3AHYA

Crystal structure of beta-glucosidase 2 from fungus trichoderma reesei in complex with tris
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
465
structure length
465
Chain Sequence
MLPKDFQWGFATAAYQIEGAVDQDGRGPSIWDTFCAQPGKIADGSSGVTACDSYNRTAEDIALLKSLGAKSYRFSISWSRIIPEGGRGDAVNQAGIDHYVKFVDDLLDAGITPFITLFHWDLPEGLHQRYGGLLNRTEFPLDFENYARVMFRALPKVRNWITFNEPLCSAIPGYGSGTFAPGRQSTSEPWTVGHNILVAHGRAVKAYRDDFKPASGDGQIGIVLNGDFTYPWDAADPADKEAAERRLEFFTAWFADPIYLGDYPASMRKQLGDRLPTFTPEERALVHGSNDFYGMNHYTSNYIRHRSSPASADDTVGNVDVLFTNKQGNCIGPETQSPWLRPCAAGFRDFLVWISKRYGYPPIYVTENGTSIKGESDLPKEKILEDDFRVKYYNEYIRAMVTAVELDGVNVKGYFAWSLMDNFEWADGYVTRFGVTYVDYENGQKRFPKKSAKSLKPLFDELIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional analysis of three beta-glucosidases from bacterium Clostridium cellulovorans, fungus Trichoderma reesei and termite Neotermes koshunensis
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords Beta-glucosidase
total genus 187
structure length 465
sequence length 465
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ahyA00
2A3BA 3SURA 2VZSA 1H0IA 3CTTA 4J3SA 3PZVA 1OM0A 3BAWA 4XV0A 1E6SM 3FNDA 1V0LA 1KCKA 1GW1A 4NF7A 4AD5A 1C8YA 3A4AA 2E9LA 3VKKA 1W9PA 4H2CA 4FLOA 2ZWZA 3POCA 1LL4A 1W1PA 4OZOA 2VVSA 4PMNA 3U5UA 3WH6A 5I79A 3QGVA 3GM8A 3BAYA 3VMOA 3WFZA 3ARSA 3VGEA 2G8ZA 3OLEA 2Z1SA 3EMQA 2F2HA 1BGGA 3W0KA 1LWHA 1K9TA 5CZKA 3VTRA 1R7AA 1Q6DA 3AIVA 4AD1A 3SCPA 5ABHA 2DDXA 1H09A 1NARA 1U33A 3I3EA 4TOQA 2CCRA 1C3FA 4DWSB 2VCCA 3CIVA 5GNZA 2RGLA 3WFLA 1QBBA 4M8UA 1ZL1A 2QV4A 3CBWA 3WMCA 2ZIDA 2WVUA 4WIWA 1KBKA 3MU7A 4ACYA 3OB8A 4NI3A 2J4GA 2PI6A 1MYRA 3QHMA 2FGLA 5CG0A 3OIHA 2JIEA 1CXLA 4FLQA 1EIBA 3SCTA 3AHZA 1CZ1A 1HNYA 2J8GA 5CPTA 1JZ7A 1XD0A 1OT2A 4QLLA 2WHMA 3OLGA 4UQEA 4JFVA 5AY7A 4CD8A 3PZ9A 1DTUA 4JKKA 3OLIA 3AIEA 4AZCB 2VRQA 2WVSA 5CGMA 1QI2A 3UR8A 1PIFA 3VO0A 3AHYA 3AMCA 4MNKA 1UWSA 4PRWA 3WQVA 1AQ0A 3BLPX 4CD7A 3NDYA 3W29A 4Q7NA 3AIWA 1WDQA 1CECA 1VFOA 2F61A 2PWEA 3VIMA 2QLYA 4KWUA 4ACZB 3LPGA 3E1F1 3U7VA 3DHUA 2V3FA 4X9YA 1KQZA 3BCDA 3T08A 1ISYA 4B3KA 2CXGA 2BV9A 3AHXA 3VINA 4LQ1A 4GQQA 1TMQA 1TUXA 5CPSA 5FL0A 3ZT5A 4DUWA 3AHTA 1J0JA 1FP8A 5CXPA 2XIIA 3WMSA 4HMCA 2EJ1A 3KL0A 2EO7A 1JYNA 1OD8A 2CPUA 4DM2A 3DECA 2ZUSA 4KMQA 5A2BA 5EFDA 1KBBA 1WO2A 1JG9A 1UH2A 2BXYA 1W9DM 4U2YA 3SUUA 1LL6A 5LYRA 1AVAA 1H41A 4KGLA 3N17A 3VUPA 4C7DA 2VCAA 4D71A 1R86A 3OBAA 4N0RA 2YL8A 3KEHA 1FFRA 5ABFB 1XGZA 3N9KA 3AS3A 5ECUA 2ZUMA 1E5JA 3DYMA 1GOQA 4LXFA 4P8UA 4CCEA 5BROA 1E4MM 1XYZA 3GTNA 4F8XA 1CDGA 3MUAA 2VO5A 1VBUA 2CNCA 2VT0A 3VD4A 3POHA 2BY3A 1GVYA 2CBUA 3EDDA 1W1TA 3T2OA 5D8ZA 2VX7A 2QMKA 2FHFA 3VNYA 3NSMA 5JIPA 1UA3A 3ARUA 2OSYA 6A3HA 2BY0A 2WBKA 4HPGA 3SCVA 2D3LA 1LJYA 4D1JA 1ISXA 1E9LA 3CLWA 5ABEA 3SUTA 1AMYA 1R8LA 4URIA 2WWCA 3B9EA 4W8BA 3AIUA 2ZUNA 2VZUA 4HU8A 4B9YA 1BVNP 2EPNA 5JBFA 2QPUA 5IHRA 4YHGA 2BVYA 3F5JA 2O92A 3WN6A 5A1AA 2ZX9A 1EQCA 3EYPA 1GOWA 1E6RA 1ZB5A 4BS0A 2B31A 4D6JA 1UR4A 3VIGA 3UG5A 1MVYA 4CU7A 3S2CA 4PBGA 4XZWA 3T0AA 2O9TA 3GBDA 4RE4A 1TR1A 5LA2A 2D1ZA 3PZMA 4HZ7A 1ZBWA 3A3HA 1W3LA 4E8DA 3W6MA 4QLJA 1TA3B 2QMJA 5FD0A 2XIBA 2Y4SA 4X0VA 4YN5A 3WENA 2YLAA 2VI0A 3OGVA 3RJYA 2J47A 2VX4A 4DUXA 2E0PA 3AICA 1EGZA 3W81A 2J8FA 4DM1A 2WSPA 5I23A 2WM0A 1CIUA 2OSXA 5BRPA 2BVTA 1G0CA 3GNRA 1G94A 3ARTA 4JFUA 1GOMA 2YA0A 3RMEA 1SMDA 4MAVA 3ARQA 3VMPA 1KQYA 3WDJA 1HX0A 4WKAA 1V3IA 2GJPA 3SCUA 3GH7A 1HVXA 4CCCA 2XM2A 2DPEA 3FAXA 2PBGA 4H41A 4PTXA 2GDVA 1UKPA 2WMJA 2YJQA 5IDIA 2GJXA 1E6QM 2D22A 4RE3A 2YL5A 3FN9A 1JYXA 3PZGA 1HP5A 2VRKA 2OWXA 1OT1A 2C0HA 2CERA 1NQ6A 4MDPA 3KE0A 3I3DA 5LA0A 4Z2IA 1LG2A 1GJUA 4AZBA 2DSVA 4LGXA 4GO8A 1QHPA 1ISZA 3AISA 4M29A 2O9RA 2VX6A 3L4ZA 4QP0A 5EB8A 2OWCA 1DP0A 4BA0A 1V02A 1JD9A 1B30A 2F8QA 3GH4A 4M80A 1E71M 1MW1A 5CLWA 1E15A 2UY3A 3AS2A 1IT0A 1X1NA 4PUDA 4HA3A 2HISA 4UFLA 1W3HA 2ZOXA 4W84A 2D0HA 5A6AA 1V03A 4HZ8A 3NIYA 1WE5A 1GORA 1BYCA 4EKJA 2VCBA 4K68A 3IAPA 4UNIA 8A3HA 4DWSA 3M6DA 2EPMX 1R7OA 2W62A 4NSBA 4DUVA 4FK9A 3W28A 1CEOA 2XUCA 3PZIA 3VIJA 4BQ2A 3MUIA 1E6PA 1G5AA 1Q6EA 2WSKA 1VFUA 2BFGA 1UYQA 2VC9A 1E43A 2G3NA 2BNJA 4HA1A 1UA7A 3AJ7A 3K8MA 4AIOA 3MV01 4D6DA 1OGGA 1UWUA 2GJXB 4OIFA 3WNPA 2D3NA 3AMLA 4UQDA 4WJXA 4J7RA 3EDJA 4HOZA 2DGAA 2YA2A 1MW3A 3WDQA 4UR9A 3AQUA 1ZBKA 4TVDA 3SCOA 4N42A 4U31A 1BLIA 1JYVA 4IPLA 3N15A 4HZ6A 1IZKA 1HJQA 3GXFA 2XWDA 1JDDA 2WKGA 3VD5A 3O9NA 4F9JA 1QVBA 1VAHA 4CN4A 2X2YA 3VDAA 3G6MA 2CBVA 5A6KA 2Y8KA 5I24A 3F4VA 3JUGA 2D0FA 3HMCA 3WF2A 3CHEA 1WB0A 4W8LA 2CKRA 5GPRA 5ABFA 1BQCA 1CGWA 1W91A 3AS0A 3BSHA 4MNMA 2WAGA 1DHKA 4HTYA 3WQ5A 1CNVA 3IK2A 5CLTA 1OIMA 3KL3A 1V3HA 3AYRA 5M17A 2GUYA 1QI3A 2DSZA 3WD0A 1E1EA 2W66A 2VMFA 3IJ9A 3MMDA 1J9YA 1YQ2A 1V3LA 2UY2A 4JAWA 5AYBA 1TG7A 1KWGA 1EOKA 3HU7A 1FHLA 4E2OA 3W37A 3IJ8A 3WUGA 5A6LA 3CH9A 3AZSA 2ZX7A 3WQ4A 5FOOA 3WEOA 1BF2A 3N18A 1ISVA 1B0IA 1XD1A 3B8SA 2W63A 2CKSA 1K6AA 1MQRA 2WHLA 5IHSA 2TAAA 1EDGA 2O9PA 3AZRA 1GOOA 1HJWA 3VDCA 5E6YA 1HIZA 1CPUA 3AIBA 1E0XA 1UWRA 2VOTA 2DIEA 5HXMA 2XFFA 4UQ9A 1WCGA 1H3GA 3W6LA 4A4AA 3L4TA 4PYSA 5A69A 1B1YA 3OZOA 4KRUA 1E4IA 3L4VA 5A6JA 3ZIZA 