4US5D

Crystal structure of apo-msno8
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
331
Chain Sequence
HHHHVKLSVVEQAPVVEGLTPAHSLQHSIELARLADRLGYERFWVAEHHAEIFNAVPAPEILIARIAAETSGIRVGSGGVLLSLYSPLKVAEVFRTLHALYPDRIDLGIGRANRVKLPVFAALRDSSDDLWRRLEQLRAYLDPDSGLPFTVSPRMPGGPALWLLGASVSSADAAARLGLPYAYAHFITPDFTREAMDTYRAAFVPGPDTPSPRPILSVVVCCAETDAEAQRVYATHRLFHRRMSQGDVRLLPPADLAVAEMDKPGPDPLAEESFEWPRYVVGSPDRVRDQLTKMADATGAEELGVVSMIHDQRDRLRSYRLLAEAFELTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUCIFERASE-LIKE MONOOXYGENASE
publication title Insights Into the Bioactivity of Mensacarcin and Epoxide Formation by Msno8.
pubmed doi rcsb
source organism Streptomyces bottropensis
molecule tags Oxidoreductase
total genus 115
structure length 331
sequence length 338
ec nomenclature
pdb deposition date 2014-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4us5D00
5AECA 3C8NA 2B81A 1BRLA 1LUCB 3B9NA 3RAOA 1EZWA 2I7GA 1YW1A 1BSLA 1LUCA 4J2PA 1F07A 5DQPA 3B9OA 1Z69A 3FGCB 1BRLB 3FGCA 4UWMA 4US5D 1FVPA 3B4YA 1NQKA 1NFPA 5LXEA 3SDOA 1RHCA 1XKJA 1M41A 4US5A 1TVLA
chains in the Genus database with same CATH superfamily
3HOJA 3A21A 3V5OA 2A3AA 3EDKA 2NV9A 4Q4KA 3H2NA 2OWXA 1IT8A 2XWEA 4L64A 2W3ZA 1EJTC 3WQ4A 4I6VA 3BW3A 4GKLA 3PAJA 1FHVA 1BG4A 1XYZA 1JD7A 4JBRA 2PDNA 2NSXA 2XG9A 4JEQA 4IFKA 2GQ8A 3C2FA 1PTAA 4QG8A 1M7JA 1UA3A 3W3OA 3WBEA 5LKYA 3T42A 2HE5A 2GSEA 4POCA 1G94A 2VT0A 2HRWA 3S2CA 1BEUA 2Z28A 2B81A 3UY8A 1PX4A 3AI0A 2DW6A 3ANYA 3LCWA 4GUJA 3KL5A 4MJ2A 3C5QA 3OLIA 2A6NA 4UTWA 3P8JA 2PCQA 4DBEA 4C1KA 1QI2A 3GZAA 1ISXA 1XINA 1NOUA 4PB5A 1C7TA 1WDWA 4WKHA 4JNZA 5BMXA 4DUOA 2A79A 1ONEA 1D3HA 4LANA 2DZBA 4Z2LA 4XBKA 5MKGB 4J5NA 1Q6DA 5FJJA 4MB5A 3WCZA 2CETA 4C6KA 2PZNA 1UA7A 4ZSTA 4ZOAA 4Z2KA 4UFMA 4J35A 3KRUA 2XSBA 5DELA 2G3MA 3CUZA 3N3TA 5KZDA 1Q2RA 2CZEA 1NDZA 4B5VA 3G1DA 4F2UA 2GJXA 4JOMA 1KRBC 2BP1A 2OX1A 4DVOA 1A47A 2D20A 3W1RA 2NVAA 3VD7A 3PAOA 1KM0A 4KWSA 3T4WA 2ONEA 4DO5A 4ROPA 3ZR4A 2VCBA 2INEA 3PWGA 1YQ2A 4PUKA 3LPOA 3ELFA 4XD6A 1IXQA 3RNDA 4DIAA 2XVGA 3N9KA 1FWFC 3LV6A 4E5TA 1KFEA 4UTWC 4JQ2A 4AZHA 3BTNA 4EF8A 3WLRA 2J47A 4LS1A 4QNEA 4RCXA 2ZICA 2YL5A 4JIEA 1Q3NA 5FL1A 1VLIA 4KGJA 3VCNA 4TVDA 1ZAIA 3KLLA 2WMKA 4CLMA 4EXAA 2ZE3A 5JIPA 2RKXA 4DEFA 3ABZA 4XZMX 4ZVJA 2FFCA 2NW0A 2W63A 2QVHA 3MMWA 4LOCA 1J0ZA 3UCQA 4GNKB 1EP1A 3GS6A 3SUUA 2F6XA 3O7UA 3B4YA 4JYFA 3UA4A 3TOPA 3ZFHA 1BWKA 4IWWA 1VIZA 1K03A 2X40A 3MB9A 4PBFA 3KVKA 3W00A 1TV5A 3RYSA 2WCGA 4XO6A 5CSYA 4MADA 4BI6A 1OFRA 1Z3NA 4CQ9A 1LBMA 2UZ9A 3BAXA 2CIPA 4GINA 1Z8AA 1TUXA 1UWTA 3VIOA 5REQA 1NH6A 2X1TA 4OUIA 1LOSA 4Z1CA 4TV5A 1KXHA 4AEEA 4I8DA 3RCYA 2Q8ZA 2OKOA 3GFYA 3PTQA 4A3QA 4LYQA 4J27A 1S2TA 4H8VA 2CLHA 2OPJA 5I6SA 5AZ1A 5B7YA 2ESCA 2J6XA 2R1MA 3LM3A 5CPQA 3BLLA 4PFMA 1OFBA 4L9ZA 3E0VA 2YA1A 2PDIA 1EHAA 2E3ZA 3K46A 1MFUA 4BQ2A 3KZSA 3W26A 1MNZA 4L80A 3BURA 3GVGA 1KFBA 2Z2UA 4HP5A 3M7SA 3TK7A 1SZFA 3C2RA 3L21A 4S39A 3G3DA 1K8YA 2R82A 2W79A 5KITA 3J7HA 2FZMA 3LNPA 3PWIA 3CZLA 2CBIA 3IIZA 4Z2IA 2R6OA 3VX0A 4JFVA 3FA3A 3UR7A 4NSBA 1JZ6A 3SQMA 5DRIA 3QY7A 5CC7A 2R1LA 1TB3A 1GOWA 2IQ0A 2Z26A 2ISSA 1WKYA 4K7VA 1LDCA 1O1HA 4QROA 4I3GA 3WQ5A 4Z0SA 3BH4A 4JTHA 1E5NA 1DHKA 3S4TA 3OIXA 2CBJA 5T9BG 4NJJA 4U2ZA 1GOQA 1S2WA 1FHLA 4Q6XA 4AX6A 3ZLHA 3KOYA 5G2HA 1K4HA 1QHOA 2Y8VA 2YZ5A 3ZM8A 4DY1A 3CTTA 1XPGA 1D7FA 2OELA 3FGCB 4HTYA 3ZQ9A 1E6QM 4XWUA 1HKWA 1JL8A 5D38A 4ZSUA 2P0IA 1TA3A 4TX6A 1RR2A 3PJUA 3ARYA 4BQ5A 4FP1A 3WEMA 1V3IA 2D0FA 2YW3A 3O8AA 3ALFA 5A94A 3PJTA 1JCTA 3LHZA 3TWBA 3QKZA 3CPGA 1XYMA 4GJJA 5EPDA 3PB2A 3TX9A 4MOZA 3N6HA 4UR8A 4UFKA 1ZFJA 4RX0A 1JZ4A 3AISA 1GVEA 3GTFA 3USBA 3U0HA 4J28A 1ODZA 4JFTA 4PULA 1H49A 1Q66A 1UD2A 1JAEA 1WPCA 1G6CA 1H5YA 2QJNA 4M51A 1MZHA 5LNSA 4GY7A 3T55A 4YJ5A 1TRIA 3MPGA 4C7FA 3ARXA 3TC7A 1N55A 4MB4A 3HZ3A 2J88A 1OF6A 2CBUA 3QMSA 2ZX5A 5DY2A 4JTFA 1EA0A 1FCVA 2NX3A 3CJPA 2BB0A 1VBUA 3A9IA 3CUFA 1WB0A 1SMAA 4JTJA 2VFHA 1EBHA 1SO5A 3SUSA 2I57A 3UNDA 3DG6A 1XSIA 3ES7A 3FS2A 1JXKA 4PUMA 1BVWA 4QRNA 3T09A 2RDUA 1IWPA 2DT3A 4JY8A 2BXVA 4MJ4A 4FR6A 2WJEA 4XZHA 1XP3A 2PBGA 4GACA 3WF0A 3O3RA 3QR3A 2J7CA 3K4WA 4X22A 3KOXA 2V68A 3G1YA 4C6OA 4AAJA 3O63A 4RZBA 1HQTA 1E55A 2CKSA 4PUJA 4C7GA 1GHRA 4DBSA 4QS6A 1ZZMA 4AZ6A 4XK2A 2PUZA 3F2DA 1UP3A 3II1A 1UKPA 4UMAA 2V3FA 3LCGA 1ESWA 4KCWA 1AQFA 1JG9A 5CPLA 3UQNA 2VYOA 1EUAA 1KFJA 1YDNA 2CBVA 2A3EA 4IFKB 2ZKMX 3GG7A 2TYSA 3FVMA 2E09A 5CSUA 4PMXA 2ALDA 3JS3A 2Z1BA 2PRMA 4HPHA 2QPXA 3N18A 3G1RA 3UY7A 3FEMA 2VR4A 1PKLA 1N8FA 2VXNA 4XD4A 1E43A 3RO8A 2J77A 1JUKA 4MFDA 3WH6A 3M5ZA 1UZDA 1H50A 2OG9A 1FWBC 1G69A 1HXJA 1BXBA 3LCXA 4O1EA 5A6LA 4URIA 4V15A 3W1NA 3AZTA 3MMDA 5K4XA 4LCSA 4CQCA 3PTMA 2JALA 5BU6A 1EZWA 5AHLA 1JYXA 1YXYA 3TXZA 1TPH1 4B4FA 2EKCA 3AO0A 4QBXA 3WUEA 1E9LA 3BSMA 2VEPA 4Q8UA 3LTYA 1UOKA 4TQTA 4JTKA 5FJUA 4H9XA 1SJCA 4LVBA 3H2EA 1JNDA 1QNSA 3KOFA 5C0QA 1R3YA 4AD1A 2H90A 1CENA 1KBBA 4Z1YA 1UD8A 4JKMA 2PDKA 1JUEA 1LT7A 1H51A 2PGFA 3HM7A 1W1TA 3QYQA 1ONRA 2PU0A 1E1EA 2IQDA 1XIIA 4LVGA 3C4UA 2F38A 4RV8A 3P6LA 3WYZA 1PX3A 1WV2A 4LCQA 1HW6A 1RH9A 3H6OA 