1RQBA

Propionibacterium shermanii transcarboxylase 5s subunit
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
472
structure length
471
Chain Sequence
PREIEVSEPREVGITELVLRDAHQSLMATRMAMEDMVGACADIDAAGYWSVECWGGATYDSCIRFLNEDPWERLRTFRKLMPNSRLQMLLRGQNLLGYRHYNDEVVDRFVDKSAENGMDVFRVFDAMNDPRNMAHAMAAVKKAGKHAQGTICYTISPVHTVEGYVKLAGQLLDMGADSIALDMAALLKPQPAYDIIKAIKDTYGQKTQINLHCHSTTGVTEVSLMKAIEAGVDVVDTAISSMSLGPGHNPTESVAEMLEGTGYTTNLDYDRLHKIRDHFKAIRPKYKKFESKTLVDTSIFKSQIPGGMLSNMESQLRAQGAEDKMDEVMAEVPRVRKAAGFPPLVTPSSQIVGTQAVFNVMMGEYKRMTGEFADIMLGYYGASPADRDPKVVKLAEEQSGKKPITQRPADLLPPEWEKQSKEAATLKGFNGTDEDVLTYALFPQVAPVFFEHRAEGPHSVALTDAQLKAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords transcarboxylase 5S subunit
publication title Transcarboxylase 5S structures: assembly and catalytic mechanism of a multienzyme complex subunit.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
total genus 168
structure length 471
sequence length 472
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
A PF02436 PYC_OADA Conserved carboxylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1rqbA01
3W7KA 1G4PA 3KVKA 1A50A 1LLZA 1JQVA 1X1OA 3UWWA 5CGQA 4TIMA 1LBLA 2FJKA 4O15A 1JUKA 3DBPA 3P5YA 1EEPA 3LV6A 3P5ZA 2PURA 3LXCA 3NQ7A 5CZJA 4XBKA 4ZVJA 3EXRA 3I7SA 4HNVA 1IIGA 4A2RA 1JCLA 4OT7A 5LNVA 3R5EA 4ICNA 2CZEA 5FESA 2V8ZA 3G0SA 4JTJA 1RVGA 3PB0A 3TROA 1KTNA 3PR2A 5K4ZA 1OK4A 4E2BA 2HMCA 3AO0A 3L0GA 3MI2A 3VKJA 3CT7A 3HJZA 3SR7A 5C6MA 3LXAA 5DY3A 3PSVA 3BVJA 3BGGA 3CB8A 1AW2A 3UWUA 5D2TA 3PC0A 3W9ZA 1TRDA 3UQNA 5TIMA 1L6YA 4FNTA 3LCGA 4PL1A 3Q58A 1QOPA 2E68A 4WOZA 4QISA 5F1VA 3MWAA 3BG9A 1TPEA 1VH7A 1SQ7A 1EX5A 4NJGA 4PL2A 4N9CA 2A6LA 5A5WA 5LSMA 4HIBA 1OJXA 4JD4A 1OX4B 2WPBA 4AMAA 3MYOA 1G4SA 2PC4A 5D37A 2DP3A 3W2KA 4JEQA 3IV3A 1VC4A 2VEKA 2Y62A 3DFPA 3DH7A 1TO3A 4H6KA 5BW6A 3R2GA 4MJMA 4N4PA 4CNOA 3ABOA 4MYAA 2GPTA 2G96A 4AF0A 1GPWA 1TRIA 2TSYA 3LB0A 4BK9A 5KZEA 3DFTA 3GZ3A 4WXYA 4FNPA 5KSWA 4X9SA 4MY8A 4R33A 3NQDA 1D3HA 1K7EA 2ABAA 4O0ZA 4RR4A 1Z48A 2BX7A 1VR6A 2YSWA 3SGZA 3GDLA 3W1NA 1K02A 1XFBA 1AW5A 1TCDA 3W70A 1ZJIA 1SO4A 1W5MA 4GUGA 5AN7A 1G7VA 4Y9AA 1XL9A 1YXYA 4GBUA 1E51A 3QPZA 3EX4A 5BRBA 3N14A 1I2OA 2Y89A 1WV2A 5U7SA 3G24A 1VS1A 4A22A 3DHDA 1ML1A 4N2YA 4JGDA 4Z1BA 4UMAA 1W5PA 4MVAA 4MYXA 1Z41A 2VFDA 1H7NA 3GKFA 3I68A 3QM3A 1XUUA 3W2JA 4S2BA 1QR7A 2O7QA 2ZTKA 4GNJA 2RDTA 3TA6A 1O5KA 3PBYA 3G22A 1ADOA 4M19A 4HNTA 4DEFA 3IRDA 5KZMA 1LYXA 1L6WA 3NNTA 1OF8A 1DJNA 2EF9A 3E49A 3SSJA 3I6RA 1KM2A 3TFCA 1Q6QA 2AQWA 4N4QA 5FF2A 5CPNA 3G1SA 1JUEA 1LTDA 3CC1A 1H7PA 3W86A 3RF9A 2OJPA 3T4CA 2A85A 2OCZA 3BLIA 2VFEA 3C3NA 2P0OA 3NR0A 4AHOA 4LVFA 2HTMA 4ORMA 3PS7A 5SWUA 3LLDA 2Y61A 2BWGA 4GUFA 3N73A 3O16A 3R13A 3QMTA 4FIRA 1WAUA 4C1KA 3THAA 1KFJA 3S9YA 3E0IA 2W0UA 3OG3A 2QJGA 2B7NA 1TMHA 1OK6A 4RZ4A 1GEQA 2J9XA 3LCIA 3L5MA 4O53A 2C14A 1LCOA 3O6YX 3CEPA 2NV2A 3M5ZA 3E96A 4ZMGA 3W75A 3NVTA 5LNSA 2NWRA 3QMRA 4FNSA 3RNDA 1TTQA 1Q45A 3YPIA 3NQGA 3WJZA 1IXNA 2WSRA 1JULA 5EY5A 1TTJA 4GXMA 3NOEA 1I2NA 1YTEA 2I9EA 3LHYA 1L2UA 5D30A 3NXFA 2DZWA 3RMJA 5FEWA 1ZFJA 3S1VA 3O63A 4R34A 3HGRA 4JYDA 1H61A 3S6DA 3DU0A 4X22A 4JTLA 3TMQA 4IMDA 1ZNNA 4RLIA 3M7WA 4PC8A 2VFGA 4HPJA 3C8FA 4G1KA 5DCEA 2QUVA 4HSOA 3P80A 1P1XA 1T96A 4YCPA 3N2MA 3W1QA 5AC8A 1LORA 3HG5A 4OQVA 1XBXA 2TYSA 2YGYA 2BTMA 1KLZA 1KBIA 4JY9A 3W83A 1V5XA 4BI7A 2VENA 1KFBA 1DOSA 1K3UA 3TFXA 4PFMA 1JJKA 2GJLA 1OX6A 5DXYA 3NL2A 3OVPA 3HF3A 3TH6A 1KV8A 1KFLA 1SSGA 3EX1A 4PTNA 5HWMA 3G18A 1JUBA 2C19A 2QCFA 4HN4A 4WQ6A 1TIMA 3L66A 6TIMA 1T8XA 3USBA 4Q32A 4MKNA 3W7RA 2WV8A 3PWAA 3EWXA 1OHLA 2NX9A 3UPWA 1C9DA 3LI0A 3C2FA 2YFNA 3OVRA 4E38A 4O10A 1KM3A 4BI5A 2FB2A 2OT0A 4CNPA 3B06A 2AAMA 5D38A 4Z0JA 2FPVA 3F03K 1UCWA 4QQ3A 4LV9A 1DQWA 4LY8A 4UCGA 3W72A 4JR5A 4DF2A 3PBVA 1GYNA 1HFBA 1I8JA 3IVTA 5LZLA 5TQLA 3SJ3A 2WQPA 2JBMA 3HPZA 3ZWTA 5J5RA 1OVDA 1ZAIA 5HUOA 2R8WA 3NZRA 1SUXA 3CQ0A 2A21A 4MFDA 5FF3A 1ICQA 4I7WA 3BG3A 3EKLA 3L0KA 3GAYA 4UUIA 3ATYA 1SZNA 4XTIA 5EBUA 1RZMA 1FDJA 4MUZA 2NUXA 4LVDA 4DXVA 3STFA 3W1TA 2XFWA 3W1XA 4O19A 3NEVA 1KM1A 3WJYA 2GJNA 1AMKA 2JKEA 4OV9A 4UTUA 1ONRA 4R7JA 2R91A 2FPTA 3UXDA 3EX3A 3UWQA 2E6AA 2DZUA 2YPIA 1ZALA 2CU0A 4PEKA 4WUIA 1JCMP 4UTTA 1K8ZA 2A7PA 4WY0F 4KFPA 4N9DA 2ZTJA 3QEZA 2B7OA 4LW7A 3U8GA 1IGSA 3S5OA 1O5XA 4IXXA 4Z1AA 5E0KA 2E09A 1A53A 1UJPA 1AL8A 5CSSA 3G0UA 1OABA 4PODA 2X1TA 2E6DA 3LGEA 1QO5A 2ZZ5A 3PM6A 2CLHA 3SIZA 2D73A 3O06A 2V2HA 2XN0A 1OX5A 1B3OA 5IBXA 1BKSA 1SFJA 4I7VA 1QMLA 2HS8A 3G1AA 2OX1A 3TAOA 3GX9A 1A5SA 1ICSA 5G4EA 2ATSA 2Y88A 3CM4A 5G2HA 4FIQA 4UTJA 3W88A 3BPWA 3HIJA 2KZHA 2NX1A 4CQ9A 3WK1A 2X1RA 3A9IA 1YTKA 1S3HA 2CLMA 3QPYA 1R47A 3LM7A 4HKPA 3GXPA 1QNVA 3NQFA 1WA3A 2BSLA 1MXSA 4KKXA 2QCHA 5HWJA 2XN1A 1ZY9A 3WJWA 1VHNA 4UMCA 2HSAA 2NX3A 4UNLA 5HQEA 3FKKA 3LBMA 3LBCA 4JXCA 3GDRA 4X3ZA 1KLYA 1AL7A 2TRSA 2C3ZA 4HSNA 4CNNA 1JCJA 3IEBA 2ZRXA 3IGXA 1O4UA 1XBYA 2ZQ0A 4UXDA 5I3FA 3NQAA 3GKAA 1H63A 1YTDA 4GFSA 2QDGA 3RU6A 2QAFA 1THFD 4GJ1A 2OZ0A 4X2RA 2QJIA 4QM1A 5HINA 2PRLA 2DORA 1TSIA 4K37A 2YW4A 4JS3A 5FEZA 4NUWA 3FFSA 4EF9A 3TKFA 2E5BA 4LUIA 4FX6M 