A5CA 3DFOA 2I17A 5BXTA 1E9ZB 1DIEA 3N9SA 3EMQA 4XZMX 4PTVA 1J6OA 3QQWA 1U30A 4JTAA 5T8GA 4Q4MA 4KCWA 1AQ0A 1GQIA 4NZCA 3K46A 1E6RA 3WK2A 3W1PA 3ITLA 3ANUA 4GYPA 5K2ZA 4DUWA 2PRLA 5DXXA 3MHUA 2I9EA 1PX3A 3NM1A 4JBRA 1KM3A 1UUOA 3CWOX 4YVPA 1JAEA 3VGFA 3E49A 4H8VA 4Z17A 3NQCA 3NZQA 2A3LA 3S8HA 2VXNA 4ZFCA 5HNUA 1EWDA 1A5UA 3RLHA 2VDIA 4U10A 2ZXBA 3WJXA 3WK0A 4MTVA 3GG0A 2V5JA 1J0HA 3GR7A 2YLAA 4RDWA 3QM3A 3MANA 3ZOAA 1LOLA 3TDFA 2WMJA 2NVDA 1LT7A 4JTIA 5D4YA 2EPLX 3TJIA 2Y5SA 2A21A 4C1LA 3P0XA 2I5IA 2PLKA 1KCKA 3A13A 1EGVA 1QRQA 3MMUA 3TJ4A 1H1ZA 1X6UA 1TJ0A 2V9DA 4UNKA 4AX7A 4LF2A 1KV8A 4ASTA 4CNPA 1VIZA 6XIMA 4S3CA 3GK0A 3L65A 3SBFA 3V5CA 1UC4A 3T1GA 5D05A 1H4PA 3VDAA 3AXIA 2CZ5A 1QASA 7REQB 1M1BA 3SIMA 1WDSA 5D30A 4QS6A 5TNVA 1A0CA 1CPUA 2QUVA 1W8SA 3LTSA 1X1ZA 2ISVA 3WDIA 4LVGA 3TC6A 2V68A 1K4GA 3M0KA 2REQA 2J24A 4DHGA 3SW6A 1PAMA 2G3FA 3M46A 5FL0A 4KEUA 3WMBA 4L61A 1HGWA 3IVTA 3UXAA 2V81A 3B0XA 3UYIA 3EKZA 1Q6QA 3EX6A 4GNKB 5EGRA 4AVNA 4FO4A 3IGXA 8XIMA 3PJXA 2FHFA 2V5LA 3LHVA 3UNTA 3TQ0A 1HJVA 4GBDA 2OZ3A 3R4IA 1WOBA 3AIBA 1S2UA 3LUTA 4Q6XA 1ESWA 3DENA 4XKYB 3SFKA 5A1AA 1UA7A 3PAOA 2J77A 4GX9A 4PTMA 3S5NA 4DBSA 3W53A 1MW2A 4LAZA 4LQ1A 4C91A 2B7PA 2QJJA 3OA5A 4K68A 3B8DA 1UR8A 4FI4A 3L0KA 3W86A 1H7WA 3D47A 3H70A 5I06A 1TKKA 4A35A 2R8WA 4PUDA 3RM9A 4P7QA 3VXGA 2DW6A 3OYZA 2VTFA 3FIGA 1J9YA 1EGMA 2XVNA 3MO4A 3OLGA 3NZ1A 4JXCA 1U22A 4NYUA 3PPHA 1Z3NA 1REQB 3PTQA 4C6QA 1UHVA 4JFSA 4HNLA 3WF1A 1VF8A 3N17A 3NJ3A 4IG2B 4KERA 1PDYA 3A4WA 1LRTA 1X98A 1P0DA 4M80A 1W9VA 4IOTA 3P60A 2PWUA 3KRSA 1B4EA 1OYBA 1B54A 2RH9A 1DL3A 1SJDA 4S3EA 4CEUC 4RDZA 1LL6A 4TTGA 1OY0A 1HZYA 4HKPA 3DFHA 3K4WA 2GOKA 1P1XA 2QDGA 3Q67A 2W6RA 1F05A 3NUKA 1MDRA 5C9RA 3AHTA 4AISA 4EIVA 5K9XA 1KM0A 4CU7A 4MNKA 4E2VA 1XD1A 3UWYA 3LPFA 3MW7A 4IMCA 3DC0A 4Z2IA 3UGVA 1QWKA 3NQBA 4F0RA 1YRRA 3B4UA 4US5A 4IF2A 4N9EA 4ZODA 4O1BA 4M29A 1FWHC 2F7FA 1A5OC 4LUTB 4DO7A 3B05A 5IFPA 3W85A 4LAKA 3WH7A 2VM8A 3STFA 2HZGA 3GU2A 1HG3A 1XBZA 4HB7A 1KQYA 2A1YA 2OQHA 3P67A 2J75A 3ARVA 1XSIA 1OFEA 5H8PA 1BRLA 2BHYA 1W1YA 3VE9A 4HNCA 4PL2A 4K8GA 3N3TA 2XWDA 1XBXA 3G24A 4LVAA 2GZXA 1TMLA 3G1FA 3EMZA 3CHVA 3WBYA 4UNIA 4G7FA 5LIYX 3DGBA 4S2BA 3A9BA 4DBDA 1WO2A 3UXDA 4JGDA 2BODX 3MV01 3EWDA 1OGSA 3LD5A 3EDEA 5REQB 3TROA 3W1LA 