5EPDA

Crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
361
structure length
348
Chain Sequence
TLFQPTSLGAITLANRIVMAPLTRNRAGAGFVPGELTAGYYAQRASAGLIISEATQISQQGQGYQDTPGIYTQAQIDGWKKVTAAVHKKGGRIVLQLWHVGRISHVNLQPNGGAPVAPSAIRAEVKTFVNNGFVDVSEPRALELEELAGIVDDFRKAAANSIEAGFDGVEVHGANGYLLEQFAKDGANMRTDTYGGSVENRARLMLEVTAAVAQEIGPERTGIRISPVSPANGISCSDPQTQYDYIVDKLDALGIAYIHVVEPFDYGSLRRRFSRTYIANDLELATSHLADGRADLIAFGRPFIANPDLVERLQSGAPLAEVNAAKIFGGSAAGYTDYPRFSETTSDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidorecctase
molecule keywords Glycerol trinitrate reductase
publication title The crystal structure of XdpB, the bacterial old yellow enzyme, in an FMN-free form.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 125
structure length 348
sequence length 361
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5epdA00
5KZDA 1W31A 5KSWA 2ZA3A 4UFHA 5F4SA 1KLZA 1TPDA 3LDVA 2DZWA 4O57A 2CLLA 4HNNA 1TJPA 3L67A 3GK0A 4O1DA 3UWUA 1TTPA 5AHLA 3L65A 3CEUA 5CPLA 2E68A 4FNPA 4QITA 1LBMA 5K9XA 3W1UA 2YZRA 3UZJA 3NQ6A 4AWTA 1GTHA 3TNOA 3TKFA 4TR9A 1F5ZA 1QO2A 4Z1BA 4XBSA 5KMYA 1YTKA 3C2FA 3M5VA 4JIPA 4NXSA 3GB6A 2XN0A 3ABRA 5I3GA 5K4XA 3IIXA 3TAOA 3W7GA 1RQEA 4ZVJA 3TQKA 2NXHA 1IIGA 4A2RA 4RZ4A 4XZ9A 3MP3A 2ZZ4A 1AW1A 1LLWA 4MYXA 4KFNA 3NL5A 1OVDA 4TMCA 4QM1A 4IPJA 4PEKA 2CLIA 1KV8A 3INPA 3LXBA 2VFDA 4IMEA 1JQXA 1ZAIA 1M6JA 4UTUA 3RU6A 5HQEA 1G4PA 2QAFA 3G1FA 4A3UA 4IMFA 1MZHA 4O10A 4GUGA 3ABOA 3DFSA 4QQ3A 1IXNA 1FBAA 2P1FA 1LCOA 3EKLA 2VC6A 1XC4A 4O54A 1F7BA 3EXTA 2CLKA 3PB0A 4LU0A 5U4NA 5CKSA 2BX7A 3ZFHA 3CLMA 3S42A 1R2RA 4M7TA 4JYFA 1QOQA 4OHQA 3A5FA 3T55A 4JDYA 3Q94A 3LOTA 5F2IA 4UUIA 1NSJA 3C2EA 5EBUA 5F4XA 1VR6A 3PWAA 3JR2A 4FEZA 2GJLA 1GVRA 1I2OA 4ONVA 4NJKA 2QCNA 1WV2A 3BW3A 3LCFA 4UFIA 2QCDA 2PURA 1I45A 3KFTA 3M16A 1K7FA 3W1TA 2JKEA 3BW4A 5DY2A 4Q4KA 3EWYA 2X16A 2Y62A 2ZZ3A 1EX5A 2RDUA 4O0ZA 3B06A 2J24A 1N55A 1SU5A 4S2BA 5K9CA 1K8ZA 4TMBA 5D04C 3NEVA 3A22A 5TQLA 3EX4A 1J5TA 4UIOA 4MZ1A 2Z1BA 3RFAA 5D32A 3W22A 4R7JA 3TUUA 1YPIA 4IJBA 3IIZA 4LVDA 4N6FA 4AMAA 4HKPA 4E0CA 5AB3A 4ML9A 2G96A 2CLMA 2DZVA 3P84A 4JYDA 1XCFA 3FJLA 1X8FA 1A53A 5LNRA 3CC1A 5LGXA 2NUYA 3NPWA 5F2LA 4WX2A 4JTIA 1NEYA 4UTMA 3SECA 2B7PA 1CI1A 1SSDA 4TU1A 2O7SA 2YGYA 1RZMA 3IIOA 3QC3A 3W85A 3DENA 4LUIA 3W70A 4O14A 3NQ8A 2JGYA 1HL2A 3STFA 1GVOA 2FFCA 1W3TA 2TYSA 1TV5A 1ICQA 3MI6A 3DBPA 2V9DA 2WJZA 3OVQA 4QNEA 4LS2A 4UR8A 4XQ6A 3TJLA 1JUKA 4O4WA 1MXSA 4Q33A 2NX1A 1HFBA 3S0CA 1GPWA 4FNUA 1LZOA 3NQCA 3K30A 2QUUA 1UUMA 2ZTJA 5D37A 3BG3A 2E5DA 3TROA 1YADA 4CCCA 2Z6IA 2OT0A 1WX0A 3C52A 1H5YA 3E9AA 1YDOA 3USBA 4UTTA 2ABBA 1H1ZA 4K36A 1JUEA 3P62A 2QJHA 3W7CA 1SZGA 3LI1A 2CW6A 4G1KA 5EPDA 2Y7FA 3S5ZA 3MP4A 1YYAA 3W1AA 4DPQA 1H50A 2VXNA 3RK8A 3MBDA 3TXZA 3EWBX 4Z1CA 1XUUA 3BG9A 3FYOA 1D9EA 2DZPA 4DF0A 1K03A 1LM1A 1G4TA 2ATMA 2HS6A 3LBCA 5DY3A 4TX9A 1PE1A 4MY1A 1DVJA 2C15A 1F6KA 1YXDA 2FPTA 1TQXA 2Y6ZA 1R2TA 3MYPA 2FLIA 1RD5A 1H63A 5CZJA 3GKFA 4ZQPA 5G2HA 5CGQA 3QJAA 1FWWA 4I9AA 1SZNA 1QR7A 1W5QA 3P8IA 3C0JA 3MI3A 2NV2A 1K7XA 5G2IA 5H91A 2OMAA 2EGZA 1TPFA 4AHOA 4E38A 1GVSA 2EPHA 1I2QA 1I8JA 3W2NA 5TBOA 3HGJA 1O4UA 3CQ0A 2QJIA 2C0AA 1OFBA 3I7RA 2VKZG 2C14A 3NQ2A 4IMCA 3BO9A 2DJXA 4LRTA 2Y61A 3UPWA 3MUXA 1W54A 3NOEA 1XL9A 2C13A 4OV4A 4Y9AA 3U8GA 4O1AA 3DU0A 3IVSA 2V5BA 3WK3A 2QR6A 3LHZA 1VYSX 4HN4A 1FCBA 3C4UA 3AO0A 1VHNA 1W5OA 3EX6A 2JK2A 3L5LA 1H7RA 2C16A 2OJPA 3NGJA 4LS1A 2CZFA 2P0OA 1YDVA 2YDAA 1R47A 3B05A 2A21A 1HO4A 2D73A 4NJIA 5HMSA 5G2WA 3KOFA 4CCDA 4JTJA 4NJHA 1QMLA 1SR9A 2QCMA 1SZEA 3L0NA 3IGXA 3L68A 4RK8A 2JBMA 1Q6QA 5E1QA 1EP1A 3ZS4A 1FWNA 3GAKA 1QDSA 1UCWA 3RLVA 4QNWA 1DJNA 1MEWA 4HSOA 2FB2A 4EOUA 2QJGA 3EEGA 4WZHA 3WJYA 4BF9A 3QEZA 1OF6A 3VI2A 4WXZA 4O1CA 2ABAA 4ZQOA 4JICA 1KLYA 1SO4A 1L6WA 1LLZA 1XKYA 4I7VA 3TFCA 4YWIA 3U6WA 1H61A 4UFLA 4LC6A 3A24A 3EX3A 2A85A 5IBXC 3L21A 2EHHA 3G1XA 1H7PA 4A21A 3TC7A 4FX6M 4CQ8A 3HG5A 1TV7A 3PR2A 1JVNA 1PL9A 1JUBA 4NX0A 1ME8A 3GXNA 3NL3A 4K38A 2VEKA 1Q6OA 4EIVA 1ZAHA 3F03K 3O16A 5AHMA 3NQEA 4IMDA 1S5VA 3BLFA 3W1LA 1YXCA 1UASA 3CB8A 4UTWC 2GVGA 3QZEA 3HBLA 2Y63A 1F2JA 3QW3A 4JY9A 5GVJA 1HO1A 1GTEA 4H3DA 2Y70A 1CW2A 2V5LA 1T99A 1TPB1 4HPJA 3NPUA 4X22A 1WXJA 3LHTA 2A7NA 3TSDA 3HB9A 5HR7A 5C55A 4HSNA 3EWZA 2CWNA 1H51A 1T96A 3R8RA 4LNYA 3N19B 3S1UA 3O8AA 2QUVA 1D3GA 5FF3A 5LZLA 3SY5A 1QO5A 1OJXA 3FS2A 3SIZA 3I7QA 5C5YA 1XBZA 1ZY9A 4JX6A 3A5VA 5DN1A 1LOQA 4Y96A 3G0SA 3LRLA 4U28A 4AHQA 3HPZA 2DZUA 3BW2A 4R34A 1EPXA 4MY9A 3TW6A 3TCEA 4WOZA 3GDLA 3SJ3A 4WY0A 1SSGA 2O7QA 5BW6A 3G8RA 3UWZA 5F4WA 3WK1A 2ZRVA 3QFEA 1QWGA 2FIQA 1WQ5A 3SZ8A 2CZDA 4XTIA 2R8WA 3P74A 5HR6A 3PAJA 1IF2A 1M7OA 4LV9A 2BWGA 3LLFA 5CPNA 3P8JA 2X1TA 3O15A 1Q45A 4QIUA 2HTMA 2I9EA 3FEMA 4RZ6A 1L9WA 1K8XA 2J9YA 1I2NA 3FKRA 4AWUA 3TX9A 1KM4A 4FNQA 5AYXA 5F1VA 2X1RA 2WSQA 1TJRA 2V82A 3PB2A 3STCA 3I68A 4D2JA 4JTUA 1XBXA 4PL2A 3LHYA 4GUFA 3S5OA 4DF2A 3R13A 1G67A 4WJEA 3MYOA 4LS0A 4N4PA 2YYTA 2AGKA 3LHVA 3TC6A 2XN1A 4M7SA 5I3HA 5KTLA 3O6DA 4TIMA 1KTNA 2CZ5A 3W1MA 5C2XA 1ZHAA 1F05A 3UD6A 3ANYA 3W87A 1ML1A 1A50A 2QCFA 1VLIA 