5EPDA

Crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
361
structure length
348
Chain Sequence
TLFQPTSLGAITLANRIVMAPLTRNRAGAGFVPGELTAGYYAQRASAGLIISEATQISQQGQGYQDTPGIYTQAQIDGWKKVTAAVHKKGGRIVLQLWHVGRISHVNLQPNGGAPVAPSAIRAEVKTFVNNGFVDVSEPRALELEELAGIVDDFRKAAANSIEAGFDGVEVHGANGYLLEQFAKDGANMRTDTYGGSVENRARLMLEVTAAVAQEIGPERTGIRISPVSPANGISCSDPQTQYDYIVDKLDALGIAYIHVVEPFDYGSLRRRFSRTYIANDLELATSHLADGRADLIAFGRPFIANPDLVERLQSGAPLAEVNAAKIFGGSAAGYTDYPRFSETTSDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerol trinitrate reductase
publication title The crystal structure of XdpB, the bacterial old yellow enzyme, in an FMN-free form.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Oxidorecctase
total genus 125
structure length 348
sequence length 361
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5epdA00
1H61A 3C2OA 3QEZA 3TIMA 4O1BA 1H50A 4NX0A 5CPLA 3T7VA 1LBFA 3NM3A 4XKYA 1F73A 4O16A 3HPXA 4JTTA 3TX9A 5LNRA 1I4NA 2BSLA 3LTSA 5DXXA 1O60A 5K7JA 1SSDA 2ZCGA 1GTEA 2HMCA 4KFOA 4MZ8A 4I7UA 2GQ9A 4IMEA 4O19A 4JDYA 1D3HA 2Z6IA 3NPXA 3KX6A 2VKZG 4A22A 4HNVA 1YXCA 5EA9A 1QNVA 2QCCA 3LDVA 4DF2A 3QMTA 4NZFA 5C54A 1W37A 4RLIA 2C19A 3NG3A 1SZNA 1QAPA 3P61A 3M47A 3LCXA 3LHZA 3W1MA 1H5YA 4IMFA 3UXAA 2OZ0A 1QPNA 3ZWTA 2ZZ2A 2KZHA 1PHWA 3QQ1A 4FXSA 4NVTA 4HKPA 3JS3A 3W86A 3KFTA 1OF8A 2H8XA 3L0KA 2Z6JA 3R89A 1K8XA 2B0MA 1GEQA 3LXAA 8TIMA 1JCYA 3C6CA 1G7VA 4N9EA 1W3IA 3FJ6A 1KTNA 1TPEA 3O16A 2Z0IA 3C56A 3UZ5A 3ZS4A 3KVJA 3GX9A 1PS9A 1WBJA 3EXRA 4O8RA 3NO5A 3PUOA 3CM4A 3L21A 1KLYA 1TTIA 3QQ0A 4JNMA 1J4EA 2VFHA 3W7LA 3PF3A 3W1PA 1M7OA 1EUAA 1TPH1 2E5BA 1C9DA 4HSOA 2A7PA 4LY8A 3NL6A 3QRHA 1ME9A 2FPTA 2Y88A 1I2PA 4GJ1A 7TIMA 4OE7A 1L6SA 1KM3A 2CLKA 2PE4A 2I14A 4TMBA 3W83A 1VLWA 4IWWA 2QCMA 1LZOA 3IGSA 3B06A 1K7FA 3BVJA 4P2VA 3DFPA 5BW6A 1SW7A 4U4MA 4C1KA 3KRUA 1EP3A 1G4PA 1M6JA 5D32A 4HN4A 4AWTA 3S1XA 3GDRA 4K6AA 4MJZA 4ADUA 2V9DA 5KZDA 4AF0B 4I7WA 1KV5A 1Z41A 3P5ZA 4YXGA 3N2MA 4JY9A 1TPDA 4RKAA 5K9XA 1S5VA 3G1XA 1KV8A 4O15A 3NDOA 5HMSA 3LLDA 1H1YA 1XDLA 3TQKA 3G1VA 2J9YA 3G22A 4BI7A 3N9SA 5F2LA 1LM1A 1VGAA 1TPC1 5E1QA 1HFBA 3WK0A 3NAVA 3NYZA 4K36A 3TKFA 4OU1A 1JQVA 3MYPA 3IRDA 1OFOA 3WJXA 5I3JA 1W31A 3C52A 5D33A 4O10A 3DU0A 1CX9A 5LSMA 1GVFA 1YXYA 3PY2A 3MYOA 3PUDA 4HNNA 3R8RA 5LGXA 4GBUA 3PSVA 4WZHA 4YL2A 3BLIA 5FEXA 5EYWA 3T78A 3W22A 4N6EA 4UR8A 4LNYA 2YFOA 4UFMA 5K3VA 2JKEA 3WK2A 2B4GA 3CIWA 3LHVA 3PB2A 3MI2A 4E2DA 4YCPA 4ZL1A 3BG3A 2VEKA 2Q8LA 1NF0A 3L0GA 4JY8A 5BMWA 2JGQA 1FWSA 5EPDA 3OVRA 3O15A 3SGZA 1H1ZA 5HUOA 3LCLA 3PB0A 1RR2A 4I9AA 1J5TA 3M1ZA 3FJLA 3M44A 3PG9A 1PV8A 1LOSA 1TQXA 3CEPA 3O6CA 4FHAA 3QFEA 5CZ0A 1P4CA 3NQ2A 1G69A 2NX9A 4XZ9A 1B4EA 1CW2A 1UB3A 1MO0A 3TW6A 1ONRA 3W71A 2OMAA 4OV9A 3DFNA 3C8FA 2VEPA 2Y7GA 2YYUA 5EY5A 2CLLA 3BLEA 1TPFA 1UBSA 3FYPA 1Q3NA 3GAYA 5D03A 4MPQA 3C0JA 3P5YA 3TV8A 3EWYA 1T8XA 4UTTC 2CZEA 1XDMA 4DO6A 3BW3A 4JXCA 5C6MA 1VJIA 3W85A 4UTKA 3GXTA 3TU9A 4GUIA 2QDGA 1MSSA 1TPB1 3DZ1A 4AAJA 1NAL1 3CWOX 3W2JA 3DFTA 1XKYA 3GB6A 4BFAA 3G18A 4UUIA 3S5OA 3SZ8A 2X30A 5HQEA 1YYAA 1W0MA 1LBMA 5CZJA 5BOOA 1T99A 2QUVA 4AH7A 1BTMA 5CZSA 3H53A 2RDTA 5J5DA 3W7PA 2Y7EA 4GWEA 4JIPA 4WXZA 1K7EA 1TQJA 4AVFA 1FDZA 1PL9A 5AHEA 3WJYA 4ZZ9A 2ISVA 1K8YA 1WAUA 3GXPA 3QH2A 1DOSA 3DKLA 4Z1DA 1FWWA 1ME8A 1A5CA 3NQDA 2DP3A 1GG0A 4MIMA 3TDFA 2PRHA 1Q6QA 1X7FA 4IMDA 3W1NA 3GKFA 4H4IA 1YDOA 3M7WA 1YTKA 5DBTA 3MHGA 4CQAA 5HWJA 1XBXA 3R5EA 4UMBA 3UPBA 4L4MA 2RDWA 1N55A 3W76A 3FFSA 3W2KA 2F84A 2YGYA 3W7GA 4BWLA 3LXBA 3LV5A 1EPXA 2YSWA 3CC1A 4Q32A 5BMXA 3B4UA 4QNWA 2DZWA 1K8ZA 4WOZA 4BK9A 3EWUA 1A5SA 3UWYA 5CPOA 4DO5A 1XC4A 2C6QA 2E5CA 4RX0A 5FEWA 4XBKA 1Q45A 3MP4A 4IXXA 4UNLA 3LB0A 1RPXA 2YR1A 1TIMA 1XM3A 2AAMA 3PVFA 1OFPA 5T26A 2G5WA 3RMJA 1VYSX 2QCGA 3L0NA 3C2EA 3LCWA 3QC3A 2GVJA 1L6WA 3L65A 2W6RA 2PCQA 1KFJA 2QUUA 2B7NA 5G1YA 5LNWA 1O5KA 3SFKA 1VHCA 5CSSA 2GJNA 1XI3A 4JTHA 5G1TA 1C8VA 2F7FA 4LC6A 4O1AA 5HWNA 5DY3A 1WX0A 2WPBA 3PM6A 4K8HA 3S6DA 3QSTA 5EKYA 1W3NA 3KXQA 4QAIA 4K7VA 1CI1A 1GVSA 3EXTA 4K37A 3VE9A 1B57A 3IGXA 1TO3A 5LGZA 3I7QA 1TRDA 1YTEA 1FY6A 4BWLC 1W5PA 5DCDA 5GVJA 5AC7A 2O7QA 1UUOA 5K2ZA 4LV9A 2X1RA 5FESA 3SECA 3HG4A 2XN2A 1FCUA 2CZ5A 3BGGA 3PSWA 3DI1A 3PBYA 2BWGA 1OX4A 3Q94A 1ICSA 2A7NA 2CLHA 3TMLA 3EX4A 5HNRA 3W1TA 4BR1A 1H60A 2C1HA 3A22A 1GWJA 5C5YA 4HPXA 1LRTA 1OYAA 3QW4B 1ICPA 4IJBA 2QAFA 4MZ1A 3U2OA 3IVSA 4EIVA 2TYSA 2Y6ZA 3PUEA 4OQVA 5K9CA 2G95A 3BARA 5D09A 4O13A 5A5WA 3G0UA 1ZNNA 3DHFA 5KITA 3ZR4A 3NQEA 2BTMA 2XFWA 4S2BA 2Y70A 4WD0A 3GNDA 1EIXA 3GZ3A 1P0NA 4IQLA 2ZZ3A 3NXFA 3MW7A 5HJLA 1TV5A 3I6RA 3M5XA 4O1DA 1F6KA 3P74A 2CLOA 4ZQOA 1YLVA 3TH6A 5D2XA 5AYZA 2ZFAA 4L4LA 5LNUA 2TMDA 4Z0JA 4O0KA 3M43A 1NF7A 3CEUA 3P81A 5ABTA 3P62A 4ZVJA 2WSRA 4M7TA 4N2YA 3S5YA 1XL9A 3I7SA 1MZHA 1HO1A 2JGYA 3STGA 1H7OA 1IF2A 3IIXA 3NOEA 4YMZA 3RNDA 3UPWA 3MWAA 2ABBA 2GUUA 1F2JA 3UNDA 4UFJA 1GVQA 3BG9A 4ICNA 1IXOA 1I2QA 3B0PA 4Q33A 3TQVA 5TQLA 1QWGA 5AHMA 5D04C 1TSIA 4Z08A 1GVOA 2ZYFA 4G1KA 3WJZA 1VZWA 1LTDA 1A50A 3QYQA 1TV7A 1SPQA 3TE9A 5D2VA 3OEXA 3GR8A 2QCDA 3N9RA 1GPWA 1B4KA 