1OCQA

Complex of the endoglucanase cel5a from bacillus agaradhearans at 1.08 angstrom resolution with cellobio-derived isofagomine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Direct Observation of the Protonation State of an Imino Sugar Glycosidase Inhibitor Upon Binding
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 119
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2003-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ocqA00
4DUXA 2VX6A 4LYRA 2TAAA 3CUIA 2C0HA 1Z32X 2WCSA 2ZXQA 2CBJA 1FH9A 3RILA 4H8VA 2E9LA 2W67A 1OGGA 2ZUUA 4UFLA 1PIGA 3A4XA 2WVVA 3OLIA 2Z1SA 3KE0A 3CHCA 3W0KA 2DH3A 5ABFA 4WK9A 4TTGA 5M03A 1I1XA 5D9PA 1JNDA 1IZJA 4QCEA 1NM9A 1A47A 1Q6EA 5GPRA 5A6AA 2JFEX 3AYRA 1MQRA 2IXVA 3FAWA 5M3WA 1UR1A 1EXPA 4KMQA 5M17A 4ZXOA 3DC0A 5A3HA 1PX8A 2F8QA 2YL8A 3SIMA 1ZBWA 4BA0A 1G9HA 1G0CA 3T08A 1R7AA 3UESA 1OSEA 4UFIA 4AD3A 1B2YA 4MNJA 4PMXA 4H8HA 4GZJA 2AAAA 2GVYA 2JF6A 2CHNA 1H0IA 2Y8KA 2XFRA 4K68A 1HJXA 1HP4A 1E6PA 3A4WA 1V0LA 1H11A 4HMDA 1KR1A 1U2YA 1BGAA 1VFFA 4OUEA 3BGAA 1LWJA 3WMCA 4A3YA 2XUCA 7TAAA 1EOKA 1GJUA 2NW0A 5CGMA 3W6MA 5I77A 1CNVA 3N17A 4W8BA 4CU8A 4W7WA 7A3HA 1JDAA 4KRTA 3APGA 3ZMRA 1GVYA 1GNXA 2GUYA 4HA4A 4Y7EA 2W4XA 1UHVA 2NSXA 4CGTA 4V28A 3BAWA 5A69A 2ZWYA 3RPMA 3OG2A 5E09A 5LA1A 1F4AA 3PZNA 1ZS2A 4PUEA 3VMOA 4LYQA 1UZ4A 4EAMA 1UKTA 1EO7A 1DHKA 1GOIA 3W81A 2OWCA 5A8PA 1H0GA 2D20A 3MS8A 3OB8A 4GIAA 3BAIA 4V2XA 3WEMA 1PAMA 1ZL1A 1KXVA 2PB1A 2GJXB 2Y2WA 3DYPA 1BG4A 1SMDA 4CVWA 4C7DA 1W3KA 1UWSA 3BCFA 1KFWA 1R85A 1UH4A 4JFWA 3MUIA 3CZLA 3HN3A 2D1ZA 1Q6DA 1TR1A 1JDCA 1TFVA 1W1PA 5BROA 3VIMA 3PZMA 3A3HA 3AHYA 3PZVA 3AZSA 3WD0A 1CTNA 1VJZA 2XVGA 1BPLB 2PWFA 1VFOA 5A6SA 3ARUA 1CXIA 5EFDA 1CENA 1VJSA 1OINA 3CHDA 2J4GA 1KQYA 3B8SA 5AYBA 5I3DA 4UQ9A 4HP5A 2BHYA 5A6LA 3ZM8A 2EPKX 2XFYA 3VUPA 2BHZA 4TVUA 5GNYA 3KL0A 4XB3A 2J74A 3W28A 1HL8A 1GQJA 2WMGA 1UR0A 3T0DA 4FLRA 2WANA 3QHNA 3ECQA 1QBBA 4XUYA 4AD0A 1P6WA 2J7EA 4D6FA 1FFQA 2UY2A 8CGTA 2E3ZA 5E6YA 4PMOA 1BYDA 5BCAA 1PIFA 1R87A 3RMEA 3N04A 4J3XA 2ZUTA 1I1WA 2G3JA 3WFZA 1LL7A 3NCOA 3AHZA 1CGWA 4GO9A 2XVNA 4PMUA 2WZHA 3PZQA 2RGLA 3HMCA 4CCDA 2YA0A 2FH8A 3VIOA 4AZHA 5BXPA 2DQXA 3WDRA 4GZEA 3ZIZA 4HOZA 3W6LA 2J7HA 3UG4A 1MYRA 3WUBA 3MU7A 2FDMA 2XGIA 5D9OA 1V6UA 2WMKA 1CGTA 4ZXLA 2VRQA 4XV0A 1TVPA 4AW7A 1V0NA 4KRUA 3VX0A 2D2OA 3AXIA 3CHEA 1BVZA 4H8UA 2EQDA 5E0FA 3CLWA 1ISVA 4P7QA 3S6TA 3TTYA 3MSDA 4UQEA 3K8MA 3EDEA 3AIRA 1WDQA 1CWYA 1J0ZA 5C8BB 1XRVA 1WDPA 1JI2A 1VEMA 4NZCA 2EPMX 2WYSA 3CZ8A 4CCCA 5C70A 3ZT5A 3WUEA 1GORA 2A3CA 1TA3A 4HZ7A 4E8CA 3CH9A 4W87A 3DHUA 2ZX7A 3THDA 1FOBA 3ZQ9A 5I24A 1BFNA 1JZ7A 3ARYA 2DSVA 3DHPA 4UR9A 4RE3A 3TTQA 1EHAA 1E55A 2C7FA 2ZIDA 1GVIA 1E5NA 1CIUA 4F8XA 1G94A 1MW2A 3ZJ8A 3KL3A 9CGTA 2WW5A 5HBFA 3RM8A 1UWUA 5KZ6A 3VIGA 1FHDA 1E3XA 3UEQA 3AIBA 4X9YA 5ECUA 2CNCA 4PTMA 1K9FA 1UQZA 3PZ9A 2YDSA 3ZSTA 3ZJ6A 4WLCA 3WFLA 1B3YA 1BYBA 1ITXA 2V38A 2WMIB 3W26A 1A3HA 2VZUA 1R86A 3NUKA 1R7OA 3O2LA 1H4PA 3WDJA 2V3EA 4JFUA 1DWGM 1W3JA 4OIFA 3WELA 1XH1A 2E40A 1E40A 2BS9A 4W8AA 2C8NA 4ZE4A 2O9RA 5DEZA 3GNRA 3WBAA 1G5AA 3VGHA 1JYVA 3AMKA 3BH4A 3AROA 5KEZA 1B3WA 5DMYA 1GOKA 2W62A 1E56A 4W88A 1OGSA 3L4XA 1X6NA 4C7GA 1FHLA 3AZTA 2JEPA 1WNOA 1UD3A 3MUAA 1JG9A 1C91A 4DWSA 4GI8A 3VDCA 2ZUMA 3NSNA 3GBDA 4W86A 2J47A 5HDRA 4CN4A 1E6SM 3AS3A 1KXTA 3BC9A 4D6IA 4BS0A 2PBOA 3PZOA 4R27A 2O9TA 2XWDA 1QHOA 1KWGA 2A3AA 4TVDA 4ML4A 4LX4A 4W85A 3O9NA 1J12A 1HKMA 3ZO9A 1HN1A 1BQCA 1E73M 4M29A 4S3KA 5FCZA 3LPOA 3HU7A 2XIBA 3L4TA 3A4AA 4YHEA 2V5DA 1OBAA 5E0CA 3ZT6A 4JFTA 3AI0A 1QW8A 1R8LA 5E6ZA 3AZRA 1B0IA 3EMQA 1NH6A 1C8XA 2VX4A 2XM2A 3WH8A 1HKIA 1TVNA 4CN1A 3BCDA 1MQQA 3W24A 4ATDA 4F79A 3VD4A 3UR7A 4ATLA 1K6AA 4PMNA 3OLGA 1QHPA 3RDKA 3U57A 4WKFA 2YL5A 4CD8A 2OSYA 4FLOA 4JCLA 1W2VA 1WPCA 1E4IA 3AQUA 1LLOA 2OSWA 1CYGA 1G01A 4HA3A 3SCVA 2W91A 1U33A 4HA1A 3VX1A 3UR8A 3VO0A 2VR5A 3KZSA 4BF7A 4LXFA 4PTWA 4KH2A 1J0KA 3N15A 2X8RA 1G1YA 4IUGA 1B9ZA 4UCFA 1HJUA 2VX5A 1DTUA 3QR3A 1H49A 3T2OA 1HKJA 3WDPP 2BXYA 2VC9A 2ZWZA 3WN6A 5IDIA 2ESCA 1QI2A 2DIJA 2RGMA 4AY1A 2J8GA 1E4MM 1FA2A 4DM2A 3CHFA 3AHXA 3CTTA 3N12A 1W9DM 2EPNA 3OIHA 4BQ4A 1IV8A 4D6HA 3F5LA 3WD1A 1HJQA 4W8LA 4D71A 4ATWA 4OJYA 3LPGA 3ZR5A 3B9AA 2CBIA 5A8MA 5E70A 1UWIA 3AMCA 2X09A 5BXSA 1W9BM 2W66A 2Y8VA 2GFTA 3AIVA 5ABGA 1E3ZA 2XPKA 3CMJA 4HZ8A 2WK2A 3VPLA 2WWCA 3OBAA 4MJ4A 4CD6A 1O7AA 1E0WA 2VI0A 2WXDM 4TXEA 5I5RA 3WD4A 4WIWA 5CPSA 3WMBA 4AC1X 4PRWA 1XYFA 4NF7A 4OBRA 2DSZA 4YN5A 4ZE5A 1LWHA 1PPIA 2PI6A 3RJYA 1EQPA 3VD3A 3IANA 1EOMA 4CN6A 1UD8A 1WKYA 1EDGA 4U31A 3M6DA 4HPGA 2J7CA 3NJ3A 4D1IA 5HOSA 2GDUA 2YA1A 1UQYA 3OGRA 1OD8A 2G4FA 1JGIA 1B31A 1KGUA 3ZJ7A 3WQWA 2VTFA 1LG2A 2D3LA 2Y5EA 1JF5A 1VFMA 1Y7VA 1O6IA 2WLYA 1NOWA 1V6YA 4J3SA 4MB5A 3B9EA 5FD0A 4OBSA 1KWKA 1BSIA 3IJ8A 3GDBA 2D23A 2XSAA 4P7OA 4AZCB 1UZ1A 4MNMA 3CGTA 4JZ5A 2V3FA 3AMGA 2J62A 1XD1A 4D6EA 3G6MA 1DWAM 3WQ8A 3K4AA 6CGTA 1J10A 3VDAA 7CGTA 2ZICA 1QW9A 3VKKA 2JE8A 5I79A 3RM4A 1QHZA 1RP8A 2YL9A 2VZOA 1VF8A 1KR0A 4UQCA 4X0VA 4OKDA 