5EPDA

Crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
361
structure length
348
Chain Sequence
b'TLFQPTSLGAITLANRIVMAPLTRNRAGAGFVPGELTAGYYAQRASAGLIISEATQISQQGQGYQDTPGIYTQAQIDGWKKVTAAVHKKGGRIVLQLWHVGRISHVNLQPNGGAPVAPSAIRAEVKTFVNNGFVDVSEPRALELEELAGIVDDFRKAAANSIEAGFDGVEVHGANGYLLEQFAKDGANMRTDTYGGSVENRARLMLEVTAAVAQEIGPERTGIRISPVSPANGISCSDPQTQYDYIVDKLDALGIAYIHVVEPFDYGSLRRRFSRTYIANDLELATSHLADGRADLIAFGRPFIANPDLVERLQSGAPLAEVNAAKIFGGSAAGYTDYPRFSETTSDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerol trinitrate reductase
publication title The crystal structure of XdpB, the bacterial old yellow enzyme, in an FMN-free form.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Oxidorecctase
total genus 125
structure length 348
sequence length 361
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5epdA00
1H62A 4HNTA 1ZHAA 4MFEA 4NUWA 1OFQA 1TV8A 1QR7A 1GVFA 1LYXA 3MO7A 5E1QA 4MZ8A 3W7DA 3WJWA 4LOCA 1IIHA 1KM2A 4HPXA 4EF8A 2PE4A 4MY1A 1T0OA 3G1VA 3L21A 3PWAA 3MHGA 3S5NA 4AF0A 3FOKA 1YPFA 2JGQA 5AC6A 2C0AA 1WV2A 1B4KA 5FESA 2FLIA 4LV9A 5HNRA 4LNYA 5I3GA 3P80A 3LTSA 5HULA 1KM6A 3M6YA 4B5NA 1I4NA 5AC8A 5K9CA 1FDZA 2Z0IA 3G1SA 4JTHA 4L4LA 1N8FA 1KFLA 3F4WA 2YZRA 1TPH1 1ZFJA 3LHUA 5T26A 3TIMA 3NGJA 2ZRXA 1L6WA 2V2HA 3EWZA 5I3FA 3NL3A 2YYUA 4NJJA 3O06A 1OJXA 2NV2A 3TKFA 2EF9A 2Z2UA 1G6CA 1YDVA 2HS8A 5D02A 1WDWA 1SW7A 3PM6A 2I1OA 5C2XA 1LCOA 5C5YA 4N4QA 3MMTA 1OX5A 4CLMA 3W2JA 4I7VA 3BLFA 3QSRA 3UQNA 3W1XA 4JX5A 1I8JA 3C56A 1W5PA 1TQJA 1OFDA 2ZZ5A 1WA3A 1ZAIA 3W1UA 2RKXA 3TXVA 3LHWA 4ZQCA 3M0ZA 4O54A 4DPQA 3MBFA 2QKFA 1K03A 1AW2A 3G8RA 1XXXA 4JICA 5DY3A 3UYCA 3U8GA 3M5VA 2WNNA 3OVRA 1JQXA 3W7QA 4WQ6A 3N34A 3N19B 1DORA 3GAYA 4ZVJA 1KFEA 2TYSA 2BXVA 5CPMA 3GR7A 5CPNA 3UWYA 1TPC1 1EP1A 5DBTA 4H4IA 3B0VC 1I2OA 1KBIA 4K8HA 3W23A 3QRHA 1W5NA 1DBTA 5KZEA 3EWUA 2V82A 2EGZA 3O1NA 2V81A 1R46A 3G1AA 5LKYA 3RF9A 2QCLA 1F74A 5LGXA 4NX0A 4W9TA 1V5XA 1V7YA 4NZFA 1GJPA 4O13A 2C1HA 4FNRA 2QUUA 2NZLA 4NT0A 3HG2A 2JBMA 4AEOA 1VYSX 5I3HA 1LZOA 4TX9A 1QOQA 1LRNA 4IXXA 3GKAA 3QQ0A 1TPUA 3QC3A 4IJBA 5J5DA 3QSTA 4WY0A 5CZ0A 3O63A 1G4TA 3NM1A 4UNKA 2V2DA 2BSLA 1EA0A 2ZRVA 4FNUA 1OK6A 5AHEA 3DENA 1XBVA 3NA8A 4O53A 1TPFA 1NEYA 3A5VA 1AL7A 5AYYA 4WOZA 4LVGA 1JCYA 1QDSA 2A5HA 2H90A 3W7GA 4RLIA 1SR9A 3MJYA 4WXYA 4PFMA 4GRSA 4UTTC 2ATMA 2NWSA 4DPPA 5A5WA 3GDTA 4X9SA 4Z1BA 5E0KA 2F84A 3NAVA 1TV5A 4IMGA 3CTLA 3LXAA 1TRDA 1ML1A 4YL2A 5F4XA 2YDAA 4AVFA 3P8JA 5I3KA 4PEKA 5U7SA 1T8XA 3LX9A 4RX0A 1S3HA 1GG1A 4MIMA 3DFPA 2WKJA 1YYAA 4P61A 3TX9A 1VR6A 2OT1A 3TAOA 1XCFA 2WO5A 2CLFA 1DJQA 4JTEA 3G1FA 3HIJA 3FS2A 4O16A 2WJZA 1FUYA 3W7OA 5K9XA 4UCGA 3HPXA 1TJRA 1TQXA 5AHFA 3UXDA 5G2IA 2NX9A 2NX3A 3L68A 1JRBA 3KFTA 3WJZA 3LCHA 3L0KA 3TV8A 4O10A 5LZLA 4BI6A 5CSRA 4AXKA 2FQIA 2DZXA 4GUJA 4UMCA 1JCNA 4YCOA 2JKAA 1G69A 1SO3A 1W56A 3W9ZA 3C2VA 3O15A 5CG7A 1FCVA 5LNSA 4NJGA 4JYEA 4NJKA 3S5YA 1WAUA 3NPUA 5ABTA 1R2SA 4OV4A 3CB8A 4JX4A 4WOQA 1HL2A 1I2RA 4XTIA 1AW1A 4OGZA 4QSHA 3M5XA 4M5PA 4DO4A 3W73A 2QCCA 1SO5A 3JR2A 1E51A 3W7LA 4PL2A 1OFPA 4WXZA 4FNQA 1BWKA 1AL8A 3R89A 3G1YA 2VFHA 1JVNA 2TSYA 1C8VA 5FEXA 2JK2A 3NNTA 4CQ9A 4EOUA 1W54A 2VENA 4MJZA 1OG0A 1WOBA 4GE8A 5EKYA 1X1OA 4P2VA 1GEQA 1F05A 4OBTA 4N6EA 3WK0A 4BFAA 3E0IA 3BG3A 3W7MA 2O7QA 3TK7A 3EEGA 5HR6A 2ZZ6A 5KITA 1LM1A 4UIOA 3IVSA 4BWLA 4ADTA 4KWWA 3NZ1A 4AWTA 3E9AA 4QISA 3PVFA 1ZAHA 4O19A 1BTMA 3EB2A 4LS1A 2Y61A 4H6KA 1A5CA 3DH7A 4GUIA 4HHPA 1PV8A 5D2TA 2BTMA 3PBWA 3RLUA 1NSJA 3UWWA 1H7OA 3A23A 2YX0A 4QITA 3TC7A 3LHZA 1XDLA 4ZQPA 3QEZA 3SGZA 4QNWA 1ZY9A 1XUUA 1KW1A 3GNNA 1R2RA 5I3JA 1ICSA 4EIVA 2V8ZA 2Q8LA 1KTBA 3D0CA 3BGGA 3S5OA 2YR1A 1LBFA 2QCDB 4HSOA 3G0XA 3BPWA 3STEA 3F4NA 1UJPA 3FKRA 4ZQRA 3E96A 2GVJA 5AC7A 4GXMA 1IXOA 2C19A 1VYPX 5AOUA 5HMSA 3DFSA 1LBMA 3MI3A 1XL9A 3NEVA 1QNVA 8TIMA 4GUFA 1VCGA 4K36A 1CI1A 1IXPA 2FB2A 3GDLA 4Y96A 1L6SA 3UWUA 1TB3A 3M5ZA 3NQ2A 3KVJA 1AG1O 1VCVA 1KM4A 1KV8A 1T96A 1ZAJA 2YW3A 5AFDA 1P4CA 3TW7A 1B9BA 1YTKA 4LU0A 1HFBA 1OYAA 2QF7A 4O14A 1QO5A 2VFDA 1H1YA 5D04C 1TCDA 3W88A 4JTKA 3W86A 3QMTA 4PC8A 5D2WA 3SSJA 3C2OA 3L5MA 5EA9A 2ZTKA 3SW6A 1VHNA 4NJIA 1PE1A 3Q2DA 4R53A 3KVLA 2E1DA 3GXNA 3DHFA 1O5XA 4MLRA 4S1FA 1UB3A 3V75A 1S5VA 1KFJA 3MHUA 1FXPA 3TCEA 3O8AA 5F4SA 3DGRA 2X2GA 4RZ5A 3P60A 4O28A 3IGSA 3W7EA 4JD4A 2OT0A 2YPIA 4ONVA 3LCGA 1VQTA 3C8FA 4HKPA 3CEUA 4C1LA 1XC4A 2A7RA 3LV6A 4N4PA 3OVPA 2OZ0A 1P0KA 3A22A 5G5IA 4JY9A 2VEPA 5CGQA 1M7OA 2R8WA 3RLVA 1W3TA 3EWYA 2C18A 3RMJA 3TAKA 4BR1A 1DOSA 4UC5A 2DORA 2ZZ3A 4BI5A 3CQ0A 3SR7A 3LRLA 4XKYA 2QR6A 4ADUA 5EMUA 1LTDA 4O17A 2QJHA 2VKZG 3P81A 4Z1AA 3MYOA 3GDKA 1B57A 5AHNA 3VI2A 4A3UA 4AAJA 3WJXA 4A2RA 1GTEA 1Y0EA 4RZ6A 1IIGA 3IIZA 3WK3A 3LI1A 1FWRA 1FWSA 1SSGA 2ZQ0A 4QQ3A 1SUXA 4MOZA 4CNNA 2E5CA 3SGUA 1VLWA 4HPJA 3DI1A 2QUVA 3SZ8A 2Y7EA 1SU5A 3O6YX 3NQDA 1EB3A 5IBXC 1NVMA 3VE7A 3T7VA 3O05A 2QCMA 1W3IA 4UTUA 2X1TA 4N9CA 3S6DA 4NU7A 1Q6RA 3TSBA 1GZGA 2R14A 4FHAA 4PCFA 3GAKA 2ZZ1A 1MEWA 2GQAA 3TJLA 3NQEA 3PC0A 4C1KA 1W1ZA 2ZCGA 1A5BA 4XZ9A 1G7VA 3USBA 3FLUA 1PL9A 3UZ5A 3PF3A 2I9EA 1IGSA 4LV4A 