1JCNA 4UMCA 1AG1O 1HO4A 3NL3A 1OABA 1SO3A 1JCLA 4NXSA 3L5LA 1M7PA 2QDHA 3LCHA 1DQWA 1NEYA 2H6RA 3W07A 1SW0A 3HF3A 4DPQA 2ATMA 3PWAA 1F6PA 1X8FA 2ISWA 2TPSA 1KM5A 2C14A 1ALDA 4LS0A 2ZQ0A 3NL5A 4EOUA 2VELA 2Q3RA 3UWZA 3W2MA 4O1CA 4JYFA 3M41A 4JX6A 3A5VA 1O5XA 3TROA 3RK8A 4E2BA 5C2XA 2JBMA 4KKXA 5EBUA 1TREA 3PBWA 5F4XA 4WY0F 1W8SA 3W1QA 2EHHA 1QCWA 2FFCA 3IGUA 1L9WA 1Y0EA 3O63A 4JTGA 4UC5A 2UV8G 3CIXA 4JICA 3WFAA 5FF2A 3TJLA 2H90A 2B7QA 4R7JA 2Y61A 3SY5A 3B0VC 3N34A 2E5DA 1HTIA 3OVPA 2A1YA 3LCGA 3NZRA 3TUUA 1B9BA 5CPNA 5I3IA 3NR0A 3LHYA 5IBXC 1NFBA 3O6YX 4O11A 3GLCA 1WOAA 1LOLA 1IGSA 4Y6GA 5FF4A 2J27A 4UFHA 1JRBA 3G0XA 4FXRA 4NU7A 4PA8A 4POCA 1WXJA 3LTYA 4M6VA 3G0SA 4DELA 4WY0B 3Q2DA 2DJXA 4M5PA 3QPZA 1V5XA 1TPVA 4JTEA 4N4QA 3L5MA 1I45A 3LCIA 2CLMA 3TA6A 2W0UA 4HHPA 3IEBA 3TXVA 3F03K 3HGSA 5H91A 4W9TA 3G8EA 3LXCA 5C55A 1XXXA 4AHQA 1YXDA 4UTIA 3EXSA 3N2XA 3HJZA 4JTJA 3LTPA 1W1ZA 3UZJA 3Q58A 2YPIA 2VENA 3M0ZA 3P67A 3NGJA 1FWRA 4S2CA 3K30A 2C13A 2DJLA 3I65A 2V5BA 3NL2A 1WYIA 2JKPA 3GXNA 2DZVA 4QIUA 4JTLA 1BEUA 3M5ZA 3ANYA 4MLRA 4ZQNA 3L2IA 1C29A 4O50A 1KFEA 2CLIA 4QJ1A 3KOFA 5L6UA 1LLZA 4XTDA 4OV4A 1H7NA 4UTJA 1WOBA 4JD4A 3W3OA 1DQXA 4CNOA 1ZHAA 3P7YA 1T0OA 2FPVA 2WSQA 3EWXA 1KM2A 3L67A 1BWLA 2C3ZA 1ADOA 1VR6A 1R2RA 3Q37A 2GVLA 2IQTA 1JULA 3A9IA 3LI0A 2WNNA 3CTLA 1T96A 3SJ3A 3H54A 1LOQA 1EWEA 2FTPA 2V2HA 3R2GA 4PCFA 3UWVA 4UTTA 1F5ZA 4JX4A 2I9EA 5KTLA 4EWND 1AW2A 4MY1A 2DZXA 3WK3A 3MJYA 3SIZA 1AW1A 4LVBA 4JN6A 4CQ9A 5IM51 3CPRA 3P82A 2VEMA 1JVNA 5F2IA 1EB3A 1FUYA 1VCVA 4B5NA 3M9YA 1G4TA 2QCNA 3LBMA 1LBLA 2EPHA 4GFSA 3CB8A 2A85A 3KVLA 5LHFA 2HS8A 4LT9A 4ZQMA 4NJGA 1OX5A 5I3HA 5FF0A 2VFIA 5LNVA 4ZMGA 1P1XA 4AF0A 1F05A 3W2NA 3EKZA 3VNDA 3LRKA 3KHJA 4JTIA 1HL2A 1AMKA 3V1PA 2YX0A 1OFQA 1PCKA 1R30A 4S1FA 3HG5A 2A21A 1W5OA 3W1LA 4RJEA 1EP2A 1SZFA 5CPMA 4Q4KA 3W73A 1GYLA 2V0TA 2YFNA 4IMGA 3W7CA 4OBTA 5D2TA 4YCOA 3GIYA 4JTKA 4M7SA 2O7SA 1H63A 3TAOA 4O52A 1K02A 4O18A 3KVKA 2QJGA 2WOQA 3PC0A 3QPYA 5DLCA 2YYTA 3A21A 2V81A 1O95A 4ZQPA 2BZNA 1OFEA 3QSRA 4MVAA 3TQ0A 3LHUA 2J9ZA 5LKYA 1TMHA 2C16A 4A2RA 2QJHA 1XUUA 4Z1BA 1R46A 3TAKA 5HINA 6ALDA 1KM4A 4LU0A 2GQ8A 2H8ZA 4NQ1A 3WJWA 3U8GA 3MO7A 3G24A 1AL8A 2YZRA 1RQBA 2QJIA 2ZBTA 3FA5A 5G5IA 4LWWA 5AFDA 2DORA 3W7JA 2YDAA 1H7WA 2DZSA 3VFLA 1TTJA 3BV4A 1K7XA 5DBUA 1S3HA 5D2YA 2CU0A 2GJLA 1FDYA 2B7PA 1IXNA 3G1SA 4JDBA 1N7KA 2OCZA 2QEZA 4NXKA 2Y63A 4LVAA 1RV8A 4A21A 3TXZA 2ZZ7A 4LS2A 1R2TA 2NWRA 1JUBA 3EEGA 4U28A 3BW2A 1GOXA 3W70A 5H2ZA 4QITA 3M16A 1W3TA 2NXHA 3E49A 1VH7A 5BNKA 3L9CA 4N9BA 4WQ6A 2GOUA 4JIQA 1ZCOA 5D05A 4UTLA 1RQHA 4QQ3A 1OFBA 3E02A 4LVGA 3THAA 3NQ7A 4IPJA 1S5WA 1FQ0A 2J6XA 1XBYA 3IIOA 2ZTKA 5FEPA 1Q6RA 4DBEA 3IV3A 3NZ1A 4DF0A 4HSNA 4I7VA 4H6KA 3NPVA 1G4SA 3I7RA 2BXVA 4GXMA 2WQPA 3GDLA 4LTSA 3M5VA 1EWDA 3CQ0A 4QNEA 1QPOA 3W23A 4BF9A 1OX4B 3LV6A 3W2LA 4A29A 1ZALA 4RK8A 1WDWA 1Z44A 2WJZA 3S1VA 4IXHA 1Z48A 4GNJA 3TNOA 1MEIA 2AQWA 5HR7A 3AJXA 1U5JA 3G1AA 5FI8A 4AWSA 5DXYA 3D0CA 3HO8A 3HG3A 3T44A 4IOTA 2HTMA 4N4PA 1FBAA 3LOTA 4QISA 2HSAA 5E0KA 3MP5A 5CKSA 4FF7A 4NUWA 1YDVA 4LUJA 4RR4A 4RXFA 4J9JA 4UNKA 3VI2A 4BI6A 3W75A 1XUZA 2ZA1A 3RLVA 2Y85A 3EX3A 5F4SA 4MKNA 3UWUA 4HNUA 1K03A 2E77A 1MXSA 4E38A 5FF3A 2R91A 4O0ZA 1QO5A 3PAJA 5CGQA 1IIGA 3V75A 3T4CA 3E0IA 4NNBA 1VHNA 3HGRA 4MYXA 5AHNA 1TV8A 4RXGA 4UTWC 4D2JA 5G4EA 4O17A 4UFIA 5TBOA 4JYEA 4NNAA 4O4WA 1PHQA 1ZY9A 5AN7A 2P1FA 1TJPA 1QPQA 3W74A 3FS2A 3G1YA 5KZMA 4JR5A 1PIIA 4PL1A 1PE1A 4IMCA 3LRLA 3L66A 2X1UA 3GKAA 3R12A 4RZ4A 1TB3A 4IGHA 2X1TA 1DL3A 4MOZA 3T55A 5FF7A 3MUXA 3W7EA 4FIRA 1VS1A 2A7RA 5J5RA 2EGZA 5KSWA 3P8JA 1JJKA 3H55A 3MBFA 5AC8A 2FQIA 4RZ5A 3UY8A 3NQCA 3GDTA 2LLEA 3B8DA 1OHLA 4LVDA 5CG7A 2QCEA 4X22A 3HG2A 1SZGA 4WOQA 4TIMA 3UWQA 1EP1A 4C1LA 4CQ8A 2QCDB 3TR2A 1JUKA 5EL1A 4Z1CA 2Q8ZA 1H7RA 3EX1A 3JR2A 3PBUA 3SSJA 1RD5A 4ML9A 4DPPA 1QPRA 3OG3A 3TK7A 4LOCA 4XUGA 3UXDA 3W7KA 1VYRA 4MFEA 3W84A 1KFBA 4NNCA 4N6FA 1U83A 5D38A 4OWGA 2RFGA 4DBDA 4FNPA 1OJXA 5F2MA 1JCJA 3C2RA 4FNTA 4Z1AA 4UFKA 1LYXA 2JKAA 2FLIA 3LGEA 4XTIA 5D2WA 2DZPA 1DHPA 3LHTA 2C15A 1OF6A 4TMCA 1ICQA 3W7NA 3ATZA 2BX7A 1KFCA 2BLEA 3B03A 4RZ6A 4WJEA 2Z2UA 1D9EA 3BGJA 4PTNA 1G7UA 1VCGA 3PBVA 3NA8A 4QM1A 3CWNA 3DI0A 3TSMA 3FLUA 3E96A 1QOQA 2VFEA 3TC7A 5D37A 3S5ZA 2ZRWA 3G1HA 4UMAA 2V2DA 3B04A 4XKYB 2R8WA 4O57A 5IBXA 3UYCA 2VFDA 2E1DA 3FKRA 3FYOA 2ZRXA 4NX5A 5AHFA 1ZAJA 5DCEA 1DJNA 1LDCA 2JK2A 5AB3A 2RHGA 2ZA2A 3W7IA 1UUMA 1QR7A 1W54A 2ZRVA 1VQTA 4IX2A 5AHLA 4NJKA 3QMSA 4YLWA 3UWWA 3NM1A 2V5LA 2OT1A 3MBDA 2WV8A 4ORMA 1P0KA 1W5NA 1MEWA 4GUHA 4RV8A 4KFNA 4O53A 3BW4A 2P0OA 2QR6A 1AK5A 2QUTA 4AXKA 3IIVA 2CLFA 1ZENA 5HUPA 5CZTA 4K7YA 4FNQA 1JCXA 2YW3A 1L2UA 1H51A 3G1DA 4K8EA 1LP6A 3NVTA 1N8FA 4RCXA 3OIXA 2QCLA 3KAOA 1OG0A 5DY2A 2ZZ4A 5K4XA 1EA0A 3DXIA 1DKWA 1F76A 1QO2A 1FWTA 2V30A 2VXNA 2E68A 4EVZA 2J9XA 2PRMA 4GC4A 3ABRA 4TU1A 3HPZA 3S9YA 1X1OA 2E6FA 2CWNA 1YPFA 1GYNA 1ML1A 1TTPA 3NQ8A 1DJQA 4N9CA 4FIQA 3S8HA 2CLEA 4IX0A 4DXVA 5EMUA 1YTDA 4FNSA 1I2NA 2C0AA 5AYYA 2FIQA 4FO4A 4K38A 5HWMA 1KM0A 3GNNA 4UR7A 4PFMA 2V82A 3DFSA 