3KEHA 3GTNA 2GJXA 1VIWA 3FW6A 4GZIA 4HZ6A 5EMYA 1OT2A 1PX4A 3VGBA 4AD2A 3FHQA 1BYAA 3ARTA 1C7TA 3K46A 3AIQA 5ABHA 1US2A 4D1JA 5IXEA 3CUHA 4B16A 4D6CA 1XYZA 3F4VA 3GXIA 3AISA 4HOWA 3EDKA 1KBBA 4AZGA 4RL3A 4UZSA 4QLLA 2EXOA 3AMDA 1WO2A 5I23A 3N9KA 5BRPA 5LA0A 2EO7A 2VZTA 1KXQA 2YLAA 3L4UA 1CXHA 4QFUA 5LYRA 3QGVA 1QBAA 3GXDA 2A3EA 2Z1KA 3F5KA 1OWQA 4EE9A 1WE5A 3NDZA 5BRQA 2QHAA 3VOCA 4U33A 3MSGA 2QMJA 4Z2LA 1WP6A 3WF0A 2JF7A 1F4HA 2VVNA 3SCNA 4KGLA 3K8LA 3CBWA 4PMDA 3SURA 3AYSA 5A6JA 2DDXA 1JXJA 2PF0A 2PC8A 3O6AA 4RE2A 1OIMA 3J7HA 5A6BD 5A6KA 2GJRA 1VENA 5AC5A 1OCQA 3QOKA 1JZ5A 2XVKA 3MV01 3SCRA 4U5IA 4MPKA 3ZSSA 3VGEA 2BVYA 1H41A 3EDFA 2UY4A 1N82A 4P8VA 4MNKA 1XSKA 5DO8A 3M7SA 1E6XM 3VD9A 1UR9A 1E4LA 1UKQA 2VCAA 3SUWA 5CPQA 3FXYA 2D0GA 3K1DA 1X6LA 2ZX9A 2WAGA 5CSUA 4B9ZA 4J27A 2PWDA 2ZUNA 4RE4A 5BYWA 1L8NA 1VEOA 3VGFA 2HISA 3N13A 3T0BA 5DT5A 3M07A 1QOXA 1HP5A 1CXFA 2E0PA 5AYIA 4PTVA 1PZ2A 3ARZA 4A4AA 4E8DA 1XH2A 1NQ6A 1US3A 2A3BA 2CEQA 3D3AA 1XH0A 1X1NA 1V3MA 2ZUSA 3PZUA 3NYDA 4AZ7A 4PYSA 1HVXA 1CGXA 5A1AA 4FLQA 1E72M 4PMRA 1GHRA 3VGDA 2G41A 3MO4A 1V0KA 3WKZA 1QVBA 3DYOA 1UD5A 5A2BA 3IJ9A 3KWXA 5D9NA 5CXPA 2VQTA 4GQQA 2AMGA 1BAGA 2D22A 1AVAA 4AXNA 2XHYA 1UWRA 5E9AA 4WSKA 3AXXA 4JIEA 4H7VA 3PTQA 2FH6A 1CLVA 3GM8A 1BTCA 3PZIA 1B3XA 5A6MA 4MAZA 1FH8A 4Q22A 1VBRA 1MFUA 4NRSA 3PHAA 1W2PA 3ARSA 1QNPA 4W7VA 4CD4A 1LF1A 3T0AA 3RM9A 4UQDA 2YDRA 3II1A 2XIIA 1TG7A 4M8UA 1JYWA 1VB9A 4AIOA 5D4YA 2WPGA 4U3CA 4PBGA 3WSUA 4TX8A 1E1EA 3RCNA 4C7FA 5EB8A 2XFFA 3BAJA 2WMIA 1HX0A 4B9YA 4J3WA 4BQ3A 1Q6CA 3AIEA 2G8ZA 3RIKA 4MADA 5JBDA 3L4YA 3QOMA 2G3IA 5DT7A 5A2CA 1JYXA 3DECA 2DT1A 4ZFMA 2WCAA 3VIFA 3MMDA 1HNYA 1GZJA 4R5EA 2WMFA 4PSRA 3PZGA 3AS1A 5I6SA 1ZU8A 2YBTA 4AZ5A 3SCTA 3UCQA 1XHGA 4YHGA 2XGBA 4JHOA 3T09A 5LA2A 1TZ7A 4UTFA 4A3HA 3VGGA 4KGJA 5F7UA 2VRJA 2WVTA 4PEEA 1KGWA 3U7VA 1MXGA 1JI1A 1RP9A 1JFHA 4AIEA 1C90A 4AD5A 1E6QM 2EEXA 5CPTA 3EYPA 1CECA 3WNKA 4JKKA 5JBFA 1PBGA 2X2YA 2YKKA 3AHVA 3EDJA 3OGVA 1BF2A 2MANA 4D6GA 1CGUA 3WEOA 4PMVA 4B15A 3L4WA 3VIKA 5AY7A 4Z2IA 2FHBA 4TTUA 3WQVA 1MW0A 4PMQA 5GQBA 3EDDA 1ZBCA 2J79A 4OOZA 1D3CA 1FP9A 1M04A 2J8FA 1LL4A 4GKLA 1L0PA 2WC3A 3GNPA 1JD9A 4MB4A 1WB0A 4XZWA 1JDDA 1QNSA 2WWDA 3AMLA 3WNPA 2J7FA 4CD7A 2VMFA 1K9EA 1TUXA 1UYQA 2CKRA 3D5HA 1BYCA 3RJXA 3S2CA 3POCA 4GQRA 3VM5A 3WENA 3ARQA 5FL0A 3SEPA 4BZYA 2WVUA 2GK1B 1HJVA 2UY3A 1XC6A 3T2QA 3TONA 3ZT7A 4J3UA 3FNDA 3WH6A 1JZ4A 1GOMA 4XX6A 1WCGA 2GDVA 1KBKA 3LMYA 2J7GA 3IAQA 4Z2GA 1MXDA 2VO5A 1QNOA 3CUJA 2VZVA 2XTKA 1SYTA 1JZ3A 3BSHA 4B3KA 3CZEA 1E5JA 2CCRA 1UD4A 3VMPA 1KB3A 4MB1A 5A8OA 4MAVA 4BQ2A 2WSKA 3SUVA 2VVSA 4HPHA 1TE1A 3W53A 3GXFA 4JL1A 3PBGA 5A94A 3K4DA 3E1F1 1MW3A 1ECEA 4WF7A 2J7DA 1UH3A 2CHOA 4ACZB 4F66A 1EGZA 2WZEA 5CLTA 1UR4A 4L4PA 1NP0A 4P8WA 1V08A 4BQ5A 2J78A 3EMZA 3W29A 1CEOA 5CJ5A 4GI9A 1H3GA 3T2PA 4URIA 1UR2A 1E6ZA 2V5CA 3WH5A 2BXZA 4W5ZA 1NOFA 1W3LA 3L4VA 4GXPA 1B90A 4B3LA 2DGAA 1ZJAA 2YIHA 3AHTA 3VDBA 1V3HA 3WEZA 1UKPA 1V6VA 1WZLA 2F2HA 2DT0A 1IT0A 1V3IA 2VOTA 3AS0A 2ZE0A 3WD2A 1J0JA 3OGSA 3WL1A 2DH2A 2FHCA 1XSJA 2WLZA 3W27A 1J18A 2BY0A 1C8YA 4JCMA 1Q6FA 3VNZA 1JL8A 5I0DA 3ARPA 1GQLA 3BLPX 2UY5A 3BSGA 3ZJKA 4AEEA 1U30A 2XG9A 1CXKA 3BLKA 1H1NA 1OM0A 2B31A 4FK9A 3WMSA 2E8ZA 2NT1A 5FL1A 4PMYA 5DF0A 2VQUA 1HJSA 3WDHA 4ZEPA 2D0FA 2WM0A 3TTSA 1C3FA 1DWFM 1RD6A 4J3TA 3CZJA 1VFUA 1WZKA 2D0HA 4IPNB 4PMZA 3VTRA 1E4NA 4NSBA 3N18A 4OZOA 2IXUA 5EFFA 3GNOA 2VCBA 4PN2A 4W84A 5A6BA 1EA9C 1D2KA 2DIEA 3I3EA 1RH9A 5D9MA 3IK2A 2OYLA 2WBKA 1Q6GA 2Y4SA 1HT6A 2ZUWA 3AOFA 3THCA 3IAPA 1XGZA 1PX3A 2NT0A 4MJ2A 4JAWA 2WBGA 2BV9A 3CMGA 1EDTA 1GQIA 1V02E 3W82A 2OYMA 1GOOA 1JXKA 3L4ZA 1AMYA 3M46A 1J0IA 1DWIM 3POHA 3VNYA 2E9MA 1KGXA 3BAYA 3FHAA 1ESWA 1CLXA 3TA9A 3GH4A 5GNZA 3WL0A 4DWSD 1NP2A 4Q7NA 2ZXAA 4MDOA 1JZ2A 3OZOA 2BFGA 3CO4A 3WBEA 3ARRA 1ISWA 1LG1A 4W5UA 1H5VA 4CU6A 3WIJA 1JD7A 2WZIA 5CQ1A 1E1FA 3MUY1 3OLDA 3GXMA 3PTKA 4TUFA 1MW1A 4U3AA 4E2OA 1CXEA 2F61A 2QF8A 4GPNA 4CCEA 1E0VA 2PWEA 4HMCA 4WJXA 3ARWA 4N42A 5JBEA 1XCWA 2VZSA 1W9PA 2WMHA 3A47A 1HF6A 4BCEA 1QNQA 1QI4A 4FF5A 1C93A 3WQ4A 1YHTA 4LQ1A 3WNOA 4U2YA 4Z2JA 1JFXA 4N0RA 5IFTA 2CPUA 3VD5A 3SCQA 4MTVA 3UG5A 2W92A 3ARVA 3SCWA 1UG6A 1HL9A 3VU2A 3WDIA 3WNLA 1JAKA 4AD4A 2UWFA 3F5JA 4H04A 1ITCA 4P7LA 3AXHA 1TMQA 1BGGA 4M1RA 1GPFA 4LYPA 5HNNA 4HTYA 3VILA 3AIWA 4Z2KA 1SFSA 2CITA 2WVVB 1OGBA 3CZGA 3VVGA 4DUVA 5ABFB 4JHZA 3K8KA 3VIJA 3WY1A 4PTXA 1EHNA 2Y24A 2WKLA 1NARA 1E9LA 5C71A 1GONA 1V02A 3EBVA 1V03A 2OWWA 1W1VA 2GSJA 4V27A 3VIIA 4F9JA 2BHUA 3G6LA 3GH5A 4EK7A 2HVMA 5IHRA 1HKKA 2XJ7A 1BLIA 2WMJA 4MNLA 1UKSA 1HIZA 4UFHA 3L2MA 2D3NA 3CUFA 4U5KA 2J7BA 4UFMA 4M80A 1XD0A 5CSYA 1KCLA 4AD1A 3ZR6A 3MUZ1 3SUTA 1YQ2A 5IFPA 2OYKA 5FOOA 1M03A 1FH7A 3NIYA 3VDHA 2CBUA 3SCSA 4QP0A 3MANA 2QV4A 3GH7A 3IJ7A 4M24A 1VAHA 3MKKA 4AZBA 5A95A 5DFAA 2DSWA 4FLSA 1NWSA 1LL6A 4L4OA 2XSBA 2G3MA 1CBGA 1M01A 3MV11 1HVQA 2QLYA 3TOPA 3BMVA 4M56A 3SCOA 1W3HA 4TOQA 1ZJBA 2DT3A 1SR0A 4KWUA 1V6WA 1CDGA 4JFSA 2BNJA 2WNWA 3L2LA 2ZXBA 1GCYA 2ZX5A 