5EPDA

Crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
361
structure length
348
Chain Sequence
TLFQPTSLGAITLANRIVMAPLTRNRAGAGFVPGELTAGYYAQRASAGLIISEATQISQQGQGYQDTPGIYTQAQIDGWKKVTAAVHKKGGRIVLQLWHVGRISHVNLQPNGGAPVAPSAIRAEVKTFVNNGFVDVSEPRALELEELAGIVDDFRKAAANSIEAGFDGVEVHGANGYLLEQFAKDGANMRTDTYGGSVENRARLMLEVTAAVAQEIGPERTGIRISPVSPANGISCSDPQTQYDYIVDKLDALGIAYIHVVEPFDYGSLRRRFSRTYIANDLELATSHLADGRADLIAFGRPFIANPDLVERLQSGAPLAEVNAAKIFGGSAAGYTDYPRFSETTSDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerol trinitrate reductase
publication title The crystal structure of XdpB, the bacterial old yellow enzyme, in an FMN-free form.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Oxidorecctase
total genus 125
structure length 348
sequence length 361
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5epdA00
3EWWA 5A8GA 4BK9A 4RV8A 3VE7A 1FX6A 4NX0A 3OG3A 1NVMA 1KM3A 4HIBA 3TC7A 4MYXA 3A24A 4N4QA 5EMUA 3S42A 2JBMA 4P61A 4UCGA 4OGZA 5CSRA 1DORA 2FJKA 3NL3A 4EF9A 3QJAA 1QDSA 2Y7FA 3HPSA 3B0PA 2X1RA 1I8JA 5D2YA 3HG2A 2QAFA 1DJQA 3NQGA 1ZNNA 4LS2A 4YCOA 1FXQA 2Q8LA 4GRSA 3IIZA 3W3OA 3VKJA 2CW6A 1VCVA 2YYTA 1X7FA 3TK7A 2GPTA 3P82A 4MKNA 5FEZA 4PCFA 1FDJA 2J27A 4MZ1A 3RLUA 3UXAA 1GWJA 1W5PA 1W5NA 4X22A 5E93A 3ZR4A 5A5WA 3P74A 5DCDA 3EWUA 1JCYA 4UTJA 4M5PA 1SW3A 5LNRA 4E2DA 1KFLA 3E12A 4IJBA 1VZWA 1XI3A 6TIMA 1TPWA 3RK8A 3TQKA 2VFHA 4NNAA 3W73A 4BWLC 1YPIA 1XL9A 4NJGA 3LI1A 1GG0A 3RNDA 3R89A 1DHPA 1I2NA 4B5NA 2B7NA 2RKXA 1XC4A 2J88A 3STEA 1Q6RA 1VC4A 2ZZ5A 4RZ6A 4O50A 4P2VA 2ABAA 1B4KA 3W1RA 2Y62A 4JYFA 3OIXA 3IVUA 1OFDA 1MEWA 5CKSA 1Z42A 3UY8A 2JGQA 4O1CA 2VFDA 1TREA 2V30A 3DHFA 4Z0JA 3TCEA 2QEZA 2QUVA 3G1YA 3L66A 3BW4A 1LBMA 3MI3A 1GQNA 1TPVA 2R14A 2AGKA 4UIOA 3KX6A 4ZL1A 3SSJA 1HUVA 2P0OA 2WV8A 4TR9A 3S1XA 2I1OA 4O53A 5IBXC 3LHWA 1PCKA 3FFSA 4WD0A 4AF0A 1F76A 1ZAHA 3E0IA 3ABOA 5K2ZA 4YLWA 5I3KA 3FKRA 3RFAA 4LVDA 1ZAIA 1H1YA 3QW4B 1SFJA 2JKPA 3HGOA 3IGSA 4JTJA 3M5ZA 1UUOA 5J5RA 3P5ZA 3A9IA 5DXYA 1KM1A 5FEXA 3QZEA 1WOBA 3U6WA 4QAIA 3GK0A 2ISWA 2IQTA 2PC4A 3NGJA 4UTKA 1KFJA 3W7CA 1AW2A 5FEPA 4A21A 3NPUA 1G69A 3TSBA 4JTKA 3MYOA 2QCHA 5TIMA 4ICNA 3LCGA 1LCOA 2C1HA 5K9DA 2VEPA 3I6RA 5I3JA 4UFJA 5SWUA 1M6JA 3G1SA 3TA6A 3NG3A 3MJYA 3R8RA 3M9YA 3NM3A 3LXAA 1F7BA 1W0MA 3KVJA 3GZ3A 3BG5A 1FWRA 5E1QA 1LOLA 3A22A 1BEUA 2C19A 1UB3A 1JUBA 1R47A 5D09A 5D03A 2NUYA 1YDVA 3LOTA 4Z08A 1KA9F 3P7YA 1LROA 5C2XA 1TTJA 4ORIA 3F03K 4AF0B 3HF3A 4C1KA 4AHQA 3MP4A 4Z1AA 4OE7A 2VEKA 5MHBA 4JICA 1TO3A 1FCQA 1ZENA 3DFPA 3LHUA 1ZCOA 5HR7A 4NJKA 2EGZA 3BW2A 2CLKA 4ADTA 2D73A 1GPWA 4WY0A 3PSVA 5KITA 1W3IA 3I7QA 3NQFA 3LLFA 5DLCA 1RQBA 2R91A 3OVRA 3KFTA 4XBKA 1RD5A 4MVAA 1PHWA 2C6QA 1W5OA 4IMDA 5HUOA 4N6EA 3MHUA 5EYWA 4TIMA 3FLUA 4IX2A 1F2JA 3CEUA 3G3DA 3W88A 4MFEA 4YXGA 3SGUA 1NSJA 3QSTA 1W56A 3KVKA 4NT0A 5F2LA 1F5ZA 4UC5A 3W2JA 4JTUA 1K02A 1W37A 3DKLA 2EKCA 3PUEA 3LV6A 4UFIA 3UZJA 1JQXA 4PL2A 2V9DA 3LGEA 3PUOA 4DPQA 1LRQA 2GQ8A 4O52A 1K7XA 1LLWA 2HMCA 3HQ1A 3S5ZA 3MMTA 3LBCA 3TR2A 1HTIA 5LGXA 4MY1A 5T26A 4LV4A 3NDOA 3PY2A 4Z1CA 5LNWA 3E9AA 3SR7A 4I7VA 3TU9A 1O5KA 2XN2A 3EKZA 3A23A 4AVFA 1DQXA 1JVNA 2QCFA 3HG5A 4WY0B 4MYAA 3JS3A 3TC6A 1K8YA 2ZZ3A 3GR8A 3TXVA 4GUIA 4UTUA 1MEHA 2TPSA 1KM5A 3QF0A 3W6YA 5D2WA 4JTGA 3K30A 1GTEA 1MXSA 1FQ0A 3E49A 1YLVA 1OX4A 2QF7A 3BVJA 4DBDA 2CZEA 3RU6A 4R34A 3LCIA 5F4XA 3NL5A 4K8EA 3W70A 2Z6IA 1YDNA 1SO5A 2BZNA 3PM6A 1DOSA 1KFCA 1YDOA 1PVNA 1QMLA 4UTTC 2NX1A 2DJLA 2J24A 1KFEA 2Q3OA 4WOZA 1EP1A 5I3IA 3DXIA 3PBWA 3DH7A 3GKFA 4MY8A 3L0KA 5F4SA 5DBTA 1JRCA 3STFA 4IMFA 3O06A 1K8XA 3IV3A 3O16A 2DZTA 2OX1A 3G0UA 3U8GA 1ZY9A 4S2CA 3S9YA 4S1FA 3PAJA 3M6YA 1CI1A 3LRMA 1G4EA 4R7JA 3WFAA 3FOKA 2PRLA 3W7KA 3AJXA 3P5YA 3BLEA 4ZZ9A 1OFOA 1AMKA 3T78A 1S3HA 1XBXA 1H5YA 1KTBA 5FEWA 3EX3A 4UFMA 1R46A 5AOUA 1BWKA 2WJZA 1N7KA 3C2RA 4KWWA 1PS9A 3NA8A 3TNOA 5CPNA 3B04A 1KFBA 3TV8A 1OX4B 4OV4A 4CCCA 1K3UA 2YCEA 2QDHA 4JTEA 3M0ZA 4PEKA 3UNDA 1TPH1 4XZ9A 4CCEA 3UQNA 3EKLA 3LXCA 2WSRA 2V2CA 1AW1A 3BG9A 3M5VA 4JTHA 1R30A 3EEGA 3TQVA 2Q8ZA 3W1LA 3H54A 2KZHA 1R2SA 1H7PA 2ZYFA 3Q2DA 4RX0A 3NQDA 2ZRUA 1U83A 2BX7A 4XBSA 1WDWA 1K03A 1P1XA 2G96A 2CLOA 2VENA 4DF2A 2YFOA 2OMAA 3FYOA 1B3OA 2A6NA 3WJSA 3W1AA 2PCQA 3HGSA 5D37A 4FNRA 5KINA 3LCLA 4NQ1A 1KV8A 4FX7A 4Q32A 3S1VA 3W2UA 3FS2A 4LT9A 1FDYA 1FBAA 5C5YA 2G5WA 3PC0A 4DF1A 1H61A 4JIPA 4K39A 2XFWA 3IGXA 1I2OA 2X1TA 2CLHA 4AAJA 2DORA 2ZRYA 1TV8A 1FCBA 5L6UA 4BF9A 1JCMP 1VHNA 3CT7A 4QJ1A 4A2SA 4N02A 1KBIA 4UR8A 3C61A 5AHNA 4RR4A 5FF3A 3B03A 1IGSA 3GKAA 2A0NA 3MI2A 3QM3A 2NV1A 3MP5A 2YYUA 3N9RA 2FQIA 4UTHA 3PB2A 1W54A 3FYPA 4U28A 2ZTKA 3MWAA 1AG1O 4J9JA 2H3BA 2DZPA 2F7FA 4JNMA 4FNTA 1FDZA 1SU5A 3LBMA 3STGA 2OT1A 1HO1A 1VJIA 3M16A 1WYIA 4FNPA 4MFDA 1SFLA 2WSQA 5G1TA 1P0KA 1YXDA 4PFMA 1JCJA 2H8XA 4ZQRA 5TBOA 1OFEA 3B05A 2NUXA 3ZWSA 5C6MA 1DQWA 3W2NA 3KRUA 1W8SA 3UWVA 3S5NA 1ML1A 1B9BA 3H55A 1VLWA 3C2OA 4FX6M 1X8FA 3KXQA 1LORA 5HNRA 3WJYA 1EUAA 2CU0A 4XKYA 4C1LA 3LHYA 1S5TA 1GVFA 1D3HA 2DZVA 3W22A 4LW7A 5H2ZA 1TIMA 3W7JA 3KRSA 3HMJG 3F1QA 1Q6QA 3BO9A 1MZHA 2CLIA 1MEIA 