1OCQA

Complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution with cellobio-derived isofagomine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct Observation of the Protonation State of an Imino Sugar Glycosidase Inhibitor Upon Binding
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2003-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ocqA00
1XGZA 1WNOA 4MADA 5IXEA 3BAJA 2XHYA 1BHGA 2D23A 1J10A 2X8RA 4D72A 5HNNA 3EMZA 3K46A 2VX6A 4RE2A 3ARSA 1MXDA 3UG3A 4MNJA 1BLIA 1TUXA 3II1A 2B31A 4CD7A 3AS0A 4W86A 1GOMA 2WPGA 3WMBA 1QI2A 1TA3B 5TD4A 1MQQA 4MB3A 2YA2A 5GNXA 1AQ0A 4IISA 1H1NA 5A69A 1TA3A 4M8UA 5A6KA 4UTFA 4CU6A 3MKKA 5HDRA 1D3CA 3GH4A 1I75A 4PMQA 2AOSA 3WEMA 4HA1A 1E56A 3UR7A 8A3HA 1UQYA 2AMGA 4XZBA 2X05A 2E40A 1V6VA 4CD4A 2VL4A 1UR1A 1PBGA 4AWEA 4K68A 2YBTA 4NZCA 5A6MA 3DYMA 2D0HA 1LG2A 4QLKA 2QPSA 4P7RA 2WZEA 4UOZA 1CXEA 5A8QA 4GINA 1HF6A 4BQ5A 4A3YA 1AQHA 3KL3A 1EOMA 1XH0A 2Y4SA 3AMGA 3WMSA 3OA5A 2OYLA 4XUYA 1C93A 1PPIA 3ARYA 4M24A 2V3FA 3OGVA 3WQVA 2BY2A 4AD4A 1MW2A 4UZUA 3UESA 3IK2A 4V2XA 2V3DA 2CIPA 1E6SM 3HJEA 3EDEA 1C92A 3D3AA 4HMDA 3U5YA 2YDQA 3NSXA 1C7SA 3BSHA 1QI5A 1WCGA 1ECEA 4JHOA 1BYCA 2XFFA 1RH9A 4AXNA 1H41A 1V0MA 4EE9A 3GXFA 2WC4A 1GNXA 1HL8A 2UWFA 3L4XA 2WVVA 3GYCA 2CERA 3DC0A 5A94A 3VUPA 5CZKA 3NYDA 4DWSB 5HPOA 4BQ4A 2VO5A 1W2VA 2CPUA 5IFTA 3BAXA 1C7TA 3NDZA 4HZ6A 1LWHA 2EJ1A 1R8LA 4U3AA 1FFRA 3LPFA 4UOQA 3RJYA 1XRVA 4JFUA 3L4YA 1JAKA 4E4PA 2VUYA 1C3FA 3WL0A 3ARUA 3WD3A 1GOQA 4W8BA 4EANA 1FFQA 2W67A 1UR8A 3MV11 3THCA 2NT1A 2XVGA 1BPLB 2XJ7A 3BCFA 1S46A 4CCCA 5DEZA 2J74A 3VIMA 2WVVB 4HZ8A 1EIBA 2ZXDA 5FOOA 1J0JA 1PIFA 2XM1A 3WNMA 2NW0A 3WQ8A 1F4AA 2X0HA 1HJQA 1P6WA 3POHA 2ZUUA 5BXSA 5D9OA 4BF7A 3VGEA 3KL0A 4XZWA 1B31A 5C70A 5EB8A 1CEOA 1UKOA 1DWIM 2D0GA 1B3XA 3VIGA 2Y8KA 2EPMX 2VOTA 4TUFA 3W27A 4OKDA 5C8BB 1GQIA 2E0PA 1KXQA 3L4UA 3OB8A 1VEMA 4AIUA 1VEPA 1LL6A 1Q4NX 4OBSA 1EDGA 1IV8A 1TG7A 3QGVA 4AZIA 2J62A 3BH4A 2BHUA 1JG9A 1UUQA 4WKAA 4MNKA 3WQ6A 1O7AA 2YLLA 2EPOA 1GVYA 1UD3A 4HOZA 3N1AA 4WJXA 2FDMA 1ITCA 4N42A 3S2CA 3QHNA 3SCQA 4GZJA 2W92A 5M3WA 4L4PA 1WDRA 2O9RA 4W84A 4CN1A 2ZX7A 2J7EA 1A47A 4UFMA 2W5FA 3L2MA 3IJ8A 4EK7A 3AI0A 4YHEA 2DGAA 4U2YA 3VIOA 3FXYA 3SCNA 2EPNA 4J7RA 4OIFA 5KZ6A 2YL9A 2G3NA 1J9YA 2NT0A 3VGHA 5M5DA 3WUFA 3A47A 3VGDA 3N04A 4JIEA 3T2PA 2Y5EA 1VF8A 3CHEA 1R87A 1V6UA 1HXJA 1BQCA 3WQ4A 1BYDA 4WSKA 3APGA 3RIKA 1EA9C 1UQZA 3TOPA 2WC3A 4PMRA 4KWUA 3EDDA 2OSXA 4IM4A 3CHCA 4C7FA 4AISA 3AIEA 2IUZA 1G1YA 3VPLA 3PZQA 1QPKA 4M82A 1CECA 3SCSA 1XYFA 3HU7A 3WH8A 1B1YA 1VFOA 4JFVA 3AOFA 4AIEA 1J18A 4KH2A 5D9NA 1VFUA 1ISZA 4JCMA 3ALGA 1EXPA 2ZXBA 1UKSA 3T08A 1XD0A 2XVNA 4Z2GA 5LA0A 2ZX8A 1AQMA 2XM2A 4HMEA 4ZE5A 4DUVA 1NOWA 1BFNA 2PWGA 2GSJA 4Q22A 3SUSA 2J77A 3WD0A 3KEHA 4JKLA 4HOWA 4AD2A 2WAGA 2YLAA 2UY5A 4UQ9A 4AY1A 5ABEA 1LF1A 3WBEA 2ZUVA 4TVCA 1E0XA 1BTCA 2VZOA 1Q6DA 2FGZA 3WD1A 4A4AA 3KL5A 4CU7A 1WZMA 1H4PA 4F79A 4GQRA 1UWSA 2OWXA 3RJXA 3DHPA 1NP2A 2CKRA 2GJXA 9CGTA 3WUGA 3ZT7A 3WDIA 3F5JA 1WKYA 2ZIDA 4J3UA 2C7FA 3M07A 2D24A 3W26A 1JDDA 4HA4A 3WQ5A 2XIIA 2CEQA 2IXVA 5D4YA 2Q8XA 2QF8A 1WZAA 4QP0A 4D6DA 6CGTA 1C8YA 4GZEA 2X09A 3OGRA 4IUGA 5EMYA 1UD4A 1UH3A 2Z1SA 3AROA 5EFDA 2BS9A 5CGMA 4JCLA 1QNRA 2TAAA 2XUCA 1X6LA 2J7GA 3UR8A 3GH5A 4UQEA 1U2YA 1M7XA 1XSKA 2WCSA 3TTQA 3ARVA 1C8XA 1V0KA 1XSIA 5E6ZA 3SUUA 1FP8A 5AYBA 2WMKA 2CBJA 3UG5A 3ZSSA 1W9PA 1DWHM 1V02A 5I2UA 4HOXA 2D3NA 1US2A 5CPQA 1NOUA 1NWRA 1CENA 2VNCA 2WVSA 1FHDA 3SCWA 1L8NA 5I23A 2YDSA 3O6AA 4JAWA 2X2YA 5A6LA 4UNIA 3CUFA 3RO8A 3W38A 2GJPA 1WP6A 4W5UA 3KZSA 3WKZA 3B8SA 2VX4A 3PTKA 3EMCA 5A6BA 1YHTA 3PTMA 1QNOA 1JXKA 3F5LA 4AZ7A 1MW1A 2WYSA 4PMVA 1K6AA 3MV01 1E5JA 1X6NA 1JYVA 3WDRA 3A3HA 2ZX6A 5FL1A 2J8GA 1E15A 5EBAA 4AD5A 1GZJA 1JZ8A 3VX1A 2PWDA 1GW1A 2ZOXA 4PYSA 1UKTA 1E55A 1KQYA 3N15A 5FIPA 3GNRA 3A6OA 2VZTA 2AAAA 3W37A 1QI0A 3VIHA 2FHCA 3GNOA 2MANA 2D22A 4UQCA 5A6JA 1K9FA 1RP8A 3WNLA 1FH8A 3MU7A 1GOOA 3BC9A 3G6LA 2PBGA 1HP4A 4TX6A 1QHPA 1VJSA 4TTGA 2VCAA 1VB9A 5KEZA 2W62A 3W82A 4PTXA 4QCFA 1V3LA 1ODUA 5LA2A 2DPEA 5E09A 3PZNA 3AIRA 4BQ3A 4W8AA 2GDUA 4QAWA 1UKQA 1KXVA 2WLZA 3O9NA 1TMQA 2A3EA 5JBDA 1LQ0A 4GZIA 4Z2LA 4UFLA 3ARTA 3JUGA 1W3KA 3VIFA 5D8ZA 5HXMA 3MSGA 2XSAA 4OOUA 3WH7A 4P7LA 1QNQA 5E70A 2YKKA 1J12A 3BMWA 3ZR5A 2VCBA 4HU0A 1E5NA 2JEQA 2PB1A 3FNDA 2CCRA 4J3SA 3THDA 3WF1A 5C71A 1NWUA 1ODZA 2PI6A 1QI3A 3WY1A 1E3XA 1MVYA 2XYLA 1HVXA 5FD0A 4LYQA 3ECQA 2IXUA 1E9LA 2WBGA 2XGBA 4AD3A 1HKIA 1V03A 2D2OA 1E4IA 2CBVA 3EYPA 4UFJA 3MMDA 4AEEA 1XSJA 3ZT6A 4W7WA 1QHZA 2YL6A 1B3VA 3BXWA 1NARA 2WWCA 3N18A 3T0DA 5IDIA 3AS1A 1E6XM 4U31A 4LX4A 4J3TA 4PN2A 2DH2A 4D6JA 4Z2KA 4HPHA 4J3VA 4FMVA 2J7HA 2FHFA 1E4MM 2J4GA 2FHBA 3TTYA 3BMVA 1H11A 1WDQA 4X0VA 1WB0A 2XFYA 1GPFA 4AZGA 3VD4A 2GK1A 1LLOA 3B9EA 3UG4A 4WIWA 4ZXLA 3RPMA 2YA0A 4M56A 2D3LA 1KGUA 2QLYA 3L4VA 5CG0A 4U5IA 1Q6GA 3DHUA 1KCLA 4UR9A 4F8XA 3FAWA 1CXKA 3GZAA 4Z2HA 2XFRA 4UQAA 2CKSA 3EDJA 2V3EA 4TTUA 2XPKA 3J7HA 3OZOA 3FY1A 1QHOA 3WBAA 1UR4A 3VDAA 2Z1KA 