3AHYA

Crystal structure of beta-glucosidase 2 from fungus trichoderma reesei in complex with tris
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
465
structure length
465
Chain Sequence
MLPKDFQWGFATAAYQIEGAVDQDGRGPSIWDTFCAQPGKIADGSSGVTACDSYNRTAEDIALLKSLGAKSYRFSISWSRIIPEGGRGDAVNQAGIDHYVKFVDDLLDAGITPFITLFHWDLPEGLHQRYGGLLNRTEFPLDFENYARVMFRALPKVRNWITFNEPLCSAIPGYGSGTFAPGRQSTSEPWTVGHNILVAHGRAVKAYRDDFKPASGDGQIGIVLNGDFTYPWDAADPADKEAAERRLEFFTAWFADPIYLGDYPASMRKQLGDRLPTFTPEERALVHGSNDFYGMNHYTSNYIRHRSSPASADDTVGNVDVLFTNKQGNCIGPETQSPWLRPCAAGFRDFLVWISKRYGYPPIYVTENGTSIKGESDLPKEKILEDDFRVKYYNEYIRAMVTAVELDGVNVKGYFAWSLMDNFEWADGYVTRFGVTYVDYENGQKRFPKKSAKSLKPLFDELIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-glucosidase
publication title Structural and functional analysis of three beta-glucosidases from bacterium Clostridium cellulovorans, fungus Trichoderma reesei and termite Neotermes koshunensis
pubmed doi rcsb
source organism Trichoderma reesei
total genus 187
structure length 465
sequence length 465
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ahyA00
4L4OA 5JBEA 4BCEA 2E0PA 1ZBCA 2OSYA 3PTMA 1JAEA 4MB5A 3RILA 3AOFA 3A4XA 3T0AA 2YDQA 4TVUA 5FL0A 1JNEA 3CZ8A 3APGA 2XG9A 1VEPA 2EBNA 3CUFA 3CLWA 1BG9A 2VC9A 4IUGA 2WYSA 3AYRA 1E6QM 2VVSA 3AMGA 4C7GA 1UH4A 3POHA 2XFYA 3DYMA 5HXMA 4BF7A 4MAZA 2WVSA 1IV8A 3VOCA 4HA4A 2F61A 1K6AA 2DT1A 4FLQA 3WNLA 4V27A 4Q22A 1QI4A 1CTNA 3WFZA 4Z2LA 1BQCA 4YHEA 4UOQA 2OYLA 1E72M 1LQ0A 4UFKA 3WDRA 4PEEA 4W88A 2PWHA 2V38A 1GVIA 1W9DM 3WH6A 3ZO9A 5A2AA 5I0DA 4AWEA 2JF6A 2NSXA 5E0FA 1WZMA 2X0YA 5GPRA 3N11A 1N82A 2WZHA 1C8XA 3ARWA 4TTUA 4PMRA 1QBBA 4KMQA 3EMCA 5F7UA 1X6NA 3NSNA 1CBGA 1NWRA 2ZXDA 4CKQA 4JFWA 2XJ7A 1MFVA 1J01A 1ZL1A 4V2XA 1PPIA 2XPKA 3CTTA 3WQ5A 2XUCA 4ZENA 5CPSA 2GDVA 1LWHA 1D3CA 4UQDA 1QI3A 1B3VA 4EE9A 4HU8A 4E4PA 4JL1A 5HOSA 5E6ZA 6CGTA 2VVNA 1HJUA 5JIWA 1C7SA 3OZPA 7A3HA 3LPFA 4GI9A 2X1IA 2X09A 5M3WA 5EBAA 3DC0A 4PYSA 1CXEA 2A3EA 2XVKA 1W3LA 4W7WA 1V03A 4CUCA 4PRWA 1AQHA 4AD3A 1JZ8A 1DWIM 2ZX6A 4J3SA 1ECEA 2CESA 3QOKA 3PN8A 1HVXA 2BNJA 1W9XA 1EGZA 3SUVA 1E1FA 1XCXA 4URIA 3SCTA 2BXZA 4MAVA 2WAGA 1U30A 2DT2A 4QCFA 2W91A 4BQ2A 2VQUA 3VM7A 2GUYA 1W32A 3F5KA 5A2CA 1V6UA 4XX6A 4D6FA 1V3JA 1HJXA 2FHFA 3AIWA 3PZQA 3OIHA 4F9JA 2Y2WA 1FP8A 4ZXOA 1SFSA 1FOBA 1W9BM 2Y24A 3WENA 3WD1A 3GZAA 4HMEA 1XYZA 1UA3A 1V02E 3MKKA 2NT0A 4ATDA 4JFVA 1OIFA 1WDSA 1UH2A 3SCSA 4P8VA 2PWGA 4W85A 3KE0A 1UD3A 3AS3A 4HA3A 5DMYA 1UD2A 1TA3A 3WDPP 1JDAA 2EO7A 2WLYA 3N15A 1W1PA 1ZBVA 3TTOA 4H8VA 1PX8A 5TD4A 4TVCA 5A6BA 4JCLA 2HISA 5IXEA 3KWXA 1D2KA 3IJ7A 4AYSA 1VRXA 1TA3B 1E6PA 1JI2A 3MUIA 4UCFA 2XVGA 3VGGA 2X2YA 5D9OA 5C70A 3BLKA 3WEOA 1SMDA 2CERA 3CMGA 5JBFA 1J10A 3IAPA 3PBGA 3OBAA 1MW1A 2J77A 2Y8VA 1ESWA 1R87A 4LPCA 3VIGA 4MNLA 3FHAA 3G6LA 3WF2A 4J3XA 5GNYA 4PTWA 1WNOA 2XTKA 1BAGA 3W82A 4W7VA 2BFGA 4KH2A 3DHPA 4U3CA 2BHYA 2CCRA 2IUZA 3MV01 3WUEA 2G3JA 2JE8A 4AD5A 1TVNA 4K68A 4J27A 1G1YA 3WBAA 3M07A 3ARYA 1FP9A 1TZ7A 3SEPA 1CEOA 1CGVA 2E9BA 4OBRA 4KGJA 1F4HA 4TOQA 4RL3A 4KRTA 5CXPA 3WDIA 1KGWA 2NW0A 1CPUA 4D6EA 3PZMA 2ZUMA 3NUKA 4PSPA 3CHDA 1B3XA 3AXXA 1QNQA 5I2UA 3WDJA 3SUUA 5LYRA 5E70A 4MNKA 4AXNA 4M29A 2GK1A 3VD5A 1V3IA 4D72A 3M46A 4PSRA 3AIUA 1JZ5A 1MYRA 3GNOA 1KXHA 4GXPA 4PBGA 1BGGA 4ACZA 1E0VA 1LF1A 2GK1B 5M5DA 1UR1A 2CIPA 4AD4A 2ESCA 1DWJM 5I77A 3L4VA 1WDRA 4F9DA 4D6CA 3W0KA 4HOXA 2W63A 5EB8A 4EANA 3ZJKA 1QI0A 5HPCA 5BXTA 1GOWA 4ACZB 3WF1A 5BCAA 1E6SM 4PTXA 5I24A 4CVUA 1EHNA 3VIMA 1X1NA 4HZ7A 2WVTA 5AC5A 2BY1A 4UOZA 3BAIA 5EFDA 5E9AA 1V0NA 1UKQA 4JHZA 4MTVA 5DFAA 4H2CA 1VFOA 4HPHA 3FY1A 1UR0A 1BYBA 2V3GA 5E0CA 4CU7A 1JL8A 5BROA 2VZVA 1NWSA 4Z2KA 4ZE4A 1KGUA 2W66A 1MQPA 3VO0A 2VZOA 1LG1A 1MXGA 2ZUVA 1OIMA 1NOFA 1J0KA 1HX0A 4QLKA 5AC4A 1GONA 1DEDA 4GZEA 4QLLA 3SCVA 2WBKA 3WIJA 2EPMX 1G01A 4XV0A 2J8FA 3PZIA 3GH5A 3ZT6A 3BSGA 2BV9A 3FHQA 5CGMA 1R85A 5FL1A 4U5IA 1BPLB 5D9PA 3THDA 4PTMA 3I3EA 2WCAA 4W86A 1UWRA 4D6GA 3AXHA 3BH4A 1WDPA 4GO8A 1B3YA 1VF8A 1E3XA 1MQQA 4LYPA 2PI6A 5DO8A 1GJWA 2VX7A 3T09A 1H09A 4ZXLA 3VU2A 2J25A 5CSUA 4A3HA 3ZR5A 4YHGA 4QCEA 1I1XA 4YPJA 1JYNA 1KCKA 4CVWA 1E4LA 1B31A 1I1WA 1VEOA 1RPKA 1CZ1A 1EDQA 1QOXA 1E40A 4P7NA 2DIEA 1EQCA 4C7FA 5FIPA 5A95A 1CGWA 1VENA 2FHBA 3EDKA 4HMCA 1YQ2A 4GQRA 1EH9A 4PMUA 3KEHA 1CIUA 1B0IA 1CXKA 1GCYA 1JYVA 2RGLA 2XIBA 1UKOA 2GFTA 2J78A 3VVGA 3WNPA 5A6LA 1JNDA 3ARZA 3NYDA 4D6JA 2C8NA 2PBGA 4UZUA 1GOIA 3LPPA 1ITCA 1R8LA 4HOWA 2VX6A 1UA7A 2CBVA 5A3HA 4MNJA 2XFRA 3VX0A 4FLOA 4OOZA 4OOUA 2O9PA 1W2VA 4ML4A 3BAKA 1XSJA 4PMQA 3O9NA 3WEZA 2X0HA 1E1EA 4D6DA 3S6TA 3TOPA 3WF0A 3OLIA 4QDMA 1BG4A 5CSYA 1FH8A 4MJ2A 3ZOAA 3GXMA 1FFQA 1E9LA 5LA1A 3NSMA 1QNPA 1CXFA 3AIEA 2QV4A 3N1AA 1E4MM 3BAXA 4W93A 1JF5A 5BXSA 1V0KA 1EIBA 3NIYA 1E6RA 1FHLA 4TUFA 5ABEA 1OBAA 8A3HA 3VIIA 1W9VA 5BXRA 4IPLA 1SMAA 2VCAA 2MANA 1WAWA 3EDDA 4OIFA 3CIVA 1W3JA 1UWUA 2XIIA 5D4YA 1BSIA 3OGRA 2YA2A 3T2OA 2WHMA 1QI5A 1EOKA 2D23A 2CITA 2W61A 2ZUNA 5EMYA 4RE3A 2G3IA 2PWEA 2XGBA 4AISA 1PEZA 3FXYA 2FH8A 1ISYA 2PB1A 3NDYA 2VTFA 3AISA 1ZB5A 2VRQA 2J4GA 1V3KA 1WO2A 3EBVA 1BYAA 2VL4A 4U33A 