5A8NA 1EDTA 5TD4A 1KXTA 4A3HA 1G9HA 3CZJA 6TAAA 1BYBA 1CXKA 2YKKA 1UZ1A 4PMQA 5BXTA 1LL7A 4B3LA 1I1XA 1JFHA 3VD7A 2WNWA 1B3VA 5I77A 5DFAA 1EO7A 2WVTA 5DMYA 4D6FA 1GPFA 3WF0A 1UR0A 3MS8A 1UH3A 3VIFA 3CZGA 2DT2A 3ARZA 2XVKA 1H0GA 2XGBA 2DT0A 3MSGA 1M01A 3WF1A 4F9DA 2WZIA 1CXIA 3BAXA 3NDZA 3VGBA 3CZLA 1MFVA 5E6ZA 1HJXA 5GQBA 2WVVB 3RPMA 3EMCA 1KFWA 2ZUTA 2WMIB 2XHYA 2ZWYA 1US3A 4CU8A 1JDAA 4AZ5A 2G3JA 2XPKA 4WK9A 3W38A 1KR0A 3WH8A 3VX0A 4JCLA 1QW8A 3WUFA 3O6AA 4W85A 1UQYA 5D9MA 4P7RA 3PZQA 4ATDA 4PMUA 3VVGA 5DO8A 1M04A 1E0VA 1GQIA 1W3JA 3PZTA 1VRXA 5E09A 1GJWA 3W82A 3WIJA 1DWIM 5CSYA 1CXFA 1VENA 3SUWA 3AI0A 1J18A 4PN2A 9CGTA 4AD2A 4AMCA 5C8BB 4GZJA 2E9BA 4ZXOA 3QOKA 3NCOA 3K8LA 4CCDA 3AMKA 5E0CA 1E3ZA 4GIAA 1GVIA 4MB4A 1XCXA 1FFQA 4OOZA 5A6MA 2X05A 4UOQA 3K4DA 3ZR5A 1Q6FA 2WCAA 1KXVA 1TA3A 1Q6CA 1BTCA 4GINA 4ZXLA 5A8QA 3WUEA 3WSUA 2FHCA 4QDMA 3RO8A 1VB9A 3GXMA 3LPOA 4AD0A 3WY1A 2J78A 2X1IA 3BGAA 2C7FA 3RILA 1EA9C 4W89A 1K9FA 2Y8VA 1BHGA 3THDA 1FA2A 4GXPA 1EXPA 1FH7A 5A2AA 1UHVA 4MNJA 1LLOA 1VF8A 4EK7A 5IXEA 2UY4A 4TTUA 3NYDA 1UKOA 5I0DA 3AHVA 3HJEA 2PBOA 1HKKA 4YPJA 1JZ3A 4MJ4A 4PMVA 1G01A 3O2LA 1CGUA 2VZOA 4NRSA 1WZKA 3WL1A 1ODUA 4M24A 2VTFA 2X09A 2E8ZA 1GHSA 2D20A 3ARXA 3DYPA 4UOZA 3I3BA 1ZU8A 4AZ7A 1EHAA 3RDKA 2XYLA 2FH8A 2W67A 4XX6A 1SR0A 3GZAA 4JHZA 1JF5A 1B3WA 1PJ9A 4Q22A 3FHAA 1L8NA 2YIHA 1V3MA 4JL2A 2CIPA 5FL1A 2W4XA 2YL9A 3CZKA 2YOCA 1NP0A 2CYGA 1FP9A 1KR1A 1UUQA 1BFNA 2CHNA 3WD3A 1TVPA 2EPLX 1RH9A 2VQUA 7TAAA 1RP8A 1MW2A 1QI4A 4PMZA 2VNCA 4U5KA 4PMDA 3WH7A 1W9UA 4HA4A 1XCWA 2J7EA 4AC1X 1E72M 2VQTA 1I75A 1KWKA 5HNNA 2JEQA 4JFTA 3ARPA 4UOJA 4FLRA 4MB1A 1C91A 3WD1A 4KH2A 3THCA 1NM9A 4CVWA 1WKYA 3UG3A 3NSNA 4CGTA 1C7TA 3LPFA 3BXWA 4M82A 1TZ7A 3PN8A 1L0PA 4AXNA 4D1IA 4WKFA 4HOXA 1FH9A 1HJVA 1G1YA 2XSBA 1HL8A 3CUIA 4J3XA 3TA9A 4PMRA 3WBAA 2JEPA 2A3AA 2YDQA 2OSWA 4PTWA 1D3CA 1WDSA 3AYSA 1QI0A 4Y7EA 1QW9A 1AQHA 4HOWA 3WNMA 1NOUA 3VD9A 1H1NA 5BYWA 3U57A 3TONA 4ZE4A 5D9NA 1V02E 1XC6A 2EXOA 1V6VA 4IISA 1S46A 4JFWA 2WLZA 2BHYA 1MW0A 3MV11 2Y2WA 3J7HA 4BCEA 3ALGA 4H04A 2OYLA 2W5FA 4P8WA 2GVYA 1Q4NX 1WZMA 1C93A 1E4NA 1KCLA 2ZXQA 5I78A 1VJSA 4L4PA 3ZQ9A 3AFBA 1CGXA 4EAMA 1GOKA 3K46A 1UR1A 1C8XA 2WW5A 1Y7VA 3QHNA 3WH9A 4OBRA 1MXDA 2MANA 4UQAA 2PWDA 2DEPA 1E56A 1BVZA 4OJYA 1XSIA 2GSJA 1TCMA 3WDPP 5JBEA 3VDBA 1WPCA 1QI5A 4MJ2A 2IXVA 3VOCA 1C90A 5D9PA 1JI1A 3FAWA 4UFMA 5A95A 3WH5A 1QNRA 3BC9A 3N04A 1DWJM 2JF6A 4WSKA 3M07A 3AXHA 1WZAA 1W9BM 5BXRA 4GO9A 1N82A 1ZJBA 1VFFA 2WC4A 4QLKA 1V08A 5FCZA 5CJ5A 2PWGA 1XH0A 4MB3A 1E6NA 3PBGA 1VEMA 4GZEA 4XZBA 2W92A 2ZX5A 3VGFA 3W53A 4NRRA 2E8YA 1HVQA 1MQQA 4E4PA 4AZCA 7CGTA 3ZMRA 5DF0A 3RM4A 2PWFA 1UR9A 4W8AA 2X0HA 1PPIA 4S3KA 5FKYA 1J12A 1B3ZA 2J7CA 2WZHA 1NWRA 4M1RA 3L4UA 2ZE0A 3WEMA 4JKMA 2ZUUA 1H2JA 3GBEA 3KZSA 1EH9A 3KL5A 4ZE5A 2JFEX 3WUBA 3OA5A 4JFSA 5C71A 3MUY1 3W4RA 1VIWA 4TVCA 4J27A 5M03A 3SCWA 2DT1A 1JFXA 1C8QA 2W61A 4PTMA 4AY1A 1GOIA 1BPLB 2VX5A 1GONA 1XRVA 1LQ0A 4GKLA 1M53A 2DSWA 3HN3A 2XVNA 4AD3A 4JKLA 1E3XA 5EBAA 3VIKA 1ZS2A 4W5UA 1Q6GA 2D2OA 4WSJA 1UWTA 3PTQA 1GNXA 2V3DA 3NSXA 3DYOA 1D7FA 4V28A 3U5YA 2G41A 1NWSA 2UY5A 3A47A 1J10A 3TOPA 3WQWA 1J0ZA 1BG9A 2XTKA 2JIWA 1KXQA 3AZTA 5I6SA 4U2ZA 5C70A 1JAKA 2YLLA 2YBTA 3GNOA 1B2YA 1UD4A 4BQ3A 1OWQA 2VURA 4CN1A 4Z2LA 4PUEA 1PEZA 2HVMA 3FHQA 1FH8A 1JNDA 3BAJA 3LPPA 2XJ7A 1GQJA 4GI6A 2BVDA 1XHGA 3PZUA 2G4FA 2X8RA 3WQ8A 1JIBA 1NOWA 3B9DA 5A8PA 1BYAA 2NW0A 2V5CA 2ZXDA 1QPKA 3VNZA 1A3HA 1J01A 1W9VA 4U5IA 4W93A 3BH4A 2NT0A 2BHZA 1ISWA 3N11A 5M3WA 3W27A 4TX6A 3WF4A 1HF6A 4TX8A 1QHZA 3BAIA 3UERA 3CUFA 4CU6A 4RL3A 3DHPA 2EEXA 3CZEA 3PTKA 3AMGA 4J3TA 3T2PA 4OKDA 1MQPA 1B31A 1WZLA 2J7FA 3A4WA 4MDOA 3CUJA 5AC4A 4WKHA 3TTOA 2IXUA 5BXSA 3GH5A 1UD5A 2X0YA 3APGA 3CHDA 2GK1A 3ZR6A 1UR8A 1V6UA 1P6WA 4CD6A 3VGHA 2VR4A 5KZ6A 1HJUA 2AMGA 2J7BA 5AC5A 1UKSA 2OYMA 3AXIA 3GNPA 4YHEA 2UWFA 2OWWA 4V2XA 2VZTA 3CZ8A 4PMYA 1LWJA 5JIWA 4ATWA 3GDBA 1WDPA 3NJ3A 1I1WA 3GXDA 1UD2A 1B9ZA 3IAQA 4CN6A 4J3UA 1DWHM 1ZBVA 1UWQA 5HBFA 3FXYA 2XVLA 4MB5A 4V27A 4CD5A 3RIKA 3UETA 2A3HA 2VUYA 3SCQA 1NP2A 3D5HA 1JYWA 5D4YA 1EDQA 3BCFA 1QNQA 2FGZA 4LYPA 2Y24A 2V38A 4BQ4A 3VPLA 4GZIA 1PX8A 2QPSA 1NWTA 1J0HA 4TVUA 2CETA 5CSUA 1TVNA 4OOUA 2XG9A 1KGXA 4IPNB 4P7QA 3VILA 2BHUA 5KEZA 1PX4A 4D6CA 3ZJ8A 1GZJA 2RGMA 2WCSA 5A6SA 2Y5EA 2WC7A 3VDHA 2XGIA 3AMDA 3ARWA 4GQRA 2ZUWA 2DIJA 3TTYA 1V0KA 4AZHA 1WP6A 1HKJA 3ARYA 3WKZA 1GQLA 3ZJKA 4D6HA 2ZX8A 1UKQA 4UFHA 4PMXA 2VL4A 1J0KA 1GCYA 2QF8A 3VU2A 5E9AA 2CHOA 3TP4A 2J77A 3RM8A 1HKMA 1CWYA 4PTVA 4XB3A 1O6IA 2A3CA 3CMGA 3OGSA 4AEFA 5HPOA 2Q8XA 2JE8A 2PF0A 4AIUA 1JD7A 4H8VA 3IJ7A 1E0WA 1JDCA 1W1YA 5JUVA 3VD3A 1NOFA 1OBAA 2WMHA 1F4HA 1CTNA 1PZ2A 5A3HA 1QNSA 4S3JA 3RCNA 1NWUA 1W1VA 1AQMA 3L4XA 4UZUA 5IFPA 4AEEA 3UG4A 4MAZA 4UFKA 2O9OA 3CMJA 3MMWA 3VIPA 4OUEA 3N13A 3UCQA 2J62A 1E6ZA 4GI8A 3WDIA 4JCMA 2E40A 5HOSA 5A6BA 3DC0A 4LYRA 2CBJA 1JZ6A 3L2LA 3MMUA 5GNYA 1PAMA 5DT5A 2E4TA 4TUFA 1Z32X 4ACZA 1RD6A 3VMNA 2E3ZA 2PB1A 3WNOA 2BXZA 1E5NA 3WD2A 1C92A 2EPOA 3LMYA 1HKIA 4ZFMA 3TTSA 3WDRA 4W7UA 1QHOA 3ZM8A 3IANA 3PZNA 1VJZA 5FIPA 3BAKA 1US2A 