4OJYA 4AYSA 1V08A 3O2LA 2YL8A 1BF2A 1MFUA 1JYWA 3CUGA 2ZX5A 1JD9A 5BRPA 1GOIA 2EXOA 3BAIA 6TAAA 1OGBA 3CHDA 3CO4A 4L4OA 2CHOA 1E4NA 1UWRA 3ZJKA 4QLLA 3L4WA 1OSEA 3M6DA 3W24A 4RE4A 4LQ1A 4W88A 1HVQA 1HKMA 3NUKA 1M03A 1OIMA 2BNJA 4HPGA 4R5EA 1BSIA 1UA7A 2D1ZA 2OWCA 1J0KA 2E3ZA 3WFZA 3WELA 1EHAA 1KBBA 3AIBA 1TZ7A 1WE5A 5BXRA 3T0BA 4PMZA 3SEPA 2VCCA 3FN9A 3OBAA 1WDPA 3VNYA 4TVDA 1CGUA 1UWUA 1JZ2A 3AIWA 1CBGA 2DSZA 3N11A 3A4WA 2ZXAA 3VO0A 2WHJA 4JL2A 3WDPP 1MWOA 4MAVA 4D71A 4P7NA 4J27A 1JFHA 1OD0A 3RM4A 1E1EA 1JI1A 2VZSA 3SCRA 1H0GA 1TVNA 1JYXA 3F5KA 5GNYA 1R85A 5F7UA 3CZEA 1JF5A 5A2AA 5BCAA 4PBGA 4FLQA 4LPCA 2A3AA 3DECA 3WEOA 3KE0A 4CKQA 5I6SA 2ESCA 2WZIA 2HVMA 1PIGA 2ZUNA 2W91A 2XGIA 3TTOA 4IPLA 1IT0A 2DEPA 3RDKA 1EQPA 4DWSC 3MMUA 1CGVA 1H0IA 3ZT5A 3BLPX 3GDBA 5BROA 3WF2A 1EO5A 4PCTA 3CZJA 3ZM8A 1SYTA 2CBUA 2DIJA 3W0KA 5BWFA 3LPPA 1ZBVA 2JIEA 3BAWA 3VD7A 4ATDA 4U33A 3A4AA 3AIVA 3L2LA 3VINA 3SCPA 1HX0A 1KQZA 1QBAA 2WVTA 5E6YA 1CXFA 4J3XA 1LL7A 1SFSA 1HL9A 3EMQA 3E1F1 4R27A 1V6XA 2V5CA 4H8HA 2YIHA 3L4TA 1I1WA 3WSUA 2F2HA 4F9JA 3VIJA 2YA1A 4DM2A 4AD1A 1E3ZA 4FLRA 1C91A 2VMFA 4CD6A 4BZYA 4E8CA 3AHXA 3L4ZA 4CU8A 1EDQA 4AZ6A 1EGZA 3AIQA 3CLWA 4AZ5A 4LXFA 2X0YA 2WB5A 1PX8A 4KGLA 2WMIA 1VFMA 1XH2A 3QR3A 2WNWA 3QOKA 5GPRA 2OYKA 1C8QA 2G41A 1K9DA 2V3GA 2WHMA 3TA9A 3W25A 1WPCA 1GHRA 2DIEA 4PUEA 3MUIA 3PTQA 2DQXA 2OYMA 4WSJA 1FA2A 2OSYA 1AMYA 3U57A 2W63A 2ZWYA 5BXPA 3OIHA 4PUDA 4V28A 5I77A 5HOSA 3VD3A 3WN6A 4E8DA 3K8LA 1C90A 5HBFA 1E6NA 3A4XA 5JUVA 2FGLA 3PZMA 2A3BA 3QHMA 1NH6A 2RGMA 1TFVA 4N0RA 1GJWA 1V0NA 1WZLA 4UZSA 3AFBA 5LYRA 2WKLA 3BLKA 2UY3A 1ISVA 3WUEA 1W9VA 1UWQA 3GXMA 4U5KA 5ABGA 1B90A 4KGJA 3VM5A 2WKGA 3PZ9A 1GONA 1E0WA 3ARQA 2VRQA 3VGBA 3VU2A 3IJ7A 3MANA 4GIAA 2EEXA 3NSMA 4FF5A 4URIA 3W4RA 4GKLA 1JZ6A 4W7UA 1XYZA 5ECUA 2WSKA 1CWYA 2E9LA 5CQ1A 2Y8VA 2QMKA 1UH4A 3T2OA 7A3HA 3ALFA 3VD5A 3VIPA 1E6RA 1JL8A 1HNYA 3CHFA 1J11A 1TE1A 3IANA 4E2OA 1OINA 3CZLA 2VR4A 1XV8A 5FCZA 1AVAA 3W53A 4Y7EA 3VOCA 1PX3A 3T0AA 4MDOA 1OCQA 3RM8A 7TAAA 1DP0A 2G3JA 1Y7VA 1YQ2A 3ZOAA 5BRQA 2V38A 2JF7A 3WNNA 2WZHA 2QHAA 1OBAA 2BY0A 1EDTA 4TX8A 5LA1A 5DMYA 4YN5A 2JIWA 1TCMA 2BHYA 4W89A 2ZUWA 4U3CA 1W3HA 3MMWA 1CLVA 3VD9A 4RE3A 2GUYA 3VNZA 2QV4A 2WLYA 3AZSA 2JEPA 2X1IA 1W2PA 4LYPA 1UZ1A 2EPKX 3M46A 3VDHA 3W81A 1JDCA 1HN1A 3PBGA 2XVLA 4CCDA 2DT0A 5AC5A 5A8NA 2JE8A 1MQRA 2YOCA 4P7QA 4W8LA 4M81A 1OGGA 3MS8A 4PCSA 4X0NA 5FL0A 1SR0A 1E40A 1QVBA 2XG9A 3WD4A 2BV9A 2DT2A 5CPTA 3NSNA 1JFXA 4H04A 1SMAA 3WNPA 1SMDA 2PWEA 3ARWA 4JFTA 1G01A 5I78A 1W3JA 4D1IA 2CXGA 3AYSA 2BVDA 4CN6A 1UKPA 1KXHA 2J25A 3WFLA 1JYNA 4J28A 5CPSA 5A6SA 3ARRA 2D0FA 5I79A 2O92A 3SCTA 5A6BD 1EO7A 1BG9A 5E0FA 1E1FA 3MSDA 1ITXA 1UR2A 2YBUA 1J0YA 1LWJA 2VZUA 4TXEA 2CESA 4BQ2A 2W66A 4ACZA 4LGXA 5A6AA 3OLIA 1IZKA 1L0PA 3MUY1 1CXIA 5D9MA 1CXLA 3QOMA 3T09A 2GJXB 8CGTA 1D2KA 4JKMA 2ZICA 3WNOA 4PMXA 1UD5A 2EQDA 3B9DA 2V5DA 4MB5A 5JIWA 1UWIA 1Q6FA 1PX4A 1LL4A 4QLJA 3IAPA 4JKKA 2JALA 3VIKA 1R7OA 1ZS2A 5DT5A 1VFFA 3GH7A 3AIUA 1UD6A 4BCEA 4GPNA 1WO2A 1H09A 3CGTA 3OZPA 3ZJ6A 3VILA 1VEOA 5A8PA 3AXHA 3CZKA 2VTFA 3POCA 4JZ5A 3I3BA 1PAMA 4AZHA 2XIBA 4DM1A 2DSKA 3VDCA 1JXJA 5CJ5A 3CMJA 1LG1A 1CZ1A 3WDJA 3ZJ8A 4ZEPA 1JD7A 4FK9A 1BYAA 3GBDA 1MW0A 3K8MA 3BAKA 2GFTA 2JFEX 3SURA 3SUTA 2PBOA 1Q6EA 3AICA 1UOKA 4ZXOA 4PEEA 1MFVA 1MW3A 2DDXA 4FLOA 4CN4A 5A3HA 1OD8A 1UR9A 5ABFB 1ISXA 3VTRA 1G9HA 3D5HA 2UY4A 4NRRA 3GNPA 3OG2A 5GNZA 4CVWA 5D9PA 5IHRA 5DFAA 4HZ7A 2XWEA 1FP9A 3RILA 6A3HA 3N17A 4W7VA 1VRXA 5E9AA 3FW6A 1RD6A 1KB3A 1BYBA 1OIFA 3ZJ7A 5EFFA 1W1TA 1UR0A 4LYRA 4AW7A 3CPUA 3I3DA 1DEDA 2CBIA 3WMCA 4B16A 2J7BA 3W28A 3VGFA 4NRSA 1HIZA 2RGLA 1JZ5A 3HN3A 4PTMA 3EDKA 1Z32X 4NI3A 5I5RA 2WMIB 4W87A 2W61A 2JF6A 4OOZA 2J7CA 1VIWA 2ZE0A 1NWTA 3CZ8A 5CLWA 5I3DA 4IPNB 1GORA 4GO9A 1FH7A 1GOKA 4OZOA 3G6MA 1J01A 3AHYA 4J3WA 3U5UA 3VMPA 1HJXA 3VKKA 2J75A 4P8WA 3WEZA 4HP5A 3BGAA 1XCWA 2DSWA 1A3HA 2PC8A 1E71M 5JIPA 3OGSA 3UERA 4WK9A 1K9EA 4KRTA 1US3A 2E9BA 2VQTA 5ABFA 1UHVA 2BVYA 2WHKA 1QNSA 1KGXA 3IJ9A 1GQJA 2A3HA 4B3LA 4HMCA 3CZGA 4MPKA 2VQUA 2OLHA 4NF7A 2XWDA 3WUBA 1UZ4A 2J8FA 2OSWA 4AIOA 1GOWA 3F4VA 2WHLA 3GBEA 4WF7A 1DTUA 4HA3A 1W9BM 3VMNA 1ZU8A 2FH6A 1QNPA 4ML4A 2E8YA 2VJXA 1VBUA 4CCEA 1UH2A 2VX7A 1OWQA 3TONA 3WL1A 4AC1X 1E43A 1CIUA 4B9ZA 4HTYA 5ABHA 1NM9A 3K8KA 3IAQA 3LMYA 1V3IA 3KWXA 1WDSA 2F61A 3SUVA 4MB1A 1DWFM 2EO7A 1BG4A 4H41A 1CGXA 3PN8A 3TTSA 4AZCA 3TP4A 1VAHA 3NDYA 1UD8A 2EPLX 3ARXA 2WANA 2WXDM 1GQKA 4AEFA 1GUVA 4GQQA 1HJSA 2GK1B 3PZUA 3CMGA 2BHZA 2FH8A 1UWTA 2WSPA 3N9KA 1QW9A 1GCYA 2CITA 3K4AA 5I0DA 1E70M 1JGIA 3WENA 3FHAA 2J47A 2WK2A 4MJ4A 3GTNA 4JFSA 2Y24A 1V6YA 1RP9A 5A1AA 4QCEA 1BAGA 1GJUA 3VGGA 1B2YA 1VBRA 2ZX9A 4WKFA 3AMCA 4PSPA 2WM0A 3VIIA 1JZ3A 2E8ZA 4EAMA 1KR0A 4PMDA 4W5ZA 4MNMA 2VRKA 2DH3A 1XHGA 3M7SA 3U7BA 4BA0A 1H3GA 1XH1A 1ISWA 4YPJA 1PZ2A 3DYPA 4DWSD 4UFHA 4MNLA 3WD2A 3VVGA 1CPUA 3PZOA 1M53A 1PEZA 3OLEA 4JFWA 1NWSA 3RM9A 4AD0A 3AHVA 1E73M 4D1JA 4ATWA 4U2ZA 4GXPA 1U30A 4D6HA 5HPCA 4D6CA 1W1VA 