3LERA 4M6PA 3VFLA 4FNSA 2V82A 2HS8A 2WSYA 2QCLA 4UMCA 2JKAA 5AHEA 3F4WA 3QMSA 3PVFA 5LSMA 3G1XA 5CZTA 3PG8A 1LRNA 1KLZA 3SW6A 4Q4KA 1PL9A 2DZUA 3GVGA 1W31A 4E2BA 2H8ZA 2P10A 3L5AA 4HPXA 5F4WA 4O8RA 4OV9A 3TUUA 4R33A 4MUZA 2GJLA 3W2MA 1JR1A 2R8WA 2TYSA 3DHDA 4AXKA 2QCMA 3W7IA 1I45A 4LVBA 4GUHA 1DJNA 3JR2A 3SY5A 1BTMA 1ME9A 3THQA 3G8EA 3BW3A 1OF8A 4UFHA 2RH9A 3NQEA 4CCDA 5BMXA 5H91A 2ZZ1A 3I65A 3G1AA 3USBA 4N9BA 4YMZA 4CQ9A 4DEFA 4W9TA 3AO0A 2AAMA 5D30A 2C13A 5DN1A 1SZGA 4UTLA 1TPDA 2V2HA 4XKYB 3UPWA 3C4UA 2FB2A 3W7MA 3KAOA 3W7GA 1IIGA 1JQVA 1O4UA 4N9EA 3R5EA 3TFXA 2V8ZA 3L0NA 2E1DA 3NQ7A 3QMRA 4G1KA 4KKXA 1XXXA 2I9EA 3N14A 4NZFA 1FCUA 3G3MA 4A29A 1EUNA 2A7RA 1OFQA 4M19A 2QCGA 3PBYA 4O54A 3N19B 3P8IA 3ZS4A 5KZEA 4PTNA 4RJEA 1OVDA 2ZRVA 4H6KA 3S1WA 1H50A 1W1ZA 1JUKA 3W87A 1YYAA 1GVRA 2Z2UA 2AQWA 3WK0A 1ICSA 4QQ3A 3IVSA 3ZWTA 4NX5A 3NO5A 8TIMA 1FWWA 1GEQA 1VHCA 3GXPA 5LKYA 2EAWA 3GDLA 4PH6A 4HPJA 2HSAA 2J9ZA 2QJGA 3G8RA 2FDSA 4AH7A 5AHFA 3PR2A 2JK2A 2YPIA 2DU2A 1DBTA 3UD6A 1N8FA 1WOAA 1WBHA 4FEZA 3W1MA 3PS7A 3QSRA 2EF9A 3SECA 5K7JA 2GOUA 4LS0A 2LLEA 5G4EA 3FEMA 1IF2A 3Q37A 3DFQA 2PRMA 3TX9A 1XKYA 2Q3RA 1B4EA 2YXGA 2QUUA 4CLMA 2VELA 4IPJA 1Q6LA 3HG4A 3O63A 4ML9A 1LTDA 4BI5A 1TPB1 5K9XA 4RZ5A 3EXRA 3WJZA 3BGGA 3TAOA 5EA9A 2ZA3A 5F1UA 4IQLA 2PURA 3IRDA 3L0GA 1C9DA 4K6AA 1WXJA 3C56A 1F6KA 4LUIA 2E5CA 5KZMA 3L21A 3MHFA 1VCFA 1W3TA 4K36A 1UCWA 3S1UA 5E0KA 3EXSA 4IPIA 3N73A 2UV8G 4UR7A 2GVLA 3G1HA 3NOEA 2FB3A 3N2XA 4LVGA 3PG9A 1OFBA 3L68A 5IBXA 5KTLA 4NXSA 2C18A 3ANYA 1UUMA 2ZQ0A 1SR9A 3QYQA 1P4CA 3RMJA 1KM6A 3QMTA 4UTWA 4AWSA 3CQ0A 3W1PA 1OX6A 2YSWA 4O12A 3FA5A 1T8XA 3NM1A 1T0OA 1J4EA 2E6AA 5EKYA 2FTPA 4DELA 1GZGA 1KTCA 5KZDA 1QPOA 2XN1A 3WK3A 3DAQA 5AC7A 2HTMA 4UTMA 1EEPA 1G6CA 2A21A 1FWSA 1H63A 3QPYA 5AHIA 5F2GA 4I9AA 4O18A 4WY0F 3SIZA 1IXQA 3WK2A 3WK1A 2GVGA 3UY7A 3MYPA 4CQ8A 3GR7A 5D04C 4HNVA 1GTHA 1TCDA 3LCWA 3PBVA 4S2BA 2CLEA 4HN4A 4MJZA 4BI6A 1AL8A 2NWSA 1G4PA 4XWUA 3HB9A 3R13A 2C0AA 2E5DA 2WNNA 4ADSA 2HS6A 1LOQA 4EOUA 2J9YA 4WX2A 3TKFA 1VQTA 3LHVA 1I2RA 2EPHA 1OFPA 2ALDA 2CZFA 3V1PA 3MI6A 1H7RA 5AYZA 3GNNA 2B7OA 1K7EA 3UWYA 1QFEA 2NWRA 3THAA 5C54A 3P84A 2TMDA 4O16A 2BSLA 3E96A 4FXRA 1LLZA 1WAUA 3EX6A 3R12A 3G1DA 2JKEA 5LNVA 1GG1A 5KMYA 3GDTA 4DPPA 5L9FA 3NPXA 5G4WA 4AB4A 1LBLA 2A7NA 4OBTA 1XBVA 2Y7DA 2Y70A 4NNCA 5FI8A 1EWEA 3MUXA 4GXMA 5F2IA 2VC6A 4O4WA 4E0CA 3GXTA 1QO2A 3GDMA 3TSMA 4DF0A 1JCLA 4MOZA 2QUTA 3W7HA 2BTMA 2GJNA 1TRDA 4CNNA 2WNZA 1HFBA 3M47A 4CNPA 3DENA 4HNNA 4OT7A 3NL6A 3W83A 4L4MA 1Z41A 2JGYA 2A1YA 1VRDA 2E09A 4H3DA 4LTSA 1H7OA 3P8JA 1MSSA 3W75A 2C14A 1XUUA 3S6DA 1EP3A 3IIPA 5G2HA 1XBYA 1NF0A 1SO4A 4RXFA 4IXXA 3SFKA 1X1ZA 2ZRZA 4IMEA 5CG7A 1TQXA 4Z1BA 1F73A 4QM1A 5U4NA 5AB3A 5CZJA 3CTLA 3W1NA 1YTKA 3GIYA 1H1ZA 3HPZA 3TE9A 1O94A 4XTIA 1SQ7A 3NQ6A 1RZMA 1IIHA 1QAPA 3T44A 2VEIA 1TTPA 3P61A 2NZLA 1FCVA 3LRLA 3DI1A 1SO6A 5ABTA 3UZ5A 1J5TA 4XQ6A 4ZQCA 2V5BA 3ZFHA 3OBKA 2BLEA 3P80A 2ZDRA 4FX8A 5HWJA 3MO7A 3P62A 2X30A 2Y89A 1KTNA 4M7TA 3L5MA 5AN7A 4WZHA 4O1AA 4NU7A 2FLIA 4WJEA 3W76A 2YX0A 1TJRA 4A2RA 3M44A 1D3GA 2H6RA 5HUPA 4O0KA 1LP6A 4HHPA 5C55A 2BXVA 4X9SA 3UYCA 4NJIA 1JCXA 4JY9A 4MLRA 3NPWA 5DY2A 4Z1DA 3W84A 2YGYA 5G1YA 1OABA 3W1XA 1JULA 4CNOA 1K7FA 3O07A 1SO3A 3BV4A 1S5WA 1X1OA 1LOSA 3E02A 3EWYA 1YADA 5AHMA 1TV7A 1QCWA 3A5VA 3G18A 5LNUA 3DI0A 4PC8A 4JX4A 3NQCA 1F74A 2BWGA 4JYEA 3GDKA 2YZRA 4LV9A 4RLIA 3HGJA 3VCRA 1J2WA 1JRBA 4AEOA 2TRSA 2V0TA 4HSNA 3SI9A 4HNUA 3LTSA 3NNTA 2DZXA 3NQVA 5EY5A 4WOQA 3NR0A 3LV5A 4POCA 4WQ6A 2NV2A 4ADUA 4HSOA 1ZFJA 1ME7A 1A5SA 1QPQA 3ABRA 3U2OA 2O7QA 3D0CA 2CLFA 1IXPA 3W85A 1A53A 3W9ZA 2YR1A 3W7LA 2YFNA 4TU1A 3RF9A 4Y8FA 3W71A 1DVJA 3W74A 4JN6A 1G7UA 1H60A 3NQAA 4JDBA 4O15A 3C2VA 1B57A 1YTDA 4GFSA 5HWMA 3V75A 1TTQA 2ZA2A 4A3UA 4K7YA 4BR1A 3CWNA 3PWAA 1A5AA 3QPZA 5DCBA 4OQVA 4X2RA 1D9EA 3QFEA 1OK4A 2CFFA 3O6CA 4ZQPA 3W7QA 3FJ6A 1SZFA 3DGRA 4XTDA 4CQAA 2H3DA 5J5DA 1THFD 1H7WA 4FO4A 4Q33A 3EB2A 3LCXA 4BI7A 3LXBA 4QIUA 4RK8A 4LU0A 3M43A 4TMCA 3INPA 5AYXA 4BFAA 1WBJA 4FIQA 4U4MA 5I3FA 1OF6A 1SSGA 2B4GA 4QISA 5G2WA 1Z48A 3C0JA 3WJWA 2VFGA 3P60A 1G67A 1KLYA 4UUIA 3L67A 3LM7A 1QOPA 2ABBA 2QCNA 5TQLA 2XN0A 1T96A 4FF7A 3BLFA 4HT3A 3ATZA 4JDYA 2NX3A 3QEZA 1HG3A 3UWUA 3B4UA 3EX1A 4PL1A 1OFAA 3NZRA 2NXIA 4O19A 2CLLA 1VYPX 2QCEA 2OJPA 5AC8A 3TJXA 1QWGA 1TRIA 2ZZ6A 2Y61A 2YW4A 2Y6ZA 3CHVA 4GJ1A 5LHFA 5D02A 1VLIA 1SSDA 3O8AA 3QH2A 2TSYA 4R53A 5IM51 1DL3A 5I3HA 1FWNA 1CW2A 5I3GA 5HR6A 1EA0A 3HJZA 2V2DA 5F2MA 1TB3A 3P67A 1V5XA 4Y6GA 3A5FA 4ZQMA 4LRSA 3Q58A 1DV7A 4FIRA 4MLJA 4JTTA 3MP3A 1FWTA 1L6WA 3C2FA 1SW0A 4QITA 1VGAA 3DFSA 5G2IA 3IGUA 1YTEA 5FF7A 4NZJA 1LRTA 2A7PA 2DJXA 1RQHA 3W7EA 1VYRA 4WUIA 3TAKA 3R2GA 2A4AA 4XUGA 1GOXA 3ELFA 3LCFA 1RR2A 3LTPA 5AC6A 2J9XA 4FB7A 4IMCA 3TXZA 1TPFA 2OT0A 1ADOA 5CPMA 1PV8A 2GQAA 2RDUA 3G0SA 3W7DA 3OVPA 1SW7A 2V81A 2QR6A 3M1ZA 4JX5A 1QR7A 3GYEA 2DP3A 5GVJA 2ATSA 2Y88A 5HQEA 3GXNA 2RHGA 1FXPA 2A2IA 2FPTA 4JTSA 4PA8A 5EBUA 2O7SA 2WO5A 5BMWA 2CWNA 3M41A 4O0ZA 3GX9A 1RPXA 3T55A 1G4SA 3TW6A 3W1QA 4DBEA 2VXNA 1AL7A 