1RQBA

Propionibacterium shermanii transcarboxylase 5s subunit
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
472
structure length
471
Chain Sequence
PREIEVSEPREVGITELVLRDAHQSLMATRMAMEDMVGACADIDAAGYWSVECWGGATYDSCIRFLNEDPWERLRTFRKLMPNSRLQMLLRGQNLLGYRHYNDEVVDRFVDKSAENGMDVFRVFDAMNDPRNMAHAMAAVKKAGKHAQGTICYTISPVHTVEGYVKLAGQLLDMGADSIALDMAALLKPQPAYDIIKAIKDTYGQKTQINLHCHSTTGVTEVSLMKAIEAGVDVVDTAISSMSLGPGHNPTESVAEMLEGTGYTTNLDYDRLHKIRDHFKAIRPKYKKFESKTLVDTSIFKSQIPGGMLSNMESQLRAQGAEDKMDEVMAEVPRVRKAAGFPPLVTPSSQIVGTQAVFNVMMGEYKRMTGEFADIMLGYYGASPADRDPKVVKLAEEQSGKKPITQRPADLLPPEWEKQSKEAATLKGFNGTDEDVLTYALFPQVAPVFFEHRAEGPHSVALTDAQLKAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords transcarboxylase 5S subunit
publication title Transcarboxylase 5S structures: assembly and catalytic mechanism of a multienzyme complex subunit.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Transferase
total genus 168
structure length 471
sequence length 472
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
A PF02436 PYC_OADA Conserved carboxylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1rqbA01
2PRHA 1K02A 3E96A 5CG7A 1AG1O 3KFTA 5F2GA 4RZ6A 2V5BA 3QMRA 3P81A 3QZEA 1GJPA 4KKXA 3W72A 2V81A 1G6CA 1F6PA 2A0NA 3CT7A 2BZNA 3TQVA 1GTHA 3GKFA 5H91A 3S1XA 4NJJA 1GZGA 2TYSA 2UV8G 4FNPA 2VFHA 3R2GA 4RLIA 4WJEA 1IGSA 4RXFA 3G1AA 3CC1A 4WOZA 3W7QA 3HMJG 1NEYA 1SFLA 1YXCA 2NX1A 2GVJA 1TV5A 3IVSA 3TKFA 1JCJA 4OU1A 4ZQOA 3PS7A 4QISA 1MO0A 3TU9A 2JKEA 2OZ0A 3MI6A 4O1AA 2FPVA 1IXNA 4FX8A 1W1ZA 3TV8A 3SR7A 5FF0A 1MSSA 4PFMA 3DGRA 2C13A 1IIHA 1D3HA 3V75A 3PB2A 4LWWA 1SO5A 4O57A 2WJZA 4LC8A 4LOCA 5D02A 1GWJA 3EX3A 4H4IA 4WY0F 5U4NA 3LM7A 2E1DA 4AWUA 2F7FA 2AGKA 3W1TA 1F6KA 3S1WA 3VKJA 3KHJA 2ZZ6A 1HO1A 3DI1A 1PS9A 3P74A 3L5LA 1GVSA 2GVLA 4M7SA 5D37A 2ZRXA 2QCFA 4NX5A 3MBDA 5FEPA 3L0GA 4MUZA 3BLEA 1PL9A 1RD5A 3B4UA 2QUVA 1H7RA 1EIXA 4RK8A 3D0CA 5DXYA 4Z1CA 5IBXA 1TTQA 3R13A 4JYDA 3WJWA 3NZ1A 2FB2A 1VCVA 1ICQA 3HBLA 3RLUA 2NWSA 3E9AA 2B4GA 1T99A 5E0KA 1OFOA 4N9CA 2G95A 1RR2A 3L68A 1G69A 1DBTA 5D05A 5K7JA 4O4VA 3FYPA 2A85A 1ZFJA 3A9IA 1A5BA 1W3IA 5BNKA 3W07A 3W1QA 3ABRA 3QQ1A 4A21A 1WBHA 3BGJA 4UTMA 1H1YA 1G4EA 1K03A 4UTWC 2WSQA 4PC8A 3G8EA 2QCLA 4ZQPA 1VYRA 3SI9A 2X1RA 3W75A 3QPYA 2A5HA 1OFDA 4LTSA 3ABSA 3TMQA 3U6WA 4UIOA 1KTCA 3LCHA 3MWAA 2QCDA 3LCIA 3BW4A 4IQLA 2Q3RA 1OYAA 2QCHA 2A7PA 3PR2A 3QQ0A 3LGEA 4ZQRA 1SZEA 3WFAA 3W1LA 2R8WA 3DFNA 8TIMA 1GQNA 1VZWA 4FNSA 3ZR4A 3W7IA 4UMBA 4WOQA 3NG3A 4HNUA 4K38A 3P61A 1VGAA 1ALDA 1S5WA 4GUJA 5DXXA 2PC4A 1QPQA 1TJRA 4MZYA 3TSDA 2PCQA 1K7FA 4Y96A 4O53A 3FYOA 1UUOA 1LBMA 3GVGA 5I3KA 3THQA 3OA3A 4Z0SA 3HPXA 4A22A 2Q8ZA 4HNVA 3N9SA 5C2XA 4Q33A 4FHAA 3GDTA 3L67A 2CLEA 1OFRA 1TCDA 3QJAA 2J24A 3HG4A 5DCEA 4NU7A 1BKSA 1CX9A 3BO9A 3NNTA 2GJNA 3OEXA 3NPUA 3QFEA 4WZHA 2WOQA 1Q6RA 3HGRA 5D09A 1KFCA 2H3BA 3QSRA 4TIMA 3HGJA 1BEUA 3GKAA 4PODA 1SO3A 2Y88A 2O7QA 3EWXA 3N2XA 1JCYA 4DQWA 2C0AA 4K36A 4JDBA 1PHQA 3UZJA 2E6YA 2QR6A 2AQWA 3PULA 4OV9A 4FXRA 2GVGA 4ZMGA 3GXPA 5CKSA 1KFBA 2QCMA 3NQ8A 3H54A 4AHOA 4JXCA 1O94A 5TQLA 5LHFA 1SO6A 2ZQ0A 1XM3A 1N7KA 5EMUA 5KZEA 3GX9A 5ABTA 1T8XA 3ABQA 3O15A 1WAUA 2E09A 5AYXA 4FNQA 4E2BA 1U83A 3HGSA 3G3MA 3KRUA 2A7RA 1G67A 3EXRA 2I9EA 3CIXA 5D03A 1X1OA 5BW6A 3O1NA 1KTBA 2CLKA 3DFPA 3KVJA 4UTTC 5EYWA 1YXDA 4FEZA 4UUIA 3HIJA 4JIPA 1XKYA 1ME7A 1KBIA 2QAPA 2CWNA 4JTSA 2OMAA 3NQ7A 3U8GA 2ABAA 2PURA 1R46A 1F2JA 3W7LA 4MIMA 1WA3A 5EBUA 1L2UA 4PL2A 3UWYA 1FDZA 3CQ0A 3CM4A 1W31A 4UTLA 2Y7EA 3LHUA 4NXKA 3TCEA 3W7DA 4FNRA 4BI5A 1VPXA 1VRDA 3GZ3A 1YYAA 4EOUA 1VHNA 1EP3A 5KZMA 1HO4A 3RFAA 2FQIA 2QUUA 1VHCA 3LLFA 2P0OA 4MPQA 1VYSX 4CNNA 2ZZ2A 4BK9A 3HF3A 1UUMA 3P67A 2ZA3A 3LCWA 1OJXA 5BOOA 3IIOA 2V82A 4PCFA 3LB0A 1Z48A 3NL6A 2ZRYA 1MZHA 3W23A 2G96A 2BWGA 3W7KA 4HPXA 4I7WA 1TV8A 3I7SA 1Z44A 5AN7A 2D73A 2YYTA 3PBYA 5FF4A 2GOUA 4GXMA 2XN2A 3W7NA 4AEOA 1GPWA 2A6NA 3G1HA 5CSSA 4DPQA 1M6JA 3WK3A 1R2TA 1H60A 3G24A 1HTIA 3EWYA 3TFXA 4FNTA 3Q94A 2E77A 3BW2A 3Q58A 1W56A 3I6RA 3C56A 1VQTA 3DFSA 3P84A 5IM51 3B0PA 3G0UA 1GEQA 3GXNA 3STGA 2RDUA 2W0UA 4HT3A 1A5SA 4S2BA 1SW7A 3CTLA 3EWUA 3WK0A 2Q3OA 4IJBA 1OX5A 2ZZ1A 2O7SA 4QQ3A 3QRHA 4MLJA 1SZFA 4YCPA 4Q32A 4HN4A 1TQJA 4DXVA 3S42A 3SJ3A 7TIMA 2DJXA 3GYEA 1JJKA 2BSLA 3EXSA 4LNYA 3N2MA 4ZQMA 3W7GA 1YADA 4XBKA 3SECA 2P10A 3MO7A 1VS1A 4FO4A 2VFDA 3O16A 2X1TA 5D38A 3WJZA 3RMJA 5K9DA 2Y70A 2GJLA 2EHHA 4O10A 2OX1A 1H7XA 3W2UA 1K3UA 1JUEA 4JX4A 3W71A 1C29A 5F2IA 2ZTJA 4YCOA 3UQNA 2WPBA 3A22A 4IGHA 1Z41A 2C18A 5FEXA 3ATYA 4JR5A 6TIMA 1KFKA 1XDMA 1H7PA 5HJLA 1H50A 5HWJA 5AYZA 4ZZ9A 1G7VA 3LRMA 1H62A 4OGZA 5D2XA 3R8RA 2Q8LA 3W9ZA 1FBAA 4JX5A 3W7EA 3M0ZA 3LHYA 5HR7A 2DJLA 1JCXA 2B7NA 4JTEA 1WQ5A 1FCBA 1GYNA 1GOXA 1TMHA 1PCWA 1H5YA 3W74A 4UTKA 4FB7A 3M41A 4O0ZA 1NF7A 1LBLA 3C52A 3HQ1A 1B57A 3W2JA 1NF0A 1J5TA 1EEPA 3TC7A 2J9XA 3IVTA 3I68A 2VEKA 4XQ6A 2WKJA 4TMBA 1CI1A 3PC0A 4WY0A 2DZVA 1W5MA 2H90A 4JGDA 3S1UA 4POCA 2BTMA 4GUGA 4UMCA 4BFAA 1H7NA 2CLMA 2H8ZA 2WSYA 4P2VA 3M5VA 4QSHA 4DO6A 4K8EA 1JCMP 4AF0B 1QOPA 3UWQA 4C1LA 4M19A 2B7OA 1U5JA 3DENA 1K8XA 4U4MA 1TPH1 5CGQA 