4ACZB 4Z2JA 1FH9A 4GI9A 2J7DA 4B9YA 4C7DA 2PWHA 3OLDA 4Z2IA 5E0CA 3PZVA 1JDAA 1XD1A 1KCKA 1WAWA 3GXDA 1VJZA 4ATLA 3QHOA 4GO8A 4P8VA 3WIJA 3N12A 4JL1A 1N82A 4TOQA 2VZVA 3NIYA 4JHZA 1W9UA 1PZ3A 5CLTA 2WCGA 2YL5A 1R86A 3CUIA 1EQCA 3W29A 4HU8A 3CUHA 1EOKA 1QI4A 2CNCA 3I3EA 4BS0A 4CGTA 1B9ZA 1OM0A 1W1YA 1JIBA 3AHZA 4CD8A 2Y2WA 1GHSA 4UQDA 4MAZA 2O9TA 1E72M 4X9YA 1W91A 1IZJA 1V0LA 5JBFA 3RCNA 1E6ZA 5A2CA 2E4TA 1E6QM 4PMOA 3VMOA 2D20A 4NSBA 3SCUA 1ISYA 4OUEA 3WNKA 3WDQA 2GVYA 1JF6A 1HJWA 3AS2A 4AZBA 3AJ7A 5D8WA 4A3HA 3BSGA 1H49A 1B0IA 2QPUA 4H8VA 1JZ7A 4UQBA 1CNVA 4W93A 1DHKA 1OT1A 2WW5A 1KXTA 1QBBA 1XC6A 1HT6A 3HMCA 3WH6A 1G94A 2DSVA 3WF4A 1ZBCA 1O6IA 5DO8A 4M80A 3UCQA 1J0IA 4D6GA 3AISA 3AYRA 1KR1A 3AQUA 1JNDA 1G0CA 1W32A 5CXPA 2G3IA 4CD5A 2BXYA 2WMHA 2VR5A 4M1RA 4C7GA 1DWAM 2DSUA 2F8QA 2UY2A 3ARPA 1CGTA 3PZGA 1BGAA 1CYGA 3CIVA 2OWWA 3U7VA 2WC7A 4QDMA 3ARZA 2HISA 1H5VA 1FOBA 3B9AA 3MUZ1 1HKJA 5DF0A 4S3JA 1MQPA 2CETA 5GQBA 1ZJAA 4DUWA 3CUJA 1NOFA 2ZWZA 3ZO9A 4P8XA 2WBKA 4D6FA 1OT2A 5AC4A 3RMEA 4XB3A 4ZENA 3SUWA 2ZUMA 1VENA 2G8ZA 4TVUA 1KWGA 1JNEA 3CBWA 3SCVA 2WMGA 1M01A 4GI6A 3WQWA 1LJYA 4B3KA 1ZJBA 5A8MA 1R7AA 1NP0A 4PMYA 4PRWA 5I24A 4PMNA 1JZ4A 3PHAA 2ZUSA 2O9OA 5FKYA 1G5AA 3GM8A 3SCOA 4KMQA 4F9DA 2E9MA 2C8NA 5CSYA 4DWSA 3ZIZA 2J78A 2NSXA 4UCFA 2VI0A 2BXZA 3AHTA 1CGYA 1CGWA 1JAEA 1HJVA 1KBKA 4ACYA 2A3CA 4ZE4A 5BXTA 2VURA 3OLGA 2XSBA 4XX6A 3UEQA 1TVPA 1B30A 1BVNP 1V3KA 2ZUTA 3WF0A 1E4LA 4B15A 3VX0A 3ZSTA 1CLXA 1MYRA 2WVUA 3NJ3A 4CUCA 5M17A 1NQ6A 3W6MA 4H2CA 5A8OA 4QFUA 3PZIA 3WF3A 1UYQA 1UD2A 5A95A 4W85A 1OGSA 1D7FA 1ZB5A 2CYGA 3FAXA 3GXIA 4F66A 1J0HA 2DT3A 3LPOA 5IFPA 1JI2A 1V3MA 1J0ZA 1DWGM 1H2JA 5A2BA 4DUXA 2J79A 3ZR6A 1KGWA 1KFWA 1V6WA 1ESWA 1K9TA 2BY1A 4MJ2A 3AMDA 2VC9A 5IHSA 4H8UA 2C0HA 4GI8A 3CH9A 1B3WA 1HJUA 4OBRA 3T2QA 4AZCB 1M04A 1W1PA 1BGGA 3MUAA 3W6LA 4P8UA 2O9PA 4S3KA 5BYWA 2VVNA 4MTVA 4MDPA 5CSUA 3N13A 2VRJA 2WWDA 4PTVA 1DWJM 5M03A 3K4DA 3BCDA 3UETA 3ZQ9A 1OB0A 1WZKA 2ZXQA 4D6EA 1B3YA 2XVPA 3AS3A 1CXHA 2BY3A 1XCXA 1X1NA 1CTNA 2DT1A 3LPGA 3VDBA 2W4XA 4D6IA 3AZTA 4FLSA 1ZBKA 4PSRA 5CGTA 1V02E 3CTTA 4KRUA 5AY7A 4WKHA 1HP5A 1ZL1A 1F4HA 4P7OA 5AYIA 2GDVA 4V27A 1RPKA 3ZMRA 1FHLA 4AMCA 1I1XA 2WMJA 4H7VA 2BVTA 1EHNA 1GQLA 1V3JA 2G3MA 2VVSA 1W9XA 3BAYA 1W3LA 2VX5A 2CHNA 5JBEA 1E0VA 1EH9A 1U33A 1GVIA 1KWKA 2YJQA 2PWFA 4UOJA 1E6PA 1ZBWA 1TR1A 4RL3A 3AMKA 1W9DM 1B3ZA 2XVKA 3AXXA 2WMFA 2EBNA 2WCAA 1QW8A 3FHQA 1MXGA 3EDFA 2BFGA 4UFKA 4CVUA 3WH9A 1HKKA 3PZTA 3EBVA 1PJ9A 3WH5A 1BVZA 1UA3A 4M29A 7CGTA 1CDGA 4UFIA 3SIMA 4YHGA 4Q7NA 2G4FA 4PMUA 4ZFMA 2XTKA 4XV0A 3DYOA 2PF0A 4MB4A 1V3HA 3AMLA 3K1DA 3WDHA 3VM7A 3AZRA 3NCOA 1UG6A 1QOXA 3MO4A 3AXIA 4EKJA 1Q6CA 2VT0A 2YDRA 2GJRA 2QMJA 2J7FA 4WLCA 5DT7A 3S6TA 4PTWA
chains in the Genus database with same CATH superfamily
1XGZA 4LAKA 3SJ3A 4MADA 2RDXA 3QLDA 1CLKA 5AYZA 1JUEA 1S5TA 4ICNA 3UR5A 1J10A 5H2ZA 1IEIA 5HNNA 4OU1A 3EMZA 3K46A 1SFJA 2E1DA 3ARSA 3KZPA 4HK5A 1O95A 2B31A 3AS0A 4W86A 5B7ZA 2WV8A 4IG2B 1EEPA 4LUSB 1GYNA 4LT9A 1RA5A 1DYSA 1JDFA 1JR1A 2RFGA 3V1PA 1H1NA 5A69A 1HQTA 3MKKA 4LNYA 4IFRA 5HDRA 3GC5A 1CB2A 2WJFA 4PMQA 1QUMA 2AMGA 2NVAA 2X05A 2E40A 2VL4A 4H2HA 2PDWA 3SM0A 3CLMA 5A6MA 2YCJA 3H2FA 3UVAA 3LRLA 4QLKA 4PEKA 1YNPA 3HG5A 4JX4A 4ZSTA 2GVEA 2XH7A 3H12A 4KEMA 3KL3A 1XH0A 2Y4SA 2A5HA 2OYLA 1C93A 4TQTA 2V3FA 3GIPA 3UESA 4V2XA 4DX3A 2V3DA 4OV9A 1SO3A 4Q8NA 1FWJC 1C7SA 3BSHA 3W72A 2F7FA 2Z28A 3P84A 1ECEA 4US5D 4DUOA 3FA4A 1BYCA 2XFFA 2ZRXA 4Z1BA 3ORWA 4I9JA 3AALA 3MI6A 2WC4A 3H26A 3L4XA 2WVVA 5CC3A 3S5YA 3BLEA 1M7JA 2ZC1A 2ZQ0A 4EF9A 4KCVA 2I5QA 2QDHA 1W2VA 1K7FA 4GYPA 4HHLA 3TFCA 5IFTA 3TAOA 1LWHA 1SJCA 3KBMA 1XUUA 2DZPA 3NM1A 1FFRA 1EJSC 3RJYA 1GVFA 1XRVA 4JFUA 2QIIA 3L4YA 3RYSA 4NZ3A 1OF6A 3WD3A 1QOQA 4QSHA 3W1XA 4FF7A 3RX3A 1FFQA 2W67A 1UR8A 1E1CA 2GLKA 3THCA 3PJXA 1YMYA 4CCCA 2J74A 4MJZA 3D46A 1YW1A 1I4NA 2XM1A 1N8WA 1HJQA 2GYIA 4LCRA 4IJRA 3SGZA 3POHA 2ZUUA 1KM0A 5E93A 3BGGA 3V5FA 4NASA 4XZWA 1B31A 5D37A 4MZYA 1CEOA 3P62A 3A5FA 4CNOA 1DWIM 4FNUA 3VIGA 1K6WA 2Y8KA 2EPMX 2PDQA 3W27A 5JQ9A 1G4PA 4OKDA 1SR9A 3FK4A 3SI9A 2ZCGA 3B4YA 4LY4A 3RRXA 1LL6A 1R30A 2CZDA 5C2XA 1ZJIA 3UXAA 1DJXA 1O60A 4UIOA 1YKWA 3QGVA 1H7WA 3EOSA 4GUJA 2Y63A 1UUOA 4WJEA 3IJDA 1MNZA 4KRZA 2FDMA 4WJXA 1NAL1 4OE7A 4GZJA 2J9XA 2B81A 1JULA 1UP3A 2EF9A 4ZTYA 3L67A 3W2LA 3BGJA 4W84A 4CN1A 3S9ZA 2R24A 2OB3A 2W5FA 2WJEA 4EK7A 3EWDA 4D8AA 1LT8A 3GVQA 2BOGX 2A85A 2XH0A 3AU2A 4IQJA 3SR7A 2BGSA 3CQJA 2OFJA 1OF8A 3VGHA 1SO4A 1S5MA 1OYCA 3R8RA 4IH3A 1EJ7L 3A47A 3N04A 2Y5EA 1VF8A 1A0EA 5AVHA 4M19A 1Z42A 2B7QA 2Z7GA 4GH1A 1HO1A 3KVLA 1EA9C 1FWBC 2R8WA 3PANA 3LX9A 2Z1BA 2WC3A 4KWUA 3DEQA 3UXLA 2OSXA 3CHCA 3QQ1A 4GQBA 3KVMA 4HU3A 2Y85A 1BRLB 4UTWC 3O1NA 5F1VA 1X7IA 3LBOA 3FVDA 2HRWA 3LD5A 4I9MA 3LBCA 1WUEA 2R14A 1CECA 3SCSA 3BARA 3WH8A 1B1YA 3KHDA 3QTGA 5HINA 3AOFA 4AIEA 4KH2A 4O12A 2IPGA 3ALGA 1EXPA 1UKSA 3T08A 1XD0A 2XVNA 3RG6A 4Z2GA 5LA0A 2XM2A 4ZE5A 1NOWA 4PL1A 2FTYA 4FIQA 4IIBA 1Q85A 3BOXA 3FDKA 1GG0A 