1OCQA

Complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution with cellobio-derived isofagomine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct Observation of the Protonation State of an Imino Sugar Glycosidase Inhibitor Upon Binding
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2003-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ocqA00
1KWKA 4W5ZA 1GONA 5DT5A 3NUKA 4JL2A 3UG4A 1VFUA 3EDKA 1UH3A 2W91A 3CHCA 1GQLA 4M80A 1E6PA 3W6LA 3AZRA 4D6JA 2CKRA 2XSBA 4PMXA 1VFOA 2BY3A 3QHOA 1HKJA 3VM7A 4UOQA 3EMQA 3UR8A 2VR4A 4P7QA 4UOZA 3CHDA 3U57A 4KRTA 4ZXOA 4GQQA 2CHOA 4URIA 1B3YA 3NSMA 3W28A 2DT2A 3G6MA 3PZVA 1PZ3A 4D6DA 1V0LA 5EB8A 4PN2A 1FP9A 4GIAA 4ZE5A 4M56A 1MW0A 1E1EA 4UQDA 2XVKA 1GQJA 2WMHA 1NARA 2X8RA 1BVNP 3WNLA 5CSUA 1HJQA 1EIBA 3ZO9A 5A6BA 4AZHA 2RGLA 4OOUA 1W1YA 3A6OA 3SURA 4BQ3A 2VCAA 3AS2A 4MDOA 2CERA 4TUFA 1FH9A 2WVTA 4PTVA 5BCAA 1V3MA 3SCOA 2OWWA 3PZNA 2YL9A 1K9TA 4QFUA 4JIEA 1BVZA 5D4YA 1SMDA 4NSBA 3MUY1 5A8MA 4D6FA 3WSUA 2YJQA 1V3LA 5AC5A 1PEZA 4GI6A 3GTNA 1GPFA 2A3CA 2J78A 3AIEA 3K4AA 2JF6A 5FCZA 3RCNA 2ZX9A 3KE0A 2A3HA 3VGDA 2WCAA 3W38A 3I3BA 3BMVA 2OLHA 2XWDA 5C71A 5FIPA 1KGWA 2WM0A 3AHYA 4U5IA 3VX1A 5A2CA 2ZXQA 4BCEA 1UD4A 5E9AA 1FP8A 7TAAA 1VBUA 2WBKA 3MU7A 1JD7A 1ZBVA 1EXPA 2YA0A 1UQYA 3FAXA 1KXTA 2ZXDA 3UR7A 3ECQA 3DC0A 5FD0A 2D2OA 3K8LA 4AZ5A 5BRPA 2E0PA 2DSWA 3W25A 3WELA 2WKLA 2C0HA 1VENA 2GFTA 1GHRA 1QNSA 1R7OA 2DPEA 3KL5A 3AYRA 3FXYA 1K9FA 2FHCA 3WDIA 2VOTA 1HVQA 2PB1A 3I3EA 2ZWYA 4A4AA 3AXHA 3HN3A 3N1AA 4U33A 4GINA 4OIFA 4GZJA 2X05A 1J10A 4PTMA 3TTYA 4ZE4A 4CU7A 1MXGA 1QNOA 1GVIA 3W53A 4BQ4A 4XUYA 3EBVA 1HIZA 3BGAA 3N04A 3WNPA 2J77A 4JFSA 2Q8XA 1V6UA 2XVPA 2BHYA 3SCTA 2IUZA 2EXOA 2D24A 4GQRA 2GJPA 1G9HA 2VMFA 3NSXA 2GJXB 3MMDA 1OGGA 4PMDA 2WZHA 4ML4A 1UR2A 5E0CA 1V03A 3AIVA 4X0NA 1G5AA 3W27A 3VIHA 1ODUA 3RM9A 3T0AA 1EDGA 4P7LA 3W29A 1NOFA 4ATLA 5A8PA 4HA4A 1R85A 1XHGA 4IPNB 3WMSA 3SUSA 3F5LA 3K1DA 2WWDA 1BGAA 5CZKA 2NW0A 2UY2A 4PMYA 1ESWA 1E6SM 2GDUA 4MDPA 1W1TA 4WIWA 4AY1A 4GO8A 1OBAA 3FAWA 5D8ZA 3B9EA 3WD3A 1X6NA 4AISA 5A6SA 1TFVA 1W9BM 3SCNA 3OGSA 1LL6A 4RE2A 1ZL1A 1GOOA 3CZLA 3EDEA 4KGJA 1JZ8A 1QI2A 3ZSTA 1D7FA 4LYQA 3F5KA 1GOMA 5AYIA 4DWSD 1E71M 3PZGA 1WE5A 4WLCA 2DSZA 1V02E 3ZJ8A 1XGZA 2O92A 2YBTA 4N42A 3KEHA 1GOKA 3ZR5A 2W62A 1G0CA 2VURA 3MSGA 2JE8A 4DWSC 1JYWA 1H1NA 1C7TA 2V3EA 1O6IA 3PHAA 3VGFA 4CGTA 1FA2A 5I3DA 2XUCA 5DMYA 2BNJA 2FH8A 3AHZA 2YL5A 3OLGA 4HMEA 2HVMA 3W6MA 2WHLA 4MNKA 1W32A 2WK2A 5CSYA 3WUFA 1J0YA 3IK2A 3CHEA 4C7GA 1E6XM 3OBAA 3WFZA 5HOSA 1FH8A 1HKIA 2QV4A 3GM8A 1E55A 1G94A 1ECEA 1S46A 2BY0A 3CZGA 4F9JA 3RJXA 2OSXA 4TX6A 4WKFA 3BLPX 4J28A 4W7UA 2YDQA 4UNIA 1MQPA 3O9NA 3VIIA 1VJSA 5HNNA 4ATWA 4MAVA 5HXMA 3PZ9A 3L4XA 3AMKA 3VOCA 2XTKA 4AD2A 1C8QA 4GZEA 2OYLA 4N0RA 4AD4A 2J79A 4JFTA 4JFVA 1JZ7A 2VO5A 4W89A 5GPRA 3TTQA 1E6NA 2XWEA 2C7FA 1HJSA 3GXFA 1C91A 5C8BB 4W85A 1XCWA 2XVGA 4WKAA 4HU8A 8CGTA 2O9RA 3WH8A 1LWJA 3U5UA 1XRVA 5ABHA 4KRUA 4AZ7A 4MNMA 2WVVB 3WD0A 5GNYA 5A2BA 3ZT6A 3AJ7A 4KH2A 2JFEX 4OJYA 2WMIB 2FH6A 1EO5A 2VZUA 3DYMA 3AQUA 1UWTA 3AIBA 1HVXA 1MW1A 4UFJA 4MNLA 5IXEA 3BH4A 4JKLA 1KCKA 1MYRA 4D6HA 4UFLA 1DWIM 3PZMA 3WMCA 3DHUA 3CZJA 4PMOA 1UR9A 2J7EA 1ZJAA 4PCSA 4W8LA 3WN6A 4W87A 4HA3A 1C3FA 1CPUA 1I1XA 1OINA 4F79A 1B1YA 4JCMA 4CU6A 1E56A 4H2CA 4MJ4A 1ODZA 3VKKA 2WHMA 4RE3A 1IT0A 4BZYA 3VD4A 2J7FA 2ZIDA 1FFQA 1F4HA 2AAAA 3MMWA 1L0PA 1QBBA 4LPCA 4X0VA 4DM1A 4ACZB 3ZT5A 4HPHA 1V0NA 2D0FA 3BAJA 4LQ1A 1JYVA 2WBGA 3ARPA 4UQEA 4UR9A 2PC8A 4F8XA 2CBIA 3PBGA 1TA3B 4AC1X 3WENA 2CNCA 3AFBA 3CZEA 1XV8A 4XB3A 4B3LA 4Y7EA 2ZUTA 1OSEA 3OLIA 1NOWA 1AMYA 4MPKA 4V2XA 1GOWA 1AQHA 5A69A 2E3ZA 3NCOA 5AY7A 5HPCA 2X2YA 1PIFA 4A3HA 5I79A 1WZLA 2WC7A 3B8SA 1UR4A 3SEPA 2AMGA 4PEEA 2D22A 4P7NA 3RILA 3IAPA 2CCRA 2WW5A 1VFFA 3AIRA 3FNDA 4L4PA 1OGSA 1E72M 5A6AA 4YN5A 5GQBA 1NWTA 1GW1A 1M53A 3GXIA 1A47A 1JAKA 4H04A 1UG6A 1WZMA 2BFGA 1CXEA 3LPGA 1UD8A 4JFUA 1UA3A 5D9MA 5DT7A 1UH4A 1JZ6A 3ARZA 4KMQA 2E9LA 3VX0A 3ALGA 4W84A 4M24A 1UQZA 2FGZA 1I75A 1Z32X 1OT1A 4CD5A 4LX4A 2J74A 2W5FA 3LPOA 1PX3A 5JIWA 1UA7A 4AZCB 4YPJA 1HNYA 1HJXA 1E4IA 3WUEA 2PBOA 1N82A 1NWSA 3CZ8A 1DWJM 1JZ4A 3WDRA 2F61A 1LLOA 2WMIA 3WDPP 5JUVA 2CBUA 4L4OA 1UYQA 2YDRA 1E9LA 3W4RA 1CWYA 4H8UA 3BAIA 1QI3A 4M8UA 1RP9A 3UG5A 2J8FA 2VRQA 1E4MM 3ARSA 4GKLA 5GNZA 4PMZA 2BXYA 4Z2GA 5A1AA 5I6SA 1XD1A 2X09A 4JCLA 1W1VA 3FN9A 2NSXA 3ZT7A 1J0JA 1LG1A 1Q6FA 4AD1A 4DUVA 1E0VA 1EO7A 2VZSA 1GCYA 1OD8A 2CETA 1EDQA 2VX7A 3OG2A 5A94A 3UCQA 4CCEA 1UR1A 4QCFA 1ZB5A 3WH6A 3M7SA 3AI0A 3OLDA 3AS3A 1CLXA 1GOIA 2WLZA 3S6TA 3ZJKA 3CLWA 3AROA 1V3HA 2IXUA 3WL0A 1PPIA 5EMYA 3T08A 1EH9A 3W24A 2YDSA 1QW9A 1K9EA 2CBJA 3AMCA 2BVTA 2EPMX 1K6AA 4J27A 4LGXA 1E1FA 3VIOA 1U2YA 3WQ6A 3NDZA 3VDBA 1B90A 3AYSA 3A47A 4IISA 1OIFA 3WH5A 1BYCA 3VD5A 1J0HA 4TXEA 4PTXA 5I23A 5E0FA 2VL4A 3ZOAA 3OB8A 1TVNA 2WKGA 1NP2A 4E8CA 2DSUA 1QI4A 2XFFA 3SCPA 1XSIA 3OGVA 3MO4A 2G3NA 1LWHA 4S3KA 1D2KA 3VIFA 4Q22A 1WDRA 4WSKA 4ACZA 2XGBA 4HMDA 3WMBA 3VD9A 