3HGRA 3SJ3A 3L2IA 3I7RA 4AWTA 3EXTA 1OYCA 4UFKA 4QNEA 2B0MA 1OHLA 3DZ1A 1KFKA 5DY3A 3W1TA 3BARA 3GDRA 4OHQA 2CZDA 2Y7GA 1KM4A 4KFNA 5D2TA 5HMSA 3PUDA 3OVQA 3H53A 2WOQA 1SUXA 3YPIA 1L2UA 1M5WA 2WNQA 3T40A 2ZRXA 2QDGA 1Q45A 2VEMA 5CSSA 4YWIA 2ISSA 4QNWA 2E6YA 4MZYA 4UMBA 1MO0A 4H4IA 1HL2A 1PIIA 3UWQA 1KBJA 1TSIA 1QPNA 4KFPA 4NUWA 3NVTA 4TMBA 3C2EA 3O15A 1IXNA 5D38A 5D2XA 3LLDA 4TX9A 1JUEA 3CWOX 1HO4A 3L9CA 4O10A 4QSHA 1NEYA 2QJHA 4LVAA 3HG3A 4BWLA 1UBSA 5DBUA 4JR5A 1LM1A 2GVJA 5K3VA 4NJHA 1GT8A 2V5LA 3W7NA 1YXCA 3HBLA 1QNVA 4O1DA 3VNDA 1VPXA 3O1NA 4O57A 4UTIA 4N6FA 3N9SA 4ZQNA 1XUZA 2RDTA 4LUJA 4M6QA 4A22A 1EP2A 3GB6A 3C3NA 3CLMA 2CZ5A 4O17A 3LHTA 3OHIA 1RVGA 4AMAA 4UTWC 3CPRA 4I7UA 3LX9A 4JY8A 4JXCA 2B7PA 1OYAA 2ATMA 1XBZA 4JS3A 3NQ8A 1EPXA 2E68A 1RV8A 4Y9AA 2DZSA 4M7SA 1P0NA 1EIXA 5CZSA 3TW7A 1SZNA 3G1FA 4MIMA 3UWWA 4O4VA 3W1UA 3PSWA 2A5HA 4IGHA 3Q94A 1Q6OA 1O60A 4EVZA 5CZ0A 3TMLA 1UASA 5D33A 1OG0A 4AHPA 1XDLA 1TPC1 3NXFA 3B0UX 2ZRWA 4YL2A 5KSWA 2A6LA 5LNSA 5FESA 4N9CA 2Y7EA 3IEBA 4ZQOA 3PF3A 2QJIA 4PODA 4HKPA 4K37A 4OU1A 5U7SA 4DO4A 3TJLA 4IUOA 1QPRA 2I14A 4IXHA 2P1FA 3NPVA 3IVTA 3M7WA 1GVQA 1R2TA 1F05A 2VFIA 3A21A 3KVLA 1OYBA 2R94A 4UXDA 4ZMGA 4NNBA 2VKZG 4LC8A 3TMQA 3UWZA 1S5VA 3W23A 5BNKA 5HWNA 3GLCA 5CPLA 1TJPA 3W7PA 1ZALA 2FIQA 1GJPA 3DFOA 4NVTA 4AHOA 3S0CA 1EB3A 1LDCA 2E77A 3DKJA 4N9DA 2ZTJA 4GWEA 4O11A 2PE4A 3WJXA 1TYGA 1O5XA 1GVOA 4EF8A 5EPDA 1RQEA 2X1SA 2X16A 5BOOA 4GE8A 3EWZA 4DO6A 3PB0A 3W72A 4N4PA 1O95A 2FFCA 4LOCA 1TQJA 4MPQA 2NLIA 3DBPA 2QCDA 4N2YA 1Z44A 5CPOA 3NZ1A 2E6FA 3OA3A 1C8VA 1FY6A 1P5BA 1G4TA 4MY9A 3W07A 3NYZA 3B06A 3ABQA 1KM2A 3T4CA 3P81A 1XM3A 3CM4A 5K9CA 1TV5A 1IXOA 1LYXA 2OZ0A 4MZ8A 3NEVA 2WPBA 3S8HA 2C3ZA 2Y63A 2NUWA 4FNUA 4ONVA 5BRBA 1GYLA 3TIMA 1YPFA 1E51A 2WQPA 2ZA1A 3L65A 5AFDA 2QKFA 3G24A 3B8DA 2YW3A 1V7YA 1NF7A 4DO5A 3ATYA 2W79A 1NFBA 4FXSA 1ZHAA 4UMAA 1JCNA 1CX9A 4DXVA 4UFLA 2RDWA 3W7OA 2E5BA 4IMGA 4NJJA 2VOMA 1L6YA 4Y90A 1C29A 3O05A 1VCGA 5AHLA 1WQ5A 3SZ8A 5FF0A 4YCPA 2QCDB 2H90A 5F1VA 4LY8A 1GVSA 1OK6A 3QQ1A 7TIMA 4K8HA 3FJLA 3G0XA 3QQ0A 3QW3A 2W0UA 2E6DA 4ALDA 3GNDA 3FIGA 4EWND 1KM0A 3QRHA 3ABSA 1FUYA 2X2GA 2Y85A 3EX2A 1EX5A 1W5MA 3DU0A 4GBUA 3OEXA 3HPXA 4GUFA 1TMHA 2EHHA 3C52A 5AYYA 3NAVA 2F84A 3S5YA 4RXGA 4GUJA 1OJXA 1F6PA 4JGDA 1K8ZA 3IIXA 1XDMA 3LRKA 4UNKA 3UPBA 4O14A 2CLMA 1JJKA 5LHEA 3KHJA 3CEPA 1VH7A 1H7NA 3LI0A 2Z1BA 4GC4A 5HULA 1ICPA 4JYDA 1VYSX 1X6UA 3SGZA 5EL1A 1AK5A 1A5CA 1W5QA 4UTTA 1Q3NA 3DFTA 3S5OA 5DELA 4JIQA 5FF2A 1ICQA 3VI2A 3L5LA 4DQWA 1DKWA 3CB8A 2GUUA 1H51A 3BK0A 1Y0EA 1UJPA 4UNLA 2J6XA 1I2QA 2YDAA 4LNYA 3F4NA 1QOQA 1GYNA 4WXZA 4NXKA 4Z0SA 2Z0IA 1SZEA 3RLVA 2ZFAA 4OWGA 1U5JA 3NQMA 1LBFA 3LHZA 3N34A 1WX0A 3EX4A 3EWBX 1BKSA 3KVMA 4E38A 2C15A 3FKKA 4LS1A 1TTIA 5K4ZA 2C16A 4JEQA 1G7VA 6ALDA 1A50A 3HO8A 1M7PA 1OX5A 5D32A 5D05A 4ZVJA 1ONRA 1BWLA 1H62A 3C6CA 3LDVA 4IX0A 5BW6A 3TQ0A 3M5XA 1L6SA 3MBFA 4RKAA 3KRZA 1PCWA 1T99A 1XCFA 3N2MA 4O13A 5K4XA 3W7RA 5DCEA 4FHAA 3BG3A 3UXDA 4EIVA 1W3NA 3W2KA 4K38A 4RZ4A 3BLIA 2GQ9A 4HNTA 3I68A 4IWWA 1ZAJA 2Z6JA 3HOJA 1TPUA 4JX6A 5CGQA 4X3ZA 4KWVA 2OCZA 2DZWA 3LCHA 5DXXA 4LWWA 2G97A 3BPWA 3I7SA 1VS1A 5LGZA 1YXYA 3TH6A 2ZZ7A 2ISVA 3MW7A 4K7VA 4O28A 2G95A 1WA3A 3TROA 3W2LA 1L9WA 3STCA 3B0VC 3TDFA 5HINA 3O6YX 2FPYA 2QCCA 1ME8A 4TO8A 2VFEA 3JRKA 4JTLA 4LC6A 2W6RA 3G1VA 4IOTA 2ZZ2A 4D2JA 4AWUA 3TFCA 3CC1A 4RCXA 2X1UA 3NQ2A 3EWXA 3DFNA 2QAPA 3CU2A 5HJLA 1EWDA 5D2VA 1PE1A 3O6DA 3PULA 3HIJA 3CIXA 3T7VA 3TSDA 1R2RA 1N55A 1KW1A 3PBUA 1SPQA 4O1BA 5FF4A 3MHGA 4JTFA 1I2PA 1A5BA 3BGJA 4GNJA 4JD4A 5LZLA 3C8FA 1M7OA 4MJMA 4GUGA 4LVFA 3MBDA 5G5IA 2NX9A 1XFBA 3GAKA 1NAL1 3CIWA 2ZZ4A 2WKJA 3KOFA 1H7XA 1I4NA 1LZOA 4M6VA 3IIVA 1TPEA 3W86A 3G22A 1AW5A 3IIOA 4WXYA 2NXGA 2FPVA 3M5YA 4KFOA 3LB0A 4L4LA 4FNQA 1WV2A 4I7WA 2A85A 4Y96A 3NL2A 3N3MA 1PHQA 3QC3A 3GAYA 1KV5A 2VFFA 2B7QA 2ZBTA 1ZJIA 2ZCGA 1VR6A 2RFGA 2PRHA 4LRTA 1OFRA 1ALDA 3VE9A 4ORMA 1QO5A 3LTYA 4JTIA 2NXHA
chains in the Genus database with same CATH superfamily
3EWWA 2PWGA 4IIBA 1FX6A 2HPIA 3OG3A 1NVMA 2P5NA 4HIBA 4JHZA 3EDKA 2W63A 2JBMA 1DORA 1K6AA 1TE1A 3MO4A 3WDIA 3QJAA 1QDSA 3SCUA 3MKKA 1H3GA 4XD5A 2X1RA 1I8JA 1A3HA 1W1B1 1GJUA 2I5GA 2QAFA 3VC5A 3LU2A 4L9YA 1IWPA 4YCOA 3SFWA 5D8ZA 4GRSA 2Q8LA 3W3OA 3VKJA 3TK7A 3P82A 4MKNA 2WHLA 4CVUA 2IKJA 3UXAA 1GWJA 1W1VA 4XISA 4UZUA 1A5LC 3W00A 3APTA 1M7XA 3QOKA 4YWSA 2GVYA 3EOOA 1EL3A 3P74A 5DCDA 3N2TA 1SW3A 1CXHA 1XI3A 4IISA 4KEMA 1TPWA 3H12A 4BWLC 4ZBCA 2ZUUA 5XIMA 3BOLA 4M6UA 4WGHA 1GG0A 5KZ6A 3OZMA 2BGQA 1U1HA 4KIRA 3SN0A 4O50A 2ABAA 1B4KA 3L4WA 2OSYA 1XX1A 3IVUA 1OFDA 1MEWA 5CKSA 2PF0A 2BNJA 2VFDA 1TREA 1K9TA 2VVNA 3OGRA 1GKRA 5G1MA 3MI3A 2R14A 1BLIA 1ZCCA 2DIKA 4IZGA 1P6BA 1MNSA 1PCKA 4JEJA 4WD0A 1P6WA 1F76A 3WQ8A 3E0IA 4Y9OA 5K2ZA 3FKRA 4XVEA 2VT0A 4H00A 4LB4A 5J5RA 2OU4A 3AUJA 3FV9A 3TLQA 4BEQA 1FFQA 5DXYA 3LM3A 5FEXA 3QXBA 4BQ5A 3QZEA 4JFVA 3GK0A 2EPKX 4NYYA 2PC4A 1T5AA 1TKKA 4D6DA 1AW2A 5FEPA 4UQEA 3ARTA 4JTKA 4QG9A 2OGYA 4PCPA 3I6RA 4NZ5A 1GORA 3G1SA 3TA6A 3NG3A 4JQAA 3R8RA 5DMMA 1F7BA 