1UG6A 1H5VA 4UFMA 4XB3A 2WLZA 3MMDA 1EHAA 2O92A 1NOUA 3RPMA 1HJSA 3VMOA 1E6XM 3AI0A 1TR1A 2DGAA 3T0BA 5GNZA 4AZIA 3T2PA 4P7RA 3OA5A 2X05A 3A4AA 3OGSA 2VOTA 1GHSA 5IDIA 1UR4A 1CLVA 2J74A 2IXUA 3OB8A 1ZS2A 2XWEA 1MW0A 3W6LA 4L4PA 2CNCA 3GYCA 4N0RA 3U7BA 3A3HA 4B3KA 1CGTA 1KR0A 1QNRA 4UFIA 3NDZA 3GM8A 1VEMA 3WEMA 1ZJAA 1US3A 1TFVA 6A3HA 3AQUA 4U2ZA 4H8HA 4PMOA 4W8AA 4P8WA 1W3KA 2DSVA 3ALFA 5ECUA 4PCSA 1WKYA 4HA1A 1EA9C 3TTSA 3VNZA 1CYGA 1KXQA 4X0NA 5DT5A 2CBJA 1UQYA 3THCA 3PTQA 3ZR6A 3TTYA 5CG0A 1H0IA 1J0ZA 1BGAA 2XGIA 4BQ5A 1HKMA 5GNXA 2D0GA 3RM4A 3DYPA 3GNPA 1LWJA 1JZ6A 5C71A 1BFNA 1J12A 1H3GA 2WK2A 4NZCA 2WC7A 3VPLA 4AEEA 3A4WA 3WQVA 4X9YA 2WHJA 2QPSA 2UWFA 3FN9A 3HMCA 1S46A 1GJUA 3MSDA 2WM0A 1H2JA 1JD7A 4LYRA 2OWCA 3AIBA 5I23A 3W29A 3CUIA 3MU7A 1VFUA 1R7AA 1VBRA 2W5FA 1V0MA 4Z2JA 1RP8A 4W5ZA 1HJQA 3VILA 4EKJA 4FF5A 5DF0A 1PBGA 5JIPA 1E0WA 3A6OA 1XSKA 1OGGA 4DUWA 5IFTA 3L4TA 4UTFA 1NOWA 1ZU8A 2DT0A 4ACYA 1OGSA 2ZXBA 4W8BA 2DPEA 5A8QA 1UZ1A 4P7OA 2V3DA 1LJYA 1PX3A 4AIOA 2V5DA 2VURA 2QF8A 2BY3A 4B9ZA 4AZBA 3N04A 1UKPA 4AZHA 2G3NA 2WMHA 2WNWA 1OCQA 1WCGA 2VR4A 1W91A 1EDTA 3WY1A 3KL5A 4UQEA 1V6XA 2WPGA 3OGVA 5IHSA 2WC4A 4Y7EA 3MMUA 3MSGA 2D0FA 2CKRA 2YA1A 4H7VA 5BYWA 4M80A 1J0YA 4GIAA 4GI6A 2G3MA 4AIUA 4WSKA 2TAAA 2OWWA 1VBUA 2WC3A 1CNVA 2E40A 4CD5A 2OLHA 1OSEA 3BC9A 3HJEA 3ARXA 1LL6A 4BZYA 3VIKA 3WD0A 2WMKA 5E6YA 1XH0A 1U2YA 4P7LA 1YHTA 1NWTA 2ZICA 1ISWA 5LA2A 3F5JA 3B8SA 4ATLA 1B30A 2BY2A 1KWGA 4HU0A 4MNMA 1HJWA 2YLLA 2XYLA 4PMNA 2C7FA 1XH2A 4W5UA 2WANA 1GW1A 1NQ6A 1OT1A 1GOOA 5ABHA 4JCMA 1L0PA 3SURA 3VIJA 3VGHA 4BQ3A 1WP6A 1B3ZA 4U2YA 5FKYA 2Z1SA 3OLEA 1KGXA 4S3JA 4GPNA 5ABFA 2VT0A 1G94A 2WMFA 3FW6A 2DT3A 3VKKA 1RD6A 2VRJA 3BGAA 3W27A 2EQDA 5D9MA 2W62A 3CZLA 4P8UA 2UY2A 1G9HA 4V28A 2XHYA 1B90A 5ABFB 1US2A 4TXEA 1OD0A 4HPGA 3WH7A 5AYIA 1UWQA 5A6SA 5D9NA 4NF7A 1GZJA 1WZKA 4A3YA 1V6YA 4ZE5A 1K9TA 4LX4A 2BS9A 1FH9A 2E9MA 4PMVA 1B2YA 1UR8A 3CZKA 1VJSA 1DWHM 2YL5A 3QGVA 5IFPA 4FMVA 4IPNB 4AW7A 1TMQA 1PZ2A 4XUYA 1H4PA 5A8NA 1C7TA 2J7CA 5D8ZA 1Q6FA 1GVYA 5CQ1A 3ZIZA 3HN3A 4GINA 2J7GA 1H11A 4DM1A 3L2MA 4NI3A 1J11A 4AD0A 5I5RA 2D3LA 2VZTA 2VCBA 1FHDA 4YN5A 3ARVA 1EDGA 4AZ5A 2YJQA 2WKGA 2ZX8A 1JDDA 4AC1X 2XVNA 2O9RA 1DTUA 2VMFA 2PBOA 8CGTA 1ODUA 3GDBA 1Q6EA 3ARUA 4D6HA 4PUDA 4WKHA 2CKSA 3TONA 1WDQA 1Y7VA 2D2OA 2DSKA 3CHEA 4JZ5A 3WF3A 1MFUA 4PMDA 3WELA 3BSHA 4J3WA 3WN6A 1DWAM 4RE4A 3WMBA 2DH3A 2VI0A 3CMJA 3KZSA 3D5HA 1HL8A 2ZX5A 2J7BA 3QHOA 1KB3A 1JXKA 3SCQA 4CD7A 2DH2A 2WKLA 3S2CA 3T08A 2G8ZA 3VNYA 3AFBA 1KQYA 2WSKA 2ZUSA 2BHUA 2F8QA 3M7SA 4CD8A 1BTCA 4CD6A 2WWDA 3VGFA 4WK9A 3U5UA 4J3VA 1J9YA 4CN4A 5FCZA 3KL0A 7TAAA 2Q8XA 1HKKA 1VJZA 3WNMA 2XWDA 4C7DA 2XSAA 1C92A 3RCNA 1NM9A 1DP0A 1C8QA 1JG9A 1JZ2A 3UEQA 2EPNA 2WCSA 6TAAA 1MW2A 3WD2A 2E4TA 2E3ZA 1HKIA 3N9KA 3OZOA 1WZAA 4M24A 2VQTA 4WSJA 2XFFA 1TCMA 4CCDA 4TTGA 1ODZA 3RM9A 4BA0A 2EJ1A 1V6WA 2F2HA 2AOSA 4NRRA 3AZTA 2YL6A 3VGBA 3VINA 3MUY1 3KL3A 4W7UA 4PTVA 2D20A 3CGTA 3AS1A 4OKDA 4B15A 3NSXA 3MUZ1 3JUGA 1V0LA 4P8XA 1GNXA 4FK9A 3SIMA 1XH1A 5CZKA 2IXVA 3N17A 3EYPA 3SCRA 2D0HA 4EAMA 1GOMA 1E3ZA 1JD9A 3L2LA 4J7RA 2UY5A 2XSBA 4JIEA 1IZJA 1UD4A 1DWFM 3ZT5A 3WFLA 3EDEA 3F5LA 3W6MA 3F4VA 5I78A 2YL9A 3K46A 4KWUA 4XZWA 1K9EA 2XVPA 4QP0A 2ZOXA 1RP9A 5M17A 4PMYA 3WUBA 1X6LA 2ZUTA 2JF7A 2JIWA 1UR9A 5I6SA 1PZ3A 2VZSA 5CJ5A 4OZOA 3TTQA 3MO4A 1GQLA 2D22A 2G4FA 1O6IA 1VIWA 2VCCA 2ZE0A 1KBKA 1HL9A 3EDFA 1E15A 3POCA 4OJYA 4AZ7A 2CETA 3T0DA 1UD6A 3CZJA 5E09A 4PUEA 1Q6DA 4PN2A 1JGIA 1E71M 1UKSA 9CGTA 1HJVA 3W25A 3DYOA 2WHLA 1QPKA 3PZTA 1K9FA 4E8DA 3UG3A 3QR3A 2FH6A 1C90A 1JI1A 2QPUA 4GQQA 5FD0A 3TA9A 2O9TA 5A2BA 2UY4A 2FGZA 3WH5A 2ZXQA 3VIHA 3WF4A 5A6BD 2ZX7A 3CH9A 3W81A 4R5EA 3RJYA 1NH6A 2EEXA 5IHRA 2WVVA 4S3KA 4F8XA 1Q6GA 2ZX9A 3VMPA 1V3MA 4M8UA 4W8LA 1C93A 1MQRA 3WDHA 5HDRA 3NCOA 2B31A 1E43A 2VX5A 3AIVA 1SR0A 1XCWA 4DWSD 1C8YA 2WVVB 5DT7A 1OB0A 1V3LA 4CCEA 1NP2A 5A8PA 2J7HA 1H49A 4MB1A 3UERA 4MPKA 3ALGA 4AZ6A 4PMZA 4OUEA 5D8WA 3U5YA 1XD0A 1OINA 4WLCA 3RO8A 1TUXA 3IK2A 5AYBA 1CENA 1GPFA 2DIJA 2YKKA 3PZ9A 3GXIA 1DHKA 2G41A 5A6AA 2X8RA 4M56A 2A3CA 3EMZA 1CGYA 2CYGA 1E4NA 3WNOA 3AMKA 2W92A 4CGTA 2EXOA 1M7XA 3W37A 3AS0A 3BAYA 5A6JA 2YDSA 2BHZA 1JZ4A 2FGLA 4AD2A 1UKTA 2DSUA 2DEPA 4IISA 3SCOA 3IJ9A 1GUVA 2CBUA 1IZKA 3DECA 4J28A 3SUSA 1E70M 5EFFA 4LQ1A 2JIEA 4IM4A 1MWOA 3CO4A 1RH9A 1D7FA 4UQAA 5JUVA 4OBSA 4D1JA 3RM8A 1OT2A 5C8BB 3VIPA 3W24A 1HP4A 3CHFA 4H8UA 5CPQA 5HPOA 2GJRA 4UNIA 1XHGA 1KFWA 3K1DA 2WW5A 1E4IA 4Z2GA 3VDBA 1CXIA 2YDRA 1PJ9A 4DUXA 3B9AA 1OD8A 1UWTA 4Z2IA 1XV8A 1PAMA 2E8YA 4JKKA 1DWGM 1M01A 2PC8A 2ZWZA 1QNOA 2J8GA 4N42A 1HIZA 1JZ7A 1B9ZA 1JXJA 1UQZA 3CZGA 3ZQ9A 4ZEPA 3BLPX 2BY0A 2ZUWA 3WDQA 4JFSA 2VO5A 1TG7A 3WL1A 3WL0A 4AY1A 2WHKA 1NWUA 3ZMRA 2WCGA 2WBGA 3PZOA 1JF6A 1HT6A 1XC6A 3VGDA 1KWKA 1W9PA 5BRPA 1EQPA 3GH4A 1MW3A 1XYFA 3W38A 1E5JA 3ARTA 2XVLA 1W9UA 2PWDA 2XM1A 4M82A 3IANA 4UOJA 2OYKA 4BS0A 2WWCA 2VNCA 1QW9A 1H1NA 1FA2A 2VJXA 4WJXA 3WKZA 1CXHA 3NJ3A 4W89A 3ECQA 2DSWA 1GQIA 1ZBKA 2GDUA 1AQMA 1OGBA 4W84A 1BYDA 2BVDA 4UFHA 3L4ZA 3BXWA 1HNYA 2ZIDA 3MS8A 1WE5A 1W1TA 1MXDA 3MUAA 