2DSKA 1XV8A 2A3EA 4UFJA 3VM7A 2WMKA 1QOXA 2XVPA 2WXDM 4UQCA 1F4AA 1R87A 4D6IA 1HN1A 4JHOA 4CD4A 1O7AA 2FHBA 4X0NA 4BQ5A 3EDFA 5D9OA 3MO4A 4E8CA 3EBVA 2XFYA 1E40A 4RE2A 3QHOA 4IUGA 1DWAM 1XH2A 1MXGA 4EE9A 1E70M 4P8XA 1JI2A 2WC3A 1JNEA 5A2CA 3AS1A 3MANA 5BRQA 3WNLA 4C7FA 4AW7A 3D3AA 1XH1A 4H7VA 2WANA 2V3GA 4EANA 3F5KA 3AIRA 2V3EA 3KWXA 4FMVA 4LX4A 2NSXA 1DWGM 2WKLA 3WNKA 2OLHA 1LF1A 3A6OA 4BZYA 4MPKA 1A47A 2GDUA 2XVGA 3QR3A 3UESA 1E1FA 1E73M 1CXHA 1CENA 1HT6A 3M46A 4HMEA 2GFTA 3ZT7A 2EBNA 3ZJ6A 3PZOA 3N12A 4FLSA 4PSRA 1K9DA 1DEDA 1ESWA 5I3DA 5EFFA 1LG1A 4D72A 1H4PA 1OGBA 1E4LA 4IM4A 3VX1A 2QHAA 2AOSA 1UG6A 1HP4A 4PSPA 1K9EA 2WB5A 4R5EA 4D6GA 3T0BA 1OSEA 2WYSA 3K1DA 2ZXAA 1W2PA 4TTGA 1W2VA 3ZJ7A 1V0NA 4H8UA 4PCTA 2PC8A 4UZSA 3SCRA 1QNPA 1ZBCA 4FF5A 4PEEA 3EDKA 4HU0A 2C8NA 1KGUA 2AAAA 2BY2A 3F5LA 2VR5A 5A8OA 3NUKA 5F7UA 4UQBA 4B16A 2YDSA 1IV8A 4WF7A 4ZEPA 1JL8A 4A3YA 4TXEA 1EQPA 2G3MA 3BMVA 5GNXA 3VGGA 4AWEA 2J75A 3M7SA 2WMGA 3TTQA 5ABGA 4LYQA 1CLXA 5E0FA 3VIHA 3A4XA 4JZ5A 4UFIA 5BWFA 3CGTA 1U30A 1B90A 2OYKA 6CGTA 2DSUA 2JALA 1UR2A 1X6NA 4U33A 4P7NA 3BMWA 3PTMA 1OGSA 1X6LA 3CHCA 4W86A 3S6TA 3VIOA 4Z2KA 1VFMA 3U7BA 1H49A 1UZ4A 2WPGA 2XWEA 5DT7A 4U3AA 4B15A 2DH3A 1GUVA 1EO5A 3CO4A 4J3WA 1B3XA 3AOFA 3VIIA 1B3YA 3SUSA 4KRTA 1TE1A 4BF7A 1UQZA 1SMAA 1W3KA 4H8HA 4UCFA 5A6BD 1PIGA 4L4OA 3WDHA 1JXKA 3K8KA 3ALFA 3OZPA 5IFTA 2WK2A 2JF7A 2DH2A 3EMZA 1ODZA 2CESA 4AYSA 1OD0A 5DEZA 4CUCA 4QFUA 2XFRA 1UD8A 1U2YA 1UH4A 3OGRA 1VEPA 1BSIA 2WZEA 5HPCA 4W7VA 1CLVA 3UEQA 2WCGA 3CUGA 1SYTA 4ATLA 1M7XA 5EMYA 2PWHA 5CGTA 1CYGA 3SCSA 4HP5A 1JF6A 1OINA 3ARRA 1RPKA 1UKTA 3WD4A 2ZXBA 2CITA 2V5DA 4MADA 5I2UA 2XSAA 4QAWA 3L4YA 1HL9A 3T2QA 3W25A 4JL1A 1W9XA 1FOBA 1XSKA 2CEQA 4UTFA 5BXPA 2ZICA 4W5ZA 2YL6A 4F79A 4W88A 3II1A 2BS9A 4JIEA 2DQXA 1NH6A 1ITXA 1IZJA 4P7OA 5A8MA 1E55A 3OLDA 2WVVA 3T09A 1VBRA 7A3HA 4DWSD 1VEOA 1C7SA 3WELA 3K4AA 1WDRA 4U3CA 1HXJA 1V6WA 1J0IA 3CUHA 2EPKX 2WMIA 4AZ6A 1OB0A 5JBDA 4QCFA 5LA1A 1JZ2A 3AROA 1CGTA 3SCNA 3OG2A 2DT3A 4M56A 4Z2HA 2ZX6A 1UD3A 1OIFA 3G6LA 4HMDA 1BGAA 1DWFM 1QBAA 2WHJA 2J7DA 4ML4A 4D6EA 3MKKA 1KGWA 4R27A 4WLCA 4AZIA 1PBGA 3SUVA 4LPCA 2EQDA 1QNOA 3L4WA 4KGJA 1GHRA 4J3VA 1RP9A 2G3IA 4CKQA 1JAEA 1R85A 4W87A 4XUYA 4Z2GA 3SIMA 2D0GA 2Z1KA 3ZOAA 3W24A 3MSDA 4MNLA 3ZSTA 1E6XM 4W7WA 1EOMA 1H5VA 2YA1A 5D8WA 1PX3A 5M5DA 1V3KA 2WHKA 3WQ6A 2XM1A 5AYIA 4OBSA 3N1AA 1W32A 2J7HA 3CPUA 2WWDA 1WNOA 4M81A 1EHNA 3GYCA 4GPNA 4AZGA 1D2KA 2GJRA 1JXJA 4P8VA 2D24A 3MUZ1 3WL0A 1UOKA 2IUZA 2WLYA 1MFUA 3FY1A 1JZ4A 3L2MA 1GQKA 2ZUVA 3BSGA 4P7LA 1TFVA 4CVUA 1UD6A 5A94A 2WBGA 1JZ8A 2YDRA 3EDEA 1FHDA 3WMBA 1H11A 2YBUA 2CBIA 3AIQA 2W91A 1MWOA 5E70A 3UR7A 4B9ZA 1JZ5A 3SEPA 3CHFA 3VGDA 1V3JA 1V6YA 1SFSA 1CGYA 4AD4A 1J0YA 2FDMA 3ZT6A 2J25A 4GI9A 4PMOA 1KXHA 1PZ3A 5CQ1A 2WMFA 4AIEA 3RJXA 3BLKA 3WBEA 3VM5A 1M03A 3WNNA 2VJXA 1J11A 4MTVA 5CPQA 3GXIA 4ZENA 2J79A 4QCEA 1KB3A 1V0MA 3B9AA 4HPHA 5BCAA 2VZVA 1OCQA 1CXEA 8CGTA 4J28A 4PCSA 2ESCA 3FW6A 3ECQA 5I5RA 3WF3A 1XYFA 1ZJAA 2J74A 1YHTA 3QOMA 3PHAA 1JGIA 1HJSA 3T0DA 1BG4A 1XSJA 4Z2JA 2BY1A 1ECEA 4C7GA 1BAGA 1WAWA 3W26A 2VRJA 3ZSSA 2D23A 3AXXA 2J7GA 2VVNA 1ITCA 3WEZA 3ZO9A 4DWSC 4NZCA 1BYDA 2FH6A 2E9MA 2NT1A 1V6XA 4F66A 1UWIA 2GK1B 1CGVA 5HDRA 3RM9A 1CBGA 3ARVA 4AISA
chains in the Genus database with same CATH superfamily
3N25A 3NL3A 1MEIA 1EZ2A 3BAWA 3OW1A 4Q8MA 3SJ3A 4NF7A 2CFFA 2TPSA 3RR1A 1XIIA 1OJXA 4R7JA 1WDDA 1SZEA 4H2CA 1IXOA 4OZOA 2C13A 2VVSA 3HMJG 1XJBA 1Q85A 3WFZA 3TQ0A 3ARSA 3VGEA 2G8ZA 3MC5A 4ZR8A 4UNKA 2VXNA 1AODA 2I5QA 3L65A 3W2LA 3FA3A 3H53A 3CU2A 4IGSA 5ABHA 2DDXA 4MM1A 1ZTVA 2F2KA 1U33A 2CLIA 1JGMA 4TOQA 2CCRA 3MVTA 2VCCA 2GSEA 3KOYA 1QPNA 5LNUA 3CBWA 4R7WA 3F4CA 1S3HA 3NGJA 2ZIDA 3B9NA 1KBKA 4H19A 3MU7A 4ACYA 3RPDA 3LS9A 4L4MA 3MDUA 4XAZA 2PI6A 1SO4A 4HCLA 4YMZA 2FGLA 5CG0A 2Y70A 2JIEA 2OO0A 3AHZA 3UZWA 1YPFA 4IG2B 3QGAC 3EWZA 1ZFJA 2W79A 4QLLA 3E9AA 1VCGA 2DQWA 5CCZA 2QUUA 4JKKA 3OLIA 4PTDA 3CIXA 2VRQA 5CGMA 4G1KA 2NV2A 2XIQA 2Z6IA 1N55A 4MNKA 1UWSA 3H2NA 2P3EA 2ZA2A 4CD7A 1TZ9A 3NDYA 1OFBA 4I6KA 3W29A 2Z2UA 3FVMA 1UUOA 1WDQA 1CECA 1GVRA 2PLMA 2Z1VA 5CSSA 4WY0F 3U2CA 3NDOA 4ACZB 3WQPA 4NX0A 1KQZA 4MFEA 3BCDA 1ISYA 3STPA 1I0BA 3B40A 2CXGA 2PUZA 3G1VA 2B7OA 3NZPA 1X7IA 3TWAA 1Q3NA 5FL0A 3ZT5A 2J6XA 5K7JA 3L0GA 4HMCA 3LTYA 2XINA 2OQYA 3S5OA 3EPOA 3WLMA 1G4TA 1OD8A 3V16A 3N2BA 5REQB 4XD3A 1WO2A 3DDMA 4HSHA 2BXYA 2X1SA 4U2YA 1SQ7A 3GIYA 1AVAA 3EPNA 1UBSA 3LXAA 5I07A 4C7DA 1R5YA 1K8ZA 2YL8A 2OKTA 5EMJA 1XGDA 3N9KA 4DJEC 2ZUMA 4Q8WA 3LQGA 3W84A 3B0PA 3W76A 4BF9A 3QSTA 4LXFA 5TNVA 3ITTA 4P8UA 3TFCA 4CCEA 1I8JA 4L1XA 1E4MM 4F8XA 3MUAA 3DFNA 2IKJA 3NAVA 1FWNA 2CNCA 5H6HA 4B90A 4JIRA 4C60A 1GVYA 2IPGA 2QVNA 4XBSA 4CCZA 5H8PA 5D8ZA 1DJQA 4IH3A 1PV8A 2QMKA 3MKCA 4W4QA 5F2IA 4JR5A 5GJNA 3LLFA 4JTAA 6A3HA 4JTJA 1XIHA 5G4EA 4HPGA 1ICSA 1A49A 1F8MA 3R0DA 1LJYA 1TIMA 4D1JA 1M7PA 4ORMA 3M5ZA 4YYFA 1OCJA 2QCMA 4WDTA 3SUTA 7ODCA 4IOTA 1X96A 5GJPA 4W8BA 2ZUNA 4HU8A 1RHCA 3TEVA 3W2JA 2EPNA 3W7OA 2BVYA 2P8CA 2O92A 3F4NA 5A1AA 3EYPA 4H3DA 2PP1A 4B5XA 1R3TA 3IVUA 4JYEA 3B05A 4NJJA 3B8IA 