3AHYA

Crystal structure of beta-glucosidase 2 from fungus trichoderma reesei in complex with tris
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
465
structure length
465
Chain Sequence
b'MLPKDFQWGFATAAYQIEGAVDQDGRGPSIWDTFCAQPGKIADGSSGVTACDSYNRTAEDIALLKSLGAKSYRFSISWSRIIPEGGRGDAVNQAGIDHYVKFVDDLLDAGITPFITLFHWDLPEGLHQRYGGLLNRTEFPLDFENYARVMFRALPKVRNWITFNEPLCSAIPGYGSGTFAPGRQSTSEPWTVGHNILVAHGRAVKAYRDDFKPASGDGQIGIVLNGDFTYPWDAADPADKEAAERRLEFFTAWFADPIYLGDYPASMRKQLGDRLPTFTPEERALVHGSNDFYGMNHYTSNYIRHRSSPASADDTVGNVDVLFTNKQGNCIGPETQSPWLRPCAAGFRDFLVWISKRYGYPPIYVTENGTSIKGESDLPKEKILEDDFRVKYYNEYIRAMVTAVELDGVNVKGYFAWSLMDNFEWADGYVTRFGVTYVDYENGQKRFPKKSAKSLKPLFDELIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase
publication title Structural and functional analysis of three beta-glucosidases from bacterium Clostridium cellulovorans, fungus Trichoderma reesei and termite Neotermes koshunensis
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 187
structure length 465
sequence length 465
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ahyA00
1ISZA 4UFJA 3LPGA 4UFLA 2ZX9A 3UG4A 1RP9A 3KZSA 1LL4A 1JYWA 3VILA 2WCSA 3CGTA 3RDKA 4F9DA 2YDRA 3SEPA 1KQZA 3AHXA 5A6AA 4PTMA 3LPFA 1GQLA 4MNMA 2WWDA 4YHEA 3SUTA 2DT0A 2DSKA 3D5HA 3GBDA 1UZ4A 3TONA 4B3KA 4ATWA 1E1FA 4XB3A 1DWAM 1C90A 1GQJA 1C3FA 2XJ7A 1LLOA 2YLAA 3WF0A 4CGTA 3ARTA 2XG9A 1JL8A 2YDSA 4W88A 2V5DA 3F5LA 2JIWA 5JIPA 4PMNA 2CEQA 4PTWA 1R7OA 3ARRA 2AMGA 3CZLA 1QBAA 2BVDA 2FGZA 1KR1A 5I78A 1PEZA 3W29A 5TD4A 1MFUA 2G3MA 1O6IA 1NOUA 3ZMRA 1UD2A 2ZX7A 2EQDA 1AMYA 2VC9A 4ZE5A 2VCAA 2XWEA 3RILA 4PMRA 5HDRA 1HNYA 1E3ZA 1BFNA 2X1IA 4KRUA 4W86A 3QGVA 1XHGA 2VCCA 4Z2JA 1CEOA 1CNVA 2UWFA 2XHYA 2PF0A 2HVMA 4M81A 4GI8A 5GNXA 4GQQA 4FLQA 5IFPA 4Z2LA 1VFMA 3VIOA 2Z1KA 1IV8A 1US2A 5HOSA 4ZXLA 1HXJA 4XZBA 1V02E 3WF3A 3WQVA 1E5NA 2G41A 1EDQA 4PMUA 4AD1A 4HOWA 1GONA 4ZENA 3WENA 2PWEA 4TX6A 2WC7A 4HMCA 3VMNA 5M5DA 3WH7A 3VDCA 4JCLA 5A6LA 1DWGM 3WH5A 4X0NA 4Z2GA 3W38A 3AMCA 1UH4A 4MADA 4Q22A 2Y5EA 1V3MA 4AZ7A 1FH8A 3W28A 1QI0A 1BG9A 1H1NA 5IDIA 2DIJA 4KGLA 3T2QA 1TFVA 4QLJA 3SIMA 2J77A 1CPUA 2PWHA 2DQXA 5BROA 1B90A 3ZSTA 5FCZA 5JUVA 2FDMA 1XRVA 1MW1A 3VUPA 1QVBA 1HJQA 3N17A 1VFFA 2VVSA 3WEOA 3PZOA 4UCFA 3VO0A 4V27A 5CLWA 4KH2A 3S6TA 2G3NA 1QHPA 2DH2A 4MDPA 3WELA 1CGYA 3ZR6A 1J18A 5FL0A 4Z2KA 2OSYA 3UCQA 3GXMA 2O9RA 2VTFA 3WD2A 3GH5A 4UTFA 1R7AA 4AEFA 4BCEA 1IT0A 1QNPA 2UY5A 1LJYA 4CCDA 1HKJA 3SCVA 1LWJA 4D6JA 2BFGA 4GKLA 2C7FA 1E6ZA 3WEZA 2DT2A 3WBAA 2VZSA 2VZTA 2D22A 4OZOA 1WZAA 4ZFMA 5M3WA 3W0KA 5DF0A 3RJXA 1JI2A 4PMZA 4TTUA 1TA3A 3AHYA 4XV0A 4GI6A 1V0LA 1G0CA 2Y8VA 3AQUA 4HA1A 1GJUA 4LPCA 5ABHA 7TAAA 3WIJA 1M01A 3FHQA 1WDRA 3NJ3A 3U7BA 3WF4A 4P8XA 3CZEA 1DWJM 4AIEA 3OLDA 3M6DA 2CETA 4IISA 3F5JA 4QCFA 1KGUA 4B15A 1QNOA 1L8NA 2XVLA 1GJWA 1HVQA 1PZ3A 1BLIA 2EJ1A 1SYTA 4S3JA 1VEOA 1NM9A 2WMHA 2WVSA 3W81A 4CD8A 3WD3A 1UKSA 4PSRA 3BCDA 4AISA 3KEHA 1ZS2A 3NSXA 2J7BA 1FP9A 1RH9A 1V6WA 4AD0A 3AIRA 3EMCA 1CGTA 2X05A 1OIMA 4OBSA 4ATDA 3VD9A 3VOCA 2ZWZA 4C7DA 3WDPP 3TTQA 4AIOA 4JFVA 1E55A 1UUQA 2RGLA 1CTNA 3DYPA 1A47A 3ALFA 1UOKA 2VX6A 3SCUA 4BA0A 3WD4A 1U30A 1ZBVA 1TA3B 5HPOA 1JDAA 1GVIA 2XM2A 3AYSA 1XC6A 1CIUA 2WVVA 1QNSA 1UKPA 3SUUA 3OG2A 3M07A 1ODZA 5DEZA 1W2PA 1HF6A 1XCWA 2VRKA 1WE5A 4D6EA 3WQ6A 3WQWA 4BQ3A 1EH9A 1PAMA 2CITA 3CMGA 4U2YA 4B9YA 3AYRA 1XH2A 5AC4A 2A3AA 1B30A 1LWHA 5I5RA 3K8MA 1NOWA 1GQKA 2RGMA 3HU7A 1J11A 3MV01 1ZBKA 2WWCA 4EK7A 1NARA 2PB1A 4MAZA 1C91A 2AAAA 2ZIDA 5IHRA 3MS8A 2VX4A 4F8XA 3BH4A 2OLHA 2VR4A 1MQRA 5D9NA 1CDGA 5D9OA 1L0PA 3T0BA 2WAGA 2BVYA 5D9MA 4CN4A 1B2YA 1CXFA 3VDAA 3AIBA 2WANA 3GXDA 4PMQA 2D0HA 2HISA 3ZO9A 1MYRA 3AFBA 4AMCA 5CPTA 3CUJA 3EDEA 3AZRA 1H41A 3L2LA 2J4GA 2IXVA 1S46A 4HPHA 3FY1A 1VJZA 2WVVB 1E4IA 3AMDA 1B9ZA 1ESWA 3GM8A 5JBEA 3SUWA 2YA2A 2CHOA 3RPMA 4D72A 4PMYA 2WB5A 2J74A 3N18A 4A3HA 1B3ZA 2WCAA 3IJ9A 3CBWA 2WKGA 1W3KA 4PN2A 5HPCA 5CZKA 1G01A 3EDKA 1H3GA 1EDTA 1HKIA 1ECEA 1OCQA 1BYBA 3CZ8A 1V03A 3SUVA 3ZIZA 1H0IA 1GOKA 2BV9A 2ZXBA 1UQZA 2A3EA 1GW1A 1BTCA 4U33A 4TVUA 5I0DA 1Q6EA 1WB0A 3AIUA 1JZ8A 1ZL1A 3VM5A 2BY2A 4ACZA 3ARYA 1HT6A 1UQYA 3ARQA 4AZBA 5KEZA 1BVNP 1KQYA 4TVCA 2XM1A 3SCTA 2EPKX 3A6OA 2CBIA 4MPKA 3GYCA 4J3UA 4H8VA 1E0WA 3EMZA 4FF5A 4QDMA 5C70A 2XTKA 1B3XA 5FD0A 1PX3A 3THCA 3ZT7A 1MVYA 5A6KA 2WMGA 4U5KA 1GVYA 1BYDA 2QPUA 1E40A 4Y7EA 1DWIM 4RL3A 2W92A 3GXIA 4J3WA 4M24A 4HMDA 1HVXA 2V3GA 1QI4A 1QNQA 1JFXA 2BY0A 2ZXDA 2CXGA 1C7SA 3II1A 3KWXA 2X0YA 1PIFA 4KRTA 1OSEA 3ZT5A 5CJ5A 7A3HA 4IM4A 3TTSA 3OLIA 1JYVA 1C93A 1HKKA 1C8QA 3T09A 5CG0A 3AICA 4D71A 1KXQA 2DT3A 4H8UA 3SCPA 2ZOXA 4U3AA 4OKDA 1C8XA 4R5EA 4AZIA 8A3HA 1UKTA 4NI3A 3BLKA 4ACZB 4UQAA 3ARWA 4PUDA 3AXHA 1UKOA 1QW9A 2QHAA 2OYMA 2W67A 5FOOA 3ARZA 5A8PA 1VAHA 2VI0A 1QI5A 3AS1A 1CGXA 1CGVA 4GIAA 3B8SA 1EA9C 4YN5A 1VBRA 4Z2IA 1UR0A 3AROA 3OZPA 1LL7A 3AZSA 3VIPA 4MNLA 1UR9A 4FLOA 4UR9A 2W63A 1FOBA 2VZUA 1G94A 2IXUA 1ITCA 2W5FA 2V5CA 4H41A 1DWHM 2YIHA 5AYBA 3CUFA 2QV4A 1XCXA 4AZCB 1XD0A 1JXKA 1PIGA 3AS0A 4AXNA 5LA1A 1HJSA 2CNCA 2D0GA 4WSKA 1EDGA 3BC9A 1UD5A 1WDPA 2J7CA 1HL8A 3CUGA 