1W3NA 3GR8A 1GVRA 1OF6A 1Q3NA 4J9JA 4O52A 5AHMA 2G95A 1LOQA 2HTMA 3DU0A 3P8IA 3QZEA 3FFSA 3TC6A 1L9WA 4O18A 5F4WA 3MW7A 2DZUA 4OWGA 4WX2A 4IMDA 4FXSA 5FF2A 3GKFA 3W72A 3CM4A 1OX4A 5CPLA 3PBVA 3PY2A 1OX6A 2OX1A 4GUGA 1KM3A 3ABRA 1G4SA 3TMQA 3FYOA 3IGXA 3DFOA 1EEPA 1QAPA 4LWWA 3F03K 3P5ZA 2ZA2A 4IWWA 4JGDA 3UWVA 1UUOA 2Q3OA 2FDSA 3PSVA 1FDYA 4K37A 5DELA 3G0UA 4DEFA 5BRBA 1R30A 2H8XA 5K2ZA 2J9XA 4TMBA 2B7OA 3BVJA 4EWND 4OHQA 1TYGA 3HMJG 1W8SA 3WJYA 1P5BA 3LHVA 1SW0A 1ONRA 3S1UA 1OVDA 3EWBX 4JEQA 1H50A 3W1TA 1WOAA 1SZEA 1GPWA 4I9AA 3H53A 2Y89A 4NZJA 2PURA 1Q6OA 4LRTA 5TBOA 4O4VA 4K7YA 1THFD 3HG3A 4Y8FA 3I6RA 1B4EA 3W22A 1KV5A 1ZENA 5HUPA 4OV9A 3PBYA 3N2XA 1UUMA 3CLMA 1FXQA 5HWJA 1I2PA 4POCA 3UPBA 5BOOA 4O15A 5G1TA 2V2CA 3MI2A 4WY0F 4NX5A 1AK5A 1EUAA 1F7BA 1G4PA 3ZR4A 2Y6ZA 1GVOA 2ABAA 2GOUA 1QO2A 4ALDA 1QMLA 4PODA 4YXGA 3KRZA 5BNKA 1L6YA 6ALDA 4XQ6A 1WQ5A 2EAWA 4ZQNA 4HNNA 1KFBA 1FCUA 1SW3A 1QPNA 1S5TA 4M6VA 1GVQA 5TQLA 4UMAA 3ZWTA 2A1YA 4M7TA 4GBUA 3KVKA 2J9YA 2Z6IA 1EIXA 4M19A 5HINA 3THQA 3Q37A 4ZQOA 5LHFA 1NF0A 2OJPA 3EWXA 4NXSA 2JKPA 5G4EA 1XI3A 1XBXA 5K4ZA 3IVTA 3M5YA 2VFFA 1Z41A 2E5DA 2C14A 3M47A 2BZNA 4O57A 1DL3A 3I68A 1MZHA 3W7NA 1C29A 3NR0A 5E93A 4JDYA 1LORA 4JTTA 5IBXA 2W79A 3BV4A 5DLCA 2AAMA 3S1WA 2E6DA 5DCDA 1XBZA 5LHEA 4FNTA 4LS2A 5KZDA 1VLIA 2WSQA 1FCQA 2CZFA 4BWLC 1KA9F 1W0MA 3K30A 3BG5A 4WY0B 1GYNA 4MYXA 2HSAA 3CHVA 4EVZA 3LV5A 1M6JA 2G97A 1PS9A 3QW3A 4K38A 3DI0A 3IV3A 4R34A 4OE7A 4N9DA 2J9ZA 3G0SA 1H7WA 4TMCA 3PAJA 4NNAA 1ICPA 3S5ZA 3MP3A 4IMFA 2CLIA 2FIQA 4IGHA 1K7XA 4L4MA 4AWSA 4DO5A 2GPTA 1RPXA 1TPWA 3I7RA 3QMRA 4OU1A 3PS7A 1OFRA 3TSDA 2YSWA 1BWLA 3YPIA 1TPDA 4UTKA 1TV7A 4UTLA 4ZQMA 3BO9A 2YFNA 3FYPA 4RCXA 3M7WA 2WPBA 2RHGA 1PIIA 1KTNA 3WK1A 3M43A 3LOTA 1DVJA 3W2LA 3NPXA 1FY6A 1TSIA 3TFXA 2WNQA 3EX1A 4G1KA 4HNUA 1FWNA 3NQCA 1UBSA 1WYIA 1O4UA 4X2RA 1MEHA 1EP3A 3CWNA 3I7SA 4MUZA 2WV8A 1YDOA 1H51A 3UWQA 2VEIA 1KLYA 3NQMA 2C3ZA 3LDVA 2V5LA 1LBLA 3MHFA 1PHQA 4XUGA 5D38A 4FX7A 1RQEA 4QNEA 1A53A 1FCBA 4UR8A 4AHPA 4UTWA 2AGKA 3IIPA 3LB0A 2UV8G 2QUTA 4XBSA 3VKJA 3VNDA 5LNVA 4ML9A 4UFIA 2AQWA 1Z44A 2JKEA 1P1XA 3W3OA 5H91A 4GJ1A 2PRLA 1LLZA 3BW4A 4UXDA 1A5AA 4N02A 3L5LA 2BX7A 4YCPA 3C4UA 2GJNA 3GLCA 3P67A 3GVGA 3M1ZA 1OABA 4JX6A 1TREA 4JXCA 3P82A 2V0TA 3NQGA 4A2SA 2NUYA 3NL6A 3PUEA 4Z1CA 2J27A 3W75A 2TRSA 3GNDA 4QJ1A 5EPDA 4GFSA 4MY8A 1CX9A 4MZ1A 5DY2A 4A21A 1ZNNA 5K7JA 1SQ7A 4RXGA 3CIXA 3UY7A 1M5WA 4UFJA 3BARA 1X6UA 5CZJA 1J4EA 3ELFA 1KM1A 3PUDA 2H3BA 5LGZA 1FDJA 5FEWA 5G2WA 5DXYA 2ZZ2A 2DZPA 3UNDA 1R2TA 3KVMA 3R5EA 3LRKA 4ORIA 4IX2A 5D2XA 4JIQA 1H7NA 2NUWA 4LS0A 3HJZA 3T4CA 1W31A 3R2GA 1TTIA 1K7EA 3O6DA 3DBPA 4CCCA 1SPQA 1PCKA 2CZDA 3TW6A 3GYEA 1SO6A 4R33A 3M9YA 4QIUA 2QDGA 1UCWA 4NNBA 5EYWA 3FIGA 4BF9A 6TIMA 2V30A 3W1MA 4LVFA 3AJXA 1ADOA 4DQWA 3G18A 5G2HA 4XWUA 1K8XA 2FPYA 3TNOA 2C15A 1EPXA 1TPEA 4XTDA 5D32A 1H60A 3W1NA 2YXGA 4Y9AA 3CU2A 1QWGA 2ZFAA 4KWVA 1JULA 4WD0A 3IEBA 1SO4A 1H7PA 2E6AA 3L0GA 3TQKA 1RR2A 3T40A 4UTHA 2ZTJA 4JYDA 2GQ8A 3NQFA 3QM3A 2H3DA 4OT7A 3EXRA 1RZMA 2PC4A 1F76A 2QCGA 2FTPA 4PA8A 5F2MA 2X1SA 5D37A 4UTIA 4JR5A 1WX0A 1PVNA 1TTJA 2VFGA 1VCFA 3DFQA 4K6AA 1N55A 4O4WA 3LERA 3W2MA 3W1RA 4PH6A 4E2DA 4CNOA 3OHIA 2DP3A 2PRMA 4N6FA 4WJEA 5GVJA 5L6UA 1OFAA 4AMAA 3G1XA 3S1XA 5K9DA 3W84A 2QJGA 4KKXA 5BMWA 5G1YA 4JYFA 5F1VA 2A7NA 3BK0A 1SZNA 2Z1BA 1DHPA 5AYZA 2Q3RA 5KMYA 1WXJA 4CCDA 3IVUA 1YLVA 1VZWA 4MYAA 3RU6A 3NL5A 3KXQA 2RDUA 3W2NA 2A21A 3EX4A 4D2JA 2DJLA 4ZZ9A 4HN4A 2B0MA 5FI8A 3B03A 2VEMA 1K02A 2ZRZA 3DHDA 1QPRA 1KFCA 3L66A 4ORMA 4UFMA 3TXZA 2NXHA 4GNJA 5BW6A 1Z48A 4Z0SA 3QF0A 2G5WA 2NXIA 4DELA 3TE9A 3HBLA 4QM1A 3LBMA 1JR1A 1VHCA 1F73A 3F1QA 1YADA 3P62A 1KLZA 4CCEA 3KRSA 3GZ3A 3OBKA 3H55A 2ZRWA 4N2YA 3TROA 3PSWA 4FNPA 5HJLA 5HWNA 2YCEA 4XKYB 3B0PA 3I65A 4LUJA 3TQ0A 3W2KA 2RFGA 5HQEA 1H7XA 4MPQA 5AHLA 3UD6A 4BK9A 2YYTA 1JCMP 1Q45A 1JQVA 5D2YA 4ZMGA 3UXAA 3MP4A 5FEPA 2EPHA 3R13A 4M7SA 1GG0A 4LW7A 5KZMA 3LCWA 2P0OA 3NQAA 4AHOA 1XUZA 3M44A 2A85A 1ZCOA 3OG3A 1ME7A 3W71A 1H1ZA 3N9SA 1VS1A 5AB3A 4TR9A 1K3UA 4O11A 2DU2A 3SECA 1QOPA 1BEUA 2XFWA 2ZRYA 3OIXA 3ZS4A 3O6CA 4NQ1A 2B4GA 4E38A 1JUKA 2ABBA 4IXHA 2A6NA 3G3MA 3THAA 3S8HA 1I2QA 4X22A 4FO4A 2YW4A 3W6YA 4KFNA 4DF2A 2ZYFA 4FNSA 1Z42A 2E68A 1F6KA 2A0NA 4YMZA 5I3IA 1MEIA 2CLLA 3E02A 3LI0A 3G8EA 3LCXA 4O0KA 1PCWA 2V5BA 4KFPA 4N9EA 4ICNA 1H61A 4O1DA 3KX6A 1NF7A 1OFBA 3B8DA 3TUUA 3SY5A 2OCZA 1K8ZA 2LLEA 3NXFA 1HO4A 1KFKA 1TTPA 1VC4A 1SSDA 3W7KA 3WFAA 3NOEA 4JNMA 7TIMA 3W7PA 2CU0A 3QW4B 4O1AA 3NPWA 2WSYA 3NG3A 1Q6QA 2NUXA 1D9EA 2DZWA 2CLMA 3RFAA 5LNRA 2D73A 1F2JA 1I45A 1KBJA 1LRTA 4GUHA 2VFEA 4N9BA 2Y63A 2YGYA 3GX9A 3SJ3A 4MLJA 1VGAA 2QCFA 1RQHA 3N3MA 4O12A 1YPIA 1N7KA 4MVAA 3VE9A 3A5FA 3UPWA 3EXSA 4LVBA 4AF0B 1UASA 4LTSA 5FF4A 4JDBA 1FX6A 1QCWA 3A21A 4FEZA 2P10A 5CKSA 1JCLA 3NQ8A 1LOLA 3TU9A 1EX5A 4H3DA 2ZDRA 3B4UA 1OHLA 1SFJA 3LHTA 3IGUA 3MI6A 2CZ5A 4Y90A 3P5YA 1T99A 2E77A 1GQNA 4PL1A 1GT8A 1FBAA 1W37A 1EWDA 3BG9A 1O95A 3W7IA 3P74A 4UTWC 3INPA 2R94A 1KM5A 1C9DA 3LCIA 5BMXA 3LTYA 3N73A 1NFBA 1P0NA 4Q4KA 