1CTNA 4QLLA 1R9XA 3W53A 3WNNA 3GZ3A 1FWRA 1LOLA 1VEMA 1K4HA 4F9DA 2VX4A 4PB4A 1UYQA 4H9XA 4IICA 8RUCA 1UB3A 1AUSL 1TZ7A 4Z08A 5A8QA 1LROA 3K13A 4ORIA 3KL0A 4AF0B 3HF3A 5GPRA 2VEKA 3MSGA 5MHBA 4US6A 1XH0A 4TX6A 3AHXA 5HR7A 4NJKA 2EGZA 3BW2A 1GPWA 5CJ5A 2YCLA 5KITA 3KFTA 2NQHA 2C8NA 1PHWA 4GYPC 4YS1A 1J0JA 3SQLA 2ACQA 2A3BA 2GJPA 5EYWA 1UW9A 3CEUA 1PAMA 1K9FA 3M0YA 1W56A 3K2GA 5F2LA 1B9ZA 1F5ZA 4JTUA 5D8WA 5FAGA 1W37A 1BTCA 1FA2A 5CPTA 2FZ8A 2V9DA 4HCDA 3LGEA 2PDPA 2QPXA 3WUGA 1Q6FA 1K7XA 1LLWA 4YTUA 3HQ1A 3HQNA 4AZCB 1IZKA 3NWRA 4JTAA 1JG9A 2FTYA 4DJFD 2VHLA 4WEVX 3AXXA 5LXXA 3VKAA 1BYBA 4OVXA 4C6KA 2ZX7A 2XH4A 5GQBA 4GZEA 3LEPA 2ACRA 2QYGA 4UQCA 2KAUC 4GLEA 4EPKA 1EF3A 1CB2A 4GI4A 4WGXA 2ZZ3A 3TXVA 1FWIC 4UTUA 2E4TA 3QLDA 4WKHA 3ITTA 4JKKA 2HJPA 3NZPA 1ZPTA 1FQ0A 5TF0A 1YLVA 1OX4A 2R24A 3IUDA 4L6OA 2W4XA 1DEDA 1RP8A 1J0YA 1IEIA 5F4XA 4OTKA 3NL5A 4NAEB 2XINA 3PM6A 1DOSA 3LG3A 1PVNA 2BOEX 2I56A 1KC7A 1DWHM 1EP1A 5I3IA 2HBXA 4U31A 4X2PA 2V3FA 1A5NC 4HHHA 2GL5A 4MY8A 4L64A 5DBTA 2QZRA 4RDYA 3VNKA 2WMJA 1G01A 2DZTA 3R10A 1W6TA 4S1FA 1EA9C 1VFLA 4OECA 4P7OA 1G4EA 4URIA 4IGMA 3F4DA 2PRLA 1E6ZA 5JBFA 3P5YA 4ZZ9A 3T78A 2WSKA 3B9DA 1H5YA 3CHEA 3FX4A 3QTPA 2WJZA 3NO1A 2Y4SA 4MNJA 4KWWA 3NA8A 3GNRA 3TNOA 1AJ0A 5CPNA 3DFHA 1R7AA 3B04A 3EPNA 4Z2IA 3SCTA 3TV8A 3IK2A 3R1ZA 2VC5A 1ZL1A 2EPNA 4OV4A 4CCCA 2E67A 3L4ZA 4FXFA 3VAVA 1BYDA 5AKQA 1T6MA 3UNDA 5F7UA 1DXEA 2WSRA 4L80A 3TQVA 3W1LA 4N42A 1XRFA 3Q2DA 4G9PA 4Z1YA 2ZRUA 4XBSA 3WQ6A 2JEQA 1M04A 2BP1A 4XZWA 1EC7A 5JBEA 1B3OA 2DPEA 2A6NA 1NDYA 2PC8A 5LIXX 1L0PA 2P3ZA 1ZGDA 3E3HA 4LT9A 1FDYA 1LWIA 2ODOA 3PFRA 3PC0A 3O9NA 2OB3A 1YNYA 3ARRA 3IGXA 1UH4A 2PLCA 2X1TA 3EMCA 2CLHA 2CBUA 4AAJA 4UBPC 5ABGA 4BF9A 4N02A 3UGRA 2NSXA 4UR8A 3C61A 5REQA 1UPPA 5A8PA 3E5BA 3B03A 4W7VA 4UOQA 3AS0A 2H9AB 1SFTA 1DIKA 5HNUA 2A0NA 3VX1A 3QM3A 2JF7A 2CERA 2YYUA 2FQIA 1W9VA 2HE5A 4UTHA 1TIWA 1W54A 1X6LA 4P8UA 2VP8A 4U28A 1VBGA 2D0GA 3VNIA 5A6KA 1Z6KA 2DSKA 3AMLA 1PWLA 2DZPA 3G6MA 4NIRA 1KB3A 1WDDA 3STGA 1WYIA 3AZTA 1XFCA 3TN6A 1J79A 1JCJA 3PNZA 2NUXA 3W2NA 3S5NA 1B9BA 1GQJA 4FX6M 1RP9A 3NSNA 3TYZA 1EUAA 4XKYA 4C1LA 4PUDA 1GVFA 5H2ZA 5BCAA 2WBKA 1MZHA 1E1CA 2CLIA 4M6PA 4YU1A 4J40A 1FWFC 1KO0A 2HS8A 2JKAA 3CQIA 1OGGA 4Q4KA 5HBFA 3PZVA 1W31A 4E2BA 1PPIA 1FP8A 2P10A 3L5AA 3L4VA 4OV9A 1R7OA 3SN1A 3TUUA 4JIEA 4MUZA 2DQXA 2GDQA 4W7UA 3W2MA 2YBTA 1JR1A 1TUFA 1I45A 3MV11 3CMJA 4EE9A 3MT1A 3THQA 4DB7A 2QPUA 1OF8A 4S3DA 4UFHA 2C1GA 3ZSSA 2RH9A 1GEHA 2HNHA 1SZRA 2ZZ1A 3H2MA 2VZUA 3VFCA 8CGTA 4TTUA 2GWGA 2AAMA 2FGZA 2D3LA 3SQSA 5HMEA 2OZ8A 3C4UA 3W7MA 3KAOA 1PO9A 2PWVA 1IIGA 1BSLA 3TFXA 4FP1A 2PLJA 2V8ZA 1IHIA 3MMUA 3W38A 5FJOA 4KKXA 3CUXA 2I9EA 3N14A 4NZFA 3G3MA 2IPJA 4L1WA 1JL8A 1EDTA 2A7RA 1J6PA 1E43A 1OFQA 3MVIA 3WQDA 5FJRA 4PTMA 1E71M 2P88A 4H6KA 4RNIA 3WDRA 1YYAA 1DXFA 1ICSA 4QQ3A 3IVSA 2E40A 4Q8UA 5FJTA 1KR0A 8TIMA 3KTSA 1GKQA 1VB9A 1FWWA 1GEQA 1UD2A 3GXPA 2HSAA 1B54A 2J9ZA 1E6PA 4AH7A 5AHFA 1QJWA 4PCNA 4DBUA 4Z2LA 3DG6A 2GWNA 2DU2A 3C8NA 2AL1A 4HCHA 3FSUA 3H8AA 3PS7A 3WSUA 1IR1A 3E0FA 1XLHA 3B8WA 1IWBA 1S38A 2GOUA 1RBOB 2Y0FA 1IF2A 3FEMA 4HU0A 4QR6A 4HZ8A 3LMZA 2VC7A 4GGHA 3R7MA 3VCNA 2YXGA 2QUUA 1CECA 4IPJA 4F40A 1Q6LA 4JHMA 1TPB1 4HCLA 5B7YA 2ZA3A 5E9XA 2WZTA 1ECEA 2VQTA 2W92A 2PURA 1WXJA 1SJAA 5CBJA 3POCA 4LUIA 1EFZA 1HJUA 2Z24A 2RDXA 4PFHA 5I3DA 2PGEA 3MHFA 1W3TA 4K36A 2VD8A 5E0KA 3ZJKA 2IQ0A 3SBFA 2X1IA 3CHCA 1CXKA 2FB3A 4LVGA 2ZE0A 3OODA 5IBXA 1T8QA 1UUMA 1SR9A 3C86A 1X39A 1PZ0A 3RMJA 3IJ7A 1KM6A 1I1XA 3BLLA 3QMTA 4FK9A 1E6NA 1OX6A 3FA5A 1T8XA 2PGWA 3GXIA 3ZJ8A 3PTMA 2FTPA 4DELA 2QIIA 1QPOA 2O9PA 3S6TA 9CGTA 1QOXA 1XIJA 3DAQA 1WB0A 3WK3A 2PPGA 2FVLA 3TN3A 3QPYA 1F6YA 5F2GA 1IXQA 2YZ5A 3MYPA 1VFUA 2J8FA 5D04C 3QKEA 3LCWA 3PBVA 4S2BA 3T0TA 5I00A 3U0HA 1U5VA 3HB9A 1N8WA 1TX2A 3PBGA 4LY4A 2PTXA 1XG3A 4YIWA 3GU1A 3FSTA 4GFIA 1VQTA 2EPHA 4AD2A 1OFPA 3M07A 2CZFA 3CUIA 3V1PA 2FMOA 2JE8A 4KS0A 4X61A 1UZ1A 3I4KA 5AYZA 3UWYA 1K70A 2PZ0A 1VBJA 3MZ2A 3E96A 4R9XA 1R9YA 3PWGA 4B5SA 1KCLA 1TG7A 1R3SA 2WMKA 1C3FA 5KMYA 2NW0A 2Z4GA 3GS6A 2VZSA 4XO7A 4DPPA 4MWAD 3U2ZA 1LBLA 2A7NA 4OBTA 1QHOA 3VGHA 4NNCA 5FI8A 1EWEA 2VC6A 1UIOA 3SUTA 3AALA 4E0CA 3ZQ9A 1Q4WA 1RSCA 4DF0A 1JCLA 3EYPA 4QTGA 4PUWA 5C9WA 1BFNA 1XHGA 4S3CA 4V2XA 8A3HA 3VOIA 3VIHA 4CNPA 1KCZA 4MAVA 3NL6A 1V3IA 1P0EA 3V5OA 4ZXOA 3WLQA 4ZCWA 1S1PA 3S6OA 4HU3A 2REQB 3AIVA 3S6DA 1F07A 2ZUTA 1XBYA 2CBJA 5I5RA 3VGBA 1PX4A 1TQXA 1K77A 4Z1BA 4QEEA 5U4NA 5CZJA 4I8YA 3HPZA 2VRQA 3R8GA 4GIEA 4XTIA 3NQ6A 1LF1A 1QAPA 4HA0A 1Y5WA 4ZTYA 5BRPA 5A6BD 3TZFA 3ITCA 3RYSA 4UZSA 3U7BA 4EKJA 1J5TA 1IEXA 2XSAA 4XQ6A 1WKYA 1O6IA 3WQFA 1O66A 3WZ0E 2V5BA 5AY7A 2BLEA 5A8OA 1KCXA 2Y5JA 4CN4A 2ZDRA 5HWJA 2GVEA 3CPUA 1IV8A 3V1HA 4O1AA 4A3HA 4LAZA 4R5EA 3M44A 1D3GA 3CK5A 4JL1A 3H24A 4LEFA 1DJYA 4O0KA 1RJPA 4W5UA 4I9TA 4Q6JA 4HHPA 4NJIA 4LBRA 3KP0A 1XIIA 5H8MA 4JY9A 4ERAA 4JCLA 1REQB 4QAWA 2YGYA 1OABA 1J9YA 2EQDA 4CNOA 1K7FA 3O07A 1BVNP 6XIMA 3TVAA 4ZGYA 1I0BA 4ZO6A 1UOKA 3A5VA 3CL7A 1P6CA 3DI0A 3PZNA 4PC8A 1Q2RA 1AH3A 1US0A 4LV9A 3VCRA 2FGBA 1BF2A 