1LOSA 5BZAA 4LYQA 4AQLA 3HJEA 4DX3A 6ALDA 1XGEA 3TW6A 1MW3A 1GW1A 3O15A 2A0NA 1YKWA 3A24A 4XG1A 4KFPA 1O5RA 5I23A 1UH4A 4DXVA 2WNQA 5KINA 1WX0A 1CW2A 3VM5A 2DZPA 4GJIA 2BY2A 3W82A 5CBJA 3QEZA 3RJXA 2VR4A 2ABAA 2VEIA 1F6YA 2OLAA 4PMRA 3PTDA 1AFSA 3TW9A 2VC7A 1X8FA 3WNPA 3R0DA 3TSBA 1JZ5A 2C1HA 3GBDA 4EVZA 3WLMA 3VD5A 3OO2A 4DVOA 2VX7A 3SURA 4EANA 4FHAA 5I3KA 3S2NA 3W2JA 4F0KA 4XVEA 1UZDA 2XZ7A 2ZX7A 3RM4A 1BEUA 3UR2A 3DFYA 3KL3A 3LPPA 2YDQA 3N19B 1BKSA 4B5WA 1K77A 4IIFA 1S5NA 2J7EA 1MQQA 1W3NA 7ODCA 1FXPA 4Y9OA 5D33A 5AYIA 3VOFA 3LCGA 3BG5A 2CLKA 3S2CA 3KZSA 1OHLA 3ELFA 3DECA 1BGAA 4OV4A 1P0NA 4JTQA 4IQEA 4J2MA 2EEXA 3WYZA 3G22A 3O16A 3VCCA 1TCMA 5JMUA 3TWAA 5FOOA 4G1KA 1MZRA 4RE3A 1XIJA 5CPSA 4C1KA 1XS2A 1ITQA 3R2GA 3KAOA 2BASA 1HL2A 1TB3A 2D0GA 4W85A 3I10A 2NW0A 3O6AA 5DMYA 3GIYA 3EXTA 4IPJA 1C7TA 3GHRA 1I2OA 2QUNA 2XISA 2VGFA 3SM0A 1FCVA 3ZS4A 1LYXA 3W2MA 2ZADA 5HWMA 1YQ2A 3OP2A 2ICSA 3CC1A 5LGXA 2FLIA 3M0LA 3N12A 4X61A 3OPSA 1TJRA 3U9IA 4BQ4A 3ZSSA 4I6KA 1W1ZA 3LV5A 4ZOCA 1J4EA 2OG9A 5T9BG 4FIRA 4UR8A 1LWHA 1T99A 1R7AA 1KA9F 4EWJA 3G1YA 1TVPA 1K8CA 1DJXA 5J8LA 3GUWA 4TVCA 4GWEA 4U2ZA 1GKRA 1PIFA 3JU2A 1ZPTA 2FVMA 3KDNA 3T81A 2HVNA 1QDSA 4CNNA 1XIGA 3WBWA 3W7EA 2YCEA 1GCYA 2O7SA 4GMEA 1J96A 4B92A 4HSOA 4IICA 2NLIA 3TFCA 3MCNA 3LGEA 1GW9A 3P8JA 1FWIC 4DM1A 4XBSA 2OYMA 1OQFA 4L64A 3O07A 3JS3A 2WKJA 1LBMA 2QCHA 3GB6A 3S4TA 4KQNA 3RLUA 3WQ8A 4ORMA 4MF4A 1GVYA 4YLWA 1TREA 1K9TA 4AW7A 1YTDA 2WHMA 5CAKA 2XJ7A 1PX8A 4PMVA 4AD1A 2ZZ2A 4TV5A 3OVPA 2YCLB 4P7NA 2WANA 3D3AA 3TMQA 1GVIA 3QY8A 3B0YA 3AJ7A 1TTPA 2DT0A 3U6WA 3ORWA 1JEZA 1QR7A 5D02A 5HMFA 4D6IA 3TYAA 3SR7A 4AIOA 1YW1A 1R3QA 4WXZA 5LA2A 3H24A 1BFNA 2E28A 3H54A 4AHQA 5C6MA 4ML9A 3WCZA 5CG0A 4DZ5A 2UY2A 4X9YA 3ARTA 4GKTA 2V5CA 3GQYA 3VGEA 3WJWA 3GKAA 4F9DA 3NO5A 2HDJA 4O0ZA 1RP9A 4KF1A 4MB5A 1BXBA 1RLCL 4LUJA 2E40A 3GWQA 2Z28A 2W3ZA 3H8AA 5CPTA 4D1IA 3LHUA 2D24A 3W84A 2XIOA 4TV6A 1IR2A 1QBAA 1JFHA 1UQYA 2XUCA 2QW5A 3KE0A 4OHQA 4DNMA 1EUAA 4JDBA 3B9NA 3O05A 4Z2GA 2IQTA 3TXVA 3DBPA 4GCAA 1XYLA 3W1XA 2D2HA 3L4ZA 3MZ2A 4MDPA 7PTDA 5F4SA 1EO7A 5HK4A 4LS0A 4PMJA 5EA9A 1UWUA 3S5SA 1KM6A 3O63A 1YDOA 1ZTVA 3MPGA 4AYGA 4A3YA 4WDTA 3E0VA 1PXGA 2VCCA 2BB0A 5HAOA 2ESCA 4GO9A 3DN5A 4EK7A 2VL4A 3VZXA 4A8RA 3W7RA 4F8XA 4FX7A 4O50A 4B3ZA 