5EPDA

Crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
361
structure length
348
Chain Sequence
TLFQPTSLGAITLANRIVMAPLTRNRAGAGFVPGELTAGYYAQRASAGLIISEATQISQQGQGYQDTPGIYTQAQIDGWKKVTAAVHKKGGRIVLQLWHVGRISHVNLQPNGGAPVAPSAIRAEVKTFVNNGFVDVSEPRALELEELAGIVDDFRKAAANSIEAGFDGVEVHGANGYLLEQFAKDGANMRTDTYGGSVENRARLMLEVTAAVAQEIGPERTGIRISPVSPANGISCSDPQTQYDYIVDKLDALGIAYIHVVEPFDYGSLRRRFSRTYIANDLELATSHLADGRADLIAFGRPFIANPDLVERLQSGAPLAEVNAAKIFGGSAAGYTDYPRFSETTSDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of XdpB, the bacterial old yellow enzyme, in an FMN-free form.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Oxidorecctase
molecule keywords Glycerol trinitrate reductase
total genus 125
structure length 348
sequence length 361
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5epdA00
3R2GA 1R2RA 2I14A 3GVGA 2RKXA 1XL9A 1YTDA 4JTTA 5D05A 5EL1A 3O16A 1QOQA 3Q58A 4AWSA 2J9XA 2FFCA 2UV8G 1YTEA 4JYFA 2Y70A 2X2GA 2TPSA 3DAQA 1OK6A 2JKEA 4JY8A 1MZHA 1SW7A 2R8WA 4IQLA 4C1KA 5D33A 1GEQA 2VFDA 2Y63A 1G7VA 4RZ6A 1FWTA 2J24A 3C8FA 3S5YA 3W2KA 3KXQA 5CSSA 3YPIA 5TQLA 1O5KA 3FFSA 2CLKA 3E0IA 3KAOA 3RNDA 1VR6A 4XTIA 3ZWTA 3U6WA 1UCWA 3WJSA 1SZGA 4DF0A 1SZEA 4JTFA 1OF6A 3Q94A 1L6WA 3SECA 1R46A 4EWND 1TIMA 1UBSA 4J9JA 3DU0A 3T4CA 3TAKA 3G8EA 4YXGA 1IXPA 4DPPA 1N55A 3P62A 3W1UA 2ZZ2A 3TMQA 2WV8A 3N14A 3L67A 4QM1A 2YYUA 3S9YA 4NXSA 1ZJIA 3F4NA 3CEPA 5K7JA 4WUIA 2EPHA 4WXZA 4TU1A 4Y9AA 1D3GA 3PG9A 4BFAA 3W84A 4HNTA 3B04A 5AC7A 2YR1A 4OWGA 4CQ8A 3MP3A 4PCFA 4AWTA 4K7YA 3W7QA 4PEKA 2Y85A 4Z1BA 3W83A 3PSWA 2CZ5A 3DH7A 2B7NA 1F2JA 4JYDA 1B57A 2BTMA 3MMTA 3HO8A 3G8RA 3BGJA 1T99A 3PY2A 3I65A 2Z2UA 3S42A 3EXSA 1QWGA 3P81A 1X1OA 2YDAA 4GFSA 3KFTA 4NX0A 4QQ3A 3ANYA 3VE7A 4FB7A 4KFPA 1J2WA 1OK4A 1FCBA 1FCVA 1SO5A 1PVNA 3L68A 1MSSA 3WJZA 2PE4A 2QCDA 2ATMA 2ZQ0A 5DBUA 4FNUA 3GAKA 2C0AA 2CZDA 1O94A 2OCZA 4RXGA 3UWUA 4JS3A 1H7WA 5AN7A 2ISWA 1FWWA 2Y61A 3TCEA 5BMWA 1OFOA 3G1SA 5I3JA 2DP3A 3TW7A 1LROA 3NPUA 5D2XA 4HPXA 2FQIA 2GVJA 3WK3A 2P10A 1SFLA 5D02A 2R91A 4LVAA 1SZNA 1XFBA 2Q3OA 4LS0A 1TV7A 3W2NA 4UFKA 4BI6A 2CFFA 2V2CA 3O07A 1W3NA 1F6PA 3W87A 3IGXA 1GOXA 1PIIA 1K3UA 3W86A 4NJJA 3N2MA 2OJPA 5KZDA 3UXAA 2QJHA 5DLCA 3WK2A 3M7WA 1WYIA 3FEMA 1W3IA 3QQ0A 3EX1A 4GUHA 2NXHA 2CLOA 4ORMA 5L6UA 3CEUA 5BNKA 1TPVA 4HNVA 3EWBX 4E2BA 3UZJA 1JR1A 3G1FA 1FCUA 4ZL1A 4BWLA 1JRCA 3W1TA 2QCGA 1TTJA 4O14A 4GE8A 5HNRA 5E1QA 3EWUA 2RH9A 3A21A 3WJYA 3A9IA 1ZENA 5AHLA 3E49A 4I7WA 2BXVA 5HR6A 1G4PA 2J9YA 3LI1A 3B05A 4O1DA 1LRQA 1EP2A 1JCJA 2H6RA 4DO5A 5DXYA 5LNSA 1KV5A 2W0UA 1B9BA 4FNSA 4IMGA 3W1QA 1VCGA 1GVFA 3CHVA 4O18A 1DKWA 4ICNA 1Q45A 3NQGA 3HPZA 1LBMA 3W7IA 3LGEA 3C0JA 3TQVA 1R47A 3DI1A 2Y6ZA 3NA8A 3UNDA 3TKFA 2Q8ZA 3GX9A 4IMDA 4FX8A 2V0TA 2Z1BA 4UTTC 3R89A 5AHNA 5FEPA 4RV8A 3NQMA 3MJYA 4O17A 3E12A 4E38A 2ZRXA 2E6DA 1KFBA 4XZ9A 1T0OA 3R5EA 1FXPA 5KZMA 1XUUA 3LCWA 2NX1A 2GVLA 1JCMP 4FXSA 3OVRA 3LM7A 3PWAA 4I7UA 5AYXA 1K7EA 4LU0A 4Z1AA 2AQWA 1VLWA 3ABSA 3I7RA 3NQDA 3QC3A 2ABAA 2QDGA 3IGUA 1LTDA 4S2CA 1OFBA 3N19B 3HJZA 2PRMA 2QAPA 1P0KA 1ZALA 2ZA2A 3NZ1A 5CZTA 1YYAA 2Q3RA 3QEZA 1OF8A 1O95A 2VEIA 3RLUA 2GPTA 4XBSA 1CW2A 1FDYA 3R8RA 1YPFA 4Q4KA 2BX7A 3CU2A 2GJLA 1EIXA 4PTNA 2XN2A 3PG8A 1JQVA 4FNPA 1LORA 1QDSA 1QPQA 1VYSX 3DZ1A 5G1YA 3HBLA 2Y7GA 4Z0JA 1YDVA 3TJLA 3DFPA 4ML9A 1L2UA 3CIWA 4OBTA 4RR4A 5CSRA 3FIGA 1IIHA 3LX9A 3N3MA 3UWZA 3G1AA 1SUXA 3STCA 4LVBA 3T40A 1ML1A 2CZEA 3UY7A 2A6NA 3ZFHA 1XC4A 2QR6A 2P1FA 4MJZA 3S6DA 1FX6A 1H7OA 5C2XA 1SPQA 3O15A 1RZMA 3DXIA 1G69A 1XM3A 4JTUA 1CI1A 2C19A 3M5ZA 2VOMA 1TPDA 2QUUA 3DFOA 3NPXA 3NZRA 4JNMA 4NT0A 4BI7A 3G24A 4O12A 2CLEA 1J4EA 1NAL1 4WD0A 5G2HA 3RFAA 1EP3A 2WQPA 1VJIA 1OX4B 3SW6A 2JKPA 1I45A 1ME8A 3ZR4A 2DZXA 3TE9A 1J5TA 3HGRA 2GUUA 4E2DA 3EX2A 2YXGA 3T55A 3FLUA 4NNAA 2J88A 1T96A 3P82A 1GVOA 4O54A 3GXPA 3QPYA 5G2WA 3HOJA 3B0VC 1NFBA 5IM51 1RD5A 5C5YA 5HQEA 2ZZ5A 1JRBA 3TC6A 3NPWA 2VENA 4GWEA 2VEPA 1KFEA 2DJXA 4JYEA 3OHIA 4HPJA 4LS1A 4PFMA 1T8XA 2QEZA 4AAJA 4DEFA 5F2GA 1W1ZA 3GR8A 4MY9A 5D09A 1UUOA 3NOEA 3B4UA 1OYAA 3NQEA 3FKRA 4AVFA 4LNYA 3T7VA 3PBVA 2DU2A 4KFNA 5U7SA 4NNCA 4CQ9A 5FF2A 4X3ZA 3CTLA 4L4MA 4RK8A 1SW0A 2WNZA 4M6VA 1IXOA 2WJZA 3TV8A 4K36A 3M6YA 4H4IA 5K9XA 1OFDA 3HGOA 1H63A 5F4XA 5AYZA 2V9DA 4IXHA 1F5ZA 1YLVA 2CLFA 1TMHA 2DZUA 3B06A 1JCNA 3KRZA 5A5WA 1LDCA 4AHOA 4IGHA 3DFQA 3UPWA 5HWJA 1N8FA 3G18A 1JJKA 4XKYA 1WQ5A 4MOZA 3M41A 3P67A 1F74A 5LKYA 2VEKA 3G1YA 5KSWA 5LNRA 1KW1A 1YXDA 2RDTA 1TV5A 5LGZA 5F2LA 1XI3A 2G5WA 4A21A 2C6QA 4NZFA 1WOAA 3OBKA 4NJGA 4MKNA 2FPYA 3FA5A 1FWSA 2EAWA 1M5WA 3C2RA 2ZCGA 4CCDA 1K8ZA 2QCFA 5FF3A 3NXFA 2CLMA 1LBFA 3W1XA 4GXMA 3W74A 4NUWA 3PUOA 4E0CA 3TSDA 4UTLA 4PODA 7TIMA 4N9DA 1EWDA 4FF7A 4O19A 2H90A 4ONVA 1ZAHA 3CM4A 2WKJA 1KM5A 1HTIA 3BV4A 1QPOA 3MP5A 5LNVA 1DJNA 5D2WA 4UTWA 4IOTA 1DORA 5BMXA 3MWAA 2PCQA 3LTYA 3LRKA 3CQ0A 3LBMA 1I8JA 1JVNA 2CLLA 1M7PA 1ME7A 3IVTA 1FUYA 1NVMA 3SFKA 4LWWA 3NQAA 3W9ZA 5C54A 4GUIA 5LNWA 5FF4A 3CWOX 3DBPA 2A7PA 2DZWA 2RDUA 4AB4A 3P61A 2NV2A 1FBAA 1F7BA 5K9CA 1X7FA 1GTHA 2V2HA 3MI6A 2C18A 2NV1A 3PS7A 