1Y0EA 2QW5A 3UZZA 3UG5A 3LG3A 2QT3A 4XZWA 1YKWA 2FTWA 3T0AA 3CQ0A 4RE4A 5LA2A 2G96A 2AQWA 1ZBWA 3QPYA 3OJGA 4QGCA 2Y7FA 2I5IA 3W6MA 3UR2A 5DN1A 2B81A 1XDLA 3COTA 4X0VA 4YN5A 1Z3NA 3WENA 2YLAA 1RXOB 2ZCGA 3QEZA 2VI0A 2X40A 2GGGA 3V0TA 3IJIA 3CLMA 3INPA 3AICA 3M0MA 4GD0A 2Q3OA 2WSPA 3PG9A 4F2BA 2FPYA 4J1OA 1CIUA 4AXKA 2OSXA 4QR6A 1HW6A 1G0CA 4DO6A 3DENA 5MKGA 5FESA 3LHVA 1KA9F 4GIEA 1GOMA 3SGZA 5HR6A 2XN2A 2ZYFA 4MWAD 3QKZA 3WDJA 2YCJA 2GJPA 1UJPA 1HVXA 4JIPA 2PAJA 4NY2A 1PWMA 1KRMA 4L61A 2OGJA 4C6JA 4JTTA 1SJBA 3GAYA 4NHVA 2DZUA 2QZRA 2GJXA 3NXFA 4QX4A 1FCVA 3LNMA 3IJ6A 2YL5A 1JYXA 1T5AA 2OWXA 3YPIA 1OT1A 4QJ1A 3GG0A 4OHQA 5LA0A 1GJUA 1MI3A 4HNTA 1ISZA 4L6HA 1KRAC 2VX6A 3I4KA 3UGVA 2Z2AA 1EX1A 3T6CA 3PB0A 4E4FA 1V02A 1JCLA 1O94A 3AYVA 2QCFA 5F2MA 1OFRA 3G0SA 1IT0A 1X1NA 3EWDA 4HA3A 1W3HA 2ZOXA 3MPGA 3SI9A 4FAMA 2P8BA 2Q09A 3T4WA 1BYCA 1TV3A 4EKJA 2VCBA 2Q71A 1PUDA 3OHIA 4UNIA 4ERGA 1PTGA 2P53A 4DWSA 3ZVHB 1IEXA 3USZA 4NSBA 1NDYA 4DUVA 4FK9A 3W28A 7XIMA 1CEOA 3PZIA 3VIJA 3W72A 1Y5WA 4BI7A 2YCIX 3K2GA 1VFUA 1EJXC 1E43A 3RLUA 4DBEA 2DZTA 1AZ1A 4NXSA 3P81A 5C2GA 3BGJA 3EA3A 2HNEA 4HA1A 4LBRA 4MKNA 3H4WA 4HJWA 3QM3A 4A3UA 1OGGA 1UWUA 2GJXB 4OIFA 5HWMA 3C2YA 2D3NA 3AMLA 3UXDA 1V79A 3KOFA 5AHFA 3W2NA 3DU0A 3W75A 4HCHA 1KKOA 2DVTA 5DANA 1BLIA 3LRLA 3N15A 3KLLA 4ENLA 1HJQA 3GXFA 3PPGA 1BTMA 2RDXA 1CB7B 1WKFA 2F9RA 4BJHA 2NX9A 1DJNA 2CZVA 1BWKA 4ZSUA 4YYCA 5A6KA 1L6YA 1XBZA 3JUGA 3RCMA 3HMCA 4R7OA 4K1WA 3W23A 4IIEA 2VEIA 3W07A 4MNMA 2X7WA 2WAGA 1DHKA 4Q8NA 4HTYA 5HMFA 3ITVA 1CNVA 3KL3A 1V3HA 2NLYA 2GUYA 2MUCA 3WD0A 1FUYA 1QPQA 3MMDA 1YQ2A 2I57A 4RZBA 5D37A 3KCJA 3N2TA 2QCLA 3B3DA 4PZVA 4K2SA 1EOKA 1QW7A 3HU7A 1KWGA 1FHLA 1TIWA 1XLAA 4ICCX 5E1QA 4IFRA 2IPJA 2ZX7A 3WEOA 1BF2A 3N18A 2PD5A 3B8SA 1HO4A 1K6AA 3G18A 4GGBA 1X6UA 1XQLA 3TH6A 1EKOA 5E6YA 5AC6A 4JYDA 1HIZA 1GKQA 2VOTA 4GIYA 1Q6OA 3RK8A 3BICA 4HNOA 4I5RA 1H3GA 3A5FA 5CPNA 3SDOA 2OTDA 3L4TA 3NPWA 1QO2A 5A6JA 5A8NA 5TD4A 3HG3A 1Q7QA 3NQMA 4FPSA 1W8GA 4MY1A 3BO9A 4XKYB 5BXTA 4B3LA 4ZQPA 2WNWA 2QGHA 3FXGA 1GPFA 1I45A 2OX1A 2Z1WA 1UP2A 3MS8A 3CZGA 9XIMA 2DT2A 3IJQA 3QW3A 3ARZA 4J5NA 1H0GA 1SFTA 3WF1A 1P0NA 2BXVA 2WZIA 4XG1A 1KW1A 1CXIA 2ZZ4A 3BAXA 3NDZA 2GVLA 3RFAA 4G8TA 4UWMA 5E6ZA 5GQBA 5K9DA 3W1LA 1KFWA 1XKYA 2ZUTA 2XHYA 3H8AA 3LI0A 2C16A 1PWLA 5DMNA 1JDAA 1G4EA 2G3JA 2XPKA 6XIAA 3W38A 1KR0A 3WH8A 1TYGA 4JCLA 2IMRA 3WUFA 4W85A 5D9MA 4P7RA 5G5IA 3VVGA 1M04A 3H12A 3QY6A 2HXUA 3PZTA 3EX3A 3ZFHA 3W82A 3TR9A 3GUGA 3AAMA 4QE5A 1CXFA 2BWGA 4X9SA 4IL0A 3T07A 4H4IA 1BVWA 1VIZA 4WDXA 1UBPC 5C8BB 5IRPA 1QT1A 2QJJA 3NCOA 4LT9A 3CC1A 3AMKA 4H9MA 3HFYA 3WFAA 2WM1A 3GC2A 1XCXA 3QVQA 4OOZA 3S2JA 5A6MA 4RLIA 2X05A 1Q6FA 4GISA 3O63A 2WCAA 1KXVA 3TR2A 1X97A 4GINA 2V5JA 5HMSA 4E6MA 3NTYA 3WSUA 3HGRA 2GUBA 3CMFA 1P5BA 4IUOA 1EEPA 3WY1A 4B5TA 3CQHA 2V69A 2B7PA 1EP1A 3NQVA 3RILA 1XUZA 1EA9C 1EC8A 3G1XA 4X3ZA 5JH1A 1GQNA 4RXFA 5A2AA 1UHVA 1K8XA 1LLOA 3B0VC 3D6NA 3B4YA 4A29A 1FCUA 1NSJA 3LSBA 1AL8A 3AHVA 3HJEA 5I0DA 3Q4DA 1MEHA 2PBOA 1TELA 1CGUA 2VZOA 2P88A 3WL1A 3QQ0A 4M24A 1TTIA 2E8ZA 4MG4A 3KVJA 2D20A 2B7NA 4JTEA 1A53A 2YW3A 2OT0A 2PEVA 3TNOA 1EHAA 2XYLA 1TUFA 2FH8A 1SR0A 3GZAA 4US5A 4GUGA 1TREA 4J35A 4MSSA 1FDJA 4Q6XA 4HCDA 2W4XA 5HUPA 5FF2A 3CZKA 1W5QA 1FP9A 2H3BA 1FWAC 2TSYA 4BR1A 2P0OA 1BFNA 1SUXA 1M65A 7TAAA 3LGDA 4UMAA 2HV5A 1XXXA 4PMZA 4FOUA 4U5KA 3WH7A 4NX5A 1M7JA 1XCWA 1I75A 2PWVA 3WK2A 4MZYA 2Y85A 1Z89A 5HNRA 4FLRA 3WD1A 4MYAA 4FR6A 4GFSA 1HUVA 3LGGA 1DYSA 2DW6A 1WKYA 3NPVA 1MDRA 4QM1A 1L0PA 2BOEX 3MP3A 3LD5A 4PL2A 3IJLA 4LV9A 1R2RA 3SY5A 3TA9A 2V5BA 2C15A 2OSWA 3LI1A 1AFSA 2CW6A 1NFBA 3FJNA 4MZ8A 1QW9A 5D2TA 3WNMA 3TA6A 2FIQA 3U57A 4ZE4A 1OFOA 4PTNA 3CJPA 2WNNA 2O56A 5AKQA 1FWSA 1S46A 3C52A 3J7HA 3ALGA 2WZTA 1WZMA 5DELA 1KCLA 3MP5A 2ZKMX 4FXJA 3G3DA 2UZ9A 5FI8A 1IWBA 2NZLA 1GOKA 5BWAA 1A3WA 3QHNA 4OBRA 2QDGA 3G3MA 3B0UX 4FF7A 1G67A 2GSJA 2G50A 1F3EA 2V9DA 3VDBA 1WPCA 1MZHA 1C90A 3SN0A 4DJFD 3M0HA 3BC9A 3DOPA 3NQCA 3M07A 4C6KA 1XFBA 2CWXA 3QV6A 4MVAA 1TCDA 2HTMA 1FXQA 5BXRA 1N82A 4HHHA 1EIXA 4ADSA 2WC4A 3I7SA 2GJNA 1W3NA 5FCZA 4JTCA 4GI4A 3UG8A 2WNZA 4WUIA 3NPUA 4HT3A 3G1HA 2W92A 1X7FA 3HG2A 3N9RA 3EX4A 3D0CA 5AVHA 2P50A 4LAOA 4NRRA 1HVQA 3B8DA 4Z1AA 4B91A 4H2HA 4B4HA 2HWGA 2WSRA 4HYWA 2PWFA 3IVSA 5AHLA 2POZA 4M1RA 1BWLA 1TPUA 2ZUUA 2A1YA 4F0SA 2EJAA 3GDKA 4ZE5A 1QTWA 3WUBA 2OEKA 3OA5A 4JFSA 5C71A 1JUKA 3MUY1 3S1XA 5I00A 1GT8A 3V5OA 3UJ2A 1JRCA 2DT1A 2TYSA 3EEZA 1PE1A 1S5WA 5AYZA 1T96A 1FCQA 3CUZA 3ONCA 1E3XA 5EBAA 1XLDA 4W5UA 3LHTA 1Q6GA 2D2OA 4LBSA 4C1KA 5KMYA 1GNXA 2J66A 2O0TA 1W1IE 3MI6A 3S6OA 3O6YX 1YEYA 3UPBA 2E1DA 3C3NA 2YXXA 2DP3A 3TOPA 2ZRVA 1BG9A 3F7JA 4S3EA 2ZADA 1KC7A 1KBLA 5I6SA 4UTWA 2Q01A 1JAKA 1B2YA 2PGFA 4BQ3A 4X63A 4PUEA 3FHQA 3BAJA 3LPPA 5HNTA 4GY1A 4KWOA 3OYXA 3DESA 3WQ8A 3W1PA 2ZC8A 1DL3A 1BYAA 1LBLA 3S1UA 4IX2A 2NW0A 5FJPA 4RX0A 3VNZA 1J01A 3S2LA 3WLKX 3VOIA 3BH4A 2ZZ5A 3ABQA 3CAQA 2NT0A 1QRQA 3N73A 3SECA 1QCWA 3LB0A 3LTPA 3W27A 3JRKA 5HK4A 1HF6A 1QHZA 2ZQ0A 1FVPA 4RL3A 3UPWA 3MY9A 3CZEA 4IFOA 4K36A 4PUUA 1H62A 3H6OA 4PRTA 4RDVA 4MDOA 3CUJA 3TTOA 