1WB0A 1U33A 1FH7A 3TP4A 1B1YA 1VAHA 1HKJA 3EDJA 2BXYA 3ARRA 2D24A 2GJXA 5CLWA 4ZFMA 4KRUA 3CHCA 4GZJA 5GQBA 4CU6A 3K4DA 2EPOA 1HF6A 2VRKA 4CU8A 1AVAA 4UFLA 1UH3A 1JAKA 3L4YA 4CD4A 1F4AA 1E73M 2WSPA 2GJXB 2JEQA 2WZEA 3WMSA 4FLSA 4W87A 3K8MA 3PHAA 5CGTA 3IJ8A 3WNKA 3U7VA 1CXLA 1LG2A 2VX4A 4D71A 3VMNA 3GTNA 5A8MA 2YOCA 3AJ7A 2WMGA 4AMCA 1E6ZA 1IT0A 3W26A 1UYQA 1ISXA 3LPGA 3VDHA 4QFUA 2JEPA 2XM2A 5JBDA 3UCQA 5I3DA 1O7AA 2JFEX 3AMLA 2ZXAA 1UR2A 1GHRA 4F79A 3WQWA 3BCFA 1G0CA 4Q7NA 3WD4A 2PF0A 3UETA 5KZ6A 1J0HA 1UD5A 4D1IA 5LA0A 2GSJA 1J0JA 1JDCA 1CECA 5BRQA 4FLRA 1W1YA 5ABGA 4J3UA 4R27A 1LLOA 3AHTA 4HTYA 7CGTA 4GO9A 2A3HA 1NP0A 1EO5A 5HBFA 3CBWA 1V02A 1W1VA 3BMWA 3WBEA 1B3WA 1HVQA 4CN1A 1JYWA 1J18A 3VUPA 2YL8A 3FAXA 3VM5A 1ZBWA 4UZSA 4HZ8A 2CXGA 2A3BA 1UHVA 2OSWA 4XZBA 2YLAA 3SCNA 3ZM8A 5A69A 1SYTA 1OM0A 4TVDA 2Y8KA 4HOZA 3VIFA 4JKLA 4F66A 1FFRA 2OWXA 1AMYA 3AXIA 3VIOA 3UR8A 3IAQA 1QVBA 4WKFA 2YBUA 3VD7A 5BXPA 1QW8A 3CUGA 1AQ0A 1K9DA 4DWSA 2J7EA 4UFJA 4PMXA 4E2OA 2NT1A 3VX1A 1J0IA 2W67A 1LL7A 2OSXA 1E6NA 3GH7A 3WUGA 1C3FA 4AD1A 5M03A 3AHXA 3GBDA 1NARA 3AS2A 2FHCA 3LMYA 4DWSB 2D1ZA 3W4RA 1W2PA 3MV11 2WZIA 3RDKA 4QLJA 1E5NA 3AIQA 4M1RA 4AZCA 1BHGA 3WQ4A 2J47A 1CGUA 4LXFA 2J7DA 2J75A 3VDCA 2VZUA 1TE1A 1QHZA 3K8LA 3AHVA 2Z1KA 3CUJA 1VFMA 4AZCB 3RMEA 1M53A 1KXTA 2AMGA 4HZ6A 3AMCA 4JL2A 1QHPA 3BAWA 1CWYA 3WD3A 2YBTA 3UESA 1V6VA 3UG5A 1EXPA 4GZIA 3FNDA 3II1A 4U31A 3RIKA 1ISVA 3D3AA 4B9YA 3SUTA 1ISZA 3A47A 1BF2A 1UWSA 4JKMA 2O9OA 4NSBA 1PX4A 1R7OA 3PZGA 1GOQA 4D6IA 3VTRA 3BMVA 2PWFA 1E55A 3MANA 4H04A 4RE2A 3ARQA 3FAWA 1ITXA 1I75A 1V08A 4AEFA 3AYSA 3SUWA 3L4XA 3AICA 3GBEA 4UQBA 4Z2HA 3I3BA 2RGMA 1JFXA 2C0HA 2WB5A 2E9LA 1QNSA 1V3HA 4MJ4A 1ZJBA 2QMKA 3GXDA 3OLGA 1E56A 3ARPA 3W53A 3WH9A 4AZGA 5I79A 3VD9A 1Q4NX 3ZJ6A 2JALA 1EOMA 3SCUA 5CPTA 3AIRA 4E8CA 1XGZA 3AZRA 1KR1A 2OYMA 3N12A 3ZSTA 4MB4A 3HU7A 3RJXA 4B16A 1PIGA 4A4AA 1BVZA 4MDOA 5A8OA 1GORA 2CPUA 1EO7A 5BWFA 5FOOA 1BYCA 1WPCA 1VFFA 3ZJ8A 1JIBA 1A47A 1PIFA 3GXFA 4JFTA 4JFUA 3CPUA 3PTKA 3WH8A 2UY3A 1A3HA 2GVYA 3E1F1 3UR7A 4UR9A 3QHNA 4TX6A 1E0XA 3LPOA 3N13A 5A94A 3L4WA 4NRSA 3WUFA 3PZVA 3M6DA 3O6AA 1HXJA 2ZWYA 3ZJ7A 2W4XA 2CHNA 4GKLA 4M81A 3DHUA 2WMJA 1GQJA 2J79A 3WMCA 2J7FA 2BVTA 1UZ4A 3WSUA 4MADA 4DWSC 2ZUUA 4U5KA 3QOMA 4J3TA 1UWIA 2CBIA 1KCLA 3OG2A 4AIEA 2YA0A 2EPLX 2VR5A 1UUQA 4H41A 1M04A 2DDXA 2VUYA 2Y4SA 1WZLA 2A3AA 4CCCA 4UQCA 3L4UA 4ATWA 3CUHA 2FDMA 4HP5A 5KEZA 4MB3A 3ARSA 1XRVA 2WVUA 3J7HA 1H0GA 4HMDA 2CEQA 3VDAA 1UOKA 1C91A 1GOKA 3BAJA 3K4AA 2CHOA 2WXDM 2Y5EA 1KQZA 1XSIA 1CDGA 1UD8A 4WIWA 4TX8A 4P7QA 1JZ3A 3AHZA 4U3AA 2V3EA 1LL4A 3SCPA 3PZNA 1P6WA 4BQ4A 1QHOA 1W3HA 3ZT7A 4PCTA 4B3LA 3VD3A 3WNNA 4EK7A 4WF7A 3AMDA 1CGXA 3PZUA 1KXVA 1TVPA 3MMWA 4WKAA 3SCWA 1HN1A 5A1AA 2QHAA 3O2LA 4LYQA 5A6KA 1HP5A 2V5CA 3WQ8A 2QMJA 3QHMA 3GNRA 3EMQA 2DQXA 5DEZA 1GQKA 4MDPA 1G5AA 2V3FA 5CLTA 3G6MA 3U57A 1M03A 5HNNA 4GI8A 3B9EA 1Z32X 1BVNP 4QAWA 3T2QA 3AHYA 1VB9A 3WQ6A 4UQ9A 1Q6CA 2WMIA 3VGEA 2J62A 3BCDA 2D3NA 2E8ZA 3OLDA 1JFHA 4CN6A 5A6MA 4X0VA 3B9DA 4JAWA 4LGXA 3K8KA 2DSZA 2WMIB 3ZSSA 1OWQA 2YIHA 2AAAA 3CZEA 3UG4A 3AZSA 1BLIA 1R86A 4DM2A 5AY7A 2BVYA 1QI2A 1KBBA 1JYXA 1MVYA 4DUVA 3W28A 1QBAA 2QLYA 3VD4A 2GJPA 2HVMA 1H41A 2EPKX 3N18A 3AROA 4JHOA 3I3DA 1L8NA 1XD1A 1CLXA 4KGLA
chains in the Genus database with same CATH superfamily
1RA0A 4L4OA 2E0PA 2J13A 3PTMA 3RILA 1ZP4A 3TWAA 3TXVA 3CZ8A 4O19A 3BZJA 1F8IA 1XBZA 3FFSA 1EC7A 3TXZA 3M41A 1O5KA 3OZMA 2EG6A 1FXPA 3URQA 2I7GA 4C7GA 4XD3A 2XFYA 3DYMA 5HXMA 3GIYA 2WVSA 3P3BA 5C9WA 2DT1A 3WNLA 4V27A 4S3CA 1CTNA 4ZQRA 1KLYA 5LIYX 1EJWC 1US0A 3IJLA 4PEEA 4ZOEA 5DRCA 2B7QA 5DCDA 3ABXA 1GVIA 1YPXA 1X97A 1NJJA 2JF6A 3S2MA 3LM7A 1ITQA 3QFWA 2C0AA 4B4FA 3HG3A 1KNWA 3E5BA 1C8XA 3QVQA 4TTUA 4KMQA 2JQXA 1P7TA 4FNPA 1A0EA 1EBGA 1U1UA 1CBGA 4IG2B 4CKQA 4JFWA 4UTTC 2QAPA 5CBBA 1PPIA 1H63A 1TELA 3EA2A 1DOSA 4YS1A 2QUVA 3UNTA 3QR1A 4UQDA 1QI3A 2G5WA 2YXXA 3T4WA 2I16A 4DZIA 5D09A 4XQ6A 5E6ZA 2XISA 5JIWA 1W17A 1C7SA 3EOLA 3ZVHB 4PYSA 5I02A 4N9BA 3L2IA 4Y96A 2VC5A 3T05A 1W3LA 1L8PA 3LN3A 3VNIA 1R3TA 1M65A 4K38A 1GVSA 2Y7FA 3ABZA 3W1RA 2OEJA 2RKXA 1AQHA 2ZX6A 1MMFA 1LBMA 2CESA 3PN8A 3SCTA 4QE4A 3LK6A 3HG5A 1YLVA 3B9OA 2WAGA 2C19A 3ONCA 4B5TA 1U30A 1KBLA 2W91A 2R1NA 2V69A 3SRFA 4PZVA 4DBDA 1Z69A 1HJXA 2FHFA 3PZQA 3OIHA 1SFLA 2Y2WA 4GRSA 4GCXA 4ZXOA 1TPB1 3QPEA 3UWUA 1LT7A 3W7LA 1IT7A 3L5MA 1XIEA 4QJ5B 1XYZA 1V02E 3KVKA 1I8JA 2NT0A 3RNDA 2QJGA 4L6OA 3W1NA 1EWDA 2NV1A 5I03A 2XDFA 3AS3A 2DZSA 2VGGA 4ZBCA 1Q63A 1IZCA 1U5JA 4OQVA 2WLYA 1V93A 4IJBA 1XJBA 3W7EA 2KAUC 2X7WA 4DJDD 3TTOA 4C65A 3HB9A 3QXBA 3GDKA 4V1YA 4JCLA 2PLCA 2ACRA 4GY0A 1HG3A 1E6PA 2CU0A 3HBLA 3PBMA 3THQA 2FPVA 1PCKA 5EMUA 2XVGA 3EWXA 4JN7A 3W2MA 3F2BA 2BODX 3BLKA 1SMDA 1FWSA 5JBFA 5AECA 2J77A 3GW0A 4CNPA 3T0CA 4S38A 3ZVIA 2DVXA 2RDXA 1VFLA 3WF2A 5GNYA 4LAMA 1BAGA 4LVFA 4GQ0A 1H7OA 2CZDA 4U3CA 2BHYA 1F6PA 5DXYA 2CCRA 3TAKA 4M6UA 2PA6A 3N2BA 1KV5A 1TVNA 3DI1A 2J88A 1M6JA 1FP9A 3CL6A 1CEOA 1CGVA 4HGXA 1BD0A 3MT1A 2E68A 4KRTA 1OQFA 4OVXA 1EJRC 1CPUA 2NV9A 3PZMA 2DZUA 4PSPA 5GJPA 3OODA 1B3XA 