3UW6A 1J2WA 4L9ZA 1CGVA 4HSNA 2OYLA 4CD5A 3N6JA 3NNTA 3NQVA 1F4HA 3BANA 2JIWA 2INZA 1RVKA 4Q8PA 2HNEA 3E5PA 3WQ5A 4Z42C 4FI4A 1J18A 4XZLX 2Z1KA 3CAVA 2NV9A 3U2OA 3D0CA 5E0CA 3W9ZA 3LPOA 4K1GA 2YR1A 3W7LA 3KW3A 3FHAA 4B5TA 3C0LA 5I23A 5CZKA 4Y8FA 7PTDA 1DVJA 1QNPA 3W74A 1J0HA 4AIUA 3KOYA 2ZXQA 2XDFA 3NQAA 4LBUA 4O15A 3F4VA 4REQA 1TZ9A 2HBVA 1TTQA 4BHYA 4K7YA 4QJ4B 1OD0A 5DCBA 4RW3A 1TZZA 4OQVA 3PUGA 3WLLA 4V1YA 3VZXA 3H4XA 3L4UA 1NU5A 3B9AA 5DMYA 4XTDA 5J5DA 1UOZA 3U4FA 5A1AA 4BI7A 2QULA 2F6XA 4W85A 4BFAA 1WBJA 4U4MA 1OF6A 4E4UA 4TOQA 2Z26A 3URBA 1Z48A 3C0JA 3WJWA 2VFGA 3L67A 3LM7A 2EKGA 1KBKA 2I57A 2QCNA 2XN0A 3BLFA 4HT3A 1B3XA 5H6HA 3UWUA 3ONBA 3II1A 4PL1A 5CPQA 4GD0A 1HP4A 2UBPC 3NYDA 3PZUA 4O19A 4HOXA 1W9BM 4F0KA 2QCEA 4UOJA 1QWGA 3N4EA 2AQVA 2Y61A 2YW4A 1OB0A 4GJ1A 2X40A 3R0KA 3LENA 2X0SA 1E4NA 4B15A 4JCMA 1Q4NX 1GCYA 1DL3A 2D23A 2V3DA 1IWAA 5A2CA 1VD6A 1UR1A 1EA0A 2OELA 5F2MA 1V5XA 4Y6GA 4LRSA 4LYQA 4F2TA 1KQYA 3GG7A 4QITA 4U5IA 2Z25A 5G2IA 4CU6A 2DJXA 1XYZA 4BQ2A 5CCZA 2PDLA 2WVVB 1GOXA 4XZNX 1US2A 1ITQA 2J9XA 2WK2A 3OOQA 1TPFA 1HJVA 3EOLA 1WE5A 4ROQA 5D4YA 1PV8A 1V6WA 3SCPA 4DXKA 2DT3A 3SDOA 4HNLA 1V0LA 1T7LA 2QMJA 5GVJA 1YIXA 1FXPA 4PA8A 4H9VA 5BMWA 1A3XA 4LF2A 5HDRA 1LUCA 3GX9A 3OLGA 4DBEA 5T9BG 2POTA 4B5WA 4QNEA 4EXBA 1OHLA 1KFKA 3BARA 3GDRA 4K3ZA 1EJTC 4OHQA 1L6GA 2Y7GA 1KM4A 5D2TA 5HMSA 4FF5A 3H53A 1J01A 4HMEA 1SUXA 4YN5A 1BXBA 4GJIA 1ADDA 2ZRXA 2QDGA 4QS6A 3KBJA 1Q45A 1FHLA 3HU7A 2EPMX 3CWHA 3IGHX 2CZVA 2ISSA 1V4YA 1PTGA 3SRHA 3U48A 1QPNA 3V0SA 1Q63A 1H0IA 5D2XA 4TX9A 3DEQA 4RPPA 3L9CA 2BOGX 3M7SA 4IM4A 4BWLA 5DBUA 3AXHA 3EBVA 3T0AA 1LM1A 3ALGA 1ODUA 4NJHA 1GT8A 2V5CA 3W7NA 2YXXA 4O1DA 3O1NA 5HANA 1HJQA 4N6FA 4DM1A 1E9LA 3AYVA 1N82A 2G3MA 3GVQA 3CLWA 3N9SA 5EB8A 1XUZA 1DPMA 3CZLA 1KRAC 4UR9A 1ZQ5A 3K5XA 2Z2BA 4XG1A 5CC3A 3PN8A 1VFSA 4AMAA 3B8VA 4UTWC 1V0KA 2IKHA 4KETA 3SEPA 4E2OA 2B7PA 3QFWA 1KCKA 3A47A 1WZLA 1LL6A 3KL3A 1YEYA 4GG9A 1EPXA 3BAWA 1RV8A 2GYIA 2DZSA 4J3VA 1SZNA 1WDRA 4KRZA 1Q6OA 1XLLA 3TOPA 3WF3A 3TMLA 3NXFA 4YL2A 4H6EA 3H70A 3GQYA 3IEBA 3HN3A 2QJIA 4OU1A 5U7SA 1PX3A 2J7BA 4I6VA 4GINA 2J7EA 3NJ3A 1Y5VA 1XRVA 1F05A 2VFIA 3A21A 5BXPA 3KVLA 1JDAA 4MNLA 3MA8A 3UT0A 2NQJA 1S5VA 3MVTA 1JEZA 5CPLA 1PKYA 1TJPA 3PJWA 4ZO8A 2P3EA 2FIQA 1A3WA 1GJPA 4ATWA 1OIMA 3IRSA 4MHBA 1EB3A 3KZPA 2E77A 3WLMA 3PWIA 4O11A 1TYGA 5BU6A 5EPDA 3RLHA 2X16A 4GE8A 1H0GA 3EWZA 1KXVA 3VX0A 1FP9A 4N4PA 1NY1A 2GUBA 4BCEA 2VM8A 2XIQA 2ZADA 1BAGA 3ABXA 4LF1A 1B5TA 1UR0A 1HJXA 3T4CA 3MDUA 4LB3A 4C6IA 2DW7A 3CM4A 2R9RA 1TV5A 3L7RA 4D71A 5A3HA 4MZ8A 4Z2JA 3K4WA 2Y63A 4ZR8A 2NUWA 5HJYA 2ONEA 4FNUA 1M7JA 1XLDA 4ZB0A 1TA3B 1T40A 3GE7A 1SYTA 1EXBA 4P7QA 4ATDA 1HL9A 1J6OA 4F2BA 2VWSA 1DHKA 2PEVA 5AFDA 1C91A 1BYCA 2PD5A 5M2FX 4BQ3A 1EJSC 4DO5A 1O5QA 3VVGA 4UMAA 4DJEC 3CV7A 4XD4A 1QASA 4UFLA 2RDWA 3N2CA 2E5BA 4NJJA 3SQMA 2VOMA 3MSRA 3ZJ6A 3O05A 4GIYA 5AHLA 4CNTA 3Q4DA 3Q67A 1XYFA 5F1VA 3ZVHB 4DZAA 1OK6A 4TVCA 3ZXWA 4K8HA 1RCQA 2E6DA 3GNDA 4H9TA 3APYA 1MXGA 1EX5A 5BWAA 4X9YA 1VBHA 4GBUA 3E38A 1YBQA 2F84A 1G1YA 4IGSA 4GUJA 4PTXA 1JIBA 1F6PA 3RU8X 3QBUA 1JGIA 3LPGA 3CT2A 3IIXA 1RAKA 2C7FA 3B8UA 3CZJA 4UNKA 4O14A 2CLMA 1PJ9A 2BBFA 3K1DA 3LBOA 3GTXA 1H7NA 2Z1BA 4GC4A 1XYMA 1VYSX 2J7HA 3VUSA 2WQDA 1P0BA 2E9MA 3HTWA 3S5OA 3IUHA 5DELA 4JIQA 5FF2A 2X8RA 1DKWA 1H51A 1HKIA 1XF0A 1J2BA 4UNLA 1BRLB 4JQ4A 4LNYA 4QP0A 5A69A 4DVOA 3TA9A 3CV6A 1JDEA 3BMWA 4NXKA 4Z0SA 3VNMA 3RLVA 3ZT7A 3I6EA 4W84A 1U1UA 1U5JA 3UBPC 1XYBA 3OZOA 3WQVA 1CLVA 4E38A 2C15A 2AKMA 2C16A 2NQ5A 3ARZA 3AMDA 1M03A 3HO8A 1A4MA 3MANA 3S2JA 3RITA 2J78A 4US5A 3WEZA 4FOJA 5BW6A 1Y65A 3Q45A 1G9HA 1PB0A 2YLLA 4RKAA 3KRZA 1T99A 3N2MA 1A5OC 5BYWA 4EIVA 4K38A 1WDSA 4GYKA 3O6AA 3CZEA 2PP1A 1CGYA 2BS9A 2DVTA 5BXRA 2MANA 3TH6A 1ELSA 1B31A 4ZFCA 4HNOA 1UZ4A 1MVYA 4BJHA 1JZ4A 1XPYA 3BOXA 3UJRA 3STCA 4C1NB 3T0BA 3JZEA 2WZHA 5DANA 2DT0A 2EEXA 3KWSA 2VFEA 4LC6A 1KQZA 1V79A 3OYZA 2PWDA 2X1UA 3EWXA 4B4HA 2VNCA 3L4XA 2O0TA 2PDWA 3CIXA 7CGTA 4TQTA 3PBUA 4O1BA 5FF4A 3MHGA 1LG1A 3FW6A 3BGJA 4Y8EA 3C8FA 3TQPA 4S3AA 3CV1A 4LVFA 3MBDA 3V18A 4JTQA 2ZZ4A 3XIMA 1NWUA 4V27A 3XISA 2WKJA 5J04A 3KOFA 3U57A 1LZOA 2Z29A 4IIEA 1TPEA 3T09A 1G0CA 4WXYA 4UQ9A 1YNPA 1PIFA 3K4AA 3TJIA 3HQPA 1UR9A 2PODA 4FOUA 4Y96A 1TJ1A 2VFFA 2W67A 4J3XA 5LA1A 2RFGA 3RUBL 1OFRA 4J3UA 1ALDA 1QO5A 4JTIA 2NXHA 3N4AA 1X96A 3QV6A 3AHTA 3CXOA 5A8GA 4B9YA 4BK9A 4RV8A 1YDYA 3IUIA 4MYXA 5EMUA 5IOBA 3S42A 1QI3A 4OIFA 1VJSA 3WDPP 4QSFA 1XPGA 2DEPA 2OLAA 3STPA 2FJKA 4GABA 4EF9A 3HMCA 3HPSA 1V77A 1YNQA 3AWOA 4JNZA 1U1JA 3HG2A 1HP5A 4GVFA 3NQGA 4GCXA 3GIQA 3SM0A 1ECQA 1T41A 2XVKA 1FXQA 3CAKA 3E6EA 3A64A 1XH1A 1X7FA 2V3GA 2FZBA 2IXVA 5FEZA 5HQLA 3ZO9A 1FDJA 2PDKA 4MZ1A 1DE5A 3RLUA 1S1RA 3H2OA 2D0HA 3QPEA 1CXEA 3CMGA 4X22A 4AZ6A 2QV4A 1K8CA 4X0VA 5A5WA 4AFYA 3PZ9A 4WR3A 1Q66A 2Z7GA 2WJEA 1JCYA 3UVIA 3WD3A 4DUXA 4ZO9A 1M65A 4E2DA 4AC1X 4IJBA 2WNWA 3UGVA 1VZWA 2FHBA 3FN9A 3MB9A 3TQKA 3W73A 5HOSA 3R89A 1M01A 4XV0A 1I2NA 4GVHA 1XC4A 3STEA 2OG9A 3WQ4A 3DHPA 3R43A 4RZ6A 4P2VA 4Z2HA 2C0HA 3W6MA 4PBFA 3W1RA 2GDVA 