3GAKA 1SO4A 3AO0A 4JX5A 4Y96A 2NXIA 4KWVA 3TSBA 2NWSA 4FX7A 2QAPA 5AC6A 3MI6A 4LC8A 3W7MA 1W5QA 5U4NA 1NSJA 3RF9A 5LZLA 2NUYA 1KM6A 2ISSA 2J24A 2NV1A 2DU2A 3INPA 4ZQRA 2E6DA 3M5YA 3BLFA 2CZDA 4FX6M 3STEA 1XBVA 4LS1A 1IXPA 1SUXA 4R53A 1SFLA 3A23A 2J88A 4TR9A 1TYGA 3BK0A 1EUNA 3SI9A 1D3GA 5G2WA 3DFQA 1UASA 4ALDA 3BG5A 1VYPX 2WKJA 2OX1A 2I1OA 1OFRA 3C2VA 2VEIA 3R13A 2R94A 1GZGA 1O94A 2NV2A 3LERA 3GDKA 3EX6A 4KFPA 1SO5A 2EKCA 1LROA 1FDJA 4LV4A 4CNNA 3C4UA 1G67A 4Y8FA 1NVMA 2ZTJA 3W6YA 4JS3A 4PC8A 3NNTA 4WY0A 1KBJA 2AGKA 5FEZA 3EWBX 3UY7A 3IIPA 3W88A 1JUEA 1L6YA 2NX1A 2Y7FA 5KINA 4NJIA 3ZFHA 4PODA 1V7YA 3P60A 4LUIA 1VCFA 4ONVA 3NQMA 3W7QA 2EAWA 2Q3OA 1KTBA 4MYAA 3U6WA 4O54A 3W7OA 4UTMA 3DBPA 1DVJA 4LVFA 3UD6A 1MEHA 3TFXA 5G2HA 2QCFA 2NUWA 3STCA 3ABQA 2FB2A 2VFFA 4MUZA 2WSYA 3ABSA 1UCWA 3OA3A 4Z0SA 2WNZA 4Y9AA 1H7XA 4AWUA 5KZEA 3B05A 3S1WA 3NPWA 1FXPA 1G6CA 1OX6A 1JCMP 5A8GA 5DN1A 2G96A 4OHQA 1TRIA 4X9SA 1ME7A 4N02A 1OYCA 3FKKA 1OVDA 3PR2A 1AL7A 4IUOA 1S5TA 1TTQA 3O8AA 3B0UX 3STFA 1GVRA 3N3MA 3VKJA 1SW3A 4MY9A 4O4VA 1RVGA 3DKJA 2PC4A 1SQ7A 1Q6LA 3M6YA 5DCBA 1FWNA 3W87A 4A3UA 4NJHA 2DZUA 3CLMA 3NEVA 5HR6A 2NX3A 3NQ6A 3O07A 3PULA 4CCEA 1SSGA 1B3OA 4PL2A 4CCCA 2E6YA 2ZZ5A 1A5BA 1EX5A 1QDSA 3E9AA 4LRTA 1JRCA 1FX6A 5AHIA 1K3UA 2C18A 3LHWA 4MY8A 1A5AA 3FIGA 5G2IA 4LRSA 4O14A 3BO9A 4MZYA 1VRDA 2YCEA 3TFCA 3I68A 1YADA 3YPIA 4HT3A 1SU5A 2GQAA 3W7DA 4UTUA 2H3BA 5D02A 2WNQA 3DFOA 3TCEA 3PG8A 3THQA 2CW6A 3LCFA 1THFD 5BRBA 2FPYA 4TO8A 1AW5A 5E93A 4CCDA 3WJSA 1OFAA 2A5HA 1R47A 2A6NA 4DEFA 3ATYA 2ALDA 2HS6A 4JTFA 1KTCA 4BI5A 4Y90A 2ZDRA 5K4ZA 3S42A 4JEQA 1XBZA 4XQ6A 1O4UA 2VOMA 5I3GA 1FCQA 4DQWA 2OT0A 5LHEA 3E12A 2FJKA 3QZEA 3F4NA 1VLIA 4M6QA 3LM7A 1OYBA 2TRSA 3IVUA 2TSYA 4ORIA 3SGUA 3NQVA 3IVTA 3OBKA 3W72A 1G4EA 2NXGA 1GT8A 2NUXA 2NZLA 3TJXA 1EEPA 4FEZA 1SFJA 4ADSA 3C2FA 3MHUA 1GJPA 4A2SA 1JQXA 4PH6A 5F2GA 1UJPA 2ZRUA 2ZZ1A 1DV7A 2A6LA 4JTSA 2VC6A 1RZMA 2XN1A 4YWIA 4HPJA 5D30A 3W1AA 2A4AA 3HQ1A 3MHFA 1X6UA 3ABOA 4N9DA 1DBTA 4GE8A 2Z1BA 4GUJA 3F1QA 4UTWA 4R33A 3EWZA 1I8JA 2QKFA 4WUIA 3HB9A 3TSDA 3UQNA 1KBIA 2B7OA 1XFBA 4X3ZA 2PRLA 3RU6A 3CU2A 4JYDA 4NT0A 1ZAHA 1TPUA 3DHDA 4K39A 4AHOA 3QMRA 3ZWSA 3TMQA 3W7RA 3KRZA 3QF0A 3A5FA 1LLWA 3RFAA 2FDSA 2X1SA 3DGRA 1IXQA 5LNSA 1TJRA 1R2SA 3O1NA 4DO4A 3OVQA 4X2RA 3KVMA 4NJJA 5I3KA 4AMAA 3P84A 3IIZA 1YPIA 1TPWA 3G3DA 3HGJA 3W9ZA 1H62A 1BKSA 3DENA 4MJMA 3HBLA 5I3FA 2RH9A 4OGZA 1ZAIA 1OK4A 5KMYA 1P5BA 3USBA 3GK0A 1BWKA 5F1UA 1FCBA 4FB7A 6TIMA 3MI3A 4O12A 2A0NA 2W79A 4M6PA 2A2IA 1JR1A 2CZFA 3GVGA 2E6AA 4M19A 4FNRA 1J2WA 1WBHA 3CHVA 5G4WA 3LX9A 3P80A 1F7BA 3QM3A 3GR7A 1W56A 5K9DA 4JTUA 3L68A 5DELA 2E09A 1DORA 4UFLA 3N73A 3CT7A 4UTHA 1KM1A 2ZRZA 2X16A 4AB4A 2CFFA 1QFEA 2ZZ6A 3NQAA 4UXDA 2Y89A 3ELFA 3W1UA 3LBCA 3O06A 3LRMA 4H3DA 3BPWA 3MP3A 1F74A 3QW3A 1KLZA 3L5AA 1QOPA 3N14A 4JGDA 3W7HA 2PURA 1SZEA 4P61A 2V8ZA 4DF1A 4E0CA 1I2OA 3G8RA 1FXQA 3HMJG 4EF9A 2QF7A 1VC4A 2H3DA 1PVNA 1W5MA 3HGOA 1I2RA 1ZJIA 3A24A 4IPIA 1YDNA 3O05A 3LLFA 4XBSA 5F1VA 2Y7DA 3W1RA 3DAQA 2ATSA 3NPUA 4R34A 3S0CA 1OFDA 2ABAA 1IIHA 4WX2A 1HG3A 1GTHA 3SR7A 3NQGA 4PEKA 4GUGA 2NLIA 3GDMA 3RLUA 3W2UA 5CSRA 2FB3A 3JRKA 4OT7A 3O6DA 5SWUA 2OJPA 3VE7A 3EKLA 1KFKA 1PCWA 1VPXA 4CNPA 5MHBA 1A53A 4UCGA 4MFDA 1LCOA 4EF8A 4WXYA 4ZQCA 1E51A 2R14A 3N19B 4HNTA 3HPSA 2ZRYA 1WQ5A 2YXGA 1FCVA 3T40A 2D73A 5L9FA 4FNUA 5AYXA 1SR9A 2GPTA 1KA9F 3FEMA 4KWWA 4NZJA 3DH7A 5F4WA 4MLJA 3SW6A 3NQFA 2QCHA 3PS7A 1XCFA 3TC6A 1OK6A 4GUFA 2P10A 4QSHA 3OHIA 1GQNA 3MMTA 1Q6OA 1KW1A 4XWUA 5HULA 1RQEA 3TW7A 2VFGA 3EWWA 4FX8A 2YW4A 3C3NA 4CLMA 3G3MA 2V2CA 4O28A 1ZFJA 2EF9A 3G1FA 1WA3A 3KRSA 4HIBA 1TCDA 3EX2A 2ZA3A 5TIMA 4UIOA 4ADTA 1M5WA 2G97A 5U7SA 4AHPA 1GG1A 2WO5A 2DZTA 3WK1A 4LW7A 1Z42A 3FOKA 4AEOA 1H7PA 3QJAA 2GVGA 3HOJA 1QMLA 3W1XA 1LRQA 3C61A 1KFLA 4GRSA 4TX9A 3S5NA 1LRNA 2Y62A 1LORA 3LI1A 2RKXA 3P8IA 3HIJA 3F4WA 5AOUA 2RDUA 3EB2A 1HUVA 3S1UA 2XN0A 2X2GA 1WV2A 3GYEA 3VCRA 1X1ZA 1SO6A
chains in the Genus database with same CATH superfamily
2HK1A 3KZSA 2Z24A 4YVVA 1E5JA 3CQJA 5CPLA 1HXJA 4XKYA 4UZUA 1F73A 3HPXA 3TX9A 2BSLA 4CNUA 1W1A1 5ECUA 3NDZA 3NPXA 4A22A 2G4JA 1QNVA 3LDVA 4DF2A 3QMTA 1UHVA 4C91A 2XIBA 1EJUC 1MW0A 3NG3A 3RX2A 2YCKX 1XIGA 2WMFA 2GDQA 3H7UA 2BY0A 1H5YA 2OFJA 3RUBL 2OZ0A 1KD0A 3MO4A 1BAGA 2ZZ2A 1PHWA 6XIAA 2GSEA 4ERAA 3QQ1A 3KL5A 2XJ7A 1Z3NA 3AIUA 2Z1VA 2XM2A 4PN2A 2H8XA 2Z6JA 2PF8A 2DIKA 2PP0A 4L7ZA 5A1AA 3S2LA 3FA4A 3M4HA 3C6CA 4F0MA 1JFXA 1QVBA 1TPEA 3O16A 1UPMB 4HMDA 3UZ5A 3V5OA 3ZS4A 3GX9A 4X61A 3EXRA 4O8RA 1PPIA 3AUOA 3QQ0A 1JZ5A 1J4EA 1F4AA 1UIOA 3W1PA 2PPGA 4F0KA 4IGSA 2J4GA 2FPTA 1M65A 5REQA 4GJ1A 1I0DA 4Y9OA 1J12A 1KM3A 3A64A 2I14A 1GQLA 4IWWA 4FLOA 2AL1A 1Q6EA 5BW6A 2J13A 1VIWA 1JYWA 1G4PA 3S1XA 3GXIA 3RJXA 2VT0A 3GG1A 4ADUA 2V9DA 2VCBA 5MKGB 4B5WA 1BHGA 1EJSC 1SMAA 2ZUVA 1W1IE 1O5QA 4UQDA 2CERA 1CLXA 4AYSA 4RKAA 4E4UA 3BMWA 4RZBA 3K8KA 3B8WA 2NLYA 4BS0A 1YNYA 2PD5A 7CGTA 1XDLA 5CBBA 3G1VA 4BI7A 1HFBA 1HF6A 3CMGA 4K36A 3MYPA 1OFOA 5D33A 4EXBA 2V68A 4U2ZA 5J8LA 1HKMA 1MRAA 1E9YB 4LBSA 5IRPA 