3N2XA 3U3HA 1AODA 4IMGA 2GK1A 1AZ2A 2NXHA 4PSRA 4XKYB 3H2OA 3AIUA 1XBVA 3GNOA 4QRNA 1BGGA 3G8RA 2CLHA 4ACZA 1E0VA 1LF1A 5M5DA 2ESCA 1KFEA 2DZTA 4H8NA 2QAFA 4HOXA 3FSUA 1XUUA 1QI0A 5HPCA 1VKFA 2A7NA 1IYXA 1C9DA 2ADAA 1Z48A 3RLHA 4CVUA 4HZ7A 2WVTA 2WNQA 5AC5A 5AHLA 4UOZA 3VCNA 1V0NA 4JHZA 1RR2A 4MTVA 5DFAA 1VFOA 3CHVA 3MWAA 2DZVA 3CUZA 1F76A 2VR2A 3AO0A 1JL8A 4NY2A 4Z2KA 3HQPA 2INZA 3HA1A 1LG1A 4J1OA 3RX4A 1J0KA 4PGLA 3KOZA 2PURA 1GYMA 2PTYA 1G01A 1VBHA 3KDNA 3BICA 4I7VA 4C60A 5CGMA 4BWLC 3M5ZA 1PKNA 1V7AA 4U5IA 3TCSA 3UPMA 1OHLA 2ACQA 3THDA 4PTMA 2F2KA 4W86A 4CQBA 4DZHA 1A49A 1Q6LA 3SFKA 1VF8A 2Y7GA 1E3XA 1MQQA 1S5MA 3CU2A 5DO8A 1GJWA 1TV2A 1DIKA 3ZR5A 4AB4A 4QQUA 1JYNA 1DBTA 3M0ZA 1KCKA 1B31A 2QJJA 5TAOA 2F84A 2QS8A 2VEGA 1SZNA 2A85A 3SGUA 5LHFA 2FHBA 1IEQA 4B91A 3EX6A 3PK7A 3LCXA 1DQXA 2OT0A 4TX9A 3KEHA 1P1MA 4HNTA 4J2MA 2Z0IA 5F1VA 3VNDA 1JYVA 2RGLA 3W3OA 3DDMA 5T9CE 3VVGA 1RCXB 3WNPA 3U4FA 5A6LA 5DY2A 3ARZA 2CHRA 1GOIA 4LBUA 4I7WA 1PIIA 4R7OA 4WEVX 2VX6A 2CBVA 3IJDA 3W7PA 3OQ8A 2DU2A 4EPEC 2XFRA 2W0UA 4FLOA 4UMBA 1UIOA 2PDMA 1TJ1A 3BAKA 1WA3A 3O9NA 4KKXA 1XPYA 4HQVA 1FH8A 2D69A 1EEPA 3DBPA 4YXGA 3RMJA 5LA1A 2HDJA 2JKAA 1JCLA 3N1AA 1E4MM 1OCNA 4UTMA 1S3HA 1JF5A 4UTHA 4HNCA 1DQWA 3VE9A 3NIYA 4ZQMA 1FHLA 2WNZA 1LQ2A 2RDUA 4DNMA 3AAMA 5BXRA 3K1GA 4IPLA 4WOQA 4UTUA 2WJEA 3EDDA 3F03K 1KLZA 1W3JA 3G1YA 3SZ8A 3B0YA 5D4YA 3APYA 5FF3A 3JU2A 1XGDA 4Y9OA 4JTAA 3LV6A 1IXNA 4HCLA 2PDGA 2WHMA 2J27A 5CAHA 3L67A 1ALDA 1X8FA 4QSHA 3ZR4A 3UU0A 2Y7DA 4NZ5A 1ICPA 2D23A 4KEMA 1Z42A 1XM3A 2ZUNA 2G3IA 4FO4A 4ADSA 3RR1A 1B5TA 4AISA 2JKPA 3HGOA 2CFFA 4XSMA 1IWPA 3P5ZA 1ISYA 2PB1A 3PUEA 3VNLA 2PLKA 1V3KA 4BR1A 2VL4A 2C15A 3SR7A 1Z9AA 1ZTVA 4XB3A 1P0KA 1EJXC 1TB3A 4BHYA 1XGEA 1NOUA 1HJSA 3AI0A 1TR1A 2ZZ5A 4Z17A 2MNRA 3H26A 3FEQA 3MPGA 3T2PA 4P7RA 1TWDA 4GQGA 3OGSA 4GVIA 2AQVA 2QEZA 2CNCA 1GVQA 3Q2DA 4ZFCA 1W5MA 1VEMA 3AQUA 4PMOA 3UZYA 1TREA 2PTWA 1W3KA 3L0KA 4PCSA 1T5AA 3IIVA 1XIBA 1R3VA 1EA9C 5DT5A 1TWZA 1M7PA 4CQ8A 4E0CA 5LIKX 1S5VA 5I07A 4O18A 4HN8A 4IX0A 3ZR6A 3H2FA 2H8XA 2H9AA 1W37A 1H0IA 5LNWA 4F2BA 4BQ5A 5GNXA 3KVJA 3DYPA 3PUDA 3CM4A 3NXLA 4AC7C 4L64A 4NZJA 4NZCA 3VPLA 4ZB5A 2RAGA 1AG1O 2DQWA 2QPSA 1P4CA 5F4WA 1RSCA 4WDWA 3MSDA 1H2JA 1JD7A 1H62A 1XDMA 4N02A 5I23A 1Q45A 3CUIA 1VBRA 4K39A 2W5FA 1GVOA 2C79A 5DX7A 3FJ6A 4Z2JA 2IMRA 1HO1A 3TZNA 2G3FA 5DF0A 3BZGA 1PBGA 4XAPA 4ECLA 5DXXA 4DUWA 3DFNA 3L4TA 4UTFA 4QS6A 4RZ5A 3VYLA 4HA0A 3NAVA 3UT0A 4P7OA 3PWAA 1PX3A 4UR8A 2VURA 3Q4DA 4IMAA 4AZHA 2G3NA 2WNWA 1GPWA 4RV3A 3TN5A 1SW7A 3WYZA 2VR4A 1EDTA 3WY1A 4EXQA 1V6XA 4L9XA 5D33A 2WC4A 4AY7A 1RK6A 3B8TA 2D0FA 2CKRA 4Q8QA 3ABOA 4GIAA 4GI6A 2ZC1A 2ZTJA 1TV8A 2PE4A 2OWWA 3S2NA 1CNVA 4LNCA 3FDKA 3R89A 4BZYA 2EGZA 2VFIA 3RU6A 1EJUC 1U2YA 1F3XA 3UJEA 2ZICA 4GFIA 1ISWA 5LA2A 2XZ7A 3B8SA 4CCZA 3R12A 1B30A 2BY2A 3BANA 3W86A 3RLUA 2OO0A 5XIAA 1MEWA 4A21A 4DZ5A 2ABAA 1GW1A 1GOOA 5ABHA 1GZGA 3M0MA 4BQ3A 1B3ZA 4U2YA 4WUIA 5FKYA 3BGGA 2VEFA 4DBEA 3OLEA 3T9PA 4B5UA 2QJHA 2VT0A 3FW6A 2XH7A 1RD6A 3BGAA 3UZZA 2W62A 3CZLA 2UY2A 4R7WA 4FX7A 1B90A 3IVTA 4HPGA 3OJGA 1PS9A 1OFBA 1UWQA 4XZMX 3A21A 4FALA 3R8HA 1JQVA 3VXGA 1A0DA 1K9TA 2BS9A 4AVNA 3D0CA 2E9MA 3W1TA 4NNCA 2PLMA 4IL2A 4YVVA 4ML9A 2BWGA 1L6SA 2O4QA 4NJGA 1K8XA 3E5PA 5D8ZA 3BG9A 1DORA 1LOLA 5CQ1A 2Q3OA 3ZIZA 3KTSA 3HFYA 3L2MA 4NI3A 1J11A 1NVMA 5BMWA 2OMAA 1SW0A 2OEMA 4MKVA 4AZ5A 4JDYA 1W31A 2XN0A 1DIDA 1DXFA 1IIGA 1ZAJA 1JDDA 2O9RA 2PBOA 1Q7ZA 4X3ZA 3LGDA 4PR4A 1R46A 4WKHA 3SIZA 3BMXA 2CKSA 2PZNA 1GYLA 2J24A 3B8IA 3W22A 3WELA 3BSHA 4H83A 4I6VA 3CMJA 1XINA 3QHOA 3BV7A 3VNYA 3FVMA 1E0TA 1OFQA 4KFNA 3GUWA 3BG5A 4ADTA 2YX0A 1P6CA 2YGYA 1HW6A 4JIIX 1QK0A 2C13A 3AYTA 1EX5A 2Z2BA 3WNMA 4C7DA 5I7GA 1C8QA 2EPNA 2TSYA 2WCSA 2JBMA 1V8EA 5FA5A 2E3ZA 5AHFA 3D6NA 1F6KA 2VQTA 4WSJA 5BOOA 1TCMA 2FVMA 2P76A 4TTGA 3W2LA 1ODZA 3WK0A 4BA0A 3VZZA 2EJ1A 3UVAA 4U10A 4XD6A 3B4UA 3BE7A 3W7KA 4PTVA 3CGTA 4O16A 4L6DA 4OKDA 3NSXA 4GZ7A 2I5QA 3MUZ1 1U5HA 4RE0A 5D02A 3U2CA 4B2DD 2IXVA 3EYPA 2CZFA 3Q65A 4V33A 3SCRA 2V5KA 3QBUA 3P5YA 3L2LA 4J7RA 4HMNA 1N55A 4Z1DA 4JIEA 1VFHA 1OFAA 4LSBA 4DI8A 2B7PA 2LLEA 4DB7A 4LWWA 3F4VA 4JXCA 4XZWA 4XZ9A 2XVPA 3UVIA 3GAKA 5M17A 4PMYA 1ENUA 2JIWA 4GIYA 1OFEA 2IKGA 3NO5A 4IQLA 4OZOA 2V5JA 2D22A 4ZO7A 2X41A 1FWAC 1H7PA 2OQYA 1DQUA 4BKNA 1HL9A 1E9IA 4NNAA 3O3RA 4XSLA 4J9JA 4BEQA 3GVRA 4RZ4A 2QJIA 1JPMA 3CO8A 4Y9PA 4FOUA 1JUKA 5HR6A 2ISDA 4AUBA 2VWSA 4PN2A 3NOEA 1E71M 3W00A 1HJVA 1G4EA 4Q8VA 9CGTA 1SUXA 3T40A 4GJIA 4CNSA 4B5VA 4A6GA 2NQJA 1K9FA 3LNPA 1ZZMA 2FH6A 4A3QA 1JI1A 4S3FA 3TA9A 1Z6KA 2UY4A 2POZA 4TO8A 1CCWB 3WF4A 4E6MA 1QU4A 2ZX7A 3CH9A 2HVNA 2V63A 1JJKA 2EEXA 5IHRA 4HNUA 1BEUA 5FJRA 2ZX9A 1V3MA 5JH1A 4W8LA 3TYUA 1XPGA 1NY1A 1J2WA 1EZWA 4AH7A 4DJDA 5HDRA 3H8AA 3ZLHA 4IHCA 2B31A 1E43A 2VX5A 3NQ7A 4FSAA 1V3LA 2Y70A 1H49A 2X40A 3KAOA 4JEJA 3E0IA 4PMZA 4OUEA 3H7RA 4C6DA 1OINA 4WLCA 1IGWA 3HPZA 4M3PA 3RO8A 3IK2A 1J4EA 1DE6A 5AYBA 3V5FA 3CK5A 3BOFA 1J96A 4MVAA 2UBPC 1F73A 3M0LA 4UNLA 5DMNA 2OZ3A 3H22A 3EMZA 1KM4A 4H6RA 4HJFA 5DN1A 3WNOA 3CYJA 2BOEX 3ITVA 4NZ3A 4CGTA 2EXOA 3SDOA 1M7XA 3CASA 