5AYZA 3TSMA 1X6UA 2ZA3A 2CLEA 3NQEA 4K7YA 4RXFA 3NG3A 4NT0A 4QNEA 5K3VA 4ZQPA 4DO5A 3OVQA 4O8RA 3L68A 1H7WA 5CPOA 2DZVA 2ISSA 1PHQA 4OE7A 3N3MA 3UWVA 3LDVA 1F6KA 2DJLA 2CLFA 1W56A 2QF7A 4FXSA 1RQHA 3C56A 3QYQA 3LHVA 1M5WA 1JCNA 1VHCA 3NPUA 2V82A 3CIWA 4NQ1A 3MW7A 4LOCA 1O95A 4UTMA 1H50A 1OFEA 3KRSA 4IGHA 4QIUA 4AWTA 3HG2A 3W73A 3TUUA 1BTMA 2UV8G 1IXOA 4JX5A 3DXIA 1FDYA 3SECA 2E6YA 2W79A 3WJSA 1LBMA 5AHLA 3L0NA 5DBTA 3GVGA 2RH9A 2B0MA 1W3IA 1YDOA 4JTIA 4Y8FA 2C18A 1ALDA 1VGAA 4EWND 4GE8A 4LS1A 3K30A 4EIVA 3O8AA 2WO5A 1G69A 3TSBA 3TXVA 2Y70A 4JYFA 1R2RA 4GWEA 1FCVA 3G3MA 1I2RA 4TX9A 3LCWA 3W1UA 4M6VA 4UMBA 3NM1A 2NLIA 4UTWC 5T26A 4A3UA 1UUOA 2ZZ4A 3VCRA 1RR2A 5F2MA 4S1FA 3ELFA 1VZWA 3FIGA 3M1ZA 2QR6A 4XZ9A 1XM3A 4K8EA 4JN6A 2H6RA 3G1HA 3LHUA 1HUVA 1NAL1 1KW1A 3IGSA 3M44A 4GRSA 3LCXA 3ABRA 3MJYA 2RFGA 3PBUA 4O11A 1K8YA 4Z08A 1XDMA 3TU9A 4TR9A 4JYEA 5J5DA 1V7YA 3QH2A 2A4AA 3NAVA 4POCA 2NZLA 2X2GA 1YDVA 3A21A 2P10A 3N19B 3HGSA 1TQXA 3W2MA 1HL2A 1XCFA 3W1LA 1KM5A 3W1PA 4UTTC 5AC6A 3TC6A 1FWTA 1IF2A 2VELA 3FYOA 3TV8A 3UWZA 1VCGA 3EWZA 4NJHA 4IWWA 3S0CA 1XC4A 3DZ1A 3GR8A 3PF3A 1TREA 2QCEA 2JK2A 5DCBA 3V1PA 3FYPA 4BWLA 1ZCOA 3BW2A 3P67A 3PG9A 4LU0A 3D0CA 3B0UX 1O60A 4IMCA 3P61A 5DCDA 1DVJA 3EWUA 1LOLA 2YDAA 4RJEA 4IQLA 3G3DA 5IBXC 2GQAA 3M6YA 3W7QA 3C2OA 3EWYA 1H7OA 4IMGA 4MZ1A 5FF4A 4AXKA 2ZBTA 1FY6A 3UZJA 1I2QA 1W54A 3MO7A 1LRTA 2CWNA 4BFAA 5IM51 1YPFA 2ABBA 3RK8A 2Y6ZA 3I7RA 2G97A 3AJXA 1GVFA 3KX6A 4LV4A 1Q6LA 2EKCA 1YLVA 3TQVA 2H8ZA 5BNKA 3IIOA 4O16A 1TPFA 2NXHA 4JDBA 4DQWA 3W74A 1T99A 1VJIA 4N02A 3LI1A 3MMTA 3GXTA 4YCOA 2CFFA 2ZRUA 3W7PA 5D05A 1Q6OA 5EYWA 1TV8A 2ZZ3A 3TW6A 5FF7A 2Y7GA 1P0NA 3HQ1A 1RV8A 4KFOA 2H3DA 4O12A 1T0OA 3VE7A 2AGKA 3N9SA 2NUYA 2WNZA 3GDMA 1DJQA 3MHGA 5G2WA 3TX9A 4LRSA 3SY5A 1DHPA 4JTSA 2J88A 3C52A 4O1AA 4JTUA 4M5PA 2GVJA 3BLFA 4O50A 5HR7A 2CLOA 3S1UA 1HTIA 3QJAA 4MZ8A 1OF6A 1PV8A 4LWWA 4WY0A 3F4NA 1XBVA 4O17A 3MHFA 3NL3A 2Z6JA 2F7FA 4UC5A 3DGRA 5I3IA 3PUEA 3IIPA 4GUIA 1KFEA 1YADA 4ZQOA 4YLWA 3L2IA 2QCDB 5K2ZA 4UFHA 2Y7DA 4XWUA 5HMSA 5I3JA 2A5HA 2BLEA 2J6XA 3G8EA 3QQ0A 1GOXA 2F84A 1XBZA 1PHWA 2E6FA 4M7SA 4IXHA 3EWBX 3S8HA 5AYYA 3VNDA 1J2WA 3DI0A 4U4MA 3P8JA 4K38A 4UIOA 3NDOA 5EKYA 1PCWA 3A22A 2QAPA 3L67A 3L9CA 1W5NA 3F4WA 3P81A 1RPXA 1F74A 1NF7A 1WBHA 4ML9A 4LVBA 3HB9A 3QW3A 3PY2A 4TMBA 3NQVA 4AH7A 3W7GA 4KWWA 3QFEA 1QCWA 3ABSA 2PRHA 1KA9F 3BW3A 2JKPA 3TMLA 3G1YA 4O52A 3I65A 3BLEA 4WZHA 3B0PA 3O6CA 1PL9A 1M7PA 3M9YA 1WXJA 4A29A 5F2LA 3O6DA 1VYPX 4K36A 4LS2A 5LNWA 3LRLA 1GT8A 3HPXA 3JS3A 5F2GA 4BR1A 2O7SA 1P0KA 3R12A 4IUOA 4UNKA 5LNUA 3UXAA 2W6RA 1QO2A 1L9WA 2ISWA 3TCEA 5HJLA 2E77A 2DU2A 1FCUA 4L4MA 3LOTA 5EL1A 1LLWA 4OV4A 1OYCA 1SW0A 3W7EA 3S5YA 4OBTA 4YL2A 1SW7A 4I9AA 3FEMA 4O4VA 5U4NA 3P60A 3TXZA 1FDZA 3W1MA 3TW7A 1WBJA 2Z1BA 3IVSA 3S1WA 2QUUA 4LVAA 3BK0A 3NL6A 1FCQA 5CPLA 4BI6A 4LS0A 1S5WA 1TPDA 3DENA 5D2XA 4Q4KA 1DKWA 1LRQA 1VYSX 1G4TA 1X7FA 1TPVA 3R8RA 1QAPA 3UY8A 5L9FA 4BF9A 2Z6IA 3NL5A 3LV5A 3OA3A 1YXDA 3NO5A 2EGZA 2J27A 3STEA 3MP4A 2YR1A 1VPXA 6ALDA 3LCFA 4QNWA 3RLVA 1SZFA 4MLJA 4JICA 1EP3A 4HNUA 1SZEA 5CSRA 4ZQNA 4JNMA 5I3KA 2LLEA 2ZA1A 3EEGA 3C4UA 1O94A 4BWLC 2GVGA 1HO4A 4RK8A 1XI3A 2ZRZA 4M6QA 1D3GA 1FUYA 1JR1A 4KWVA 4O1DA 4Y96A 1KM0A 1QWGA 4O54A 2A7RA 4E0CA 2G95A 2ZRWA 2BXVA 1LP6A 2YZRA 4CQAA 1K7XA 4OHQA 2WOQA 1C29A 3G1FA 1J4EA 4QJ1A 4NJKA 3LRKA 3H54A 1H1YA 1VCFA 3NQ2A 1VYRA 1H5YA 5A8GA 3PUOA 3DAQA 3V75A 2ZZ2A 5DLCA 7TIMA 1Z44A 3O1NA 4ZZ9A 5D2VA 4GUJA 4AVFA 1GYLA 2I1OA 3CWNA 4O18A 2J9YA 4ORIA 2X1SA 3B4UA 5LNRA 5KITA 1OFBA 2V9DA 3TR2A 4PH6A 2FDSA 2V2CA 2WSQA 3LHWA 4MJZA 2R94A 3LHZA 1OYAA 2J9ZA 5FEXA 2C13A 2YXGA 3S42A 1WYIA 4NJJA 3S5NA 4LNYA 1F73A 3C61A 4WXZA 1A5BA 2JGYA 1TJRA 3TJLA 5K9DA 2CZFA 3GR7A 1I2PA 4NU7A 1W5OA 4NX5A 4NZFA 5LKYA 4MY1A 1MO0A 3L65A 4WY0B 2QDHA 2X30A 5BMXA 3GK0A 3GLCA 2VEPA 5HNRA 1VLIA 5F2IA 4FX8A 1MZHA 3MYPA 3IIVA 4GC4A 4PCFA 1W3NA 3KRUA 3M0ZA 4RZ5A 3VI2A 1PCKA 2TMDA 3T7VA 1H1ZA 3HO8A 5CPMA 3GNNA 3VFLA 5LHFA 1G4EA 3TSDA 2V30A 3IGUA 1YYAA 1GTEA 2C1HA 2VXNA 4AAJA 4QAIA 1JQXA 2NXIA 5DN1A 1UBSA 2RHGA 3W7IA 3ZR4A 4AWUA 1OFOA 5G1TA 4FNUA 5K9CA 4N9EA 2CZ5A 4UR7A 4RCXA 4P61A 3STGA 3PUDA 1S5VA 3W2LA 3L21A 3PG8A 3TIMA 3VE9A 3O05A 2VOMA 5D32A 5HULA 3MP5A 1GWJA 4IOTA 4N6EA 3TQKA 3MI3A 5KINA 3FKRA 1WDWA 4S2CA 1FWNA 4UTIA 3B8DA 1N7KA 1IXQA 2Y63A 1W1ZA 3WK0A 1NF0A 1NSJA 3QZEA 3TQ0A 2B7PA 1R2SA 1ICPA 3EX2A 3SGUA 2WNNA 5CG7A 5AOUA 1K7FA 3W22A 5K9XA 4H3DA 4K7VA 3C0JA 4Y6GA 1DBTA 1XKYA 5KMYA 4K39A 3CWOX 4D2JA 4DO6A 4P2VA 2QCNA 5LHEA 3WFAA 4O14A 1B9BA 2QEZA 4AB4A 1ZENA 3GDKA 4UTKA 4OU1A 3LCLA 2Y85A 2QCDA 3Q37A 3W87A 1CW2A 5D2WA 2FQIA 1M7OA 2E5DA 3BGJA 1OFRA 4PA8A 3NA8A 3W71A 3N2XA 5K4XA 3GYEA 1SU5A 1SZGA 3KOFA 3GB6A 3EB2A 1H7XA 3TJXA 1LM1A 3NYZA 3T78A 1DQXA 1F05A 4FB7A 2J24A 2WSYA 2PCQA 1EA0A 2ZZ6A 4XUGA 4U28A 3W7CA 5AHIA 1QPQA 1VQTA 1TV7A 4A2SA 1EWDA 2IQTA 3B0VC 4OWGA 1FWWA 3N34A 5C55A 4WX2A 4MOZA 1AK5A 3OEXA 2H90A 1GVSA 1MSSA 3GDTA 3A23A 4O0KA 5BOOA 3DKJA 2NV1A 1DL3A 4NNCA 4IMEA 1DV7A 4K6AA 3C6CA 1UASA 3M43A 3HBLA 1FXQA 5C54A 2X16A 4LVGA 5FEPA 1TPWA 5CZTA 3JRKA 4O4WA 