3JZUA 2QCHA 1FWDC 1UD5A 1V4YA 2MNRA 3APGA 2I56A 3GZ3A 2GK1A 3M5VA 1FQ0A 4GWEA 2WQDA 3OQEA 1HJUA 3OBKA 1QNVA 4KRZA 2OYMA 1VJIA 4DYKA 3S0CA 5C2CA 2ZZ1A 3CZ8A 5JIWA 3PY2A 3PK7A 1S1RA 3GXDA 1UD2A 4FEZA 4Y8EA 1QPRA 1DWHM 5F4SA 5HBFA 1VRDA 4IG2A 2XVLA 4M6PA 4C6IA 3UFYA 2YXOA 5HJXA 3UETA 2VUYA 8XIAA 4QSFA 1I2PA 1EDQA 3VKAA 2NQ9A 1XIDA 4S3CA 2FGZA 3T40A 1OK4A 3PBMA 4JTUA 3R10A 4DB7A 2NUWA 1VZWA 4PULA 1TVNA 3TXZA 4QJ3B 3VILA 5AHIA 3ZJ8A 1GZJA 2PZNA 2RGMA 3VCNA 4XZLX 3RRXA 4PUMA 3AMDA 3AC0A 3ARWA 3C6CA 3S6DA 4WHBA 2Z7GA 1WP6A 3O15A 4PR4A 1T8QA 1AA1B 3WKZA 1UZHA 3ZJKA 3IK4A 1SO3A 1OX6A 3MDWA 1MEWA 1TJ0A 4IF2A 3TP4A 3QV9A 3PBWA 2J77A 3RM8A 5B80A 3N3MA 1G6CA 1FWJC 4O1AA 2Q8XA 2ZDSA 3H2MA 4Z1CA 3VD3A 5A3HA 3EOEA 1QNSA 1NWUA 1AQMA 4IJCA 3L4XA 3NO1A 3S8HA 3MBFA 1IXPA 3T0CA 2DFAA 3BLIA 4MLRA 1PIIA 4Z1DA 4QEEA 2IKIA 3UZ5A 1E6ZA 4NZJA 3KZPA 5A6BA 1JZ6A 5GNYA 3GTHA 5ECVA 1Z32X 3QKEA 1RD6A 4AF0B 3VMNA 2ZRZA 3WNOA 5D33A 1C92A 3RF9A 3FJ6A 4JD4A 1W5OA 1JDEA 4W9TA 5FIPA 3BAKA 3FCPA 1XLBA 3WG6A 4LC8A 1E9IA 1QOXA 2WXDM 4UQCA 3TQPA 1R87A 4BWLA 1EB3A 1O7AA 5XINA 1Q63A 4AU0A 1XH2A 4GX9A 1MXGA 4EE9A 3LCIA 4DZ5A 2FTPA 1JNEA 5A2CA 3MANA 3IIPA 3TYDA 3ISIX 1YRRA 3QPEA 1PB0A 1EYEA 3C86A 5IOBA 3VNDA 1S2VA 4KEUA 2CXEA 1A4MA 1IXQA 5I3GA 1W31A 2X30A 1AW2A 4KT2A 4HK7A 3QR3A 4LW7A 3ZWTA 1E73M 2GVJA 3CK5A 1GYMA 1RBAA 1CENA 3M46A 3MO7A 2YCLB 3K4WA 5LSMA 1X8CA 4FLSA 1W54A 5C0QA 1K9DA 3HPZA 3W88A 5C5YA 1OGBA 3UBPC 3KTCA 1EZWA 3H7VA 1UG6A 4GCXA 4ZODA 1N2VA 3PF3A 3T0BA 3ITCA 4M7TA 2HS8A 2VEPA 1F73A 4TTGA 1V0NA 4H8UA 2PC8A 2BZNA 1ZSXA 1KM6A 1ZBCA 4FF5A 3MZNA 4BI5A 4PEEA 4H6EA 4HU0A 1RCOB 2C8NA 1OF6A 2AAAA 3F5LA 2VR5A 3NUKA 1JRBA 5F7UA 4AYGA 2X1RA 4JQ3A 2ADAA 3P61A 4TXEA 2ISVA 5EL1A 2OOFA 5BOFA 1VKFA 1ZJIA 3L5MA 3VGGA 4YVPA 2WJFA 3TCSA 1M5WA 5C9XA 1S1PA 1AD1A 4EPDC 1ZENA 1OEPA 4JZ5A 3E49A 3F2DA 1HKVA 5FSDC 1XG3A 3LCFA 1B90A 2QIWA 1OVDA 2DSUA 1UR2A 4U33A 3F4WA 4P7NA 4HK5A 1OC5A 1OGSA 2ZVIA 3VE7A 3E0VA 4R34A 5HMDA 4Q4RA 4L5ZA 4CQ9A 5DT7A 2V2HA 1OQFA 1GUVA 3N3TA 4HBKA 2OOGA 1X1ZA 3E0FA 4WEVX 3SUSA 4O8AA 4KRTA 2QUNA 1XQKA 4NIRA 7REQB 4GRSA 3EAUA 3TW9A 2YZRA 1XLLA 3WDHA 1JXKA 3K8KA 3ALFA 3EMZA 4GNJA 2C3ZA 3R79A 1K02A 4CUCA 1Q7MA 1UMLA 1IE7C 2VFHA 3EXSA 1CLVA 3HQNA 2WCGA 3UEQA 1VGAA 2PDXA 1OF8A 3Q58A 3TUUA 3E0WA 4HNUA 3DUGA 5EMYA 2CLFA 1SPQA 4MWAA 1ZQ5A 4IMFA 5CGTA 4O28A 4F2UA 4AFYA 4HP5A 1U1UA 1OINA 3UF9A 4EX4A 3N6JA 1FBAA 2ZXBA 4REQB 4CQBA 1Z8AA 4WDWA 3L4YA 1IGWA 1HL9A 3W25A 3EWYA 2ZTJA 4JL1A 1D9EA 4MHBA 4W88A 3II1A 5CGQA 4JIEA 3RYSA 3GC4A 4X60A 1NH6A 2H9AB 1ITXA 4HSOA 4P7OA 4NNBA 5CPMA 2C91A 4NJGA 2E1WA 3ATYA 3DG7A 1OFDA 4NZ4A 5MKGB 1JVNA 4DWSD 3A13A 3ZZ1A 3LM7A 2GQ3A 1IGSA 3GHTA 3MCOA 3RAOA 3P8JA 2QR6A 2DU2A 3BLOA 3AWOA 2IPFA 2WMIA 4AZ6A 5K9XA 3TZNA 1XDMA 3UD6A 1I2NA 4C6BA 1N7KA 3N2MA 3LXCA 3OG2A 1KD0A 3VKDA 1OIFA 4LAUA 3UNDA 3S9ZA 1DWFM 4ML4A 2J7DA 3MKKA 4GX8A 4K7VA 4KEVA 4PE8A 3PC0A 3RGTA 1XINA 1LWIA 2UBPC 3P5ZA 4AZIA 3SUVA 1OCBA 2EQDA 1RA5A 4KGJA 4B3ZA 4J3VA 2QQ6A 4L9ZA 5AHMA 3A21A 2GQ9A 2G3IA 3ANUA 1JAEA 1R85A 4FNQA 4F0LA 4LVGA 1M1BA 4ZB5A 3ZOAA 4RDZA 1XLIA 4Y2WA 4W7WA 3EEGA 2PTWA 3WCZA 1H5VA 3MHGA 4GVIA 1TO3A 5HJLA 4GYFA 3HPAA 5AYIA 3CPUA 3M0KA 1AD4A 3UXKA 1TWDA 1EHNA 2FPTA 2WSYA 3VOGA 1V5XA 1LYXA 1JCXA 3BG3A 3HM7A 4P8VA 3QW4B 1SZGA 1UOKA 2FKPA 2VGFA 1PTAA 3O05A 3BSGA 2RAGA 3U4AA 2IW0A 4AWTA 4CVUA 2WBGA 1OG6A 3WMBA 4YU1A 3V4BA 4I5XA 3C0JA 3IGSA 3AIQA 1MWOA 4ZBCA 1JZ5A 3W87A 3PBUA 1SFSA 2VWSA 1CGYA 2J25A 4PMOA 1A4LA 4IJRA 2OGYA 3RJXA 4UTIA 3LBMA 3QYQA 3UVAA 3L68A 5T26A 3PULA 4HPHA 5BCAA 3M6YA 3DGRA 1CXEA 4PCSA 1FWRA 2ZVRA 2I5GA 4RE0A 2Z1XA 3RUBL 3HBLA 2OELA 5F1UA 1J4EA 1XSJA 2ZA1A 3KBNA 4KERA 1ECEA 4ROPA 2XH7A 4Z2JA 3TDFA 5LIUX 3W26A 1P0DA 3O0FA 2QUTA 3ZSSA 1LRNA 4XSMA 3WQEA 2J7GA 3HFTA 1EJVC 4JQ1A 3WEZA 4LSBA 3KFTA 3V36A 1F6KA 4KWWA 5D38A 1I2QA 2FH6A 3EWBX 4XBKA 3H55A 1CBGA 3ARVA 4AISA 2VYOA 1EL3A 3SURA 4J3SA 1OM0A 2GWGA 1KM3A 4XV0A 1YNYA 1KRCC 3TTEA 4O10A 1V0LA 3FSTA 3QV7A 4AD5A 2A7RA 1C8YA 3A4AA 3REQA 3W22A 4FLOA 2ZWZA 5K3VA 1MDLA 5J5DA 1R9YA 3WH6A 3HQPA 2BVWA 2PP3A 4LVDA 3GM8A 3BAYA 4DI9A 1RY8A 3NWRA 4I7WA 2KZHA 5CG7A 1BGGA 1PO9A 1KTNA 1RR2A 4FALA 4HVXA 1Q6DA 3AIVA 3SCPA 4YTUA 4AX6A 2EG8A 4G7FA 1H09A 3W7EA 3R4IA 4H9YA 3DI1A 1GKPA 5GNZA 4XZNX 2RGLA 4NJKA 3U48A 4WIWA 2BBFA 2VWTA 3W1XA 2DUXA 5HJYA 2PGEA 5C9RA 2X0SA 4XAFA 2TMDA 3BW4A 3O07A 2WV8A 5D09A 1XRFA 2A7PA 2GVGA 2DY3A 1W1A1 2OCZA 2QAPA 2Z29A 3CO8A 4LS1A 4BI6A 1DTNA 1XLCA 3BLDA 5CPTA 1JZ7A 3FOKA 3CAVA 2ACQA 5JMUA 1OT2A 1Z9AA 2GOKA 1D8WA 4DRSA 3OLGA 1U1JA 4JFVA 3PZ9A 3SRDA 3AIEA 4AZCB 3UR8A 2W0UA 4PUJA 3AMCA 1SM9A 2E68A 4XZIA 1R3SA 3XINA 3GRIA 4MIMA 4AVNA 5RUBA 2F61A 2C1IA 2PWEA 4JIQA 3PWIA 3VIMA 4KWUA 3C0QA 1R3RA 5D05A 2V3FA 4X9YA 1S5MA 3T08A 1BKHA 4XIMA 4B3KA 4Q4OA 3AHXA 4LQ1A 3W01A 3QTPA 1Q2SA 1J0JA 1W3IA 2XIIA 3NO5A 2D69A 3GVGA 2CPUA 2DZXA 3SFWA 3I6TA 4I9TA 2ACRA 2NSOA 5A2BA 3OBEA 1PL9A 3UGRA 5EFDA 4EWJA 1KBBA 1EA0A 6REQA 4TQTA 3PAOA 1W9DM 3SUUA 4GYKA 4ZZ9A 3CPRA 3FX4A 4MFDA 3VXGA 2FFIA 2V68A 6ENLA 3C8FA 4D71A 1R86A 3OBAA 4N0RA 3TC3A 3KEHA 5ABFB 3THQA 3HG4A 3AS3A 5ECUA 1QR7A 3DYMA 1GOQA 