4FMVA 5GNXA 1E0XA 1MWOA 3I3BA 3WF2A 1UD6A 1DP0A 2CETA 6A3HA 3BAXA 3VM7A 3LPFA 3W38A 4P8UA 2OSXA 2WC7A 2AOSA 1QI3A 5HPOA 2J75A 2CERA 4NRRA 1WDSA 1UWQA 2A3HA 2X0HA 4J7RA 4HMEA 2JIWA 3SCPA 4AIUA 4MDPA 4QAWA 4UOJA 5BWFA 1UKOA 3ALGA 1E43A 5EBAA 3FAXA 4D6DA 1J0YA 3RO8A 4EKJA 5JIWA 1ZB5A 1J9YA 5A8QA 2WKGA 2PWGA 2JALA 2X1IA 4CD5A 5AC4A 2JEQA 2BVTA 2E9BA 4AWEA 3AJ7A 1JIBA 2DPEA 1FP8A 3VMNA 3WF4A 4GO8A 1B3ZA 1J11A 1GW1A 3WH9A 1AQHA 4UFKA 4UOZA 3CZKA 2ZOXA 3VD7A 2PBGA 1OT1A 2E8YA 2YBUA 1D7FA 1V6XA 1WZMA 1GUVA 1B3VA 1ISZA 1EH9A 4Z2HA 1JF6A 3WDQA 3A6OA 1QPKA 5JIPA 1C92A 4IISA 3WD3A 2FGLA 1NWRA 1DWJM 2WVSA 2OWXA 1EDQA 1NWTA 1CPUA 3KL5A 4WSJA 2WB5A 2J25A 3DYMA 3SUSA 1LJYA 3FN9A 2YDQA 1V0MA 1GOQA 2EJ1A 5CLWA 4CUCA 2YOCA 1MQPA 3WF1A 3N1AA 1NOUA 3BMWA 3TTOA 5JUVA 1UD2A 3TP4A 5HXMA 1PEZA 1CZ1A 3SUUA 2XVLA 4P7NA 4UFJA 1JAEA 5D8WA 1XCXA 4AMCA 5CZKA 4J28A 2DSKA 1E6NA 2CBVA 4PCTA 4HOXA 2QPSA 2VX7A 2ZX6A 1Q4NX 2QMKA 4EANA 4J3VA 2DEPA 4E4PA 3CPUA 4W7UA 1EQCA 4IM4A 2ZX8A 2G3NA 3BXWA 3EMCA 3GZAA 2WSPA 2FHFA 2GK1A 1IZKA 2W61A 1DWHM 1GJWA 2XVPA 4WKAA 1I75A 2FGZA 5IHSA 2W5FA 3W37A 2VUYA 2XYLA 4UOQA 4DM1A 2CIPA 5ABEA 4QCFA 1TA3B 1M53A 2D24A 4DWSC 1KCKA 1AQMA 1B30A 2X0YA 2O92A 1XSIA 2EPOA 1K9DA 4ACYA 1CGYA 3WF3A 1S46A 2GJPA 1VEPA 4PCSA 4AEFA 2DT2A 4JL2A 3WQ6A 5I2UA 2WHMA 4W93A 4X0NA 4P7RA 3MMWA 3W25A 1V3KA 1WZAA 4PSPA 4ACZA 3LPPA 2VJXA 3HJEA 3WNMA 1FFRA 2JIEA 1KQZA 3MMUA 3NSMA 4GINA 2VURA 3NDYA 1E15A 2EPLX 5CGTA 1KXHA 1WAWA 5BXTA 1UH2A 3W4RA 3PN8A 2VNCA 1TCMA 1HJWA 2QPUA 2DSUA 4P8XA 2WCGA 1J01A 3ZOAA 2ZXDA 1MFVA 1HXJA 5FIPA 3PTMA 3ARXA 1UOKA 3WNNA 1SMAA 1CXLA 3AICA 3SCUA 1JZ6A 2BY1A 2BY3A 1V3JA 5I78A 4M81A 3OLEA 1ISYA 1ZBVA 3AS2A 1OB0A 2BY2A 3JUGA 2E4TA 4UNIA 3WUFA 1JZ8A 4D6JA 1CGVA 1JNEA 1W1YA 2VRKA 1QNRA 1E70M 1UR8A 4UQBA 2VL4A 1UA3A 1E6RA 4U2ZA 2EBNA 2BVDA 5TD4A 2CESA 1RPKA 3I3DA 4JKLA 1WDRA 4QDMA 3QHMA 3AIUA 1OIFA 1H09A 3AFBA 1ODZA 4QLKA 4DWSB 4DUWA 2CKSA 2XWEA 4AISA 2CYGA 1H2JA 3NSXA 1AQ0A 2W63A 2J77A 2Q8XA 3UETA 5CG0A 2YL6A 4UQAA 1VRXA 4XZBA 3UG3A 1W9VA 4OOUA 2YA2A 3BAKA 4LPCA 2O9OA 4HU0A 1GOWA 3U5YA 4YPJA 2VR4A 3B9DA 2V3DA 5A8NA 4UZUA 2ZUVA 3GYCA 2V3GA 2WHKA 4ZENA 4LGXA 2O9PA 1C8QA 1W9XA 5M5DA 3U7BA 1C7SA 1EO5A 4QLJA 3GBEA 3WUGA 2PWHA 3U5UA 1QI0A 1B1YA 3PZTA 1ZBKA 4JKMA 1J0HA 1E71M 1M7XA 2X05A 4M82A 1V3LA 1XV8A 4NI3A 1OD0A 1JYNA 1PJ9A 3CIVA 3QHOA 1QI5A 3CUGA 1PZ3A 3VIPA 1EIBA 4D72A 3ALFA 4GI6A 3UERA 1MVYA 2OLHA 4TVCA 2CXGA 2WC4A 1ODUA 4AYSA 3WH7A 3VINA 4CKQA 1NWUA 5HPCA 4HU8A 1W1TA 1W9UA 2WHLA 4CU7A 5BXRA 5FKYA 4JFVA 1GHSA 4AZ6A 4AZIA 3VIHA 4S3JA 5D8ZA 1BG9A 1DEDA 4MB3A 4AZCA 3N11A 8A3HA 3OA5A 4W89A 1VBUA 4H41A 4TX6A 1W32A 1UUQA 4PUDA 1ISXA 2WHJA 3FY1A 5A2AA 1UA7A 2VT0A 1GQKA 2YLLA 4IPLA 3WQ5A 4H2CA 1BVNP 1LQ0A 1W91A 3OZPA 4F9DA 2VCCA 2XM1A 2YJQA 1UWTA 4WKHA 2IUZA 4CVUA 1BHGA 1K9TA 6TAAA
chains in the Genus database with same CATH superfamily
2AGTA 3MZNA 4NNBA 2I9EA 4JTGA 4LYRA 3CUIA 3DKJA 4IOTA 1TUFA 1FWCC 1OZQA 4IP5A 3B8UA 3BANA 1SZRA 3RILA 4H8VA 2XZ9A 2W67A 1FWDC 4QROA 3TN3A 3PFRA 4EOUA 3OLIA 1OZMA 3W0KA 2DH3A 3N4EA 1H7PA 1I1XA 1JNDA 4GYPC 1TJ2A 4ES4A 5GPRA 2HPMA 5A6AA 2JFEX 2PEVA 2IXVA 3DDMA 4KMQA 4R33A 3GIPA 1EYWA 4HU3A 1UMYA 1PX8A 3GW0A 2DZVA 3MSYA 1OSEA 4AD3A 5G2HA 4H8HA 2GVYA 1J2BA 4GKTA 3C2FA 1W5MA 4K68A 1HJXA 1V0LA 1H11A 1KD0A 1Q7MA 3HA1A 3BO9A 1BGAA 3LENA 3KLLA 3N2XA 1LWJA 5FJOA 2ALRA 4A3YA 1TPB1 2XUCA 2ZADA 4NUWA 7TAAA 3P84A 4RK8A 2V2CA 2NW0A 4MM1A 1UASA 2X2GA 2ACRA 4W8BA 1R47A 4HNCA 4AEOA 1MDRA 3ZMRA 4H2HA 1GNXA 4Y7EA 4K39A 2W4XA 4CGTA 4Q4RA 3RLVA 1LUCB 2FFCA 3OP2A 3RPMA 1F4AA 4YTSA 5HNTA 4EIVA 3QM3A 4EAMA 3W81A 3M7WA 1VYRA 2GJNA 1XDLA 1H0GA 4AY7A 4ZTXA 3OB8A 3WEMA 4IMEA 4DJFA 2PB1A 3DYPA 4JNYA 1N8IA 4QISA 4S3AA 1R2RA 2XISA 1UH4A 2PODA 3CZLA 3JZEA 1EEPA 3H2CA 5K3VA 4IHCA 4G1KA 1CTNA 2JKAA 4MYAA 1V7AA 3ARUA 1CXIA 3H22A 4NILA 5EFDA 3OHIA 1QCWA 3IGXA 1GOXA 4UQ9A 4HP5A 2BHYA 5FJJA 3EX2A 5GNYA 3KL0A 3L0GA 3TV8A 4XB3A 3WQCA 3GVRA 1HL8A 2BX7A 2FTWA 3ECQA 1QBBA 3RR1A 1SJDA 4AD0A 3G24A 4TX9A 3MCOA 3EXTA 5LKYA 4PC8A 4JTAA 1GVSA 1KM6A 1FCBA 2G3JA 2VYOA 4ZOCA 1REQB 3D46A 1TWDA 2PDHA 1RSCA 2NQLA 3ENLA 4R7WA 4ZOBA 3CK5A 3UP8A 5BXPA 3GC4A 3QMTA 3ZIZA 2HCVA 2DVTA 3V5CA 4HQVA 4OECA 4UTWC 5I09A 1F6PA 2FDMA 4CQBA 5D9OA 3KOWA 4KRUA 3IRDA 3VX0A 2D2OA 2AL2B 2PLCA 1UR3M 4IGMA 3E5BA 1Q4WA 2BSLA 3B4UA 5DANA 3K8MA 1R2TA 3AIRA 1CWYA 3STPA 3VZZA 1J0ZA 4JDYA 1XRVA 4OGZA 3TNOA 1JI2A 2VOMA 4K3ZA 2A5HA 2PCQA 2NXGA 4WGXA 3CLMA 4IT1A 4PULA 1EJVC 3WUEA 5FEWA 1TA3A 1G4EA 3CH9A 5LXXA 5HMDA 2GVJA 4YTTA 3BLEA 1BFNA 3GDKA 4Z1YA 1JZ7A 4UUIA 4UR9A 1PCWA 1EHAA 1XQKA 4E2VA 2PS2A 2Z28A 1CIUA 3M43A 1DE5A 2PDFA 1ONEA 3ZJ8A 1PKYA 9CGTA 3H7RA 3N2TA 4S38A 4KCUA 4NZ1A 3UY8A 4GY7A 3VIGA 3PK7A 1G4TA 1EKOA 4S3BA 1P5BA 3WG6A 3IVUA 2NXHA 4ICMA 3ZSTA 1U1JA 1GVQA 3WLPA 2WOQA 4AWSA 2AKZA 3QW4B 2VZUA 3QZAA 4MKNA 5MHBA 1RCXB 3UPBA 2WNZA 3WLMA 3GVWA 2C8NA 4ZE4A 1PTGA 3LHTA 3KBJA 3C3NA 2IPJA 3AMKA 3BOFA 1JUKA 3AROA 1B3WA 1UIPA 1DKWA 3SQMA 4JBRA 3URQA 1HW6A 3CUXA 1TV8A 1X6NA 2GUBA 4C7GA 1F3XA 