5CKSA 1SW3A 3B05A 4ADSA 5G5IA 1JCYA 2NUWA 1FBAA 4LC8A 2FLIA 2GQ9A 4M7TA 1HG3A 1PE1A 3BO9A 3PULA 1Q6RA 5AHFA 4CCEA 1TPUA 3UYCA 3N9RA 3TK7A 2V2DA 3Q94A 5D09A 3PAJA 2QCLA 4MFEA 2BZNA 1Y0EA 3KFTA 3FS2A 2YFOA 2I14A 2QCMA 1C8VA 4YXGA 1P4CA 1KM4A 3W84A 4NJIA 2Q8LA 1F5ZA 4CQ8A 1Z42A 3E12A 3B03A 1GZGA 5TBOA 3QRHA 5AFDA 1RQBA 5E93A 3QSRA 4Z1CA 4B5NA 1IXPA 3P8IA 4XBSA 4DELA 4DPPA 3W23A 1TV5A 3DFOA 3INPA 2QJHA 3FA5A 4QITA 1TYGA 1DORA 4DF1A 4M6PA 3C2EA 1JRCA 2VEIA 4RV8A 1K03A 3S5ZA 2A7NA 4IPIA 3W7HA 3OBKA 3BARA 3W2NA 5LGZA 2V0TA 1Q3NA 3LHTA 5AHEA 5D04C 3KHJA 4JTHA 5I3GA 4HHPA 4ZQMA 4UFIA 5AB3A 3QF0A 4DBDA 4FXRA 3F1QA 3IIZA 4UFMA 2QCGA 3PB2A 1R46A 4NVTA 1R30A 3EWWA 3UWYA 3G0XA 5KTLA 1QPNA 3NPWA 3OIXA 4N6FA 1ZHAA 2ZZ1A 1ZAHA 4IX0A 2A0NA 5D33A 3RFAA 3QW4B 4AEOA 2PE4A 2YW3A 1S5TA 3HMJG 1GG1A 2WJZA 4MZYA 1KBJA 4AHPA 2VEMA 2ATMA 4HNNA 1H51A 2Q3OA 1K8XA 4LUJA 2FB3A 3NPVA 1RD5A 1EWEA 1UB3A 3MBFA 3WK3A 4N9BA 5DY2A 3FJLA 4K8HA 4AWSA 1TJPA 4WOQA 1QPRA 1CX9A 4UTLA 2CLIA 3PBWA 1P5BA 4QSHA 3W7OA 5EMUA 3UNDA 1X1ZA 3LLFA 3KAOA 3MUXA 3MI6A 1GQNA 1ME9A 1W3TA 3ATZA 3HG4A 2RDWA 4NX0A 4DF0A 3U2OA 4NNBA 4FHAA 3FLUA 1PS9A 1EUNA 1SO6A 1WOBA 2FTPA 4C1LA 2GOUA 4IPJA 2PRMA 4LT9A 4R53A 2ZA2A 1FX6A 3HG3A 5CZ0A 1EP1A 2V5BA 4GUHA 1N8FA 2NWSA 3M47A 4JTKA 4CCDA 4JX4A 4Q33A 5DBUA 4ZQCA 3M5XA 1EPXA 3W7DA 1OFQA 4JIQA 1VCVA 4ONVA 4IX2A 4RZ6A 1JCXA 1FQ0A 4JTGA 3E02A 2H3BA 5F1UA 1QDSA 1LROA 1M6JA 5AYXA 5EA9A 3KRZA 1VRDA 3GIYA 3LRMA 5LGXA 5AHNA 5FI8A 3UD6A 3GAKA 3NQMA 5AHMA 4Y90A 3PVFA 2RKXA 1JRBA 3HPSA 2X1UA 2A2IA 2RDUA 1TPC1 4JDYA 1I45A 1W31A 3LERA 3R89A 4EOUA 3UPBA 2CLLA 3MBDA 4Z1DA 2ZFAA 3A5FA 1QFEA 1EIXA 3BW4A 1FCBA 1WOAA 3KVLA 3SFKA 3C2RA 4DO4A 2DZXA 4FNRA 2VFIA 3ABQA 1B4EA 4EF8A 1KTBA 2ZDRA 2Y7FA 2FPYA 4JTEA 2QUTA 1LBFA 4YMZA 1W37A 5D2YA 8TIMA 4UFJA 4FX7A 2P1FA 3DFSA 1IIHA 4NXKA 1TPH1 2VC6A 3MP3A 3W3OA 1H62A 1KM6A 2C15A 5HUPA 2R14A 4H4IA 3DHFA 3DKLA 4XKYA 2FFCA 3JR2A 3TNOA 1KV5A 1OFPA 1B57A 4KFNA 3ANYA 1W0MA 4JY8A 4MIMA 3W7LA 3UZ5A 2NXGA 4YWIA 5E1QA 2OT1A 3CTLA 2DZSA 5DXXA 4I7UA 1PIIA 5ABTA 3H53A 4JTTA 3E9AA 2GUUA 4IMFA 2C6QA 3A24A 2G5WA 3FJ6A 1G67A 3KXQA 2Z2UA 1W5QA 2HS6A 4UTHA 2WNQA 3TDFA 4MLRA 3DFNA 3OHIA 3H55A 5MHBA 3CLMA 1QPOA 4WD0A 5F4WA 1R2TA 3G8RA 3B04A 5I3HA 3PSWA 4FEZA 4ADTA 5DELA 3UY7A 4FO4A 1L6SA 1TB3A 1LDCA 4NZJA 3LTYA 3NM3A 4ZL1A 2Q8ZA 3G1VA 3G1DA 4NXSA 3MHUA 4CLMA 1D9EA 2B4GA 2V5LA 3LXBA 1YXCA 4MY9A 3G1XA 3BG5A 2A6NA 5F4XA 3BV4A 4WJEA 3TAKA 2OMAA 4AF0B 3I7QA 1LOQA 4EVZA 1MEHA 3A5VA 3NQ8A 5L6UA 2ALDA 2ZZ7A 3P62A 4UTWA 1MEIA 5F4SA 3NQCA 1UUMA 2ISVA 1SSDA 2QKFA 1B4KA 1TTPA 3C2VA 3S1XA 4E2DA 3QMSA 4RKAA 3Q2DA 1XXXA 4ZQRA 1TPB1 1LZOA 1VLWA 3LTPA 2JKAA 1BWLA 3U6WA 4UR8A 1GVQA 2H8XA 4JTFA 1AW1A 4ALDA 2E1DA 2CLKA 3QC3A 2C16A 3QSTA 1EUAA 3CU2A 2VFHA 1CI1A 1OYBA 1KTCA 5H2ZA 1AG1O 1GG0A 1SR9A 1RQEA 4XQ6A 1H7RA 2YCEA 3FOKA 3M16A 1FXPA 2C0AA 4J9JA 4UFLA 4IJBA 3W1RA 1NEYA 4FF7A 2GVLA 3STCA 5HR6A 1HO1A 1SFLA 2TPSA 1F6PA 3GXNA 2Q3RA 3NZ1A 1GJPA 1FWSA 2B7QA 1OX4A 3W7JA 4MPQA 3EXTA 3W76A 5BMWA 4Z0SA 5G1YA 2YX0A 4RXGA 1ME8A 5AC7A 3SW6A 1XDLA 4XTDA 3TC7A 4TO8A 4AHQA 5H91A 5KZDA 3O15A 5HWNA 4L4LA 2ZRYA 4ADUA 4JX6A 3W07A 2ZCGA 3TE9A 1SO5A 1MEWA 4NNAA 2ZYFA 2V81A 1GTHA 5K7JA 3NQ6A 5C5YA 2GQ8A 2VKZG 2Y7EA 1GVOA 3W85A 1A5AA 2E5CA 1XUZA 2QCCA 3NGJA 5CZSA 3RLUA 4O1CA 5G2IA 3CIXA 3T40A 3SI9A 4W9TA 3W2UA 1F7BA 1LOSA 2YYUA 3LTSA 5EPDA 2FIQA 1NVMA 5D03A 3ZWSA 2Z0IA 1NFBA 1LRNA 3M5YA 1F76A 3HGOA 1W8SA 1OFDA 3EXSA 4CCCA 5G4WA 1KFKA 2EAWA 5C2XA 4HPXA 3DFQA 1F2JA 3EX6A 3W7MA 1JVNA 1X8FA 3THQA 4A21A 2EHHA 3EKZA 1BWKA 3LCHA 1OG0A 2YYTA 3ZFHA 1BEUA 2A1YA 1YPIA 2DZTA 2DJXA 1SO3A 1YDNA 4LC6A 1KFCA 4O1BA 3W7NA 1WX0A 3ZS4A 3SZ8A 3KVJA 4TU1A 1H60A 3LX9A 3P7YA 1A5CA 3CPRA 3P84A 1PVNA 4XKYB 1J5TA 1TTIA 4JIPA 1ME7A 3L5LA 2DZPA 3HOJA 1I4NA 2EPHA 1FWRA 2XN2A 3W6YA 3NPXA 3M41A 3WK2A 3M5VA 4HT3A 3CHVA 1OFAA 4FNQA 3T55A 1SPQA 2ZRVA 4RX0A 1EP2A 4LRTA 5D02A 4TMCA 1U83A 1WQ5A 3WJXA 1U5JA 1G7UA 3HGJA 3P82A 4O28A 1QOQA 3DI1A 4O57A 4OGZA 4LTSA 2CW6A 2VFFA 3W1AA 3IVUA 3KVMA 1EB3A 3CEUA 3T44A 3L5AA 2WKJA 3O07A 3IIXA 2CZDA 4DBEA 4DPQA 4UFKA 5FF0A 1TQJA 3QQ1A 4O13A 1GVRA 2JGQA 1G6CA 3P74A 1N55A 5GVJA 1ZAJA 3GNDA
chains in the Genus database with same CATH superfamily
1W17A 1TX0A 5LXEA 1M3UA 5ABFA 2UZ9A 2IPGA 3VNZA 1MWOA 1LBLA 2YBTA 3RCNA 3DBPA 2FMOA 3M46A 3P5YA 3NQ7A 4XBKA 4C5YA 2O4QA 3I7SA 2VR5A 5EMLA 1K4HA 3R5EA 2INFA 2CZEA 1HVQA 3PB0A 3PR2A 4KRUA 2HMCA 3AO0A 3L0GA 1XH2A 3KTXA 3MI2A 3HJZA 1KWGA 5JU6A 2OR2A 1R8LA 3BVJA 4H41A 3GUGA 1AW2A 4M82A 4FI4A 5LIWX 3TN4A 4J35A 4IIEA 4B16A 1QI4A 1QOPA 1EBHA 1GOQA 5F1VA 2XPKA 3PUGA 1VH7A 2PWGA 3URNA 3IARA 5A5WA 3VUSA 2GJXB 2WPBA 3LPFA 4KWUA 1XIMA 3W2KA 1EYEA 9RUBA 3UJ2A 1OC5A 4AZ5A 1AJ2A 4NIRA 2PA6A 3UETA 2VX6A 5BW6A 2F6KA 1G01A 1RSCA 1EJVC 4W85A 2YBUA 2W66A 2XGIA 4AF0A 1FWGC 4Z1YA 2O9RA 4DZHA 4BK9A 3DFTA 4X9SA 2A79A 4R33A 5BOEA 2ABAA 1K7EA 3SRHA 3UF9A 4O0ZA 1KQZA 2BX7A 3VD4A 2YSWA 3GDLA 1K02A 3D3AA 1XIBA 2WHJA 3W70A 1C7TA 1SO4A 3OZPA 1CGWA 1XL9A 1YXYA 3QPZA 3KCOA 5MF5A 4B5VA 4UQDA 4A22A 2W4XA 3DHDA 4Z1BA 1MQRA 1AQHA 4GGHA 4NF7A 4GQQA 3KZPA 1MRQA 3BC9A 2WWCA 