3AHYA

Crystal structure of beta-glucosidase 2 from fungus trichoderma reesei in complex with tris
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
465
structure length
465
Chain Sequence
MLPKDFQWGFATAAYQIEGAVDQDGRGPSIWDTFCAQPGKIADGSSGVTACDSYNRTAEDIALLKSLGAKSYRFSISWSRIIPEGGRGDAVNQAGIDHYVKFVDDLLDAGITPFITLFHWDLPEGLHQRYGGLLNRTEFPLDFENYARVMFRALPKVRNWITFNEPLCSAIPGYGSGTFAPGRQSTSEPWTVGHNILVAHGRAVKAYRDDFKPASGDGQIGIVLNGDFTYPWDAADPADKEAAERRLEFFTAWFADPIYLGDYPASMRKQLGDRLPTFTPEERALVHGSNDFYGMNHYTSNYIRHRSSPASADDTVGNVDVLFTNKQGNCIGPETQSPWLRPCAAGFRDFLVWISKRYGYPPIYVTENGTSIKGESDLPKEKILEDDFRVKYYNEYIRAMVTAVELDGVNVKGYFAWSLMDNFEWADGYVTRFGVTYVDYENGQKRFPKKSAKSLKPLFDELIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase
publication title Structural and functional analysis of three beta-glucosidases from bacterium Clostridium cellulovorans, fungus Trichoderma reesei and termite Neotermes koshunensis
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 187
structure length 465
sequence length 465
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ahyA00
3IJ9A 1M04A 2WWCA 4GI6A 4UZUA 2D1ZA 3WF3A 1LL7A 2CXGA 3F5KA 1IV8A 1HP5A 2AAAA 2CETA 2VR5A 3ARVA 4B3KA 1V0KA 4OOUA 4PSPA 5D9NA 1E15A 3U57A 2WANA 4CN4A 4MTVA 1W1VA 4GI9A 2VRJA 3WDRA 2W63A 3GXIA 4GIAA 1TG7A 3GXMA 2J25A 2ZUUA 2D0GA 1UR9A 4E4PA 1QI5A 1JYVA 5I79A 3VIGA 5CGMA 5I5RA 3VD5A 3N15A 1UOKA 5GPRA 1BPLB 1E5NA 3N1AA 4R27A 3VD9A 3ZIZA 5CXPA 1GVIA 3FXYA 4AZIA 1WZKA 1R86A 9CGTA 4UFIA 2CYGA 3SUUA 4CN1A 3ARZA 3NSXA 2OSXA 1H4PA 3WD2A 3G6LA 1Y7VA 1CXFA 2J74A 2O9PA 3AIQA 1W91A 3L4YA 2Z1KA 3WUBA 4H8UA 4LGXA 5BYWA 2F61A 2WK2A 4WKHA 4ATDA 4C7FA 1CXEA 4P7NA 1GJWA 4GO8A 5ECUA 4ZENA 4AEEA 2XSBA 3D3AA 3WDQA 4RE3A 1ISVA 1KWKA 2XVGA 4TOQA 4ZE5A 1EOKA 1E72M 1TUXA 2D24A 3UR7A 3ZOAA 1FH7A 5CSUA 3GH4A 1PBGA 1V3IA 4U33A 2VZTA 1KXHA 3SCSA 1JAKA 3NSMA 1HJXA 4Z2JA 2GSJA 2XJ7A 4JZ5A 4PSRA 3VNYA 2VX6A 1BVZA 3AMKA 4HPHA 3ZT5A 2BHUA 2V5DA 3GNOA 1JFHA 1WZMA 5E0FA 2J75A 3WFLA 5F7UA 3WQVA 3E1F1 5C71A 5A6JA 3GNPA 3ZJ7A 2WLYA 3MO4A 1J11A 1G9HA 2Y2WA 2CKSA 3BGAA 4LQ1A 4PCSA 3WH6A 4Z2KA 1XD0A 3VNZA 1YHTA 2FHBA 3QOKA 4OZOA 1JYXA 4MNKA 2PWEA 2YL8A 1BGGA 1CLXA 1E4MM 2DSUA 4J3TA 4BQ2A 1C8YA 4W7WA 1BAGA 1J0JA 1D3CA 2YLAA 1J01A 1GW1A 1I1WA 1V6UA 4B9YA 3WN6A 1V6XA 3CUGA 1VEPA 2E40A 3M6DA 4A3HA 1VENA 1E6XM 1CBGA 3MUY1 3NYDA 4W7VA 5A6MA 4QFUA 1UR4A 1ISYA 2J7EA 5FKYA 2WBGA 2G41A 3VIJA 1US2A 3L4VA 1JZ6A 5CLWA 4HA1A 4LXFA 3AJ7A 4AC1X 2YLLA 3EDKA 4AZCB 4UOJA 3K1DA 4CD7A 4J3SA 4D72A 5CPTA 3AS2A 3MUZ1 1TR1A 4H2CA 3CLWA 1E0WA 1ZJBA 1K9DA 2BY0A 4PUEA 5GNYA 1UG6A 4TVDA 3CZKA 5IHRA 1WB0A 3NSNA 3TONA 3NDZA 1OT1A 4A3YA 3S6TA 3BCFA 3N04A 4JHOA 3TP4A 2BXZA 3MSDA 4P7QA 2VMFA 4AD2A 1UYQA 3WF1A 5A95A 3ZT7A 4QDMA 5M3WA 3T2QA 2WNWA 3SEPA 1A47A 3W53A 4M56A 5CSYA 3AHZA 3OZPA 3VX0A 5IFTA 1GORA 4MDOA 1V6WA 3ZR5A 3TTOA 1CLVA 1PZ3A 2X0YA 4X0VA 1KB3A 4B16A 1E4IA 2J47A 5CPQA 4AZCA 4UOQA 3FNDA 5DMYA 3OB8A 4W88A 1EA9C 1R8LA 1MW0A 2D2OA 3DYMA 4FLSA 4OBRA 4TVUA 4W8BA 3AHXA 1OD8A 4D6GA 1F4HA 3VGGA 3UESA 2EBNA 4JCMA 1OGBA 1R7AA 3FW6A 4NF7A 5E6YA 1QPKA 1C90A 3VTRA 1V3KA 4ZE4A 2X05A 4KRTA 3A3HA 1HJUA 1DWJM 4JFVA 3TTQA 3M7SA 2Y24A 3CTTA 1NWTA 2FGLA 1W9VA 3WENA 4CU6A 4AWEA 3PZTA 4D6IA 5AYBA 3THCA 5BROA 4X0NA 1QHPA 2J62A 1QNQA 1I75A 1VBUA 4U2ZA 4RE4A 2E9MA 3UEQA 5CJ5A 4UFMA 2J77A 5JUVA 2IXVA 4HA4A 3T0DA 2C0HA 3FY1A 1TE1A 2Y8KA 2YIHA 2WKLA 4R5EA 3RM9A 2YJQA 4FMVA 4HP5A 1C8QA 3VGBA 3ARPA 1JG9A 2W92A 4M24A 4AZ5A 1ZBVA 1OM0A 1RH9A 1GVYA 3DHUA 1W9PA 4IPLA 1TCMA 2CHOA 1L0PA 4BZYA 4CKQA 1HL9A 5A6KA 4HA3A 3B9DA 3MUIA 1J9YA 2XIIA 3L4WA 1NWRA 3NIYA 4YN5A 2WLZA 3K46A 2ZX7A 1ZB5A 2PF0A 1X6LA 2CBVA 5C8BB 1E3ZA 1LJYA 2DT1A 4FF5A 1JD7A 2VQUA 4GI8A 2DIEA 1Q6CA 3PTQA 1WP6A 4L4PA 1KXVA 4UQBA 1ZBWA 3JUGA 2XFYA 4W7UA 1R85A 1FHLA 2ZUNA 3OGVA 5CG0A 1HF6A 5JBFA 4AD0A 3CIVA 2E8ZA 5M17A 2WMJA 1ODUA 1UH4A 3GDBA 4UQEA 3RJXA 2FDMA 3UG4A 1GPFA 4P7LA 4D6JA 4QP0A 5AC4A 1E6QM 4W5UA 1HKKA 3AIBA 1H0GA 4P8UA 1BYDA 2W5FA 3EMZA 4PBGA 1OWQA 4WKFA 2V38A 8A3HA 2DSVA 4B15A 1HIZA 4WF7A 5BRPA 1W2VA 1KGUA 1FP9A 4AYSA 3VVGA 3N9KA 1XSKA 1HJWA 1VEOA 3KL3A 1GHSA 3AS3A 4LYPA 2ZX8A 4MAVA 2D20A 3BAIA 3WKZA 1SYTA 2QPUA 2DH2A 2ZX6A 3N12A 1OINA 3GZAA 1UR2A 1UR8A 1E6ZA 5BRQA 2CBJA 2J8GA 4BS0A 3MMDA 3W28A 1W1TA 1UD4A 4GO9A 2A3BA 4S3KA 2V5CA 1FFQA 1K9FA 3WL0A 2XVKA 4M8UA 3AIVA 1UD8A 2VCBA 1QI2A 3NCOA 2CIPA 1QI4A 2J8FA 5LA2A 2BY2A 1O7AA 4N42A 1E4LA 3M46A 3AMCA 1W32A 2QF8A 1HVQA 2WYSA 1VAHA 2O92A 2QMKA 1TVPA 1W9DM 1C3FA 1W3LA 3EBVA 1UD6A 1UHVA 3KZSA 3OIHA 4MB5A 1C91A 1E40A 1W1YA 3WQ6A 2JIWA 3WH8A 4F66A 2YL5A 4J3WA 3T0BA 3AZRA 3IAPA 4YHGA 3L2LA 1JDAA 4BQ3A 3MV01 2D3LA 3A6OA 4XB3A 1VFOA 1R7OA 4DWSD 1HX0A 3VIPA 1E6RA 2CKRA 1J0IA 1EGZA 2E4TA 3AICA 5AYIA 3CUJA 3SCWA 2J4GA 1IZJA 3CZEA 3MKKA 3OGRA 1E0VA 5A94A 2UY2A 4MAZA 4NRRA 4UQCA 3I3BA 3WQ5A 1XD1A 3LPPA 5EB8A 3OZOA 3PZ9A 3ALFA 4WSJA 2J7CA 4J3VA 2J7HA 2DH3A 4P8VA 3T09A 1UD5A 2D3NA 1IZKA 1VEMA 4XZBA 3AFBA 3VDHA 3A4AA 2UY3A 2XVLA 1DEDA 4HPGA 3TTSA 2DT0A 2BNJA 1GQJA 1QNPA 2UY4A 1XYZA 1GOIA 3AXIA 3VDCA 1EDGA 2JEQA 4MJ4A 3WNLA 1PAMA 4PMRA 1FP8A 1EIBA 4D6HA 2ZXQA 