3LHWA 4O18A 3EX1A 3DH7A 5A5WA 2H8XA 3KAOA 3HOJA 3STGA 3W3OA 4Y6GA 5D03A 3S5YA 5SWUA 1O60A 1OHLA 2R94A 2V2DA 1FWSA 3G24A 2YYUA 4BI5A 4EF8A 4CNPA 4M5PA 2E5CA 3U2OA 1TCDA 3CHVA 4LRSA 2VENA 1BWKA 1TIMA 4LY8A 4CQAA 3VKJA 1TPWA 4K7VA 1FWTA 4WUIA 4WQ6A 3G1HA 1JCXA 3HGOA 1GG1A 2TRSA 3B8DA 4Y90A 3UXDA 4GC4A 3UWWA 3G1AA 1I2PA 3TSMA 4ZZ9A 4DEFA 3L66A 2W6RA 4GXMA 3NQFA 5LKYA 1SO3A 1GVQA 5CSSA 4IMGA 2NXIA 4WY0B 2VFHA 5LSMA 3OA3A 4BI7A 1VC4A 4GUHA 3CM4A 1THFD 3S9YA 2ZZ7A 4EWND 3PS7A 4UTIA 2BSLA 6ALDA 1RVGA 4N9EA 1LBLA 2TPSA 2VFGA 2DU2A 3LV5A 1G4SA 1NFBA 4MY8A 4O12A 5H2ZA 1LRNA 4FNSA 5F1UA 3C8FA 2ZBTA 1SFJA 5DCEA 5AN7A 1FX6A 3HG3A 3TQ0A 2H90A 3QW4B 3HMJG 2GOUA 3HG2A 4O4VA 4JNMA 1JQVA 4ZMGA 3R5EA 5BRBA 1E51A 4CQ9A 2CLFA 5TIMA 4JTGA 5L9FA 4LVBA 2ZCGA 3GAYA 1HG3A 1ME7A 2KZHA 4RKAA 3IIPA 2Y89A 3N34A 4DXVA 4UR7A 4NXKA 3W07A 3NM3A 2WNZA 3W73A 1KFJA 1G4EA 4AHPA 3TR2A 2VEPA 1C29A 3BG5A 1JRCA 5KZEA 1EIXA 1JCNA 1VCGA 1DKWA 3QPYA 1TO3A 3QMTA 5L6UA 4GUJA 4BI6A 5HNRA 1DORA 2ZRZA 2QDHA 2A2IA 3N2XA 3P60A 3SR7A 3WK2A 1ZAJA 4ORIA 3S5NA 2V8ZA 2VFEA 3W83A 4LTSA 3NQMA 4KWWA 2E6YA 3THAA 4JDBA 3PY2A 5LHEA 5ABTA 4ADSA 4KWVA 1PCWA 3NPVA 2V30A 3I65A 3TDFA 2VOMA 4A22A 2GJNA 1ICSA 3O63A 5D38A 1OFOA 1GVFA 3KVMA 3GIYA 1FCQA 3L5AA 3DKJA 1IXPA 2QAPA 4O53A 4OBTA 4CNOA 4O0KA 5IM51 2ZTKA 4FXRA 3ABQA 2PE4A 4B5NA 4P2VA 1QPRA 4X2RA 5D2TA 5LHFA 3W7DA 2H3DA 2HS8A 3N9SA 1SUXA 4IOTA 2CZEA 3E12A 2V81A 2Y7EA 1R30A 1GEQA 1FCVA 1B3OA 2BXVA 1OYAA 3DHFA 3IRDA 4JTKA 3OG3A 4MOZA 1EA0A 5G1YA 1N8FA 1OK4A 3HPSA 3LM7A 2YW4A 1J2WA 1T0OA 2A1YA 2V2CA 1OX5A 4O19A 3W7LA 3TW7A 4W9TA 1EWDA 2ZYFA 3UWYA 5AFDA 1SFLA 3LTPA 1K8YA 2OT1A 3LRMA 1P4CA 2A7PA 1FCUA 4KFOA 2E6FA 1LRQA 1YXYA 3W2KA 7TIMA 1A5BA 3NM1A 1RR2A 4FX8A 1W8SA 3O1NA 2CU0A 4WY0F 2TMDA 1DQWA 4UMBA 3PUOA 1B4EA 3QMRA 3S6DA 5BNKA 3CEPA 1OFEA 4ADUA 2VELA 3WFAA 2BLEA 2NWRA 4WXYA 3TJXA 5LNSA 1V7YA 4N4QA 5FF0A 1YPFA 1MSSA 4AH7A 1OG0A 1XM3A 2R91A 5FEPA 3PF3A 3W7QA 3ELFA 3HQ1A 1KM3A 3DFPA 1XFBA 1DQXA 3E0IA 5G5IA 1RV8A 3RF9A 4O15A 4UMCA 4MUZA 5CZ0A 5C6MA 1VRDA 3P5ZA 2UV8G 4YXGA 5MHBA 2DZXA 5AHIA 4PFMA 1VGAA 4AVFA 1S3HA 4NJGA 4YMZA 2Y7DA 5FEZA 2NUWA 4OV9A 3V1PA 1JCMP 4ZQRA 3F4WA 1PS9A 1KW1A 5HULA 2QCGA 4IWWA 1NVMA 2EAWA 3LGEA 4ORMA 4YCOA 3PG8A 1PIIA 1VPXA 1XBYA 3SSJA 3THQA 3W2LA 2QKFA 1IXQA 3FLUA 2CLOA 1HUVA 1B57A 3HIJA 2GVJA 4RCXA 1Y0EA 4JGDA 3EWWA 3M1ZA 3W71A 4PA8A 3GNNA 3N2MA 1Z42A 3PUDA 3CU2A 4HIBA 3BGGA 2GVLA 4O8RA 4TO8A 4PCFA 5EA9A 4HNTA 1FWRA 2VFIA 3AJXA 4AF0A 3E49A 4Z1DA 1TPH1 1P0NA 4FIQA 4QSHA 5HWMA 3LTYA 2RDWA 5E0KA 4E2BA 1KTBA 2VEMA 5DXYA 3MMTA 4U4MA 4UTLA 5D05A 4PL1A 3EX2A 4MFEA 5CPMA 2XFWA 1P5BA 1DOSA 3GVGA 1QOPA 2Q8ZA 5DBTA 3OVPA 3W7HA 3KRUA 2RKXA 4FO4A 4UNLA 3UWQA 1IXOA 1QNVA 4UTJA 1TTIA 4IX2A 3KX6A 5AC7A 4NJJA 3NPXA 3L9CA 2WNQA 1OFQA 2NLIA 4UFJA 2DP3A 3CTLA 4NUWA 1U5JA 1ZNNA 1Q6LA 3SGUA 3W7EA 4L4MA 1W1ZA 3B0UX 2WOQA 2CLEA 4YCPA 2C19A 1M5WA 3L2IA 1JCJA 3BGJA 1LOSA 3WJWA 3W2UA 3LXAA 3DZ1A 1VQTA 5KITA 1ZJIA 5IBXA 2QEZA 4LV4A 3F1QA 1BEUA 4FB7A 1OX4A 1FQ0A 3DKLA 3TV8A 1F76A 4RXFA 5CZSA 3ABSA 4R53A 1W5MA 3M41A 3VE9A 4N6EA 4O16A 5AHEA 1QPQA 1UBSA 2Z2UA 1TTQA 3IIVA 4BWLC 3BLIA 1OK6A 3SFKA 3GYEA 5FF7A 3MI2A 5AHNA 1ONRA 4UTWA 1T8XA 1K7EA 1SO5A 5A8GA 3Q37A 3FOKA 3HGSA 1Z44A 3PUEA 3CWNA 4MKNA 1KBIA 1TB3A 3O6YX 4H4IA 1S5WA 2RH9A 3B04A 3H54A 3NZ1A 2FTPA 3DFOA 3W75A 1TPUA 2J9XA 3DXIA 1VCVA 2GUUA 4O28A 4QISA 2ALDA 1LBFA 4AF0B 3MW7A 1Z41A 4YL2A 2ZZ1A 3MJYA 1MEHA 1SW3A 1FXQA 1O95A 3LLDA 4N9DA 1UJPA 3CIXA 4IQLA 3UQNA 4QJ1A 1W5NA 3NQDA 2GQAA 4LT9A 4JXCA 1GG0A 3FKKA 4FHAA 4DBEA 1DHPA 2VFFA 4CCEA 3IVUA 5LNUA 2A4AA 3DHDA 3NQGA 4NU7A 4OE7A 1VZWA 2C6QA 3N9RA 4BFAA 3ATYA 3B4UA 3LCLA 1VYRA 2RFGA 3TIMA 4OT7A 5K7JA 4QAIA 2Z0IA 4CNNA 1TTJA 3KXQA 2QCHA 4MIMA 3GNDA 2LLEA 1LRTA 1TRIA 1VJIA 3DGRA 4NNCA 3H53A 3EWXA 3UZ5A 5LNVA 3HJZA 4IXHA 3G18A 1FDJA 3NA8A 3GR7A 5FEWA 1KA9F 3W84A 3NVTA 4LWWA 1GWJA 3LCIA 1NF7A 4JEQA 5DBUA 3D0CA 2TSYA 3W1QA 3NR0A 4EF9A 3TH6A 4ZQNA 2PRHA 3S1VA 2FJKA 1OX4B 3T4CA 2B7QA 3WJZA 4XWUA 3GDTA 5D33A 4HNUA 3KRSA 4KKXA 1L6YA 3QF0A 4PTNA 2FPVA 2PC4A 5AC6A 3P5YA 2OX1A 3GDRA 4JN6A 4X3ZA 2W79A 1LOLA 3W6YA 3EKZA 1PCKA 3P80A 3IVTA 4IGHA 1TPVA 2F7FA 2QF7A 4UTHA 1KV5A 3LB0A 1W56A 3PSVA 3QSTA 4RXGA 3GXTA 1BKSA 1YLVA 3BK0A 2GPTA 5I3FA 4FIRA 5LGZA 4JYEA 2Z6JA 3DI0A 1LORA 3A21A 1H7NA 4Z0JA 4JS3A 1F73A 1R46A 1TMHA 4JY8A 5CPOA 3RNDA 1TYGA 2Q8LA 2C1HA 5DXXA 1W5PA 1GZGA 1H7WA 4JTHA 4UMAA 3MWAA 3NNTA 2ZFAA 1DV7A 2X2GA 2BTMA 3R2GA 2DZSA 2QUTA 4DO4A 3OBKA 2RDTA 3LXCA 2FPYA 5DCBA 6TIMA 4K7YA 2P10A 2YPIA 3PC0A 4Z0SA 1KTCA 3TMQA 4UNKA 3QMSA 4P61A 3WJSA 1W3IA 3H55A 1W3NA 3PBUA 1VLWA 2ZQ0A 4JTEA 5HUOA 4H6KA 3I6RA 4A29A 1XDLA 1U83A 1GJPA 2Y85A 4AWSA 4MZ8A 1SZFA 1KM6A 5G4EA 2WQPA 4BR1A 2WKJA 4C1LA 5EMUA 1M7PA 3NQAA 1XI3A 5E93A 3GDMA 3P67A 3FIGA 3RMJA 3IGSA 3O6CA 4N2YA 1UB3A 1HTIA 1JRBA 4ZQCA 5HWJA 1W0MA 3W88A 3VCRA 4LOCA 3EB2A 1QCWA 3CWOX 2FQIA 3DAQA 3GLCA 5AC8A 3UXAA 2F84A 5T26A 3W7JA 3W1PA 1G7VA 2B0MA 5HINA 1TRDA 2PCQA 3W74A 1DBTA 3GR8A 4JTTA 3MP5A 4KFPA 1ZENA 4Q32A 4DPPA 1H1YA 3LCGA 3PM6A 2VEIA 1SPQA 1F6PA 3B03A 