1OYAA 1K8YA 3O63A 5LHFA 3B06A 2PZNA 3KDNA 2F2KA 3MUAA 3KOYA 1EUAA 3OZYA 4US5A 5U7SA 3BZGA 1J5TA 3R8GA 2QJNA 5HDRA 3MI6A 3OVGA 3BC9A 4D6IA 1P7TB 3CMFA 4YNGA 4GXMA 3T4WA 2TODA 1EB3A 4R27A 2B81A 2HXUA 3G2GA 3VOJA 1KWGA 3QZ6A 4TVDA 4W85A 4LX4A 3O9NA 1J12A 3RPTA 3ZO9A 2BODX 3CB3A 5FCZA 4DZHA 5CC7A 2V5KA 5D2TA 2PD9A 3L4TA 1F76A 1OBAA 1DQXA 3PJXA 1KM4A 4IMCA 3BMXA 3MA8A 1XKJA 2LLEA 3EMQA 2I16A 1HKIA 3A5FA 3PPFA 3W24A 1OG6A 4F79A 3UR7A 3W1MA 1LRTA 1K6AA 3RDKA 3U57A 3BURA 4DPPA 1JR1A 3QH2A 4H8NA 3MHGA 3UW6A 3S5NA 2DVUA 4V33A 4D9PA 4RCXA 3QRHA 4HA3A 2R91A 1P0EA 4G9PA 2QUTA 3KDOA 4H19A 4HA1A 1I0BA 3UR8A 3EOOA 3KZSA 1RK5A 3GXNA 4LXFA 2DP3A 2A7PA 1G1YA 2AQWA 4IUGA 3IIZA 1R9XA 3QR3A 4NAEA 3T2OA 1FWBC 1PE1A 2ESCA 1QO5A 4GGBA 1YYAA 4QRNA 3IJ6A 4MLJA 3VC5A 4MIMA 1FA2A 2DJLA 3NA8A 3OEXA 1ZJIA 3TZNA 3EWXA 4DYKA 3CHFA 3AHXA 1A4MA 3N12A 4ZSTA 5HQEA 3ES7A 4NJIA 2QCDB 3F5LA 2FZNA 4KEMA 2PFHA 4QNEA 4XAPA 3LRLA 2G0WA 3ZR5A 3LPGA 5FF4A 2EG7A 1YXCA 4XWUA 2CBIA 5CSSA 4H7CA 2AQVA 3OYZA 4HBKA 1F3WA 3P60A 3NPUA 5BXSA 4JYEA 3N2MA 4I9TA 4BF5A 3AIVA 3LI0A 2GWNA 3C61A 1SO4A 2PDMA 4IMFA 1X97A 4RZBA 1QPQA 2WWCA 3CNYA 2VI0A 3M16A 2IQTA 1BSLA 1LRQA 3JZUA 1Q3NA 2Q3OA 5T9BG 1AZ1A 2A85A 1XYFA 3W76A 3VD3A 4CN6A 1UD8A 3M6DA 5AC6A 4HPGA 2J7CA 3NJ3A 2YA1A 3OGRA 3KVMA 4E0CA 4WVXA 4IX2A 2VEKA 1JGIA 4PB3A 3ZJ7A 3QQ0A 2R8WA 2VTFA 2D3LA 1FWTA 2Y5EA 3E96A 4MB5A 1NOWA 4J3SA 1KTBA 3B9EA 3UF9A 2OPJA 1BSIA 4GIRA 2QCMA 4C6JA 4DNMA 3AMGA 2J62A 1RZMA 4N9EA 3RRXA 1XD1A 4D6EA 1DWAM 1G4SA 3F2CA 3P5YA 1TWZA 3HG4A 1J10A 3EPOA 7CGTA 2QCHA 1TVLA 1A5CA 2FGBA 1P4CA 1VF8A 5DLCA 1RHCA 1Z9AA 4DBEA 1Q6QA 3KTCA 1Q2SA 4LEQA 3V4BA 1IXQA 2DORA 2GJXA 1TWWA 2OOGA 1OT2A 1TQJA 3VGBA 1B5TA 4FAMA 2TYSA 4C6MA 1BD0A 1G7UA 4GC3A 3G8EA 4E2DA 1OFQA 2Y85A 2QW5A 3AIQA 5ABHA 1K7FA 4A3QA 2XN0A 4B16A 5I3JA 4PFHA 4Q7BA 3EDKA 3ZWSA 4YCOA 5GVJA 3WJWA 2Y5SA 4YWIA 1A5KC 1TV2A 1KFBA 4NJGA 1XS2A 5I23A 1VH7A 1Q45A 3SRDA 3GWQA 4M6PA 1FKXA 5BWAA 2FMNA 4I6VA 3ABSA 1MO0A 4QFUA 3GXDA 3VOHA 3F5KA 1OWQA 3MMTA 3NDZA 3VNIA 1FWRA 3O16A 4H6RA 1X6UA 2IPFA 4JICA 4RPPA 1KBLA 1ADSA 1IGWA 2R14A 3AYSA 4LJ3A 1JXJA 1LT8A 5EU9A 1FXPA 3SSJA 4CNSA 3O6AA 4RE2A 2X1SA 3J7HA 2BBFA 1S38A 1SZFA 4U5IA 1F07A 4LCSA 3VGEA 1VIZA 3ITVA 4P8VA 1VJIA 4LW7A 5F2LA 3B97A 3BE7A 5DO8A 3FDGA 1S2TA 3CUZA 1M65A 1E4LA 1VGAA 3FXYA 2NUWA 1OFEA 5CSUA 2WAGA 3FX4A 5AVNA 5DCBA 3HZ3A 4J27A 2PWDA 4RE4A 4OUIA 1L8NA 2QCGA 3MWCA 5HATA 3T78A 2E0PA 4LC6A 1PZ2A 4O0ZA 3STEA 4E8DA 1XH2A 4PB4A 4G8TA 1XH0A 2YYTA 2E28A 2ZUSA 3PZUA 2VHLA 3TX9A 4PYSA 4RW3A 4FLQA 3CTLA 1EP3A 4PMRA 4RE0A 4LUTB 5EL1A 1GHRA 4UIOA 1V0KA 4JTEA 3WKZA 1F3EA 1UD5A 3ES8A 1W5NA 2ZC8A 4DO7A 2OG9A 1ZRQA 3GDMA 3R4IA 3F1QA 4S3CA 4O57A 5AN7A 3QQ1A 2D22A 2OT1A 4DO4A 2CLPA 3H2MA 2XHYA 4LV4A 2OLAA 5E9AA 3CIWA 3FGCB 3QR1A 3TOYA 4I7UA 3AXXA 3R58A 5F4XA 2FH6A 3GM8A 1XLKA 2PLKA 1KV5A 1OF6A 4J40A 4MAZA 1FH8A 3IARA 4ZBCA 4H9MA 1ZSXA 3NL3A 1W2PA 1XIDA 4NZFA 4EF8A 1TV7A 3RM9A 2VXNA 4C6OA 4C1LA 2UV8G 4AIOA 5D4YA 2RUSA 4GX9A 1BXBA 1T5AA 2V30A 4JTCA 4PBGA 5K9XA 3NYZA 1W1A1 4C7FA 4AUBA 2ZRXA 1HX0A 4RKAA 1F7BA 3KW3A 2HSAA 2DW7A 2P0IA 4L1WA 3L4YA 1Y5XA 2Z6JA 4N9BA 3AU2A 1EP1A 3K1GA 2ON3A 4RLIA 1LYXA 1W37A 3VIFA 3MMDA 1XYMA 1GZJA 2WMFA 4PSRA 2PGWA 2H9AB 2G95A 3CASA 3P74A 4C65A 3O0FA 3C0JA 2ZRYA 3A23A 2YBTA 3ANUA 1MNSA 5J04A 1QK0A 2XGBA 5LA2A 2ODOA 3L5AA 4UTFA 1A50A 3SB0A 3NO3A 2VRJA 2WVTA 1KGWA 3D3FA 1MXGA 3TDFA 3W1LA 2P53A 1E6QM 3EYPA 1THFD 2PDGA 3FIGA 5EGRA 4NASA 3UZZA 1CGUA 4PMVA 2H3DA 4BKNA 2FHBA 3R0DA 1WYIA 2OEJA 4PMQA 4H9YA 1S2VA 5F4SA 3EDDA 3UWEA 3GNDA 2H90A 1DJZA 2J8FA 5HUPA 4GKLA 4B5NA 1IR2A 1OG0A 3LI1A 4XZWA 4EWND 5EBUA 1XJBA 3HF3A 2CKRA 2ISFA 1HGYA 3W1AA 4GQRA 3P80A 3QV6A 3RLHA 2WVUA 3HGSA 2GK1B 4KWSA 1XC6A 3WK3A 4J3UA 3R8RA 1YPFA 2GDVA 1KBKA 3PUEA 2J7GA 1MXDA 2VO5A 3MUCA 9XIAA 2FQIA 2GL5A 3JRKA 4QXIA 1Y5VA 2ZDSA 3B05A 3W7HA 2GGGA 4K8HA 4MB1A 4LUSA 3NQEA 4DAIA 3ME3A 5HJXA 3VNJA 4MAVA 3OYXA 2WSKA 4DLMA 2CHRA 4JL1A 1US0A 1MW3A 2NV2A 1GVRA 1WX0A 2CZ5A 1ONWA 2J7DA 3LUTA 1U1HA 3DENA 4ACZB 1TREA 3DG6A 2PD5A 3NDOA 1L9WA 3GTXA 4KWOA 4X2RA 4HJFA 2JKEA 1LRNA 4HVXA 2J6VA 1H3GA 3VI2A 1UP0A 1UR2A 1VLWA 1RD5A 9XIMA 3B9NA 2J8TA 1K6WA 5CJMA 3LRKA 1GZ1A 2HRWA 1B90A 2YIHA 3AHTA 4UMAA 2Z4GA 1ML1A 1AJ2A 1V6VA 2DT0A 3AS0A 3OGSA 5HA7A 3BVJA 4EP8C 3SECA 3M5ZA 1J18A 4KESA 5I0DA 3ARPA 1QFEA 3BLPX 5C9WA 1U30A 2XG9A 3MDUA 2J9XA 2B31A 3TWBA 3QMSA 1DJWA 4HHPA 2E8ZA 4XIAA 1AW2A 2Z6IA 4PMYA 4ZEPA 3PC0A 2D0FA 1O5XA 2NX9A 1YDNA 1DWFM 2C19A 3W7RA 4XTIA 3VTRA 5MKGA 2Y89A 4NSBA 3CM4A 3CU2A 1F6KA 1LOLA 1L6FA 2GQ9A 1X96A 3BLLA 4JS3A 2DIEA 2INZA 5D9MA 3IK2A 3M0ZA 3BTNA 4KFPA 1QATA 2JGYA 2Y4SA 2BMBA 1PTAA 5G2IA 2QXWA 2NT0A 3TVAA 3U8GA 5ECVA 4JAWA 4I8DA 2WBGA 4JNMA 2BV9A 3CMGA 1M7PA 1GOOA 4NKCA 1DJIA 1DWIM 4U28A 2YZRA 1UJPA 2E9MA 4HN8A 1M68A 4FOJA 2QJIA 1R9ZA 1RY8A 4TV6A 2GWGA 3MTWA 3T81A 3DERA 1ISWA 3G0UA 3ABZA 3OBKA 4W5UA 3M9YA 4CU6A 3PUGA 3WIJA 3H2FA 4GNKB 2VFEA 3KTXA 3DUGA 5CJNA 1DOSA 2WZIA 3GFYA 2QVNA 5CQ1A 3L7RA 4ZSUA 2P8CA 2CFFA 3M0HA 4I9MA 3GXMA 4TUFA 