2HWGA 3FEQA 3BICA 3F2DA 5CC5A 1VJZA 2ZTKA 5EMJA 2HV5A 4GNKB 4C6LA 3PBYA 2CEQA 2I16A 3S2LA 4M19A 3QZAA 4DEFA 4EKJA 5KZMA 2UY3A 2BXZA 2PDIA 1L6WA 2NV9A 4HOXA 5EMKA 1OF8A 1FP8A 3RILA 4F0RA 1EDGA 1Q6QA 1DJWA 2AQWA 1W1PA 3AAMA 4J2PA 4D9PA 3G1SA 3I10A 1R5YA 2OJPA 4BEQA 2VFEA 3NR0A 2P0OA 1WAWA 2WMGA 1W9UA 3QGAC 1RK5A 3TWBA 2PF0A 3AXKA 4GUFA 3WENA 5AY7A 3MSGA 3HA1A 1QT1A 2BOFX 3TLLA 4JZ5A 4FIRA 3BOXA 4XISA 3S9YA 5AYBA 4U10A 3U4FA 4RZ4A 4DM2A 2GYIA 4GINA 4MKVA 7TAAA 3D6NA 3L5MA 1PKNA 2PEVA 3NSNA 1QXLA 1V02E 2NV2A 1E55A 2JALA 3E96A 4DBUA 4D6JA 4LXFA 2C8NA 3QMRA 3BQ6A 4FNSA 3SBFA 2DH3A 1GYMA 4V33A 3RNDA 5M3WA 2WSRA 3CUIA 3NOEA 1JYWA 1Q4WA 3KBJA 4IF2A 4OTKA 3V0TA 1I2NA 4DI9A 3MWCA 4HGXA 3ZLGA 3E0FA 1CECA 3NXFA 2DZWA 2DIEA 5FEWA 1PYFA 3TONA 3R7MA 2NVAA 1R3WA 2UY4A 1H61A 3THCA 3TMQA 1ELSA 4Q4PA 2VFGA 5DCEA 4UR9A 1QK0A 3P80A 1P1XA 4TV5A 4YCPA 3N2MA 1QHPA 3A9BA 3EMCA 3T0DA 4PB3A 3W83A 1V5XA 2GWNA 4GVGA 2RJHA 1K3UA 4PFMA 1OX6A 3M4HA 5DXYA 4XG1A 1KFLA 1GK8A 1E15A 2XWEA 4DIAA 5HWMA 1HP5A 5D9NA 3RX3A 1TIMA 4F79A 6TIMA 4D6DA 1T8XA 4ICCX 3USBA 2PDMA 1UP3A 3W7RA 3GUWA 3UPWA 1C9DA 2PDUA 3C2FA 4E38A 1GQJA 1P6BA 1KM3A 3KP1A 3UXKA 3SCUA 3ZLHA 1WP6A 4Z0JA 3AYTA 4QQ3A 3AMGA 4LV9A 4GZ7A 1DQWA 1W1TA 2VC7A 3GW3A 4GABA 3N18A 3W72A 3HQOA 1P43A 4GQBA 2JIWA 5DT7A 1I8JA 4DJFA 1EZ2A 1GPFA 2C79A 2PC8A 3RPDA 3SJ3A 3FGCB 1P0EA 4MNJA 1JG9A 4WDTA 1GHSA 3ZWTA 4FOUA 1OVDA 2OU4A 1ZAIA 2E7FA 4MFDA 2PP3A 4F66A 4I7WA 3VOCA 3WKZA 1JYXA 1X1NA 3ARPA 3BSHA 4XTIA 4ZB0A 3JW7A 2NUXA 3QTGA 1NARA 2EEXA 1DIDA 4J7RA 4O19A 1RVKA 3L23A 2NSXA 2JKEA 4OV9A 4OBSA 2R91A 1WPCA 4Q8PA 3WQOA 3UWQA 1PJ9A 3HMCA 1H49A 2YPIA 1JD7A 3BMWA 1C9WA 4O0QA 4WY0F 5HNNA 3L4WA 1Q6DA 3OGRA 2NW0A 1JXJA 2B7OA 1IGSA 3S5OA 1O5XA 4IXXA 2E0PA 5E0KA 4WSKA 1XCXA 4OJYA 1AL8A 1K8CA 4H9XA 2GL5A 1UWIA 1OABA 5DEZA 3RDKA 1BYBA 3LYEA 3VA8A 4DXXA 2GDUA 2V2HA 2XN0A 1OX5A 3RPTA 1QMLA 1QOXA 1GOKA 3QV9A 2HS8A 2ICSA 2OX1A 3CM4A 1QRQA 2KZHA 3U5YA 2NX1A 3OJGA 2Z1XA 3A9IA 4K1WA 2F38A 3GIPA 1L2QA 1QNVA 1GONA 1QUMA 5FA5A 4CVUA 1B30A 2QCHA 3EYPA 4GIEA 3AIQA 2XVKA 2Z2BA 4DUXA 4UMCA 4UNLA 5HQEA 5IRPA 3LBMA 3LBCA 4X3ZA 1NM9A 2TRSA 4HSNA 1JCJA 3R94A 2YA0A 1O4UA 1XBYA 2ZQ0A 3G6MA 4EE9A 2B31A 4YYFA 2QAFA 1YE6A 2DSWA 3ITTA 2ZVRA 4QM1A 2P3EA 2DORA 3GD6A 4XO6A 4MWAB 4JS3A 4YVXA 3A4AA 1JCTA 4R3UA 4U33A 3QHNA 1PYMA 3B9OA 4FX6M 1MFUA 3NQEA 4RXFA 3L68A 3MB9A 3E2VA 3SJNA 1ZJAA 2DJLA 1LL7A 4JFWA 2CLFA 1W56A 4HMDA 1RQHA 4JIEA 3VO0A 3PZMA 1VHCA 2V82A 4CEUC 3CIWA 4LOCA 1XIEA 1H50A 1U2YA 1OFEA 5LIUX 1XRVA 3UXLA 3AIBA 4EXQA 3W73A 1A3HA 4PSRA 1RBLA 1UZDA 2UV8G 1IXOA 1FDYA 1OD8A 2W79A 1H3GA 3DYMA 3E0LA 1AVAA 4ZO6A 3GVGA 4JN8A 3ZQ9A 4JTIA 3W28A 3WEMA 1WZAA 1FHLA 2C18A 1ADDA 4EWND 4GE8A 2V3DA 3SQLA 2AGTA 2Z1VA 3LQLA 3RLHA 1NH6A 1R2RA 4WKAA 1I2RA 2VRQA 3LCWA 4UTWC 5T26A 3VCRA 4WLCA 5I03A 1RAKA 2V63A 1XV8A 2E1WA 4LJ3A 4UQBA 3M1ZA 2OWWA 4PMVA 1NAL1 7REQB 1F3WA 3ABRA 3MJYA 3NFUA 1GGOA 1PPIA 3KW3A 1K8YA 1KQYA 3H7UA 4Z08A 3UCQA 3UR8A 1K6AA 3C0QA 4PGLA 5FAJA 4B3ZA 1IEXA 2A4AA 3A47A 5HNTA 4BF7A 2X2GA 1R3SA 5BRPA 2V5DA 1K9EA 1BYAA 3N19B 3HGSA 4NHVA 1ZBWA 2DGAA 2X7VA 3GC2A 1TQXA 1SFSA 4AZBA 1AJ0A 3RPMA 1CXIA 3W1LA 2WJEA 1P0DA 4A3QA 1K9DA 4KIEA 1JZ7A 3GG1A 4MB3A 4NJHA 3QN3A 4IWWA 4IPPA 3DZ1A 3S0CA 3PF3A 5AC5A 3EDDA 1Q13A 4DWSB 5DCBA 3A4JA 1GVYA 3P67A 3BW2A 3JUGA 2VD9A 1R7AA 1O60A 1YE4A 1DVJA 2OX4A 4MWAE 1MDLA 3GVVA 4ZO7A 4BCEA 4NAEA 2L5HA 3M6YA 5GJNA 1H7OA 2IS7A 3AQUA 2ZBTA 1FY6A 5B7ZA 3UZJA 3PK7A 1LF1A 2CWNA 2X09A 3C0LA 4BFAA 2GGEA 5IM51 3RK8A 2V3GA 3TJ4A 1BXNA 4X0NA 2B81A 3HQPA 5T9CE 2QULA 3H4GA 1YLVA 3IIOA 4CNSA 1TPFA 4JDBA 1Q6GA 3W74A 2PLKA 3S46A 4JHZA 3MMTA 4YCOA 1M41A 1Q6FA 5FD0A 2ZX6A 4E3VA 2Y7GA 1UOKA 1BVZA 3I3EA 4J27A 1T0OA 1TMQA 4NZ3A 3N9SA 2NUYA 2IXUA 2J88A 3BAIA 2CLOA 3QJAA 1PV8A 1ZBCA 2ZC1A 4WY0A 4H01A 3AYRA 3F5LA 5I3IA 4ZQOA 2C71A 5K2ZA 5HMSA 2Y7DA 2A5HA 1U30A 4JQ4A 4WJ8A 1GOXA 1YRRA 2YA2A 1E72M 1GOOA 3S8HA 3DFYA 2BVTA 4PMOA 1J2WA 4Y9PA 2YDSA 1S1PA 1M65A 4K38A 1MW3A 4PBFA 1ZZMA 5A8QA 4I5RA 3E0VA 3L67A 1W5NA 3WEOA 3F4WA 1OWQA 6A3HA 4WDUA 1WBHA 3CL6A 4ML9A 1DJXA 3HB9A 2BGQA 3QW3A 3PY2A 4MKSA 4D6FA 4TMBA 1IQ8A 2OELA 5FJUA 4EAYA 3UCDA 4G2DA 1E40A 1KA9F 2JKPA 3C5QA 2Z29A 2ISFA 4A3YA 1JAKA 1VYPX 1S38A 2D0FA 2G3IA 1PZ3A 5BROA 3WBEA 4RPPA 4H7VA 3UXAA 3SDOA 1QO2A 1DWJM 2ISWA 5GNZA 2HXTA 2AMXA 1ONXA 2DU2A 4L4MA 2INEA 3VFCA 1XLAA 1QHZA 1SW0A 3WNKA 4OBTA 4KWOA 1JYVA 1SW7A 4UBPC 4I9AA 4HB7A 3E5BA 1JDAA 5JH1A 1BXBA 1OADA 4AWEA 1H0IA 3NL6A 2XSAA 5CPLA 4QGCA 5BU6A 1M53A 1H09A 1G4TA 4QDWA 1TPVA 2JF6A 3VKDA 1F3EA 4BF9A 2Z6IA 3VIGA 3NL5A 3LV5A 3PN8A 4JTQA 3NO5A 2J27A 2Z1KA 3LCFA 4QNWA 4OVXA 4X61A 3GIQA 3RLVA 1SZFA 4MLJA 3GH5A 5CSRA 4JNMA 1KRAC 1EF2A 3C4UA 1O94A 1SZRA 2R1NA 1PTGA 2PAJA 3WLSA 3UG4A 1CEOA 1VJSA 4O54A 4TVCA 4E0CA 2ZRWA 2ANUA 2BXVA 3BAXA 4OHQA 4HTYA 1RXOB 2NQ9A 3HM7A 2O9OA 1J4EA 4QJ1A 3LRKA 4OOUA 1KGUA 1ENUA 1H1YA 5LA0A 4N42A 1NFGA 4RPQA 2AQVA 3FN9A 3WLLA 2PD9A 5D2VA 4GUJA 4YN5A 4AVFA 2I1OA 4KS0A 4C6QA 1PWMA 3CYJA 3BCJA 4E4UA 5KITA 4XZMX 2VGGA 1V3JA 4GCXA 4PUNA 2ZE3A 3PHAA 1XH0A 2HRWA 2DQWA 2R1LA 3LBOA 1OYAA 1T40A 3Q45A 1WYIA 3R0DA 3TJLA 