2J77A 3WD0A 4HOWA 4AD2A 5B80A 5ABEA 2NUWA 4NAFA 4NG3A 1TMHA 1XL9A 3WD1A 4A4AA 3KL5A 4CU7A 1IIGA 3GHUA 3EOOA 1R2RA 2W79A 1P0NA 1NP2A 2CKRA 2GJXA 3ELFA 9CGTA 3CAWA 1VD6A 2ZIDA 4J3UA 2C7FA 2X2GA 4IJCA 4O8AA 1JCLA 1JDDA 4GCAA 5HAOA 3WQ5A 5REQA 2X30A 2W3ZA 3SAZA 1LBFA 3H70A 5D4YA 4A8LA 4QP0A 1S2CA 4IUGA 1UH3A 2Z1SA 4Q8OA 1VS1A 3T6CA 2CLKA 5JH1A 3M0XA 1QNRA 4YTSA 1VJIA 2J7GA 5I06A 4KEUA 4H9MA 2DUZA 3LGDA 1XSKA 3AU6A 3TTQA 1MZHA 3SUUA 2JKEA 1FP8A 1Z9AA 2CBJA 4XZHA 1W9PA 3UW6A 1V02A 3T9PA 4JTIA 4HOXA 2C18A 4JEJA 1NOUA 1NWRA 3IGSA 5HJXA 4GZ7A 2YDSA 4GC3A 3G2GA 3KP0A 1EUNA 3O6AA 2FJKA 2X2YA 2POZA 3NM3A 1UW9A 2V68A 3RO8A 2QDGA 2GJPA 1WP6A 3ITTA 3GR7A 1JUKA 3EXSA 3PTMA 3F5LA 1QRQA 3CS2A 2WYSA 2W27A 1K6AA 3OVQA 5BU9A 1XBVA 4J1OA 2FDSA 1K8XA 2J8GA 3BG9A 2BTMA 1GZJA 3O63A 3NWRA 4PYSA 2BOFX 4Q4PA 1E55A 3QMSA 4RV3A 3QV9A 1QI0A 5K2ZA 3GNOA 1RHCA 4UQCA 1K9FA 2X1RA 3GHTA 1FWSA 3LBMA 1TWWA 1BSLA 1PWLA 3MU7A 2PODA 2PBGA 3NPWA 1VPQA 2VP8A 2HQAA 4F0LA 4TTGA 3GKAA 1VB9A 5KEZA 2W62A 2AQWA 3DG7A 4S3GA 4GYPC 2DPEA 2QDEA 3GD6A 4QAWA 2CLFA 2ISDA 3P5YA 3O9NA 1TMQA 2A3EA 2O4MA 3TXZA 5JBDA 2HWGA 3ICJA 1AQFA 3OTRA 3H4WA 3QXBA 2TMDA 5C5YA 3TX9A 1KTNA 2ZDSA 3WH7A 3GUGA 3U2OA 3TCEA 5FAGA 3SDOA 3O07A 4I8DA 3BMWA 1Q13A 4HU0A 1ZCOA 1F3TA 4BI6A 1R3QA 3FNDA 4J3SA 3SECA 2PEVA 3RU8X 4HNUA 1E3XA 2VEFA 4NT0A 3C3UA 4XKMA 3DFOA 2QCNA 3F4NA 3QF0A 4LYQA 5C0QA 3LI1A 1OX4B 5CPNA 5IRPA 2WBGA 2XGBA 1UC4A 3ITLA 3PJTA 4ZQCA 3WO8A 1V03A 3B97A 1J5TA 4AU0A 1E4IA 3U8GA 1F6PA 3MMDA 3Q67A 2YL6A 3BXWA 3B9OA 4E3TA 3E2VA 3LEPA 3N2BA 3C2RA 4D6JA 4Z2KA 3IV8A 3TAKA 4LVGA 3GG0A 3TTYA 2VOMA 1H11A 4YS1A 5HMEA 3AXMA 2FLIA 1VYSX 3PPHA 1JCNA 2CWNA 4F4RA 5LIKX 1GVSA 4M56A 4OV4A 3L4VA 2YW4A 1KCLA 4JTRA 3P81A 5HQEA 3USZA 3QQ0A 1Y5XA 4DO7A 2HXTA 1P5BA 4UQAA 3EDJA 3J7HA 3FY1A 1MSSA 1Y5WA 3APYA 1KFJA 3VDAA 3EEGA 2Z1KA 3UNDA 2QULA 3O2LA 3HGSA 5C6MA 1BF2A 3R1ZA 1GZGA 4CEUC 4KBXA 4NX5A 1DE6A 2EXOA 1FCQA 3NZRA 3Q2DA 1U1HA 2ZRVA 1QMLA 1XLBA 1E4NA 2NV1A 3FGCA 5CBBA 1L8PA 3M6DA 1PZ1A 1ZP4A 5D2YA 2WNNA 3B8VA 4ZQOA 3NUKA 3R5EA 1E9ZB 4K8GA 2BNJA 4R5EA 2Z6JA 3E6EA 2IPJA 3GNNA 4P5UA 2E3ZA 1NQKA 1RVKA 1TZ7A 3BTNA 1VH7A 2INFA 1V7YA 2DZBA 1LP6A 5AECA 2VCCA 3BICA 3FN9A 1JZ2A 5DRCA 3VO0A 4JL2A 3PJWA 4GI4A 3WDPP 1RA0A 4Y9NA 1AW1A 2I5IA 3U48A 1Y0EA 1X8FA 1E1EA 2VZSA 3V18A 1TVNA 4XSLA 3KM8A 3FIGA 5GNYA 2Y88A 1EFZA 4MZ1A 3UG8A 1ZFJA 5BCAA 3ITXA 3ME3A 4PBGA 1WUFA 2P53A 4AVNA 5I6SA 2ESCA 3M5VA 4DF1A 3RDKA 2X41A 3B0UX 4DWSC 3ZT5A 4YCPA 3KRUA 3IV3A 4M5PA 1TX2A 3WLSA 5E0KA 2CBUA 2DIJA 2PP0A 1HL2A 2JIEA 3VD7A 1B57A 3R10A 1A3XA 4TO8A 3H21A 3SBFA 3AIVA 3L2LA 2B0MA 3P61A 1RJPA 2I57A 2VFDA 3BLLA 2GGIA 2A4AA 5KZMA 5LSMA 3LS9A 2PGEA 1A5CA 3PTDA 9RUBA 1KFKA 2EG7A 3JW7A 2V5CA 3PULA 3BG5A 1I1WA 3WSUA 1XP3A 3B8IA 1T8QA 1XIGA 3C2EA 1XM3A 4ADTA 4CD6A 3WLNA 2GGEA 3L4ZA 3U4FA 4CU8A 1CX9A 4AZ6A 3AIQA 3CLWA 3E2RA 2EG6A 1V77A 5E9XA 5H1WA 2WB5A 2C0AA 3BK0A 1VFMA 1JCTA 4B5WA 5GPRA 2J9ZA 4YTTA 1AZ1A 2BB0A 1BEUA 2I16A 1WPCA 1US0A 4R33A 3GYEA 3MUIA 2QCEA 4WSJA 1EJVC 4ZZ9A 1IXNA 1G7UA 4PUDA 4KF1A 1P0EA 3QMRA 3UJ2A 1YDNA 2FGLA 1OC6A 4B91A 3WLQA 2QCFA 5H91A 3QHMA 2RGMA 3V1HA 1TFVA 4N0RA 3NPXA 1GJWA 3W7QA 3I7RA 1WZLA 1D8WA 1O12A 3DI1A 5AC7A 3M44A 2OPJA 5HQMA 2I5GA 1GKRA 1UZHA 1ISVA 1XRTA 3WUEA 1W9VA 3R12A 4FNPA 4KGJA 3BV7A 1VCVA 3SZ8A 4GABA 2VRQA 3WFAA 4GIAA 2TSYA 3NSMA 3H7UA 1TVLA 4CQBA 4ZB0A 4URIA 3MMTA 3W4RA 4GKLA 1FRBA 5TF0A 3L23A 1XYZA 1OZQA 2E9LA 2Y8VA 4C6IA 1GWJA 4E0CA 1ITQA 1QWKA 2QMKA 1UH4A 4XZLX 7A3HA 3ALFA 3EPNA 3FJ4A 2PGWA 3HJZA 2F2KA 3GTHA 3IVSA 4NU7A 3S5NA 1XV8A 5H8PA 1AVAA 3KRBA 3RN6A 1X98A 6REQB 1SW3A 1I2NA 3VKJA 1PX3A 3RM8A 4X22A 2FZNA 3N25A 1DP0A 1DIKA 4L6OA 2G3JA 4LW7A 3ZOAA 3C52A 2WZHA 3B0YA 2V2DA 2IKIA 3B03A 1XLIA 4W89A 4QTGA 4U3CA 2WJZA 3FKKA 3S1VA 1UWAA 1WKFA 3BE7A 3ZWTA 1TWIA 2PTZA 1SUXA 2V69A 1QPNA 4RE3A 2GUYA 2NQJA 4MMWA 1F6YA 3O06A 1R38A 1W2PA 4H6RA 1UZ1A 1DXFA 4A6GA 3CAQA 1HN1A 4CCDA 5K9XA 4UC5A 1UUMA 2C3ZA 1TRIA 3G0XA 5A8NA 1JCXA 5CH9A 2CLMA 1IWBA 4P7QA 4W8LA 5DMNA 1A0DA 1JPKA 1OGGA 3PUDA 1QR7A 4RDWA 5FL0A 4PCSA 4LUSA 4XK2A 1E40A 4UNLA 1QVBA 4MJMA 1ALDA 4JDYA 1EGVA 1TELA 1MNSA 3LCFA 4ZB2A 1SMDA 2PWEA 4JFTA 5FAJA 5I78A 1FCUA 1D8CA 3W7NA 2PDGA 4CN6A 5BRBA 2VEKA 1UKPA 1BF6A 2J24A 5CPSA 2ATMA 4NZJA 5A6SA 3W7EA 3ARRA 1W8SA 3HFTA 4LRSA 3IIVA 5REQB 4HHPA 2VZUA 2BASA 2W66A 4RW3A 1IZKA 1L0PA 2G4JA 1ICSA 3MUY1 2CLIA 3QOMA 3T09A 1RV8A 3GE7A 3GLCA 2EQDA 5LNUA 2ZZ4A 1LL4A 4QLJA 3FYOA 3G8RA 1J2BA 4WCJA 3HGRA 1Q4WA 2EKCA 3HOJA 3FJ6A 3WLHA 3NL6A 4NP7A 1UD6A 1QK2A 3GS6A 3P0XA 4ZOCA 4OQVA 3ATYA 1ZENA 4ML9A 3VILA 1VEOA 1TPH1 3LNPA 2VTFA 4JZ5A 3HIJA 4DM1A 2DSKA 2NX1A 3EX1A 3OHMB 1A5KC 3LCXA 2R94A 4ZEPA 1GKQA 2XIQA 2ZZ3A 1FWGC 3RUBL 2FFIA 4GBDA 2PBOA 1Q6EA 2LLEA 8TIMA 3R94A 1MFVA 1MW3A 3TK7A 1E1CB 5A3HA 3F2DA 1ISXA 4GIEA 1AUSL 1SZGA 2UY4A 5GNZA 5D9PA 2I7GA 3K2GA 3RILA 3BL3A 3S9IA 1JGMA 5E9AA 4XUGA 4IP4A 1UIPA 4BKNA 4XIAA 4LAZA 3QY8A 5IOBA 1OG6A 4LYRA 2X1SA 3CPUA 3I3DA 3A21A 1JZ5A 1IR1A 4V33A 4NI3A 1JEZA 1BWLA 4JTAA 3HQOA 1NY1A 3RXZA 