4BK9A 3GIYA 2ALDA 1U83A 3HPSA 1K8XA 3W7DA 1H5YA 3NO5A 4WX2A 4DELA 2FIQA 3R13A 4AH7A 2Y62A 2C14A 1EEPA 2B4GA 2A6LA 3TQKA 4K6AA 4M6QA 3BG5A 4UIOA 2QDHA 4Y96A 4MZYA 3TIMA 3PB0A 4WY0F 4N6FA 3LERA 4JDBA 1KV8A 1A50A 5HUPA 2HS8A 1W8SA 4WXYA 1KM1A 3P7YA 2EGZA 2A85A 4YMZA 4UNKA 5HR7A 4NX5A 3ZWSA 1A5AA 4OQVA 1I2NA 2VFIA 3BG3A 4IMEA 2CZFA 2VFEA 4RKAA 5HUOA 3GXTA 5D30A 3W7RA 5FEXA 4H3DA 1H50A 4AF0A 1HG3A 1L9WA 2WO5A 3LTSA 2NZLA 1UB3A 1WBHA 4MLJA 1GYNA 1O60A 3W1AA 1WDWA 2Z6JA 1BTMA 1W5QA 3H53A 4PH6A 3STFA 2H3BA 1ZY9A 3E9AA 3W7HA 4LUJA 3L2IA 4O0KA 5F4WA 3W1NA 3TH6A 1XUZA 4IUOA 2WOQA 4LS2A 3QSRA 3L66A 4BI5A 5F2MA 2QJGA 1C29A 3GDRA 3LHTA 5CPMA 1KTNA 3G1DA 3BLEA 4A3UA 4K8HA 1Q6LA 3S5OA 4GNJA 3PVFA 3W22A 1M6JA 1VRDA 2GQ9A 3C56A 4S1FA 4GUFA 3W7LA 1KTCA 4LC6A 3L5AA 1UJPA 2Y7FA 3W70A 4CNOA 4M19A 3UWVA 5C55A 2YPIA 3PAJA 5LNUA 1GTEA 3IV3A 4JX4A 1OFEA 2ZZ1A 3BW3A 1TJPA 1ADOA 3NL3A 3S1XA 3LCLA 4JTHA 1R30A 1L6SA 2C1HA 3TJXA 2ISVA 3PB2A 1AW1A 4OV9A 3GR7A 4MYAA 2WNQA 2QKFA 1R2SA 3GDLA 1XBZA 3W07A 1W5OA 1VQTA 3KVJA 1DHPA 3MHUA 1JUEA 5G5IA 1SZFA 1LOSA 1V7YA 3UYCA 1KFLA 4JEQA 5J5DA 1E51A 4B5NA 1P4CA 1LP6A 3THQA 4K39A 5LSMA 1PCWA 3PBYA 4UCGA 1QFEA 2QF7A 3TROA 3TC7A 1TTIA 3OEXA 3T78A 2X1RA 4NNBA 3NQCA 3BGGA 3NPVA 1NSJA 2OT1A 4MJMA 3NEVA 3NL6A 1FY6A 4Y6GA 2QCEA 2NUWA 5KINA 4JN6A 1TRDA 1M7OA 5CPLA 1IF2A 2WSRA 4MUZA 4N4QA 4D2JA 2FPTA 5HJLA 1P5BA 3TDFA 3QM3A 4R34A 4XTDA 1LBLA 3CB8A 2JKAA 1LRNA 2E6AA 2E09A 1QMLA 3W76A 2PURA 2GQ8A 4JR5A 4DO6A 3S8HA 1AL8A 4Z1CA 1DOSA 1ZAIA 2NWRA 4IX2A 3W1PA 1PHQA 3FJLA 5F1UA 1W5MA 4BF9A 5G4EA 4QNEA 4LOCA 2GQAA 2ZTKA 3C3NA 3W72A 2JGQA 2FLIA 2EF9A 3O6DA 3GK0A 5IBXA 2ZZ3A 4WQ6A 3IIVA 3W7OA 3IIXA 4UUIA 3NQ7A 2ZZ4A 4M6PA 4K7VA 3M5XA 4NJIA 4EIVA 1FDJA 5AOUA 5EMUA 3Q2DA 4Y90A 4NZJA 1YPIA 4UTUA 1P1XA 3F1QA 4K8EA 5K3VA 1K03A 4UTTA 3VE9A 3C4UA 2OZ0A 1H7RA 3AO0A 3C61A 4IX0A 3EWXA 5EKYA 4HNNA 3GDMA 1W5PA 4O52A 4PA8A 2X30A 3LRMA 2V82A 4KFOA 3N73A 1SFJA 3JRKA 3N9RA 1LOLA 4O50A 3QYQA 3LCFA 3W7NA 3LCGA 4O4WA 3PSVA 2Y7EA 3VNDA 3IIPA 3A22A 3QMTA 3P8JA 2B7PA 3LHVA 2ATSA 4QAIA 2BSLA 3JS3A 3LXCA 4O1BA 1KFKA 3FYOA 5EPDA 3VFLA 1JUKA 2B7OA 1DJQA 1K7XA 3IIOA 3T44A 1IGSA 3MW7A 1JUBA 2FJKA 1LOQA 5HWMA 4LUIA 1TO3A 2R94A 1SW3A 1W56A 3W75A 5T26A 3W6YA 4MPQA 1ZCOA 3W88A 1OVDA 1X8FA 3M0ZA 2ZRVA 5G2IA 4AMAA 1OFQA 1LLWA 4UR7A 2Y89A 3DHDA 2QJIA 1GYLA 4OGZA 3G1XA 1ALDA 4NVTA 5CZJA 3G0SA 3OG3A 5KMYA 1QCWA 1TTQA 3LTPA 3RK8A 4DBEA 6TIMA 4WY0B 5CGQA 3MP4A 2WSYA 1ME9A 4O16A 1MEIA 3SGZA 5F1VA 1MXSA 1PHWA 1AMKA 4O53A 2NUXA 3GB6A 3FJ6A 4A22A 2DJLA 4OE7A 4UTWC 4CNNA 1X1ZA 5D04C 3UY8A 5DCBA 3LCIA 2OMAA 4CCEA 1THFD 4PL1A 4IJBA 3STGA 1NEYA 1OG0A 4XKYB 5I3KA 5AC6A 3NL5A 4XWUA 4ZQCA 1LLZA 1OYBA 1XDMA 4Q32A 4EF9A 4GRSA 1Z42A 2JK2A 3M5YA 1GT8A 2ZTJA 2CLIA 3DGRA 1I2RA 1TB3A 1EWEA 1GVSA 1WV2A 3BK0A 2A1YA 1D9EA 4HNUA 4WJEA 1VPXA 1HO4A 1DBTA 3EKZA 3PUDA 1OYCA 4NJKA 2J9ZA 2HS6A 3EXTA 3ABQA 4RCXA 3Q37A 3A23A 1XXXA 3HG2A 5FI8A 1H51A 2OT0A 4UTMA 2G95A 3EX4A 1VZWA 4AF0B 1VGAA 3LLDA 4FEZA 1YTKA 3S1VA 1TQJA 4TMBA 2V81A 1WBJA 2A4AA 3UPBA 5G4WA 3C2EA 4FX7A 2VFHA 4UMCA 4NU7A 5CKSA 3LDVA 3R12A 3TXZA 3SZ8A 1OFAA 4MY1A 2ZZ6A 3P80A 2DZSA 3UWWA 5LGXA 2YGYA 1TRIA 2GOUA 2AAMA 1Q6OA 1LM1A 1I4NA 2ZA1A 3GNNA 3KRUA 3W7KA 4JTGA 4JIQA 4XBKA 4Z08A 2YW4A 3DENA 4LVDA 2YYTA 1G6CA 3S1WA 3QH2A 3W7GA 3LCHA 1SO6A 1WX0A 4IWWA 4QJ1A 3TFCA 3L21A 3M43A 1QOPA 1PS9A 2E77A 2VXNA 3U2OA 5MHBA 4GUJA 1GJPA 2V5LA 2AGKA 3C2OA 4IPIA 3PBUA 1EUNA 4HSNA 3C52A 3O6YX 1N7KA 2ISSA 1JCYA 1K8YA 8TIMA 2G96A 1KBJA 3BO9A 1KM2A 1VYRA 6ALDA 3LLFA 4ZMGA 3WK1A 3ATYA 3DKLA 3G1HA 4HKPA 3TAOA 4GC4A 3IVUA 3PM6A 1F6KA 1G67A 2HSAA 3O1NA 3LXBA 3MYPA 3UD6A 3P8IA 3M1ZA 1IXQA 5CPNA 5K4XA 4N9CA 3BPWA 3C6CA 4UC5A 1DL3A 4GUGA 1HO1A 3N34A 3E96A 3I68A 4TO8A 5AHMA 4ADUA 5BOOA 1U5JA 4O15A 4N6EA 3LXAA 3NQ6A 4I9AA 5DBTA 1TSIA 2V8ZA 3MO7A 2O7QA 3BLIA 4MZ1A 4O57A 2F84A 4DO4A 2QUVA 3DFTA 2F7FA 2VEMA 1FXQA 2ZDRA 5K9DA 3THAA 3L9CA 3DI0A 5A8GA 2VKZG 4DPQA 1Q6RA 1YXCA 1S3HA 2ABBA 3A24A 1VHNA 5AYYA 1BKSA 4ZVJA 1Z41A 1HFBA 4HT3A 3OVPA 4JX5A 2GJNA 1AW5A 1TCDA 5D2YA 1ICPA 2V30A 3NAVA 4RJEA 1A5CA 3O6CA 1WOBA 4UTKA 5CG7A 1F05A 2A5HA 2C3ZA 2NX3A 5L9FA 3HGJA 3N9SA 2CU0A 4X22A 4PL2A 1BEUA 3W7JA 3BARA 3EWWA 4MFDA 5K4ZA 4YWIA 2DORA 4DF2A 3CIXA 1RV8A 3TUUA 2X1UA 4FXRA 1B4EA 1GZGA 3G0UA 4JGDA 4QSHA 3W23A 2DZVA 3W2MA 4O11A 3G3DA 1QPNA 1TREA 4CLMA 4A2RA 4UFMA 5C6MA 4QISA 4DXVA 1OJXA 3SR7A 1YXYA 3UXDA 4O8RA 4JTIA 4L4LA 1AL7A 4LV4A 3NM1A 3TNOA 1IXNA 1MEHA 1RQBA 4K37A 4YLWA 3W7CA 2WNNA 5LHEA 1F73A 3W2UA 4MYXA 1KM0A 3GZ3A 5E0KA 3G3MA 5FEWA 4X9SA 3MYOA 1PCKA 4RX0A 3L0NA 2QCNA 3MBDA 4Z1DA 3LV6A 3M16A 3TMLA 3W7PA 5TBOA 4DBDA 2YFNA 4WY0A 1ZNNA 2C15A 4O28A 1BWLA 1WXJA 2BWGA 3GDTA 1R2TA 1V5XA 5U4NA 2V2DA 3W73A 3LHZA 1XBYA 3SY5A 1DQXA 3ABRA 3G1VA 3WJXA 1W54A 1Q3NA 2Z0IA 2PRHA 3QW4B 2X1TA 3NM3A 2O7SA 3W2LA 2QUTA 1OX4A 3QRHA 3VKJA 3USBA 3FYPA 1GVQA 1TPWA 1RQEA 4JD4A 3AJXA 2RDWA 4XUGA 4OU1A 2XFWA 3G0XA 2V5BA 1I2QA 3W3OA 1W37A 4FO4A 1LCOA 5D2TA 2OX1A 1SO4A 2VFGA 1GPWA 3S5ZA 3S5NA 3FKKA 3W7MA 3QPZA 3TXVA 2BLEA 3CWNA 3PR2A 4EVZA 2C13A 