3WMLA 4NU7A 1W5OA 4DHGA 5LKYA 3XINA 3ITOA 4UTFA 4MY1A 3AISA 3L65A 2QDHA 4HA0A 3ZYZA 2W61A 1GOIA 5F2IA 2PTYA 1MZHA 1OCJA 1H2JA 4PCFA 1LJYA 4RZ5A 3VI2A 1IHIA 1K6WA 2ZC8A 5T91A 1EC8A 1H1ZA 5CPMA 3CH0A 2VGFA 3VFLA 2PGWA 4BQ5A 3W81A 1KXTA 2DW6A 2C1HA 4Q8TA 2NXIA 5DN1A 2RHGA 4FNUA 5K9CA 1W3JA 4M6UA 1EKOA 1KGWA 2PPGA 4RCXA 4HYVA 4XK2A 1QI0A 1S5VA 5GVJA 3L21A 3QLDA 1LUCA 3AMDA 3O05A 2OZTA 2CBUA 1EPVA 3MP5A 1GWJA 4N6EA 3UW6A 4MPKA 4IIBA 2ZOXA 1FWNA 3B8DA 3K4WA 1NSJA 4HP5A 2XFYA 3IJIA 1R2SA 2Q6ZA 4MWAC 2WNNA 1K7FA 4K7VA 3C0JA 1FWBC 1DBTA 5H6HA 1XKYA 4IL2A 1UYQA 3CWOX 4RDZA 4D2JA 4DO6A 1QVBA 2QCNA 5LHEA 4O14A 1C90A 1PKMA 4US5D 4YIWA 4NAFA 1B3YA 4OU1A 3GU2A 2YKKA 1SJCA 3M0VA 3P14A 3A12A 3NDZA 3T8QA 8CGTA 3N2XA 1R9YA 4IIGA 1OCQA 3EB2A 1A0CA 2J24A 4XD3A 3NIYA 2BGNE 2PCQA 4DUVA 4F4RA 3CHDA 4XUGA 4IP7A 3CS2A 1OSEA 1TV7A 1J0YA 2A3EA 4WX2A 2OKOA 5HMEA 2WMIA 1TUFA 1AK5A 3OEXA 1CWYA 2H90A 1GUVA 5H8MA 4GQGA 2BMBA 2IPJA 3FSTA 3BLPX 3DKJA 1DL3A 3W0KA 4DWDA 3N6QA 1DE6A 3KOZA 2GGGA 2WANA 2VVSA 2WC7A 1VBGA 1NY1A 3PANA 2IKIA 3ALGA 3N1AA 1SW3A 3B05A 5G5IA 1FBAA 3GFXA 2GQ9A 4B4FA 1MW2A 4E3TA 1UWTA 3RRAA 3I6TA 2VNCA 5AHFA 1TPUA 3BAWA 3N9RA 2V2DA 1RBOB 2IKJA 2VCCA 5D09A 3PAJA 1VBRA 2PP0A 3KFTA 2YFOA 1I1XA 2QCMA 4JFSA 4UNIA 1C8YA 1P4CA 2Q71A 4GMEA 4JQ3A 3FA3A 1E6NA 1FH9A 1Z42A 3WH8A 2PLMA 3U7BA 2D3LA 2WVUA 2XG9A 2PDWA 4Z1CA 4DZ5A 2I57A 2ASHA 3UCCA 3ITCA 3SCVA 1TV5A 3UNTA 1FFRA 3MSRA 2Y4SA 4KBXA 1DORA 1FH8A 1BQCA 2WKLA 1FA2A 1S39A 4CN4A 1JRCA 4RV8A 3W7HA 4MGGA 1GVEA 3HV8A 2V0TA 1UZHA 5AHEA 4DWSC 4J40A 4XZWA 2E28A 4WKFA 4NP7A 4FXRA 3RLGA 2CKRA 4KT2A 1P7TB 2OZ3A 2I56A 3CAWA 4K1GA 3PB2A 1PKLA 1U5VA 5HNUA 1DWGM 1A80A 4UCFA 5TD4A 1GORA 3B97A 1RCOB 3QW4B 2PBOA 3ERPA 2VC5A 3H2AA 3HMJG 4HPHA 4MZYA 1Q63A 4AHPA 2VZUA 1FWHC 3MUZ1 3OGSA 1K8XA 5FCZA 1IE7C 4N9BA 1XIIA 3FJLA 5A8OA 1QPRA 3BANA 1KCKA 4ZOBA 5C8BB 2BHZA 1UIPA 5EMUA 1ECQA 1L8PA 5I02A 3UNDA 1X1ZA 2JE8A 3HPFA 4P7NA 3MI6A 1GQNA 1ME9A 3HG4A 3ATZA 4NX0A 1CPUA 3QFWA 1LWHA 2J6VA 1SO6A 1WXYA 4PUKA 2FTPA 4EX4A 4C1LA 4FXJA 2WMFA 3APTA 2BGSA 5CAKA 3FV9A 3HG3A 4GUHA 2IQ0A 2NWSA 3DECA 4PCNA 5CPTA 1FWJC 4JX4A 4Q33A 5DBUA 3OODA 3S5SA 4J3SA 5H8UA 3VIOA 4JIQA 2XVGA 4Z2IA 3WLMA 4RZ6A 4H8HA 1XG4A 5JBEA 5D9PA 1MNSA 2VX7A 4A8RA 3DFHA 1OIMA 2H3BA 3U5UA 2VP8A 5EA9A 4C5ZA 3GNOA 1QPKA 5FACA 3SUTA 5LGXA 5AHNA 2OTDA 3FX4A 5AHMA 4I9JA 4M81A 3PVFA 3O9NA 3URAA 4C6KA 1TPC1 1IR1A 4EOUA 2GGHA 3BV7A 5E09A 2CLLA 2V3EA 4S3CA 4GACA 1QFEA 1HIZA 1FCBA 2WCGA 1IZCA 4YVPA 2Q09A 4DO4A 1IR2A 4CQBA 4M29A 3ABQA 4GJIA 1KTBA 2ZDRA 3ONBA 2Y7FA 2FPYA 2W27A 3ANUA 5D2YA 4PSPA 8TIMA 4IGMA 3CBWA 3VNJA 1TPH1 2HVNA 3IS4A 2QDEA 4HQVA 3D46A 1CT5A 2OPJA 2FFCA 3JR2A 4QXIA 3L4VA 3VPLA 3HV9A 1SM9A 3W7LA 3B8IA 2NXGA 2OT1A 3CTLA 3BH4A 1EXPA 3H53A 4JTTA 3GH4A 3KL0A 3GHUA 2C6QA 3GQYA 4X9YA 3UXIA 2AL2A 1GOWA 3OHIA 3H55A 3MZNA 3CLMA 4GI9A 1R2TA 3B04A 2OG9A 3EB4A 5I3HA 3MKKA 3TN5A 4ADTA 1WKFA 2WJDA 3UY7A 4FO4A 5D4YA 1L6SA 2UY5A 2OSXA 3WX7A 4S39A 4BY3A 4IQJA 2VEGA 1MW0A 2OODA 2PTDA 1NDVA 3LXBA 1QU4A 3V5CA 3NJ3A 4AF0B 2HVOA 4WDXA 3AROA 1NFPA 4M56A 3NQ8A 5IFTA 3KCJA 2ZZ7A 4UTWA 3NQCA 3APYA 1UUMA 2ISVA 1FWDC 1OCNA 4EP8C 4EPEC 5I24A 3MUY1 4W93A 3C2VA 1AQMA 5E5CA 3QMSA 4GVIA 3LTPA 2PGRA 2EBNA 1AW1A 1Y65A 4OUIA 3HU7A 1UR9A 5ECVA 3BCFA 1K9TA 4J5NA 1V51A 2VFHA 4TTGA 4C65A 1VRXA 1TZZA 1SR9A 2Y8UA 1H7RA 1MFVA 1WDRA 1V02A 3W1RA 5C71A 1VEMA 4LCQA 2TPSA 3AS0A 1ZCCA 2DIKA 2B7QA 1FWSA 2GJXA 1P6WA 3RHGA 4JTDA 3VINA 3EXTA 2GK1B 4FA3A 2BOGX 1KGXA 1KKRA 2DSUA 1YW1A 3R1ZA 3EA3A 2G37A 1XIHA 2XU2A 1JDFA 4H2HA 1XD1A 5H91A 3O15A 4L4LA 4ADUA 4JX6A 3ZT5A 3NCOA 1A5UA 4J4KA 2YIHA 3H2CA 2YDRA 3LPPA 4IUGA 4XKMA 4TOQA 4ZSTA 2V81A 1GTHA 3TWAA 1UD4A 5K7JA 1SJBA 5C5YA 2GQ8A 3T42A 3W85A 2QCCA 4ZO8A 1GQIA 1EJSC 3NGJA 4AYGA 4D1IA 5M17A 2Z7KA 3CIXA 2DY3A 4U3CA 2E9BA 4WGXA 3AS2A 4IPLA 3SI9A 3W2UA 3LTSA 3MDUA 3ZJ8A 5D03A 1FHUA 3M5YA 2QPXA 4KEVA 3ITLA 4E2OA 3CUJA 5DO8A 4XAFA 4XO7A 2EAWA 1JFXA 4HPXA 5C2XA 2FKPA 3H8AA 2J74A 3CL7A 1F2JA 4IIHA 3WD0A 5B7YA 3IK2A 3RN6A 3THQA 4A21A 4DI8A 3LCHA 2Z24A 3WDPP 1YPIA 2FZMA 1KFCA 1WX0A 4QE5A 1J10A 3ZS4A 2GUYA 2P8BA 4TU1A 3KBVA 1YHTA 2YL9A 3FJ4A 2XN2A 3W6YA 2J62A 4ZA0A 4B5TA 1OFAA 1SPQA 4L5ZA 1XLBA 1UMLA 3HFTA 1EJXC 4CKQA 1FHDA 4P8WA 3E3HA 1U5JA 3P82A 3DI1A 3R0KA 4DY1A 4OGZA 4R9OA 4MF4A 3AWNA 1GZ1A 2P50A 3WDIA 2J7CA 2HEJA 4DBEA 2EO7A 5FF0A 1TQJA 3QQ1A 4HVXA 3RU8X 2OWCA 3QGVA 1AA1B 2JGQA 3CAQA 3DX5A 5EFFA 1ZAJA 1C7SA 4GZIA 2YXOA 1E5JA 4DAIA 1LLZA 3S9ZA 3R79A 1JPHA 5G4HC 5IDIA 4U3AA 4TIMA 4QTGA 1XLLA 4L65A 4H2CA 1ITQA 2ZKMX 1VAHA 2PURA 4QROA 4HNVA 4A2RA 4OT7A 3T6CA 5A6BA 1KTNA 1OK4A 4E2BA 3R0UA 5A69A 3WLTA 3V7PA 5DY3A 3FW6A 1BXCA 4M8UA 1GEHA 1E6PA 1EC9A 1KB3A 3W9ZA 3UQNA 1NDWA 4IJRA 5TIMA 5HQMA 4KEZA 3S9IA 4FNTA 4PL1A 1RP8A 3QHOA 4AD2A 3M0XA 3DG7A 3BG9A 5A6LA 1SQ7A 1EX5A 2ON3A 1HX0A 4FK9A 4N9CA 2Z2AA 2E8ZA 2A6LA 2R1PA 1UZ4A 2VR4A 4HIBA 3WLIA 3MYOA 1G4SA 2PC4A 3UFYA 5AVHA 3BAJA 3IV3A 1UKOA 1VC4A 2VEKA 2Y62A 3DH7A 3QLLA 1TO3A 4H6KA 3N3TA 3TNBA 1XSIA 2ZIDA 2WZMA 5EU9A 1TR1A 1TRIA 2OOGA 1CXHA 1Y7VA 4H83A 3LB0A 1QJWA 5REQB 2WAGA 3OP2A 4I8YA 4E8CA 4MY8A 4PMXA 3VTRA 1Q2RA 