4JICA 4N9BA 1PIIA 1LOQA 3PUDA 1SU5A 3QC3A 4PTNA 3E12A 3C3NA 3THAA 4O12A 1F05A 3FS2A 2J88A 1ICSA 1OFQA 2Y7GA 5HMSA 3W87A 3W2NA 4A29A 3C2RA 1O4UA 3NQCA 3G1VA 5AHEA 4JTTA 4O28A 2H8XA 4UXDA 3R89A 3YPIA 3LX9A 3OIXA 3G0SA 4R33A 3C2OA 3KXQA 1VC4A 4BWLC 3TA6A 1DHPA 5FF7A 3NPVA 5CZTA 4N2YA 3VE7A 2CLOA 2Y61A 3LV5A 4OV4A 2BLEA 2BXVA 2RHGA 5G2WA 4IOTA 3BV4A 3LHZA 3HPSA 1Z42A 4NX0A 1B4KA 2V5LA 1XBZA 1QFEA 4TMCA 1I45A 4IMGA 4O19A 3Q37A 3FIGA 2VENA 1F73A 1UCWA 3LI1A 1SPQA 2R91A 3U2OA 2XN0A 3W22A 4Y90A 4NT0A 2V30A 1ONRA 1D9EA 4I7UA 1AW1A 3L5AA 4RKAA 2A21A 3O63A 3VNDA 5C54A 1QCWA 1O5KA 4GUFA 1PE1A 1FCVA 2P1FA 2HS8A 2F84A 5D32A 3B04A 4MZ1A 1OFBA 1TREA 2NXHA 3TE9A 1KLZA 3BG5A 2RDTA 4JTHA 5J5DA 5CZSA 4DO4A 4L4MA 3LXBA 1SO4A 4W9TA 1JRCA 2RDWA 4KWVA 1R30A 1DVJA 5EA9A 3MBFA 2JK2A 3W2KA 4X3ZA 4AXKA 4ZL1A 2ALDA 4H3DA 1TPVA 4AWTA 3B0UX 3L9CA 2QCGA 4JD4A 3DHFA 2H6RA 2C19A 4WXYA 1EUNA 2VC6A 4NZFA 3M16A 5F4XA 5KTLA 1FXPA 4XBSA 3BG9A 2ZTKA 2FJKA 3BGGA 4E2DA 4K39A 3NZRA 5DELA 3PG9A 4UFJA 4LS0A 3PM6A 2NUWA 4CQ8A 3KVLA 4NXSA 1HG3A 5CZJA 5DN1A 2FDSA 5LSMA 3C4UA 2V9DA 2ABBA 3A24A 4MFEA 1TV7A 3OBKA 4NJHA 2E6AA 5G5IA 3Q2DA 5FEZA 2CLHA 3FJLA 5K9XA 3W73A 4CCCA 3M1ZA 1WYIA 1RQHA 4HSOA 3W2LA 3KRZA 4TU1A 1W54A 3KVMA 5HNRA 3EX6A 1JUBA 3BLFA 1A5CA 3PUOA 2VFIA 3LXCA 3PSVA 2DORA 1X6UA 2EAWA 3BVJA 1GG1A 1VCGA 3LBCA 3W7JA 2CZFA 1WDWA 3SSJA 4Z1BA 2RH9A 4YXGA 2ATMA 3O05A 3QW4B 3OVPA 1JCNA 3N73A 4CNPA 3W83A 2G97A 3G0XA 3G1YA 2DZXA 3ZWTA 4Q4KA 1Q6LA 3SW6A 3TH6A 4MY8A 3NQAA 1KLYA 1XDLA 1EPXA 2Y7FA 2OJPA 3UXDA 1KFJA 1OFPA 3NL2A 2ZA2A 3P80A 1H51A 2DZWA 4NVTA 1F7BA 1QDSA 3EWBX 4FIRA 2ZZ5A 3ELFA 3ABOA 3CU2A 4GUHA 4LVBA 5KMYA 1FY6A 1JVNA 1X7FA 3NM3A 4LV4A 3GB6A 3LOTA 3W3OA 1R2RA 4M6VA 2VFEA 1O95A 5AFDA 3C8FA 1TPB1 2ISSA 4NNAA 1K7XA 3GDLA 4IPIA 3UYCA 2EKCA 1M5WA 3B8DA 4R34A 5EPDA 4IX0A 5LKYA 4I7VA 2YZRA 3RNDA 1FDJA 1L6WA 1QAPA 1UJPA 5AYYA 3IIZA 3HPZA 3O6YX 3IVUA 2DP3A 1BWKA 5A8GA 2X1SA 2X2GA 4DF2A 1TPFA 1W3TA 1JR1A 3KOFA 4N02A 5C55A 3S0CA 1FWTA 3MHFA 1WOAA 3ZWSA 4JYEA 4LRSA 3GNNA 2CLIA 1A53A 3UPWA 1EA0A 4EVZA 3MI2A 5G2IA 4S1FA 4LT9A 3PSWA 1PVNA 4K37A 4UFHA 1IXPA 3R5EA 2TPSA 4N9DA 1LRTA 1OX4A 2YYUA 1FCUA 3I7RA 4LC6A 3HG5A 4WQ6A 5AC6A 1UASA 1XUZA 4QIUA 3PBVA 4UR7A 5FI8A 4LVAA 1GG0A 4S2CA 4XUGA 2CZEA 1E51A 5DY3A 4BI7A 1L6YA 3EKLA 5EKYA 1ZCOA 1RZMA 3CLMA 1VR6A 1OF6A 3F4NA 1KM2A 3TXZA 1T0OA 4ZQCA 3CWOX 3NQFA 1MEWA 3O6CA 5I3HA 1JUKA 2YGYA 2BX7A 1ZHAA 1XI3A 3LRLA 5DBTA 4UFKA 4HIBA 3SZ8A 3W70A 1Y0EA 4AHQA 2QCDB 4IMDA 1EX5A 3LHWA 1SSGA 1ME9A 3QEZA 4JYFA 3DFTA 3EX1A 1FXQA 4D2JA 2E5BA 3TW6A 5D2YA 1P0KA 2C3ZA 4MJZA 3NPXA 1GYLA 3HO8A 2QJIA 4NZJA 3W1AA 5I3FA 4O13A 1OF8A 4JS3A 2XN1A 2QAFA 3L2IA 4Z1DA 3UWWA 2RFGA 3S8HA 5D2WA 3MI3A 3W7MA 1TJPA 3M43A 4MJMA 4CQ9A 2RKXA 1Q6QA 3NDOA 3BPWA 2JGQA 5BMXA 1SSDA 2E6DA 1XFBA 2CLLA 3EB2A 1N55A 1KM6A 3W7RA 5D04C 5C5YA 3NM1A 4ORMA 3PBWA 2YW4A 1QO2A 3UWZA 2Z0IA 4YMZA 4A2RA 4FIQA 5HUOA 3TJLA 3BLIA 2ZRVA 1PHWA 3GDKA 5FF3A 3GNDA 3LBMA 4FX6M 5EL1A 3LERA 4UTUA 3P60A 3S9YA 4RXGA 4HNTA 2Y89A 4XTIA 4XTDA 3EKZA 2QCEA 1X1ZA 1RQEA 1TB3A 3KX6A 4AB4A 5LNWA 4JDYA 3NQ6A 3GAYA 4YWIA 3RLVA 4N4QA 1G4TA 3CEPA 1LDCA 3O8AA 1C8VA 4JTGA 3LTPA 4UTWA 1THFD 3L66A 5LNVA 3B0VC 2ZA1A 4RZ4A 3UZ5A 3LTSA 3T78A 3LDVA 5AHFA 1W5OA 4O0KA 2B7PA 2I1OA 1GVFA 3NQEA 6ALDA 1WBJA 5H2ZA 4MYAA 3STFA 5DLCA 4GFSA 1HFBA 1UBSA 2C16A 2ISVA 3IGUA 3MYPA 4IXXA 2PE4A 3TNOA 1TPEA 1KV8A 2NV2A 1X8FA 2QUTA 4WXZA 3EX2A 4EIVA 5LNRA 4ICNA 5T26A 3SIZA 3M5XA 4HPJA 4TR9A 3S5YA 1G4PA 4OHQA 2X30A 2YPIA 5GVJA 5IBXC 3TFCA 4GUIA 1M7PA 3LHVA 2VFGA 1G4SA 4DO5A 3W85A 4ADTA 4XKYA 3P82A 4DEFA 1OABA 3TQKA 3PBUA 4U28A 3DFQA 2VEPA 1Q45A 3EX4A 3WJXA 1AMKA 3GAKA 1C9DA 1SW3A 1VJIA 1W8SA 1J4EA 3W76A 3AJXA 4DBDA 1BWLA 4IUOA 3MUXA 4JTKA 4GJ1A 2PRLA 2E5CA 2G5WA 2GQ9A 4JIQA 4JTIA 1JQXA 3IEBA 4QITA 4A2SA 2ZCGA 3TROA 2OCZA 1PCKA 4RJEA 4RX0A 1H63A 1SR9A 3B03A 5F1UA 1WX0A 2YFOA 2YW3A 1GT8A 3ANYA 4JN6A 2J27A 4IXHA 3TQ0A 4AVFA 4DF1A 1LLWA 4K6AA 3C0JA 1P4CA 2TMDA 5LNSA 3KAOA 5BMWA 1F76A 1TQXA 3UY8A 4AHPA 1I4NA 2JBMA 4LRTA 5L6UA 3P5YA 2Z6JA 4JTJA 1QPNA 2HMCA 3QW3A 3SGUA 3RK8A 2V2HA 1YTEA 1K8YA 1YDOA 4KFNA 4OQVA 4OWGA 3TDFA 2A1YA 4K8HA 3M5YA 3NQ2A 1NVMA 3VI2A 3W7HA 3HGOA 5DBUA 1OFEA 5MHBA 3S1VA 1IF2A 2ZRUA 2TSYA 3NR0A 4PH6A 2FTPA 1KFLA 4UTTA 4XZ9A 1G7UA 4N6FA 2QKFA 3JR2A 2EGZA 4RCXA 2Y62A 4ML9A 1IXQA 3VE9A 1MEIA 4NNBA 2W79A 1O5XA 2ZFAA 2ZDRA 4O15A 2I14A 3O6DA 2R94A 2NZLA 3GR8A 3OHIA 1QNVA 1YPIA 3FKRA 1FX6A 3IV3A 4O1BA 1TPDA 4RV8A 5HWMA 1YDVA 5HINA 3IGSA 2KZHA 1FUYA 5G1YA 1H61A 3GIYA 4DPPA 3IIXA 1V7YA 2NXGA 3DU0A 2GPTA 3TSMA 3NOEA 2EPHA 4FF7A 3T40A 3LV6A 3BARA 3L5MA 4E0CA 2FB3A 1YLVA 2C1HA 1L9WA 4M5PA 1YPFA 3UD6A 4CCDA 2NX3A 4LV9A 1OG0A 3TK7A 5LGXA 3DXIA 2HS6A 1LRNA 3QMTA 4JY8A 2GQAA 2A6LA 4YLWA 4MVAA 2Z1BA 3PAJA 1XCFA 3DZ1A 3MHGA 5CSRA 3NAVA 2NV1A 1KM1A 4CQAA 4UCGA 4O11A 2PRMA 2QF7A 4QJ1A 5I3IA 1ZNNA 1YXYA 2YCEA 4TO8A 3UNDA 1LORA 5CPMA 4EWND 5I3JA 1TIMA 2YFNA 4EF9A 3W6YA 4EF8A 1QPOA 1LOSA 5AOUA 4B5NA 4WX2A 1ML1A 3GK0A 1XBYA 4O54A 3G18A 1S3HA 3GDRA 1BTMA 2A7NA 2NX9A 4O17A 3WK2A 3S5NA 5K2ZA 4JEQA 2TRSA 5BRBA 1WV2A 4PA8A 3M44A 3DKJA 1ZENA 