1QHOA 5BXSA 3W26A 1B3YA 3RM8A 4UZSA 2DEPA 3S2CA 4CCEA 1JDDA 1JI2A 1ZBCA 1W2PA 3MUAA 1PIGA 3BAWA 3VUPA 3SCVA 3CHEA 3WMBA 1B30A 4P7RA 1J18A 4EE9A 5HNNA 3KEHA 4AMCA 1PJ9A 4AZGA 4UQ9A 2VZSA 2XWDA 3KL5A 1M53A 1B3XA 1I1XA 1JDCA 3BLPX 1VJSA 4TX6A 4LPCA 3VPLA 2GFTA 3PHAA 2XM1A 2WHJA 2CBUA 1CGVA 2D0FA 4CCCA 2EPNA 3A4XA 4QCEA 3RDKA 1V6YA 1TA3A 2C7FA 3SCQA 1MVYA 3EMCA 2RGMA 1MQPA 4M82A 2XIBA 3WNKA 1SR0A 3ZSSA 4XZWA 3DYOA 2OSWA 3AZTA 1W3KA 1ISXA 3AISA 2V3GA 5I2UA 3HMCA 3WDHA 3W24A 1NOWA 4W8AA 2BY3A 4F79A 3ALGA 1JZ2A 4J3UA 4UNIA 1HL8A 2D22A 1E73M 1E43A 3T0AA 3GBDA 5I6SA 1H5VA 1KBKA 1U2YA 1XHGA 1RPKA 2A3HA 4JAWA 5M03A 1J0ZA 1PX8A 1JF5A 1AQ0A 4F9JA 5A69A 2JEPA 1QNSA 1EHAA 1X6NA 2EPKX 5ABGA 4MJ2A 2WVSA 3VGHA 1BHGA 3VMNA 1V08A 4HTYA 3CUFA 4A4AA 5I78A 4OKDA 1JZ4A 1BG4A 2BS9A 1WDPA 5CZKA 3HU7A 3GH5A 2WCAA 2W61A 1JIBA 1CXLA 3PBGA 5JBEA 1YQ2A 2XM2A 3LMYA 3WH9A 3DC0A 3W27A 3SUWA 1K9EA 1CGYA 1B9ZA 2JFEX 2G3NA 3L4XA 3GTNA 2VI0A 2DSZA 3RCNA 4CD8A 2GUYA 4FLRA 3SCNA 2DIJA 1OT2A 4JL1A 3W4RA 3WD3A 3VINA 2VC9A 3ARRA 2WVUA 4PTWA 3AMLA 2ZUVA 1WKYA 4UFJA 3FN9A 3O2LA 1UKPA 5BXRA 5I24A 3W25A 2ZX9A 2QPSA 1KQYA 4NI3A 4U3AA 2HISA 2VNCA 3WIJA 1GUVA 1LLOA 1MXGA 4H8VA 4MB1A 3SCOA 3U5YA 3PZMA 2GDUA 2WXDM 2YDRA 2PWDA 3RJYA 2ZUTA 1ECEA 3WNMA 3GXFA 2GVYA 3DECA 1NM9A 2WHKA 4PMDA 1C7SA 3L4ZA 1JZ8A 1B31A 2X1IA 4UQDA 1NARA 1KFWA 3J7HA 1DHKA 1PZ2A 3APGA 1E1FA 4ACZA 4OBSA 4JCLA 5EMYA 4CN6A 4JFTA 1HKMA 4J7RA 2W62A 4BQ4A 1MFVA 3NJ3A 3RMEA 3IAQA 2JIEA 5JIWA 4LX4A 1CZ1A 4UFKA 2EXOA 1FFRA 4DWSA 1K6AA 5FOOA 4KH2A 1FA2A 3VMOA 1GQLA 5BXPA 1LF1A 3VKKA 3QHNA 2YA1A 1Q6DA 3MS8A 1H0IA 1JGIA 2IUZA 1BVNP 1AVAA 3MSGA 3UERA 3W37A 3VM5A 4UFHA 1UH3A 3VD7A 3GXDA 5D8ZA 4U5IA 2VURA 2E0PA 1UA7A 1DP0A 4IISA 1CYGA 1UZ4A 2WBKA 4H7VA 1H41A 2WB5A 3MMUA 1ZJAA 1OB0A 4LYRA 5CGTA 4PMXA 3RPMA 3WUEA 3NDYA 3K8MA 3SURA 2XVPA 4MB3A 4JIEA 1V3HA 5EFDA 4J3XA 3G6MA 5A2CA 2VO5A 5IHSA 4M80A 4DUVA 3M07A 3WUGA 2ESCA 2V3DA 1UKOA 2O9RA 1HVXA 1FH8A 4E8CA 3VGFA 5E70A 1BG9A 5DFAA 4CGTA 1B3WA 2YBUA 1JFXA 3ZM8A 1MW2A 1B90A 1SFSA 1VRXA 5A8QA 2E3ZA 1H1NA 2D23A 1NWSA 1UZ1A 3BAJA 4PN2A 2VZVA 6A3HA 2HVMA 3OGSA 4M81A 3OG2A 2E9LA 4TTGA 5E6ZA 1E55A 1U33A 3O9NA 4B9ZA 1DTUA 1V03A 5CQ1A 1UKSA 3PTKA 1BF2A 2VRQA 1H09A 5CLTA 2ZXAA 1ODZA 1OSEA 2J7BA 1CNVA 3K4DA 4GQRA 1MFUA 2VUYA 2B31A 4H8HA 4TUFA 1HXJA 1XSJA 3BH4A 1UWRA 5LA1A 1EOMA 3IANA 2BHYA 1V3LA 1A3HA 1W3HA 3CUHA 2ZUWA 3KL0A 1H49A 3WEMA 4DUXA 1JXKA 2WMHA 3EYPA 3RIKA 4HOWA 6CGTA 1Q6GA 1E6PA 2ZX5A 3VIMA 2QHAA 2WVTA 2YKKA 4AXNA 1TVNA 3SCTA 3CZJA 3W38A 1DWHM 3VOCA 1EDTA 4PEEA 1AQHA 1G01A 1GOMA 2TAAA 4PMYA 3GNRA 2VVNA 2NW0A 4LYQA 3A4WA 1EO5A 3WUFA 3F5LA 1MWOA 2ZIDA 3WL1A 2ZUMA 4L4OA 1XH0A 5A6BD 1WDRA 1ZL1A 2CERA 4EK7A 2JE8A 1UR1A 5GNZA 3VM7A 4D6EA 1B0IA 1ZU8A 3WNNA 4W86A 3PZVA 2ZE0A 4E8DA 3ZT6A 3ZQ9A 2VZUA 4IPNB 2EQDA 2XGBA 1TFVA 4AD4A 2XVNA 5FD0A 3KWXA 4XUYA 2NT1A 2VVSA 3AHYA 4P8WA 1MQRA 3ARWA 2WKGA 1KGWA 3CMGA 2CEQA 4KGLA 2WSPA 1M01A 1JZ5A 2YA2A 4H04A 4ATLA 2GK1A 3UCQA 5HPCA 4U5KA 4URIA 2CITA 3MANA 1UH2A 4U3CA 1GHRA 4HMCA 1C93A 2WVVB 4HMEA 3PZIA 1BFNA 2OYKA 1MYRA 1V6VA 2WWDA 3ARXA 4FK9A 4C7DA 1J0HA 3K8KA 1J12A 4Q7NA 1US3A 1R87A 4KWUA 3AS0A 3T08A 3AIWA 1CEOA 3WQ8A 1FH9A 2GJPA 3AYSA 1UKQA 1U30A 1BTCA 3AQUA 2PBOA 1JYWA 3QHOA 5I77A 3LPGA 4PMNA 3VIIA 2V3FA 3BMWA 7CGTA 2DGAA 2WMKA 2YL9A 5A2BA 4KRUA 4CCDA 1E6NA 1TZ7A 4WJXA 3TOPA 2VCAA 1V0LA 5ABFA 1GNXA 2DDXA 1E56A 3SCUA 4AZHA 3BAYA 3HN3A 4HZ6A 3K8LA 1WPCA 1PX3A 2WVVA 2VL4A 2VX4A 2YBTA 3FHQA 4AZ6A 4ACYA 4AD5A 1C92A 5BCAA 1BLIA 2QLYA 1Q4NX 5D8WA 4CVUA 3PZNA 4HZ8A 3VIFA 2O9OA 3II1A 3THDA 5DEZA 2AMGA 5HOSA 3RO8A 4C7GA 4CUCA 1UKTA 4QCFA 2W66A 1LG2A 4D6CA 2JALA 1ISWA 1UWIA 1W9BM 3FHAA 3CGTA 3CMJA 1BGAA 5IFPA 5KZ6A 3ZJ6A 4HOZA 3VX1A 3EDJA 2OSYA 3WFZA 2XYLA 4AIUA 2RGLA 1B3ZA 4V28A 2Y8VA 1VB9A 5LYRA 3UG3A 1GQKA 2X0HA 1CIUA 2J78A 2DT3A 3AIRA 2W4XA 1WE5A 3T2PA 4V27A 4GXPA 1DWGM 3CHDA 4ATWA 3UG5A 1GOOA 1QNOA 2VR4A 1JZ7A 3ZJKA 1KGXA 4PCTA 2AOSA 3ZJ8A 2XHYA 5FL1A 3BCDA 1VBRA 3OLEA 3EDDA 3QGVA 3VGDA 1V02A 1CENA 2XFFA 3LPFA 3WBAA 2XUCA 1AQMA 1QOXA 1TA3B 1MW3A 2V3EA 3U7BA 1M03A 1J0YA 3W6MA 1WCGA 1E71M 2ZWYA 4J27A 4AZ7A 2WAGA 3ZR6A 7TAAA 1NOFA 3MMWA 1KXQA 4HOXA 1HKIA 2JF6A 3WH5A 1J10A 3PZOA 4Z2HA 2PBGA 3CZGA 3ARYA 3AHVA 1VJZA 2X2YA 2VT0A 1GOWA 1E0XA 2VZOA 1G1YA 4EKJA 3AHTA 4OOZA 1JL8A 2OWCA 3W82A 4BCEA 1K9TA 2VX7A 4ZFMA 4BA0A 4JFWA 4Y7EA 1ISZA 2X09A 3AOFA 5FIPA 3POHA 4CD6A 1UWQA 2ZOXA 4Q22A 2BVTA 4B3LA 3U7VA 1KR0A 4D6FA 4E2OA 3QOMA 2FHFA 4JHZA 1CGUA 2WCGA 3DYPA 1WNOA 3WD0A 5M5DA 1E5JA 2JF7A 1UR0A 4UFLA 4AD1A 4NZCA 6TAAA 3UETA 1S46A 4MNJA 1QW8A 3AIEA 3WELA 4JFSA 4JKLA 1DWIM 3VIHA 1WAWA 3VU2A 4CD4A 1PPIA 4AIOA 5D9PA 3FAWA 1JNEA 1XCXA 2PB1A 3KE0A 1EXPA 3SIMA 2VCCA 2GDVA 1WDSA 4CVWA 4HU8A 3RM4A 4WSKA 2PWHA 4YHEA 2QMJA 1TMQA 3F5JA 3AYRA 1KBBA 4UR9A 4GZEA 2ZXDA 2NT0A 2WMIB 1WZLA 1UQZA 1CGXA 1UWUA 1WDQA 3BXWA 1XH1A 4GZIA 1HJSA 3DHPA 1UUQA 2BVYA 4MPKA 4JKMA 1L8NA 4CU7A 1E6SM 1B1YA 3F4VA 1W3JA 3CUIA 2G3MA 1QNRA 2VX5A 4UQAA 4H41A 5D9MA 5GQBA 1SMDA 3MV11 5A6SA 1NOUA 3T2OA 3WH7A 3CZ8A 1G94A 5IDIA 5DT7A 3WNOA 1QW9A 4ACZB 1UD3A 1UWTA 1UQYA 2GJXB 4QLLA 