1E72M 5DMYA 3AYTA 3ZR5A 2A7NA 2EJ1A 3U4AA 1VENA 3KE0A 3SCSA 2XFRA 3CO4A 5H1WA 3GXPA 4MTVA 4PMRA 3P0WA 4AWSA 1OF8A 1WDRA 4P7LA 1CWYA 3BUVA 3OEXA 1VC4A 4U5IA 3PPCA 4DZIA 3WMLA 4Z2JA 2EG6A 1HGYA 4N9DA 1ZTVA 4X0VA 4C6MA 1J0HA 1I9CB 1QO5A 2XU2A 1OBAA 4U28A 3SAZA 4P5UA 3PG8A 3WK0A 3LGDA 2A7RA 3B0VC 3DKLA 2CHRA 2VDIA 5BW6A 3V18A 2BXZA 1IF2A 5REQB 1GG0A 1WOAA 1KQZA 2G3FA 1NQKA 1B4KA 1CXKA 1FDZA 4NRSA 4JYDA 1DIKA 3U7BA 2YDAA 4FS9A 3VX1A 3AHXA 2Y7GA 3VNJA 5I03A 3PUOA 3WQPA 1HP4A 4UQDA 2XSAA 5A8PA 1DJWA 2X2GA 1XD0A 1JRBA 1W3HA 4Z1AA 2J25A 3ARQA 5A6BD 4HPGA 3UXIA 2YCLA 3F4VA 4FAMA 4OOZA 1UCWA 3NVTA 1SSDA 3S47A 3KBJA 3VTRA 1HKMA 3M41A 1IYXA 3P2VA 1VQTA 5CPSA 2ALRA 4IISA 4AVFA 1BGGA 1EJXC 3OQ8A 3MWCA 1PXGA 2XYLA 4DJDD 5IHRA 3M0JA 3M5YA 5HK4A 2J74A 2E9MA 1X38A 3R4IA 3BW4A 3KHDA 1O6IA 2QNEA 2VC6A 1S5MA 4NL1A 4GFIA 4HTBA 2PDPA 2DZUA 3WUBA 2Y88A 3OB8A 1K1DA 2PWHA 4LUSA 3QW3A 4LC6A 3SGZA 1A5AA 3KL0A 2VCCA 3FSTA 2GJRA 3F4NA 1KV8A 2OEMA 4U33A 5A1AA 3WF2A 3VPLA 1PO9A 3N2BA 3H2CA 4GY0A 3EWUA 1DOSA 1VYRA 2ZIDA 1AL8A 3VKJA 1BXCA 4D8ZA 1SSGA 4CNOA 3ONCA 4D6DA 4FLRA 2WK2A 3SCVA 3TC3A 4M5PA 5FJOA 2OLAA 2Y5SA 1TA3B 1CGYA 4DZ5A 3QV6A 3UG4A 2XIIA 1K6AA 3GZ3A 4Y2WA 3PBMA 4M6UA 5BYWA 1NDYA 1E0XA 1XQLA 2EGZA 2JKEA 4P7QA 1FP8A 3GLCA 1XLJA 4TXEA 3U8GA 3BV4A 4MNLA 4NXKA 3KOWA 4PH6A 3UZYA 1UH4A 5CGMA 5I5RA 3M5VA 3UXLA 4GX8A 5SWUA 3QQ0A 3YPIA 2ZRXA 1CGTA 3WH5A 3KVJA 1OWQA 3GNNA 1YNQA 2ZX7A 4Z42C 1XYFA 2G8ZA 1GEHA 1QDSA 3VIFA 1XYAA 2W66A 4P8WA 2ZX9A 4LAOA 2FJUB 4ZEPA 3G0SA 2PDMA 4L4OA 2V2HA 2O4QA 2PGRA 5D37A 4OHQA 3ABSA 1OYAA 4JNMA 3T07A 3IIVA 2VRKA 3V0TA 2Z2BA 4C1NB 4NF7A 3VIPA 3IGXA 1V6YA 3VOJA 1CGXA 3R25A 1HVQA 3ZR6A 4LY8A 1K9EA 3WBWA 4CKQA 4PE8A 2VWSA 2WQDA 1LP6A 3UJEA 4H9VA 3LENA 3OYXA 4DO7A 1H62A 4AH7A 1Q6FA 1SW0A 4R88A 5CBIA 3S5SA 4GXMA 1WDDA 5M2FX 5H8MA 1EWDA 4Q6JA 3EOEA 4B2DA 1XH1A 2Y24A 3ITLA 4UTMA 3W25A 4AX7A 4IMEA 2CLMA 2BY0A 3KCLA 4PL2A 3H70A 4GUIA 5D9MA 3WJSA 1LRQA 1EJVC 3KS5A 1TE1A 1XJBA 3NNTA 1EA9C 3T0TA 4FEZA 3ZT6A 4YCPA 3WLIA 5C7HA 4OBSA 2FLIA 2WO5A 3KBWA 4Y9OA 1GOXA 1O60A 1A3XA 2Q3RA 5B7ZA 4XVDA 1IR2A 2H8XA 5G2IA 1H7WA 3W4RA 4JQAA 2W67A 1AMKA 1BSIA 2D3LA 4LRTA 3MO4A 3TFCA 4LAUA 4DQWA 3B0YA 3VOGA 1NOFA 2NT0A 2HPMA 2V5CA 3SUTA 1XI3A 1GWJA 3RIKA 1TR9A 5TQLA 4UTTC 4EAMA 1I1WA 3VCCA 4O0ZA 4TTGA 2X7VA 4LCRA 1I2QA 2BV9A 1W37A 1LWHA 1E9IA 2HBVA 5GQBA 1NFBA 1P48A 4EE9A 3AHYA 4WJ8A 4HNVA 2DZSA 5KZ6A 1OYCA 4NXSA 2P76A 2NUWA 1J0IA 5F4SA 1UMLA 4EWJA 5GPRA 1W1A1 3FEQA 3V0SA 5EGRA 4S3FA 4Z2HA 4UTKA 4EKJA 4I5UA 3TLQA 4GISA 4HZ8A 2LLEA 1IR1A 4FXFA 4BK9A 4V28A 3WQWA 4MIMA 3L2MA 1VD6A 4IL2A 4ZO6A 2DJLA 5HJYA 4LAMA 4A8IA 3V1PA 2VFIA 1U5JA 2YXXA 1FWHC 8XIAA 3L12A 2CLIA 3MZ2A 4PYSA 3JU2A 4XIAA 3UU0A 4WDWA 4YWIA 3SJ3A 2E5BA 2E4TA 3HB9A 1HJSA 3VGEA 3QFWA 2GVJA 3OO2A 2XHYA 3CAWA 1RBAA 1FWRA 3BZJA 1AW5A 1MMFA 3W85A 5LIUX 3IIXA 4F79A 2O7SA 4D6FA 1W5OA 2WSKA 1W2VA 2PPGA 1BTMA 1SFSA 4IPIA 1V02E 3VGFA 3PWAA 4B5UA 3WL1A 4WUIA 2J75A 3DHPA 1WZLA 4OE7A 4HZ7A 2P3EA 3NYZA 4PN2A 1O5KA 2A6LA 1OCJA 3O05A 4JAWA 3NO5A 3QLDA 2ZDRA 3WLOA 1VFOA 2X09A 3QGAC 1J2WA 3BOFA 3HBLA 4Q4OA 2DP3A 3QY6A 4YIWA 2HS8A 3CUXA 5AC8A 3GUGA 1CXIA 2VCAA 1XIHA 2EJAA 1R7OA 3EX3A 4KF1A 2NVDA 3C61A 4AZCA 2DZAA 4WY0F 4EWND 4MLJA 4UQ9A 4QG9A 4CD8A 2HPIA 1NOWA 2J62A 3CUIA 1UH3A 4MSSA 4PSPA 1W32A 3VIHA 1VBHA 2QCCA 9CGTA 2Z1KA 1DWIM 2QXWA 3CQJA 1GW9A 3GW3A 1ICQA 1T99A 3GWQA 4QIUA 1UP0A 4FXSA 4Q8MA 2ZQ0A 3G24A 3Q94A 4HJFA 3A4JA 4Q8VA 3W7JA 3BVJA 3VU2A 4IP4A 1B5TA 4PRRA 4R33A 1YKWA 1RVGA 3E0IA 1IZCA 3A23A 3TYAA 1SZGA 4M56A 1P6WA 3L65A 4M19A 4D6HA 5A6KA 2YCKX 4B90A 3L4ZA 4F0KA 3QC0A 1BRLB 4KH2A 1NF7A 4RZ4A 2ODOA 4DAFA 1JQXA 1X6LA 1M65A 5C9UA 2ZDSA 1W1PA 3MUIA 3MZNA 2XTKA 2YL9A 3W76A 3VVGA 2Z7GA 3HMCA 2XIOA 3W28A 4CQDA 4Q7NA 1Q6QA 4YTQA 2V67A 4JTRA 3DI0A 5M17A 2Z25A 4A6GA 2ZUSA 2YA2A 3AHVA 1F3XA 4FOJA 3KCOA 4I9AA 2QUUA 4MNJA 1PS9A 3MVIA 2DH2A 3PBUA 3EX6A 4LRSA 1XRFA 1RQEA 5BROA 3GDMA 3CPRA 4I6KA 4UOZA 1A53A 2PRLA 2PSNA 4N9EA 3AZRA 2IKIA 2CXEA 3UGVA 1NQ6A 4JQ4A 2ZX8A 4AZBA 3MHUA 2FZBA 1X97A 3TW7A 4FOUA 3H53A 4PUEA 3U48A 7PTDA 1W54A 4A8RA 2FGBA 4DUVA 1TTQA 3WQVA 4AVNA 3DERA 1L2UA 3BANA 1V6UA 1VFTA 1V03A 2YBTA 3FIGA 5DF0A 2ZUTA 4BFAA 3S46A 2HISA 6CGTA 2CESA 2QCFA 2ZUNA 4B3LA 1XD1A 1XDJA 3BCFA 1X1ZA 4L6OA 2JKAA 3CZJA 3AWOA 3I4KA 3RM9A 4N6FA 4PMOA 3QMTA 4C5ZA 1XCFA 1ITUA 2VD8A 4YVPA 1Q63A 1EUNA 1N8WA 4BJHA 5DT5A 1EZ2A 1DIEA 1TIMA 2WWDA 4Z08A 3NA8A 2VURA 1VH7A 3NQGA 1Y8BA 3I10A 3GU9A 2G50A 3OZYA 2WJDA 5DBTA 3H7RA 4H9TA 2C19A 4RDZA 1A5SA 3FAWA 3QV8A 4Z17A 1C9WA 4HOZA 4XTDA 1FHUA 1FWAC 3KRBA 2C14A 1MNSA 1J5SA 3GXMA 3W72A 2YSWA 3S42A 1PX8A 4YS1A 4U10A 1TZZA 2WLZA 3K8KA 1KC7A 1OM0A 1E6RA 4Q4QA 1NP0A 2Q8XA 3RAOA 1E9YB 3EWYA 5M5DA 3QC3A 2J7FA 4N0RA 4E2OA 3S9YA 1OYBA 5FL0A 4V1XA 3SDOA 4ZZ9A 1W9BM 1TV4A 5IBXA 4H6EA 1QATA 1LUCA 1LOLA 2PDGA 3KP1A 5H8UA 4WR3A 1UWAA 2RDTA 1YBQA 3B8IA 2GLKA 1OT1A 4Q8NA 1HKJA 3EWDA 1MUCA 4XD3A 2GZXA 4G2DA 4GX9A 1QBBA 3M0VA 1Q6LA 4B15A 3LCHA 2V2CA 4MAVA 3NZRA 2VP8A 3P60A 5DANA 4O18A 4JTQA 3GVQA 3NDOA 4UFIA 4GHRA 3GYEA 1OC7A 1G67A 2BVDA 4P8UA 2R1KA 3EKGA 3B05A 