3UCDA 4HPHA 2D2JA 4XZLX 3MANA 4MF4A 1BQCA 1FFQA 4OFCA 2YFOA 4GVGA 2PZNA 1B2YA 1U1JA 2GK1A 4E2DA 4ZL1A 1TV2A 2FGZA 2VEKA 1NF0A 4JY8A 5BMWA 5FAJA 2PDYA 5DRIA 5HQMA 4B2DD 2Y8VA 2BOFX 2EQDA 1P7TA 3KDOA 4L1WA 2PS2A 1VBJA 2QUNA 3CEPA 4HHMA 3FCPA 1P4CA 2XIJA 4XZ9A 1CW2A 1V8EA 1LL6A 3DFNA 3C8FA 2VEPA 3R0UA 2Y7GA 4PBGA 2YYUA 4HBKA 3UXIA 5HK4A 5I23A 3R1ZA 4PTMA 2CZEA 1CDGA 1R3WA 3CZGA 4DO6A 1LQ2A 1SJCA 1VJIA 3W85A 5JIPA 3DZ1A 1L6FA 4AAJA 3GB6A 2GJRA 3VNMA 3PANA 5HQEA 4BZYA 2F6XA 3E6EA 1T99A 5CZSA 2VEFA 2Y7EA 4BY3A 3TOYA 4B3KA 4L6DA 3GXPA 4AZIA 1KRAC 3MKKA 1DOSA 1TG7A 1A5CA 3NQDA 4JOMA 1HNYA 5CGTA 4A05A 2VX5A 1CXEA 3LU2A 4BEUA 4B16A 1UD2A 3ITCA 4H4IA 1YDOA 1Z6KA 4G6CA 3GYCA 1E6RA 1PXGA 1IEIA 2WZHA 3MHGA 3DECA 2IKIA 1O1ZA 1XYAA 3W76A 3W7GA 3CASA 3WNLA 3QV7A 2WCAA 2YSWA 1AJ2A 4QLKA 3TQPA 4QNWA 2DZWA 4WOZA 1A5SA 1E71M 5E6YA 5EGRA 3EPMA 5FEWA 5C7HA 3VC6A 2XGZA 2IPFA 4MNMA 3VM5A 2V3FA 4LBRA 1OFPA 5AECA 2QCGA 1VFHA 3C2EA 1EO5A 4D6DA 3CHFA 3LD5A 2GVJA 4ZTYA 3I6EA 5HPCA 3SBFA 2QUUA 4JIIX 1AD1A 5G1YA 1O5KA 4DJDA 1H2JA 4JTHA 2J7CA 4TTGA 4GI9A 1VD6A 5A8NA 4XK2A 3WF2A 1WCGA 4ERIA 3PM6A 3S6DA 4PBEA 3QSTA 4K7VA 3U5YA 2FVKA 1GVSA 1UH4A 2PDBA 1YTEA 1LG2A 3WSUA 1PZ1A 2YB4A 1R7OA 3V0UA 5LIYX 2CZ5A 1GCYA 3VFCA 2CLHA 3EX4A 2Z2AA 3DYOA 4HPXA 3ECQA 4IJBA 1MW1A 4MZ1A 4A3RA 3OVGA 1TWWA 2G95A 3D46A 4PTDA 3II1A 3BAXA 4EE9A 5A5WA 1YIXA 1ZNNA 5KITA 1ZZMA 3SUVA 5LXXA 1WDRA 1GOWA 2XGIA 1Q8JA 3BAIA 2BG5A 5DRCA 3NXFA 3MW7A 1TV5A 3KE0A 3M5XA 1RK6A 3P74A 2Y0FA 3TH6A 4ATLA 1DQUA 3TTSA 4DZ5A 3TN6A 4L4LA 3CUJA 6REQB 4L80A 3JZUA 1W1VA 4AX6A 2D0GA 3CEUA 1JCTA 1O5RA 3GG0A 4DJEC 3L4YA 3T42A 2VX4A 1M7JA 3RGTA 3S5YA 1GOOA 1XL9A 4HCHA 1UZDA 4EKJA 4F0HA 3VIPA 4IPNB 1HO1A 1A5LC 1RA5A 2JGYA 3STGA 1IF2A 3IIXA 3RNDA 1CXHA 4AZ7A 3EPNA 3GUGA 3VOCA 3WEOA 4XX6A 3B3DA 4UFJA 1BQGA 4ICNA 1I2QA 1XLGA 4AZCA 1TSIA 4Z08A 2EPLX 1GGOA 1DJWA 4IQDA 5C8BB 2QULA 4PSPA 2DSUA 3OBEA 4LAUA 3QV6A 3UR5A 2QXWA 1A50A 3WUGA 2P76A 1XLJA 1E9LA 3QYQA 1TV7A 1SPQA 3DEQA 4MKVA 3CUXA 1GOKA 1FH7A 4D6EA 3N9RA 4J3WA 3U2CA 3I3DA 2BGQA 2VX7A 3JUGA 1AG1O 5EBAA 4AD2A 3M0LA 3RJYA 3LMZA 4JCMA 1MQPA 5HNUA 1DQWA 1EGMA 1NEYA 1DTNA 2H6RA 3N2BA 1T41A 5E9XA 1F6PA 2ISWA 4QR6A 5CH9A 1NDWA 2C14A 4H9MA 3KP1A 1TE6A 2ZQ0A 3GHTA 1M03A 1OT2A 1MW3A 4GACA 3OYXA 3PTMA 1TCMA 3W2MA 4S3BA 4JX6A 3A5VA 3SRHA 3WMCA 3TROA 2DT0A 9RUBA 4E2BA 5C2XA 4IZGA 1TREA 1XJBA 4WY0F 2VURA 1EYWA 3O63A 3FSUA 4WJ8A 2UV8G 4KERA 3T2PA 2VJXA 2E5DA 2PD9A 3R0DA 3LCGA 4V1XA 4HGXA 3WBWA 1NFBA 1KB3A 1Q7QA 4O11A 4AZ6A 1WOAA 1OD0A 5C71A 1DWFM 2EG8A 4FXRA 1VBHA 4PA8A 2VRKA 4YTTA 3Q2DA 3VGHA 2D1ZA 1TFVA 2J77A 3EAUA 4TUFA 3DHUA 3RX4A 3AOFA 3F03K 5H91A 5EMLA 4WSKA 2ACSA 3R11A 3B97A 3VKDA 4JTAA 3CUIA 3EXSA 3H8AA 3CAQA 3N2XA 4QX4A 4WDXA 4QLLA 4G7FA 1GYMA 3BURA 4QXIA 1W32A 1I1WA 4IPLA 3NGJA 4AVNA 4S2CA 2J8TA 1Y5VA 2C13A 4DBUA 2FHFA 3N2TA 3NL2A 2JKPA 2Z28A 3ANYA 4PBFA 1EC8A 1V0MA 2X0YA 3SO7A 4WKAA 1T8QA 3E1F1 2EPNA 4QJ1A 5I2UA 1E0WA 5L6UA 1LUCB 2OGYA 3SEPA 2WZMA 3AWOA 1WOBA 4Q3MA 3W3OA 1T0OA 3EWXA 1R38A 1BWLA 2P8CA 2C3ZA 3MUIA 3E0LA 4RDYA 3QHMA 4ACYA 4XSMA 4QEHA 4I5RA 2WNNA 1HP4A 1LOQA 3UCCA 4PCFA 1GVIA 3FY1A 2IKJA 3XISA 4UTTA 4E6MA 3Q4DA 4JX4A 1CGTA 2X0SA 2I9EA 3FV9A 1E1CB 3USZA 1AW2A 1NH6A 2E4TA 1Z7AA 3OP2A 3WK3A 3VABA 1ZQ5A 2AQOA 2DT1A 2X40A 1EJWC 1JVNA 5F2IA 5KZ6A 4IMAA 1VCVA 4U5KA 2EPHA 3CB8A 2A85A 3KVLA 1POJA 4QHRA 4OUIA 2FHCA 1JNDA 2GUYA 1NQ6A 3AXHA 4JTIA 2PA6A 1HL2A 1OD8A 3UEQA 4XO6A 3M64A 4M80A 4L5ZA 2FZNA 2V5KA 2ZX7A 1GKRA 2WZEA 3SFWA 1PCKA 1R30A 4LCQA 5LA1A 2A21A 2XH7A 3S46A 2P0IA 4JFTA 4CQCA 1GYLA 3GIYA 4BEQA 3CNYA 1XRSA 4PTVA 2WNWA 1K02A 4WR3A 3OZYA 2QJGA 2DH2A 4HNCA 4AXNA 1DXEA 2V81A 2WAGA 1E40A 1JZ8A 1UQYA 3WQ6A 2C16A 1TR9A 5JVLA 1B5TA 3GXDA 3W26A 3VPLA 3GNPA 1E6QM 3LA4A 2Z1WA 3TYAA 3MO7A 3TW9A 1AL8A 2YZRA 1OQFA 2QJIA 2BXZA 3NJ3A 5G5IA 4D71A 3HJEA 3EDDA 3CLWA 2X8RA 5AC4A 4I8YA 5CC3A 1W9VA 3GG8A 1TTJA 1EOKA 2ZXDA 1UJQA 2VEGA 4XAPA 1YNPA 2B7PA 4J3XA 1ZJHA 3NFUA 4ZFMA 2QEZA 3PUGA 1EL3A 4A21A 4PRTA 1S5MA 4NKCA 1E55A 3WLNA 1JUBA 4U28A 5H2ZA 1UR9A 3G2GA 1KGWA 2ZX8A 2YDSA 3E49A 3OQEA 3L9CA 4N9BA 3ZT5A 3CAWA 2GOUA 4JIQA 1ZCOA 5D05A 4UTLA 1RQHA 4QQ3A 3REQB 1WO2A 1AD4A 3VMPA 2VX6A 3NQ7A 4MB1A 2J6XA 4C65A 1LQAA 1SFSA 2XVGA 2ZTKA 3IV3A 3TOPA 1E0XA 4I7VA 4H6KA 3I7RA 2BXVA 2WQPA 4QNEA 3TLLA 2E1WA 1QI5A 4A29A 4HVXA 1WDWA 3KOZA 4FXJA 3TWBA 4KGLA 4IXHA 3LY0A 1TJ2A 3LNPA 1PZ2A 5I6SA 4XUYA 3D0CA 2V67A 3T44A 2HTMA 2JFEX 2JEPA 2HSAA 4PMUA 5E0KA 4FF7A 3KBMA 4NUWA 1YDVA 3R4IA 4RR4A 1KQYA 1XUZA 4FOUA 2Y85A 3RLVA 2DY3A 2VVNA 5F4SA 3UWUA 3EOUA 1C8YA 1QU4A 1XYLA 4O0ZA 1EXBA 1QO5A 4IUGA 3WFLA 5CGQA 1IIGA 3ISIX 3E0IA 4GIAA 4MADA 3HGRA 3HQOA 4RXGA 4XB3A 5G4EA 4DWSA 2OWWA 2AKZA 2ZVRA 5TBOA 3RR1A 2CCRA 4NNAA 1XHGA 4OVXA 3ABZA 1QPQA 3W74A 5AY7A 1S2AA 1UYQA 3NYDA 3R7MA 2J7EA 4GO8A 5D8ZA 3GKAA 1TB3A 1DL3A 3WD0A 3T55A 3W7EA 1JZ4A 2DV0A 4WKHA 2A7RA 4R9XA 3V3WA 2EGZA 2I5QA 3AZTA 4UOZA 2R9RA 1JJKA 3H55A 2YLAA 2FQIA 2QIIA 1JYVA 3R0KA 2WZIA 1GW1A 1SZGA 4HA1A 3IV8A 4X2PA 2VQTA 4N7QA 4CQ8A 4C1LA 2QCDB 1ECEA 3TR2A 1JUKA 1WKFA 5EL1A 2Q8ZA 2PP1A 3AS3A 