3NQAA 2DVXA 1DIOA 4OOZA 4AHOA 5HMDA 2ZE0A 1NWTA 1EL3A 4C65A 2BVWA 3GQYA 1UP0A 3TE9A 4MG4A 3QZAA 2C91A 1HJXA 4GXWA 2YZRA 1YDVA 3P60A 2J75A 1XLLA 5LHEA 2XDFA 3B8UA 3WEZA 4HP5A 1UCWA 3UR2A 4JX5A 1L6SA 2DQWA 1XCWA 2DSWA 4XIMA 3ABXA 1K7EA 2C71A 2EG8A 3O15A 4UBPC 4Z17A 4IGMA 1H61A 1UHVA 5HMFA 2BVYA 2WHKA 1GQJA 3CZGA 4R9OA 5LXXA 3B0VC 4NF7A 1ZPTA 4OHQA 1SZNA 2HVNA 3WUBA 1N55A 3GU1A 4QGCA 2OSWA 3AXKA 1DJWA 3F4VA 3R7MA 2F84A 3DBPA 5LNRA 4BK9A 4HA3A 2GQ9A 2GOKA 5DMLA 3URAA 1W9BM 3VMNA 2YSWA 4GVFA 4ML4A 1K02A 2E8YA 2VJXA 4JIQA 4CCEA 2BOEX 1E43A 1CIUA 2V2HA 1PE1A 4B9ZA 3FJNA 1NM9A 3K8KA 4N9DA 2HS6A 1WDSA 2F61A 2QCMA 2OEMA 1DWFM 3UJSA 1CGXA 1BRLA 1RVGA 3TTSA 1FWCC 3S4TA 2H9AA 3NDYA 3MVIA 3ARXA 3I6EA 1QASA 8XIAA 3KP1A 3S3GA 3LG3A 4GD0A 5LIXX 3CMGA 2VC5A 3LUTA 2BHZA 4ERAA 1LQAA 3ATZA 2DUAA 1XKJA 1QW9A 4ILSA 4CQ9A 2F6XA 5I0DA 4S38A 1E70M 3E2SA 1JGIA 1VHCA 3DFYA 3ABOA 3GTNA 4JFSA 2O7QA 3SSJA 3O6DA 3RPTA 3R6IA 4UB9A 4H9YA 3S1WA 1HO4A 3LGGA 1A5MC 3AMCA 4WKFA 3LM3A 4LWWA 1VHNA 2E8ZA 4EAMA 2AAMA 8XIMA 2V63A 2PDUA 3AO0A 2GPTA 1H3GA 1VFLA 4BA0A 3TH6A 1ISWA 3B0PA 4LY8A 1LOLA 4OWGA 3WD2A 2XZ7A 1CPUA 3EX4A 4C6QA 3QQWA 3OLEA 4JFWA 1W1B1 1YTKA 4OECA 2R1KA 2HROA 1M3UA 4LUTB 3IWPA 3OLDA 4Z2IA 1OK4A 1QW7A 1O1ZA 4AFYA 4PUKA 1IGWA 3KOFA 1O4UA 4GO8A 5HA7A 4LEQA 2VGIA 3ERPA 3S2MA 3N6HA 3N12A 1YPXA 3L5LA 4TOQA 2VZVA 3Q37A 4PBEA 4JHZA 3GC2A 4JTFA 1A5BA 2YL5A 3CUIA 4O1EA 1EOKA 4ZVJA 1IEQA 1P1XA 1OM0A 2XIOA 3HG2A 4H8NA 2V2CA 1LUCA 2DZXA 2ZTKA 4IIDA 2O9TA 1E72M 1S2TA 3W1TA 2XINA 3E5BA 1G4EA 4NSBA 3VCRA 1ISYA 4RJEA 3WNKA 5FEPA 1HJWA 3AS2A 2J66A 1H7OA 2FB3A 1Z41A 4CLMA 1UPPA 3CUZA 1K70A 3LA4A 3NTYA 1TPB1 1KM3A 4DO4A 3FVMA 1CNVA 3E38A 4KKXA 1DHKA 1FWAC 1OT1A 3E02A 4R53A 2WW5A 4FA3A 1QBBA 3S0CA 4HNLA 2E25A 3VZYA 1LRQA 2E1WA 3WLPA 3ZLGA 3WLJA 3UCQA 1WX0A 4D6GA 4C6JA 2HK0A 3G1FA 4CD5A 1DQXA 2BXYA 1M65A 2WMHA 4A3UA 1ZAJA 4C7GA 2ZBTA 3QVQA 2F8QA 1FHVA 2UY2A 2VD9A 1CGTA 2NUYA 3O0KA 3PZGA 4RXGA 4WZHA 2BGQA 1IT8A 1W1A1 3ARZA 3P93A 2HISA 3CV2A 2QCDB 3OEXA 2JKPA 4R7WA 1RSCA 1BQGA 1L6YA 3RITA 2ACUA 1DVJA 3DU0A 3M4HA 1PL9A 4H9TA 3UNTA 1KD0A 2A0NA 4XB3A 1W1IE 2NZLA 1A53A 3T55A 2ZUMA 1VENA 3U3HA 1XBZA 1KWGA 2ASHA 3SCVA 5D04C 3WQWA 4O17A 3UT0A 2Z0IA 3GY1A 4PMNA 3TMLA 1JZ4A 3W2NA 3BMXA 5XIAA 4C1NB 3HM7A 5AFDA 1M41A 3TW9A 3LLFA 2HEJA 1F76A 5CSYA 4DWSA 4K1WA 1PS9A 2E6AA 4G5DA 1K4GA 3ZIZA 4MZ8A 4JQ2A 1LZOA 3UWEA 3IIXA 1Q7ZA 4JTLA 2RDTA 3GB6A 3EA2A 1CGWA 4DYKA 1JAEA 4JQ3A 4ZE4A 2ACRA 3UEQA 3OLGA 2CLHA 2NX3A 3ITCA 2PLKA 5TNVA 3MYOA 3THAA 1OFDA 1E4LA 1RK6A 4M6UA 3VX0A 4QROA 2DZSA 1CLXA 1MYRA 3NJ3A 1ONWA 3PZIA 5CSSA 1UYQA 3JRKA 4WR3A 3WJZA 3HPXA 4MWAE 1OGSA 4Q6XA 1D7FA 1ZB5A 2PZ0A 3FAXA 5F1UA 3VC6A 3N2TA 1XLMA 1G67A 1H2JA 3GVVA 3ZR6A 2NUXA 1QPRA 1UP2A 1KFWA 1ESWA 2AGKA 3EWXA 2QUNA 5KTLA 3HG3A 1UROA 2VC9A 2AKZA 1M04A 2OR2A 1TTJA 1W1PA 3W6LA 4MKNA 3TC7A 3HPFA 4RV8A 3H55A 2PS2A 4C1KA 1Q65A 2OTDA 4MDPA 1R3RA 3WJSA 1G4TA 5D03A 2VRJA 2F9RA 1P4CA 2HTMA 3ZQ9A 1F3WA 1OB0A 1WZKA 3QYSA 2ZXQA 4D6EA 4ZO6A 2XVPA 4B5SA 4QQ3A 3LPGA 4HQVA 3W1QA 3G77A 3W1UA 4PSRA 1W5PA 5CGTA 4AG0A 7ENLA 1JQVA 1HP5A 1HUVA 2R9RA 1M1BA 3B8WA 5AYIA 3W1MA 1RPKA 4AMCA 4F40A 4XZMX 5KMYA 1A5AA 1I1XA 4MVAA 1EHNA 3N29A 1GQLA 2YCKX 3PNZA 2BG5A 1QXLA 1W3LA 2V0TA 4HCDA 2CHNA 1U33A 1R47A 4Q4SA 2P8BA 1TR1A 4RL3A 2RJHA 1W9DM 3AMKA 1B3ZA 3VNLA 2WMFA 2EBNA 2PDLA 1EF2A 1AG1O 1MXGA 1GEHA 2NQ9A 4M0XA 4BHYA 3WJYA 3EBVA 5K7JA 1T96A 2DV0A 2VKZG 1BVZA 4M29A 7CGTA 1CDGA 1X38A 4DO5A 4Q7NA 2PLJA 4QS6A 4G6CA 3AMLA 3BANA 3K1DA 3FXGA 3L5AA 1UG6A 3TCSA 3AXIA 5HANA 1F3EA 1Z8AA 1YPFA 4WLCA 2Y89A 4L1GA 4PTWA 4BI7A 2Q3OA 3O7UA 1WNOA 3T78A 2GUUA 1NF0A 1S39A 3R0DA 2D23A 2X8RA 3NGFA 3MW7A 3II1A 1EWDA 2Q01A 2B7NA 4CD7A 3PWGA 3TYZA 5JMUA 3JZEA 3WMBA 1QFEA 1QI2A 1WKEA 5TD4A 4R7OA 2Z2BA 2WQPA 1TIMA 1PB0A 3DXIA 1TA3A 4M8UA 3S6DA 3MA8A 4UTFA 2PTDA 3FJLA 4F0SA 3UGVA 3PWAA 3WEMA 2AOSA 3LCHA 5J04A 3UR7A 3M16A 4XZBA 1FCBA 4KFNA 4EVZA 1UR1A 3L2IA 1YDOA 3WX7A 4K68A 1UR3M 1UBSA 3DYMA 4DF0A 2D0HA 2FPYA 4AX6A 4O0KA 2Z4GA 2WZEA 4K37A 4L9XA 4A3YA 2DIKA 1OFAA 3WMSA 3OA5A 3TEVA 2BMBA 3PSVA 1YTEA 1IHIA 4DAIA 3KX6A 3TQKA 1M7PA 4LVAA 4UZUA 1KLZA 4NJIA 2Q6ZA 1EA0A 3P3BA 3D3AA 4JIHA 3T4CA 2PRLA 2C14A 2FIQA 2OZ0A 1O5QA 1BWKA 4X63A 4N7QA 4RZBA 1RH9A 4YTRA 4AXNA 3GXFA 2UWFA 1EJRC 2J6VA 1IEVA 3DC0A 1C9DA 1BVWA 5CZKA 3NYDA 4DWSB 2VO5A 3VC5A 4ORMA 3BAXA 1C7TA 5DELA 4HZ6A 3NZPA 2EJ1A 3VOIA 5CPLA 4H9ZA 4U3AA 3LPFA 4EX4A 1P6BA 1JAKA 5EL1A 4E4PA 2VUYA 2Y7FA 3ARUA 4QNWA 3VKCA 4EANA 4QXIA 3MV11 4EWJA 1S46A 4D2JA 4PC8A 3VIMA 1EIBA 4GIYA 5FOOA 1MRQA 3WNMA 3WQ8A 4LAUA 4S23A 2INEA 5CBIA 3C2FA 3FOKA 3T44A 4ZOBA 2OZ8A 4A2SA 3VK5A 3LSBA 5K4XA 5C70A 2PRHA 3PPFA 1B3XA 1TJRA 4K8EA 2V30A 4B4HA 1HFBA 4HNVA 2GJNA 4BEUA 1GQIA 2BXVA 4JR5A 3IGXA 4HA0A 5HK4A 2GZXA 4YVVA 2WQDA 3OB8A 1VEMA 3BOFA 3G18A 2PCQA 4JBRA 1S5NA 5ENLA 3QW4B 1VEPA 4I7WA 3RX2A 3VA8A 3F4DA 2G95A 4OBSA 2GOUA 4QG9A 5GJNA 1EDGA 6XIAA 5D2XA 3TYAA 1V51A 2J62A 1JG9A 1UUQA 2F38A 3CU2A 1OFQA 2YLLA 2EPOA 2E5DA 3N1AA 3BSMA 3QHNA 5CZ0A 