3WH6A 4BF7A 2DSWA 3VINA 1ODUA 4B9ZA 4A4AA 3NIYA 3BGAA 1NWTA 3WH8A 4LX4A 1AVAA 1JZ4A 1UA3A 4JL1A 1CLXA 4UQBA 1E5JA 1US3A 1EOKA 3WUEA 5M03A 1GPFA 2J47A 3L4WA 2J7DA 3SCNA 2GVYA 4U31A 3EMQA 2XVNA 1OWQA 6TAAA 5FIPA 3POCA 1I1WA 4GINA 2W4XA 3KL0A 1CBGA 2WVUA 1I1XA 2YBTA 1H49A 2YBUA 5ECUA 1R8LA 4J3SA 3NSNA 2BY3A 2GJXA 4NF7A 5E70A 4JCMA 4DWSD 3VNZA 4DUVA 3CO4A 5JIWA 4A3YA 6CGTA 4GZJA 3N1AA 4WJXA 2G3JA 1OBAA 3KL5A 1J0KA 1EGZA 1GCYA 3A4WA 3AS3A 3VIJA 1ISXA 1YQ2A 3OLGA 2EPNA 3T2OA 4W7WA 3GDBA 3L2MA 1M03A 1W9BM 5HBFA 2GSJA 3WQ4A 3MUIA 2XGIA 5CPSA 2E9BA 1HX0A 5A94A 1DP0A 5CSUA 4BQ2A 5BRPA 4CU6A 2BHZA 4UOZA 2BHUA 3VU2A 4IUGA 1PJ9A 2WC3A 5FKYA 2A3CA 1BGGA 1V6YA 4PEEA 4JHZA 3IK2A 1KXTA 4QFUA 1HKMA 3A4XA 2VX5A 3N12A 1E6QM 1V08A 3VDBA 2PWGA 3UESA 5BRQA 4CUCA 3OIHA 2GJXB 2Y24A 3TP4A 1CXHA 1N82A 3MUY1 2QLYA 3IANA 1V0MA 4AC1X 3BAJA 3CHDA 1BPLB 1CWYA 3CZGA 5A6SA 4AEEA 2WBKA 4BS0A 5D8ZA 1XD1A 4UFHA 1OIFA 2VX7A 3OBAA 1UG6A 2PC8A 3PZIA 4NRSA 1GUVA 3ZJKA 3UG3A 3O9NA 5DFAA 3TA9A 2FHBA 3ZSSA 1DTUA 1NP2A 2ZX6A 3VD3A 5BXPA 2YL8A 4V2XA 3RM9A 3W53A 3QHNA 2WHLA 2VVNA 1OGGA 3U7VA 3VGDA 5DT5A 4HZ7A 1OGBA 3AIEA 1JG9A 1MFVA 3F4VA 1D3CA 4RE2A 3L4TA 1H11A 1JF6A 1BQCA 4JKKA 3MO4A 1OM0A 1Y7VA 2O9PA 2CKRA 3BMWA 1UR4A 2ESCA 4MB1A 4V28A 5CSYA 4UQDA 3WD1A 3VD5A 1GOIA 4LGXA 1OT1A 4WF7A 3PTKA 4PTVA 3IJ7A 3ZT6A 1C8YA 3AZTA 4PYSA 1B0IA 4MB4A 3WUFA 3L4VA 2G8ZA 3K4AA 2CIPA 5LA0A 5E0CA 1QHOA 3AMKA 1JIBA 1WDQA 2DSZA 1E1EA 2YKKA 4J3VA 5EFDA 1KXVA 3MV11 1VEPA 1BYAA 1W9XA 2JE8A 3WN6A 3CZJA 1HJXA 2XFFA 1EO5A 2VQTA 2ZX5A 1WCGA 5BXSA 3DHPA 1SR0A 2WMJA 2BHYA 2D20A 4S3KA 4Q7NA 1H09A 1E0VA 1UWUA 1BYCA 3WNPA 1HJVA 3MU7A 1BAGA 3DECA 4PTXA 2A3HA 3U5UA 2CERA 1TG7A 1W9VA 1GHSA 1E0XA 1B1YA 1EIBA 1UWQA 2DH3A 3MSGA 2PWFA 4W7VA 2X8RA 1JYXA 3T0AA 4DM2A 3WF1A 1Q6FA 3MKKA 1ISYA 2D2OA 4PUEA 5A69A 4UZUA 3CH9A 4CCEA 4FMVA 1U33A 1LQ0A 2VT0A 3VIFA 3MMUA 1K6AA 2EO7A 2C8NA 1GNXA 5M17A 1AQHA 2WHKA 1XSJA 3A4AA 4PSPA 3N11A 5E6YA 3LMYA 3ZJ6A 4EKJA 2QMKA 1JNDA 3QR3A 4HU0A 3FN9A 5A6BA 5I6SA 2CBJA 4Z2HA 2XFYA 2QPSA 2JF6A 2VOTA 4JAWA 1JZ5A 1GOWA 4AYSA 2VZOA 2O9TA 4E4PA 2NT1A 1HJWA 3VIKA 1UD6A 4IPLA 5C71A 3JUGA 3HMCA 4J3TA 1P6WA 3QOMA 2WC4A 5IHSA 3O2LA 2ZXAA 3N15A 2X09A 1XH0A 4PMDA 2YJQA 3AOFA 5I77A 1V0KA 3DC0A 3VGBA 4DWSC 3L4XA 1VFUA 3VX0A 1G9HA 2YA0A 4JFSA 4BQ4A 3A47A 4P7LA 1MW3A 4EAMA 2PI6A 4MJ2A 4W8AA 1QI3A 7CGTA 2YL5A 3SUSA 4H7VA 4OIFA 1OGSA 4F79A 4X9YA 2WCGA 2G4FA 3WL0A 3U57A 3TTYA 1CENA 3PTQA 1U2YA 1GHRA 1BVZA 4P7QA 8CGTA 2ZX8A 1OD0A 1Q4NX 3AHZA 1E6NA 1E71M 2VZVA 2WMFA 1JNEA 1RD6A 2CYGA 3OA5A 3CHEA 4PCSA 2D0FA 1FH7A 3ZJ7A 2XGBA 2JEQA 2XSAA 1BGAA 4D6FA 3WNNA 3PZTA 5ABGA 2NSXA 4AY1A 4J3XA 3O6AA 2WSKA 2NT0A 3BCFA 3BAYA 1F4HA 4FK9A 3ZQ9A 3EDJA 1JD9A 1LF1A 4J7RA 1R86A 1UR8A 1W32A 2J7HA 4LYQA 2UY2A 4GZEA 1XH1A 2V3DA 3W27A 4AD2A 3I3BA 4KMQA 1SFSA 1R85A 1E6RA 1E9LA 2Q8XA 1I75A 5EB8A 4CD5A 1SMAA 3W82A 2ZUWA 2VRQA 1EQCA 3ZJ8A 5BXTA 4AIUA 5A95A 5A6BD 1VJSA 3L4YA 4W85A 4WK9A 1UH2A 2D23A 3BAWA 4AD4A 2D24A 1JDCA 2EXOA 3OZOA 5D8WA 3HN3A 4W5ZA 2WHMA 4MTVA 4F9JA 1KBKA 2GK1A 3WF2A 1WZKA 5F7UA 4XUYA 3CHCA 2BS9A 3FHAA 4NZCA 2W61A 4GO9A 2J7GA 4PRWA 1VENA 3CHFA 1E4LA 1PPIA 3W26A 5AC5A 1WP6A 4W89A 2WPGA 3RJYA 3VGGA 5A1AA 4BZYA 4MAVA 4AZ6A 3GNOA 1UD4A 1TCMA 1NH6A 1CGWA 4PMXA 1K9TA 2Z1SA 4XX6A 1CECA 2EEXA 5I3DA 4WKAA 2GJPA 4E8DA 1C7TA 5ABEA 4JFUA 1GOMA 3NYDA 1J0HA 5GQBA 5BXRA 2JFEX 2BY1A 2W91A 2J75A 3VGFA 3FW6A 4DWSA 5EMYA 2YL9A 1FFQA 1YHTA 2VO5A 5CXPA 4DM1A 3AIVA 4AZHA 4CCCA 1CGUA 1D7FA 4JKMA 4MDOA 1UWRA 4PBGA 1JYNA 1W91A 2WMIA 3CLWA 1J01A 1GOQA 3G6MA 1QNRA 3S2CA 4WIWA 3I3EA 4P7OA 5BCAA 4HMEA 1FHLA 2GK1B 3WFLA 1EHAA 4UOJA 3LPPA 1E15A 2FH8A 3SCWA 5ABFA 4LXFA 5IFTA 2F61A 3WH9A 2VCBA 1UWIA 1ZBWA 3WDQA 1J9YA 4FLSA 4HTYA 2G3IA 3AI0A 2X0HA 3VM7A 1V6VA 5A6MA 4ZXOA 1HIZA 3BAKA 2JALA 3W25A 1CXIA 1WDSA 1D2KA 3G6LA 2BVTA 3VKKA 4H04A 1W9UA 2XYLA 2A3BA 1E3XA 1UWSA 3WBEA 3WUBA 5A8NA 5A2AA 3CPUA 4C7GA 4CVUA 1J0ZA 4OJYA 1H0GA 3VMPA 4DWSB 3GXFA 3MUZ1 4X0VA 3GNRA 1FFRA 3NUKA 2BXYA 1CXLA 4J27A 5CLTA 3FXYA 2ZUUA 3T0DA 4ML4A 4UFKA 2WMIB 4UOQA 1UD3A 3CIVA 1V3IA 5BWFA 1ZU8A 1HP4A 5A2CA 3DYMA 2E9LA 3DHUA 3TOPA 1V02A 2GDUA 3WMBA 4GO8A 4HZ6A 1E73M 2WZEA 1TZ7A 3PTMA 5CQ1A 4D6CA 1UR1A 3ARVA 1PZ2A 2WXDM 1NWRA 2E40A 5A8QA 3RMEA 2BNJA 2XVPA 1ITXA 4CN1A 4IPNB 2D3NA 3ARSA 2YDQA 3AS2A 1F4AA 2CKSA 3SURA 3CUIA 3K8KA 2DGAA 1OT2A 1J0YA 3WSUA 3B9AA 5DT7A 5CGTA 6A3HA 3BAIA 1ZB5A 4HOZA 4RE4A 4YHGA 1KXHA 3BLPX 3UETA 2FH6A 2MANA 3WMSA 4HPGA 1J0JA 3NSMA 3W24A 3OGSA 3VVGA 4RE3A 2AOSA 3WDHA 4UFIA 3MUAA 3VX1A 1NWUA 3FNDA 2GUYA 4CN6A 1EOMA 1Z32X 3SCOA 2CCRA 1AQMA 3VIMA 2WK2A 4GZIA 1OINA 3AIWA 3AMGA 1UA7A 5JBFA 1AQ0A 3VIGA 1VB9A 2VMFA 1W1PA 3VMOA 1JAKA 1K9DA 3GH7A 4OOZA 1GORA 1ZBCA 5E09A 2J79A 2CHNA 3WNLA 2WSPA 3WKZA 5DO8A 1MXDA 1DWFM 3VIIA 3WNOA 3OLEA 3WQ5A 3PZGA 2QF8A 2YL6A 3UR8A 4OUEA 1UHVA 1RPKA 1CXKA 2CBVA 5E0FA 3PZ9A 1B31A 2XSBA 3D3AA 3CTTA 1JGIA 4UFMA 4TOQA 2GFTA 1TMQA 1K9FA 4JHOA 3WNMA 2Y4SA 3RO8A 1G1YA 1W1YA 4JFTA 1DEDA 1J0IA 1V3HA 3PZNA 2XVGA 2WM0A 2WKLA 4ATLA 1TE1A 4B3LA 5KZ6A 1EXPA 1KBBA 2DPEA 4FLRA 1O7AA 1QPKA 4P7RA 4JZ5A 2YLLA 1HL9A 3UEQA 