3NQ6A 3IIVA 5TIMA 5AN7A 2V9DA 1A5SA 2PCQA 3VFLA 2NWRA 4O0ZA 1ZJIA 4AH7A 1RD5A 4O1CA 3L9CA 3M16A 3LLDA 3UWZA 2WOQA 1CW2A 5KTLA 1OYCA 3B04A 2RH9A 3HGSA 4MFDA 3QJAA 3S9YA 4ADSA 3TSMA 1TPVA 5CZSA 2QDHA 2DZSA 4IMCA 4IUOA 2I14A 2EKCA 5FEZA 1YXYA 4A22A 3W2UA 4MZYA 3EWWA 2GUUA 3NL2A 2C16A 1ME9A 3TFCA 4DXVA 3TDFA 2P1FA 3A24A 2C13A 4LVAA 5C55A 4HNVA 1IXQA 5D03A 4HIBA 5L9FA 4S2BA 5LNUA 3C0JA 4JY8A 3DXIA 4UFHA 5KINA 3BW2A 3NO5A 4RV8A 4Z08A 5D09A 3W7HA 1TO3A 5EY5A 2ZA3A 1HO1A 2Y7GA 2FFCA 2EHHA 5CPOA 3S1VA 5CSSA 3IIXA 3R12A 3PG8A 1H5YA 3CC1A 2VELA 1YTEA 3SFKA 1VPXA 1YTDA 1HTIA 4S2CA 4JTSA 4NVTA 3G3DA 1JUEA 1LRQA 1F5ZA 2WSRA 3PULA 1O60A 3CIWA 1YDNA 2FB3A 1XFBA 1KM0A 3ABQA 3KAOA 3C61A 2E6FA 1DQXA 2B7QA 5SWUA 2F7FA 1R47A 4IQLA 3HB9A 2J88A 3PB0A 1BKSA 4A29A 4NNCA 2TMDA 3EX2A 2H8ZA 4DBEA 2VC6A 3KOFA 3HG4A 1ICQA 1OK4A 3DZ1A 2Z6JA 3GDMA 3HPSA 3LGEA 4CNPA 2Y7FA 4Z0JA 4AB4A 2DZTA 2BWGA 3LCLA 3LTPA 5D33A 3L2IA 3IIOA 1ME8A 1F6PA 3EKZA 4IPJA 3T78A 5DCBA 3C52A 4XBKA 3QPYA 1JUBA 1LP6A 2Y62A 2CFFA 1SFLA 3AO0A 2XN2A 3M41A 4M6PA 2NV1A 2PRHA 3O16A 5F1UA 5FF7A 3ABOA 4NJHA 3Q94A 3W1PA 3W7RA 3NPVA 2OMAA 3GDRA 2BLEA 3CT7A 1JRCA 2NLIA 5G4WA 1D3GA 4K39A 3BGJA 3DFTA 5A8GA 4TIMA 1GVSA 1O94A 4DF0A 4YWIA 5AYXA 3L0NA 2A6LA 4JS3A 1DKWA 1VYRA 2VEKA 4E0CA 2CZEA 5DXXA 2QCEA 1LOSA 3ABSA 2ATSA 3L5AA 1ALDA 4FXRA 4UTMA 3W74A 2NX1A 1VRDA 4Y6GA 1G4EA 5D30A 2NXGA 3BW3A 2W0UA 3WJSA 4CQAA 5EL1A 1J5TA 2CLHA 4FB7A 3PG9A 5D2VA 4JTGA 1MSSA 4FX6M 3W1QA 2Y7DA 1GWJA 3S42A 4PTNA 4OQVA 1LLWA 1AMKA 2O7SA 3HG5A 2CW6A 4JTIA 4M6QA 1J2WA 1S5WA 1OF8A 1SZGA 1W5QA 2A2IA 1NAL1 3W7CA 4JTUA 2X1UA 3JRKA 1JCXA 3CEPA 1JCJA 1EWEA 3MUXA 3EKLA 3NQVA 4I7UA 3I7QA 3HF3A 3MYPA 5AHIA 1TRIA 3GIYA 3NDOA 5K3VA 4UFLA 4NXKA 4UUIA 4YLWA 5IM51 1X8FA 1M7PA 2YFOA 5D05A 1G67A 1HG3A 1GOXA 4UFKA 5C54A 4JTLA 2ISSA 1DV7A 3QMSA 3BLIA 4ZL1A 3PB2A 4U4MA 4KFOA 3KRUA 1O5KA 2FJKA 4GWEA 4Q32A 2QCHA 5F2LA 2JGYA 3O07A 2GVLA 3VCRA 2X16A 3S0CA 3STCA 1TJPA 3W1AA 5HR7A 1EUNA 4HT3A 3SI9A 1GYLA 1K7FA 1IF2A 1U83A 2ZZ7A 4RJEA 3PR2A 5FF3A 3QFEA 5H2ZA 4DO6A 3B06A 1H7RA 3P61A 2HS6A 4LC6A 4GC4A 4RZ4A 1SZFA 1A50A 2QCNA 3LM7A 3GXTA 1FWTA 1QPQA 2DZVA 3C3NA 3W85A 4FIQA 2X30A 4MJMA 4JIPA 3C6CA 3ZFHA 1VJIA 3NVTA 3FJ6A 3GXPA 3L67A 3DFNA 2TPSA 3T44A 2A4AA 5HUOA 2FPVA 2B7PA 1HUVA 3TJXA 3LCFA 2CLOA 5EBUA 4LVDA 2Q8ZA 2ISVA 4E2BA 5F2IA 5FF0A 4K8EA 3TR2A 5HWMA 3FEMA 2IQTA 2R91A 5DCEA 4O1BA 5DBUA 3FA5A 2XN1A 1FWWA 2GQ9A 4LRSA 4UTTA 3N9RA 3QPZA 3G22A 3HPZA 2A7PA 3G1HA 2GJLA 1YXDA 2E09A 4WUIA 2XN0A 3FJLA 4MY9A 1X1ZA 2CLEA 4IX0A 2RDWA 4FX8A 1RQBA 4RKAA 3EXTA 1OFEA 4IOTA 2ZRUA 1WBJA 3PUOA 3A9IA 2QJIA 3PBUA 4FIRA 2QCDA 3U2OA 5J5RA 4LUIA 2QEZA 1DJNA 1TTQA 3W70A 3IRDA 4UTJA 5KSWA 4UR7A 3DKLA 3LXCA 3HOJA 3KHJA 4JTJA 2W6RA 3W07A 1MXSA 1XM3A 3E12A 2QAPA 2VOMA 3W7JA 1TIMA 5F2GA 1RV8A 3N14A 4AHQA 3ANYA 1H63A 3QYQA 4R7JA 3MWAA 3EX6A 3N2MA 4WZHA 3HGOA 3OA3A 3W76A 4JTFA 3TH6A 3RNDA 1Q6LA 4O8RA 2Y88A 3CPRA 4LY8A 3STGA 3FKKA 2GVGA 3GB6A 1LROA 5K4XA 1QPOA 3UZJA 4RXFA 1X7FA 2RDTA 5DN1A 1XBYA 4TO8A 2ZBTA 3C2RA 4LC8A 3ZWSA 3TMLA 2E5BA 4I7WA 3QQ1A 3WK2A 4K7VA 1G7UA 2CWNA 1MO0A 4UMBA 2WNZA 3MBDA 4FF7A 1PHWA 4RR4A 3DKJA 1B3OA 3P84A 3NQ7A 2J6XA 4AWUA 1D3HA 2C6QA 2ZZ4A 4UNLA 1IXNA 1OFOA 2B7NA 3LLFA 1L2UA 4IMEA 3QH2A 3MP5A 3ATYA 3SIZA 4QAIA 3C2EA 1AW5A 4O50A 3HQ1A 3TA6A 4IPIA 1W5OA 1LDCA 5C6MA 1OX4B 3EX3A 1ZALA 5MHBA 3G1DA 1JJKA 2G96A 1XKYA 3UY8A 2Y85A 1TPB1 2E6YA 5U4NA 3L65A 4CQ8A 2Y70A 1KTCA 4Q33A 2QAFA 1XDMA 4MKNA 3Q58A 1U5JA 2HMCA 1YXCA 3B05A 2H6RA 4X3ZA 1I2NA 1QFEA 4BI7A 2ZA1A 3LBCA 3RK8A 4RK8A 1OYBA 3V1PA 3H54A 3TQVA 3DAQA 1EP2A 3HGJA 3ATZA 3C2FA 1W5MA 3BLEA 1GTHA 3W1LA 5CZTA 2VFIA 3NZRA 1K8YA 5LNWA 1VH7A 3NYZA 3OEXA 1DQWA 1RVGA 2KZHA 4LT9A 2CLKA 3NM3A 3W87A 2ALDA 4JN6A 3HGRA 2WQPA 3JS3A 4HSNA 4U28A 3STFA 3LXBA 3U6WA 2ISWA 2FPTA 3G24A 3P7YA 1TMHA 1WBHA 3OVQA 3LHYA 2X1RA 3B0UX 5LSMA 2J24A 4DBDA 4Z1DA 4EF9A 4TU1A 3T55A 3W83A 2VXNA 1FQ0A 3LRMA 3R8RA 2DJXA 3E49A 4DF1A 3GK0A 3HO8A 3CWOX
chains in the Genus database with same CATH superfamily
4HNTA 1MQPA 8CGTA 1VF8A 5BOFA 3VGHA 2PDUA 4LOCA 3G6LA 1M01A 4AXNA 4HK7A 3TC3A 3ARYA 1R3WA 2ZX8A 4MWAD 4AF0A 1P7TB 5AC6A 2C0AA 4LV9A 3M6YA 5K9CA 1E9IA 3G1SA 2FFIA 3CHDA 1JD9A 4JTHA 1N8FA 3F4WA 5A1AA 2CCRA 3BJTA 1TPH1 4PCPA 1ZFJA 4F9JA 5T26A 3EWZA 5I3FA 3AIEA 5M1TA 1I0DA 4PB3A 2GDUA 4Q7IA 2INFA 3KP1A 1M04A 3TYCA 2HPIA 1OY0A 3BTNA 1V08A 4MDOA 2WBGA 1SW7A 1LCOA 1XHGA 1LT8A 2FHFA 5XIMA 2D20A 3W2JA 5KEZA 3EPMA 4I7VA 4YVPA 4HA4A 3CV1A 1I8JA 1OFDA 1TQJA 1R5YA 1OC6A 4H83A 3W1UA 2RKXA 5AYIA 2Y1HA 1Q6GA 4REQB 1PX8A 2QKFA 3KOWA 3KCLA 3VNZA 1AW2A 1IT7A 3U8GA 3VILA 3OVRA 1E1CB 2AQOA 3GAYA 2TYSA 4ZVJA 4NILA 2ACUA 5DBTA 3WDQA 2VQUA 2PDMA 4H8VA 1Q7ZA 2EGZA 3G1AA 3RF9A 2GWNA 1ONEA 2QCLA 1UD4A 4QS6A 2VRJA 1V5XA 3MTWA 1W32A 2IW0A 3MMWA 4NF7A 1GJPA 2C1HA 4FNRA 2QUUA 3HG2A 2JBMA 3CUHA 4AEOA 4TX9A 5FA5A 4IXXA 4YPJA 4RE4A 3PANA 2GK1A 5CZ0A 1LG2A 3ISIX 4UNKA 4OOZA 4D6DA 2BSLA 1EBGA 3BAJA 4FNUA 3SUUA 1SMDA 3FAXA 4E8CA 1WKDA 4A35A 2IPFA 4C90A 3A5VA 1AL7A 2A5HA 2H90A 3W7GA 4RLIA 3AXIA 2WYSA 4UTTC 2ATMA 2NWSA 