3HG4A 1XBXA 4NXKA 3NG3A 2I9EA 4P2VA 2PC4A 3OVQA 3HB9A 3H55A 3CLMA 3EXRA 4ADSA 1TPB1 1RVGA 4HHPA 4U4MA 2LLEA 1G7UA 3GNDA 4GBUA 1JULA 3EWYA 3P84A 3E02A 2YFOA 3C2FA 3QJAA 5GVJA 3INPA 4UTJA 3W2JA 1VS1A 4UTHA 3B0PA 4O1CA 1P0NA 1ONRA 4LC8A 4AHQA 3L0GA 5LZLA 3L65A 4WOZA 4IMCA 3JR2A 3NGJA 3OA3A 5F4SA 2ZRYA 3I7QA 3QMRA 3B8DA 3NL2A 3PBWA 4X2RA 1VCFA 5CPOA 3B0UX 1SO3A 4RXFA 4NJHA 3PUEA 3KOFA 3SIZA 2TSYA 1I2OA 4JTLA 4AWUA 2KZHA 3EEGA 1GVRA 4MZ8A 3ATZA 2DZPA 2BZNA 5SWUA 4ORIA 5HINA 2B0MA 1C9DA 5HWNA 1KLZA 2P0OA 3C2VA 3EKLA 5D32A 3P60A 1KA9F 1H62A 3STEA 4UFIA 3MHFA 1SU5A 2Z6IA 3GDKA 3MBFA 3I6RA 2QCMA 4JTJA 3LV5A 3LI0A 5HULA 4K38A 4GJ1A 4JTSA 1F76A 2H3DA 3MUXA 3CC1A 3KVKA 2HMCA 2CWNA 5I3GA 4S2BA 1AG1O 4P61A 1KM3A 4OT7A 1B3OA 2NXIA 1S5VA 3B03A 3M9YA 1VLIA 4QNWA 4EOUA 4LRSA 3RMJA 3W7EA 1G4TA 3SI9A 1OHLA 1DQWA 2HTMA 5K2ZA 1HL2A 4N9EA 3NYZA 4JIPA 1K02A 1FWNA 4LTSA 5DN1A 4FNQA 2JGYA 3W71A 3L5MA 3WJWA 1WAUA 1VH7A 4FIQA 2FDSA 4AEOA 2YSWA 1CX9A 1VCVA 1H1ZA 5HMSA 5D38A 4YL2A 4KKXA 3W1LA 5E93A 5D03A 4HSOA 3O06A 1EPXA 4UFJA 2NXGA 2J6XA 4EF8A 2QAFA 1FDZA 4TMCA 4UXDA 3LB0A 3ABOA 1UUMA 2GVGA 5F2IA 1EUAA 4LVGA 1PL9A 2E68A 1KTBA 2RFGA 3KHJA 4M7SA 1GWJA 4JTKA 2TMDA 5AFDA 1Y0EA 2VFFA 4ZZ9A 1SSDA 4JTEA 4MLRA 5DCEA 3HPXA 4KWWA 1TQXA 1GQNA 1TV8A 3QQ1A 1EX5A 3UWQA 4IMFA 1TPEA 2E5CA 4TX9A 2ZBTA 1LZOA 5FEZA 3NR0A 3KVLA 4WOQA 5EA9A 3RU6A 3QMSA 1Q6QA 4UMBA 5H2ZA 1W5NA 3LCXA 2NUYA 2XN1A 4M7TA 5H91A 5EYWA 1KFCA 1Z48A 3O05A 3I7SA 4LY8A 2TRSA 1X6UA 4I7VA 3IEBA 1EB3A 3NQVA 1W0MA 2ZYFA 3TFXA 4ZQNA 2ZRZA 4ZQRA 1FCQA 4Q33A 4HIBA 2H8ZA 1DV7A 3DFSA 2QCDB 4LW7A 1TPH1 3W85A 3LHYA 3SJ3A 1MO0A 5KITA 5LHFA 3W1RA 1JQXA 1KLYA 3O8AA 3FOKA 2VC6A 5FESA 4N02A 3FS2A 3VI2A 1VC4A 4AXKA 1QR7A 4A2SA 1ZAJA 4R7JA 2ZRUA 2A21A 1O4UA 1L6YA 2E5BA 1QO2A 3NDOA 4O4VA 4LV9A 4QIUA 2WPBA 5J5RA 3NQ2A 4R33A 4FNRA 1H7PA 5AC8A 3MHGA 4O10A 3LOTA 1XKYA 1GG1A 1TPC1 3QW3A 1SSGA 1KBIA 4JY9A 3O63A 5I3IA 1OX6A 3GKFA 5DY3A 2E5DA 3LHWA 3OIXA 1H7NA 4HN4A 3ZS4A 2FB3A 2FTPA 4OHQA 1MEWA 1YDOA 4WZHA 3W1MA 1QPRA 3EB2A 3H54A 4KWVA 5EBUA 2W79A 3M5VA 3DKJA 3N2XA 1JCLA 5CZSA 3EWZA 3MI2A 1D3HA 1H1YA 2YW3A 1KFJA 1XDLA 4QITA 2D73A 3EX3A 1TPFA 5BRBA 1LRTA 1PE1A 3LBCA 1NF7A 4R53A 1FWRA 2QCHA 2DZTA 3QSTA 2X16A 4RLIA 3PF3A 1KM4A 1H7XA 1O5XA 3S0CA 4UMAA 3V1PA 4JX6A 4RZ5A 4W9TA 4ALDA 1I2PA 2Y7DA 2J27A 5AHFA 1HUVA 2A7RA 2E6FA 2JBMA 3F4WA 3HIJA 1TJRA 1RQHA 4DF1A 4UR8A 3L0KA 2WSQA 2YZRA 4UTIA 4N2YA 2A0NA 3KX6A 4C1LA 1RR2A 4MVAA 4O1AA 3BLFA 3MI3A 1S5WA 3IRDA 3KVMA 4A29A 5DCDA 3QFEA 2CLHA 3SSJA 2TYSA 3U8GA 2Y88A 1VHCA 1EA0A 1VYPX 1IIGA 3BVJA 1AK5A 3K30A 3CPRA 4OV4A 3DHFA 5I3HA 1FQ0A 1H61A 1LYXA 5IBXC 4BWLC 2ZA3A 5KTLA 4RZ4A 5I3FA 3F03K 4N9BA 3TW6A 1UASA 1TPUA 3TR2A 1W31A 2YCEA 5FF7A 1OABA 1S5TA 5TIMA 4FX6M 4Y8FA 4PC8A 3HGSA 4H6KA 3TA6A 1AW2A 2E1DA 2ZFAA 4IXXA 4CCCA 3HQ1A 2FB2A 2QCLA 2H8XA 3PC0A 3UWYA 1A5SA 1WA3A 3HF3A 5AHEA 1PV8A 4LVFA 3GLCA 3GXNA 3SGUA 2NWSA 5DXXA 3IIZA 1BWKA 5CZ0A 2I1OA 1QAPA 4O0ZA 1A53A 3QZEA 2EHHA 2Q8LA 3P5YA 2ZZ7A 2NX9A 1QNVA 3GYEA 2FPVA 2XN0A 4G1KA 3IVSA 1G4SA 3P5ZA 3D0CA 4ADTA 4DQWA 2CW6A 5AB3A 1K7FA 3ELFA 3RLVA 4N4PA 3P74A 3NQFA 2NLIA 3WFAA 3HG3A 5KZEA 3NVTA 1EP1A 3G22A 3BW4A 3A5FA 4FNTA 3TSMA 2R14A 1B4KA 1G4EA 1TTPA 2QCCA 3TSBA 3NQ8A 1ZHAA 4MIMA 3TX9A 1KM6A 2A2IA 1XCFA 3UQNA 3BG9A 1YDNA 1ICQA 2PRLA 4ZQOA 3M47A 4Z0SA 3RF9A 1ICSA 2YX0A 3HG5A 4IPJA 4YCPA 1C8VA 1A5BA 4UFLA 3V75A 5AHIA 4POCA 4LRTA 1SR9A 1NF0A 2C16A 1XBVA 2IQTA 4ZQPA 4YCOA 1QO5A 1OFPA 1DVJA 4TIMA 4M5PA 3QF0A 5DY2A 1GG0A 3PULA 4LT9A 4JDYA 5ABTA 4NQ1A 4FIRA 3VCRA 2G97A 2RHGA 3DFNA 4JXCA 1JCXA 4CNPA 1YADA 4UNLA 1SQ7A 2B7QA 2X1SA 4BR1A 2W6RA 3L5LA 3EX6A 3NNTA 5FF0A 2E6YA 4TR9A 5DELA 1OX5A 2EKCA 4ZQMA 3TU9A 3GAYA 3KRSA 3M44A 2VELA 4O13A 3IGSA 4MFEA 1OFRA 4JICA 2ZRWA 4UFHA 5D2VA 4MY8A 4FHAA 5D37A 4XQ6A 5BW6A 5EY5A 1TYGA 3LRLA 3CT7A 3A5VA 4U28A 1W3TA 2A7NA 3LHUA 3GKAA 3HMJG 3WK0A 1H60A 1ZFJA 4CQAA 5G1TA 3BW2A 3TK7A 3UZ5A 1RPXA 3S1UA 4AHPA 3TQ0A 1Z44A
chains in the Genus database with same CATH superfamily
3BJFA 4JN7A 1HNYA 5A6BA 2QGYA 3GHRA 2EG6A 3ARWA 1RJQA 1W2PA 4L1WA 2XFFA 3T0CA 1YTDA 2QVHA 1RCOB 5IHRA 2J9XA 3ZR5A 2J75A 4C91A 4JIHA 1YTEA 2X0YA 3MA8A 4V2XA 4B2DD 1T7LA 2C79A 4XUYA 1SW7A 2IS7A 1XISA 1GEQA 2W63A 3SN1A 2Y63A 1G7VA 3UA4A 2OYMA 3CMGA 1FWHC 2VQTA 3KXQA 3YPIA 5TQLA 2WLZA 3CT2A 3FFSA 3UJSA 3U2CA 2CLKA 1NWSA 2X0HA 3GTIA 4H00A 3RNDA 3W00A 3ZWTA 3EZ4A 3U6WA 2F2KA 2DH3A 4AFYA 1UBSA 3T4CA 3H2FA 3TAKA 1EJUC 1FOBA 3G8EA 2D23A 1MNSA 3NJ3A 3WLHA 2ZOXA 3P62A 1YRRA 4KCWA 4PUWA 2YYUA 1OCQA 5E09A 4NXSA 1S1PA 4B2DA 3NZPA 1JPMA 4RW5A 3FJNA 4WXZA 3EPNA 4Y9AA 3GYCA 2YXOA 1XFCA 3W84A 3B04A 2YR1A 4DZHA 4JQAA 4PCFA 4XO6A 4K7YA 3W7QA 1DJXA 1WZLA 2C71A 1YNQA 5CPQA 3PSWA 2CZ5A 1JFXA 2B7NA 1JDAA 4PUNA 2F6KA 3MMTA 1B3ZA 3SADA 4QP0A 2VWSA 3PY2A 1PZ1A 2VRJA 3ZR6A 1GYMA 3L2MA 3P81A 1E4IA 3BMWA 3WENA 3MKVA 3PAOA 2FH8A 4GVFA 4C6KA 4HA3A 4Q8UA 4KFPA 1J2WA 1OK4A 1MSSA 2PE4A 5DF0A 3FAXA 3U0HA 3PNZA 4FNUA 1ZUAX 4RXGA 1UQYA 2VTFA 5H8PA 3VOCA 4IQEA 4UZUA 1V0LA 1NARA 5EGRA 4FALA 3MY9A 3KOXA 4GVGA 5I3JA 4HCLA 5DMLA 3LUTA 