2OLHA 1KXQA 3FGCA 1XFBA 1IWBA 4QE1A 3PFMA 3RR4A 1ZJIA 1LT7A 2QVHA 5A6KA 1A4LA 1G7VA 1MUMA 1E51A 3EX4A 3N14A 3OO2A 5U7SA 3G24A 1VS1A 2DT2A 5JUVA 5D8WA 5HPCA 2DT0A 4N2YA 3LPGA 4UMAA 1W8GA 4LBSA 1O6IA 3GKFA 3QM3A 3W2JA 4S2BA 4O8AA 4XZHA 4AD5A 3WLPA 4PCPA 4INFA 4G1NA 1F3XA 4H8UA 1ADOA 2NSOA 4Q6XA 1FWEC 1JNDA 4JTAA 3S6OA 4GIAA 2RJGA 3T07A 3UVAA 2EF9A 1UOZA 3SSJA 4AYSA 1LQ0A 3TFCA 1UH4A 4N4QA 3RGTA 2Y5JA 4AX7A 1QK2A 1LTDA 4RE4A 1H7PA 3RF9A 1P6CA 2OCZA 1GOMA 2Z00A 3C3NA 4LVFA 2HTMA 4ORMA 5SWUA 2BHYA 4DRSA 2DVUA 3WSUA 3CUFA 3OPSA 3R13A 2XYLA 2OQYA 3OHMB 4C1KA 1XLDA 3SRDA 4FPSA 3THAA 1XSKA 3OG3A 3Q67A 3FDKA 1T6MA 3E0WA 4AZ7A 1LCOA 1XRSA 4AIUA 1WDPA 3BXWA 4AD1A 2Y5EA 3VDBA 3NVTA 1EOMA 1XYCA 1UWUA 3KBNA 4KMQA 2OVLA 4F0LA 1TTQA 2HE8A 1Q45A 3NQGA 3WQ6A 1CXEA 5EY5A 3CH9A 3JVAA 1MXGA 3CWHA 3MUAA 4EPDC 1YTEA 2OOFA 4DJFD 3LHYA 1KBKA 1L2UA 3M07A 4CD6A 5D30A 1ZJBA 3CPUA 4X60A 4MDOA 3S1VA 1BGAA 3O63A 1MDRA 3NGFA 4DX3A 3KP0A 3DU0A 2OLAA 4X22A 3WBXA 2OO6A 4MWAA 3C86A 3BJSA 3M7WA 4IJCA 4PC8A 2YL6A 4ZTYA 4HSOA 3ZMRA 1VBHA 3W1QA 1UWAA 4OQVA 2CPUA 1XBXA 1X38A 2BTMA 3K8LA 9XIAA 1KLZA 2CETA 4GYPA 1N8WA 4JY9A 2PDCA 2ZXQA 5XINA 1KFBA 3A4WA 3KWXA 1DOSA 4ACYA 5I00A 4XBJA 3TFXA 1JJKA 3OVPA 3HF3A 3SCQA 3EX1A 4XAYA 1T5AA 3G18A 2FHBA 2GSJA 2QCFA 1Y5XA 4U5IA 1YQ2A 5I7GA 4IG2B 4MKNA 4QFUA 2J7GA 1R3TA 2D24A 3LI0A 1P0BA 2XVNA 2YFNA 1ADSA 3K5XA 2WWDA 2FB2A 1AD4A 2OT0A 1VEPA 1UWQA 4PUJA 1UCWA 2O92A 4LY8A 1F07A 5BZAA 1Q8JA 4DF2A 1HFBA 3CMFA 3AXMA 4P8XA 1JPKA 1EGVA 3HPZA 3LS9A 4NL1A 5J5RA 3W6MA 3GVRA 3WLNA 3PZQA 2CIPA 3WQ4A 3TTEA 3N12A 1F8IA 1XD0A 5HANA 2YL5A 4HCHA 4JL2A 5FF3A 1AQ0A 1OG6A 3BG3A 1AMYA 5CGMA 1SZNA 2WHMA 3ITGA 1RZMA 3STFA 3WD3A 2DFAA 2WQDA 3W1TA 3W1XA 3FAXA 1HW6A 4A3HA 5GQBA 7REQA 1O7AA 3WJYA 1AMKA 1BKHA 2FPTA 3FCPA 4ERAA 3E38A 3EX3A 2E6AA 2CU0A 1MRAA 1K8ZA 2A7PA 4KFPA 3VOJA 2ZTJA 3E74A 2WZIA 3B3DA 3RJXA 1HXJA 1UJPA 1LL4A 2PTXA 3I4KA 4YPJA 2ZXDA 4Q4OA 3LGGA 1TCMA 2X1TA 4UQAA 3I4EA 3L4UA 2ZZ5A 3PM6A 2CLHA 3KS5A 3O06A 5FL1A 1B3OA 5IBXA 4DWSA 1SFJA 3WCZA 3JZEA 3G1AA 2QJMA 1UD6A 5G4EA 4L1XA 2ATSA 2Y88A 3DGBA 5G2HA 4FIQA 3W6LA 3SUUA 3BPWA 3WLHA 3AXIA 3V4BA 2KAUC 3VX1A 4CQ9A 3OZYA 2ZX7A 4QG6A 1O12A 1TFVA 1YTKA 1S3HA 2CLMA 3AUOA 3VK5A 4HKPA 3H22A 4E6MA 3GXPA 2OQHA 2GQ3A 4XD6A 5IFPA 4IFKA 2BSLA 1MXSA 4DBWA 3PP7A 5H8PA 3FYYA 3TQPA 3K8MA 1ZY9A 4W7UA 4GIYA 1VHNA 1PB0A 2HSAA 4DNHA 3FKKA 2OEKA 4PBEA 4NZ1A 3V1HA 3CQIA 3W26A 4LSBA 3VX0A 2ZRXA 3IGXA 3L7RA 3NQAA 1H63A 3ARSA 1PTAA 2QDGA 3RU6A 4B9YA 2OZ0A 1E71M 4MDPA 5KEZA 2F6XA 4QEEA 3PJUA 3OLEA 1CGUA 4K37A 2YW4A 1HQTA 3MJMA 5FEZA 4NUWA 1RHCA 2V38A 3WD1A 2XIOA 1XR2A 4H8VA 2REQB 5AYZA 1X6UA 2ZA3A 4K7YA 2DSKA 3VMOA 4NT0A 3WD4A 5K3VA 4ZQPA 1C8QA 1MUCA 1H7WA 2G4JA 3GRIA 3TYAA 1PHQA 4BQ3A 3KE0A 3LDVA 4O1FA 3U3HA 4HHLA 4IL0A 1ZL1A 1U5HA 3KCLA 4NQ1A 4ZOAA 1Q7ZA 4QIUA 4HA3A 4AWTA 2PLJA 4J1OA 2VZTA 1BTMA 3TEVA 4Y9NA 3DXIA 4GY1A 2E6YA 3VOGA 5DBTA 4OZOA 3W37A 3OQEA 5M03A 2RH9A 5E0FA 2B0MA 5I77A 1W3IA 3WQGA 1IT7A 4Y8FA 3R58A 1VGAA 4LS1A 1BF6A 1UW9A 1G69A 4JYFA 2INZA 1IV8A 2BY1A 1LWIA 4LUSB 4DJEA 4B3LA 3NM1A 2W62A 4HYWA 1A5LC 1N2VA 5F2MA 4DJFC 3ELFA 1HNYA 3ALFA 2Z27A 5A8NA 2NQHA 4HU3A 1XM3A 8XIMA 2H6RA 3IGSA 3GNPA 3CB3A 2OO0A 4PYSA 2RFGA 3I3BA 3PBUA 2EKGA 4O11A 4PMYA 3TU9A 3W01A 3DG6A 4F8XA 2BP1A 4ZE5A 5J5DA 1V7YA 3NAVA 3TYBA 3MDWA 2D2JA 3A21A 2P10A 1FWFC 2GLKA 3DC8A 3W2MA 1HL2A 1XCFA 1KM5A 5AC6A 3TC6A 1FWTA 3FYOA 2VELA 4PMRA 3EWZA 1XC4A 5CJMA 5LA1A 3KBSA 2WZTA 2YB4A 3V1PA 4BWLA 6REQB 1MYRA 3B0UX 1CIUA 4NI3A 3N4AA 5DCDA 2OFJA 4TVUA 4GLEA 3KDNA 2YDAA 4IQLA 3B4YA 1HT6A 1QWKA 3GBEA 4RE2A 1ZU8A 1Q65A 4EWJA 4F9DA 2BNJA 4PTMA 1OGBA 3MO7A 2BASA 1YPFA 1NWRA 3PNZA 2ABBA 3M0YA 2Y6ZA 3MC5A 1VPYA 4PTXA 2VZSA 2EPMX 4FOJA 3C0SA 3SUWA 1UR2A 3TQVA 2H8ZA 3NDYA 4PMZA 4B9ZA 4GO9A 2RGMA 2CFFA 4QSFA 2IPFA 5D05A 1F6YA 1Q6OA 5FF7A 3W24A 1CGVA 3HQ1A 4KFOA 4XAGA 3FXGA 4NILA 4Q8MA 3VE7A 4URIA 4YHEA 1VEOA 3TX9A 1HJWA 3SY5A 3ES8A 1AD1A 3LD5A 1IT8A 2X2YA 2Z1WA 4O1AA 3DUGA 4PE8A 4B3KA 9CGTA 1ECEA 4M5PA 4QS6A 2GVJA 3BLFA 2FGZA 1A3XA 3ZSSA 3BAKA 4W89A 1EH9A 5CZKA 1FOBA 1QNOA 1V3HA 3G77A 3LY0A 3VVGA 4O17A 3AYVA 1VFTA 3MHFA 3RG6A 4KH2A 3IJ6A 4UC5A 1QI5A 3PUEA 5EBAA 3IIPA 4GUIA 1KFEA 1V7AA 1YADA 5HJYA 4S3FA 3WBWA 2XGBA 1KC7A 4UFHA 1B9ZA 3TOPA 3STPA 4I5XA 3QQ0A 3QZ6A 4HU0A 1XBZA 4ZODA 4LPCA 3QY8A 4IXHA 2PCEA 3EWBX 4LEQA 5A2AA 3H4XA 5GJMA 1S2AA 4MM1A 1XLCA 3CQHA 3VNDA 3H2NA 1JZ3A 4U4MA 1DJIA 4JNYA 4UIOA 3KOXA 1CGYA 3WZ0E 3A22A 3E6EA 3LM3A 5C7VA 2D23A 4PTDA 3SRFA 1CB7B 1NF7A 2F61A 2Y8KA 4LVBA 4GD0A 1R38A 4ES4A 4F2UA 1I1WA 2PMQA 1J01A 3OW1A 2QJNA 3IUDA 4AU0A 3W7GA 3QFEA 4C6PA 1HJUA 2FZDA 3B8WA 2QLYA 4UQCA 3TMLA 3N6JA 5AZ1A 4G8TA 3KM8A 3BLEA 3UT0A 3M9YA 4A29A 4C6JA 3S2MA 3HPXA 4GYJA 2W6RA 3TCEA 2ZX9A 1E43A 2Z7GA 3ORWA 1NOUA 2D0GA 1FCUA 4BHYA 1OYCA 1RUSA 2EQDA 3PZOA 3S5YA 3R11A 1UIOA 1UMYA 4O4VA 3ABXA 3KL5A 3P60A 3SQSA 3IVSA 4RUBA 3BK0A 3VOFA 1XKJA 1FCQA 4BI6A 4GIRA 4LS0A 4EK7A 2PDPA 1F8MA 4Q4KA 3ICJA 1VYSX 4I90A 3R8RA 4A05A 3ZT7A 3UY8A 5L9FA 4D6GA 1YKWA 2V67A 2ZICA 3OA3A 4X63A 2JQXA 4GYKA 3TA9A 3UG5A 4HN8A 3EAUA 5JH2A 1XSJA 4J3VA 1W1VA 4LB3A 6ENLA 4Z42C 