3NCOA 1MW2A 4E8CA 4UQCA 4W5UA 1QOXA 4M80A 3ZOAA 3QOKA 3OGRA 3AXIA 2F2HA 4DUWA 2ZUVA 1KB3A 1WPCA 4OBRA 3J7HA 3E1F1 3KL3A 2W66A 2E8YA 3A3HA 4EANA 2XPKA 1JDDA 1UD8A 1VIWA 3NDZA 4TTGA 1JZ6A 2V38A 1E70M 3MSDA 2WZIA 3PN8A 4BQ5A 1UYQA 5I23A 1XYFA 1UWTA 1TUXA 2XFRA 1OD8A 3MMWA 3WFZA 3K8LA 1JXJA 1IZKA 1J10A 9CGTA 1GQIA 2EPMX 3N13A 5GNZA 1EHNA 3MMDA 2FHCA 3T08A 4HU8A 1SMDA 3APGA 1G5AA 5JBDA 3FAXA 1W3LA 4LQ1A 1CZ1A 1WZLA 4MB5A 3UR7A 1FH9A 2J25A 4M82A 2XVKA 1A3HA 1V0NA 4CD4A 3AHTA 1NOFA 1JFHA 1VRXA 3W6MA 1BHGA 2V3EA 4URIA 3CUHA 1PX8A 3IAPA 3THDA 3IAQA 4W8LA 2UY4A 1W9PA 1UKQA 4DUXA 4GI9A 2J7FA 1MWOA 3ARPA 2YOCA 3CMJA 4CD7A 1MQQA 2J8GA 3RM4A 5CPQA 1LG2A 3UERA 3PHAA 1W3JA 2DDXA 4R27A 1FHDA 3HJEA 4P8UA 4GQRA 3WDRA 1LG1A 1LL6A 3EBVA 3TTOA 4U3CA 4WKFA 3SCRA 4CU7A 3U5YA 4JFWA 1KFWA 3GTNA 2V3FA 5FL1A 1VF8A 1JZ3A 1M04A 3VPLA 4AZGA 4HA4A 4W84A 3PBGA 1QBBA 3L4ZA 2XIIA 1Q6CA 3AISA 1V6XA 2O92A 3MANA 1CLVA 1ZJAA 5E9AA 3WUGA 1KWGA 4AD3A 3B9EA 3RIKA 2VURA 3GH4A 3BAXA 2GJRA 5AY7A 3RCNA 3WY1A 1ISVA 5BYWA 1KR0A 1B3WA 4U2ZA 1Q6DA 2WLYA 1CXEA 2VQUA 3NDYA 4HOXA 4KWUA 1XGZA 5IXEA 1KWKA 4D6DA 4LYPA 1NWSA 4UQ9A 1JI1A 1WNOA 4AWEA 3POHA 4HZ8A 3AJ7A 3BSGA 3PZUA 1IZJA 2ZWYA 4WLCA 3T2PA 4P7NA 4N0RA 4HA3A 3W37A 3RM8A 5A6JA 4TX8A 2NW0A 1JAEA 2PBOA 3WD0A 4AD5A 4K68A 1H5VA 2VNCA 3BXWA 2WNWA 1J12A 1PX4A 5LA2A 5I2UA 1QI2A 2TAAA 4P8VA 3VIHA 2XUCA 2WW5A 3AIQA 2CPUA 2F8QA 1MW0A 2OWCA 2DT1A 4LYRA 4UZSA 2OWXA 2ZUMA 1QW8A 1E4MM 1RP8A 4NSBA 1KCLA 2OYLA 4OOUA 3CZKA 2JIEA 1BSIA 1WZMA 4D6HA 1FP8A 1BG4A 2XIBA 5GPRA 1NQ6A 3LPOA 3SCSA 1KGXA 1XV8A 2E9MA 2FGLA 1UZ1A 2ZXQA 4M56A 1UR2A 1FA2A 2JEPA 1M7XA 4QAWA 3M7SA 3N04A 3AMLA 1ISWA 3WDIA 2VJXA 1JZ2A 1K9EA 2ZE0A 2ZUNA 3PZQA 3VGEA 4KGJA 5LYRA 2D3LA 2OYKA 4CD6A 1C92A 2E8ZA 1W1TA 5EFFA 3EDFA 1HN1A 1XSKA 2PWDA 4D6IA 1QHZA 4N42A 4PMOA 4MJ4A 5HXMA 5GNYA 2CBUA 4UNIA 3KE0A 2UY3A 2J8FA 4TVDA 3SCQA 1GZJA 2WYSA 1WAWA 5CGMA 4L4OA 1X6NA 3AXXA 3VNYA 4QLKA 2DIEA 2FHFA 1DHKA 2PBGA 4YPJA 2E3ZA 1HP5A 4WSJA 3IJ8A 4CVWA 2BXZA 4TUFA 1VFOA 1W1VA 1TVPA 4C7FA 1X6LA 4UQEA 3AHVA 2W62A 4W87A 1H2JA 1W3HA 5AYIA 3WL1A 2ZUTA 4E2OA 4QLLA 5EBAA 4ZE4A 5C8BB 2E0PA 1TR1A 4M29A 3VD7A 1OB0A 3VTRA 2WZHA 3F5KA 4W7UA 1E6PA 1E6XM 1R87A 1V3KA 2XWDA 3PZVA 2ZICA 3ZM8A 1HJUA 2IUZA 3WMCA 1UH3A 2B31A 1EO7A 2CESA 5I79A 2OSWA 1EQPA 2EPLX 4H8HA 3ALGA 2J62A 2J78A 2WMKA 3M46A 1CYGA 3BMVA 2WLZA 4QP0A 2WHJA 3DYOA 3B9DA 3W4RA 1VBUA 3VD4A 1GOOA 1X1NA 4TXEA 4P8WA 3ECQA 1PBGA 5A3HA 2WBGA 1WKYA 1V3JA 4ACYA 2JF7A 1MXGA 1JF5A 1MQPA 4ZEPA 2O9OA 4MNKA 4AZCA 1VEMA 1E4NA 1M53A 2EBNA 3OGVA 2ZUSA 2VR5A 2Y8KA 1V6UA 3BSHA 4D6GA 3FAWA 1WO2A 4H2CA 1XYZA 4XZWA 5HNNA 4W8BA 3I3DA 4JKLA 2X2YA 3WNKA 4EE9A 2EPOA 5A8OA 3K1DA 3PZMA 5I24A 3VDHA 5A2BA 3WQ8A 3WDJA 1E43A 2E4TA 4JIEA 4D1IA 2DSVA 4JL2A 2WVTA 3L4UA 4PCTA 1W2VA 4L4PA 4CU8A 4MNJA 3K4DA 4WKHA 4QCEA 2GDVA 4B16A 3ARUA 3GBEA 2VL4A 5D4YA 3ARXA 3VGHA 5DMYA 1KGWA 3K46A 3EYPA 4MB3A 1JD7A 1H4PA 3ZR5A 3QHOA 1TVNA 3OB8A 5D9PA 1XSIA 1NP0A 4U5IA 4CKQA 3WEMA 3EDDA 1ZJBA 2Y2WA 3W6LA 2OSXA 4F66A 2VUYA 2DEPA 3QHMA 4GPNA 2C0HA 2D1ZA 2DSUA 4HP5A 4M8UA 1V3LA 1B3VA 4PMVA 1W9DM 1E6SM 2OWWA 2J7EA 1KCKA 5A8MA 4D1JA 3UG5A 1JZ7A 3GNPA 1E56A 1BF2A 4AZ5A 1B3YA 2YA1A 3GZAA 2QMJA 4M1RA 5E6ZA 5ABFB 3N9KA 2VRJA 1E72M 4J28A 4NRRA 4AW7A 1Q6GA 4GXPA 4W93A
chains in the Genus database with same CATH superfamily
1ISZA 3MDWA 4UFJA 4H83A 1YXYA 3UG4A 4Z17A 3CGTA 4L1GA 3KRZA 3RLGA 4RNHA 4F9DA 3N2MA 3R25A 2C16A 5C2CA 5HUOA 1L2UA 3FYPA 3LPFA 3VABA 1L6SA 4YHEA 4NZFA 3TONA 4DY1A 4G6CA 4NIRA 1DQXA 4C6PA 3RU6A 3ARTA 3H26A 1XFBA 1HG3A 4W88A 5EL1A 2V5DA 2X1TA 4PTWA 3W1XA 1XIDA 1RR2A 8RUCA 1P0NA 4GQBA 1EPVA 3CZLA 2ACRA 4H9ZA 5I78A 1MEHA 1FKXA 1HO1A 1ICPA 4DBSA 3PULA 1XF0A 2IQDA 1MFUA 1WV2A 1IWPA 3IJIA 3ZMRA 1UD2A 2ZX7A 3M0LA 2QCFA 2VC9A 2EAWA 1LQ2A 3H12A 2VCAA 5HNTA 1HNYA 1E3ZA 1LORA 4L9ZA 2X1IA 4W86A 1XHGA 4I90A 2VCCA 3N14A 2XHYA 2PF0A 3AXKA 4ZSTA 4RX0A 3VKBA 3GHUA 4U4MA 3V18A 3H8AA 4DF2A 1QJWA 5IFPA 4Z2LA 3VIOA 1TPVA 2Z1KA 1IV8A 5HOSA 4ZXLA 3STFA 2Z4GA 2WPBA 3AU6A 1J5SA 3P62A 2Z27A 4ZENA 2C71A 2PWEA 3TZFA 3RCYA 4NG3A 4HMCA 3UPBA 2VUNA 4AY7A 4XSMA 5IRPA 3K2GA 4JCLA 1OFBA 4R88A 1VPYA 4Z2GA 2NXHA 4LUJA 4XO7A 1O5XA 1K6WA 1Q6QA 1J6PA 5I3KA 3C0SA 5ABTA 1H1NA 1TREA 3Q94A 3T2QA 4YU1A 3ZWSA 4HBKA 3SIMA 2VYOA 2NQLA 1QPNA 3CV6A 1S2WA 2QJMA 3PWAA 3Q65A 2BODX 2HNHA 1C9DA 2ZRXA 1HJQA 2Y6ZA 1OJXA 1S5MA 3U6WA 1DXFA 1TTPA 4WX2A 2FVLA 2GWGA 1T96A 4GFSA 4GQ0A 5EMMA 1TJPA 5C2XA 3KRBA 3B8DA 1T8QA 1CGYA 3WELA 2I16A 3QF0A 2ALDA 2PTDA 2PTWA 5J5DA 2OSYA 2O9RA 3W2JA 2HPIA 3SADA 3TNBA 1R7AA 3H2AA 2NV9A 1QNPA 1JRCA 2EJAA 4CCDA 5DY2A 4D6JA 1TJ0A 1TIWA 3TZNA 2QIIA 4GKLA 1FUYA 1EBGA 3U4FA 5F2LA 3KCJA 2IPJA 2WQPA 4CQDA 4FEZA 2CZ5A 1KV8A 2HE8A 4Y9OA 5BWAA 3NL3A 1ZUAX 4H9UA 5DF0A 5FSEC 3NGFA 4LNYA 2GGGA 2OOFA 4TTUA 2Z2BA 3LCLA 1TA3A 1JPMA 2OZ3A 4QJ1A 4GI6A 2YW4A 3IVSA 3ABRA 3NXFA 1A5BA 3WIJA 3D0CA 3DHDA 4ORIA 1WDRA 5AKQA 3U7BA 3WF4A 3R94A 3CZEA 4US5A 1DWJM 3W7JA 1O5QA 4JTJA 2W79A 1EUNA 2ZTJA 4QE1A 4C6NA 1XLCA 4GI4A 4IP7A 4B15A 2X1SA 1A5CA 2GVEA 3A5FA 4EXBA 1W3IA 1L8NA 3NPXA 1GJWA 1SYTA 2R1KA 4S3JA 4QM1A 2ZE3A 