4HOWA 1QPKA 1M03A 2ZXBA 2JEPA 2GK1B 2W61A 7A3HA 5I24A 2YIHA 4NI3A 3AXIA 3BSGA 4V28A 5EFDA 3WDJA 3D5HA 3TONA 2YBUA 1OD0A 4AIUA 3VVGA 1C8XA 2VVSA 1NWUA 3ARTA 5F7UA 3PN8A 2UWFA 3IJ7A 3BMWA 1BTCA 1HKMA 4Q7NA 2VQTA 3AMLA 4WKHA 1UWUA 4EE9A 5A6LA 4JKMA 2Z1KA 2X0HA 3N9KA 3VIPA 2EPNA 2V38A 1UZ4A 4CN4A 2EBNA 2B31A 1UKPA 4EKJA 5CGMA 1V3JA 3MKKA 1V3KA 4RL3A 2A3BA 4UQ9A 1R8LA 1YHTA 2ZX5A 4AW7A 5A95A 1CGWA 4B3KA 2DDXA 1M7XA 3ARUA 2E9BA 3MUIA 2J75A 4MTVA 4C7DA 2WMGA 2G41A 1ITXA 2WYSA 1FH7A 5A8NA 1A3HA 1H4PA 2GJRA 2D20A 3BCDA 1J01A 1MVYA 1XYFA 4YHGA 1U33A 2V3FA 4CUCA 3QOMA 4MB3A 4P7OA 5CQ1A 4OBSA 5E6ZA 4W7WA 3WIJA 1GJWA 1B9ZA 2YA1A 5BWFA 1ISVA 3L4WA 1TG7A 1DP0A 1H49A 1J18A 3ZR6A 1KR1A 1LF1A 2VCBA 1E0WA 3GXDA 3THDA 3WDQA 4AYSA 2UY3A 5EBAA 1PX4A 1HP5A 5I5RA 3VGEA 3T09A 3VNZA 3DECA 2OSWA 4AD0A 4QCEA 1W9UA 3PZUA 2JEQA 3WL1A 3WUGA 4DWSB 3UERA 5CJ5A 1E0XA 1Y7VA 1BPLB 4BA0A 1H0IA 1J11A 2V3DA 3ARYA 3BAKA 2DEPA 4WK9A 1SMAA 1QNQA 1H11A 1V6VA 4TTUA 1CGXA 1VAHA 4UFIA 3N12A 4D72A 3BAXA 2BVDA 1B3ZA 3AIWA 5JBFA 1MWOA 2J7GA 4AXNA 3HJEA 1LL4A 2BS9A 4UCFA 4QLLA 5A6JA 2D0HA 2W66A 3F5JA 4UFKA 2ZUNA 1PBGA 1W3KA 3TA9A 2WMKA 4TOQA 3AHTA 3WDHA 5ABEA 5BRQA 5E6YA 1EOMA 2XYLA 5AYBA 2ZWZA 2G3MA 2EO7A 2OYKA 1PIGA 3NSNA 2PWFA 4FLQA 1ZJBA 2XVNA 3OZPA 3PTKA 5HBFA 3GH7A 1KGXA 2TAAA 2DT0A 2J47A 4BQ5A 2EJ1A 1Q6CA 1BGGA 1VF8A 5LA2A 1UWQA 1B3XA 1CEOA 5DO8A 2X0YA 1QW8A 2WVVA 3VPLA 2J8GA 4BS0A 1W2PA 2DIEA 4HOXA 4CU8A 2WC3A 1GJUA 5HDRA 2PWDA 1E6ZA 3AIUA 1AQ0A 1E3ZA 1XH1A 3O2LA 4AZCA 1U30A 5DF0A 4FLRA 2D1ZA 1FHLA 3SCRA 2CBVA 2J4GA 1UR0A 1NOUA 1E70M 4XX6A 2VZVA 4PMQA 1EA9C 1H09A 2XFRA 1TVPA 5ABFA 2Y8VA 2WCGA 3VIKA 4UQAA 1V6WA 1UHVA 1JIBA 4HP5A 2A3AA 2ZX8A 2WLYA 4HA1A 2ZUUA 4BF7A 3B9DA 1B0IA 1DTUA 1NP0A 4P8VA 2W63A 3K8KA 3BAYA 2OSYA 2YL6A 4FF5A 1JZ5A 3AHXA 1QHZA 3EMCA 4UZSA 3HMCA 5AC4A 3L2LA 3QOKA 1CLVA 3VIJA 3K8MA 5CLTA 5CGTA 1X1NA 5IDIA 4HU0A 4AD3A 1CXKA 2WAGA 3WBEA 3WFLA 1PJ9A 1CZ1A 1E40A 2J62A 5DEZA 3F4VA 4NF7A 3BAWA 2PBGA 4UTFA 4W5UA 3AOFA 3PZTA 4CCCA 1WPCA 5E09A 3RIKA 2CPUA 1JZ3A 1P6WA 4PMUA 1OCQA 1Q6GA 2W92A 2O9OA 1DWGM 2QMJA 3MMUA 4AZ6A 1QNPA 4KGLA 4J3WA 1UZ1A 2E8YA 4CD4A 1JI1A 4OOZA 3WQWA 2E8ZA 2Y5EA 3NIYA 4LYPA 1HL8A 3T0DA 1GUVA 3RM8A 5I77A 5CG0A 2BHZA 5M3WA 4Z2LA 4PUEA 2ZX7A 1WCGA 3FW6A 1SYTA 1TUXA 4Z2JA 2VTFA 1CXLA 2MANA 4AIEA 1PZ2A 3ZJ6A 1H0GA 1E15A 4ZXLA 1TR1A 1E43A 2VRJA 4UQBA 5I0DA 4QLKA 4HPGA 1IV8A 4JHZA 3VGBA 4B9ZA 2F2HA 1VIWA 1HJVA 1CIUA 3IANA 2OWCA 1LL7A 5D9NA 3VGGA 1JXJA 1BYAA 2VR5A 1XC6A 3JUGA 2XIIA 1OWQA 2WMFA 1C90A 2J7DA 4GPNA 3WQ8A 4F66A 1DHKA 1VBRA 3VO0A 3AZTA 1DWAM 1UKSA 4XV0A 3DHPA 5IHSA 3T2OA 3VU2A 1CENA 1UR8A 3DYOA 1D3CA 3EDDA 4GI9A 1JFHA 1EGZA 1NH6A 2UY5A 4H8VA 1IZJA 4QAWA 3LPFA 4KWUA 4K68A 4MADA 2IXVA 1WDPA 4JHOA 3J7HA 5M17A 3T2PA 1V02A 4EANA 2QPSA 1W91A 3AMGA 4LYRA 4W7VA 2J7HA 4DUWA 3VDAA 1UD5A 5D9PA 2WC4A 4IPLA 4PSPA 3VUPA 1XH2A 1H3GA 3N13A 2CIPA 2EPLX 4NZCA 2YA2A 2VX6A 2Y2WA 1V0MA 3QHMA 2XIBA 4MNJA 3GH5A 3SUUA 5A8OA 4HZ7A 4U2ZA 1W9VA 2D3LA 1RP8A 2GVYA 3CUIA 4WF7A 1IZKA 5CPSA 5BXPA 1VJZA 3TTSA 2DT3A 2J7BA 3WH7A 4H8HA 1GQIA 3NDYA 3VDCA 4Z2HA 1HP4A 5LA1A 1JZ2A 1UKTA 3GBDA 4H41A 3RMEA 3SCVA 3E1F1 1HL9A 3WQVA 3ZM8A 2UY4A 4AEFA 3WQ5A 3CUHA 1B31A 1GZJA 2GJXA 1HJWA 1EHNA 1KBKA 1SR0A 2VNCA 4AD5A 1ISYA 1W9PA 5D9OA 1VEPA 4D71A 2PF0A 1GQKA 2V3GA 2PWEA 2WNWA 2BV9A 4JFWA 1X6LA 3M6DA 3A4XA 1BF2A 3NJ3A 3O6AA 1KGUA 5KEZA 1WZAA 4Z2KA 1E6QM 1JAEA 3BCFA 4V27A 4ZFMA 3BSHA 2ZE0A 3CIVA 2WSPA 1MW2A 3ZSSA 1KWGA 1KCLA 4EAMA 3N18A 4CD8A 3CUJA 1G01A 2A3EA 1JNEA 2RGMA 3T2QA 3UG3A 6CGTA 4XZWA 1EDTA 2WVSA 1W1PA 4UQCA 4PMVA 1BSIA 4WJXA 4M1RA 1V6YA 3M46A 2DSKA 3VMPA 4QLJA 1E6RA 2CHNA 5BYWA 1J0ZA 1C92A 3ARXA 2VT0A 1HN1A 1UOKA 1BG4A 1H2JA 3VNYA 2XM1A 1JXKA 1JYNA 3WNNA 1OB0A 2GDVA 1UD6A 4FLSA 2E9MA 4R5EA 3SUTA 3VD7A 3WBAA 3VMNA 4GI8A 1ZBKA 2WZIA 3SCWA 3L4TA 2XPKA 3BC9A 3WQ4A 5IFPA 3AXXA 3VM5A 1JNDA 1UKQA 3A3HA 2W67A 3WF4A 1GORA 5FOOA 4JZ5A 4DM2A 4J3XA 1QVBA 1ISXA 1WB0A 1TE1A 5FKYA 2VZTA 3VD3A 5FL0A 3SCUA 5A2AA 4XZBA 4MB5A 4AEEA 4J3VA 3W37A 2EEXA 4W86A 4CCDA 1W3JA 1KB3A 2WB5A 3RO8A 1CNVA 1RD6A 1XD0A 3M07A 1CGVA 1OT2A 3N11A 3UESA 3OIHA 1B2YA 1CGYA 4C7FA 2ZOXA 4CD6A 1QHPA 4AZGA 4S3JA 3AICA 4J3TA 4ZEPA 3IJ9A 2CESA 2ESCA 5JBDA 2YL8A 1ITCA 1E3XA 1V3IA 1JF5A 3A4AA 2V5CA 4D6IA 4RE4A 9CGTA 1B30A 1SFSA 2O9TA 3W26A 3APGA 3GZAA 4WSJA 5CPTA 2PI6A 2FHFA 1W3LA 2BVYA 2VCCA 4EK7A 1XCXA 3GNPA 2WMJA 1UD2A 4P8UA 2DSVA 3CZKA 4BQ2A 1HT6A 4A3YA 1MQQA 4TX8A 3SUWA 4TVUA 5DFAA 4AWEA 1NWRA 1KQYA 2JIEA 2YLLA 2QPUA 1LQ0A 3SIMA 4PTWA 4E8DA 3WUBA 3GXMA 2Y24A 3L2MA 4QDMA 3VIMA 4PYSA 1WDSA 3WF2A 2WCSA 3VILA 4U31A 3OLEA 3N17A 3G6LA 1LJYA 1KQZA 1EQPA 1C7SA 1KXVA 1ZBCA 1BHGA 2VZOA 3MS8A 2QHAA 1W9DM 1US2A 1HX0A 4R27A 4F9DA 1QHOA 1W2VA 3KZSA 2WANA 4CN1A 2AOSA 4HOZA 4TVDA 1WDQA 1DWHM 1WO2A 3POHA 2J7CA 4P7RA 1BYBA 1GNXA 4JKKA 2XVLA 3CPUA 3TP4A 2YKKA 1WZKA 5IHRA 5D8WA 1BQCA 2QLYA 3II1A 3GH4A 3THCA 5CPQA 3WD4A 2WHKA 2GUYA 1E5JA 2NT0A 3HU7A 4ATDA 3CO4A 4DWSA 2X1IA 3MSDA 1CXIA 5I78A 4NRRA 1UWSA 1GHSA 2XHYA 