1EH9A 4F8XA 1HN1A 1NP0A 5TD4A 2FGZA 1RP8A 4MDPA 4PTMA 5DO8A 2EPMX 4DWSB 3AMGA 4RE2A 3OBAA 1E9LA 1E70M 1JXJA 5ABHA 3UR8A 3AXHA 3WY1A 4PMVA 1D2KA 4OIFA 2WMIA 1JD9A 5BWFA 1NWUA 2WC3A 2D0HA 1E4NA 1XGZA 4MB4A 3WBEA 5JIPA 1RD6A 1W9XA 5E0CA 2WPGA 3NUKA 2BFGA 2DPEA 1ITXA 5DF0A 3AXXA 4UCFA 4WLCA 4PYSA 3SUTA 5ABEA 5E9AA 1LWHA 3K4AA 4ZEPA 1BYAA 3VO0A 3N18A 1KWGA 5DT5A 2F8QA 1QBBA 2G3JA 1JZ3A 1BYBA 2WC4A 2XSAA 3FAXA 2OYLA 2GJXA 2OWXA 3BSHA 5HXMA 4MADA 2WCSA 1G0CA 3VIOA 1EQPA 4DWSC 2EEXA 4WKAA 4P8XA 1D7FA 1GQIA 4QLJA 1XV8A 2EO7A 2WHMA 3O6AA 3N13A 3RILA 5I3DA 1VF8A 1IT0A 3OLDA 4GZJA 4D1IA 2YDQA 5FL0A 1OGSA 3VD4A 4JL2A 4AIEA 1B2YA 1GOQA 4PTXA 1LWJA 2G3IA 3AROA 3TA9A 4DM2A 1X1NA 1FHDA 2IXUA 1OIFA 1HT6A 4OUEA 2J7FA 2Q8XA 1PEZA 3OLGA 5A1AA 1V3JA 2FH8A 3HJEA 4MNMA 4FLQA 1HKJA 2CHNA 2XTKA 4W5ZA 3IK2A 3B9EA 4HU0A 3L4TA 1OBAA 1LL4A 1CECA 1UA3A 1QBAA 3ZSTA 3W29A 4UTFA 1NQ6A 2ZICA 1P6WA 4K68A 4NRSA 4AZBA 3QR3A 1J0KA 3VDBA 1OIMA 2WW5A 2WMGA 2Y5EA 1H2JA 1UWSA 2BHZA 2BVDA 3VGEA 1LG1A 1H11A 2WMFA 2G8ZA 4ML4A 4OJYA 2VQTA 1BQCA 1PIFA 5HBFA 3CO4A 2OWWA 1AMYA 3GYCA 1JYNA 3LPOA 4CD5A 3SUVA 1HJVA 4KGJA 2O9TA 3SCPA 2YDSA 4QAWA 3WEZA 3EDEA 3L2MA 4AW7A 4U31A 2FHCA 1MXDA 4HMDA 1KXTA 2A3CA 1GZJA 1O6IA 3B8SA 4Z2GA 1HNYA 2W91A 1V0MA 4PMUA 4UOZA 1SMAA 2E8YA 1ZS2A 2OYMA 4TTUA 5AC5A 1W1PA 2XPKA 3VIKA 5D4YA 4W85A 3CZLA 2GK1B 1CPUA 2XWEA 3BSGA 1FOBA 4GQQA 4V2XA 3AS1A 3BC9A 3WF4A 1HP4A 3WDPP 1LQ0A 4ZXLA 1VFMA 1OGGA 1C8XA 4HZ7A 1ESWA 1JAEA 5A2AA 4Z2LA 2CESA 1CWYA 5BXTA 3AMDA 2EPOA 2XG9A 3WQWA 3MU7A 1QI3A 3GM8A 2CBIA 4AEFA 3PZGA 1JI1A 3IJ8A 1XRVA 1KCLA 1PX4A 3D5HA 4EAMA 3EMQA 4IM4A 4ZXOA 4PTVA 5A8PA 5EBAA 2Z1SA 3ARTA 4W89A 4W93A 5D9OA 1BYCA 4AD3A 3PZUA 2VOTA 4KMQA 1ZBKA 1CXKA 2EPLX 3ECQA 4XX6A 4DM1A 5GNXA 1CDGA 1XYFA 1V0NA 4TXEA 2CCRA 3W6LA 5ABFB 1M7XA 3AZSA 3IJ7A 3W0KA 2PI6A 2YA0A 4BF7A 1CGTA 1EQCA 2BY1A 5AY7A 1MQQA 3WEOA 1XCWA 2UY5A 2UWFA 3CBWA 1EDQA 5EFFA 2FH6A 2NSXA 5A8MA 2DSKA 3WMSA 4XV0A 4JFUA 1GCYA 4D6DA 4MNLA 3VD3A 1DWFM 2W67A 3U5UA 2PWGA 4N0RA 3PZQA 4BQ5A 1QHZA 2WZEA 1CXIA 2J7DA 3GBEA 1UD2A 2CPUA 2A3EA 5A8OA 2YL6A 1C7TA 2VJXA 3PN8A 3SUSA 5CPSA 3ARUA 1NP2A 3PTMA 3WD1A 2ZWZA 3BMVA 1CTNA 2EJ1A 3CHFA 4NSBA 2YOCA 1N82A 2QV4A 3WQ4A 1Q6EA 3BLKA 4RL3A 1OD0A 1JF6A 4TX8A 1XH2A 2OLHA 4F9DA 3W81A 3OA5A 4W87A 3BAKA 3AIUA 1HJQA 1KCKA 3QHMA 1XSIA 1CXHA 1EHNA 4D1JA 1NH6A 3A47A 4TVCA 2X8RA 1GOKA 2F2HA 3CHCA 4P7OA 1B3VA 2DQXA 2ZUSA 8CGTA 4YPJA 4AISA 1E1EA 1E3XA 1GJUA 3GH7A 4CU8A 5IXEA 3AI0A 1Q6FA 1V3MA 5KEZA 7A3HA 1MW1A 3ZO9A 3ZMRA 3WMCA 1XC6A 2WSKA 1VIWA 1LL6A 4PRWA 3WD4A 3WF0A 3POCA 1VFFA 1W9UA 2G4FA 3SCRA 3I3EA 3BAXA 1CGWA 3OLIA 3VMPA 3EDFA 4PMZA 1DWAM 1JNDA 2VRKA 3VILA 5A6LA 4QLKA 1G5AA 5HDRA 3B9AA 2WHLA 2WZIA 5FCZA 2PWFA 1ITCA 4EANA 1WZAA 4WIWA 2J79A 3L4UA 4GPNA 1KR1A 4FLOA 2DSWA 4PMQA 2E9BA 2DT2A 4IUGA 1VFUA 4X9YA 3I3DA 4Z2IA 3TTYA 5I0DA 2WC7A 4J28A 4DUWA 4AY1A 4U2YA 4W84A 1F4AA 4GKLA 4PUDA 1RP9A 3WNPA 4W8LA 1WO2A 2J7GA 1BSIA 2WM0A 2ZXBA 2Y4SA 3N11A 2WZHA 5JBDA 3ARQA 4D71A 3WDIA 5E09A 3CH9A 5HPOA 2XFRA 2A3AA 2XGIA 1H3GA 1QVBA 5I23A 1GONA 2VTFA 4JKKA 2BXYA 1OCQA 4M29A 3WSUA 4M1RA 1EO7A 2C8NA 1KQZA 1V02E 5A8NA 2PC8A 1QI0A 5A6BA 3VDAA 2BV9A 5LA0A 3WF2A 3WDJA 5C70A 4GINA 3N17A 4WK9A 2CNCA 3CPUA 1Z32X 3ARSA 5A6AA 2MANA 4PMOA 4S3JA 5A3HA 2GJRA
chains in the Genus database with same CATH superfamily
2QAPA 1R9YA 2EG8A 1O95A 3NQ7A 3RPDA 2PLJA 1LL7A 1HGWA 3F2BA 3U57A 3NTYA 3W88A 4WXZA 1F3XA 2R8WA 1XM3A 3BL3A 4IMDA 1W1VA 3UCCA 2WSRA 2VRJA 1UJPA 2GJLA 1TG7A 2J66A 2J25A 2FTYA 2YR1A 2ZUUA 5D33A 3EOEA 3E38A 3GTFA 1DQUA 1QDSA 1BKSA 1S2VA 3VIGA 3VD5A 1JCMP 4Q32A 3EB3A 3N1AA 2G4JA 3ITCA 5I3KA 5CXPA 1Q5MA 1ME8A 3FXYA 1FKXA 2ZVIA 1WZKA 4GI4A 3DDMA 5IBXA 2OZ0A 2CYGA 4CN1A 1OX5A 3PBMA 2DZUA 1HO1A 3TSDA 1Y7VA 2J74A 4PFHA 2JGYA 3FA4A 1VBHA 2O9PA 5FESA 3NA8A 1W91A 3QF0A 4LGXA 3U2EA 4M7SA 2PTYA 1XIIA 4P7NA 1TX2A 1GJWA 4FPSA 1OFBA 2XSBA 2F84A 1KWKA 1Y5WA 2WJDA 3M0XA 1XLBA 1Z89A 3EWZA 1UJQA 2RJGA 2OZ3A 1FH7A 4GC3A 4H6QA 1V3IA 1JAKA 4HPJA 1PTDA 2ADAA 4Z2JA 4TO8A 1BVZA 3NGJA 4HPHA 3H54A 1H51A 2RKXA 1B5TA 1PB0A 2G97A 1RY0A 3TW9A 3WFLA 1TX0A 4CQDA 1XKJA 2P8CA 1PHWA 3ZJ7A 3MO4A 2ON3A 2PDYA 3IV8A 2PTWA 1VFHA 4Z2KA 2A85A 2NXGA 1H7XA 4AG0A 2QV5A 3GC4A 4OZOA 4MNKA 2YL8A 3QZEA 4PE8A 5DRIA 4JTRA 3CQIA 1J0JA 1I2NA 3WK2A 2YLAA 4DYEA 3KOXA 1GEHA 3WN6A 2QUNA 3I6EA 1E6XM 1CBGA 2EG7A 5A6MA 1PUDA 4JXCA 5FKYA 2WBGA 4NNCA 3EKGA 2RDTA 2RDUA 1JZ6A 4JQAA 3DEQA 3O16A 3H22A 3AJ7A 4J40A 3MTWA 5C6MA 2OQHA 3QTGA 4FX6M 1SZFA 2PFHA 5LGXA 3BW4A 3AS2A 1W3IA 1DVJA 1ONEA 1SO5A 1IE7C 3UY8A 1K9DA 3JR2A 5GNYA 1DQXA 1JJKA 4JTLA 3GUGA 3S6TA 3N04A 3TP4A 5AECA 4ECLA 1UYQA 3WF1A 4WZHA 4DRSA 5C2GA 3T2QA 1EYEA 2OQLA 1A47A 4ERAA 4Q8QA 1TJ2A 3AHZA 4GNKB 3NO3A 1O1HA 3W6YA 1H7NA 3B03A 3CYVA 3TTOA 3S4TA 2O56A 4O8RA 4US5A 2YZRA 1PZ3A 1E4IA 1LBFA 4AZCA 3FNDA 1PYFA 1VFSA 5FF4A 1F6KA 1WYIA 1BD0A 1EA9C 1R8LA 2DZPA 2H3DA 2D2OA 3DYMA 1J2BA 4C1KA 3TLLA 3VOFA 3CHVA 4FXJA 4P5UA 1F8IA 1OD8A 4D6GA 3RX2A 3P60A 1F4HA 4YTSA 4JCMA 3FW6A 1QPKA 3P5YA 4ZE4A 2X05A 4RR4A 4PBEA 4JFVA 1ML1A 1SU5A 1O68A 3M7SA 4HPNA 2F6UA 1NWTA 1W9VA 2QCDA 3WENA 