3SY5A 5KINA 3ATZA 1YTDA 3HB9A 3EEGA 4R53A 2NUYA 1DKWA 3H55A 4A3UA 2OT0A 3M5ZA 4IMCA 1UB3A 2FPTA 5D2VA 3FFSA 1KM3A 1W0MA 4MFDA 1AL8A 2YSWA 3C61A 3PF3A 3NA8A 2DZUA 5J5RA 3ZS4A 2LLEA 5DY2A 5AHIA 1B9BA 3IGXA 3QM3A 4WY0B 3LTYA 3F4WA 3UWUA 5HUPA 3W7PA 2QDHA 1MXSA 1KFEA 3G22A 1GVOA 3OVQA 1XC4A 3W7OA 1SZGA 4OE7A 1KV5A 1T96A 1W37A 3W88A 3QF0A 2V0TA 1VH7A 1EWDA 1RV8A 1FWSA 3MP3A 4UR8A 2Z2UA 1MEHA 4Y9AA 5SWUA 3PWAA 4HSNA 1EB3A 4UFIA 2Z6IA 4GBUA 4NJGA 1GTEA 1JRBA 1LOLA 1OFAA 2GUUA 1H7WA 3FKKA 5U7SA 2WV8A 4ADSA 5HWNA 1A5AA 3E0IA 1NFBA 3M6YA 1HUVA 4WD0A 1DL3A 1F74A 1WOBA 1LBFA 3HG3A 3LCGA 3F1QA 2ZZ7A 1KM0A 3JS3A 4M7TA 5F2MA 4QM1A 1GVRA 3T7VA 1LROA 3NPWA 2YR1A 3NVTA 3FLUA 3W1NA 4O16A 1EUAA 1XUUA 3DH7A 3TJXA 1ZY9A 1QR7A 4QNWA 1KTNA 4GNJA 3NEVA 1KA9F 1I2NA 3QPZA 3GR7A 3CEUA 1Q3NA 2C14A 3A23A 1XBVA 4UMAA 3IIVA 3TC6A 5K4XA 1P5BA 1JULA 1TPWA 4CCEA 4MKNA 3NYZA 4I9AA 1VLWA 1VCFA 3CHVA 2EF9A 3WJSA 5AC7A 3LHTA 4ZVJA 1QMLA 3NL5A 2FIQA 4LVGA 1ZAHA 4L4LA 4UTHA 4O50A 3LXAA 1FDYA 1DQWA 1I2RA 4LUJA 2YDAA 1I2OA 4Y8FA 2DZSA 3UY7A 4N6EA 3TX9A 3OVRA 1OK4A 4JTLA 1FWRA 5F2LA 3TR2A 5D2TA 5AB3A 2V8ZA 5AHLA 2VEIA 4NUWA 2QCNA 4MLRA 3AO0A 4M6PA 2WNQA 3L65A 5LNUA 3QMSA 4UTIA 1FWWA 2WSRA 3M7WA 3T55A 4JTFA 1TTJA 3NGJA 3BG3A 4X9SA 4LVFA 4CLMA 3GXTA 1A50A 1SFJA 3TW7A 3LCXA 3MHUA 1QWGA 4N4PA 1TRIA 3DAQA 2YXGA 1LLZA 1AW5A 3MP4A 2FFCA 1LYXA 3W1MA 3STCA 1I8JA 3S6DA 4J9JA 3QSTA 3W1RA 1DJQA 4E38A 3LCLA 4M6QA 4GC4A 3HOJA 4YL2A 3TAKA 1J2WA 1LCOA 3HG2A 2ZZ3A 2JGYA 3C2VA 1LTDA 3LI0A 2ZRWA 1ICPA 3RF9A 1OVDA 3E49A 1D3GA 3S5ZA 3WJYA 5F1VA 2DZPA 3H53A 5CZ0A 1LM1A 5D30A 5CPLA 5G2HA 3NL3A 1DQXA 3W1UA 4BWLA 2VELA 2CZDA 4PEKA 1TSIA 4UNKA 3C2FA 3G1DA 2W6RA 3A5FA 3MYOA 3V1PA 5EY5A 2E68A 4JTUA 2NLIA 2VKZG 3LLDA 1TPUA 2YX0A 5FEWA 1K8ZA 1EWEA 3NO5A 4ZQNA 5E1QA 3SFKA 5LGZA 4K7VA 1S5VA 5LHEA 2OT1A 3W1PA 1EP2A 1IIGA 4X22A 2CFFA 1TPC1 3DI0A 4FXSA 5FESA 3LCFA 1S5TA 4QAIA 1ME8A 3L0NA 4JX6A 3W2MA 2J9ZA 4Z1AA 1B3OA 2X16A 3HJZA 3E02A 1XXXA 2Y7DA 2DU2A 2WQPA 5CPOA 2DZTA 4ALDA 3O07A 4UTJA 1ADOA 2CU0A 4NJIA 5L9FA 3G1FA 4IWWA 4G1KA 3DBPA 3P8JA 3TSBA 2ISWA 5HR6A 1RPXA 1I2PA 4CNOA 3P8IA 1R2SA 1XBXA 2JKPA 4AH7A 4ORIA 4UC5A 4WUIA 1KM4A 3SGZA 3CWNA 3C6CA 3L21A 3P7YA 4IMFA 3VCRA 4Z08A 5F4SA 4ONVA 1IXOA 1AL7A 2E5DA 1KBJA 4RZ5A 2VFFA 4O52A 3NQMA 1H1ZA 3FEMA 4LS2A 3N19B 1K7EA 3DFOA 2ZRZA 5G1TA 4BR1A 1I2QA 3WK1A 4AWSA 4BF9A 1Q6OA 3TIMA 4Y6GA 3K30A 4JY9A 4LS1A 1SW0A 2FPYA 4DBEA 4MZ8A 1O60A 1WXJA 2FLIA 1LZOA 3STEA 5LZLA 1QO5A 1DV7A 3GLCA 4O8RA 1KM5A 3BW3A 2VEMA 3MJYA 4LVDA 2QEZA 3CIWA 3N9RA 1XL9A 4UFMA 1ZALA 2B0MA 4NJKA 3T44A 3G3DA 1PV8A 4OBTA 5AHMA 5K9CA 4AF0A 1TYGA 3IIPA 2NXIA 4IPJA 1CW2A 4KWWA 3G1XA 1W3NA 2H3DA 4O18A 3B05A 1JQVA 3I65A 3IRDA 1TTPA 3P62A 3W7CA 4UNLA 4PL1A 3DHDA 1W5NA 5A5WA 5K4ZA 3TMLA 2ZYFA 1FWNA 1OK6A 1OYCA 3S5OA 3BK0A 3L0KA 3FJ6A 4O14A 1OX4B 2J9YA 5G4EA 4AAJA 3INPA 4GE8A 4K7YA 1GVQA 2QJHA 4H6KA 1QOQA 5TBOA 2HTMA 2C6QA 2WNNA 5D33A 4HHPA 2QJGA 4O1CA 1DJNA 3UXAA 3FOKA 3VFLA 1ZAJA 2JKAA 5I3GA 1L6SA 4Z0JA 4NQ1A 3NXFA 3DKLA 5KITA 1EP1A 1W5PA 3PUEA 5FF2A 3NQDA 4XWUA 5AHNA 3R12A 5HULA 4IMEA 2VXNA 4FX7A 3NQVA 2GQ8A 1HL2A 1B4EA 1LP6A 3O06A 3PG8A 3N14A 4HNNA 3GDMA 3MP5A 4LW7A 4GWEA 2R14A 4NNCA 3UPBA 1VLIA 3LRKA 2V2CA 1NAL1 3KVKA 3W84A 1LRQA 5AC8A 2Y63A 3PVFA 4OT7A 4P61A 3N3MA 2HSAA 4TX9A 4LU0A 3T4CA 2QDGA 2NUXA 1RQBA 2ZBTA 3PB0A 2AAMA 4QNEA 1R47A 4O1DA 2C15A 5TIMA 3PY2A 4UFLA 5CPNA 1H7OA 1M7OA 4MY1A 4HKPA 2J6XA 3N34A 3A21A 3EWZA 3G8RA 4AMAA 3FA5A 2NWRA 2Y6ZA 2A4AA 3CB8A 1FCQA 4FNUA 3M47A 3A5VA 3USBA 5C6MA 1KW1A 4C1KA 4KFPA 1F5ZA 4IX2A 2CZ5A 3CPRA 3W1XA 1N8FA 4BI6A 4JNMA 1W5QA 3EXTA 1SZNA 2CW6A 2E6FA 2ZZ4A 2XFWA 3NQGA 4DF0A 1AK5A 2WO5A 5KSWA 3JRKA 4LY8A 4MYXA 4N9EA 3ZFHA 1AW2A 3G1SA 2IQTA 1OX6A 5DCBA 2X1UA 4LUIA 1RVGA 5KZDA 2ATSA 1JCLA 1YDNA 1NSJA 4MY9A 3UWVA 3MW7A 3RU6A 3P5ZA 5G4WA 4DELA 3EWWA 4R7JA 5F4WA 5E93A 5HQEA 3QH2A 4RR4A 1VYPX 3MMTA 1SQ7A 2A2IA 2V2DA 3M9YA 3KRSA 3B06A 3TXVA 3OG3A 5DCDA 1TRDA 3QYQA 1DORA 1TO3A 1DOSA 4X2RA 1P1XA 4GRSA 3TUUA 3F03K 3I7QA 2VOMA 4KFOA 1P0NA 1ZJIA 2Y85A 1QPRA 1FQ0A 2CLFA 3C2EA 2B7QA 3TAOA 4ADUA 1SUXA 5K3VA 1OYBA 1V5XA 2WNZA 1ZAIA 1OHLA 4O4WA 1YTKA 2QCCA 4MOZA 4XKYB 3W86A 1TTIA
chains in the Genus database with same CATH superfamily
5I5RA 1K02A 3E96A 3KFTA 5M2FX 3KBSA 2V5BA 3S6OA 4ZFMA 4R5EA 3W72A 1UR2A 4J3ZA 4AZHA 3MC5A 2ZICA 3CT7A 2V3EA 2BZNA 3TQVA 1IR1A 3CL8A 1CGYA 2OFJA 2GDQA 1R0MA 4HOWA 5H91A 3MB9A 3N11A 4Q4QA 3TTYA 4WJEA 3G1AA 3QFWA 3RX3A 4WOZA 1OBAA 3S2CA 2Z27A 3F5KA 2XGZA 4DWSA 3UCCA 3B8TA 3M0VA 2NX1A 3TKFA 3VGBA 4OU1A 4ZQOA 1HJWA 2L5HA 3TU9A 3MI6A 3T1GA 2R6OA 3TV8A 3SR7A 1MSSA 3SCVA 1IIHA 3BMXA 2OELA 3HFYA 1SO5A 3FA4A 2PTDA 3GG0A 2XJ7A 4LOCA 1US0A 4WY0F 3LM7A 2CITA 4K68A 2AGKA 5GNXA 1YBQB 4O1FA 2PDWA 3VKJA 4B5VA 1HO1A 4AG0A 2I5QA 1Z32X 1ZL1A 4M7SA 1UR8A 2ZRXA 2QCFA 4FR6A 1UWUA 1QHOA 4MUZA 4QE5A 4DJDA 2OLSA 3GHSA 1BQCA 1EIXA 5F7UA 4M56A 2ACRA 4Z1CA 4E2OA 1TWIA 1SJAA 4LSBA 1W2VA 1PIGA 1VCVA 2Y1HA 1ICQA 2EG6A 3FDGA 3E9AA 1AH3A 3SCWA 4N9CA 2FZBA 1ZTVA 4GNKB 2CBIA 2WMFA 5CBBA 5DMMA 1DBTA 4MDPA 3KCJA 3FYPA 1ZFJA 4XUYA 1A5BA 4PUEA 2VX7A 3VC5A 3KLLA 3W07A 