3LPPA 2VC9A 3GNRA 1EOKA 3CMJA 4NRSA 2YLAA 1W9XA 1MXDA 2J25A 3UEQA 3AHVA 1AVAA 3ARRA 1XSJA 6A3HA 3KWXA 4PCTA 2G3IA 1NM9A 1CXFA 1VEMA 4OKDA 1CGUA 3L4ZA 3W82A 3SUVA 1JDCA 4PUDA 1W3HA 2F8QA 3WNMA 4ZENA 4FMVA 3K46A 5M5DA 1WNOA 4CKQA 4IM4A 1JDAA 2XSAA 1V0KA 2EPOA 2FDMA 2DGAA 3U7BA 2ZUSA 1JL8A 1QBAA 1J0KA 3CUGA 2QF8A 3I3DA 3EYPA 1Q6DA 3AIQA 4PRWA 1HJUA 3WEOA 1Q6EA 7CGTA 3GBEA 2CKSA 3AISA 3AMDA 2VUYA 3AS0A 2EPKX 3VIGA 3OA5A 3QR3A 4W88A 4E4PA 1J9YA 4GXPA 3QHNA 4J3UA 1R87A 5JIPA 2ZUMA 3FHAA 2BY1A 3PZQA 1R7AA 1TMQA 3AZSA 1JGIA 3MANA 4MB4A 5ABGA 5C70A 3WD1A 3UETA 4HTYA 5CLWA 4LXFA 3KL0A 1ISZA 3VTRA 1BLIA 4D1JA 1C93A 5A6MA 4HZ8A 1JYXA 3RM4A 2PWHA 3K4DA 1TA3A 1CBGA 1MW3A 1H41A 1UH2A 5FL1A 4U3AA 1XYZA 4P8WA 4UFMA 2WHJA 4AZBA 4J7RA 5A8QA 2G3JA 3GNOA 4OZOA 2V5DA 3POCA 1VFMA 1HKKA 1FFRA 4U2YA 5A6KA 2VJXA 2WXDM 2DT1A 5LA0A 3IJ8A 2DQXA 2FGLA 3L4UA 5ABFB 3MV01 2WPGA 3NYDA 1GOQA 4AZIA 1OM0A 3CMGA 2CXGA 3IAQA 2G4FA 3KL3A 2D23A 2CITA 1E73M 2W4XA 1JF6A 4UOJA 1XH0A 4B15A 4HMCA 3CBWA 1PX8A 3LMYA 1BFNA 2VX4A 1MQRA 1ZBWA 2D0GA 3WNKA 1RPKA 3A4WA 3W0KA 2ZICA 1AQMA 3L4VA 1EHAA 2XG9A 5LYRA 1DWFM 1E5NA 4OBRA 1KBBA 3VDHA 5EFFA 4Z2IA 1R86A 1QOXA 1PAMA 1BAGA 1OIMA 4M81A 3ZJ7A 1B3VA 2E4TA 4FLOA 1BG9A 1GVYA 3ALFA 1BYDA 3U7VA 1M01A 3CH9A 2ZUWA 2O9PA 1NQ6A 4U3CA 2HISA 3ZMRA 3T0BA 3EMZA 4PMRA 1EQCA 4UFHA 1TCMA 2ZX6A 1CXHA 3MUAA 5ECUA 2EQDA 1UD3A 5M03A 3GYCA 1LG2A 2D3NA 1UWRA 3ARVA 4U5KA 2XM2A 1H5VA 3RDKA 4P8XA 1HF6A 3EDJA 1J12A 5GNXA 1M04A 2XGIA 2WVUA 1B3WA 2Y4SA 1ISWA 3WEMA 3WH9A 4D6GA 3QGVA 2WSKA 3CUFA 3PZOA 3WKZA 1US3A 1VRXA 3PZIA 2NT1A 4DUXA 4PBGA 1JG9A 4W93A 4AMCA 1CGTA 2VVNA 1JI2A 3DYPA 4IUGA 3BXWA 3S2CA 3PTQA 5I2UA 3B9AA 3VGHA 5TD4A 2XFYA 2Z1SA 1CTNA 1VB9A 4GO9A 1QI0A 2WWCA 3RJYA 3SCQA 3WF0A 4QP0A 2JF7A 1UUQA 4CVUA 5BXRA 2ZUVA 3WNOA 3SCSA 4OUEA 1I1WA 1HXJA 4MJ2A 5KZ6A 2BHUA 4TVCA 3PTMA 4B16A 1JFXA 4M82A 8A3HA 2BXZA 3CHFA 3GDBA 5A6BD 1KFWA 4W8BA 2BY2A 3ARQA 2GSJA 2XJ7A 4W8AA 4JL1A 5HPOA 1JD9A 1WP6A 3WEZA 3TTOA 3WF1A 4YHEA 4AIOA 3FHQA 1QNRA 4UZUA 3VINA 5E70A 3OZOA 4X9YA 2OYMA 1C8YA 2GK1A 4CN6A 2C8NA 4MAZA 3CTTA 3TOPA 3MUZ1 2Y8KA 1ZU8A 3CGTA 1YQ2A 1QI5A 5BROA 1CDGA 1O7AA 1CYGA 5BXTA 2VX5A 1JDDA 1Q4NX 1TZ7A 2E40A 2WZEA 1CECA 2G8ZA 3RPMA 4TTGA 1F4AA 3BLKA 1E4NA 3FY1A 1XSKA 4CD7A 2DH2A 4CVWA 2OWXA 5A3HA 1FOBA 4M29A 1L8NA 1MFUA 1RH9A 5JBEA 2PWGA 4JAWA 2ZXAA 2YOCA 3VMOA 3L4YA 3WY1A 2QMKA 3W81A 4D6CA 1V08A 4B9YA 1WAWA 2VRKA 4D1IA 4E2OA 5CXPA 4HZ6A 3U5YA 2CYGA 3D3AA 2DH3A 2CEQA 6TAAA 4J3SA 4H7VA 4MB1A 4ACYA 1V6XA 1G1YA 3AS1A 4FK9A 1E4LA 2JIWA 1UKOA 1MFVA 1WKYA 4GZIA 4D6EA 3ARWA 2VI0A 3OGRA 3MV11 2DIJA 1KXHA 1UWIA 4PMNA 1VEOA 5BXSA 1OGBA 1ZS2A 1K9DA 3N15A 1DEDA 4PSRA 5IFTA 1FHDA 1KXQA 3ZIZA 3WD2A 1J0IA 3ZQ9A 1KR0A 3EDFA 3WF3A 2FHBA 2JALA 2VQUA
chains in the Genus database with same CATH superfamily
4IPPA 4QS5A 5DT5A 3HQOA 3SN0A 3ABXA 3W6LA 3AZRA 2Y7EA 3NQ7A 2CKRA 2G3FA 2BY3A 3PULA 2Y62A 3QHOA 3KTCA 1HKJA 1Z69A 5BU9A 3UR8A 1FCUA 2DJXA 1GYNA 3CHDA 3U57A 4ZXOA 1TIWA 1IIHA 3A3XA 1Z6KA 1TUFA 1HTIA 1UC4A 5DCEA 2ZQ0A 3NSMA 1TMLA 2OQHA 1Q7QA 1DYSA 1TO3A 4D6DA 3Q2DA 1P7TA 1FP9A 1F61A 4M56A 1OQFA 2ISWA 1MW0A 3JU2A 3MQTA 2XVKA 1NARA 4NIRA 2X8RA 4DHGA 3GNNA 4JYFA 3QMSA 1HJQA 1ZZMA 3TYDA 5A6BA 3SGUA 2A6NA 3ZR4A 4UTWC 3DI0A 4BQ3A 3GR8A 4LUSB 4MDOA 5D2WA 1FH9A 4YXGA 5DY2A 1Q8JA 1VBJA 3SCOA 4DRSA 3NL3A 4DELA 3VKDA 3GG1A 1GVOA 1P5BA 4C6FA 2QIWA 3TC6A 3LM7A 4NSBA 2QDHA 4D6FA 2YJQA 4LWWA 1V3LA 1A53A 2LLEA 2PA6A 1YDYA 4B5TA 3MZ2A 4OT7A 4XAZA 4XVDA 3WLLA 4L6HA 1SZGA 2J78A 1ML1A 3M5ZA 3AIEA 4Q8VA 5FCZA 3EWBX 2A3HA 2W9MA 4WUIA 3W7HA 3FJ6A 3EX1A 4NL1A 3HG5A 3BMVA 3EA1A 3FIGA 1GYLA 3TIMA 4QHRA 4OWGA 5C71A 5FIPA 2HSAA 4U5IA 3VX1A 5A2CA 1UD4A 3MO7A 3UPMA 1AW5A 1TMHA 3MU7A 3NEHA 3RPDA 4AWUA 3ONBA 1L6YA 4GCAA 4ADTA 5GJPA 1KXTA 1PZ0A 1EJUC 4AZ5A 2IPWA 3WELA 3M16A 2WKLA 3C0QA 2DPEA 1ONXA 4V1XA 2XIOA 3L21A 6XIAA 2PDKA 4L1WA 3I3EA 2ZWYA 4A4AA 2D2JA 3EEZA 5H2ZA 3QTPA 2QCGA 4ZO8A 2QAPA 4IMEA 4OIFA 1MZRA 3IGSA 4L61A 1Z3NA 2AQWA 2ISSA 4UR7A 4XUYA 4Z0SA 3IGHX 2C91A 3W84A 4IJCA 2C15A 5FA5A 1DJNA 2CLMA 4JFSA 1VCFA 1O1ZA 2IUZA 2EXOA 4O4VA 4GQRA 4N6FA 1G9HA 2VMFA 3NSXA 3R6IA 2G97A 2GJXB 3MMDA 1IYXA 1N8FA 2X30A 2QYGA 5E0CA 1V03A 3QZEA 3W27A 3L0NA 2NXGA 3W29A 1NOFA 4HQVA 1UR3M 5F1VA 2GQ8A 1NFBA 2Z29A 3K1DA 2WWDA 2EHHA 4YVPA 2INFA 3LUTA 2UY2A 1UW9A 3NXLA 4PMYA 1TX2A 1XRSA 4AY7A 1LBLA 1E6SM 1K7FA 3E38A 4QGCA 4MDPA 4AY1A 4GO8A 3B9EA 1TFVA 3WBYA 3H8AA 4LCQA 1R38A 4WY0B 1HZYA 3OGSA 4C6DA 3MHGA 1NAL1 4UCGA 3QSRA 3DI1A 3BOFA 1JZ8A 3ZSTA 4DJDC 5KTLA 3F5KA 1GOMA 4F0HA 1E71M 4WLCA 4C60A 3CV7A 3PWIA 1A5KC 3ZLFA 2O92A 3UGRA 3UA3A 1LYXA 4O57A 3ZR5A 1TVLA 4EVZA 3MSGA 4IGMA 4DWSC 3S6DA 3DKLA 2V3EA 3PP7A 1MRQA 2BXVA 1O6IA 2QJJA 1A5MC 5I3DA 1OCJA 1XWYA 5DMYA 3E6EA 4KKXA 3W2MA 3TWBA 4HMEA 3KXQA 2HVMA 3W6MA 4N9EA 3CH0A 2ZRZA 3IS4A 4O1DA 4H83A 2YCIX 3G2GA 1YBQB 5I02A 4JY9A 1P6BA 4PGLA 3R8RA 4FSAA 3GM8A 1TTPA 2PDPA 2PDHA 1E55A 1S1RA 3TYAA 4EPKA 4TR9A 3Q67A 3GXTA 2HS6A 3CZGA 3MI6A 4F9JA 1TZZA 3RJXA 3REQA 3ABSA 5J5DA 