3O6CA 1H7OA 2PDWA 2ZRXA 4ZFCA 3M0IA 3ZS4A 3OVPA 2VT0A 3POHA 4Y9OA 1PYMA 1O5QA 1HZYA 4N4QA 5EGRA 2IQ0A 3VNYA 3LHZA 1QO5A 1H7NA 3UT0A 2OSYA 4IICA 2WBKA 3VK5A 3QZEA 1HKWA 3VNJA 2RFGA 4M19A 2E5BA 4XD4A 3SGGA 3GXNA 2A79A 4FNSA 3U6WA 1ISXA 1FWWA 3QQWA 3LNPA 4KFOA 1IR1A 4LFYA 4AB4A 4ZB0A 4HA0A 4CQAA 2Z26A 5JBFA 4YHGA 1XF0A 4TX9A 3WN6A 1EQCA 1ECQA 2E09A 1E6RA 4EF8A 4BS0A 4FB7A 5LIWX 4Z0SA 3UP8A 1XYMA 3S2CA 4O16A 4PBGA 4DJDA 1K77A 3GBDA 4KWSA 5AN7A 1MXSA 4E8DA 3CAWA 5HQLA 3KBWA 1GWJA 5FD0A 5C2XA 3L21A 2Y4SA 3VOHA 4IP7A 1Q4WA 1PKMA 5ABTA 3RJYA 4TR9A 4DUXA 3RNDA 1D7KA 4H6RA 4YCOA 2WM0A 4HHPA 3U9IA 2CZDA 3GNRA 2O7QA 4QNEA 4KS0A 4D9PA 2JBMA 3N4AA 4RNIA 1SJDA 4YWIA 2Y0FA 3NG3A 3M5XA 3SSZA 4J2MA 4I9AA 1KQYA 1HX0A 1JDFA 4WKAA 2PDUA 3V0UA 1XRTA 2BOGX 2Z28A 3HV8A 4S3GA 2XN1A 4M51A 2XM2A 2QJGA 4NASA 3BZJA 3FAXA 2EG7A 2PBGA 1X1OA 3PJWA 4OWGA 2GGHA 3VNMA 4QAIA 4HSNA 2AL2A 2C1GA 4IP5A 4WSHA 4H6KA 2C0AA 3BLFA 4RE3A 3FN9A 3BZGA 5LNVA 2VRKA 3W1MA 3ME3A 1O5KA 2C0HA 2CERA 4UTUA 2XZ7A 3KE0A 2J13A 3I3DA 4MDPA 1XRSA 3AXMA 4Z2IA 1LG2A 4LGXA 1XIJA 1QHPA 3TSDA 3AISA 3EX2A 3QBUA 2O9RA 1JPMA 1K4HA 3L4ZA 4GBUA 3NQBA 4GFIA 3OP2A 1Z7AA 1I60A 1DP0A 3LOTA 1JD9A 1B30A 4PA8A 4IQDA 2BDQA 3GH4A 4KWVA 4M80A 2D2GA 1MW1A 4REQA 4JPGA 1E15A 1REQA 3IPWA 1RV8A 4UFLA 4EP8C 2D0HA 3NIYA 4LUTB 4O52A 4Y9MA 3IAPA 3NZGA 1KFJA 1R7OA 4OBTA 1RCXB 2FDSA 4ADTA 3RPTA 4JIIX 3T0TA 2XUCA 4PODA 5FAJA 2WKJA 3WJSA 1Q6EA 2WSKA 8TIMA 2VC9A 2AQOA 3GDLA 1XYCA 1J96A 2G3NA 1C29A 3AJ7A 3SZ8A 4GH1A 3RG6A 1NVMA 3AU6A 3LZ3A 4LUYA 1T8XA 3WNPA 3EXTA 4UQDA 2R82A 4NAEA 4J7RA 3G24A 3EDJA 1U83A 4C1LA 3CXOA 4JDYA 4DWDA 1G69A 1ZBKA 2GQ8A 1DVJA 4N42A 1WKEA 1TQJA 1TTJA 4IMDA 5LIXX 3G5EA 1QWKA 5LXEA 2WKGA 4RZ6A 1QVBA 4JDBA 1E9YB 2X2YA 3ERPA 5I3JA 2PU1A 1G4SA 5I24A 3GY1A 2CWNA 1RY0A 1VFSA 1OX5A 3WF2A 3CHEA 1WB0A 3W7DA 2QUVA 5ABFA 3AS0A 2XIJA 1ONRA 4N9BA 1F6YA 2VFIA 5M17A 3OU8A 4HNVA 1T41A 3UJEA 1E1EA 1IR2A 1NDZA 3V1HA 2W66A 4LWWA 4NZ5A 2VD9A 2VC5A 4JAWA 4A35A 1DQXA 1TG7A 2PDPA 3A12A 4PBFA 4D8AA 5EMLA 3JR2A 4E2OA 3W37A 3IJ8A 3M47A 1ME9A 3THUA 3QC0A 1ISVA 1M41A 1XD1A 3A3WA 2QYGA 2W63A 1B54A 3GSMA 5IHSA 4Q33A 1EDGA 2O9PA 2Z00A 1RUSA 3OZMA 2HROA 2INEA 4BKNA 4TIMA 3S1VA 3GG1A 1YE4A 5G1MA 3ABRA 1CPUA 5HXMA 2XN0A 3I6RA 3VZYA 1HQTA 4A4AA 3NA8A 5A69A 1B1YA 3H70A 4N6EA 4DELA 4R85A 2X42A 1K8CA 3T78A 4HN4A 3CZJA 4FSAA 5T91A 4Q7BA 4Z08A 5BZAA 1I1XA 2OT1A 1JFHA 4K8GA 3BE7A 3L12A 3WF0A 3KBJA 1UH3A 3VIFA 4O50A 3TSBA 4LH8A 4Q8OA 1T6MA 5D04C 3MSGA 3TYCA 1CT5A 3CNYA 2INZA 2FB2A 3CZLA 1MFVA 4Q8VA 3CS2A 3GDRA 3P60A 2YYTA 3EMCA 3T42A 4JTKA 1KV5A 3SN4A 4Q4MA 3MI2A 2VGGA 3BJFA 4M6QA 2WJDA 3E74A 4GH3A 4O8RA 2PDYA 1QW8A 1TV5A 1UQYA 3BDKA 4NNAA 3PZQA 5DO8A 1E0VA 2HK1A 4UMBA 1VRXA 4S23A 1S5VA 3AUJA 4LUSB 4F2TA 4PBEA 4XIAA 3T8QA 4AHPA 1A5UA 3I65A 1TSIA 3SUWA 3AI0A 4IGNA 3SY1A 1J18A 4PN2A 4AD2A 1Z42A 1ZP3A 4AMCA 4KIEA 4GZJA 2E9BA 3QOKA 3EKGA 2DZVA 4H7CA 4QSHA 3K8LA 2DZBA 5E0CA 4KIRA 3EA1A 4K7YA 3V35A 1OG0A 2OO6A 1FFQA 2E5CA 2WNQA 4JTQA 3K4DA 3ZR5A 2OQLA 1J2BA 1K7FA 1Q6CA 4DPPA 5A8QA 3KP0A 3LCLA 1HO1A 2PTXA 5FEZA 1VFHA 2J6VA 3H2AA 3QLLA 3W83A 5AC7A 2Y61A 3DG6A 1W1B1 2C7FA 4GVFA 4A22A 2Z25A 3THDA 1EXPA 1TPFA 1N8IA 4MKVA 1B4KA 1RJPA 2R6OA 4E3TA 4Y8FA 3B8WA 3KCLA 4RDYA 3W1QA 4YPJA 4ZSTA 4MJ4A 1G01A 3O2LA 4LU0A 4RKAA 4I8YA 2Z7KA 4E0CA 4EVZA 1YTDA 5C55A 3N29A 1ZU8A 1GK8A 2W67A 1JF5A 1LLWA 3PP7A 2GYIA 3GFXA 3FHAA 1V3MA 4C6FA 2OKOA 4JL2A 2CIPA 2YL9A 4E5TA 3NZ1A 1MUWA 1NP0A 4GJ1A 2CYGA 3MYPA 3F2BA 1TVPA 2NWSA 5AOUA 4ASTA 4XAPA 2HE8A 2VNCA 1ONXA 3OVQA 3BURA 1W5MA 1GTEA 3VFLA 4OTKA 4UB9A 4EOUA 2R1MA 3PUEA 3ARPA 1NM9A 2OX4A 2W6RA 4CVWA 3LY0A 3NO3A 2DZPA 2V5LA 4C6NA 4CGTA 4QG8A 3NQGA 3CUXA 1D3HA 3M16A 3PN8A 4AXNA 1IT7A 3NPXA 1FH9A 1HJVA 4LUTA 3CUIA 2ON3A 5HANA 1MO0A 4FXFA 2Z1BA 3Q45A 4RCXA 2A3AA 4RJEA 3OVGA 1D3CA 4K6AA 3WLNA 3AYSA 4Q8QA 4KESA 1AQHA 5EA9A 1NOUA 5JH2A 3VD9A 1H1NA 3I7RA 3TONA 5D9NA 3KX6A 3NEVA 3GXTA 2OZTA 4IISA 3W70A 4IIHA 1E51A 4AF0A 1F3TA 2VENA 4ROQA 3G1YA 4H04A 2OYLA 3GVWA 2GVYA 3OHMB 1VJSA 1NF7A 2P1FA 3LCHA 4EXQA 1DIOA 4MUZA 1EWEA 3OQ8A 1UR1A 4GYPC 3UJSA 2WW5A 3GHUA 1Y7VA 4LTSA 2NQ5A 6REQB 2MANA 2DEPA 1E56A 4AQLA 1XSIA 3GS6A 1S2AA 1LBFA 4R3UA 3NR0A 5D9PA 3BGGA 3HPFA 3WH5A 1TV2A 1P1XA 4MJZA 3N04A 1XM3A 4WSKA 3NL2A 1EPXA 1NIUA 2XDFA 3W71A 1DIEA 3CWOX 3MJMA 3G1DA 1XS2A 4XAYA 4H6QA 1Q13A 2ATSA 1VFFA 4ZO8A 4A8LA 3KHDA 4BFAA 3Q67A 5AYXA 5CJ5A 2QDEA 2YCLA 3G0UA 3PBGA 4G5DA 1VEMA 2JKEA 4C6CA 4GZEA 3VGFA 5DRIA 2E8YA 1OK6A 4AZCA 7CGTA 2QAFA 3ZMRA 3RM4A 3KCOA 1QMLA 4JY8A 3U2OA 1ME7A 4XTDA 3CWHA 3IJDA 4S3KA 4XUGA 5FKYA 2FVKA 2WZHA 2Y1HA 1N8WA 3V7PA 3L0NA 3WEMA 1K70A 1H2JA 3GBEA 2J9YA 2B0MA 5EYWA 2DZSA 1XX1A 3KZSA 1EH9A 3KL5A 4GK8A 5LGXA 3GDMA 5BMXA 4TVCA 3WQOA 4Q4PA 4Y9NA 4YIWA 2W61A 2V8ZA 3QLDA 5D2WA 4HYVA 5TQLA 3DFTA 1GZ1A 2H9AA 1GONA 3SQSA 1M53A 5EBUA 2XVNA 2NX3A 4AD3A 4AWSA 3IWPA 1ZS2A 1UP3A 2G5WA 1IEQA 4OGZA 4DLFA 4WSJA 1E0TA 1JCTA 1TPH1 2F6KA 1YADA 4QS5A 3U5YA 2E6AA 4IL2A 3N2XA 3W1NA 4US6A 1J10A 3TCEA 1BSLA 3BV4A 2XTKA 1KXQA 5EMMA 1LTDA 4GABA 1WX0A 2Z27A 4CN1A 3FFSA 3FEQA 1FH8A 2XJ7A 2BVDA 1XHGA 3PZUA 2GWNA 1JIBA 