1Q8AA 2Y62A 1MW1A 3NEHA 1XICA 2JGQA 4O1CA 1AQFA 2OODA 4Z0JA 3QR1A 1XIGA 1FKWA 2YA2A 3WH5A 3DDMA 4UQAA 1E40A 1TPVA 4HHMA 2OOFA 2BODX 2OSXA 4JOMA 3KX6A 1GPFA 3CS2A 3SSJA 4L5ZA 5EMLA 1N2VA 2HISA 2OGJA 4NSBA 4YHGA 2QDEA 4YLWA 1GQLA 3GW0A 4IG2A 1H1YA 3QW4B 2JKPA 1VP5A 4AX7A 1UP3A 5IHSA 6A3HA 2D20A 3A9IA 1KM1A 1ZZMA 1QI2A 1WOBA 1FHUA 2C79A 2PMQA 2IQTA 3NGJA 3BSHA 4FLRA 4UTKA 2DSVA 2MUCA 1BKHA 4FSAA 3MTWA 3WCZA 5TIMA 1E0WA 1XLKA 1EJVC 3UA3A 3WDQA 3ID7A 2PP0A 4H8VA 4BQ4A 3F5KA 2VEPA 3CYJA 1EBHA 1BG4A 3M9YA 1XSIA 1QRQA 4C65A 1Q8JA 3LQLA 4D8LA 3UCDA 5E1QA 1NFPA 2C19A 3T0CA 4WJ8A 4QX4A 2EPOA 1KA9F 3BAKA 4GOAA 1PKMA 4AW7A 3TYEA 4JIIX 4DUWA 1WKDA 1FTXA 4AHQA 2G0WA 3MP4A 4P7LA 4Z1AA 1H4PA 1TO3A 1IQ8A 3DFPA 3OLIA 2CLKA 4ADTA 2D73A 4GIRA 3PSVA 1VF8A 3WYZA 1W3IA 3I7QA 1WAWA 5D9PA 1JAKA 4WVXA 5DFAA 3BLOA 1XSJA 3BCDA 5HUOA 1V93A 1XLCA 1V3HA 3WNPA 1RPKA 2D3NA 4TIMA 3FLUA 1MDLA 4ACZB 1F2JA 4GISA 3CZ8A 3W88A 4MFEA 4YXGA 3SGUA 2Y2WA 3CUGA 3QSTA 3PK7A 3KVKA 4UC5A 2QUNA 3E2VA 2EKCA 1V6UA 3PUEA 3I6TA 4UFIA 1TWWA 4JNYA 2J7CA 4PL2A 1ZLPA 4B16A 2GK1B 2IW0A 3S5ZA 1JPIA 1R0MA 3EA3A 1GVYA 4J35A 5T26A 1ZBWA 5CJMA 2DGAA 3PY2A 4QCEA 1KXHA 1XGZA 2GDUA 3E9AA 1VFFA 4I7VA 3TU9A 1O5KA 3EOUA 4Q8QA 3EKZA 3A23A 1ZUAX 3WELA 5LIWX 4IGNA 4GKLA 4AXNA 4D6IA 4MJ4A 2IS7A 2AKZA 2QCFA 3MWCA 4WY0B 2VCCA 1K8YA 4LEQA 1CDGA 3ES8A 1MEHA 4OKDA 1KM5A 1AJ2A 4JTGA 1NQ6A 3KCJA 3K30A 3S47A 5JIPA 3GIPA 3BVJA 2QF7A 4RUBA 2CHRA 5C2CA 4R34A 1OG6A 2VO5A 2UZ9A 4K8EA 3W70A 3N11A 2BZNA 1KFCA 1YDOA 2WZMA 3CUJA 1QMLA 4PE8A 3SY1A 4WOZA 3D3AA 1ZSXA 1HW6A 2WMIA 3DH7A 3DC0A 2ESCA 3OBAA 5F4SA 2PS2A 1TVPA 3O06A 4IMFA 3N04A 1B30A 3O16A 2WBGA 2L5HA 3P14A 3GO2A 4S2CA 4GZ7A 5FA5A 4J3WA 4ENLA 4JFWA 2GOKA 3W7KA 4DRSA 4LFYA 4QJ3B 4C7GA 3BLEA 4DLMA 1OFOA 1SVDA 1AMKA 2O56A 2J47A 1S3HA 4UFMA 5AOUA 4NZ3A 3UXLA 2PI6A 1BWKA 1N7KA 4C6FA 2CNCA 2Y8VA 3PPCA 1EJUC 4DNHA 2CEQA 1V02E 3VD9A 4JTEA 1TPH1 3HPAA 1FHDA 1MUMA 3TLLA 1E15A 3LXCA 1AW1A 2QLYA 2AL2B 3EEGA 3TTYA 2Q8ZA 3MDWA 1IT7A 2HPMA 2QGHA 3G6LA 3IAQA 3K8KA 3NQDA 4WSKA 1WDWA 4I6KA 2HVNA 4WF7A 2QT3A 3CIVA 3FYOA 3EA1A 2ZOXA 3W1AA 4XD6A 2PCQA 2QVHA 2XIIA 3UJ2A 3A12A 4FNRA 1V08A 1UP2A 1MQPA 3R8HA 3L23A 4PCSA 4Q32A 3NGFA 3S1VA 6ENLA 3GTNA 5MF5A 2G5WA 1QNOA 3AS2A 4RPQA 3OGVA 1C92A 1PYFA 2DORA 3S2CA 3W26A 4CGTA 3FJNA 4H9MA 3CT7A 4K8GA 3B9NA 3PZGA 2YL5A 4D6JA 3WFLA 5CC7A 1JPMA 1KBIA 1YHTA 5BXSA 1XLIA 5FF3A 3WLRA 1EDQA 1IGSA 3GKAA 1JF5A 5ENLA 4AD5A 4QLJA 4C6EA 1A47A 3SCRA 4NZCA 1U5HA 1DP0A 1PBGA 4B5VA 1KFWA 3U5YA 1OGBA 2F7FA 1UC5A 4JNMA 4FNTA 1SU5A 3LBMA 1VJIA 4FNPA 4ILSA 3EWDA 1XYAA 5G1TA 1P0KA 1YXDA 4IH3A 4PFMA 2H8XA 4ZQRA 5TBOA 1OFEA 2PU1A 5C6MA 1DQWA 1POKA 4DWSB 3M4HA 2XGIA 5BXTA 3EMQA 1HNYA 3H55A 2CLPA 2X41A 3C2OA 4YTQA 2QJNA 1QWKA 1X8FA 3HM7A 2I9UA 3GHUA 3W7JA 4Q8MA 3KRSA 3F1QA 3BO9A 1FWEC 3ONCA 1BQGA 1YX1A 1X38A 2BVYA 2V82A 3LYEA 2QCLA 1E0VA 5I0DA 5AHEA 3F4WA 3PVFA 5LSMA 3G1XA 5CZTA 4LGXA 4ECLA 3GVGA 2RGMA 2WJDA 3T81A 4HZMA 4R33A 2TYSA 4EWJA 1WPCA 1WP6A 2D69A 3DHDA 4AXKA 4UNIA 3W7IA 4YJ5A 1NJJA 2G41A 4LVBA 3PANA 3G8EA 3BW3A 2PDHA 2VZOA 4MB5A 1EZ2A 3BLDA 1GZ1A 1VEOA 2GJRA 2WKGA 4KRTA 1RY8A 1W9DM 4W9TA 3GYCA 3EMZA 4WHBA 3GFXA 3UPWA 1UG6A 2VQUA 1O4UA 4I8DA 2PZNA 4XZMX 3KE0A 2HWGA 3NQ7A 3QMRA 4PUUA 2QVNA 2FHCA 4U2YA 3HV9A 3ARSA 4MAZA 4J3ZA 3KDOA 4Q4PA 3AIWA 2HRWA 3DCPA 3N19B 3P8IA 1Z89A 3SCQA 1QXLA 4J3TA 3PZIA 2BY0A 3W87A 1PZ2A 2AQWA 3ZWTA 4FS9A 3PAOA 1QBAA 5H1WA 4AVNA 4NX5A 3E1F1 1VHCA 2EAWA 3WF4A 1EO7A 2V6AA 3PR2A 3VIIA 1KRMA 2OZTA 5ABEA 1DBTA 2PWHA 4W87A 1QI5A 2E9BA 3KBSA 2DSUA 3QY8A 2EF9A 4WDXA 2BGNE 2LLEA 3EOEA 5G4EA 5E0FA 1F3XA 3Q37A 2IMRA 2Q3RA 2VELA 1C7TA 3F2CA 4UQBA 3QLLA 1ISYA 3R25A 1LTDA 4RZ5A 3TAOA 4GK8A 4D6FA 1UWUA 2CETA 4IQLA 2PBOA 3IRDA 1C9DA 3FNDA 5KZMA 3WUBA 3N2BA 1WUFA 1XCWA 1UCWA 5EMKA 4GXPA 2FGLA 2ICSA 4DAIA 4IPIA 2UV8G 2OWWA 1E3XA 3DHUA 1TR9A 3MMWA 2WC4A 3N2XA 4JTDA 1W8GA 4U33A 3PG9A 3L68A 3ANYA 4KEVA 3ME3A 2NVCA 3UNTA 5FCZA 4UTWA 4AWSA 4IQDA 3W1PA 3ERPA 3UFYA 5EKYA 1B90A 5KZDA 1W1A1 1TV2A 2XN1A 3URNA 5CPSA 3CUFA 1W2VA 4L9XA 1V8EA 2A21A 4ZOBA 2R1LA 4I9AA 4O18A 3SIZA 1E72M 1GTHA 4NRSA 2CLEA 3GTIA 4MJZA 1G4PA 4XKMA 4XWUA 3R13A 2C0AA 3ZMRA 4B3KA 3N6HA 2ZDSA 2HS6A 4EOUA 4S3JA 4PRWA 1JCTA 3TKFA 2QV5A 1M3UA 2FJUB 1VIWA 4XUYA 3GNNA 1K7EA 4LCRA 2NWRA 3THAA 2TMDA 1UQZA 4O16A 4GBDA 1LLZA 5FSDC 2F2HA 1V02A 3VDBA 1ZS2A 2JKEA 1ZB5A 2HCVA 3IARA 5LNVA 1GG1A 5I6SA 7ODCA 5L9FA 3NPXA 4AB4A 3AYSA 1LG2A 2Y7DA 1A5MC 4AQLA 2J8TA 3KBNA 4Q7BA 4M0XA 4WRHA 3EZ4A 3FGCB 4PMJA 4Q3MA 4UB9A 5E6YA 4ZEPA 2J6VA 3UZXA 3TSMA 4YVPA 2QUTA 3W7HA 4C5YA 1FWAC 2D2JA 1TWDA 1P7TA 4ICMA 4JAWA 1E1EA 1JNEA 3B8TA 4EPDC 4B5XA 4UOZA 3KP1A 4XX6A 3UYIA 4DI9A 2JGYA 1XWYA 2A1YA 1VRDA 4G2DA 1NOFA 3PBMA 5DRIA 1MSSA 2XFYA 2C14A 3N25A 1OCQA 3IIPA 3QV9A 2PTZA 4RXFA 4IXXA 4PMXA 1X1ZA 1E0TA 2XGZA 4IMEA 4AIEA 1F73A 3CTLA 4R88A 5JXQA 1Z32X 1HQTA 3F2DA 4D1JA 1FOBA 4M29A 2XVPA 1SQ7A 1RZMA 3T44A 2JFEX 4DJEA 3RM4A 3FCPA 1FCVA 3LRLA 3DI1A 4GACA 3BTNA 3BJFA 3W82A 1AQHA 3I10A 1O68A 3PTKA 3ZFHA 3OBKA 2XH0A 5BROA 3VD7A 1CIUA 1CCWB 3P62A 4NKCA 5AN7A 2CIPA 3IK4A 