3BV7A 2VUNA 1R3SA 1M53A 3H4GA 4MPKA 4K68A 4QDPA 3JR2A 3PBUA 2XPKA 3LENA 3A12A 4ML9A 1QPRA 5A3HA 1V3KA 3AYRA 4LOCA 4XUGA 3W7KA 4JQ2A 3W84A 5I03A 3R8GA 1SFTA 4NNCA 4N6FA 2RFGA 4M81A 1ZL1A 1JCJA 3C2RA 4KW2A 2FLIA 3LGEA 4XTIA 5D2WA 1DHPA 4TMCA 1KCLA 1UD8A 2VZVA 5GNZA 3IJLA 4RZ6A 1XLAA 3KP0A 2OKTA 3MDUA 5XINA 5AYIA 3U7BA 7REQA 1VCGA 1QNRA 1J0ZA 3DI0A 3TSMA 1VBUA 2VCCA 3E38A 3AIWA 1F6YA 2ZRWA 3S5ZA 2QDDA 2QUMA 3S6OA 2V2DA 1SZRA 4XKYB 2HWGA 1U5VA 3PBMA 2E1DA 2HCVA 3SCNA 1FOBA 2E0PA 1REQA 1MUCA 4IFKA 1B3VA 1LDCA 5AB3A 3VNKA 3W7IA 1W54A 1VQTA 4LGXA 4NJKA 4P8VA 2YBTA 4YLWA 3ALGA 3PJWA 4RDZA 3MBDA 1Q7MA 3RPTA 3WLMA 2VC7A 1P0KA 4KEVA 1MEWA 3RMEA 3BW4A 4DAFA 1XIEA 4AXKA 4PGLA 4LYKA 2CBUA 3RPMA 5HUPA 5TAOA 2VOTA 3BMXA 3K4DA 1FWIC 2NT1A 3QGKC 2ZIDA 1D7KA 4V2XA 2A3HA 4A8LA 4M24A 1H51A 2PTWA 1SVDA 3NVTA 4DM2A 4RCXA 2REQA 3RLGA 2OYMA 2XFRA 1PX3A 1XCXA 3KAOA 4AIOA 4S3CA 5KEZA 3TNBA 4WCJA 1EA0A 4X0NA 1QO2A 1FWTA 2XVNA 4M1BA 4ENLA 2J9XA 4AC1X 4Z2IA 4B9ZA 1OGSA 1X8CA 3HPZA 3S9YA 1QT1A 1WP6A 2CWNA 5BOFA 1QXLA 1WZMA 2GLKA 4J27A 4W7UA 1DJQA 1TR1A 3CTTA 4R85A 3BAJA 1WE5A 2C0AA 2FIQA 1AJZA 4K38A 1IYXA 1WAWA 1KM0A 5HWMA 3GTIA 2FZMA 4PFMA 4ACZA 4H7ZA 4AY1A 3GAKA 4Y96A 1LF1A 2OLSA 2INZA 3WD4A 4H41A 1X97A 3IACA 1UKQA 3V5FA 1S2CA 3MI6A 2INEA 1W5QA 5U4NA 2JALA 1NSJA 4K1WA 5LZLA 5ABFA 3SUSA 4YYCA 1KM6A 2SFPA 4PUUA 1LG1A 2NV1A 4ZQRA 4IJCA 3BLFA 2CZDA 4LYRA 4DYEA 3HN3A 4DYKA 3AYVA 1IXPA 3UU0A 1Z9AA 2P3ZA 3A23A 4TR9A 1TYGA 2FTWA 3BK0A 4JN7A 3WQCA 1FP9A 1YE4A 3NSMA 3AHVA 3MS8A 1DEDA 1MXGA 3WX7A 1JL8A 1GZGA 4C6FA 1Q5MA 3EYPA 4DYJA 3BCFA 2AMXA 3WQPA 4ZEPA 1FDJA 4B15A 5C9UA 2ZTJA 1U30A 3UESA 4AEFA 4WY0A 1KBJA 3N1AA 5FEZA 3BAKA 3UY7A 4J3UA 2DIEA 1V7YA 4ONVA 1HP5A 3UW6A 2P50A 2EAWA 1XGZA 2J7HA 4O54A 3IK4A 4UTMA 2QIWA 1EO7A 1XQLA 5G2HA 2XINA 1P7TB 2C71A 3M0YA 3NGFA 4MUZA 4JL1A 1H09A 1UCWA 1F61A 3OA3A 2WC3A 4AZ5A 4UOQA 1OZMA 1W9BM 1EC7A 1G5AA 3CAVA 3MKVA 3LZ3A 2QJJA 2PWHA 1V6YA 3ZLGA 4FXFA 3LK6A 2E25A 1TRIA 1D7FA 4X9SA 2IPGA 4JTQA 1Y5XA 1OYCA 3UJSA 4YTRA 1RLCL 3R58A 1WZAA 5IDZA 1JZ7A 1PKNA 3TYBA 3B0UX 3STFA 4F0RA 3N3MA 2F9RA 1SW3A 1RVGA 2PC4A 1UPPA 1W3KA 4M51A 1X39A 4A3UA 4NJHA 4REQB 5ENLA 2NX3A 3PULA 4CCEA 4GGHA 1UWAA 1NP0A 1BVZA 2E6YA 1XH0A 3E9AA 4HHLA 3SADA 1FX6A 1K3UA 3LHWA 1ZU8A 1B3XA 5G2IA 4XIAA 4ROQA 3GHUA 4MZYA 2YCEA 2J75A 1WDQA 3I68A 1VPYA 3A47A 4GY0A 3WDIA 2VDIA 3OHMB 1A5KC 3DFOA 4DJFA 2VR2A 2QJNA 4JHOA 2WC4A 1THFD 2FPYA 1AW5A 2WYSA 1XIDA 1QASA 1OFAA 1QBBA 3N6JA 3WF0A 2I16A 3NO3A 1UZ1A 2ZDRA 4E2OA 3R25A 2VOMA 4TX8A 3U3HA 2Y2WA 2FJKA 1Z8AA 1VLIA 4WEVX 4GKLA 1P43A 3IVTA 1EDGA 3OBKA 3DGBA 1G4EA 1OG6A 1W2VA 3SCPA 1XGEA 5IHRA 3T81A 1EEPA 3CUHA 2OTDA 4HYWA 3C2FA 2QVNA 3U9IA 3DUGA 1E9IA 3TYUA 1EQCA 3S4TA 1UJPA 2E9MA 4RE3A 2A6LA 4JTSA 5T91A 3M07A 2XN1A 5E0CA 4HPJA 5D30A 3SB0A 3W1AA 4IISA 3HQ1A 5BU6A 3H7RA 3C8NA 2VNCA 4GE8A 4GKTA 1IT8A 3W0KA 1SGJA 3V0TA 5BWAA 1AH4A 2OWXA 4ZO8A 4WUIA 3HB9A 1K70A 3TSDA 1FWCC 3CHCA 3OLIA 4CGTA 1XFBA 4X3ZA 4PB3A 1FHUA 3CU2A 3EDFA 4NT0A 1R0MA 2O56A 1TPUA 4K39A 5FA5A 4AHOA 2WZTA 5CJNA 2OZTA 1TUXA 3SRDA 3DGRA 2GGIA 1TJRA 3O1NA 4PRWA 4DO4A 3KVMA 4LPCA 4AMAA 3K46A 4E3VA 1E6XM 1H62A 4OECA 3HBLA 5I3FA 5FCZA 1U22A 2QPXA 5IFPA 4E4FA 3C3UA 1UKPA 3STPA 1FWDC 4QDMA 6TIMA 4Z2HA 3MI3A 1XQKA 4K8GA 3ZMRA 4O12A 3LQGA 2A2IA 3GVGA 3FJNA 3ZJKA 4FNRA 5CC7A 2YXOA 1W56A 3VGGA 5K9DA 3APYA 1DORA 3N73A 5FJIA 3IGHX 4BKNA 4UTHA 1KM1A 3I3BA 1Q4NX 4J3ZA 2CFFA 1QFEA 2ZZ6A 4RW5A 1RBOB 2CPUA 4Z2KA 3ELFA 3IK2A 4JQAA 4LYQA 5EMJA 3MKCA 1EOMA 2FGBA 4GIEA 1W3LA 2DQWA 5CCZA 4XIMA 3W7HA 4ERGA 2PURA 2TODA 3VKKA 2Z27A 1T7LA 4HA0A 4UQAA 3UF9A 1I2OA 3KM8A 3L4UA 1RP9A 1V3MA 1ZJIA 4IPIA 3LPGA 1UWQA 4XBSA 1A5MC 1J0YA 2ATSA 3NPUA 1J79A 4QGCA 1OFDA 2PMQA 5BZAA 1IIHA 1HG3A 3CO8A 3SR7A 3VNLA 3RLUA 1PIGA 2HNEA 3JRKA 4OT7A 3O6DA 5SWUA 2X1IA 1X38A 3A6OA 3EKLA 3W37A 1PCWA 1VPXA 4HJWA 4JQ4A 5MHBA 1A53A 2WLZA 1LCOA 1VJSA 1YEYA 2IKHA 3CXOA 2QJMA 3UZYA 4HNTA 3HPSA 4RE4A 1TWDA 3T40A 1MDRA 1UR1A 3VYLA 1SR9A 3FEMA 1KA9F 1HGYA 3AU2A 1EJVC 1MQRA 2AMGA 5E70A 3NQFA 2QCHA 3PZUA 3PS7A 1XCFA 2P10A 4Q4RA 5E09A 3AXIA 4D8LA 1W1YA 4OIFA 4DUVA 4XWUA 4NAFA 3TW7A 2JIWA 5E0FA 2A3CA 3G3MA 1QK2A 4MB3A 3VUPA 4O28A 2H9AA 4B5SA 2VGBA 2F8QA 3BL3A 3KRSA 3KS6A 5B80A 2ZA3A 1M5WA 5M03A 2PAJA 5U7SA 1GG1A 3WQWA 4LW7A 4AEOA 1UMLA 3AIEA 2PFHA 4KBXA 2TAAA 4GRSA 3MVTA 3KBSA 3W28A 5AZ1A 2RKXA 3WENA 2DSWA 2WMKA 3EB2A 2PDQA 3A4JA 4B91A 1YRRA 5GJMA 2X2GA 1WV2A 3B9EA 1X1ZA 3C2OA 3QEZA 1H50A 4PMZA 1H5VA 4O16A 4QBXA 2CLPA 1JAKA 1ZTVA 4C6EA 1ODUA 1UH3A 2ZCGA 4KFOA 4MZ8A 1R9XA 4I7UA 4AUBA 1E4MM 2WLYA 2Z6IA 4H8HA 3KX6A 4HNVA 1B1YA 4GYFA 4NZFA 1DWHM 4P8WA 1W37A 5C54A 1RCQA 3WF3A 2AOSA 1O68A 3ZVHA 2C7FA 4DZHA 3ZWTA 4DJFD 4GY7A 5HATA 4HKPA 4EXAA 3W86A 3KFTA 1OF8A 4P7NA 3L0KA 5FJRA 3DC0A 2BHYA 3QOMA 2B0MA 1GEQA 3LQLA 2VZTA 5I7GA 2VWTA 8TIMA 2EXOA 3AHZA 1G7VA 4N9EA 4GYJA 1W3IA 3FJ6A 1KTNA 2VM8A 1VBRA 4HCDA 3KVJA 1PS9A 1WBJA 4CNTA 3DFYA 3L21A 3RHGA 3MQTA 2E8ZA 2VFHA 2I7GA 3PF3A 1TPH1 2YDRA 2E5BA 1NDZA 4R5EA 3F4CA 3NL6A 1ME9A 3H2MA 4EPDC 3GWQA 1EBGA 4OE7A 7TIMA 4HZMA 1L6SA 3N9KA 4Q4OA 