3NQCA

Crystal structure of the mutant i96s of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAISVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 87
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqcA00
3C56A 3N3MA 1DQXA 2DORA 1RVGA 2VFDA 3PBWA 1AL8A 3HGSA 1VGAA 3C3NA 4PL1A 4RKAA 4FIQA 2YGYA 3S8HA 1G7UA 1J2WA 1OVDA 4LVGA 1DBTA 2DZPA 3OBKA 3L5AA 4MUZA 3IVSA 3ELFA 1IXQA 4PA8A 4WZHA 1RR2A 4JYDA 2EF9A 5CPMA 4R7JA 2ZZ1A 2FIQA 1VPXA 1XFBA 3A9IA 3TKFA 1KW1A 5EA9A 3W9ZA 4A22A 1KLYA 4UMBA 1FXPA 1G69A 2VFFA 7TIMA 3A22A 4D2JA 1XBYA 5LSMA 5D2VA 2Y85A 1VS1A 1R2SA 4O4VA 1VLIA 2ZZ7A 3NQ2A 3PR2A 4TIMA 3G8EA 1ZAIA 1NFBA 3N9RA 4X2RA 5D03A 3G1FA 3HJZA 5LNRA 1X1OA 1LROA 4XTIA 3TH6A 1HO4A 4FNRA 1DHPA 3LTPA 2PRLA 3PG9A 2CLIA 2WSQA 2ZZ4A 1XI3A 2BXVA 4WY0F 4DELA 4RZ5A 3LLFA 3CTLA 1QO2A 1R46A 3P61A 3R8RA 2YYUA 5CG7A 3RLUA 4O12A 4AHOA 5K9DA 2R8WA 2R14A 1GZGA 4BI6A 4CQ9A 3EX6A 2X1RA 4LS2A 3DI0A 3MMTA 3O8AA 4JR5A 3TXZA 2TSYA 3GB6A 2ZRXA 1OFBA 4N6EA 1H7PA 1TYGA 3EWBX 3NQ6A 2W0UA 3W86A 3SIZA 4ZVJA 4A2SA 6ALDA 1GTHA 4OV4A 4Z1AA 1AG1O 3NM1A 2GQ9A 2ZQ0A 3W7DA 3V75A 3BPWA 1L6SA 5LGZA 2DJLA 5CGQA 4K7VA 5H91A 3C52A 3EXTA 1JUBA 4N2YA 3EXSA 3NM3A 2QCMA 1TTPA 3WJWA 1PHQA 3O6DA 3W7OA 3P8JA 3C4UA 5AHMA 3BG9A 3W76A 3GDRA 4O0ZA 5K3VA 2OZ0A 4O4WA 4M6QA 1KM1A 2FB2A 1OF6A 3M6YA 1CI1A 3H55A 4Q33A 4UR7A 1PCWA 5E0KA 1WV2A 3R5EA 1KFJA 1LCOA 2VXNA 3NA8A 1KM2A 3ABRA 1H60A 1OABA 3W84A 1KTCA 1IGSA 5LKYA 4CCDA 5D38A 1FWSA 2LLEA 3NZ1A 3IV3A 4HSOA 1PV8A 5C6MA 4MYXA 1OJXA 1IXNA 3W71A 5K7JA 3U6WA 3N2XA 3GYEA 4JDBA 1ME7A 1VHNA 3UZ5A 4A3UA 2VELA 1KFLA 2QCGA 3LHTA 1SU5A 3W1TA 4EVZA 1KFKA 3P84A 5HNRA 4JIPA 1DVJA 1M6JA 3TR2A 2NLIA 1G7VA 2J9ZA 4NT0A 2WPBA 1RPXA 3NQEA 3TUUA 3BW2A 1J5TA 1TO3A 1EA0A 3QFEA 2Z0IA 3EX4A 3G3DA 3SW6A 3TMLA 3ABSA 3F1QA 3M7WA 4YCPA 4DBDA 4JY9A 1O5XA 4LOCA 1H61A 