5D2XA 4HPXA 4LCRA 2P10A 4W7WA 2GWGA 1UH3A 4LVAA 1OT1A 1SZNA 3W24A 3LNPA 3W2NA 2ZX8A 4RE0A 4UTFA 4UFKA 4WJXA 3O07A 2YA1A 3IGXA 1GOXA 3W86A 1EJ7L 1UKSA 3N2MA 4GMEA 4HA4A 2QJHA 4KETA 3WK2A 3FEMA 1W3IA 2J7HA 3QQ0A 4GUHA 4GACA 3EOUA 2I57A 3DGBA 3EWBX 3T81A 1M68A 3EB4A 4EACA 4V27A 1FCUA 1GOKA 3IRSA 3W1TA 3BTNA 2DUZA 3VA8A 3GVVA 1UP3A 3WMCA 5I09A 1Z7AA 3H2EA 1OZQA 3E49A 4I7WA 1UD2A 4O1DA 5DXYA 1KV5A 4FNSA 5JXQA 4TUFA 3U7BA 1VCGA 4ZB2A 1GVFA 2CNCA 3WKZA 3OODA 4GI4A 4HJWA 4XD4A 2A3EA 3O2LA 2V3GA 3POHA 3CV2A 2I16A 3LGEA 3NA8A 3UNDA 3GNXA 1QI2A 4IMDA 2V0TA 4UTTC 1D7KA 1FWFC 4UR9A 1W1A1 5EFFA 4O17A 2ANUA 2ZRXA 3KOWA 2E6DA 4XZ9A 4LY4A 3R5EA 1Z6KA 2XVNA 1AQHA 1CXLA 2NX1A 3WD2A 2YBUA 2WVVB 4FXSA 2X42A 4WJ8A 3ARSA 3OYZA 1VLWA 2ABAA 1O68A 5IRPA 3N6HA 1DWAM 2NVCA 3SSZA 4DBWA 4ERAA 1E4LA 1RA5A 4Z2GA 2DFAA 2PRMA 1JZ5A 3UG8A 1ZALA 1GHSA 2ZA2A 1XIEA 3NZ1A 2ZC1A 2QT3A 1NOFA 2VEIA 1DJYA 3CXOA 1CW2A 3R8RA 1BQGA 3E0FA 5JBFA 4PTNA 1EIXA 2PDCA 5CZKA 1V3KA 1XLIA 1ISXA 3TYUA 1LORA 3N11A 1VYSX 4LNCA 3V5CA 3DZ1A 5G1YA 3SCSA 2DUAA 3K8MA 4AEEA 1FWDC 3TTEA 4C6CA 4OBTA 2VD9A 5CSRA 3FIGA 1VENA 3UW6A 1GQLA 4F4RA 1J5SA 5H6HA 5J04A 2OGYA 4DWDA 4O1FA 3VC5A 4I8YA 2IKGA 1TJ1A 4MJZA 1OWQA 1FX6A 5C2XA 5C8BB 3ZJ8A 3DXIA 4JTUA 1ZQ5A 3RGTA 3I3BA 3T0TA 1Y5XA 2QUUA 4ZO7A 4DLMA 3DFOA 4Y8EA 3EA1A 4Z42C 4BI7A 1GNXA 1XLJA 2CLEA 5G2HA 3RFAA 3IACA 1F3WA 2O0TA 1BRLB 3A64A 4D6DA 3AMGA 3ZVHB 3HA1A 3UCCA 1F3XA 5T91A 1IT8A 2DZXA 2I9UA 1VF8A 1J5TA 3HGRA 4RNJA 3NURA 3DECA 3K13A 4ZE5A 2Y8UA 4PTVA 3EX2A 1DXIA 1TE1A 1VB9A 3GXPA 3CUHA 4C5YA 3NPWA 5TNVA 1R0MA 3B0YA 1K8CA 4HPJA 3SM0A 4HHLA 4H9VA 4F2UA 2QEZA 4JBRA 4AAJA 1W1ZA 5D09A 1UUOA 3URNA 4PCSA 3RR4A 1EOMA 7REQA 3WX7A 1XRSA 3NQEA 5IDZA 5GJNA 5BRPA 2DU2A 2G50A 5HATA 1KRMA 3SCRA 2R82A 3WQFA 4ATWA 1OC5A 4WLCA 4C6OA 1TKKA 3N17A 2X40A 4DZIA 3ZLFA 2YOCA 2AQOA 3TVAA 1OFDA 2P76A 3F4CA 4ACZB 1F5ZA 1YLVA 2CLFA 1TMHA 2WVVA 5JH2A 1UH4A 1JCNA 3AAMA 1IEIA 1V51A 4TV6A 3CUGA 2G37A 3KP1A 2VEKA 2E67A 4V15A 3NIYA 4X63A 1F3TA 5LGZA 4MTVA 4A21A 4OUIA 3VMNA 4YTUA 4H9XA 3OBKA 2OZTA 4CD5A 2EAWA 1M5WA 1HGWA 1JYNA 3CZEA 4KMQA 2CLMA 3T4WA 4GXMA 3TLLA 1IEQA 4E0CA 4PODA 4DJDC 4GK8A 4O19A 4B5VA 4AISA 1P6BA 3VK5A 3TONA 1KM5A 4F3HA 3SCOA 3AIWA 3BV4A 3MP5A 2WMGA 2VDIA 4AC7C 3EMCA 3CQ0A 2IKHA 1I8JA 1M7PA 2BGQA 1FUYA 3WDJA 4LWWA 4ZXLA 2YJQA 1ADDA 4G6CA 5C54A 5LNWA 5KEZA 4TXEA 4IUGA 3P61A 5IDIA 1FBAA 5K9CA 3MI6A 1QHPA 1BYCA 2XH7A 3VCCA 1U83A 4PBEA 4AD4A 3HPSA 3W7DA 3DYMA 1H5YA 2HISA 4WX2A 3R13A 3BURA 2C14A 1EEPA 3TQKA 3JZUA 4DO7A 3BG5A 1W1B1 4PR4A 1UUQA 3B9NA 2DW6A 2J8TA 2WMFA 5E9XA 3CTTA 4D6HA 4HCHA 3PB0A 4DJEA 3LERA 1DIKA 4PN2A 1A5NC 4X0NA 5CBJA 3QHMA 1A50A 2VRKA 4DI8A 2HS8A 3XIMA 3ARPA 1KM1A 3CZ8A 1IR1A 1B30A 1FH8A 4UNKA 3ZWSA 2GDVA 1A5AA 5C70A 9RUBA 2CZFA 5XIAA 2L5HA 4IM4A 3GXTA 3EMZA 3VDAA 2WK2A 3IARA 4IPNB 2WLYA 4G56A 2WHLA 2NZLA 1FRBA 5C2GA 5E6ZA 2GGHA 3IUHA 3TYZA 4XX6A 4OJYA 1W5QA 3SUVA 1SR0A 1RLCL 4UOJA 1XLGA 4LBSA 3W1NA 1RAKA 3SO7A 2WOQA 3QFWA 1X98A 4B5XA 1RP9A 3QSRA 3PZMA 2QJGA 1VFFA 3M0MA 3EDJA 1KTNA 1CXFA 3BLEA 2YL6A 1R85A 3H22A 2VVNA 4QS5A 4YNGA 4F9JA 1PYMA 3WQPA 4GNJA 4GI9A 1DTUA 3UP8A 3W22A 4J27A 3N4EA 1XYLA 5I6SA 3RN6A 4ZTYA 3C56A 3G1RA 3ONCA 2VURA 4H6QA 3M07A 1J18A 1DIEA 2Y7FA 3L5AA 3M7SA 4CNOA 3MDWA 1AH4A 5C55A 2YPIA 2ZX7A 3BLKA 3FCPA 2OPJA 4JX4A 2ZZ1A 1BTCA 4M8UA 4UB9A 3VGFA 2C1HA 1EX1A 3VFCA 4E2VA 4RNFA 4OV9A 5FKYA 2WNQA 2FZMA 4B4HA 1XBZA 3EDKA 1W32A 1JUEA 3ARZA 1W6TA 1LOSA 2GGGA 3UYCA 1KFLA 1IEWA 1SFTA 4IIBA 2HXUA 1P4CA 4E4UA 1B1YA 3O6AA 4K39A 4HZ8A 4QTGA 1YE6A 4XK2A 2NVDA 4E5TA 1QI5A 5HDRA 1PBGA 1NU5A 1TTIA 3CK5A 3H7RA 3T78A 2X1RA 3NQCA 1JGMA 2OT1A 4MJMA 3NEVA 4MKSA 3NUKA 2NUWA 5KINA 1TRDA 1M7OA 3BAYA 4GZIA 1P5BA 4XTDA 4QE5A 3WFLA 5LYRA 1LRNA 1KCXA 4BQ4A 1MZRA 1QMLA 3GHSA 2XSXA 5I77A 5F7UA 2WZTA 2KX9A 2IW0A 1ZAIA 3W1PA 3N13A 3RILA 1JZ7A 2UY4A 4JFSA 2JFEX 1M1BA 4LOCA 1HKWA 2GQAA 4H6EA 2G3MA 3CH0A 2WMIA 2YLAA 1MRQA 3GK0A 3IIVA 3L4UA 1MI3A 3FJ4A 1EC7A 4GX8A 2F38A 4IIDA 3FXGA 3TWBA 4RZBA 1CGYA 1XCWA 4K7VA 4WSJA 3LGGA 5H8MA 3N12A 4ZSTA 2VGFA 3Q2DA 4ZR8A 3MZ2A 1LT8A 5CJ5A 4NZJA 1P1XA 4A8IA 4KS0A 5C2CA 5K3VA 1D3CA 1WNOA 3C4UA 3AO0A 1GKRA 5EKYA 1T5AA 3MSRA 3GDMA 4O52A 1BRLA 4KFOA 1S2UA 3QYQA 3LCGA 4CU8A 3WDIA 1W1IE 3EMQA 4PMDA 1J12A 4LANA 1QW7A 3KRBA 3CASA 1CGXA 1N8WA 2Z29A 3P8JA 2B7PA 1BXBA 2BSLA 1RUSA 3VFLA 2HVOA 3HMCA 4KCUA 1XRTA 1XH0A 3AFBA 2FJKA 1VFLA 1WXYA 2D22A 4NAFB 3W75A 1KKOA 3W6YA 3VKCA 1JGIA 3W88A 2YL8A 2ZRVA 2PDUA 5G2IA 4Y9OA 3UA3A 2QJIA 1GYLA 1MW2A 5D8WA 5CZJA 3E74A 3KUMA 3RK8A 4DBEA 4HZ7A 1AMKA 3AS2A 4GIEA 4MJ2A 3H2CA 4CD7A 2DJLA 4CNNA 3WDPP 5I24A 3UY8A 5DCBA 1R86A 1S3TC 3P6LA 4PL1A 5AZ1A 1MW0A 4IJBA 5HQLA 4FLRA 5I3KA 3TTOA 5AC6A 4DUXA 4GO9A 1KGWA 1GORA 4XWUA 4P8VA 4ZQCA 1E1CA 1LLZA 3WMBA 4A3RA 4GC3A 1XDMA 1V6TA 1VJSA 2ZTJA 4W5ZA 2QJNA 2XFRA 2XH4A 1GVSA 1TZ9A 3IK4A 3WLLA 1HO4A 5KETA 1HXJA 4XAYA 2UY5A 3EXTA 3CQKA 4ZOEA 3ABQA 2UY2A 4WEVX 1XQLA 1XXXA 3HG2A 2PBGA 4ZO8A 4YTSA 2OT0A 5D9MA 4O8AA 2PDLA 1EXBA 3WD3A 3EX4A 4NI8A 4V33A 3LLDA 1UD4A 1HP5A 4M82A 2V81A 4ATLA 1U1JA 4JCLA 3UPBA 2WQDA 