1DWHM 4UTMA 1G4EA 4U33A 1AQ0A 3G8EA 2Z2AA 1OD0A 2QCLA 4XV0A 3UGVA 4DLMA 1W32A 4ZQPA 2HVNA 1VYRA 3SI9A 2X1RA 3WUGA 1HP4A 4LTSA 2W4XA 5EFDA 1XS2A 3U6WA 2E8YA 3LCHA 1KRCC 4IQLA 4LAKA 4Y9MA 2Q3RA 3QQ0A 4UBPC 2XSXA 3AIUA 1JD7A 1ZS2A 3EA1A 2HISA 3WQGA 2DH2A 1PTAA 1UWTA 1VZWA 4FNSA 4F0HA 1KXVA 5CEWA 4HNUA 2DT3A 4K38A 3P61A 4UR9A 1ALDA 1B3ZA 1S5WA 5DXXA 4JL2A 3N12A 1QPQA 1TJRA 1XLHA 5ABHA 3MDWA 3KE0A 3PPGA 4MZYA 2HDJA 1KWGA 3T2QA 4D9PA 2ZUNA 1UUOA 1LBMA 3GVGA 3TN4A 4GZIA 4RPPA 4A22A 3QZAA 3N9SA 5C2XA 1W1A1 2HVOA 3TWBA 5A2AA 5EU9A 3OVGA 1Z3NA 4W8LA 3AU6A 2YZ5A 5DCEA 1YDYA 4Y8EA 4H04A 2WVSA 3K1DA 1GK8A 1CX9A 3NNTA 3U7VA 3N18A 3OYXA 3CK5A 2GJNA 4L61A 3H22A 4HMCA 1CECA 1E9LA 3QVQA 1HGWA 3APGA 3HGJA 1BEUA 2J8GA 2V5CA 3EWXA 3IAPA 3JW7A 1BYCA 3PZTA 3SN0A 2AQVA 2QR6A 1CXLA 3EPOA 2GGHA 3VKDA 2O92A 1MYRA 3UESA 1CCWB 2ACQA 3H54A 5ABFB 1SO6A 4ACZA 1V0KA 1JPHA 2ZQ0A 5I77A 5EMUA 2PU0A 3O15A 1SMAA 4D6FA 3WYZA 1U83A 3G3MA 3HGSA 1G67A 3NSXA 5D03A 2WMJA 5BW6A 2CLKA 4D6EA 1FWHC 3KHDA 1Q7ZA 3KVJA 4UTTC 2EG8A 3T9PA 4L6HA 5ABEA 3VKAA 2W67A 1ME7A 4LEFA 4MNLA 4AZIA 4JTSA 3NQ7A 5ECVA 4JFWA 1VBUA 7A3HA 4RDYA 4MIMA 3RPTA 1PKYA 4KEUA 4PB3A 4PL2A 4PZVA 1FDZA 3LGDA 3AI0A 4UQ9A 1W31A 4UTLA 1OGSA 1VB9A 4J3WA 3BL3A 1VRDA 5C8BB 1JCTA 2FVKA 4EOUA 1OQFA 3RFAA 4CNNA 1ITCA 2VVSA 2BFGA 1X97A 3HF3A 3ES8A 3SN1A 2POTA 2AL1A 1M41A 5BOOA 1ECQA 2V82A 1OIMA 4IMAA 3V4BA 3RX4A 3LB0A 4C7FA 4DUXA 4GKLA 3KTXA 1VJSA 2ZRYA 5FKYA 1D8CA 3W23A 2G96A 3W7KA 4I7WA 1TV8A 3QTGA 4F2UA 5AN7A 4LYRA 1GORA 2CETA 3PBYA 4LYKA 1NWTA 4AVOA 2QIIA 1DXFA 3CXOA 4X60A 3WEZA 2CBUA 2YOCA 4HA1A 1IEWA 4DPQA 3WK3A 1H60A 5FJPA 2A3BA 4FNTA 2QUNA 3Q94A 2E77A 3BW2A 3E0VA 4BY3A 3C56A 4C6LA 4DUVA 5IM51 3B0PA 3G0UA 4LQ1A 3VOJA 2W0UA 3IJIA 4TXEA 4KMQA 3AICA 2PDPA 3WK0A 2Q3OA 4XK2A 4IJBA 1OX5A 2INZA 2O7SA 3VGFA 2E9LA 2VD9A 3QRHA 4MLJA 4HN4A 4DXVA 2XSAA 2PBGA 4IGSA 4FLOA 4XIAA 3SQMA 3SCUA 3WNMA 3STPA 5CSYA 3IJ7A 2W27A 3M0JA 5I03A 3N2MA 4ZQMA 5C9RA 5I24A 4G6CA 4FO4A 3KOWA 3WJZA 1HT6A 1EOKA 5K9DA 2Y70A 3GC4A 1H7XA 3I10A 3VKKA 1JUEA 1K3UA 1JPKA 3OHMB 4JX4A 3H2CA 3VD3A 2ADAA 3A4JA 1MFUA 5XIAA 4IP7A 3A22A 2CBVA 3ATYA 1FHDA 1XRFA 3ALFA 1FWIC 4X63A 3KDOA 3DYMA 2VR4A 1H7PA 1QI0A 3PFMA 4XAGA 4ZZ9A 1G7VA 3LRMA 1GHSA 2D69A 3RJYA 4EXAA 1UMLA 4HPNA 2X09A 4JTEA 1FRBA 1PCWA 3W74A 4UTKA 2PWFA 1NF7A 2E0PA 1QI2A 1DIEA 2J9XA 3I68A 1W1B1 3PC0A 2DZVA 4LPCA 1PWLA 1W5MA 2EPLX 2VX6A 3F2BA 4POCA 1IQ8A 3UJ2A 1H7NA 2WSYA 1MUCA 2I56A 5JXQA 4WDTA 4B9ZA 1F61A 3L2MA 1GOIA 2PGFA 4LF1A 3CUGA 2YA1A 1ISVA 4C1LA 1IWAA 3CO8A 3UR8A 1LOQA 5BWFA 3FX4A 5DF0A 1OCNA 2FGZA 4S3KA 3CQIA 4CEUC 3C3NA 3N15A 4O12A 3FS2A 4B2DD 4DJED 2PLCA 2WMIA 1RPKA 3NXLA 2XFFA 5HMSA 1R5YA 3W2NA 3C2RA 3CQKA 2VL4A 4DI9A 4G8TA 4G1NA 1FTXA 4HU8A 5DRCA 5AHEA 4GZJA 4JTTA 3URQA 4O28A 3R89A 3YPIA 3V1HA 3ID7A 3OP2A 2NVDA 4GO9A 2G3JA 2CLOA 4MKSA 3GC2A 3LV5A 4OV4A 2VM8A 2BXVA 1REQA 1U1HA 3HPSA 2G3MA 2SFPA 1QFEA 4P8UA 3V16A 1I45A 4IMGA 1W9VA 1TR1A 2GK1A 3VDGA 2ODOA 1H49A 4NT0A 4WGXA 1K77A 1D9EA 3PZUA 3URNA 5T91A 4BEQA 2XZ7A 1F6YA 1HJUA 4DYKA 2ZE3A 4E3TA 2F84A 1R9XA 2ZOXA 3BCFA 3IS4A 1TREA 1L2QA 1LT7A 5EB8A 4AZ6A 2P53A 4V1YA 3D5HA 3KBWA 2XIMA 3BCDA 2CHRA 4ASTA 4KWVA 4HSHA 3W2KA 4AWTA 2YBTA 2QCGA 5C9XA 3DHFA 2H6RA 2J74A 4GYPC 1OADA 3D46A 1QJWA 3SUUA 3M16A 5KTLA 1VFTA 2ZVIA 1L0PA 2ZTKA 1Q85A 3OOQA 3VDCA 4MB4A 1DWFM 3VUSA 2WC4A 3PM6A 3KVLA 3A3XA 4R9OA 5CZJA 5DN1A 4NYYA 3C4UA 4ZE4A 2E6AA 5G5IA 5FEZA 3DG7A 1S46A 3GNOA 4HSOA 3W2LA 3ZXWA 3GR4A 2EEXA 3ENLA 4OVXA 3Q45A 1DXIA 4P8XA 3LGGA 1UP0A 1R3QA 3BVJA 4CNSA 1V6YA 3VNZA 3MMWA 2FJUB 3SSJA 1JD9A 3N17A 3F2DA 4Z1BA 5CJMA 1FWCC 4PB5A 3MANA 3O05A 1MNSA 4GACA 1JCNA 2XVLA 4CNPA 2G97A 3WNNA 2DZXA 1Q6LA 3HA1A 3GY1A 2Y7FA 4QLLA 4MNKA 2OJPA 3QV6A 3H7RA 5FCZA 4F48A 3P80A 4DNMA 2WCSA 2VNCA 5KMYA 3MMUA 2BVYA 2J8FA 3W3OA 1R2RA 2VFEA 3C8FA 3AIWA 3VM5A 3VD4A 1FH8A 1P0BA 4QDPA 3UYCA 3URBA 3WF1A 3KTSA 3B8DA 5EPDA 4GY7A 3RNDA 4H2HA 1L6WA 3N04A 3D3AA 2YXXA 3IVUA 5C2GA 2FTWA 1OB0A 1J12A 2PDJA 1QNOA 3OZYA 1W3TA 1JR1A 3R8HA 3KOFA 3TLQA 3EMQA 3DC0A 2YKKA 5C55A 5IHRA 3ZWSA 2DVTA 3UPWA 3DN5A 4LT9A 3PSWA 2WHJA 3R5EA 2QDEA 5FIPA 4N9DA 3VOHA 1LRTA 4DJFC 1OX4A 3I7RA 1U1JA 4WQ6A 1EXPA 1UASA 1XGDA 3RUBL 4QIUA 3QV8A 2RGMA 3ARPA 4LVAA 2G8ZA 4S3FA 5LIUX 2CZEA 4YS1A 3PZMA 2EQDA 3ICJA 3EKLA 4QLJA 1VR6A 3BANA 1OF6A 4CD6A 5A8NA 4U2YA 2GJXB 1BRLB 3PHAA 2XWEA 1N8WA 3LK6A 4PRWA 3WEOA 5FL1A 2YGYA 1QHPA 4HIBA 3W70A 4MF4A 5AECA 2QCDB 4FXJA 2WZIA 4EAYA 1SSGA 1ME9A 3QEZA 4JYFA 3DFTA 6XIMA 1FXQA 2I9UA 3RO8A 1E6SM 3TW6A 5D2YA 2EO7A 1P0KA 4C6OA 5I3FA 3AWOA 3DCPA 1J0KA 4JS3A 3E2QA 4Z1DA 3UWWA 4LX4A 4W87A 4WVXA 3M43A 1FH9A 4MJMA 4CQ9A 1V0NA 2JGQA 3BAWA 1DIDA 1JPMA 4LAOA 2XHYA 4UQBA 4PMNA 1XFBA 4HP5A 3FYYA 3PBWA 3EDJA 4YMZA 4A2RA 1KXQA 7REQA 3TJLA 4YVXA 3G6LA 1E6NA 2BMBA 1PKNA 2ZRVA 3UT0A 3R10A 1AD1A 3S9YA 4RXGA 3TW9A 3EKZA 4J28A 1BVZA 5FAJA 4AB4A 4US5D 5LNWA 3TC3A 2G50A 4JDYA 4B3LA 1WPCA 3HQOA 3B0VC 4Q8VA 2INFA 3LTSA 3UWEA 1W5OA 4DAIA 6ALDA 5E5CA 2OYKA 2YCLA 1A5UA 4NP7A 4PMQA 4ZODA 5DLCA 6XIAA 1B5TA 1M68A 4MJ2A 4QJ3B 3TVAA 3S2JA 3U0HA 2PE4A 3TNOA 3VUPA 1O1HA 1KV8A 2NV2A 1X8FA 3OU8A 1WZAA 