3G1DA 1ZFJA 4NQ1A 1FDYA 3C61A 4ZQMA 4FF7A 4RR4A 3QH2A 4HNVA 1P1XA 2JKPA 1JULA 2C3ZA 1OFPA 3TU9A 3W72A 1EUAA 4HHPA 3QQ1A 3G22A 4HPXA 3QQ0A 3C3NA 5J5DA 2ZZ5A 2QCCA 2JKAA 1KFLA 1RQBA 1YTEA 2QCEA 1VCFA 1JJKA 4GRSA 4GBUA 2CLHA 3ZWTA 3W76A 2QDGA 3W1NA 2YSWA 2ZA1A 3O07A 3STEA 1OYBA 3HGRA 5K4ZA 2ISSA 3BPWA 4FXSA 1TQJA 3SGZA 5J5RA 4I7UA 3CPRA 1S5TA 4MFDA 5EY5A 4AB4A 5EL1A 5U7SA 4A2SA 3M6YA 1GYNA 2EKCA 4IUOA 3VE7A 3L5MA 2ISWA 1AK5A 1X7FA 3PSWA 1DJQA 1GYLA 4O13A 2A6LA 3IEBA 1I4NA 3GKAA 4M6QA 1B9BA 3FJ6A 2ISVA 1X1ZA 2X1UA 5I3JA 1Q6RA 1KM5A 4M19A 5D2XA 1WDWA 1K3UA 3T40A 1H60A 3TXVA 2NV1A 2A6NA 2XN2A 3T78A 3C2RA 2WPBA 3E02A 1KFEA 5HWNA 4I7WA 2Y7GA 5CZTA 4BK9A 3C2VA 4LVAA 1LYXA 2I1OA 4ICNA 5C54A 1EUNA 4M6PA 1ADOA 3S1XA 3JRKA 4S2CA 3UY7A 3Q58A 3OEXA 1FXPA 4MZYA 1L2UA 1YTDA 3G1YA 4NT0A 3W1XA 2GQ8A 2DORA 2WV8A 5DLCA 2I14A 5FESA 4AAJA 5D2YA 1WOBA 1O5XA 1ZALA 1F74A 3IGUA 1SW7A 3M5XA 5FF2A 1KM2A 3HO8A 3ZWSA 3OHIA 2X30A 4UFKA 4JX5A 3W2MA 1JCLA 2WO5A 1RQHA 3E96A 3FFSA 4S1FA 5BMXA 5AYYA 3LCHA 4Z1AA 5CG7A 1EEPA 4Y8FA 3C6CA 3W7OA 3W7IA 1R2SA 1FUYA 3NO5A 1SO6A 1JCYA 4MYAA 1AL8A 1GQNA 1OYCA 2V0TA 4O50A 4DF1A 3M7WA 4E2DA 4LC8A 2IQTA 5K3VA 2WSRA 3P7YA 2YR1A 2NUXA 2ZZ2A 2R14A 3G8EA 4O17A 4HT3A 5DELA 1KBJA 1OFRA 4FNRA 1EP3A 1P0KA 5DCDA 5AOUA 2J6XA 5D2WA 4GUIA 4IX0A 1KFCA 2ZRUA 1AW2A 3I7SA 1K02A 5D30A 1NF0A 4M6VA 4EVZA 3NG3A 2Y88A 4UFMA 2B7NA 4K39A 1MEIA 1GT8A 3V75A 1LDCA 2Q3RA 4OQVA 5D02A 1AL7A 2E5BA 3R89A 3UPBA 3T7VA 4JR5A 1O94A 4RZ5A 2E6DA 4XBKA 4MLRA 4WOQA 5EYWA 3EXRA 4K6AA 1WAUA 4UTTC 2ZRXA 2PRMA 3TAKA 2QCDB 1NAL1 3NDOA 1AG1O 2GQ9A 3TQVA 3HF3A 1DL3A 1JR1A 2FB3A 3UY8A 4C1KA 3TMLA 1O5KA 4O11A 5HJLA 3NL2A 1WYIA 3OIXA 2J9ZA 4AXKA 3NXFA 1TPC1 1PHWA 5LNWA 4YLWA 1C9DA 1LROA 1WBJA 2A7RA 5F2MA 3NL6A 4MJZA 1VH7A 4MLJA 1KM0A 1BTMA 2E77A 3BVJA 2J88A 4R33A 5D2VA 3TE9A 1EWEA 4JTFA 3M47A 4GJ1A 1H62A 1ZCOA 3PULA 3DFQA 4LUJA 4UTKA 4X9SA 2ZA2A 3W23A 3FYPA 4UXDA 3GX9A 4Z08A 3L0GA 3TA6A 3DI1A 4K8HA 3A23A 4GFSA 3ZR4A 1PHQA 2ATSA 1QAPA 5F2GA 3N73A 4J9JA 5KINA 1ICPA 3KHJA 3MBFA 1QPNA 1IIHA 1XUZA 3G1SA 3G0UA 2QCLA 3GDKA 3NAVA 2HMCA 4JTSA 3BV4A 4FX7A 1AW5A 1SQ7A 2BZNA 3UWVA 5BOOA 4DO5A 4K37A 1I2RA 4ZL1A 4XTDA 1WOAA 4NNAA 2DZTA 3KRZA 5FF4A 1TREA 3HPXA 4OGZA 4N9CA 5BMWA 1A5AA 4LW7A 1ME9A 2AQWA 3KVLA 1PV8A 4BWLA 1YDNA 3G3MA 3M44A 3TSBA 3M43A 4NZFA 1OFDA 1LTDA 3W9ZA 4XKYA 3TFXA 4UC5A 4L4LA 3LCWA 3BLEA 3M0ZA 4DELA 1OX6A 3B0VC 4MVAA 2YX0A 1J4EA 3W86A 3W1RA 3M5YA 1B4KA 1X1OA 8TIMA 3IV3A 2ZRYA 3OVRA 3MHUA 1CX9A 4N02A 2H3BA 4LVGA 3PVFA 3G3DA 4JTLA 4LVFA 3W7NA 1EP2A 3WK0A 4GWEA 4NVTA 5AHFA 4IXXA 2B4GA 5AYZA 1SW0A 3UNDA 3VFLA 2ZRWA 2NZLA 3QSRA 3M5ZA 4IPIA 3N3MA 4RX0A 3A9IA 3WJXA 5I3IA 3RLUA 3LERA 1TPEA 3UYCA 1VYPX 3QYQA 3LX9A 3W7RA 4DO6A 5FEXA 1VS1A 3L0KA 3O05A 3SI9A 3KVJA 3PBWA 4NZJA 3G1VA 1X6UA 3LRKA 3QPZA 4ALDA 3NQVA 1LP6A 1KM1A 3EWUA 3MHFA 1Q3NA 2HSAA 3VNDA 1GOXA 2NX3A 1H7XA 4RLIA 2X1SA 1WA3A 1N7KA 4WD0A 2NWSA 3W7KA 4DBDA 1D3HA 5FI8A 3JS3A 1KFBA 2RHGA 2V2HA 4AEOA 3T44A 3LTSA 4K8EA 1XBVA 3GXPA 1L6SA 4NNBA 5I3KA 3F4NA 5G1TA 3PG9A 2G97A 1MO0A 3GZ3A 2ZZ6A 2Q3OA 4GE8A 2NXGA 3N14A 1XXXA 4JX4A 5G4WA 3S1WA 4OU1A 3P82A 5HUPA 3P61A 4XUGA 1RPXA 5EKYA 5K9DA 1QFEA 3BARA 2J27A 3QRHA 3W7MA 3TK7A 4MPQA 3C56A 4O52A 3NZRA 2E09A 3W7PA 3DFTA 2PRLA 2ZDRA 3NYZA 2E1DA 5KZMA 2OCZA 1OFAA 4OWGA 4PC8A 4JIQA 2G5WA 1XDMA 2WSYA 1Z48A 2A0NA 2E6AA 2A5HA 2FDSA 4XKYB 2W0UA 2JGQA 2AAMA 1EB3A 1KFKA 1V5XA 1A5SA 1IGSA 4JD4A 5CSRA 3MO7A 3R12A 4GNJA 1H7OA 1ALDA 2EF9A 3LV6A 3W2JA 3QM3A 2YFNA 3DFNA 2CFFA 1A5CA 1QPOA 1TV8A 3SW6A 3P81A 2OZ0A 3EXSA 4N9BA 4FNTA 2H8ZA 1W37A 5D09A 4PH6A 3PBVA 3G0XA 3O06A 1WBHA 4O1BA 3C2OA 3KVKA 1G69A 2YFOA 5K2ZA 4CLMA 4RV8A 2DJLA 1C8VA 2G95A 3B0PA 2H6RA 3FA5A 4NX5A 2YCEA 3S8HA 2NX9A 1UUOA 4UCGA 1G6CA 1FDZA 1VHCA 2WNNA 3LCXA 3Q2DA 4DQWA 3CT7A 3PBYA 3YPIA 3ATZA 4POCA 3LI0A 4ADTA 4MJMA 1BWLA 1PVNA 3HG4A 3LHUA 4RJEA 3M9YA 1TSIA 3MHGA 1OF8A 4PODA 1G7UA 2C18A 3LBMA 1OABA 2B7OA 2YXGA 1AMKA 1FY6A 2YW3A 3CIWA 3NQ7A
chains in the Genus database with same CATH superfamily
5KSWA 3REQB 1PIFA 3LDVA 1AVAA 1XIGA 3H23A 4H8UA 3GC2A 4L1GA 4O1DA 3UWUA 3L65A 3WF3A 4CUCA 4QITA 3F5JA 4FLQA 4NYUA 3NQ6A 1OCQA 1AMYA 4U31A 3IPWA 4D8AA 4UB9A 4WDTA 1QO2A 4QLLA 3VXGA 2AMGA 8XIAA 2XN0A 3CL6A 3F4CA 2DIEA 2ZXDA 3RM9A 3K5XA 3IIXA 3W7GA 3GTNA 3K4AA 4ZVJA 3DC8A 5T9BG 2CBIA 3MP3A 2ZZ4A 3N6QA 1GORA 4KFNA 4I8DA 3CAVA 1Z7AA 4IPJA 3RCYA 1RCOB 2CLIA 1DJYA 1KV8A 4QEEA 4LAKA 4IMEA 1M6JA 3V3WA 3RU6A 4UTUA 2QAFA 3GG0A 1XSJA 1HNYA 3BAIA 4GUGA 4QQ3A 3DFSA 1FBAA 4DI9A 2O55A 1GONA 2OSWA 4A8LA 1F7BA 4AISA 4GNVA 4W7VA 4XBJA 3EXTA 3PB0A 5C9UA 1H09A 3ZFHA 3CLMA 4IIGA 1OG6A 3T55A 4JDYA 1H11A 2QYGA 5C2GA 2IS7A 3WD3A 3AUJA 3C2EA 5EBUA 5F4XA 1VR6A 4FEZA 1E73M 2GJLA 3MUY1 1BF2A 3EMQA 4GH3A 1XPGA 2VDGA 3LCFA 4MJ4A 2PURA 1QNPA 4Q4OA 3M16A 1K7FA 3AU2A 2DZBA 3TN5A 3BW4A 4ICCX 4GZIA 1ZP3A 2Y62A 2ZZ3A 1EX5A 1CT5A 2BHUA 1SU5A 4F0RA 4OKDA 4LCRA 4HZMA 5D04C 1EF3A 3EX4A 4D72A 1NWSA 1P48A 1XFCA 4DO7A 1XS2A 1YPIA 1QHPA 3IIZA 4LVDA 3QPEA 4J3ZA 1UR3M 2QZRA 3SFWA 5AB3A 2PB1A 1S2TA 5BYWA 2EKGA 4JYDA 5GNZA 