3BG5A 3OG3A 4EWND 4NX5A 3RFAA 1FCVA 4ZL1A 3ZS4A 5HWJA 2CZ5A 8TIMA 3M5XA 3TAOA 3L21A 1I2OA 1SPQA 5D02A 1VCFA 4C1LA 4LV4A 1LRNA 4NJJA 5LNWA 4RK8A 1SZFA 3W88A 3N9SA 1U5JA 2JGQA 1SZEA 4KFOA 1TREA 1OX4B 3G1YA 1ICSA 3TIMA 5J5RA 3LV6A 3IGXA 3G8RA 1WDWA 1KM0A 1NF0A 1H63A 5LHEA 3P7YA 3LGEA 4YCOA 2XN0A 4TO8A 3BLFA 4QSHA 1KLZA 3G0SA 3S1XA 3LCWA 3HG3A 5TIMA 1H7WA 4QIUA 2FFCA 3LHWA 4NJGA 2Y7FA 2R91A 2A7NA 2A5HA 2QAPA 3MBFA 1LORA 4K8HA 1QMLA 3IIZA 4S2CA 4DO6A 4UTMA 4MOZA 3W7GA 2DZWA 1PE1A 3GVGA 4NQ1A 2RH9A 3KRSA 2QR6A 2C16A 3GAYA 3KVMA 3EWZA 3B06A 4XTDA 2BZNA 3PC0A 3ZFHA 2D73A 2ZRZA 2EPHA 4JTHA 1SZNA 3UWWA 4GC4A 2Y63A 4TR9A 4N9EA 3PUOA 1QOPA 3GNNA 2J9YA 3MI6A 1TPEA 2YFOA 4JEQA 1FBAA 2C0AA 4DXVA 3GDKA 3UWYA 1M5WA 4OT7A 3ANYA 4LU0A 2E5BA 3W1LA 4LUIA 3NOEA 3CIXA 1FDYA 4M19A 3S5NA 4AHQA 1Z41A 3FYPA 4OV9A 2GQAA 5U4NA 4KWVA 1AK5A 3I6RA 3WJYA 3DFQA 3NL3A 1T96A 2VFIA 3G0XA 4NU7A 4FNQA 1GYLA 3NPWA 2NWRA 4JTJA 4CNNA 1FWTA 1TSIA 4KFPA 4JD4A 1XM3A 2V81A 3B0PA 3G0UA 2NX1A 5KMYA 4ZMGA 3NQFA 1OFDA 2HSAA 1VRDA 3E96A 2QCNA 3R89A 3LB0A 3DXIA 5K4XA 2PRMA 3TE9A 1BKSA 3GDLA 4HSNA 2QCEA 3MW7A 3W2UA 3FJ6A 1Z48A 4O14A 2I9EA 1JJKA 4O28A 1HFBA 1QPOA 4TMCA 2E6DA 2Q3OA 3P82A 1ZJIA 2FPYA 4WXYA 3CU2A 5H2ZA 1Q6QA 3STGA 4IJBA 4U4MA 3JS3A 4Y6GA 3IIXA 2ABBA 1V7YA 3O06A 1FCQA 3UWVA 3BV4A 5CSSA 5BMXA 4YL2A 5HR6A 3STFA 4EF8A 3G24A 1C29A 5FEZA 1VYPX 2FTPA 3HOJA 3BGGA 5D2WA 2EHHA 2KZHA 3WJXA 2O7SA 3B05A 5A8GA 4PH6A 4Y96A 4LRSA 3NNTA 1K02A 1LBMA 4JYFA 1TJRA 4ORMA 1RD5A 5LNUA 2R94A 3M5YA 3G1AA 3VNDA 1TPFA 4K6AA 1KFBA 5DBTA 4AXKA 2OJPA 3OA3A 2QEZA 2CZFA 2H8ZA 2ZA2A 4CNOA 2ZDRA 4JIQA 3KRZA 3W1RA 1A5AA 4FNSA 2BSLA 5KTLA 2ALDA 1ZHAA 1MEIA 2VENA 1WYIA 3TFXA 1OF8A 3NZRA 1KV5A 5DCEA 1RZMA 3DFOA 1TPVA 3QQ0A 3UXAA 2O7QA 3DENA 5FF0A 1JCLA 3PSWA 2PE4A 2W79A 1SO4A 2E77A 3SFKA 4O1DA 1TV7A 1RQBA 3LXCA 