4DPPA 3XINA 4Z1BA 3NAVA 4F79A 1GGOA 1ML1A 4PEKA 3B8UA 2PDHA 4MIMA 4DUVA 2OT1A 1E0WA 5I07A 3G1FA 5HK4A 3HIJA 4Q8PA 1VENA 2JE8A 3GHSA 2WJZA 1FUYA 3W7OA 3CL6A 4UCGA 3HPXA 2UY5A 1TQXA 3UXDA 3URQA 2HBXA 2NX9A 2D3LA 1JRBA 1J79A 4H9UA 3TV8A 4C6JA 2QGYA 4O10A 3IAQA 2BGQA 3RRXA 4UMCA 1JCNA 1FTXA 2JKAA 3ITGA 1W56A 5CG7A 1QVBA 1FCVA 4NJGA 4ZSUA 3NPUA 1ITUA 4OV4A 3CB8A 4ATDA 3FDGA 4UOQA 4WOQA 1QI4A 1AW1A 3FVDA 3OB8A 4AUBA 3M5XA 4D6JA 2QCCA 1QBBA 2DDXA 1E51A 2PBOA 1OFPA 3CUIA 3ITTA 3BCDA 2R1LA 1BWKA 3GXMA 1C3FA 2OYLA 1BGGA 2TSYA 3BAWA 1AH0A 1JDAA 2JK2A 2VX7A 4E4UA 1WZLA 4DN1A 1W54A 2VENA 4MJZA 3QPEA 2Y0FA 1OG0A 1WOBA 4X0VA 4GE8A 1MUWA 4IIGA 4C6LA 3WLQA 4P2VA 3DC0A 4JQ4A 3COTA 1F3XA 4N6EA 1QI5A 3N6QA 3E0IA 4HQVA 3TK7A 3WDPP 3UU0A 4FLOA 3EA1A 5KITA 1LM1A 4BWLA 1D3CA 1WZKA 4KWWA 4HZ8A 3NZ1A 4HTBA 4ICMA 1SM9A 5CPSA 3PVFA 4NRRA 4HZMA 4TQTA 3VNLA 4J27A 1HP5A 3S2JA 1DE6A 4DYJA 3BLKA 1X6LA 3RLUA 2J4GA 3N4FA 2YX0A 3TC7A 5IFPA 3LHZA 3UR7A 3D5HA 1BKHA 1E9YB 2XPKA 3VIMA 2P8CA 4WCJA 4QNWA 1E6ZA 4MJ4A 2IKJA 4CGTA 2YL6A 1XV8A 1U33A 2Z24A 1UKTA 3G0XA 5A2BA 2ZUUA 4O1FA 3K1DA 1UKPA 3ABZA 4PYSA 4GQRA 4WDWA 5AC7A 1IXOA 1KBLA 2C19A 1LBMA 4AZCA 2WHKA 3EAUA 4K36A 2VGFA 1IXPA 4HA1A 3GDLA 4GGHA 4L4PA 5DO8A 1I60A 1KRBC 1FHUA 4P7RA 1AG1O 1KM4A 2QV4A 2J25A 4GO9A 1SJAA 2YCJA 3TOPA 4HOWA 1G94A 1P4CA 3VGGA 3S2CA 2QIIA 2RJHA 3FJ4A 1YKWA 4O14A 2VFDA 4MADA 4BQ5A 5D04C 3BLDA 3MQTA 3T4WA 1CXKA 2W63A 1VHNA 2E1DA 3OJGA 4ZA0A 3CPUA 3S46A 1R3YA 3MHUA 1TMQA 1FXPA 3TCEA 5F4SA 1Q2SA 3ES7A 2X2GA 2HROA 3IGSA 3W7EA 2YPIA 1BF2A 4PUEA 3C8FA 2XGZA 4HKPA 3CEUA 5I2UA 2A7RA 5A6SA 3VD5A 3OA5A 3WIJA 3FXGA 4UQDA 3RCYA 1P0KA 2DSVA 2VEPA 1M7OA 4IGSA 1EHAA 3RLVA 4KEUA 2ZUMA 1TV2A 4M3PA 4FMVA 5JBFA 3TAKA 4BR1A 4IJCA 1UR9A 3CQ0A 3VD4A 3UCDA 3HFTA 4ADUA 5EMUA 2OQLA 4O17A 3MYOA 2V5KA 3GDKA 5A2AA 3CZKA 4TVDA 3L4TA 4A2RA 3W29A 3IIZA 3FSUA 4Q8VA 2VL4A 2WB5A 4MOZA 1B3XA 3CASA 2FVMA 5IBXC 3T7VA 1W3IA 3IUDA 2X1TA 3EMZA 3S6DA 4NU7A 1DIOA 2WSPA 2R14A 4FHAA 2DVXA 3UT0A 1C90A 3VIOA 4XZ9A 3OIHA 3VMOA 4C6PA 2X42A 3USBA 2P5NA 3QZAA 1X39A 3FLUA 1PL9A 3PF3A 2DT3A 3L7RA 3WBXA 3V5OA 2G95A 1LOQA 2QXWA 3P8IA 4FPSA 2DZUA 3O0FA 1RP9A 4IMDA 3URAA 2ZVRA 2J13A 3L4UA 3PBVA 2J7CA 3PY2A 1K9FA 1KM3A 2ZICA 2WZIA 2REQA 1P48A 3TMQA 3MDUA 1JPIA 2ZA2A 3QHNA 3UWVA 1EPVA 2I5GA 2V3EA 2Q3OA 4HMNA 3MJMA 4L1GA 2G3NA 3RRAA 5A69A 4DEFA 5BRBA 2H8XA 5K2ZA 3CS2A 1BQCA 4GCXA 2B7OA 4CUCA 4EWND 5H8MA 1SW0A 4AMCA 3IAPA 3C5QA 4HB7A 3A13A 2AGTA 4CD5A 3KZPA 1SZEA 1NWUA 3EDKA 1M53A 3WEZA 2EG7A 3AYTA 3UR5A 4Y9MA 3FDKA 1ZBWA 3TJ4A 2EBNA 1THFD 5HQLA 4Y8FA 3I6RA 1KV5A 1ZENA 4C5ZA 1OM0A 2UZ9A 4Q6JA 1GKPA 1UUMA 3N2XA 3UPBA 2VZTA 4O15A 4WY0F 4NX5A 1JEZA 3ZR4A 4MWAA 4IPLA 1GVOA 1BF6A 2POTA 3GNRA 3ABXA 1QO2A 4EAYA 3DHPA 1S5NA 3ITOA 4YXGA 4NSBA 2C8NA 2EAWA 4XUYA 1JIBA 1HF6A 4CU7A 3S2MA 4Q4SA 4Q8NA 2YBVA 3GU9A 4QEHA 3LBOA 1TJ2A 4S38A 1BD0A 1ZJAA 3T42A 1P7TA 3PJUA 2A1YA 4E2OA 3OLEA 4IQDA 2R1PA 1UH2A 2Z6IA 2IUZA 3WF0A 1NF0A 4A3RA 1N8IA 2OJPA 3V0SA 3SGGA 5G4EA 3IVTA 1CXLA 3GXDA 2C14A 3M47A 1IZJA 3I68A 1MZHA 3N29A 1C29A 4JFTA 5C7VA 3NR0A 3BV4A 3VDCA 2AMGA 4BA0A 2E6DA 1XBZA 4EXBA 1KA9F 3BG5A 1KBBA 4EVZA 3LV5A 1B2YA 3QW3A 1F9CA 3FVMA 1ZQ5A 3EMQA 4K38A 5ABEA 2EPNA 4S3JA 4R34A 4QQUA 3ARRA 4NI3A 2PGRA 1L6FA 4TMCA 3PAJA 3B8IA 5IRPA 3POCA 2NVCA 3OBEA 1DJZA 1EKOA 1OG6A 4DO5A 1IEWA 1A0EA 3HZ3A 1TPWA 1PXGA 3H7RA 3I7RA 3WF3A 1JZ5A 1OFRA 2QPSA 4REQA 4F40A 2V3GA 2EO7A 3WUBA 3YPIA 1TV7A 3UXIA 5C8BB 3EDDA 3QQWA 4J28A 1XD1A 1E1CA 3CT2A 1PIIA 2GVEA 2OEKA 2WCAA 1XIEA 2G50A 2QIWA 4H04A 4U2ZA 3ITYA 2X40A 3W2LA 4XIAA 3WLRA 2PWGA 1RY8A 4G1KA 4HNUA 2VHLA 3NQCA 1UBSA 2UBPC 1UD3A 3WH5A 3CWNA 4HCHA 4IIEA 2W27A 1XLHA 2WV8A 1ZBCA 1H51A 4J3ZA 3GY1A 3MU7A 3IARA 1LBLA 3CZGA 4P5UA 4XUGA 5D38A 1A0DA 2FGZA 1RQEA 3WLLA 3RX3A 2RDXA 3IIPA 3KL5A 2E0PA 1G0CA 3CZJA 1RK6A 3VKJA 5LNVA 1VFLA 1R38A 4ML9A 2X0SA 3LSCA 1P1XA 1WP6A 2Z1XA 1QT1A 1A5AA 4N02A 3V1HA 2BX7A 5JBDA 3NZQA 4DLFA 3M1ZA 2CITA 1TREA 4AD1A 5FSDC 4A2SA 3KE0A 3MDWA 4ACYA 3W75A 1TUXA 4GQQA 4QJ1A 3WLSA 1BSIA 1SQ7A 1PKLA 3PTKA 1QTWA 4FXJA 1X6UA 3WY1A 4Q6XA 1J4EA 2QULA 4S3KA 1KM1A 3PUDA 1UWTA 3KLLA 1IEVA 3VOIA 5FEWA 3KHDA 5DXYA 2HQAA 2OX4A 1JXKA 1XFCA 3R5EA 3QKZA 4JIQA 1H7NA 1A3XA 1X38A 3SUVA 2QYGA 2ZUNA 1CGYA 4N42A 1SPQA 1HVXA 4R33A 2QDGA 1UCWA 3FIGA 4LUSA 2NQ5A 3W1MA 4LVFA 5CJNA 4DQWA 1EZWA 3G18A 3H21A 3TNOA 1TPEA 4XTDA 5D32A 5T9CE 1JI2A 2ZFAA 4KWVA 1JULA 3QOKA 3L0GA 4QS5A 4YVXA 1VEMA 1H41A 3G2GA 3AHVA 5CGTA 1Z89A 3WNOA 2H3DA 4GK8A 3RM8A 3EXRA 1Q6EA 2BODX 4H9XA 4KRTA 2IKGA 1KGXA 4JR5A 4DUWA 1PVNA 3DFQA 1OEPA 4KF1A 1N55A 4O4WA 2J7HA 4HMCA 3W2MA 4KEVA 4Z2JA 1XGDA 5CPTA 4CNOA 2XFFA 3VGBA 2PRMA 2PA6A 1PTGA 5K9DA 3OQEA 3OTRA 4WSHA 3W84A 3L4VA 5T9BG 5F1VA 2A7NA 3BK0A 2DUAA 1NIUA 3AYVA 1DHPA 3TN4A 4F0MA 1EDQA 3LZ3A 2GGGA 1MMFA 4QJ3B 2Q3RA 5AECA 1KQYA 4L1WA 3OW1A 1VZWA 2GFTA 4CNUA 3NL5A 3KXQA 2HDJA 2GJPA 1Y5VA 3SCOA 3RJYA 4F0RA 2OU4A 3L66A 1XLBA 3UCQA 1CXFA 4UFMA 4J3TA 1A5MC 2FVKA 2NXHA 3R0KA 1AFSA 4ERGA 1EBHA 4H41A 3QF0A 2G5WA 1E6XM 3RCNA 3TE9A 5ABHA 4HBKA 6CGTA 4XAGA 5CC5A 4ZTXA 1TV3A 1Z9AA 