2DUXA 4WEVX 1XS2A 3S42A 3CIXA 3IGHX 2ZX7A 4PUNA 1EJWC 4NJJA 1XGDA 3L7RA 4J5NA 3IJ8A 2Y7DA 4PCPA 4CEXC 2DGAA 3BQ5A 3MCOA 4U2YA 4CNNA 4PCNA 4ZO9A 3C3NA 4XZ9A 2AMXA 2G3NA 1J9YA 4O4VA 3CQHA 2NT0A 3UY8A 5K3VA 1TUFA 1QT1A 4FSAA 3CHEA 2KAUC 4ES4A 1YX1A 3WQPA 1BQCA 3C56A 4GJJA 4RDZA 1Q3NA 2DZAA 2QUVA 1FWNA 4XVDA 4AISA 3AIEA 1XQLA 3I68A 2QYGA 3VPLA 5DCBA 4JIRA 5DY3A 1OFBA 3QV7A 1BXNA 2UV8G 3N2XA 3T7VA 3FA3A 1VFOA 3HA1A 4JFVA 1XR2A 4B4FA 4W9TA 1J18A 2PTYA 1ISZA 4JCMA 5C2GA 5TAOA 1OCNA 1AQMA 2R1MA 3UGRA 1BFNA 2PWGA 2GSJA 4Q22A 3KEHA 3W2MA 2YLAA 4OT7A 4EXBA 4UQ9A 1VCFA 4K36A 1AL7A 4ICCX 4LOCA 4N9EA 2REQA 4S1FA 2YBVA 1WZMA 6ENLA 5I00A 1BKSA 3RJXA 4QDPA 3DHPA 4LSBA 3LHVA 2Z1WA 4L6DA 3WDIA 2J9YA 3F5JA 2REQB 1WKYA 2NQ5A 1B54A 3M07A 4K8HA 3D3FA 4GJIA 1KFLA 4J4KA 2CEQA 4YL2A 2IXVA 3STCA 4S3CA 4D6DA 3CAVA 3S2JA 3M7WA 2X09A 1RLDA 5CZJA 1UD4A 1RUSA 3AROA 4FR1A 3TZFA 1BKHA 1VYRA 4DEFA 4JCLA 3QW3A 3NZGA 2XUCA 1X6LA 3B3DA 1EWEA 4IX0A 2Y5SA 1U2YA 1KFBA 1M7XA 2WCSA 4WDUA 2AGTA 1V0KA 3GAKA 4DBUA 1LROA 4F0HA 2PF8A 5AYBA 3QKEA 2WMKA 4IP5A 1VQTA 4NZ4A 3IJIA 1DWHM 2WNQA 3EOEA 3HPAA 5FEXA 3TIMA 2D3NA 1DJNA 1SZEA 5BOEA 3GAYA 4DVOA 5CPQA 4RZ6A 2E7FA 1OHLA 4JAWA 1YNYA 5FF7A 1KLYA 4O11A 2QIWA 5F4WA 3DFPA 4W5UA 3N4AA 3PWIA 4DY1A 4HPXA 3KZSA 2ABAA 2VX4A 5ECVA 2XSXA 5A6BA 1P0BA 3QRHA 1QNOA 2D2JA 4PMVA 1TPC1 4IFKB 2QV5A 1PDYA 1W3TA 4I7VA 3WBXA 4GIRA 1JYVA 3WDRA 3A3HA 2ZX6A 3ISIX 5EBAA 1RPXA 3RLHA 3INPA 1Z89A 3VX1A 1IEWA 5FI8A 3FDGA 1UKTA 3OBEA 1KQYA 3GNRA 4CQ8A 1S2UA 3U4AA 3W37A 3VIHA 2D22A 2GWGA 5A6JA 1WYIA 3PBWA 2GGJA 1FH8A 3AWOA 4LEFA 3HO8A 1HP4A 1XQKA 1XRFA 3O8AA 2VCAA 3W87A 4GGBA 2DFAA 4JNYA 2OO0A 3W82A 4QCFA 2YXXA 2ZZ7A 1J96A 5LA2A 3AIRA 2GDUA 1X1ZA 4YYFA 3CQ0A 1EPVA 5A8GA 5G4HC 3NQ7A 3G1AA 2WLZA 3C4UA 1T99A 2ZE3A 2VFFA 3FCPA 4Z2LA 2DORA 4UFLA 3GXTA 3JUGA 1W3KA 3VIFA 4LALA 3RMJA 2XSAA 3M9YA 5LNSA 2FB2A 3PAJA 2X7VA 4P7LA 1VP5A 5FJUA 1KBJA 3TW6A 2VCBA 3Q65A 3G1DA 2G3FA 1RJQA 1PKYA 4GUGA 7REQA 1NDYA 2PB1A 1XBXA 5C71A 3VZXA 1NWUA 1ODZA 3R79A 2QJNA 3DENA 4DYJA 3WK2A 1VGAA 1MVYA 3W7DA 4LCQA 1H51A 3C0QA 1U5JA 3A64A 4DRSA 3ECQA 4K2SA 2ATSA 2YYUA 2ZC8A 3LTYA 3CT2A 4WY0B 3MHGA 1N8IA 1DJGA 1XLCA 4JTEA 3NVTA 1VCGA 1QHZA 3NPVA 1H62A 5IDIA 1E6XM 2X40A 3IK4A 3F4CA 3QY7A 3RF9A 4J3VA 2X7WA 2OLSA 2J4GA 4KEZA 3T8LA 4DYEA 3BMVA 4S3FA 3SGGA 3OBKA 2XFYA 1GPFA 3VD4A 4ROQA 2FVMA 3B9EA 4IOTA 3B4UA 4PZVA 3A5VA 4WIWA 4ZXLA 2QZRA 5M2FX 3BO9A 2C13A 4JY8A 1Q6GA 3DHUA 4Z2HA 2L5HA 4JTCA 1A80A 2CKSA 4TTUA 3TFXA 3OZOA 3LI0A 3WLMA 3NA8A 4AYSA 5MKGB 3HBLA 3EWZA 1JYWA 3UCCA 2ZX5A 4LJ3A 1JD9A 3NXLA 5EU9A 4IZGA 1TRDA 4NZFA 3CO4A 4L4OA 1UWRA 1ZHAA 2GVLA 4QLLA 3L4WA 1OSEA 5FJTA 3PM6A 4IT1A 4LQ1A 4W88A 1HVQA 2P1FA 2Q02A 4FIRA 1GJPA 2PDKA 5I3JA 1OIMA 1BSIA 2D1ZA 4LUIA 3W1RA 3AIBA 1YLVA 3M0MA 1XWYA 2QUMA 4DBEA 1TB3A 3SEPA 3OBAA 1ONRA 3BQ6A 3CL6A 4TVDA 1CGUA 2YR1A 2X0SA 2VD8A 1UWUA 2YCLB 5C7VA 3W07A 1KCZA 1O5KA 2DSZA 1OABA 3TJXA 2ZXAA 3FYYA 3A3WA 5B7YA 3LERA 3MZ2A 4P7NA 2PSNA 4J27A 1YTDA 3M0LA 3FA5A 3RM4A 1JI1A 4GNKB 4KIEA 1T7LA 1JYXA 4M6VA 5I3IA 1R85A 5F7UA 4FLQA 4LPCA 3GFYA 3DECA 3RHGA 1RR2A 2WZIA 1PIGA 1O94A 3EPMA 4WQ6A 3TTOA 4IPLA 5I03A 2QEZA 4WOQA 1CGVA 4XKYB 1H0IA 4D8ZA 5HUPA 1QPOA 4PCTA 1FCVA 3TYBA 1C9WA 3ZM8A 1SYTA 4LVBA 3UPWA 4NAEB 4K1GA 3A4AA 5C9RA 4Z1YA 3VINA 5FF0A 3CB3A 6TIMA 1HX0A 1QBAA 2WVTA 1CXFA 1OFOA 3VUSA 4DZ5A 2GGHA 3C8FA 4Q7IA 3E1F1 3GIQA 4F9JA 4DM2A 1E3ZA 2OODA 1C91A 4BZYA 4E8CA 4KESA 1FDZA 1EDQA 4I7UA 3W1LA 3RX4A 3TQ0A 1IR2A 4MUZA 4GYKA 3WQEA 4NZ5A 2OX1A 4LXFA 1PX8A 4Q4RA 3NYZA 3PS7A 1TKKA 2IPWA 2WMIA 1XH2A 3IACA 4S3AA 3P8JA 3E74A 1K9DA 2V3GA 2WHMA 2DIEA 4QM1A 3HMJG 1K77A 1AZ2A 1QWGA 2A6NA 2OYMA 3OODA 3PVFA 3OIHA 5HOSA 2DW7A 3K8LA 3CTLA 4GYFA 1HZYA 2NLIA 5LKYA 1E6NA 5JUVA 2A3BA 3LENA 3R13A 1SFTA 2YFOA 1NH6A 1Z6KA 4TR9A 3CHVA 2FMOA 2O7SA 3UJRA 2IQTA 4IMFA 3IPWA 1Y8BA 3M1ZA 4HPNA 3THUA 1V0NA 2VUNA 2ZA1A 3VE7A 2YCLA 4UZSA 3AFBA 1TWSA 5AC6A 2QJGA 4GACA 3KOWA 1AMKA 5BOFA 1T6MA 1VC4A 3WZ0E 1UWQA 3GXMA 3QV8A 4U5KA 1B90A 3VM5A 2QGYA 2WKGA 3PZ9A 3ARQA 4O53A 3VGBA 4M7TA 2EEXA 4FF5A 2PUZA 3B8TA 3T0CA 4ADSA 1JZ6A 5AHFA 5ECUA 2WSKA 1KV5A 3UZYA 1WV2A 3T2OA 3VD5A 3VIPA 4L1WA 4KPLA 3GNXA 1J11A 4AVFA 4ZOAA 3IANA 2MNRA 1ICPA 3CZLA 4EPEC 1YXYA 5AC8A 3VOCA 4OFCA 1R3YA 2V5JA 1ZTVA 4C90A 3MWCA 1OCQA 4FAMA 1A5LC 4PUUA 1JPDX 3O05A 1DBTA 3UZJA 5BRQA 4DJFA 4ZL1A 2JF7A 3WNNA 3QR1A 4C6BA 1OBAA 4JS3A 3WK1A 5DMYA 3P2VA 3M0KA 1PSCA 2ZUWA 2V5KA 1IZCA 3UWYA 5L6UA 4HPJA 4LF2A 5E1QA 2IPFA 2GDQA 3W7OA 4N9CA 1XIMA 3H4XA 4G7FA 1NEYA 2ZZ1A 4MWAA 2X1IA 2OCZA 1R3SA 2HNEA 1KM6A 3T05A 4XZIA 3PBGA 2QR6A 1J4EA 4L80A 4KIRA 5AC5A 1AH0A 2P88A 4C6PA 3F2BA 3S2NA 4IF2A 4TIMA 3IRDA 5M1TA 2CLOA 3ID7A 5HJLA 4QDWA 1RY8A 4WDTA 4QHRA 1TPUA 5CPTA 3W1AA 4H04A 1G01A 1CI1A 1W3JA 3B06A 3I6RA 3N3TA 3AYSA 2WO5A 1SSGA 1KXHA 1JYNA 2XIJA 4GX9A 4DZAA 4NVTA 2D0FA 3SCTA 1OEPA 4GWEA 4XG1A 2VYOA 3KBNA 3UXKA 4WOZA 3LQGA 3SSZA 3O6CA 3W7PA 1J0YA 3CK5A 2QDDA 4DPQA 3H24A 4RPPA 4ACZA 2A3LA 3P5ZA 5I09A 3ZFHA 4YXGA 4QR6A 1FWWA 2QCCA 8CGTA 