1OCQA

Complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution with cellobio-derived isofagomine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE 5A
publication title Direct Observation of the Protonation State of an Imino Sugar Glycosidase Inhibitor Upon Binding
pubmed doi rcsb
source organism Bacillus agaradhaerens
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2003-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ocqA00
1MW2A 3W29A 4DM1A 3EYPA 1UD4A 4TXEA 1FH8A 3VINA 1EOMA 5I0DA 3DC0A 2G41A 1OIFA 4C7GA 4MB4A 1TG7A 4H8UA 4LYPA 2BVYA 3EBVA 1JYVA 3WEOA 2C8NA 4F66A 4QLKA 5AY7A 3SIMA 1W1VA 3DHPA 1UOKA 1JZ6A 4J3VA 2YL6A 1NM9A 1CZ1A 4KRUA 3THCA 2D3NA 3TTQA 1D7FA 3K46A 3RM4A 1KR1A 2W5FA 4FLOA 1HL8A 1V02E 3A47A 4TVCA 4NZCA 2BV9A 3CUIA 2GJXB 4GI9A 4HMDA 2CEQA 1O7AA 3WEMA 2C0HA 3EMQA 1B90A 1R8LA 3WD0A 2DSUA 3WDRA 2XVGA 3W53A 2YL9A 5E9AA 1VENA 1OWQA 1MVYA 1DWFM 1XGZA 5AC4A 2ZE0A 2RGLA 4MB3A 5HPOA 2E3ZA 2J7FA 4P8UA 4IPLA 3AHZA 1OGGA 3T0AA 4CD5A 4FF5A 2W4XA 4KMQA 2FH6A 1JZ7A 1E43A 5D9MA 3MMUA 3VKKA 4GO9A 4BZYA 3WD1A 1UWIA 1ZU8A 2PWFA 3I3DA 3WL0A 2WLZA 5A6BD 3IJ8A 2YKKA 5I77A 5JUVA 1QW9A 3W27A 1H0IA 4AMCA 1JFXA 3CZLA 4CKQA 1JG9A 3FHAA 1US3A 2Z1SA 1CGYA 4JFTA 6CGTA 3CZGA 2ZOXA 5FOOA 2J79A 2V5CA 2ZUVA 3NIYA 2VI0A 4U2YA 1JZ2A 2X0HA 1EO5A 3L4WA 1E5NA 3W81A 2ZICA 2WVTA 2DH2A 3S2CA 3VM5A 1EOKA 3SCOA 4QAWA 1K9EA 4GQQA 1UD8A 1EGZA 1B3XA 3WN6A 3L4UA 4HZ7A 3B9DA 3WF0A 1CDGA 2OWWA 1YHTA 2BY0A 3QHNA 3CUHA 3POCA 3AHVA 2QF8A 2HISA 1EH9A 3BCFA 1OSEA 2YA2A 3K8KA 3G6LA 1O6IA 1VIWA 2F8QA 1M01A 3ZR5A 2XUCA 1UH4A 3CUJA 1ISWA 1LWHA 3DYOA 1GOOA 1OGSA 2F61A 5GNXA 1PIFA 4AZGA 3WQ4A 5A6SA 1ZJAA 3N15A 1DWHM 1E4LA 3GM8A 2IXVA 2UY2A 1LL4A 3NDYA 4OUEA 1PZ2A 3AMDA 3CHEA 5CPTA 3VD5A 2O9TA 3AIRA 3T0BA 1XCWA 3B9EA 1WZMA 3HJEA 2D22A 1CEOA 2DT0A 2X1IA 4PCSA 1DEDA 4PMQA 1XV8A 2OYLA 4EKJA 2XVKA 2EQDA 3NSXA 1VFFA 4BCEA 3AHYA 3GXFA 3AYSA 1QI3A 4W84A 1XSIA 2CBVA 1ITXA 2UWFA 1NWTA 3AMKA 4BF7A 2WVVA 7TAAA 5M5DA 2A3HA 3KL0A 4P8WA 4WKFA 4U31A 2JF6A 1JNDA 1UZ1A 4CD8A 3L4XA 1JDCA 2VT0A 1Q6FA 3BSGA 5FIPA 3ZQ9A 4OKDA 3VD3A 2OWCA 3ARZA 3WDIA 1MW1A 2X05A 3MUZ1 2EPMX 4UOJA 5HXMA 4MNMA 2VX5A 4N42A 5LA2A 4UFHA 2E4TA 3N12A 3LPOA 1J10A 4W93A 2XVNA 5HBFA 5ECUA 3GNRA 1J12A 1H11A 4PMXA 3WFZA 1MQQA 1BVNP 2Y4SA 4JCMA 2YBTA 3AIBA 3ARTA 4WLCA 4KGJA 1E70M 4QLLA 1KB3A 2OWXA 1JXKA 4FMVA 1G0CA 3CLWA 1WDPA 1KXHA 1W1PA 1ISXA 3PBGA 1MQPA 2WB5A 4PSRA 3VIMA 1GNXA 1LG1A 4CD6A 1HL9A 2CERA 3RO8A 1E4NA 1HJQA 1VEMA 2ZXAA 4M56A 3SCSA 1KGXA 2WYSA 4AIEA 1ISYA 4MADA 1JZ5A 3T2OA 3W24A 3OLDA 1CWYA 1GQIA 3PN8A 5CGMA 3N04A 4ZEPA 5FL0A 1WO2A 3AHTA 3AXIA 3VMPA 3WNOA 3GBEA 1M53A 1CECA 5HNNA 4AEEA 1JAKA 4YHEA 1B3VA 2YDRA 3MS8A 4MJ2A 3VIOA 2G8ZA 3L4TA 3RDKA 4CD4A 4PUDA 4W8AA 4QCFA 1E6XM 3ZT7A 5BROA 1QOXA 5D4YA 5C71A 5BRPA 3I3EA 3VD9A 3ARVA 1UH2A 3VIFA 1E5JA 1ITCA 3W26A 5EBAA 1Q6EA 2XM1A 2ZUSA 1XH2A 4W87A 1TFVA 1DTUA 1OCQA 2ZUUA 2DPEA 3CGTA 1BQCA 3VGFA 4AYSA 3WMSA 1CXKA 3UESA 4S3KA 2VCAA 2V38A 5BWFA 1XSJA 5M3WA 3AMCA 1E4IA 3MV11 4JIEA 5DF0A 2W66A 2GK1A 3WH8A 4GQRA 2XHYA 3VDHA 1TVNA 2J7GA 3GH4A 3NJ3A 3ZJ8A 2FH8A 1LJYA 2PBGA 2DIJA 1JL8A 4XB3A 4AD2A 1UQYA 4B16A 3D3AA 2CITA 2CNCA 4OJYA 1UWTA 2G3NA 1DWGM 4DWSB 3L4ZA 3AIQA 3WDQA 5C8BB 1QNPA 4AIUA 4V2XA 5A6LA 1MWOA 2PWDA 2XWDA 4PTMA 3T09A 1ODZA 1MW3A 1WZLA 4JKMA 2YA1A 2CYGA 3ZO9A 3MUIA 4HZ6A 4GIAA 2Y5EA 1XD0A 4X9YA 2WMJA 4YHGA 1HKMA 1B0IA 1E71M 1NWSA 5D8ZA 4CN4A 2DT1A 1JYWA 3MMDA 2G3MA 1GZJA 1VEPA 3ZMRA 1E1FA 2WXDM 3CPUA 1VRXA 1C8XA 3WDPP 1JYNA 1E15A 2XJ7A 3O9NA 3WH6A 1CXFA 1R87A 2WHLA 1WPCA 1VFOA 4QP0A 2VVSA 2XIBA 3ECQA 1HJXA 1JZ8A 1NWUA 4PTXA 5E0FA 2DGAA 3WBAA 2CPUA 2JIEA 3SCWA 4V28A 4UOZA 1JIBA 4GXPA 2DEPA 2VURA 3VO0A 1VAHA 2J4GA 4JL2A 4JCLA 2J8GA 1C93A 2DSZA 2WHJA 4JKLA 3OGRA 1QVBA 3OLIA 1MFVA 3L2LA 5CPSA 4Z2IA 1OT1A 1GVIA 1XYZA 2J62A 5I5RA 4PRWA 3WSUA 1ESWA 3GXMA 4ZFMA 1CLVA 5CZKA 1SR0A 4W8LA 2YJQA 5KEZA 4J3WA 1CIUA 3T0DA 1CGVA 2WZIA 2VZUA 2BFGA 3IJ9A 3BSHA 1FH7A 1X6LA 2D3LA 3VDCA 5E09A 3CUGA 4BQ4A 1GHRA 1G5AA 5CLWA 1U2YA 2F2HA 2XG9A 2XTKA 2ZIDA 3O6AA 4WK9A 1E6QM 2X2YA 4D6CA 3TTOA 1CGXA 5DT7A 1J0JA 2D0HA 4TOQA 4D6HA 1NP2A 4HA3A 3O2LA 1TMQA 4UR9A 2FHFA 2OSXA 3AIUA 4GI8A 4D6DA 5D9PA 3BLPX 1ODUA 2EPOA 4P8XA 4E4PA 2ZUMA 1HP4A 3GTNA 1XYFA 3APGA 5A1AA 1E0WA 5E70A 2Y8KA 4CCEA 1W2VA 3WMCA 5JBFA 1ISVA 3HMCA 2E0PA 2WZEA 3QHOA 4PBGA 5GQBA 1E73M 5A6MA 4JFWA 4N0RA 4OOUA 3CO4A 5CGTA 4AZ5A 3VIIA 1XHGA 2YOCA 5IDIA 4DWSC 4AZ7A 3IAPA 1GORA 1WKYA 1MFUA 1W32A 4AD0A 4W88A 1HX0A 3AICA 1ZS2A 2E9MA 4CU7A 2UY5A 1LL6A 2QPSA 3BAXA 3CHCA 4RL3A 1W9DM 2V3GA 2RGMA 1RP8A 1G94A 3AMLA 4MB1A 1SYTA 4ACYA 2VRJA 3AIEA 2ZX6A 4U3CA 4DM2A 2VR4A 1LWJA 1CXIA 2FGZA 2CBJA 2WVVB 1FP9A 2WVUA 2CKRA 3VGEA 1UA7A 3IANA 2VVNA 4V27A 2VUYA 2WK2A 3FW6A 5D9OA 1OT2A 3LMYA 4HOXA 2VNCA 2VZSA 1J11A 4HMCA 1UR0A 1EDQA 3FY1A 4M80A 3WNNA 3LPPA 3MKKA 3ARUA 3SEPA 4UQCA 4BQ5A 3BAYA 2J78A 4J27A 5JBEA 4ZXOA 1E56A 3KZSA 1E6SM 2VMFA 1JZ4A 3VGDA 2WWCA 2XM2A 3WMBA 5BXRA 1PEZA 3ZSSA 4Z2GA 1GOWA 1M03A 1R7OA 4AD5A 3FHQA 