2O4MA 4WKFA 3BLPX 3W7PA 2NQLA 6PTDA 1U5HA 3H2AA 2FVLA 1VJSA 4ATWA 4IPJA 4H9ZA 3OJGA 5ENLA 3L4XA 3KCJA 3MP3A 5AYYA 1FWBC 3OVRA 4KERA 4GZEA 2D2HA 3UXIA 5G1YA 1O68A 4DZ5A 2GOKA 4AD4A 4JFTA 1OX5A 4CLMA 1P1MA 1JZ7A 5GPRA 3TTQA 2QJGA 1E6NA 1RJPA 5KITA 4QITA 2XWEA 4I5UA 1YADA 4G5DA 5FJIA 1TWSA 3DOPA 2O9RA 3RU8X 3ZVHA 5F2GA 2O7SA 2AQOA 4ML9A 2YR1A 1EBHA 5AB3A 1BWVA 3WD0A 1D8WA 2HMCA 2DIKA 3GFZA 4AF0B 1EO5A 3EA3A 3DYMA 3AIBA 1HVXA 3JVAA 1T96A 5IXEA 4RXGA 5BNKA 3E0IA 3SO7A 1MYRA 4X60A 4HHHA 3WMCA 3CZJA 4K7VA 4KESA 1XIFA 3BURA 1UR9A 4H19A 1ZJAA 4PCSA 1GK8A 3W22A 4W8LA 1IQ8A 1CPUA 4LYKA 1E56A 3H4GA 1YYAA 3M4HA 2OGYA 1AK5A 5I03A 1S2UA 1FFQA 2AAAA 3MMWA 3QJAA 4LPCA 4DM1A 4MGGA 4QRNA 5FEPA 1XUZA 3XISA 2D0FA 3BAJA 4S3EA 3W72A 4GD0A 1JYVA 2JKAA 4UR9A 2G95A 3VKCA 3GLCA 1G4SA 3AFBA 2RFGA 1XV8A 1X39A 4J2PA 4F2UA 3LENA 4IUOA 3GX9A 4GCXA 3W2LA 1PIFA 2IQDA 3B06A 1XDMA 4YWSA 3NVTA 4FX6M 4HNVA 3GR4A 4UTMA 2D22A 4P7NA 1XLLA 4MY1A 3IAPA 2HE5A 2CCRA 4L4PA 1GW1A 2DZTA 2PPGA 3PBVA 3QY8A 1A47A 3C0LA 1UG6A 1WZMA 3LLFA 3EB2A 2X7WA 2UZ9A 5FI8A 5DT7A 3QMTA 1JZ6A 4MUPA 4NILA 3QRHA 2PDBA 5AHMA 3G8EA 2G0WA 3ALGA 4W84A 4GY7A 5IOBA 1I75A 1Z32X 1ELSA 2G5WA 1LT7A 1Q5MA 1PX3A 3W07A 3QTGA 4ORIA 4AZCB 4YPJA 1HNYA 1HJXA 1P0NA 2OKTA 3KOZA 3TROA 1LLOA 2G50A 1EJSC 2HROA 3SDOA 1QK2A 5J8LA 2VRQA 3AU6A 3ZVHB 3NTYA 1E1CA 1SJBA 1K3UA 3APTA 2DVTA 5LZLA 3GW0A 3N2MA 2BMBA 3V3WA 5A1AA 3E0WA 1LDCA 3P61A 1Q6FA 4Z1CA 3F4DA 4BI5A 1QU4A 5FESA 1E0VA 1RV8A 1OD8A 3P84A 2CETA 4AFYA 5D03A 5RUBA 5A94A 4CCEA 1QT1A 4ZCWA 1MUWA 3OLDA 2H3DA 3CYVA 1VFHA 1CLXA 1GOIA 4L5ZA 2WLZA 1T7LA 1O5QA 3AROA 3NQCA 3U48A 5GJMA 1EH9A 2YDSA 4ZQRA 3Q4DA 3NPUA 2J9ZA 4IMCA 4LGXA 2I5QA 3VIOA 4JTSA 1M7OA 3C0JA 3A47A 5D37A 2WJDA 9XIAA 3QKEA 5A5WA 1R0MA 3E9AA 5CEWA 1CI1A 3IACA 4O54A 4RJEA 2J13A 2WKGA 1S2TA 1QI4A 2QXWA 1QW7A 3ES8A 3P5ZA 2WQPA 2G3NA 4Q22A 1T0OA 2QCLA 4HMDA 3VD9A 4HOWA 1M03A 3QBUA 5EFDA 3BSGA 1G7UA 2HVOA 2PODA 3WDJA 2QDGA 5D04C 2VVSA 3NO5A 4FS9A 1NWUA 1W3IA 4EPDC 3R4IA 5EY5A 2VYOA 1BTCA 1JPDX 1H7PA 1HKMA 3LLXA 1HUVA 4WKHA 3CAKA 4I9AA 3KRUA 3QV6A 2VUNA 2X0HA 3AU2A 4LV9A 3SJ3A 3N9KA 3HIJA 3TDFA 3MVTA 3VNMA 4JXCA 4EKJA 1V3KA 4GQBA 3MI2A 3MBFA 2Z2AA 5LGXA 2ZX5A 1EGMA 1Q6LA 2DZVA 2DDXA 3HA1A 1M7XA 1F3XA 1JRCA 3QW4B 5T26A 4C1NA 2XN2A 1E9ZB 1IEVA 2WYSA 1FH7A 3VOGA 3KP0A 4BF9A 4MB3A 5CQ1A 2NV2A 4OBSA 5E6ZA 2V2CA 4YCOA 3WIJA 4GIEA 4KWSA 1DP0A 1KW1A 4FX7A 5DELA 3ZR6A 2GGHA 2VCBA 1E0WA 3OEXA 6ALDA 3W1LA 2UY3A 3TN3A 1HP5A 3T09A 3DECA 3H2CA 2OSWA 4AD0A 4QCEA 3PZUA 2JEQA 4FZIA 4LW7A 1AG1O 2IKJA 5EKYA 2HPIA 4NY2A 4IP5A 5AC8A 1J8VA 5D38A 3IUDA 1W54A 1S2VA 3NWRA 1W5MA 1TKKA 2DEPA 2P1FA 3FKKA 4MYXA 3UT0A 1QNQA 4P5UA 4PTNA 1VAHA 3D47A 1M68A 1T5AA 3TAKA 4A22A 4ZO6A 1KFBA 5KZEA 5JBFA 4HJFA 1MWOA 3M1ZA 2J7GA 2W79A 1X7IA 3DX5A 3HJEA 3PPGA 5A6JA 3S1XA 4JNZA 3MUCA 2QIIA 3GIQA 3LXBA 2NVAA 4TOQA 1VHCA 4O15A 5ABEA 1IXOA 5E6YA 1EOMA 2X16A 2XYLA 4L56A 2QUTA 3W2NA 3QH2A 4O1FA 2PF8A 2HQAA 4XZ9A 3NQ6A 1YIXA 4IF2A 3P8IA 2V5BA 2YCJA 3W1XA 3C2OA 1A3XA 3WX7A 2WVVA 3VPLA 1A5CA 2KAUC 1GJUA 3AIUA 3KHDA 3TYZA 3MMTA 4H9XA 3FCPA 4HYWA 2CBVA 4PODA 1DKWA 3M0VA 3H26A 1E70M 4ROQA 4XX6A 1XIIA 3L12A 4O19A 3WQEA 3LQGA 3SM0A 5ABFA 2WCGA 4XAFA 1OCBA 4WX2A 1MDLA 3VIKA 3S5ZA 1EP1A 3BLLA 4IL0A 3B4YA 1Q7MA 4KT2A 2ZUUA 3LN3A 1V7AA 3ELFA 4S3GA 3BLFA 1TV5A 3M0ZA 2ZRWA 2ZRYA 4P8VA 3MYPA 1S38A 4RZ4A 2W63A 3N2XA 3PAJA 1BXBA 4X61A 4M6PA 3AHXA 1QHZA 5AC4A 4IFKB 1W0MA 3QOKA 1CLVA 4QBXA 3JZEA 3WJXA 3LOTA 2V5JA 3EWZA 2FZDA 1X1NA 3PUGA 4HU0A 4LUTB 3W76A 4H6QA 2WAGA 5KETA 4POCA 4V15A 2NVCA 4XAPA 1CZ1A 3LXCA 3UG8A 3BAWA 2PBGA 1PWMA 2BP1A 4FAMA 2C13A 1YXYA 2FZ9A 5DQPA 4CCCA 5E09A 1G69A 2DVUA 3PBYA 1P6WA 4PMUA 1OCQA 2W92A 3W7LA 4GX8A 3R8HA 1JI1A 2CLKA 2F84A 4JTEA 3UY8A 1HL8A 1W5PA 1IEXA 1KV8A 3HOJA 5I77A 3BE7A 2VKZG 2C79A 2VEIA 5XIMA 4Z2JA 3ME3A 4JD4A 4QG9A 3GXNA 3SQSA 1RCOB 2MANA 3AUOA 1PZ2A 1H0GA 3RU6A 1XLDA 4K36A 1VJIA 2FTWA 1DE6A 3LTPA 4HCHA 3VKJA 1IV8A 1YE4A 1KA9F 1LL7A 2FPVA 3R2GA 1YX1A 1XC6A 3WBXA 3UNTA 2J7DA 3ABRA 4GPNA 3P8JA 3QYSA 3C2YA 3L5LA 4XZLX 2WSQA 3QY6A 1UZHA 3PB2A 5CBBA 3EOUA 3G0XA 4K37A 1KLZA 1GVQA 2QCCA 4LY4A 1XLCA 4CQ9A 4FIRA 1EGZA 2HDJA 1UOZA 4H8VA 1UROA 3LPFA 2P53A 2ZDRA 3GRIA 1UIOA 1JCLA 2REQB 1P7TB 1GWJA 1US0A 1P48A 4LUIA 1V02A 4RZBA 3DENA 1W91A 2J7HA 3MT1A 5D9PA 2WC4A 5HK4A 4IPLA 4G7FA 2I5GA 2YB1A 1H7RA 1WKDA 3N13A 4UTJA 2CIPA 1GT8A 1KCZA 4PB4A 4RNIA 2Y2WA 2Z24A 1MSSA 2C1IA 2XIBA 3QQ0A 1XUUA 4WOZA 3NM3A 5D2YA 1X8CA 2D69A 3WK0A 1ZAJA 2ZE3A 1RP8A 4L80A 1XIEA 2X1TA 3BSMA 3CUIA 2PDFA 4UTUA 1UZDA 1IZKA 4HB7A 2DFAA 4QE5A 4B3ZA 5F4SA 2V2DA 4NJHA 3BVJA 4Z2HA 1TV4A 2NV1A 3IVUA 3RMEA 3E1F1 1HL9A 3L23A 3B9OA 4YU1A 2OX4A 4IP4A 3WQ5A 1GZJA 3O15A 2GJXA 1KBKA 5JU6A 2VNCA 1LQAA 3NQBA 1ISYA 1NDZA 1VEPA 7TIMA 4BK9A 4UXDA 2V8ZA 2R1NA 3G1HA 1W1B1 1MNSA 1X6LA 4J9JA 2ACRA 3LCIA 1BF2A 5ABTA 1E6QM 3BCFA 4V27A 4ZFMA 3BSHA 2ZE0A 3CB8A 4ZQPA 3AYTA 4XO7A 3MSYA 1ITQA 1IWPA 2PP0A 4LF2A 4CD8A 1ADDA 2V9DA 5BOFA 1EDTA 2E6YA 4NZFA 1BSIA 3MPGA 3M46A 3VMPA 1MDRA 3E2QA 1K1DA 