1POJA 3F1QA 1YADA 3P62A 4H00A 4MF4A 1UZDA 3GZ3A 3SB0A 3QXBA 2Q02A 1NDZA 3CIVA 4GZIA 3VZZA 4PMUA 3ZVHA 3KBSA 1T6MA 3B0PA 1JGIA 3CGTA 4LUJA 1JZ7A 3OP2A 1H7XA 2BGNE 4E4PA 5JVLA 2XIQA 4GINA 4L5ZA 3RPMA 2W5FA 3MS8A 3MP4A 5FEPA 4ZMGA 2EPHA 2W3ZA 1WAWA 4Q8TA 1GG0A 5KZMA 3CAVA 3LCWA 1LWIA 2ODOA 2AKMA 1ZCOA 4G6CA 1Q8AA 3D3AA 4ECLA 3EDFA 1ME7A 1ECEA 2XH0A 4F9DA 3N9SA 3FN9A 3R6IA 2G3MA 1UPMB 2DU2A 1QOPA 3DGBA 5CZKA 2ZRYA 2GUBA 3N4EA 3OIXA 3EGJA 4UOZA 2HE5A 4E38A 1JUKA 1MNSA 4GKTA 3O3RA 3KWXA 2IXVA 2UY2A 5BRPA 4FO4A 3JZEA 1W2VA 4KQNA 2BVDA 3QV7A 1TJ1A 4KFNA 4FALA 2DIKA 3MKVA 1VBGA 4GYPA 2A0NA 5C0QA 4IP7A 1YBQB 2OQYA 4I5XA 3E02A 3LI0A 3G8EA 1HX0A 4MB3A 4O0KA 4A05A 4KFPA 4ICNA 3KZSA 1K8ZA 3IPWA 1HO4A 1WDPA 5TF0A 3W7KA 1NWRA 4Q8UA 1UZ4A 3AMLA 4JNMA 2VCCA 2CU0A 1ZJBA 1MXGA 2OSYA 5FJOA 1XWYA 5G1MA 1P0DA 2G4FA 4RDWA 1D9EA 2VR5A 3RFAA 1F2JA 4GUHA 3VKBA 4DAFA 1UKSA 1ZU8A 1K6AA 1JZ4A 4W8LA 3N3MA 4O12A 3WQVA 1E40A 4MVAA 3UPWA 4JDBA 3WDHA 1F4AA 3GBDA 4FEZA 2AL2A 1L0PA 2PLJA 4QX4A 4AZGA 2ZDRA 1R8LA 1QJWA 1OHLA 3LHTA 3IGUA 2E77A 1TX2A 4GBDA 1U22A 1UC4A 1W37A 2XTKA 1R3TA 3UVAA 1KM5A 1C9DA 3LCIA 5BMXA 4ZB5A 1DE5A 4GI9A 4Q4KA 3DYPA 2OOGA 1J0IA 5TIMA 2Z2AA 2NWRA 1J6OA 1PB0A 1Z7AA 4AH7A 2C1GA 3QHMA 1PUDA 2CERA 4HHLA 1Q65A 3HGSA 1GOIA 2ZC8A 3TEVA 1HL9A 2EKCA 1QW8A 1YXYA 4LUTB 5LIXX 3EWWA 3NURA 3NL2A 3HV8A 5C7HA 2P1FA 4OBSA 2C13A 3ITLA 1UHVA 1V0LA 3UBPC 5D03A 1VRXA 4S2BA 5LNUA 2CHNA 3C0JA 2VWTA 4GO8A 5GJPA 5C71A 1JDDA 3BW2A 3NO5A 4RV8A 4Z08A 5RUBA 4JEJA 1UG6A 5DRIA 4C60A 5M5DA 2FFCA 4XV0A 3HQNA 3PTDA 4ZB0A 3AOFA 3IIXA 3VIFA 4IZGA 1VP5A 4AU0A 2DPEA 4NYUA 4IGMA 1YTEA 3CQIA 2YCKX 5I23A 4JNYA 3AUJA 1MQRA 1J8VA 2ZE3A 2YXXA 3PULA 2ACRA 4D8ZA 1XFBA 3TTEA 3KAOA 2OOFA 1DQXA 5SWUA 3IUIA 4FLQA 1PJ9A 3SRKA 3V4BA 1VIZA 3WQOA 1TG7A 5M17A 2PMQA 1K6WA 4A29A 3B8VA 1DXFA 3U48A 1JPHA 4QJ4B 3CMJA 3KOFA 3HG4A 1ICQA 1OC7A 2Z6JA 2PAJA 4CNPA 2Y7FA 1AUSL 2DZTA 2NQLA 3LCLA 1PX3A 2XDFA 2D2JA 3L2IA 1ME8A 5IXEA 4GG9A 1F6PA 4IPJA 4PCTA 2BVYA 3T78A 3F2CA 3KBVA 4MDPA 3IRSA 1B3YA 3NIYA 1JUBA 2ZVIA 3OVGA 3WEOA 3WF1A 1SFLA 2XH2A 2NV1A 4Z17A 5HPOA 1V02E 4PB5A 4GVIA 1E1FA 1ESWA 1ZLPA 1XF0A 3R8GA 4HPHA 2DUZA 2OMAA 7CGTA 4QCFA 1HIZA 2BLEA 2YA0A 2YA2A 1HJQA 3GD6A 1A80A 3BGJA 4MAVA 4DBSA 4CEXC 1UC5A 4IFKB 1R9YA 1H4PA 5AYXA 1DWJM 3M46A 3R4IA 3RR4A 1DKWA 1JZ6A 3FK4A 5BXPA 5DXXA 3N9KA 5DQPA 1O12A 2QCEA 5DT5A 3UYIA 3AWOA 3DUGA 3KTCA 1AVAA 4QSFA 3W74A 3ZIZA 4J3WA 3W01A 2W0UA 3LPFA 4PZVA 3TTSA 3WJSA 3CQKA 4CQAA 1NY1A 1RY0A 4EPDC 3RG6A 2CLHA 4C6BA 4Y9OA 1TVLA 3DECA 3PG9A 4KERA 3MT1A 1S2CA 2Y7DA 4XZWA 3PZTA 4C6FA 5FJTA 4ZO6A 4PTNA 3Q45A 2BY0A 1W1B1 3HG5A 4QLJA 2CW6A 3BICA 1J2WA 1OF8A 4CD7A 2DSKA 4JNZA 4JTUA 1VFTA 2Z25A 2EPOA 3MUXA 1CXEA 4ZODA 2WMHA 1WE5A 4XBJA 1C8XA 2FZBA 1E0VA 4NXKA 3E3HA 4X2PA 5AC4A 2X2YA 4P7QA 2YFOA 5DX7A 1G67A 1HG3A 1GOXA 5C54A 4ROPA 1VB9A 3VKDA 3R10A 4XZBA 4Q4OA 2FJKA 3VZXA 3S2NA 2QCHA 5F2LA 2JIEA 2PTZA 3PPHA 3N15A 3FW6A 3WMLA 4KIRA 3QFWA 5HR7A 5FJUA 4HT3A 1GYLA 3UJ2A 4RJEA 5FF3A 5H2ZA 1H5VA 3II1A 3TTOA 4DO6A 1H7RA 5FOOA 2HS6A 4D9PA 3SEPA 1EDGA 2C1IA 1B0IA 1MRQA 2QCNA 1E6SM 3HJEA 4PULA 3TTQA 3UG4A 4AZBA 4FIQA 1J11A 4S3CA 1HKIA 4WIWA 5GNZA 1WXZA 3UR2A 3M0KA 5F7UA 1VJIA 3NVTA 1PZ2A 1UIPA 2TPSA 3DG6A 3T44A 4OECA 4LYKA 1O1HA 2BVWA 5HUOA 1RVKA 3PFRA 3ORWA 3HN3A 1MXDA 1XH2A 2BOFX 1MDLA 4LVDA 3WMBA 4MNJA 4E2BA 2PTWA 4K8EA 1EEXA 2IQTA 2R91A 4JCMA 4U3AA 2GQ9A 4JTCA 4UTTA 2XVKA 2A7PA 3VK5A 2ZUWA 3WF2A 3QOMA 4IOTA 1TVPA 2ZRUA 3M7SA 1WBJA 1KC7A 3VIGA 4JL1A 3WNPA 3T8QA 1CPUA 1WDSA 3U2OA 1DJNA 3H26A 3URBA 1O6IA 1W3HA 3DKLA 4UR7A 3HOJA 2W6RA 3W07A 3S4TA 2VD9A 3K5XA 4DBWA 1IZCA 1RV8A 1GOMA 4AHQA 4ROQA 3QYQA 1J0JA 5IDZA 1BXCA 1N2VA 1Y5WA 3GG8A 4JTFA 2CPUA 4O8RA 3PTQA 1R0MA 5EU9A 2W91A 3A4WA 4DZIA 8XIMA 3GB6A 1LROA 1OBAA 5DN1A 1XBYA 3TZNA 2FHBA 2ZBTA 3ZWSA 2WK2A 1ZTVA 1OD0A 3TMLA 3QQ1A 1G7UA 3QR3A 1MO0A 2QZRA 4JN7A 3AYRA 4RR4A 2XZ7A 2DGAA 3WQ8A 2ZZ4A 2C6QA 2OLHA 4IISA 4IMEA 3ATYA 4HU0A 1AW5A 3OYZA 1UR0A 3HQ1A 2ZXQA 4IIBA 4J7RA 2X09A 3RPTA 1LDCA 1OX4B 3EX3A 1XKYA 3H8AA 3UY8A 3KOZA 3LGGA 4NASA 1TPB1 1LLOA 2Y70A 4HSHA 2QAFA 1XDMA 4UZSA 3URNA 5DRCA 4NP7A 1U5JA 3AFBA 4U10A 5JH1A 2H6RA 4HNLA 4BI7A 3XISA 4RK8A 2QUMA 1PDZA 3V1PA 4ML4A 3TQVA 3PZMA 1KXQA 4PTXA 1Q4NX 4ZO7A 3VO0A 1FKWA 7REQB 1DWHM 5ABGA 4NI8A 4OZOA 4NAFB 3QR0A 1XSIA 5B7YA 1DQWA 1M41A 2CLKA 3VIPA 3NM3A 3W87A 1O1ZA 3ZXWA 2PLMA 2WQPA 3JS3A 3EOSA 4W7WA 3AALA 1FFQA 4XX6A 3L12A 2WC4A 1OCNA 2B31A 4RW3A 3PJWA 1FWCC 4Z1DA 3V5CA 3W83A 5C9XA 4MM1A 5FJJA 1FQ0A 3R8RA 1UOZA 1R86A 3M64A 3E49A 4HYWA 2XVNA 2D2GA 4A8RA 3IGHX 3HO8A 3AHTA 1OC5A 1BVZA 5HOSA 1BYAA 2Z1WA 4UQEA 1L8PA 1OFQA 1GVFA 1XJBA 3FX4A 3TYUA 1LYXA 3CUFA 3MO7A 3F5KA 3VU2A 1GVYA 3SCSA 4HPXA 3REQA 2EXOA 4PBEA 3PWAA 3MHGA 1YPFA 2JGQA 1E71M 1WV2A 3MSRA 1MDRA 1QNRA 3KP0A 3VNMA 4LNYA 1V0MA 5I3GA 3P80A 3H7UA 3DG3A 3LTSA 4TV5A 5HULA 4PSPA 5LYRA 3SCWA 4NIRA 3GUWA 1A5KC 4W93A 1GORA 2YL8A 1TFVA 4L9YA 3TIMA 3NGJA 3OO2A 1ENUA 1CWYA 1XCWA 4ZSTA 3AS3A 1KCXA 2WMGA 5IOBA 4DJFD 4NJJA 2XVGA 3O06A 1OJXA 1W6TA 2NV2A 4DWSD 2Z2UA 1G6CA 3AHYA 1ZCCA 2DUXA 4XIMA 