4MTVA 3CC1A 5LGXA 3PZTA 1CWYA 4JTIA 4EX4A 1L6FA 3RPDA 4OUEA 1RZMA 1TVLA 4LUIA 2JEPA 2PLCA 4XZHA 1UWQA 3UXIA 1J8VA 1Q6EA 3ITLA 1TV5A 2ZXQA 3PJWA 4XAGA 4C6EA 2V9DA 1KQZA 1PWLA 1XD0A 3SCSA 1J18A 3TJLA 1YDYA 1BLIA 5FIPA 4O4WA 3S0CA 1IWBA 1JI1A 3K30A 1W91A 4P8UA 2XIJA 1UUMA 3SCOA 3TROA 4PGLA 1RHCA 4PUKA 1HJUA 1WX0A 1JFHA 3E9AA 1H5VA 2G3JA 3TTEA 4K36A 3WDRA 2QJHA 5BRPA 4YHGA 4G1KA 1A5NC 3VYLA 3S5ZA 3MP4A 2GUBA 3WQGA 4DPQA 1A3WA 3EEZA 1PKLA 3EWBX 2HISA 3BG9A 4TVDA 2QMJA 3B8WA 4H2HA 1G4TA 5ABHA 1WB0A 4YYFA 1R3VA 5DY3A 4P7QA 4C60A 2HNHA 3HFTA 3MMWA 4NYYA 3VDHA 4KIRA 3GH5A 1YE4A 5G2HA 4I3GA 1ZSXA 4FOUA 2AMXA 4I9AA 4CU8A 1SZNA 3CIVA 3P8IA 1W5QA 2NV2A 3L2LA 4UZSA 5CXPA 4CU6A 4ZB5A 2EGZA 1I0DA 1NWUA 4YIWA 3V16A 4PBGA 4S23A 4RW3A 4Q4RA 1I2QA 1GZJA 3CQ0A 2VKZG 4IMCA 4I6KA 2QJJA 2DJXA 4I8YA 1P0BA 3URAA 3NOEA 1XL9A 2QV4A 4R27A 5HPOA 3BAKA 3U8GA 3VZZA 3C0QA 4V15A 4HN4A 1FCBA 1AODA 4K1GA 3C4UA 3AO0A 3E2RA 1W5OA 2PDCA 3EX6A 3BCFA 4GISA 2I56A 4E3VA 2QF8A 2OB3A 1XGEA 1XH1A 1Y5VA 1CLVA 3L0NA 3IGXA 3ARWA 3TQPA 5AY7A 2JBMA 1MUMA 2DW6A 1FWNA 4WLCA 1TZ9A 2GGEA 4DXXA 4QNWA 5M3WA 1OD8A 2GGHA 4EOUA 2QJGA 2R82A 5IDZA 2WSKA 3EEGA 1CLXA 1MW2A 4IIFA 3WJYA 4YTRA 3QEZA 4F9DA 2WMHA 4O1CA 1XKYA 4UFLA 3LGGA 4W8LA 4A3YA 3FA3A 1UPPA 1H7PA 3G1XA 3P93A 4FX6M 4B5UA 3PR2A 4KRZA 3CH0A 3GXNA 3COTA 4EIVA 1JPMA 3SCWA 3NQEA 3ZO9A 3W1LA 2WPGA 1J96A 3T09A 1ZP4A 3QW3A 4JY9A 5HNNA 1HO1A 5BU6A 4L4PA 5EFDA 4AD4A 3BZJA 4H3DA 1EEXA 1X38A 5BXSA 2V5LA 1T99A 1TPB1 4S3EA 2E9MA 2ZC1A 4LALA 3LHTA 4J4KA 2A7NA 3BMVA 3VIMA 5C55A 1KR1A 2CWNA 1H51A 5H6HA 4LNYA 3N19B 3VA8A 1DWJM 1XSKA 5FF3A 3SIZA 3SUSA 4JX6A 3CV7A 1LOQA 4Y9NA 1BQGA 1Q2RA 3IJ7A 3LRLA 4NY2A 4AZ6A 4R34A 1EPXA 3VZXA 1R6WA 4HPGA 1ADDA 2HPMA 2VCBA 2QT3A 1SSGA 2O7QA 5BW6A 2F6KA 1C93A 3G8RA 3ECQA 3ICJA 3BUVA 3QFEA 1AQHA 3SZ8A 3LY0A 3P74A 4QFUA 3HQOA 4AZBA 1PTDA 4TUFA 2WLYA 3O15A 4QIUA 2HTMA 2E4TA 9XIAA 3RITA 4AWUA 2PP3A 5AYXA 1D8CA 5F1VA 1JGMA 3MDUA 5IFPA 2BHZA 3UA4A 2BDQA 1IEXA 2WSQA 2WAGA 3AQUA 1D7FA 2OZTA 4HMEA 4GZEA 5DRIA 3ARRA 4A6GA 4Q7NA 1ZGDA 3AWNA 3POHA 4N4PA 4DBUA 3TC6A 2XN1A 5I3HA 5KTLA 3O6DA 3W1MA 1CNVA 1KBBA 1PWMA 5GPRA 1F05A 3W87A 1ML1A 1A50A 4D6EA 4XSMA 3KAOA 4WDUA 1VBHA 3EOEA 3GHTA 1CXLA 3W3OA 2BGNE 3N4FA 3S1GA 4GO9A 4B5TA 1RP8A 2PDLA 2PDNA 2BS9A 2R94A 4E8CA 4HGXA 3G24A 5FSDC 4IFKB 3PUGA 2ZE0A 3CZ8A 1ENUA 1DJXA 1LLOA 4CQAA 4E8GA 3VKJA 1YQ2A 1FWTA 4WUIA 3THUA 2IQDA 4DJED 3MUIA 1QNOA 2TRSA 1QVBA 1V03A 4Y90A 1RUSA 2XIMA 1W3LA 1WDSA 1EJRC 1E5NA 5LKYA 1SO3A 1HL9A 4AZCA 3IJQA 4IMGA 2NXIA 3OLDA 3U2CA 2PTDA 4ECLA 2IPGA 4UNIA 2VO5A 4R9OA 1V0NA 3UWEA 4PMUA 4U3CA 4G6CA 3MJMA 4GD0A 2VFGA 4XAPA 3LV5A 4TXEA 1RY8A 3LPPA 4AY8A 3T1GA 4QCEA 1FKXA 1GVEA 1C8QA 5DCEA 3AMKA 2CLPA 3HG3A 3TQ0A 1VJZA 3QW4B 3HMJG 3HG2A 4O4VA 2NW0A 1JQVA 4ZMGA 2WHJA 3R5EA 2Y8UA 4PB3A 2PDGA 5C9ZA 4XG1A 5L9FA 5HPCA 1GJWA 1ME7A 4GQBA 5HJYA 5E9AA 2BNJA 4RKAA 1UWUA 2UY3A 1XLHA 4NXKA 3PZVA 2DUAA 4MWAA 4MMWA 3W73A 4AHPA 1B0IA 3AXKA 1C29A 4DN1A 3OU8A 1UWAA 1JCNA 2DFAA 1PDZA 4GUJA 5C7HA 2VP8A 1OWQA 1BFNA 5DMMA 3GIQA 3WQ5A 3P60A 3WK2A 3WIJA 1UD5A 1HJSA 3W83A 2VFEA 1JPDX 4KWWA 2E6YA 4JDBA 1KRBC 3PY2A 3VU2A 1TVPA 4KWVA 3VNKA 2AKMA 3I65A 3LN3A 3TDFA 2VRQA 3N2CA 3L4WA 1UZHA 2XH0A 3BZGA 3WO8A 3EB3A 4O0QA 3KVMA 1UZDA 4A3RA 5LA1A 1IXPA 4KF1A 4PTWA 4FXRA 4HOWA 1ZL1A 4ZFMA 3AIBA 1SYTA 3ITCA 4B4FA 2H3DA 3CS2A 1KO0A 3KP0A 1OB0A 4IOTA 2CZEA 4KT2A 1JPHA 3VZYA 2Y7EA 1VD6A 1GEQA 4OJYA 1DWAM 1XLKA 2AL1A 3W7LA 4W9TA 4GG9A 1B3ZA 2GK1A 3R0KA 1K8YA 1AD4A 2D24A 5FJPA 4C6FA 1OZQA 1RR2A 1TE6A 2CU0A 4P8XA 4WY0F 2TMDA 1DQWA 2X7WA 4QDWA 3LNPA 3S6DA 3RDKA 2X0YA 4H7ZA 2VELA 2YCKX 3WFAA 1KCKA 2NWRA 4MWAB 3TJXA 3CPUA 3F4VA 4N4QA 4DJEC 1ZCCA 1YPFA 4DUXA 3PZGA 3T07A 1Q8JA 1HIZA 3QY8A 5CGTA 3ELFA 1NQKA 2QHAA 5C6MA 1VRDA 2UV8G 4IPNB 5AHIA 1CGWA 1VGAA 4B2DD 3GZAA 4LEQA 1S3HA 3EYPA 3WG6A 2OO0A 4GK8A 3KZSA 3V1PA 2XINA 2Y4SA 2QCGA 3W37A 4IWWA 2EAWA 3BDKA 1NARA 1PIIA 4CQBA 1BYAA 1P6BA 4BEUA 3HN3A 3QY6A 4HCLA 3CUHA 1B57A 2HROA 2J47A 4S3BA 4RCXA 3B8IA 3WEMA 3LNMA 3N2MA 1Z42A 1UP0A 2A3LA 1YNYA 3E49A 1OCJA 1TPH1 1R3TA 5I79A 2RDWA 3BWWA 1KTBA 3KS5A 1L8NA 1UH2A 1ZJAA 4PL1A 2GK1B 1B5TA 4MG4A 2XFWA 4ACYA 3GVGA 3JW7A 4J3WA 4HU4A 1IR2A 5DBTA 5ABGA 1G01A 2RKXA 1EDQA 4KEZA 1AH3A 4FO4A 1RXOB 4UNLA 4A05A 3E0VA 3ITYA 2BG5A 1E0VA 1Y5XA 1V6XA 3KX6A 4JZ5A 2INEA 2NLIA 4UFJA 4NL1A 3RX2A 4NUWA 2ZX8A 1OEPA 1U2YA 1Q6LA 3IV8A 4L4MA 3CPGA 4FOKA 1LL6A 2WOQA 2CLEA 4QJ3B 4XD3A 1JF6A 3QZ6A 1KBLA 3L2IA 3O2LA 4ZE5A 4PMQA 4IIDA 1D8WA 1KC7A 1ZJIA 4LV4A 3F1QA 3PZOA 4Q8WA 4FB7A 2XIOA 1FQ0A 3DKLA 3TV8A 3UF9A 3ABSA 3M41A 3A12A 3AYVA 2FH6A 5DT5A 5AHEA 1UBSA 3LEPA 2Z2UA 2WJDA 4BWLC 1OK6A 1TV3A 1MI3A 5FF7A 1NDYA 1T8XA 1W1TA 3M0LA 3TP4A 3PUEA 4MKNA 3M0HA 3R79A 5CC7A 3CTTA 4YU1A 1ITCA 2OTDA 3NZ1A 2ONEA 5CSUA 2J9XA 1VCVA 4L9ZA 2VX5A 5GJNA 1J6PA 4QE1A 2DGAA 3L23A 1GOMA 1Z41A 1F6YA 3B9EA 3MJYA 1SW3A 3BANA 1O95A 4N9DA 3UT0A 4IQLA 4QJ1A 4XD4A 2GQAA 3R8HA 1GG0A 3FKKA 2YA0A 4FHAA 1DHPA 1I1WA 2WMJA 3KS6A 3DX5A 1GCYA 4ZTXA 3NQGA 4NU7A 1VZWA 3N9RA 4M56A 1UQYA 3SRKA 2W66A 4B91A 1VYRA 2ZDSA 3GE7A 4US5A 