4FNSA 2WVSA 1WKEA 4FXRA 4PSRA 3KEHA 3BJSA 2J7BA 3BWWA 2ZZ1A 3VD9A 4NJHA 3VOCA 3BW2A 3C86A 4C7DA 3R4IA 3ZYZA 3WDPP 2IPFA 1VBJA 1A47A 4GYKA 3GDLA 3HGRA 1Q85A 1R9ZA 1J96A 1S3HA 1RBAA 1GVIA 2NQZA 3T7VA 4O0QA 4JEJA 3SUUA 2WQDA 3UG8A 4ILSA 3GNNA 1JVNA 1D9EA 3WQWA 3W22A 3SRDA 1WX0A 4ZOCA 3EX6A 4PUKA 4B9YA 5I5RA 1B30A 1JCYA 3K8MA 1EUAA 4QSHA 3MV01 1ZBKA 3HFTA 1F9CA 4AQLA 2AAAA 4NP7A 1Z6KA 2VX4A 2ZC8A 4Q6JA 5HANA 4ZZ9A 2HE5A 2VR4A 4O28A 4O4WA 1MQRA 3Q2DA 4HTBA 1CDGA 2P5NA 5D9OA 3L5MA 2BVYA 4A29A 3M7WA 1KNWA 4GIEA 3EOOA 1DJQA 4XZ9A 2A1YA 1H61A 2J4GA 4FNRA 4YYCA 2FPYA 3LM3A 2IXVA 1S46A 4A8NA 5A5WA 3Q45A 3WQCA 1B9ZA 1S5NA 1VHNA 1VYSX 3NZQA 4HK5A 3GM8A 1Z8AA 2NUXA 4QGCA 3RYSA 3SUWA 4DO5A 3IARA 3RPMA 2GZXA 4PMYA 4IIGA 1KRBC 3M47A 2WCAA 1XGDA 3IJ9A 1LLZA 4CQ9A 4DO6A 1G01A 1BSLA 5H6HA 4JTEA 4O10A 3QC0A 2A7NA 1OCQA 2PTYA 4G9PA 3BLDA 3ZIZA 4Z1CA 1XLEA 3TJ4A 1RQHA 3EKGA 1UQZA 2FQIA 1BTCA 4U33A 4E3TA 2YB4A 3IJLA 3LZ5A 5D37A 3VM5A 4AZBA 3UBPC 1I6NA 3SCTA 3A6OA 4HSNA 1W5NA 2ZRYA 3EMZA 2Y7EA 3W3OA 5C70A 5FD0A 3B8VA 3U2OA 4EWND 2DUZA 1E40A 2CLPA 4RL3A 2W92A 3VZYA 4J3WA 3H6OA 4GIRA 3PBYA 4L4LA 4A2RA 1T40A 3WLQA 1QI4A 4MKNA 1PE1A 7REQB 3GD6A 1EXBA 1HW6A 1XBZA 3II1A 2P53A 3WMLA 3KWXA 1UZHA 2BDQA 1R3TA 1TO3A 3C4UA 3ZLFA 1C8QA 5F2IA 1HFBA 2VFFA 3AICA 1F6KA 3TJXA 5LIWX 3L12A 4R5EA 2ZDSA 4ACZB 3DDMA 4HSHA 2ICSA 3AXHA 2OYMA 2W67A 1G4TA 2DZVA 5D2VA 3IUIA 1O12A 5DMMA 5U4NA 1J6OA 3M0KA 3B8SA 1EA9C 4YN5A 3LV5A 3VIPA 4MNLA 1UR9A 4FLOA 3PB0A 2B4GA 3OIXA 3S5NA 4UR9A 1FOBA 4L80A 2IXUA 3OBEA 3EX3A 3W9ZA 5BOOA 2HCVA 5KETA 4AXNA 5LA1A 3NQDA 3DFOA 4V33A 3QEZA 1W0MA 1OFEA 1N8FA 2D0GA 3B8TA 3CUGA 2CW6A 4BF7A 4O19A 1NIUA 3MKCA 3NPUA 3WH8A 4S3BA 1XX1A 2OPJA 4GKTA 1AVAA 5A6TC 5C5YA 4JL1A 2NSOA 3GIYA 4DVOA 4O15A 2POZA 5HK4A 2J47A 2LLEA 1RY0A 4U31A 3EMQA 4UUIA 4MZ8A 2XVNA 1OWQA 6TAAA 1AW2A 1FWRA 1NDVA 1RLDA 3MQTA 2EG8A 4GINA 3KL0A 4RW3A 2X1UA 1I1XA 2YBTA 2YZ5A 4JTGA 3W7IA 2GJXA 3CIXA 3GG8A 2DP3A 5G4EA 1I0DA 3LHYA 4NNCA 5JIWA 1PYFA 4Y90A 5DQPA 2G3JA 1BXCA 3KL5A 1EJUC 4ONVA 2VP8A 3AS3A 3VIJA 5EMLA 2EPNA 3L2MA 1M03A 3WQ4A 3T55A 2E9BA 4IX0A 5A94A 3QGKC 5CSUA 4A8IA 2HTMA 5BOEA 1Q5MA 3MB9A 4LCSA 4PUWA 4FP1A 4IUGA 3BLEA 5FKYA 3TKFA 3SB0A 4D8AA 3PNZA 1OFDA 3FX4A 2QUNA 3GS6A 4QFUA 5EA9A 3N12A 1ZNNA 4M6PA 1V08A 3VDBA 3I7QA 3OIHA 2Y24A 1FWSA 2GJLA 2OG9A 2D2HA 1V0MA 3KBNA 1IEIA 1W31A 2ISFA 4TMCA 3CZGA 4U10A 5A6SA 2PDNA 4BS0A 1NY1A 1Z69A 1OIFA 1OHLA 1M3UA 1YTDA 1OCBA 3PZIA 5CPOA 1LBLA 3VFCA 4B5TA 1S1PA 1MEIA 3UG3A 4G5DA 4K7YA 3WK1A 3VD3A 5BXPA 4HMNA 2R9RA 4K3ZA 2YL8A 3CNYA 3TYCA 3W53A 3SQLA 1RJQA 4RZ6A 3MI3A 3VGDA 3AIEA 1JG9A 4IGNA 2IPGA 3L4TA 3APTA 4ZGYA 1QO5A 3SQSA 2X7VA 3QFWA 2BTMA 4I9AA 3QW4B 2CKRA 3NQCA 3TC3A 1K7FA 4DN1A 3QY7A 3L0KA 1W8GA 3HB9A 4LGXA 1OT1A 4YVXA 3PTKA 2CLOA 3ZT6A 1SQ7A 3TQPA 2CIPA 5E0CA 1QHOA 3AMKA 4J3VA 4O57A 5EFDA 3G0XA 3T40A 4K8HA 2PDGA 2F38A 3E0VA 3PBWA 1BYAA 4G2DA 3WN6A 1HJXA 1DQWA 2FTPA 3C0QA 2XFFA 2HXUA 2C1HA 2VQTA 2KX9A 4LC8A 3UZYA 3LCIA 3CUZA 3M4HA 1SR0A 3C6CA 2WMJA 1I8JA 5M1TA 2D20A 3TWAA 3W2LA 3UWQA 2PGWA 3TQ0A 2PDYA 1UWUA 1TPWA 3TFXA 3UWVA 1BAGA 1B4EA 4PTXA 3CMFA 1FCQA 2PDXA 3KS5A 1Z89A 3VFLA 1SUXA 1UWQA 2DH3A 4L6HA 1Q6FA 3UJFA 2ZCGA 1GW9A 2PE4A 4UZUA 4CCEA 1U33A 3KRUA 1YEYA 3WO8A 3P2VA 2EO7A 3OQ8A 4JY8A 1UJPA 5M17A 4PSPA 5E6YA 2QVNA 4HU0A 3FN9A 5A6BA 5I6SA 3EA2A 2CBJA 4Z2HA 2QPSA 4IHCA 4NHVA 2VOTA 1GOXA 4JAWA 3HA1A 1OYBA 3AUJA 3LHZA 2VZOA 1PWLA 4DJED 4H9YA 1Z42A 4XKMA 1T6MA 2BGNE 1EF3A 3E3HA 1P6WA 2XH0A 3GFYA 3D3FA 3O2LA 1C8VA 1ONRA 3S2LA 2PLJA 2QJNA 4NVTA 3AOFA 2XN1A 1W5PA 4Q7BA 5E5CA 4JQ1A 4P61A 4BWLC 3VGBA 1ITQA 3C2YA 3L4XA 3VX0A 5HUPA 3W07A 1G9HA 5GJNA 3A47A 4GJJA 4P7LA 3HJZA 3GRIA 1U5VA 4MJ2A 2QUUA 4IT1A 2H9AA 1XIIA 1O4UA 3ANYA 3O63A 1OK4A 2G4FA 4H9TA 1UCWA 3FJLA 1WAUA 4MSSA 5LZLA 2OELA 3MWCA 4UTWC 3AHZA 1E6NA 2VZVA 4JTLA 1FWTA 2WMFA 2CYGA 2BOGX 3T81A 3BJFA 3OA5A 2FJKA 2YDAA 4GLEA 3TN4A 4PCSA 2O55A 1JUEA 3CPRA 3TJIA 1FH7A 4L56A 3QQWA 2XSAA 4PRTA 1BGAA 2VEGA 3H2MA 5HA7A 2FZNA 3V0TA 1F4HA 1TV5A 2OEKA 5IM51 3OODA 3PM6A 3ATYA 1JCNA 1LBMA 2UY2A 4GZEA 1XH1A 2V3DA 1UPPA 3Q58A 2C15A 2Q8XA 4MPQA 1I75A 3H23A 2ZUWA 3UU0A 3FJ4A 3ZJ8A 1OABA 2HVNA 1VJSA 3L5AA 2D23A 3BAWA 4AD4A 1W56A 2CZDA 3NZRA 3LLDA 4AWTA 3LBCA 4JN8A 2XIOA 1YDOA 4LVFA 4MTVA 4S3GA 4WOZA 3WF2A 2VR2A 3QH2A 4XUYA 3CHCA 3TNOA 3FHAA 1R9YA 4QQ3A 4PRWA 1V93A 1C29A 3KXQA 2DZBA 4W89A 4HNLA 4ZO8A 1F2JA 3KRSA 4DZAA 3W00A 4ZQNA 2ISSA 1NH6A 2WV8A 3EWDA 4MHBA 1CECA 2PLCA 4WKAA 3NTYA 4E8DA 2YBVA 2E6YA 3NYDA 2HPMA 1VFLA 1R3YA 3BE7A 2JFEX 1OFAA 1XRTA 1SW0A 2J75A 3VGFA 3FW6A 1KBIA 5HULA 4BWLA 4BF5A 3SBFA 5EMYA 3UJEA 2YL9A 4AHPA 5AHMA 3ZLHA 1X97A 1U1JA 4F2UA 1CGUA 3NQ6A 4MKSA 2XIJA 3UY7A 3HFYA 3CLWA 1QNRA 4J40A 1A5MC 3L7RA 3G2GA 1N8WA 1OZQA 3WFLA 2DVXA 2QUTA 3MYOA 4UTWA 3QXBA 4R53A 3WH9A 4RZ5A 3FSTA 3C3NA 3MSRA 2HNEA 4GVHA 4CNNA 9RUBA 2ZQ0A 1Y8BA 2PDJA 3UGVA 1D2KA 3NL2A 5LIXX 2XYLA 2A3BA 1IHIA 4YIWA 4Q8TA 4XSLA 1ZZMA 1UWSA 3WBEA 3EX4A 3WUBA 1F7BA 3DFQA 2YCEA 1WKDA 5A2AA 3CPUA 4C7GA 1O66A 2X40A 4DWSB 3GXFA 1ZAIA 4REQB 3I6RA 3NUKA 5E93A 3ERPA 1I4NA 3R7MA 3M0VA 2NQ9A 4UFKA 3GDKA 2WMIB 4JYFA 