2EPKX 3VX0A 4QCEA 3KE0A 3BH4A 5FD0A 3QGVA 3M07A 3UG4A 4MNKA 1BYDA 1E72M 3K8LA 1WDQA 5CXPA 3VOCA 3F4VA 3SUUA 1ZBCA 3EDJA 3W38A 3F5KA 4IM4A 2BVDA 1V08A 1RH9A 5GNZA 3AJ7A 2YDSA 3OA5A 4U3AA 1EIBA 1ECEA 3J7HA 3SCVA 3QOKA 3MMWA 3BGAA 4WKAA 3PZMA 5JBDA 1QI2A 2ZWZA 2E40A 3M7SA 2FHBA 4M81A 4Q22A 6TAAA 3VU2A 2WCSA 3U7BA 3FN9A 2X09A 1ZL1A 3VIGA 2G3IA 4CD7A 2CIPA 5CPQA 3MU7A 1PAMA 1OM0A 4A4AA 4J3TA 4D1JA 4LQ1A 1BAGA 3VILA 2XGIA 1UR2A 4PEEA 4B15A 4J3SA 5M03A 4AD1A 4GKLA 2CCRA 5D8WA 2XFRA 4B3KA 3ALGA 2BY2A 5AC5A 2VC9A 5DMYA 1AQMA 1RPKA 2VOTA 1JI2A 2D20A 1V3IA 2ZUWA 1IV8A 2WC4A 3WIJA 2GK1B 1HJUA 3WNPA 1V0KA 1J0IA 3W25A 2QMKA 4LYRA 2WMFA 2WMGA 1JD7A 3OG2A 3DYMA 1EDTA 1WCGA 3CH9A 3L2MA 3BAKA 1KWGA 1XC6A 3BAWA 2JIWA 1LG2A 4JL1A 1KFWA 3SCRA 4DUVA 1U30A 1BPLB 1PBGA 1OBAA 3MSGA 1R86A 2VX7A 3FAWA 5BXSA 2J7DA 3MUAA 1J0HA 4H8VA 4UNIA 1H41A 1FHDA 2J25A 1IT0A 1V0NA 4HMEA 4J3UA 4DUWA 4AEFA 2VZVA 2NT1A 1UG6A 2NW0A 2CHOA 3UR8A 2EO7A 1KBKA 4MB5A 3SCUA 1K6AA 2XVPA 3MUY1 4D6EA 1BYBA 4B9ZA 5BYWA 1BSIA 1Q4NX 1V0MA 1Q6DA 1E3XA 2JEPA 4DUXA 1JNEA 5A8OA 1GW1A 3UR7A 3OLGA 3VMOA 3AMGA 1TUXA 1FH9A 2BHYA 4P7RA 1JD9A 1UKTA 4B9YA 2ZX9A 1QNOA 4WKHA 1MXGA 2PBOA 1HN1A 1LL7A 3ZR6A 4CVUA 2E8ZA 4W8BA 5C70A 2OYKA 3TTSA 4W7UA 3RJYA 4XX6A 4M82A 1QW8A 4P7NA 3T2PA 1UWUA 3KL3A 5LYRA 4M1RA 3BXWA 5E0CA 3THDA 3OB8A 1XD1A 1US2A 2GUYA 3CIVA 1GOMA 1H09A 3VNYA 5I3DA 1W9BM 3SCQA 4URIA 4TTUA 4PMZA 2NSXA 4RE4A 4E8CA 3IAQA 4IUGA 4D6IA 3RCNA 1HT6A 4JFSA 1HP5A 1HKJA 3WL1A 1WZKA 3VGBA 3ZSTA 5IFTA 2BY1A 4HP5A 1EHAA 2ZX8A 1XCXA 2NT0A 3K4DA 1HKIA 5CLTA 2QMJA 1HXJA 3DECA 5I2UA 3WNKA 4Z2JA 3U7VA 3WD3A 4X0NA 5DFAA 1BG4A 4WSJA 1TCMA 1V3LA 3TP4A 4AXNA 5A8PA 5A8NA 1A3HA 3RJXA 3IK2A 1RP9A 4PMUA 4PMNA 4BS0A 1UR9A 1UHVA 3F5LA 4YPJA 1KGWA 4W85A 3GH5A 3WH7A 4JHOA 1UA3A 2ZXBA 4D71A 1R7AA 4M29A 1NH6A 4TUFA 2Z1KA 5FL1A 3WDJA 3VD7A 1WB0A 2CKSA 2WBKA 4CN1A 3AIVA 1E55A 4KRTA 4W5UA 1KXVA 1E0VA 4TX8A 4AISA 3PZVA 3VGHA 4D6JA 2PC8A 4F9JA 3UEQA 3WQWA 1AMYA 5HPCA 1UQZA 1SFSA 2CETA 1E6PA 1CXLA 1QNRA 1BTCA 2V3EA 1BVZA 1UUQA 3VM7A 1XSKA 1P6WA 3WD4A 5A6BA 2O92A 1QI0A 3VIPA 4AZIA 3TTYA 1EA9C 1E1EA 3D5HA 3PZGA 1VBRA 1TA3A 3QR3A 1EQCA 5E6YA 3AROA 1TVPA 4HA4A 2CESA 1W3LA 4OZOA 3CHDA 2AAAA 2ZX7A 1UWQA 3A4WA 5A8QA 2VO5A 4J28A 3UERA 1W1YA 3N13A 2D0FA 2E9LA 4QFUA 3VTRA 5AYIA 1NWRA 3ZJ6A 5EMYA 5F7UA 4ACZA 4CUCA 1GQLA 3PZTA 3EDEA 1BFNA 4W5ZA 4KWUA 3ZT5A 4PMVA 3HU7A 1V02A 4TVDA 5I78A 4HPGA 4DWSD 4JHZA 3WQ6A 2WSKA 4PMRA 3AS1A 4H41A 4CCCA 1WZAA 2GSJA 3AS2A 3WENA 4GINA 3GNOA 5BXTA 1X1NA 3A4XA 4CCDA 2WSPA 3PTQA 1ZBVA 1OGBA 3AFBA 5ABGA 3E1F1 1ZBKA 5A2CA 2WNWA 2EPNA 4GO8A 3U57A 2GFTA 5CJ5A 4L4OA 2Y2WA 3NUKA 2CBUA 3ARWA 3AZSA 4HOWA 1JXJA 1C7TA 3KEHA 1FFQA 1GONA 5DEZA 4IPNB 1I75A 1KQZA 4EK7A 1H49A 1GOQA 1V6VA 4P7LA 1JF6A 1NP0A 3WUBA 5ABFA 1PX3A 3UG5A 5A6KA 3PZUA 2VJXA 2EXOA 3N17A 2WANA 3WQ8A 1QPKA 1E6NA 3WNLA 2XGBA 1ZB5A 3W37A 4CN6A 3ZM8A 3PZIA 1CGWA 4EAMA 3EMCA 2D0GA 4UFMA 4GI6A 4PYSA 2WHKA 3AIWA 3CZEA 4AZHA 2E9BA 3G6MA 2WW5A 1V6UA 2VRQA 3UG3A 2WC7A 2ESCA 3MV01 1FP8A 2WHMA 4LYQA 5LA0A 3SCPA 1BHGA 3N1AA 3NDZA 1W3JA 1UKPA 1JI1A 1B3ZA 4F79A 1E9LA 2QHAA 4HZ8A 2XFYA 1HF6A 1VFMA 3AI0A 1AVAA 1QHPA 1B3YA 1UD3A 4AIOA 1KCKA 1RD6A 3K8MA 2ZUNA 2OSYA 5A94A 2BXZA 3VIJA 2A3BA 2CBIA 4P7QA 3RMEA 3TOPA 1UYQA 4MAZA 3OZPA 4HTYA 2D24A 4WIWA 1C90A 1H2JA 3VD4A 1GVYA 1B30A 2QPUA 2QLYA 3GBDA 2J8FA 3SCNA 3FNDA 1E6ZA 4U2ZA 2JALA 4D6GA 3HN3A 1UKSA 2BHZA 5FKYA 1MW0A 1DWJM 3CZJA 3WH9A 1J0KA 2E8YA 4R27A 4UZSA 3NCOA 5BCAA 4Z2LA 2DDXA 1H4PA 1NQ6A 5M17A 1NARA 3SUTA 1H1NA 3WDHA 1QHOA 3GDBA 5LA1A 3CHFA 2VZTA 5BXPA 1BYCA 4YN5A 1GQKA 5ABHA 1YQ2A 2IUZA 3NSNA 2VCCA 1UH3A 1HJWA 1UWRA 1MYRA 1HJVA 5JIPA 4A3YA 4HOZA 3ARXA 4LPCA 2DIEA 1HVXA 4GZIA 3A3HA 1WNOA 1W3HA 2WC3A 2MANA 1H5VA 1W9PA 2QV4A 2XIIA 1TR1A 1C7SA 4OBSA 1KQYA 3WH5A 3TONA 4AZ6A 1CYGA 1EDGA 4MDOA 2X8RA 3WF4A 1L8NA 1V3MA 3JUGA 1HJSA 1TZ7A 7CGTA 1B31A 1JDDA 1HIZA 2D1ZA 2XVLA 1KXTA 1XRVA 4MTVA 1N82A 1WDRA 2ZWYA 4NRRA 5I24A 4BQ3A 5A6JA 4L4PA 3RM8A 2WWDA 3RM9A 3AZTA 3A6OA 4FLRA 2PWGA 1VB9A 4AC1X 3F5JA 1QBAA 4CU6A 3AZRA 1LQ0A 5A2AA 2EEXA 2WBGA 4NRSA 3WUGA 1VBUA 4WSKA 4QDMA 1ISZA 4GZEA 3SUSA 3ZT6A 1PX8A 2BHUA 1M04A 2WMHA 4XV0A 4GZJA 3LPFA 2AOSA 2J7HA 1NOFA 2VZOA 3NSMA 2VQUA 5CQ1A 3WFLA 4RE2A 2YIHA 2A3EA 4XZWA 1V0LA 4FLSA 4H8HA 4AD4A 2V3DA 4UQ9A 3ZJ7A 3WD2A 1QI4A 4JFVA 2W67A 3M46A 3ARYA 2YBUA 2XPKA 4TTGA 2GJRA 3A4AA 5CG0A 1VEOA 3VUPA 5I6SA 2WPGA 1VJZA 4MAVA 4P7OA 4AZCA 2EBNA 3EMZA 1C8YA 2WMIA 3RILA 3WBEA 4J7RA 4QLJA 2ZUTA 3SCTA 2CHNA 3BC9A 2DH3A 1F4HA 5A6AA 2JF7A 1CGTA 4ZENA 4ATWA 2BS9A 1J0ZA 4NSBA 4PUEA 3W28A 3GXDA 3KWXA 4LGXA 4F9DA 4MPKA 3WUEA 1D2KA 3GXIA 1CTNA 4FK9A 1TA3B 1OD8A 5HOSA 3W82A 8CGTA 2VRKA 5A8MA 6A3HA 3ALFA 2OLHA 1VFUA 2GVYA 4Q7NA 3MANA 1I1XA 2Q8XA 1E0XA 3AOFA 1QI5A 2O9RA 3W0KA 4E2OA 3AXXA 2ZX5A 1IZKA 3AYRA 4ACZB 1KCLA 3VGGA 3UCQA 3WEZA 2WCAA 1D3CA 2J7EA 3GH7A 7A3HA 1GJWA 3VPLA 5A2BA 1KGUA 1R85A 2HVMA 2VQTA 2UY3A 1HVQA 5DO8A 4JAWA 1GUVA 8A3HA 3U5UA 3BMWA 1Q6GA 4M8UA 2VX4A 3PZQA 1NOWA 1UWSA 1A47A 2FHCA 1X6NA 