2VL4A 5K7JA 4LAZA 4MNJA 4U33A 4GGBA 2Z0IA 3KXQA 2QCHA 4HYVA 4MIMA 2DVUA 3GNDA 4H9VA 2OYLA 4LGXA 2CWXA 1LRTA 1TRIA 1VJIA 4HYWA 3U4AA 4NNCA 3H53A 2OQHA 1K4GA 1NQ6A 3NA8A 3ZJKA 1US2A 4LWWA 1L2QA 5C7VA 1MUCA 5I5RA 5HMEA 3N15A 3OLIA 3NR0A 4QTGA 3CYJA 4XZNX 2B7QA 5D33A 4HNUA 2J75A 1XYFA 3QF0A 4PTNA 2J8GA 2FPVA 3I3BA 2HEJA 5A6AA 1UROA 3P5YA 3U3HA 1T41A 4J5NA 4X3ZA 2O56A 2UZ9A 3BLLA 4C6IA 3P80A 1R9ZA 4IGHA 4C6JA 4UTHA 1KV5A 1EDGA 4PCPA 3QSTA 4UWMA 1BKSA 1ZB5A 4FIRA 2E8YA 5LGZA 4JYEA 3DI0A 1LORA 3RCNA 1IZCA 1R46A 1KRMA 4YNGA 3RNDA 4JFUA 2PPGA 5DXXA 2NLYA 1UD3A 1Q63A 4C6KA 1Q85A 2WZHA 3R2GA 3EA2A 2QUTA 4UCFA 4B4HA 1DIDA 2FPYA 6TIMA 4K7YA 3GQYA 3EOSA 2BY2A 4GY7A 4P61A 4XD5A 1LUCA 1W3IA 3H55A 1WDDA 2ZQ0A 4JTEA 2VD8A 1XDLA 6REQA 3G5EA 4LUSA 4GIYA 4U2ZA 2Y5SA 2VUYA 4DWSB 4GVFA 1KM6A 1KFWA 1HJVA 3G1RA 1H3GA 2VEFA 2RJGA 2FZ9A 3IGSA 4JTAA 3O6CA 4N2YA 3SIMA 3OLGA 1HTIA 2X0HA 1UWTA 1XWYA 3WBXA 3QKZA 3OZOA 1W0MA 3W88A 1QCWA 1R9YA 2OLHA 3QC0A 4GNKB 2F84A 3GSMA 3OVGA 3TW9A 4BEQA 3AYSA 1G7VA 2XPKA 1EXBA 1UA3A 1Q6CA 4N0RA 2PCQA 1EF2A 4JTTA 4H7VA 4YHEA 1ZENA 5A8OA 3E5PA 3TOYA 2DPEA 4GHRA 3W25A 3E0WA 2YA1A 2XDFA 3IWPA 4S3KA 4Y9MA 1Q7MA 2O4QA 5E6ZA 1WCGA 4NQ1A 3C61A 4HNVA 1X98A 4OTKA 3SADA 2C3ZA 3W72A 4HHPA 3QQ0A 3H26A 2ZZ5A 1C8XA 2YZ5A 1V08A 1AUSL 4GQ0A 4GRSA 4Q8MA 2CLHA 4GO8A 2YSWA 2WBGA 2XVLA 3O07A 1RP9A 2WVSA 4W8AA 2ISSA 4FXSA 1GOWA 3CPRA 3TR9A 1S5TA 4MFDA 4ES4A 5LXXA 3M6YA 1E56A 3O3RA 2CBUA 2Q71A 1AJ0A 1NTHA 1DJQA 1UMYA 1TWZA 1BRLA 3N29A 2P8CA 4S3DA 1GYLA 3WLKX 1LUCB 2OEMA 3VPLA 1YNQA 3GKAA 3PJTA 1B9BA 3U0HA 2EG7A 4D6JA 4LUSB 1K3UA 2Q8XA 3TXVA 3RM8A 1F3TA 3LENA 3C2RA 2WPBA 4NASA 3E02A 4MM1A 4JL2A 4EANA 3E2SA 1UP2A 4S3FA 2C1GA 4H83A 3C2VA 3QQWA 2WWDA 4ICNA 3CAQA 5C54A 4M6PA 3Q58A 3DYOA 2C8NA 1L2UA 3FA4A 4GJIA 1CXIA 1PZ3A 1FOBA 2GQ8A 2DORA 4QBXA 1A3XA 5FESA 1PEZA 4AAJA 3KE0A 3CQHA 3BAJA 1SW7A 1VFFA 5I6SA 3B8TA 4GKLA 1QOXA 3PN8A 1JG9A 5CJNA 2VZSA 1RQHA 3SCVA 1EHNA 3H12A 4E6MA 3CYVA 5FJIA 2X8RA 2Z4GA 3W7IA 1R2SA 1UR4A 1E9IA 1IEQA 3LQLA 3KTSA 4IGNA 4RL3A 1AL8A 3VNIA 3A4JA 3UA3A 3NEHA 1NWTA 4LC8A 3ITTA 3MCOA 3P7YA 1EYWA 2YR1A 3WUGA 4JN7A 1O6IA 2R14A 4QRNA 1FWDC 1HKMA 1KBJA 3OB8A 2DSUA 4J35A 2BOEX 2YOCA 1FWEC 3UG3A 3O0KA 3BAYA 1AW2A 3I7SA 2Z26A 5BXRA 1V02A 4F8XA 5D30A 4E2VA 4EVZA 3WCZA 4UFMA 4WK9A 1BRLB 3A4XA 1DJGA 2NSOA 2DSKA 2ZUTA 1LDCA 5D02A 2OXNA 2X42A 4L80A 2E5BA 3R89A 4GXPA 3TN4A 1BF6A 1O94A 4JQAA 4WOQA 5EYWA 3EXRA 3VIFA 5FA5A 4J40A 2WC4A 2ZRXA 3TAKA 4H6RA 3T6CA 1AG1O 3HF3A 4C1KA 3EDKA 1O5KA 1IWPA 5BRQA 3EKGA 4O11A 4ZSTA 1DEDA 2OU4A 5HJLA 2NQLA 1VRXA 2J9ZA 2CBJA 3KWXA 4FLSA 4H6QA 3WLJA 3NXFA 4NAFB 4H8HA 1MRQA 4HMDA 3A47A 4GIRA 1UKQA 5F2MA 3IJ6A 4MJZA 3NVDA 4R33A 3BMXA 4XZMX 3TE9A 1FFRA 4FI4A 3WNKA 3ABZA 4GJ1A 4UTKA 4X9SA 3QN3A 2ZA2A 3AZRA 3W23A 2SFPA 5CCZA 3TA6A 3S2MA 3TYZA 1I75A 1OT2A 3ZR4A 2BHYA 1W2VA 2ATSA 4CVUA 3CV6A 1ICPA 1KGWA 3KHJA 3G1SA 3GDKA 3NZQA 2HMCA 3QGVA 4EXBA 1US3A 1TR9A 1AW5A 3TYAA 2OSYA 3VK5A 4K37A 1I2RA 4F3HA 4NNAA 1MDRA 3KRZA 4ZOAA 3DFYA 5EMLA 1LWHA 2Z7KA 3PNZA 1R86A 3KVLA 3D6NA 3GNPA 1XISA 4J7RA 3RRAA 1LTDA 2OZ8A 4R88A 2MANA 4ASTA 2A3BA 3BLEA 2HQAA 3B0VC 4AX6A 2E67A 3WLOA 1XIHA 4DBSA 1DXIA 1WUFA 2IKJA 3W1RA 1DE5A 1MYRA 2HVMA 3UETA 3OVRA 4LXFA 4N02A 4LVGA 3W7NA 1EP2A 3WK0A 4KGLA 2VVNA 5AHFA 3WF4A 1EBGA 2B4GA 1ZRQA 3LUTA 2XWEA 3ZLHA 3WJXA 4I6VA 3LERA 2HNEA 1EJXC 1S2CA 3QYQA 3LX9A 7REQA 1VKFA 1VS1A 3L0KA 3D3FA 4RNFA 3O05A 3KVJA 3PBWA 3V5FA 1KXTA 3VD5A 2IXUA 4PMDA 3W29A 3ZT6A 3QPZA 3EZ4A 1KM1A 1EJSC 4K2SA 1Q3NA 3T0BA 3VUSA 8A3HA 1WXYA 2NX3A 3C5QA 4AQLA 1EQCA 1W9PA 5KETA 5CSYA 3S46A 3AIWA 2I16A 3HV9A 4JCMA 3UG5A 1UQZA 5FI8A 3ZQ9A 3JS3A 3IJ8A 4AEOA 3T44A 4K8EA 2YJQA 4NNBA 3WMSA 5LIYX 5G1TA 3PG9A 4DUVA 1QWKA 4Z2HA 3P3BA 4ZSUA 2GGIA 3GZ3A 3VD3A 1PX3A 2ZZ6A 3MS8A 5A6JA 5G4WA 2PS2A 3TC3A 3P82A 5HUPA 2D22A 3P61A 1YPXA 4MWAD 4XUGA 4ATLA 2WHKA 3BARA 2J27A 4MPQA 2YBUA 4IPPA 1CTNA 3QTGA 3DFTA 1GJUA 1TWDA 1XG3A 3NYZA 2E1DA 1TA3B 4OWGA 3PAOA 3KP1A 4F9JA 1Z48A 3GTXA 7ENLA 2A0NA 1OC5A 2FDSA 3W0KA 3KEHA 5XINA 9RUBA 1A5SA 3JVAA 4JD4A 1QJWA 4X0VA 5CSRA 4UTFA 2VVSA 2YFNA 2RDXA 2CFFA 3SW6A 2OEJA 2OZ0A 1SMDA 2WHLA 1MNSA 1DWIM 5FAGA 3WQVA 5D09A 3IGHX 4RE0A 4PH6A 1TX2A 3AMGA 3WQWA 3G0XA 4GJJA 1UA7A 3E0LA 4O1BA 2VUNA 7REQB 4IG2A 3GWQA 2ZIDA 3ITOA 3FA5A 4NX5A 4QS6A 1TMLA 2EG8A 3S8HA 3ISIX 4QE4A 3SGGA 1G6CA 2WNNA 3QLLA 4DQWA 2HPIA 3PBYA 3YPIA 4POCA 4MJMA 2FTYA 3TLQA 4KCVA 4X61A 4RJEA 2R1LA 4TOQA 3AXHA 1XYAA 2Q01A 1G7UA 3GXMA 3LBMA 4EPDC 4GI4A 3B0YA 4ZEPA 4WSKA 3NQ7A 3THAA 5KZDA 1W31A 4UFHA 5RUBA 4WGXA 2Y24A 1JZ7A 1TPDA 3WH7A 4O57A 1FWHC 2CLLA 2OGJA 3HZ3A 3TVAA 3IK4A 3GK0A 1RH9A 6XIAA 1TTPA 4C6DA 5JIPA 3AYTA 1U33A 2EPNA 2FHCA 3QFWA 5CPLA 4FNPA 2PDUA 4M81A 3W1UA 1UKPA 3N13A 4JIEA 3MUCA 4AWTA 3IUIA 4PTVA 5I3DA 4DJFA 4M1BA 1JDCA 4CKQA 4NXSA 3VDAA 3BTNA 3ABRA 5I3GA 3WUFA 2ALRA 3TAOA 3S2CA 1RQEA 1B54A 3ALGA 2NXHA 4AC7C 4RZ4A 4XZ9A 1S39A 2D2OA 1LLWA 2W67A 3W81A 5I0DA 2W5FA 4PEKA 3IUHA 2PODA 3INPA 1GQKA 3GH4A 3N2OA 2VFDA 2J25A 1QPKA 2OYKA 3EB4A 3Q67A 2PP1A 4J3VA 2VJXA 4GH1A 4O10A 4IG2B 3W53A 1IXNA 4U2YA 2AAAA 