4I5UA 5J8LA 1Z7AA 4JKMA 2VXNA 4DJFC 1ONEA 1KA9F 4F0KA 4MB5A 1EIXA 1Q6FA 3NQ6A 2JALA 1K8CA 3GKFA 1WKDA 3AIUA 5AVNA 1R46A 3CWNA 3MHFA 3GIYA 3ZJ6A 3GNDA 5A8PA 1QNVA 3MPGA 1XYCA 3PB2A 4EAYA 3BUVA 3UPBA 2VFGA 4IICA 4AXKA 3WDJA 3ZJ8A 3NQMA 3VCCA 3QPYA 1FHUA 1ZALA 2ABBA 3TQPA 3K5XA 3CM4A 4MSSA 4FXRA 2A79A 4A8IA 3KVKA 1XG4A 2DDXA 1WXJA 1OD8A 4HK6A 1UR9A 4ADUA 1A50A 1G9HA 1L2UA 4MWAB 1EC7A 3OG2A 1DHPA 1JRBA 5I3FA 3OO2A 2XWEA 1FP9A 3AWNA 1NSJA 5CPOA 3N17A 4IMDA 1IYXA 3O16A 4MGGA 2Y7GA 1RD6A 3USBA 4DELA 3ZJ7A 1W1TA 3RO6A 3W6YA 5AB3A 3M0YA 1TREA 3MVTA 4I6KA 3O3RA 2J7BA 1B9BA 3F4WA 4BR1A 1HIZA 2RGLA 4WDXA 1BWVA 4MUPA 3ITOA 4DXKA 3EDKA 1Z32X 1I9CB 4W87A 1OJXA 2JF6A 5C7HA 3LYEA 4ONVA 5D2VA 2E6DA 2J7CA 3TLLA 3CZ8A 1L9WA 3D47A 1GORA 4CCZA 1FH7A 3WQOA 2JKAA 2VC6A 4OZOA 5FACA 1VFTA 3R4IA 4LUYA 3QJAA 3LZ5A 3BLIA 1A3HA 2P76A 1XPGA 2FPVA 2PC8A 3AJXA 3VNDA 3TSMA 3UERA 1K9EA 1TE6A 3GVRA 3O6YX 1XYMA 3QGKC 5CZSA 2VQTA 3CWOX 2H8ZA 4HMCA 1Q7QA 2A7PA 3LHYA 3TUUA 3NQCA 3S83A 1S3TC 4I8YA 5EY5A 3S47A 2OGYA 1UBPC 2J8FA 4AIOA 1GOWA 4HKPA 1XLAA 1TZZA 4O1CA 1ZU8A 4DJFD 4L9ZA 1QNPA 4DPPA 1VBUA 1UH2A 3GZ3A 1UOZA 1DL3A 4MFDA 3EGJA 2OJPA 3SQSA 3WG6A 1TPEA 3KWXA 1K1DA 4MB1A 5D30A 4H41A 4AZCA 2PDYA 1UD8A 2ODOA 4AEFA 1W5QA 3H8AA 4GQQA 1HJSA 4DN1A 3XIMA 3D0CA 1UWTA 3C61A 3N9KA 3GG8A 1HTIA 3NOYA 1GCYA 3SY8A 1IGSA 3MI2A 1XIFA 4MJ4A 4PRTA 2Y24A 4H9XA 1V6YA 5A1AA 1W37A 4HYWA 3VGGA 1AFSA 1B2YA 1VBRA 3NO3A 3DOPA 3G1HA 3VABA 1JCYA 1AH3A 1DV7A 2ZZ2A 2IQ0A 3HGOA 1EEXA 4MNMA 2VRKA 4NIRA 3M7SA 3U7BA 1XIBA 3GXPA 1NTHA 1I0DA 4QAIA 1PZ2A 3DYPA 4DWSD 4MNLA 5CCZA 3PZOA 4YJ5A 3KBJA 1PIIA 1Q6RA 2VWTA 5EMLA 1GTEA 4D1JA 3TR2A 4FXJA 3T40A 2H9AB 5AZ1A 3IUIA 1U30A 3O0FA 4D6HA 2A7NA 4D6CA 4ACZB 1EP1A 4GI9A 1FUYA 4B9YA 4C7DA 2H8XA 3WLKX 3BCJA 1F7BA 3W7RA 1XD1A 1VJZA 3QZEA 2IMRA 4N6EA 3QHOA 1XLHA 3WIJA 1UPMB 3UY7A 4TMCA 1OG0A 1FBAA 1PZ3A 2WCGA 1R86A 1EQCA 1ZGDA 3MY9A 5DXXA 4CGTA 1B9ZA 3VNJA 3SQLA 3W84A 1JIBA 4JXCA 5D05A 2Y1HA 3JZUA 3KCLA 2GJLA 1XINA 4L4MA 4X2RA 1XDMA 3CL7A 2NSOA 1W91A 1V0LA 4GBUA 1E6QM 1EJXC 1ZAHA 2D20A 5D02A 3U2CA 3DG3A 4Y96A 3WDQA 2GVYA 3UWUA 4A3HA 1H49A 1XX1A 1B0IA 3IARA 4C6OA 1JZ7A 1TPWA 3MQTA 2PE4A 2ADAA 4UNKA 1Q8JA 1KXTA 1VBHA 3HMCA 5DO8A 3L9CA 3NG3A 3URQA 1IXOA 4UMCA 1W5OA 3AISA 4V15A 1M68A 4CQCA 1JNDA 1G0CA 5CXPA 3KFTA 2G3IA 1IE7C 3W74A 2VR5A 3GX9A 2FJUB 4M1RA 3C86A 4NZ1A 3EB3A 1TQJA 3ARPA 5EPDA 2DY3A 1MO0A 1BGAA 1CYGA 1QATA 4HSHA 3U7VA 1C29A 1FVPA 2WC7A 3DFQA 3CPGA 3I7SA 3KRSA 1FOBA 3LB0A 1MQPA 2CETA 3N2OA 2JQXA 1ZJAA 2C19A 3N6QA 2HCVA 2Y0FA 1XFBA 4IFKA 2ZWZA 3ZO9A 4QRNA 4GGHA 3VNKA 4LB3A 4ZENA 1TZ9A 3C2YA 2G8ZA 4E2BA 2WMGA 1M01A 3OQ8A 3TROA 2KX9A 2PC4A 4JTSA 2TYSA 2G5WA 4PUMA 2QJMA 3OQEA 4GFIA 1J79A 3GTXA 2Z00A 2ZUSA 1W6TA 1R9YA 3EB4A 1X1OA 4AY8A 3GM8A 2HZGA 3SCOA 2IKJA 1Z69A 4KMQA 1I2RA 3R0UA 1Q66A 4O14A 4DLMA 3W2JA 3STFA 4YTQA 2NQZA 4KS0A 4UCFA 3KTSA 2VI0A 4C5ZA 3AHTA 2WZTA 4DBWA 4Q8MA 2PLMA 5EKYA 4AYGA 2OEKA 3E5PA 4XTDA 5BXTA 4G1NA 4XX6A 1W5MA 1TVPA 5CZTA 5LZLA 1V3KA 2FZ9A 2ZUTA 3V0UA 1VFHA 3WF0A 1AL8A 5D2TA 4B15A 4OUIA 3E0WA 3EXRA 4IQDA 3W7IA 3ZSTA 5EBUA 5CC6A 5M17A 1NQ6A 5T8GA 5A8OA 4Y6GA 4JQAA 3MUXA 4L64A 3RR4A 4GC4A 4I3GA 4W85A 4HHMA 3MI3A 3GXIA 3LPOA 4AWSA 1V3MA 2IW0A 1J0ZA 2V5LA 1DWGM 5A2BA 4DUXA 1EF3A 1KGWA 1S1RA 3VZZA 4MJ2A 5AHIA 4YVXA 3AUJA 1TJ2A 4GOAA 1UASA 4LF1A 5IHSA 3EWCA 4MIMA 4JTTA 1IF2A 3GDRA 4H8UA 4GI8A 3CH9A 1B3WA 1NF7A 3T2QA 4AZCB 1LRTA 4E8GA 1BGGA 3LCIA 3MDUA 5AHEA 3K30A 3EKGA 1VBGA 1KBLA 1F9CA 4MLJA 2XH4A 5M03A 2ZTJA 3UA3A 2IQDA 3UETA 2PDFA 2TODA 2PU1A 2WOQA 3NDOA 3M5YA 1ZLPA 4JTQA 3PFRA 4HIBA 1CTNA 2DT1A 3I7QA 3W7CA 1TMLA 1YADA 3CXOA 4XVEA 4YVPA 2JBMA 2OOFA 1V02E 3CTTA 5BWAA 1B4KA 4KRUA 4AHPA 3N14A 4L61A 1ZL1A 1F4HA 2H3BA 4G7EA 5F2GA 1GPWA 2GDVA 4V27A 3MO7A 1OX4A 1YDYA 2WSQA 1F61A 5HWNA 2WMJA 1MI3A 4JN7A 4H7VA 2BVTA 3MT1A 1JJKA 4EF8A 1V3JA 2VVSA 1EBHA 3N2CA 4JICA 3HF3A 3UF9A 4MKSA 2YX0A 4BWLC 1KWKA 2YJQA 4UOJA 1ZBWA 2FGBA 2KZHA 1U83A 4DBSA 2HMCA 5G2WA 2XVKA 3GVGA 3G1RA 3L65A 3FHQA 1OADA 3EDFA 4ERGA 1GVQA 2Y5JA 2Y7EA 4B3ZA 4D9PA 1UA3A 4C60A 3OP2A 4YHGA 3ITVA 3KTXA 2G4FA 3BPWA 1VLWA 3ZWSA 1SM9A 3FSTA 3WDHA 3E3HA 4QQUA 3VM7A 3BV4A 1K3UA 1MXSA 4EKJA 3HQNA 4ORIA 3MHUA 3QM3A 2QMJA 2HXUA 3ABSA 2OQYA 2CFFA 3RLVA 1PUDA 3GHSA 1AD4A 2PRMA 4FHAA 4Q32A 4LBUA 3SRKA 4IHCA 3BAJA 4M6PA 1BHGA 1WDWA 1QO2A 4K39A 2GQ3A 4XZNX 4D72A 4KCUA 3K4WA 2VX6A 2W6RA 1MXDA 3UG3A 4MNJA 1BLIA 1TUXA 4AC7C 3FGCB 1GOMA 4UCGA 4B90A 3CV1A 5DY2A 3QC0A 2PU0A 2Z25A 5CC7A 1MQQA 2EJAA 1Q7MA 3KBVA 2YA2A 1YBQB 5GNXA 4TV5A 4IISA 3VNMA 3H7RA 1K8ZA 5A6KA 1ZQ5A 4UTJA 1D3CA 2DP3A 4LRTA 4PUJA 4XSMA 2OMAA 3MB9A 4HA1A 1E56A 3W1NA 3UZWA 3NZ1A 1V6VA 3ABZA 2BODX 4JN8A 3I65A 4AWEA 1KTBA 3EA1A 2YBTA 1F73A 4NZCA 5GVJA 2RDWA 2F6KA 4A8NA 4O19A 2QPSA 2E77A 3LM7A 4P7RA 4YMZA 4UOZA 5LIUX 1QOPA 5A8QA 4GINA 1HF6A 4BQ5A 1UJPA 1EOMA 4EPBC 4XUYA 4RE0A 4N6FA 3XISA 4M24A 3WQVA 2BY2A 2Z29A 1MW2A 4UMAA 3TW7A 4KFOA 3IK2A 4AAJA 1E6SM 3HJEA 3HGJA 3KS5A 1N8FA 3EDEA 1C92A 3CAKA 1VPYA 4FPSA 2YDQA 4JGDA 1S2AA 