5HMEA 4NU7A 3MANA 5CKSA 3EOEA 3LDVA 3UR7A 5E6YA 4XSMA 2CERA 1Q6FA 5AKQA 4DRSA 5LGXA 4JTCA 2GOUA 1Q6OA 2XGIA 3AU2A 3LQLA 1I4NA 4E3TA 3GFYA 3AYVA 2PAJA 4Z08A 2GGIA 3F2CA 1W1VA 1J96A 1G6CA 2A79A 1YHTA 3W7GA 3S46A 3ID7A 1SO6A 4LYPA 3UJFA 4J2PA 3H7VA 2EJAA 4IWWA 1PKMA 3QKEA 1QOPA 3ICJA 1MDLA 1Q66A 2VXNA 3U2OA 3V5OA 1OM0A 1D8WA 4D1JA 1CB7B 4JQ2A 3VMOA 4IPIA 3PBUA 3SRHA 3O6YX 1JCYA 3BO9A 2Z1SA 6ALDA 3L4TA 5TD4A 2OZ3A 1FH9A 4HKPA 4KH2A 7ENLA 3G6MA 1E15A 3IVUA 1F6KA 1G67A 3O1NA 3LXBA 1VP5A 3P8IA 3CL7A 3M1ZA 3WY1A 4HYWA 3KDNA 5CPNA 2FYMA 2OLAA 4I6KA 1LUCA 1L8PA 4L9ZA 2R1LA 5BU9A 3N18A 2W62A 3MO7A 2O7QA 1PKLA 2D0GA 4MZ1A 4O57A 4DO4A 2QUVA 4ZXOA 2DT0A 1REQA 4Q3MA 3AYTA 1TWIA 1B3WA 1QUMA 3WLRA 3A24A 3M6DA 3E5BA 4A3HA 1FA2A 1V7AA 1HFBA 4HT3A 4A8RA 4JX5A 4RDYA 3WQEA 1ICPA 1SJCA 2V30A 3GVQA 3NAVA 3R8HA 1Q4WA 3O6CA 1VD6A 5C0QA 1K70A 6TAAA 2G4JA 3LSCA 1R87A 4MFDA 4A6GA 4YWIA 3ABZA 2DORA 4DF2A 6ENLA 5A94A 1RV8A 4FXRA 4JTQA 1Y7VA 4QSHA 2QLYA 2W4XA 1S2AA 2BS9A 1DJWA 4A2RA 1ODUA 4DXVA 4S3AA 3UESA 1JDDA 4LV4A 1LG1A 1TIWA 4PMXA 1WXZA 3HPAA 3TNOA 3ABXA 1VFSA 1IXNA 3MSDA 2V38A 4QEHA 4MYXA 4KEUA 3G3MA 3MYOA 3CGTA 4AZ7A 2DVUA 1XW8A 3R6IA 4HQVA 2GVEA 4RX0A 2XIBA 2V5DA 4K2SA 3WNOA 4Z1DA 3GIQA 3TMLA 5LIWX 4DWSA 4O28A 4L65A 4FK9A 2ALRA 1R2TA 1V5XA 4IFOA 4PFHA 3AXHA 1Q7QA 3ABRA 2PRHA 3QW4B 3AZRA 5GJPA 3NM3A 6REQB 2F2HA 4D9PA 2DH2A 3FYPA 9XIAA 4JD4A 3QBUA 3G0XA 4UNIA 2HCVA 3W3OA 4FO4A 1I60A 1FVPA 5D2TA 4GH1A 1MNZA 2GWNA 4MB4A 1NTHA 3S5NA 4MNJA 3QPZA 3TXVA 3U48A 4DM1A 1ISWA 4YS1A 3JU2A 2XINA 4H01A 2WW5A 3H55A 1MXDA 1LQ2A 1RVGA 3S2JA 3GVRA 4U4MA 3GNDA 3H26A 3EWYA 3E02A 3C2FA 3QJAA 3W25A 2VCAA 4AG0A 3E3HA 4DM2A 3VVGA 1UZHA 4IP7A 3FA4A 3NGJA 3W38A 4IFKA 3I3EA 3VYLA 2DQXA 3NL2A 2CBUA 3WLSA 2WYSA 1GQKA 3VOFA 3C8NA 4RXFA 4BS0A 4DBSA 4L1XA 1BXNA 3KOFA 1RY0A 3SIZA 4JTLA 1A5MC 2UY3A 1K9FA 1PTDA 3N04A 3D5HA 3RX2A 2V5CA 4MZ8A 4NZ1A 2DZPA 2RUSA 2WMIB 4KQNA 3E38A 3MU7A 3VNLA 1KLZA 1IGWA 4EXQA 1UA3A 4UFIA 3GDKA 3I6RA 3P3BA 1AQFA 1G94A 1H1NA 1XHGA 3LI0A 4IP4A 3TYBA 4YWSA 2H3DA 3K4WA 1I1XA 3MUXA 2D69A 2CWNA 4CQDA 4S2BA 1DPMA 1BPLB 4FF5A 4I5UA 5CG0A 1KM3A 4OT7A 2PWDA 3M9YA 4QNWA 3KLKA 5K2ZA 3H21A 1OCBA 3VGBA 4JKKA 3SUSA 3A3XA 1EGMA 1EYWA 1VH7A 1ZZMA 2GGEA 2FDSA 4AEOA 4IPLA 3CV6A 5D38A 4MWAA 2OODA 3HQOA 4HSHA 3W1LA 4C6QA 1WKDA 1EPXA 2BBFA 2DUXA 2NXGA 2PD5A 2GVGA 2O4QA 3AIQA 4LVGA 1PL9A 4F0MA 1CBGA 5MF5A 3KHJA 3SRKA 3A3HA 4Z1YA 2FKPA 1LL6A 4ZZ9A 1SSDA 4JTEA 1TELA 4MLRA 2YLLA 5DCEA 4KWWA 3QQ1A 1EX5A 2E5CA 2QPUA 1X1NA 2ZBTA 3K2GA 1FHVA 3KVLA 1ONXA 5EA9A 3RU6A 3VNJA 5CLWA 1Q6QA 4UMBA 3V36A 3FK4A 2AL2B 2XN1A 2HEJA 1QJWA 4A3YA 1KC7A 1Z48A 1EGVA 1E0UA 2IUZA 4WDXA 3OIHA 4I7VA 1P7TA 2Z7GA 3PTMA 4ZQNA 4XG1A 5C71A 3E2RA 2H8ZA 3AALA 3ZT5A 4YHEA 1V3JA 4B4FA 3TJIA 1W9DM 2QVNA 3L23A 4J40A 2AMGA 1H09A 1X8CA 1N2VA 4N02A 3OYXA 2WKGA 1ZAJA 4KEZA 1Z3NA 4R7JA 3T6CA 3UWEA 4NZ3A 2DW7A 1O4UA 3NDOA 4Q7BA 4F40A 3SQLA 2NQHA 5AC8A 3MHGA 4O10A 1VBRA 3K4DA 3OOQA 5ECVA 4Q4MA 4LAZA 2ZDSA 3RLGA 4GLEA 1TPC1 4G5DA 3NO1A 1SSGA 3MV01 2QDDA 5I3IA 1CGWA 3WSUA 4W88A 4XAFA 1Q2RA 2XIOA 1GEHA 4OHQA 1YDOA 4WZHA 2AGTA 2CXGA 1FWAC 1GUVA 3M5VA 4PTMA 4JKMA 3N2XA 4HYVA 1D3HA 1H1YA 2VCCA 4TTGA 4ZBCA 4LUTB 1TPFA 5BRBA 3LBCA 3CV1A 1NF7A 3QOMA 1XLFA 4WR3A 2DZTA 3V18A 4P8UA 4L80A 2X16A 4RLIA 3S2MA 1O5XA 1H2JA 1DWIM 5DX7A 1V3HA 2E6FA 3PPHA 1RQHA 5I03A 4UR8A 3L0KA 2Y1HA 2YZRA 1RBOB 1JEZA 4GI6A 3T1GA 1CGVA 2BB0A 3UG3A 1KR0A 4Z2LA 4R27A 2CLHA 3HV8A 4W93A 3SSJA 1GQJA 3U8GA 3URAA 2ZC8A 3CNYA 1EA0A 2DQWA 1MUMA 3MVTA 1KKRA 2WMKA 1XYCA 2OELA 3F5LA 1PDYA 1FQ0A 1HKJA 4OOUA 2VZVA 3NYDA 3BV7A 1TPUA 1W31A 3RHGA 1FTXA 1YBQB 3MCNA 4F48A 3URBA 4YYCA 4IXXA 2Z25A 2WCAA 3KL3A 3HF3A 1K9TA 4Q8QA 5AHEA 3LZ5A 5DXXA 1A47A 3FHAA 1XGZA 3QZEA 2Q8LA 2D1ZA 1CGTA 2ZZ7A 4ECLA 1QNVA 1JF6A 2VL4A 3GYEA 2FPVA 4HJFA 2Z7KA 4BZYA 4DQWA 3D0CA 3PZIA 2PLJA 3CQJA 3E2SA 2WM0A 3ELFA 4J3ZA 3NDYA 3RLVA 2VVSA 5LIKX 3WFAA 3PJUA 2X7WA 1EP1A 3G22A 3A5FA 4FNTA 5CPSA 2R14A 2EPLX 1PIFA 5ABGA 4D8ZA 1O5RA 1XCFA 2J4GA 3UQNA 1KCZA 1YDNA 1XLCA 2OZ8A 1ICSA 2E3ZA 1C8VA 2E8YA 2OOFA 1UD3A 1W1YA 3V75A 5AHIA 2QF8A 4POCA 4LRTA 4QLKA 3ZLGA 3TEVA 2ZKMX 1XX1A 1CLVA 1AQMA 1NF0A 2C16A 1XBVA 2VX4A 1OFPA 2WAGA 3PULA 4PSRA 1WZMA 3OBEA 4FIRA 6REQA 2G97A 4ZCWA 2RHGA 4GKLA 1G0CA 1YADA 2WZHA 3AHVA 3EX6A 4O0QA 1EDGA 5DELA 1OX5A 4ZQMA 2IMRA 2CHOA 3GNPA 1QATA 1V6WA 3GAYA 4JHOA 4QG9A 1OFRA 2CZVA 3AXMA 4UBPC 1SFSA 1B3VA 2Z1WA 3W01A 1TUXA 4F0RA 3LRLA 1XG4A 1PZ3A 4U28A 3AHYA 4B5SA 3LHUA 3VGHA 4L6OA 2VUYA 4CQAA 4DAFA 3UZ5A 1A5LC 1E6PA 2J7BA 1BWVA 1PSCA 3S1UA 3TQ0A 4AHPA 5FCZA 1RK5A 3SRFA 4QR6A 1PB0A 4HPNA 3R2GA 2ZXDA 1R2RA 3GVGA 2RKXA 1AH0A 2P5NA 4NZ4A 4JTTA 5D05A 5EL1A 3TLQA 2ZUUA 2Y2WA 2VC5A 4PUEA 5I5RA 1PZ2A 4NIRA 1EJVC 4DAIA 5HJYA 2Y70A 2X2GA 2GJPA 1OK6A 3GVWA 3KS5A 5FJOA 4JY8A 4JIRA 4IQLA 4RZ6A 4EAYA 2EXOA 3C8FA 5CSSA 1O5KA 4PTXA 1TWZA 4AZ5A 1V0MA 3E0IA 1TWDA 4XTIA 7XIMA 1VIWA 1UCWA 3FAWA 1SZEA 1HJQA 4N0RA 1OF6A 3Q94A 3VGGA 2E40A 1TZZA 4HBKA 3ME3A 1TIMA 3DU0A 1UR1A 1SJBA 2YB1A 2PU1A 4YXGA 6XIMA 5GNXA 1N55A 1F3EA 2WV8A 4TV5A 3WQ5A 3UNTA 3WL1A 