3GBDA 1OSEA 1LCOA 3THDA 3EKLA 4FPSA 2D0GA 4QSFA 4GXWA 3E5BA 3UCCA 4AC1X 2OLSA 4IMAA 4LU0A 5CKSA 4OUIA 1VJSA 3W01A 4M7TA 1SMAA 1QOQA 4OHQA 1ZS2A 1UD8A 4MWAC 3KCOA 1HJXA 3E0FA 4DWDA 4HZ7A 4ROQA 3JR2A 1GVRA 1I2OA 5C9WA 3BW3A 4UFIA 4NZCA 4KS0A 1I45A 5A2AA 1S46A 4F66A 1LT8A 5BROA 2RDUA 1JGIA 3GG7A 3MU7A 4S2BA 5K9CA 4S3CA 3RX4A 2HZGA 4KRUA 2Z1BA 3GHSA 3VTRA 4HBKA 4IJBA 1KB3A 5I02A 3U4FA 3CZKA 3WSUA 2BASA 2QDDA 2G96A 1TIWA 4JBRA 3P84A 4JKMA 1X8FA 5LNRA 2J8FA 5ABFA 2NUYA 3ANUA 1NEYA 4MWAE 3SECA 3S83A 2B7PA 4TU1A 3FSTA 1IZJA 1PAMA 4R3UA 4QXIA 1VFMA 3QC3A 4U3AA 1S1PA 3NQ8A 4GYFA 3IJIA 1HL2A 2IW0A 3STFA 1LWIA 4V1YA 2TYSA 1AH4A 3MI6A 3QKEA 1W1A1 2D0FA 5CG0A 4LS2A 3GNXA 4GGHA 4Q33A 2NX1A 1HFBA 1LQAA 4FNUA 1LZOA 4GZ7A 3NCOA 2POTA 3QGAC 4AW7A 2XSBA 2O0TA 1R3SA 4G1NA 2WCGA 2HWGA 4CCCA 2XM2A 1BHGA 1RBAA 2PMQA 3USBA 3OBEA 3H6OA 1JUEA 2EBNA 5A2CA 2FKPA 2CW6A 3WBYA 4AFYA 4MKVA 3W1AA 3VGDA 2VXNA 3FYOA 4US5D 2DZPA 2GJXB 2GJPA 4DZHA 1IT7A 2HS6A 3VM7A 1QW7A 5JBEA 4TX9A 4MY1A 1DVJA 2C15A 1F6KA 3TJ4A 1V3LA 3MYPA 2OG9A 4B5XA 1BG9A 1E0UA 4ZQPA 3UU0A 5CGQA 1CXFA 1FWWA 3PP7A 5HJXA 2JE8A 1WAWA 1CXKA 4QLJA 3C0JA 3KDNA 2NQ9A 3EOLA 1K7XA 5G2IA 3MC5A 3MKVA 4AHOA 2JEQA 5ABFB 2BY1A 3HGJA 2QJIA 1OFBA 1P0DA 3N6HA 1KWGA 3HM7A 4LRTA 3UPWA 1LWJA 3MUXA 2Y2WA 2GVEA 2C13A 4JQ2A 4PUNA 4OV4A 3WX7A 2ZVIA 1WKEA 3QGKC 4Y9AA 2ZWYA 4O1AA 1EOKA 3DU0A 3UR5A 1DHKA 3WK3A 1V6VA 1VYSX 1F8MA 1T40A 4P7LA 3FX4A 3C2YA 4L9XA 1H7RA 2HXTA 2OJPA 3QR1A 4U5IA 1WKFA 4LAOA 2YDAA 3H2AA 3TEVA 2D2JA 2D73A 4NJIA 5HMSA 3KOFA 4BQ3A 4NJHA 4GCXA 1HN1A 1QMLA 2CESA 4ZE4A 1NY1A 2QCMA 2G3NA 4RK8A 1X96A 4LYPA 1QDSA 3RLVA 2QLYA 1B1YA 1FWJC 4HSOA 4IIHA 1VP5A 4BF9A 1OGGA 1MW3A 4ZTYA 1OF6A 5CJMA 1M1BA 4JHZA 4KW2A 5A6BA 2RUSA 1LLZA 3T0DA 5C70A 4MJ2A 1H0IA 1H61A 5D4YA 3BMWA 5DEZA 2EHHA 3PBGA 1XX1A 2XWDA 3HG5A 3OPSA 1JVNA 1JUBA 4NX0A 2V68A 1G0CA 2VEKA 3BQ6A 3K4WA 1Q6OA 3WQ6A 3KM8A 2QDEA 3F03K 1HP4A 3O16A 2PSNA 4H9YA 1RAKA 2INFA 3BLFA 1MQQA 3WELA 1QBAA 3W02A 4HYRA 3R10A 2VCAA 1OINA 4C7FA 1XH2A 1S38A 3DHPA 1Y7VA 2WM1A 2QPSA 2D3NA 3KCLA 1J0HA 3F4DA 1H1NA 3CUJA 3NPUA 4DNMA 3TYCA 1W3HA 4AWEA 4HSNA 3EWZA 5CGMA 4YVPA 4S3GA 4H8NA 3O8AA 1OZMA 1H41A 4D6CA 3TYUA 1EO7A 4XAFA 1WZAA 5LZLA 1M41A 4HK7A 1QO5A 1X6LA 3U2EA 1OCBA 4UQCA 3G0SA 5AC5A 1A47A 3HPZA 2DZUA 1W9VA 1S3TC 1YRRA 4W7WA 4NRSA 3TW6A 4KQNA 3TCEA 3GDLA 2E0PA 5GQBA 1PPIA 1GOKA 2ZRVA 1GGOA 4PYSA 4DM1A 4DYKA 1ZZMA 2YLAA 1IF2A 3DG6A 3VOCA 4RPPA 5CC3A 3CV2A 1YNPA 4Q8NA 4RZ6A 2BXZA 2I9EA 1OD0A 4X2PA 5B7YA 2NQJA 1OQFA 4LJ3A 4JTQA 5E09A 1E0XA 1XRVA 3WLRA 2I5GA 1HJWA 3LD5A 2V82A 4D2JA 4JTUA 1XBXA 2VX4A 3LHYA 4GUFA 4P7NA 1G67A 2I5QA 2XISA 3MT1A 4TIMA 3UD6A 3ANYA 3MSDA 2QCFA 4NI8A 3DH7A 4QGCA 4GBDA 1XRSA 2DSZA 3HOJA 7TAAA 2EJ1A 3H7RA 4Y6GA 4I5XA 1O68A 4Z2JA 1O60A 1DJHA 3MCMA 5AKQA 1FWSA 4UQ9A 1CGVA 3R0UA 3WMCA 3QR0A 4EF8A 3FXGA 3DUGA 2XU2A 2E5CA 4QG6A 3MV11 3U2OA 2Q09A 3QLDA 1Z69A 3KOWA 5A6KA 1D7KA 2VYOA 2ADAA 1R3RA 1BWKA 4LY8A 4E3TA 2QIWA 1TPWA 2XIBA 1JCXA 3HGOA 5LIXX 1GG1A 2GDQA 5DQPA 4XISA 2P53A 4WVXA 3G1AA 1I2PA 4ZZ9A 1WUEA 2DH2A 2W4XA 2W6RA 2Z25A 4NZ1A 5I07A 4AEFA 1ECEA 1GVQA 3JUGA 3DFHA 3ARYA 4BI7A 4I5UA 2QUMA 3BGAA 2XH7A 3R6IA 4GUHA 3CM4A 1THFD 1CB2A 2D1ZA 2ZZ7A 4HZ6A 1H2JA 4ZOBA 1ITXA 1WNOA 1X8CA 2BSLA 1RCQA 4N9EA 4B5VA 2TPSA 4TVCA 4AD0A 1G4SA 4A3QA 1NFBA 4O12A 1UR9A 2F38A 1F8IA 5F1UA 2BOFX 1PTAA 1EGZA 3AMLA 1GEHA 3S6OA 2H90A 2PWVA 4JTRA 4C6OA 2JALA 3CB3A 5BRBA 1F07A 1XLMA 1DIOA 3PWGA 3HQNA 1XLAA 4CQ9A 5TIMA 1NWRA 4JTGA 3CJPA 4LVBA 3GAYA 3BURA 2DY3A 3KTCA 3N34A 4UR7A 1PDYA 1GOOA 2VI0A 1KFJA 4LANA 4QE5A 1IT0A 5FL0A 2HK0A 2O9PA 1FRBA 3RR4A 1EIXA 4YYCA 1DKWA 3QMTA 4IFOA 4BI6A 1DORA 4LAMA 2QDHA 4M80A 3AI0A 2A2IA 4ORIA 1ZJBA 2V8ZA 3BICA 3FEQA 4ILSA 3S9ZA 3V5OA 3UFYA 5IHSA 3AWOA 4ADSA 3BSMA 3NPVA 3NQBA 1ISYA 3VIHA 1SFTA 4A22A 2GJNA 2BY3A 3VCCA 1PZ2A 2VEGA 3R58A 1HGYA 1ICSA 4Q4QA 3O63A 5D38A 1VENA 1OFOA 1FCQA 3L5AA 3L4TA 1BQCA 3DKJA 4LNCA 4OBTA 1IEIA 3B3DA 3GTFA 3PZQA 1TZZA 5LHFA 3W7DA 4CNSA 1JFXA 5M2FX 1I0BA 1P7TA 3VX1A 3E12A 3NZPA 3UG4A 1JYXA 3RMEA 4IGMA 3FDKA 1UWSA 2EJAA 3OG3A 1FA2A 1OK4A 2VR5A 3HPSA 3AHVA 2YW4A 1J2WA 1UBPC 3LM7A 6A3HA 2FMOA 4PBFA 1EWDA 2ZYFA 1SFLA 2I9UA 4S3AA 3LRMA 1JI2A 4KFOA 3ZVIA 2E6FA 3W2KA 3H2EA 3VIPA 3UXLA 4DY1A 1WXZA 3SN1A 4GKTA 1GQLA 3PUOA 1B4EA 4Z42C 5BNKA 1A0CA 3CEPA 1OFEA 3FHQA 2G4JA 1W1PA 1C90A 4XIMA 5LNSA 4B9YA 3VNYA 3SCPA 3F2BA 1MSSA 2PDMA 1OG0A 1XM3A 2R91A 3K46A 5FEPA 3PF3A 2VX7A 3VVGA 5CLTA 1KM3A 4AMCA 1XFBA 1DQXA 3E0IA 1JYNA 1HL8A 3RF9A 4CQDA 5CZ0A 4W7UA 2DZXA 3GDBA 4AVFA 3VC6A 1UD6A 4YMZA 5FEZA 3SRHA 1WKDA 2PUZA 4ZQRA 3PPHA 1KW1A 3CL8A 3HURA 1EJ7L 1QATA 4ORMA 1DP0A 1MQPA 2GYIA 2Z29A 1VPXA 1XBYA 3I3EA 1LQ2A 1OGBA 1J10A 1DJIA 2CC0A 4NP7A 3NDZA 3SSJA 4OOZA 2W63A 3W2LA 3G6LA 2JIWA 3S2NA 3SUWA 3NUKA 4W85A 1RALA 1HUVA 4LY4A 1B2YA 1XLCA 4KRTA 2GVJA 3VO0A 2WZEA 4B90A 4LBRA 4H19A 5A1AA 4PA8A 1P7TB 3GNNA 4F0SA 4XVDA 1UC4A 3AFBA 3AJXA 3WENA 1P0NA 1CYGA 5HWMA 2Y1HA 5JUVA 5E0KA 2VEMA 4U4MA 4X0NA 1O1HA 3IARA 3M7SA 5CPMA 5FJRA 1DOSA 1E4LA 1QI3A 1K77A 2QULA 3OVPA 3KRUA 3FSUA 4KWSA 1V02E 3UWQA 