1MW1A 4E2OA 4Z1CA 2Z1VA 4GPNA 3W2UA 3R79A 4EXQA 5JBEA 3WLSA 5LIYX 5LNSA 2P50A 1W9PA 2HDJA 2WMHA 3A47A 3LERA 1HF6A 4BCEA 1K8CA 2GOUA 2ZRVA 1VYSX 4A8IA 3BQ5A 4ZOAA 4C6PA 4QNWA 3SCQA 3WQDA 3N4AA 1NJJA 1Z8AA 1W17A 1HL9A 2ISWA 3VU2A 4AD4A 1YIXA 2DFAA 2YR1A 4GVHA 1ZZMA 1PHQA 1XGEA 3G1XA 3EX6A 4R7JA 3HPSA 4HNNA 1XIMA 1BGGA 3FJ4A 3AIWA 4LY8A 4DJFC 1SFSA 3CZGA 4JHZA 3VIJA 1S2CA 4DJEA 2XSXA 4DZIA 2C14A 1NARA 1TTPA 1V02A 3EBVA 4L9XA 4MWAA 2H8ZA 4MMWA 2BHUA 3EA3A 3BLDA 1YBQA 2HVMA 3E3HA 4KEZA 2XJ7A 1B54A 4MNLA 4O28A 3S42A 4UFHA 5TAOA 4DYEA 3CHVA 4QIUA 1HQTA 2D3NA 2PAJA 4DJDA 4UFMA 3JS3A 4AD1A 1KCLA 3ZR6A 4GUHA 3SUTA 1YQ2A 3EX1A 5D03A 3QZEA 3SCSA 4QP0A 3MANA 2QV4A 3GH7A 4HN4A 4M24A 1SW7A 4K7YA 4IG2A 1FWJC 1OC5A 1M01A 1HVQA 4GX8A 1AD1A 2QLYA 4CQ9A 1VCGA 3TOPA 3BMVA 5HMEA 4ML9A 1V7YA 2GLKA 1CX9A 3IUIA 4KS0A 4JFSA 1XIJA 2A4AA 2BNJA 2WNWA 3L2LA 3EWYA 4K37A 3TAOA 1GCYA 5CGQA 1R30A 3VZXA 2X16A 5GNXA 2Z27A 1MWOA 2GSEA 3PM6A 4WY0A 3I3BA 2JK2A 3HQNA 4D2JA 5KTLA 4UB9A 3RLGA 1EEXA 1A5SA 4KKXA 4O1CA 2J75A 1HTIA 5DMMA 3SSZA 2WZMA 4J7RA 3H7UA 1QJWA 2R1NA 2WSYA 1Z89A 1DJYA 1Z6KA 4MDPA 1FCUA 3TFCA 4FSAA 3VDGA 2GGEA 4UOJA 5BWFA 1FDZA 6XIAA 1ICSA 3QPYA 3E9AA 1TKKA 3RO8A 5JIWA 4Q8OA 4FXFA 3ABRA 3ANYA 5H8UA 1YXYA 2R1MA 4RNJA 4XD5A 2JEQA 2BVTA 4G7FA 3AJ7A 4GD0A 3PPCA 4ZB0A 4GO8A 2I5IA 2QIWA 4UOZA 3M5XA 1O94A 2C18A 2R9RA 4LS2A 1QR7A 2HWGA 1GYMA 3V7PA 2HS8A 1WZMA 1GUVA 1WBJA 2ZDRA 3O15A 3GDRA 4Z2HA 3A6OA 1NY1A 4UTTA 5JIPA 4N02A 4KFNA 1C92A 5XIMA 3WD3A 3ABXA 3LY0A 1DIDA 1OK6A 3IJLA 3NQ6A 3IACA 1EFZA 4JX5A 1VFSA 2J25A 2Z1BA 3DYMA 1EA0A 1LJYA 4RW5A 2YDQA 3SRHA 1GOQA 4CUCA 1PVNA 3E74A 2YOCA 1G4PA 5GJPA 2NUXA 2G4JA 2OMAA 2EF9A 5JUVA 4HK6A 3KRUA 3C5QA 1OYBA 3SUUA 3QW3A 1XP3A 1XCXA 2BGSA 2DSKA 2IQDA 3LXBA 4FXJA 2EKCA 2ZX6A 4YVXA 2EKGA 3IVSA 4DJFD 2QMKA 1FRBA 5CZSA 4E4PA 3BJFA 3CPUA 2ZX8A 4F40A 3GXTA 3BXWA 4UTKA 2FHFA 4RDZA 3KOXA 3ATYA 4DM1A 3HMJG 2ZRZA 1TSIA 2CIPA 3TE9A 5ABEA 1TA3B 4LNYA 2FVLA 2D24A 4H01A 3EWWA 1B30A 2X0YA 3LXCA 4AQLA 1XSIA 2OR2A 1SZNA 2C1HA 1EJ7L 4BF9A 1VPYA 2F9RA 3E5PA 4RV8A 3GFZA 3FK4A 5AZ0A 3GKAA 2D2JA 1DJHA 4QE4A 5C9RA 3TMLA 3H4WA 2WHMA 2ZYFA 3QMRA 4X0NA 3W25A 1WZAA 4HZMA 3THQA 4HMNA 2JIEA 2W27A 3KHDA 3NSMA 2VDGA 3Q45A 1WAWA 5AKQA 4CQ8A 1S5TA 1UH2A 2BVWA 3W4RA 3VNMA 1TCMA 2QPUA 2DSUA 4PH6A 1J01A 2G5WA 1MFVA 3PTMA 4IXHA 2X40A 1SMAA 4DELA 2BY3A 1H51A 1F6YA 3OLEA 5HULA 4D8AA 1DIOA 2BY2A 3JUGA 2E4TA 1GYNA 1LQ2A 4Y8EA 3WUFA 1OY0A 1QUMA 1E70M 4NZJA 4H1ZA 4UQBA 3PNUA 4NJJA 4XO7A 4MUZA 2BVDA 3ZLHA 2PTZA 4WRHA 1WDRA 3O8AA 3QHMA 2HBXA 4QHRA 1GZGA 2CKSA 1MUWA 1LDCA 4AISA 4JTJA 1H2JA 4NX5A 1W0MA 3UETA 1RCQA 5CG0A 2YL6A 3HQPA 4Q8QA 4C6QA 5G2WA 4JY9A 4FX6M 1JPIA 4FEZA 4OOUA 3P14A 3B8TA 4KEVA 3W1NA 4O1BA 3I4KA 4JIHA 2Z2AA 5A8NA 4UZUA 3O06A 3N73A 3QN3A 4LGXA 2O9PA 4YVVA 3PFMA 4FNSA 3LNMA 1TPC1 1NFBA 1ICPA 2PWHA 4LUYA 3N6QA 4EPBC 3UZYA 1ZBKA 2HZGA 1RLDA 1Y65A 1OD0A 4PFMA 3QHOA 2A3LA 3QEZA 4DXXA 3NO1A 4GIYA 4TVCA 1GPWA 5BMWA 3HQ1A 1ODUA 1FQ0A 3VINA 4JEJA 4LBUA 5U4NA 4HU8A 1W1TA 4DNHA 4CU7A 2FKPA 2V2DA 3LV6A 5HNUA 3IRSA 4S3JA 3OQEA 2DZXA 1DEDA 4ORIA 4K1WA 3FEMA 3N11A 8A3HA 3IJQA 5DELA 1VBUA 1TPVA 2IPGA 4PUNA 4HSNA 2WHJA 3FY1A 2V69A 1UA7A 2J6XA 4IPLA 4NAEB 2PDQA 3I7RA 4F9DA 2VCCA 2OLSA 3B9OA 4H83A 1RVGA 4OQVA 1ZUAX 4DO5A 3GNNA 1VC4A 3TN6A 4I6KA 1K9TA 1SSGA 6TIMA 3M0VA 3TKFA 3NZRA 2VX6A 2TAAA 1Z32X 3U2EA 2WCSA 3KM8A 1FH9A 2EGZA 4FI4A 3UJ2A 2PSNA 2OQHA 2ZTKA 1E9YB 1OGGA 2VEIA 4UFLA 4JY8A 4XZ9A 1XKYA 3I7SA 3A4XA 2ZC1A 3MJYA 3Q2DA 2Z1SA 5ABFA 3CHCA 4TTGA 2DZWA 1Q6EA 1MQRA 4D8ZA 2Y7EA 1UR1A 2QS8A 1SJCA 1JCNA 3DC0A 4JOMA 5FF7A 4MGGA 5A3HA 4AAJA 4EWJA 3LN3A 1ZBWA 3QC3A 1G9HA 1DJQA 3T08A 1B2YA 4MNJA 4DIAA 2ALDA 3T8LA 3K4WA 3E38A 2CHNA 5DXYA 2Y8KA 2Z1XA 3KCJA 4L64A 1WXZA 2FZDA 4HMDA 4H3DA 1UCWA 3PSWA 1VFFA 4OUEA 3WMCA 3FKRA 4GYPA 3A22A 3HFTA 1OC6A 3LXAA 1GJUA 3E0WA 4F0KA 1RJRA 3OOQA 1UPMB 1JCTA 4KRTA 3APGA 5AYYA 4NG3A 4K2SA 2NSXA 3TMQA 1EXBA 4LB3A 1O1HA 2ZWYA 3AUJA 5LA1A 3FVDA 4PA8A 3W2KA 3KS6A 4EXAA 1ZS2A 1UZ4A 1UKTA 1DHKA 3B8IA 4RNFA 3U0HA 3S9IA 3Q67A 3BAIA 4V2XA 1ZL1A 1KXVA 2AAMA 1O5KA 3OW1A 2GJXB 4GHRA 2RJGA 5AHMA 3GNXA 1SMDA 4CVWA 4C7DA 1QK2A 1UWSA 1W3KA 3IPWA 3PB2A 3Q94A 4WXYA 1Q6DA 2CZVA 1TFVA 4TIMA 3IK4A 4IJBA 1V6TA 5BROA 4QJ5B 4GYFA 3A3HA 3AHYA 2P5NA 3AZSA 2XVGA 1BPLB 2VR2A 1CENA 1VJSA 1OINA 2V2HA 4LYKA 3FYYA 2A0NA 3B8SA 4MFDA 5AYBA 2NSOA 4MJMA 5A6LA 3ZM8A 5AZ1A 2XFYA 3VUPA 1VFHA 3R1ZA 3W1RA 3QY6A 2E7FA 2GZXA 1JDEA 3W28A 1GQJA 4R85A 3HURA 1ALDA 2QUMA 5T9CE 3CS2A 3W01A 2A1YA 1P6WA 4LEFA 3W84A 5B7YA 1LT7A 4Q6XA 1FFQA 4ZO9A 4PMOA 4RZ4A 3RX4A 5BCAA 3BG9A 4MYXA 1R87A 2Y61A 3N04A 3RMEA 2GVGA 1I1WA 3D47A 3W7OA 4OV9A 3C2RA 1LL7A 3AHZA 3F4NA 1RBAA 3HMCA 4CCDA 2YA0A 4AZHA 1N7KA 4GZEA 2QJJA 3GG7A 3MU7A 4J9JA 4Q8PA 3PPHA 3ZZ1A 1DVJA 2XGIA 3UWVA 4ZXLA 2QVHA 4XV0A 1WKEA 4AW7A 3MCNA 1VRDA 3AXIA 4M6VA 3PUDA 4H8UA 2EQDA 3C52A 4ZB2A 3ABQA 1M1BA 4HYRA 2H6RA 4P7QA 1D9EA 3S6TA 3EB4A 2XGZA 4Q4KA 1WDQA 3P8JA 1CCWB 1WDPA 2E6DA 1ZPTA 3L68A 5JH2A 3MY9A 2WYSA 1LORA 1XLDA 5C70A 2A3CA 