1J0ZA 3ARXA 5CJMA 2VT0A 1BG4A 5CPLA 3S1VA 4BR1A 1OB0A 1AJ0A 1W8GA 3SUTA 3WBAA 3VXGA 3UR5A 2OZ0A 3CAWA 4GJJA 3VM5A 1OZQA 3GU2A 3CIXA 1S2WA 5FOOA 4M51A 1PWLA 4HGXA 1EZWA 1AL7A 5FL0A 3SCUA 1LUCA 4H6KA 3W37A 4W86A 4DYEA 1W3TA 2WB5A 3GG0A 3KBWA 4XWUA 2WJEA 2FPTA 4AVNA 5LHFA 3T6CA 3IIXA 1QPQA 1B2YA 3IK4A 4C7FA 3TNBA 1QHPA 3GU1A 3AICA 3GSMA 4XBKA 3CTLA 1ZHAA 2CESA 3DC8A 3DXIA 3WLQA 2YL8A 3BG9A 3H7VA 5JBDA 1YTKA 3P82A 2A0NA 4H7ZA 1EJRC 1PO9A 4D6IA 3DFNA 1G4TA 3LQLA 3WFAA 5G1MA 1SFSA 5TNVA 2O9TA 3GS6A 3DBPA 1W56A 4CNPA 3ITLA 3GZAA 5CPTA 2VEPA 1SSDA 3R94A 1TRDA 1W3LA 4EK7A 3S9ZA 4WXZA 1E0TA 3GNPA 1VCVA 1UD2A 2GZXA 1WV2A 1NWRA 3E12A 3TN6A 1LQ0A 4E8DA 3GXMA 2ALRA 1CW2A 4QDMA 1UC5A 1O1HA 4IGHA 2WCSA 5I00A 3VILA 1RZMA 4JDBA 5F2LA 1FWDC 4Q6JA 4QR6A 4HNNA 1EQPA 1KM3A 2E1WA 3Q94A 3G8RA 4HSHA 2QCDB 1VFSA 3AALA 2Q3RA 2VFIA 3PG8A 1CX9A 4F9DA 3KBVA 3W1AA 1PDZA 3KZSA 4HOZA 1ZJHA 3D46A 1X7FA 3IGUA 4P7RA 2ZKMX 2R1LA 1QPOA 1YW1A 2IS7A 4GIRA 1BKHA 4K1WA 3TP4A 2YKKA 5CBJA 5KINA 3CQJA 4H9UA 4EX4A 2QLYA 3A13A 3II1A 3PG9A 3RK8A 3C86A 3THCA 5CPQA 3WD4A 1F5ZA 2WHKA 1GJPA 3EB4A 3MVIA 1WXYA 3CO4A 3A4JA 4FNSA 3NM1A 1U22A 4PA8A 1CXIA 3LPPA 3GNRA 1XYAA 2YLAA 2Z0IA 1BXCA 1DJHA 4WVXA 3R79A 3ZWSA 2ZRXA 1AVAA 2FIQA 3ARRA 3W73A 5FJJA 4PCTA 4GH1A 3TX9A 1VEMA 5FF0A 1CGUA 3FDGA 3W82A 3W70A 2OLAA 4RV3A 4E4UA 2ISVA 4Q7IA 1PZ1A 3UZZA 3K46A 4JPGA 3RITA 3BW3A 5IBXC 4IM4A 1GVSA 3PS7A 2EPOA 3UZWA 3PSWA 1J0KA 3I3DA 3TVAA 3AIQA 1R3SA 2GSEA 5F2IA 5DRCA 4YL2A 3O63A 3VZYA 3BLIA 1UPPA 3AISA 3AMDA 2Y5SA 3LGDA 3RR1A 1KBLA 4W88A 1JQVA 4XBSA 3EX3A 4JTHA 5JIPA 4P2VA 3PZQA 3CWHA 4RE0A 1R7AA 1TMQA 3AZSA 3EX4A 3MANA 5ABGA 3BL3A 4HTYA 2YW3A 3DG3A 3TN4A 3VTRA 1BLIA 4D1JA 1C93A 1TJRA 4FX8A 3HGJA 1VR6A 3VE9A 3LI1A 3I7QA 4GUGA 1TWWA 1XLAA 4RLIA 3CQIA 4GVFA 4R34A 3KS5A 3H55A 1ZP3A 4RDYA 1K6WA 2GPTA 1XYZA 4P8WA 2FZMA 2D2GA 3W7CA 2G3JA 4OZOA 2GL5A 4ZBCA 2PDNA 3C8FA 1U5VA 2XN1A 4U2YA 5A6KA 3T1GA 1TTJA 4KRZA 2WXDM 1EIXA 1EC8A 3IJ8A 3L4UA 3MTWA 1POJA 4A3UA 1GOQA 3TQVA 1XYCA 1ZQ5A 2G4FA 2QUVA 2WM1A 2W4XA 2PFHA 4UOJA 3U4AA 3BCJA 4Y9NA 3UA4A 4B15A 4DLMA 1XQLA 2RH9A 2ZA2A 1BFNA 2VX4A 4LJ3A 1MQRA 1ZBWA 4HZMA 1XLKA 1A5UA 3PR2A 4ORMA 3ZZ1A 3W0KA 4G8TA 3QLDA 3AO0A 3HQNA 1EHAA 5LYRA 1M1BA 4QTGA 2HK1A 3VDHA 3HPXA 4NJGA 1Q45A 4I7VA 4M81A 1R9XA 4YJ5A 2BB0A 4PMJA 3PC0A 3PWAA 4PUNA 5F2MA 2ZVRA 3OVGA 2O9PA 4IXXA 1NQ6A 3EMZA 4LNCA 2V6AA 2HRWA 3THAA 2NQHA 2GJNA 1TCMA 2ZX6A 1CXHA 3GYCA 1LG2A 3TJIA 5AVHA 4NJKA 3LCFA 4DBDA 1FUYA 4U5KA 3UD6A 4P8XA 1NFPA 1M04A 5AHLA 2XGIA 2WVUA 2PAJA 1V77A 1B3WA 2Y4SA 1K7XA 1ISWA 3WEMA 3R89A 3QGVA 2WSKA 3CUFA 3F4CA 2I9EA 3PZIA 2NT1A 4PBGA 1VYRA 4YTQA 1OC6A 3EWUA 3TQPA 2NUXA 1CGTA 3DYPA 3S2CA 3RGTA 3L0KA 4NASA 2HVNA 4X63A 2ZADA 4GOAA 4WDXA 1VB9A 2TODA 4GO9A 1QI0A 1XP3A 3FDKA 2WWCA 3LBOA 4RCXA 3SCQA 3BGJA 3MUXA 4XZMX 2JF7A 4B5UA 5D05A 3S2MA 2ZUVA 3WNOA 1MEWA 2ISDA 3NPWA 5KZ6A 2PP1A 1NELA 3PUOA 4TVCA 1QASA 4M82A 8A3HA 2BXZA 4L6OA 1F6YA 3DEQA 4WY0F 4HPXA 2BY2A 1U1JA 4JL1A 2DZUA 2XH7A 3TJ4A 3WEZA 2FZBA 2WZTA 2QUMA 4IG2A 4HVXA 4EP8C 1XIBA 1HGYA 4GQGA 4AHPA 4JBRA 3KFTA 1C8YA 4XAGA 2DY3A 1YKWA 4MAZA 4QEHA 3TOPA 3CNYA 1NU5A 5BROA 2FMOA 1CDGA 4RX0A 1O7AA 1UP3A 3R8GA 3S2JA 1QNVA 1Q4NX 4KCUA 3UJSA 4Q8PA 5AHFA 2Z6IA 1OK4A 1F4AA 3E74A 2DH2A 4UC5A 4RPQA 4N6EA 2AL2B 4JAWA 2B7NA 2YOCA 1ZPTA 2XIJA 2Z26A 4O8RA 3SJNA 4D6CA 4GZ7A 1MI3A 3PPCA 4E2OA 1XYBA 4UTTC 3N6JA 3N73A 2CEQA 2QULA 4H7VA 2B7QA 2QCFA 1G1YA 3DHDA 4O52A 4FK9A 2PZ0A 1UKOA 4LVBA 4K8EA 4GZIA 5DMNA 2VI0A 3L5MA 4XD6A 1PKLA 1VEOA 4KIRA 1ZS2A 4PSRA 4AC7C 5IFTA 1FHDA 4RZ5A 4I9TA 4S3AA 3ZIZA 1J0IA 3ZQ9A 3EDFA 2JALA 3B8IA 4A6GA 3TSDA 1HFBA 1LZOA 5K4XA 2E67A 1OJXA 4JL2A 3UG4A 4C6PA 4I5XA 2Y6ZA 3EDKA 2W91A 2FZ8A 3V5OA 1X97A 1XBZA 2CLFA 2XSBA 2A2IA 4PMXA 3H4WA 1P6CA 2VR4A 2GLKA 4P7QA 2Q6ZA 4KRTA 2FVKA 4GQQA 2CHOA 2J24A 4URIA 1FWTA 4E38A 2VDHA 3CLMA 2VGFA 3FA4A 1B3YA 2ZA3A 4CNOA 1ITUA 2DT2A 5BOOA 5EMUA 3F4NA 4PN2A 4ZE5A 4MM1A 4JTAA 1E1EA 2YXOA 4UQDA 2PGEA 2RJGA 3WNLA 5CSUA 4KEUA 3ZO9A 4G1NA 4OOUA 1W1YA 3SURA 3OPSA 3WQCA 4YVXA 4DJED 2DQWA 2WVTA 4PTVA 3B8WA 5BCAA 1V3MA 3HGRA 4GUHA 3H53A 4O18A 3GQYA 4MYAA 1AZ2A 1DIEA 4C6LA 2E5BA 3GVVA 4I8YA 5TIMA 5A8MA 3CT2A 4JN6A 1XL9A 3C4UA 3OVQA 2VFFA 3GDMA 3ID7A 2J27A 2WJFA 5J5RA 5AC5A 1PEZA 2VR2A 4GI6A 3GTNA 4D8AA 4PH6A 2GWGA 1KRAC 1FXPA 3W38A 3GYEA 5B7ZA 2TYSA 4CQ8A 3I3BA 3GU9A 3KBNA 1QOQA 1F9CA 4FOKA 4PL1A 2WM0A 1FWHC 3FGCB 4IMAA 3IARA 3F2CA 3N4AA 1YPFA 2VC5A 7TAAA 1AH0A 3GUWA 3V4BA 1K8ZA 1BRLB 4H01A 4LB4A 4RDVA 2E0PA 3M43A 2DSWA 1YPIA 3EKZA 1FWCC 4HYRA 1R7OA 3KL5A 3AYRA 2FHCA 2DZSA 2VOTA 3WDIA 1EPXA 2XINA 3HN3A 3N1AA 5IM51 4BEUA 2X05A 4GZJA 3PK7A 4O1EA 3EB3A 3TTYA 3B05A 1QNOA 3S1GA 4CNSA 1H5YA 4QDWA 3EOOA 4BQ4A 4QIUA 5LKYA 4XTIA 3EBVA 1DPMA 5AC6A 3N04A 3M0IA 3RG6A 4HCLA 2BHYA 1MRAA 1ECQA 3E0LA 3UY7A 3LCLA 4PMDA 3MC5A 3N9RA 3CC1A 4LC6A 4TIMA 2R1MA 4X0NA 1QK0A 3UZ5A 1O5XA 1ODUA 1M9HA 3RM9A 3B40A 3T0AA 3IUHA 1XW8A 2E1DA 5CG7A 4DF2A 5HWJA 1Q63A 1XFCA 2DJLA 5A8PA 3NQMA 1ZENA 1R85A 3WLOA 3BARA 1I2NA 4IPNB 