3QH2A 3PTKA 1EC9A 3HG3A 3EBVA 2ZUVA 2NV2A 3WLTA 3M0MA 2ZRYA 3VZYA 2C15A 1JGMA 3F1QA 4LTSA 3UP8A 4GRSA 2B7PA 2AMXA 3O0FA 4DJFD 3TZFA 5AHNA 3G6LA 3QEZA 2ASHA 1BFNA 1E1FA 4HSHA 2IKGA 4IJBA 1P1XA 3IJLA 1AUSL 3EB3A 3BAWA 3OOQA 1E6PA 1SQ7A 1IGSA 1ZALA 4KEUA 5IBXC 5LGZA 4ILSA 4ZE5A 3CZKA 3LI1A 3KHJA 4MFEA 3UBPC 3NZPA 4GIRA 3VK5A 3W84A 4EF9A 3P82A 4WKAA 1THFD 1WOBA 1NM9A 1VFLA 3PFRA 1OC6A 2PDLA 1ZBWA 4MPKA 3FOKA 4IIDA 2WVVA 4HMNA 5FOOA 4M24A 4PR4A 4NAEA 2Z2AA 1WDPA 1TPC1 3UESA 1P0EA 4NASA 4JHOA 4CEXC 3IRSA 2Z7KA 2Q8LA 2HEJA 3E2QA 2VEKA 5HR7A 1M03A 3ANUA 4AZIA 4ZXLA 1DJHA 3MYPA 3MQTA 3PZVA 2BOGX 2WHLA 4WD0A 4XO7A 3W02A 5FF3A 2VGBA 4YL2A 4HMEA 4L4PA 3GNDA 1ECQA 4KIRA 2E0PA 5FAGA 4FNSA 3I6EA 4JQ3A 5I78A 1A0EA 1JEZA 1WKEA 7ENLA 1EJSC 3GTHA 1ZJAA 1EYEA 1KO0A 2ZXDA 1TPVA 2DJXA 5CLWA 4HNUA 3SN0A 4DJEC 3LPPA 1VBJA 4R5EA 2JKPA 1PB0A 1DWJM 1OG0A 3UZZA 3AICA 4IG2A 3NSXA 5HNTA 2Z6IA 4ZO9A 4G1KA 4LNYA 4IIGA 1JAKA 3DH7A 3AYRA 3R13A 3T0DA 2DUZA 1WBHA 4QE5A 3WNMA 2YCJA 5FI8A 1ML1A 1KLZA 4TV6A 4D72A 3ZIZA 3W23A 1E6XM 2VZTA 3MUCA 3K2GA 3V7PA 3FK4A 4I7VA 2B0MA 3GH7A 2QCLA 3PPHA 3ZLGA 1R3VA 1W3IA 3EA3A 2CKRA 5AZ0A 6XIAA 1E4IA 4JR5A 4HK7A 2ZVRA 2CZVA 4ZQMA 4R3UA 4UMCA 3NFUA 3EDEA 1JYVA 3G18A 2EPOA 5CSSA 3LGGA 3WK1A 2HWGA 3OLDA 5DO8A 3N11A 3KL3A 1O95A 3B9NA 4AG0A 3GU2A 4HIBA 1IEXA 1SO3A 5ABGA 4UTLA 4JICA 3COTA 4WXYA 5D09A 5FSDC 3URNA 2A5HA 3S1UA 3IJ7A 3TZNA 3QW4B 4JGDA 2IKHA 1V6TA 5EMYA 1X8CA 1LOQA 5EBUA 1SU5A 2FPVA 2FVKA 4C90A 2ISFA 3FXGA 4JFSA 4A8NA 2WSRA 3DHUA 1HN1A 2WB5A 1OD0A 2DQWA 4EACA 3OG2A 4ACYA 1YE6A 2DIEA 1PPIA 3V0UA 4AWTA 4H7VA 4IGMA 1JCLA 3TOYA 2H9AA 1S38A 1QI5A 1VKFA 4WK9A 2DW7A 2QEZA 5DMMA 1R5YA 1H7OA 2GL5A 2XZ9A 4M81A 1Q6RA 3AIRA 5BNKA 1JI2A 4DM2A 2BZNA 3QN3A 2V5DA 4DO4A 4IT1A 4MY1A 2OLHA 2Z27A 5HMFA 1O66A 4IFOA 2Y4SA 2Y7EA 2ZX6A 2DT1A 1K8CA 3BOLA 3CHFA 3QQWA 3UA3A 3IGHX 5FD0A 3ZMRA 3NQVA 3RU8X 4GGBA 1TTJA 2IW0A 3UWUA 2FZNA 3C8NA 5HANA 1XC4A 4GI4A 2A1YA 2VO5A 1QR7A 3N2MA 1L6YA 1LLWA 3SCRA 1KCXA 3QV9A 1TZ7A 1NWTA 5H91A 4GG9A 2VZSA 1R9XA 3R0UA 1S1RA 1HL9A 2WNQA 2J7GA 4KFNA 1I2PA 1CNVA 2PTXA 1DWGM 1JD9A 1H3GA 3ZVHA 2PTWA 1HFBA 1A0CA 1LORA 4YNGA 2QDHA 3GH5A 1GQKA 1P43A 2PWGA 5XIMA 2WZMA 3AALA 1JCYA 2GDUA 1O1ZA 3KCJA 3L5AA 3T8QA 2WM0A 4X2PA 4U3CA 4Y8FA 2QMKA 3N4FA 3URQA 4ZOBA 3UWVA 1B9BA 1I60A 3HO8A 3T6CA 4WQ6A 2J9XA 5A8GA 5I77A 3IJIA 1HVXA 1RHCA 1LCOA 2E7FA 4RNJA 1GOMA 1W5NA 3WNKA 3W75A 3NPVA 1LLOA 2BS9A 4DWDA 1QNRA 3LI0A 5G1MA 3HQOA 5PTDA 1OCQA 3GVRA 3FJ4A 2GUBA 2QDEA 5EL1A 1UKQA 1W1YA 2HBXA 4AD4A 4O14A 5D9NA 3WFZA 2CERA 2O9TA 3VD5A 1K6WA 1ZUAX 4LVDA 2XH7A 5KETA 2QT3A 2XM2A 4EVZA 4XSMA 3DU0A 5CZTA 5HUPA 4QM1A 5JBDA 1GVFA 2DFAA 3BW2A 4FX8A 4QP0A 1XGEA 2XN2A 4D1IA 1GQIA 1RBLA 2FDMA 4WGHA 4KQNA 4GO9A 3WJWA 2BOEX 5CAHA 3UG8A 5HQMA 2GSJA 1FCUA 3HG4A 3BE7A 3LRKA 4KBXA 1Z7AA 1T8QA 1BQCA 4C6JA 3HV8A 3ANVA 3NM1A 5JU6A 5ABHA 1OD8A 1QASA 1XISA 1XM3A 3JZEA 1UWSA 4MZ8A 5LXXA 3U2CA 1GQNA 4R7WA 2ADAA 2DSVA 1AD4A 2FMOA 4ZE4A 1RP8A 1XIMA 1HJXA 1AH4A 3W24A 1M41A 5HUOA 1K8XA 1Z6KA 2D73A 3P14A 1MXSA 1GYMA 4KCTA 1TQXA 3W7CA 2GQAA 4UBPC 4AIEA 3WK2A 1WYIA 2ZTKA 4QQ3A 3S6TA 4TOQA 1MWOA 1ZCCA 1TJRA 3TWAA 4Y6GA 3B0UX 1JJKA 4AYGA 3O2LA 3NL6A 4UR7A 3E74A 4JIIX 4OOUA 1GHSA 4WHBA 3WEOA 1FXPA 4HMCA 1P0BA 4F2TA 3VC5A 1KFLA 4R85A 3GC5A 4ALDA 4LBRA 2GQ9A 2VGFA 1WAWA 3UR5A 3WENA 3VO0A 4XZLX 1TKKA 4ZFCA 2AL1A 3MSRA 3C0LA 3LCFA 3W6LA 3GBEA 1PYFA 3WD0A 4UB9A 3M07A 1R3TA 2YLAA 1MW1A 4G8TA 1TWSA 1CEOA 1JPIA 4K8HA 4HU0A 1XH2A 3NO3A 4TU1A 1J6OA 3IAQA 3Q2DA 1JNEA 5TF0A 1PDZA 1ZU8A 4M1RA 3M6DA 2GJPA 2XISA 4IXXA 3LV5A 3SRDA 4CGTA 3QTPA 4GQRA 2WVVB 2A21A 2QVNA 3QPZA 4NAEB 3U5YA 4TIMA 3QHNA 3E6EA 4R9XA 1VRDA 3SM0A 5DFAA 2DT2A 3L2LA 4NJIA 2PWDA 2TAAA 3CMFA 2AL2A 1J0JA 2CXGA 5I23A 1GZGA 2ZUWA 4B91A 5I79A 3UNTA 2DV0A 5AHEA 9XIAA 3SUWA 2W27A 2QCGA 3CPUA 4RLIA 5I2UA 3P67A 2ISDA 1RV8A 3S9IA 3KBSA 1AG1O 2NQLA 3RR1A 2J7EA 3CV6A 2VMFA 4NNCA 4OQVA 5EMLA 4C6DA 3ITYA 4W8LA 3CTLA 4O4WA 3L4VA 3NVDA 4CNPA 3PJWA 1M01A 3CGTA 5AHIA 1Q65A 4GUHA 4XAFA 5BXTA 3M0IA 1W3LA 1YNPA 1UZHA 1KM3A 4JL2A 1HJVA 1EX5A 1EL3A 1UJPA 5K9CA 4XQ6A 1DKWA 1K3UA 5E5CA 3ZJ6A 4WY0B 3TN6A 4K3ZA 2RGMA 3GNPA 3CT7A 1UZ1A 1R3SA 1V3JA 1QNVA 3C0SA 3S5YA 3I68A 3A3WA 3O6YX 4DBWA 2AAMA 3WQEA 3TQVA 4HYRA 5AHMA 3TYCA 2VX4A 4DNHA 4KRUA 1DL3A 5LGXA 1J93A 1U83A 2ZRUA 4XZWA 2XH0A 1EF3A 3VYLA 1C29A 3CYJA 2PDUA 3GDBA 1TPDA 2C1GA 1XSKA 4X61A 1S3TC 1PTGA 3BCDA 3GXNA 1T8XA 1EIXA 1R3QA 3WELA 3R11A 4CNNA 4O52A 2XGIA 3WDJA 1OEPA 3SIMA 1W1IE 1XL9A 3VGHA 3SCUA 5CPTA 3ARSA 2VELA 5GVJA 4IQEA 4V33A 1XF0A 3L2IA 4J2PA 3U9IA 5D2YA 1XIFA 4GY1A 3CT2A 4C6IA 3LD5A 4LX4A 4O4VA 3O6DA 2H9AB 2TPSA 4XUYA 2EHHA 1SZEA 3MMTA 1UR4A 2W4XA 3FA5A 3I65A 1YHTA 4RE4A 1U1JA 1L8PA 4S38A 1FWCC 3LHUA 1EXPA 2DH3A 1E71M 1DXFA 4FMVA 1GVRA 3IGUA 1NF0A 4LYPA 1WUEA 2QF7A 3A22A 5K2ZA 4AXKA 4PUWA 3H24A 5A3HA 3M6YA 4H8UA 3MANA 3DFOA 3UT0A 2E6DA 1NU5A 1V3HA 2E8YA 3LHYA 1JXJA 3TYUA 1XGDA 3VZXA 1EO7A 2WC7A 3I3EA 1VPXA 3QLLA 3W07A 3S2NA 5E1QA 3LMZA 1GKQA 2XIJA 1UMYA 1K7FA 4W9TA 1MYRA 4LY4A 2NWRA 3PZGA 1RLCL 4LT9A 1TE6A 3W1LA 1NFPA 3WH9A 4HHLA 2WZTA 