5FJOA 1QNVA 4GI6A 1BXCA 1A3HA 5FJJA 1XYCA 3E2QA 3BE7A 4NJJA 1KXVA 2GWNA 3WDHA 2P3ZA 3OYZA 3CTLA 3STPA 4OOUA 3SGUA 3CO8A 4YCPA 2C19A 4D8ZA 1EQPA 3BGJA 1LOSA 1S2WA 3HQPA 3OQEA 5KITA 5D9PA 5IBXA 2PTYA 4QHRA 1OX4A 5XIAA 4HA1A 5CZSA 3RCMA 5HANA 5BWAA 3U2ZA 1XRFA 1SM9A 1V8EA 3ES8A 1W1IE 1TTQA 3IIVA 4ZENA 2OFJA 2GJRA 5A8QA 1E1FA 3TYEA 5JXQA 5E0FA 4LQ1A 5A8GA 3Q37A 1CBGA 4HHMA 3CWNA 3DCPA 4DAIA 2NT1A 4Q8QA 5JU6A 1TB3A 4EAMA 4JHOA 4H4IA 1ZTVA 1S5WA 1CXHA 3WUEA 3H54A 3GW0A 1ZPTA 2FTPA 3DG3A 4JIRA 1ISVA 1XJBA 3KBVA 4DJFD 4QISA 4QCFA 1LBFA 5T8GA 3MW7A 2AL2A 3SCQA 3WNPA 1MEHA 3LLDA 1UJPA 1OY0A 1J01A 3NIYA 3UQNA 1ITQA 1W5NA 3NQDA 3EA3A 1JDFA 1O5RA 2KAUC 2HE8A 4WSJA 1S5MA 4CCEA 3AHTA 5LNUA 4ZXOA 4EPKA 2A4AA 4OE7A 2C6QA 3CQJA 3NGFA 3ATYA 3B4UA 1B90A 1VB9A 2Z1VA 4C6LA 4L6DA 4OT7A 4CNUA 4C5ZA 3GVRA 4JFTA 4UQDA 4S3JA 4X63A 3R11A 3LMYA 3FAWA 1B30A 4IXHA 3G18A 3ZIZA 1FDJA 1Q66A 3LSBA 3N6JA 5TF0A 1J5SA 3GR7A 4AIBA 1KA9F 4UOZA 4KCWA 3NVTA 5A8MA 3WNNA 3W27A 1NF7A 3PFRA 5DBUA 3UVAA 3VMPA 4Z2KA 4HPHA 3W1QA 4Q8VA 4MAZA 3WZ0E 2FJKA 4XD6A 1OX4B 3MA8A 3ME3A 3VC5A 4XWUA 3KRSA 4KKXA 1W3KA 2JFEX 2OOGA 3TTSA 2ZX9A 3BCJA 2W79A 3IVTA 2F7FA 2QF7A 2NVCA 3UP8A 3EPMA 2MUCA 3BK0A 3AJ7A 4RNJA 1WPCA 2V5JA 1F61A 2Z6JA 2GOKA 1PX8A 5FAJA 1E0WA 4C6QA 1JZ3A 3RR1A 4IL2A 1TMHA 1E9YB 5BXPA 4GY1A 3A3WA 1TYGA 4W89A 2C1HA 3WQPA 1W5PA 1X7IA 1GZGA 4UMAA 4WJXA 3NNTA 2X2GA 2BTMA 4DYEA 4PULA 2Z7GA 5T9CE 3GC5A 4M24A 5T91A 3LXCA 5A95A 3GU9A 2ZX7A 3HTWA 2WQDA 3N04A 4XZWA 1UKTA 3S2JA 3QMSA 3GHUA 1W3NA 1VLWA 5HUOA 4NSBA 1JPKA 4HTYA 1U83A 3PZUA 2Y85A 1WKYA 2WCSA 1CPUA 1A80A 3AZSA 5G4EA 1E5JA 4FALA 4Z17A 2WKJA 4C1LA 4XO6A 1QT1A 5EMYA 4Q7BA 2WKGA 4BCEA 1V0MA 3P67A 5A3HA 3HJEA 3RMJA 3FVDA 3IUDA 1XINA 1Q65A 4AZ7A 5M5DA 3GXFA 5HWJA 3THCA 3KL0A 2PP0A 3VCRA 4C6PA 4AZGA 3GLCA 5AC8A 3OLEA 5T26A 4EP8C 1EGVA 3AUOA 1DBTA 4RUBA 4RE2A 3GIPA 4ERAA 2OELA 1O5QA 2VC9A 1N2VA 3BL3A 4AG0A 3LCGA 2VEIA 1DIEA 2BOGX 3WD4A 4L6OA 3W24A 1KKOA 1ZFJA 1NOFA 4DJFC 5IRPA 4LSBA 4YPJA 2XVKA 3TU9A 1JPIA 3QQ1A 3G22A 4J2PA 4X9YA 2QCCA 4PTDA 1RQBA 1LT7A 3AC0A 2QCEA 1JJKA 4DZAA 4GBUA 3ZWTA 3W76A 2GGGA 2QDGA 1IGWA 2ZA1A 4HQVA 1OYBA 4WDXA 5K4ZA 1TQJA 5J5RA 4BS0A 1XCWA 4Q8OA 1AZ2A 1RVKA 2VX6A 1HKIA 3OYXA 5EY5A 4LB4A 2PBOA 5U7SA 6XIMA 2EKCA 4IUOA 1KR0A 3VE7A 3L5MA 3WMBA 4DAFA 2I17A 2A6LA 3CBWA 4UQEA 4G56A 5FOOA 4UR9A 4M6QA 1X1ZA 1Q5MA 1KM5A 4M19A 3T40A 1H60A 2A3CA 2NV1A 4DJDA 5CJ5A 1V3IA 1U5VA 2GDUA 2HXUA 2G4FA 2G8ZA 3DERA 1PB0A 1GKPA 3FCPA 1C7SA 1S2UA 2PWFA 4LVAA 1BGAA 7PTDA 2FVMA 1LYXA 4B16A 2BGSA 2ACSA 4G7EA 1ADOA 2YL5A 3S1XA 4IF2A 3K8KA 3OEXA 1YKWA 1LL4A 1YTDA 2WK2A 4NT0A 4LYQA 5CZKA 3BCDA 5DLCA 2I14A 4H01A 1WOBA 1JEZA 1F74A 2EPLX 3IGUA 5FF2A 4L64A 4E4PA 3SURA 3HO8A 3N11A 1CECA 5A6BD 4Q22A 1BYBA 1A5KC 1QW9A 5AYYA 4BY3A 2C0HA 4Z1AA 3LK6A 4Y8FA 3C6CA 3MUZ1 1VFSA 1FUYA 1JZ4A 1U1UA 4MYAA 1VFHA 3V18A 2P5NA 1M7JA 4DF1A 3WL0A 1LQ0A 3M7WA 2OWWA 1XLDA 4LBUA 5K3VA 2ZZ2A 2OKTA 3ZXWA 4O17A 3CL7A 3ARZA 4AZIA 4HT3A 5DELA 1SGJA 3MQTA 2GL5A 1P0KA 2NVAA 3D46A 5D2WA 3DC0A 1OIMA 4GUIA 3MKCA 4ZR8A 4IX0A 1IR1A 3CZGA 2B7NA 1Z89A 4FR6A 1V0LA 3V75A 2G41A 1UR8A 1LG1A 3UR8A 5EMKA 3UPBA 3T7VA 2FMNA 2QUNA 2PDHA 4JR5A 4H9XA 4BJHA 4XX6A 4XBKA 4MLRA 1JDEA 1W6TA 4MB4A 2E1WA 1Z32X 4V28A 1LG2A 3WQ8A 1K8CA 1LF1A 3TQVA 4LF1A 3PFMA 3TCSA 5C2CA 3PANA 3QVQA 2WC7A 2ZOXA 2VHLA 3N2TA 1V3MA 1XSIA 1PHWA 1XIJA 4YLWA 1ZU8A 2A7RA 3NL6A 4Q4MA 4MLJA 3T2QA 2HDJA 3XINA 1KCLA 3MVTA 4C6CA 2J88A 4HTBA 2J6VA 5D2VA 4XV0A 4ACZA 4JTFA 2IXVA 3UVIA 3M47A 4W93A 1ZCOA 1MQRA 3GFZA 1MFVA 2OODA 1EC9A 2CHRA 2XG9A 3A23A 3SUTA 1PHQA 1QAPA 3N73A 4DZIA 4W87A 5KINA 2A79A 3GC4A 3MBFA 3CAWA 1QPNA 1XUZA 2PLKA 4PMVA 4L6HA 5IXEA 1V93A 2X41A 1JXKA 2BB0A 4E4FA 5CAKA 1JF5A 5BOOA 2PU0A 4DO5A 1E6SM 4XTDA 2DZTA 5FF4A 1RK5A 5BMWA 4N9CA 3VKCA 4LW7A 1FWAC 2PDYA 5IDIA 4WEVX 2ZUVA 3G3MA 2V5KA 3VGFA 1J6OA 3M43A 1OFDA 4I5RA 4GABA 3SB0A 4XKYA 3W9ZA 4UC5A 4L4LA 3HA1A 3M0ZA 4HD5A 3VX0A 1OX6A 1Q4NX 4MVAA 1BVZA 2YX0A 3FVMA 3UCDA 1B4KA 8TIMA 4F2BA 4TV6A 4C1NA 4DNHA 2D2HA 3GRIA 2DSVA 4IJRA 3MHUA 2V69A 3PVFA 4JTLA 4NVTA 2IMRA 1SW0A 4L9YA 2ZRWA 2DW7A 5AZ1A 5I2UA 3ITVA 3MSYA 4RX0A 5D8ZA 3RLUA 3GTHA 4WSHA 4DO6A 4NRRA 3MO4A 1E1CA 4YWSA 3OG2A 4NZJA 1VFTA 1W9XA 3G1VA 2QW5A 1REQA 1UJQA 1TG7A 1CXEA 4NIRA 3NQVA 5J04A 3MHFA 3N1AA 3QOMA 3WQOA 2BV9A 4ACZB 1RD6A 2X1SA 3NYDA 1CEOA 1WA3A 2EPMX 4Z2GA 1D3HA 2RHGA 4WF7A 3UZYA 1UHVA 2PCEA 3URBA 4PBEA 3GXPA 5I3KA 3VUPA 3F4NA 1B3WA 2G97A 3APTA 4QQUA 2Q3OA 3N14A 4JX4A 2BBFA 4OU1A 2EXOA 1AH0A 5EKYA 5K9DA 3UJFA 4CD8A 1KCZA 3TK7A 4O52A 1GVIA 3LMZA 3NZRA 4N42A 3ARUA 2HBXA 1PKNA 4NZ3A 2OCZA 4PC8A 1OFAA 4IUGA 1XGDA 1ZBKA 4XK2A 4XKYB 5ENLA 3H24A 1V3KA 3TA9A 2AAMA 1V5XA 4XB3A 2NVDA 5DRCA 1FWCC 1IGSA 2YKKA 3QY7A 2PF0A 5FJUA 3R12A 4GNJA 1H7OA 1VEMA 1ALDA 3EMZA 2EG6A 2XIQA 3QM3A 2QPXA 3RPMA 1QPOA 2H9AA 4PCNA 3P81A 4N9BA 2EPKX 5TNVA 3PBVA 1MRAA 3PPFA 1QNQA 4RV8A 2DJLA 3UEQA 3B0PA 3UJ2A 1E1CB 2YCEA 4A8IA 4HPNA 4UCGA 3VIIA 3LCXA 2J77A 3CT7A 3ATZA 3RILA 2DVXA 2OEKA 3LI0A 4ADTA 2R6OA 1PVNA 3HG4A 5E70A 1MNZA 3SRDA 2E40A 4PODA 1BPLB 2C18A 1OABA 3GUGA 