3PZTA 4HNTA 4ONVA 5AYBA 3BLFA 5G2WA 3H24A 2J62A 3CH0A 4GQGA 2QDHA 1S2UA 1VBUA 3PFMA 4U2ZA 5I00A 3CO8A 2E9MA 3W7PA 2J77A 4HA4A 4BWLC 2ZRYA 4CQBA 3KCLA 2C0HA 3UZ5A 2KAUC 3B97A 4L1GA 4F0SA 2NQZA 4R5EA 1YX1A 3R43A 1UP3A 2WZMA 4NYUA 1C8QA 2BG5A 2YCKX 2W92A 5HR6A 4A35A 2GGEA 1TCMA 2CHOA 2JKPA 4HA3A 1PKMA 3ORWA 4KT2A 2WLZA 1TMHA 3IVUA 5C8BB 1GKPA 1E3ZA 2Q09A 4NQ1A 2DIEA 4MYXA 3H26A 2EHHA 3O0FA 3QPEA 4IFOA 4IIDA 1KXVA 3NL6A 3GK0A 2XFYA 4W7UA 1SJCA 4Y8FA 2Y1HA 2C71A 1VFTA 5CG0A 3SIZA 3O15A 1WBJA 1HF6A 1EJUC 4UQEA 1LRNA 3RJXA 3TXVA 3UG4A 4D6JA 4QP0A 4DO6A 1FTXA 1XDJA 1W1A1 5DQPA 2C91A 3AIBA 4EXBA 4IMAA 2PDKA 4WQ6A 4MUPA 3FJ4A 5E1QA 3PWGA 4PBGA 4JTIA 5BU9A 1SFLA 3ZWSA 2ZBTA 3RFAA 2R82A 1KGUA 1T7LA 4AYSA 3VVGA 3N9KA 1HJWA 1VEOA 3VK5A 5HUOA 3KBNA 3AS3A 4MAVA 4X61A 3BAIA 3TWAA 3WKZA 1QPRA 3TMLA 2DH2A 2VDGA 3FVMA 4R53A 1KC7A 5C7HA 4O53A 1AW2A 1UR2A 3A5VA 1EZ2A 3W7RA 1UD4A 3LN3A 1FHVA 4KQNA 1O1ZA 1QPOA 1X97A 3VNLA 4KEUA 1IEWA 3NCOA 4NJKA 1IWBA 1QI4A 3ZXWA 4JIIX 3CT2A 3W1XA 2QF8A 4O4VA 2O92A 2QMKA 3UNTA 1TVPA 4PGLA 4TU1A 4R88A 1W3LA 1ZCCA 3CWHA 1UD6A 3OIHA 3KZSA 4MB5A 1C91A 2HEJA 4C65A 3WQ6A 1BVWA 4RZ5A 3AZRA 4YHGA 2HJPA 3R8GA 4CNTA 1KFKA 4XB3A 3B04A 4DWSD 3ISIX 3UJ2A 3NQCA 4H6RA 3AICA 4ZTXA 5AYIA 1LBMA 5H6HA 1S5MA 4L9XA 1XX1A 5JH1A 1E0VA 1SZEA 2UY2A 3BE7A 3WQ5A 1CI1A 5J5DA 4I5RA 2QF7A 2WSQA 5LSMA 3ALFA 5CBIA 1GOXA 3ITGA 3Q2DA 3R79A 3LQLA 2J7HA 4NT0A 4L1XA 1UD5A 3MP3A 3LLXA 1SO4A 1JDFA 3LCIA 3WLNA 1VEMA 3PPHA 4YTRA 4ZZ9A 5AVNA 2UY3A 3S83A 2XVLA 1DEDA 1G69A 3DFTA 4ENLA 3TTSA 1TKKA 1G7UA 1LQAA 1EDGA 1F05A 2G96A 4XIMA 1QATA 1EIBA 5DMLA 2PU1A 5BXSA 3HMJG 4HCLA 3W26A 3V0UA 2WJEA 1PTAA 3URQA 4DJDA 2VUNA 3BG3A 4GFSA 5AYYA 1ZBCA 1Q2SA 1W2PA 3BAWA 3EXTA 1B30A 4QQUA 4EE9A 1PJ9A 1ZCOA 4AZGA 2XWDA 3KL5A 3E0IA 1EYWA 4XO7A 1JDCA 3RAOA 3P84A 1DJNA 3TNBA 2P76A 2GFTA 2WHJA 3UYIA 1RJRA 3N25A 4DBDA 2C7FA 3BK0A 4XD3A 4HNLA 2QDEA 1LUCA 4KERA 2DU2A 3DYOA 3MUCA 2OSWA 1ISXA 3S0CA 2V3GA 3JZEA 1S2CA 1W8GA 1ZRQA 5I2UA 5IDZA 2O0TA 1NOWA 3L2IA 2BY3A 3ALGA 3H4XA 2YZ5A 3PPCA 4CQ8A 4UNIA 2VXNA 4FNPA 5HJXA 3T0AA 2OKOA 3NAVA 1KBKA 1XHGA 1LQ2A 2WZTA 4NZFA 4JAWA 3VDGA 3NZPA 3HQNA 5M03A 2X41A 4F9JA 1QNSA 1EHAA 3BZGA 3FV9A 1WKFA 3LCGA 1V08A 2WQPA 3ANUA 4QITA 2OG9A 2GGIA 4A4AA 5I78A 2FZ9A 3CV6A 3W75A 1I9CB 3GH5A 2W61A 3E5BA 2ALRA 2QCCA 2CC0A 3PBGA 4XZMX 5LZLA 3AXKA 3HGRA 1CGYA 3A3XA 2G3NA 1XRSA 3GTNA 2DSZA 1BQGA 2NV9A 3RCNA 4FLRA 1JQVA 1OYBA 2DIJA 2W79A 3ARRA 1F6PA 2WVUA 3LHZA 3VNMA 3EWYA 4RNJA 3CEPA 3AYTA 1K4GA 1WKYA 4UFJA 3FN9A 3O2LA 3PUEA 1UKPA 3QEZA 3W25A 3LUTA 3FXGA 2QPSA 2GLKA 4B2DD 4NI3A 4U3AA 3CB8A 3QW4B 3G24A 2RHGA 4R7JA 1LLOA 1MXGA 4H8VA 3WK0A 4YS1A 4LEFA 4PCFA 2FMOA 2GVYA 3CAWA 3W1MA 1NM9A 4ZO7A 4PMDA 3HFTA 4MWAC 5D37A 1JZ8A 1BRLA 4GY1A 1PV8A 2QDGA 1B9BA 1XBXA 3G22A 1OEPA 3FSUA 1UC5A 1J93A 3ES7A 1PIIA 4G6CA 3STGA 5F2LA 8XIMA 3QHNA 2QJNA 1TPWA 1Q6DA 3UWVA 1H0IA 3V4BA 3NZQA 1LLWA 5LIXX 1BVNP 1AVAA 1EFZA 3T07A 3VD7A 4MHBA 3GDRA 2ZZ2A 4U5IA 1TPEA 3UPBA 1T6MA 2HSAA 2VD8A 4XD4A 2WB5A 4NAFA 4LYRA 1DXEA 3C5QA 1HTIA 3RPMA 3BUVA 3SURA 3KTXA 1RVGA 4ZFCA 3NNTA 5AZ0A 3U4AA 4LTSA 5A2CA 4A8IA 2V5KA 3W7NA 4JQ2A 1YEYA 1MRQA 1N7KA 5IHSA 1F8MA 4IJBA 5CH9A 2ESCA 1LT7A 2P88A 4E8CA 5DFAA 4LVDA 3QC0A 3I6RA 1ME9A 1JFXA 6REQA 1AW1A 4LV4A 2ZC1A 3W70A 3P14A 1GVEA 2Z28A 4PN2A 2HVMA 3A64A 3K30A 3OG2A 3GVVA 1E55A 3CQKA 4QE4A 4HU3A 5GVJA 4Q8NA 1IEIA 4RW5A 4GQRA 4TUFA 1EOMA 2IPFA 2ZRXA 4DZ5A 1A3HA 2QDDA 2ZUWA 1H49A 2QUVA 4GCXA 2Y6ZA 1XLFA 4HOWA 4HN4A 1VR6A 1Q6GA 4RJEA 3QVQA 5TF0A 3W38A 3CZJA 3KBMA 1AQHA 4C6BA 3TLQA 1GOMA 2TAAA 4PMYA 3T7VA 3W7OA 3BGGA 3GNRA 3IPWA 4QS6A 2NQ9A 4O8AA 3A4WA 5HMFA 3DZ1A 4UTTA 1MWOA 1KCXA 2ZIDA 2VD9A 4UTIA 3LZ3A 4L4OA 1UBPC 2CERA 2G3FA 1UR1A 4D6EA 1B0IA 4CNOA 2ZE0A 3M0YA 3EOSA 4DBWA 2VEPA 2VZUA 4IPNB 1GZ1A 2VP8A 4ZMGA 2XH2A 1TFVA 4L6HA 2HWGA 2CZFA 4XUYA 3SJ3A 3SB0A 4KF1A 2H9AA 3ARWA 4ZQMA 1KGWA 5D32A 2WSPA 5H8MA 3V0SA 2GK1A 2Z25A 3DBNA 3ZLFA 2A6NA 2CITA 1Z9AA 3N6JA 1GHRA 4HMCA 4E5TA 4YU1A 4HHPA 4IP7A 4HMEA 5D05A 3PZIA 3W7CA 4GKTA 2OYKA 5HWMA 1XIBA 1UB3A 3T05A 4POCA 1XI3A 1R3TA 1J0HA 1A5SA 4YYFA 4S23A 1MMFA 3TVAA 1J12A 2V8ZA 1R87A 3PVFA 3AS0A 1YXCA 3BG5A 3WQ8A 2WM1A 3W1RA 2PTZA 5F1UA 2PDMA 1U30A 5HMSA 2PBOA 1EZWA 1XISA 3LPGA 3WQEA 3VIIA 3BMWA 2DGAA 4F2UA 1K8CA 5A2BA 4KRUA 1R9XA 5BWAA 4XZNX 1ZLPA 4LS0A 3TOPA 4EOUA 7REQA 2DDXA 3SCUA 3EOOA 3BAYA 4N4QA 3MWCA 4HZ6A 1ZZMA 1GK8A 1JCLA 3UJFA 1XLDA 2CZDA 5BCAA 3GSMA 2QLYA 2R1LA 4QHRA 3R8RA 5H8PA 3ONCA 3PZNA 3UWUA 3VIFA 3MVIA 5DEZA 1AQFA 1UKTA 1O12A 4XKMA 8XIAA 1LG2A 4D8AA 1YPXA 4D6CA 3KOFA 3RGTA 3TJXA 1LCOA 1RCQA 3RX4A 1PS9A 3CMJA 4XAPA 2NLYA 4E2BA 5IFPA 1DE5A 3W71A 3VX1A 4DI8A 3WFZA 4AIUA 2P5NA 1I60A 3CV1A 2DP3A 3T0TA 1GQKA 1V77A 3A9IA 3HJZA 1CIUA 4YMZA 1XYBA 2DT3A 3AIRA 4V27A 4HSOA 1DWGM 3O6CA 3CC1A 3ZJKA 2AOSA 3KVKA 1TCDA 5FL1A 3BCDA 3R7MA 3VGDA 2PMQA 1DJGA 2FPVA 2QJIA 3LPFA 4IX2A 3GDTA 4JGDA 1VIZA 1AQMA 1S5NA 2PGRA 3M0HA 3NOEA 5REQA 1M03A 2YFOA 3BJSA 3W6MA 1E71M 4J27A 4Z17A 1YNQA 7TAAA 4K38A 1IR2A 1KXQA 1HKIA 2Z24A 1J10A 1H60A 2PBGA 2QJMA 3CZGA 3SDOA 3S2NA 3AHVA 1VJZA 3M0VA 2VT0A 2IPGA 1GOWA 3WMLA 3RF9A 