3H21A 1AFSA 5G1YA 2XIMA 3EXSA 3T1GA 2ZZ1A 1IT7A 2PDUA 1AJZA 1KC7A 4LAZA 4OWGA 1RA0A 3KX6A 3ZQ9A 4JTUA 1UW9A 5I24A 3EXRA 2P88A 3ARYA 5F1VA 1E55A 3GR4A 3T7VA 2C7FA 2XH7A 1OFOA 2VEMA 4NU7A 4WZHA 3G0SA 3KL3A 2PDWA 1UWUA 3LLFA 1DBTA 3JW7A 3W7IA 1JQVA 2C6QA 3AIBA 4JHMA 7ENLA 5KSWA 1NIUA 3QV8A 4KQNA 4EPDC 3ZJ6A 4WLCA 4ZQPA 3HIJA 1JPMA 3NR0A 3W26A 1A3HA 2Z2UA 4PMJA 1R86A 3AALA 1H4PA 3WDJA 2V3EA 1EL3A 1QU4A 4ZFCA 3PJUA 3P0WA 1E40A 1DE6A 1I2PA 5HAOA 3LCHA 1TRDA 4XKYA 5DEZA 3BG5A 2GQ3A 3WBAA 3AC0A 1L6WA 3MP3A 3VGHA 1JUBA 3Q4DA 3BH4A 5KZDA 1E56A 4ICNA 2QCCA 1M7JA 4Y9MA 5F2IA 4IMGA 1OX6A 2JEPA 4O16A 1DL3A 1L6GA 1KM5A 3DI0A 4H9XA 1C91A 4DWSA 4GI8A 2ZUMA 4UR7A 1EZWA 3UNDA 3USZA 2IKIA 1P43A 4CN4A 1W3TA 1E6SM 3AS3A 4DAFA 1P0KA 4BS0A 1QWGA 3B0PA 3E0IA 3ITGA 5AC8A 1F8IA 2O9TA 2QDHA 3BICA 4XTDA 1XC4A 4CQDA 3V0UA 3APYA 2XIOA 1XIHA 1ME7A 3ZWTA 4ML4A 1HKMA 4M29A 1BQCA 2HVNA 4S3KA 3W86A 4FO4A 4N4PA 4Y9AA 1YDYA 1G7VA 4A2RA 3A4AA 4B5VA 4YHEA 3AYTA 3BJTA 3W1PA 5E0CA 3ZT6A 3AI0A 5EPDA 1IIGA 3U4AA 3ANVA 4GZ7A 1NH6A 2YX0A 1GKPA 1LLZA 2X41A 3WH8A 4EXBA 3BCDA 3VKCA 1RA5A 4O54A 4PMNA 4F4RA 1QHPA 4ZGYA 1F5ZA 2YL5A 3EWUA 2H3BA 3FS2A 2OSYA 4FLOA 5ENLA 4GISA 1W2VA 3BL3A 5HANA 4X9SA 3AQUA 2PZ0A 4J2PA 1LLOA 3T07A 4L5ZA 2OSWA 2ADAA 1G01A 3AJXA 4GGHA 3SCVA 4LUSB 2Y0FA 1U33A 1ADOA 3NQMA 4NAFA 3VO0A 2VR5A 3WLRA 3F4DA 2BP1A 4BF7A 3SO7A 4PTWA 3RU8X 1J0KA 4GQGA 2BASA 3SGGA 1V79A 4UCFA 1HJUA 2VX5A 1DTUA 1RCOB 1H49A 4HK7A 3WDPP 1C9DA 2PDYA 3CJPA 4C6LA 2BXYA 3DFHA 2VC9A 1RXOB 4WGHA 1NFGA 1R9YA 1E4MM 1XBYA 1KRAC 1DYSA 4DM2A 1ZJHA 4GVGA 4HPNA 2CLHA 3U2ZA 3LZ3A 3VKJA 2G96A 5K4ZA 4PGLA 4YL2A 2EPNA 2QF7A 3OIHA 1IV8A 3CAKA 1HJQA 5HQLA 5TBOA 4ATWA 4OJYA 3N9SA 5A8MA 3FFSA 4L61A 1PKNA 4JXCA 1TELA 5CCZA 3NEVA 1XDMA 3TQKA 2FPTA 5ABGA 3CEUA 5D2WA 3N3MA 4NYUA 4UTHA 2O7SA 3CMJA 4HZ8A 2R24A 2E09A 3OBAA 4V15A 4C5ZA 1O7AA 1UBPC 4DO6A 4TXEA 5I5RA 2B7NA 3WD4A 2GGHA 2ZQ0A 3B8VA 5DY2A 5PTDA 2QAFA 4OBRA 2DSZA 4YN5A 3WLHA 1LWHA 2PI6A 4GH1A 4XBKA 3IANA 5AB3A 5EMUA 2GDUA 1I2RA 1UQYA 1I6NA 4GLEA 5MKGB 4PRTA 2J27A 4YVPA 1B31A 3WQWA 1LG2A 3PG9A 1T0OA 1MEWA 1VFMA 1PZ0A 4Q3MA 1TJ1A 3KVJA 2D23A 1SZEA 2XSAA 4P7OA 4AZCB 4MNMA 1XG4A 2V3FA 3H8AA 3WQ8A 4HPXA 3IIPA 2ACQA 3NXFA 2V5BA 2ZICA 1Q8AA 4DJEC 3W23A 1M6JA 1QHZA 2X0SA 4QR6A 4MWAC 2ZBTA 2NQJA 4OKDA 4YTUA 4GVIA 3KBMA 1TV3A 3FW6A 5EMYA 2BWGA 2INEA 2OQLA 4YXGA 3LTPA 2BOGX 4GC4A 3ARTA 3NL2A 1QTWA 4GYKA 3QPEA 4LS1A 5IXEA 1V4YA 4G6CA 4M6QA 3C86A 4UNKA 1L6YA 4NI8A 3GXIA 5C6MA 2VFGA 1JCYA 3EKGA 3SJNA 2Y8UA 4AYGA 4GVFA 2R6OA 3MVIA 2GYIA 5BRPA 2MUCA 4WDUA 2YLAA 1E0UA 3L4UA 4R34A 3TLLA 3QGVA 3V5OA 1P1XA 2A3EA 3E0VA 2Z1KA 4ZQNA 2WKJA 5AHEA 1WE5A 5BRQA 2QHAA 4YTQA 3MCMA 3WX7A 1VPQA 1MUMA 3MSGA 3FYOA 4Z2LA 2FTPA 4EAYA 2ZFAA 1F4HA 3G0XA 3LM3A 3DAQA 5TIMA 3B0XA 1B57A 2DDXA 4KERA 1QAPA 3UNTA 3C2OA 2YFNA 1OIMA 1PWMA 5K9DA 4S3DA 3H2NA 4XD6A 3TYBA 5AC5A 1AW1A 1JCLA 4S1FA 4XVEA 1JZ5A 3SCRA 1PYMA 3G3DA 3ZSSA 1H7NA 3LEPA 3EDFA 5DBTA 1S2UA 3GTHA 3T6CA 2Z25A 1N82A 1PDYA 3GD6A 1V51A 4MWAB 1M7OA 2ZE3A 4R9OA 1TPEA 1YBQB 1XL9A 2VCAA 3QPZA 3STFA 1JRBA 2D0GA 3K1DA 4B9ZA 5FI8A 4J4KA 1VEOA 3M07A 1QOXA 3OIXA 1HP5A 1CXFA 4I8YA 5AYIA 4BR1A 4NJHA 2DUXA 1KLZA 4H00A 3UVAA 1US3A 3D3AA 1FBAA 1Q6RA 2AMXA 3NYDA 3UVIA 2FTYA 1Q5MA 1CGXA 2DV0A 4IG2B 4F3HA 1DJNA 2G41A 3RPDA 4RDWA 5A2BA 3IJ9A 3KWXA 4E6MA 2WV8A 3GTIA 1VS1A 4GQQA 4NT0A 5AHLA 2TPSA 2VFFA 1JPHA 3CQ0A 4Z1BA 3W7EA 4JQ1A 4JIEA 1G6CA 3A13A 4MY9A 4FA3A 3PTQA 1WOBA 3B0UX 2X1RA 4WY0B 3PZIA 5A6MA 4JGDA 4ADUA 4Q22A 1MFUA 3QR0A 2HPIA 4A21A 3SADA 3DEQA 2DVXA 4YU1A 2YDRA 4QSHA 2XIIA 1AQFA 1TG7A 1UJQA 1X8FA 2E77A 1VB9A 1FKWA 1MNZA 3W7CA 4YMZA 4WOQA 1I9CB 3LGGA 5KETA 3CT7A 3C0QA 3WSUA 4LVBA 4PCFA 5EB8A 4JQ3A 3K5XA 5A6TC 4DJED 3AIEA 4B2DA 3BLFA 3UG8A 2DZPA 5BW6A 5LSMA 1S5WA 4MWAD 2OXNA 5BOFA 1U5HA 5FF0A 2G3IA 5DT7A 1JYXA 1TRIA 3DECA 2DT1A 1NEYA 1W5OA 4DBWA 3EWZA 1KCZA 1YTDA 5CC3A 3AS1A 4AG0A 1ZU8A 3SCTA 3CQHA 1V5XA 4PE8A 1LCOA 4DJDD 2ANUA 5E93A 3UR2A 3UXKA 4YTRA 1XPYA 3UWWA 1XUZA 1JGMA 5FEZA 3G1AA 3OTRA 1XGDA 5CBBA 3U7VA 1JI1A 1RP9A 1VPXA 5LIUX 1C90A 1S5MA 1EC8A 4L9ZA 3WBYA 1CECA 1TJ0A 3VUSA 3M1ZA 4GXWA 3AHVA 3WQFA 3OGVA 2MANA 3QY8A 4D6GA 3WEOA 2QCLA 4B15A 4K1GA 1ZP3A 4LAKA 3AU6A 4GYJA 4C6BA 4TTUA 5GQBA 3CWOX 4N7QA 2RHGA 3E2QA 4ROQA 1FDJA 2V5JA 3H24A 3OPSA 2B7QA 3AMLA 3TWAA 4CD7A 4JTIA 2X7WA 5FESA 4KIRA 3A24A 2OFJA 2Z1WA 3POCA 3VM5A 3WENA 4FHAA 3KVLA 3KUMA 3WQOA 3NO5A 4DQWA 4BZYA 1Z44A 5IBXA 1TO3A 2Y5JA 4AH7A 4E3VA 2UY3A 1RJPA 5CC5A 3FNDA 2Y1HA 3R94A 2BG5A 1EF3A 3IAQA 2Q8ZA 1CLKA 4V1XA 3EPMA 2C1IA 2VZVA 1DIKA 2XTKA 4PBEA 4JTKA 3QY7A 1JUEA 4LBRA 1EGMA 4B3KA 5H8MA 1HG3A 2CCRA 1UD4A 3P82A 1OEPA 2PTYA 1KB3A 4XZLX 5A8OA 4JN6A 1OFRA 5F2MA 4BQ2A 1TE1A 1IZCA 2PWVA 1KFEA 5A94A 2PE4A 2Z00A 4NL1A 3QLLA 4AWUA 3E1F1 1UC5A 4WF7A 2NX3A 4HPJA 3ZVHA 2PLJA 3P2VA 3WYZA 1RQHA 2WZEA 1K4GA 4G7EA 3R25A 4B4FA 4PL1A 4JQ4A 1V08A 4BQ5A 4O4VA 3EMZA 2A7RA 5CJ5A 3FDKA 3NL6A 4AX7A 4W5ZA 3PBMA 1W3LA 4GI4A 3L9CA 5JU6A 2DW6A 2F2HA 1L2UA 3TYEA 4IX0A 2VOTA 1HKVA 3WD2A 3ZVIA 4ZO6A 