1PDYA 1XXXA 3WMSA 4C6IA 1BGAA 3VNDA 2NW0A 3RNDA 2OQLA 3TQ0A 1OFEA 1W1TA 1V4YA 2HE8A 1OBAA 4HPNA 3FAWA 4NNAA 4AISA 5A6SA 4RR4A 2Q71A 2JBMA 3SCNA 3MWAA 1G4EA 1XIGA 4DXXA 1UP0A 1ZL1A 3U2ZA 1FCVA 4Z42C 3EDEA 1F8MA 3VNJA 1QI2A 1XM3A 3UZXA 5AYIA 4DWSD 1Z8AA 1V02E 3STPA 1GOKA 3GE7A 1AJ2A 2W62A 4JYEA 2EG6A 2DZAA 2YSWA 2VURA 4UR8A 1JYWA 4ZO7A 1C7TA 1TB3A 3PHAA 5LXEA 4CGTA 1FA2A 2XUCA 4CQBA 2C71A 4MY8A 2FH8A 1XIHA 4PRRA 3AAMA 1W32A 4QG8A 3HPAA 3HQ1A 3WUFA 1X6UA 3VA8A 1RAKA 5HOSA 4DXVA 1G94A 3LS9A 3PPHA 4KEVA 1LM1A 3OO2A 5F1UA 1I2QA 1MUCA 2PCQA 2V67A 2W0UA 4UNIA 5HXMA 1EKOA 1OG0A 1R30A 3WLPA 3LHZA 1UCWA 1JPIA 2XTKA 3M0HA 2MNRA 5EU9A 1VD6A 3UWWA 4R88A 3OQEA 4FB7A 5G2IA 1W5QA 2J79A 3L67A 1DJGA 3H7RA 1TV7A 3GY1A 2G37A 5AHEA 4LNYA 4O16A 4W89A 5CZ0A 3HF3A 1G6CA 1HJSA 3GXFA 1C91A 5C8BB 4W85A 4WKAA 4HU8A 3DIPA 4HTBA 3VI2A 3WH8A 4FF7A 3U5UA 2YFOA 2I9UA 1ZLPA 1W1A1 4MNMA 1NDYA 4DIAA 5A2BA 5D33A 2JFEX 4OJYA 2WNZA 2FH6A 4OU1A 1R9YA 1VKFA 5FEXA 1POKA 1UWTA 1MW1A 2YCEA 3TKFA 3VCRA 1F05A 4MNLA 1KFKA 2CWNA 1OYBA 1XIJA 3DHUA 1OEPA 5FAGA 5CPMA 1TPEA 3B0UX 1VP5A 1X38A 1G4PA 4G2DA 1HKWA 3OHMB 4HA3A 4F79A 4XSLA 1ODZA 1YXDA 2V68A 2WHMA 2JKPA 2PRHA 2P3EA 1F4HA 3G3MA 3LA4A 2E6DA 2OPJA 4FNRA 4S3DA 5G2HA 3OP2A 4ACZB 3C2EA 3SIZA 3EGJA 4HPHA 4XSMA 4Y6GA 2WBGA 1KBIA 3EWWA 3GIPA 4UQEA 2PC8A 3JRKA 4QE1A 2VEMA 2A7NA 3QW3A 1AW2A 4AC1X 2H6RA 3CZEA 2E68A 1SFJA 4FR1A 1OSEA 3DFYA 3OLIA 4MPKA 1X1OA 4YWIA 1JDFA 4V2XA 1GOWA 5J04A 2KZHA 1AQHA 3NCOA 1WXJA 5HPCA 4K3ZA 3UVIA 2BGNE 3T44A 2WC7A 4JEQA 1SGJA 2AMGA 5HA7A 4MWAB 3GB6A 1TJPA 1M53A 3UWZA 4H04A 3G0UA 2TMDA 4FXSA 3LPGA 1UD8A 5D9MA 1OX4A 3TN5A 2J6XA 4KMQA 3V18A 1UQZA 3DERA 2B81A 3CV1A 4LX4A 4AVFA 2W5FA 4MZ8A 1KFCA 1IT8A 3W88A 4MMWA 1UA7A 3GD6A 1E4IA 3MI3A 4ES4A 3NZRA 1NWSA 3P67A 1F2JA 1AH3A 2IKHA 3CZ8A 1Q13A 5H6HA 2H3BA 2WMIA 4LT9A 3WDPP 5JUVA 2BODX 3U9IA 5E0KA 2GQ3A 2YDRA 3V0SA 3DFSA 3G3DA 2E5DA 1FVPA 3AXMA 2ZTJA 4M8UA 4YMZA 3LXAA 3SY8A 3W1TA 4XK2A 1DJWA 5F4XA 4N02A 3WQGA 4PMZA 3BOLA 1YNYA 3FSTA 5K7JA 1W1VA 1W1ZA 3ZT7A 4H3DA 1EJTC 4FNPA 4DUVA 1EO7A 2ZZ7A 4E2BA 2ZC1A 1VBHA 2GGJA 5CC5A 2PGWA 3W9ZA 2Y8UA 4O13A 5HWNA 3N25A 4UWMA 1R46A 1JCNA 3UCQA 4IQDA 3LYEA 1ZB5A 4Z1BA 3AI0A 1W5NA 4LRSA 4F0SA 2DORA 4J3ZA 1R47A 3CLWA 3TE9A 3IIOA 1V3HA 3LDVA 3WL0A 5EMYA 1MNZA 1QW9A 1K9EA 1TREA 4GGHA 3W3OA 4KCTA 3G77A 1K6AA 4J27A 3KCOA 1U2YA 2A5HA 3WQ6A 1IXPA 4HNOA 3SAZA 3VDBA 3KZPA 1OFOA 4IISA 1OIFA 3WH5A 1KTCA 3ITXA 2PTZA 3M5XA 3ZOAA 3OB8A 4B2DA 3FJ4A 3LGGA 4DEFA 2DSUA 1QJWA 2XFFA 2QUUA 3SCPA 1XSIA 4S3KA 1XX1A 1WDRA 4GY1A 4ACZA 1HO4A 2XGBA 3WMBA 4O0QA 1BD0A 4ZR8A 3UZYA 1F3TA 5CSSA 2ZXBA 4K39A 1ZJIA 2Q8LA 3OBEA 2JEPA 1TPUA 3ANVA 7A3HA 4NI3A 3AXIA 4M7TA 4JTKA 4XISA 1PCWA 1DIDA 2O0TA 1DOSA 3KRBA 4GG9A 4AEOA 4A8RA 3BJFA 2UWFA 2Y88A 3GFYA 3BLDA 2XN0A 4Q7NA 1Z9AA 3AMLA 4AU0A 1BWKA 1O12A 4EE9A 2PU1A 5JH2A 4JKMA 3H2MA 2QQ6A 2UV8G 2B31A 1ME7A 4RL3A 1ALDA 3QGKC 2BASA 5A95A 4DAIA 2QAFA 4B3KA 3N6HA 1RK5A 1RSCA 2CZEA 4UTHA 3MUIA 1TPFA 1FTXA 3KTSA 4S2BA 4GBDA 3MZNA 2G41A 2ACQA 5LNVA 5HMEA 1ITXA 4RDZA 4C6OA 2VHLA 4JTIA 4JGDA 1TE6A 4DJEC 3EA2A 1S39A 4W7WA 2P0IA 1B9ZA 1RCQA 2YA1A 3L4WA 1XG4A 2ICSA 4PC8A 3LRLA 4JR5A 1RD5A 4AYSA 1P4CA 3VNZA 1XBVA 4DJEA 3NQAA 3WL1A 1TTQA 2FTPA 1Y7VA 5C9XA 1JQXA 1GZGA 4A21A 1KFJA 1BPLB 1XKYA 1OYAA 1HW6A 3ARYA 2XDFA 3VNIA 4MWAE 1A5SA 1SMAA 1M7PA 3DGRA 5E93A 3BJSA 4UTIA 3TH6A 2QGHA 1F76A 2V0TA 4UFIA 3LNMA 1WBJA 4GACA 4NZ3A 1IIGA 4NUWA 2ZVIA 1OY0A 1OX4B 3HJZA 3CHVA 2VEFA 4UCFA 3SFWA 2HBXA 2W66A 3F5JA 4UFKA 2ZUNA 2VWTA 2FJUB 1RK6A 3UW6A 2FQIA 1W3KA 2IKIA 4AX6A 3LEPA 4WOQA 3AHTA 3C61A 3WDHA 5BRQA 4MKNA 2G3MA 3NSNA 2IW0A 1H7OA 1ZJBA 2XVNA 4MPQA 3GXPA 2QCDA 2RDUA 3GH7A 4Q8NA 3OYZA 1Q6CA 1BGGA 1VF8A 3BG3A 3RCMA 1CEOA 1QW8A 2PRMA 3GDKA 1W2PA 5EYWA 1T99A 3W7DA 4AMAA 2PWDA 4XG1A 1E3ZA 5F4WA 1S2AA 3KOXA 4ICNA 2D1ZA 1FHLA 3SCRA 7REQA 1EF2A 1NOUA 1DQXA 4PMQA 1L6FA 1TVPA 1JPMA 1TV8A 3OQ8A 4UQAA 2P88A 1JPHA 3U8GA 1PL9A 5FF4A 4IIFA 4HP5A 2A3AA 2ZX8A 4HA1A 4C65A 2EKGA 3CT7A 1OFQA 1B0IA 3IVSA 1TTIA 1G67A 3BAYA 3THQA 2YL6A 4FF5A 1JZ5A 1J5SA 4YS1A 2CW6A 2YBVA 1TQXA 2TRSA 4J5NA 5CLTA 5CGTA 1QRQA 5IDIA 3R12A 3L68A 4AHOA 4WSHA 3GK0A 2BGQA 3NO3A 3WFLA 2FPYA 1E40A 2OMAA 1Q65A 1IE7C 1LBFA 4UTFA 1BQGA 1WBHA 4DO7A 3S4TA 3U2EA 4C6MA 1WPCA 2PD9A 3ORWA 4R85A 2CPUA 1JZ3A 4NG3A 1Q6GA 2O9OA 4DVOA 1DWGM 3MMUA 4AZ6A 4J3WA 4RUBA 3KX6A 2NSOA 3WMLA 3NXFA 2E8ZA 2Y5EA 1Y8BA 3G24A 1WOBA 5CG0A 3NZ1A 3FW6A 1SYTA 1UB3A 3HGOA 1CXLA 5HATA 3KTXA 1E15A 1TR1A 1L2QA 4UQBA 4QLKA 2P10A 4HPGA 4JHZA 4CQCA 3CWNA 2OX1A 3IIPA 1VIWA 3RCYA 4Q8TA 3VGGA 1X1ZA 2VR5A 1DE5A 1MMFA 2WMFA 4JQ3A 4ONVA 3WQ8A 3S5OA 4F66A 1DHKA 1VBRA 3VO0A 3AZTA 5H8MA 5IHSA 3T2OA 3VU2A 1P0KA 1UR8A 3KDNA 4ASTA 2ZZ5A 4N9CA 2VC6A 3NGFA 1S3HA 1A5LC 2PU0A 2FMNA 1NH6A 2PTYA 4B91A 1IZJA 4KWUA 1D3GA 2C14A 4K68A 4MADA 4OBTA 1WDPA 3NG3A 3GTFA 1FDZA 2AKMA 1OADA 1XRFA 3AMGA 3DKJA 4W7VA 3VDAA 3NQ2A 2ON3A 2QR6A 4CEUC 3KRZA 4NZCA 2VX6A 1V0MA 2F6XA 2YYTA 1AODA 1ICQA 3MCMA 1K03A 3O1NA 2GUBA 3S3GA 1V8EA 3SUUA 1IF2A 