3U4FA 2WJFA 3T44A 1H1NA 4ZOEA 1A5NC 2E77A 4PN2A 5FEWA 1DQWA 1P0KA 2NUXA 5G2IA 1U5HA 1RVGA 3EOSA 3EOUA 1DV7A 3RPDA 3PAJA 1S2VA 4AZ6A 5RUBA 1R30A 3GTFA 3KHDA 2WQPA 1VFTA 2VEKA 4JN7A 3E74A 4HYVA 1TPC1 2GK1A 1TTIA 3SRKA 2B0MA 4JPGA 3STGA 2A3CA 2G3JA 3RX3A 3EBVA 2WMIA 1S1RA 3CHFA 4JTKA 1GPWA 2ZOXA 4RCXA 2X1IA 2QCCA 3GXMA 4X2RA 3VKJA 5MKGA 2PF8A 1XDJA 4NKCA 2XGBA 2Z6JA 3AIQA 2FZNA 5I79A 4HNOA 1HP5A 1E0XA 4DJDD 5M2FX 3TN5A 1PVNA 1JUEA 1RD5A 4HQVA 4U33A 4DJFC 4J3WA 3SN4A 3T40A 3WH5A 3CWHA 1WDDA 3LGGA 3AXXA 1H1YA 4NJHA 5T91A 5J04A 2D3LA 4ZOAA 1TR1A 1XUZA 1QUMA 2PDHA 1W5PA 1LRQA 3M0MA 1CXFA 2FZMA 1LRNA 2C0AA 3KLKA 3OVQA 3HV9A 5KTLA 3G1HA 3T07A 2FTPA 4FEZA 4PUMA 1FDYA 2H9AB 1XRTA 3WLOA 1K7EA 5LIXX 1G6CA 1MW1A 1LWIA 4JQ3A 1AZ1A 1HXJA 3FAWA 2KX9A 4JCLA 4C6PA 3DESA 1P0EA 3KZPA 3A47A 3LPGA 4W93A 3BL3A 1UZ1A 2DT1A 4LAMA 2H3BA 1LLZA 2PDWA 1UR3M 1M03A 3WLSA 2BY3A 4HK7A 2MUCA 4OBTA 3T0AA 2VRQA 4PTDA 4ADUA 1RHCA 4EPEC 2Z2BA 5A8MA 3QH2A 1HKMA 3WQPA 3VE7A 1JF6A 3NDZA 3E3HA 2GVJA 3C3UA 2WC4A 3BAXA 1KFJA 3BW4A 2JEQA 3P93A 5K4XA 1MXDA 2J7HA 4K39A 3IUDA 4NJGA 4Y9NA 3RUBL 5KZ6A 4XZ9A 3WENA 3G6LA 1M5WA 1KWGA 1G4EA 1PWMA 2P10A 1TV5A 4Y9AA 3NL2A 4DWSB 4NX5A 4F0HA 5D04C 1ISYA 2IW0A 5CZTA 2AAAA 4LTSA 3KEHA 4DPQA 6TAAA 1F3EA 1XCWA 3VKBA 2CBUA 1FA2A 2PP3A 4GQGA 2CKSA 2WZEA 1CLXA 2BV9A 4IMGA 1EA0A 4UOZA 2TYSA 3CM4A 3ZT5A 3WD2A 4AZCB 4XKMA 1S2TA 2PEVA 2DGAA 4BA0A 1SU5A 3GFZA 1YXYA 1GVSA 1B2YA 4KESA 3FFSA 1XLAA 1DWJM 4UTLA 1IEXA 2Y4SA 4AC7C 4GNJA 1GTEA 3IAPA 4JEQA 2Z1XA 4GG9A 4Z0SA 2XVPA 4P61A 1ZSXA 4H8NA 4U4MA 3BW3A 1PHWA 4BZYA 1JDEA 4RE0A 5I0DA 4H9YA 1W2PA 1QU4A 1TQJA 3BPWA 4F0LA 2VWTA 1KM4A 1YIXA 5BMXA 5C2CA 1VS1A 4TVUA 3EDFA 2CZFA 1LCOA 2QNEA 5CZ0A 4DWSC 1YHTA 1W3IA 3HURA 1R3TA 4FK9A 1UBSA 1O4UA 3KP0A 2J13A 5LNVA 3GC4A 1FWTA 3FNDA 4LVFA 3EPMA 3KUMA 4PMYA 3F7JA 5HR7A 3M5XA 2ZTKA 1NOFA 4HYWA 4JIRA 3LI0A 4AD3A 3VOJA 1M04A 4OECA 3VI2A 1TZ7A 3HTWA 4EPKA 4MG4A 1NWTA 3VOIA 2FZ9A 1X1OA 3EWBX 1PJ9A 3ANVA 2JKAA 3PVFA 4ZO9A 3P80A 1Q6CA 3VIOA 2R6OA 2C8NA 5KITA 1O60A 3BAYA 1JYNA 3VKDA 3BC9A 3RYSA 5C9UA 1NEYA 2VDHA 1ENUA 4JTHA 4GQRA 4HU0A 3VZYA 2NVCA 3BICA 1O5QA 2WLYA 1GYNA 4WJXA 4PH6A 3UF9A 1JQVA 5LNRA 4RNFA 5CXPA 3U8GA 4LVBA 5U4NA 3AWOA 2GPTA 1N82A 4BR1A 3UJRA 2UV8G 4REQB 2GGIA 5CJ5A 3TEVA 3MUZ1 2BLEA 1PKYA 