4WXZA 1PZ1A 3EX2A 4EIVA 1TA3A 1LQ0A 1P0DA 4REQA 4ICNA 5AZ1A 5T26A 3SIZA 4AC1X 4NASA 3RJXA 5IBXC 3S9ZA 4D6CA 3LHVA 1SJBA 2V38A 4B3KA 1GKQA 4DO5A 1EF2A 3QR3A 1C90A 3PBUA 1UPMB 2NT1A 3TQKA 3DFQA 3WQEA 3EOLA 3KOYA 2FZ9A 1WP6A 2OU4A 4L4OA 3GAKA 1ZBVA 1W8SA 2XPKA 4QTGA 1BWLA 2OPJA 1TE6A 3RO6A 4XSLA 4GJ1A 3R25A 2PRLA 2E5CA 1E4MM 4JIQA 2BV9A 4A2SA 2ZCGA 2WHKA 1MQPA 1PCKA 1H63A 1TX0A 3B03A 1FWAC 2YFOA 1PTGA 4H9UA 2YW3A 4JN6A 1VBGA 3DFYA 3V0SA 3F4DA 3TQ0A 4DF1A 2WZHA 2X0HA 1ITXA 3QHNA 2TMDA 1OM0A 3KAOA 5LNSA 4A3HA 4CD5A 1WNOA 3L4WA 1M53A 2VZSA 3UR7A 2JBMA 3W25A 1VRXA 3GVVA 1E6PA 1YBQA 3MUAA 5DT5A 3LPGA 1VIZA 3SGUA 2V2HA 3PJWA 1K8YA 4OWGA 2UY3A 3CNYA 4K8HA 3NQ2A 1NVMA 3W7HA 5DO8A 5DBUA 3VYLA 2PZNA 5CC7A 4ROQA 1RBAA 1IF2A 3OLGA 4A8NA 3NR0A 5XINA 4ZB5A 1G7UA 3CAKA 3JR2A 3EOSA 2Y62A 3TTSA 4IFRA 3VE9A 2W79A 1O5XA 1Q65A 2FDMA 4QQUA 2WJFA 5A8PA 1YPIA 3FKRA 1FX6A 3IV3A 1MW2A 1TPDA 5HWMA 4ZCWA 2OSYA 1FUYA 2HK1A 3KBNA 3DU0A 3NOEA 3TJIA 3DC8A 1JYWA 3LV6A 1KQZA 3AUOA 2WMKA 2PB1A 4UQEA 3UETA 1I1XA 1MNZA 2C1HA 1L9WA 1YPFA 3TZNA 3ARSA 2WHMA 2A6LA 4MVAA 1V02E 3AS0A 3DZ1A 1UWSA 1PTDA 3NAVA 4GYKA 1MW1A 2PS2A 2VGBA 1JZ3A 1C92A 1ZNNA 2VRJA 3WQOA 1LORA 5CPMA 3MUY1 4EWND 1TIMA 1SMDA 1GHRA 1LOSA 4O54A 1CXEA 1S3HA 1XD0A 2NX9A 3S5NA 2OOFA 3MSDA 4XSMA 1ZBKA 2GWGA 4CQCA 1PZ2A 3OGRA 2BOGX 4ERIA 3SY5A 3AIRA 3CAQA 5EMYA 3HB9A 3H55A 3M5ZA 4Q4PA 1A0CA 4J3UA 2VC9A 4MFDA 2IXVA 3C61A 3PF3A 3NA8A 2A3AA 5EFFA 5AHIA 2YA2A 3MCOA 1XIMA 1KFEA 2X1IA 3CUJA 1GVOA 3OVQA 2CIPA 1SZGA 1KV5A 1T96A 3LQLA 3W88A 3QF0A 4H8VA 1A3WA 3ANVA 1PSCA 2QPSA 3LZ5A 1MEHA 3ZO9A 4M29A 3T0DA 2Z6IA 5ABFA 1GTEA 1YRRA 1NH6A 3NGFA 1LOLA 1YKWA 1B2YA 5A6SA 2GSHA 1A5AA 1AMYA 2OR2A 1WOBA 1LBFA 2ZZ7A 1KM0A 3JS3A 4QM1A 1GVRA 3O0KA 3GTNA 1NOWA 2YR1A 3GXMA 1E0UA 5TAOA 5HOSA 1ELSA 1EUAA 5A6BA 1XUUA 4J7RA 1ZY9A 3SCOA 1XD1A 4QNWA 3GNPA 3RM4A 1V3JA 1J6PA 3QPZA 2DT0A 1OD8A 4EAMA 2C14A 3CEUA 4PFHA 1XBVA 3OZOA 3TC6A 5K4XA 5CH9A 1P5BA 1IGWA 4S38A 2P8BA 4AFYA 1TPWA 4GABA 4IPPA 4WKFA 3GTHA 4UTHA 3LXAA 2PDIA 3UXLA 4YPJA 1I2RA 4Z42C 2BP1A 2DZSA 4XZLX 3TTEA 4N6EA 4AIUA 3TX9A 3TP4A 3WQDA 3GM8A 8XIMA 1Y65A 2XIBA 1DIKA 3EOEA 5D2TA 2V8ZA 4NUWA 1WDRA 4YWSA 4C6DA 3PANA 3GG8A 1FWWA 2WSRA 3MUZ1 4R3UA 3BG3A 4X9SA 4RDVA 4K8GA 5JIWA 4IIBA 1KNWA 1E3ZA 1QWGA 4DJEC 1MXDA 1LLZA 4ZSUA 3RMEA 4HCDA 3A3WA 1Q8JA 3W1RA 3QSTA 1DJQA 3E1F1 4E38A 1RY8A 2C7FA 1UZHA 4QE4A 1J2WA 3OYZA 1LCOA 4HJFA 2ZZ3A 3C2VA 3LI0A 4OJYA 3E38A 1UA7A 3PZGA 1ZBWA 1BYBA 2JQXA 1LQAA 3W82A 3S5ZA 5H8MA 4I5UA 3R7MA 4JKKA 1LM1A 3NL3A 1A5LC 2QHAA 4RE0A 3M7SA 3C2FA 3MYOA 4HK5A 1GQLA 1A3HA 1TPUA 2YX0A 1EWEA 1BVNP 5LGZA 2FHCA 5A8OA 3PZIA 3T2PA 3W1PA 3EWDA 4X22A 3WELA 3DI0A 3AXKA 5FESA 3LCFA 1SFTA 4JX6A 3NZQA 4OUEA 3S3GA 3ISIX 1QATA 3LPPA 3VM7A 1PKLA 4HQVA 4J1OA 4V2XA 3GNXA 1XWYA 3CBWA 3DBPA 3AZSA 3SN4A 4G7FA 4PMOA 1EC8A 3ZLHA 3FK4A 1R2SA 4ZENA 4GGBA 1XBXA 2JKPA 4WUIA 4ES4A 3IGHX 4AZ7A 3C6CA 3UGRA 4D8ZA 3L21A 2ESCA 1KRBC 3VMOA 1Q6DA 4HCHA 1XQKA 4ZA0A 3QHMA 1NELA 5I6SA 1GOMA 4Z2GA 1VAHA 1TV4A 3CHFA 2IPWA 2ACUA 4Y2WA 2NV9A 4QS5A 4LS2A 2OEKA 1K7EA 1NARA 3WK1A 1TZ9A 4ATWA 3K30A 3DDMA 4LS1A 5CZKA 2PWUA 1SW0A 3ZM8A 4MZ8A 1UBPC 2FLIA 3T81A 1E56A 3STEA 1DV7A 3GLCA 4LVDA 3S2NA 3VIKA 4A3YA 4S3DA 3SCPA 2B0MA 4OBTA 2XIQA 4PMZA 2D20A 3IIPA 2NXIA 4IPJA 4J5NA 2VGGA 4YYFA 3G1XA 3QTPA 1W3NA 1TTPA 4KBXA 1KBLA 3ITTA 3VO0A 1U30A 2BGNE 3THCA 1RJPA 2MUCA 3L0KA 4B4FA 4Q4OA 5G4EA 5KEZA 4D72A 3CHCA 1IEVA 1GVQA 2OXNA 1U5HA 4JKLA 1QOQA 2HTMA 3VX0A 1VJZA 2WNNA 2BXZA 2QJGA 4HNCA 4O1CA 3QHOA 1WUFA 1MZRA 3VFLA 1ZAJA 4C6EA 4ZTYA 4NQ1A 1EP1A 2FTYA 3TTQA 4H00A 3R12A 4QLKA 1ZRQA 2GQ8A 1LP6A 1Y5VA 1UUQA 4WSJA 4GWEA 3UPBA 4WRHA 3U4FA 1VLIA 3PTKA 5FJTA 1G01A 3S47A 1LRQA 1PDZA 5AC8A 4OT7A 4TX9A 4XIMA 1E6QM 1AUSL 4GA8A 2NUXA 2G3FA 5CJNA 1TV2A 4E5TA 3PY2A 4PCSA 4CEXC 3K8MA 3N34A 3ONBA 3G8RA 4AMAA 4D71A 3QV9A 3A5VA 2EBNA 3DGBA 1VPYA 3AZRA 5FJRA 1GYMA 4IX2A 2CZ5A 1UD4A 3CPRA 2QJNA 3W1XA 4JNMA 4Q7NA 3EXTA 1M7XA 2A3EA 3T0BA 3CYJA 2FZDA 2E6FA 3NVDA 4IL0A 1NFPA 1SR0A 4MKVA 4H6EA 4LY8A 2PDNA 5TF0A 3DERA 1BWVA 4C60A 1OX6A 1Z8AA 5HK4A 1MRAA 4IIEA 4KGLA 4LUIA 2YDSA 1RVGA 3KOZA 4GVFA 1Z89A 3M64A 3SQLA 1UKQA 2J13A 3VTRA 5FL0A 1JCLA 3WF0A 3CH9A 1UIOA 3MW7A 1FWDC 1FFQA 3P5ZA 3EWWA 1XLIA 3CUFA 3MWCA 2PDUA 4PULA 3FVMA 3GHRA 2A2IA 2DT2A 3M9YA 3KRSA 3B06A 4XO7A 4A8LA 3VD5A 3FY1A 2HPMA 3PTQA 1JDDA 4HZ6A 1CGXA 3QKEA 4G9PA 1DOSA 2GUYA 4CVUA 3I7QA 1QASA 2Y85A 2V63A 2VJXA 4ADUA 1A5KC 1V5XA 1M9HA 2WNZA 1ZAIA 4ZBCA 3PPHA 1KCXA 1YMYA 1W17A 5BXPA 4IISA 4MOZA 4KPLA 4XKYB 2CESA 3SQSA 1TIWA 4LCQA 3BZJA 3BOLA 2PRHA 3KP0A 1QXLA 1R87A 5CG7A 1XYAA 1AG1O 4QS6A 5F2GA 4Y9OA 5DMLA 4RZ6A 5CXPA 3CL7A 3ITGA 4GJJA 1F6PA 2A0NA 4QP0A 4MSSA 1GTHA 3GKFA 3S1XA 1GZGA 2UV8G 2VFHA 4RLIA 1B3WA 1O66A 5CGMA 4RXFA 2O9TA 4UZUA 4JIIX 1SFLA 2WKGA 2P5NA 1YNPA 3KZSA 3U3HA 3TYZA 4QISA 1M7JA 4JQ3A 1NWUA 3SBFA 1D3HA 5EMMA 3PB2A 2D2OA 4O57A 3EX3A 2E1DA 4JQ4A 1XSJA 2RGLA 3CMGA 2F7FA 4U2ZA 4CGTA 1XYMA 1AH0A 3BE7A 1BXCA 2ZZ6A 3KHJA 3CPUA 4S3EA 3DI1A 3EWCA 3ARXA 4Q8UA 2YL6A 5KZ6A 4ZGYA 3OB8A 3L5LA 1TWZA 2GVLA 3GVQA 3RG6A 2J8TA 4XAZA 1EJRC 4H6RA 4JFUA 3M0XA 2DVXA 3E6EA 