1R6WA 1ZP4A 4H1ZA 4XKMA 3W6MA 4CLMA 4GOAA 2ZDSA 3BLFA 3UQNA 3W1XA 4JFSA 4PMYA 3WO8A 3C56A 3ITVA 2ZZ5A 2DQWA 3QVQA 2I17A 1JDEA 3LHWA 3TXVA 2E25A 1KR0A 3M0ZA 3EOEA 1HQTA 3WNLA 1PTDA 1CENA 3MBFA 3C86A 3RAOA 4JICA 1XXXA 3MANA 5DY3A 4XD5A 3N34A 3N19B 5CPMA 2BXVA 7ENLA 4HU8A 3B0VC 3W23A 1UR1A 3QRHA 1DBTA 1CIUA 3WLIA 3W4RA 4LAZA 1XQLA 3BJFA 2OEJA 2HEJA 5E6YA 4RDZA 3FY1A 4NT0A 4P8XA 1S1PA 1LZOA 6REQB 5DMNA 1K70A 3QQ0A 1TPUA 4PTDA 4J1OA 5J5DA 3UR8A 3QSTA 3E38A 4D6GA 4GI4A 1DJWA 2V2DA 3Q65A 3H70A 1ODZA 4QGCA 3QKEA 3I6TA 2WPGA 4UQ9A 2WKLA 3GVRA 1TPFA 5AYYA 2EEXA 4WOZA 1JCYA 3AMCA 1SR9A 3MJYA 3P93A 5CH9A 5ECUA 4WXYA 4ZOEA 3PNUA 2XINA 1KWGA 5CGMA 1GNXA 4X9SA 2F84A 5FIPA 3LA4A 2OYKA 1TV5A 3LXAA 3THUA 4YL2A 2YDAA 1BQGA 2Z2BA 1YE4A 3VDHA 5CJ5A 2VTFA 1Y5XA 4GQBA 2HWGA 3TX9A 3M07A 1POKA 1DJQA 3P2VA 3NTYA 3H4XA 3LYEA 3S6OA 5G2IA 3T0DA 3L68A 1I9CB 3OHMB 3WJZA 3I10A 5H8PA 5CSRA 1PBGA 1BXNA 3MUIA 4LAMA 2FQIA 4OTKA 2DZXA 1YIXA 1L6GA 1EJVC 3OOQA 1SO3A 4KIEA 3C2VA 3O15A 5LNSA 2J62A 1JPKA 3S5YA 1EIBA 1W3JA 1DXEA 1HL2A 4A3HA 4XTIA 3HU7A 3JU2A 5TD4A 4OGZA 4M5PA 2CYGA 4XAYA 1X8CA 3CQJA 1DIDA 3W7LA 4WXZA 4TV6A 4FNQA 1H0GA 4NZCA 1AL8A 2QUNA 4HGXA 4NL1A 3G1YA 2NV9A 2VFHA 4DXKA 2O0TA 1C8VA 4B4FA 3NNTA 2YZ5A 1CT5A 1XIMA 3VDAA 2OWXA 5EKYA 1X1OA 4MMWA 1F05A 3PZQA 1YMYA 4PCNA 1EJRC 2YB4A 3BG3A 4YHEA 2C0HA 4DUXA 2XVLA 1E4LA 2VC9A 3EEGA 2ZZ6A 3MVTA 3IVSA 1E43A 4AWTA 3OU8A 5FJIA 1ZAHA 1BTMA 2Y61A 4WLCA 2UY4A 3H2EA 4DZ5A 3DH7A 2A3AA 3APYA 2BTMA 3PBWA 4UB9A 1HKKA 4AQLA 1NSJA 1P43A 1FHDA 4AFYA 4M1BA 3QEZA 1IWPA 1FHLA 4IT1A 4P7LA 1UKOA 4URIA 1JFHA 4LUYA 5HNUA 5I3JA 4EIVA 1CCWB 1TE6A 3TYDA 4HNCA 1SJCA 4KMQA 4ZB2A 2BVTA 2QCDB 4HSOA 3UERA 5C2GA 3BPWA 3STEA 3F4NA 3FKRA 4ZQRA 3GVVA 2GVJA 3LSBA 3SADA 2CIPA 4ZFMA 5HMSA 3M0HA 3WD1A 5GPRA 1QUMA 4Z42C 1JZ8A 1XL9A 3MCMA 1VBRA 3MUAA 1Y65A 4JQ1A 1Z6KA 4HZ6A 3VTRA 4H9TA 3PBGA 4GUFA 4PFHA 1VCGA 3MMUA 2EJAA 1TV4A 3WN6A 1M7XA 4JBRA 2VC7A 4DJEC 4MNKA 3VM5A 1KQZA 3WNKA 1JAEA 1B9BA 1YTKA 4NZ4A 4LCRA 3AISA 2DEPA 1FWBC 4TVUA 1ZS2A 2ZTKA 3SW6A 4L80A 2G0WA 3KVLA 3GXNA 3ALFA 4MWAC 4S3EA 2XGIA 2OT0A 1IEIA 3WLTA 2E40A 1XC4A 1P6BA 4IIHA 4B91A 3LV6A 3EB4A 3OVPA 4V2XA 3H7VA 3A22A 4JY9A 4Q8MA 5BU6A 4F0SA 3TLLA 3GUGA 1XLKA 3A6OA 4UC5A 3DX5A 2ZZ3A 3SR7A 3U2CA 3LRLA 4XKYA 2NQ9A 2QS8A 2QJHA 4AZ5A 3H2MA 3VI2A 4AAJA 3QV8A 3PPGA 3TVAA 1Y0EA 4RZ6A 2A3CA 1TA3B 1LF1A 1NM9A 2WMIA 4NAEB 5BOEA 2Q01A 2QUVA 3DI1A 3PAOA 3O6YX 1TZZA 1EB3A 1NVMA 1OZMA 4D72A 2XH7A 2XSBA 3SUSA 3TSBA 4NZ1A 1GZGA 3QBUA 1U1JA 1UMYA 4PCFA 4FA3A 3GAKA 2ZZ1A 2TODA 3TJLA 1W1ZA 4KCUA 2VYOA 1QK2A 4HOZA 3TTYA 3UZ5A 4N7QA 4O52A 1OF6A 2OYMA 4GH3A 5DMYA 3FFSA 3TC6A 2C7FA 5F4WA 3WENA 3MW7A 3MUZ1 3AHXA 4E5TA 3GKFA 1EJXC 4C7GA 1YEYA 1OX4A 3QY8A 5CPLA 4Q8QA 1EJUC 2OX1A 4GUGA 3ABRA 3LMZA 1G4SA 4UNIA 1JPDX 3DFOA 1V51A 5FAJA 4LWWA 1BYDA 1BHGA 4WEVX 1IR2A 4JGDA 1GCYA 2FDSA 2GQ3A 3DC8A 3PSVA 1X96A 5DELA 2VZOA 3G0UA 3WUGA 1V3JA 2JEQA 3VD9A 4F66A 4TMBA 3V3WA 3T1GA 4RUBA 3HMJG 1C91A 7REQA 1P5BA 1VEPA 3LHVA 4DZHA 3GYCA 1MW3A 1M1BA 3GTNA 4FSAA 4NAFA 3S1UA 5LIWX 4KCWA 1WOAA 2I5QA 3N2CA 3GG1A 1GPWA 4INFA 4NZJA 2NSXA 1PYMA 3N18A 1IZKA 2P76A 4O4VA 3HG3A 4KWUA 3EDEA 5XIAA 1R85A 3WZ0E 3CHCA 1S38A 3EA3A 3ECQA 5HWJA 2V69A 2R9RA 1I2PA 3CV7A 2V2CA 2Z1SA 4W85A 1G4PA 1ECQA 2F6UA 1J0ZA 5DFAA 4BY3A 1BXBA 2W62A 4LBSA 1DQUA 2GLKA 2A3LA 1OGSA 4D8AA 3LGDA 2JFEX 2R1MA 1XLLA 3ZT6A 3NWRA 4LEFA 1S5TA 3ZVIA 1HJWA 1GVQA 2HVNA 3ZWTA 4M7TA 1CGXA 2J9YA 3ZJ6A 3MPGA 3P14A 4M1RA 4DJFA 2X0YA 2AMXA 4JIIX 4DWSA 1XI3A 1XBXA 2VFFA 3RPDA 3E0WA 1S39A 3GXFA 4L9XA 5A6TC 3VCCA 4O57A 1DL3A 3GZAA 2AKZA 4GJIA 3RHGA 3PN8A 4WF7A 5LHEA 4FNTA 5FL0A 1WO2A 1VLIA 4DX3A 2CZFA 3WQCA 1W0MA 2O9PA 4MB5A 1MNZA 3ANVA 1NOFA 4P7NA 2G97A 4H9VA 3GNOA 4WJ8A 3W25A 3IV3A 2FMNA 1IWBA 4OE7A 4N9DA 1F6YA 2PDXA 2RUSA 3TCSA 2YCIX 4NNAA 2GSHA 2GZXA 5EB8A 3R7MA 3LD5A 2FIQA 4L4MA 1PTAA 4JQ3A 3KEHA 3UXKA 1RPXA 3WQ5A 4EKJA 3QMRA 2V5JA 3KLKA 1W8GA 1MFVA 3PZOA 1BWLA 3EDJA 1TPDA 3AQUA 4FXFA 4GISA 1Q2RA 4RCXA 3M7WA 2WPBA 2RHGA 1KTNA 4GABA 1XGZA 4YYFA 1DVJA 3BAKA 4DNHA 1FY6A 1MUMA 1XG3A 4Q8OA 3EOUA 3TLQA 5T91A 4WDTA 2RGLA 1WYIA 3AU2A 1XRVA 1R87A 3UZZA 4MUZA 3UWQA 1KLYA 3NQMA 2C3ZA 3R0DA 4QFUA 1PHQA 1A53A 3K4WA 1X1NA 2P3ZA 6ENLA 2J7BA 3BV7A 3VINA 3OGSA 1AQHA 3U57A 2R1KA 3VNDA 3B9EA 4UFIA 3UP8A 3BSMA 1TIWA 4GJ1A 1FRBA 3BW4A 4UXDA 3CWHA 4YCPA 4JHOA 3C4UA 2BDQA 2VVSA 2GJNA 1VFOA 3BLLA 1QRQA 1GOWA 4UQBA 1RJQA 2NUYA 4GYFA 5CBBA 3PUEA 4Z1CA 3MMDA 2TRSA 1QHZA 4AY8A 4B4HA 2VZUA 4GFSA 1JPMA 4MZ1A 2OWCA 3VABA 4HOXA 4AYGA 3CIXA 3UY7A 1EFZA 3E6EA 4UFJA 4V1XA 2XVPA 1WDQA 1AJZA 2BG5A 1XIJA 3ELFA 2VM8A 1C92A 1GVIA 3W24A 3WQDA 2ZZ2A 4XZNX 3UNDA 3KVMA 4YTRA 2HE8A 3K8MA 4ORIA 4HPNA 4X60A 4RDYA 1E4NA 4HCDA 2W66A 3MZ2A 3R2GA 4IP5A 3H6OA 4KCTA 1PCKA 3TW6A 1SO6A 5EYWA 6TIMA 3VMNA 1L8NA 1CGTA 4PRWA 1S2AA 1UH4A 2C15A 3F5LA 1EPXA 2PDWA 1XH1A 1H60A 3WLHA 1QWGA 3U9IA 3ARZA 4TX6A 1W9PA 3KBJA 1LWHA 4UTHA 2ZTJA 4JYDA 2GQ8A 5BRQA 2G8ZA 4OT7A 3VM7A 1E1EA 1IQ8A 2QCGA 2W92A 3B3DA 2VNCA 5F2MA 2CC0A 1LL4A 3WH6A 3RCMA 3NSXA 1TTJA 3N6HA 4GLEA 1GQKA 2PZNA 4K6AA 1YRRA 