4G7EB 4J3VA 1OC5A 5DRCA 2E3ZA 1NOUA 3FXGA 1TWSA 2TRSA 2OEKA 1R0MA 4IX2A 3MMTA 1B3YA 1DPMA 5AVNA 5AHLA 3SY5A 2R1MA 1ITCA 3VX1A 4HZ6A 3AXMA 1L6SA 3R8RA 3INPA 1UASA 3HV8A 2PI6A 3NDYA 3M7WA 3CL8A 4Q4OA 1QW9A 4M1BA 4Q8PA 5IBXA 2VWSA 4FX6M 1RBLA 2OU4A 4DZAA 2UBPC 1NVMA 1U5VA 5F2GA 3R1ZA 5EB8A 4JHMA 4JTDA 4WKFA 3GIQA 2GJNA 4FOKA 2VMFA 2YPIA 4RZ4A 4GVFA 3LSCA 1K9FA 2WWDA 3NSMA 4JTLA 3W25A 5G5IA 1ADOA 2QXWA 3UQNA 1DJZA 5HQLA 1SJBA 5CC6A 1XIDA 4RKAA 1MXSA 3EDKA 2DZSA 1OINA 1R2SA 3ZLFA 4P8VA 3FYOA 2QUUA 5G2WA 2GQAA 1CGTA 1J93A 1H3GA 4N4QA 1UA3A 3KRZA 5EL1A 1KR0A 4R85A 3W26A 3ES8A 1DIOA 4KPLA 4HN8A 1IIGA 1EXBA 4NL1A 1GGOA 1VYRA 4W7VA 1FWSA 2J9YA 3GXPA 2PDFA 3T9PA 4ATLA 2EG7A 2DUXA 4LPCA 3OIXA 1NU5A 4LALA 2DEPA 2CHOA 4LRTA 1W5MA 3K8LA 1RD6A 3SSJA 1ZBWA 4NP7A 7TAAA 3MB9A 1UZ4A 1LLWA 2AKZA 2OTDA 2YFNA 2RDXA 4TTUA 2GDVA 3VDHA 1OB0A 3W23A 3TONA 3WLNA 4KCUA 1N7KA 3ITYA 3BOXA 1HGYA 4QSHA 1ODUA 2BOFX 2CW6A 4JIQA 3F2DA 5GQBA 3FVMA 2PD5A 4UTKA 5I07A 3KS5A 5DCEA 4DB7A 3B8WA 3L2LA 4UFKA 6CGTA 2BDQA 2JQXA 3B8VA 4E4FA 1WE5A 2ZX8A 3BAKA 3QSRA 4B16A 2DSVA 2NXIA 4IL2A 5A8NA 1UWIA 3SQSA 2PSNA 1E40A 3ABSA 1FFQA 2ZVRA 1YADA 3BLFA 1K9EA 3S1GA 5BROA 1EX5A 4OUIA 1JL8A 4QCEA 5C71A 3LRLA 1XLKA 2IXVA 4QQUA 3TOPA 4MIMA 4QE1A 3PG8A 3XISA 2GUYA 4MPQA 1XV8A 1ISVA 3QC0A 1RR2A 3TK7A 2CBVA 4IJRA 2VDGA 4QDPA 1ZFJA 3W7CA 1A4MA 3QOMA 1J12A 3UYCA 4JR5A 1L9WA 1FWDC 2ZXDA 5BOFA 2QIIA 3G0UA 5BRPA 3CYJA 3M0ZA 5DN1A 1XXXA 2PTXA 1GPFA 2EXOA 3PJWA 3LNPA 2Y7EA 2E8YA 4UR9A 1V6TA 2ZRUA 3CUXA 3RMEA 3QQ1A 4W7UA 4CNTA 3VIIA 1EJ7L 1XLIA 1XH2A 3LX9A 4MWAA 4QJ5B 2ZA2A 2CERA 5A6BA 3JRKA 3T2QA 3FKRA 1LQ2A 3DDMA 2GSEA 4S38A 2PTWA 3RRXA 3O0KA 1B1YA 4CD7A 2BS9A 3U5YA 1I2QA 5CGMA 1XYBA 2ZKMX 3AYSA 4ZB2A 3QW3A 1VZWA 4JTUA 5LXEA 4IP5A 1JNEA 2ACUA 2EF9A 4HPJA 4S3GA 2F6KA 3PFMA 1VFUA 2DZXA 4M0XA 1NDZA 4K1GA 4L56A 1UW9A 2YXOA 5U7SA 1PE1A 2DV0A 3QC3A 5C70A 1P6WA 1ZAHA 3VOHA 3U2OA 3LK6A 5A2BA 3EB3A 3UJFA 5AY7A 5FSDC 3CQIA 3L5LA 3H4WA 4YTTA 2AQWA 1HFBA 2PDNA 2HS6A 2IPJA 2DSWA 3FAXA 3KTCA 3V1PA 1V3LA 3VKCA 1XGDA 4WSJA 1EQCA 1TPWA 3EWWA 2G3NA 5BWFA 4PBGA 4HVXA 3OEXA 3MKCA 4MLRA 4RDYA 4FNQA 1HKVA 3VPLA 3W7PA 1H49A 4PCTA 1TJPA 2VZOA 1EDGA 3AC0A 5HR6A 3UR8A 1B0IA 1HNYA 1O94A 1VBJA 1AW2A 4GCXA 1W1B1 1XYZA 5T9CE 2ZA1A 3UR5A 2OZ8A 1UPPA 1LZOA 1WKYA 