2WM1A 4KWSA 4C1NB 2BGSA 2HVNA 1IHIA 2DIJA 1BVWA 4WUIA 2EPHA 4RPPA 4TU1A 3DYPA 3OPSA 2OU4A 5GNZA 3PG9A 4BFAA 4HNTA 1YE4A 4XIMA 3BCDA 3WLQA 3MP3A 4C90A 4EKJA 1EYEA 3IJDA 1F2JA 4WSHA 3H2NA 1D2KA 3DESA 3G8RA 2P53A 1XLBA 3BGJA 1T99A 4H41A 2EG8A 3EXSA 2POTA 3VIGA 1X1OA 4ZO6A 2YDAA 4GO8A 4QQ3A 4L9XA 1FCBA 3W02A 5DBUA 3GAKA 2CZDA 2OCZA 4JFTA 4JS3A 4EK7A 3BXWA 2J8GA 3TCEA 5I79A 3PPFA 2DP3A 3TW7A 2FZ9A 2QV4A 4WKHA 5FACA 5D02A 2R91A 1OY0A 1TA3A 2Y5EA 1KNWA 4C6MA 3VIFA 3PK7A 2PDGA 3W87A 2D3NA 2BODX 3UXAA 5M03A 1V02E 2AMXA 2JE8A 2RJHA 4INFA 3P0WA 3EX1A 2CLOA 4GYPC 3VIPA 4MNLA 2INFA 4NZCA 4WDUA 4ZL1A 2Z26A 1GOIA 3WUBA 3OZYA 5JVLA 3O9NA 4PB5A 5E1QA 2Q71A 4EPEC 2CKSA 4LBUA 3A9IA 2R1NA 1GOQA 8XIMA 3LI1A 3B05A 3N15A 4HD5A 1LRQA 4DO5A 2W0UA 5A2BA 2GSJA 1E3ZA 1DKWA 3MO4A 3EPMA 1Q45A 3UFYA 1OSEA 1LBMA 1R47A 4ZODA 3PJTA 1HL9A 7PTDA 4AZGA 1RPKA 4FX8A 1OB0A 1UHVA 2YCLB 4RV8A 1R7OA 3QV7A 4MGGA 4E38A 5C9RA 3CUJA 1KFBA 1W2VA 1UZDA 2Z1KA 3JVAA 4PMNA 1XP3A 4I7UA 1WDPA 5AYXA 2WJDA 2FTYA 2OX4A 4Q4RA 3UF9A 2PS2A 3NQDA 1UR3M 3QC3A 1J0KA 1S2WA 2QDGA 4Q22A 3NVDA 1HF6A 1OFBA 4PB4A 5T8GA 6CGTA 4NKCA 5CZTA 1FHLA 3EWCA 2Q3RA 1OF8A 3RLUA 2VEFA 3G6LA 2V69A 2NQLA 4XZIA 1OIMA 4H9ZA 4R88A 2XN2A 4FLQA 4JEJA 1ONWA 3PG8A 4LUYA 1A4LA 1EJTC 1QDSA 4FZIA 1B9ZA 3BAXA 3HBLA 1M53A 3ZZ1A 4RUBA 4WF7A 1QWKA 1CLKA 3LX9A 1PO9A 3G1AA 1SUXA 1A0CA 4N42A 3T2QA 1NY1A 5T9BG 2A6NA 4FLSA 1DIDA 1H7OA 3O15A 3APGA 1IZJA 5CC3A 2C19A 3SQSA 1K6AA 2I5IA 1TPDA 6PTDA 3EGJA 4DZAA 3NZRA 2WHKA 3LU2A 4JNMA 1KXQA 2WNWA 1BD0A 4NT0A 3RG6A 1ITCA 3R4IA 4HPHA 3GU1A 3V1HA 1NAL1 2PP3A 2F8QA 5FJIA 4D8AA 3SW6A 3V7PA 3KHDA 1UIOA 3KTCA 5BXRA 2PC8A 2QIWA 2YXGA 3D3AA 3FLUA 3B9EA 3OQEA 4NNAA 2J88A 2YBTA 3RLHA 5M1TA 3P82A 4HCDA 1CNVA 3RITA 4O54A 4HTBA 5G2WA 3UJRA 2D3LA 1KXHA 3HOJA 3B0VC 1RD5A 1MUCA 4XZMX 2HQAA 5HQEA 1P1MA 4YTTA 1JRBA 3P0XA 1CXHA 3SUWA 2PTZA 5MKGA 3PJWA 2YL5A 4F2BA 4PFMA 3V3WA 4LGXA 2O55A 1OYAA 3FKRA 4AVFA 4LNYA 3K4AA 1WUEA 1OGGA 2I17A 3PBVA 4B3LA 1ELSA 3TCSA 4AIOA 5U7SA 1AA1B 4JHZA 5FF2A 4PMUA 1OGBA 2GDUA 2WJZA 5A3HA 4H4IA 1QPKA 5AYZA 5FSEC 3O7UA 2FZNA 3T8LA 4REQA 3UPWA 5HWJA 1T40A 3G18A 1VIZA 3WLMA 1UC5A 3QLLA 4MOZA 4BA0A 2BVDA 3G1YA 1UP2A 5LNRA 3FGCA 1KW1A 2RDTA 1QK2A 5F2LA 2G5WA 2FVMA 4UQDA 4DLFA 4AYGA 1K9DA 4HVXA 2PDWA 4LXFA 2R1MA 2GLKA 1K8ZA 4NUWA 3TSDA 4EANA 1ODZA 3LMZA 3O0FA 3TP4A 4M80A 4N9DA 1EWDA 1YX1A 4GD0A 3PJXA 1VEOA 1ZCCA 2R6OA 1QPOA 1W17A 1DJNA 3GUWA 5LNVA 5D2WA 1Q4NX 4IOTA 2PTWA 2PCQA 2DY3A 2GQ3A 1JVNA 1TJ0A 3SFKA 3IVTA 4KIEA 1HJSA 3W9ZA 4GUIA 3VD4A 1Q5MA 3CWOX 3T2PA 3TOYA 3BAJA 4NZ5A 4AB4A 1E1EA 1F7BA 1US3A 1X7FA 2Z1VA 2V2HA 2DVXA 4PEEA 4KGLA 5HNTA 2QQ6A 1R3RA 3PS7A 1ZP3A 1J9YA 2W27A 1WB0A 2ALDA 3WLKX 1GW1A 3NO5A 5FAJA 5FD0A 1E5NA 1EJWC 4H8VA 4W8LA 4AXNA 2Y62A 3LBOA 2R24A 1J6PA 1VFHA 2A6LA 4K6AA 1QI4A 2QDHA 3VIIA 3E2VA 3H7UA 4WY0F 4GH3A 4Y9MA 2ZX5A 4JDBA 1Z32X 1V3LA 3RJXA 4CVUA 4U5KA 5I06A 4GA8A 3EPOA 4S3CA 1W8SA 4CD8A 5HR7A 2FHBA 2HJPA 3BCFA 4IMEA 3R11A 4PMOA 4RKAA 4KERA 4WVXA 3LMYA 1R3TA 5D30A 2PWUA 5FEXA 4H3DA 4P7LA 2Y8KA 3LNMA 3F2BA 1HG3A 3BE7A 4AZBA 4PMRA 4MF4A 1WBHA 3ZJ6A 1WDWA 1KQZA 2Z6JA 2IQ0A 2HPMA 1BTMA 1QT1A 2HWGA 3H53A 3SUUA 3E9AA 2QJJA 3L2IA 1FHUA 3FDKA 1PZ0A 2XIIA 3N4AA 2ZX9A 1RJRA 1Q13A 3L66A 4BI5A 1WUFA 1VJZA 1OIFA 3ARXA 1XIBA 4AX6A 4S39A 2PDQA 4A3UA 4ML4A 4MB3A 2PBOA 1Y5WA 5LXEA 4S3FA 3S5OA 1UMLA 1E73M 1M6JA 1VRDA 2PWHA 5IFPA 3ENLA 2EG7A 2D0FA 4GUFA 5ABFB 3KL0A 3RPMA 2CWXA 3PAJA 3UVIA 1OFEA 3WD4A 4EXBA 3M0YA 3S1XA 4CNUA 3UGVA 2BXYA 1L6SA 4QX4A 2NQ5A 4REQB 2ISVA 3R43A 5I3DA 2WJFA 1AW1A 3GR7A 4MYAA 3RCYA 3EBVA 1R2SA 3GDLA 3W07A 4GVHA 4IG2B 1W5OA 1VQTA 3RIKA 3KVJA 5G5IA 2C1GA 5J5DA 3NSMA 4B5NA 2BY3A 3FGCB 3THQA 5LSMA 2XWDA 4GJJA 1PCWA 1B54A 2PUZA 1POJA 1KO0A 3PBYA 1QFEA 3OEXA 4Q7NA 1SJDA 3BGGA 3NPVA 1NSJA 1DHKA 1XINA 1A0DA 1FY6A 4H83A 1VBHA 4N4QA 2YDSA 5HJLA 3TDFA 2AL2A 2WHJA 4R34A 3CB8A 2JKAA 4J3VA 2E6AA 2GQ8A 4JR5A 5A6LA 1JDFA 1EJXC 3CYVA 1P43A 3S8HA 2PDNA 4Z1CA 4PUKA 2NWRA 1UIPA 4PSPA 3S83A 4BF9A 1V3IA 5I78A 5G4EA 1U1UA 2JGQA 4LAOA 1R3SA 2VR2A 3RMEA 2EF9A 5IBXA 1XQKA 4FAMA 3IIXA 4UUIA 3NQ7A 4MHBA 1JI2A 3CZGA 1NELA 5ECUA 2ZZ4A 2WZIA 4AZIA 1DWJM 1RK6A 2EKGA 4Y90A 4UTUA 3F1QA 4XZBA 2DSZA 2HRWA 2XISA 1K03A 5DMMA 4MNKA 3VE9A 1YEYA 2D2OA 4GIRA 3EWXA 1SJAA 4G1NA 1PDZA 2ZXAA 2OR2A 4DJFA 1LOLA 4O50A 1E0TA 4AZ6A 2VMFA 3M0LA 3R10A 3N4FA 3N6JA 2W3ZA 4O4WA 3N25A 2Y7EA 4AEFA 4HOWA 3IIPA 4O1EA 1E4MM 3A22A 1EZ2A 1R9XA 4BCEA 3WBWA 3ES7A 3LXCA 3JS3A 1A4MA 3MS8A 1JUKA 2XDFA 1IGSA 3ARRA 4XZHA 2VT0A 2HK1A 3KBNA 4H19A 2C0HA 5HWMA 4LUIA 4A35A 2R94A 1Q6GA 3ARUA 3SURA 3TQPA 3W82A 4MJ4A 2OXNA 4U33A 2EEXA 4AD1A 1Y8BA 3AIUA 1ALDA 4IICA 4NHVA 3WQGA 1XS2A 3BH4A 5KMYA 3SN4A 1QCWA 3LTPA 3PPCA 4DB7A 2EPMX 4WY0B 3TOPA 4B92A 1GKQA 3MP4A 1MEIA 3SGZA 1UKQA 1MXSA 1PHWA 2WZEA 4ZTXA 3C0LA 4HK5A 3FJ6A 4OE7A 2QHAA 1JXKA 4GZJA 1JYWA 1LLOA 4AD2A 1W3JA 4CCEA 3STGA 2HROA 2QUNA 1BKHA 3NL5A 4M29A 2ONEA 3CQIA 4Q32A 4EF9A 1I0BA 1Z42A 1LT7A 3M5YA 3AXIA 1ITUA 4Q6XA 4XAGA 2IPJA 1I2RA 1P48A 3AUOA 2J79A 1IEVA 3BK0A 3S6TA 3MPGA 3GTHA 8CGTA 4HNUA 4WJEA 1C8XA 1VPXA 