3W82A 1Q13A 1K9TA 3R4IA 4MM1A 4NJIA 4CCZA 3LI1A 4Y7EA 1ISZA 4Q22A 2BVTA 1R3SA 4B3LA 3W7HA 1KR0A 2E68A 3CL8A 4E2OA 2FHFA 2WNNA 3RU8X 4DLMA 5M5DA 3EX6A 3W7QA 4PRRA 3LS9A 3OW1A 4AD1A 4NZCA 1QJWA 2UV8G 1QPQA 2R24A 2XN1A 3NXFA 1QW8A 3PNZA 4ZOAA 3UJEA 5JMUA 4DBEA 1PPIA 4AIOA 5D9PA 3SIMA 3UWYA 1A0CA 1WDSA 4IJRA 3GNDA 4FAMA 1OC6A 3CEUA 2ZXDA 2WMIB 4FXFA 1SW7A 4WOQA 1CGXA 3LRLA 4HYWA 1PHQA 3A22A 4GZIA 4CEUC 4N9CA 2P1FA 2BVYA 1ONXA 3UWEA 3REQA 4CU7A 1UP0A 4N6FA 3R8HA 1B1YA 1FCBA 3F4VA 3RITA 1LZOA 1QNRA 2VX5A 4H41A 3MV11 1NOUA 4OGZA 2PP3A 2PDPA 4H4IA 3IUDA 2X1SA 3L5MA 3M0IA 3VKBA 2Q8ZA 3MUXA 1HN1A 1NP0A 5TD4A 4GCAA 3P74A 4Y9MA 1E9LA 6XIAA 1I8JA 4LC8A 5ABHA 7XIMA 1L2UA 4KCUA 4IIEA 4OBTA 2XN2A 3AXHA 4PMVA 1D2KA 4OIFA 1UIPA 3BV7A 3VOJA 4C1NA 4CLMA 5BWFA 1X96A 2DJLA 4IMFA 4DNHA 1W9XA 5E0CA 3NUKA 3AXXA 4WLCA 4PYSA 2DORA 1LWHA 4NYYA 4ZEPA 1BYAA 4NL1A 1EKOA 4X9SA 3P3BA 4JTAA 4NASA 3CL7A 3PG9A 5DT5A 1F73A 4AVNA 2F6XA 1IYXA 1JZ3A 3K2GA 3ICJA 1QFEA 4C6DA 2OWXA 2RDWA 5AC6A 2OOFA 4D9PA 2R6OA 4UTJA 1KTCA 3VIOA 1KM0A 6REQB 3STEA 1EQPA 1KA9F 1VBGA 3NQGA 3E2SA 2D69A 1D7FA 4QSHA 1UBSA 3RILA 4BF9A 4MG4A 3OLDA 2GOKA 4GZJA 5FL0A 2AAMA 5FJOA 1OGSA 3PY2A 1B2YA 3DFQA 1BXCA 5CCZA 3VI2A 1LWJA 4I7WA 3TA9A 1X1NA 3RCYA 1PWLA 1Z69A 2WNZA 3VZZA 1O5XA 3OLGA 3FCPA 1U83A 2G50A 4FLQA 2QZRA 2XTKA 4XKYA 1THFD 3O06A 1OBAA 2Z1WA 5CBJA 3NPUA 3LI0A 1CECA 3ZSTA 1IQ8A 5U4NA 2FZNA 3VFCA 4L61A 3VDBA 1OIMA 2WMGA 1SZNA 1H11A 2G8ZA 5DY2A 4HYVA 4ML4A 3ME3A 4OJYA 1M3UA 4ZSTA 2PLCA 1TRDA 2AL2B 3CO4A 2OWWA 1S1RA 1F2JA 4I9AA 1JYNA 2QIWA 4CD5A 5AHFA 3SUVA 3LCXA 1FWDC 4DXVA 4IUOA 3B8TA 3UPMA 3WEZA 3EDEA 4HK5A 4U31A 2BTMA 2HE8A 4HMDA 1KXTA 4QS5A 2E7FA 1A5MC 1GZJA 3B8SA 1ZENA 5L9FA 3QFEA 3TOYA 2V5JA 4KFOA 4PUWA 3KOYA 4XQ6A 1ZS2A 2B7PA 5AC5A 2PDCA 4QBXA 3VIKA 4HHLA 3TDFA 1XGDA 4IMEA 2GK1B 4BR1A 1CPUA 2TODA 4O11A 1VBJA 2XWEA 1AODA 1FOBA 4GQQA 1XLJA 3WYZA 4YCOA 1HP4A 3QZ6A 4GY7A 2BOGX 2D73A 1NEYA 1H7WA 3UJSA 4QSFA 1OGGA 2DZAA 1C8XA 4HZ7A 4UNKA 1IXOA 4PFMA 4Q7BA 1A4MA 3TR9A 4JPGA 3G2GA 3WQWA 3MU7A 4IIFA 1AK5A 2HMCA 1EF3A 1V93A 3MDWA 1OCNA 1EX1A 1JI1A 4ZGYA 3N73A 4DEFA 4IM4A 4DELA 1RLCL 4C6FA 2DUZA 1EJVC 4UTKA 4W89A 3OQEA 4AD3A 3PZUA 3S47A 3QV9A 1GT8A 1DL3A 3O8AA 1ZBKA 4LAOA 1AFSA 5I07A 3ECQA 5GNXA 3W6LA 1TWSA 1M7XA 7REQB 4GZ7A 4XUGA 4GH1A 3H2FA 2CLIA 3LYEA 1TV4A 5AY7A 3QMSA 3PJWA 4RV8A 4QIUA 2AKMA 4FSAA 4B5WA 3H6OA 2ISDA 2FH6A 2NSXA 5A8MA 1M7OA 3SRHA 4RLIA 4GJJA 4KCWA 4D6DA 3MSRA 4MNLA 4B5VA 4GYFA 4JTCA 3TCSA 3NZ1A 3EWCA 4IJCA 4PUNA 4KIRA 3QYQA 4YLWA 3UVIA 5A8OA 1C7TA 5MHBA 3TYZA 1B3OA 3SUSA 3HBLA 2Y70A 4I9MA 3CQJA 4GYPC 4N6EA 3ABZA 1RUSA 3HOJA 4NSBA 1N82A 4H6EA 4HJWA 3VCRA 4O1CA 4O18A 1VCFA 5CBBA 3TYBA 3C3UA 3MO7A 3M5VA 3QHMA 2OELA 1CXHA 1WDWA 5I3HA 1IXNA 1VFLA 1UUMA 2NV1A 3WJYA 3GIPA 1GOKA 2PDIA 2CFFA 2DZTA 2YX0A 2ZUSA 5KETA 1A0EA 4YPJA 3T4CA 5F4WA 3QY7A 1V6TA 3DHFA 4DNMA 3SN4A 3AU6A 4GFIA 3BQ5A 3ATZA 3LX9A 1XC4A 5KEZA 1EUAA 7A3HA 3LM3A 3ZO9A 3APTA 1JPMA 1MZHA 3MYOA 2H3BA 3GG7A 3I3EA 1R47A 1TSIA 4BEUA 1RBOB 3VMPA 4GVIA 4K1WA 4MWAD 2WJZA 4V15A 4A3UA 2GSHA 1ZUAX 4BFAA 2WZIA 5FCZA 2PWFA 5K4XA 1QO2A 1I2QA 5AC7A 1A5BA 2DSWA 4DYJA 2E1WA 4ORMA 3R58A 3G1XA 4B4FA 2PPGA 2QJJA 2YCLB 3I3DA 4AWTA 1MEWA 4W84A 2V63A 2Q8LA 1F4AA 4AHPA 5CC6A 1BSIA 3AYVA 4D71A 3ANVA 2XFRA 4OU1A 1SPQA 2C1IA 4GVFA 4QG6A 1GONA 1OX4A 2VTFA 4JKKA 2BXYA 3M0MA 4M29A 1P7TB 3OODA 4QE5A 4KFNA 3C4UA 4FXSA 4Q4QA 1WKDA 3S9IA 4WVXA 3VDAA 1F3TA 1V5XA 1MNSA 4GINA 3QMRA 3M0LA 3ARSA 4H1ZA 2MANA 4PMOA 4S3JA 4X22A 3GY1A 4ZTYA 4EPDC 2GJRA 1AD1A 4ILSA 1A5OC 3VNJA 3NVDA 4UZUA 4Y90A 1OJXA 3WF3A 3T78A 2QCGA 3R0DA 2CXGA 3L67A 4B3KA 4LVBA 2HRWA 2Y89A 5D9NA 3SECA 3BOFA 5AOUA 4Z1DA 2B7OA 4CN4A 1B57A 4GI9A 4RNIA 4MY8A 3WDRA 2OCZA 4PB4A 1GEQA 2B7QA 4Y96A 3IEBA 3LTPA 3IARA 4FI4A 5BOEA 4IPIA 3W2LA 5CGMA 5GPRA 2PRMA 1E5NA 4C1NB 4KKXA 3C8FA 5CZTA 1Y0EA 4JQ4A 3N19B 3THQA 1NDWA 1S5WA 3SUUA 3WLHA 3A9BA 4ROQA 2OSXA 3WD2A 1H7PA 2NX1A 3LHWA 4EPEC 3N2BA 1CXFA 3IRSA 5LNUA 3AIQA 1GTHA 2X0SA 1YDOA 2Z1KA 3WUBA 3W00A 4IFRA 4KWWA 4LFYA 3WLOA 1IT7A 4DF2A 1W5PA 4C7FA 1CXEA 4F48A 3WDQA 2J9YA 2XVGA 4TOQA 4ZE5A 1JULA 1V51A 4XBSA 5MKGA 1TQJA 2D24A 3UR7A 5KMYA 2PZ0A 4O1AA 3O7UA 1FWSA 1ZQ5A 3GH4A 2GUUA 1K8XA 2OB3A 1OCJA 3S46A 4GHRA 2IQ0A 1U22A 1HJXA 1DBTA 2OMAA 4LRTA 2GSJA 2XJ7A 3GG0A 3R12A 4NNAA 2QVNA 1NFPA 3LV6A 2V5DA 3KTSA 1DJZA 1IEQA 2J75A 4HZMA 2P3ZA 3L23A 1Y8BA 1KM2A 1SSDA 1G9HA 2UBPC 2A5HA 2Y2WA 3WH6A 4UTWC 1XD0A 3BMXA 3VNZA 4FIRA 2P8BA 1TPH1 3NURA 3U3HA 4A8NA 2DSUA 4J3TA 2GGGA 4BQ2A 1C8YA 4GK8A 2OO6A 3WLPA 1J01A 2YB4A 1I1WA 3CS2A 1V6UA 1GVQA 3FKRA 1SZGA 3CUGA 2E09A 2F6KA 5D03A 3NYDA 3LLFA 3N6QA 4QEHA 1UR4A 4DQWA 5EU9A 5AYZA 2FTPA 4HA1A 4LXFA 1IWAA 3H2CA 3GFZA 1TELA 4C5YA 3NQDA 3BTNA 1YNPA 4MJMA 1FCQA 3LRMA 4UOJA 3Q94A 2B0MA 4J3SA 2G0WA 3UA4A 1O4UA 1ZJBA 2BY0A 1UG6A 3U2CA 3CZKA 1R38A 3HV8A 3E3HA 1AL8A 1KFEA 5IHRA 2NZLA 3HGJA 3TONA 1PKNA 3QR1A 4A3YA 2DV0A 2BXZA 5BRBA 1EPXA 1N8WA 1P0KA 2VMFA 4AD2A 5A95A 2NX9A 3ZT7A 4QDMA 1TVLA 3W7KA 5DRCA 1SO6A 2VENA 2O4QA 3SEPA 4M56A 4O16A 5FF3A 1PSCA 3TAOA 4REQA 3OZPA 2XIMA 1Q6OA 3ZR5A 2NV2A 4Z1BA 4NX0A 4WCJA 1CLVA 