3W7CA 3NFUA 3P2VA 3R5EA 1JQVA 1EJSC 1EYWA 3N11A 1ISWA 3KUMA 3SADA 3UU0A 1Q8JA 3BAIA 3C8NA 4ALDA 3CUFA 3DHPA 3A4JA 4YJ5A 3MKVA 4J3TA 1B31A 5CKSA 1WZLA 4LV4A 5I3IA 1NFGA 1WAUA 5I03A 2IXUA 1CCWB 5BXSA 2FVLA 3GH5A 4F40A 3MYOA 3PS7A 4EXBA 1XDJA 4YTSA 1UR8A 4TU1A 2YB1A 1PCKA 4CD6A 4IIDA 2AMGA 5AC5A 1RD5A 4GNKB 4N9DA 2OWWA 3HGSA 3KVKA 1LWJA 2PDIA 3GDBA 4ATWA 4FS9A 4L56A 1I1WA 3M0ZA 1RVKA 3KP1A 1B9ZA 3SRKA 3HJZA 2V0TA 1ZBVA 4DF2A 3DG3A 4HPXA 1DPMA 3E0LA 4JN7A 3FXYA 1VHNA 1EC9A 4CD5A 3RIKA 3D5HA 3APYA 1XLHA 1F6PA 3LTSA 4IX0A 5DQPA 3V5CA 3C2EA 3UR5A 1FY6A 1TJRA 3FGCA 3VPLA 2PTYA 1NWTA 1J0HA 6XIMA 2EG6A 4F4RA 3OA3A 4OOUA 5HUOA 1KGXA 4JN8A 3NNTA 4K3ZA 4YL2A 2ZZ7A 3G77A 3E3HA 4D6CA 2WCSA 1MMFA 1S2UA 1A5NC 5A6SA 1ICPA 2Y5EA 3DFHA 3MI3A 5DY3A 3VDHA 1RLDA 4GQRA 2ZUWA 2DIJA 3P67A 2KAUC 3TTYA 1XIEA 1HKJA 3ARYA 2PPGA 1GQLA 4X22A 4D6HA 2ZX8A 4HMNA 4PMXA 5LHFA 3RLVA 1GW9A 4FIRA 3MZ2A 2NQZA 2CHOA 4IIGA 1REQB 3MSYA 3RN6A 1A0DA 1ZALA 1KM2A 7ENLA 4N4PA 3S4TA 5H1WA 3CMGA 3N6QA 3OGSA 4FX8A 4LRSA 5HPOA 3M0YA 1QDSA 4AIUA 1YTKA 1TQXA 3FYOA 1NDWA 1DV7A 4GCAA 1YLVA 4S3JA 4IFKA 1O66A 1TB3A 2VDIA 3FDGA 4IZGA 4UZUA 1YDYA 3V5FA 1F9CA 4MAZA 4UFKA 2O9OA 4OVXA 3CMJA 1YW1A 3LENA 1ZZMA 4DBUA 1ML1A 4JIHA 2BGQA 4LYRA 3MMUA 3C2RA 3LUTA 1KBIA 4IFKB 2OZ0A 2W9MA 4ACZA 3G8EA 2E3ZA 2PB1A 1F76A 2DVUA 2REQA 2EPOA 1ZAHA 3TTSA 3WDRA 3IANA 3G8RA 1H5YA 2XIMA 5LIYX 2A3EA 3VM7A 4PRRA 1K3UA 3P8IA 4TMCA 1F4AA 4TV5A 4E8CA 1EJRC 3MO4A 3K30A 5KITA 1EJ7L 3UXAA 4QHRA 1DORA 1LOLA 2QVHA 2RDWA 2RHGA 1JI2A 5AVNA 2HK0A 3BOFA 2YBVA 1HFBA 3OIXA 4WJEA 5BRQA 2JKAA 2WQPA 3WNLA 4C7FA 1YXCA 1AH4A 3Q2DA 1IHIA 1WXYA 2V3GA 4EANA 3F5KA 1XBXA 3LBCA 4BY3A 1AW1A 4GY0A 2WKLA 3WNKA 4Q4SA 3LXBA 3A6OA 4BZYA 4N6FA 4MPKA 3REQB 5DRCA 1ZCCA 5DMLA 1N8FA 1HT6A 4E2BA 4DO7A 1IZCA 1UB3A 3URBA 1DEDA 1ESWA 1LG1A 4D72A 1DJIA 1UJQA 5D2YA 1H4PA 1DKWA 3VX1A 1MSSA 3LDVA 3RHGA 3AWNA 3N6HA 1RJQA 2HS6A 1HP4A 4LNCA 4PSPA 3TX9A 4R5EA 3NYZA 1IIGA 3NQ2A 1OSEA 2WYSA 3K1DA 3LCXA 2Y88A 2ZXAA 4U28A 1K4GA 4FZIA 3WLJA 3SCRA 2EGZA 4RNFA 3EDKA 1R0MA 1I4NA 2J27A 4XQ6A 3OEXA 2YDSA 3S5ZA 3HQOA 3BMVA 4NT0A 4C6LA 4QQUA 1R3VA 4AWEA 1M68A 3PNUA 3TTQA 1WKDA 4LYQA 3S9YA 1CLXA 2FPVA 3A4XA 4C6EA 4UFIA 3WLPA 2A3LA 2A7NA 6CGTA 4LB3A 2NLIA 2Z0IA 3W7IA 3IACA 4I7VA 4W86A 3CHCA 4JNYA 4DBSA 3VIOA 3TW6A 3TN3A 5CH9A 4E4UA 1YBQB 1DOSA 1EO5A 3IUHA 4C91A 3LEPA 2P3ZA 3VUSA 4G2DA 1ONWA 3KRBA 1O5XA 4PEKA 3WZ0E 4BF7A 1UQZA 1SMAA 2RKXA 4AY7A 2NVDA 2E7FA 1PIGA 3PWGA 1Q6QA 2GDQA 3QTGA 4R88A 3TN5A 3VZXA 2JF7A 1PKYA 3R13A 1GPWA 1ODZA 4HU4A 2CESA 1OD0A 3SW6A 1UD8A 5CC6A 4JQ4A 3OGRA 4KCUA 4ZQCA 3W7QA 5FSEC 1VEPA 2P10A 2AGKA 4W7VA 1VBJA 2I7GA 5L6UA 1QK0A 3DKLA 2P76A 4LS0A 1XW8A 1SYTA 1ZUAX 2XH2A 4C90A 1ADSA 1JF6A 4Y90A 3MMTA 1UKTA 4AMAA 3ICJA 3BG5A 3O7UA 3N19B 4ICNA 1YXDA 5I2UA 3OPSA 5G2IA 3FYPA 3P0WA 1LLZA 1XYLA 2EPHA 3WLTA 2ANUA 4RV3A 1FOBA 4KPLA 4DQWA 2YL6A 3UWVA 1A5KC 4R9OA 3MVIA 3SSJA 1IZJA 4B4FA 1VR6A 3FA4A 3T09A 3HURA 1VBRA 3N4FA 2H8XA 2ISSA 5T9CE 4PL1A 1AL7A 1DJXA 3FKKA 3K4AA 3TJXA 4L6DA 2FVMA 1HXJA 4XVDA 5REQA 2C6QA 3CUHA 1IQ8A 3GTFA 1MUMA 4QBXA 1PZ0A 4EXAA 3Q37A 3VAVA 3KVMA 1ZHAA 4Z2HA 3V1PA 3KXQA 1LRQA 1FDZA 1FWEC 3UZYA 5CZJA 2WHJA 4S2BA 2HPIA 3GW3A 5AZ0A 1QJWA 2A6LA 3NXLA 4R27A 3RCYA 5C6MA 3E5BA 1QNOA 4L1GA 4MWAC 1GHRA 5EU9A 1BQGA 5E5CA 1DJGA 1WYIA 1A5OC 2AKZA 3LLXA 2PRLA 3NQDA 2R1NA 4CLMA 3LGEA 4FX6M 4QG9A 2ASHA 1RJRA 3SGUA 1EOMA 2I1OA 4HHLA 2YA1A 1R9ZA 5M5DA 2WHKA 2DW7A 1S5TA 4H9TA 3BJSA 3WQ6A 1W32A 2WWDA 4JQAA 1WNOA 3FIGA 4M81A 4GUHA 3GYCA 4AZGA 4H9XA 2CLMA 1D2KA 3Q94A 2GJRA 3S83A 3MUZ1 3WL0A 2IUZA 2WLYA 3FY1A 4LS2A 1JZ4A 1KTBA 3SN1A 3GLCA 3BL3A 4OE7A 4J2PA 1TPB1 3EDEA 1AMKA 2CU0A 3S5SA 4F3HA 1Q2RA 3UR7A 4YTTA 3GKAA 3SEPA 3CHFA 5KTLA 2FDMA 3ZT6A 4NP7A 5C9UA 1WXZA 1KXHA 1PZ3A 1NAL1 1ONEA 4FX7A 3BLKA 3WBEA 3VM5A 4LVFA 1M03A 3W7JA 4NILA 4MTVA 5CPQA 3GXIA 1Z6KA 4ZENA 3W02A 1ZY9A 2J9XA 2J79A 5AECA 3VOJA 2DJLA 3B9AA 1ZNNA 2ACSA 2VZVA 3W9ZA 1OCQA 8CGTA 3GR4A 2ESCA 5JVLA 3WK1A 2Y7GA 3ECQA 4O0ZA 3WF3A 1D8CA 3R8GA 3FJ4A 1POKA 1YHTA 3QOMA 1YPIA 3PHAA 4DIAA 1HJSA 1OHLA 1NDVA 1XYAA 3N14A 5TF0A 2L5HA 4XZ9A 1QWGA 2R8WA 4JEJA 2PU0A 5C7HA 1A5CA 3QR0A 4AAJA 3AXXA 1R38A 1Z44A 3QFEA 4NYUA 1UPPA 1S2CA 1BYDA 1B9BA 2Y63A 1ZJHA 1P48A 2E9MA 2A6NA 1V6XA 1UWIA 4NZ1A 5LNWA 1CGVA 1KFBA 4US5D 4MY8A 5I3FA 1L6GA 3TN6A 2A3BA 3TOYA 3LERA 3L2IA 3PZVA 1E6SM 3B97A 1GW1A 3EOLA 3BLLA 3B8VA 3GU1A 4KFPA 3VKKA 1W9PA 1EF2A 2VEFA 4O1DA 1XYBA 1LL4A 1O12A 4GIRA 3WBXA 1W1PA 5HA7A 4LBUA 4PMNA 3L66A 5E0KA 2IS7A 3OO2A 3B8TA 1OYAA 1WOBA 2V2DA 3OLEA 4IPIA 4CNNA 1LWHA 3VTRA 4AD1A 1TWIA 4WJ8A 4TV6A 2V5KA 3I3EA 1EF3A 1C3FA 4DWSB 3CIVA 3KW3A 3QMRA 4NG3A 1QBBA 2YFOA 2DZAA 4M8UA 4HKPA 4LF1A 4MPQA 2I9EA 4QRNA 4S2CA 4NI3A 1O4UA 1OCNA 4L7ZA 4UIOA 3OIHA 2R91A 4F0MA 5HAOA 3ENLA 4G7EB 2IKGA 1CZ1A 3O6DA 2J8GA 3ITLA 2NVAA 2WHMA 4UQEA 4B5SA 1QASA 3F1QA 3VCRA 3TMLA 2WVSA 3STCA 4V1XA 3UWEA 1XG4A 2D2JA 1TR9A 3AHYA 2DZWA 2HQAA 3C61A 1EJUC 2ZZ6A 1OADA 4PRWA 1I2RA 3WQVA 3CEUA 3BLPX 3L7RA 1AH0A 1ALDA 3VKJA 4Q7NA 4CQDA 3AIWA 4CQCA 1PS9A 2E6FA 3FEMA 3ELFA 5TBOA 3PG8A 1TWZA 2HSAA 3U7VA 3DHUA 2A2IA 1A5AA 2G95A 