1A5NC 4RZBA 2WKLA 4NX5A 3MBDA 3L0GA 3MO4A 1RD5A 3B4UA 3WQCA 1IT7A 1Z7AA 1TTQA 3R13A 5HMDA 4BQ3A 4F0LA 2Y5EA 5E0KA 1OFOA 1JG9A 1RR2A 1G69A 1HNYA 5D05A 2EPOA 4O4VA 5K7JA 2A85A 3A9IA 4DWSD 1W3IA 3F4CA 4LCRA 2VD8A 4L6OA 4EX4A 3W1QA 2GJXA 3QBUA 1GW1A 1BRLA 3W6MA 4PC8A 3NEHA 4X2PA 8CGTA 3W75A 2PAJA 2OODA 3QPYA 2A5HA 1OSEA 1W2PA 2HK0A 3TMQA 1POJA 3R58A 1TCMA 2QCDA 2QCHA 3ABZA 3GIQA 2R82A 1SZEA 1FWFC 3W1LA 3SSZA 1ITUA 2MNRA 2QVHA 4J40A 4GIAA 8TIMA 1TZ7A 4L80A 1Q7QA 1XYCA 2ZE0A 1OCQA 5JMUA 1O5RA 1P0EA 3SUTA 4DJDD 4D8LA 4GUJA 5IRPA 2J47A 2GSEA 3MMDA 2AMGA 1Q6FA 4HNOA 3VD9A 4QG9A 1CDGA 2PCQA 5I3KA 3OA3A 2Q8ZA 3CASA 3CZEA 1HVXA 1G94A 4BZYA 1JDEA 1OFRA 1CB7B 1TCDA 4GQGA 1JAEA 4XG1A 3HG4A 3WL1A 3T0AA 4YHEA 1BKSA 1EQPA 3BO9A 3N3TA 1DJXA 3NPUA 3QFEA 2WOQA 5D09A 3R4IA 2PWEA 2H3BA 3QSRA 2DEPA 3GKAA 4UOZA 3NO3A 2O7QA 4FAMA 1HJQA 2Z4GA 1JDFA 1PHQA 3NZPA 3PULA 2JFEX 1Q7MA 3RRXA 4ZMGA 3S5SA 3GSMA 5CKSA 3WQ4A 4JXCA 1U2YA 3U2EA 4F79A 3L4YA 1N7KA 5KZEA 3S2MA 4H9VA 5ABTA 1NDVA 1T8XA 5HANA 5I79A 3WZ0E 2E09A 3W6LA 1FKWA 3CIXA 1BQGA 1V8EA 3EA3A 3DFPA 1ZPTA 1YXDA 4Q3MA 4JIPA 1XKYA 3L4UA 1KBIA 4QGCA 5DT7A 2CWNA 3E74A 1E0WA 1XLEA 5JBFA 4LBSA 1M03A 1WA3A 3VOFA 1CLKA 1L2UA 5EBUA 4PCPA 4K3ZA 3UWYA 3CQ0A 1UD8A 3CM4A 2Y7EA 3SCSA 3LHUA 5D9MA 1KCZA 8RUCA 3TCEA 2PDGA 1EXBA 1VPXA 3GZ3A 4KCTA 4GG9A 4ZO8A 1I60A 1K9TA 4AD1A 2FQIA 1VHCA 4MPQA 2P0OA 3N2BA 2ZZ2A 1UUMA 3ZJKA 3IIOA 2R1KA 4IHCA 3OGVA 3VMPA 3AYTA 3VGGA 2BVDA 4FF5A 2YBUA 2DSVA 1RLDA 2BWGA 4JIEA 4HPXA 4CN1A 1AQMA 4NF7A 4XZNX 4PCTA 4KRUA 3V0UA 2GOUA 1VD6A 1XIDA 4XVDA 4L5ZA 3TYEA 1GPWA 3G1HA 2BVWA 4BQ2A 3ITVA 4DNHA 5E70A 2YCJA 4IP5A 3EWYA 4JPGA 3U9IA 1P1MA 4F4RA 1VQTA 2UZ9A 3KM8A 2RDUA 2PDKA 4S2BA 4ZXLA 2C8NA 1SW7A 1WUEA 1EJTC 3PTDA 3KCOA 1UWIA 5JH1A 2DH3A 3M0IA 2OWXA 3P93A 3MU7A 7TIMA 3CZJA 1KRMA 4WF7A 2QZRA 3RAOA 3AALA 3MO7A 1VS1A 3PK7A 5E9AA 2VFDA 1BGAA 2X1TA 3RMJA 4O10A 4QROA 1IZCA 1C29A 4KS0A 3RM8A 3HV8A 3LMYA 3ITXA 3W4RA 4IGHA 1EDTA 1Z41A 4D8AA 4GQBA 2C18A 3PNZA 6TIMA 1KFKA 5CAHA 2PBOA 5HJLA 1UH2A 4HOXA 1FHUA 5GJPA 2VUYA 1O7AA 1H62A 3R8RA 3KL0A 3LHYA 1HN1A 3B9DA 3H12A 5E0CA 2I7GA 4PN2A 5BRPA 1JCXA 2CPUA 2HROA 3UA3A 1H5YA 4XD4A 4FB7A 3CS2A 3IARA 4DN1A 2TODA 9XIMA 2W92A 3W2JA 1Q8AA 4CQBA 3KZPA 1EEPA 3TC7A 2XDFA 3ARVA 4JGDA 4PMXA 3S1UA 2C79A 3VNYA 4RW5A 1A4LA 4BFAA 4PUJA 4CN6A 4W4QA 3V5CA 4DO6A 3LPFA 4K8EA 2J78A 4DZIA 1BF2A 1D8WA 4XZMX 3RLHA 1NDZA 4M19A 4TV5A 3VPLA 3G1RA 1TPH1 4G2DA 4N9BA 1PUDA 1S39A 1SU5A 3XISA 1J5SA 4H9YA 3WBYA 4B5WA 3QC3A 1XLFA 1F9CA 4PTNA 3E12A 1X38A 2J88A 1JZ2A 2Y7GA 3GUWA 1R86A 2VTFA 1G5AA 3ES7A 3C5QA 3HMCA 3K1GA 4MDOA 3BAYA 4X61A 4JIRA 2O55A 3G1VA 4YIWA 4GK8A 2H8XA 4XD5A 4ERAA 3LX9A 4DI8A 4L9XA 3KXQA 3WLPA 1VC4A 1H41A 3TA6A 4IP4A 5FF7A 3R43A 1E1EA 1EPVA 3KRBA 3N2OA 2EPNA 3M6DA 2RHGA 4URIA 3SCQA 2V5LA 1XBZA 4QE1A 2RDXA 4AX7A 1QNSA 4KRZA 4O19A 3Q37A 4M0XA 3FIGA 2VENA 1F73A 4NRRA 3PWIA 2FKPA 2EJ1A 4JTDA 3LI1A 2R91A 4JHZA 3W22A 3HTWA 4Y90A 2PP1A 3VNKA 4IICA 3SURA 2VZTA 3BZGA 4YHGA 5C70A 3VNDA 5C54A 4U5KA 1QCWA 1O5KA 5JIPA 1C7SA 3E0WA 1N82A 4GUFA 4Q4SA 1PE1A 2DZAA 3QC0A 3R94A 2HS8A 3D3FA 2UY2A 5BOEA 5HMEA 1TV3A 2BNJA 4PTMA 2RDTA 2OX4A 3GQYA 2XFYA 5CBIA 3C0SA 5GPRA 4AZCB 3FHQA 3ZJ7A 4Z2LA 4W9TA 3JZEA 3IUDA 2RDWA 4FS9A 1DVJA 5EA9A 1OCBA 1E6RA 4TVDA 2ALDA 3B0UX 3L9CA 3BAKA 2ZXDA 4JD4A 5ENLA 3MVIA 5BU9A 2HQAA 3GYCA 2IKGA 3VVGA 2X42A 4AIOA 2FJKA 3BGGA 4E2DA 4K39A 3ZVHB 2RAGA 3P0XA 3T6CA 4UFJA 3GD6A 3UEQA 3UFYA 3FSUA 1MUWA 3GE7A 3GTIA 1R7OA 2OB3A 1AQFA 5XIMA 5LSMA 4J3VA 2ABBA 3A24A 3BAJA 4NJHA 1BG4A 1XIGA 1NWRA 3Q2DA 5AC4A 3W73A 5K9XA 4CCCA 1RQHA 3KRZA 2BOFX 1W54A 2WC7A 3KVMA 3OLDA 4E4PA 2YL9A 2J25A 4IPNB 2VFIA 4HYWA 3VNLA 3W81A 2EAWA 3GC5A 1EJUC 2NQLA 3FSTA 1EIBA 5HQLA 3W7JA 4QR6A 1WDWA 4XBJA 3AMDA 3CWHA 1J0ZA 2Z1KA 2RH9A 2ATMA 3QW4B 3UPMA 4JQ2A 3AROA 3ZWTA 3GXIA 4Q6JA 1KLYA 4H8HA 1EPXA 1EJ7L 4BQ4A 3UXDA 1BXNA 2VHLA 3NL2A 1H51A 3IUIA 3QXBA 1QDSA 2OQLA 2ZZ5A 1E9ZB 1K4HA 3CU2A 4GUHA 1JVNA 3GB6A 1CGWA 1TPB1 2ISSA 4NNAA 5CJ5A 1IWBA 5IFPA 4H8NA 3GWQA 1HJXA 4IX0A 4I7VA 1UJPA 5AYYA 3IIZA 2OEJA 3O6YX 2DP3A 1BWKA 3B9OA 5A8GA 3SUSA 2DGAA 2X2GA 4DF2A 4LF2A 3RCYA 3H6OA 1UIPA 4LUTB 2D2HA 3S0CA 1FWTA 2CLPA 3B0XA 4LYQA 1WOAA 1PKMA 4LRSA 1EA0A 4QBXA 4D6JA 3MI2A 4S1FA 1PVNA 2IKIA 4K37A 1IXPA 4NRSA 3F7JA 3ZSSA 2E3ZA 1O6IA 1ZP4A 2PU1A 4LC6A 1UZ1A 4PB4A 1XUZA 3A4XA 1QK2A 2XYLA 3ARTA 5JH2A 1RALA 4GIYA 1E51A 4JZ5A 5DY3A 4JTAA 5EKYA 4C6BA 1ZCOA 4D6GA 1KM2A 5A2BA 3TXZA 1T0OA 4ZQCA 2I17A 2IQ0A 3LBOA 3CJPA 4P7LA 1JXJA 1Z9AA 1QI3A 3NQFA 4CUCA 4XVEA 5I3HA 3I6TA 1C7TA 3LRLA 3VZXA 5AYBA 4UQCA 2Q02A 3LHWA 3E2VA 1EDGA 1IZKA 3SIMA 3B97A 1XH1A 3EX1A 2E5BA 2J7HA 2QDDA 3GU9A 1FH7A 3GU2A 5T9BG 3RN6A 3W1AA 3NPXA 4NZJA 1RCOB 3L4TA 2WK2A 3L2IA 2RFGA 2PZ0A 4ZEPA 5D2WA 3W7MA 4FA3A 4GIEA 2AOSA 1EC9A 2GZXA 1JFXA 2RKXA 1DWIM 1Q6QA 4HZ7A 1KR1A 3BPWA 1SSDA 3FAWA 4FOUA 3MZ2A 4ROPA 1MI3A 2CLLA 2VR5A 1N55A 3AYVA 3W7RA 2NT0A 3OPSA 5C5YA 4ORMA 2J79A 1QO2A 3LLXA 4DY1A 1LL6A 1WZLA 2JEQA 5HUOA 1JZ5A 3G77A 5M3WA 2Y2WA 3C86A 5FF3A 5EL1A 5CPTA 3VGDA 2NQJA 4DWSC 1T41A 4LYPA 3FV9A 3OO2A 5DMYA 3KX6A 4TTUA 2DSWA 4IZGA 1E73M 4IGMA 2HJPA 