2PGFA 1KB3A 4TV6A 1NFGA 1U5VA 2ZQ0A 3QKZA 3OTRA 2W0UA 3SY1A 4R3UA 3LGDA 3H7RA 4AIBA 3H7UA 2CZEA 4W8BA 2F38A 3R10A 2Z2UA 1R7AA 3HFYA 5E6YA 3WLIA 1V3KA 3W3OA 1AH4A 3V16A 2OR2A 2BASA 1O5QA 1VRDA 3QW3A 3KUMA 4FO4A 3LXCA 4LU0A 3CTTA 1FDJA 2FIQA 4CU6A 2MUCA 4D6IA 3H70A 3THCA 3I7SA 3LY0A 1ZP3A 1SFTA 4O0ZA 1QHPA 1W8SA 1TJPA 4KPLA 4BWLA 1HW6A 4JTQA 2Y8UA 1CT5A 2OQYA 1YTKA 3LG3A 5F1VA 3NYZA 4XAYA 4F0LA 2DQWA 4KWVA 3FY1A 4HMNA 4S38A 1RJPA 2WKLA 1RZMA 3RM9A 4CEXC 2YJQA 3CWNA 3B8UA 1TIWA 4JOMA 3C0JA 4FMVA 2TPSA 1ZBVA 3C2RA 1OM0A 1RH9A 1GVYA 4JIRA 3V35A 4IT1A 5JQ9A 4N9EA 3B9DA 4A6GA 2XIIA 3OO2A 3DUGA 3NIYA 4NHVA 4YIWA 2PF0A 2ZFAA 1X6LA 2CBVA 5LHFA 3GTHA 3W07A 4J1OA 4HQVA 1LJYA 2DT1A 3SN1A 4L7ZA 2VQUA 4JQ3A 1Q6CA 3PTQA 3S6OA 4C90A 1TJ0A 3EB2A 1ZBWA 4IHCA 3FSTA 2XIOA 2Q01A 1FHLA 3AU2A 4C6KA 3OGVA 3G0XA 4LNCA 4Q4KA 4EWJA 5JBFA 3CV2A 4ZOCA 1RY8A 1I2RA 1ODUA 1KM1A 2FDMA 3KAOA 3OG3A 4P7LA 5GJNA 1RCXB 1E6QM 1K77A 3PWAA 2ZDSA 1R30A 1GVFA 3CU2A 5K7JA 4R33A 2A7PA 3EPNA 1H0GA 3R6IA 2REQB 3QPZA 4P8UA 2W5FA 3H4WA 3EMZA 1OWQA 2C13A 2DSVA 3W9ZA 4B15A 4WF7A 3F1QA 2HBXA 1W2VA 1U1HA 3UCDA 4RDYA 1FP9A 2PDUA 4NIRA 5G1MA 4LUYA 1U1UA 1D3HA 1GYMA 1KBIA 1JPHA 1F74A 1MEIA 1S38A 3APYA 1GHSA 4IICA 3WJWA 1SYTA 5LNVA 2ZX6A 3N12A 3RX3A 3GG1A 1OINA 3K5XA 1RHCA 3GZAA 2V81A 1E6ZA 5BRQA 4IOTA 4IPPA 2QR6A 1OFAA 1W1TA 1OK6A 1M7JA 3QFWA 2V5CA 1FFQA 1K9FA 3W74A 2XH7A 3UQNA 1UD8A 3SGUA 4HNNA 2XISA 1I6NA 1R2RA 3HGSA 3M46A 4UTUA 1OFPA 4MLJA 2YXGA 1WXYA 3NO5A 4UXDA 1HVQA 1XFCA 2OEMA 1H5YA 2VFGA 1W9DM 5FJIA 3R13A 3CM4A 2E28A 1H7OA 1FXPA 3WH8A 1WOAA 3P82A 5DBUA 2OLSA 4QXIA 2YL5A 3DFOA 5EBUA 2I17A 5HJLA 3T0BA 4NP7A 1JDAA 5G4EA 2D3LA 4KCVA 1VFOA 1R7OA 3VIPA 4O14A 1E6RA 1IGWA 4ZODA 3SR7A 3HPFA 5PTDA 2CKRA 2OKTA 2BGQA 4H7CA 4WY0A 3CUJA 3SCWA 1XJBA 1NJJA 5B7ZA 4DPQA 1P6CA 1QWKA 3CZEA 4Y6GA 5CPLA 5FSDC 1ZAHA 1TWZA 4NRRA 4UQCA 4AXKA 4AFYA 5EB8A 2FGBA 3OOQA 3OZOA 3CUXA 4DZAA 2IW0A 2Z0IA 4P8VA 3T09A 4DHGA 2ZA3A 3HZ3A 3RLHA 2D3NA 5CAKA 4XZBA 3VDHA 2Z29A 4HPGA 2DT0A 1JCNA 2BNJA 3LCWA 4QE1A 3HG3A 4U4MA 1XYZA 3AXIA 3VDCA 5ECVA 3PB0A 1ADDA 1YKWA 1PAMA 3AWNA 3GXPA 4IQLA 1VHCA 1AJZA 4DJEC 4PUMA 4I7VA 3BURA 4I3GA 3HB9A 1B3YA 1NDVA 3GKFA 3U6WA 2DEPA 1AA1B 1RQHA 3MUAA 2I1OA 3S2JA 3DHDA 3PM6A 4P7RA 1J18A 5XIAA 3KEHA 1HO4A 3TSBA 3HGOA 4UQ9A 3KOWA 1YTEA 1WXJA 3QLDA 5MKGB 1H1ZA 2F7FA 1I1XA 2QYGA 3URNA 4ZO8A 3BLPX 1L2QA 1SW0A 2CBUA 2D0FA 4CCCA 3A4XA 3RDKA 1V6YA 3BDKA 5F4SA 3EMCA 2RGMA 2XIBA 3ZSSA 4ZO6A 3AISA 3QM3A 3W83A 4JTJA 3ONBA 3HMCA 5AHNA 5IBXC 4RXGA 3TA6A 4A05A 2Y0FA 3NDOA 4MGGA 4S2CA 2E77A 5HULA 1E73M 1E43A 5AHEA 4XO6A 5I6SA 3SAZA 1L6YA 1JF5A 1AQ0A 1JCJA 1JRBA 3W7EA 1X6NA 2EPKX 5KTLA 4NX5A 1K8ZA 2WVSA 3VGHA 1BHGA 1A5LC 3VMNA 5E9XA 4HTYA 2POTA 3CUFA 4E8GA 1BG4A 5CZKA 4EF9A 2BVWA 2WCAA 1JIBA 1CXLA 5JBEA 2XM2A 5J5RA 3LMYA 3DC0A 4WDWA 4X60A 1BWKA 4I5UA 1K9EA 3RRAA 5TNVA 2BSLA 4XVEA 1JRCA 1ADSA 4PTWA 5CPNA 2NXIA 4OE7A 4H00A 1L6SA 5BXRA 5I24A 2D2HA 1KTNA 1T0OA 4PUKA 2HISA 2PDGA 5CC3A 3M5YA 1DPMA 1GUVA 3WG6A 5LIYX 3T9PA 1CB2A 4N2YA 1TMLA 3ZLHA 1ECEA 1XKYA 1C7SA 2ONEA 1OFOA 2ZTJA 4XAZA 2I5IA 1S5TA 3J7HA 1E1CB 4OBSA 4JCLA 1YDVA 1TV7A 5BZAA 3RMEA 3IAQA 3O07A 1X38A 4EP8C 3NZRA 5JIWA 1T8QA 1CZ1A 4UFKA 3SSJA 4DF1A 4IGNA 3USBA 4KH2A 1FA2A 1SW3A 3BO9A 3TZNA 3ZVHB 1Z8AA 2X40A 3O6DA 4LY8A 3CIWA 1JGIA 3SRKA 3LHYA 1YXYA 1AL7A 3VKDA 2IUZA 3XISA 2GWGA 1Z42A 3UERA 5I3IA 1FKWA 3VM5A 4UFHA 1UH3A 1IGSA 1SO3A 3UZZA 2E0PA 1UZ4A 4TMBA 1H41A 3MMUA 4Q8OA 1DIDA 3K8MA 2XVPA 1V3HA 3NL5A 3DENA 5HNUA 2QUMA 3T0CA 3VNIA 4J3XA 3GU9A 4GVGA 1SFJA 2DVUA 2VO5A 2FYMA 5LXEA 3B4YA 3TKFA 2PTDA 3I6TA 4XZ9A 2E5DA 3M07A 2GJNA 4DZIA 5LIWX 1GVRA 2O9RA 3W22A 3NL2A 4YTUA 3VGFA 1UMLA 4DIAA 1TV5A 1UPMB 3EEGA 3M5ZA 4PCPA 4CGTA 1J96A 3F7JA 3PG8A 1JEZA 3ZM8A 4EPBC 2ODOA 3MCOA 2VZVA 6A3HA 3OGSA 1DQWA 4TTGA 5E6ZA 3O9NA 1KW1A 1NSJA 3VOGA 1BF2A 2I57A 2VRQA 5D09A 1L9WA 4G9PA 1IZCA 2XH0A 1H09A 2XZ7A 3MWAA 1ODZA 1OSEA 4EXAA 3TYUA 1FVPA 1CNVA 3K4DA 1SUXA 1MFUA 1OABA 4H8HA 3BH4A 3UGVA 3IANA 3DXIA 3GW3A 5FAGA 4R34A 1FCVA 3RLVA 3QQ0A 3KRUA 4M5PA 3KL0A 3WEMA 1JXKA 2WMHA 3RIKA 2ZX5A 1E6PA 3H2NA 3QV8A 2YKKA 1EEXA 1S5VA 3SCTA 1BSLA 3VOCA 4PEEA 5DN1A 1S2WA 4HK7A 1XBYA 2VVNA 4LYQA 2FVLA 2DZWA 1EO5A 3F5LA 2GVJA 4HHHA 2QCLA 2ZUMA 1ICSA 1DJWA 1WDRA 2ZZ7A 1WX0A 1HKVA 4EK7A 1Y5XA 4MY1A 1ZU8A 3WNNA 4ZSUA 3L0KA 2Y7EA 1IEXA 5AKQA 3M43A 9XIMA 1QCWA 1QK2A 3OP2A 3MHFA 3ZQ9A 1EF2A 1RPXA 5FD0A 2AMXA 5DLCA 3KWXA 4HSNA 3ZS4A 4MMWA 3HV9A 2FVMA 4YNGA 2OGYA 2FMNA 3AHYA 2PWUA 3HURA 3UXIA 2Q3OA 1M7PA 1KM4A 2WKGA 1XG3A 2VFEA 4KGLA 1E51A 1JZ5A 2YA2A 3HG2A 2Q6ZA 3GNNA 4ATLA 4A8RA 4F0MA 3UCQA 1S3HA 3L9CA 4JTEA 2HNHA 3VE9A 4URIA 1LOSA 1US0A 3QPYA 3WK3A 3MY9A 3N2OA 2WVVB 4HCHA 1BFNA 1MYRA 4JEQA 1V6VA 4L1WA 2R1NA 2PURA 3R5EA 2PU0A 2R9RA 1Q85A 1XIJA 1OF8A 4E4UA 2ZE3A 4IH3A 4O4WA 1K8YA 4Y8EA 3K1GA 3GR4A 1BTCA 4A22A 4Z1YA 3QHOA 4ZQOA 5I77A 4PMNA 7CGTA 2V3FA 2YL9A 4KETA 4GE8A 1VKFA 5C9UA 4LVAA 3G3DA 4WJXA 5CC5A 1T96A 3H7VA 3CAVA 4Q8PA 1V0LA 3LQGA 4WY0B 4AZHA 3HN3A 3ES8A 3I4EA 1OK4A 3VZYA 1Q7ZA 3DGBA 3FKKA 5D2TA 5D8WA 5HQLA 4GVHA 4M6PA 4IIBA 4CUCA 2QNEA 3I7RA 4EVZA 3FGCB 