3VVGA 1KWKA 3II1A 2WKGA 1UKOA 3BAJA 5EB8A 1V6WA 3BCDA 1UR1A 4JKKA 4LXFA 3POHA 4NF7A 2J75A 3PTKA 1WP6A 3W4RA 3WF2A 1WDSA 4NI3A 5A69A 5IXEA 3M6DA 4J3XA 4W7VA 1XH0A 4CVWA 3CMGA 1EQPA 1Z32X 3GYCA 4HPHA 2IXUA 2WZHA 2WMKA 4AD3A 3OGVA 5IHSA 1G1YA 4P8VA 5A95A 5ABFB 4W7WA 1FFRA 1JGIA 3PZ9A 3FAXA 2UY4A 1UR4A 3WY1A 2V3FA 2PWEA 2FDMA 1J0YA 2W61A 4KGLA 4CGTA 2WVSA 4MNJA 3CUFA 2GDVA 2EPLX 2D2OA 2BVTA 3WF3A 3EDDA 2W92A 5A3HA 2W63A 1MXDA 1ZJBA 4XUYA 2VTFA 1C91A 2A3CA 5FCZA 1I1WA 4U5KA 4F8XA 3OBAA 4UFJA 1G01A 3S6TA 4B3LA 3B9AA 4Y7EA 2BXYA 2FGLA 1KBBA 4U5IA 1BG9A 3U5YA 4PMOA 1CXEA 3VDAA 4BQ2A 3N11A 1W2PA 4AZBA 1GPFA 1CLXA 1C8QA 2JFEX 4UQAA 4C7FA 1DP0A 1GOKA 3PZNA 3VDBA 3W6LA 3CTTA 2W62A 5I79A 2YLLA 1QHZA 4XZBA 2GJXA 1CGUA 2D23A 3VX1A 1UD6A 1Y7VA 4K68A 3OLEA 2JEQA 4UFIA 1FA2A 3MO4A 3OIHA 1OB0A 1OINA 5EFDA 1UD5A 1AQ0A 4PTVA 3QOMA 4AWEA 1JZ3A 3BAIA 2WM0A 1U33A 1J18A 4R5EA 3ARSA 4UFLA 1K9TA 1Q6CA 1H3GA 4PMYA 5EFFA 1VJSA 1LLOA 1EO7A 1HNYA 2A3AA 1V3HA 1OD0A 2G4FA 1W9XA 3DHUA 1UR8A 3MSDA 3WUFA 1KXQA 2VR5A 3NYDA 4A3HA 5I23A 2ZXQA 2AMGA 1W91A 1WE5A 1M7XA 1NOUA 3WELA 2CXGA 1PIGA 1SMAA 4H7VA 1B3WA 4WJXA 1B1YA 5JIWA 3GNPA 1CXHA 1UZ4A 4EANA 5TD4A 1FOBA 1F4AA 4H04A 2V5DA 3SUWA 5IHRA 2WCGA 2DT3A 1CENA 1AQHA 1TE1A 3PHAA 1BGGA 5AYBA 4ZE4A 4W89A 1E6RA 3ARPA 3RIKA 1HKKA 5GNYA 1CNVA 4BA0A 4JFUA 3LPGA 4E8DA 4ATDA 1GQJA 4UZUA 2BNJA 1ZBWA 4W86A 4EE9A 2J47A 5DT5A 3ARRA 4ZE5A 3L4VA 4OIFA 1J01A 1J9YA 1S46A 2XSBA 4OOZA 4PTWA 3TA9A 1QNSA 3WNMA 4M24A 2WKLA 3W6MA 4JZ5A 2WLYA 3WKZA 4MDPA 3I3BA 2OYMA 2Y8VA 4UQDA 5CSUA 4MJ4A 2DSWA 4AY1A 2DT2A 4UQEA 1LF1A 3KL5A 1V3JA 4RE3A 3AHXA 4PCTA 1BYAA 2XYLA 2XWEA 1VF8A 5IFPA 3N18A 3ZOAA 4D6FA 2YL5A 3SUVA 1UKQA 4OBRA 4WF7A 2XFFA 2C7FA 3AISA 3VIHA 3AXHA 1PJ9A 4MNLA 3OZOA 4ATLA 2YDQA 3EDFA 4UOQA 1B2YA 4CU8A 5BRQA 3AS0A 1V03A 1EHNA 2DSVA 2G3JA 3L4YA 2PWHA 3PTMA 4AZCB 2ZXDA 2VX6A 4TVUA 2WMIB 2VL4A 1UD2A 4KH2A 4TX6A 1CBGA 1MQRA 4D1IA 1GCYA 4AW7A 1K9FA 2O9PA 4PSPA 3WQVA 1IZJA 2YA0A 1JFHA 5HDRA 2EJ1A 1EXPA 3CBWA 3DYPA 2DSKA 1E3ZA 9CGTA 1GOIA 4GPNA 3VNZA 1PZ3A 4ZXLA 3FXYA 2Y24A 5CSYA 1CPUA 1V6XA 1WAWA 3B8SA 2VCBA 3BMVA 3WQ5A 1DHKA 2BY3A 4FLQA 3AS3A 4ML4A 2PF0A 3CZ8A 4S3JA 3UETA 5ABEA 1W9VA 3AQUA 1JF5A 1E40A 4UQBA 2J74A 3ZJKA 3GZAA 3RPMA 2GDUA 1B9ZA 4UCFA 4H2CA 3ARQA 1K9DA 2J7CA 2JE8A 1W1TA 3VMNA 2DQXA 1QBBA 4PN2A 4X0VA 1W3KA 1L0PA 1C3FA 3ZIZA 3T08A 3PZOA 2X0YA 4PMDA 1V3KA 3K1DA 3QHMA 1GHSA 5GPRA 3N9KA 2XSAA 1H0GA 2PI6A 4UTFA 1QNQA 1SMDA 3BLKA 2O9OA 2YLAA 2OSWA 1JYXA 3WF1A 1BGAA 3CMJA 1FHLA 4C7DA 4LX4A 4HU0A 3CZKA 1XH1A 2J77A 3OGSA 4D72A 1V6YA 1DWAM 2W91A 1PX4A 1G9HA 1GJUA 1JAEA 5D9NA 4Z2KA 4UFKA 1JDAA 4IISA 2PB1A 3EDKA 1C92A 1PPIA 1W9UA 1BF2A 1E4MM 1KR0A 2J7BA 4HA1A 3K4AA 5E6ZA 3IJ7A 1OIMA 2TAAA 4DWSA 2B31A 3T2QA 3SURA 5KZ6A 4Z2HA 4HU8A 2WAGA 2GJPA 1BLIA 2YL8A 3VIKA 1DWIM 4U33A
chains in the Genus database with same CATH superfamily
4LJ3A 2XIQA 3CB8A 4TXEA 1K3UA 4JR5A 5AHIA 4R7OA 1EWDA 2G41A 2WJZA 4QTGA 3R8GA 2O56A 2FZNA 4MB4A 2F9RA 1W3TA 4M6PA 5AY7A 2HBVA 4ZFCA 1JZ6A 4X60A 1OVDA 4J3VA 1Q6OA 4E5TA 2B7NA 2YL6A 3HGJA 3O15A 2P50A 1LTDA 3THCA 1FWJC 4LUIA 1TELA 4NJKA 3K46A 3JR2A 4ZO6A 4ZSTA 4XQ6A 2ZCGA 4HK6A 4CQDA 1U22A 4GI9A 1O5XA 2C1IA 1LRQA 1R8LA 3WD0A 4M19A 2QVNA 3ZVIA 2VWSA 3WDRA 3W53A 1JPKA 2GUBA 4QEHA 1IQ8A 1MVYA 1DWFM 1XGZA 4GHRA 3LU2A 4FO4A 4GXWA 2A7NA 2J7FA 4P8UA 4D8LA 2VEKA 2FH6A 3GKAA 1JZ7A 5D9MA 3OU8A 3VKKA 3T0CA 1Q7ZA 3PUGA 3LGGA 4A8RA 3OODA 3U2OA 3LNMA 5A6BD 3DFTA 4IXHA 4G56A 4S1FA 3CZLA 3T6CA 3C2YA 1CB7B 3CZGA 3QRHA 2ZUVA 2VI0A 1JZ2A 4JDYA 3L4WA 3W81A 2ZICA 3GAKA 4A35A 4R9OA 3K5XA 1L6YA 4TV5A 3VM5A 4DJFA 4FI4A 3SGUA 3NQ8A 3QN3A 1CDGA 1R38A 3N29A 2WJDA 1XQLA 3OZMA 3CUHA 3POCA 2HISA 1WOBA 1EH9A 3BCFA 3G1HA 4H2HA 3ZR4A 3GSMA 1VIWA 2WNQA 4ZODA 1ISWA 1OGSA 5GNXA 3SY1A 1PIFA 4J1OA 3NQCA 3VOHA 1E4LA 3GM8A 4L6OA 3NDYA 1LL4A 4HHHA 3T0BA 2D22A 1CEOA 4ZQOA 2EQDA 1VFFA 3QW3A 1XUUA 1I9CB 4JPGA 3FA3A 1QI3A 1ITXA 1NWTA 5M5DA 4MKSA 2A3HA 1QPQA 1Q4WA 3KL0A 2CZDA 4U31A 1JNDA 1H63A 2VT0A 5DELA 2Z7KA 5FIPA 1AH0A 1IYXA 1A5AA 1EJRC 4Q8QA 2V5JA 3SQLA 2DFAA 4BI7A 5HXMA 4A2SA 3O6YX 3GHTA 4GY7A 1S2TA 2ISVA 3SFWA 4C6DA 5HBFA 4LC8A 3LY0A 3FJNA 5H6HA 2GWGA 3N2OA 1H11A 3WFZA 1K8YA 1BVNP 4K8GA 3KAOA 2X1UA 1OCBA 4B5UA 4B5VA 1Q2RA 2QNEA 1KFJA 1E70M 2EKGA 3MKCA 1V79A 1JXKA 1G0CA 3CLWA 1WDPA 1MEIA 4OECA 3R5EA 4ZO9A 4JNZA 4N7QA 4CD6A 5FSDC 2XISA 1HL9A 4QE4A 1IGWA 4I5XA 3E0LA 1HJQA 4ZQRA 1KGXA 1FWIC 3SM0A 4AIEA 3CL6A 4JTEA 4GJ1A 3T2OA 3W24A 3OLDA 4LS0A 4ZTYA 1AZ2A 3KHDA 4ZEPA 3NQ6A 5FL0A 3TXZA 3SQSA 1WO2A 1DKWA 4EWND 3B9OA 2AGTA 4GOAA 4C6MA 1ZP4A 2FVMA 1X1ZA 2PWUA 4YNGA 3H7RA 2R94A 1DV7A 3BK0A 3EX3A 4LT9A 3LI1A 1N55A 4AH7A 5I3GA 4PUDA 4QG6A 4MUZA 4CNOA 1G4PA 2OLAA 3I3EA 2HCVA 1UH2A 5FF7A 1G4SA 1MDLA 4L7ZA 4FA3A 2XM1A 4W87A 1XUZA 1J6PA 3TDFA 2WZMA 4JEJA 2HTMA 2YB1A 1BQCA 1FWAC 4AYSA 1CXKA 3UESA 4NX0A 2RDTA 3OQEA 1XSJA 5M3WA 3T7VA 3G2GA 4GFSA 4JIEA 3GE7A 4MHBA 3WH8A 1MEHA 4RZBA 1TTIA 1TVNA 3P8JA 2R91A 4QS5A 4TU1A 2J7GA 3NOYA 1XLEA 2PUZA 3ZJ8A 2PBGA 1N8IA 5HMDA 3TSMA 