3W83A 3KLKA 1PWMA 2QCMA 4W8BA 3IGSA 1OCQA 3NO1A 3BVJA 3DFPA 3A3HA 2WKLA 1EP3A 4CNSA 5JBDA 2ZXQA 3K8MA 3M46A 4K6AA 4LAKA 1JPIA 1CXKA 2OSWA 4BHYA 4C6NA 5I3DA 4J35A 3E2SA 1XYZA 1FP8A 3SUUA 3N2MA 2CXGA 3FNDA 1KGUA 4WRHA 3UYIA 2VD9A 4JKLA 1IT7A 4O15A 4EAYA 4Q4QA 3NDOA 3GIQA 3N4FA 3LLDA 3FYYA 5H6HA 3MCNA 3G22A 1WB0A 3N9SA 3BZJA 1LM1A 5JIWA 5E1QA 2FZ8A 4YPJA 3WK0A 2W9MA 3NAVA 3SCSA 3NYZA 3H26A 2WWDA 3TKFA 4OU1A 4HQVA 1M3UA 5GJNA 3WJXA 5I3JA 1V02E 1W31A 4O10A 1XSIA 1QW9A 1U1UA 5LSMA 1GVFA 3PY2A 4I9MA 3Q65A 5LGXA 1QI0A 4GBUA 3PSVA 4YL2A 3BLIA 2RJGA 5EYWA 3T78A 2W66A 3GC2A 1ECQA 3GTXA 2R82A 2XIIA 4LCRA 2ANUA 2B4GA 3G6LA 3LHVA 4DY1A 4AG0A 1XYMA 3BG3A 1P0DA 1XLCA 2PU1A 3L0GA 5HMEA 1OEPA 1FWSA 3OVRA 3M7SA 1FHLA 3AJ7A 5HUOA 3CK5A 1RR2A 3GHRA 4I9AA 3M1ZA 1ONWA 2AGTA 1PV8A 1SJBA 1LOSA 4FHAA 1DWGM 1G69A 1MO0A 2A3LA 5FOOA 4PUEA 2OMAA 1PTGA 3BTNA 3UBPC 3BLEA 3D6NA 3FYPA 5D03A 4W89A 1RA0A 3EOOA 3TTEA 1DP0A 1KC7A 4FS9A 3VM7A 2D2OA 4JXCA 3DG3A 4GUIA 4HOZA 1MSSA 1TPB1 4HOWA 1NAL1 4F40A 3CWOX 3DFTA 2GVEA 3K2GA 3G18A 4I8DA 1YYAA 4MGGA 1LBMA 2ZC8A 2V63A 5CZJA 2ZKMX 2VCAA 4D6JA 4LYPA 1H4PA 1J0HA 5HXMA 4G56A 1TQJA 3MV11 4GFIA 3WJYA 4AFYA 3TTYA 1FWWA 3A4XA 3OQ8A 4NZ4A 3VKAA 1XS2A 4QQUA 3TDFA 1QHOA 2PRHA 1Q6QA 4M6UA 4IMDA 1SM9A 3GKFA 3WQDA 4F4RA 3U57A 1YTKA 3ZT7A 1J8VA 5BXTA 3OJGA 2RGMA 1BG9A 3R5EA 2HZGA 2F84A 2YGYA 4BWLA 1QRQA 3AMGA 3TN3A 2WPGA 5BMXA 3B4UA 3GC5A 4F2TA 1K8ZA 3EWUA 3OLGA 4H01A 5CPOA 4DO5A 3ARZA 4US5A 2C6QA 1QNSA 2E5CA 2YCIX 1S2VA 3UZXA 4RNHA 1Q45A 3NEHA 3P2VA 3LB0A 2YR1A 1XM3A 2AAMA 2WSPA 1OC6A 3RMJA 3L0NA 4UQ9A 4AY7A 3QC3A 3AZRA 1L6WA 1PBGA 1MWOA 3WMBA 1I1XA 1VFOA 1KFJA 4GVIA 4BF7A 3NOYA 3OTRA 5G1TA 4LB3A 4LC6A 4PMQA 4C7DA 2FTYA 4Q4SA 2EPOA 1KRCC 1WX0A 2WPBA 4K8HA 3VDGA 7TAAA 3F4DA 1MFUA 1JIBA 1ZSXA 3RM9A 1CI1A 2ZOXA 3I4EA 1TVPA 4K37A 3VE9A 3Q45A 5D9MA 4WHBA 1RVKA 3WNMA 1XG3A 1W5PA 3URQA 4W86A 5A94A 2O7QA 4ZA0A 1JPMA 5K2ZA 3FHQA 4PZVA 3KW3A 3SECA 3HG4A 2XN2A 2J7GA 3BGGA 2W61A 3DI1A 3B4YA 2BWGA 1OX4A 3Q94A 1V0LA 3T9PA 1FTXA 3GE7A 2PUZA 4G2DA 1ITUA 1GWJA 3FVDA 1OYAA 2WMIB 3VC5A 4ZOBA 4FA3A 3AZSA 2XIOA 1E72M 3UG5A 5LA2A 4OQVA 5K9CA 1U33A 3IANA 1BVWA 4O13A 3G0UA 3P14A 2OZ3A 1W2PA 3N29A 3RR4A 3ZR4A 4S2BA 4WGXA 3GNDA 4A4AA 1P0NA 2ZZ3A 3WBAA 3VD3A 3I6RA 4O1DA 1CCWB 2GGHA 3VUSA 7REQB 4KEZA 3IWPA 1IR2A 5D2XA 5B7YA 1R3TA 5CAHA 4JZ5A 1GEHA 4Q7IA 4O0KA 3M43A 4GXPA 2PWEA 4ZVJA 1HT6A 2BY2A 4N2YA 1A0EA 1CTNA 3W4RA 1REQB 3UG4A 3U2ZA 5XIMA 1Q4WA 2BVWA 4J1OA 1ONXA 1EHNA 4JNYA 3BG9A 4IFOA 1IXOA 3B0PA 3D5HA 3TQVA 1QWGA 5D04C 1GVOA 4L1GA 1NWUA 2GOKA 4G1KA 2J47A 3GVVA 1NELA 1MFVA 4Z17A 3ARVA 1LT8A 3OEXA 3BOFA 4TVUA 3Q67A 1GPWA 4OBSA 3B40A 3HA1A 1LJYA 2CYGA 2PWUA 3MUY1 1J2BA 2CHNA 3NL3A 1OABA 1KCXA 4MTVA 2PTZA 4MAZA 2IQDA 2O9PA 3UJFA 1EFZA 2BGSA 1SW0A 5A6BA 4NHVA 2ATMA 2BOGX 3PWAA 3A13A 1X8FA 1KM5A 4KEMA 4LS0A 2Z2BA 3DN5A 1KFWA 4EOUA 2Q3RA 2ACQA 1UWSA 1Q2RA 1TWIA 3M41A 1YE6A 3QY7A 2VZSA 1DE5A 3ANVA 3QOKA 5ABFB 1XD1A 3MCOA 2JF6A 5F4XA 3WBYA 1XSKA 4S3DA 2OEJA 3L4VA 3TCSA 2EHHA 2HBXA 2QV5A 3PK7A 2NV9A 1L9WA 1DJYA 1TKKA 4UQEA 3U4AA 2POTA 2Y61A 4R7JA 5PTDA 4LNCA 1OC7A 4RPPA 4F2UA 4LUSB 2A1YA 3NR0A 3LHYA 3O6YX 1S1RA 1SJDA 3HM7A 2W63A 2YBUA 1IGSA 4Y6GA 2Y8KA 1DJZA 5FF4A 3OODA 1VEOA 3LTYA 3G0SA 4X60A 4WY0B 1LWIA 2DJXA 4M5PA 3DDMA 1V5XA 4H7CA 1TPVA 1E15A 1XLIA 4AWEA 4UZSA 1X1NA 3LCIA 2DW6A 3ES7A 1PDYA 4LUTB 4HHPA 3T08A 3IEBA 1VBGA 5JXQA 3KWXA 3HGSA 4S23A 4BQ2A 2WVTA 1UD4A 5DMNA 3VTRA 2CWXA 4AHQA 1ADSA 4UTIA 4C6PA 2NVDA 4H9VA 1VFFA 1C92A 3M0ZA 2Q09A 2NSXA 2YA2A 2X05A 4OZOA 1JYXA 2DJLA 3V16A 3I65A 4P7RA 1WYIA 2DZVA 1GW9A 4JTLA 3ABXA 1S39A 3CQHA 4DBSA 4H6QA 4IM4A 1M68A 2HK0A 4U10A 1RD6A 4O50A 5FL0A 2CLIA 2PGFA 2Q02A 3KOFA 4WLCA 3VGFA 3CUGA 1LLZA 4XTDA 1H7NA 4ICCX 1VRXA 4UTJA 2O4QA 1A3WA 5A69A 3A3XA 2I17A 4AEEA 2WCSA 5IXEA 7ENLA 4I5UA 3VDCA 2YCLA 4FF5A 4CN6A 4US5D 4L4PA 1NWSA 2IQTA 4GX9A 4XZNX 1DJXA 4PCSA 1F3TA 3H54A 3UGRA 3GFXA 2XU2A 2CITA 3ARUA 1WUEA 3UWVA 3VIHA 3SIMA 3N6HA 3WLJA 5KTLA 4MY1A 2DZXA 3MJYA 4H9UA 1RSCA 3SIZA 4LVBA 4DUOA 4AQLA 1CNVA 4JN6A 1F8MA 2P8BA 3S2MA 6CGTA 1B3YA 3AXKA 3VNIA 5GJPA 1EB3A 2CXEA 3WQVA 1G4TA 3LBMA 3F2DA 4ZGYA 5LHFA 2HS8A 4NJGA 5I3HA 5FF0A 1H0GA 3GXMA 2QVHA 5E9AA 2ISFA 3RM8A 3VNDA 1JNEA 5HBFA 4C7GA 3HURA 3BAWA 3MDWA 2HVNA 2HDJA 4S3FA 1EP2A 1C7TA 2BB0A 3BXWA 4GI8A 3ENLA 1JD7A 2V0TA 4IMGA 4OBTA 5D2TA 4YCOA 5AVHA 4FI4A 1H63A 2BASA 3TAOA 1RJQA 4O18A 1IGWA 3PC0A 2WOQA 3QPYA 3TLQA 5DLCA 4R9OA 1QWKA 3A21A 5CAKA 4TVDA 2Q01A 1O95A 2GFTA 4ZQPA 4AVOA 2BZNA 3QSRA 3WEMA 2L5HA 2PDPA 4AD1A 2CBVA 3TQ0A 4R7WA 1TMHA 2KAUC 4L64A 1XUUA 2XFFA 1SMDA 4KWSA 3TAKA 6ALDA 3GNXA 2Z25A 1KM4A 4LU0A 3WJWA 3IRSA 2ZUMA 2EO7A 1RQBA 3H6OA 4TV5A 4PMRA 1OADA 4QEEA 4CVUA 4JN8A 4CD5A 2DZSA 3VFLA 1S2UA 3RX3A 4Q7NA 5DBUA 4L56A 2CU0A 4HU3A 1R87A 4ASTA 3IJQA 1N7KA 1JZ2A 5AVNA 2MNRA 4NXKA 3B9NA 2WB5A 3KLLA 4S3KA 1XR2A 5CJMA 2A3BA 2VQUA 4YWSA 3TXZA 1T40A 1R2TA 2NWRA 1DE6A 4IIEA 2D2HA 1W3TA 1VH7A 4JFWA 4DI9A 4WQ6A 3GM8A 1OFBA 1GZJA 4LVGA 3GVRA 3TTOA 4IPJA 4NRRA 1S2TA 3SCQA 2PDLA 3N18A 4HTBA 5BOEA 1TMLA 2GGGA 3IIOA 2VGGA 3N4AA 