3LCHA 3O63A 1FRBA 2GVLA 1KTBA 4M3PA 5AYXA 3CGTA 1GW9A 3KDOA 4I9TA 4D8LA 1GKQA 3EDJA 3RN6A 5C5YA 1AH0A 4H2HA 3BWWA 2AL1A 2X1RA 2RGLA 3WLLA 1EUNA 3IVSA 3R25A 1B3ZA 1AD4A 4ERIA 3UG3A 4ZA0A 2V2CA 2WPBA 2FZDA 4FOKA 2FJKA 2J78A 4NZ3A 1ZNNA 3FLUA 3T2PA 4GXPA 1X98A 3TFCA 5EY5A 4PUJA 1TYGA 1UOZA 5CZSA 3NWRA 3ITXA 3KCJA 4M19A 1JZ7A 3UZWA 1KGXA 4PA8A 4PCTA 2QUUA 1QASA 1VBRA 1J6PA 3OLEA 4LBRA 3TR2A 4HNVA 2XFFA 2BB0A 1LBLA 3GUWA 1TIMA 3S42A 3W1LA 2E6YA 4E3VA 1TB3A 1J0YA 8RUCA 2ZWYA 5KSWA 3TYAA 3DG3A 4HOXA 3V7PA 3N2MA 1QXLA 3LTYA 2JF6A 3WH5A 1REQB 1F6YA 3CQHA 3PZOA 4Z2HA 1PXGA 1A5KC 1B4KA 4YTTA 3ARYA 2X2YA 4MPQA 3OA3A 3ZVIA 4S1FA 1FDYA 1JL8A 2Z7GA 1KO0A 1RBLA 3RXZA 4AF0A 2PTXA 2VX7A 4ZFMA 3NQ6A 4R7WA 3S1WA 3AOFA 3POHA 3W72A 5EYWA 2OU4A 2HVOA 3T6CA 4D6FA 3QOMA 3GS6A 4IMGA 4JHZA 4FIQA 2L5HA 1WNOA 3TC3A 3L21A 2VWSA 2JK2A 1FCUA 2X16A 2P53A 3MKCA 3UETA 6TAAA 1DKWA 2GL5A 1G4TA 3CL6A 1P1XA 5EL1A 4JFSA 2BZNA 3QYSA 1FX6A 1FXQA 1XCXA 2VCCA 2C16A 1AG1O 5EPDA 3RM4A 2PWHA 2ABAA 4YHEA 4MOZA 3QN3A 3E12A 2HTMA 4EAYA 3UU0A 5E0KA 4ADSA 1WZLA 1UQZA 5D2VA 2X2GA 2BLEA 4WSHA 2QAFA 5E5CA 2V5BA 1UUQA 4O50A 4J9JA 1Q6QA 1KLYA 2W9MA 2ZZ4A 3INPA 4NNBA 4UQAA 5LHEA 3I7QA 4Q4MA 4MFDA 3C52A 3PS7A 1XRTA 3WLTA 4RDWA 3WH7A 3N34A 2Y7GA 4AX7A 2GZXA 5DT7A 1QW9A 1UD3A 5BNKA 1UQYA 3UF9A 2GJXB 4F8XA 2FGZA 3PUGA 1FWAC 1RP8A 1JCTA 4LUTA 3ABSA 3C2EA 5EA9A 4C6IA 1E70M 3UR8A 3LSBA 3NM1A 1EWDA 4YWSA 3TIMA 4XTDA 5CZJA 4F3HA 1NWUA 2WC3A 2D0HA 1XLLA 4W9TA 3UY7A 5JIPA 1RD6A 2ABBA 3W01A 2C3ZA 1ITXA 5DF0A 4UCFA 5E9AA 3K4AA 3GHUA 4GYJA 1K03A 3L65A 3PC0A 1BTMA 2F8QA 3A3WA 2WKJA 4ZR8A 1NY1A 3MA8A 2XSAA 2OYLA 4DBUA 3P7YA 4WGHA 2WCSA 2QPXA 3IWPA 4IPJA 2RH9A 1OZQA 4Q7IA 5DMNA 3HG4A 1SJBA 2EEXA 1DJYA 1PKYA 3RU6A 4HB7A 1XV8A 2EO7A 3O6AA 4GX8A 3R94A 5I3DA 3L7RA 2FKPA 3RR4A 3OVRA 1VF8A 2E25A 5D30A 5DXYA 3LHUA 2J24A 4D1IA 4OTKA 3P67A 1QMLA 1POKA 4GXWA 5FAJA 3F4DA 3KLKA 1GOQA 2EPHA 4FNQA 4PTXA 1J8VA 2INEA 3EX3A 4B92A 3CTLA 3ZWTA 2IXUA 1OIFA 2J88A 1HT6A 4OUEA 1TR9A 2Q8XA 4H7ZA 3PPFA 2OPJA 3HPZA 1MO0A 4MNMA 1HKJA 2CHNA 3MHGA 1UW9A 1I45A 4BKNA 3M64A 3JZUA 1OZMA 2QEZA 3B3DA 1UA3A 2WOQA 3W29A 2ZC8A 1NQ6A 4AZBA 3EOLA 1EP3A 1D9EA 3AWOA 2VEGA 1UWSA 3UYCA 3FA5A 2WJFA 3FOKA 2AGKA 2WMFA 2ZRUA 3NQ8A 3GVWA 3UPWA 5LNWA 5L6UA 1PIFA 5HBFA 3I10A 2YCJA 2UZ9A 2YPIA 3QMTA 3T40A 4KEMA 2YDSA 3USZA 1BXNA 4AW7A 1MXDA 4GJ1A 4JYFA 4Z2GA 1HNYA 1WUFA 1V0MA 2XIQA 3L68A 2DIKA 2OYMA 4IFKA 2OT1A 3TNOA 4MKVA 2RFGA 5B7YA 2Z26A 3GDLA 1PE1A 1LOQA 4LW7A 1I0DA 3LB0A 1LQ0A 3TQKA 1DTNA 1RR2A 1XUZA 1YBQA 1ESWA 4FOJA 1JAEA 3GNXA 4Z2LA 2CESA 2EPOA 1QI3A 5LNSA 3IGUA 1XPGA 2CBIA 4JX4A 4EIVA 1Q8JA 4DJED 1S1PA 3PJUA 4AEFA 1MUCA 3THUA 5G1YA 3IJ8A 4XZLX 5AC8A 1R3QA 5C9WA 1TV8A 1JVNA 4ZXOA 1ITUA 4PTVA 1DV7A 3H12A 4JNYA 1ELSA 2QKFA 2Z1SA 1XYLA 1H7RA 3ARTA 3TJLA 1BYCA 2INFA 5F2MA 1FQ0A 2VOTA 2FB3A 1K4HA 1PZ0A 4M7TA 4LB4A 3SY5A 3ZYZA 4XX6A 1QO5A 3QZAA 4OV9A 4GABA 4FOUA 4K3ZA 3IJ7A 1QOPA 4BF7A 2ZZ3A 1CGTA 2BY1A 1MQQA 4K7VA 1XCWA 2Z2BA 1EC8A 2GPTA 3C8NA 3DGRA 2UWFA 3ERPA 1Z48A 2DSKA 3WMSA 1X39A 3UXAA 3VD3A 4WR3A 2W67A 3EWXA 4DPPA 1X8FA 4BQ5A 5DX7A 1QHZA 3D3FA 1EJSC 3GBEA 4C6OA 3MVTA 2CPUA 5IOBA 3VOHA 4RZBA 2VJXA 4IGMA 3B9NA 4GYPA 4E2VA 4LUSA 2PE4A 1XF0A 5CPSA 3BGJA 1TTJA 3TN4A 3BANA 3VXGA 2Y62A 2EJ1A 3KZPA 2J6VA 4PTDA 3DIPA 3NEHA 1Q6EA 3BLKA 5FJJA 1K7EA 1JF6A 1XH2A 3M1ZA 3OA5A 1A5NC 3OYZA 3AIUA 3KX6A 3HQOA 1KCKA 3GYEA 3MMTA 1EHNA 4TVCA 5FJTA 2X8RA 5G4WA 5AHLA 1SR9A 1XLMA 1XWYA 1F3WA 3QGAC 3C0QA 2B81A 4L64A 3LHTA 8CGTA 4NKCA 3RK8A 2R91A 1EX5A 3V5CA 3IIVA 1FWIC 2G95A 1GJUA 3GH7A 1VH7A 2I9UA 3W85A 4HD5A 2NQJA 3ZMRA 1LP6A 1JPIA 1UZDA 3S1VA 4PRWA 4LRSA 3SCRA 1KV8A 3D47A 3BAXA 4AHQA 1XIMA 3EDFA 5A6LA 3VILA 1S2TA 2ZRVA 1OY0A 1DJIA 4C6EA 3B9AA 1Z6KA 2WHLA 4DJFC 2MNRA 1NF0A 1LDCA 1ITCA 1WZAA 4FLOA 2P3EA 1Y65A 4PMQA 2FFCA 1WXZA 4OHQA 2VFIA 2WC7A 1J5SA 3LK6A 3D46A 3BJTA 4QDWA 1E9IA 4G1KA 3WNPA 4W8LA 1O94A 4GIEA 3V3WA 2Y4SA 5JBDA 2PLKA 4RE0A 3ARQA 4QGCA 3CH9A 1H3GA 2V6AA 4F0KA 5T9CE 3EA1A 2OOGA 5T8GA 3LGGA 2XSXA 7ENLA 3IGXA 5AZ1A 5C2XA 2J8TA 2IKJA 1UIOA 3W2KA 3N9RA 4JR5A 2V69A 2BV9A 5LA0A 3WF2A 3WDJA 5C70A 1D3GA 1DORA 3N17A 3CPUA 3QV6A 4DO7A 3SQSA 3ZR4A 3VC5A 3G1DA 5A3HA 3H2MA 1M04A 2WWCA 4GI6A 2V2DA 1W0MA 1TTPA 3KW3A 2EGZA 2DUAA 3T4WA 2CETA 2VR5A 4I8YA 3ARVA 1RA0A 3UZYA 4PSPA 1E15A 4WDXA 2Y7DA 4US6A 3F4NA 3ZZ1A 3UXLA 4JDYA 5D38A 2DW7A 4H9UA 1OC7A 1YDNA 2P10A 4PB3A 3BOLA 1UR9A 5IRPA 1QI5A 1JYVA 2PDQA 1UOKA 2BODX 3N15A 3LEPA 1BPLB 3AJXA 3EKLA 3QXBA 1GVIA 3A13A 1R86A 4FZIA 4IIGA 9CGTA 4UFIA 3ARZA 4RPQA 5I02A 3G6LA 1B54A 1FWBC 1XLCA 1XXXA 3PB2A 1M65A 3CPRA 3OZMA 2FPYA 3VKCA 3MJYA 1OYCA 3F4CA 2PAJA 4E6MA 3Q4DA 4H8UA 2KX9A 4IIHA 2F61A 2WK2A 4RXFA 4WKHA 3L0GA 2GVEA 3B0YA 2HQAA 1LYXA 3QGKC 5ECUA 5BMXA 4ZENA 2ISFA 1RSCA 4O28A 3OBEA 1ISVA 3CV7A 4Z1CA 1EOKA 4IL2A 4XD5A 3SGGA 3TC7A 3KBJA 4KEVA 3RG6A 1TUXA 2HPIA 3N29A 3MPGA 3NR0A 1FWNA 3ZOAA 3VYLA 3H23A 1XBVA 4U33A 1GJPA 2VZTA 1KXHA 3SCSA 1E9ZB 4FF7A 3QRHA 4BHYA 4NAEA 4DAIA 4PSRA 2VX6A 2HS8A 3ZT5A 4JIQA 2BHUA 3L12A 4DB7A 2BDQA 4C6NA 3WQVA 2NWRA 3E1F1 4HNUA 5C71A 1FWWA 5A6JA 2AQWA 5JU6A 4UTWA 1XRFA 2WLYA 