3VNJA 1UQYA 3O7UA 3D3AA 4CLMA 2CNCA 3UJEA 4IXXA 3S42A 4PTDA 4I7VA 4GI4A 3AIQA 3WDQA 4AIUA 4Q4SA 3MDUA 1IEWA 1MWOA 4PTMA 1ODZA 5TIMA 2V6AA 4HZ6A 3ZO9A 3E0IA 2Y5EA 5F4WA 1OABA 3NQDA 4IG2A 1HFBA 3IACA 5B7ZA 2VFHA 3CAQA 4IF2A 1JYWA 2DT1A 3L5LA 3MMDA 1BXBA 3W3OA 3UWQA 2I1OA 7ODCA 3ZMRA 1E1FA 3WDPP 2FZBA 3WH6A 1RSCA 1CXFA 1WPCA 1K02A 4MPQA 2VVSA 4UTHA 3TFCA 1NFGA 4GKTA 4PE8A 5E0FA 2JIEA 4MYAA 4DN1A 3KOZA 2DEPA 2VURA 1XYAA 3APTA 3Q2DA 3CAWA 2J8GA 3ES7A 3H12A 4ZQCA 4JKLA 2XDFA 1UOZA 3OLIA 2A85A 4Z2IA 3C86A 1XYZA 2J62A 2CWXA 2DVXA 2FB3A 4PRWA 2GYIA 1ESWA 3QPYA 3W88A 1CLVA 2Z6IA 5CZKA 4W8LA 5KEZA 3AWNA 2PFHA 4J3WA 1P7TB 2IMRA 3GUWA 5I3FA 1QCWA 3T0DA 5C0QA 4R7JA 1FH7A 2D3LA 5E09A 3CUGA 5CLWA 2XG9A 3W1RA 5A5WA 2YZRA 5GJNA 1A5OC 1ZCCA 3TTOA 1J0JA 2D0HA 4TOQA 3BG9A 3NURA 1XLFA 5T91A 1FDJA 5K9DA 3AIUA 4GI8A 3KTCA 1DQUA 5D9PA 2HS6A 4E4PA 4Y96A 1F9CA 5A1AA 1BXNA 1XLCA 3TZFA 3T81A 1RCQA 3SBFA 2A6LA 4CCEA 1T7LA 3AJXA 3E74A 3WMCA 1XX1A 3S1VA 1PXGA 3HMCA 3GUGA 2GWNA 1O68A 5GQBA 4RCXA 4AIBA 4OOUA 1TZZA 2SFPA 4EF9A 1Q7QA 1C9DA 2CLFA 4AZ5A 4WDUA 2RH9A 4KIEA 2GDQA 4K8HA 1WKYA 4N02A 5E93A 1DJWA 3CUXA 1ALDA 1FWHC 3T4CA 3K2GA 3UWYA 4Y8EA 4BEQA 5EMKA 2PCQA 2QPSA 3B04A 4YL2A 1PKYA 1W9DM 1G94A 1VFTA 1SYTA 4GIRA 3AIEA 1VFSA 1A50A 2ZX6A 1XGDA 3UBPC 1KM4A 3VCRA 1LWJA 1CXIA 1YX1A 3NNTA 4P5UA 4QBXA 3CLMA 2WVVB 4YTQA 5CPOA 4MVAA 4XAYA 2WVUA 2CKRA 3VGEA 1UA7A 4F0MA 2VVNA 4E8GA 3FYOA 3FW6A 3LMYA 4GUGA 3QM3A 5LKYA 2VNCA 2C1GA 2YPIA 5CAKA 4H8NA 5D2VA 3TROA 4D9PA 3FY1A 2OLSA 1J5SA 3SEPA 3R0UA 3BAYA 4J27A 4ADUA 4NAEB 1OC7A 3XISA 1E56A 3C4UA 1X98A 4Z2GA 4WDWA 5HMEA 4F2TA 3W83A 3GHRA 1UMYA 3LX9A 1B9BA 1TRDA 5FD0A 1RXOB 3QGVA 2E25A 2QCCA 5K9XA 3UG4A 4NUWA 1BYDA 5AHNA 1WDQA 3VOCA 1ZBCA 5F2IA 2I5QA 3PB0A 4FAMA 2YDSA 1O1HA 2OQYA 1SZRA 3TV8A 4WKAA 2R9RA 3PZMA 5JBDA 2CZ5A 3PR2A 1TTJA 4M81A 4WZHA 3FEQA 3VU2A 2QCNA 5LSMA 3WQEA 4HT3A 3U7BA 3FN9A 2X09A 2QZRA 3VIGA 3O3RA 2G3FA 2YCLB 3W7EA 4UMBA 3OP2A 1I0DA 2CIPA 2J88A 5CPQA 2O7SA 2ALRA 1OM0A 4A4AA 4J3TA 1KM2A 1XG4A 1QFEA 3NPUA 2XGIA 4PEEA 3U2EA 1SJDA 4B15A 1FCUA 3MCMA 4WCJA 1RVGA 2PP0A 2RFGA 1P0EA 4B3KA 3MWCA 4O54A 2BY2A 3VOGA 4F48A 2VC9A 1ZLPA 4H7CA 2VOTA 1JI2A 3LHTA 3WJWA 2QCMA 1M7OA 1V3IA 4GH3A 3Q65A 1TRIA 1F73A 2POZA 1HJUA 1LLWA 1ZHAA 3W25A 3ONCA 2QMKA 4H1ZA 2BLEA 4LYRA 3H53A 2W27A 1KWGA 2QJNA 2ZYFA 4NZ4A 4JL1A 5EKYA 5KSWA 3ZZ1A 5AVHA 1EX5A 1WXJA 3G1VA 3EPMA 4ROQA 3TQVA 3MSGA 1R9ZA 1J0HA 3UQNA 4LFYA 2HXUA 2J25A 1V0NA 3TX9A 3I4KA 3RPTA 5D09A 3VKJA 4ONVA 2NT1A 3UCDA 3U4AA 1GQNA 1KBKA 2XVPA 3PPCA 1P1XA 1V0MA 3ZWSA 5C9ZA 2VR2A 4R34A 3P14A 1GW1A 4LWWA 3RN6A 1XI3A 3VMOA 3N6HA 3EA1A 1FH9A 3VC5A 1JD9A 1SZEA 3OBKA 4GA8A 5DY2A 1QNOA 1ICQA 1UC5A 2YGYA 3ONBA 4UNLA 5D2YA 3ZR6A 1GTEA 2R82A 3NFUA 4X2PA 3TTSA 1W5NA 3TW7A 4XX6A 4M82A 3UZJA 1DVJA 1UWUA 2NUYA 1NDWA 3WJZA 3THDA 2Z6JA 3UVAA 5M2FX 5CJMA 1O5QA 4A05A 1B4EA 4OVXA 5EYWA 3M0LA 4IUGA 4LV4A 1W8SA 2FQIA 1U83A 3WL1A 2C16A 1HGWA 2BY1A 4HCLA 4MM1A 1GVOA 4A3UA 3HZ3A 1XCXA 2VC5A 3KCLA 4JTAA 3SN1A 5CAHA 1LROA 2YCKX 5DFAA 3QZ6A 2OOFA 3OG3A 3RXZA 2A2IA 3S1UA 5G4EA 4PMNA 4BS0A 1UR9A 1A4MA 3DHFA 1HZYA 3GR8A 4YPJA 3G24A 3TE9A 2VM8A 4KCVA 1UA3A 2ZXBA 3PSWA 3NM1A 5T8GA 1KC7A 3NZRA 2Z1KA 5FL1A 1XIHA 2GGJA 3GG7A 2BGNE 4D6JA 4F9JA 3ITGA 2VKZG 3HGSA 1ELSA 3HM7A 1PKLA 5HPCA 1PV8A 4AEOA 4HPNA 1SFSA 3C0SA 4ORMA 3EZ4A 1LZOA 1TJRA 2W0UA 3N3TA 4IJRA 4LEFA 4RW3A 4PUNA 1R30A 5FJUA 3VM7A 2HVOA 3HMJG 1RBOB 3VIPA 3L21A 3DENA 3TTYA 4RE0A 2AKMA 3D5HA 3KRZA 1ZRQA 4ECLA 1KRMA 4HA4A 2CESA 2AAAA 4GVFA 1UWQA 5A8QA 2VO5A 4J28A 5BWAA 4JXCA 4JTFA 3FIGA 2P8BA 3VTRA 4L9XA 4ACZA 3PZTA 5GJMA 1BFNA 4W5ZA 2VGIA 2IKIA 3G77A 1O60A 3P7YA 1EC9A 1YDOA 1Z89A 4H41A 3L5AA 3LRMA 3WENA 4MJMA 2OFJA 3M41A 5BXTA 3GDTA 3M5YA 3UG8A 1ADSA 5ABGA 1JCJA 3O07A 4L1XA 5TAOA 2QKFA 2GFTA 4RZ5A 4GFIA 1R3YA 1YMYA 3NUKA 4KCUA 4HOWA 1JXJA 5HNRA 3KEHA 1FFQA 2NV9A 4BR1A 1GONA 1A5KC 3B8UA 2BTMA 4IPNB 1D3GA 4US6A 1VQTA 1V6VA 3MJYA 1FHVA 1JF6A 3C6CA 3WQDA 2HSAA 3MP3A 3PZUA 2VJXA 4EXQA 1YADA 1ITUA 4CN6A 1KTBA 3S2LA 4XZIA 1A5BA 4HQVA 3LGEA 4HNTA 3EMCA 3B0UX 4PYSA 2X0SA 4DUOA 5LIWX 5D02A 3AIWA 1A5CA 3K13A 3G6MA 1BD0A 2WW5A 3WLMA 3P60A 2WC7A 3P6LA 2Y7DA 1SSDA 1UWAA 1WKFA 2V5LA 3SRHA 5LA0A 3GK0A 1H50A 1W3JA 1P0BA 1HG3A 2X16A 3DFNA 4I7UA 1B3ZA 3OJGA 2VEPA 5F2MA 4NYYA 4HZ8A 3BMXA 4LRTA 1HF6A 3L66A 4QX4A 1AVAA 2P3ZA 1RD6A 2WJEA 2JQXA 2OSYA 4AVFA 1CT5A 1LRTA 4P7QA 5G2IA 1JQXA 3SZ8A 4HTYA 1N2VA 3H2FA 3M0MA 1ADDA 2GQ3A 2Y7FA 4CNTA 4DELA 3N6JA 3GBDA 3T44A 3TN4A 2J8FA 3SCNA 2Y88A 3C2EA 1E6ZA 4JBRA 3HN3A 3WLJA 5ABTA 1M7JA 1AODA 1MSSA 5BU9A 3LTSA 4R27A 2ZA2A 3VOFA 3N2MA 3VNIA 3FSTA 5BCAA 1JCLA 2VENA 5C2GA 2QUTA 1NARA 4FZIA 3TFXA 3MPGA 4AQLA 3CHFA 2DUZA 4HNUA 4IIEA 5CKSA 5ABHA 1YPIA 2IUZA 3ABZA 1N8WA 1SGJA 4P61A 2DZSA 1UWRA 3HA1A 4Y6GA 5JIPA 3IIXA 3OOQA 4HOZA 3CH0A 1WOAA 2DIEA 3MVTA 4GZIA 2E5DA 1XYCA 3BUVA 3ITXA 2QV4A 3SDOA 1TR1A 3ZVHB 4F0HA 1QDSA 1KQYA 5LXXA 2QUUA 4AZ6A 3U2ZA 1V3MA 1P5BA 7CGTA 3V4BA 3UJSA 5C55A 3KRUA 4O1CA 4HGXA 2DY3A 2C18A 2D2JA 1QMLA 3GKFA 1ZENA 2OG9A 