2PDBA 1IEVA 5AHFA 4ERGA 1Q63A 2UY5A 3BSGA 1ZENA 2VC5A 3IGSA 1NDYA 3MKVA 1OM0A 3KBWA 3DFOA 5CEWA 3LSBA 4DLFA 3CIXA 3WMSA 5FL1A 1T8XA 2FVKA 2OOFA 2R1KA 3WDHA 3GLCA 2WM0A 1C3FA 2CLMA 2RFGA 1RD6A 3M44A 3CZJA 1EJTC 2EHHA 1WZKA 3M64A 3RHGA 2ATSA 4PMZA 1E4NA 2IXUA 5EFFA 3GNOA 1EP2A 3W71A 1YNYA 3I68A 2YXGA 5A6BA 1HGWA 1PV8A 1RBOB 3I3EA 1GVEA 1K8ZA 4UWMA 3O7UA 1Q6GA 4LB4A 3NAVA 4IQEA 4F48A 1HT6A 3HFYA 4IQJA 2OJPA 3IAPA 3THCA 3GKFA 1XGZA 3MUXA 3U2OA 1XLCA 3G1DA 4M0XA 1EDTA 3WBWA 1V02E 5T26A 4MWAE 1T7LA 5I3KA 1KNWA 2QDDA 1J6PA 3POHA 1RJQA 2O4MA 3G18A 1KGXA 1XXXA 3FHAA 5LGXA 3TA9A 5GNZA 3WL0A 1NP2A 1N8FA 5D2YA 1K8XA 5GJMA 2FB3A 1BVWA 1GEQA 1X38A 3WFAA 1JZ2A 3OZOA 1JCJA 1BRLA 4C6DA 1QPNA 3A9IA 3UA4A 3XIMA 2Q09A 3U9IA 3G1YA 3CAVA 3O6YX 3COTA 2UZ9A 3OLDA 3M4HA 4JTTA 4XZMX 4U3AA 3ZR4A 2QYGA 4XAYA 4HMCA 4WJXA 3ARWA 3VCRA 3RLUA 2WQPA 1K7XA 2OODA 5RUBA 3EWBX 3WQ4A 2VGBA 3WNOA 2GGJA 4LTSA 5IFTA 3S4TA 2XIJA 1TQXA 3S1WA 3DC8A 1Y0EA 2HK0A 3G1HA 2UWFA 1ITCA 2L5HA 3TZFA 1GPFA 5HNNA 4A8RA 3LTYA 4GMEA 1CB7B 4IPPA 2PWUA 4N4QA 4UBPC 1OGBA 5ABFB 4MSSA 1ICQA 3SAZA 1EHNA 2Y24A 2ISDA 1BXNA 3MHFA 2WKLA 1DORA 2QR6A 4FP1A 1E9LA 4LUJA 5C71A 4RZ6A 1W1VA 3GIQA 3GS6A 3B03A 4V27A 4NYYA 4QJ4B 3GH5A 1J96A 3LGDA 5IHRA 1HKKA 4ZO7A 1NU5A 5I3HA 3OA3A 1HIZA 1LZOA 1NF0A 4BI5A 2C1GA 3CUFA 2F6XA 1TB3A 1YLVA 4M80A 1XD0A 3SQLA 3P61A 1F9CA 3MUZ1 3THUA 2PUZA 5IFPA 2EG8A 3H23A 3VDHA 5AC7A 3LCGA 3IJ7A 5E0KA 3DBPA 4LVGA 4GY0A 1Y5WA 2CWNA 2YZ5A 2G3MA 1CBGA 3MV11 4B4HA 2XDFA 4ONVA 1W3HA 4TOQA 1ZJBA 4QTGA 1SR0A 4IMDA 2B7OA 2GQAA 4Q6JA 2NLIA 1XPGA 3PB0A 4O18A 2I1OA 4H6KA 4R9XA 2ZXBA 5LNUA 4IIBA 2DZBA 3APTA 3P67A 1A0CA 1AMKA 3WF2A 1UD6A 3L66A 4G1NA 4NNAA 3EA1A 5LHEA 1HO1A 2WC7A 2OZ0A 3N29A 1XDJA 3D6NA 2AOSA 2OKOA 3ZLFA 3GDLA 5CZTA 4JD4A 4GIEA 2CERA 4NRRA 3WJYA 3SIZA 1Z48A 2A3HA 4HNTA 5CBJA 4PUMA 3LSCA 3TR2A 3VKAA 1H7XA 3TLQA 3H53A 1VCVA 2O56A 4O50A 3VE9A 5HQMA 4QAWA 3HB9A 4WR3A 4CEXC 5XIAA 4D6DA 4EKJA 1BQGA 2E1DA 5A8QA 2PDCA 2PWGA 2JALA 4RR4A 1IGSA 4TU1A 4CD5A 4F2BA 2E9BA 4C1KA 2DPEA 4ZZ9A 5BU6A 3GC5A 2VDHA 3WF4A 3RGTA 1FTXA 4GJIA 2ZOXA 4IIEA 3EB3A 3UWQA 3LS9A 4HCLA 3P5ZA 1OT1A 1D7FA 4OVXA 2VFHA 3BUVA 4JN8A 4LCRA 1BF6A 3KXQA 1JF6A 4E4UA 1YTEA 2AQOA 8TIMA 2FJUB 2F7FA 2FZ8A 3I65A 2FGLA 1Q8JA 3ABOA 3CEPA 4EX4A 1T96A 2OWXA 1NWTA 3NPVA 3KL5A 4WSJA 2WB5A 1D3HA 3FN9A 5BU9A 2ISVA 2V82A 4CNOA 1MQPA 4ADSA 1H5YA 5AOUA 4QJ1A 2OKTA 4XUGA 3BMWA 3TTOA 4UNLA 5LGZA 1X1OA 3TP4A 1M41A 5HXMA 3G77A 1OX5A 3EEZA 1QRQA 2BOEX 1VFTA 3MYPA 3ITCA 1W56A 3LBOA 1I8JA 1QOQA 4HOXA 2VX7A 3PWAA 2XZ7A 3MQTA 4J3VA 3GX9A 4W7UA 1EQCA 3CPRA 4IM4A 2ZRUA 2G3NA 3MBDA 3EMCA 5D33A 3QYSA 1DWHM 2NV9A 2FGZA 1XRFA 2OELA 2VUYA 2XYLA 5BOOA 3O6CA 1BWVA 3UCDA 1RLCL 4KWVA 4OT7A 3JR2A 4DWSC 4NZ4A 2HE8A 2OO0A 4C6IA 4UXDA 1XF0A 3TUUA 3NQ8A 3LLDA 1K9DA 3I6RA 3SFKA 4ACYA 1F73A 3WF3A 2OVLA 4GE8A 2GJPA 1VEPA 3NNTA 4PCSA 5DX7A 5KITA 1ME9A 3MZ2A 1R3TA 4X61A 1V3KA 1UC4A 3TW7A 3LPPA 2VJXA 1ZCCA 1OYCA 4FXRA 3RFAA 2VURA 3G1FA 1IIHA 2PGRA 3RAOA 7TIMA 5CGTA 1KXHA 5C7VA 4C90A 4P8XA 5C9ZA 3VOIA 1BXCA 2QJGA 3RCMA 3ZOAA 3LK6A 1YX1A 3F4WA 1D8CA 5J8LA 1IEXA 1M3UA 2PRLA 3T8QA 3IUHA 3IJDA 1QPRA 3SCUA 1JRCA 5AFDA 1WAUA 3NZPA 1Q2RA 2W6RA 3T40A 3TC6A 1VD6A 1OB0A 4PUJA 4XKYB 3CV1A 3R11A 3P8IA 4UNIA 4D6JA 1CGVA 2WNQA 3UZXA 1F74A 4UCGA 1IEWA 2CZDA 2VRKA 2QJHA 4XAGA 4UTLA 4ZOEA 2VL4A 3WLOA 1J8VA 2EBNA 2VEGA 4Y90A 1YPXA 4WDTA 3EOEA 4DWSB 4DUWA 2FJKA 2XWEA 4AMAA 3AWOA 4KIEA 1ZGDA 1AQ0A 2FZBA 1Q66A 2W63A 4GCAA 3UG3A 2YXXA 1GT8A 2BOFX 4KCTA 2A79A 4N9DA 4GUJA 4HU0A 3SI9A 3U5YA 3B9DA 2EJAA 2ZUVA 3GYCA 4ZENA 3G8RA 3UJEA 1W5PA 2E1WA 1BTMA 3U7BA 1C7SA 2XU2A 3GBEA 4WD0A 3WUGA 3U5UA 1QI0A 4HIBA 6ALDA 1J0HA 1E71M 1XV8A 1SR9A 3CIVA 5H6HA 3N2CA 1QI5A 3CUGA 3VIPA 2DZAA 1F61A 3LDVA 3ALFA 3UERA 1MVYA 1R3VA 4EPEC 1POJA 4FOUA 2CXGA 3BK0A 2WC4A 3NZQA 4X3ZA 4JTFA 3QSRA 2FZ9A 4S23A 1KTCA 3H55A 1GJPA 2QUNA 4BFAA 3A3XA 3REQA 4W9TA 5DXXA 5FKYA 1UP3A 4JFVA 3BLOA 5K7JA 4AZIA 3NZ1A 5D8ZA 6REQA 4MB3A 4LFYA 3CL6A 4BI7A 3I4EA 3DKLA 4ERIA 4NAFB 2OO6A 4WDXA 3WLJA 3UD6A 1F2JA 1XBVA 2YLLA 1LQ0A 5DMNA 3OVRA 5D32A 4V1YA 4P61A 2XM1A 3HBLA 1OHLA 1W3NA 4GBUA 3S2LA 4CVUA 2BB0A 3KP0A 3G1VA 3L0KA 2F84A 3WLQA 3FA3A 1TIWA 3LHWA 4CNUA 4DF1A 5D2XA 3DU0A 4DRSA 3W3OA 4O12A 3LMZA 1FWGC 4AHQA 5LIKX 1HO4A 1TE6A 3KBSA 4Q8UA 3GHSA 5AECA 5M03A 5D9PA 4XAFA 3GW3A 1IZJA 4QCEA 4JIPA 2Y7DA 2Z0IA 3AYRA 5LZLA 1TV5A 1EXPA 2QGHA 2QUUA 5M17A 4AFYA 4ZXOA 4IXXA 4L4LA 2YL8A 3SIMA 1I45A 4IIGA 4BA0A 2Q6ZA 3NL5A 1G0CA 2HEJA 4PTDA 4UFIA 4AF0A 3O05A 4PMXA 1GG0A 4GZJA 3GR7A 3TN5A 2AAAA 2ATMA 2JF6A 4IFRA 4XZHA 4E8GA 3HPAA 3PS7A 3BV7A 1HP4A 1E6PA 5BRBA 3M5YA 1U2YA 1S2AA 1MRAA 1B4KA 4LY4A 3QJAA 3W83A 2J9YA 4JIRA 1FDYA 2A7NA 1ZTVA 2HE5A 2YCEA 4LAMA 3W6MA 1CNVA 1MDLA 5F4WA 3Q65A 4ZQCA 4W7WA 1JDAA 1GVYA 2GUYA 1KTNA 4HA4A 3MPGA 5C9UA 2I5QA 3EKZA 1YKWA 4Y9PA 1O1ZA 3PP7A 3S2JA 5A69A 3UPMA 4DWDA 3PZNA 2X1TA 1W3IA 3W1UA 2V5LA 1EO7A 3GK0A 5A8PA 1R3YA 3DH7A 2D20A 4GIAA 1RPXA 1PAMA 3TCEA 2Y2WA 1BG4A 7ODCA 2BZNA 1KFWA 3OZMA 3QC0A 4HT3A 2CLLA 3HN3A 2D1ZA 