4ZQNA 3CZEA 4A35A 5I3KA 2LLEA 1XI3A 2Y5SA 4Q8UA 1IZKA 1JR1A 4KWVA 5JXQA 4E2VA 4W5ZA 4AW7A 3AS1A 3VIMA 2G95A 3P0XA 2QV5A 3H7VA 4CQAA 3KS6A 1DTNA 2X8RA 1C29A 1E9YB 4XB3A 4L1WA 3G1FA 4UQEA 4PUMA 2J77A 4NJKA 3XISA 1GKQA 3CAVA 2O4MA 2VDIA 1B1YA 1H5YA 4ZB5A 1UR4A 1E73M 5AC4A 3V75A 3UGVA 2A3BA 5DLCA 3CAKA 3T2OA 1Z44A 2WHLA 1GYLA 4JFTA 2UBPC 4ORIA 1D7KA 3B4UA 3ARYA 3MKCA 4ZXOA 2WBKA 4PH6A 5CSUA 3POHA 4HYRA 3LHWA 4MJZA 4BZYA 4PB4A 1TWSA 2J9ZA 4HBKA 5FEXA 5HATA 2YXGA 2ZUWA 4LNYA 3OU8A 4WXZA 1A5BA 4GPNA 4C1NB 4R7OA 3GR7A 1I2PA 3RITA 3A3XA 1KRCC 1R6WA 3ZOAA 1MO0A 3V18A 5LIYX 3EWDA 4C6MA 3GLCA 4D6IA 2VEPA 5HNRA 2J7BA 1FWCC 4ZOEA 1P1MA 3IIVA 1WDDA 1VP5A 4ZO9A 1W3NA 4S3EA 3HPAA 3VMNA 1F9CA 4NY2A 3T7VA 1E1EA 3I6EA 5LHFA 6XIAA 1G4EA 5HXMA 3UGRA 4QHRA 3AI0A 4JIIX 4C7FA 3SRKA 2FJUB 1MUWA 5D9MA 2O9TA 1UBSA 4AWUA 2ISDA 4JL1A 3HZ3A 5HAOA 2CZ5A 3ZVIA 4LAUA 3GS6A 1O5QA 1RJPA 1DWIM 3K1GA 3PG8A 3VE9A 3VDGA 1OC6A 1A0EA 3RO6A 3NZGA 1TIWA 3T2PA 2YCJA 4D72A 3FKRA 2QUMA 1MZRA 4XSLA 1D7FA 1W1ZA 3GC4A 3GDBA 5AOUA 5M2FX 5K9XA 3UA3A 4AD4A 1HJSA 4Y6GA 1PIGA 4IH3A 1B9BA 2QEZA 4UQ9A 3VNMA 3U2ZA 1ZENA 4H6RA 1WUFA 1P48A 2QCDA 1V3IA 4M51A 1EDQA 5G1MA 2AL2B 1M7OA 1KO0A 3BGJA 1OFRA 4PA8A 3UPMA 3VAVA 3NA8A 1XLEA 4PMDA 5J8LA 3NSMA 2CCRA 1SU5A 1VIZA 1MI3A 3WUFA 1E56A 4LYRA 3KOFA 5HDRA 4QEHA 2EXOA 1LM1A 3C2YA 3VDHA 1U22A 3NYZA 2VX5A 2WSYA 1A5MC 2PWVA 1QPQA 5TAOA 7A3HA 2XZ9A 3O2LA 3B0VC 4OWGA 3N34A 2HNHA 3OQ8A 5T9BG 3MMUA 1BD0A 2PDJA 1XWYA 3FXYA 3JZUA 1GVSA 3GDTA 3A23A 3RX2A 3CPGA 3GU9A 2PZ0A 2NV1A 3TLQA 4IMEA 2CWXA 3C6CA 1UASA 1EQPA 1FXQA 5C54A 5CBJA 3IPWA 4KWSA 2X16A 4LVGA 3KOYA 2Z25A 1NQKA 4IHCA 3OLGA 4TXEA 5CKSA 1NJJA 1Z32X 2NUWA 3KDOA 3IUHA 1UD2A 4LC8A 3WLJA 2FLIA 3G5EA 4M7TA 1HG3A 3BO9A 3KTSA 3KL3A 4J2MA 4F48A 3UYCA 4MFEA 2BZNA 1Y0EA 1J2BA 4W5UA 5I3DA 3W4RA 3W84A 4NJIA 3B9AA 2JIEA 4CQ8A 3EDKA 3B03A 4CN6A 3WO8A 5E93A 4TX6A 4C6EA 3TYZA 3P8IA 5EFDA 1EQCA 4S3GA 4DPPA 1ISVA 3MANA 4QITA 2ZDSA 1JPMA 1TYGA 4ZOCA 4HHMA 5GNXA 4DF1A 3WF3A 5LIXX 3S5ZA 4KW2A 2A7NA 2PDLA 1RP9A 5F7UA 3XIMA 1JGMA 5LGZA 1Q3NA 4ERGA 4JTHA 5I3GA 4HHPA 2VZVA 5AB3A 2QCGA 2WBGA 2OSYA 2D2GA 1QNPA 4NVTA 1YNPA 1R30A 2BVDA 3EWWA 3VIPA 1Z7AA 5KTLA 4N6FA 1ZHAA 2QUNA 3PZIA 1TV2A 3WLRA 3WFZA 1GG1A 3T05A 4AX6A 3DC0A 1KBJA 2PDYA 3UZXA 5JMUA 3KRBA 3NPVA 5BU9A 2ADAA 1X39A 3WY1A 1UB3A 3SADA 3MBFA 3WK3A 3GVQA 1VD6A 2VRJA 4K8HA 4AWSA 2C0HA 1HKJA 3PBWA 2Y24A 4MTVA 1X6LA 3W02A 3W7OA 3LLFA 3V36A 4J3UA 1W3TA 4H9ZA 4DF0A 4N0RA 2GK1A 4NNBA 2SFPA 3GFYA 4FHAA 3AMLA 1AODA 1EXBA 4W8AA 3VGFA 1SMAA 3ZR5A 2ZA2A 3QY6A 1X8CA 5CZ0A 1W9BM 4BJHA 2A3AA 4CCDA 4FAMA 1V6XA 2MUCA 1S3TC 2BY0A 4GXWA 3CMJA 3IAPA 3W7DA 3WMCA 4XD5A 1RY0A 4ONVA 2QXWA 4IX2A 3OB8A 4JTGA 4JKKA 2A3HA 1QASA 3R4IA 3E02A 1TVNA 5F1UA 3KOWA 1V8EA 3KRZA 3CNYA 3LRMA 3UZZA 3UD6A 4MG4A 3K8KA 2RKXA 2WM1A 3URQA 2RDUA 4QCEA 3A3HA 2VURA 1XYFA 1ISXA 3LERA 2HQAA 2ZFAA 1UKPA 1PZ0A 1J9YA 1W1IE 1WOAA 3QOMA 1ODZA 3KVLA 3SFKA 4D8ZA 1OCBA 2VFIA 3GG0A 1H1NA 3E5PA 1K77A 1POKA 2DZBA 3M0IA 1DWHM 5A6JA 1L8NA 1W37A 3M64A 3N13A 4YS1A 4UFJA 2J8FA 3M6DA 1M68A 4NXKA 1IIHA 3DFSA 4GH1A 4WGHA 2ZUVA 2VC6A 2F2HA 2J7EA 2BOEX 4MHBA 3EKGA 4Z2JA 2W5FA 2C15A 2VOTA 4J3ZA 2R14A 5FJRA 4Q4RA 4QJ4B 4ATWA 1OFPA 4KFNA 1G0CA 2FMNA 3ANYA 9XIMA 1W0MA 4JY8A 4MIMA 2VWSA 3DCPA 3EPNA 4Q22A 2DZSA 3H6OA 2GUUA 4IMFA 2D20A 3FJ6A 3UZWA 2Z2UA 1W5QA 1V77A 1V0LA 3DFNA 1WKYA 1Y5WA 5F4WA 3G8RA 1HJXA 3AHYA 3PSWA 3T0BA 1DIOA 1KFWA 4P5UA 2QJJA 3OLDA 1US0A 4NZJA 4V1XA 4QAWA 3G1VA 4CLMA 1D9EA 2DDXA 5F4XA 3EA1A 1TG7A 3SN1A 5DRIA 3R10A 2CYGA 4FLSA 4K2SA 1LOQA 3QOKA 4EVZA 1M1BA 1MEHA 4CU7A 3P62A 1XRFA 2HK1A 1MEIA 2G3JA 2BV9A 3R6IA 4S38A 4BQ4A 3MTWA 1B4KA 3VMPA 4E2DA 3M7SA 4RKAA 3Q2DA 4J3WA 4ZQRA 1TPB1 4YYCA 2XIJA 2P8CA 4HMCA 1M9HA 1M7XA 3UJRA 3CHFA 2CLKA 1JYNA 4KQNA 3CU2A 4E4FA 3CXOA 1OYBA 5H2ZA 3N2TA 5LYRA 1Q7MA 1RQEA 3FOKA 3S6TA 1FXPA 4C7DA 1JZ6A 1C8XA 5HR6A 2QW5A 4LH8A 4LF1A 3GXNA 1ZSXA 3B40A 4QLJA 4MPQA 3UR7A 1GW9A 4WKHA 3IGHX 3E2RA 3SW6A 3DERA 3TC7A 4UWMA 1XP3A 4CD7A 5KZDA 5HWNA 2ZCGA 5A6SA 4NNAA 4CCZA 1OT1A 5REQA 4C6CA 1RLCL 3OVGA 2VKZG 2CXGA 1A5AA 2PWDA 2X41A 4P8VA 4ILSA 3RLUA 2WB5A 4AMCA 1E5NA 1GJWA 3T40A 3PJXA 2HXUA 3EEZA 2P76A 2WVTA 4Z2LA 3FVDA 5CBBA 1DIKA 1X7IA 5EPDA 3GTNA 3WG6A 1NVMA 4KEMA 1NFBA 1LRNA 2FVMA 1WDSA 3B0YA 1OFDA 1KFKA 1EC7A 2WVSA 2PWHA 3DFQA 2D3NA 3EX6A 3W7MA 1JVNA 5RUBA 2AKMA 3GTHA 3UZYA 1BWKA 5XIAA 2DZTA 4AY8A 2XJ7A 2QIWA 1SO3A 5PTDA 3SN4A 4GH3A 1YDNA 3CIVA 1A0DA 5A6BD 3SZ8A 2NQJA 2YCLB 3P7YA 4K8GA 1AH4A 4Z17A 3CPRA 1PVNA 2VGIA 1XYMA 4XKYB 2D2HA 1J5TA 1TTIA 3N29A 5FJJA 1W9PA 2EPHA 1FWRA 1BSLA 3GVWA 4XZLX 4FNQA 1QI3A 1D8WA 4LRTA 4TMCA 2OEJA 1G7UA 1J93A 2EPLX 4O28A 1VIWA 4MJ4A 1QOQA 4RE3A 3VABA 3ISIX 4R5EA 5D8ZA 3A4XA 2ACRA 4LTSA 2CW6A 1X97A 2ONEA 3KVMA 1EB3A 4XV0A 2WKJA 2NT1A 3WQVA 3RUBL 1ISYA 1B54A 4O13A 4ML4A 1G6CA 3P74A 1XF0A 7XIMA 3GNDA 4AG0A 3AZSA 3OLIA 2WHKA 3O6AA 3ARQA 1G4PA 3KVKA 1KXVA 2PGFA 3UWWA 5DF0A 4O15A 3WIJA 1JUKA 4MADA 4IZGA 1EEPA 3LV6A 3P5ZA 3LXCA 2IKGA 1IIGA 3CGTA 4B15A 3WNLA 5LNVA 3CO8A 4ICNA 2V8ZA 1RVGA 4YTTA 1UP2A 1WKDA 3H12A 2HBXA 4RDWA 1QTWA 3VKJA 5C6MA 4D8LA 4I5UA 