1QASA 2Y5SA 5I03A 2QCDB 3TSBA 5EMLA 5A6JA 4IGHA 1FCVA 4G9PA 1VB9A 4AC1X 1QBAA 2VFGA 4CU6A 3BPWA 2C14A 3AZRA 1L6FA 1LQ0A 2ACQA 1XICA 4AG0A 4QITA 1VBUA 3M4HA 4LTSA 3QY6A 2VHLA 4JQ4A 3VOJA 1V7AA 4NT0A 4XV0A 1OK6A 4GZJA 2AOSA 2J7HA 1XFCA 4REQB 2VZOA 1AG1O 2PTDA 4GXMA 3ABQA 1D3HA 3CQHA 3PJTA 2VQUA 4LAMA 3GZ3A 2IPWA 2YIHA 3W6YA 4XZWA 4O15A 3D0CA 1F6PA 5HAOA 2V3DA 3N25A 1FXPA 3PBUA 1SZGA 2GVEA 3TC6A 1KFKA 4C6EA 1IXQA 2OZ3A 4TTGA 3NGJA 1FY6A 3H2CA 1IXNA 3O0KA 4IFRA 3TR9A 2GQ8A 1Z41A 1VJZA 4O8RA 4MAVA 5REQA 3T07A 5D04C 5LGXA 5I07A 1H1ZA 1WQ5A 2ZUTA 3ITOA 2DZPA 1F4HA 1A5MC 4E6MA 4YWIA 2Y7EA 1XLJA 4UTTA 4DZAA 1TR9A 1VC4A 2Z2UA 4PFMA 4F9DA 3LV6A 1D2KA 2HQAA 1ZNNA 3VKBA 1K4GA 1OD8A 1TA3B 1XYMA 3URQA 1A5SA 1TWWA 5I00A 4BFAA 2D73A 2GQ9A 3A3WA 2OLHA 2E67A 3SN4A 3UF9A 5I06A 3E0WA 1E0XA 1VCVA 1QI5A 2O9RA 4XZNX 3AXXA 3PSVA 4ADSA 3TQ0A 2PGRA 3WEZA 1K7EA 4DO7A 1D3CA 1S2VA 3GH7A 1IIHA 1SO4A 7A3HA 1GJWA 5A2BA 1KGUA 2HVMA 2ZZ6A 2VQTA 4Q4OA 1A49A 1W31A 4JAWA 2XN0A 3H26A 8A3HA 3MI2A 2GOUA 5G1MA 3NVTA 4ADTA 3BARA 1K1DA 2VD8A 3TW9A 4A6GA 4J4KA 2PODA 2ACRA 1X6NA 2YX0A 3VVGA 3K4WA 2WKGA 3UZ5A 3W2NA 5EB8A 4KEUA 3U4FA 4LUSB 2HMCA 5FF3A 1K7FA 3R4IA 4NF7A 1E9YB 4FP1A 3W4RA 3WF2A 5IXEA 4LS1A 4W7VA 2X30A 1PB0A 1EQPA 3OPSA 3PUDA 4AD3A 2WNNA 1JPMA 1UB3A 2NXHA 3CWNA 2XU2A 5ABFB 3URBA 1UR4A 4K39A 5LHFA 4AB4A 1S5TA 1UP3A 1Y0EA 4WY0B 1WAUA 3S1XA 3H21A 3SN0A 3BG3A 4KGLA 3GVGA 4L6HA 4MNJA 2BVTA 1R0MA 3NO1A 1ZJBA 4FXJA 2VTFA 3SJ3A 4KPLA 4WOZA 3LHUA 3OBAA 3B0VC 3IVTA 3KOYA 2FGLA 1BG9A 4H9MA 3HFTA 3VDAA 1ZY9A 3WO8A 3GD6A 1DQWA 4G7FA 2ZVIA 1GOKA 3RR4A 4Z0SA 2H9AB 3W6LA 2W62A 1PWLA 2OZTA 2FYMA 4BJHA 2GJXA 1KFEA 2OZ8A 3EXTA 2JBMA 3WG6A 3T42A 3WQGA 4QE1A 3LCHA 4JTTA 4UFIA 4LCSA 1V5XA 3JS3A 5AC6A 8RUCA 1OINA 3LCWA 3QOMA 3KVLA 1JZ3A 1AW2A 4KEVA 3B05A 3VKCA 2B7PA 4ZB2A 1J18A 3HURA 4MUPA 4ALDA 5D32A 4NJHA 4A21A 2I9EA 4QSHA 3GVVA 1PHWA 3ARSA 1SW7A 1Q6CA 1S2CA 3NQEA 2RJGA 1HNYA 3WLIA 2AMXA 1R9XA 2V0TA 1ME8A 1L8PA 4LCRA 1FWWA 2V81A 1I0BA 3LCLA 4IP4A 3OHMB 4P2VA 1I2QA 3UCCA 4LC6A 2ZXQA 1AW1A 1WE5A 1M7XA 1PS9A 1PKNA 1SMAA 4AYGA 4WJXA 3VOIA 3AUOA 1AH3A 3GNPA 3PBMA 4EANA 4HSNA 2NVCA 4M3PA 1R2SA 1F4AA 4H04A 1TPB1 3R12A 1ZZMA 5D30A 4Y2WA 3PNUA 1AQHA 3Q45A 4AX7A 5IM51 1BGGA 5LNRA 3KTXA 1E6RA 1PTAA 1GK8A 1KRAC 3E3HA 1CNVA 2A6NA 1XKJA 1IF2A 1ECQA 4DBWA 4YXGA 4E8DA 4UZUA 4QG8A 2Z2BA 1NDYA 2QIWA 1VCFA 4ZE5A 1UASA 1I45A 1NF0A 2VWTA 1S46A 2XSBA 5CC6A 1YYAA 3TA9A 4C6KA 4ZQPA 3QQ0A 3RK8A 4H4IA 4GUJA 4MDPA 1SJBA 2E68A 2QULA 2OYMA 4H6QA 5CSUA 4H7ZA 5C6MA 3KL5A 1V3JA 5AFDA 4ZGYA 3HTWA 4PCTA 3V36A 5IFPA 1B54A 4D6FA 3B8TA 3QZAA 1MRQA 2OKTA 2HE8A 2XFFA 2C7FA 3AXHA 2J66A 1PJ9A 3O0FA 4XISA 2CFFA 2R1NA 3AS0A 4JN7A 2GVJA 2G3JA 3L4YA 4YMZA 1AZ1A 4AF0B 2AQVA 2ISFA 1VBJA 3VKDA 1EL3A 2EJAA 3IV3A 3VCNA 2BSLA 1DIKA 1JFHA 5HDRA 2YFNA 5K4ZA 3R6IA 3W00A 9CGTA 3L65A 3BQ6A 2EHHA 3VNZA 3BVJA 3FXYA 1S3HA 2ZC8A 4GCAA 1CPUA 1V6XA 2GJNA 3B8SA 4GIYA 4OQVA 1ZALA 4ML4A 2PF0A 4S3JA 3UETA 1JF5A 3H2AA 2XH4A 3KCOA 1B9ZA 2DP3A 1YDVA 5U7SA 3BICA 3LD5A 1L2UA 4BEUA 3W7CA 3VMNA 1QNVA 1RLDA 5DN1A 4X0VA 4IFKA 2J6XA 1L0PA 2OEKA 3PZOA 4ZMGA 3STFA 3K1DA 5TF0A 2VGFA 3TAKA 1GHSA 4RDYA 1TYGA 3KOFA 5GPRA 2XSAA 3FS2A 3LYEA 2PI6A 1Z8AA 1OCNA 3NL5A 4O0QA 1QPNA 5HA7A 1Q3NA 2F2KA 3R7MA 2OSWA 1BGAA 2CWNA 5MHBA 4HSHA 4C7DA 4I9MA 3E38A 4O1FA 1J79A 1PDZA 4BF5A 2NQLA 1XM3A 3TN5A 3MZNA 1GJUA 5AHLA 1NTHA 2YB4A 4UFKA 4NXSA 2VEFA 1TZ9A 3CQJA 3EDKA 1C92A 2Z1VA 1BF2A 1E4MM 2J7BA 4HA1A 3XINA 5HUOA 4DWSA 4NIRA 1QR7A 3UPWA 3GG0A 1AK5A 3M0HA 4AU0A 2OJPA 3ABXA 1DWIM 1XPGA 3PWAA 4DM1A 1FH8A 1ZQ5A 3VINA 2X2GA 2BGSA 3E0VA 3QBUA 4DIAA 2PDYA 4L65A 3WEOA 5EMJA 3SIMA 1W1VA 3HJZA 3A22A 4FNPA 3ANVA 2XINA 4H6EA 1EGVA 1UUMA 3LBMA 2E6YA 2D3NA 3TTQA 1SSGA 4U28A 3W84A 3IJLA 1YDYA 3RM4A 1RQHA 1HL8A 2PU0A 3UZXA 2PDPA 1I60A 2EGZA 4HMDA 3CMFA 3WLPA 4B90A 3PB2A 2J27A 5E9AA 1VYSX 1B5TA 4WUIA 2ZE0A 3DBNA 4W9TA 7ENLA 3BOXA 4IPLA 3AUJA 3MUCA 4GIEA 5H91A 4PUWA 3CWOX 4LVFA 3P0WA 3MMUA 1J2WA 4GO9A 5HWMA 4H00A 1CB2A 2GUUA 3G5EA 5F1VA 3UGRA 1SZNA 4DBSA 2NWSA 2G0WA 3OIXA 4K1GA 2YKKA 3BW4A 5I77A 1QW9A 1WBHA 2GGIA 1H0IA 4AMCA 4CKQA 3NQAA 1AUSL 3S3GA 1P0KA 1CGYA 1XRFA 4MFEA 2ZOXA 4Q4PA 2AQOA 2J79A 4XBSA 5BMXA 2V5CA 2GGEA 2CU0A 1E5NA 3I68A 3TH6A 2INFA 3UY8A 1EGZA 3L4UA 4Z1BA 2OWWA 3THAA 1KRBC 4QQ3A 3TLLA 1NVMA 5G5IA 4JYFA 3G6LA 5J8LA 1M01A 2XUCA 1UH4A 3CUJA 3KZPA 4FXSA 4HN8A 1LWHA 3ZLGA 4AZGA 2QYGA 4XKMA 1H7OA 1WUFA 1JUBA 5CBIA 5J04A 3XIMA 3F4WA 2UY2A 4LS2A 5CPTA 2BASA 3VZZA 4EKJA 2X1IA 2BODX 1KLZA 1Z6KA 5AC8A 4MLRA 3AHYA 3DBPA 2ON3A 3MT1A 4IMEA 1BWKA 4Q8PA 4W84A 1XSIA 2CBVA 2HV5A 3EB4A 3OA3A 3C2OA 3L9CA 4EPBC 3GC4A 1UZ1A 3R0DA 4CD8A 1JDCA 1K8ZA 3VD3A 1XINA 2OWCA 3ARZA 1F6KA 1XL9A 3DN5A 4UOJA 2VX5A 5LA2A 1EPXA 2OXNA 4XO6A 4MLJA 2W3ZA 1J10A 4W93A 3C52A 2TYSA 1O4UA 1EJXC 5ECUA 3GNRA 1O94A 3AALA 1J12A 3VE9A 1XPYA 1OEPA 4PMXA 3CT2A 1MQQA 3I65A 3RHGA 3SB0A 4K3ZA 3AIBA 1GVSA 4O57A 4KGJA 1F3EA 1FWDC 2OWXA 3UYCA 4FMVA 5IRPA 1W1PA 4J2PA 1SJAA 2WB5A 4PSRA 2ZKMX 1LG1A 4O1DA 2CERA 3RO8A 4ZOBA 1E4NA 