1HKWA 1LWIA 4X2PA 3L66A 1YHTA 4BK9A 4RV3A 3GVGA 3QOKA 1JYXA 1VJIA 5DY3A 1E4MM 1BAGA 1F9CA 1GW1A 4J2PA 1DXFA 1P4CA 2FVKA 1Q2RA 2VC7A 1V6XA 1YPFA 1VEPA 2JGQA 4H83A 1VENA 3MUY1 4QTGA 4A29A 4W7VA 4O54A 2CWXA 1ISYA 2J7EA 4R9XA 1US2A 2HVNA 2VC6A 4Q8MA 1TWIA 5CLWA 1O66A 5CSRA 3V75A 4AC1X 5FI8A 2YLLA 4JN8A 3EDKA 2P0IA 4AZCB 2ISVA 4D72A 5C0QA 3I68A 4JTHA 5CPTA 3W1UA 4JS3A 1XQKA 2CLFA 4LVFA 3ITVA 1RQBA 1TR1A 4H2CA 3ZLGA 3CLWA 4AWUA 2ISSA 1WB0A 5K2ZA 3M7WA 2Z4GA 1EXBA 4P7QA 3VCCA 4Q4RA 5EKYA 2CLHA 1P0DA 3KRZA 2WO5A 1TTQA 2QCDB 5CPMA 5AHMA 5A6TC 4C91A 2WNWA 4EWND 3W53A 2A2IA 1ZAIA 5CSYA 2QT3A 1W17A 3RR1A 3EX2A 1QR7A 1XLGA 3VX0A 4MDOA 1V6WA 4IL0A 1X7FA 2X30A 1TPDA 2X0YA 4B16A 5CPQA 4UOQA 1XCFA 3OB8A 4W88A 4AEOA 3E9AA 2Z00A 1MW0A 1OHLA 4OBRA 4TVUA 3RRXA 4HKPA 3LV5A 3VGGA 1Q6LA 4HU4A 1OGBA 1C90A 5GJMA 3EGJA 1G7VA 3GFYA 3QC3A 3A3HA 1DWJM 2Y24A 3C61A 1KRCC 4S3CA 1KLZA 2Y7FA 4X0NA 4JTUA 1QNQA 1I75A 3P6LA 4J3ZA 4RE4A 5C9RA 2VEFA 3IIPA 4O17A 4UFMA 1XR2A 5JUVA 3NQMA 3T0DA 2NUYA 4JEJA 3KS6A 1XDLA 2A79A 9RUBA 4Y9AA 2EKGA 4HVXA 2YIHA 1EJWC 3PAOA 3VGBA 1M6JA 3ARPA 5CSSA 1EPVA 3GG8A 4M24A 2YXOA 2QIIA 1XLEA 4IPLA 1L0PA 4BZYA 1HL9A 3NQAA 3PBUA 3HM7A 3MUIA 3TYCA 3B40A 4LS2A 1NWRA 2R1PA 4Z42C 3GHTA 3K46A 2ZX7A 4Q6XA 1ZB5A 3MT1A 3GQYA 1JD7A 3NEVA 4UQBA 5KZMA 3JUGA 2C1GA 1SVDA 3TU9A 3V36A 2VEMA 4AD0A 3ABQA 3CIVA 1UH4A 3GDBA 1PTGA 1TPB1 3QJAA 4H19A 4GY0A 5AC4A 5SWUA 2ZA2A 3TQPA 3GTIA 3N9SA 4ES4A 3WBWA 1ENUA 2Z6IA 2CZ5A 3ABOA 4W5UA 1HKKA 1OX6A 2TMDA 1MZRA 1NDYA 2EJAA 1KFLA 1Q63A 4IQEA 4WKFA 2V38A 8A3HA 1JDEA 3HPAA 3UBPC 7PTDA 3NQEA 4NXKA 2HZGA 5G1TA 3FA3A 2A0NA 1C8VA 1D7KA 3UG8A 2A1YA 3RMJA 3WQFA 2QPUA 3O05A 3SFWA 4LBSA 1UR8A 4C6LA 2J8GA 3MMDA 3W1QA 3W28A 2A3BA 1LRQA 5LGZA 4GQBA 1KRMA 4DYKA 4NUWA 1XL9A 3WL0A 2XVKA 1C9WA 3AIVA 3BLIA 1RVKA 3WJZA 2NQLA 1KRAC 2CIPA 1RCOB 2BY2A 4N42A 5I3GA 1ADOA 4K8HA 1E4LA 4K39A 1W31A 3IJIA 3A5FA 5H2ZA 3AMCA 2WYSA 4Q33A 5FF7A 1VAHA 4XK2A 1DJQA 3ID7A 3WLKX 3TE9A 2ZRZA 1E40A 3EXRA 3EPOA 1UUOA 2JIWA 4F66A 2Z27A 2QJHA 4GUHA 3L2LA 1QNVA 3BLDA 2QGHA 4J5NA 3CQ0A 3TH6A 5U7SA 1TJRA 4ZB2A 3WLQA 3SY8A 1J0IA 1EGZA 3DH7A 1R9ZA 3LZ5A 5HUPA 3ATYA 3OGRA 5GJPA 3CNYA 5A94A 3KTCA 3KVLA 2BBFA 3GVQA 5K9CA 1XD1A 4ERGA 3PZ9A 4DY1A 4WSJA 5JVLA 4J3VA 1ZALA 2DH3A 2ZRWA 1ZJIA 2YYUA 4K8EA 3IJDA 2V82A 4GUJA 4H9VA 1LUCB 3JVAA 1QNPA 2AKZA 4IP5A 2JEQA 4DJEA 3AXMA 1XIHA 1FDZA 1FP8A 3BJFA 3B8DA 2ZXQA 4JDBA 2X7WA 4UZSA 5TQLA 3S2CA 4CCEA 4JD4A 1JI2A 3VE7A 3NGFA 2R1MA 1PIGA 3VUPA 1HZYA 3STCA 3PF3A 2V30A 3WMBA 4C6QA 5HNNA 2HK0A 5DMMA 2OXNA 3WZ0E 1B3XA 1R0MA 5H1WA 4TX6A 4Y9PA 3VPLA 3PHAA 2XM1A 1CGVA 2NQ5A 2EPNA 2ACQA 2FDSA 2XIJA 1TA3A 1MVYA 4NAEB 1K70A 4RNFA 4XZWA 4G5DA 2FJUB 1N2VA 3AZTA 3S2LA 3WDHA 3W24A 4W8AA 1T8XA 4Y9NA 3UP8A 4F79A 1JZ2A 6ENLA 3DX5A 4QG9A 5G2IA 2FZ8A 4K2SA 2YSWA 1KBJA 1H61A 5T26A 4BI6A 3GBDA 4UR8A 3TYEA 1UASA 4Q6JA 2A3HA 4XAFA 3B0VC 3QY8A 3M44A 5ABGA 3LCFA 4MJ2A 4X63A 4ZCWA 1BRLB 1PDZA 2BS9A 1WDPA 2PEVA 3TAKA 3LNPA 5HQMA 4EACA 1YQ2A 1GGOA 5CZ0A 1FBAA 2PSNA 3W27A 2TRSA 3SUWA 4UTLA 3LCLA 1FWFC 1B9ZA 2JFEX 3DFHA 2GUYA 3TSMA 1ZY9A 1OT2A 1RALA 2IKIA 3W4RA 3B0UX 3VINA 2VC9A 2CU0A 3AMLA 2ZUVA 3WQPA 1NFBA 2ZX9A 3DN5A 4E3TA 1DIKA 4AWSA 2C18A 2PDHA 3EA3A 2VNCA 4MB1A 3SCOA 3U5YA 4G8TA 1MUMA 1EEPA 2YDRA 1PDYA 2PWDA 2ZVRA 3QKEA 3RJYA 2ZUTA 4DUOA 3GXFA 1T40A 4K37A 4NAFB 2ZA1A 4FEZA 1JR1A 2PA6A 3CJPA 1B31A 1NARA 1KFWA 4OVXA 4MWAE 4DO5A 1K1DA 4F2BA 3APGA 5AFDA 4TQTA 1E1FA 3I4KA 2BWGA 5EMYA 3SM0A 3SADA 4ZVJA 3IJQA 1HKMA 4J7RA 1X7IA 2W62A 4OECA 4BQ4A 1MFVA 2PD9A 3RLUA 2JIEA 4LX4A 2EXOA 4DWSA 2TYSA 4O1FA 3EXSA 3BPWA 3VMOA 3W1TA 1VS1A 3ITTA 5BXPA 4HTBA 3PUOA 4GMEA 3VKKA 1W1IE 2YA1A 3MS8A 1F61A 2EKCA 2BGNE 4Z08A 3MSGA 4QISA 2F9RA 1YE4A 2FB2A 5D8ZA 4O1EA 2HROA 2VURA 1DP0A 3P8IA 1CYGA 4H7VA 4N9BA 1ZJAA 2IPJA 1OB0A 3EB4A 5CGTA 3NDYA 4NZ5A 2GUBA 4O13A 1OVDA 1DE6A 3G6MA 3W7MA 1QK0A 3IACA 1MSSA 1GVOA 4WHBA 2CLPA 4HNCA 3WUGA 3IIXA 1MXSA 1HVXA 1FH8A 1R3YA 1B3WA 4OQVA 4EF8A 5FEWA 2YBUA 1MW2A 1B90A 1SFSA 2E3ZA 4LAMA 5CEWA 5K4ZA 1ZJHA 2D23A 4Y2WA 4DJFD 1UZ1A 5FF2A 3BAJA 4KESA 3ITYA 3VFLA 2XGZA 4B9ZA 3N3MA 1RAKA 1V03A 3DKJA 4KCTA 2ACRA 4DZHA 1MEHA 1FY6A 2J7BA 2X7VA 3S6DA 1UMYA 3R0UA 4JY8A 3SQLA 2VUYA 2B31A 4PH6A 1VYPX 5EMUA 5LA1A 1U5HA 1IXQA 5FACA 5HJYA 2PLMA 2VYOA 1W3HA 3CUHA 1JQXA 4WOZA 1CB7B 5B80A 4LH8A 5BW6A 1K02A 4DUXA 3SSZA 3EYPA 4G7EA 3S9YA 2H9AB 3VIMA 1TUFA 2WSYA 3MZ2A 4AXNA 1IWPA 1DWHM 1G01A 2V67A 2NW0A 3LHVA 4FALA 2RAGA 2IQDA 2NX3A 3LLDA 4AU0A 3WX7A 1LORA 3WUFA 2QCMA 3WL1A 4UBPC 2DVXA 1FWEC 4NJGA 5A6BD 4OWGA 1ZL1A 3H2EA 3GWQA 1XG4A 5GNZA 3VM7A 4W86A 3NQ2A 4ICMA 4LVGA 4O19A 3V5FA 1NAL1 4GBUA 4AD4A 2IKHA 1MDLA 1MRAA 3G0UA 1TPC1 3C2FA 2NT1A 2VVSA 3P5ZA 4S3AA 4P8WA 4WY0F 1MQRA 1VYSX 3W23A 4YYCA 3M41A 4ICCX 3CLMA 3CMGA 4S2BA 2CEQA 4H04A 4LV9A 2XN0A 4B2DA 4L9ZA 3E2VA 5HPCA 2J6XA 4GX9A 3HO8A 4U3CA 2CLKA 3N4FA 2NWSA 1XYMA 3W76A 1QW7A 1TQXA 2BOEX 2SFPA 1C93A 4GJIA 2PGWA 2OTDA 2WWDA 4DO4A 2GGHA 4YL2A 3DFSA 3EX1A 4PTNA 3LRKA 3GR7A 1VLIA 1K3UA 1R6WA 1US3A 4KWUA 2PCQA 3T08A 3GU1A 3AIWA 4JTTA 1YYAA 3AQUA 1JYWA 3VCNA 4Q3MA 2JKAA 3GIYA 2WMKA 4CCDA 1TZ7A 3GTXA