4DN1A 4AIBA 1JDCA 2R94A 2GDQA 3VIMA 3PZMA 4GJJA 1XICA 3PZVA 3ITOA 3CC1A 3WD0A 2HBVA 1XLLA 4XD3A 1VFOA 5A6SA 3C4UA 3RR4A 3EOLA 3CHDA 3FJ6A 1KQYA 1FWAC 4W4QA 4DF0A 1F8MA 1WV2A 1XRSA 3W7KA 3DXIA 3RYSA 4WOZA 4HNUA 2DY3A 3C8NA 5CPMA 3HGRA 2QCFA 1UR0A 2WMGA 4FLRA 2WANA 3QHNA 2V9DA 3ID7A 4KT2A 4L65A 2SFPA 1TIMA 3EWCA 1YDOA 5E6YA 2JGQA 1PIFA 3T4CA 4O17A 4J3XA 2I57A 1XLJA 1WXYA 3IIXA 3WFZA 3NG3A 3NCOA 4R3UA 4GO9A 2XVNA 3O0KA 3C3UA 2WZHA 3PZQA 3HJZA 1HKWA 4PL2A 3M0KA 3INPA 3NURA 2FH8A 2MNRA 2KAUC 2DQXA 3DI1A 3KBVA 3WDRA 1P0NA 4MZ8A 2J7HA 1V6UA 2WMKA 1CGTA 3GU2A 1RV8A 3ONCA 1EJRC 4NXKA 3CHEA 1BVZA 5E0FA 3CLWA 1ISVA 1V93A 3TTYA 3MSDA 3LB0A 4IPIA 4UQEA 5SWUA 3N9RA 3B3DA 3GG0A 2QIIA 3EDEA 1TX2A 5C8BB 3TYCA 2NVDA 1NDWA 2G50A 3LNPA 4A35A 2PF8A 2EPMX 2QQ6A 3CZ8A 4CCCA 3BW2A 3ZT5A 3RF9A 1GORA 4N6FA 4Q4QA 3HPXA 4E8CA 3DGRA 1OQFA 4Q32A 1Q6OA 2NQ9A 2P3ZA 4W87A 1UBSA 3DHUA 3NQDA 1WA3A 2TSYA 3W1TA 3SN1A 2VD8A 4RE3A 4UTIA 3OU8A 5J5RA 3RU6A 4M19A 3BLIA 1GVIA 4LVDA 1G94A 1MW2A 1PCKA 3UXIA 5HBFA 2R82A 5KZ6A 2QV5A 1LOSA 3UEQA 3S1VA 3WCZA 1YNQA 4L80A 1K9FA 1UQZA 3PZ9A 2O7QA 1PB0A 3A3WA 2YPIA 1BYBA 3FOKA 5CPLA 1KKRA 1OCNA 4M5PA 3O2LA 5IBXC 3VCNA 4ERAA 3TW6A 3KOZA 4OIFA 1A5MC 3TROA 5IRPA 2BS9A 4W8AA 3M0YA 3VKBA 4L1GA 3CV2A 4WJEA 3E2RA 3HTWA 3GNRA 1G5AA 1JYVA 1K02A 3W7GA 3M0JA 1A3WA 2PDKA 5KEZA 3S5OA 5DMYA 2W62A 4J5NA 2QGYA 3GAYA 5FF3A 4BEUA 1FHLA 4Z1DA 1IE7C 2NLYA 3ZLGA 1JG9A 1OVDA 2D69A 3GBDA 4KWWA 3PAJA 1KA9F 1JEZA 2VENA 3CYJA 3E6EA 3BW4A 1YE6A 3PZOA 2O4QA 3UCCA 1TTJA 3BOXA 2NVAA 3W7JA 4E4FA 4LSBA 2A3AA 2DZUA 1EC7A 3PNZA 1RR2A 1E73M 1MSSA 1TCDA 5REQA 4ZQOA 3HU7A 2XIBA 2Y70A 2ZRWA 2V5DA 4JDBA 3GQYA 1FXQA 4JFTA 1IWPA 1SM9A 1QW8A 4S3FA 1FX6A 3EPNA 4MJZA 3AZRA 1B0IA 3HQOA 1C8XA 3SN0A 3W6YA 3UXLA 3TQ0A 2X42A 3S8HA 1MQQA 1LBMA 1VCFA 5LNVA 3S6DA 4XD4A 1EBHA 3KS5A 3VD4A 3ORWA 4ATLA 3NQCA 3ERPA 4B2DD 4TMCA 3PAOA 2PDXA 2OTDA 4TV5A 1E4IA 3FEQA 1R3SA 1H7OA 1UOZA 4HNVA 2W91A 4DVOA 2DJXA 1W6TA 4KH2A 3G5EA 4INFA 1A5OC 3N15A 4CCZA 2X8RA 4F0SA 3EOSA 4GBDA 3ZVHB 3VNDA 2J9ZA 1H60A 4AY1A 1WQ5A 4L1XA 1E51A 3G3MA 4G7EB 1S5VA 5J5DA 1KFCA 2PGFA 4Z42C 2ACUA 2WJFA 1DXIA 2ZZ6A 1PL9A 2A2IA 4UR8A 4GK8A 3CTTA 3KLKA 3GG1A 5DY3A 1W9DM 3QQWA 1VHNA 4D6HA 1TWSA 1LQAA 1LLWA 4YYFA 4D71A 3H70A 3NVTA 4FIRA 5BMXA 3P62A 1I2OA 5E70A 1K3UA 4QS6A 1UWIA 5EMLA 3AMCA 4Y9NA 2TMDA 4UTUA 5LXEA 3SY5A 2Y8VA 3WJZA 6ENLA 3CL7A 1R3WA 2XPKA 3VPLA 4MJ4A 4CD6A 1PS9A 2P76A 3ITYA 4WIWA 1VR6A 3LBCA 3WMBA 3IGHX 3LHYA 1OX4A 4MFEA 3C2VA 4ZE5A 1PO9A 4E5TA 1PPIA 2GUUA 4B5UA 4I5RA 4K8EA 1D7KA 1EDGA 3B8DA 4DX3A 5HOSA 1T6MA 1OD8A 4O0QA 1AJ0A 4HNLA 1KGUA 1LBFA 5LNRA 3S47A 1Y7VA 2D2GA 5I00A 1V6YA 1TPUA 5FD0A 1XIBA 3BW3A 4GRSA 1KWKA 3GDBA 2PDPA 4B5XA 5HJYA 3CYVA 1VLIA 2V81A 4Z0JA 3GO2A 6CGTA 3O1NA 1A80A 4EACA 3VKKA 1PYFA 4AWTA 5I79A 3L0NA 3FVMA 4E3TA 4KCVA 4RPQA 1RP8A 1Q85A 2YL9A 4IFKA 2VZOA 3NOYA 4DI9A 1LP6A 3S0CA 3KEHA 1DXFA 3TJ4A 4PCNA 1MZRA 1VIWA 2REQA 3R0KA 4JYFA 3SFWA 4EPKA 3GVVA 3U3HA 3FHQA 3UT0A 3K30A 1BYAA 1C7TA 2O0TA 1WOAA 1XLFA 3K46A 4E2BA 1BRLB 2XH0A 5DBUA 4F0HA 3NQ7A 4Y9OA 4D1JA 3UJRA 2C3ZA 1MRQA 3CUHA 4HOWA 2EAWA 4AZGA 4RL3A 4UZSA 4QLLA 4H9TA 3ZS4A 3P6LA 3OQ8A 2W3ZA 3N9KA 4DPQA 4LVFA 1OF8A 2VGGA 5LA0A 1EZ2A 2EO7A 3C2EA 3PJWA 1KXQA 3KVKA 1CXHA 5LYRA 3UXDA 4EE9A 4OFCA 3VOCA 4IF2A 3K13A 2VVNA 3SCNA 4KGLA 3BGJA 3CBWA 2PRMA 4PMDA 5D2VA 2W9MA 3CH0A 2PF0A 2QKFA 4QEEA 2PC8A 3CV6A 3HV9A 4NQ1A 5A6BD 1ITQA 3G1SA 1IR1A 1OCQA 3QOKA 1ADDA 4D8LA 1XINA 1U5VA 1OFDA 3MV01 5DCDA 4NNCA 1VFLA 1H41A 3QV9A 3FLUA 4FALA 3NEHA 4MOZA 1XSKA 2NQHA 3USBA 3QKEA 2NWSA 3M7SA 1E6XM 1UR9A 1HUVA 1ONRA 3O07A 3CWHA 3SUWA 1SW0A 1XLAA 3ELFA 3V75A 3O3RA 2ZX9A 5HUOA 1YW1A 3T9PA 1UUOA 2ZUNA 4MY1A 1KBIA 3VGFA 4CEUC 5DT5A 2VUNA 3WJXA 4MY8A 3ARZA 4A4AA 4UTJA 2VC7A 1NQ6A 1P1MA 2CEQA 2XFWA 5BZAA 1UPPA 4U4MA 3W07A 4AZ7A 2B4GA 4MUPA 4HGXA 1SQ7A 1V77A 1YDVA 3MO4A 4WSHA 1QVBA 3URNA 3R7MA 5D9NA 1NTHA 4QJ3B 1QT1A 1W1ZA 2VQTA 2AMGA 3EGJA 5H91A 3R2GA 5CSRA 1YMYA 4AXNA 4Q7IA 1ECQA 3MBFA 1WDDA 3QSTA 4WSKA 4UC5A 2UBPC 4BWLA 5CG7A 2PDNA 2PP1A 1CLVA 1KFLA 1W54A 1ZP4A 4REQA 1OCJA 4FR6A 5M1TA 3ARSA 3FKKA 3R5EA 1QNPA 2Y63A 4CD4A 4FXSA 3T0AA 3M6YA 4UQDA 4QDWA 5K2ZA 1JULA 4M8UA 1JYWA 3PY2A 4HNOA 3SY1A 2PP0A 4GY1A 4NXSA 2WPGA 3IIOA 1AUSL 4U3CA 4J1OA 3S2MA 2YGYA 7REQA 5C2CA 4TX8A 1E1EA 3RCNA 3WMLA 2XFFA 1O66A 3BAJA 3KHJA 2RJHA 2WMIA 1H61A 3OBEA 4J3WA 1QPOA 4JTSA 4MADA 5JBDA 3VOGA 3BOLA 3QOMA 5FAGA 3UZWA 5EMJA 2IW0A 5A2CA 4JR5A 1BKSA 4ZFMA 1TPFA 3TSBA 1KFKA 1HNYA 1QOPA 1BWKA 4IL2A 3NQ2A 3WK1A 4AZ5A 3I10A 3GR8A 4YJ5A 4YHGA 4JHOA 4GQ0A 3T09A 1AD4A 4A3HA 1OC7A 2R1LA 3VGGA 4PEEA 3IWPA 2PDIA 4X60A 4PEKA 3ICJA 3MB9A 1JFHA 4X22A 4AD5A 2EEXA 3WNKA 4JTDA 3EX3A 4WY0F 2Z26A 1NDVA 3L4WA 3VIKA 5AY7A 1OADA 3SRFA 4Z2IA 1W8SA 3WQVA 1MW0A 4AC7C 3EAUA 2J79A 3BJSA 1FP9A 1VZWA 3BZJA 1PIIA 3PG8A 3QVQA 1O68A 2RDUA 4RXGA 1JDDA 1QNSA 2WWDA 3WNPA 2J7FA 3PANA 1SO6A 4ZQMA 3S9ZA 3WLNA 3IUDA 3WBXA 1BYCA 3FA4A 3S2CA 3ARQA 1OABA 4IJRA 3S5SA 4XSMA 3VE7A 1HJVA 1VKFA 2G97A 4MZ1A 3QFEA 3E2VA 3DOPA 4XX6A