4KCWA 4KERA 1JDFA 3RCMA 1ISYA 3W7OA 5DBUA 4QQUA 3QY8A 2QEZA 2QJMA 1DIDA 3HQ1A 5AZ1A 3EB2A 3CAVA 3VUSA 1UBSA 4ZOCA 5H2ZA 3KLKA 1VCGA 1EZ2A 5HNNA 4AEEA 3CS2A 3GDRA 1B3VA 3GX9A 4GJIA 3REQA 4N9BA 3G1XA 4LF1A 4Q8TA 4AVOA 2W6RA 3ZT7A 5D4YA 2HZGA 4X63A 5BRPA 3VD9A 1E5JA 3HQNA 3MCOA 1ITCA 3L23A 3GFZA 4Q4RA 4XBJA 1RALA 1T41A 3IUIA 4X2RA 5FJPA 3VGFA 3CGTA 3SAZA 3GU9A 3DH7A 1QTWA 2A3LA 3MB9A 1QWKA 2G50A 4GGBA 2BBFA 5BWFA 3W7MA 1AJ2A 1OZMA 5DF0A 2W66A 2A79A 2GK1A 3N2BA 1L6SA 1X8CA 3OVQA 4GQRA 4PZVA 3EPNA 2PE4A 2E5BA 3DOPA 3GH4A 4XB3A 2E28A 1KFBA 3QKZA 4B16A 1E0TA 2CITA 1A5LC 1TTPA 5EMMA 4OJYA 3USZA 3FLUA 3P82A 3HGRA 1LCOA 3L4ZA 2C79A 1QNPA 5A6LA 3EWYA 1OFAA 1JCYA 3GRIA 4JKMA 2CYGA 3DI1A 3SY8A 3GW0A 2VXNA 3PAOA 4RX0A 4S3AA 3PUOA 1GPWA 2XFWA 3GR7A 1REQA 4QIUA 3TNBA 1S1RA 4K38A 1E71M 2OU4A 2G3MA 3T8LA 4PMJA 3TK7A 3UJRA 1GZJA 1TJPA 1VEPA 4H83A 5DBTA 2WXDM 3CPUA 1VRXA 1JGMA 3R8RA 1E15A 1TV3A 2XJ7A 3P93A 5CZTA 3O9NA 2PC4A 2NLIA 2WHLA 2DZXA 3O6DA 4E38A 3UXIA 2XIBA 3ECQA 1HJXA 1DORA 1JPIA 2CPUA 3SCWA 4V28A 2H3BA 3A24A 5H8PA 4PEKA 1VAHA 2ACSA 4JCLA 3WCZA 1MEWA 3STGA 2Y63A 3RPDA 1PE1A 1R5YA 1QVBA 1GYNA 1MFVA 1A0EA 1TMHA 3AU6A 4C6CA 3GFXA 1R3WA 3MUXA 5I3IA 1SR0A 1IEVA 3S8HA 1U1UA 3HGOA 2PTXA 4QM1A 1JCMP 2VEMA 3U0HA 1G5AA 3ES8A 1U2YA 2ZIDA 3EOEA 2X2YA 1TJ2A 3CHVA 3EA2A 4DPPA 1TB3A 5BU6A 1NP2A 4NJIA 3O2LA 9XIMA 3PF3A 3TA6A 2VFDA 4PBFA 3W02A 3BLPX 4P8XA 3E96A 4PODA 4LANA 5G2HA 1E0WA 5E70A 3USBA 2C3ZA 5F4SA 6ENLA 5JBFA 1ISVA 2E0PA 2WZEA 3ISIX 3UP8A 3KHJA 1F8MA 4PBGA 3T9PA 2Z29A 1E73M 4S3EA 4G1KA 3CO4A 1FWSA 3G1SA 4WXYA 4YCOA 3GS6A 1KKOA 3IAPA 1VP5A 1GORA 4NNCA 2Z1BA 3TW6A 4CQCA 4W88A 3NQVA 3HV9A 1HX0A 3AICA 1ZS2A 2FJUB 4DB7A 2UY5A 2QDHA 4QG9A 4DF1A 3BAXA 3RYSA 4EWJA 1FUYA 4MB1A 1LQ2A 2VRJA 5DCBA 1MNSA 2VR4A 3AWOA 3CU2A 2PDHA 4DQWA 2QCHA 2CBJA 3ZXWA 4GQ0A 1FP9A 1DBTA 2Q8ZA 1K4HA 3UGVA 1L2QA 3MMTA 2WK2A 2PTZA 1TPH1 4H9UA 4NY2A 1PWMA 5D9OA 1OT2A 9RUBA 4MJZA 3R0KA 3NR0A 4HMCA 4O13A 2BB0A 2UBPC 3UT0A 3UYIA 4M80A 3MKKA 2CHRA 4V33A 2HE5A 4KW2A 1K03A 3RLVA 3DG7A 2JKAA 2YXXA 3WMBA 1PEZA 1GOWA 5MKGA 1XLAA 1ZTVA 2OT0A 1VJIA 3FHQA 4GUHA 4G7EA 4S3CA 3KE0A 4DPQA 3M07A 3IJ6A 5I7GA 3WQPA 4YIWA 1KM0A 4WJEA 2ZRXA 3F5KA 4WQ6A 2INZA 3C2VA 2PTYA 4IUOA 2YSWA 4U3AA 2EAWA 1PL9A 4LUTA 2QCLA 1OFRA 3SCVA 1Q7MA 3QOKA 1IIGA 3BGAA 5HNTA 3M7SA 2ZWZA 2E40A 4KWOA 4DWDA 2FHBA 4IZGA 4K7VA 4DJFC 1A5UA 1ML1A 2WCSA 1MXSA 3IVUA 1Q65A 3F2CA 5U4NA 5AKQA 1F07A 1W6TA 4LQ1A 2E6FA 1BAGA 3RITA 2YCJA 2C19A 2VFFA 4C6OA 4RR4A 4A8IA 4NAFA 1VFHA 3M44A 3LK6A 3FK4A 2ZZ4A 4C6IA 3SRFA 4KKXA 1JUKA 2PGEA 1DPMA 4GKLA 4TMBA 3UW6A 5AC5A 4B4FA 1AQMA 3VI2A 4WXZA 1RPKA 1PO9A 1QPOA 2UV8G 3GIPA 4DYKA 1IV8A 2WC4A 3WIJA 1PTGA 5KTLA 1V0KA 2WMGA 4ICMA 1TPDA 2P0IA 1WCGA 1QU4A 3BAWA 2B81A 2GGGA 3DC8A 3SCRA 5C7HA 3W73A 1PZ1A 3V5OA 1BPLB 3PBYA 5EA9A 1PBGA 5CG7A 1OBAA 4JEQA 1CI1A 3FAWA 2J7DA 2PP1A 2CLEA 1H41A 4UNIA 1FHDA 4X22A 3WBWA 1IT0A 4DUWA 4KWWA 4AEFA 4MFDA 3FKKA 1QW7A 2Q3OA 2NX9A 3GIYA 2VZVA 1EIXA 2NW0A 1IEIA 4IG2B 2CHOA 2EO7A 1M6JA 2R1KA 3ATZA 2VEGA 4MYXA 1K6AA 5BYWA 3SIZA 2CLOA 1C9WA 1BSIA 4GQBA 4DUXA 1QAPA 4JX6A 4RUBA 5A8OA 3LLDA 3OLGA 3I7SA 1JEZA 4NG3A 4P7RA 3N73A 3EWZA 1T96A 2OGJA 3S9YA 2PBOA 1HN1A 4Q8OA 2NX3A 3N14A 5CZSA 4CVUA 4W8BA 2OYKA 5F2LA 4W7UA 1SW3A 4LRSA 4Y90A 5E0CA 4WGXA 1EJWC 2NLYA 1H09A 3LXBA 3VNYA 3SCQA 1MMFA 4TTUA 4PMZA 4RE4A 3N2XA 4E8CA 5FA5A 2R8WA 1Q85A 2ATMA 1HP5A 1HKJA 2Z26A 5IFTA 4JIQA 4US5D 4HP5A 3F4DA 1PUDA 1HKIA 3H7UA 1HO1A 3DECA 4GNJA 1QUMA 2F6UA 1EPVA 1A0DA 1BG4A 4WSJA 4IJBA 1V3LA 2AGKA 2BDQA 4O0ZA 5J5DA 2GJLA 3CJPA 3OQ8A 3D3FA 4W85A 1VPXA 3GH5A 3AXKA 1ZSXA 1XLMA 4IMCA 4NX5A 3G18A 4TUFA 2PDCA 4H01A 1XQKA 2V30A 1WB0A 2CKSA 2WBKA 3MY9A 1JVNA 1X6UA 3AIVA 4KRTA 4QJ3B 4Q7BA 3W71A 4TX8A 4AISA 4O14A 2PC8A 2Y61A 1SW0A 3QFEA 3UEQA 3TNOA 2YZ5A 4KESA 4B3ZA 3WQWA 3CV1A 4ZQMA 4A22A 1AMYA 4C6BA 4Z08A 1UCWA 4EF8A 1E6PA 3G0UA 2B0MA 1QNRA 1ZAJA 1BTCA 4YVXA 5CPNA 3E49A 4B5WA 1J5TA 3WD4A 1U5HA 1QI0A 4OGZA 1Q13A 4Z17A 2R24A 2OTDA 4DEFA 1EQCA 4RV3A 1JUEA 2QJJA 1YEYA 4FOKA 1E9ZB 4Z1YA 3WBXA 1W1YA 3PPFA 1NSJA 5FJRA 3N13A 3KS6A 2JKEA 3ZJ6A 5F7UA 1GQLA 1KM3A 3EDEA 4HB7A 2TPSA 4KWUA 3KXQA 3PG9A 4H9XA 4TVDA 2BP1A 1FX6A 2PDNA 4JHZA 2WSKA 1R9YA 3R2GA 1SU5A 4PMRA 4LBSA 3AS1A 4XKYA 3K1GA 1TPVA 1WZAA 2GSJA 4I5UA 3QR0A 4LAZA 2Z1XA 1KO0A 1YKWA 2WSPA 4CCDA 1VZWA 4AVNA 3AFBA 3W76A 1ZBKA 4HMNA 3QQWA 2I14A 1GTHA 4GO8A 1R3SA 3HPSA 3TMLA 3LS9A 2Y2WA 4QRNA 1HUVA 4IP5A 3V0TA 2I56A 3AZSA 3ITTA 1IR1A 5DEZA 1LM1A 3CIXA 4M7TA 1I75A 3L7RA 4EK7A 3RX2A 4YTTA 1H49A 2FVKA 4P7LA 3C8NA 2TMDA 4JICA 1G7VA 4AHQA 3WYZA 7REQA 3LRLA 2WANA 1QPKA 1OCJA 1E6NA 1KTNA 3WNLA 3UWZA 4Z1CA 3H2NA 1ZB5A 1QK2A 4B5XA 3LRKA 1CGWA 1H1YA 3N9SA 1UP2A 2D0GA 4UFMA 1GVFA 3IGSA 1FQ0A 3MWAA 3CZEA 3MBDA 1ZGDA 4ZOAA 4MY9A 1V6UA 2VRQA 1H5YA 3UG3A 3M6YA 2ESCA 1FP8A 3RU6A 1QO5A 3GW3A 2IS7A 4US5A 3C2RA 3H7VA 4Q6JA 1RLCL 4NZ1A 4MZ1A 4JTKA 1B3YA 4AIOA 5C9XA 2PEVA 2Q3RA 4FNSA 5A94A 5D37A 4JTUA 8XIAA 2CBIA 4S3GA 4L9ZA 3TOPA 1GKPA 4MAZA 4Z1AA 1H2JA 1TJ1A 1GVYA 2QPUA 2QLYA 