1JZ4A 2FGLA 4AD2A 3QY7A 3SCOA 2DEPA 4IISA 4L80A 1VC4A 3IJ9A 1M5WA 4UTWC 3Q67A 5I3GA 2QXWA 1MWOA 3LTPA 1RH9A 4UQAA 1U5VA 4KWWA 5AB3A 2V8ZA 4LYKA 1OT2A 4IOTA 5IBXA 5C8BB 4GC4A 1HP4A 3F2CA 1XICA 3TVAA 1XHGA 1KFWA 1LOSA 3T0TA 1W5OA 1E4IA 4Z2GA 3VDBA 2OLSA 1AJ0A 2PGWA 3UY7A 3O05A 1OD8A 4Z2IA 3RLGA 4YU1A 1DWGM 1A5OC 2ZWZA 3LV5A 2P50A 3R10A 2J8GA 1K77A 1HIZA 3LGEA 1JXJA 3CZGA 2PCEA 2VC7A 2VO5A 1TG7A 4HCDA 4A22A 4AHPA 3NQBA 4LS2A 1NWUA 2WCGA 4FNTA 3VGDA 3LA4A 5BRPA 1VBGA 1UP2A 3WLHA 1QJWA 5C0QA 4I9TA 2Z6JA 3GDLA 1CW2A 2ZRUA 1TPDA 2XVLA 3KRZA 3C2RA 4MKSA 3W01A 3VOIA 4RK8A 1H1NA 1L2QA 2VJXA 3DBNA 3EOUA 3N2CA 4WCJA 3NJ3A 3JZEA 4B4HA 4ALDA 2A21A 3TQVA 2FIQA 3IIZA 4Q4PA 5I3KA 4UFHA 4CEUC 1XLBA 1ZFJA 4RZ6A 3MS8A 1WB0A 3UCDA 4LUSA 4AWTA 1Q7MA 4TR9A 5U7SA 1VAHA 4QTGA 1HKJA 3EDJA 7ODCA 2GJXA 2O0TA 4MZ8A 1M68A 3K4DA 1A5AA 2FDSA 1SZFA 3ABRA 4XBKA 4PB5A 1F4AA 1A5UA 2DZPA 3QZEA 2WZEA 3CS2A 1FKXA 3WMSA 4FLSA 1BQGA 3K8MA 5C54A 4EPKA 4PTDA 3O06A 4QG8A 3U7VA 4GY1A 4L65A 1LG2A 3AJ7A 2WMGA 3TYBA 2VFDA 4LB4A 2VWTA 4WY0F 4PFHA 3P14A 3TYCA 1BVWA 1KKRA 5JBDA 5I3DA 3AMLA 4XVEA 3H2EA 3C2FA 2GVGA 4MUZA 4DF0A 1XLCA 5KZDA 1GHRA 1NTHA 5KZ6A 4D1IA 5LA0A 2HE5A 2NVCA 2CWNA 1JDCA 2OOGA 1CECA 3WQCA 3MCNA 3E2SA 1R3QA 2MUCA 5DELA 2E6DA 4RXGA 2NLYA 1TR9A 3LHZA 4EF8A 3GIQA 3NM1A 1NP0A 4RX0A 4HNLA 3QY8A 4DF1A 1JYWA 2YL8A 3CT2A 4YCOA 4YTRA 1UP3A 3FAXA 3APTA 1XIDA 3W7DA 1S2UA 4UZSA 2Y8UA 4HZ8A 2A3BA 1UHVA 1XYCA 1GGOA 3H70A 5H1WA 3ZM8A 1UUOA 3AC0A 2VKZG 4XTDA 4HOZA 3CIWA 1TV3A 4KCVA 4ZL1A 2OWXA 3IEBA 3UR8A 3IAQA 3TJ4A 1S5NA 1L9WA 2YBUA 4FNSA 3TDFA 5BXPA 1PWLA 4HZMA 5GVJA 3NEVA 3VX1A 1J0IA 3E02A 4RDWA 2QIWA 4L1WA 2RFGA 4O0QA 3GH7A 3GBDA 3LMYA 2D1ZA 3JZUA 3E0FA 3EB2A 3SB0A 2WZIA 3BDKA 4AF0B 4ERAA 3RF9A 1SSGA 2J47A 1CGUA 5H8MA 4IIDA 4LXFA 4Q7BA 2HBXA 2J75A 2VZUA 1QHZA 2P0IA 3AHVA 3O07A 3CUJA 2NSOA 1VFMA 3W1AA 2CLEA 2OU4A 2VGBA 1KTBA 4FZIA 3AMCA 3BAWA 3SGZA 4H9YA 4TMCA 5AHIA 2YBTA 3UESA 1N7KA 2A6NA 2HCVA 4U31A 4JN8A 4NKCA 7XIMA 3D3AA 4XVDA 4A8IA 3A9IA 4FX8A 3UJFA 1VR6A 3UJRA 3PZGA 4D6IA 1AW2A 2PWFA 1TV7A 1HKVA 4OV4A 3S3GA 3WBWA 3LUTA 1V08A 3L23A 2OGJA 1B57A 3W72A 3PBVA 2ZZ3A 5JMUA 3KFTA 2EF9A 4WY0A 1R9YA 3GYEA 2RGMA 2Y7EA 2C0HA 2WB5A 2E9LA 3M6YA 3DH7A 1A5MC 1VFSA 4MJ4A 3W74A 2ZRZA 1S2AA 1DJXA 1SU5A 1E56A 3ARPA 3WH9A 4AZGA 1TPEA 3ITXA 4DN1A 2Q71A 3SCUA 2F6XA 1XGZA 4AG0A 1JEZA 3IGSA 3V0SA 3DIPA 1O66A 1HQTA 2QDEA 4GUFA 4ORIA 1BVZA 1F8MA 3EOSA 4R7JA 2VGIA 2NUWA 2ZC8A 1EO7A 5FOOA 2QPXA 4QG9A 1I2OA 3LERA 1JIBA 1A47A 4H7CA 1PIFA 2ZA2A 4JFUA 1QOQA 3TJXA 1X98A 3SY5A 4X2RA 1EBHA 1LWIA 3H23A 1KO0A 1EZ2A 3L4WA 3WUFA 3PZVA 2ISWA 3MKCA 2CHNA 4M81A 3LHWA 1MDLA 3DHUA 3RUBL 1GQJA 1M3UA 3T78A 4ENLA 3WO8A 1UZ4A 4MADA 3TYDA 4U5KA 2I9UA 1UWIA 2XINA 1XR2A 5B7YA 4AMAA 3T8QA 2Z2AA 4AIEA 2R14A 4NIRA 2EPLX 1FWIC 2PF8A 1QO2A 4YYCA 1K7EA 3P0WA 4C6KA 4DEFA 2E5CA 3CUHA 4MB3A 3ZWSA 2PDKA 1DIEA 2QCEA 3J7HA 1EGMA 1H0GA 4H4IA 3IGUA 1UCWA 1C91A 3C52A 2CHOA 4KF1A 5D38A 2WQPA 3CT7A 2PGRA 4HU4A 4U3AA 6TIMA 3SCPA 4BK9A 1ME8A 3KBMA 1P6WA 4BQ4A 5J5DA 1QHOA 4GJJA 4ZZ9A 4F0LA 3ZT7A 1OYAA 4B3LA 1VZWA 3KCOA 4WF7A 4H6QA 2PDHA 3H54A 1TVPA 2YCLA 1A4MA 3MMWA 3TK7A 2A1YA 3STPA 2QHAA 5A6KA 3H2NA 4NP7A 1TV5A 2CW6A 2V5CA 3R94A 3WQ8A 2Z2UA 2QMJA 2DQXA 5DEZA 4WX2A 4YWSA 1YDVA 2Q8ZA 4MDPA 3L9CA 5EYWA 3WBYA 2PDBA 1WXJA 3V5OA 3G6MA 3U57A 5HNNA 5SWUA 1FWFC 4ZGYA 3MYOA 4QAWA 3T2QA 1FWTA 3AHYA 4UQ9A 2F6KA 5HNTA 4JY8A 2J62A 3W70A 1QMLA 3O0FA 2PPGA 2VFFA 3OLDA 4FB7A 4CN6A 3PPFA 1IT8A 1K4GA 3BARA 1ADSA 4NAEB 2TODA 4LALA 1DPMA 4ZOBA 3CZEA 2BDQA 5LKYA 2J9XA 1DJGA 2P3ZA 2A5HA 2BVYA 1KM3A 4MWAA 1RBLA 2PD9A 3C0QA 1MVYA 3WLPA 3SADA 1AK5A 4CQAA 1I9CB 3LHVA 3ISIX 3DAQA 3I3DA 3KS6A 4JX6A 3SM0A 2ZZ2A 5JBEA 4BCEA 1VH7A 1ZBCA 1Y8BA 3AOFA 4RJEA 3AUJA 2YDQA 4TVUA 1JNEA 2EBNA 1RY0A 4PL2A 4UTIA 5CBJA 2RDWA 2VC9A 1OABA 1GVEA 2AKZA 4K36A 4G7EB 4S3AA 3AMGA 1UH4A 4XWUA 4PODA 5HMSA 2I57A 4C1KA 4H19A 1I2NA 1TUFA 3BOLA 4HA4A 2F61A 4NG3A 3PSWA 1UIPA 1QI4A 3G1HA 3MHUA 5D2VA 3C5QA 5CC7A 1BQCA 2A4AA 3RPDA 4UOQA 2REQA 2OYLA 4K37A 3P8IA 4UMAA 1OFRA 4K8GA 5AYYA 4WVXA 3UCCA 3ZO9A 1TPFA 4JNYA 3L5LA 4N2YA 2NSXA 5E0FA 1WZMA 3VUSA 2X0YA 4PEKA 1N82A 4GQBA 3ARWA 3S6DA 5FJTA 1BWLA 4K7VA 4Y9MA 3CQHA 1A53A 1EP1A 1FWGC 1X6NA 3NSNA 3GY1A 4LW7A 2ZXDA 1TYGA 4Y9AA 1XLIA 4V2XA 4AU0A 3CTTA 3QPZA 2XUCA 2AQWA 3G1AA 4ZENA 2GYIA 3O16A 3NA8A 1R3RA 1B3VA 4B2DA 1YTKA 3GVGA 4EE9A 3R0KA 5FJPA 3C86A 4EWJA 1OADA 1Y65A 3CTLA 2BTMA 6CGTA 2VVNA 3BL3A 3CMFA 3DESA 4K1WA 5G1MA 1U1JA 4LS0A 2X1IA 3LPFA 4NXSA 3ANUA 3WQGA 5M3WA 5EBAA 2R1PA 3NQGA 3ITCA 1DJZA 3QEZA 5EL1A 1V03A 4CUCA 1QNVA 1ECEA 1HVXA 1UUMA 3QKZA 3TZFA 4L5ZA 1E1FA 1XCXA 4MAVA 3TN4A 4ICCX 4MPQA 1VLIA 2C1GA 4L61A 4CQ9A 3TYZA 1MEHA 2VQUA 3VM7A 2GVLA 3GU9A 1XRFA 3F5KA 3W87A 5A2CA 1V6UA 4XX6A 1N8FA 4D6FA 3LQLA 2A7PA 4RPQA 5C5YA 5F2GA 3NL2A 2FYMA 3WD1A 1XWYA 2NV2A 2PRMA 3SY1A 4ATDA 2V6AA 5H2ZA 4JTQA 2V0TA 2W6RA 4NZ4A 3NGFA 4WGXA 3NPVA 3SCSA 4DWDA 4W85A 1XLMA 3KE0A 2VENA 1M7OA 1TA3A 3QRHA 4MJZA 3HTWA 2RHGA 1JDAA 4W9TA 5REQB 5HJYA 3HMJG 2EO7A 4MKNA 3N15A 4DO4A 3F4WA 1LQAA 4NNBA 4O11A 2QCFA 2DFAA 3KWXA 4O12A 1JDEA 1VRXA 3SFWA 3DFHA 