4UOQA 3LYEA 3L5LA 4JIHA 4A3RA 2E9LA 1VHCA 2OLAA 4EXQA 3FCPA 5DBUA 1E73M 2PZ0A 4IIHA 1Z44A 4D6CA 3ARVA 2V5KA 1XIHA 2QCDA 1NWRA 3RRAA 2E40A 5A8QA 4J9JA 1EC7A 1ITXA 4L61A 1I45A 3CL7A 4DI9A 5H8UA 2YDQA 4QEHA 2WSQA 3HV9A 3WX7A 1EX1A 3WYZA 1MZHA 3B9AA 1ZB5A 4DYJA 2PGFA 3BLPX 3KBWA 5EYWA 2FH6A 3UETA 3E2RA 4DO4A 4RNIA 5T91A 3PUGA 4PB5A 3H22A 3VK5A 2AOSA 2PRMA 3G0UA 3HV8A 3EWBX 2PC4A 3KM8A 4FX7A 4RKAA 4ZB2A 3BV4A 1U1UA 4ZL1A 4ES4A 4O11A 3W1PA 3ZFHA 1MMFA 4GZIA 1OC7A 5A8GA 5JBFA 3STEA 3VIGA 1F3EA 1JAKA 1BRLA 1K9DA 2J79A 2WSPA 1SJBA 3LHVA 3FXGA 1DWFM 4CNUA 3A9BA 3TN6A 1JCXA 5DN1A 1DJNA 2YL6A 4Z1YA 4GK8A 4C6LA 5I3IA 1QXLA 3PZ9A 1CLKA 1TCDA 3QJAA 1Q66A 3WJYA 2PUZA 2GFTA 1FWDC 1TMQA 4UMCA 2Y4SA 1G1YA 1DEDA 4F4RA 4BEUA 2HROA 3TN3A 4JNZA 3EKLA 2J9XA 2Q8ZA 3RLUA 1EXPA 3HMJG 5BW6A 5EPDA 4D2JA 2I56A 2CLHA 3OP2A 4JZ5A 4E8CA 1MW2A 3MHGA 4W5UA 1QOXA 3QOKA 3AXIA 3GWQA 4NJIA 1KM5A 1NFGA 2E8YA 7ODCA 3DFTA 1XIBA 2VXNA 1RD5A 3DFNA 3ZWTA 1UMYA 4Q4PA 1JZ6A 2B7NA 5IDZA 4FXJA 3SIZA 2F7FA 1K7EA 3PN8A 4BQ5A 2PTZA 1QUMA 1UWTA 1EP3A 3RK8A 4MFEA 4IWWA 2KZHA 3WFZA 5G2WA 3EB4A 4DELA 5FACA 1JXJA 1J10A 1GQNA 1IZCA 4PODA 3E96A 3RGTA 4HU8A 2FHCA 4BI6A 1DJZA 1P1MA 1SMDA 3APGA 4J1OA 1LQAA 4PUJA 2QAPA 2E7FA 4JS3A 1TE6A 4WDWA 4M82A 1EJ7L 2XVKA 4ZVJA 1NDYA 3VC6A 4AF0B 3V5FA 3GG7A 1JFHA 1AG1O 4LRTA 1H7PA 2VC6A 4JTUA 5MKGB 3B8UA 1CB2A 3THDA 4EXAA 6XIAA 2DZWA 3IAQA 3M5ZA 1JGMA 2UY4A 4RXGA 4MWAE 1UKQA 4DEFA 4DUXA 2J7FA 4DAFA 3H2CA 3CMJA 4CD7A 4GUHA 2J8GA 2OFJA 3PHAA 3GZ3A 1N2VA 2DDXA 4R27A 3UJRA 3W72A 3HJEA 3LHTA 4GQRA 3WDRA 4WXYA 1LL6A 3BANA 3GVQA 4G7EB 2GDQA 3V7PA 3SCRA 3U5YA 4JFWA 1G4EA 3MBDA 5GJMA 1DHPA 3P5ZA 1XLAA 5FL1A 3QYQA 5EMJA 3P67A 5DLCA 5JQ9A 4I5RA 3AISA 4CCZA 1GG1A 1V6XA 4OBTA 5E9AA 3CWNA 3B9EA 3SGGA 3VI2A 4DYKA 4C5YA 1UMLA 3S3GA 2IKJA 4YL2A 5K3VA 3ABXA 1SO6A 5AY7A 4OU1A 1B3WA 3LBOA 6ENLA 1JUKA 1ONWA 1XGZA 4D6DA 1IGSA 1FWGC 4EF9A 2OTDA 1LOLA 2VFEA 4WSHA 3VKJA 2W6RA 4EAYA 4W4QA 3PZUA 4HA3A 3KCLA 7TIMA 4WJEA 2NW0A 3ITGA 4AD5A 1AJ0A 4TX9A 3BXWA 2WNWA 5LA2A 1KLYA 5I2UA 2HXTA 3GHTA 1P0DA 3VIHA 4Y6GA 2JKAA 4ML9A 2ZRUA 2XUCA 4IMAA 5AYXA 1IQ8A 2WW5A 2HS6A 4LS1A 4WJ8A 2AQOA 2DT1A 4GNJA 1F05A 1M9HA 1XBYA 1ME8A 1QW8A 3MJYA 3S1GA 3CZKA 3TQKA 1WZMA 3LBMA 2F6XA 4CNOA 3SCSA 3PPFA 1XV8A 5I3JA 2E9MA 4XBJA 5B7YA 4TQTA 4HD5A 3M7SA 3ENLA 2YZRA 2YFOA 1P48A 4IUOA 4GJIA 2V9DA 3VGEA 5LYRA 5EFFA 2PWDA 3NOEA 4A21A 3HG2A 2ISDA 2V69A 4A6GA 2J13A 4KBXA 1J79A 5GNYA 3BDKA 2UBPC 2UY3A 3R58A 4QG8A 5K4ZA 3G77A 4HHMA 4Y8EA 2YXOA 2JK2A 5CGMA 4QLKA 2GUBA 4C6DA 3DXIA 3IGXA 3DH7A 3PAJA 2FHFA 1DHKA 4YPJA 2RH9A 4WSJA 3LXAA 2VFGA 4CVWA 4TUFA 1VFOA 1TWSA 4EF8A 4C7FA 4PULA 5LNUA 3ABSA 3QZEA 2O0TA 3O05A 3CC1A 4LV9A 1MDRA 4DBUA 1DIKA 5EBAA 5C8BB 2V30A 3QMSA 3LLFA 4M29A 3C2FA 1OB0A 2WZHA 4JTIA 4WY0B 2FMOA 2VD9A 3B03A 3O15A 1E6XM 1V3KA 4RK8A 3BOLA 3LN3A 4Z0SA 2G4JA 3G1XA 2CESA 5I79A 1Q2SA 4H8HA 3ALGA 2J62A 4WZHA 2WMKA 4OECA 5J04A 3EXSA 4PTNA 3E0FA 3W4RA 3INPA 4DJDD 1VBUA 4DJFC 3VD4A 1X1NA 4TXEA 3ECQA 3GVVA 3F2DA 1Q45A 5G5IA 1YDYA 3MKVA 1W8SA 1MQPA 3EPNA 2O9OA 4XD6A 1E9IA 1KCXA 3GC4A 3NYZA 1M53A 2EBNA 3HQNA 2ZUSA 3WJXA 3S83A 1XYZA 4YXGA 3KBMA 4XZWA 3I3DA 4ZQRA 4XBKA 1Q63A 3P80A 3TUUA 3AC0A 1ADSA 2EPOA 1TWWA 3VDHA 1JULA 3WDJA 4C90A 2E4TA 2OKOA 2DSVA 2VEMA 4H00A 4XAPA 2AL1A 1VYPX 1XYMA 4WKHA 1GJPA 1IEQA 3MUCA 3ARXA 3VGHA 3K46A 3LV6A 3NZGA 1JD7A 3SQMA 3QHOA 3OB8A 4GQGA 3L9CA 4ADTA 3VC5A 3Q37A 1AL7A 1ICSA 3QV9A 4L9YA 4OHQA 1B3VA 2CZFA 4PMVA 1W9DM 2ZKMX 2DW6A 5A8MA 4HHLA 5B80A 1XLMA 1YADA 3UZWA 1S39A 1DPMA 1BF2A 4RNFA 4KIEA 2VWTA 3UZJA 3D47A 3NQ8A 3C5QA 2VRJA 2FTWA 4GY7A 1TRIA 2PTXA 3A3XA 4W93A 3TYDA 2RJGA 1TWZA 4O1EA 1MUCA 4GISA 2ZX9A 3KZSA 4WGHA 3WQGA 1OEPA 2WCSA 4Q6XA 1PCWA 2ACUA 2R82A 1X98A 5FEWA 3OEXA 2AQVA 1TX0A 1FWBC 4PCNA 2G95A 3IGSA 5GJPA 1FTXA 4XAFA 3UWZA 2FIQA 1GVQA 4UR8A 4DAIA 1EX5A 1EEPA 1XUUA 3D5HA 3R43A 3GBDA 3PTDA 3MWAA 4XAZA 4KEVA 1S3TC 4RW5A 3XINA 5U7SA 3USBA 4CGTA 1NTHA 2V6AA 3RR1A 4DRSA 1A5LC 1KRMA 2JIWA 4EVZA 4PMNA 4DJFA 2V2HA 2ZVIA 4I7UA 1R7OA 3ARRA 5AZ1A 3SN4A 1QBAA 2BVDA 5CPMA 4LUYA 1ZRQA 2FGZA 1Y0EA 4FAMA 1BEUA 4IMDA 3FSUA 3W29A 4O0ZA 5TD4A 1O6IA 5E1QA 2QF7A 4O12A 4KEZA 2EQDA 2H3DA 3C8FA 4DBWA 1M41A 2YGYA 4MY8A 3GG0A 3TC6A 5HDRA 1UC5A 4FOJA 3W7PA 3ABOA 2RHGA 1BFNA 4KRUA 3QGVA 6PTDA 4K1GA 1CEOA 2Z1VA 1RPXA 2HVMA 3CU2A 4NAFA 4GQQA 2OGYA 3OOQA 4FLQA 3W7OA 3UA4A 2J6XA 5AHLA 5HNUA 5AHIA 1DORA 3SSZA 4XZBA 5AB3A 4BY3A 4LUTA 3HURA 4XD3A 1I60A 4AD1A 4HOWA 4MJMA 3RO6A 1R3WA 4A2SA 5K2ZA 3LOTA 1SFTA 4H01A 4ROPA 3IRSA 3CEUA 4GUFA 3VMNA 4E2BA 3GKFA 3WH7A 1IIGA 3BMXA 2Y5EA 1V3MA 3W28A 3CV7A 2OEMA 3HPXA 4ZQOA 3UXLA 3N4FA 2DIJA 3VOFA 3AYVA 4KGLA 4LB3A 5I02A 1QFEA 2PWHA 5BROA 5T8GA 5FCZA 2FDMA 4FZIA 1T8XA 2X2GA 3PWGA 1VFFA 1EEXA 3UNTA 3WEOA 3BG5A 4PUNA 4GABA 4E6MA 4KH2A 3S6TA 2G3NA 1QHPA 2DH2A 3N6JA 2PWVA 1JDEA 1J18A 3UCQA 2Z7GA 3TU9A 2ABBA 1QK2A 4FR6A 2H8XA 3SM0A 4ZOAA 3GH5A 3KP0A 1FWJC 1ENUA 4BCEA 3P0XA 3FA3A 3BG3A 3KTSA 1LJYA 1GKQA 1HKJA 2A21A 3SCVA 1V79A 1LWJA 2FYMA 2BFGA 1B57A 2I1OA 3MZNA 3HG4A 4I8DA 1PYMA 5CC5A 1GVSA 8TIMA 3WBAA 1DXIA 2VZSA 4N9CA 4Q8QA 1DVJA 4NJGA 1RCXB 1WZAA 