1B9ZA 4HCLA 4DBEA 1EJTC 3MSDA 4LUYA 3GNOA 2QQ6A 3KCJA 4DNMA 4GXMA 4KIEA 3GDLA 4LTSA 1UC4A 3VCNA 1CT5A 4RK8A 1Q6DA 3NUKA 3HPFA 1TX2A 4GNJA 4G5DA 3WDQA 1MEIA 5HR7A 4C90A 4Q8TA 5DT7A 2VR5A 3AJXA 5A6BD 5M2FX 4F2BA 3TC3A 4IOTA 1FBAA 3LOTA 1AVAA 5FJJA 1NWRA 4LUJA 4J9JA 4BI6A 3EX3A 2Q8XA 3MU7A 4JCLA 3SY1A 4KGJA 3H4WA 2NQZA 4QS6A 3SRFA 4QE5A 4E38A 5FF3A 3PAJA 3QLDA 3IJ6A 3WL1A 3T4CA 3WMSA 1W9DM 4KPLA 4GMEA 4UTWC 1HJVA 3KHDA 4D2JA 4Y9PA 3P0XA 4O17A 4BA0A 1BFNA 3MMWA 4IPPA 1TMQA 1PHQA 3G77A 3WUBA 5AN7A 2W4XA 2W92A 4HN8A 3VKBA 4M1RA 1OZQA 4IGHA 2D24A 1WDDA 2YZ5A 1EKOA 4JQ3A 3MUXA 4BQ4A 1TVLA 1Y8BA 3SN0A 2E3ZA 3BLPX 1VS1A 5J5RA 2Y8UA 1C90A 4IIGA 5I0DA 1JFHA 1AZ2A 1MNSA 3UY8A 2G3IA 4QAWA 3S83A 2LLEA 2BODX 1G9HA 5CG7A 1RBLA 3VD9A 4NAFB 3UWQA 2DUXA 4Q8NA 3WY1A 4WDTA 4Z1CA 4MKSA 2MANA 1RD5A 2H9AB 3OG3A 3TK7A 3OGSA 3CPGA 4MFEA 3S47A 1HX0A 1XYFA 2DT3A 1HKWA 1U83A 4OWGA 5F2MA 3PWIA 4MJ4A 1PSCA 4UFKA 2PDXA 1LYXA 2JKAA 3VO0A 1G94A 3THUA 3LHTA 2C15A 1ICQA 2INFA 1BRLA 1R85A 3R6IA 1KFCA 3FDGA 1N2VA 3PZVA 2BLEA 1R3QA 3EDEA 4YVXA 4KIRA 1D9EA 3BGJA 4PTNA 3WQOA 1G7UA 2PLCA 5HPOA 3SRKA 9XIAA 3IUIA 1JI1A 3TC7A 2V69A 2Z1KA 4QLJA 4NG3A 4ZENA 3UYCA 2ODOA 3FKRA 4H2CA 2EPMX 2C1GA 2ZRXA 4L9YA 4NX5A 4QE4A 4MSSA 2JK2A 2RHGA 1XYCA 2ZA2A 2PDWA 5DFAA 4DVOA 2ZRVA 5AHLA 3N13A 3IUHA 3DYMA 4DLFA 1LL7A 2V5LA 2OT1A 1FHDA 4OKDA 4RNJA 2WV8A 1FWJC 4ORMA 4DUWA 1HKJA 4W87A 4KFNA 4O53A 3TYEA 3ZVHB 1JDAA 1R9YA 2QR6A 2QUTA 2RAGA 5C9WA 2CLFA 2DSZA 5JUVA 4PMNA 5JH2A 4Z2LA 1L2UA 3NTYA 5BXRA 2PDUA 3QKZA 1LP6A 1TX0A 2X42A 4EP8C 1N8FA 3OIXA 2QCLA 1UD6A 5CPQA 2YA0A 1OG0A 4I6VA 2PGEA 1BWVA 4GOAA 3E0VA 2V30A 4EVZA 3ABRA 2UY2A 1YPFA 4ZB5A 1ML1A 4CCZA 3WH9A 2D3NA 3RDKA 4C6QA 1PYMA 4DXVA 5EMUA 1YTDA 4GQBA 3ZXWA 2FH8A 5AYYA 4DZIA 2YBVA 3GNNA 4TQTA 2NSOA 2V82A 1JDFA 5JMUA 1BXNA 4I9JA 4JX5A 4B9YA 4FX7A 1I6NA 1XF0A 2VL4A 4IIFA 5AC6A 1V3LA 3W7MA 4GC3A 3RF9A 3WLIA 2ALRA 5HMFA 2J24A 1GK8A 3INPA 3QTGA 1BYBA 3LN3A 4HU8A 3STEA 1XBVA 4LS1A 5A6TC 5JBFA 1W1PA 2PGWA 1KXHA 3ZLHA 4A3YA 4S3AA 4PCNA 4DI8A 2WKJA 2VEIA 2R94A 1O94A 2NV2A 3VIJA 3MZNA 3EX6A 3SM0A 1UP0A 3AFBA 1IEWA 5FKYA 3G1RA 2XVKA 4KH2A 4LV4A 1CB2A 3UA3A 1TIWA 1NVMA 3OU8A 3SN4A 4GQ0A 4Z2GA 3NNTA 3IUDA 3VOJA 5I06A 2G37A 1J6OA 1L6YA 2G3FA 2YKKA 2G3NA 4PODA 1RUSA 2W91A 3CZJA 1VCFA 2VC9A 3NQMA 4GYPA 4TVCA 3W7QA 3GC4A 3N15A 4MYAA 3W7OA 4DXXA 3DBPA 4LVFA 3RO8A 1VKFA 5H8MA 2ONEA 4MWAA 5D9NA 2QCFA 2NUWA 2J79A 3STCA 5C0QA 3ABQA 3V35A 3MVIA 4PR4A 3O0KA 4KQNA 3ABSA 4LEFA 3VDHA 4FR1A 4C6KA 4AWUA 4AISA 1EYEA 4EACA 1NDYA 4YVPA 4NY2A 1AMYA 1CECA 4HU0A 3W82A 4CEXC 1K9TA 1RY8A 1AJ0A 1CENA 5DN1A 2G96A 3NCOA 3ANUA 3VCCA 1J96A 2FGLA 1RJPA 1CGUA 3ME3A 1TZ9A 3VIOA 1GHRA 3TTQA 3ZSSA 3KOYA 2ZWZA 3PR2A 4JIRA 3O8AA 4HHHA 2R1PA 2PGRA 4UR9A 3V5CA 3C86A 1SQ7A 5DCBA 1WNOA 3ITTA 3NEVA 3NQ6A 3O07A 4Z42C 5I09A 3UVIA 1EZWA 1SSGA 4PL2A 4CCCA 2VZOA 1QDSA 4HZ6A 2NQHA 2OSXA 2C18A 3THCA 1X98A 3LPFA 5DO8A 3L4WA 4O14A 4PFHA 1F3WA 2R1NA 1YADA 3YPIA 1SU5A 3W01A 5A2BA 3FK4A 5FJTA 1PKLA 2P5NA 1JZ6A 3KDNA 5E93A 3W53A 1DWJM 3WJSA 4CEUC 1M01A 2PB1A 3UCQA 1R47A 2JF7A 2FH6A 2HS6A 1KTCA 3PBGA 3VIIA 2C0HA 1OIMA 3KZPA 4KMQA 1O4UA 1FCQA 2PDIA 3E12A 3LM7A 1NP2A 1OYBA 3PFMA 2TRSA 3IVUA 3WDJA 4BCEA 2PDKA 4W93A 3OYZA 4IGNA 4ORIA 2O55A 1XLLA 3W72A 2NXGA 4B3ZA 1XD0A 4I90A 2NZLA 3TJXA 1WKYA 3ITGA 3KL0A 4FEZA 1V6XA 1GJPA 1GVEA 1RCOB 1TWSA 3QLLA 5F2GA 3WLLA 4AIBA 3MSRA 4PUJA 2ESCA 1RZMA 3M0VA 4W88A 4DJFC 3AMKA 4WJXA 2Z1BA 3WQ5A 3TN5A 2GUBA 1I8JA 4GH1A 3M0MA 3P93A 4B4HA 3PZQA 3CPUA 1LL4A 4C6IA 4AMCA 3UQNA 3H24A 2X2YA 2B7OA 1FWEC 1PX4A 2GJXA 3EDKA 4GI4A 1PTAA 1ZP3A 2OX4A 4QCFA 3QMRA 3WD1A 4ECLA 3QF0A 3A5FA 1LLWA 3RFAA 2XSXA 3EWDA 2X1SA 1R2SA 4GNVA 1CGYA 3C0SA 4MM1A 3EMZA 2VYOA 3P84A 1YPIA 3PPHA 1LT7A 3HGJA 3CQKA 3UJ2A 1BKSA 2OQYA 4MJMA 1XGDA 3PTQA 4L4OA 3CT2A 1Y5WA 5KMYA 1P5BA 1EDTA 3GK0A 1BWKA 5F1UA 4FB7A 1KO0A 1V0KA 2W79A 3GH4A 4D6GA 2E6AA 4M19A 3AS1A 1U5HA 1WBHA 2QT3A 1JPKA 1XIJA 2BP1A 1F7BA 2IPJA 4CUCA 3L12A 4FK9A 1WXZA 3GR7A 1W6TA 3L68A 3OW1A 5LYRA 3VK5A 4AC7C 2V6AA 2C8NA 3IJ7A 4UXDA 3VNYA 2Y89A 3M0HA 3H12A 1G01A 3W1UA 5A6LA 5A6JA 3VIGA 4H3DA 3BPWA 1M7XA 4JGDA 4XSLA 2BY1A 1SZEA 4F48A 1PJ9A 2V8ZA 5ECVA 4EAMA 4EF9A 2QF7A 1QJWA 1VC4A 4P8XA 1PVNA 4O0QA 4AYGA 1AUSL 3CO4A 4PE8A 1FWHC 2Z1XA 2XUCA 3AAMA 1JDCA 2PBOA 1WUFA 1K4HA 2IS7A 2ABAA 3N12A 3S3GA 4WX2A 1ZCCA 4J5NA 4RW3A 1DIKA 4ZB0A 4PEKA 3WN6A 4JKMA 3GDMA 3W2UA 3PZTA 5CSRA 1UWIA 4OJYA 4DWDA 2O9RA 5CQ1A 3QGAC 4FOKA 3T8QA 1EHAA 2F6KA 3GH5A 3K1GA 2CETA 4MFDA 2GJPA 2Y5SA 2R14A 3N19B 2ZRYA 1WQ5A 4U3AA 4ZCWA 5L9FA 1R3YA 5AYXA 2GPTA 3HU7A 4C6OA 4MLJA 3TC6A 1UOKA 5DF0A 4GGBA 7PTDA 4GLEA 3QZAA 4KT2A 1W1B1 2VFGA 4MWAD 3LM3A 4Q8MA 3A3WA 4FZIA 1CXIA 4LCSA 1ELSA 5T9BG 2YW4A 3C3NA 1GOMA 3PZOA 1MVYA 2V5JA 1WA3A 2ZUNA 4UIOA 3K5XA 4AHPA 2DZTA 1XFCA 3W38A 1C7SA 3WZ0E 3PP7A 3JU2A 4HTYA 1P0BA 2P88A 2A79A 4TX9A 3S5NA 3G5EA 2G41A 1LORA 1PUDA 3F4WA 5AOUA 5FSDC 1K6AA 2ZXBA 1ZUAX 5CLWA 2GSHA 2GVYA 1CGXA 3VCRA 3R10A 2Y4SA 3LZ5A 3TIMA 1TELA 4NX0A 1A0CA 4B3LA 1JPHA 3NM3A 3ARQA 3T05A 4JTTA 1MMFA 3KS5A 1I4NA 3LTSA 5K7JA 2V3DA 