3TW7A 2BV9A 3HGOA 3VINA 4GQQA 1RBOB 4RNJA 1V7YA 4RPPA 4XD6A 4DUWA 3O06A 4BK9A 1F61A 3WMSA 3BCJA 2EO7A 2OEJA 1YBQA 2BODX 1JYNA 4DM2A 4DXVA 3DECA 1UASA 2OR2A 4KCWA 4DLMA 3M1ZA 1LL6A 5LYRA 4UR8A 1H41A 1Y5VA 4J40A 4HN8A 1VS1A 4PB4A 3FS2A 3N17A 4EPBC 1U5HA 2VCAA 1XGZA 3PBYA 1F3XA 3A64A 3A9BA 5EMUA 2FZNA 2CLEA 3VD4A 3WJZA 1R3QA 1A0CA 4RZ5A 1GVOA 3T2OA 2VX7A 1JCNA 1LM1A 4RK8A 4EPKA 2FHFA 4ZQOA 4DX3A 3ARUA 4IXXA 1W8SA 3MHFA 1TV7A 3LU2A 3PBVA 3UWZA 2D3LA 3F2CA 1AZ2A 3WYZA 4I3GA 3PM6A 1U5VA 3HTWA 5ABEA 3B8UA 1AMYA 4H9UA 2WWCA 3B9EA 3AIUA 2VZUA 4B9YA 1BVNP 5IHRA 3ES7A 2ZX9A 5BOOA 2QCNA 1GOWA 5EPDA 3TU9A 1ZB5A 1H63A 2ATMA 2NUYA 2B31A 4D6JA 1S2TA 3L0KA 4FIQA 1UR4A 4FNRA 4X61A 1MVYA 4CU7A 2O9TA 1O95A 4HZ7A 1QFEA 1MNSA 1TRDA 3A3HA 1W3LA 3CYVA 4QLJA 1RCQA 1TA3B 2QMJA 1QU4A 2XIBA 4PUNA 4FXRA 3P3BA 2OLAA 1NQKA 4IXHA 2C79A 1XCFA 2VX4A 3LA4A 2E0PA 1GYLA 4DAIA 4NAFB 4RPQA 4DM1A 4D8ZA 5I23A 4RZ4A 3B03A 3AUOA 4OFCA 1G94A 2QS8A 1YMYA 3P62A 4JFUA 1R47A 2YA0A 3RMEA 4MAVA 1K03A 3M5YA 4Q32A 4UC5A 4CNSA 1V3IA 3LMZA 2PS2A 4Q6JA 4CCCA 2RDUA 3VKBA 2PA6A 2DPEA 1NTHA 4H41A 4AG0A 1A5MC 2VFDA 3ORWA 1KFEA 3B06A 5SWUA 4I90A 2PDGA 5DX7A 2WMJA 1TWWA 3KAOA 2YJQA 2OZ3A 5IDIA 1DJHA 3S2NA 1VLIA 2D22A 4H8NA 4E8GA 1HP5A 5M1TA 5C7VA 1VBGA 3W1TA 4NU7A 4ZOAA 4UNLA 2XU2A 4QS6A 4FNTA 4AZBA 4FO4A 2DSVA 3ZLGA 4GO8A 4ERIA 4A3RA 3DH7A 5EB8A 5EMKA 2OWCA 5CJMA 3G1AA 2ZRYA 1QK2A 4HNNA 4WQ6A 2YR1A 1E71M 3W7NA 3P84A 5CLWA 2UY3A 3VABA 5PTDA 3AO0A 3W1UA 1FHUA 4UTLA 1B3OA 3PAJA 2LLEA 3GE7A 1GORA 4ZTYA 1TV8A 1QOPA 8A3HA 4KFNA 2ICSA 5CPOA 3S47A 2EPMX 3C2OA 3T1GA 3SJNA 4BQ2A 1E6PA 4JQ2A 4AH7A 3R12A 1J79A 3GTIA 4LC6A 4E38A 3W2MA 1L2UA 2BNJA 3TC6A 1UA7A 3K8MA 4AIOA 3MV01 4D6DA 3BANA 1TJPA 1QAPA 3IIXA 4DF1A 3CV1A 1DE5A 3LQLA 4WJXA 3EPMA 4HOZA 2OEMA 4UR9A 4ZQRA 3AQUA 3FVDA 4U31A 4IPLA 3PTDA 4HZ6A 1IZKA 4WR3A 1QOQA 4YTRA 4DZIA 1ITUA 4GBDA 4UTTA 3QRHA 3RX4A 4F9JA 3TN4A 4CN4A 4LVAA 1OFEA 5I3KA 2CBVA 2Y8KA 4UBPC 5KINA 4HPNA 4H83A 2CKRA 1C9DA 1BQCA 1CGWA 1W91A 4G9PA 2QCGA 1DQWA 2DORA 1X38A 1OIMA 3BLEA 3M43A 4JNMA 4H9VA 1QI3A 2DSZA 1L6WA 2NV9A 1I2OA 2VMFA 3IJ9A 3H7RA 3ZWSA 1XFCA 1J9YA 1JUEA 4GVHA 2UY2A 5AYBA 4IQLA 3WJXA 4WGHA 2V67A 3I4EA 3WUGA 3CH9A 3AZSA 2XH0A 2QKFA 4Q4KA 4S38A 5FOOA 2PDCA 3UJFA 3UY7A 3VDGA 3GK0A 1EXBA 1MQRA 2CKSA 2WHLA 3QY7A 2VELA 4GE8A 3AZRA 1GOOA 4L65A 3VDCA 5F2GA 3K5XA 4U10A 3TQVA 1OABA 1UWRA 4R53A 2DIEA 2OFJA 4UQ9A 3GU2A 3W6LA 4NVTA 2ZE3A 3LV6A 4F0RA 5AFDA 4PYSA 1CB2A 3PWAA 3OZOA 5G4WA 1E4IA 3L4VA 3IIZA 4DXKA 5C54A 1SZFA 4A3HA 1G9HA 2GUUA 6TAAA 1BYBA 1VYSX 4RW3A 1UR3M 1ZAJA 5HINA 1CXKA 1UZ1A 1VLWA 4PMQA 1LZOA 3VD7A 2FLIA 4OV4A 5I77A 5DFAA 2WVTA 4H1ZA 1UR0A 3VZZA 4A3QA 1SW3A 4K8HA 2CZ5A 2GLKA 1LT8A 1Q6LA 5C9WA 2DT0A 3BUVA 1M01A 1BRLB 4F9DA 3FJLA 3DXIA 3VGBA 4L9XA 4L6OA 2Q3RA 2PDHA 3ABZA 1KTCA 3TYEA 3RPMA 1WBHA 2OODA 2WMIB 2PDJA 4IJBA 4CEUC 4CEXC 3IVTA 4LAKA 4IQJA 4DJED 4AZ5A 1XGEA 4LJ3A 2BASA 1XL9A 3VX0A 2CLPA 3SQMA 3WO8A 3O6AA 2ZBTA 5DY2A 1I9CB 1W56A 1W3JA 3U2EA 5E09A 1A80A 1GJWA 1GG1A 4GJIA 3WIJA 3BQ5A 3LYEA 4LCRA 7TIMA 5CSYA 1VENA 3TLQA 4QDWA 1F07A 1P4CA 4AVFA 4ZXOA 2A0NA 3CQIA 4CCDA 1O1HA 3R8RA 4GIAA 3MB9A 1GVIA 4MB4A 4DBWA 5IDZA 3S5NA 4UOQA 2PLJA 2PFHA 3CL7A 2IPWA 4INFA 2AKMA 3F03K 1TA3A 3FK4A 4LF2A 2OPJA 3WUEA 2VC6A 3SR7A 1IEIA 2FHCA 3VE9A 3RO8A 1VB9A 1BRLA 3ABOA 4S3DA 3AU2A 3LPOA 2GPTA 1LT7A 4AD0A 2J78A 3BGAA 2ZDRA 4M6UA 1K9FA 1BHGA 1YX1A 4V33A 1FA2A 4GXPA 2P5NA 1FH7A 4MNJA 4EK7A 3NGFA 1T0OA 5IXEA 1S39A 4PB5A 2V63A 3E0IA 2YX0A 3NYDA 5CJNA 3QJAA 4KF1A 4IT1A 3BOXA 1JZ3A 1IF2A 2GJLA 3ITYA 4PMVA 1WZKA 5D32A 1SVDA 4XWUA 5HATA 2EF9A 1RSCA 2VTFA 1GHSA 3DYPA 3I3BA 4DNMA 3R6IA 1B3WA 3VYLA 1M9HA 2AL1A 4FI4A 4XKMA 3P7YA 4XO7A 3JS3A 3AJXA 3OYZA 1KR1A 1UUQA 3CM4A 4A2RA 1MRQA 4AEOA 4WDUA 1PSCA 3FA5A 3MTWA 3URAA 3ZYZA 3WD3A 2EPLX 1RH9A 2YB4A 1Y65A 3FGCB 3QR1A 4O17A 1QI4A 4JX5A 1E9ZB 2G37A 4PMDA 3H26A 4HA4A 2J7EA 4AC1X 5HNUA 2C1HA 4R9XA 1L6FA 3QQ1A 3GD6A 2JEQA 4UOJA 2DUAA 1SZRA 4KH2A 3THCA 1JEZA 3GVQA 3UG3A 2Y8UA 1C7TA 3BXWA 4GUJA 4LEFA 3I7QA 4M82A 4ONVA 4D1IA 2POTA 3KOWA 4DZAA 2V6AA 3CL8A 3DFSA 4J3XA 9XIAA 3ATZA 2VR2A 4MYXA 3G1SA 2JEPA 5CZ0A 1KFLA 3WBAA 3ABSA 4PTWA 1X8FA 1QI0A 4HOWA 4IQEA 2NQHA 5BYWA 3EWWA 2ACUA 3HIJA 4NAFA 1XC6A 1OY0A 3GFZA 4JFWA 2HNHA 1S38A 2WLZA 1IT8A 2BHYA 3C56A 3MV11 3OG3A 2Y2WA 3PR2A 4BCEA 4E3VA 3LCWA 2W5FA 5GVJA 4P8WA 5K4ZA 1C93A 3TXVA 5I78A 3R0UA 3ZQ9A 4AY8A 1FWCC 4ZVJA 5FEWA 3AFBA 1CGXA 3K46A 3WH9A 4I6VA 4UQAA 3UQNA 1BVZA 4OJYA 3BG9A 1W5PA 1TCMA 2R9RA 1QI5A 1XLFA 2BMBA 2GVEA 4TMBA 3IGHX 3VOCA 1RBLA 1JI1A 4UFMA 5A95A 3U0HA 1NF0A 1QNRA 2ALRA 2C14A 2JF6A 1TWSA 3EWUA 3MJYA 5FJJA 3N9SA 1SU5A 1KBJA 3DX5A 1UOZA 1FWBC 1TKKA 1MNZA 3THAA 1TPWA 2ONEA 2VKZG 4GO9A 1ZJBA 1PHWA 4QISA 1PTDA 2ZFAA 1ME8A 1SSDA 3GAKA 4O54A 4A8RA 4LOCA 2PWGA 4MB3A 2DVXA 1E6NA 3STGA 4XZBA 3O0KA 4LYKA 5JQ9A 3W53A 4HZMA 3PJXA 1UW9A 3VC5A 5DF0A 1UR9A 1V77A 2X0HA 3M7WA 3C2VA 3HPSA 1TVLA 3L4UA 1QPOA 2ZE0A 4YXGA 1EEXA 4JKMA 2PDQA 1LOQA 1PYFA 3CEPA 2D2HA 3W4RA 4LY4A 3NL5A 4FHAA 5TIMA 5KSWA 1JFXA 4M6VA 1C8QA 2FZMA 4XBJA 2VX5A 5IBXA 3HN3A 3ITXA 4IMEA 3VIKA 3L9CA 3MQTA 2FJKA 2PDNA