1V8EA 3BMXA 3VNZA 3FJLA 1EDQA 3LX9A 2YLLA 3BXWA 3EOLA 1W9PA 3ZVHB 3BARA 1V77A 1A50A 4HSOA 3EDDA 1PSCA 8CGTA 3E02A 4FA3A 3VNKA 4MWAE 3RGTA 4F0LA 2QUTA 3SCPA 1KXQA 1CCWB 1QHPA 1FFRA 3E96A 4W86A 3ALGA 3ABRA 4TVUA 5F1UA 4LF2A 4F2BA 4PUUA 1KBLA 3H55A 5ABFA 1VCGA 1L6FA 1L8NA 4GGHA 3OYZA 4NIRA 1QPKA 1CXFA 2A3HA 2DT0A 2PURA 1F4HA 4XZNX 1E3ZA 3IJ8A 3ZT5A 1R8LA 3NGFA 4ICCX 3QHOA 1FUYA 5G4WA 1YTEA 1TZ9A 1QNPA 3WNNA 5HBFA 4Q22A 4AHOA 4LUIA 2I14A 3CZEA 4LEFA 4FLOA 5RUBA 4REQB 4PUNA 2GWNA 3G8EA 4S1FA 3ID7A 1P6CA 4MAZA 4FI4A 2WKGA 3G0UA 4DHGA 1ZJHA 3AIVA 4WIWA 4MY8A 4AZ5A 1JZ2A 3QM3A 3NQCA 3P93A 3TQ0A 2RFGA 3MTWA 2F6KA 4N4PA 3TCSA 8XIMA 4FXJA 4GQQA 1DQWA 1UD6A 3LRLA 7REQB 5E9XA 3AHTA 3MCOA 1EDTA 1I2RA 4YHGA 4NRRA 2DVTA 1E6SM 1FWNA 1HKIA 4FLQA 4NNAA 1RPKA 1Q7MA 1YX1A 1ZGDA 1GPWA 1GUVA 1JVNA 5IDIA 2WLYA 4HD5A 1QNOA 3PBGA 4H3DA 4GQ0A 1J2BA 4GI8A 1VEMA 4HYWA 3HF3A 1TTPA 1Z69A 1CIUA 3FYOA 2XDFA 1A3WA 2YBVA 3M7WA 4DUXA 4HB7A 2GFTA 1DE5A 4JTDA 1EOKA 4AC1X 4M7SA 1S2VA 5A6TC 3AS1A 1EJWC 4A2RA 5A6AA 4P8VA 2VFGA 2IPWA 4HPNA 3P62A 2PS2A 2V0TA 2OB3A 3W87A 4XVEA 3MUZ1 1E56A 3NJ3A 2B7OA 2OWCA 3VILA 1FWWA 3RRAA 3PUGA 2GQ3A 2E6YA 1EGZA 4DB7A 1E51A 5E6YA 1O94A 4L9XA 1A5NC 3DFPA 1PHQA 3OW1A 1TMQA 2F7FA 4BF9A 3UPMA 1UUQA 1EHNA 1EBGA 4YU1A 3WG6A 4P7NA 4O13A 4BCEA 5AECA 2P8CA 3P8IA 2KZHA 4DJDA 4BI5A 1CGVA 1AL7A 1WXYA 2BVWA 1ENUA 1S2UA 3VUPA 2DU2A 3SN4A 3V5CA 1C90A 3RXZA 1W9VA 3IV3A 4ASTA 2IQTA 3NQMA 3CH0A 4MF4A 4NUWA 3VOIA 3GM8A 3AQUA 3LPFA 3BG3A 4UNIA 4UQBA 3W1TA 1MUMA 2XGZA 1DWFM 4GUFA 1D3GA 1XLFA 3FCPA 1DXIA 4MUPA 4H6QA 3PZOA 3CQHA 2WNNA 1OX5A 4YVVA 4AFYA 3EXSA 1W9DM 5A6JA 4YYCA 5LNRA 3RHGA 1F07A 2A3LA 3M44A 3IPWA 2VRJA 4PBEA 3MJYA 3W1QA 2Y70A 1OABA 1YMYA 2Q09A 2PCEA 3GG8A 3RX4A 2WCAA 3ABOA 3STEA 4UQAA 1DVJA 1ONXA 4JS3A 3EPMA 4W7WA 2XINA 4GNJA 3MBDA 3MT1A 2HNHA 1TFVA 2OZ8A 1WAUA 3ABQA 2BGNE 1VPYA 3E49A 3GKAA 2UY5A 4DJDC 1SJAA 5H6HA 5CC5A 3L0KA 1H41A 4AXNA 3PBWA 2CU0A 5HMDA 5LHFA 2FGZA 3TA9A 3TU9A 5IXEA 1TPEA 4HNCA 1DBTA 1MRQA 2O55A 1WNOA 3U6WA 3TN3A 3G1SA 3V4BA 2IUZA 1MQRA 5K9DA 1L0PA 2X05A 4DYJA 1M53A 1XIEA 1UPPA 3KZPA 2ZXBA 2CITA 4OIFA 4XBSA 3H26A 3ECQA 1XDLA 3OBEA 5CC3A 5C9RA 1MQQA 2ZYFA 4W7UA 1UZ4A 4ROQA 1EO5A 4GIYA 1ZQ5A 3T2PA 4AY1A 1K02A 4CD6A 1SJDA 1KM1A 4S2CA 5HDRA 5M1TA 1Y7VA 2I7GA 1XIJA 4LUYA 4QJ3B 3GHRA 5ECVA 4MVAA 3N4EA 1SO6A 2WMHA 5C5YA 2IKJA 3PG9A 1F5ZA 3TV8A 2YIHA 1JCJA 4NI8A 1I45A 1Q13A 3D5HA 3W1XA 1ADDA 5KEZA 2FB2A 4KKXA 2ZWZA 1C8XA 5CBBA 2J66A 3DFSA 4GJIA 3NSMA 2UY2A 3WLMA 1C91A 4H7CA 4W4QA 2WVSA 4ZGYA 2RHGA 2WV8A 4CU7A 5LNVA 3ARTA 3CHEA 3GRIA 4X9SA 4C6NA 2C1IA 1FHDA 2OSYA 4KPLA 3HFYA 3EX2A 3M9YA 1QVBA 4HK6A 5EKYA 2ZZ1A 3XIMA 4JX4A 1G4EA 1X1OA 1JYWA 3UYCA 4ERGA 3HPSA 5HULA 2OTDA 1K7XA 1UQZA 2VHLA 4K8GA 1KFWA 2YR1A 1ZHAA 4GJ1A 3AXXA 4BHYA 5HQLA 4AMCA 3KUMA 2WSPA 3SY8A 5I24A 2Y6ZA 3SY5A 1XG4A 3PK7A 4BZYA 5E0CA 4NNBA 1F8MA 4XAYA 1E4NA 4NYUA 3GU1A 2DZXA 1U22A 4S3BA 5CAKA 4FB7A 3LZ5A 3LTSA 1WA3A 1BVNP 1BYCA 4PTXA 5CBJA 3OVRA 3MSYA 2WOQA 3TP4A 1RD6A 3LN3A 3FLUA 4XD5A 1RSCA 3MBFA 4GWEA 4C65A 3QYSA 2BDQA 4M1BA 3MUXA 4LQ1A 4K38A 4CNTA 1V6VA 1DJQA 3M64A 1TELA 2D2JA 4V27A 1F74A 4J2MA 1V0NA 2EBNA 4L7ZA 1TMLA 1AZ1A 4PODA 4PC8A 3TYDA 1EF2A 3TW9A 4LC8A 3K8MA 3L67A 1JYNA 2ISVA 3O6CA 1P5BA 2PFHA 1F2JA 3S3GA 1XX1A 3NO1A 3SR7A 1OINA 3B0PA 1JQVA 3CZ8A 4E2DA 2CCRA 2PWUA 1PEZA 3DDMA 3RR4A 3GTXA 4UTJA 4Y7EA 3QZ6A 1RXOB 4D9PA 1KBIA 2CZ5A 1YPXA 3GK0A 1ZBVA 4IPLA 1CLXA 3BOXA 4DF1A 4I9MA 3MV01 4D8LA 1XRTA 4QR6A 4L4MA 5ABFB 4Y96A 1XFCA 2VC5A 3RCMA 1HNYA 1XFBA 3KWSA 2NUXA 1Q4NX 3BG5A 1R2TA 1LL7A 1S5WA 2C16A 3QF0A 1T5AA 3G1AA 1G7UA 1UROA 4DI8A 3I4EA 1IEWA 1JDEA 3CO8A 3GNXA 3H4GA 4GZIA 4NKCA 3K5XA 4PTNA 3TKFA 1QW8A 2HSAA 4IMDA 4ZBCA 4GCXA 4IIHA 3KWXA 2P88A 4ZQNA 2CHNA 1M5WA 1EDGA 4HPXA 1TTIA 4Q8QA 5D32A 4ADSA 5I00A 1XRVA 3N2CA 4O8RA 1VF8A 2FIQA 1TJ0A 1OADA 3GC2A 4U3AA 1XC6A 1VCVA 4B5TA 1H0IA 4JFWA 3CH9A 1UC5A 4Y8EA 3GG0A 2BHZA 1DXEA 4KEMA 2C3ZA 3UF9A 3VOHA 5U4NA 3LOTA 3N15A 5HWNA 2XWDA 2QMJA 1R9YA 3SFWA 5LNUA 2E68A 4QFUA 3BO9A 5EY5A 4P7RA 3H7VA 4OGZA 4R7JA 5C55A 3W1PA 4YYFA 3K13A 1XICA 1X1NA 4N9BA 2FTPA 3GDKA 3PM6A 3JVAA 2XIBA 4K2SA 5LA0A 2W61A 2FH6A 3SCTA 4NT0A 3KX6A 3WZ0E 1VLWA 7TAAA 2QCMA 3SCQA 1V7AA 5C54A 3DHDA 4RZ5A 4US6A 2UWFA 3IUHA 4A3UA 3W7NA 1GG1A 2R94A 3HGSA 1PZ3A 3OIHA 3AZSA 1WO2A 1UR1A 2EPLX 3QOKA 1JPDX 3BC9A 1U5VA 4KERA 2HVMA 3NG3A 3CUHA 3BAKA 3CIWA 1TR1A 3MC5A 1R46A 3UEQA 5J5DA 3UZJA 3EMCA 3QGVA 1NTHA 3IS4A 4GVIA 3VE9A 3WD3A 4DF0A 1Q8AA 3PVFA 4AWUA 5XIAA 3UWWA 3CBWA 5FF7A 3VM7A 3BZGA 1DEDA 3MP4A 4AQLA 4WDTA 3GC4A 2QQ6A 1FXQA 3W7RA 1QXLA 4RNFA 1OG6A 4CN1A 2DIKA 3GXTA 3IVTA 2ACQA 3MJMA 2X1UA 1KRCC 5CC6A 1KGUA 4AD5A 1DJZA 2CLFA 2WJFA 2Y7DA 3B9AA 2EPHA 2DUAA 3L4WA 2WVTA 1VPQA 4GC3A 1ELSA 3KDNA 4JHMA 3TQPA 3C0JA 3VKDA 1B0IA 3EPOA 1UR8A 4WX2A 1NAL1 3W37A 2NQ9A 3FHAA 3DFHA 2Y1HA 3UERA 3B8SA 4XBJA 1Q7QA 3WEZA 1W91A 4RE3A 3A5VA 1BF6A 4JCLA 3ATYA 4JTGA 4IJRA 2YDSA 3WMCA 4Z0JA 1UR9A 3VNYA 5E93A 2HZGA 2Z6JA 3GXIA 3AIUA 4I7WA 2QPSA 1XYLA 3DECA 3ZS4A 2O4MA 1XLGA 3IRDA 1P0KA 2XVNA 3EEGA 1TV7A 3TYZA 3D3AA 5IHSA 1QU4A 