2A4AA 1H41A 2CETA 3UFYA 3PBMA 3GYCA 4AZBA 1XLDA 1TPEA 2FJUB 5REQA 3ABOA 1OD8A 5LXXA 3MMDA 2BXZA 4IIGA 2EPOA 1JZ7A 2Z00A 2HTMA 1TIWA 4TX9A 4M82A 4J9JA 3NDOA 2E9LA 1Z69A 1ZJIA 3IPWA 1I2NA 1GG0A 4IFRA 3NOYA 1V7AA 5I3GA 2EG6A 4C6IA 4NAEA 1CX9A 2W92A 2XVKA 3E5BA 1J0ZA 3VKAA 1TIMA 4GFSA 1Q6FA 3BW2A 3F4VA 4JHZA 4UOQA 1PO9A 4RZ6A 4G6CA 1OK4A 4QRNA 1KW1A 2O4QA 4FP1A 4HU4A 3I65A 2J7CA 1KRBC 2HK1A 3L66A 1G94A 1FKWA 4H3DA 4JX6A 5C9ZA 1J01A 1WCGA 2QCFA 2VX4A 4MB4A 4UXDA 4M5PA 3WEZA 1FWAC 4G8TA 3FKKA 2V5BA 4OOUA 1UMLA 1YLVA 4OBRA 5JIPA 3PUOA 3MJMA 2GVGA 1XIFA 3R8HA 3GFYA 2EPNA 2FHBA 4U5KA 1POKA 3AMKA 3RR4A 4Z2HA 3Q45A 1XIBA 1Q6GA 2GVLA 2E5CA 4QFUA 3OIHA 4W84A 4C6DA 3G1XA 2WKLA 2BY1A 6XIAA 1KFLA 5D9OA 2OLSA 3LTYA 3W7QA 1F3WA 3ARZA 1O68A 3OG2A 2PDBA 3WQFA 2ZDSA 1CGVA 2ZRYA 4GZIA 3H2MA 5EBAA 2QCLA 1EPXA 5GPRA 5HA7A 3PB2A 3JW7A 5C2XA 3H2NA 3S2LA 4ZEPA 3FVDA 1N8WA 3MSDA 1XLEA 4GRSA 4I7UA 3WN6A 1K02A 3NXLA 4RE2A 4BY3A 1JYVA 3G1RA 4QHRA 3S47A 1QCWA 4N9CA 1I4NA 2ISWA 5DCBA 1BTCA 3DHDA 2VURA 4DI8A 2ZQ0A 4JL1A 2XH7A 1O1HA 3C8NA 5FEXA 3VGHA 4N9BA 1HO4A 3IUHA 1IXQA 1D3GA 2ZCGA 3MSYA 3C0QA 1OD0A 4O0QA 3AHYA 2GVYA 3ZJ6A 2PU1A 3OVRA 4EXQA 1V3MA 3A3HA 3GE7A 4IPNB 3VIFA 2D22A 5KZEA 4EAYA 5DMLA 5KEZA 1W1PA 1BF2A 2Z29A 2I9UA 3WF2A 2E09A 4JTFA 4QDMA 2B7QA 3CYVA 5HQEA 4MADA 2Q8LA 4MWAE 1QHOA 5E9XA 3L7RA 6PTDA 1JZ8A 3AAMA 1VCFA 1W3JA 1OIMA 1J5TA 1NWSA 3GNXA 5LKYA 2CLMA 4M3PA 2OLHA 1VPXA 4WY0B 3QTPA 1DTUA 2JK2A 3BJFA 3RNDA 3BMXA 3L21A 1R3RA 3PUGA 3PUEA 2PP0A 3WFAA 1K6WA 2V5KA 3TTYA 4AUBA 1SZNA 2JGQA 4UQAA 1MUMA 3LV6A 1UH3A 1A5LC 3UXLA 4ZGYA 4YHGA 3PN8A 3TIMA 1XLHA 2HE8A 3LLFA 2D1ZA 4JN6A 4K6AA 5CZKA 2YCLA 4LEQA 2O0TA 1MW0A 3MU7A 4AZ5A 3ZVHB 1H7NA 4B3LA 4FX8A 3H6OA 3FSUA 5C7HA 2POZA 2DSKA 1JDAA 4C1NB 1GORA 2VJXA 1RBAA 3WSUA 5DT7A 2E7FA 1O1ZA 5DBUA 4A3QA 3FX4A 2G0WA 3R43A 2HJPA 1F07A 3RCNA 4GYPC 4NIRA 2CEQA 2QAPA 4GISA 4XB3A 3W2NA 1H2JA 4LYKA 1UIPA 1EA9C 2VVSA 4RV3A 3W81A 4Y9PA 2V2CA 1E3XA 4MNJA 1OIFA 1H11A 3CIVA 3K2GA 1WUEA 3EA2A 4IPIA 1X8CA 4DYJA 3P3BA 2WHKA 4PR4A 3NZPA 1QOQA 4V1YA 3QY6A 1JCMP 1VJZA 3QJAA 2BXVA 1UKSA 1XQKA 4L4LA 2J9ZA 1SZRA 4D8AA 2EPHA 3TSDA 3IJLA 2FZBA 2JF6A 1F7BA 1NDWA 4GOAA 1XC4A 2BOEX 5HNNA 4E5TA 1ITUA 2EAWA 1TVLA 1XFBA 3MI6A 1BG9A 4R7WA 4Y7EA 3LHYA 2C19A 4RXFA 1KFEA 1SW0A 3QLDA 