2B7OA 3AAMA 1WE5A 5JBFA 2W3ZA 3CIWA 1Q7ZA 3WD2A 5GNXA 3PJXA 1AQFA 5F4SA 3KBNA 1E15A 2DZWA 2PFHA 4PMXA 4HNNA 3L67A 4KPLA 3P0XA 4P7RA 2IKGA 4HZ8A 5AHLA 2VWSA 3WLSA 2G3FA 1LBMA 4CQCA 1XLGA 2W27A 2YZRA 2CPUA 3TNOA 2XIIA 2P76A 4XBSA 5KMYA 3P2VA 4GVIA 5K4XA 3VFCA 3TN3A 3SCNA 2POZA 3MANA 1VAHA 3WLQA 2WVTA 4HVXA 1AW1A 1AFSA 3UGRA 4MYXA 3AZTA 4FXFA 2H9AB 2YCLA 2WSPA 3H4XA 3SUUA 1R3YA 1BKHA 3LXBA 4J3SA 3ZR6A 2QNEA 1JQXA 1ZAIA 2ODOA 5HQEA 2X05A 1XQKA 3G1FA 5BU9A 4A3UA 4IMFA 1MZHA 3B8UA 3H22A 1E4MM 4H41A 2PDJA 1GOQA 1TV2A 1W8GA 4MAVA 3HMCA 1K9EA 3BXWA 3J7HA 3VD7A 1AQMA 4DZ5A 5U4NA 2BX7A 1WZLA 4E4UA 3N12A 3S42A 1R2RA 4JYFA 4PMJA 5G4HC 1BTCA 1YBQA 5F2IA 4UUIA 1NSJA 3FV9A 4A8RA 4FSAA 3G77A 4NJKA 3RX3A 1WV2A 2JF7A 3CZEA 2QCDA 1R8LA 3KFTA 3W1TA 1FVPA 3EWYA 4TTUA 2X16A 2HJPA 3B06A 2FYMA 1US0A 4LX4A 4DB7A 4HNLA 3A22A 2BGQA 4AZCB 5TQLA 1J5TA 4UIOA 3UJRA 3IACA 4R7JA 3TUUA 1YE6A 3A4AA 4PCTA 1EH9A 4N6FA 1RPKA 3GU1A 1ZQ5A 1CGXA 2HCVA 2VRJA 2WVUA 1YMYA 3QHNA 4M8UA 1W9BM 4S38A 3NPWA 5HXMA 3KBMA 4UTMA 2VR2A 1RSCA 3ITGA 2O7SA 2YGYA 1ONEA 2DQWA 3IIOA 2YCLB 3DENA 3W70A 1VIZA 3G2GA 4O14A 3TTYA 3LS9A 2O9OA 4H9MA 1P6CA 5CQ1A 1T6MA 3GR4A 1GVOA 2EPOA 2FFCA 1W3TA 1ICQA 3RGTA 4PUDA 3M0KA 3OVQA 2VZTA 4QNEA 4UZUA 5GJMA 4RDWA 1GPWA 9CGTA 4ZCWA 3S47A 1QK0A 3RYSA 4RDYA 2VM8A 3BG3A 2E5DA 3VIKA 3M0MA 2A3HA 3R94A 2OT0A 3IRSA 1H5YA 1YDOA 1Z6KA 4RDVA 4UTTA 3UZZA 1H1ZA 3VGBA 2OZ3A 3P62A 5EPDA 2Y7FA 2NQZA 1RBLA 4IQEA 1YYAA 4OECA 2WNWA 1YX1A 2XFYA 3QZAA 3RK8A 3MBDA 4TQTA 3TXZA 1NFPA 1XUUA 4DF0A 3CHDA 3GUWA 3H7VA 2ATMA 1BXNA 1V3HA 3LBCA 6TAAA 2D0HA 3CUGA 2EO7A 3EPOA 3LM3A 1UG6A 1R2TA 5BOEA 4CN6A 3GKFA 3PPCA 1FHUA 4KGJA 4DXKA 4CD6A 1E72M 1HKVA 1QR7A 3MI3A 3SY1A 5H91A 2OMAA 1TPFA 2A3EA 1PZ1A 1BXBA 1V79A 2EPHA 4AY1A 1I8JA 5TBOA 2C0AA 2AQOA 2YXOA 2C14A 4JCLA 2Y61A 2DT3A 3I3DA 3CQIA 1W54A 2INZA 2VGBA 3T81A 4E5TA 4RE3A 3DG7A 3NSNA 3VKAA 5HA7A 3SCRA 2QR6A 4B15A 1UIPA 2DH3A 3LHZA 4Z1YA 1KKRA 1GHSA 1XIEA 2WANA 4AXNA 1SJAA 2ZVRA 3P6LA 3GU2A 4JTDA 1TFVA 2JK2A 3L5LA 3VNMA 4B5SA 4GIAA 4LS1A 1EJVC 4QDPA 3B05A 2A21A 4A4AA 1HO4A 4JFVA 1AA1B 2PZ0A 1UWIA 4CCDA 2KX9A 3ONBA 4JTJA 3RRXA 3L68A 2OLAA 2GZXA 2YA2A 1Q6QA 5E1QA 1EP1A 2WMGA 1B3YA 1K9DA 3T8LA 2ZWZA 1XYLA 2FB2A 3NFUA 3Q65A 3VI2A 4MDPA 1FWGC 4WXZA 3CHFA 4ZQOA 1KLYA 1SO4A 1L6WA 4N7QA 4I7VA 2AQVA 4YWIA 3U6WA 4LC6A 2PTWA 3A24A 3EX3A 2A85A 5IBXC 4ICMA 3L21A 4Q4PA 1MXGA 4A21A 3UPMA 4EXQA 5AECA 1TV7A 2BY0A 3JZUA 3SCUA 1HVQA 1A4LA 3ZJ6A 5J8LA 5CBIA 4QS5A 3OOQA 4QX4A 1S5VA 1XLLA 4UBPC 4TV5A 4MB5A 4I9JA 2GVGA 3QZEA 4OBSA 1F2JA 5GVJA 3WLNA 3WMLA 2ZKMX 1GTEA 2VZOA 4TX6A 4IICA 3I10A 1VEPA 1M65A 4M0XA 1A4MA 1EL3A 4NF7A 3O0FA 4X22A 1WXJA 3TSDA 3HB9A 1J0YA 2GUYA 5AVHA 1E9ZB 2PDXA 3REQA 3WN6A 4F2UA 1KNWA 1D3GA 1P43A 3PBMA 3SY5A 1OJXA 3N4AA 3I7QA 2PTZA 3A5VA 4Y96A 4U28A 4AHQA 4DLMA 1V7AA 1XRTA 4MY9A 3FN9A 3UJSA 4P8WA 3H2OA 4P7OA 4WOZA 3K4DA 5A2BA 4WY0A 3XISA 3UWZA 1QBBA 5CEWA 1XF0A 2R1MA 1WQ5A 3MUAA 2CZDA 2YBTA 3L7RA 4BZYA 2R8WA 5E5CA 3WH6A 5HR6A 3PAJA 1IYXA 4FP1A 1M7OA 2QQ6A 2X09A 3GNOA 2PI6A 9XIMA 5CPNA 3P8JA 2V3DA 3FEMA 3T0TA 3N17A 3U7BA 2J9YA 3RPTA 3DGBA 1I2NA 3FKRA 4MNLA 1XIDA 3TX9A 1O66A 3ARVA 3ZSSA 4DJDD 2X1RA 3POCA 3PB2A 3GBEA 3STCA 4EKJA 4WJEA 4MNKA 2AGKA 3LHVA 3P14A 4JN8A 2ACRA 4M7SA 1KTNA 1BVWA 2CZ5A 1ZHAA 2WLZA 5I24A 3NO3A 4PUWA 1NP0A 1AQ0A 3SN0A 2H8XA 3VD4A 2CYGA 3STGA 2PDQA 4PRWA 3CV1A 3S5YA 1OHLA 2V2DA 3EBVA 3E74A 2G0WA 4CNPA 1EHAA 1PBGA 4M5PA 3CQKA 3UZWA 1EA9C 1TCDA 3CHVA 4YTQA 4LRSA 3H70A 1MVYA 1DTNA 1PKMA 2VENA 3DOPA 1TIMA 4MGGA 3MZ2A 1XGZA 3WQCA 1OBAA 3QV7A 3B8DA 3T4WA 1CDGA 1Q8AA 4IHCA 4DEFA 3EAUA 2HBVA 3L4VA 1UKSA 1QASA 2W92A 5PTDA 4WY0B 1GPFA 1JZ6A 3DYMA 5LSMA 2BVYA 4HNOA 1VC4A 3K2GA 4JHMA 3S9YA 5I09A 1HX0A 1W3JA 1E6PA 5B80A 4LCSA 5MF5A 2XH4A 3RN6A 3HV8A 4KBXA 3BOXA 1RY0A 1M04A 4IFRA 5H2ZA 4FNSA 1EC8A 2J7BA 3C8FA 4LH8A 1HQTA 4DVOA 1IHIA 3MKKA 1HW6A 4GVGA 4IJCA 5FKYA 4ZBCA 3RU8X 4JNMA 5BZAA 2OQLA 2F9RA 1E51A 4BQ2A 3OA5A 3S2LA 2PDFA 2CLFA 1FH9A 5AZ0A 3N2BA 1XICA 2KZHA 4OBRA 1EJUC 3LZ5A 3IIPA 1V3JA 2WNZA 3M6DA 1BGGA 3TR2A 5KZEA 3SN4A 3WH5A 4GYJA 1VCGA 3QPYA 1TO3A 4M51A 3K1DA 3ARXA 2AGTA 3N2XA 2DDXA 4G7FA 4ML4A 2X40A 5LHEA 2Z1WA 3T8QA 5FSEC 3H4GA 3CLWA 1E6RA 2VOMA 1NU5A 6REQB 2CIPA 2I5IA 3L4YA 2WMFA 4GQRA 3G6MA 3GH7A 3I4EA 1DWHM 1VFUA 1PJ9A 3TYDA 3ANVA 2PLJA 2FZMA 1GQIA 4O53A 4CNOA 4O0KA 1EZWA 5A6TC 4OVXA 4DJDC 2UWFA 2PE4A 2PDWA 2V5CA 1QPRA 3FJNA 4BF5A 4IM4A 2VGGA 1H0GA 4JIHA 2W91A 1SUXA 2J7CA 3GYCA 1ODZA 2PGRA 1R30A 1FCVA 4ATWA 2BXVA 1OYAA 4JTKA 3IRDA 1EA0A 1N8FA 3ZVHA 5JH2A 2D3LA 4PTMA 3CHEA 1Q2SA 1P1MA 1POKA 1E4NA 1P4CA 2A7PA 1FCUA 2WYSA 4CNTA 3N9KA 7TIMA 1A5BA 3NM1A 4FX8A 1W8SA 1KD0A 3AALA 3MSGA 4GCAA 3VMNA 3TTQA 4UMBA 2BVDA 3V4BA 4ADUA 2ISFA 1EZ2A 2OPJA 3KHDA 1V7YA 3SJNA 5FF0A 2CKSA 2BXYA 1WZMA 1G1YA 4PE8A 2NQHA 1PUDA 3GG1A 3W7QA 1XCXA 1UH4A 3KOXA 4W5ZA 1RV8A 4FR1A 1JD9A 3S4TA 3WLMA 3P5ZA 4JPGA 1EKOA 3VIOA 1ESWA 1J12A 4NJGA 2Y7DA 3LYEA 3EPNA 3UXKA 1JCMP 3F4WA 1PS9A 1L8PA 4HJWA 4ENLA 3CASA 1NVMA 1KRAC 4UOJA 3FAXA 3MVIA 3ZSTA 4G5DA 3THQA 2QKFA 3FLUA 3EOUA 2XVGA 2CLOA 3ARPA