1MQPA 3QKEA 3LSCA 3PSVA 1CB2A 3BGGA 3CB8A 3OA5A 4FF5A 1E6RA 4LGXA 1A49A 3UWUA 3TTOA 3WDRA 2GVYA 3N2OA 1TRDA 4LBRA 1W1B1 3COTA 3SFWA 4GI4A 3Q58A 2ZUNA 3BZJA 3IRSA 2FVKA 4QISA 3S1GA 1FWAC 5CC7A 4L6OA 2FHFA 4PZVA 3CHCA 1BG9A 3E2SA 1OJXA 1OX4B 3GTIA 5D37A 2DP3A 4S3JA 1C3FA 2R9RA 4IG2A 3TZFA 2P0IA 3T81A 3ID7A 2BY2A 3ZJKA 4N4PA 4CNOA 3ABOA 1XYBA 4MYAA 1EGZA 4ZCWA 5CH9A 2W67A 1KCLA 4OUEA 4ATLA 1GPWA 2TSYA 1I6NA 4YU1A 5KZEA 4WXYA 3GZ3A 4FNPA 1R3VA 3BUVA 4QBXA 5C9XA 3NQDA 2FZBA 1XYLA 4RR4A 3ARTA 1Z48A 2XIQA 3EOEA 3W1NA 1KRMA 3VIFA 1V6VA 1HP4A 4GX8A 4I8DA 3U2EA 4FZIA 2ACUA 3FJNA 5BRBA 4IFKB 2XIIA 1WV2A 4RL3A 3WNPA 4IIFA 3WFLA 1YNYA 2PGEA 3PBGA 2EJAA 5DX7A 4HNLA 4JPGA 4F0SA 4MVAA 4MYXA 1Z41A 1PKYA 3I68A 4XAZA 2PDGA 4IP5A 3FHAA 2JEQA 4DJDA 1UD5A 2YZ5A 2X0YA 4GNJA 3GHSA 2RDTA 4LB4A 1O5KA 3AS3A 3G22A 4GY0A 4HNTA 1UQZA 4I9MA 1XLKA 3NNTA 3QY7A 3E49A 3L4ZA 1QI2A 2C1GA 3WQDA 2CBIA 5FF2A 5CPNA 4MWAD 1JUEA 3CC1A 4WEVX 3W86A 4L6DA 3T4CA 4B2DA 2A85A 4L61A 1R3YA 2QDDA 2CXEA 1VFMA 4KRZA 1O66A 4AHOA 1TA3B 3PS7A 4ENLA 5FJTA 2IKHA 3CV6A 2Y61A 5KZ6A 4LUTA 3N73A 1CLXA 4PTVA 5A6MA 3AALA 2YB1A 4GQ0A 1WAUA 5BOFA 4G7FA 3BMXA 2XINA 2DQXA 3E0IA 2W0UA 2QJGA 2EPOA 2GGJA 3HN3A 5A95A 1TMHA 1OK6A 2VC9A 3WF0A 2OZ8A 4GJJA 3LCIA 3LG3A 1U1UA 5HJXA 1IGWA 3AIUA 1RBAA 4Q8WA 1KR0A 2NWRA 4KESA 3LZ3A 1IXNA 2OXNA 4H9UA 2WLYA 1Q7QA 1JULA 1WCGA 3CO4A 4C6IA 3N2BA 3RMJA 1V0MA 1ZFJA 2CKSA 4IM4A 1V6UA 1FH7A 4R34A 4JYDA 2E9LA 2ZADA 4JTLA 1ITXA 1LWJA 4O1EA 1ZNNA 4HPJA 3C8FA 4G1KA 2GUBA 1T96A 2REQA 4YHGA 4TQTA 5I23A 1LORA 3HG5A 2TYSA 2HBVA 1KRBC 2YGYA 1WZLA 4GISA 2VENA 2YBVA 1FHVA 2GJLA 1D2KA 4JKMA 3TH6A 1KV8A 4U2YA 1SSGA 4PTNA 1EHAA 4LAZA 1KR1A 1BF2A 1SR0A 2C19A 3L66A 3WBAA 3UJSA 3FNDA 4Q32A 2R1KA 3OYXA 2WV8A 3PWAA 3LGDA 4DLMA 2NX9A 2GWGA 1UWSA 4IGNA 1UZ1A 3VILA 4O10A 4BI5A 4CNPA 1TWIA 2AAMA 5FJIA 5D38A 4GO8A 5DRCA 3S2NA 2FPVA 5AECA 4FLRA 1GKRA 4DWSD 4UOQA 4UCGA 3KBWA 4JR5A 3VUPA 3PBVA 1GYNA 2HE5A 2R24A 3F5JA 5TQLA 4AEEA 4AIEA 2J4GA 4A6GA 4LUSA 1XQKA 5HUOA 2R8WA 4L6HA 3NZRA 3CQ0A 5DT5A 2A21A 4AY7A 1ZGDA 5I06A 1KBBA 3N2CA 3ATYA 5EBUA 2I7GA 1FDJA 3DOPA 1VENA 4DXVA 1LLOA 1G1YA 2QIIA 1XCWA 4MB4A 5EB8A 1KM1A 1NOWA 1TE1A 2QZRA 4UTUA 1ONRA 4JAWA 4R7JA 4HZ8A 3DIPA 2R6OA 4S3BA 4C6BA 1UR8A 1B3ZA 2AKZA 3R43A 4H00A 1I0BA 1JCMP 4UTTA 3OGVA 4LF2A 4PUWA 1EGMA 3TN6A 3QEZA 3U8GA 2WMKA 2E09A 1A53A 3JU2A 5CSSA 2X0SA 3G0UA 2G3NA 4LNCA 2E6DA 2QHAA 3LGEA 5DQPA 3TZNA 5C2CA 1QO5A 1JPDX 2ZVIA 1GZJA 3B8VA 1TX2A 3ZIZA 4I7VA 2DT3A 3NYDA 6REQA 3R8HA 1A5SA 4Q6JA 3EZ4A 6PTDA 1CZ1A 1M03A 3T09A 2PDHA 3WK1A 2X1RA 4Z2GA 4GHRA 3QPYA 1R47A 3LM7A 4A3RA 3NQFA 1WA3A 3VZXA 4H9VA 3LLXA 2DEPA 5HWJA 7ODCA 4IP4A 3EOOA 4IFRA 1RJQA 3WJWA 1HL8A 3O0FA 1E1CA 1E3ZA 3QR0A 1HKWA 4JXCA 1AL7A 2OQLA 1PBGA 3PPGA 2C3ZA 4S23A 4AFYA 4CNNA 3IEBA 4HZ6A 5LIKX 2D1ZA 4UXDA 5I3FA 1YTDA 4B4HA 4GJ1A 1DWAM 4AEFA 4X2RA 2QJIA 5HINA 2PRLA 4QJ3B 5BCAA 2FGBA 3MS8A 3CQJA 1JEZA 3ZJ6A 5CSYA 1T41A 1NTHA 3TKFA 4Q8QA 2E5BA 3EGJA 4LYKA 4QNEA 4TV6A 4DO5A 1TJ2A 3OVQA 4O8RA 5E9AA 4TTUA 3V3WA 5CPOA 3RO8A 2ISSA 1CCWB 1L0PA 3WQ5A 3ENLA 5GJPA 2QF7A 2J8TA 3GWQA 4JHOA 1N8IA 3NPUA 2E25A 4GZJA 3MW7A 1O95A 4UTMA 4HNOA 2V6AA 4GYPC 2VQTA 4IGHA 1BRLB 3B9DA 3SN0A 5JIPA 3TUUA 4NASA 4MNMA 4JX5A 5JIWA 3NZPA 1G5AA 3WJSA 3D3FA 1IWPA 2WNWA 3IAQA 2WXDM 3TJIA 1YDOA 1XINA 4NZ5A 4IT1A 4EXBA 1HKIA 4JIHA 4H9MA 3IJ9A 2WO5A 3TSBA 2WC4A 1Q8AA 3REQB 4WSHA 3TXVA 2Y70A 3CUZA 1PDYA 3AU2A 1J11A 3NTYA 4GWEA 1FCVA 1ZUAX 2Y2WA 4FMVA 3G3MA 4HK6A 4TX9A 1S2CA 2ODOA 4M6VA 3GHRA 2NLIA 4W84A 1UUOA 2ZZ4A 4FSAA 1RR2A 4Z2KA 3PBMA 3EOLA 3M0MA 4S1FA 5CQ1A 3CV2A 4RW3A 1VZWA 3FIGA 4DBSA 1AFSA 4XZ9A 3EWCA 3RX4A 3G1HA 3GHTA 1HUVA 2FDMA 2ACSA 1DHKA 5CJ5A 4GRSA 3LCXA 5D9OA 4U31A 4DZIA 4AVNA 4ASTA 4HCDA 1W2VA 3P0WA 4PBGA 2WKGA 4JYEA 4GI8A 4AZIA 1R9ZA 1V3KA 1W2PA 4POCA 4L9ZA 1DXIA 1UPMB 4PRTA 1XC6A 4AZHA 4BA0A 4PULA 1H41A 1DWFM 3CT2A 3G1RA 1R87A 1J0JA 1VCGA 2C7FA 3GR8A 3EA2A 2XFFA 2PFHA 1DTUA 3FYPA 1ZCOA 1IEVA 3PG9A 3AHVA 4LU0A 2ZXAA 1CXKA 4IMCA 3P61A 3DHUA 2MNRA 3NQBA 1F61A 5CC6A 4NRRA 2X1IA 3G3DA 5IBXC 2GQAA 1IZJA 4IMGA 4MZ1A 4L64A 2IQDA 2P53A 2VL4A 2WJFA 4EXAA 2ZX5A 3ZZ1A 1I2QA 3BLDA 1RH9A 3N6HA 4Y9MA 2FZ9A 2GVEA 3KX6A 4LV4A 1DJHA 2BG5A 1Q6LA 2EKCA 3GXDA 2OB3A 3DBNA 4W87A 1RPKA 5BNKA 4O16A 4DQWA 1H4PA 3WQEA 1K9FA 4N02A 3FA4A 4XD4A 3ONCA 2PDQA 1XYZA 3GXTA 3L2MA 4A8IA 4MNLA 3W7PA 5EYWA 1TV8A 3AHXA 1P0NA 1RV8A 5I07A 4W8LA 4O12A 1KNWA 3CK5A 3AIVA 3AHTA 3V5FA 2WNZA 3GDMA 1DJQA 4GNVA 3N25A 4JTSA 3BDKA 4MNKA 3E1F1 1WUEA 4PUUA 3THUA 2E8YA 4UOZA 3L2LA 3WUEA 4C1NA 2ZUMA 1OQFA 4O50A 4BQ2A 4YTUA 3S1UA 1HTIA 1OF6A 3B0XA 4L4OA 3TP4A 1OINA 3F4NA 1K1DA 2Z6JA 2F7FA 4ROPA 3DGRA 3T0AA 1V08A 4DAFA 3SQMA 5FJPA 1REQB 2QCDB 5I3JA 2DSVA 2WSPA 2BXYA 2J6XA 4IGSA 2F84A 4M24A 3RCMA 5AYYA 4HZMA 2EG7A 1WZKA 3UR2A 1F4AA 1KKOA 1E0VA 4LYQA 3NDOA 1N82A 3BJFA 4LCRA 1PCWA 2OGYA 1F74A 4IICA 3SSZA 4KRTA 1AZ2A 5AYIA 1WZMA 4GBDA 3GG8A 1EJ7L 1R85A 3SGGA 4AH7A 1J96A 1HZYA 4QG8A 1AH0A 1EZWA 1R3QA 4DJEC 1W9DM 3MCNA 4WZHA 1WXJA 4LS2A 2QYGA 4GGBA 1GT8A 1MW1A 5F2GA 4HK7A 3PJTA 1P0KA 4IUOA 4UNKA 5LNUA 2DIJA 2CESA 3B8SA 4XZNX 3A6OA 2E77A 3OYZA