4PMNA 2CWXA 3SN1A 3NUKA 3WH7A 4O53A 2YYTA 3WQDA 1C8VA 1W2PA 1FTXA 1ZP3A 5LHEA 2I9EA 3MKKA 1F73A 4X3ZA 3S5OA 4OV4A 2BBFA 1EC8A 2FPTA 1HX0A 5EMUA 1WKDA 4JIHA 3DESA 2ZZ3A 3ZJ8A 4UQEA 1US3A 4ERIA 2B4GA 1H09A 3SGGA 3I7SA 3FV9A 2HK0A 5T8GA 3GX9A 5DCDA 1WCGA 3SECA 4IPPA 2Y5JA 3EYPA 1SZNA 2QCDB 2R8WA 3TXVA 1N7KA 3L4XA 4NZ1A 4MDOA 3DGBA 3LHTA 2QIIA 2NXGA 3H7UA 2Z1VA 1WXJA 4MMWA 2WWCA 3FDGA 1HIZA 2QGYA 5I3FA 2J8GA 3HQ1A 3ZYZA 2C1HA 4NVTA 4R7OA 1R3WA 3NSNA 1A5MC 2RAGA 4DYEA 2FHFA 2PDJA 4K36A 4IIFA 4J3TA 8A3HA 4HNOA 2DVUA 2NX9A 2HXUA 2GJLA 4U2YA 4IP7A 1GKRA 5TBOA 1NDVA 3C2YA 1PIGA 9RUBA 2BY2A 1TWDA 4PFHA 3DGRA 2Q6ZA 2WSYA 1QI4A 1DIDA 3GTNA 1YE4A 1GZJA 3TSMA 1U30A 4A05A 4DJFA 1RPXA 1ZNNA 4LW7A 4ONVA 3VABA 1W6TA 2TMDA 4GK8A 3WD2A 2GGHA 3KLKA 4S3AA 1ZENA 3Q37A 3KP0A 4U4MA 2AKMA 3NL3A 7ODCA 3ITGA 4GXPA 1MXDA 1FWTA 1PE1A 2YKKA 4ZB0A 3AMDA 3G1XA 3LA4A 3PF3A 4DPPA 4IX2A 2V81A 3A4WA 3LLFA 4C1NA 3R43A 5MF5A 4GOAA 2BY3A 2PLKA 3M5XA 3AFBA 3ICJA 1QI0A 4FNPA 1FWGC 3M46A 2R14A 5JH1A 3WH8A 1MW3A 2F84A 1NELA 2BG5A 4IOTA 4PZVA 1GVOA 3THAA 1W1ZA 4J3SA 3W2JA 4CN6A 1KKRA 4C60A 4E4PA 1R86A 3KOZA 1XR2A 3ZZ1A 5D2WA 3OA3A 3TMQA 1RCQA 3VZZA 2VVSA 1V5XA 3Q4DA 4ERAA 3NEVA 3QGKC 2REQB 4JKLA 4N9CA 3QZAA 5DXXA 1KGWA 2UBPC 2ZUUA 3HGRA 4R9OA 3UR8A 5AVNA 3MS8A 4DJFC 3PB0A 2FTYA 3ZLFA 1AW1A 1XKYA 3DFYA 1KB3A 4K39A 3VE7A 4FX6M 2JFEX 3CYVA 4K1WA 5A2BA 4MJMA 5JUVA 4M6PA 2ZBTA 3A12A 1XYBA 4UTHA 5D33A 1RUSA 3GXDA 3WQOA 4MYXA 1NEYA 4Q8TA 3BMWA 3RITA 2R91A 3FX4A 3E5PA 4Z2GA 1Y5WA 3LXAA 4UFJA 2Z29A 4L1XA 3MW7A 4MM1A 5FIPA 3T05A 4Q7BA 2Y8KA 3STFA 1E4LA 3W7KA 1OT2A 4HHMA 4O50A 1FBAA 4IZGA 2OU4A 1EPVA 2UY3A 3N12A 2GOUA 5FSEC 3W0KA 1J79A 1XUZA 1CI1A 4QEHA 3O6AA 1LRNA 3PP7A 5G4HC 1CT5A 3M4HA 1LWJA 4HCLA 5E6ZA 4KIEA 3SUVA 4O1CA 1MW2A 2EF9A 3V36A 5C6MA 2VEMA 3CQIA 3RJXA 4FSAA 1A4LA 1W1B1 2BASA 4AY7A 3VGDA 4RV3A 2AQOA 3JW7A 1EJRC 2WW5A 2DQXA 4DZHA 3PY2A 3VDAA 1FH7A 5DMLA 2ZE0A 3R12A 1EGMA 2VGGA 2PGWA 1SW7A 1IEIA 4PCPA 2OQYA 5D8ZA 4WKFA 2CLLA 3P0XA 4US5A 3B8DA 1QWKA 1ZJBA 5J04A 2QJIA 3R94A 1KCKA 3WLHA 3IUIA 4UXDA 4F0MA 1UR3M 1IZJA 4UCGA 2YBUA 1QT1A 3LSBA 5C2GA 4NG3A 5M03A 1LROA 1E70M 3BGJA 2NQ5A 5G4EA 1HJUA 1W9XA 4FF7A 4J3ZA 4IH3A 2VOMA 1DJXA 4UC5A 4CCZA 4CQAA 2FVLA 3EOUA 3IUDA 3TJ4A 3NDZA 5D4YA 5CPOA 2QUVA 3PPGA 5J8LA 1FWJC 3VI2A 1QMLA 4PCNA 1ITCA 3FN9A 5H8PA 4HA3A 2DSKA 3N6QA 3FJ6A 1DIOA 4HCHA 1D2KA 4PMDA 1E0VA 1LLZA 3W9ZA 4M0XA 1PHWA 1HG3A 1KTBA 3BV7A 3UFYA 4BQ3A 2PD9A 4MWAD 2ZXAA 2OR2A 4HT3A 1P1MA 3E2SA 2PRHA 4GYFA 4NU7A 3P5YA 1J12A 3INPA 3UZWA 1XIBA 4GZJA 3PSVA 2FZ9A 4NAFA 3CK5A 3IIOA 3HJZA 1HT6A 1PAMA 1PIIA 2XZ7A 1JULA 2E67A 4GNVA 4LEQA 4DYKA 1O5XA 5GNYA 1BPLB 4ZB5A 1AH0A 1S2AA 4LBSA 2X1IA 3PZIA 3SRKA 1R2SA 1V0LA 4L6DA 3VFCA 2GJNA 3U57A 4G5DA 4LSBA 3U5UA 4C6EA 2G41A 2BSLA 4W5ZA 2XFFA 5AOUA 2QV4A 4O12A 1PWLA 4GFSA 1K77A 1BRLA 4D1JA 1Q6EA 1FRBA 1XPYA 4NQ1A 2OZ3A 4ATLA 5BOOA 5AY7A 3W29A 2G3IA 1KM5A 2HCVA 2VZVA 1UWIA 4MZ1A 1BWLA 1F7BA 1OC5A 2WC3A 3FNDA 3AMKA 5DLCA 1LYXA 2EXOA 4A3HA 2VZUA 3GIYA 1ZAJA 4JDBA 2HS6A 1XYCA 3U4FA 4LYKA 5HNUA 4PL1A 4R34A 2JEQA 1Q85A 3ZSSA 5HR6A 4L1WA 3EWCA 3VD9A 2SFPA 5AVHA 3Q58A 4F8XA 5LIYX 3LGEA 1HL2A 1ME7A 1PWMA 4H6RA 4QNWA 4JYEA 5I7GA 2BX7A 2QULA 4ENLA 2OMAA 3PBVA 1EC7A 3ONBA 1KRAC 1FDJA 4EPBC 4X9YA 2OYMA 1DYSA 3GQYA 3M0XA 1FA2A 4P61A 4LV9A 4RR4A 4CQ8A 4WSHA 1G4TA 1AW2A 4CCDA 1XLDA 1GT8A 2QJGA 1LF1A 1UC4A 1MEWA 3WBYA 3QQ1A 1H7XA 2GVGA 4DWSD 5D2TA 4ZMGA 2XJ7A 3IANA 4Y90A 2WYSA 1KBKA 2I1OA 1DJYA 4PMVA 3TLLA 3THCA 2OYLA 5K3VA 4MKVA 5FEPA 3AROA 3TJIA 3B9EA 3UG5A 1QPNA 2CFFA 3N13A 3L4YA 2PU1A 1W5PA 1M7OA 5EFFA 1J4EA 3OGRA 4IMAA 4LF1A 3LY0A 1W8SA 4JN6A 1QWGA 3TW6A 4F40A 1EWEA 5DN1A 2E77A 1OIFA 4QDWA 3Q65A 3GKFA 1TPWA 4IUGA 4HMDA 1S5VA 3AMGA 3SQLA 2MANA 1MEIA 5A8OA 3EWBX 2OVLA 3TSDA 3K8LA 3PFMA 5CJMA 2GSHA 1G4PA 4LB4A 3NQDA 4L1GA 4FNRA 3T78A 4DELA 3KBVA 1UBPC 4G1NA 4G9PA 2PC8A 3HTWA 2L5HA 3W7MA 4RK8A 1DP0A 3C8FA 4AYSA 4O1AA 3ARPA 1Z89A 1R87A 2ZA2A 5JH2A 4W8BA 4AD0A 4O11A 3BK0A 4FF5A 4J7RA 3WQ6A 1KLYA 3TAOA 1S1PA 4UQCA 1BYBA 2YXGA 4QDPA 2NQHA 2QKFA 2PMQA 3W2NA 1NWSA 1CB2A 1XBVA 2P3ZA 1XLEA 2QHAA 3ARUA 4XKYA 5DT7A 3UCDA 4UTTA 3VC6A 4F9JA 4NILA 1AQMA 3HPZA 4QSHA 4JXCA 3VIIA 2KX9A 1P0NA 4V2XA 4JX5A 5DY3A 1TCMA 4UR9A 4D6EA 4YTSA 3SCWA 2V6AA 2BTMA 4O1FA 3TJXA 2FVMA 1NVMA 5CEWA 4HOWA 4RXFA 3DG3A 1GJWA 1RAKA 2ZTJA 4LU0A 3F5KA 5EU9A 3HQNA 1RK6A 3WLKX 4NJGA 2VNCA 4RDYA 4CNUA 3BCJA 3PNUA 2J7HA 1KKOA 1S39A 4KWWA 4S3CA 5CJ5A 1ZRQA 1TPUA 3OJGA 1KD0A 3RF9A 5T9CE 1QRQA 4IM4A 3WNPA 3TFXA 2EAWA 1GONA 3SW6A 1US0A 3GNRA 4Q4RA 2HNEA 2OX4A 4WOQA 3GHTA 3W6MA 3AWNA 2GVEA 3MHGA 2F2KA 1SPQA 1FH9A 3LERA 4I90A 2HQAA 4PB4A 4AEFA 5L6UA 2TODA 2A85A 4DX3A 5T91A 3W53A 3AXIA 1VBRA 1KTNA 4HKPA 1FWSA 4X63A 3W2MA 1G9HA 2MNRA 3BLPX 2V63A 4HNLA 4PA8A 5I07A 5EMMA 2YDQA 1GQJA 1BF2A 3KVLA 3OLGA 4PTMA 2VUNA 1RP9A 3OVPA 2KAUC 4G7FA 3TTSA 1UBSA 1HF6A 5GJPA 4ZFMA 1C8QA 3BSGA 3FJNA 3W7PA 4A21A 1WDSA 1I2OA 3OODA 3E2RA 2YFNA 3S9ZA 3W2KA 3FSUA 1DJNA 1SO4A 3LHWA 4GQGA 4RPQA 1H1YA 4QJ1A 3GIQA 3UJFA 1XCWA 2Z1SA 4QG6A 2VX7A 3TNOA 3NQAA 2Y8UA 4B9YA 5A95A 1JZ5A 3A6OA 