5B80A 1S2WA 5IXEA 4YWIA 2BODX 3RLVA 1NP2A 7PTDA 2E8ZA 1C8VA 3LTPA 2BHZA 4UTWA 2QW5A 2QT3A 4BF7A 2ZA1A 5HNTA 4F0SA 3W0KA 1XYFA 1GOQA 3NQEA 5H2ZA 5LXEA 5H8UA 1SGJA 1W8GA 1WDPA 4GFSA 1BPLB 4B92A 1NTHA 1A80A 3UP8A 1JZ7A 1S1RA 2FH6A 3PFRA 3WMCA 3IGUA 3H2FA 4XKMA 4FOJA 5D9NA 3LN3A 1XLCA 2VC5A 3FAXA 4DJDC 2QMKA 1XIEA 1H0GA 4OHQA 1V77A 2X30A 2YPIA 5GVJA 3BOFA 2YL5A 1U33A 3TFCA 2E1WA 2VFGA 2QYGA 1G4SA 3SCRA 2O9PA 2QIWA 4ADTA 1H5VA 1F3EA 4XKYA 3CH0A 3P82A 4DEFA 3SAZA 1V6TA 4U28A 3KEHA 2VCBA 5LA1A 2PPGA 1Q45A 3EX4A 1PWMA 1GPFA 5DEZA 3N2CA 2ONEA 4FLRA 1XISA 1C9DA 1VJIA 3OBEA 2HRWA 4AD0A 5HXMA 5E6YA 4CD8A 1EJVC 2G5WA 2GQ9A 2BB0A 1UW9A 5BXTA 2R1NA 2OCZA 4G56A 4RX0A 4FI4A 5F1UA 4EXBA 1S38A 2EG7A 1XLGA 7XIMA 1GT8A 1PAMA 1JZ6A 2W3ZA 3HFTA 1LLWA 2Y5SA 2QVNA 3C0JA 4K6AA 1C93A 2ZXAA 2OG9A 2B81A 3FDKA 1F76A 2VX5A 4Z2HA 1P6BA 4GVGA 4C65A 5L6UA 3OTRA 3A4AA 1YTEA 4S3GA 1YDOA 4KFNA 3CAVA 3O7UA 1JGIA 3M5YA 2C1GA 3W28A 4MG4A 3UXKA 4YTTA 3H2NA 2F9RA 4BEUA 3UG4A 3WBWA 2VCAA 4HNLA 1MWOA 4W89A 4QCFA 1GJWA 2X0SA 2EGZA 3LA4A 2WVUA 3TYAA 2D3LA 3GR8A 5C7VA 2NQ9A 1C8QA 3PAOA 2CKSA 1QNVA 4RV8A 1J96A 5HINA 2QLYA 3IGSA 3I4KA 8XIAA 5G1YA 1H61A 3GIYA 3GH5A 3IIXA 1F07A 1V7YA 2GPTA 2EPHA 4B5TA 1X6LA 3BARA 3G2GA 2RJHA 3N13A 4HTBA 1GW9A 1Z6KA 5I3DA 3TK7A 1XLDA 3QMTA 3HZ3A 1LF1A 2UWFA 2Z1BA 3MHGA 1P6CA 1IR2A 5KETA 1V02A 2NV1A 3QLDA 3VIMA 3W53A 3WQVA 3HJEA 4O11A 4L9ZA 2QF7A 5I3IA 1AFSA 4L56A 1X39A 1YXYA 1KCKA 2YCEA 3UNDA 3GVWA 3WLTA 2XM1A 4C90A 4HK7A 4B5NA 4WX2A 3GK0A 1XBYA 3GDRA 3WK2A 4GY1A 4QDWA 1WDDA 3I3DA 2HCVA 4PA8A 3M44A 4DBUA 3DKJA 4GCXA 3R0KA 4W8AA 3GH7A 2XINA 1DXEA 3VCNA 4DZAA 4R53A 1UWRA 4S3CA 2CERA 2OT0A 1SFSA 3BXWA 5IDZA 4IMCA 1UB3A 1KM3A 1R9YA 2YSWA 2VZVA 5J5RA 3DIPA 3F4WA 1DP0A 3GZAA 5HUPA 3VMNA 5HMFA 4J3XA 4QXIA 1Q13A 4XO6A 3BSMA 1EWDA 2F2KA 4TX6A 1FWSA 1H3GA 3SGGA 5SWUA 4C91A 4NZ1A 4NJGA 1RA0A 3S83A 2ZIDA 4WKAA 2GUUA 4ACYA 4AEFA 3E0IA 3NDYA 3WLIA 3HG3A 3LCGA 2JIWA 2HWGA 1XIHA 5F2MA 3T7VA 1E9IA 2YLAA 3FLUA 3GRIA 4D6HA 4O16A 3TJXA 1UMYA 3GH4A 3SJNA 1QR7A 3WH6A 1L8NA 1KTNA 4JHMA 1TELA 3EOOA 4QSFA 2G3IA 1XRSA 3GR7A 2CZVA 1V4YA 1GKRA 2BVTA 2V3FA 3I3EA 3IIVA 7CGTA 2NQZA 5LIXX 2YL8A 2AGTA 3SM0A 4MKNA 1VCFA 4ZVJA 4KWOA 1XICA 1ZAHA 4W5ZA 4O50A 4BA0A 1DQWA 4LH8A 4LUJA 1I2OA 3UY7A 1T6MA 1FWRA 3ARZA 1D7FA 5F2LA 3WIJA 4AMCA 3TQPA 3LU2A 4MLRA 4X0VA 1DWGM 2VUNA 2WNQA 3L65A 5CLWA 1GONA 1TUXA 3R0DA 3T55A 3W01A 4NAFB 3GXTA 1SFJA 4ICCX 1YW1A 1XINA 3BTNA 3EB4A 4N4PA 3DAQA 3W1MA 1FP9A 3S6DA 5A6BD 4HHLA 4UZSA 5CG0A 2EPKX 3E5PA 3GBDA 1J10A 3HG2A 1LTDA 1ICPA 1V6VA 2DUXA 1OVDA 4WR3A 4WK9A 4A3QA 4QCEA 2IKJA 1OG6A 4LCSA 5F1VA 3HM7A 5D30A 2VVNA 4BWLA 3A12A 3U48A 2VWTA 3BWWA 4PEKA 3G1DA 3V1PA 2W91A 5EY5A 4GQRA 3WLHA 4JTUA 2VKZG 4LFYA 4NYUA 4PTXA 3NO5A 5E1QA 4ZQNA 3SFKA 2ZUMA 1UZ4A 3GHTA 1EGZA 1EP2A 3AXHA 1JI2A 2ZKMX 4MWAB 1S5TA 4N0RA 3GHUA 2WLYA 1I1WA 4O0QA 1XH2A 3W2MA 3BSHA 1OT2A 2X16A 4M1BA 1YEYA 2V67A 4JQ1A 5GJNA 4B5SA 4YTRA 1HX0A 4ALDA 2CU0A 4NJIA 3G1FA 3VABA 3KW3A 4M82A 1E71M 1E6XM 1Q6EA 5A1AA 4WKHA 4CNOA 3P8IA 4HZMA 3MSRA 3WFZA 1EHAA 4BQ5A 2P8CA 4NHVA 1KM4A 1GZJA 3BCJA 1LT8A 4G7EB 4A3RA 1SJCA 1CGUA 4IMFA 3DOPA 2NVCA 4LUSB 4Z08A 1TWWA 3N6JA 3RR1A 5F4SA 4S39A 1UKOA 3THDA 2XH4A 3WL0A 4ONVA 4NIRA 4PMRA 4B3ZA 4B90A 2POZA 3VNIA 4JCLA 2UY5A 4NZ5A 3K46A 3SY8A 3WBEA 1KB3A 2D1ZA 1XCXA 4GIRA 1H1ZA 3LQGA 2QQ6A 3DFOA 2WMHA 3QY6A 5G1TA 4W5UA 4BR1A 1CB2A 1HKKA 4AWSA 4BF9A 1Q6OA 2ZWYA 1D3CA 3MY9A 2FPYA 4KT2A 2OWCA 4EPDC 2OSXA 1O60A 4GI9A 3ZOAA 3PZOA 4GD0A 1HF6A 1XL9A 1SM9A 2WB5A 5EMJA 2WVVB 5C9ZA 5K9CA 3QGKC 4KWWA 4O18A 4V1XA 4QEHA 2QNEA 4UNLA 1Y5XA 1N8IA 3DHDA 4GVIA 4OUIA 5K4ZA 4BKNA 1FWNA 2BOEX 3N25A 2A3LA 3PPCA 3S5OA 3NSNA 1OGGA 3AMCA 4AAJA 3TN5A 3INPA 4UOJA 3CV2A 5TBOA 5D33A 2D22A 1EDQA 2G3NA 3FOKA 1YQ2A 3LY0A 5I3GA 1UP3A 1NY1A 1L6SA 4PMDA 2J7EA 3NXFA 1W5PA 5FF2A 1XW8A 1EKOA 1A47A 4XWUA 3UZWA 1XLKA 5AHNA 4RE4A 3NQVA 3O06A 3UJFA 2WJDA 3WUFA 3N14A 3WQFA 4HA0A 3MP5A 2WZTA 1W6TA 1PBGA 1NAL1 3APTA 2V5JA 5AZ0A 4GJIA 4WDWA 2HSAA 2WNWA 4LU0A 3T4CA 1EOMA 1RQBA 3KBJA 4XZBA 3C3UA 3KUMA 4LAUA 2YDRA 3AYRA 1W91A 4LB4A 4HKPA 4J4KA 3REQB 4WIWA 3A21A 2V68A 2A4AA 3USBA 1KW1A 2WCGA 1F5ZA 3WQ8A 3RM9A 2PGWA 1TVPA 1N8FA 2CW6A 4JIHA 4RNFA 1EJWC 3KBVA 1LG1A 2XFWA 3WD2A 1CT5A 1GGOA 2FVLA 2GL5A 5JU6A 3O0FA 4AZCA 1QPKA 3JRKA 1B1YA 4MYXA 4N9EA 1AW2A 3A4WA 3F4VA 5DCBA 2YIHA 2X1UA 4YTQA 3VDAA 1DTNA 5KZDA 1L6GA 2ATSA 2VO5A 1E0XA 3DHUA 1AVAA 3RU6A 1EHNA 3WLSA 3D47A 4J3TA 4R7JA 2F6KA 4XZIA 3ZVHA 3MMTA 1SQ7A 4NKCA 1JPDX 3LPOA 4A05A 3VA8A 3RU8X 4JQAA 1X98A 5I23A 3CLWA 1TRDA 1BSLA 1EEXA 3CV1A 1JFHA 4C1NB 1POKA 1P1XA 3TUUA 1G9HA 3ABXA 4Y9NA 1P0NA 4AW7A 1FQ0A 2IPGA 3C2EA 1ZU8A 3TAOA 5B7ZA 5K3VA 4GKTA 2IXUA 1VFOA 3H70A 2ZVRA 5AVNA 4GVHA 2BY2A 2XWDA 3U57A 2OGYA 1MW3A 4H6QA 1YTKA 1V3HA 2Z24A 1CXHA 3VIIA 4PYSA 5IOBA 3QMRA 3QZEA 4KKXA 2V81A 1MDLA 5M17A 1PZ3A 2C1IA 4QHRA 1L6FA 1S3TC 3ZT6A 2TYSA 1IGSA 3L4ZA 3CC1A 5REQB 3BMWA 2OZ8A 1NEYA 3WF3A 4Q8TA 1T40A 1TV5A 3IVSA 3NZGA 1JCJA 2JKEA 3OGSA 4GX9A 3GO2A 4AXNA 1D2KA 1W1ZA 4PFMA 2C13A 1WKYA 3APYA 3JVAA 3V75A 4LWWA 1RVKA 5D02A 4LC8A 1GWJA 4H4IA 3LD5A 4NZCA 4AWUA 2DIJA 