3AWOA 3PUDA 4AZCA 3RM9A 1E43A 1KCLA 5FI8A 5AVHA 4UOQA 4UTMA 4RV3A 1C92A 3AXXA 4AF0B 4C6BA 1Z9AA 2BY0A 1H0GA 3K46A 1TQJA 4PBFA 2A4AA 3CMJA 3AIBA 3QYSA 3W28A 4DIAA 5EMYA 2VGGA 1OFAA 1ITQA 4MY1A 2ZZ6A 3P80A 1XCXA 2PDJA 4QROA 1TRIA 5FSDC 1JI1A 3VNKA 1LM1A 1Z89A 4CGTA 3KRUA 3DBNA 4JTGA 4JIQA 2YW4A 3DENA 2YYTA 3QH2A 3LCHA 2GJXB 1HT6A 4MAZA 3TFCA 1B3XA 3L21A 1PWMA 2PP1A 4DUOA 4NSBA 4NG3A 3FX4A 3UT0A 2H9AA 3V35A 4GUJA 3CZKA 1V03A 3C2OA 4GYJA 2ACRA 3WNKA 1XYBA 3OO2A 8TIMA 1K8YA 2G96A 1VFUA 3DUGA 1ENUA 2WPGA 3NDZA 3ATYA 3LPPA 2VR4A 3WF3A 1R3QA 3PM6A 4GFIA 3KDOA 3PBMA 5HNNA 1JCTA 4GKTA 2VDGA 4IPPA 4KRUA 3N34A 4LAUA 2D2GA 2QW5A 4ADUA 2CIPA 4O15A 3QC0A 3WQWA 4IGSA 2I56A 1OCNA 5DBTA 3QQWA 3CMFA 2XVLA 3GRIA 1X96A 3BLIA 3DFTA 3BJSA 4GGBA 4W7VA 1FXQA 1O5QA 2ZDRA 3L9CA 3DI0A 4GXPA 5EB8A 4DPQA 1Q6RA 1TWSA 1V4YA 3CS2A 3AUJA 4ZVJA 1AW5A 1EFZA 4HB7A 2I5QA 3ONBA 5CG7A 1D7FA 3LQGA 2NX3A 2AOSA 1ZJAA 3HGJA 3N9SA 4X22A 1XLEA 4TVCA 1R9ZA 3LZ3A 5DMYA 3CIXA 1EIBA 1XV8A 2X1UA 1B4EA 5LA1A 1OADA 4U3CA 3CYJA 3W23A 3W2MA 5EFDA 5I07A 1XKJA 5CPTA 1G9HA 3UG5A 4HMEA 5C6MA 4QISA 1XIFA 3SR7A 3UXDA 3ITVA 1MWOA 4L4LA 2XGBA 2BMBA 1ISVA 1MEHA 1RQBA 4YLWA 3W7CA 5LHEA 4H7ZA 1VFTA 3GZ3A 1HL8A 1JXJA 4X9SA 3V0SA 4Q4OA 1X6NA 1W9XA 2CESA 1K77A 3VO0A 3SBFA 4DUWA 1PJ9A 3M16A 4IJRA 2ZICA 5TBOA 4NILA 4U2ZA 2HK0A 1WXJA 2BWGA 2ZWZA 4ZE4A 3VKKA 4XAPA 3QKZA 4FI4A 3BC9A 1O12A 2PGEA 2C7FA 3G1VA 3WJXA 5BCAA 4PRRA 2QUTA 4MKVA 2QV5A 3USBA 1MUWA 3DERA 3AJXA 4XUGA 4R85A 1P0DA 2D24A 1W37A 3S2CA 3WIJA 3BUVA 1IWPA 3SCNA 1ZB5A 2MANA 5A1AA 4NYUA 2VFGA 1R3WA 1QU4A 3S5ZA 3FKKA 3W7MA 1AQ0A 1JZ3A 3GDBA 1CXEA 1FKXA 3W81A 3HG4A 3PNUA 3KWSA 3NG3A 1YNPA 2PC4A 3OVQA 3HB9A 3CLMA 2J78A 3OLDA 3G5EA 2UBPC 2NV9A 4QRNA 3WUFA 4US5D 1EOKA 3P84A 2OFJA 5E0FA 1U33A 3V16A 4O1CA 3NOYA 1P0NA 3MCMA 3WLJA 3U4AA 1XC6A 3L0GA 1JG9A 1NM9A 3T2OA 3L2LA 3GSMA 3ZJKA 1UYQA 3I7QA 3QMRA 3B8DA 2WB5A 4U31A 3VDHA 3PBWA 3OW1A 3H4GA 2ZIDA 5DQPA 1VCFA 5CPOA 1IYXA 1SO3A 2VRQA 4NJHA 3GXDA 2XZ7A 4QE1A 2BHYA 4QLJA 1GCYA 1UZ4A 1I2OA 2TSYA 3OGSA 2KZHA 3AS3A 4H8UA 8RUCA 2Y5SA 1ZRQA 4GQGA 2J62A 4IFKB 5HINA 4W8BA 3VDBA 3BSMA 2PP0A 4MAVA 5D32A 3P60A 1GVYA 4XVDA 3MHFA 4JFUA 1SU5A 2Z6IA 3WF2A 5T9CE 5I00A 4AD5A 2YA0A 4JTRA 3WBYA 3FN9A 4B3KA 1F76A 3CHCA 3KTXA 3CC1A 2ODOA 2HMCA 2VM8A 2A3HA 4MM1A 3BSGA 2REQA 3RMJA 4XZNX 3CQHA 3C0SA 4GYKA 2HTMA 2FJUB 3GWQA 3ITOA 2JGYA 3W71A 3WNLA 1W9PA 3WJWA 3C3UA 1VBGA 4KEVA 3HURA 4E8GA 1BQCA 1BAGA 3QY6A 4KKXA 4W87A 3RRXA 4J3UA 1CWYA 4XV0A 4YPJA 4R7OA 3OGRA 5E93A 5D03A 1TA3B 3O06A 3C2YA 4GNVA 4IMAA 4AU0A 4UXDA 2DSKA 1FP8A 4DHGA 3LB0A 3QR0A 3ABOA 3VOIA 4OUEA 1P6CA 5F2IA 4DY1A 1EUAA 4FR6A 1KTBA 2RFGA 1GWJA 4JTKA 2TMDA 3PZ9A 4JL2A 1W3LA 3GH4A 1US2A 2WC7A 2PZ0A 5D9PA 4IMFA 5FEZA 3NR0A 3WDHA 4I5XA 2E8ZA 3WH5A 4JOMA 1XIIA 1G1YA 5H91A 5EYWA 3R8GA 1KFCA 1SGJA 3VNZA 3M0IA 3O05A 2VD8A 2TRSA 1XYMA 3P2VA 3B9DA 3MCOA 3EOOA 4LCQA 1V93A 4UQBA 3TFXA 3CO4A 3K5XA 1NP2A 1E9IA 1FCQA 4Q33A 3VNIA 3HFTA 1XH2A 2GK1A 2QCDB 4LW7A 4LX4A 1J0HA 1R6WA 4C6PA 2V3EA 1MO0A 3QV6A 4GNKB 4CD6A 3L4WA 3CHFA 2YCLA 1EL3A 3FOKA 1SMAA 5FESA 3QR3A 4KF1A 1JYVA 3ZXWA 2ZRUA 2YDRA 2E5BA 4CUCA 1J79A 3NQ2A 4H9UA 1HKVA 4TQTA 2G3NA 1H7PA 1NWTA 2V6AA 5CC7A 2E4TA 3OJGA 3RR1A 3FA3A 5HXMA 3EWDA 2MNRA 1KXVA 3TC3A 2P3EA 2VZUA 2CBJA 1KBIA 2QMJA 3E1F1 1QHZA 2GGJA 4GZ7A 5IFTA 2J7GA 2E5DA 1UPPA 3FSTA 3S3GA 1RH9A 3JZEA 5J8LA 1CXKA 3H54A 4MMWA 2NT1A 5HOSA 4C6LA 3HPFA 3EWZA 4J7RA 4B5UA 1HKIA 3MZNA 1PE1A 5JU6A 4S23A 3AI0A 3HU7A 2QCHA 4H6RA 4WKAA 3GW0A 1KM4A 3PF3A 1XLAA 4JX6A 2DDXA 3GD6A 5FAGA 2BP1A 1I2PA 2FVLA 5A6AA 2J27A 1HUVA 3TYEA 1B90A 4IHCA 3OA5A 5XIMA 3AYRA 5PTDA 4UTIA 3M0KA 4N2YA 4MVAA 3TN4A 1GOWA 4O1AA 3BLFA 3TZFA 3IRDA 4LYRA 2OLSA 4PUJA 2WSKA 3UXLA 2TYSA 4P7OA 1MQRA 3ZO9A 1VHCA 4DJED 1IIGA 4DJDA 1BLIA 2PTYA 1AK5A 3DHFA 1DEDA 4MDPA 3IS4A 1GZJA 1HW6A 1XGDA 1LYXA 3PZVA 3RXZA 4BWLC 3B97A 4RZ4A 5I3FA 5GPRA 2YCEA 4JL1A 5TIMA 4Y8FA 4GVIA 1M9HA 4P7RA 1K4HA 2WHMA 1UA7A 4YVXA 3LD5A 1AW2A 2E1DA 2QUMA 2ZFAA 2E0PA 3CIVA 4CCCA 4LPCA 2FB2A 2QCLA 2H8XA 1W9BM 1OD8A 2PDFA 5C9XA 3A4JA 4PGLA 1EJSC 1U5VA 2HNEA 2XGZA 5EU9A 4IGNA 1DYSA 1E56A 4F0KA 3QV9A 1M65A 1RCXB 2INZA 1PX4A 5EBAA 1E6NA 4UQCA 3WLIA 1BWKA 4IH3A 5CZ0A 1QAPA 4B3ZA 1H49A 3QXBA 2NX9A 3PWGA 2XN0A 3GZAA 1G4SA 1J0JA 3P5ZA 2CW6A 4N4PA 4PMYA 1MMFA 5KZEA 3IGHX 1QW8A 1EC8A 2ZUVA 3MUIA 3OZOA 3TSMA 1G4EA 4WIWA 2ZXBA 4E8CA 5HK4A 3WQ4A 3TX9A 1UR2A 1VEMA 4D6IA 1ICQA 2PRLA 3DFHA 1XLHA 4Z0SA 3RF9A 3F5KA 3VKBA 2W5FA 3HG5A 1C7TA 1LG2A 1YIXA 3LN3A 1XR2A 2HXTA 3PTQA 3GHUA 1BSIA 1HJXA 1G5AA 2XYLA 3KCJA 1B0IA 4XAZA 2IQTA 4PMVA 4ZQPA 4YCOA 1DVJA 4M5PA 3QF0A 4H9MA 5JQ9A 4LT9A 3QHOA 5ABTA 4NQ1A 3CAQA 4HU4A 3VCRA 4JXCA 4FSAA 3TYDA 1JCXA 4CNPA 1SQ7A 2X1SA 3L5LA 1VPQA 2E6YA 1U2YA 2IXVA 3ORWA 2EKCA 4DUVA 4DYEA 3KRSA 3NXLA 4O13A 3IGSA 1BVNP 1UD8A 1XYFA 3VCNA 4JICA 5D2VA 3RRAA 1C8QA 4XQ6A 5BW6A 4JPGA 1AUSL 5EY5A 4C60A 4F9DA 3SRDA 3A5VA 2NW0A 3BDKA 3S4TA 3BMVA 5BRQA 1YDYA 3HMJG 1H60A 2XHYA 3BW2A 1RPXA 4AY1A 1Z44A 4NP7A 1HZYA 2GSHA 2I14A 2PD9A 1Q6CA 3KEHA 1HJWA 4KWOA 4PUMA 1LL7A 1KR1A 4IGMA 3ZSTA 