3TYAA 3FNDA 3WLRA 4RDVA 4N9EA 4U2ZA 3R89A 4D6GA 1FKWA 2Z7GA 2BHZA 1YTEA 2XIJA 4DJFD 2IW0A 3DAQA 5RUBA 2E8YA 4RXGA 4QGCA 4RNJA 2A7RA 3L67A 3EAUA 2DDXA 4CEUC 2A21A 4XAZA 3NQMA 1WXYA 3E6EA 2WM1A 1ENUA 4WDXA 3L68A 4X3ZA 3W74A 4S38A 3NGFA 5BXPA 4YN5A 1YQ2A 1YE4A 2G97A 3FDKA 3NSNA 3FYYA 4MG4A 2IQTA 3O05A 3S83A 4PRTA 3N4AA 1KM1A 3S46A 4LPCA 4UTJA 2OODA 3PP7A 2MANA 4U10A 1W9PA 1MNZA 3NAVA 3PVFA 1Y5WA 4LAKA 1I2PA 1UIOA 3WH5A 1L8NA 3PC0A 1HJSA 1W5OA 4ZOEA 1RA5A 3H2OA 1JDDA 3UNTA 3IPWA 2XVLA 1P1MA 4ILSA 1N82A 4NRRA 5I24A 4FNRA 2JGYA 2OELA 1K8XA 1TQJA 3T78A 4C6NA 2EG7A 4L4PA 2WWDA 3RM9A 4Q8NA 3AZTA 4FLRA 2FZMA 2PWGA 1UBPC 4LNYA 3F5JA 2QS8A 1YNQA 2EEXA 4S2CA 2WBGA 1TV8A 3WUGA 3KM8A 1ISZA 4GZEA 5KZDA 1S3TC 3W7HA 2MNRA 3SUSA 3ZT6A 4RZ4A 5FEXA 1Z7AA 2WMHA 2OMAA 1G4EA 3CPRA 4FNQA 2FPTA 1NF7A 1GOXA 3NQ7A 1O1ZA 2O4MA 4LVGA 5CEWA 1DYSA 4ENLA 3GWQA 1EWEA 4NZJA 4FLSA 4HK7A 3M5ZA 4ERAA 3N34A 3EA3A 3GTHA 3GDLA 4G6CA 3KCJA 3M46A 3ARYA 4ORIA 1YNPA 4GUFA 2XPKA 4ERGA 4L1GA 2WPGA 3RLUA 3W7RA 4FSAA 2EG6A 4P7OA 3TQKA 4QEEA 3EMZA 3RILA 1YRRA 2QQ6A 3W23A 4J7RA 1UMLA 3KBWA 3SCTA 2CHNA 3R10A 1EEPA 3HOJA 4UB9A 2CLHA 3LHYA 1ZFJA 4MGGA 4DJED 3C3UA 4MPKA 2GVLA 3WUEA 3GXIA 3BURA 4FK9A 5HOSA 4UC5A 4MWAC 3Q37A 1RA0A 3P2VA 3IIVA 4BI5A 1M68A 4Q7NA 1JRCA 4YS1A 4H19A 1I1XA 4L9YA 2HVNA 2Q8XA 3AOFA 3W0KA 3AYRA 4ACZB 4RNFA 3LUTA 4XD3A 3UCQA 5C9UA 3IUDA 3N2CA 4O0KA 3VPLA 1R85A 1HVQA 5DO8A 4B5SA 4HSOA 5I02A 4D8ZA 4NNAA 3ERPA 2VX4A 1LP6A 3QFWA 3SGZA 1EX1A 4GCXA 4IIDA 5LIXX 3WK2A 1UKOA 1AJZA 2ZZ5A 3BAJA 4OTKA 1W0MA 1T5AA 4JKKA 1S5VA 4PUJA 2X1SA 3AC0A 1HQTA 3IIZA 3POHA 5HWNA 2J75A 4WEVX 1HW6A 3PTKA 1IR2A 1S2UA 4NI3A 4J3XA 2ZC1A 3SQMA 4CVWA 3QC0A 1Z32X 1XKYA 2FZ8A 2IXUA 4TQTA 2QV5A 3EKLA 4QHRA 1FHUA 3OGVA 5IHSA 1VRDA 1POJA 5KZEA 3KLLA 5A95A 3PZ9A 2FMOA 1IHIA 1UC4A 4JTJA 4HKPA 3R8HA 3WY1A 4A8NA 1U1HA 1EJSC 5T9BG 5FJJA 1KRCC 1OFOA 1BQGA 2P1FA 4CGTA 1ONRA 3UPBA 1VYPX 3CUFA 2GDVA 1M7PA 3EDDA 3TCSA 2PZNA 1MXDA 4F2UA 3BOFA 5FCZA 1I1WA 3GR4A 2QJIA 4UFJA 2FPVA 2XN1A 4U5IA 1VGAA 1CXEA 4S39A 3ID7A 2GOKA 3N11A 4BQ2A 3E9AA 4H6KA 4RZ6A 2A1YA 1CLXA 1LUCA 2PDMA 2H90A 4JD4A 1DP0A 3PWGA 3M7WA 3VDBA 4K37A 1F8IA 4HBKA 1F2JA 1OZQA 3NYZA 2YLLA 1YTDA 2DZAA 1GEQA 3A23A 4XZBA 4GLEA 3STCA 3FJ6A 3VX1A 3QTGA 1UD6A 1A4LA 1PCWA 4NXKA 3MO4A 4IH3A 1OB0A 2PLMA 3FXGA 5EFDA 1UD5A 3PFRA 1EBGA 4GACA 4FX7A 1T8XA 3B8VA 1DXIA 3W1LA 4IIFA 1LT7A 3G8EA 3BAIA 3B0YA 4JTCA 3UFYA 3QH2A 4O8AA 4LAUA 5FSEC 2YW3A 2HS8A 4XD6A 4FXFA 2C71A 1S2AA 2D2GA 4IOTA 3A4JA 1FWTA 4K7YA 4DJEA 1H7XA 1OD0A 2G4FA 1W9XA 1UR8A 3MSRA 3E2RA 3MSDA 2VR5A 2OO0A 4EPKA 3F1QA 1EF2A 4ZL1A 4IQDA 3LCXA 1NOUA 3WELA 2XH2A 4H7VA 1B3WA 2Q71A 5JIWA 3UJ2A 1HKWA 1UZ4A 5TD4A 1ICSA 2V5DA 1MI3A 3SUWA 3ZFHA 4GYPA 5IHRA 1X38A 2Y7GA 4UWMA 2Y1HA 2Y70A 1HKKA 3FA5A 5GNYA 4KRZA 4PULA 2YYTA 3WLSA 1L6GA 4EX4A 3TJIA 1GQJA 4EE9A 5DT5A 4F0RA 4J5NA 2W79A 5AYXA 3CWHA 3NOEA 1F3XA 4OIFA 3UXKA 4PTWA 4YTSA 4M24A 4OV9A 2WKLA 3W6MA 2WLYA 3WKZA 4WY0F 4LEQA 1XIDA 2Y8VA 4UQDA 4POCA 1ONWA 4AY1A 4V15A 2OT1A 4RE3A 1FWRA 1B57A 1TREA 1YTKA 4Q4MA 1EUAA 1VF8A 2KX9A 2XWEA 4Y9PA 1OX4A 3N18A 3P3BA 2X7WA 3NWRA 4XZMX 1IWPA 2HNHA 1UKQA 1OG0A 3PS7A 4C60A 3STPA 3DUGA 3P5ZA 4GY0A 1SFTA 4PB3A 2PDBA 4ATLA 3M0XA 4UOQA 2ABBA 3HO8A 3F2DA 1M9HA 5BRQA 1X8FA 2DSVA 3JZUA 3BJSA 5FF4A 2BZNA 5REQB 3PTMA 3LXCA 1AQFA 2ZXDA 2VL4A 1UD2A 5B80A 4TX6A 4D1IA 3RAOA 3WQVA 4HN4A 3QY7A 1EXPA 3VNLA 3ATYA 1E3ZA 4LSBA 4R33A 1GOIA 1EYWA 2Y24A 1AW5A 1FCQA 3SSJA 4WD0A 4H9ZA 2VCBA 3KS5A 2NQJA 1Q66A 4YVVA 3M0JA 1FXQA 2NSOA 3CZ8A 3DFYA 2V2HA 3MA8A 5D2WA 4MZYA 3S2MA 1YXDA 1H7NA 4ZQNA 3OO2A 4H2CA 2E6AA 4L1WA 1BRLA 3EEZA 5FI8A 3W2MA 1W1TA 1GVQA 4GVHA 3MVIA 3PK7A 2XH7A 1OX6A 4CNUA 4PMDA 2Y6ZA 1V3KA 3OYXA 5HQMA 3S4TA 3QHMA 3E0FA 3N6QA 2ADAA 5AN7A 2X41A 3N9KA 3BW3A 4R9XA 4H9TA 4V1YA 4JTQA 2X42A 1QNQA 1OX5A 1PIIA 1SMDA 3TN3A 3BLKA 3T40A 3O63A 4HPJA 3RCYA 3KDOA 3WF1A 3ME3A 3CMJA 4MWAD 4FNTA 4HU0A 1F61A 1XH1A 3G0XA 4DJDD 4LY8A 3MI3A 5TBOA 3KBVA 3TYZA 3GAYA 1HGYA 5D03A 4M6VA 2ZRUA 3B0XA 3G1AA 1MO0A 4XAFA 3H2MA 3MKVA 4I9JA 3WLTA 1JCXA 4X9SA 3S5OA 4LBRA 3D6NA 1TCDA 2ZE3A 4IISA 4F4RA 1W9UA 5DMNA 4WHBA 1TIWA 2OB3A 5E6ZA 2TAAA 2B31A 3T2QA 5KZ6A 4HYRA 2GJPA 2YL8A 3NQ2A 4M1BA 3VIKA 4WX2A 2ZZ2A 3SGGA 3W29A 5HWJA 1SO3A 1UD4A 3JRKA 3HFYA 1S39A 4LYPA 4BY3A 2I7GA 2BVYA 1JYVA 1XF0A 1VPYA 4F66A 4QLKA 3H4XA 2ANUA 4HPXA 4EXAA 1UOKA 4M0XA 4XWUA 5K2ZA 4DI9A 2AL2A 4UTTC 4Y8FA 4KRUA 3CQIA 2HRWA 1OFEA 3EWWA 4NILA 1Z48A 1XIBA 3NXLA 4JTRA 4FLOA 2ONEA 4F3HA 3A47A 2DU2A 4TVCA 4NZCA 2H8ZA 2GJXB 1S5NA 2CEQA 1O7AA 2C0HA 3EMQA 4JIHA 1B90A 4UNKA 1V8EA 2DSUA 3RMJA 1ME9A 4CNSA 5IOBA 2V9DA 1EJ7L 3AYVA 2RGLA 1XDLA 3QLLA 1YXCA 4BK9A 1JR1A 4MKNA 3AHZA 2DZTA 1FWNA 1OGGA 4CD5A 4FF5A 2W4XA 1E43A 2E5CA 3CYJA 1OF8A 4BZYA 4NJGA 4NNBA 1RZMA 1XJBA 1ZU8A 1BKHA 4C91A 2FJKA 4A8LA 3I3DA 2ACUA 4G2DA 3WL0A 5JUVA 3W27A 1Q45A 1RD5A 4YWSA 4L4MA 1OHLA 1JG9A 3FHAA 1US3A 5FEWA 4JFTA 4ICCX 4Q4KA 5AYZA 9XIAA 3NIYA 1S1PA 3LHWA 4UTUA 4U2YA 3T0TA 2X0HA 4AUBA 3IJIA 1UROA 3S2CA 1EOKA 3SCOA 3O06A 2AKZA 