1UMYA 3C2OA 3VGGA 1YNQA 3CMGA 5D03A 5I3FA 3V7PA 1J10A 3H4WA 2Y8VA 1EP2A 1R87A 3KP0A 3GZ3A 3VIGA 1L6WA 4Q8OA 1RK5A 5H8UA 4J3XA 1LRNA 3ZWTA 1E1CA 1UJPA 3RU8X 2Z1BA 2BFGA 1O12A 1ZAHA 2IUZA 3MV01 2JE8A 4AD5A 2Y63A 3TC6A 4GK8A 4J27A 1G1YA 3WBAA 3M07A 5L9FA 5HQLA 3GNDA 4KGJA 4O53A 5CXPA 3WDIA 1KGWA 4D6EA 2ZUMA 3CHDA 1QNQA 5E70A 3CL7A 1S2WA 4Q4SA 3VD5A 1V3IA 4D72A 3N6QA 3M46A 3SI9A 3QV8A 2GPTA 1JZ5A 1G7VA 1TPUA 3QV6A 4DVOA 4BJHA 4PBGA 2FJUB 4NJHA 1UR1A 4REQA 3NYZA 3THUA 2G96A 1P0DA 3LHYA 1DWJM 2A79A 2PAJA 4EANA 3ZJKA 2BGQA 3S0CA 1YBQB 3L12A 2FTWA 4HB7A 2BY1A 2FQIA 4FXFA 1GTEA 3BAIA 4PCPA 3HG2A 4S2BA 1UKQA 7PTDA 3NQEA 1YDYA 3OVRA 3B0VC 4HPHA 3FY1A 1H61A 2F38A 2OOFA 1UR0A 4A8RA 1BYBA 3BLLA 5E0CA 2QDGA 3G1DA 2VZVA 4ZE4A 3CYVA 3VO0A 2VZOA 2OCZA 5FF2A 3TIMA 4JYFA 2ZUVA 1OIMA 2C1HA 1C29A 4RLIA 5AC4A 3RRXA 1GONA 1DEDA 4GZEA 3RX3A 2WBKA 2EPMX 5FJOA 2VUNA 3PZIA 3GH5A 3ZT6A 1TQJA 3CB3A 4KIRA 2C71A 2QQ6A 1GJPA 2F9RA 1W1IE 4PBFA 3I7QA 1BPLB 2YW3A 5D9PA 3I3EA 1W56A 4HNVA 1TJRA 4HHHA 4GO8A 3S42A 1B3YA 1KV8A 3BW3A 1LT8A 2VD9A 1ONRA 4DBWA 2C14A 1H1ZA 1H09A 3CB8A 4HYWA 4QS5A 2J25A 4GC3A 1N8IA 4A3HA 4I7UA 1I1XA 3TNBA 4CVWA 1E4LA 2EG7A 2ZA1A 4P7NA 1E40A 2DIEA 1TMLA 3PJTA 4C7FA 5A95A 1GKRA 2HQAA 1YQ2A 4GQRA 4PMUA 1CXKA 3BOXA 4KCUA 1VHCA 2DUAA 1UKOA 2J78A 3PB0A 1JNDA 4PCFA 2PBGA 3H2CA 5AVNA 3QY6A 4OWGA 1ITCA 4ZQPA 1PXGA 1R8LA 2CC0A 1WBJA 3TSMA 1WV2A 3LBCA 1WUFA 1OZQA 1FRBA 4PL1A 4OOZA 4OOUA 1GT8A 3UYIA 1OYBA 2BBFA 3GO2A 2BGNE 3WEZA 3TOPA 5CZJA 3OLIA 1BG4A 2WZMA 5CSYA 4UTTA 2QYGA 3FEMA 1FCQA 3M47A 2J66A 4QDPA 4DO6A 2YDAA 1E9LA 1PB0A 1K8CA 3KP1A 2QV4A 1TKKA 4D8ZA 3BAXA 3F4CA 4LRSA 5BXSA 4BY3A 2PDYA 8A3HA 1W9VA 5F2LA 2XH0A 2MANA 1TRDA 1WAWA 4OIFA 3CIVA 3SECA 3LHTA 4EX4A 1BSIA 3GAYA 4DO7A 4FXSA 6PTDA 1H1YA 1OCJA 4PRRA 1UR3M 4FNUA 1V5XA 3MHFA 4A35A 4O28A 1YX1A 5LXEA 5E0KA 2XFWA 1PEZA 2QCDB 3LS9A 1GVFA 1XW8A 3FXYA 3N4EA 2E6FA 2FH8A 3VI2A 3NDYA 2ISVA 3C6CA 3AISA 1QAPA 4FS9A 5T26A 1E0UA 3H4GA 1BYAA 1ICQA 3KBNA 3W9ZA 3PG9A 4QEHA 1H5VA 4UFMA 4GH3A 3U0HA 2WLZA 3IRSA 3RPMA 3O8AA 1V79A 1B3OA 2HS6A 5BWAA 2DVTA 2PP3A 3M7WA 3LRKA 2FZDA 3A4AA 1S39A 1GHSA 5MKGB 3E6EA 5IDIA 2J74A 3MSYA 2RH9A 1S1PA 2ZBTA 5CJMA 1RALA 4L4PA 3U7BA 1SO3A 4N0RA 3A3HA 4B3KA 3UPBA 3ATYA 1QNRA 3PFRA 3XISA 3NDZA 1NFGA 3WLMA 1IF2A 1ZJAA 2VC6A 4N9CA 4X22A 3WX7A 2BASA 2WOQA 4IMFA 1WKYA 2GJNA 4JQ3A 3N3TA 1YE4A 4ZTXA 5IRPA 4ADUA 5AYZA 2CBJA 1AW5A 5D37A 3THCA 1UC4A 4WSHA 3PTQA 2WPBA 1J0ZA 1XLJA 1HKMA 3WJWA 3F7JA 3N29A 4GNJA 4E38A 3VKAA 3TR2A 1L6FA 1BFNA 1H3GA 3FKRA 4AEEA 1UMLA 1TIWA 5LNRA 1JRCA 3KOFA 1GJUA 4LYRA 3N9RA 1RCOB 1EPXA 1FX6A 1A5KC 4QIUA 5D30A 1V0MA 3TU9A 1RP8A 2V2HA 4NX0A 4W5ZA 1HJQA 3VILA 3G0UA 1YTEA 2H8ZA 5F4SA 1E0WA 3I65A 3A13A 1XSKA 3PR2A 1NOWA 2DT0A 4US5A 4FOJA 4H2HA 4JTIA 2GSHA 1OGSA 2YW4A 2IKJA 2PC4A 1QR7A 4IJRA 3P81A 2ZRVA 2GUUA 4AIOA 3V35A 3UWEA 5JXQA 4AVFA 2QF8A 3GDRA 4AZBA 3N04A 3N9SA 4IT1A 1DJWA 3CQJA 4DRSA 3QMTA 2QV5A 2WMHA 1R2TA 1KA9F 1AFSA 1WCGA 3VABA 3EXSA 4OT7A 3B0UX 4QE1A 3KL5A 4Y7EA 1PKYA 4YYFA 1TTIA 2E6AA 3MSGA 2R1LA 4H3DA 3GVWA 3SRHA 1W54A 4Q4MA 3IGHX 2YA1A 3WQPA 5BYWA 4M80A 2VDGA 5GJMA 1SZGA 4WOZA 3W7MA 1J2BA 1SSDA 4WSKA 2TAAA 3SBFA 1VBUA 1LROA 1BXBA 1LCOA 2WC3A 4M7SA 3ITLA 3CQKA 3F2DA 1QCWA 3ABSA 1PTDA 1BXNA 1LL6A 1PHWA 4BWLA 3VIKA 4WXYA 3LHUA 5E6YA 1ME7A 1XH0A 4P7LA 4UC5A 1OX5A 5LSMA 1KTCA 1L6YA 1OF6A 2Z28A 3WQFA 5AC8A 3S4TA 1Y5XA 3RN6A 4QAIA 3LTYA 4LB3A 5KSWA 2GGIA 1H7RA 2J8TA 4PMNA 2C7FA 4LY4A 1WDWA 2Z6IA 1NQ6A 4JIQA 5ABTA 5KINA 3BO9A 2VFGA 1VCFA 3VGHA 1WP6A 5FF4A 1A50A 5DCBA 3PB2A 4RR4A 3I6TA 3LBOA 4WDUA 5T9BG 1XISA 4GPNA 5ABFA 3MC5A 3GLCA 1EJTC 1RQBA 5AZ1A 2VEKA 1G94A 3GG1A 2ZZ7A 1QDSA 2GGJA 4P2VA 5LGXA 2EQDA 4C91A 2AL2A 4P8UA 1G9HA 4I8YA 1W3TA 3I7RA 4V28A 2H6RA 2V67A 3U6WA 3LCIA 4F3HA 1I2RA 3WH7A 3RK8A 5A6SA 1V6YA 4ZE5A 3V4BA 1TJ2A 4XG1A 1RD5A 5G4EA 4IIFA 3SRDA 2V5BA 4HYRA 1B2YA 4QM1A 3W71A 3QGVA 2YL5A 1LYXA 3REQA 4FMVA 4XUYA 1H4PA 3VK5A 3N73A 5A8NA 5CAKA 1Q6FA 4IPPA 1EPVA 1RLCL 4HHLA 4I5UA 3HN3A 4GINA 1H11A 4DM1A 3SQLA 4G8TA 4AD0A 4Y9NA 2VCBA 4YN5A 1EDGA 3LRMA 5C9UA 1KCXA 3NQ8A 5BZAA 1S3TC 1KC7A 3MB9A 8CGTA 3TSDA 1Q6EA 3ARUA 3FA5A 4PUDA 3GK0A 1Y7VA 2DSKA 5AZ0A 2BVWA 3LRLA 3CHEA 4O54A 7TIMA 4LS1A 1MFUA 5KZEA 2Z26A 1MZHA 4GUGA 1ZSXA 2ANUA 2O55A 4PH6A 4RE4A 3WMBA 2DH3A 3KZSA 1POJA 3D5HA 1P0BA 4PC8A 1JXKA 5M1TA 4CD7A 3T08A 3OVPA 2G8ZA 3XIMA 4I9MA 4I8DA 2BHUA 2I5GA 1Q2RA 1ZCCA 2PDNA 4M6QA 3KTCA 2QJNA 4CD6A 3UWVA 4H9ZA 2FZ8A 3P7YA 2HXTA 3CV6A 4AQLA 2Q8XA 3MZNA 1S38A 2OPJA 3GHRA 1K70A 4F0MA 5JQ9A 1EXBA 1S2VA 1JZ2A 3DX5A 1OJXA 3OVQA 1MW2A 4DI9A 1YXCA 3K5XA 3OZOA 1RBAA 4PE8A 1JUEA 4CCDA 3RM9A 1ONXA 1SQ7A 1AUSL 4PULA 1V6WA 4EPBC 3B0XA 4Q8PA 1FWJC 3P2VA 2FPYA 3VGBA 3VINA 2KX9A 4LANA 4KESA 2NZLA 3TH6A 3T42A 1X1ZA 2HE8A 3UZWA 1ML1A 1V0LA 1LDCA 2IS7A 4J5NA 3W88A 3N17A 1QRQA 3DFOA 3G3DA 1GOMA 1IE7C 1JD9A 5TNVA 1IR2A 2XSBA 1YMYA 1IZJA 2OZTA 1EP3A 3L7RA 3WFLA 3F5LA 2YL9A 1GEQA 1EC8A 1K8ZA 3ZXWA 4QP0A 2ZOXA 1RP9A 2PSNA 1XL9A 1X6LA 2JF7A 1UR9A 1ZAIA 1ZLPA 3I6EA 4IIHA 1NELA 2VCCA 4NXKA 1OX4A 3G22A 2CXEA 1KBKA 4Q8UA 4UCGA 1JULA 3EDFA 3NDOA 4OJYA 4AZ7A 3RR4A 