5M3WA 1XDMA 2O7QA 3W0KA 2Y1HA 1JI2A 4PMZA 4IFRA 1RZMA 2GVJA 1ZAJA 4LVDA 1XYCA 3KDNA 4DNMA 1UP3A 1G0CA 5DRIA 2WJFA 2Y8VA 4IP4A 3AQUA 1XLKA 3QGAC 5ABHA 4U28A 2PGEA 4M6QA 3B0YA 4HJFA 3NJ3A 1XYAA 1SGJA 4O8RA 2CETA 2QUVA 2F9RA 4S38A 4QCFA 5H8PA 1XKYA 5TF0A 1QNOA 4AC7C 3JR2A 5CZSA 5JU6A 1HVQA 1PZ3A 2WMHA 1NM9A 2E25A 3U9IA 2FZDA 4CD8A 3V4BA 3WD3A 1UKSA 2GSEA 3BCDA 2B7PA 4YTRA 1UROA 4K36A 3NSXA 1OF8A 1U1HA 1A80A 1JRBA 4AD0A 2PDUA 2ZRVA 4ZSUA 2HBVA 4AIOA 1TYGA 1UUQA 4ZOBA 4NL1A 4WXZA 5D2WA 1UOKA 3SCUA 4BA0A 3L0NA 3TXZA 3WD4A 1ZBVA 1TA3B 2Z1BA 1HO4A 5HPOA 4QHRA 3NQ2A 4B90A 3AYSA 2I17A 2WVVA 3LM7A 4NT0A 1VC4A 4DB7A 4DWDA 1ODZA 1W2PA 4O1FA 5AC6A 4XD5A 5KTLA 1QO2A 2VELA 1EH9A 3RITA 1PAMA 2CITA 3CMGA 4QAIA 3GHRA 3P60A 3AYRA 3ABZA 5AC4A 2RGMA 3HU7A 1J11A 2WWCA 4EK7A 2YCKX 1LBFA 2ZIDA 5IHRA 3SZ8A 1DJIA 2QCGA 5D9NA 2WAGA 1K03A 5D30A 3B8WA 4HPNA 4X2PA 3GXDA 4PMQA 2HISA 3ZO9A 3PJUA 4C6BA 3IJQA 3CUJA 2PMQA 3QVQA 3L2LA 1TPH1 4LBUA 4HPHA 3FY1A 4US5D 3MHFA 1AUSL 1ESWA 2NX1A 1S2CA 3G1YA 5L6UA 2BWGA 5CAKA 1YPIA 4EP8C 4QG6A 3PFRA 4D72A 1AW1A 3DZ1A 3MP4A 2PF8A 3AUOA 3N18A 1B3ZA 4MYXA 1QDSA 3CBWA 2WKGA 1W3KA 5HPCA 3RCMA 5CZKA 2AL2B 2FB2A 4QNEA 3N3MA 1TV4A 1MI3A 4NASA 1FWWA 1BYBA 2CLMA 4QJ3B 5FJOA 1H0IA 2J6VA 1YTKA 2HJPA 1HQTA 5I0DA 3B3DA 3AIUA 4L1XA 3CQIA 3R11A 1LT7A 1RK5A 3ARYA 5DX7A 1FDYA 3ARQA 1BVNP 2VDHA 4GVFA 2XM1A 5I09A 1EJRC 2E28A 2CBIA 1PWMA 2ZVRA 4H8VA 3DERA 4UTUA 4FF5A 4QDMA 2XTKA 3LNMA 2GQ8A 3JS3A 1MVYA 4XIMA 5A6KA 3NDOA 4U5KA 1GVYA 4YWSA 3GXIA 4M24A 1TQXA 1HVXA 3QLLA 2VFIA 3SRKA 2ZRWA 5I06A 5JH1A 1W37A 2YPIA 1M5WA 4AX6A 7PTDA 1KM3A 2C18A 3LG3A 4IM4A 2DY3A 1AJZA 1JYVA 4IJBA 3V35A 1HKKA 3FDGA 4RNJA 1T7LA 3IRDA 4YLWA 1FWFC 4UBPC 2OQHA 3EOSA 5G4WA 1P0KA 2CHRA 1BWVA 4UQAA 3ARWA 3W7NA 4PUDA 1P6BA 2GL5A 1UKOA 4GUJA 5TNVA 3W7HA 3MDUA 3ARZA 3W88A 4JX4A 4GVIA 1RCOB 1XQLA 1QI5A 1CGVA 2D2GA 4MWAC 3NL6A 4Z2IA 1UR0A 3AROA 4QE4A 3OZPA 3AZSA 3GFXA 4EPEC 2FZ9A 3G5EA 3N2BA 4NJJA 4CNPA 3GAYA 4Z1AA 3SAZA 3RPTA 3T44A 3CPGA 4LANA 4RDVA 2YIHA 3SFWA 2QV4A 1XD0A 1JXKA 5IOBA 1PIGA 2CLEA 4S1FA 3URQA 4WSKA 2J7CA 3G3MA 4Z08A 1IXNA 3EWYA 3WH6A 3ZXWA 1TELA 1VJIA 2DSWA 4AIBA 1ODUA 4B9ZA 2BSLA 3BQ5A 3LMZA 3BGAA 2C79A 3TV8A 1JZ4A 4PMJA 4UQBA 3I10A 1EOKA 3FV9A 3AU2A 2ZADA 3W70A 3N25A 5HATA 3P3BA 3KZPA 5D2XA 2C19A 3VCRA 1TQJA 4I9TA 4JIPA 3POCA 1TPB1 4Y9MA 2NV1A 3LTPA 2W4XA 3N6HA 4IL0A 1CBGA 3T4WA 2YBUA 1R8LA 3NSNA 4PL2A 4FIRA 3LCWA 1FCUA 1E0UA 4NF7A 4JCMA 4S3FA 4DUVA 1R3SA 3CO4A 6CGTA 4GZJA 1ZJIA 3DG7A 3N1AA 1OBAA 4AHQA 3M0MA 2OQYA 1DIEA 1EGZA 1GCYA 3A4WA 2QKFA 3OLGA 1NFBA 2ANUA 3O6DA 3DFPA 3DCPA 3AJXA 3UPMA 4J2MA 2X30A 2XSXA 5CPSA 1HX0A 4PL1A 2R6OA 2VHLA 4DF0A 1F61A 1OFQA 1A50A 4C60A 1NFPA 2GVGA 2GPTA 4CNTA 4UOZA 3U48A 1XQKA 2BHUA 4JPGA 3VU2A 4NX0A 1AH3A 4C1NA 1Q8AA 1CI1A 2VFHA 5LNVA 4MUZA 2HSAA 3IK2A 3UXKA 1KXTA 1HKMA 1HUVA 5LSMA 1ME7A 1V7YA 2J66A 1E6QM 2C14A 1LP6A 4F0KA 3U2ZA 2GJXB 1FWIC 1Z41A 1ME9A 4J2PA 4LWWA 4MWAA 4RV8A 4ZO6A 3IANA 1BPLB 1ZP3A 3N73A 4IMGA 3N6QA 4AEEA 2WBKA 5D8ZA 4N02A 2OEJA 4HN8A 4IQDA 4UFHA 3TOYA 4CNSA 3EXRA 2PC8A 2BMBA 4NRSA 4IFKA 4C6EA 4LRSA 1GUVA 2V5JA 2DZAA 1NF7A 4EPDC 4I5XA 2FHBA 2ZX6A 1Y5VA 4V1YA 3VNMA 1XLGA 3LXBA 4PTDA 4IIDA 3WBYA 5G2IA 5DT5A 5DCBA 4B2DA 1YBQA 2XH2A 1D3CA 2GGHA 3RG6A 3KAOA 3EB3A 2QCNA 4K8GA 3ITOA 1OG6A 2W9MA 3MO4A 4F2TA 1GG0A 1RV8A 1ALDA 3BMWA 1UR4A 5B7ZA 4V28A 5CSYA 4UQDA 3WD1A 3VD5A 1GOIA 4R9XA 4NYUA 1T99A 1FWCC 1PDYA 3AZTA 4PYSA 4MB4A 2G8ZA 4UNLA 1AD1A 1JIBA 1VCVA 1WDQA 2DSZA 2CWNA 1FVPA 1YMYA 1N7KA 2QV5A 2TSYA 1QPRA 4AEOA 2JE8A 4US6A 3IK4A 1EO5A 2RUSA 3W2KA 1GKPA 2ZX5A 4K39A 4CEUC 3DHPA 5K9XA 3QV6A 4E0CA 1K7XA 4ZCWA 4S3KA 2E5BA 4S3EA 4DXVA 1H09A 1NDZA 5G1YA 1AZ2A 3WNPA 4S3DA 3KCOA 3RLHA 2ZA3A 3BOFA 3P82A 2YYUA 2PU1A 3U5UA 4LAZA 2CERA 2QCEA 1KM2A 3G8EA 3S2JA 2X8RA 3T0AA 1MNSA 3VNKA 1TJ1A 3S1VA 2AGTA 4PUEA 4KERA 5A69A 3CH9A 2QZRA 1LZOA 3H24A 3AALA 3W83A 1LQ0A 4DUOA 1GEQA 5HR7A 4JN7A 4O13A 4JTDA 2C8NA 4JY9A 1AQHA 4FNTA 1Q2RA 2WHKA 1XSJA 3A4AA 2FVMA 3N11A 2QMKA 1JNDA 1WXZA 4ZO7A 1EIXA 2XFYA 2JF6A 1GOWA 1XIJA 3W1UA 3QMRA 5F2GA 1R38A 4DYEA 2JKEA 2O9TA 2NT1A 2PODA 3IS4A 4O53A 1JCJA 2H6RA 1L6GA 4LCRA 1O68A 1N55A 4AUBA 3HMCA 1GVEA 2OX4A 3N2XA 4J3TA 2C0AA 5G1MA 3QOMA 3K13A 3L0GA 5IHSA 1IR1A 1G7VA 2X09A 3TYAA 1XH0A 3H21A 2OR2A 1V0KA 3DC0A 4LCQA 1WQ5A 1RA0A 4C91A 4KKXA 4TO8A 2ZA2A 2XGZA 4EAMA 1MW3A 4MFDA 1SW7A 1SVDA 4ZOEA 2Y0FA 2BOEX 4DIAA 4PCPA 5PTDA 1OGSA 4F79A 3WL0A 5AN7A 2YYTA 3TTYA 5SWUA 1GHRA 1BVZA 1TPDA 3FA5A 1EB3A 4L7ZA 1Q4NX 1E71M 7XIMA 5D05A 2F84A 1OFPA 2CLIA 5CJMA 1OFRA 4D6FA 3WNNA 4C6KA 5ABGA 4KFPA 3O6CA 2NT0A 3BAYA 2GGEA 3WLKX 3KOXA 1JD9A 2VGGA 1F5ZA 1LRQA 1UR8A 2Y89A 2PWUA 3CAVA 3NQBA 3VNJA 2J7HA 4LYQA 1WA3A 4M5PA 2E5DA 4JICA 2NVCA 4AD2A 4A3QA 3V16A 1DL3A 1SW3A 1E9LA 3W82A 1TKKA 3C2EA 4GD0A 1Y65A 3JRKA 2VRQA 2H9AB 3RHGA 2QAFA 2E09A 5A6BD 3L4YA 3UQNA 1BVWA 2PDBA 4JYDA 2D24A 5AYYA 2DZXA 1XFCA 4KESA 3OQEA 3MSYA 4I9MA 3HN3A 1VRDA 2WHMA 1MO0A 4F9JA 3OZYA 4ZQMA 1Y5XA 2Z25A 3FVDA 2GK1A 4IIEA 3RLVA 5F7UA 1WOAA 4JDYA 1O1HA 2BS9A 1JPKA 4NZCA 5K9DA 3UY8A 1F6PA 1VENA 1ZLPA 2WPGA 3USZA 3RJYA 1P5BA 5A1AA 