1K9EA 4GQQA 1B3XA 2GLKA 1KTCA 1H7RA 3B9DA 1K6WA 3WF0A 2BY0A 3NPWA 3QHNA 4RLIA 3AHVA 2ODOA 3TYDA 1OSEA 4PA8A 2J6VA 2F8QA 1A5NC 2YFOA 2ISWA 3GHSA 2ABAA 4L4LA 3R79A 1KNWA 3DYOA 5E0KA 3WQ4A 1ZAHA 1BWVA 5EL1A 1FWBC 3ITCA 5A6SA 1DWHM 1RHCA 3QV6A 1PZ2A 3AMDA 4R53A 3VD5A 1V7YA 4MWAA 3AIRA 1XCWA 1WZMA 3HJEA 1GG1A 4PCSA 2DT0A 1W3NA 4DJDA 1XV8A 3U8GA 5CBBA 3JU2A 2REQA 2XVKA 3NSXA 4BCEA 3LTYA 4OU1A 1OQFA 3W7PA 2BXVA 2J13A 2UWFA 3AMKA 2TODA 4BF7A 4P8WA 4WKFA 5AB3A 3TMQA 2V63A 4S3DA 5C2XA 1Q6FA 2VD9A 3ZQ9A 3KBSA 4XTDA 3W87A 3S5YA 1VFLA 2X05A 3MUZ1 2QGHA 1ME7A 4N42A 2I9UA 4XIAA 3ENLA 4UFHA 3V75A 2E4TA 2OPJA 4A2RA 3C0LA 3LPOA 1S2WA 1XBZA 4N4QA 2CW6A 1M3UA 2ZRZA 3CQKA 4JGDA 3TJLA 4FB7A 2PPGA 3S5NA 4HHMA 3ARTA 4QS6A 3DFHA 3KVKA 1KXHA 2WSRA 1ISXA 3PBGA 1GNXA 1DJZA 1S5MA 4IIBA 2OQHA 1I8JA 3W2KA 5LIKX 1VEMA 4M56A 3PNZA 2WYSA 3SCSA 5IDZA 4LVDA 1JZ5A 3G1FA 2WV8A 5CGMA 1A0CA 3AHTA 4IFKB 3AXIA 1W17A 3MI6A 3VMPA 4BF9A 1EEXA 4C6JA 1QO2A 1RJQA 3MS8A 4MJ2A 3VIOA 3RDKA 1JCNA 4W8AA 1A3WA 1AD4A 1EP2A 4A3QA 4QCFA 1E6XM 5BROA 2FKPA 3NVDA 3BWWA 3TQPA 2WJFA 5C71A 3V35A 3GO2A 3VIFA 3FJ4A 1GYMA 3W26A 4MF4A 1Q6EA 2ZUSA 5DRCA 3V1PA 1TFVA 1OCQA 1S5WA 2HNEA 3NZ1A 4S3KA 3CV7A 2VCAA 2V38A 4PB5A 4FR6A 2XHYA 3PPHA 3KWSA 5FF0A 1MZRA 3QLDA 2FH8A 1LJYA 1A80A 1LQAA 3W1QA 3DCPA 6XIAA 3TYEA 3DGBA 1DWGM 1GT8A 1T0OA 4DWSB 4V2XA 2PWVA 2XWDA 1MW3A 1WZLA 1GVRA 5BOOA 4HNOA 2CZEA 1VLWA 2VFEA 4JYDA 3A64A 3LI0A 1XD0A 2J9XA 2WMJA 4S3FA 1XYBA 1B0IA 4E3VA 4RKAA 3I7QA 4CN4A 2QIIA 4EPEC 1H62A 1C8XA 1JYNA 5DY3A 4K1WA 4L6DA 1R87A 5JXQA 3TOYA 2V5KA 4YJ5A 4QP0A 1XLHA 4YYCA 2EKCA 1JZ8A 1NWUA 4PTXA 2DGAA 4UOZA 3WLLA 1JIBA 4XZLX 4O10A 1XW8A 1W5QA 4JL2A 1MRAA 2DORA 4DF2A 3IWPA 3QEZA 4MY8A 3W7GA 1DXEA 2CZVA 2DSZA 3OGRA 3TC3A 1YLVA 3R25A 4JTLA 1I2OA 3QW4B 3L2LA 5CPSA 3SJNA 3CNYA 1NIUA 1WYIA 3GXMA 4ZFMA 3BCJA 2CLLA 2QVHA 2ZZ7A 2YJQA 3S0CA 4IICA 1SFJA 1CGVA 4FHAA 4XD5A 5CCZA 2BFGA 3IJ9A 3BSHA 1X6LA 1WDDA 1GHRA 3O6AA 4WK9A 1E6QM 2CC0A 4N6FA 3W7KA 4D6CA 5AYYA 5DT7A 3VYLA 5ECVA 1IT8A 1PTDA 1SM9A 1R3TA 1XBVA 1SPQA 1TMQA 2FHFA 2O7QA 2Z28A 1BVWA 5H8UA 3TZNA 1Q2SA 2OSXA 1XRTA 1GKRA 5LXEA 1ODUA 3GTNA 1XYFA 1GZ1A 3DESA 2PGWA 2NUWA 2Y8KA 3A12A 3QHOA 3DFOA 2PCEA 4XG1A 2GSHA 3GG1A 1UJQA 4N0RA 4W4QA 1J2BA 3VIIA 1XHGA 2J9ZA 2ZDRA 1SFLA 2YOCA 5IDIA 4DWSC 4AZ7A 2WQDA 1MFUA 1W32A 4AD0A 3FOKA 3GTIA 2HWGA 2VP8A 4UUIA 4LY4A 1SQ7A 1IXPA 2E9MA 2XGZA 3H2EA 1A3XA 4M51A 1LL6A 2P88A 3E5PA 3CHCA 4RL3A 4EP8C 2DVUA 3WZ0E 4LF2A 2ZA3A 1RP8A 2PMQA 1ZCOA 4D8AA 3ABSA 3N19B 4C65A 4DM2A 4QJ4B 1DJQA 3HQOA 2O55A 2Y85A 3A9BA 4F0SA 4O12A 2FGZA 3QPZA 1F5ZA 3DHDA 3IANA 5CH9A 3NQBA 4V27A 4EVZA 2VUYA 1YBQA 1BF6A 1LYXA 3QMTA 2VZSA 5AECA 1J11A 1UR0A 3GYEA 2R1PA 4I8DA 4F0LA 3NQGA 3SRDA 4UQCA 3WLNA 4BQ5A 1EJUC 5HJYA 1F3TA 4DNMA 4ZXOA 3W1MA 1E6SM 2VMFA 1JZ4A 3VGDA 2WWCA 5BXRA 4JNYA 1M03A 4Q6XA 3RX4A 4IPIA 2Z27A 3R1ZA 3S6OA 1AMKA 4DYEA 2EPKX 4UBPC 1EF3A 1VR6A 3VX0A 4QCEA 3FJLA 2WOQA 4DBEA 3W2UA 1YXYA 4MNKA 4OE7A 3QGAC 1BXCA 3QXBA 3SUUA 3W38A 4DVOA 4IM4A 2BVDA 2GPTA 1V08A 5DCDA 1RH9A 5BMWA 3GFYA 3FGCA 1OYBA 5HATA 1KM5A 1ECEA 3J7HA 1M5WA 4IP7A 3BGGA 2PDXA 3V18A 1W1A1 1Z42A 3IEBA 1X7IA 2G3IA 4CD7A 3MU7A 3PG8A 3REQB 3BZJA 4HCDA 4RNHA 3KBMA 1WKDA 3VILA 3V0UA 2X7VA 3NO5A 1UR2A 4YLWA 5HUPA 4J3SA 3DZ1A 1XG3A 3BDKA 3UWVA 4AD1A 2CCRA 5D8WA 4O50A 3M0KA 4LUJA 2OGYA 3EWXA 5C54A 3ALGA 2HK1A 3C61A 4E2BA 1E1CA 3ANYA 4BWLA 1F74A 3PAJA 4LB4A 4KS0A 2GK1B 1X39A 2Z25A 3APYA 1J0IA 1T40A 2ZRVA 4DAFA 1Y5XA 1EDTA 1UZHA 3SR7A 3L2MA 3BAKA 3BJTA 2JIWA 1LG2A 4FOUA 3MW7A 4DUVA 3DGRA 2C6QA 1U30A 4O19A 4C6LA 4RV8A 2PDJA 3CASA 2Y0FA 1XS2A 1WX0A 5BXSA 3GNXA 2QCGA 4H8VA 4HMEA 2NZLA 3CL7A 2GL5A 4N9CA 3NA8A 3CC1A 5C2CA 2XN2A 1REQB 2ISDA 1MZHA 3TYBA 3UR8A 5IBXC 2P53A 4WDTA 4MB5A 3SCUA 1Q6LA 3MUY1 4D6EA 4ZB5A 1F05A 4B9ZA 2HROA 3RG6A 1Q4NX 4N6EA 2JEPA 1JNEA 1E0UA 3UR7A 3TEVA 3AMGA 1KFLA 2BHYA 2BOEX 4DZIA 2ZX9A 4LW7A 3SW6A 5I3HA 1MXGA 3PJWA 4R88A 1LL7A 4PRRA 3P5YA 2FLIA 1XIMA 2E8ZA 2RKXA 5L9FA 2D2HA 3W22A 1RJRA 1QW8A 3T2PA 1VHCA 3BJFA 5LYRA 5JH2A 3BXWA 1T8QA 3FA4A 1K8CA 3CPGA 3OB8A 1XD1A 1US2A 2GUYA 3DIPA 3KVJA 5I3DA 1W9BM 4URIA 1KKRA 1J4EA 3IAQA 1SJCA 3E2SA 2FGBA 1HT6A 3RCNA 3WJXA 2VDGA 3S9IA 4Q7IA 5FAJA 3VGBA 2IKGA 1FTXA 3ZSTA 2XIOA 3WLKX 3ZYZA 1OF6A 3L0KA 3M16A 3URAA 3B4YA 3K4DA 3KP1A 3MDWA 1MUWA 2QMJA 3ANUA 5I2UA 4Z2JA 1OFBA 3WD3A 1XLKA 3COTA 4X0NA 4AXNA 3TAOA 5A8NA 1A3HA 3RJXA 4UMCA 1RP9A 1XIFA 5C7VA 4PMUA 1ZPTA 5M1TA 2WQPA 4GVGA 3S2JA 1C29A 3F5LA 2V2DA 3O6CA 1KGWA 3KP0A 3WH7A 2ZRWA 3DXIA 4KWVA 2ZRYA 1DTNA 1R7AA 4M29A 3P74A 1NH6A 2YR1A 4H9VA 1A53A 1GWJA 3WDJA 2B4GA 4CN1A 3BLDA 2XZ7A 4UIOA 4W5UA 6REQA 1E0VA 2DUXA 1TJ0A 2CETA 1CXLA 3F7JA 1BVZA 3LTPA 4PR4A 1XSKA 5F2GA 1P6WA 5BZAA 5A6BA 2O92A 4AZIA 1R3QA 1EA9C 1AFSA 2XSXA 3LGDA 4FR1A 3PZGA 3I6RA 1R3VA 1VBRA 3I6TA 3QV8A 3AROA 1TVPA 2DVTA 1W3LA 3CHDA 3M0IA 5AOUA 3BV7A 1YNYA 3UERA 4BKNA 2D0FA 2E9LA 4M6QA 3RF9A 1NWRA 5EMYA 4MMWA 5I09A 3NPVA 5DXXA 3H22A 4JS3A 3HU7A 5D38A 3P84A 4J40A 4DWSD 4DO5A 2HK0A 4GJJA 4WSHA 1VPQA 1DJNA 4GINA 3BLFA