3ARSA 4UQAA 3TOYA 3W1RA 4PH6A 3AROA 3OHIA 1OIFA 1CXIA 4AMAA 2IS7A 2YB1A 3G1XA 3VOFA 2QJGA 1UR3M 4C6OA 5G1YA 3IJ6A 4HMEA 1HKMA 1XSJA 1SZNA 2Z1BA 4HD5A 2WHMA 4GFIA 1A49A 5AYZA 2Z26A 5KMYA 1HZYA 1DWFM 3R43A 4PCSA 4CCDA 3S9IA 5BWFA 2PUZA 2NQHA 3AI0A 3CAKA 3I3EA 4EXAA 3RJXA 3VUPA 5A8OA 4KW2A 2DW7A 4WSJA 3DYMA 8A3HA 3B8SA 4ZZ9A 2FMOA 1K02A 3DHDA 1QPRA 4HK6A 3TXZA 1ZP3A 5FACA 4GNJA 4C6IA 3VIHA 4O0QA 3VFCA 4AEEA 1JR1A 4WGXA 1KLZA 4CCEA 3OODA 3KRSA 1FWAC 5B7ZA 5XINA 5BZAA 2IPWA 3NO3A 2NVDA 4PMZA 3XIMA 1GONA 3ALGA 4B92A 3PSWA 1O5QA 1OB0A 3I65A 5GNYA 4U33A 4BK9A 1GEHA 3HM7A 3QLDA 2CBJA 3PPFA 1AZ2A 3DCPA 4M7SA 3OLIA 2P0OA 3NQAA 1JG9A 3B9DA 3OG3A 2PC8A 1Z8AA 1A47A 2YXOA 1H1ZA 1QOXA 5LA2A 2JQXA 1I1XA 3SRDA 1HVQA 2E9BA 3D46A 1BEUA 4WKAA 1FFRA 3N2BA 3ZS4A 4DWDA 3O6CA 2OSWA 2ABBA 3WBWA 1XRSA 1QI2A 1KXVA 1WUEA 3N13A 1VAHA 3THAA 3S8HA 1I2QA 2Z28A 2XH4A 4MAZA 3GU2A 1XLEA 2E68A 1GW9A 2CLLA 3W82A 4D6CA 5EMYA 5I77A 2FGLA 4XVDA 1E0UA 1NF7A 3B8DA 3TUUA 3WD0A 4C6KA 3SY5A 2OCZA 1RBOB 2ISFA 2REQB 3VXGA 2Z27A 1VC4A 1SSDA 3WFAA 4M80A 2IXUA 4G9PA 7TIMA 2EQDA 3QW4B 4O1AA 3NPWA 2WSYA 4CD6A 2NUXA 2DH3A 3GHRA 3T2QA 1TA3A 4ICCX 4HNOA 3PZVA 5EMLA 1KBJA 3KOYA 4NAEA 4N9BA 2Y63A 4M82A 4XB3A 3GX9A 1QW7A 1F4HA 3BSHA 2O4QA 4U3CA 4MLJA 1BGAA 1RK5A 3POHA 4E8GA 1YNPA 1OWQA 4P7OA 1N7KA 2BP1A 1VBJA 4L9ZA 2BASA 2O9RA 3A5FA 2PDNA 1FX6A 1ITCA 4AD3A 3WLMA 4TX8A 5EGRA 3NQ8A 3B4UA 3L4YA 4GXWA 1SFJA 3V36A 3AZRA 4CQCA 4J3SA 5EFDA 4MWAB 1RAKA 2C91A 3N17A 5CAHA 1NDYA 3GFZA 4UTWC 3INPA 3RO8A 3UCCA 4DLMA 4FOKA 3SY1A 2YL5A 1NFBA 3FV9A 4IF2A 1YPXA 4GY1A 2NQJA 1UP2A 3MSDA 3VFLA 1ZJIA 3CMFA 1LQ2A 3A4AA 1RD5A 1OGBA 3O7UA 3LLDA 4X61A 3UWZA 2I5IA 3PZGA 1E15A 4J3UA 2VZSA 2RH9A 2INZA 3HA1A 1K77A 3S9YA 4ADSA 4I6VA 3PBMA 1M7JA 3TSMA 1C93A 5CZSA 4IMCA 2DZSA 3GDBA 2FKPA 5FEZA 2BBFA 3SM0A 4MZYA 2VVNA 2XM1A 4K1WA 3TFCA 4DXVA 3TDFA 1WNOA 4BF5A 4LVAA 2OO6A 3WBEA 4HNVA 1HKJA 3APTA 4QAWA 1Y7VA 5JMUA 3DXIA 1US3A 1IEXA 2RJGA 3IJQA 4LB3A 4XG1A 4GI6A 2D2OA 5D9PA 2D69A 2XIMA 3MZNA 1KRCC 2VZVA 2EHHA 3DERA 5HPCA 1P0BA 3IS4A 3PG8A 1H5YA 2GSEA 3CC1A 3N04A 2YDSA 1MUCA 4IP4A 2QJNA 4NVTA 3G3DA 5D4YA 1JUEA 3SFWA 1TWDA 2PDBA 2BY3A 1QWKA 2WSRA 3GRIA 3WNMA 2WQDA 2FB3A 1KM0A 1J0YA 2E6FA 4KCVA 2BGSA 1YX1A 1JCTA 3QTPA 1BKSA 4WDXA 4NNCA 3EX2A 3B9AA 2FZ8A 2H8ZA 2FZMA 2FZ9A 1OK4A 2IPJA 3M6DA 3GDMA 4QG6A 2F6KA 3LPPA 3SDOA 5D33A 3IIOA 3GC2A 2AQVA 1QATA 2IKIA 3GR4A 5DCBA 2A79A 4QROA 4RE0A 3BE7A 3WQFA 2PWFA 3LY0A 3QPYA 2OPJA 5E9XA 3LU2A 3IJIA 4JKLA 2XN2A 3H4GA 1EH9A 2PRHA 4R9XA 3THDA 2GJXB 2PF0A 3VNYA 1VFSA 2GYIA 4NJHA 3K8LA 3FYYA 3CUXA 1R3SA 3NPVA 1V6VA 3HV9A 1JRCA 1JNDA 4FR1A 2ASHA 2NLIA 1DWAM 3PZIA 4W88A 1ISZA 1DEDA 4YTSA 4K39A 1DWIM 2DFAA 1UA7A 3RX2A 4DF0A 2HXTA 4MNMA 1SYTA 2A6LA 1B31A 2VEKA 3EYPA 2CZEA 1XH0A 3CTTA 4AZ7A 1LOSA 3ABSA 2ATSA 2R82A 3MCNA 1GZJA 3GG7A 4CQDA 1ALDA 4UTMA 1B90A 2PGEA 1RXOB 1UPPA 1SVDA 1J01A 2NX1A 4V28A 1G4EA 5D30A 3CUJA 3BW3A 3F5JA 4QXIA 1W1VA 1OIMA 1YNQA 3OGRA 3WL1A 1J5TA 1E73M 2EG6A 2BS9A 3UZYA 1PWLA 2PGWA 1CXHA 4FB7A 3CUZA 4C6DA 4JTGA 1MSSA 3FA3A 4EPEC 2ZADA 4LUSB 3W1QA 4D6FA 3B0YA 5E9AA 3GC5A 4OOUA 3S42A 3UVIA 4Q7BA 5AVHA 2O7SA 3ZLGA 1HGWA 1HN1A 4RNIA 1TJ0A 2A2IA 1NAL1 2X1UA 4YVVA 4FLRA 1KNWA 4B5SA 1JCXA 3D6NA 3CEPA 2V68A 2PWHA 3NQVA 3I7QA 5IHRA 1W9UA 2W67A 5CLTA 3GIYA 1S2VA 4UUIA 5IM51 2BB0A 4AX6A 1M7PA 1RCOB 2P0IA 2MNRA 4IIFA 1EXPA 1K9TA 3N25A 3QMSA 1XLMA 5REQB 3SRFA 3TNBA 4ZL1A 4U4MA 1BVWA 4LANA 3KRUA 1O5KA 4Q32A 3VA8A 5A6JA 2GVLA 3W27A 1BYCA 3S0CA 3LK6A 1UOKA 4QHRA 2QDDA 1GHRA 1K7FA 4CU6A 1IF2A 1U83A 2ZZ7A 4PMVA 4GX8A 3RLHA 3B97A 3B06A 3F4CA 3P61A 4LC6A 5JIPA 3WG6A 4RZ4A 1A50A 4IFOA 3LM7A 3PZNA 3CZEA 4OFCA 3GXTA 2WBKA 4IIDA 2J7DA 1UWAA 4C5YA 4Y9PA 1A4MA 5LXEA 4ES4A 4E8DA 4JIPA 3BJSA 3FSTA 2PDJA 1FH8A 3V5FA 1MVYA 4JAWA 3UETA 3ZFHA 3A3WA 4PUUA 3GXPA 3DFNA 1D8WA 3ZO9A 5E0FA 3WD3A 4EWJA 4US6A 2B7PA 2WNWA 1HUVA 3K13A 2PODA 5F2IA 3UPMA 3TR2A 3TN3A 5HWMA 1H0IA 5A6BA 4O1BA 5DBUA 3DEQA 3ZVHB 4W8BA 3G22A 3G1HA 2GJLA 5EBAA 3T81A 4PUWA 3VX1A 2RDWA 1M65A 3P3BA 4GACA 3A9IA 3TQPA 3PBUA 4FIRA 1MW0A 2OR2A 2G3JA 2FTYA 4DVOA 1TIMA 3SCVA 1RBLA 1NOUA 1EZ2A 5I6SA 4XZIA 1H63A 3MWAA 3EX6A 3N2MA 1BG4A 4WZHA 2AOSA 3OA3A 3TH6A 4Z2IA 3RNDA 4BS0A 3CPRA 4LY8A 3STGA 2GVGA 5HJYA 1E9LA 3E2RA 1R3VA 5I03A 1Q66A 4FZIA 4LC8A 2E5BA 2I9UA 3R11A 4GYKA 3OZYA 3VX0A 4UMBA 1XIIA 1QASA 4DM2A 1FWDC 3ONBA 2J6XA 2HXUA 5GQBA 2VC5A 1KXHA 1OFOA 2B7NA 1L2UA 3QH2A 2PDLA 1ZSXA 2XZ9A 3LZ5A 4GZJA 4F8XA 1DIKA 2OELA 3NUKA 3SIZA 4QAIA 4QDPA 3E5BA 4IPIA 2PDCA 1UD8A 3UG8A 4CQ8A 3RILA 1J0HA 3BL3A 3A4JA 4LAOA 3Q58A 1E6PA 3EBVA 3B05A 4X3ZA 1I2NA 2AL2B 1M03A 4LEQA 3PNZA 2V63A 1KXTA 1T8QA 3C2FA 4KGJA 1S2TA 4KEZA 3VZYA 2VFIA 4TTUA 1IT0A 1K8YA 3L4ZA 2HCVA 1A4LA 4Q4PA 4A4AA 5CJMA 1TWWA 1XYZA 8RUCA 4JN6A 5BU9A 5I7GA 3EOOA 4GYJA 3KCOA 2BY1A 3S9ZA 3LXBA 2ISWA 3G24A 3AZTA 3CH0A 1JAKA 3AYSA 2X1RA 3B0UX 4TU1A 4AVOA 2VXNA 4M81A 1BLIA 3LRMA 4OKDA 3ZYZA 3GK0A 1TWIA 1CZ1A 1H62A 3EPNA 4MFEA 4C1NB 1B3VA 3RITA 3W7DA 1IIHA 2WVUA 1K8CA 1KM2A 4EF8A 4DJEA 3H12A 4AZHA 2PE4A 1UD5A 1T0OA 3G1VA 3L21A 4BZYA 1B4KA 3KL0A 