3MP5A 5D2WA 2OZ0A 1LUCA 3T0DA 1F3TA 1UD6A 3DG7A 1X7FA 3G8EA 1EX1A 1NU5A 2O7QA 1FKWA 3K4WA 1VJIA 3H21A 2BLEA 2NLIA 3FGCA 3PZTA 5CEWA 2AQOA 1V6TA 2AL1A 4GQQA 1XIMA 5FD0A 1GG0A 1H51A 4S2CA 1X96A 4XK2A 3NO3A 3DZ1A 1Z44A 5A6BD 1BKHA 3QH2A 4OV9A 3W81A 4M19A 2OT1A 3RJYA 1KM5A 1A5NC 3G18A 3I4EA 1OYCA 3MKVA 3CLMA 4F8XA 1Q6GA 1REQB 1KM1A 1C93A 1NFPA 1MQRA 3WDHA 1RJPA 3H7UA 4JIPA 3NPXA 3AIVA 1XCWA 3MYPA 2WVVB 2PTZA 3NVDA 5EKYA 3PBUA 4NHVA 3FOKA 3A5VA 1D3HA 1X39A 5D8WA 4E5TA 5C6MA 3QR0A 1TUXA 4K3ZA 1F6YA 1GPFA 4DPQA 1YTDA 3PZ9A 3TLQA 3QSRA 1LTDA 3GXIA 5A5WA 2GQ9A 2GZXA 1OK4A 1VCVA 2X8RA 3CEPA 4M56A 3LCGA 1AH0A 4F48A 2QCMA 4A8LA 1R3WA 3NNTA 5K9DA 3O15A 3OHIA 4N4QA 5BNKA 2BHZA 4J40A 1XIFA 2DSUA 4N9EA 1IIHA 1T6MA 3DECA 4GUHA 3D3FA 1CLKA 1J6OA 5EFFA 4LQ1A 1W3IA 3IUDA 1D7FA 1JDFA 4IUOA 3W24A 3BK0A 4H8UA 5CPQA 5HPOA 2E7FA 1F3EA 3K1DA 3EKGA 3QYQA 4J4KA 1CXIA 4WHBA 4NUWA 3H7VA 1UWTA 1XV8A 3WBXA 1M01A 1QNOA 5C2GA 3P67A 2ZQ0A 3GC4A 1B9ZA 3LXAA 1UQZA 3ZQ9A 3BW4A 4E3VA 4ZEPA 3BLPX 3TA6A 2ZUWA 3WDQA 1GVRA 3G1VA 3VCCA 3ZMRA 5J04A 2WBGA 2FTPA 4LUTB 1JF6A 4GKTA 5B80A 3IV3A 3TW6A 2VP8A 3W38A 4NL1A 5T8GA 3V16A 1AL7A 4AY8A 5EY5A 4UMCA 5PTDA 2PWDA 4M82A 3IANA 3DI0A 4UOJA 2OYKA 2YCEA 5LNVA 3UF9A 1XRSA 4WJXA 3VC5A 3QQ0A 1QPQA 3WKZA 4W89A 4UBPC 2VELA 3ECQA 1F7BA 1ZBKA 1UC5A 2GDUA 3N34A 1SFJA 2PP1A 5FAJA 2BMBA 3DFQA 4W84A 2BVDA 1W3NA 1B4EA 1TPC1 5CZSA 2J6XA 2J9YA 4DY1A 5AC7A 1WE5A 1W1TA 4G9PA 3MUAA 1Y5VA 4NJIA 3ZLGA 4C6BA 3ARRA 5CLWA 3IJQA 3T81A 3CHCA 4GZJA 5GQBA 1LRQA 4CU6A 5ENLA 4DJDC 1HF6A 4JTKA 2PRHA 5F1UA 3O63A 4CU8A 1AVAA 3NZQA 1UH3A 3R8GA 1JAKA 3UG8A 2GWGA 1E73M 5LIUX 4QEEA 1DV7A 2Q09A 1T96A 2NWSA 5CGTA 4HNNA 2PDIA 4IXXA 3P62A 3RFAA 1UWAA 2P1FA 1OY0A 2NXGA 1ZNNA 3VMNA 5A8MA 2ZZ1A 3IACA 2ZE3A 4G6CA 3W26A 1UYQA 3VDHA 4QFUA 2OKTA 3UCQA 3C2YA 4IFKB 1NDZA 4FXRA 3PAOA 1OFOA 3W1LA 1G0CA 1ZALA 3ITYA 5DANA 1J0HA 1UD5A 1MSSA 3C4UA 4JTTA 1J0JA 3MBDA 4HSNA 5BRQA 2A7RA 3GC5A 4FLRA 2CLFA 2RJGA 3WLQA 3DGBA 1P1XA 4R27A 2Z7KA 3H24A 4AEOA 3W7HA 3AHTA 5CC5A 4HTYA 3LBMA 4GO9A 1R9XA 1LLWA 2A3HA 3MDUA 1V02A 1W1VA 3BMWA 3SRKA 4GNKB 1HVQA 4EWND 1WYIA 1A80A 3ZLFA 4LBRA 2X1RA 4LV9A 4LF2A 2OSWA 3N6HA 4AWUA 4GX9A 2YLAA 3QZAA 4O4WA 4YLWA 3M16A 4I9JA 2E5DA 4GCAA 1FFRA 4IQEA 3VIOA 3V5CA 1FWHC 1QVBA 3U48A 1AQ0A 4DWSA 3S5YA 4ERGA 4C1NA 2P88A 4E2OA 3ZYZA 3M5YA 4Z1CA 4AVOA 1G4SA 3WUGA 1C3FA 4AD1A 3AS2A 2FHCA 3O1NA 1D7KA 4QLJA 4MY8A 5XINA 1BHGA 4NAFA 3WQ4A 3W1XA 3OG3A 5E5CA 1PZ0A 1TE1A 3K8LA 1B9BA 3JS3A 3IARA 4QXIA 4AZCB 2R91A 3RMEA 3GQYA 3FKKA 1ITUA 1CWYA 3R25A 5B7ZA 3GNXA 4M6PA 4DLMA 4ZO8A 4IIGA 3PVFA 3DGRA 2B7OA 1V6VA 3GG7A 3SSJA 3UG5A 1EXPA 3NGJA 1KFCA 2GJLA 1DJHA 4KW2A 1PCWA 3A47A 3R4IA 1UWSA 4JKMA 2PDUA 2O9OA 1GTHA 2CLLA 1K4HA 1NAL1 1GOQA 3VTRA 3BMVA 1KFLA 5J8LA 5FSDC 2I56A 1J93A 3MANA 4H04A 1LORA 2BZNA 4OTKA 1ITXA 6REQA 5EMMA 3SUWA 4O50A 4C6LA 2H3DA 3GBEA 5DLCA 1CT5A 3HPFA 4S39A 2Z25A 3W1UA 1K03A 5EGRA 5BU6A 5D32A 1FDZA 1WXZA 2VEPA 3GXDA 3W53A 3A5FA 5E93A 3WLLA 5I79A 1Q4NX 3ZJ6A 2JALA 5DRIA 3HV9A 4LJ3A 1EOMA 4TV6A 3LI1A 3PUOA 3R13A 1AD4A 1SJCA 3CL8A 3FJ4A 1KR1A 3N12A 3LU2A 3W7NA 3UZXA 2JKEA 1PIGA 1G69A 1ZQ5A 3UGRA 5IDZA 3R6IA 1K7XA 2CPUA 5BWFA 4V1XA 3HPXA 2HVOA 3GU1A 3P93A 1WPCA 1TPWA 3EPOA 1AA1B 4JFTA 4LVAA 1A3HA 3VNKA 2X2GA 3E1F1 5KZMA 1RCQA 1K1DA 2QIIA 2X16A 1O1ZA 4UR9A 1JPKA 4TX6A 4UB9A 5A94A 3W2UA 4ZO6A 3G5EA 3O6AA 7REQB 2ZWYA 4GKLA 3ZS4A 2B81A 3ANYA 4PMJA 4E4UA 3T8LA 4ICNA 2BVTA 4C6MA 3WSUA 2ALDA 2ZUUA 3G24A 3QOMA 2ZKMX 2H90A 4PFMA 4Z08A 5TQLA 3N3MA 4P61A 3FK4A 3OA3A 1Z89A 4H41A 2A3AA 3P84A 4CCCA 1I2QA 2Y5JA 4ATWA 1BRLA 4MZ1A 2HBVA 2FDMA 3LOTA 3Q94A 2EKCA 3LXBA 3KVMA 4LNYA 3URAA 3VDAA 2BX7A 1H7NA 3BAJA 3K4AA 4O1FA 3BWWA 1J5TA 1UD8A 1IXQA 1JZ3A 3AHZA 2V3EA 3V3WA 2Z24A 3TYEA 1WDDA 1W3HA 1UZDA 5DMMA 5HMDA 5K2ZA 3WNNA 4HVXA 3AMDA 3PZUA 3QSTA 2VEMA 4PUWA 1FUYA 1SO6A 5A1AA 3O2LA 3DUGA 3GR7A 4LYQA 3S9ZA 3M5XA 4U4MA 3EPNA 2B7NA 1KCZA 1TZZA 4FI4A 3EKLA 3BLDA 3PUGA 1SR9A 5FAGA 5CLTA 3E3HA 5CC6A 4ROQA 3CIXA 1Z32X 4DJEC 2P0OA 5KMYA 3KLKA 1TX2A 1SM9A 3MP4A 4HJWA 4GYPA 1JFHA 4KEVA 2ABBA 4X0VA 3B9DA 3YPIA 3KRUA 2HRWA 4S3DA 1F2JA 2FFCA 3PY2A 2WMIB 4EXBA 2AAAA 4IIEA 1BLIA 4DBUA 2PUZA 1W5PA 2V68A 3GXPA 2GOUA 3PJXA 4M51A 3VNMA 1JYXA 1KM2A 2G0WA 3KXQA 4DF2A 4FIRA 4MGGA 4DUVA 2EPHA 3LLFA 1T41A 1QBAA 2QLYA 3N18A 1L8NA 1XD1A 3VAVA 3U2ZA 4Q8NA 1CLXA 2VGFA 4RW5A 2OSYA 4MB5A 3R8RA 1WQ5A 3A4XA 4DJFC 4L9YA 3APGA 2XG9A 2FB3A 2YR1A 1XG3A 3CLWA 3FIGA 3I6RA 3QTPA 1BG9A 4YTQA 4FEZA 1MZRA 5GJNA 2WYSA 3AYRA 1LOQA 1JCYA 5C2CA 3POHA 1TWSA 2FB2A 4JTFA 4BF7A 1AMKA 1GW9A 3HURA 3NL3A 3MMTA 5CC3A 2YCIX 1A4LA 5C2XA 3DENA 5ECVA 2YZ5A 3UJSA 2CLPA 4Z2LA 4YHEA 5CZTA 4YIWA 3UXDA 8XIMA 1BF6A 1PWMA 3GHSA 3UGVA 1RA5A 4KT2A 4ZODA 1W9DM 3WH6A 3MCOA 8XIAA 4AWEA 1YDNA 3C0LA 4ZCWA 3M5VA 4C6PA 1SO4A 4IG2A 2ZZ6A 3N11A 1QPNA 4PMRA 1QBBA 2NUXA 5F7UA 4GBDA 4XTIA 3CH0A 4MUPA 3B40A 4NU7A 2J6VA 3LB0A 2PFHA 4RNHA 4CNNA 1NWRA 2YZRA 2C18A 4M7TA 1ZL1A 2XPKA 4AXKA 3WQOA 4QHRA 1P7TB 3WZ0E 3W76A 3FCPA 5CPSA 4L1XA 1XKJA 2OKOA 1QOPA 1LWHA 4I6KA 4DIAA 3ZVHA 3R7MA 5CH9A 2UZ9A 5U4NA 5HOSA 4M0XA 3QV9A 1O68A 5HQMA 4GI9A 2X09A 