3NSXA 3W70A 3EOUA 3DIPA 1VPXA 4B92A 1WCGA 2YDAA 4JHOA 1U1UA 1W1ZA 4AHQA 1V0MA 1HL8A 4H19A 3OA3A 3GYCA 2CERA 3Q45A 3VFLA 1EZ2A 5A94A 3LQLA 1LOQA 4BQ4A 4BEQA 3VKBA 1ME8A 2JGYA 5EMKA 2VWSA 4O16A 1DJQA 3W75A 3HFYA 2VEPA 2DZVA 3GW3A 3QYQA 3WQFA 4W4QA 4F2TA 4JEQA 4DIAA 1L2QA 1C3FA 3WL0A 4IWWA 4IMEA 2G37A 2GGGA 1EJUC 4S3DA 2XJ7A 2HBXA 5DEZA 3GUWA 4Q6JA 1OK6A 1XBYA 2ZXDA 4QITA 2QAPA 3C2OA 2NW0A 1W56A 3E12A 4JNMA 4Q8UA 2OELA 3KL0A 3SQMA 1UMLA 3P67A 2TRSA 4Y9PA 4NAEA 2PGRA 1UKOA 2D0GA 3MJYA 4JTGA 3M0HA 3S46A 3PAOA 4YWIA 2E0PA 3L4UA 4EP8C 4AIUA 5BOOA 4HNNA 1AW5A 1Q4NX 1U5HA 3L0NA 1WXYA 4HCHA 1IV8A 1TG7A 3LY0A 4XTIA 5K4ZA 1OYAA 4WKAA 4MNKA 2V6AA 4RNIA 4AWUA 2SFPA 5FEWA 1GVYA 1UD3A 4ZA0A 4HOZA 3CJPA 3A23A 3S2CA 4N42A 2PP3A 1TX0A 3CUXA 1I0BA 1WDRA 4YWSA 3BZGA 1QK0A 2J7EA 1A47A 4UFMA 3WCZA 4UTTC 1DORA 3F03K 4YHEA 3IGUA 3A4JA 3VIOA 3FXYA 4Z1CA 3SCNA 1F5ZA 4J7RA 4GVHA 1ZCCA 1SFLA 3SO7A 3VKDA 4CQAA 4WJ8A 3WUFA 3UQNA 5C55A 1SPQA 1YE4A 3VGDA 4JIEA 4WY0F 3W85A 1PWMA 1R87A 3LLDA 1G6CA 2ACSA 1V6UA 1HXJA 3BWWA 3RNDA 1BYDA 4IXXA 2MUCA 3APGA 3NEVA 3RIKA 2GSHA 3TWBA 1Q6OA 1UQZA 2B7PA 2QKFA 4PMRA 2QJHA 1GOXA 3KHJA 3K13A 4G2DA 4RW5A 1P0KA 2IUZA 3VAVA 4GA8A 1G1YA 1QPKA 4M82A 2NXIA 4JTHA 1EYWA 3GXNA 4M51A 2HV5A 3EB2A 1LDCA 3E0VA 5D9NA 4XO7A 1VFUA 4J2PA 2YGYA 2ZX8A 3DCPA 4HMEA 4DUVA 3DERA 2DZWA 1JUBA 3N6JA 3SUSA 1GVOA 2UY5A 2OX4A 4QBXA 3LV5A 4AY1A 1XIJA 3WBEA 5ABTA 1E0XA 4QG8A 2VZOA 3ONBA 3TYCA 1T0OA 3LGEA 1DKWA 4KERA 1P7TB 4AB4A 3WYZA 2OWXA 4Q8QA 2JK2A 4E4UA 3STPA 2BLEA 4UUIA 4DLFA 3WUGA 1AJ2A 1Y65A 1LLWA 2NX9A 3DGRA 2D24A 5DQPA 3B9NA 4HA4A 4UTMA 4DBDA 3OU8A 5G4WA 2FFCA 4LVDA 1YBQA 4O13A 2Q8XA 6CGTA 1C8YA 4GZEA 5H8UA 4TU1A 4O50A 4KFPA 1R2TA 2ALDA 4Y9AA 5EMYA 3OHIA 5HNTA 2E5BA 5EMMA 2BS9A 5CGMA 3SFKA 4GISA 3E49A 3UR8A 3GH5A 4AUBA 2PD9A 3CEPA 4LS1A 2BSLA 3ARVA 2YXOA 3E0LA 2Y62A 4GLEA 1HKWA 4ZQRA 5AHMA 3UG5A 2CLPA 3ZSSA 3BW4A 1TJ1A 1QPQA 5DBUA 4LAMA 5RUBA 1POKA 5I2UA 3BVJA 4IP7A 1X39A 3ANYA 2O55A 1SW7A 4N4PA 1QO5A 1CENA 4HT3A 1GYLA 2WVSA 1TSIA 1FHDA 5I23A 1UZDA 2ZKMX 3CUFA 5HNRA 3WKZA 3A12A 2DW6A 3B8SA 3PTKA 2AL2A 3EMCA 3UWQA 1YHTA 1Z44A 4AZ7A 1MW1A 3MV01 3CWHA 3PB0A 5G1MA 1BXCA 2HDJA 4ASTA 4O0ZA 1JZ8A 1H7XA 1FQ0A 1GW1A 2ZOXA 1PCKA 1XCFA 5FIPA 1OZMA 3IIPA 3A6OA 1FWTA 2QJIA 4LYKA 4WUIA 2DVUA 3KBWA 2MANA 5AYYA 4IQEA 1RP8A 3WNLA 3R25A 3NL2A 3LU2A 5C9ZA 2IKGA 3G6LA 2OZTA 1QHPA 1VJSA 1XLKA 4P61A 3UD6A 1N2VA 2QF7A 1S5WA 1BD0A 4FR6A 4BQ3A 4W8AA 1RBAA 3WJWA 1KXVA 3VCNA 5F2LA 3ARTA 3M5ZA 5D8ZA 2WZMA 3MSGA 4FZIA 4OOUA 5K9CA 3QSTA 1M9HA 1QNQA 5E70A 1J12A 1E5NA 2VGGA 4MWAD 4C91A 2CCRA 2PI6A 4FXSA 4EPKA 1QI3A 2YCEA 3WY1A 1S38A 2EHHA 4J35A 1HVXA 2IXUA 1E9LA 3HV9A 3SY1A 4RXFA 4A8RA 1HKIA 5IBXA 3G24A 4QS5A 3EYPA 5E5CA 2VFEA 1H50A 3ZT6A 3H2MA 4W7WA 4XO6A 1NARA 4DJEC 3ABRA 2ZRYA 1TV2A 1O5XA 4R3UA 3N18A 1H1ZA 1XPYA 1SQ7A 4U31A 3ENLA 4LX4A 4J3TA 4PN2A 4HPHA 6XIMA 1ME9A 2FHFA 2BWGA 4PMJA 4WSHA 1WDQA 4X0VA 4RNFA 3T1GA 4LV4A 2GK1A 5KINA 4BFAA 3KWSA 1K4HA 1PDZA 2YA0A 2BZNA 2D3LA 1KGUA 5CG0A 4UR9A 4F8XA 1U5VA 1CXKA 3GZAA 4JIPA 2XFRA 4HN4A 1O5RA 1G4SA 4B5UA 2E6FA 2V3EA 4DJDC 3WBAA 1UR4A 3L5MA 4NXKA 2YL8A 4WD0A 4DNMA 3CUGA 4XD6A 3FX4A 5CPMA 5FEZA 3VYLA 2Y61A 3ZYZA 3M41A 2V5BA 4J2MA 5K9DA 3PP7A 3TJ4A 2CHOA 3ZJKA 3KBSA 4Q4QA 4JTKA 3W24A 2Q8ZA 1TCDA 3V75A 1H7NA 1V7AA 3E96A 3LRMA 3VOFA 1M03A 1I2OA 1UA7A 4K6AA 4KWOA 2AL1A 4LC8A 4PR4A 3WFZA 4C6NA 1GVEA 6ALDA 4Q33A 4EOUA 4NAFB 4ICMA 3MZNA 1I45A 4QSFA 4MFEA 3S8HA 4DB7A 1U22A 2PDHA 3LXCA 3VNYA 3G3DA 2B4GA 4POCA 3AIWA 1CBGA 3N11A 3A4WA 1A5SA 4O4WA 1KV8A 2PDIA 1MWOA 3BJTA 4D71A 1ICQA 1OD0A 1H0GA 3R8GA 1ZNNA 4N02A 1PV8A 4UR7A 5HR7A 5KZDA 1JF5A 1TPVA 3CNYA 4K7YA 5KITA 4JX6A 2HVMA 2DEPA 2FYMA 1B5TA 3HPSA 2Z26A 1EQPA 2FZDA 3BLPX 3GDBA 5BROA 5D2WA 3WF2A 1EO5A 2E67A 4HYRA 3TKFA 2ON3A 2VR2A 1PVNA 5BWFA 1ZBVA 3TVAA 5FJIA 3S2LA 2PURA 2OVLA 4H6KA 3M0IA 2X42A 3NAVA 2QUTA 4PA8A 4J3XA 1LL7A 3SJNA 3EMQA 3IVUA 4LFYA 4NNCA 4R27A 2GQ8A 2YIHA 1SJDA 2F2HA 3VIJA 2YA1A 3DI0A 4AD1A 1E0UA 1FX6A 4FLRA 1XICA 1P48A 4M3PA 3AHXA 3OYXA 9XIAA 5F2IA 5HULA 1EGZA 2OQHA 4U28A 2OXNA 4REQB 2OQLA 2X0YA 3ANVA 1U1JA 3WLIA 3SRFA 3GTIA 4KGLA 3N19B 3QR3A 2ZYFA 3PBVA 1QAPA 3QOKA 2WSRA 2OYKA 1TTQA 1D7KA 3GG7A 3UZ5A 5FJRA 4HBKA 3I10A 1H5YA 1IIHA 2QXWA 3PTQA 2DQXA 4C1LA 1FA2A 2OSYA 2W63A 2ZWYA 5BXPA 1CB7B 5I77A 1WBHA 4R85A 3VD3A 4AQLA 3WN6A 4E8DA 2J13A 5HBFA 3BDKA 4FNSA 4I6VA 1IEXA 1TV7A 4XAYA 3FKRA 2Z27A 3CQKA 4JTJA 4LCSA 3L68A 1NFBA 1WQ5A 4DZHA 2NLYA 2XN0A 3NFUA 5LYRA 4E3VA 2WKLA 1RQEA 4E38A 1K03A 2DZTA 1F07A 3BLKA 3P6LA 3GR8A 5ABGA 2QCHA 4L9YA 1SSDA 3BJSA 1NU5A 1E0WA 2HBVA 4S39A 3IJ7A 3MANA 2VFHA 2NXGA 5HWJA 4RNHA 4XISA 3TN6A 3EPOA 4N9BA 3G1YA 4ZB5A 2HJPA 1CWYA 5CQ1A 3V16A 1YXDA 4HMNA 5CKSA 1XI3A 3NQEA 1E6RA 1HNYA 2YZ5A 4DO6A 4O0QA 1ML1A 1ADSA 5MF5A 4E2OA 4I9AA 5DXYA 5FCZA 3PC0A 3EEZA 1XYBA 2Z2AA 3T0AA 7TAAA 3H2OA 1Y7VA 4HJFA 3RPDA 3U6WA 3DDMA 1SZFA 2UZ9A 3LXBA 4BWLA 1YQ2A 3CH0A 3DAQA 3Q4DA 3FS2A 4IJBA 3S5OA 3M6YA 2BY0A 1EDTA 3GR4A 3EA3A 5LA1A 4YN5A 3EX2A 4NUWA 2JIWA