2HMCA 3MSYA 4O19A 4JDYA 4LBUA 4S3EA 2VKZG 4E8GA 3QY8A 3OO2A 1SZNA 5ABEA 1QAPA 3P61A 3GNRA 3LCXA 3EMQA 3W1MA 3LEPA 4IMFA 3UXAA 4IG2B 1QPNA 1O12A 4G8TA 4FXSA 1XH1A 1XLEA 4QE1A 3JS3A 1ITCA 1KGXA 1K8XA 3LXAA 5LIKX 2YCLB 3N25A 1JCYA 4X0VA 4M56A 4GXWA 4Y9NA 4NILA 9CGTA 3IAPA 2QGHA 3NO5A 3PUOA 4NAEA 1NFPA 3W7LA 1JAEA 2VVSA 4C6LA 4LALA 2X7VA 4H9ZA 1C9DA 4HSOA 2A7PA 4LY8A 5E6ZA 5LIXX 1US0A 2J78A 3TR9A 4AD5A 1V08A 3DG7A 5C70A 5FACA 2CLKA 2PE4A 5CJ5A 5BXSA 3B06A 1JZ3A 3QR3A 4U4MA 3KRUA 1M6JA 5D32A 4HN4A 3WLSA 4AWTA 4YNGA 3B9DA 3EWCA 1N8IA 4MG4A 4MJZA 1KRMA 4JHMA 3N4EA 3H2EA 4I7WA 1VFTA 2E7FA 2JE8A 1Z41A 2RJHA 3P5ZA 4YXGA 1J0JA 3SURA 1XRTA 3HV8A 1TPDA 5K9XA 1AQFA 4HU4A 4C6BA 3W24A 2ZX9A 1KV8A 4I5XA 2ZUTA 3WH6A 4CU6A 5HMSA 3ALFA 3HFTA 1QHZA 1JDEA 1H1YA 3TQKA 2PEVA 3AQUA 3SCWA 5F2LA 1Q65A 3CMJA 4F0LA 3KWSA 4GZEA 1J5SA 1P48A 4Q8QA 3IRDA 3C52A 2WM0A 1AQMA 4YHEA 4H9YA 3DU0A 2OO6A 4LAOA 4Q4PA 3VZYA 1YXYA 4UWMA 2QYGA 3MYOA 4DJDD 1J0KA 3ZR6A 1QNPA 3W25A 5FEXA 3W22A 3WLHA 2QZRA 3NZGA 4PSRA 4FALA 2BNJA 3CIWA 4YCPA 2OZ8A 1UR8A 3GVWA 2Q8LA 2JGQA 4XD3A 3W02A 4AIUA 3SGZA 3LCLA 1N8WA 3JW7A 2ASHA 2DW7A 3FJLA 3BJTA 1D2KA 1M1BA 1UR2A 3QFEA 4E8CA 4GO9A 1B4EA 2PTYA 1UB3A 3TW6A 3W71A 2E9BA 4OV9A 4IGMA 3VOIA 5EY5A 1XICA 3WLTA 3U5UA 1C8XA 1EZ2A 1Q3NA 3ARWA 2UZ9A 4MPQA 3FN9A 3VOFA 3C0JA 3TV8A 2IQ0A 4UBPC 1XDMA 5C6MA 2C79A 4UTKA 3GXTA 1F8IA 3W00A 2Z1SA 4QG6A 4F79A 3NVDA 3W2JA 3OB8A 3T0AA 4BFAA 3S5OA 3SZ8A 5ABHA 1NQKA 4E8DA 2PI6A 1KR0A 2VZUA 5BOOA 4YS1A 5HMDA 2QUVA 2FKPA 4AH7A 3H53A 3H21A 5FL1A 1R3RA 3BC9A 3DIPA 4WF7A 1EPVA 3SCOA 5AHEA 4ZZ9A 2ISVA 1K8YA 2GGEA 1WAUA 3QH2A 2Z7KA 2VUYA 1I9CB 3DKLA 1CBGA 1V93A 1ME8A 4TX6A 1ENUA 1GG0A 1N82A 4MIMA 1X7FA 3W1NA 4JKKA 2CHOA 3L4TA 5FJPA 3WQEA 1W91A 1ISZA 5DBTA 3P6LA 5BXPA 1XBXA 3IARA 3RAOA 4UMBA 4L4MA 2RDWA 1N55A 3FXGA 3FFSA 3W2KA 3VMOA 4IHCA 4EPBC 1KBLA 1EPXA 4Q32A 3CC1A 3WQ8A 1NARA 3T0DA 2V3EA 5F7UA 2E28A 3SUTA 3HV9A 5HAOA 4C60A 1X6LA 3TONA 3UWYA 1XC4A 3J7HA 4LH8A 3VX0A 3T4WA 2YL8A 4IXXA 2XH0A 3ITXA 4D8ZA 3EB4A 1DPMA 4FR6A 3PVFA 4ZO7A 5T26A 3ITYA 1VYSX 3FX4A 3LCWA 3AHYA 3QVQA 8XIMA 2PCQA 3AIRA 1ZGDA 1FH9A 2VTFA 2BDQA 5LNWA 3SFKA 1VHCA 1XI3A 4IF2A 4DX3A 2BHZA 1C8VA 2ZXAA 4ZOCA 5HWNA 3WO8A 2FVMA 3GU2A 1OB0A 5DY3A 1W3NA 2DQXA 3EXTA 3MUCA 2AKMA 2ZDSA 1TRDA 3GY1A 4B2DA 4BWLC 2OLHA 4S39A 5M3WA 3EOEA 5GVJA 3WH5A 5AC7A 2CIPA 5TD4A 3WH7A 4XD6A 1UUOA 4L61A 4LV9A 2X1RA 3XINA 5FESA 3PSWA 2G8ZA 2A7NA 3TMLA 2DIJA 1R7AA 5FAGA 1DWAM 1H60A 3A22A 2WK2A 3TYCA 4CD4A 5A8OA 4YTUA 1ICPA 4KRUA 4L65A 5DX7A 2QAFA 3U2OA 3IVSA 4EIVA 2TYSA 2Y6ZA 3F2BA 1P6CA 1XWYA 4Q6JA 1PKMA 5D09A 1ZBWA 3V36A 3DESA 4XZWA 2VP8A 4D1IA 2PDHA 2V5CA 3DHFA 4QJ4B 3E5BA 2UY3A 1V6TA 4R7OA 2Z00A 4D8AA 3NQEA 2BTMA 1BRLB 4EK7A 2OXNA 1U2YA 1EIXA 4OUEA 3BJFA 3GZ3A 3QR0A 4IQLA 4B4FA 3K8LA 5LXEA 2CLOA 1GPFA 4ZQOA 1WPCA 1YLVA 2BVTA 2W27A 2ZFAA 3EB3A 4J7RA 1QI4A 4HZ7A 3O7UA 3P62A 1UZ4A 1Q8AA 5LIWX 5C2CA 4RV3A 4JTRA 3I7SA 4GISA 1NTHA 5BWFA 5I24A 1DTUA 1H7OA 4R88A 3FA3A 4QP0A 1TUFA 1UW9A 3F2CA 1E4LA 2GUUA 3MT1A 2D0HA 4QDWA 1F2JA 3O6AA 1ZP4A 3UNDA 3B0YA 2P3EA 1XCWA 3K4AA 5DANA 1E5NA 4GJIA 5AHMA 1HGWA 2QDEA 4GHRA 4MNJA 3T0BA 4A8NA 2HE5A 1KXVA 1E1FA 1VZWA 1LTDA 5FSEC 3SY8A 2B31A 1GONA 1RJRA 5HDRA 5FIPA 3GR8A 2QCDA 1A47A 1NY1A 1SJAA 1CLKA 2WC7A 1B4KA 1P0EA 2J25A 2IUZA 9XIMA 2E67A 1AZ1A 1JCNA 3OGRA 1KWKA 2JEQA 1CWYA 8XIAA 1ODZA 2E8YA 1SO3A 2YJQA 4NXSA 1YKWA 1M7PA 5I78A 3W07A 1PYFA 2PLMA 3VOHA 3HF3A 1J93A 4DPQA 1R8LA 1ZS2A 3BQ5A 1R5YA 2EG7A 1ALDA 1PIFA 4DRSA 2CESA 2HVOA 2WANA 2XG9A 4JNZA 3NL5A 2VELA 1OCJA 4Q8PA 1RPKA 1Q13A 4O1CA 1DHKA 1O5XA 2DGAA 3RK8A 4GZJA 5EBUA 3FAWA 4IIHA 4D6FA 1BGAA 3W1QA 1QCWA 2FFCA 3O2LA 4HK6A 1XRVA 3IGUA 5H8PA 4JTGA 4UC5A 4U31A 5C7VA 4Y2WA 5FF2A 2H90A 4NASA 1R86A 1BG4A 3B0VC 4HZ8A 3N34A 3RRAA 1HTIA 4ILSA 3JZEA 2PP3A 3NZRA 1B9BA 5I3IA 5HNNA 5IBXC 2Z26A 3BLDA 3ZYZA 3WYZA 2DEPA 4E4PA 1LOLA 2WWCA 5REQB 2J27A 4XAFA 3CQIA 3G0XA 2PWFA 4NU7A 5G4HC 4RDWA 4POCA 1E0TA 1WXJA 1VFLA 4NRSA 4M6VA 3MMUA 4KF1A 5TNVA 1V03A 3GD6A 5GQBA 4PTWA 2CLMA 2W0UA 2RUSA 2WHKA 4L6OA 1E0VA 3WKZA 4H8UA 3G8EA 3LXCA 1XXXA 3POCA 4MWAB 2WBKA 2GQ3A 3HJZA 3GO2A 4JTJA 3LTPA 4HP5A 3UZJA 2YDQA 3EZ4A 2BY3A 3Q58A 2YPIA 3WF4A 3P67A 3B0XA 1FWRA 5I77A 4EXQA 1O1HA 3WNOA 4IP5A 2R24A 3IJ8A 4XO7A 2J62A 4RNFA 3N3TA 4UQBA 1BEUA 3AIBA 4ZQNA 3L2IA 3B9AA 2NW0A 3BUVA 1IQ8A 1KFEA 4UB9A 4XZHA 1AH0A 3ARXA 2GWNA 4IP4A 2XIMA 3I6TA 3QQWA 3BSGA 4JD4A 5T8GA 1AQ0A 1DQXA 3WL0A 1ZHAA 3P7YA 1A49A 2PDGA 1AH3A 2WSQA 1KM2A 2XM1A 1B0IA 4PRRA 1ADOA 4P7LA 2GK1B 1VR6A 4A35A 1US3A 3Q37A 2GVLA 2HPMA 1XW8A 4W84A 3AI0A 2V38A 3CTLA 1XIBA 3RLHA 1K77A 2FTPA 4GCXA 2V2HA 3R2GA 4K2SA 4S3JA 4GYKA 3IPWA 2EPKX 1BXCA 1V77A 2IXVA 4EWND 2EBNA 1OIFA 1Q7ZA 3UGVA 3ZT6A 1ITXA 3S9ZA 1YDYA 5IM51 2GYIA 3CPRA 3P82A 2VEMA 1FUYA 4B5NA 3M9YA 2QCNA 2BS9A 2W62A 1OY0A 1ZLPA 2Q71A 4ZOAA 4ZQMA 4OOUA 3KL3A 5LNVA 4ZMGA 2MUCA 1P1XA 1VFMA 4AF0A 1PAMA 3KHJA 3U2EA 1JD9A 3QC0A 1AMKA 4JFSA 3I10A 1EJXC 3V1PA 1OFQA 4S1FA 3W1LA 4Q4KA 1DJIA 3AS2A 3WMLA 3W7CA 3CUZA 4JTKA 4PYSA 7XIMA 4BQ3A 1YHTA 3OIHA 1VENA 2O7SA 4DWSD 1Z69A