5AKQA 5AOUA 3W02A 1CXEA 3QGAC 2XVKA 2OQLA 2ZZ4A 3SJ3A 1DWIM 4Q4KA 3STEA 3SUVA 4QE5A 4URIA 1YW1A 2BXZA 4NI8A 4DPPA 1H5YA 2AGTA 2DT2A 4QCFA 2R1KA 1W1A1 2GUYA 1M9HA 1W32A 5CKSA 2PLJA 1O5QA 1V3JA 1P5BA 3AIWA 4CQDA 4F9JA 3BCJA 1SFSA 2EJAA 2IQDA 2R94A 1W9BM 2Y24A 3EWWA 3RAOA 3USZA 2D2GA 5FSEC 3GZAA 3MKKA 5H6HA 1XLHA 4JFVA 2PDLA 4MWAC 4O8RA 3TX9A 3M0HA 1JGMA 4P8VA 1UD3A 5DMYA 3Q45A 1UD2A 2G97A 4GMEA 4R34A 1L2UA 3WDPP 1NIUA 3HO8A 1TVLA 2CZEA 1AZ1A 5TD4A 5A6BA 4F0SA 1D2KA 3DHFA 4NQ1A 2VM8A 3NURA 1JI2A 3MUIA 2FGBA 2X2YA 4QJ4B 5FF0A 4JTHA 5D9OA 5C70A 4Z1YA 3SQMA 2CERA 3IAPA 3OBAA 3KRBA 1EKOA 3TC7A 3BLIA 3G0XA 3V0UA 1ESWA 4MNLA 3FHAA 2DJXA 3G6LA 2QCCA 4PTWA 5H91A 1XLAA 1WNOA 2XTKA 4KEUA 3W82A 2CZ5A 4W7VA 4KH2A 4O10A 1AJ2A 4HIBA 3BJSA 2OX4A 4R88A 4JTCA 2CWXA 1QUMA 4K68A 1G6CA 1TZ7A 4YJ5A 4JQ1A 3NZRA 4P5UA 2E9BA 4OBRA 4US6A 4H9XA 1F4HA 3IJ6A 4RL3A 4QNEA 4IP7A 4XKYA 4IPJA 5I2UA 3AXXA 3E96A 3WDJA 2EHHA 3SUUA 5LYRA 3B8DA 4AXNA 1N8WA 3TQPA 4O13A 3WLNA 4OE7A 4QNWA 1KXHA 3ES7A 4GXPA 1PDYA 1ECQA 2GK1B 3ICJA 2D2JA 2HWGA 1VHNA 4R9XA 1WDRA 4D6CA 1FWRA 3W0KA 8TIMA 2W63A 4LOCA 5EB8A 4PBEA 3ME3A 4FR1A 1GOWA 4ACZB 1VYPX 2GVJA 5BCAA 4PTXA 5I24A 3B8VA 1X1NA 3U2EA 3P82A 1AQFA 3S9IA 4RDVA 3CV7A 4FXJA 1G4PA 4LCQA 3UZJA 3B3DA 4MY9A 3TFCA 5A8GA 1FBAA 1F5ZA 4UUIA 3CUXA 4J3ZA 1X38A 4GX8A 1WKEA 1QPRA 5BROA 2R8WA 1UOZA 4JNMA 1KGUA 2W66A 1MQPA 4MG4A 2Y6ZA 1Z8AA 1MXGA 1PV8A 1J6PA 4WJEA 2DUZA 3NQDA 3OBKA 4QLKA 4B5WA 3B8WA 1XG4A 4X61A 4QLLA 2HK1A 1ZPTA 4XIAA 2OFJA 3C3NA 1DHPA 3IIXA 3QW3A 1EEXA 1JCJA 2ZYFA 1R85A 3NQ6A 4Q8MA 3HQ1A 1F61A 3IRDA 1WXYA 4IX2A 3PP7A 3MY9A 2GL5A 1UJQA 3S6OA 4HSHA 3KCJA 3BH4A 3M44A 1WDPA 4C90A 3CAWA 4LYPA 1TSIA 2JGQA 4XBSA 3T09A 3ELFA 5CSUA 1AW1A 2A3LA 4YHGA 1OK6A 4YPJA 2QT3A 2Z4GA 1I1WA 1RPKA 1QOXA 3LQGA 1EQCA 1CGWA 2PCQA 4JN6A 3SSZA 4EPDC 4RNJA 1P0EA 3QMSA 5LIWX 1W1ZA 1VD6A 1B0IA 3OVGA 4C6JA 3GDMA 2XIBA 3BSMA 3W7GA 2EAWA 3NYDA 4D6JA 3D46A 5HUPA 4HOWA 4OGZA 1UA7A 4MNJA 4RNFA 3VX0A 1XYBA 4BI7A 2O9PA 1W2VA 3THAA 4PMQA 4RPPA 1E1EA 1VS1A 1TCDA 3DKJA 2ZDSA 3B03A 3HPAA 5HNUA 4QDMA 4QQ3A 4EP8C 3FYPA 4H7ZA 2BXVA 4MJ2A 5FF7A 3ZOAA 3GXMA 2IKHA 3SGGA 4O0ZA 1FFQA 7ENLA 1HGYA 3SAZA 2QUUA 4LV4A 3PPCA 4QDWA 3LLDA 3F1QA 3SW6A 5LNSA 3N4FA 1EUAA 3E0WA 3STCA 4L1GA 4YTUA 1V0KA 2FKPA 4KBXA 1T7LA 4Y8FA 2GLKA 4WDTA 3VIIA 2PEVA 3FS2A 1HGWA 5G1TA 1SMAA 3H2AA 1K6WA 1R38A 2VDHA 1VIZA 4GUIA 3AJXA 1Q6RA 1EA0A 4EXAA 1UWUA 2XIIA 2SFPA 2BG5A 3EGJA 1ELSA 3OGRA 1F07A 1UB3A 4A3RA 3T55A 4R3UA 3T2OA 4XZNX 3UFYA 1W8GA 2OQHA 3KLLA 2G37A 3VOGA 5AC6A 5CSRA 2ATMA 2IPWA 3RITA 2IPJA 1EOKA 4NX5A 2WNNA 5EMYA 4XO7A 3KUMA 3MVTA 1Q7QA 3EPMA 4V15A 2WO5A 5FJIA 2OTDA 3LZ5A 3KOXA 1IEXA 3HQOA 1KRCC 4LTSA 1ZB5A 2NQHA 1WO2A 3EBVA 5K4ZA 2Z29A 3OQEA 4U33A 4A2RA 3MMDA 1AJZA 1MNZA 3QQWA 3T0BA 5GNZA 4AZIA 2YBVA 2X05A 4HN4A 3MI2A 2VOTA 2XWEA 3W6LA 5KITA 4IGNA 3KDOA 3QJAA 3LSBA 1KR0A 1T0OA 1EF3A 2GOKA 3K30A 3GM8A 3WEMA 6A3HA 5HWMA 4H8HA 3ALFA 5L6UA 2Y85A 3M43A 2P53A 1EIXA 4GIRA 3TTSA 3VNZA 2QDHA 1CYGA 3VOHA 3NL5A 4X0NA 2QVNA 1A5BA 2XIOA 1POKA 1TX0A 3S1UA 3DG6A 3RRAA 3TQ0A 5DBUA 4GLEA 3S9YA 3E49A 5M2FX 3TTYA 5DMLA 5CG0A 3LMZA 4KPLA 2XGIA 3TWBA 2FLIA 3RM4A 1Q2SA 4LVGA 3DHDA 1JZ6A 5C71A 4UTJA 2QCNA 1TJPA 3BV4A 5AVHA 3W6YA 1J12A 4IFOA 2H9AB 3V36A 1JPDX 3A4WA 3N6JA 3WQVA 4LC6A 3S46A 1TPVA 2WHJA 2YFNA 1UASA 2UWFA 2WM0A 3IJIA 5F2MA 3AIBA 3BG3A 4GJ1A 1R7AA 4BF9A 4LFYA 3ITGA 1SVDA 3OP2A 4EKJA 1T8XA 4XAYA 4JPGA 3NFUA 5DCEA 5JIPA 1U1HA 4MOZA 3A6OA 3VA8A 4IZGA 3WLRA 5BRBA 2Y0FA 4TMBA 1ZU8A 3E74A 4ACYA 1G67A 3MDWA 3FLUA 1NDVA 2V9DA 2DPEA 3UWYA 4ZQNA 4UNKA 3W7QA 3L0NA 2BY3A 2E67A 3E2VA 3IUHA 3W84A 3WLJA 3GR4A 4WJ8A 4IP4A 4YTTA 3EA1A 1W91A 3LM3A 3WG6A 2WPGA 5IHSA 4ZB2A 4S3GA 3QV7A 2PDWA 4O17A 3QKEA 3MWCA 1XLDA 3EWZA 4H7VA 1ONEA 4H9MA 2CLKA 4ZB0A 3AXMA 4A2SA 2X7VA 4FX6M 3QLLA 4N9DA 2E40A 4FPSA 4CD5A 1XF0A 5G4HC 1JPIA 3BC9A 4KCTA 3BQ6A 2PZ0A 3WD0A 2R82A 1RLDA 5HMEA 2AKMA 2WMKA 4OECA 3NWRA 3RCMA 4GABA 1NWTA 5JU6A 3GNNA 4LU0A 3GXTA 3W7RA 3F5JA 3IV8A 3OIXA 3NM3A 1KWGA 4HU0A 1AH4A 2W3ZA 2OLAA 2NWRA 1Q6QA 2XYLA 3GE7A 3I68A 1VQTA 4W5UA 3DFPA 2WANA 4RW3A 1XYMA 3BLOA 4JCMA 1L0PA 3VIJA 3JR2A 4IPIA 4CNTA 1PKLA 4IMDA 1X8CA 3H12A 3A3XA 3H2MA 3VKKA 4Y6GA 4OU1A 1ZP3A 2XHYA 1S2CA 3NQFA 1US2A 1K3UA 4HTBA 3MVIA 1EJVC 5CPNA 3DERA 5AYIA 1GG1A 4NF7A 1GZJA 4A3YA 2O56A 4I3GA 3P6LA 1FH9A 4PMVA 3KBWA 3OHMB 2XH4A 3CPGA 2XIJA 4IPNB 1TMQA 1PZ2A 3E2RA 1EJSC 3UY8A 1VGAA 2QCHA 3EX4A 3MO7A 3RPTA 3SN1A 3BPWA 5EMJA 5I5RA 1ZCOA 3M0IA 2VZTA 1FHDA 1GKQA 2YJQA 2YPIA 3FX4A 1OEPA 1JR1A 2DUXA 2XVNA 1DTUA 2VMFA 1A3WA 1R6WA 3E0LA 1JUBA 1WBHA 3GTFA 3KHJA 4DYJA 3TONA 1WDQA 2D2OA 1PSCA 1NF0A 3W07A 3QM3A 2V82A 3WF3A 3DEQA 4J3WA 3WN6A 1DWAM 1WOAA 2VI0A 1HL8A 4MY1A 1MRAA 1Y5WA 3SCQA 4N7QA 2DH2A 3S2CA 1KQYA 2WSKA 2WJDA 4C6IA 3KTXA 3CWNA 4G1NA 3OEXA 2V30A 3M7SA 1DJNA 9RUBA 3VGFA 3OPSA 4JS3A 4K7YA 4J3VA 5FCZA 4CN4A 3KL0A 1HKKA 4YNGA 1VJZA 3L65A 1RPXA 5AN7A 1C92A 2H3BA 3RCNA 1JG9A 3HGSA 3WFAA 5TBOA 3UEQA 3UZ5A 2KZHA 4DYKA 2E4TA 2I5IA 3M1ZA 2R6OA 5HWJA 4MJMA 2ZCGA 3I7SA 4H6EA 4L4LA 2HK0A 3SQSA 3AZTA 2YL6A 4ONVA 1C9WA 3KL3A 4HBKA 2D20A 3M0KA 3AUOA