3WDRA 3KDNA 5HNRA 3HURA 3WLOA 3NYDA 3VKCA 2GWGA 3NXLA 4XZLX 3ANUA 1LJYA 1FDZA 5A2CA 1DWGM 1JYWA 3IACA 1Q85A 4L4LA 5FKYA 2CKRA 4CN4A 1FVPA 2I7GA 2P88A 1J10A 4QDMA 3AS2A 2ZRXA 2V2HA 3KM8A 3NL3A 2XWDA 4GIAA 2YYUA 4IJRA 4J4KA 1F3TA 1XSKA 5HAOA 3TKFA 3PWGA 2EF9A 2Y5SA 5D02A 1YDYA 1A3HA 5AKQA 2QNEA 1VD6A 5LIYX 1KKOA 2I1OA 1T7LA 3A47A 4N4QA 4PUKA 1ISWA 3ZJ8A 1OX5A 2YDQA 3PJTA 4CD4A 1L2QA 3QSRA 3APGA 4ZOBA 1W5PA 5LXXA 1ADDA 1JF6A 1O5RA 1WA3A 1Q6DA 1ZAIA 2QLYA 3PK7A 3T8LA 3JW7A 2Y8VA 5D9MA 4ZQCA 3U2ZA 1VFHA 4O54A 2J74A 2PP1A 2OODA 5B80A 1KWKA 1QI3A 3G8RA 4WKFA 2GGHA 3UYCA 3M5VA 1XINA 4CU8A 3W7QA 4WQ6A 3HFYA 2ANUA 3UWYA 1TPC1 5MF5A 3AUOA 3FGCA 4K8HA 1PIGA 2ESCA 4CNSA 5KZEA 2V81A 4V33A 5LKYA 4HK5A 4B5TA 1XLAA 1CYGA 4YNGA 3S83A 1F74A 3VOGA 1RLCL 4NX0A 3HQOA 4W9TA 1V7YA 4NZFA 2PZ0A 3O0KA 1GOOA 2NT1A 2NZLA 4QLKA 1VYSX 1BPLB 2WSKA 1QOQA 3U7VA 4M24A 3QC3A 4IJBA 1HP4A 4WY0A 1V6WA 2DSWA 3O63A 3NM1A 3SBFA 1OK6A 2BV9A 4LBRA 3CH9A 1XBVA 4O53A 3QGVA 1NEYA 1KGWA 1QDSA 4K8GA 1E72M 3CLWA 2OZTA 5I79A 3G6MA 4GRSA 4AZ6A 1UW9A 3CZLA 1Q6FA 3GDTA 5E0KA 2OVLA 4IMGA 1W1IE 1TRDA 4AVFA 3THCA 1VBUA 3P8JA 5JIWA 1T8XA 3W38A 1S3HA 3B8TA 3DFPA 4XO6A 2WKJA 4P61A 1GKQA 1VR6A 1AMYA 4RDVA 1K4GA 1XCFA 2WO5A 2CLFA 2RAGA 4JTEA 3KBNA 1XCXA 4YYCA 2QJJA 3FS2A 4O16A 5K9XA 1TJRA 2J66A 5AHFA 2NX3A 5GNXA 3LNPA 2GJXA 3NSNA 4R88A 4FOUA 3LCHA 3GW3A 3VPLA 3VUSA 5LZLA 4BI6A 4AXKA 3RU8X 4LALA 3I3BA 1V02A 3QV6A 4AIUA 4AC7C 2WVTA 1VPQA 1G69A 3W9ZA 2VO5A 3WCZA 2VWSA 4JYEA 4NJKA 1WAUA 5ABTA 1R2SA 4ZE4A 1I2RA 2B81A 2CBVA 1DIEA 4QSHA 5C9RA 1BRLA 4GH1A 2G4JA 1SO5A 2O92A 3JR2A 3N2TA 4DB7A 1UR8A 1S2WA 1I6NA 4L56A 4JN8A 2DIEA 4KPLA 1LUCA 3QTGA 5FEXA 4AD2A 4CQ9A 4Y2WA 2OQHA 4EOUA 2PI6A 4W87A 4RZBA 1SJBA 2AL1A 4LAKA 3VKAA 5I24A 2VGBA 5DEZA 4GQ0A 3V0TA 4ERIA 4XO7A 3W7MA 1FP8A 1ONWA 4DIAA 3NCOA 3WQWA 2Q09A 4UIOA 4Y7EA 4ADTA 3PFMA 2FYMA 1TR9A 1U1UA 3E9AA 4IGNA 4O19A 5EMJA 4H6KA 3FNDA 1PV8A 4XAPA 3UJFA 5D2TA 2WAGA 2E8YA 1UP3A 3RM9A 3UWWA 1H7OA 3A23A 4QITA 1IV8A 4IL0A 2V3FA 1CECA 2XJ7A 1XDLA 2VX6A 4ZQPA 3M0IA 5REQA 1R2RA 4J3XA 2V8ZA 1KTBA 3WDIA 3BGGA 3S5OA 1LBFA 1UJPA 4Y8EA 4S3GA 1VIWA 1XS2A 4GXMA 4B5XA 3E1F1 5AOUA 4DY1A 2HZGA 3MI3A 3IJ8A 4MGGA 3RMEA 3H2FA 1CI1A 2DW6A 3TN6A 2WVVB 3PP7A 4PB4A 1L6SA 3UWUA 1TB3A 3KVJA 2GGEA 1KV8A 1ZBVA 1FA2A 5AFDA 3MUY1 3TW7A 3CHFA 1HFBA 3VMPA 2FGBA 5PTDA 3QMTA 3SSJA 3CL8A 3C2OA 3L5MA 1P6WA 4Q8WA 4HJFA 1IGWA 1XYMA 5EA9A 1J5SA 4NJIA 5ABFA 4R53A 3DN5A 4MLRA 2ADAA 4S1FA 1ZB5A 1UB3A 3OZMA 1S5VA 5HQMA 1W9VA 1LQAA 1TCMA 2PP3A 3A3XA 3LS9A 4RZ5A 2CBUA 3P60A 4O28A 3OZPA 4H9MA 4JD4A 2JF6A 1UIOA 1WDDA 1Q7QA 2VOTA 3BQ6A 4X0NA 4FR6A 3UEQA 2R8WA 1W3TA 2HV5A 2DORA 2VKZG 1RJPA 3BOLA 1B57A 4DJFC 3FHQA 4A3UA 1DXIA 3KL3A 3NOYA 1RUSA 1PZ3A 4DWSC 3UA4A 4IUGA 1IIGA 3TONA 3SCNA 3WK3A 1FWRA 1SUXA 3WNNA 4CNNA 1E6QM 4HA0A 1KFWA 2E5CA 3DHUA 4HPJA 4UCFA 3SZ8A 1AODA 1SU5A 2E7FA 2TAAA 4I8YA 1Q6RA 3MO4A 4P8UA 2CETA 4J3VA 1MEWA 2GQAA 4HHMA 4C1KA 2ZCGA 3AMKA 1A5BA 4MSSA 4V1YA 3QGKC 3OQ8A 3QV9A 2O9TA 3S1GA 4KRUA 1E4IA 4GNVA 2I9EA 1IGSA 3ZSSA 2OZ8A 1ELSA 3GR8A 1GVRA 3QY6A 5JU6A 2ICSA 3H2OA 3N6JA 5CC7A 3QZEA 1L9WA 4PE8A 4WX2A 4M51A 4W89A 4FXSA 5FF2A 1JXJA 3CM4A 3TYZA 5FD0A 4AYSA 4TVCA 1OX6A 4R5EA 2PWVA 3LEPA 1S3TC 3EA2A 3IGXA 4H8UA 4AD5A 7ODCA 3U4FA 1QAPA 3REQB 3CZ8A 3P5ZA 4A8NA 1UUOA 4ZOCA 4K37A 5H1WA 2BOGX 2P3EA 2DZBA 2OFJA 3D3FA 1R30A 3EWCA 2J9XA 2VCBA 3LPOA 4PMDA 3B9NA 3BVJA 3AIQA 4BQ3A 1XP3A 2WHJA 3WJYA 1US0A 3W37A 3BAXA 1A5LC 1GQLA 2Z7GA 1XIHA 2PTXA 2QMKA 1OVDA 3EWBX 1GQJA 4JEQA 3W1TA 3WLPA 2XM2A 3H53A 1QHOA 1UH3A 5TBOA 4CEUC 1X7IA 3ZSTA 4K7YA 1OT1A 3W22A 5HUPA 4OV9A 5FAGA 3CLMA 4EX4A 1FXQA 5G1TA 3I3DA 3NZGA 3OPSA 1XYAA 4AZIA 2ZXAA 4H2CA 2ABAA 2GOUA 4ALDA 1QMLA 2WZMA 1CLVA 2OLSA 4PODA 5BNKA 3FA4A 4C1NA 1E3ZA 6ALDA 1J12A 3AIVA 3NVDA 1KFBA 4YJ5A 5J8LA 1FCUA 1SW3A 1QPNA 4M6VA 5A8PA 5CXPA 5TQLA 4UMAA 4TOQA 4GBUA 4XD6A 3KVKA 1PYFA 1EIXA 3THQA 5GJMA 1I75A 5BROA 2JKPA 2ZUSA 1V4YA 5K4ZA 1EOKA 1XIBA 5I02A 1Z41A 1EYWA 1Q5MA 1RSCA 1TVNA 3W7NA 2JF7A 5HMDA 1U2YA 5HDRA 4JTTA 2W79A 1HJXA 2OEMA 5DLCA 5DCDA 1E4MM 2FH8A 4MB4A 3K30A 3SCUA 4LY4A 3WBAA 2D22A 2G3FA 2P50A 4Q22A 4MYXA 1W9DM 2HSAA 2QVHA 2JEPA 4ZO9A 2J8GA 1CGUA 2ISDA 2Q8XA 2FHCA 2J9ZA 3G0SA 3T0TA 1HKVA 1K1DA 4IMFA 2CLIA 4AG0A 1K7XA 1EQCA 4AWSA 5T8GA 4XSLA 4Q4RA 4OU1A 4D1JA 3PS7A 2VGGA 3SCRA 3TSDA 3UWEA 2WZHA 3AU6A 4UTKA 4UTLA 4ZQMA 4CN1A 3N1AA 4QRNA 2YFNA 3FYPA 1W3KA 1XICA 3WK1A 2ZXBA 3RX4A 5JUVA 1TSIA 1XRTA 2WNQA 3T6CA 4HU4A 1SMAA 1FWNA 2RGMA 4X2RA 1E5NA 1NARA 2QJMA 3ARXA 1MEHA 1EP3A 3I7SA 3NO1A 1KBKA 2VEIA 3LDVA 3O9NA 1NQ6A 2V5LA 2NVAA 4JTRA 3ES8A 3T05A 3AC0A 4FX7A 4QNEA 1FCBA 4UTWA 2AGKA 3SQSA 3LB0A 1BSLA 3WBYA 2A3BA 3A4XA 4PMXA 2QUTA 3QGAC 1GW1A 3GO2A 2AQWA 2WZTA 3SJNA 4H6QA 1H1NA 3W3OA 2PTDA 2PRLA 1JI1A 1OSEA 2EJ1A 2QPUA 2GSJA 1EDTA 3P67A 5CBIA 4DI9A 1KO0A 3P82A 2EKGA 2V0TA 3NFUA 2ZE0A 2J27A 2W9MA 3GHUA 3UFYA 3L4XA 3GNDA 3N2OA 1Q63A 5EPDA 4YS1A 4MY8A 2E8ZA 5DY2A 1ZNNA 5K7JA 2WM1A 1XLIA 3GSMA 4HU3A 4PTMA 3BARA 2ONEA 1XLJA 3MKCA 2P8BA 2H3BA 4L65A 1OCJA 5LGZA 1E9ZB 1UWRA 2QQ6A 5I78A 2GGIA 2DZPA