3CUJA 4GYPA 2GYIA 2PTYA 3ORWA 3R0DA 4PTVA 3VIMA 2OO6A 1VS1A 1HZYA 3TYBA 2W62A 4IP5A 2R24A 4DPQA 1B3OA 4ZO8A 3NM3A 4S3EA 3N9SA 1OB0A 3M0KA 4LS0A 4K8EA 2X16A 3MP3A 1T40A 3WQ8A 5BMWA 3RLUA 2GGIA 2OGJA 3LPGA 2DZTA 3EXTA 1H2JA 3GG1A 5F2LA 1W9UA 4HOXA 4FR1A 3GE7A 2CC0A 2VJXA 5C2CA 3QV7A 4HA0A 3RCNA 1JPKA 1Q4WA 3QSRA 1KA9F 4QLJA 3GO2A 3SSJA 1FQ0A 5DCEA 4IMGA 4MY9A 3JZUA 2PDQA 3V75A 4IGSA 1IZKA 4MZYA 3TE9A 1EXBA 4DZAA 3T44A 1SVDA 4DXKA 4YTUA 1V0KA 1ITQA 3BL3A 3CL7A 3WLSA 3HURA 3P80A 4D6JA 1V6WA 4RUBA 4H9MA 3N25A 4HNNA 1OX4A 3BICA 4HK5A 1FWEC 2YXOA 2BGQA 5BZAA 3HPXA 3KFTA 1FX6A 1E6NA 2E6FA 5TD4A 4H6KA 1O5RA 4YTTA 4NAFB 6A3HA 4O1BA 3THDA 2E5CA 3R58A 2Z00A 1AJ2A 2C79A 4QAWA 4GYPC 4C6LA 5K4ZA 4BA0A 3IJ6A 3NQEA 3BLEA 4GUGA 4YXGA 1F3TA 1UWRA 3AMCA 3ITCA 1MXGA 5LIWX 2V5BA 2JK2A 1LWIA 3E5BA 2FFIA 1V02A 3VKBA 4QDMA 3FDKA 3VKAA 3UVIA 1SUXA 1I8JA 2WAGA 1VEOA 1REQB 4Z1BA 3CASA 2H3BA 1QUMA 1QNQA 1XUUA 5BWAA 3ITOA 2WKLA 4LALA 4H9YA 3UXDA 3MSGA 2EPKX 3NQ8A 2QV5A 2YL8A 3GTIA 2WPGA 4FIQA 5HJLA 1VFFA 2HE8A 3LCLA 2RH9A 3DFQA 4E0CA 2W9MA 4IIBA 1C92A 3DFTA 4IFRA 4H41A 3DYPA 3U2EA 3E0FA 1PKMA 1GYLA 1C8YA 3NQ6A 1BHGA 2Y0FA 1KQYA 2WXDM 1GGOA 3W7OA 5AHFA 3BG9A 3B06A 3P74A 3TCEA 1VHCA 1EYWA 3L4UA 3NDYA 1XXXA 2EG8A 3LZ3A 1UR2A 4YLWA 1F4AA 4PTDA 1S3HA 3IEBA 2CNCA 1K8ZA 3MUY1 5LSMA 5F2MA 4OTKA 1POKA 5K7JA 1D9EA 5CZSA 1YXCA 1Z44A 4XV0A 2VL4A 1RBOB 3CQ0A 3MHFA 1FP9A 3RU6A 2Y7FA 3VKKA 1OVDA 2OGYA 1F9CA 5C70A 1AODA 3N19B 1TWZA 1R30A 1DE6A 4K1GA 3W81A 2NXIA 2X1SA 2HROA 3BQ5A 4PCFA 2I5IA 1RD5A 2RJGA 5AN7A 3WJZA 4MKSA 3MCMA 3THQA 1PKNA 1LBLA 4WVXA 2R1PA 2AOSA 4WF7A 3RRXA 3IWPA 4QEEA 1UH2A 4DN1A 5F4WA 4D8AA 2I9UA 4IQLA 4L9YA 1TPB1 4QTGA 3NQFA 4A2SA 3CZGA 4JIPA 4JN8A 4LFYA 4B4HA 1JDFA 4HCDA 2P10A 3KTSA 2VR5A 4M80A 4CQBA 4O16A 4LAZA 2QJJA 3G3MA 2ZRZA 3RX2A 2D1ZA 4XZBA 4HU4A 3R5EA 1XLCA 5FA5A 3M1ZA 4ICMA 2QGHA 3BJTA 3HGOA 1V6XA 5A8QA 3PS7A 3AIBA 4V1YA 2D23A 3CL8A 4TMCA 3ARRA 4L4LA 1O4UA 1XG3A 3R89A 8RUCA 2D24A 2ZCGA 4XAGA 3W2UA 3UXAA 1B3VA 1F6PA 5KSWA 3KRZA 1L6SA 2XUCA 3EA2A 2Q3OA 2WHKA 5A5WA 1EJ7L 4Y9PA 2TRSA 4HYVA 5HMEA 4I5XA 5EMKA 1Y5VA 1C93A 3DKJA 4DLMA 1LT8A 3POHA 2HMCA 1F6YA 1R6WA 2O56A 5DX7A 2OOFA 1BG9A 4OVXA 1JDCA 2VEFA 4CEUC 3WIJA 1TIWA 4JNYA 1EP3A 3M0LA 2AGTA 3LU2A 4J3WA 4XKYB 3N29A 1AMYA 1XLHA 3WLPA 3M0HA 1ZP4A 1ZBKA 1R38A 4RXGA 1D8CA 3JUGA 2WMFA 1NARA 4YVXA 1YDVA 4HPJA 3UPWA 1OFPA 2ZZ7A 3ENLA 4B5SA 3CQKA 1JGIA 3W70A 3QFEA 4E8DA 2ISWA 2RDXA 3O06A 5H2ZA 4HNTA 3UG3A 1H60A 1OFAA 2PP1A 4LV4A 3NQ2A 3RPDA 1VRXA 3A47A 3HG5A 4I7UA 2UV8G 3PZ9A 2Z1XA 2VTFA 3S2MA 4CCCA 2POZA 4HA4A 4QJ5B 3OBAA 3LDVA 3E12A 5TAOA 3SSZA 4WGXA 3MWAA 4GIEA 3K30A 4FHAA 3MYOA 1V3LA 1F3WA 1M68A 2E8ZA 4KT2A 1EGVA 4DJEA 1RY8A 4AC7C 2J7DA 1ADOA 4YHEA 2WZEA 3ZOAA 4EPDC 3G2GA 1G01A 3EMQA 2P50A 5AC6A 1WZKA 4K68A 5A2CA 1LJYA 3W38A 5LYRA 3LQLA 1VJIA 3AXMA 1K9TA 3T8LA 3W1MA 7CGTA 4H1ZA 3VMPA 4N2YA 3CLMA 4BF7A 2ACSA 2EPMX 1A0DA 5HXMA 3APTA 3B04A 1B3WA 1LTDA 2PDHA 3PZQA 4Q8PA 2AKZA 1FDYA 4M6VA 3FFSA 5B80A 2BODX 3UWEA 2J6VA 4L6HA 4HGXA 1IV8A 3KM8A 4QJ4B 5DXYA 1J0YA 4FK9A 3C0QA 5FACA 3PSWA 2PDFA 5JIWA 4NI3A 7TIMA 3DI1A 4EP8C 3WLNA 5CZKA 2BLEA 4J9JA 5BOFA 2E9BA 2OWWA 2C13A 3AXHA 1EQPA 3WF3A 1D8WA 1TJ2A 1M7XA 1UUOA 3W7IA 1TVNA 4OBTA 3LM7A 3QBUA 1HTIA 4GVFA 2CLOA 4WJEA 5CG0A 5I3IA 2OOGA 3HPFA 5JBFA 3MI2A 5L9FA 1UWUA 1Q45A 2OQHA 4TVCA 3V35A 1YPFA 4B9ZA 4H2HA 2OT0A 5T26A 3UJRA 1SFLA 3AIWA 2DGAA 4AD3A 2YGYA 2J13A 4IIEA 1NDWA 4N02A 4QHRA 3W7LA 4WY0A 1BXNA 1EQCA 3H21A 3OVQA 1CLVA 3DBPA 5CPMA 3TSBA 2DDXA 1TYGA 3HG2A 5EBAA 1V7YA 3TTQA 4JTEA 2X30A 3PNZA 1H7PA 2MUCA 3EKZA 4TX9A 3PZTA 3MP5A 1RZMA 1Z9AA 4OKDA 3LYEA 3B03A 2O9RA 4AD2A 2DZPA 4P7OA 4FZIA 1JDDA 4B16A 2WPBA 3WMBA 1OX4B 1ECEA 1VFHA 1VJSA 3CAKA 3LLDA 1Y5XA 3LBOA 3L23A 3LBMA 4PMJA 4UCFA 4HSNA 4J3VA 1Z42A 2YCIX 1B2YA 1K4GA 1X39A 4S3DA 4GQBA 1B90A 1ZL1A 4Q32A 3CEUA 4UFLA 5AKQA 3TJLA 3GBDA 4NJHA 5CCZA 1BWVA 1B4EA 1IXPA 2G3JA 3ES8A 3F03K 3SADA 3MY9A 2QAFA 1KCLA 3WLLA 4D71A 1KCZA 2GJXB 4KFOA 4F9DA 3PZMA 1IWBA 4PMQA 1HP5A 3TH6A 4WXZA 3QHMA 3IVUA 3L4TA 3PHAA 1XLBA 2D0GA 3F4WA 3P7YA 1GVQA 3PTDA 3G5EA 1WZMA 2I17A 4AZGA 4HZMA 1E5JA 3MCNA 2FTWA 5KINA 3B9OA 3ZWTA 2JIEA 4QX4A 3IV8A 2HV5A 1W17A 1GTHA 1SM9A 3OZOA 4N7QA 3SURA 4C6PA 3LEPA 4HQVA 2WCSA 1A5BA 2JEPA 4ES4A 1GORA 3WKZA 4O57A 1B54A 2D22A 3RLVA 3F2BA 3B8VA 4YWSA 2G0WA 1D3CA 4F3HA 3PZNA 3A4AA 4R53A 4KEZA 3LXCA 2C8NA 5IOBA 4RPPA 3QMRA 4B5NA 1U5HA 3DX5A 1ZY9A 1F3EA 5ENLA 1XIGA 3GFXA 1W5QA 3R7MA 2IMRA 2D2OA 2E28A 3G22A 1XHGA 4QCEA 1FWIC 1G5AA 8TIMA 4EXQA 2D0HA 3CL6A 1S2CA 1W56A 3OPSA 2WMGA 1W3TA 6REQA 1GYNA 4WRHA 4B5XA 1GVIA 2Y63A 3DCPA 1VBGA 5FF2A 1E6ZA 4GYJA 3IAPA 1ISVA 3O15A 3RPTA 5KZEA 1P0DA 2Z1WA 4LGXA 5HA7A 3GFZA 1I4NA 3LK6A 3C2VA 1E0TA 4MDPA 4L65A 2PP0A 2ZC1A 1Z48A 1X8FA 2OO0A 2C7FA 2ATMA 3NOYA 2A3CA 2O9PA 1CX9A 1Q7ZA 2PE4A 3REQA 3PC0A 5E0FA 1H11A 5AYIA 5HPCA 5ABTA 4EXBA 1G7VA 4E3VA 3BMVA 3EDJA 4ZOCA 1UD5A 4NJKA 4GCAA 4EAYA 1A80A 3OU8A 3GH4A 1QJWA 4REQA 4ICNA 1XLKA 1HO1A 1K9DA 5CZ0A 4JTAA 1CXLA 1DPMA 2OXNA 1PDYA 3DN5A 2XIMA 2I5GA 3PR2A 5D9PA 3S1GA 3NXFA 7REQA 1K7EA 