4MAVA 4PFMA 1F8MA 3D46A 3QY6A 1UD4A 3EGJA 4NNBA 1HZYA 3GUWA 1RUSA 2VGBA 3H4WA 4YWIA 4PMXA 3S1WA 3KW3A 2QCLA 3TMLA 3SJ3A 3L67A 1G4SA 3QTPA 1V6TA 2X41A 2I5QA 5AFDA 1QU4A 5BXRA 2VGFA 3GB6A 1RVKA 4DQWA 4HPJA 4IJCA 4RZ4A 5FF7A 3A12A 2X1RA 1G4PA 4B91A 2PS2A 3NQGA 4LC6A 1O5KA 1YHTA 5CXPA 3UCCA 3AIVA 3GUGA 4KFOA 1J2BA 1HGYA 1J01A 1GOQA 3G6MA 5KINA 3RRXA 3S2CA 4BK9A 3GK0A 3I3EA 5CZ0A 1UP0A 2PDFA 4HMEA 3R5EA 2KAUC 3QZ6A 1EHAA 1R3RA 4FHAA 1E15A 3MYPA 4LXFA 2F61A 1UBPC 2FMNA 1UWIA 2Q09A 3I7RA 3AI0A 2QJJA 5DCDA 2BOFX 4Y2WA 3VM7A 1A5NC 4ZXOA 4LVGA 5GVJA 2A6NA 3A24A 4M7SA 4RLIA 3GE7A 4HCHA 1FWEC 1W9UA 4P5UA 3N4AA 2P10A 4PB4A 1OVDA 1EJWC 1J0ZA 1KM1A 4O14A 3RF9A 1Z3NA 4JN6A 4NZ3A 2A7RA 1FFRA 3LSCA 4FIQA 1OCJA 1CXLA 5CLTA 2VKZG 3T0DA 4ML4A 3OJGA 1AJ2A 1UD3A 4NXSA 4PB3A 1ZU8A 1HP4A 2J9ZA 1XICA 4IXXA 1VLIA 3Q4DA 3NNTA 2WZEA 2V0TA 1IT8A 3PTMA 5CQ1A 4QR6A 3QC3A 3F4NA 4M51A 2PD9A 1PZ2A 3L65A 4DXXA 2VEFA 3CYJA 3RMEA 2BNJA 3UT0A 3LCXA 2R1MA 1F4AA 2CKSA 3SURA 3CUIA 3K8KA 3ITTA 4WUIA 2DW7A 3WSUA 1Q7MA 5CGTA 3BAIA 3W71A 2G50A 3BO9A 1S5TA 4RE4A 4YHGA 1KXHA 4IP5A 1IIHA 3NSMA 1YPXA 1H50A 1M1BA 3MA8A 1ZJHA 3C2RA 2GUYA 3SFKA 1SZFA 4CN6A 3SCOA 3GVRA 1J5TA 3N2CA 1UPMB 2Z2UA 2POTA 3W1RA 3DFHA 4PC8A 3W7MA 4S3AA 4KEUA 4EOUA 2FLIA 2VMFA 2QCDB 3EXTA 4NZ1A 4Q8NA 3WLLA 3GH7A 4WR3A 4OFCA 5E09A 3C2VA 1K77A 2CHNA 3GKAA 3WFAA 3RU8X 3WNOA 4H6KA 1DQUA 3PG8A 4AH7A 1A5OC 4LU0A 3I6TA 4OUEA 4R7WA 2CBVA 1B31A 2XSBA 4IQEA 4JTQA 1LT8A 1JGIA 1HKWA 2V5LA 4DO7A 4WDUA 1QOPA 1ITUA 1W1YA 1YE6A 4PH6A 1V3HA 4FO4A 4GXMA 4DBDA 3T8QA 1TE1A 3B04A 2DZPA 2ZC1A 3W23A 2D2JA 1R9XA 3S0CA 1O7AA 3CQ0A 3BZGA 3E2QA 3ZOAA 4N9DA 4AHOA 2MUCA 1QWKA 4DUWA 1WPCA 3WBWA 1BRLB 3KL3A 2YCLA 1O5RA 3VKCA 4H6EA 2XPKA 4JTTA 4MY1A 1Z9AA 2IKGA 2VDGA 2V38A 1EGVA 2R1PA 2WZIA 2XFWA 3TROA 1I0BA 1XM3A 4ZTYA 5LHFA 4RZBA 4O52A 1UIOA 3HQOA 3SGUA 3E9AA 2GQ9A 4B5UA 2PEVA 4S39A 9CGTA 4Q8OA 1GQIA 2EPMX 3T08A 3IIZA 1XR2A 3SO7A 3NXLA 3BW4A 3M0XA 1F3WA 1G5AA 5JBDA 1ADDA 1PHWA 1CZ1A 1MRAA 2DUAA 1WZLA 4MB5A 3UR7A 3P8JA 4DXKA 2INEA 2VENA 3P6LA 1QAPA 2NX3A 5D03A 1A3HA 2V63A 1K02A 1JPIA 3U2EA 1VRXA 1BHGA 2V3EA 1PX8A 4HKPA 3IAPA 3TVAA 3BLOA 1XIGA 3H53A 1W9PA 4QE5A 3O8AA 4O8AA 1W1A1 1MQQA 1G6CA 1FCVA 4E4FA 3LTSA 4XZMX 3EBVA 4XD4A 1R30A 4WKFA 4CU7A 3BL3A 1YPFA 2OJPA 4ZA0A 1VF8A 1FHUA 1JZ3A 4HA4A 2HWGA 2PCEA 4W84A 4HQVA 3PBGA 3L4ZA 4B5WA 3V36A 3QRHA 4CQAA 4HNCA 1ZJAA 1KWGA 2FFIA 5LIKX 3P84A 5DMLA 4AD3A 3UWYA 3T0CA 3W86A 2J8TA 4Q4OA 3GTHA 1CXEA 2QDDA 1NQKA 2TPSA 4KWUA 4ZB5A 4HOXA 1NWSA 4UQ9A 2Y7FA 3K4WA 3E38A 4NY2A 3T42A 3POHA 2QUMA 4UTLA 4HZ8A 5C9UA 5CSSA 2DV0A 2XISA 2SFPA 4IQJA 1QK0A 4N0RA 3SR7A 3Q67A 3W37A 1RLCL 5CBBA 2P0IA 4UTHA 1JAEA 3QSTA 3EEGA 2VNCA 2PDKA 1DIOA 2OU4A 1QI2A 1R0MA 4FXSA 3TW6A 3QFEA 3AIQA 1MW0A 3GG1A 4IPIA 2PP3A 2QEZA 1PL9A 4LYRA 4KFNA 3GVWA 3T8LA 2JIEA 2D73A 2AL2A 1VQTA 4LS0A 1FP8A 1BG4A 4LUSA 2XZ7A 1SZGA 3PBVA 5GPRA 1NQ6A 3LPOA 4XKYA 5LIUX 2GGIA 1VS1A 1LLWA 3FJ6A 1JJKA 2RAGA 2XZ9A 4MVAA 2ZXQA 3NURA 1UR2A 1FA2A 2Z0IA 3O0KA 4QAWA 4QQUA 3AMLA 2W0UA 3TJLA 4ROQA 2CZVA 3VYLA 1XIEA 1JZ2A 1FWHC 2VJXA 4AWSA 2PDCA 1XIMA 1ZALA 1DTNA 1POJA 4Q3MA 1UWAA 3R6IA 4D6IA 3BGJA 4OE7A 4PMOA 1FWNA 4MJ4A 1XRSA 4KWSA 2CBUA 3KE0A 5DXYA 3SCQA 3UPWA 2JBMA 3C0JA 3B0UX 3R2GA 1WAWA 3VNYA 5KMYA 5LXEA 4O18A 3FFSA 3TW9A 4PRRA 1RVGA 2E3ZA 1S5VA 3IJ8A 4E8GA 3QYSA 1X6LA 5EKYA 3AHVA 2W62A 4JIRA 1W3HA 5AYIA 2QCMA 2ZUTA 2P50A 3G1DA 3QM3A 1A3WA 2VEKA 3VTRA 3F5KA 3BLIA 1R87A 2XWDA 3W87A 1H7OA 1L8PA 3PSVA 1HJUA 2X0SA 4LALA 2IUZA 1UH3A 2B31A 2R24A 2OSWA 3M44A 3MMTA 1PUDA 3E49A 4IPPA 2FDSA 1A0EA 1YNPA 1KW1A 3BMVA 4QP0A 3DFYA 4O1CA 2QW5A 2XH4A 4QTGA 4OV9A 2HS8A 4IJRA 3STCA 1PBGA 4R9OA 3T05A 2G37A 1WKYA 3HF3A 5CBJA 1LOQA 4TIMA 4ACYA 2E6AA 1JF5A 3FEQA 4ZEPA 4MNKA 1SO3A 2ON3A 4F0SA 2VD8A 1W1B1 3S9IA 2Y8KA 1WO2A 4XIAA 3WNKA 3NA8A 3K1DA 2BZNA 3EPOA 4NYYA 5A2BA 3V3WA 1E9YB 3KOZA 3LRMA 4D1IA 3OZMA 2Z28A 2X16A 1W2VA 3GR8A 4L4PA 1V5XA 4CU8A 3HGJA 1N8IA 1CCWB 2XIMA 1S5WA 5CC3A 5C54A 4JNMA 3EYPA 4MB3A 3QQ0A 3ZR5A 1XSIA 3LA4A 2BBFA 3ITLA 3KS6A 1ZJBA 3W6LA 4O17A 2OSXA 4JTCA 3GQYA 2PRLA 1BF6A 3URBA 2PSNA 3MBFA 4UXDA 2C0HA 2TRSA 4Z1BA 4C6CA 3BV7A 4LVBA 1E6SM 2CFFA 3OU8A 2J7EA 4E38A 4Q4KA 1VPQA 1FWAC 3B0PA 2PD5A 4HU3A 1YLVA 3RX4A 2Q8LA 1TVLA 2YA1A 3H2EA 4AW7A 2FJUB 1J0YA 1Q6GA 2ATMA 4LY4A 2QULA 3LPGA 4UFLA 1WBHA 1O60A 1RP9A 1LL4A 1JYWA 3NFUA 3U3HA 1VBHA 2YDRA 3SEPA 1KQZA 1DIDA 3HTWA 2EG6A 1X7FA 5A6AA 4UCGA 3TSBA 4PTMA 3WQFA 4KCTA 4MNMA 2WWDA 3SUTA 2DT0A 1UZ4A 1E1FA 3NEHA 4XB3A 1DWAM 2Y62A 1GQJA 2XJ7A 1LLOA 4B4HA 4LV4A 2I57A 2YLAA 3LXCA 2ATSA 3DI0A 5HMFA 4PBEA 5CC6A 3KBJA 1V77A 2YDSA 3SECA 2ZZ5A 3F5LA 2B7OA 3W7CA 5JIPA 5CGQA 2CEQA 4GBUA 4UMAA 4H3DA 4EWJA 4CQ8A 2AMGA 2BP1A 2Y7GA 3OO2A 3U8GA 4QSFA 3A3WA 3TFCA 2QCHA 3MI6A 3W1QA 3V1HA 2XINA 1WKFA 2FKPA 2ZZ4A 2G3MA 3N2TA 1SR9A 1DKWA 2HV5A 3IUDA 4NXKA 5DMNA 4ZE5A 3RILA 3N4EA 3N29A 3LRLA 4JQ2A 1W5MA 3QR0A 4Q4MA 4Z2JA 3EKZA 3G1RA 1CNVA 1QCWA 3JU2A 1KD0A 3CO8A 2PPGA 5GNXA 3CYVA 1YRRA 4PBFA 2HQAA 1VFMA 1HXJA 3W6YA 1V02E 5TBOA 3WF3A 3WQVA 3M5VA 2G41A 1EDQA 4PMUA 1GONA 1YKWA 3OTRA 3GVGA 3KX6A 3PP7A 3S5OA 1PS9A 4TX6A 