3DHFA 4C5YA 1QHZA 4TOQA 3B0UX 2G50A 1GHRA 3B0PA 3UW6A 4EAMA 4ACZB 1E5JA 5BW6A 2OT0A 5ABFA 2BGQA 2E6YA 3CMGA 1QOXA 3EB4A 5M17A 1WDPA 1NDYA 4NXKA 1IZJA 1WKFA 3GTHA 3NZGA 5C9WA 1QI2A 2LLEA 3R8GA 3SY8A 2PWHA 4C6CA 4ADTA 3IJDA 2NUWA 1W9UA 3F2CA 1JZ3A 1O95A 3WBAA 5H1WA 4AEOA 1XINA 4HTBA 3AYTA 4UR7A 3NZRA 1WZKA 3FJNA 3ZM8A 2DSUA 4ZSTA 1XWYA 3F5KA 3LZ5A 5EMJA 3LPOA 5A6TC 5CSYA 3ALGA 2ZUTA 1LT8A 3URBA 4UWMA 3C2VA 1QNVA 3GSMA 3TSMA 3NL6A 1RK5A 1WB0A 1XX1A 2Z1VA 4DLFA 1Q6EA 3ZXWA 2Q6ZA 1CWYA 3I7QA 4YN5A 2F2HA 4LW7A 3P8IA 1EEPA 3V36A 1E4NA 1J0IA 3W87A 2XH2A 4H04A 1CXLA 4GGHA 4H4IA 2XFYA 4EF8A 2P3EA 4Y90A 4MMWA 3GH4A 3KBNA 1O5KA 2DORA 2QCDA 4HZMA 3MBFA 1JCTA 4GYJA 2E8ZA 3ARQA 3WG6A 1C9WA 5HPOA 2D2OA 4FXJA 1PTGA 2E4TA 1QPKA 1T7LA 4RZ5A 2EKCA 2TMDA 3MJYA 2ONEA 4EF9A 1A5SA 1ZQ5A 2XSXA 3W1NA 2H9AA 1CCWB 4JIPA 1E0UA 4AD4A 2DDXA 4HCHA 1QI4A 3G3MA 3M6DA 4HMCA 1C90A 3GAKA 3FYYA 3CPUA 4S39A 3ZVIA 4H6QA 1BVNP 3AIWA 4ZBCA 3EXRA 1S5WA 2V82A 5CBIA 1C8XA 2NWRA 3G0SA 4EOUA 2VGIA 4S3DA 3GIPA 5CCZA 4CQBA 3VFCA 4QEHA 3DXIA 4E8CA 2PC8A 3ANYA 4DUOA 1TPVA 6TIMA 2IKGA 4XISA 4DWSD 3ZSTA 1Q45A 3L5MA 2HXTA 4WCJA 4HNTA 3BXWA 1SVDA 1UP0A 3KCLA 3PY2A 3PR2A 4JYEA 4GZ7A 5AYXA 1VPQA 2GGGA 3LHTA 4IISA 2A79A 3A3WA 2GOUA 4K8EA 2DJLA 2ZA3A 4OU1A 4RZBA 1FBAA 3VMNA 4O18A 3H2FA 4Q3MA 1V0MA 1IEWA 2QUTA 3NQ7A 4PC8A 3VO0A 5BCAA 2HWGA 1P1MA 4J40A 1W9DM 3SCNA 4A8IA 3VUPA 4UZUA 3HGSA 1H0GA 3AU2A 2ZUWA 4UNLA 1JG9A 2Q71A 3BLIA 2PLCA 3W7IA 4ATWA 3M7SA 2TODA 4HNNA 1V3IA 4QAWA 4GXMA 1SO3A 2H90A 1SFJA 4NJJA 3MCMA 2ZRWA 4ZE5A 1DQXA 1W5NA 2HE5A 1KFCA 4AZCA 4YYCA 4E3VA 2J4GA 1EJRC 1EYEA 3TYZA 5D9MA 1JD9A 4WEVX 1E4IA 4MLJA 5I24A 4DF1A 2BMBA 1X96A 2I57A 3AUOA 1GONA 3OW1A 3CT7A 3W7DA 3BSHA 4HPHA 5E0CA 3VNMA 5I00A 4PUEA 2XFRA 4CN4A 4ERGA 3IVUA 3GBEA 5K9CA 2BHUA 1Q65A 3QLLA 4Q4PA 3M0JA 1UPMB 4TVDA 1B3WA 2X42A 4IZGA 4QLLA 4KEMA 4GIYA 5IDZA 2BVYA 3BV4A 3QMRA 3SB0A 4PULA 8RUCA 3WK1A 3CUGA 1W1TA 2NQ5A 3NTYA 5C8BB 3WQWA 4E0CA 5DXYA 4KCVA 1XRFA 3R5EA 4K36A 5F1UA 4UZSA 5BRQA 3ATYA 2XZ9A 4D6FA 1W3HA 4LYPA 2QHAA 1EKOA 3SGGA 3C5QA 1PSCA 4JDYA 1OABA 3MWCA 1Z41A 3GTNA 4JOMA 2WAGA 4IFKA 3UZZA 4YTSA 4O1FA 1LUCB 3CLMA 3OYXA 4LGXA 3IACA 1V6WA 1RVKA 3QKZA 1NP0A 4NAFB 3V0SA 2F84A 5BNKA 1NDVA 4XTDA 2IPFA 3W88A 4J4KA 4WGHA 4F0SA 1R6WA 3QHMA 4FLOA 4FNTA 