1NDVA 4NU7A 3LQGA 1UKPA 2FLIA 4WJEA 3WDJA 3W76A 4A2RA 1VFTA 1FH8A 3AMCA 5CG0A 2H6RA 5FAJA 4DY1A 5HK4A 5EMYA 5C55A 1UPMB 2OFJA 1Q5MA 1RA0A 3KBMA 1JCXA 4MLRA 2MNRA 3W84A 2O4QA 5HA7A 1SO3A 3TC3A 3VXGA 1S5WA 3OBEA 5CSYA 1LOSA 3P6LA 5AHMA 3ZSTA 3A3XA 1QCWA 3G18A 2Q02A 4Q7NA 4C60A 3AAMA 3TNBA 5E70A 4JX4A 4HMDA 1F74A 2BWGA 4JYEA 1TJ0A 2YZRA 3HGJA 3NDYA 3REQB 4NRRA 1JRBA 4AEOA 3ABZA 4HNUA 3LTSA 1J0ZA 2B81A 3SURA 4FXJA 3NR0A 3CZGA 4IIHA 1ME7A 1A5SA 2VR5A 4PTWA 4WDUA 2ZUNA 1A53A 4YNGA 4TU1A 5BOEA 3W71A 4ROPA 3NZGA 2X0HA 4DLFA 3O0FA 4JN6A 1H60A 3FJ4A 2J62A 3C2VA 1YTDA 3VDHA 4AG0A 3V75A 3ZM8A 3CWNA 1C8XA 3URQA 1A5AA 1C90A 3B40A 3W6LA 3JUGA 3SUVA 1Z7AA 1OK4A 4W93A 3WO8A 4NY2A 2IKIA 3O6CA 3GSMA 3W7QA 3EPOA 3FJ6A 4LUTB 1UHVA 6XIAA 4FO4A 3QY6A 4NP7A 4QIUA 1Q2SA 4LU0A 1XKJA 2A3CA 4FIQA 4D9PA 2B4GA 3TTQA 5G2WA 3BMVA 4DWDA 4UUIA 2BMBA 2IUZA 4LPCA 2EG7A 5M5DA 4US5D 2OEMA 2ABBA 4YTRA 5TQLA 3TN5A 3T6CA 4FF7A 1R85A 2NQ9A 1HG3A 4IHCA 4HK7A 1VRXA 3B4YA 1ISXA 2NXIA 1CGWA 2OJPA 5ECUA 1TRIA 3CHVA 2VC9A 1XINA 3SRKA 5LHFA 3UR8A 5D02A 4ACYA 2VYOA 3TEVA 1LWHA 1J8VA 4G56A 4FLSA 4OOZA 4R53A 5I3HA 1CW2A 5I3GA 1ESWA 1FWDC 2V2DA 1ITUA 3EWCA 2XZ9A 2XWEA 3BC9A 4FIRA 4MLJA 1ONEA 4JTTA 3MP3A 1FWTA 1QI0A 2XHYA 1RQHA 1VYRA 3Q65A 3TAKA 4XUGA 4AU0A 3ELFA 3GTFA 3CYVA 4GQRA 2VMFA 2FDMA 4IMCA 4ZE4A 2G50A 3G0SA 3OVPA 2V81A 4JX5A 1QR7A 4PUEA 5DEZA 2ZX8A 4JTSA 2E28A 5EBUA 7XIMA 1V03A 3KS6A 4GI9A 3M41A 4O0ZA 2FH6A 4F3HA 3HGRA 1XLEA 1E3ZA 4LUSB 1LL7A 3I7RA 4ERIA 1PKLA 4D8ZA 3A3WA 1XLAA 4UFKA 3MCMA 3A13A 3GU9A 1VFOA 5DY3A 4DXXA 3NVDA 4F0RA 3PUDA 3WH7A 3W37A 1WXYA 4B2DA 1B3ZA 2WOQA 3UXIA 3YPIA 3MCOA 1YQ2A 1M5WA 4P7NA 3T40A 4UTFA 1LLOA 1GOWA 4YYCA 5AVHA 1HKWA 1RJRA 4YWIA 3MY9A 3H2NA 1LQ2A 1H11A 4QNWA 3K46A 4UQDA 1MO0A 1HL2A 1PIIA 3UWQA 4XBJA 4KFPA 4TMBA 3O15A 5D38A 1E9YB 1IR2A 3CWOX 3FAWA 3WUFA 3MUY1 2D24A 4DNMA 3OHMB 4O10A 3WBAA 4QSHA 3WQPA 4LVAA 2FVKA 4PSRA 4XK2A 3QHOA 3FXYA 4IT1A 3CQJA 5MKGA 2IPFA 3S2NA 1OC7A 1RUSA 1S39A 4RDVA 1KD0A 1YXCA 7TAAA 2FVMA 4UTIA 5CLTA 3AHZA 2WHMA 4RW5A 4F4RA 4ZQNA 4LUJA 3S2MA 3GB6A 3U3HA 3C3NA 1XIDA 2CZ5A 3LHTA 3QZAA 3KLLA 3OHIA 3VOJA 2X09A 3GU2A 3CPRA 3LX9A 1CENA 1OYAA 1GYMA 3DFYA 4JS3A 2XIMA 4MM1A 1EIXA 1MUWA 3G1FA 1PIGA 2A5HA 4IGHA 3MPGA 3Q94A 1O60A 4EVZA 1SFSA 4KWUA 5D33A 4AHPA 1XDLA 3E2QA 1TPC1 4NASA 1HF6A 2BASA 2WWCA 4LAUA 1UA3A 2O92A 3FVDA 1V7AA 4IFKA 1E5NA 4PODA 2XM1A 4PUNA 5EFDA 1XG4A 3RM8A 5AC4A 1XIMA 2P1FA 3NPVA 3M7WA 4HYRA 1R2TA 1EGMA 2R94A 4ZMGA 4NNBA 2VKZG 4RV3A 3OQ8A 4NAFA 4M1BA 3W23A 5BNKA 3UG5A 3GLCA 3W7PA 4NVTA 4AHOA 3GVVA 4QG6A 1LDCA 1POJA 1JXJA 1SJDA 4TVDA 1KR1A 4GWEA 1O7AA 4KT2A 1GUVA 1O5XA 1EEXA 1BGGA 4C6CA 4EF8A 1B0IA 5BOOA 2XPKA 1UH3A 4G7EA 4E8CA 3PB0A 1O95A 4LOCA 3VD5A 4MWAB 3WIJA 4D8AA 5CPOA 2E1WA 1E4MM 1C8VA 1GGOA 4PMOA 2W5FA 1P5BA 7REQB 3B06A 3QR0A 1VPYA 3P81A 3VM5A 2OZ0A 2YLAA 1IT8A 3GBDA 1E4LA 4ONVA 5BRBA 1NWTA 3VINA 4M24A 1YPFA 2FZNA 2ZA1A 2WHJA 3UP8A 5XIAA 4GY1A 1EF2A 1CEOA 2GFTA 1A5KC 3G24A 2CYGA 3TYBA 3B8DA 2YW3A 5M1TA 4Z2KA 2XVGA 3ATYA 1E6XM 2W79A 1NFBA 4AY7A 1CYGA 1OINA 5CC5A 4QHRA 1ZHAA 3UJEA 1CX9A 4H1ZA 5I09A 4XSMA 3AS1A 1VBRA 1ZTVA 3WLTA 4N0RA 4IMGA 1K1DA 3OZYA 4Y90A 4BY3A 3JVAA 3SZ8A 4YCPA 4ZOEA 2QCDB 3P2VA 1FWCC 4P7RA 4LAOA 2NLYA 7TIMA 3KEHA 3MUIA 3FJLA 4QGCA 3VNZA 4Q8VA 3ABSA 1TFVA 3ITVA 4C6MA 1ZP4A 4Q4MA 1E4IA 2BVDA 2XYLA 4HPGA 4WKFA 3DU0A 4FPSA 4GUFA 3W29A 3S5YA 4H2HA 6REQA 2J77A 4RXGA 1LWJA 4JGDA 5FKYA 1K8ZA 2GJXA 2WB5A 3UPBA 1XRTA 3E0LA 3T2OA 3PP7A 1I60A 5FIPA 3SGZA 5EL1A 4E2VA 4E5TA 1DIEA 4XAPA 1A5CA 3QV7A 5I78A 1UH2A 1W5QA 2YL6A 4JTCA 3DFTA 4XAFA 3HURA 4NI8A 3VI2A 2GUUA 5CSUA 4GC3A 2J6XA 2W62A 3LGDA 1UBPC 1QOQA 1GYNA 3TW9A 2PB1A 3WQOA 2Z0IA 1SZEA 5I24A 2ZFAA 2V63A 2Z00A 1OT1A 3V5CA 2CESA 3NQMA 3BE7A 1LBFA 3N34A 1WX0A 3EX4A 2WWDA 1YRRA 4KWSA 3VCCA 3IWPA 3WN6A 1L8NA 6ALDA 4AEEA 1M7PA 4LXFA 1ONRA 1BWLA 3UZZA 1H62A 1UROA 4UWMA 4KCVA 3TQ0A 4XAYA 3M5XA 4C6PA 3GC5A 1PCWA 5K4XA 2ZC8A 5D9NA 2ZKMX 4E3TA 4EACA 3BLIA 4QE5A 4IWWA 4NILA 1OM0A 1ZAJA 2Z6JA 3HOJA 4N7QA 1U33A 1TPUA 3CH0A 3MJMA 2CWXA 5CGQA 4J7RA 3ZLGA 3F5LA 2DZWA 4FZIA 3LCHA 1RLDA 4W8BA 5DXXA 3ITOA 4LWWA 1Z8AA 2G97A 3I7SA 1EGVA 1YXYA 2PTYA 4WKAA 3MKVA 4WK9A 5C70A 2EJ1A 2QPSA 4O28A 3TROA 1WA3A 4Q4QA 3BOFA 5HINA 3O6YX 4JQ3A 1OGSA 1UD8A 3V7PA 3WBYA 3CC1A 4E4PA 3DFNA 1BYAA 3CU2A 2DY3A 3VKDA 1EWDA 3WMBA 5D2VA 1XIBA 2GGGA 4GX8A 3VZZA 3UZWA 3HIJA 3TSDA 1OT2A 3SRFA 3ALFA 4AD3A 1SPQA 1I2PA 4GNJA 4JD4A 5LZLA 1XISA 3EB3A 4GUGA 1JI2A 1A0DA 3M6DA 2IQDA 4AZ5A 4PMQA 2NX9A 1NAL1 1R3RA 3GD6A 3CPGA 3CIWA 4GO8A 4HB7A 2XH2A 5HMFA 1GZJA 3MQTA 1H7XA 3QHMA 1GOQA 3H26A 4M6VA 2YDQA 1TV4A 3W86A 3UA4A 3KOWA 3DESA 2BOFX 3M5YA 3UXKA 4KFOA 3LB0A 2CXEA 2CPUA 4L4LA 3H2FA 4KCTA 1XIFA 4E4FA 2XJ7A 6CGTA 1S2CA 2A85A 4LQ1A 4GH1A 3NL2A 3N3MA 1PHQA 1KV5A 3UVAA 2RUSA 1ZJIA 1VR6A 4LRTA 3VE9A 4AVOA 3P3BA 4GH3A 3VE7A 4NX0A 4U3AA 1KM3A 3PZMA 3A24A 3GW3A 1CB7B 4S3GA 4P61A 3NTYA 5ABFB 5CSRA 4OGZA 3RDKA 2ZUMA 3FDGA 3NL3A 2WVUA 1OEPA 2Y7FA 3B0PA 5D2YA 3PPGA 1JYXA 1HKVA 1JDCA 3W0KA 4LS2A 1GW9A 2FKPA 3IIZA 4UCFA 2CW6A 3V0UA 1VCVA 1B3VA 2GPTA 