2WC7A 1Q8JA 1W3TA 4ZQPA 4ASTA 2A7PA 1VLWA 5LGXA 1L6WA 2HEJA 2BVWA 1DWGM 3W38A 1RA5A 2IQ0A 3T4CA 1QI0A 1P4CA 3KTXA 3PANA 5C55A 3GC5A 3K5XA 2FPTA 4IMFA 5F4WA 1TFVA 4UIOA 4QLJA 3LLXA 4XZNX 3V0UA 5CH9A 5HJLA 1B90A 3ZSTA 4FX6M 5JUVA 1UBSA 3ANUA 3P5YA 3W1MA 1MW1A 3VUPA 4Q8UA 3N17A 4NAFB 4S23A 1VP5A 1TZ9A 2PDHA 4DPQA 1TMHA 1O94A 4V27A 4G1KA 1EYWA 5CLWA 4IG2A 2YSWA 1FDJA 2TMDA 4MMWA 3BTNA 3KOYA 4DJFD 1J93A 4LUTB 4ZTXA 3S5YA 4Z2KA 1H51A 3GXMA 1IWBA 1T5AA 4AEFA 3LB0A 3APYA 1IT0A 5D32A 2UY5A 2Z24A 2CXEA 4PCFA 1I9CB 1UUMA 4DLFA 5K9CA 2NXGA 3LEPA 4B92A 2VZTA 3TYUA 2D22A 1XLFA 1R2TA 4IZGA 5BMWA 1VFSA 5CSRA 3AHYA 5LGZA 4HYWA 2R8WA 4HA1A 3RR4A 1I2OA 7TAAA 1M01A 3TWBA 2PLMA 4P8XA 4AIEA 3C56A 1HKVA 6REQA 1A49A 4YNGA 2ASHA 3F5JA 4RJEA 3PS7A 1W1IE 3MY9A 4K37A 2XVLA 2EJ1A 3PPGA 1FY6A 1BD0A 1VEOA 3M0JA 2HRWA 4JDBA 4M19A 2INZA 2ACQA 1ZS2A 2EF9A 1RH9A 3KBSA 1V6WA 3TA6A 4WY0F 2W27A 3AIRA 1CGTA 2X05A 1OIMA 4ATDA 4WD0A 1MXSA 3L21A 3CAKA 3TTQA 1XWYA 4JFVA 3LCGA 3DYPA 3HOJA 3CT7A 3B4YA 3ALFA 2VX6A 3F2BA 4HHPA 5CCZA 3DESA 2XM2A 3CXOA 4HNVA 1XC6A 1QNSA 1UKPA 3TMQA 1NDWA 4D6EA 4LBSA 1HF6A 3WQ6A 3OBKA 4K6AA 4BQ3A 5HMSA 3CIWA 1LWHA 2Y70A 1NOWA 3L23A 3O6YX 5TAOA 1NARA 2PDPA 2PB1A 4MAZA 4JBRA 2PDMA 4HGXA 4XVDA 1DOSA 5K4XA 3I4KA 3OVGA 3O16A 2A79A 3LS9A 4MIMA 3T0BA 1IEWA 7ENLA 4GX8A 5D9MA 2A85A 4MLJA 3TK7A 1XYLA 2WANA 3AIBA 5CZJA 3IVUA 3DU0A 1MYRA 2OO6A 4RDWA 4AMCA 5CPTA 2ZDRA 4FB7A 5H91A 2GGJA 3AZRA 3EDEA 1B9BA 4ZQCA 1W1ZA 2CU0A 2PFHA 4PUMA 3BW3A 3NGJA 2WVVB 3AMDA 4WHBA 3CB8A 3UWEA 4INFA 3FKKA 2YA2A 2CLLA 4O1AA 4RR4A 4GY1A 5T9BG 2WB5A 2J74A 3B97A 4A3HA 2IW0A 4RPQA 3EDKA 2F6UA 3ORWA 3UZXA 2YCJA 1EDTA 1HKIA 2QR6A 2G97A 5HMDA 1V03A 5DCEA 4YCPA 1GOKA 2BV9A 2A3EA 4TVUA 3OVQA 1WB0A 4JTKA 3AWNA 3GTXA 1UQYA 3KVMA 4GZ7A 5IBXC 4TVCA 3GTFA 3DBPA 2ISWA 4FXFA 8XIMA 4MPKA 3GYCA 9XIMA 3NQ7A 1B3XA 4BFAA 1PX3A 3KVLA 3UJSA 2QGYA 2WMGA 1A3XA 2YW3A 2QPUA 1VFTA 4Y7EA 4LSBA 4LEQA 4HMDA 3S47A 4LEFA 2CXGA 3W01A 1C7SA 5JH2A 4ICCX 5AVNA 5BNKA 4KRTA 1PIFA 1OSEA 2OZ8A 4E3VA 3B8IA 7A3HA 4GHRA 4GBDA 5C9ZA 1W17A 3MHUA 4AWUA 2I9EA 3C0LA 4AYGA 4Q7IA 1Q4WA 1HTIA 2C13A 5CG0A 2YXXA 3TTEA 5F4XA 2QDGA 4D71A 1KXQA 3FS2A 1A4MA 3HGOA 1R6WA 3SCPA 4U3AA 3CB3A 8A3HA 1UKTA 3GXPA 3BLKA 3NAVA 5LNRA 2WSRA 1A5AA 2QHAA 4LBRA 1KFJA 5C9RA 3T78A 4UTKA 5L9FA 5FOOA 4GYFA 3LHWA 3BOXA 3WJZA 4GIAA 3PBMA 1QATA 3NVDA 3S4TA 2PZNA 3O06A 1GWJA 2XH7A 4Y96A 2W63A 5EY5A 3LX9A 4FR1A 3EPMA 1ITCA 1P43A 1POKA 2V5CA 2OODA 1OY0A 2W5FA 3MI2A 1A0CA 1DWHM 5AYBA 3CUFA 2UV8G 1DJGA 3TYEA 4AZCB 3QMTA 5HMEA 3AS0A 1RXOB 1EJSC 3BC9A 1WDPA 1HL8A 1FXQA 3WQPA 4A4AA 4LX4A 1BKHA 3UWUA 1UA3A 2H3BA 1CLXA 1US3A 3QKEA 5I3HA 3GU1A 4F0RA 3SCNA 1KTNA 2GVYA 3H7UA 3BCJA 1MEWA 1FBAA 5IBXA 5REQA 4LYKA 1PTDA 3T9PA 3R8RA 3MJMA 5F2MA 4QJ4B 5ECUA 2I9UA 1ELSA 3W7EA 2AMXA 3LY0A 2J88A 5E70A 4TMBA 1YX1A 4DWSD 1KRCC 3VNZA 2QPXA 1DV7A 4R3UA 3DGBA 3LGGA 4A3YA 2WJEA 3SSJA 4WJXA 3A5VA 1J8VA 1J0KA 3S5SA 5M2FX 5TIMA 1ISXA 1V7AA 4W7WA 3GDBA 1W9BM 4GIYA 3FJNA 3GU2A 5CKSA 1DP0A 4YJ5A 2TODA 5BRPA 3BSMA 2BHZA 1K4HA 2NQ5A 4B4FA 3HQ1A 1PJ9A 1JCTA 3GFZA 1BGGA 1V6YA 4PEEA 4V15A 1ONXA 4KETA 4KWOA 3IIOA 1BXNA 3E0WA 1PCKA 4XAGA 1BXBA 5CPNA 1E0TA 3DAQA 3EWZA 2X42A 3BARA 4NZ5A 3UESA 5BZAA 1R47A 4CUCA 5XIMA 3R8HA 3S5ZA 3UZ5A 1N82A 3N2OA 1ECQA 2Z6IA 5T9CE 4TU1A 1DE6A 2PLKA 4AC1X 3LQLA 3BAJA 1L6FA 1CWYA 5DELA 4ORMA 4JNYA 1M65A 1XD1A 3SN1A 5AYZA 2VX7A 3V75A 1UG6A 3OG3A 4GJ1A 1V8EA 1EP2A 3O9NA 5DFAA 3TR9A 4KPLA 1DTUA 1NP2A 3E2SA 3M41A 3GW0A 2DVTA 4H7CA 4C1NB 2VVNA 1OGGA 3G0SA 1MNZA 3U7VA 4HZ7A 1OGBA 4HYRA 4I3GA 1UC4A 3MC5A 3F4VA 1KV5A 2IQTA 1H7WA 2OZ0A 5C6MA 3EWUA 4Q32A 1E9ZB 4BEQA 3PY2A 4JKKA 2TYSA 4H4IA 1REQA 3W1NA 4F0HA 1Y7VA 2REQA 2O9PA 4MB1A 1ICQA 3AYTA 1F07A 2YXGA 4MWAB 4Q8PA 3B4UA 3QBUA 4EX4A 4O0KA 4NAEA 1PTGA 4WF7A 1TPC1 3IJ7A 4WDXA 1C8YA 1B0IA 3L4VA 3K4AA 1M7PA 3TXVA 5LA0A 3EA1A 2YKKA 2VEIA 1G69A 4NZJA 1KFCA 4IFKB 2NLIA 4LFYA 2BX7A 2DJLA 3P93A 1GVFA 1W9XA 4RUBA 1ZGDA 2A0NA 1NJJA 3CZJA 1VR6A 5DXXA 5BXSA 3WLSA 2WJDA 1GT8A 5FF3A 4GUIA 4IMCA 1SO4A 4N6EA 1YBQB 2NVDA 2RKXA 2P8CA 5T26A 4ERAA 1E0VA 1GTHA 4MWAD 5D2TA 1HJVA 3MU7A 3VXGA 1YIXA 2D69A 1LROA 4NILA 3DECA 1X1ZA 4Q8MA 3G1FA 4IMEA 1TG7A 1P7TA 1E0XA 1S2AA 1B1YA 4W7VA 1JYXA 2JQXA 1OX4A 4LJ3A 3MKKA 2D2OA 2HK1A 4FMVA 1BWKA 2VT0A 3VIFA 3MMUA 4N2YA 2R1NA 3H7VA 5CPLA 3LMYA 3ZJ6A 1GK8A 3QR3A 3MCOA 4IXHA 4B2DD 1QASA 3F4DA 1I2NA 1X1OA 3T1GA 3QV7A 4AYSA 2QCCA 3R0KA 4E4PA 4X9SA 1HJWA 3DUGA 3VIKA 1W6TA 5DRCA 1UD6A 4XAYA 4IPLA 4CLMA 3JUGA 3KLKA 3R13A 4QG9A 2XDFA 3TDFA 3HPAA 2Z6JA 3N15A 4GWEA 4A8LA 3O07A 1F6YA 4PMDA 2YB1A 3OYXA 2YJQA 5I77A 1KBLA 4YTQA 1EKOA 3DGRA 3HQPA 1Q6RA 3CASA 2Z26A 4W8AA 1QI3A 1IGWA 4OIFA 3BJTA 4EPKA 3NQAA 2QT3A 1M7JA 1CENA 3CV1A 1U2YA 3PTQA 3RMJA 1A0DA 2ZX8A 1R3VA 3CEPA 4HHHA 4H9XA 1K8CA 1ZSXA 1ZCCA 2R91A 3CHEA 4C1LA 1VGAA 2D0FA 3ZJ7A 2XGBA 1CW2A 2NLYA 3PZTA 3M0IA 2NSXA 3S9YA 1PSCA 2WZTA 4J3XA 3W2MA 4F0MA 1KCZA 3O6AA 2WSKA 3BCFA 2L5HA 4Z1DA 1GZGA 3H4GA 4ERIA 5C2GA 1FHVA 3EDJA 1LF1A 4J7RA 3BQ6A 5AZ0A 1QOQA 3O1NA 2HVOA 3MVIA 2P8BA 3I3BA 3PFMA 4KIRA 3R0DA 1E6RA 4BF9A 4CD5A 3NPVA 3CL8A 5BXTA 3DI1A 4AIUA