4PGLA 2OZ0A 1UG6A 2Y5EA 4ATWA 4DAIA 4LB3A 4WDUA 1XBXA 2Y2WA 4RW3A 1UIOA 3WNOA 1BD0A 1OJXA 4GC4A 3OQEA 3SGUA 4OWGA 2X0HA 3N2XA 4Q7IA 4KETA 1QW9A 4PUDA 3NZQA 4KWOA 1TJ1A 2A4AA 3CEPA 4ORIA 1R47A 2NVCA 4B3ZA 4GMEA 4RDVA 2PEVA 3RJYA 4MNMA 3T40A 1MVYA 4TTUA 1OCNA 3IK4A 3MMUA 1WZAA 1V0MA 2BFGA 2QJHA 2XSXA 3F4DA 2HTMA 3KTXA 4GI9A 5GNZA 5FKYA 4AWEA 1IEQA 1S5NA 4NX5A 2VVNA 4JIQA 1Y65A 4ZTXA 3S1XA 4NHVA 4F0HA 4OU1A 3KXQA 3QR0A 1I2NA 1TSIA 2EO7A 1IT7A 4LH8A 1A5UA 2H8ZA 1QPRA 4P2VA 4WOZA 5AYXA 3C3NA 4AVOA 1A4MA 2C6QA 3E1F1 3MDWA 5JQ9A 3B8WA 3ZSTA 5D9OA 4HVXA 1NFGA 2XVLA 1VIWA 2IXUA 2Z4GA 5HOSA 1KFCA 2DSWA 3VIGA 1EB3A 2EG7A 1L6WA 3N2OA 2F9RA 2GGJA 4HZ6A 3SZ8A 3W88A 5G5IA 1E3XA 3VFLA 4AF0A 3EB4A 3LQGA 1FKWA 5CQ1A 5FF0A 1AD1A 3AYSA 4GXWA 4BI7A 2QDGA 3V5FA 3SFKA 1KR1A 4JZ5A 4HBKA 1EIBA 2VR2A 5HWJA 1LL4A 2G4FA 3W1UA 4IJCA 4G6CA 2FQIA 4CCEA 3TN5A 4NZ3A 4ORMA 2WMJA 2CLEA 3EXRA 1TO3A 1V08A 3A5FA 1I6NA 2FYMA 1NJJA 3K1DA 3CB8A 3QJAA 4GABA 1ZSXA 1ISYA 1TCDA 1Q6CA 3G6MA 4MYAA 1U33A 4TR9A 2DY3A 1XBYA 2VUYA 3KTCA 3H4WA 3M0ZA 2CWNA 3LSCA 2WSQA 5BOEA 3D6NA 2E5DA 4GA8A 2G3NA 4ZCWA 1MRAA 3TYEA 5A69A 2WMIA 5JVLA 3TTEA 5FJTA 2Y62A 2XM1A 1QOPA 3L68A 1E0WA 3TAKA 4H00A 2UY4A 3VMNA 3K4DA 2JGQA 4O0KA 3ARWA 2DEPA 1LG2A 3ATZA 6XIMA 4J3UA 1TX2A 1VP5A 3AYVA 1S5TA 1KWGA 2HXTA 3LBCA 1TWWA 3BLOA 4ZENA 2QDDA 4M82A 3H23A 1E1CA 2X41A 4UTIA 4OT7A 3WQFA 2PLJA 1RJQA 1DTUA 1A3HA 3SRFA 5ECUA 4QLKA 5HATA 4DUWA 3TONA 1PZ1A 3BLKA 3RX3A 1E4MM 3VOCA 1BYAA 4MPQA 4KEVA 3WUGA 5I3DA 1OZQA 2RJHA 4OBRA 3UW6A 4D6IA 3AIQA 1VFMA 3PBYA 2I56A 2OZTA 3C56A 1HKKA 4FO4A 3VKCA 4P8XA 3W71A 1KM6A 2JF7A 3GHUA 2JGYA 1JFXA 4RZ6A 6PTDA 3H2FA 1H1ZA 2X8RA 3KVMA 3L9CA 3BAYA 1QBAA 2BHUA 3C52A 2IPFA 4JKKA 3UWYA 2C0HA 4S3JA 1OGBA 4W87A 4EIVA 2AAAA 2WVUA 2PLCA 1M04A 2ABAA 3G1VA 3Q45A 1ITXA 4C1LA 3U7VA 1EP2A 2G37A 3HPAA 1V4YA 2PF0A 1AK5A 1WUFA 1U1HA 4XSLA 3BJSA 3UD6A 3F2CA 2ZRVA 4AY8A 2J4GA 1RQHA 3CIVA 1RCXB 3Q67A 2JIWA 1JDAA 1IXNA 3TVAA 2O92A 4Q33A 4PCTA 2YJQA 4S2BA 4ECLA 3THUA 3F5JA 3L5LA 4IPNB 1JFHA 3NOEA 1IEVA 1ME8A 3SIZA 3UWQA 1OX6A 5D05A 3O07A 3WJYA 3S2JA 1IT0A 2GDVA 2NUYA 2QLYA 3DZ1A 1GVYA 3N4AA 5C9WA 3OGSA 4CD5A 3NL2A 3P3BA 3KDOA 4ZXOA 4F4RA 1CYGA 1VB9A 2AMGA 3WQCA 3CHVA 2VC7A 1UOZA 3P5ZA 1PCKA 1BVZA 3I6TA 4PRWA 4U31A 2NQZA 3KS6A 3CV7A 1J0KA 1B1YA 1H1NA 2W91A 3GR8A 3HJEA 1SR9A 4X60A 3TA6A 1B3XA 4QE1A 3STCA 3TTOA 3OG3A 3DC0A 3WX7A 2YX0A 4JTUA 1V93A 1I75A 4UZSA 5C9ZA 3URAA 3T1GA 3APYA 1POJA 3LCIA 3VDGA 3TUUA 1QHZA 3NZ1A 1ODUA 4F48A 1XW8A 1XSJA 3MDUA 1Z32X 4JEJA 4IICA 3BQ6A 4K7YA 5I3JA 2YOCA 4F0RA 5DMNA 1VHNA 2X0YA 1SYTA 2NQJA 3ARZA 3CUGA 4AB4A 1O7AA 2QUMA 5AYZA 5I3HA 3RK8A 4H8HA 3G1HA 4O17A 6REQB 4QCFA 3RLGA 6TAAA 5FEZA 1YADA 4BKNA 3WD4A 2PGEA 3R79A 1CTNA 3D47A 4JTIA 3WLQA 5AYBA 1JIBA 3BDKA 4UNLA 4J1OA 4C91A 1DORA 2P0OA 2B7NA 2WHJA 4NY2A 2YCLB 2IPJA 1EJUC 1W3KA 3HIJA 3REQB 1GTEA 1ISZA 2PDWA 3BJFA 5C71A 2F6UA 4KW2A 3LB0A 1TREA 3DFNA 1IE7C 4EOUA 3PULA 2GWGA 3LNMA 2ZZ6A 1J5TA 3BLDA 3QR1A 2Y89A 5BXSA 4RKAA 1TVLA 4JTSA 4QXIA 3PJXA 3UJSA 3PN8A 5I06A 1RALA 4Q8OA 4AIBA 1UW9A 4LAKA 1LRTA 4NP7A 1ZAHA 4JCMA 3VD4A 1ZBCA 5CJNA 1Q6GA 3U2ZA 3CM4A 1R7AA 1AZ2A 5DEZA 3NYDA 2F61A 4DRSA 4MWAA 4H2CA 1XCXA 3CWOX 1XLMA 4JHZA 3U2OA 2PDBA 4LUSB 1W3NA 1CPUA 4E2VA 3BWWA 4ACZA 4IGNA 1JZ8A 4MB3A 4LVAA 3NR0A 1UASA 3B0XA 1VYPX 3C2EA 1QOXA 3LRMA 3S1WA 3W01A 3I3BA 5U7SA 4S3KA 4S3GA 5IDZA 3EMZA 4WJXA 1BKSA 1KM2A 2GGEA 1H7NA 3S83A 4LNCA 1UKOA 5F4XA 3S6DA 4A4AA 2PWVA 3EB2A 1X6UA 1OSEA 2C91A 3CC1A 5A6BA 1ONWA 4WLCA 1H7RA 4Q4MA 2PA6A 3DYOA 3C6CA 2D2HA 1FCBA 3LMYA 4MUZA 2P8BA 1OY0A 3WFAA 2XGBA 1QCWA 3UCCA 2X42A 3CV1A 2X2YA 3GAYA 1HGWA 3H2AA 4DF2A 1KRMA 1XLLA 3T0AA 5FF4A 1DHPA 3RDKA 1NP2A 3IIPA 1UD3A 2CLKA 2ABBA 3IJQA 2B7QA 5EB8A 5E09A 1UYQA 2QAPA 4H01A 2I16A 5CZJA 1X98A 3S5ZA 3DBNA 4MWAC 3H12A 1LQ2A 1DJGA 4AF0B 2CEQA 1VR6A 2F8QA 4B3KA 2F2HA 1QOQA 4XG1A 1F61A 1ICPA 2R9RA 1MI3A 4JPGA 2PDXA 4FOKA 3HMJG 4O54A 1SFJA 3CLWA 3NPXA 4QITA 5HJXA 4J3XA 2VX6A 2JQXA 2VQUA 4WSKA 3W7DA 3A3XA 3MI6A 4RNIA 3O0KA 4ZQOA 2WNZA 1UKTA 1OCBA 2J7BA 2ZZ5A 1XGZA 2QCEA 4Q4PA 5CPNA 4NZ5A 4DWSA 1Q6OA 1N2VA 2FHCA 1QI3A 1BGAA 2FZ8A 3G8RA 1J11A 2DUXA 2V9DA 3JR2A 2E1DA 3UPBA 4MLRA 3AS3A 4RE2A 4RDWA 3VCRA 3NPWA 1QPQA 1O5QA 1RK5A 1MFVA 2WMIB 4FNQA 3XINA 1Z41A 2XVKA 4GE8A 1TV8A 4ADTA 1PZ2A 3ZWSA 4GD0A 4IL0A 3R8RA 1AJ0A 1EH9A 1N8IA 2NLYA 3EA1A 1S46A 3QPYA 3IK2A 1V51A 3RFAA 3AS0A 4JQ1A 4I5RA 4I9TA 5I3GA 4W84A 4NX0A 4QSFA 4MKNA 4UNKA 4Y9AA 3AS2A 5BCAA 3CS2A 3EWXA 2OKTA 4H4IA 1E1CB 2PWFA 2QIWA 4J40A 1GOKA 1F76A 3DIPA 3AIEA 2IPGA 3N17A 1MUWA 5CGTA 3VDHA 3DUGA 3N3MA 5BRBA 1UUMA 1VYSX 2FJKA 1KWKA 4HJWA 3T2OA 4IQJA 2WZIA 2PD5A 2WKJA 2VFDA 3NEHA 5C9XA 2G95A 4UUIA 1CXHA 2H6RA 1U2YA 3ERPA 2O0TA 2PTZA 3A4XA 4YCOA 4ZQPA 4DWSC 2FMNA 1GEQA 4ZL1A 5FJRA 1W8GA 1XLAA 3GHSA 2BWGA 5A6MA 1IQ8A 2W5FA 3QPEA 1IGWA 1HKVA 4XISA 3EX4A 1UR0A 5G1TA 1V3KA 3VDCA 3PPFA 4ZB2A 4KRZA 3WQGA 2QCDA 1JUBA 2DZVA 3FW6A 4NZ4A 4AHQA 5ABEA 4O28A 4W88A 4BS0A 3QOMA 3B97A 1KW1A 2ON3A 1MO0A 2GDQA 1TMHA 1XLIA 4PTWA 5CXPA 3W73A 4TMBA 3B8UA 5CG7A 1JR1A 3H2OA 3TIMA 1YYAA 3WDRA 4BY3A 