2GVYA 2VGBA 2AGTA 3IV8A 4XKYA 4M5PA 1H7XA 4WF7A 5CPSA 4H8HA 3VDCA 4HA0A 4NNCA 1UKTA 4Z1DA 3P0WA 2GDQA 4TO8A 1NDVA 1S5TA 4AEFA 4Y9OA 2QF7A 1EHNA 1Q6OA 3T42A 5EA9A 3RPTA 3GFXA 4MLRA 2OT1A 3M47A 1JCJA 4GXMA 4QQ3A 1W9PA 3N14A 5AHNA 1GQKA 2IPGA 1R2TA 5HANA 2PWEA 4JFWA 2BV9A 3BICA 1AQFA 4NAFA 5DLCA 3V5CA 3BW4A 3PJTA 2IQTA 3ZLGA 3LLDA 2L5HA 4FOUA 2PS2A 4XIAA 3TAOA 4H2HA 1MW2A 3ZSSA 3UWEA 3PTDA 4PTDA 4ZQNA 6REQB 1FXQA 4IZGA 5DBTA 5AC7A 5CSRA 1G01A 2RGMA 2WQDA 3KS6A 2WVSA 5HMSA 3UXKA 2P5NA 4WJXA 4M1RA 3VOHA 2QVNA 1U83A 4PL2A 4UNLA 4U28A 3HPSA 4CNTA 5H1WA 1HN1A 1X8FA 1H2JA 3OW1A 1BRLA 4JTQA 5EBUA 4Y9AA 2GDVA 1UD6A 4R5EA 3MSRA 3VD7A 3VMNA 4H8NA 3L4TA 3BC9A 3WQ4A 5IFPA 1ZGDA 3AXXA 4YIWA 5CPNA 1UKQA 3A3HA 2W67A 3KVKA 4QM1A 1K8XA 2ZZ6A 2VWSA 4ALDA 1QVBA 4JDYA 1ISXA 2HZGA 1TE1A 2Z4GA 4HPJA 5FKYA 3LCGA 4J3VA 2EEXA 4CQAA 4DI9A 2W27A 1TPH1 1W3JA 3R43A 4I5RA 1VLIA 4J35A 1IWAA 1CGVA 4NP7A 2XSXA 4DX3A 1OT2A 3DFTA 1I45A 1CGYA 3H24A 3NZPA 5JVLA 4F48A 1LRTA 2VGGA 3NL5A 3A22A 1XBXA 3IJ9A 4GABA 1WDWA 4ZZ9A 1QR7A 1XLBA 2YB4A 4IGNA 1ITCA 3SADA 5U4NA 3W7JA 2C18A 4XKYB 2V81A 2Y7FA 4L7ZA 2J9YA 1TZ9A 3VZXA 9CGTA 4IIHA 4IGSA 4GUIA 4IIDA 3TMQA 3USZA 3MWCA 3U6WA 3GR7A 4H1ZA 2PI6A 1PVNA 5D32A 3MHFA 1XCXA 1PXGA 2WMJA 3NL6A 5BOEA 4XD3A 4AWSA 1MQQA 4FPSA 4TVUA 4AWEA 3E5BA 1KQYA 2YLLA 3NAVA 2QPUA 3G1FA 3M5VA 4M6VA 2Y24A 1Q3NA 3VIMA 3PJWA 4U31A 2PD5A 5G4WA 3OLEA 3N17A 1LJYA 1XLEA 2DU2A 5DCBA 1WX0A 1GEQA 1KXVA 5LIWX 2VZOA 3GG8A 3M5YA 3DN5A 2FFIA 2WNQA 4R27A 4Q6XA 4CN1A 2AOSA 1DWHM 1WO2A 2J7CA 1XRTA 4D2JA 3EXSA 4JKKA 3R13A 2XVLA 5LNRA 3NQDA 1WZKA 5D8WA 3VKBA 5JXQA 3B9NA 1QPRA 3MCNA 4F0KA 2GUYA 4ATDA 1SW7A 3S6OA 4DWSA 1K8YA 5C2GA 1TV2A 3WJZA 5I78A 3MY9A 4C5ZA 4DYKA 5HQMA 3B3DA 2ABBA 3CMJA 3W7QA 4NRSA 1R3QA 5CGQA 2FDSA 3XIMA 4R33A 1R9ZA 2Z1WA 1UBSA 1MXDA 2NQ5A 1I2OA 2CWXA 3F7JA 4RK8A 3KWXA 3RFAA 3EWYA 2G3IA 3KLKA 3L4ZA 1JDCA 1FWGC 4YNGA 5C2CA 3P74A 1BKSA 2F8QA 3CB3A 3RN6A 1A5NC 1V51A 3S2NA 3TV8A 3QKZA 3B8DA 3HPFA 4FO4A 3PSVA 4KPLA 3CJPA 1JDAA 1S3TC 3UU0A 2NXIA 1V0KA 3QR1A 2E28A 1LRQA 2DGAA 3BJTA 9RUBA 5CPOA 3TYEA 1X98A 1NJJA 3UPBA 2J8TA 2VD8A 2CKSA 1SO3A 4XVEA 4M1BA 3QEZA 3VIGA 4JQ4A 4Q8UA 3EOLA 3TUUA 3E2RA 1QDSA 4IJRA 4LXFA 2EGZA 3FYOA 2CHRA 2PE4A 1ISZA 4WGHA 4EPEC 2Y61A 3CK5A 3QLLA 3RM4A 3K4DA 2QCEA 1B54A 3HV8A 4S3CA 3LB0A 3FYYA 3ZYZA 5CBIA 1E51A 1RBLA 2EKCA 4OFCA 1UH2A 3UXAA 5FL1A 4INFA 4AZBA 5A8QA 3QPZA 3GNOA 4UUIA 4CEXC 2UBPC 3I4EA 4B4HA 4YTRA 1P1XA 1FCBA 2E6FA 2VJXA 4H00A 4PFMA 3LZ3A 3IGXA 5FJTA 3SR7A 2VDGA 2DQXA 4WDWA 3GVGA 3M0KA 5DRIA 5ABFB 4B5NA 4KF1A 4AZIA 3CAVA 3CMGA 2PDYA 1BSLA 2A6LA 3E3HA 1O94A 1ZCCA 4JN8A 1GPWA 4IMGA 3WJYA 3ZS4A 1PX8A 3LMYA 3RLVA 3A5FA 4F4RA 1NDWA 2D0GA 3S1WA 3DESA 4M6UA 3A4WA 3UWQA 1AMKA 3NPVA 2R6OA 3E2SA 1DXIA 4QDPA 1E5NA 1XFBA 3T8QA 1EJWC 1QOXA 1BAGA 1OIMA 1Z48A 3PFMA 2E4TA 4FLOA 4V1YA 1BYDA 4Q8WA 3CEUA 1XDJA 5TQLA 2P50A 4U3CA 2HISA 3E0FA 3T0BA 3PBUA 3ERPA 1IR1A 3G22A 3NO1A 3P62A 5M03A 4W9TA 3O07A 3ARVA 2FVMA 2XM2A 4ZOAA 3ENLA 2IKGA 3EDJA 2Z28A 4PUJA 4KWOA 1J12A 4Q3MA 5GNXA 5E1QA 3VK5A 1XLGA 4IMDA 1M65A 5MHBA 5HUPA 4D6GA 4WDUA 1XGEA 4HK6A 1US3A 4DUXA 1HL2A 1JG9A 4AMCA 1VPXA 1BF6A 4WD0A 2JK2A 2VVNA 3TOYA 2E09A 1YNPA 4GUFA 2WZMA 3UBPC 2Z1XA 5I2UA 4LF1A 1ICSA 3VGHA 1UMYA 1O4UA 2X40A 4LBSA 3BW2A 4KETA 1VGAA 3CUZA 3RUBL 2DUZA 2EJAA 4NAEB 1N8WA 1OC7A 4N4PA 3QV8A 1UUQA 5BXRA 4LAKA 1I1WA 1MZHA 2BVWA 4MJ2A 2BHUA 1O5KA 3VAVA 4FA3A 3FVDA 5AN7A 3G1AA 2VP8A 3L2IA 4LAMA 4ZSUA 3CHFA 3GDBA 3IPWA 4W8BA 4ERGA 3W1RA 1AJZA 2GSJA 3STEA 2XJ7A 4W8AA 4DAFA 1KFLA 3VCNA 1JD9A 4HSOA 1WP6A 2OXNA 1JCTA 3IV3A 3L65A 1YEYA 1WXZA 1KRBC 4AIOA 1QNRA 3KVLA 4UZUA 3BTNA 2YFNA 4DBUA 2G4JA 3OZOA 4X9YA 1ADSA 4IWWA 1SSGA 1XLIA 4CN6A 4JTDA 3MUZ1 3CGTA 1A3WA 4I7WA 2OCZA 3TSBA 3GO2A 4U10A 3TA6A 3UNDA 3VDGA 1YTEA 3I65A 4MWAD 3VOIA 4ZTYA 4P61A 3C52A 1GVEA 2VX5A 1GG1A 3LV6A 1JDDA 4G56A 4C6BA 1T8XA 1VCGA 5B7YA 2E40A 3TFXA 3BGGA 2JGQA 1Z7AA 4GVGA 1IHIA 2ODOA 4CD7A 3BQ5A 5HJYA 1L8NA 1RH9A 3WLNA 2X41A 3VMOA 5FJOA 4B9YA 1WAWA 1B4EA 4KFPA 4D1IA 2P0OA 3O3RA 3LTYA 4JQ2A 1NF0A 2OZTA 3R11A 4KWVA 1ZUAX 1PIIA 3D3AA 3DAQA 1GG0A 3RF9A 1XICA 3AS1A 1E4LA 2JIWA 2REQA 3EWDA 4Y8EA 3RYSA 4D6EA 3ARWA 4GISA 3MV11 1QMLA 5BXSA 2Z6JA 3GC4A 1CB2A 3N15A 4O1CA 3QSTA 1A50A 1V6TA 1KXQA 3WD2A 2SFPA 3LMZA 2VOMA 3WJWA 1N82A 1LBMA 5C7VA 2F7FA 1GONA 5G4HC 3NUKA 1TPVA 1VFUA 4I6KA 1UH3A 2BOFX 3I4KA 3I6RA 4M80A 3I7RA 4FR6A 1VFOA 3P60A 4S23A 1J6PA 2NQZA 4HNTA 5CAKA 1RY8A 1SJDA 1E9IA 5D09A 1GZ1A 3Q65A 4YLWA 3ITTA 1TRIA 2A1YA 2PLKA 1TJ0A 3I10A 3VC5A 3W28A 3PZVA 3G6MA 1PZ3A 3UJEA 1V0LA 3MA8A 4ZMGA 1RUSA 5C9WA 1RXOB 1GQJA 2WMHA 1OC5A 3ZWTA 1BVNP 2BG5A 2IMRA 1TYGA 1D7KA 1NIUA 4AZHA 3VNKA 3CASA 3N29A 3RMJA 2FYMA 4LVFA 1H1ZA 4A29A 3AS2A 2CERA 2B7PA 1KRMA 1THFD 3U2CA 3PF3A 1FKWA 2P8BA 3PZNA 2OWWA 1KKRA 2YL9A 3QN3A 4H9TA 3T0CA 4XO6A 2PDJA 1BVZA 1SMDA 2WV8A 2FLIA 2PDWA 5K3VA 3AUJA 2DW7A 1Q66A 2V5KA 2ZZ3A 3KAOA 3B8UA 4S1FA 2PDLA 3DBNA 1GPFA 2A3CA 4LVDA 4M7SA 2ZX9A 1OABA 3GKFA 3KE0A 2Z27A 2OQYA 2Q09A 3VGDA 3U0HA 3C2RA 