1H09A 4MJ2A 1DHPA 1T0OA 3CH9A 3CMJA 3UWQA 2V3GA 4B4HA 3IEBA 3KVLA 4GQBA 2NQ9A 2X8RA 3B8IA 4ZTYA 3WDQA 1GOOA 3D46A 4XD5A 2QVHA 4X22A 2PRMA 3BLEA 1CB2A 1FWFC 1A5BA 4INFA 4CCEA 2PBOA 3D3FA 2C16A 3ZQ9A 4H8UA 1UOKA 2FQIA 4HMEA 2YA1A 3CLWA 1I60A 1RUSA 4XAFA 2R82A 4BQ5A 2ZX9A 3V7PA 2I5QA 1UKQA 2ZWZA 3LI1A 1H63A 1JI1A 1B90A 1B30A 5LHFA 3LRKA 3REQA 5ENLA 5AVHA 1SR0A 4F2TA 4I8DA 1SW7A 2R1LA 3DUGA 3G1VA 1QW8A 1KLYA 3URQA 4RR4A 2FDSA 3A4XA 1K7FA 5D2YA 1B9BA 2Q02A 1XDLA 4NZJA 1U1UA 2PWGA 4BWLA 4IJCA 4DYEA 4LYRA 4RNIA 1K70A 3UG5A 2JGYA 4ROQA 1ZAJA 4FA3A 1U2YA 3G8RA 5E0KA 3II1A 3UR7A 2XGIA 3W71A 1FRBA 1VEPA 3M0YA 1UZHA 3BUVA 4O4VA 3QVQA 5EPDA 1FY6A 3R6IA 1BWLA 1AL7A 4MUZA 1I0BA 5FCZA 5EMUA 3HFTA 1QPRA 3DI1A 1U1JA 1B31A 4XWUA 2IMRA 4C60A 3BJTA 1CT5A 3CGTA 3WLKX 3FA3A 3K30A 5CEWA 4GZJA 3SGUA 5TQLA 4U3AA 2CZDA 3LCWA 4I9MA 2WM1A 4XO6A 2UWFA 4MDOA 4M6VA 3WF3A 1QPNA 1XD0A 3DX5A 2OYKA 5J5DA 2H6RA 4IH3A 1QPOA 2FGLA 2RFGA 4LT9A 1ZRQA 4MNLA 1LOQA 2PUZA 1EO5A 1VC4A 3W70A 2NX1A 2ISSA 3N2CA 1N55A 3F03K 3U57A 2HSAA 3S5ZA 1JAKA 1MZHA 3G6MA 2DZTA 1X6LA 3CWNA 2X1UA 1F6KA 1R9YA 3TQKA 1D9EA 2DZAA 1T5AA 2I5GA 1TFVA 3S6TA 1A3XA 1GOKA 4KETA 2X7VA 1J0JA 4UTHA 3DG3A 3TLQA 3HG4A 4Z2KA 3PZGA 3VD4A 1UH2A 1JI2A 3SCOA 1L6WA 3LY0A 2Q3RA 3N2BA 1XLGA 3OOQA 1PZ2A 5HULA 1OF6A 2X1SA 1JYXA 4IL0A 4R34A 4AB4A 1A49A 2X09A 1KXHA 1PB0A 1B4KA 4Q7BA 1KRMA 4O8AA 3WMCA 3TJXA 3ONCA 3TN4A 3L4YA 3GVWA 2GGHA 2WWCA 3DFSA 3L23A 1UWRA 3JVAA 4FSAA 2PB1A 3QBUA 2WMIB 1V7YA 2HROA 3AWNA 3KCOA 2YCIX 2H8XA 2PGEA 4UUIA 3FHAA 1A3WA 3PHAA 1QHPA 1TMHA 1E1CA 4R3UA 4B5VA 1SFSA 2B7OA 3B4YA 9XIAA 4K1WA 4NU7A 4LV4A 2V30A 3BLPX 3B40A 5C54A 2QUMA 3PFRA 4LF1A 1CECA 4PTWA 4P8UA 3K4DA 4N02A 3G77A 1RZMA 1XIHA 1AD1A 4S2CA 1ISXA 5FACA 3GUGA 5CPQA 1TVNA 2BOGX 1OM0A 2DIKA 3BURA 4P5UA 1XQLA 2P76A 1CXKA 2C1GA 5AC4A 4NILA 4Z1AA 2DJXA 3PTMA 2CXGA 5GJNA 3GVGA 3G2GA 1A50A 1GOXA 3M0VA 4UC5A 3QMSA 5EMMA 1D3CA 2FVLA 4F40A 1V3JA 3EEGA 4O17A 1Q2SA 5D9NA 1I9CB 4LXFA 1IYXA 1MDLA 4WY0F 1E0WA 3IJIA 4QS5A 2OEJA 1LBLA 2L5HA 4LSBA 3H7VA 5G4WA 2DVTA 2YJQA 1VHCA 1QTWA 2WZIA 3NR0A 2Q8XA 4UMCA 3M5VA 3NYDA 3GDRA 3MT1A 4O1AA 4QLKA 4ICNA 4OGZA 2FVKA 3SADA 2V6AA 4LUYA 4J28A 3PANA 1F4AA 1KCZA 2QJHA 4D6JA 1RJRA 4KIRA 3V0TA 4KMQA 3THQA 1TWWA 5G1TA 2GSJA 3KRBA 4IPLA 4CN1A 4TUFA 4B5SA 