2HXUA 1XCWA 3P74A 4IJCA 4LUTA 2OLHA 3KS5A 6PTDA 1XPYA 4F3HA 2WSKA 5D37A 1V6UA 5FEPA 3UA4A 3BLEA 3VGEA 3DEQA 2EJAA 3D0CA 5DXYA 4IFOA 4M80A 4ML4A 2FB2A 4PMUA 3RLUA 1T99A 2HNHA 4IQDA 2G95A 3NQBA 2YCKX 4I6KA 4GNVA 3AS1A 4DBWA 3NWRA 3OLIA 2YB1A 3GIPA 3E0LA 4HGXA 1QHZA 3ABRA 1VEMA 5BYWA 3QR1A 5TNVA 1K03A 2WSQA 1UPPA 1Q6GA 3DECA 4M8UA 4UIOA 1H0IA 2KAUC 1KTCA 3MZNA 3EGJA 1HJSA 3BW4A 1OYAA 2A7PA 4GC3A 3PR2A 4IQEA 3LGEA 1E4IA 3V0TA 2RUSA 1GQIA 1EH9A 7ODCA 1GQNA 3A9BA 2CXGA 3ZVIA 4WOQA 3NG3A 2E25A 4H9TA 3RPDA 1F8IA 4U10A 4HU3A 1Q2SA 1RAKA 4WJ8A 4UWMA 2PA6A 3TSDA 1XIBA 4NI3A 1K7FA 4H2CA 1EO5A 4ECLA 4NI8A 2PTWA 1XJBA 4K1GA 3IAQA 4HNVA 2BS9A 4Q33A 3GDTA 2CC0A 5E09A 3L67A 2CLEA 2O9OA 3QJAA 1QK0A 5J04A 1JNDA 3E3HA 4NU7A 2Y0FA 3GG1A 3FCPA 1UA3A 3OEXA 1BFNA 1Q6RA 4HK6A 1KFCA 1HKVA 2X7WA 4PUUA 2G0WA 4PODA 1CIUA 1KR0A 1XH0A 3EYPA 4DQWA 1M04A 4KWSA 2JEPA 4K36A 3AWNA 4JDBA 1EZ2A 1NOFA 3VIPA 1PX4A 2Z1VA 2GVGA 4O8AA 3NQ8A 4AHOA 2QPXA 3PZQA 4ZXOA 1EQCA 2FMOA 3ABQA 1ESWA 4PMVA 4FNQA 2PP3A 3WLNA 3HQNA 3E0FA 2A7RA 3EXRA 2I9EA 1X1OA 2R1PA 3O1NA 5FSDC 1KTBA 1UWQA 1EO7A 5EYWA 2O56A 1CPUA 1LG2A 1QVBA 4UUIA 5ECUA 3BJSA 2OYMA 2EKGA 4KH2A 4B5UA 1JNEA 3KCLA 5C7HA 4XX6A 1W9BM 2ABAA 2PDHA 3TOPA 5DRIA 2I5GA 1R46A 2XU2A 3W7LA 3K8KA 3FEQA 3ZR5A 2W61A 2OSWA 4HMEA 3QOMA 1PZ0A 4CNTA 1A5MC 4NXKA 2PWHA 2W63A 4FNRA 5DANA 1K6WA 3EPNA 2Z7KA 2VURA 1YYAA 1OEPA 1VHNA 2W9MA 5KZMA 4MMWA 2GUBA 5T9CE 1DJYA 2QUUA 3LLFA 4CD7A 2X40A 3ZLGA 2ZA3A 4A4AA 1OJXA 3BV7A 4ZO7A 2J62A 1WB0A 4PCFA 2CWXA 2GJPA 4MM1A 4XB3A 4E8CA 1Z48A 4ZTXA 4Q4MA 1EJXC 1VFFA 3NL6A 1VFLA 2GVEA 2PDLA 3WDIA 4HB7A 3TONA 4AVNA 3ZIZA 2PWVA 3UJRA 5FJJA 1A0EA 3GFXA 1OT1A 3WH7A 1GVYA 1FOBA 1MW0A 3TJ4A 2YYTA 1CNVA 5FF4A 1RCQA 5I07A 4WCJA 4PBFA 3W7NA 4YYCA 1PX8A 1J0YA 5CSSA 5CQ1A 4RDWA 1UOKA 1R2TA 2GGJA 4C6JA 4F9JA 3G24A 1X1NA 1HTIA 4G5DA 2X0YA 3VCCA 3I6RA 3DESA 3P84A 1GEQA 3GXNA 3VAVA 1I0DA 3NIYA 3CTLA 3WSUA 2YA0A 3EWUA 2HPIA 1TMQA 4YCPA 4Q32A 2GWNA 3IUHA 3VKCA 5EMLA 2DPEA 3HU7A 2QF8A 1BYAA 2DJXA 3EMCA 3VFCA 4YN5A 3EB3A 2BSLA 2CHOA 3CAWA 2ANUA 2FHFA 1FHLA 2JF7A 2PWDA 1F3TA 3KLKA 3SECA 2P10A 2AL2B 3AC0A 4DUWA 3O16A 4EP8C 2PTXA 5D38A 2GDUA 1GOWA 4PUNA 2GJLA 2WCAA 4LAZA 3AIVA 4KEZA 5F2IA 2ZTJA 1EBHA 4RNJA 4YCOA 4AYGA 1GCYA 3UQNA 2Z1XA 2PGEA 3RPMA 1QW9A 4IF2A 4A6GA 1KKRA 3BLDA 1XX1A 2GGIA 5FJOA 4F0KA 1IEXA 2V69A 1R85A 5HWJA 1FWEC 2P3ZA 4GQQA 1KGWA 4GI4A 1H2JA 3W9ZA 2WM0A 1FBAA 3M0ZA 6ENLA 2XH2A 1C9WA 3K4DA 2CCRA 1UC4A 3AJ7A 1FCBA 1S5MA 4RV3A 1RH9A 4OOUA 1CTNA 1BXBA 1WDQA 4H9XA 1WXZA 3ITOA 4O0ZA 3C52A 4CNUA 1NF0A 1UD2A 1J5TA 1J0IA 3BLPX 1VBRA 1XLBA 2VEKA 4OBSA 3H4XA 5C2CA 1CI1A 2H90A 3WN6A 3T8QA 2BTMA 1EGVA 4GUGA 4UMCA 4FSAA 3WY1A 1C3FA 2H8ZA 4P2VA 3M5VA 3UR2A 4QSHA 1JCMP 4P7OA 4AF0B 1QOPA 3AISA 4JL1A 5BXSA 5FOOA 2E4TA 4AY7A 3EDDA 1U5JA 3DENA 1K8XA 5HPOA 4U4MA 3AHYA 3FHAA 1PIIA 3PPFA 3PUDA 4AYSA 2DSZA 1UYQA 3T0TA 3O9NA 3THAA 1Q4WA 1WZKA 1F05A 3U2CA 2ZX7A 2DSKA 4AZBA 1ICSA 1OFQA 3MKVA 4INFA 3CL6A 5EGRA 5JBDA 1RHCA 2OQHA 1ONWA 3VINA 4D1IA 4MTVA 1PJ9A 3ZZ1A 9CGTA 3OIXA 5GNZA 3L4XA 3TEVA 5EMKA 1OWQA 3C2OA 1UD5A 4GGHA 3TNBA 3NPVA 4MNJA 5CZTA 1XGZA 4N2YA 1KCLA 5CLTA 3UCDA 5M1TA 3CPGA 2QGHA 1M01A 2O9RA 5G2WA 2INEA 5FA5A 1CGTA 3BV4A 3LHZA 5HDRA 4MGGA 2FFIA 2A79A 3QPEA 2QXWA 4D1JA 4R7WA 3MS8A 1A5OC 3PUGA 1UCWA 1SPQA 2XN0A 2WLZA 2GOKA 2V30A 3BUVA 4I7UA 4BHYA 4RKAA 4UNIA 3O63A 3M46A 4N7QA 2YJQA 4AIEA 3ZLFA 2PODA 4AU0A 2PLJA 1FCVA 3EOUA 1UR3M 3B04A 4NAFA 3THUA 3T4WA 1XYLA 2NXHA 3TE9A 1KLZA 5I00A 5DX7A 5J5DA 5CZSA 3DUGA 4DO4A 2VRQA 3R1ZA 1JRCA 3E5BA 1QTWA 4PBGA 1R30A 2X7VA 2JK2A 4AXKA 4ZL1A 4H3DA 4CKQA 3WF4A 2OQYA 4HN8A 4KGJA 5GNYA 3IJLA 3NFUA 1HQTA 1DWAM 4V15A 4NZFA 4XBSA 3BG9A 2XFRA 1ZLPA 4DLFA 4KQNA 2X2YA 4LS0A 1ZB5A 2PTYA 3WF2A 2IUZA 1EYWA 3S2LA 1HG3A 4W86A 2FDSA 2PCEA 2V9DA 4HOZA 1BTCA 3OBKA 4HMNA 4IM4A 2P50A 4MWAA 5A8QA 2G37A 2IQDA 1OC6A 2D2GA 1E0VA 1WKDA 1WYIA 2GDVA 4PMYA 2R1MA 3B9EA 2XG9A 4TU1A 3K5XA 2OOGA 5HNRA 3EX6A 1JUBA 3BLFA 3PUOA 3LXCA 1UR0A 3TCSA 4E8GA 2C71A 3H2AA 1F8MA 1VCGA 1R3RA 3LBCA 4HHMA 1OY0A 2XUCA 3K4AA 3XINA 1JYVA 1S5NA 1ODUA 4FK9A 4OFCA 3N73A 1CLVA 2GJRA 1GKPA 3LENA 4G7EA 4MY8A 5A6AA 4ZOCA 3WDPP 5CGTA 4LUSA 2OZTA 2VGIA 1W9XA 1OFPA 3GTXA 3U5YA 2J6VA 3V5FA 2ZA2A 4HU0A 3ABOA 4HPGA 3WLRA 1LWHA 1B9ZA 1FY6A 3NM3A 4LV4A 4NL1A 3LOTA 1V3LA 1US2A 1EYEA 5JQ9A 3GDLA 2EKCA 4Q8WA 2OKOA 1M5WA 2J66A 2JF6A 4R34A 2VEFA 1W1PA 5LKYA 3HPZA 4WHBA 1IEIA 4ZOEA 5BRQA 4KRTA 3MJMA 3ITCA 2ACSA 4TTGA 1FHVA 2ZWZA 1I0BA 5HAOA 4N02A 1ADSA 2WVVA 3MHFA 3UERA 4IL2A 2QJJA 1KXHA 3AS2A 4NZ3A 2CLIA 3AYSA 4HA4A 1LQ2A 1EBGA 3DG3A 4DWDA 4CU6A 4UOQA 4UFHA 2VDGA 2TPSA 3AOFA 4XZHA 3MV11 2PTZA 2FZNA 3HV9A 2YYUA 5HATA 1FCUA 2IMRA 3HG5A 5AC6A 1W3JA 3PBVA 4F8XA 1CBGA 2HBVA 1MRQA 4UR7A 2ZXBA 3QN3A 1GG0A 4S2CA 3K2GA 3SUVA 4E2VA 1UKSA 1OC7A 3BLOA 5LA2A 3F4NA 4I5XA 3CWOX 3ZSTA 5CAKA 2CBJA 2XTKA 2BX7A 1ZHAA 4LXFA 2WMGA 3CZ8A 4GYFA 1Y0EA 4AHQA 2OTDA 5TD4A 4IMDA 3T09A 1IT8A 5AVHA 1H1NA 1E70M 3UYIA 4P8VA 5D8ZA 1ONXA 4MJZA 3URAA 4PUWA 1GYLA 1GVIA 2PLKA 4DHGA 3CHEA 2XN1A 2QAFA 3WNKA 2XVNA 3VILA 1K1DA 1TJPA 3REQA 1VFSA 1RBOB 3NDOA 5BMXA 1PPIA 5D9OA 4S23<