4O4WA 3DG7A 2XWDA 3EEGA 4UTTA 3PFRA 3UYCA 2RJHA 2ZXQA 4BCEA 1FP8A 5HNTA 2OO6A 3EWCA 2WBKA 3LHWA 3NQFA 4NHVA 4DO6A 1ZBVA 1UQYA 3WQDA 2ZXDA 3ECQA 3DC0A 3K8LA 4N2YA 3EKLA 1QCWA 4TV6A 5JH1A 5C5YA 2JQXA 1HVQA 2R94A 3SSZA 3BLEA 2QGYA 5HMFA 4LH8A 5MKGB 2Z1BA 3U2OA 1CB7B 2X42A 3GNDA 3KBMA 1Z89A 1J10A 4PTMA 4A8NA 3EPMA 4ZE4A 4CU7A 4JIQA 1QAPA 4HNCA 1GVIA 5HULA 3CAQA 3A23A 4GUJA 2XH2A 3TLLA 3BGAA 3WNPA 2J77A 4HNUA 5EGRA 5D2TA 3GC5A 3NVDA 3SCTA 1TPWA 2GJPA 1TJ2A 5AKQA 2I56A 1DJZA 1OGGA 2OEMA 1JRBA 1UR2A 4ML4A 1RVGA 3KOWA 3AIVA 3P7YA 1G5AA 3VIHA 3PJXA 1LOLA 4HA4A 1VH7A 2GUUA 3F5LA 2HS8A 5CZKA 4KW2A 1DV7A 7REQB 1TPDA 2GDUA 4LV4A 4HMNA 1NFGA 1H63A 1S1PA 5G1TA 2R24A 3P5YA 5D8ZA 4FIQA 3WD3A 1X6NA 4HYVA 2PSNA 1ZRQA 4PBFA 1A0CA 1SJAA 4S39A 3WLIA 1QO2A 4WHBA 3CZLA 3GHTA 4JEJA 4KGJA 4NAFB 1D7FA 4LYQA 5C6MA 3BLOA 2QVHA 3PZGA 1WE5A 3ZJ8A 3V7PA 1XGZA 2CLOA 3OA3A 5HAOA 2DZWA 1P0DA 3KEHA 2I16A 2E25A 3MJMA 2PDQA 2WSYA 3LRKA 3C0SA 2XGZA 5M1TA 1BEUA 1XKJA 3M44A 2R8WA 2Z2BA 1RALA 1FQ0A 2BNJA 3HO8A 1AFSA 1GKQA 4E2DA 3OLGA 4F0MA 1I2RA 4MNKA 3WJSA 4LFYA 2PDUA 3T0TA 3DG6A 2RAGA 3CHEA 4C7GA 1E6XM 4X3ZA 3A9BA 4GGBA 1FH8A 4EWND 4JS3A 2QV4A 3N4FA 3PWGA 3FKRA 2ZRVA 1ECEA 2X1RA 4LVAA 3DZ1A 1S46A 2BY0A 5HUOA 5I09A 3OZYA 4LUTA 3MYOA 4TX6A 4NU7A 4J28A 4KBXA 4QG6A 1NVMA 3NQ8A 1DJXA 3QQWA 2YDQA 5MKGA 1RLCL 4ERIA 5HNNA 3TWAA 2X2GA 4MAVA 2OEJA 4F0RA 1TCDA 3HV9A 4GQ0A 4JX5A 1C8QA 2J66A 4I90A 2OYLA 3CL8A 4N0RA 2PGRA 5CC3A 5L9FA 4IPIA 5A6TC 1SW3A 3IJDA 4JFVA 2CZVA 4KCVA 2VO5A 1XBYA 2C7FA 3HPZA 2I17A 4EXBA 8CGTA 2PC4A 1LRNA 1EA0A 2ALDA 4KRUA 1ZCOA 4NXKA 5HR6A 4REQB 3VYLA 2WVVB 1H50A 3ZT6A 3WLHA 2WMIB 3AQUA 2DZPA 4UFJA 3BH4A 4JKLA 3CEPA 4NT0A 4IHCA 2NX9A 4Q4SA 3PZMA 2GVEA 3IWPA 4DWDA 3QC0A 4PMOA 2J7EA 2A7RA 3PUDA 1FWAC 3DUGA 3WN6A 2QCNA 3JZUA 1C3FA 1I1XA 4YCPA 1B1YA 4C6EA 3B0PA 4H2CA 4MJ4A 3VKKA 1FRBA 4BZYA 3VD4A 2J7FA 3OOQA 3BOXA 3P3BA 1EP2A 1QBBA 3ABZA 2PURA 1V0NA 4LQ1A 1UIPA 1ME8A 5BRBA 5JMUA 2NV9A 1M3UA 3V36A 3R25A 1KD0A 2V2HA 3H6OA 1TA3B 3WENA 2CNCA 3HB9A 4XB3A 4B3LA 2NX3A 1R2SA 1NOWA 1A5BA 4FXJA 4LAZA 5A69A 3CPGA 2X2YA 1L6SA 4A3HA 3W02A 1K4HA 4K6AA 1XPYA 4PEEA 3TLQA 1IEIA 4W4QA 3T8LA 3R0UA 3AIRA 1OGSA 1E72M 3C3NA 1NWTA 3GXIA 5KMYA 2BFGA 2YGYA 4JTFA 1CXEA 1O60A 4ZOBA 4JFUA 1UA3A 4NAEA 1UH4A 4CNUA 2NQJA 3SRKA 3ARZA 3VX0A 3EZ4A 3HURA 3VOFA 1V93A 2WO5A 2R91A 3LRMA 4NZ5A 2DZBA 1SZEA 2OODA 4CD5A 2J74A 2BOGX 3LPOA 1Y65A 4HK5A 3QPEA 3OBKA 4BFAA 1XINA 2PBOA 3QYQA 3BG5A 3GHRA 3FLUA 1JZ4A 2F61A 3B0VC 4FEZA 1NF7A 1TWZA 3BUVA 1T40A 2W6RA 4L4OA 4RPPA 1E9LA 3W4RA 1CWYA 1U1UA 4H8UA 4PULA 1NSJA 1S5WA 4AY8A 3UG5A 3INPA 1I0BA 3GC2A 3TU9A 4JTRA 3LSBA 4WR3A 1E4MM 3W2UA 3GHUA 3ARSA 4GKLA 5GNZA 3RRXA 2PWVA 2BXYA 3K13A 4JCLA 3FN9A 1LG1A 3G5EA 4AD1A 3IEBA 4J4KA 4IQJA 2R14A 2GVLA 4PB5A 1K77A 3FV9A 1O66A 4HKPA 3W1NA 3M9YA 3M7SA 4C6NA 1XLJA 2QCMA 3EWXA 1QO5A 4MWAA 5IDZA 4ZO9A 3D6NA 3GDRA 4FNQA 3FK4A 4GYJA 4DBEA 4PBEA 2IXUA 1PPIA 3T08A 3L5AA 3S9YA 2TPSA 2GQ9A 2CBJA 3AMCA 2EPMX 3IJQA 1FWJC 2QT3A 2X1UA 5FF3A 2C3ZA 1IR2A 1E1FA 4WY0A 1LTDA 4MFDA 1SZNA 3H12A 3VD5A 1J0HA 4TXEA 1RLDA 2PCEA 4LY8A 4PTXA 5E0FA 4YTTA 1NP2A 1R3YA 4Z17A 2CZ5A 1KM4A 3E2VA 4A8LA 3MO4A 1LWHA 1D2KA 3VIFA 4WSKA 3C2VA 4LCRA 2GK1B 5I24A 1CCWB 1VYPX 2YIHA 3GHSA 5HQEA 4V28A 1PUDA 1B4KA 3D5HA 3TONA 2YBUA 1OD0A 4V33A 4AIUA 3VVGA 3P14A 2HNEA 2Z7GA 1EL3A 5C0QA 3IJ7A 3BMWA 5D30A 2B0MA 3N19B 4LALA 2YCLA 1UWUA 3LHTA 3FYPA 3LY0A 2WPBA 2RDXA 2EPNA 5FEZA 3VIPA 4DBWA 4E4FA 4CN4A 3H23A 2ATMA 3FSUA 4UQ9A 1FDYA 4IICA 3JR2A 3SRHA 3WCZA 4LEQA 3T7VA 3ARUA 1OFAA 2E9BA 4MTVA 2XZ9A 4C7DA 4O0ZA 2IPJA 4GYPC 3QZ6A 3CL6A 4MY9A 4FXFA 3RLHA 4GNKB 1KRCC 1H4PA 3PJUA 3BCDA 3T78A 1J01A 1AA1B 4CUCA 4P7OA 1RPXA 1GJWA 5BWFA 1DBTA 4HJWA 3KW3A 1H49A 1J18A 2YYUA 4QS6A 1LF1A 4K38A 1SFTA 3GXDA 3DCPA 3LERA 5I5RA 4PCFA 3VGEA 4ZVJA 4A3RA 3PBMA 1W9UA 5I3IA 3WUGA 4WZHA 4ZA0A 1AZ1A 2GGEA 1DJYA 4QSHA 1DHPA 3A9IA 1J4EA 1WKEA 1YXCA 4MJZA 4US6A 1RCXB 2V3DA 5DXYA 3V35A 1H11A 1V6VA 3UQNA 3R0KA 3E5PA 3N12A 3BAXA 5TF0A 2BVDA 1B3ZA 3AIWA 3ZFHA 4GX9A 5AZ0A 2NQ9A 4A35A 3WLKX 3T9PA 2D0HA 3IRSA 4QSFA 1PBGA 4LAUA 1TWDA 2PRLA 2GVGA 3UFYA 4FLQA 1JJKA 3OZPA 3LSCA 4NZJA 3RO6A 2TAAA 2J47A 4BQ5A 1B3XA 2F9RA 2OEKA 5DO8A 2X0YA 2V30A 3W2KA 4HN4A 2J8GA 1T6MA 3JS3A 4ADSA 4BS0A 2DIEA 3WK1A 5LIUX 4AH7A 4CU8A 5HDRA 4R3UA 1AQ0A 1K02A 1XH1A 4AZCA 1U30A 2WKJA 4FLRA 1OF8A 5AYZA 5CAHA 1R2RA 1UR0A 3O6CA 5LSMA 2VZVA 1D9EA 1EA9C 2Y8VA 3ISIX 4JIIX 1EFZA 1A5AA 1Q85A 1UHVA 1JIBA 4I9JA 2NUWA 3WO8A 3S2LA 4BF7A 2NWSA 3WLMA 3C2FA 1DTUA 3M0JA 3MBDA 3K8KA 2ZFAA 4QNWA 5PTDA 3EMCA 4UZSA 3HMCA 2Y63A 3NQVA 5FAJA 3EKGA 4QNEA 3CQ0A 3VIJA 3K8MA 4DO4A 5ECVA 3DFOA 1CXKA 2R1KA 4IL2A 3WBEA 3B8VA 4NF7A 3B4UA 4A8IA 2ATSA 4W5UA 4GHRA 2ABAA 2ZZ2A 1A5OC 3FJNA 2O55A 4L6DA 2QMJA 3LHYA 1QNPA 4KGLA 3VABA 4KS0A 4QQUA 4XUGA 3TXVA 3C56A 4S38A 4AYGA 4OOZA 1SO6A 4ZQMA 3NIYA 3FOKA 4LYPA 3V0TA 3T0DA 1GUVA 3RM8A 6XIMA 2BHZA 4PUEA 2ZX7A 1WCGA 2F6KA 5HINA 1ZY9A 2VTFA 4AIEA 1L8PA 4OV9A 5TBOA 3S1UA 1E43A 2VRJA 5T9BG 5I0DA 3WG6A 4XZHA