3W83A 1QVBA 3LMYA 5E93A 2WO5A 1M7JA 2XH4A 3O1NA 3HGJA 4NZ5A 1EHNA 1FXQA 3G8EA 4L6DA 3CXOA 1J18A 4CQCA 1ONXA 1QNQA 2IKJA 4NNBA 3PG9A 2XVLA 3BGAA 1IXNA 4ENLA 1A3HA 5CSRA 3VMOA 2Z4GA 4QE4A 3LHZA 3W1AA 1EEXA 1AG1O 1EJTC 2CITA 2Y88A 4B4FA 3KBWA 1MNZA 3S5OA 2AGTA 3ZYZA 4DN1A 1EP2A 4AD0A 2QT3A 3W1QA 2D3NA 3CL7A 3DFNA 1MRQA 3W37A 3GNOA 5LIWX 4DF0A 1I45A 2VP8A 1S1PA 1BLIA 2VZVA 3KX6A 1FX6A 1KM2A 5IXEA 3R10A 1GVFA 1VBUA 4TXEA 3W2KA 3V4BA 1OCJA 1P0BA 1VFMA 3O0FA 4HSHA 2OX4A 3VIKA 3ENLA 2OB3A 1KFKA 4HA4A 1WZMA 1Z48A 3WQVA 5HANA 4XAZA 3B06A 4GBUA 3BCDA 3W02A 1VGAA 1BSIA 1TG7A 4YL2A 1GWJA 3HIJA 5K3VA 5DMNA 4FR1A 3T2PA 1E9LA 1JRBA 3BH4A 4WUIA 4B5XA 3TX9A 1WQ5A 1E55A 3CH0A 4JD4A 3FJ6A 3GXTA 1E72M 1P7TA 2CFFA 1IT8A 2INZA 1QJWA 2ZUNA 5XIAA 3F2BA 1B9ZA 3QPEA 5CQ1A 1GOMA 2EHHA 3LQGA 4V27A 3RPTA 2Y6ZA 3GDBA 3M0IA 5H6HA 4OT7A 3RG6A 3MVIA 2WJEA 1J0YA 3NGJA 3U2CA 3NEHA 4K2SA 2VRJA 5I6SA 4KFNA 2Z25A 4WZHA 3CHCA 3UCQA 4DBEA 3D0CA 1H7XA 4ILSA 4O19A 4YVVA 4IPPA 2O9OA 4M19A 2QAFA 4GX8A 2W67A 3UCDA 3WUFA 4ERIA 2Z7KA 5HUOA 3LNMA 2E68A 3PBWA 3WK3A 4GO8A 3KOXA 5AZ1A 4FAMA 3FYPA 1E6ZA 1V0LA 5C2GA 3QGAC 2OWWA 3R11A 4LB4A 4ZOBA 4CVWA 3VYLA 3P82A 1P6CA 3L0GA 3GW3A 3E2QA 2YL6A 1Q2RA 1XSJA 3PZIA 3STCA 2WSYA 2VNCA 3VD7A 1NOWA 3ECQA 1TJ2A 3DKLA 5A5WA 1DWHM 1OBAA 2V2HA 1C8VA 4XUGA 3W7OA 4O1CA 1A5AA 3BWWA 3BANA 2OEMA 1XKYA 4ZXOA 1QOPA 1ALDA 1BTMA 1GOQA 1DJYA 4AMCA 2E67A 3RPMA 1SMAA 3EX1A 3VUSA 3TWBA 4X9SA 1J79A 2ASHA 3KL0A 2J6XA 4D71A 3E12A 4O13A 4MKNA 1KFBA 2NQZA 5ABTA 5CGQA 3BSMA 1EF2A 3EA3A 4HIBA 3W7MA 1B57A 2PMQA 3GC5A 3N2TA 1R47A 4AC1X 3KVKA 1TELA 5CGTA 1FH7A 1LROA 4W7WA 4JHOA 3PNZA 1FWBC 1UP3A 2OT1A 2YDSA 5MHBA 1XICA 1W9BM 3UJEA 4ZVJA 2JKEA 2E6FA 1A5KC 3OZYA 5M3WA 3GDLA 3F4CA 3WMSA 3UCCA 2FZDA 2QYGA 1NM9A 2EJ1A 2GSHA 3B8SA 4PUWA 2Z2UA 5BU9A 1IXOA 5A6KA 3EA1A 5FEZA 3W7HA 4H41A 1V4YA 5FF4A 2OOFA 2VYOA 1TR9A 3CASA 3ERPA 5CZSA 3GAYA 4R9XA 1FWGC 1MUCA 1CXHA 4I3GA 1Z89A 3MUAA 3WL0A 1LJYA 1SZGA 1UYQA 3RGTA 1TO3A 1XCXA 3GX9A 3RHGA 5JUVA 5AHIA 4UTIA 4GACA 1JRCA 2ABBA 3UG4A 4KW2A 4RL3A 2PDIA 1YE4A 2X05A 1UWQA 2KZHA 4LU0A 3C2FA 4WY0A 1M9HA 4DXXA 1NIUA 5K4ZA 3APTA 1IWAA 1XH0A 2Y89A 4ZXLA 4C5ZA 4DAFA 4PFMA 1JGMA 3KDOA 2OQYA 4BQ3A 3FK4A 4S3FA 3DAQA 3VOGA 1YE6A 2NT0A 3QGVA 1L6YA 3LZ3A 1HKKA 1BPLB 1EQPA 4IXXA 1OFQA 3ZVH