4N4QA 3ISIX 4L5ZA 4YN5A 5HQEA 5A6SA 3FXYA 4G7EA 1JCNA 1B3YA 3GUWA 5AFDA 1QO2A 4IF2A 3CWNA 1HUVA 3SEPA 4ZTYA 2VZOA 2ZFAA 4DM1A 3H4XA 5FAJA 3UWZA 3R8HA 4HHHA 4UTUA 1A5KC 3TNBA 1R2RA 3QZEA 4OV9A 3NGJA 1VZWA 5CH9A 1NWRA 1PYMA 5CGQA 3C86A 1CGWA 1GQLA 2DSZA 3E9AA 2INFA 2XH4A 3FKRA 3ZVIA 2JE8A 2PZ0A 3TDFA 1ADSA 1I1XA 2FH8A 4EPEC 3WF1A 1MSSA 4CD4A 1PCWA 3LHVA 1NWUA 3W1AA 4GZEA 5TNVA 3N2TA 4E2BA 3SQSA 3GVWA 3MA8A 1XIDA 4LVFA 4ZODA 3VUSA 3O16A 2XPKA 2G4JA 4JD4A 1RLDA 1LZOA 3L7RA 4QE4A 2VFEA 2XFWA 4UTFA 3RMEA 5GNXA 1YXDA 1J10A 3VXGA 3UGRA 4Y9NA 3N73A 3APGA 4AEOA 1U1UA 3VNMA 4AZCB 5D2XA 1JPMA 3OGVA 1A49A 3VAVA 3OA5A 2PAJA 1M9HA 5G2WA 1YDYA 1YDOA 2J9ZA 4LPCA 1JPHA 2REQA 1XS2A 3WDIA 2VM8A 4H8NA 4QAIA 1UWQA 1OFDA 4US5D 4Q4SA 4Y9MA 3C3UA 5J5RA 3W83A 1ALDA 3KBMA 2ACRA 3AAMA 2V5KA 1DWAM 1RJPA 1X7IA 3A24A 4B5WA 3AC0A 4HN8A 4GH1A 7A3HA 4HN4A 1A5OC 1UIPA 7XIMA 6ALDA 2QW5A 2P5NA 4M6QA 2GUUA 2YZRA 3F4CA 1KFKA 4PMUA 1F05A 4A29A 1L6GA 1OGGA 1M3UA 3LG3A 5D2VA 4CN4A 3W7EA 4NZCA 4XIMA 3V1HA 3GIPA 4ZR8A 1T41A 3LTPA 2OEJA 3MU7A 2X1RA 1CECA 3IVSA 2A2IA 4LUTA 2V82A 1TRDA 3HN3A 1C7SA 4LS2A 1OFOA 4FIRA 1GJPA 3UVAA 4E8CA 2J78A 3R10A 3WD1A 1Q5MA 3DOPA 4A3YA 1TJPA 4CVUA 1W1VA 4DO6A 2YDRA 4JFUA 1NY1A 1QTWA 4MWAB 2HK1A 4ZA0A 3R1ZA 1EEXA 2VRQA 2GK1A 3WDHA 1BYDA 1E9ZB 4AU0A 4ACZB 1W5MA 3KRSA 1H61A 2D2GA 4JTTA 3E0WA 4PB3A 4FNUA 2DPEA 1QPOA 3MV11 2RGLA 4O8AA 2VOTA 5G1YA 5E70A 3MSDA 3OHMB 3TEVA 3VOFA 1YPIA 5GJMA 4E38A 2FHBA 5F1VA 3FYYA 3IGSA 2WBKA 1EOMA 1H0GA 3I7RA 5LZLA 2VD9A 2C71A 1AA1B 3RO6A 3EOSA 1VAHA 3R8GA 4BEQA 5FJPA 2PF8A 4IX0A 4K37A 4JN7A 4DNMA 5KZMA 1J18A 1JI1A 3WDPP 3STGA 1MDRA 4FPSA 3SRHA 1BSLA 1F8IA 2WC4A 3CMGA 4PSRA 4E3TA 1EKOA 3OBKA 2XIQA 3RMJA 1BAGA 3T9PA 4YTRA 1DWHM 1EPXA 3BGGA 1RVKA 3RUBL 3NTYA 1XDMA 1ZLPA 3K1GA 3AU6A 3EDFA 4ML9A 1GW1A 1IIGA 5JMUA 4D6CA 4C6CA 3RN6A 3BPWA 4UOJA 1JZ3A 3H22A 3H2MA 5EA9A 3OHIA 3FAXA 4F66A 4ZO7A 2FPYA 3M0YA 1FVPA 4KCUA 2A0NA 1AH3A 6ENLA 4IUOA 4B92A 4OECA 4H83A 3CV2A 1O12A 4ZQRA 4XAPA 1CLKA 3EAUA 2ACUA 5FEWA 1PTDA 2TSYA 3TQKA 1L9WA 3IARA 2D69A 1JCMP 1QW7A 1PVNA 1B57A 4ATDA 3AJ7A 4DXVA 5AB3A 4OFCA 1IXOA 2Y61A 1LL6A 3OP2A 4WZHA 2BVTA 1YNYA 4N42A 2V30A 2EEXA 5BWFA 2G96A 3WNLA 3SBFA 4NYYA 3NURA 1LUCB 4IMFA 3WO8A 2QUNA 2NXHA 4DWSB 2VQTA 3ZT7A 1YBQB 5AC4A 4AISA 1K9FA 3S8HA 5GJNA 1SFTA 5BU9A 5HNRA 2Y85A 4XZ9A 3SCNA 4O19A 3SB0A 1A5LC 3AU2A 3FHQA 1G0CA 4RW5A 5D02A 1XBZA 1AJZA 2PODA 4K6AA 3ZJ7A 2VX5A 5LNWA 3CHCA 4OJYA 5XINA 3CNYA 1E73M 2ZXQA 2G5WA 3CB3A 3T0BA 3GAKA 1BQGA 4GO8A 5I09A 3VGGA 5I0DA 3CMJA 2WHMA 4LYRA 3A9BA 5FJIA 4RL3A 4E8GA 1YLVA 3B4UA 1UB3A 2OEKA 3I7QA 2QS8A 2PC4A 2XH2A 4QS5A 3GD6A 2VWTA 2HDJA 3NPUA 3URBA 2FB3A 3LXBA 3USZA 1JCXA 3VIJA 1GPFA 3G0XA 5IFTA 5LXEA 1N82A 2DORA 1US2A 1Q8JA 1M6JA 4FLSA 4CNSA 3T0CA 2EKGA 1NSJA 4G56A 3N04A 4MJZA 1CZ1A 3OTRA 1G4SA 1DTNA 1Y0EA 3M43A 4CVWA 2ZUMA 1SZRA 1R9ZA 3RM8A 2DSUA 2VDGA 4IGHA 4TUFA 1TG7A 4D6GA 1ISWA 2OODA 2FKPA 2J8TA 1B31A 1TWIA 3TMLA 4DLFA 3IACA 1CDGA 5I02A 1VJZA 2Z24A 1ZJIA 3BLFA 3U3HA 2J27A 5K9XA 2V5LA 2VDHA 3NQBA 2OQLA 4CD7A 2ATSA 2BOFX 2D3NA 5FEXA 2B31A 2ZOXA 4B2DD 2VGIA 4W85A 3DG7A 1XRSA 2V3EA 3LS9A 2PB1A 3F7JA 3WMSA 4BR1A 1VEPA 1BTCA 3AXKA 1Q2SA 2WANA 4WSJA 2PP3A 4WCJA 1DV7A 2QPUA 3SJNA 1HJWA 2GVLA 4JTCA 4BWLA 1SJBA 4G7EB 3EX1A 3KBNA 4JX6A 3T08A 1G1YA 1WP6A 2BXYA 3K4AA 2WJZA 4IHCA 4MG4A 5A2AA 3QSTA 3TTYA 3WL0A 4W93A 1L2QA 2NT1A 4IXHA 2Q01A 2YA0A 3UR2A 3VGBA 2PWEA 4IG2B 1DQXA 3T7VA 1MDLA 2ANUA 5F2GA 3WBXA 1ZCOA 1C9DA 3BAIA 3N14A 3GR7A 5A8MA 3V16A 1ZB5A 1FKXA 3MVTA 4GLEA 3W86A 2CLPA 2A7PA 5MHBA 3TR9A 1GJUA 3NWRA 4PMZA 3W7GA 2YB1A 1B3ZA 1WBJA 4CUCA 4GBDA 3NZGA 3DXIA 3B40A 2V38A 4H9UA 3A3HA 4GBUA 4H9ZA 1GKPA 4H04A 3CU2A 4GYKA 3SY1A 4LXFA 4TO8A 3W27A 1KM4A 2WM1A 4EPKA 2WBGA 1CXEA 5AC7A 3E2VA 1SR0A 1UD4A 3WDQA 1OQFA 2J9YA 1P6BA 1P4CA 2I5QA 1MEHA 3TN4A 4BWLC 4UIOA 2RDWA 4JY9A 3B8TA 2BMBA 2IXVA 4UWMA 2C0AA 4CU6A 1RA0A 3S0CA 2WZHA 5HMSA 5AC5A 1E40A 1EX1A 2INZA 3GDRA 3N1AA 1OZMA 3FA4A 1J8VA 5HINA 1TV2A 1LBFA 5EYWA 4KESA 2QR6A 4D2JA 1XV8A 4A3RA 4C7DA 3NQ7A 5DCBA 3EZ4A 3LLXA 1TUFA 4ADUA 5F7UA 2CHOA 1PBGA 1I0BA 3I3DA 2XN1A 3POCA 3QY8A 1RQBA 2VEIA 4XB3A 5KMYA 1JF5A 1KGXA 4IMCA 4HHPA 4MHBA 4FNTA 5C2XA 1LQAA 1YEYA 1KTCA 3DHFA 4N6EA 5TIMA 4IQDA 3AMLA 4Z1DA 1XKJA 4O0QA 2JBMA 1T96A 1B30A 4KFPA 3MI3A 4UZUA 2QCNA 1FY6A 5LA2A 2J8FA 2ZWYA 3WUFA 2XFYA 1P7TA 3CHDA 3QTGA 1R3RA 4AIUA 1OHLA 4I9JA 1EFZA 1NIUA 4YMZA 3S5NA 3M47A 4LUTB 3GW0A 2OSWA 1QK0A 2ZA3A 1FFQA 3OLEA 5CKSA 3AUJA 1AVAA 3W22A 3RM4A 4A35A 4UFHA 4M8UA 1PL9A 5LIXX 3WLJA 3O9NA 3FYPA 3KEHA 1M1BA 3N6JA 4INFA 2DZWA 3H8AA 4CU8A 2V8ZA 1SMDA 2EQDA 3E38A 2ZZ2A 3AUOA 3N34A 4ML4A 2PDCA 2GK1B 1WQ5A 3W6YA 2IS7A 2QJMA 2BVYA 3OVGA 1B9ZA 1W31A 1J01A 1R85A 1RA5A 4JTLA 4E6MA 4HU3A 1QFEA 3UYIA 3A64A 3M16A 1QAPA 2NLIA 1T0OA 2H3DA 2CZDA 4BF5A 2FZDA 1OFEA 2XN0A 3GDTA 1DJIA 3UZ5A 2V3DA 5JXQA 2QZRA 4BQ4A 2PLMA 2Z0IA 1PKYA 1KR0A 2VKZG 5I3KA 3VIKA 5EMJA 1F6KA 2V3GA 3ITTA 4WDXA 5F2IA 3ZO9A 3VNDA 4PCSA 4AW7A 1DQUA 2VI0A 3GDLA 2BGSA 1H4PA 1X6NA 3EWZA 2E25A 3NXLA 1R0MA 2VEGA 3BLIA 5AYYA 4WEVX 3V3WA 1GNXA 5HWMA 4QLL