4BQ3A 2UV8G 4W89A 1ZTVA 1I1WA 2VQUA 1W9UA 3VMPA 4AWEA 2YCJA 2JEPA 2TPSA 3BLLA 1MZHA 4C1KA 5D33A 3N2BA 2G4FA 1FWTA 2J24A 1UWQA 2POZA 4FS9A 1E0WA 1R8LA 3VTRA 1S2CA 3LYEA 2NQZA 3S5YA 4QJ4B 2D2JA 3SFWA 4RE2A 4CVWA 4TOQA 4CN1A 3ZJ7A 2Z2AA 3LPGA 1SZGA 1YPXA 4YN5A 4DF0A 3ARQA 4JTFA 1G01A 1OT2A 3GM8A 4EWND 4J9JA 2BG5A 1IXPA 4DPPA 1L0PA 4HU3A 3W1UA 2ZZ2A 4ICCX 1ECEA 3EDEA 3L67A 3U5YA 3S9YA 1ZJIA 1E40A 3CEPA 1ZBVA 5K7JA 2REQB 2PWFA 1E6ZA 1D3GA 3IJQA 5DANA 1R38A 4OWGA 4CQ8A 2QPXA 2DSWA 3IAPA 5DFAA 1QNPA 2IQDA 3GFZA 5A8NA 3GQYA 3VIMA 4PEKA 2PF8A 3W83A 4JYDA 3PTDA 3UPMA 1XSJA 4JQ4A 1B57A 2BTMA 1IWAA 3HO8A 2G3IA 3I65A 2Z2UA 4GXWA 3O3RA 3S42A 4Z17A 4OFCA 3T0DA 3LA4A 1W91A 2PFHA 4I6VA 3ANYA 5FA5A 3AYSA 4FB7A 4B15A 1VAHA 2WJEA 3L68A 1SO5A 1PVNA 2CEQA 4ZB0A 3WEMA 2ATMA 2ZQ0A 2C0AA 3BGAA 4Q8WA 3UWUA 1VKFA 3RX4A 1H7WA 3VC6A 1ZGDA 1PWLA 2ISWA 1FWWA 2Y61A 4Q8TA 3F7JA 5AYIA 2E9MA 3KE0A 3WZ0E 1LROA 3NPUA 2FQIA 2PTDA 2SFPA 1HQTA 5AZ0A 1TV7A 2INEA 1R7AA 2BDQA 4RNIA 2DGAA 2V2CA 1F6PA 4E4FA 2E9LA 3PBGA 1A49A 3ARTA 3ERPA 3H8AA 1XIDA 2FMOA 5JMUA 1X97A 5KZDA 4HZMA 1RALA 5DLCA 4Q8OA 3V4BA 3M7WA 1WYIA 3CL6A 1YBQA 2GYIA 2GK1B 2R1PA 2Q02A 4E2BA 1GVIA 3UZJA 1JR1A 3G1FA 3Q67A 3VOJA 1JRCA 4KWUA 2J7DA 3KBSA 2QCGA 1S5NA 4O14A 4GE8A 5HNRA 1JPIA 1JAKA 4FPSA 4E6MA 3RCMA 2BXVA 1G4PA 4NAEA 1TUFA 1EP2A 1F9CA 3CO8A 5LNSA 3VNYA 2OSXA 1O1HA 3W1QA 3UEQA 1KB3A 3CHVA 4O18A 1E9LA 1TR9A 3EDDA 3NQGA 3HPZA 5DO8A 4GZEA 3C0JA 2Y6ZA 3TKFA 4GINA 1K1DA 2VZSA 2Z1BA 3WF1A 3CHEA 4F0SA 1V6VA 5AHNA 5CAKA 1JPDX 3QPEA 3EYPA 4M24A 3E12A 3KOZA 4QSFA 5M5DA 3WMSA 5A6BD 5KZMA 1XUUA 2XU2A 1RSCA 3WDQA 2AQWA 1HP4A 2VI0A 1O1ZA 2OWXA 3BICA 1E6RA 1V02A 2MUCA 4M3PA 3IGUA 4S2CA 3N19B 2X09A 2QAPA 1P0KA 1MYRA 1MQQA 1Q85A 4ZSUA 1O95A 1TMQA 5IOBA 4W5UA 4XBSA 1E71M 1YPFA 3MSYA 3JW7A 5A95A 4Q4KA 3CU2A 2GJLA 2BGNE 5DMNA 4PUDA 1R3YA 5H8UA 1JQVA 3WLOA 3GC2A 1QPQA 2VGIA 4J2MA 5EMMA 4Z0JA 1MW3A 1L2UA 2EPOA 1FP9A 4RR4A 1V08A 4EWJA 3N3MA 3UWZA 4X0VA 2VGBA 3STCA 1ML1A 3UY7A 2I7GA 3WCZA 1NQKA 2QR6A 2P1FA 9CGTA 1SPQA 1DIOA 2FH6A 1G69A 1M04A 2VO5A 2J8FA 4R5EA 4JQ1A 2J13A 3E2QA 3NPXA 4C7GA 2X41A 1EF2A 4MWAC 2ZVIA 3G24A 4O12A 1J4EA 4YVPA 4JCMA 4KIRA 1HVQA 1VJIA 1OX4B 1WDSA 2C91A 1ME8A 4DZ5A 3TR9A 3TW9A 4E2DA 2F6XA 3G2GA 4F0LA 2BASA 5IM51 4JHMA 5C5YA 2VZTA 5CAHA 4GWEA 4D1IA 1KFEA 4JYEA 4J3WA 1EJRC 1AZ1A 3SCWA 1T8XA 5F2GA 1EQPA 4C6DA 1T6MA 4MY9A 3UJEA 3NOEA 3ARVA 3B4UA 3QGAC 2J25A 5DRIA 1E0XA 4GCXA 4LCSA 3GUGA 1V79A 2XVPA 4CQ9A 3VZXA 4X3ZA 1HX0A 3CTLA 1LL4A 5M2FX 1SW0A 4M6VA 4ZA0A 1IXOA 2J6VA 5BROA 4YYFA 5TAOA 3IJ6A 2VYOA 5DRCA 3XINA 3TWAA 3TV8A 2UZ9A 4JIIX 2FZ8A 4NY2A 3M6YA 5F4XA 1H63A 3A4XA 2V9DA 1E72M 4IXHA 3B06A 4WGHA 3KRZA 5A5WA 1LDCA 4IL0A 4IGHA 3UETA 3GW3A 4GI8A 5REQA 1N8FA 3A3WA 1JJKA 3D47A 4XKYA 2OEJA 1WQ5A 4EE9A 3GC5A 3M41A 3VIJA 1F74A 4DBUA 2EPKX 1QTWA 3M0HA 4UQEA 2WWCA 5LKYA 5B7YA 1UC4A 2ICSA 1YXDA 1E9ZB 4X2PA 2QULA 3V0UA 1JYXA 3CJPA 1AJZA 4NZFA 2O56A 1ZU8A 1XD1A 4PUUA 5HMDA 4MKNA 4GQ0A 2VEGA 2FPYA 3FA5A 1FWSA 2ZCGA 3AIVA 4MADA 4CCDA 1GJUA 1IR2A 3NXFA 1LBFA 3W1XA 1PXGA 2O92A 5BYWA 7TIMA 2IPGA 1B5TA 4FF7A 2H90A 4ONVA 1ZAHA 3WH6A 4NAFA 4UTWA 4I9TA 3V5FA 3MWAA 4JN8A 5I0DA 1ME7A 1NVMA 3NQAA 2BFGA 5FF4A 3DBPA 3AHZA 3VKDA 4LH8A 3PPGA 2FGZA 3QOKA 5C9UA 5CLTA 2DSVA 3B8TA 3GG7A 3H23A 5E70A 2GJRA 1W8GA 2FGBA 1VFOA 1K8XA 1XYAA 4EPKA 4DELA 2QGHA 2FIQA 1QBAA 2Y0FA 2IPFA 5BU6A 4UIOA 1UG6A 1E9YB 2EPNA 3UJ2A 4MZYA 1FWIC 2VX5A 4IQDA 4JIEA 4BEUA 1KV8A 2PPGA 5HUPA 3VD7A 2RDXA 4BHYA 3KS6A 1AZ2A 4QG6A 3MUAA 4DJDD 3C5QA 1DTNA 2PTXA 4XBJA 4M1BA 2VFEA 4A8LA 4C7DA 4AC1X 1M01A 1UJQA 1UWTA 1L9WA 2WO5A 2OWCA 1DWHM 3LTSA 1UB3A 3A6OA 1GYNA 1E6XM 1RBLA 1REQB 4BY3A 4WCJA 1VRXA 4PH6A 3STFA 3S1GA 2H3BA 1ZY9A 3AZTA 3CLWA 3VD5A 5CC6A 5F4WA 4D6JA 3TH6A 1JZ2A 7CGTA 2E28A 4H8HA 3FEQA 3W6MA 1GK8A 5F2MA 1C29A 3GDRA 1KRCC 2ZE3A 5CPMA 3B4YA 3RPTA 2YCKX 3SCQA 4XB3A 3WD0A 3K1GA 3KZPA 4K8HA 1Q6LA 4S3GA 3UBPC 1CDGA 3PVFA 1TVNA 3W6LA 4OVXA 1AJ0A 1QBBA 2YL9A 3FW6A 4KRTA 3WLTA 6A3HA 3W7LA 1KTCA 4QS6A 4LC6A 3DDMA 1C3FA 1TMLA 1PX3A 3DX5A 1KRAC 4M19A 4D8LA 1BYBA 4QHRA 3OZMA 4TTUA 5D8ZA 5ABHA 3W4RA 3NL3A 3RCNA 4JTHA 1R30A 4AW7A 4AZCB 3PB2A 1EBHA 5HPCA 4YHGA 2PSNA 3WQVA 4ZGYA 2QKFA 4AYSA 2HBXA 3BWWA 1DHPA 3MHUA 1SZFA 3ITXA 1V7YA 4JEQA 1FWEC 5HPOA 2V5JA 2ZUSA 4U2YA 4XSLA 1CEOA 4TVDA 4UCGA 4P5UA 3TROA 4IG2A 5A2CA 2YA2A 3NL6A 2OYLA 4Y6GA 2QCEA 4RE4A 2WSRA 4MUZA 3TTQA 1RHCA 5M17A 3HM7A 1TR1A 2FPTA 1C91A 5LXXA 3QM3A 5JIPA 1TZ7A 3B8WA 4MDOA 5HNUA 4C6EA 3IJ7A 3W76A 2PURA 1TCMA 3N2TA 1V77A 1AL8A 1DOSA 1C7SA 5DT5A 1EHNA 7A3HA 1PHQA 2QJMA 4E3VA 1W5MA 4QNEA 2ZTKA 3L4XA 2FLIA 2ZZ3A 4WQ6A 5A6KA 1OG6A 1WCGA 4JFVA 5CGTA 4M6PA 4NJIA 1EXPA 3NCOA 4EIVA 2W92A 4HK6A 2ESCA 5AOUA 5DT7A 3HN3A 4EP8C 4XD5A 1H7RA 1XF0A 3C61A 3ALFA 3S47A 1TVPA 3LRMA 1SFJA 3JRKA 1ECQA 3WF0A 1KGXA 4LUSB 3W7NA 2PA6A 4C5ZA 4ZOAA 2FHFA 1NOUA 3CWHA 3GTNA 2WC3A 3GG8A 2PGRA 2Z00A 2XSAA 3QMTA 4V28A 3LHVA 4AVNA 3FYOA 5EPDA 2PGWA 4CN6A 2B7OA 3ALGA 2YZ5A 1U30A 4YTQA 1JUBA 3KCOA 2PDBA 3W37A 2DIEA 1SW3A 5EMJA 5T26A 4MPQA 2HE8A 1ZCOA 4A8NA 1J0YA 1OVDA 1X8FA 3M0ZA