3RO8A 2WANA 3R0UA 4INFA 4FR6A 4PCFA 1HGYA 2ZXAA 3J7HA 4R7WA 2AGTA 2XFFA 3V36A 3KCOA 5I07A 5E93A 1X1NA 3GNXA 3ZR4A 2ACUA 3TOYA 3CB3A 1TUXA 1UUQA 4J4KA 5D9OA 3XINA 1EQCA 4UTJA 5LNRA 4ZSTA 1KFLA 3E12A 4OBRA 1RCOB 4YTSA 5J8LA 3VKCA 1R6WA 1XQLA 3ZLHA 1NQKA 3LI1A 1GONA 1V3MA 2B7NA 3G5EA 3AMGA 1XLJA 1NELA 2CHOA 3SN4A 5A6AA 4JYFA 1Z42A 3UY8A 3CH9A 3WQWA 4HJFA 3ITLA 2V30A 3VIMA 3UG3A 3RR4A 3DHFA 3AIBA 2QEZA 2QUVA 3G1YA 3RM9A 2XSBA 1LBMA 4C6JA 4MG4A 1NWRA 4IP5A 1UR3M 2AGKA 4HPNA 4ZL1A 4RNJA 4HJWA 2WV8A 4HSHA 1OC5A 4O53A 4IFOA 4JQ2A 3U4AA 3SJNA 5IBXC 2VX5A 3LHWA 4ASTA 4AF0A 3V0TA 2VURA 5DO8A 5GJNA 1SFJA 3HGOA 2JALA 3IGSA 4JTJA 1UUOA 1HKJA 3P5ZA 3AOFA 4MKSA 3CJPA 3KUMA 5A95A 3AIRA 4KF1A 2OO0A 4ZOCA 3B9OA 1MW0A 3U6WA 3H4WA 3T08A 3RILA 1KFJA 2G4FA 3PPHA 3NPUA 2OEJA 4ICNA 3O7UA 2GLKA 1DXIA 3LCGA 1UC4A 2WZIA 1LCOA 2C1HA 1XIEA 5K9DA 5SWUA 4UFJA 4Q8OA 1M6JA 3RX2A 3G2GA 1W2PA 1X6NA 3ITYA 3MJYA 1EO5A 3BXWA 1QVBA 3NM3A 1W0MA 2P50A 2AMXA 4JN7A 4TTGA 3BG5A 3RPDA 4J28A 1R8LA 4EPBC 4F0HA 1JUBA 1WUEA 1W9PA 4YHEA 4AZCA 1YDVA 3JU2A 3QQWA 3LOTA 3RJXA 1XC6A 3P7YA 3OIHA 2CC0A 4KCWA 1TTJA 1IEQA 4KCUA 2GGJA 4ES4A 4C1KA 1A80A 2PF8A 3NXLA 5HAOA 1EDGA 3PZTA 3T8LA 4JICA 1FCQA 1ZENA 4WDWA 3GNOA 2PGRA 2J13A 1ZCOA 4KW2A 2FMNA 4X63A 4JN8A 1R87A 3NQFA 3W4RA 3THCA 5DLCA 1RQBA 2R91A 4MB1A 1QBBA 3T0DA 1PDYA 1RD5A 4MVAA 3T8QA 3OYXA 4A8RA 2CXGA 1JYWA 3MHUA 4ZENA 1BVWA 3G1RA 4H83A 3PJXA 4NAEA 4YYFA 1BGAA 4GQQA 1MRAA 3BZJA 4NT0A 3W2JA 4RE0A 3A4JA 5EMJA 3K1GA 4J2PA 3T42A 3LV6A 5I77A 4FA3A 3UZJA 1JQXA 3PUOA 1V3JA 4DPQA 1LRQA 3OP2A 4O52A 4Q6XA 4GNVA 3TR2A 1UQYA 3R79A 5LGXA 2NQZA 3NDOA 1IEVA 4MNMA 5I03A 2ZWYA 1ODZA 3VZYA 1ISVA 1SGJA 1H41A 4AVFA 4W89A 1Z9AA 5CBIA 1WZMA 1JVNA 4LSBA 4J5NA 1DWFM 3O3RA 2QF8A 3TC6A 2YCLB 4GUIA 2EPLX 2TPSA 2FHFA 3BL3A 4PRTA 3R58A 5D2WA 2I7GA 1MXSA 2WAGA 3E49A 2CZEA 3RU6A 1EHAA 1UD4A 3SIMA 1SO5A 2FH8A 1AMYA 1R3VA 3VD4A 1XD1A 2HZGA 4UTTC 1AQ0A 2DJLA 2J24A 1KFEA 2Q3OA 3WLOA 3I3EA 4QRNA 2W66A 4H01A 4EXAA 3UEQA 1TCMA 1IT0A 3GKFA 3L0KA 1JRCA 3VU2A 1C9WA 1NDZA 1K8XA 1PEZA 4Y9NA 3QOMA 2OX1A 3U8GA 3BSGA 3S5SA 1OWQA 3S9YA 3PAJA 3BLKA 3M6YA 1CI1A 3LRMA 4R7JA 2ZWZA 3TWAA 3FOKA 3WFAA 1KWGA 3AJXA 3AMKA 4W8AA 2PDCA 1AQMA 3D6NA 1XBXA 3AISA 3BWWA 3EX3A 3GHRA 1OCNA 4H8HA 4PMZA 9RUBA 3T2QA 5GNYA 4ZODA 4EAMA 1OX4B 3U5UA 1K9DA 1VFMA 4M56A 1MZRA 5FSEC 3U7VA 4PEKA 4XZ9A 1JF6A 2H9AA 2QGYA 4CCEA 2WSPA 1FKXA 1YPXA 2ZXBA 2V2CA 3PHAA 3BG9A 4Y2WA 3M5VA 1K6WA 1R30A 3ARVA 3ARQA 4WLCA 1NM9A 2BX7A 2Y5SA 3QC0A 2O9OA 4H6QA 1K03A 1P1XA 2G96A 3RR1A 4DJED 1DJHA 3R4IA 5A2BA 4XO6A 2YFOA 1JPDX 3M0IA 2GUYA 2XTKA 3BSMA 3HGSA 5D37A 3ANVA 3LCLA 4IIGA 4NQ1A 2DDXA 3VIOA 4FX7A 1MW2A 4OJYA 3W2UA 1TE6A 1X98A 1FBAA 5C5YA 2OYMA 4HOZA 1H61A 4K39A 2A3HA 2O9TA 4GIAA 3CGTA 1I2OA 3S46A 4CN1A 4GYFA 4P8WA 1FCBA 1JCMP 5CC6A 3KBVA 2X2YA 2O4MA 4RR4A 3F2BA 3MSDA 4KEZA 2XFRA 2YB1A 3VMOA 2ZX6A 1FH9A 1GQKA 3ARWA 3AXMA 1P1MA 3MP5A 3PB2A 2VRKA 1OC6A 1KXQA 1AG1O 1BPLB 2H3BA 2PAJA 1V6YA 4LYKA 3COTA 4X0NA 1FDZA 3BAJA 4G5DA 5E09A 1WCGA 2OT1A 1HO1A 5IFPA 3GXMA 5FACA 3USZA 3AZSA 3UJSA 4TVUA 3B05A 2J7FA 1CPUA 1PDZA 5CEWA 3KRUA 1W8SA 4QXIA 2BHZA 1ML1A 2IXUA 4C91A 3H2EA 4PMYA 5IRPA 1VLWA 1QTWA 2PA6A 4HHLA 1LORA 3UWEA 2ISFA 1LT7A 3N17A 2CU0A 4HTYA 3LHYA 1S5TA 1QUMA 2DZVA 4LW7A 5BRQA 9XIMA 4OUIA 1Q6QA 3S2LA 4BF7A 3IV8A 4Q4SA 1MEIA 3LERA 4CVWA 3E0WA 3VFLA 2DV0A 5CXPA 5REQB 2WSYA 2Q8XA 4ZA0A 3QMSA 1EJ7L 3PG8A 1LRNA 1L6FA 1KLZA 1PL9A 1WDPA 3RRXA 1I75A 4HPXA 4HVXA 1ZJHA 3TYUA 1US3A 2FZMA 1E73M 2GJLA 3C3UA 3ISIX 2R8WA 3VTRA 4RDZA 2DZBA 1MNZA 1MQQA 5C9UA 2FFIA 1R3QA 3UG4A 4XZHA 1C93A 1DJNA 4F8XA 2YBUA 1VFHA 2PFHA 2D0FA 1XDJA 3NQEA 5FOOA 3EDEA 1ONXA 3TTEA 3I65A 3G1AA 3USBA 4N9BA 2G3NA 2P0IA 4F0SA 4YMZA 1XSKA 4CQ9A 4RNHA 3AO0A 2C13A 1XS2A 2W91A 2JEPA 1XGDA 3G77A 5DN1A 1SZGA 4UTLA 1TPDA 2V2HA 4HOWA 4XKYB 1XGEA 2VEFA 2FB2A 1JQVA 4N9EA 3LS9A 2E1DA 1E1CB 1XRSA 3OLEA 2VX6A 1XXXA 1HT6A 2W9MA 1FCUA 1EUNA 4YPJA 2NVAA 4FR1A 3B8SA 2OYKA 4G8TA 3L4TA 4R7OA 1XD0A 3PBYA 1B3WA 5KZEA 4PTNA 4RJEA 1S5MA 1H50A 1W1ZA 5I2UA 2UY2A 1GVRA 4TX8A 3WK0A 2CCRA 1CT5A 3NO5A 4RNFA 3HFTA 1S2WA 2WMHA 3GDLA 4MGGA 4HPJA 4PH6A 4DUVA 1MFVA 1UD3A 3FEQA 4BZYA 2QJGA 5JUVA 4PZVA 4FALA 2JK2A 2YPIA 3FYYA 2VDIA 4CQDA 1N8FA 2PDMA 1WOAA 4FEZA 3QSRA 1FRBA 5K7JA 1C7SA 1VENA 4LS0A 4F66A 1EIBA 3GNPA 2SFPA 4DJDC 1Q13A 1DIDA 2PRMA 1XKYA 1RJQA 1YE4A 3HG4A 3O63A 2I17A 4ML9A 1PYMA 3VGDA 5K9XA 4D6HA 3BGGA 4R85A 5EA9A 3B0XA 2DH3A 5F1UA 2D1ZA 3VIFA 2W3ZA 4B90A 1F6KA 3AICA 3MMDA 2E5CA 4PMVA 5TAOA 3L21A 1R9ZA 1QI4A 1VKFA 2ASHA 2JQXA 1F3TA 2PTWA 4JQ1A 4B2DD 3L12A 3N73A 1YW1A 2GVLA 3G1HA 3WD1A 3S9IA 5KTLA 4NXSA 3QYQA 5AYBA 1KRBC 2BDQA 4S3KA 1IEWA 1WO2A 1Z69A 3CQ0A 4L4OA 2YSWA 2Z28A 4LH8A 1T0OA 1C8QA 1RBAA 3KZSA 4EX4A 2QQ6A 3WNOA 4H9UA 1GZGA 1KTCA 2QW5A 1EGZA 3OO2A 4XZBA 4F79A 3LNPA 2YDSA 5AC7A 2HTMA 2XVNA 1EEPA 1G6CA 2D2GA 5AHIA 4LJ3A 3P0XA 4WY0F 3UETA 2YIHA 4S3FA 3GR4A 4ZE5A 3WK1A 3GR7A 4GVGA 4IPPA 2ZVIA 1AL8A 2NWSA 3BMXA 3M46A 3PZQA 1WKFA 3P93A 4C6QA 2E5DA 2PDFA 2WNNA 4ADSA 3PJUA 4IFRA 1S2VA 2J9YA 3LHVA 5FD0A 2ALDA 2REQA 5A6SA 3MI6A