3UWUA 5CZ0A 3Q2DA 3NR0A 3KVJA 4GNJA 4DPPA 4GUHA 3CEPA 3W85A 2F84A 3WFAA 4JYEA 1DKWA 3NL5A 3CEUA 1UUMA 2QCDB 4JX5A 4IGHA 4LW7A 4QM1A 3TW6A 1LRQA 2DJXA 4O15A 1WAUA 3LBMA 4JTGA 3S1VA 4JTKA 3M43A 3H53A 3W83A 4RCXA 2VEIA 1EEPA 3CPRA 1SO6A 3W1NA 3W7HA 3NL6A 3HGRA 2X1TA 4LC6A 4IMCA 2BWGA 1UBSA 2E6AA 2GQ8A 3SECA 4AWUA 2FDSA 4Z1BA 2JKAA 3UQNA 3B4UA 3W2MA 1W8SA 2QCHA 3UD6A 4PODA 2V2DA 3NQCA 4UCGA 4H3DA 4DBEA 3HO8A 3TMQA 4Q32A 2NZLA 5AN7A 1XDLA 1G4TA 2WNZA 4ICNA 2WJZA 1QPQA 1XL9A 2V0TA 3VFLA 1VCGA 5EYWA 3N19B 1H62A 2Q8ZA 3SGZA 2Y61A 2VC6A 4UR8A 3I68A 4OWGA 1H7XA 3MYOA 4JX6A 5DELA 1K3UA 4R33A 2QDHA 2PC4A 4UFLA 4IWWA 2HTMA 1K7FA 1W3TA 3W74A 4O1AA 1H1ZA 5HWMA 4KKXA 4FX6M 3EB2A 1VLWA 1OHLA 3NQGA 4XKYA 2E09A 4LC8A 4UIOA 4UTTA 5G4WA 1EX5A 3O6YX 3UPWA 4UTLA 4UTWC 3M0ZA 4IMFA 3CIWA 4O17A 3SI9A 3F4NA 5I3FA 1IXPA 3QSTA 3M5ZA 2ZCGA 4QITA 1IF2A 4JGDA 1W56A 1TJPA 2H90A 1I2RA 3IRDA 3A5VA 5KSWA 2B7QA 3W23A 3QZEA 2CLOA 1W5MA 3C2VA 2ISWA 1TPUA 3G18A 2RHGA 4O50A 5G1TA 2OT0A 1ZFJA 2DZSA 3G1HA 1BEUA 4WXZA 4JNMA 2Y89A 3QC3A 1SUXA 2C14A 2BLEA 1TB3A 2A0NA 4I7UA 5KINA 2Q3RA 3DHDA 1VZWA 4HNNA 4HNVA 5MHBA 3QRHA 1GWJA 2CLHA 1C8VA 5FEWA 2V2CA 4MLJA 2V30A 4UFKA 1B9BA 4FF7A 4M7TA 1O94A 5F1UA 3FEMA 1OFEA 1QAPA 2HS8A 3EWUA 1JUKA 3FA5A 3EX2A 1XCFA 2ZFAA 5G2IA 3HMJG 4A29A 4FIRA 3CWOX 4LVFA 2FQIA 1YDOA 4NJKA 2EAWA 2DU2A 1LTDA 1VR6A 3HG4A 5HINA 1B4KA 1FDJA 3E02A 5KZEA 4HHPA 1S5WA 2CWNA 3UYCA 2A6LA 3N34A 5D2XA 3NXFA 1ONRA 3LXAA 4S2BA 1JCNA 3GNDA 4IXXA 1QR7A 1BWKA 1XXXA 2Y70A 3IIPA 3L0NA 5BW6A 1W3NA 5F1VA 3DAQA 4G1KA 4GUIA 5F4XA 1LRTA 4CLMA 4HIBA 2J88A 3AO0A 3NL2A 2YPIA 1EPXA 3LI0A 4N9BA 1P0KA 1N55A 3LCXA 3KVKA 1XC4A 4XZ9A 5D04C 3DKJA 5CPNA 4FX8A 3HF3A 2V82A 3W75A 5HQEA 3PY2A 3EWWA 1SSGA 3W87A 3YPIA 4JTEA 2QUTA 4ADSA 2ZA3A 3OVQA 2GPTA 4LVDA 4MPQA 5K9CA 2Y62A 3EX3A 1A5BA 2J27A 2ZRWA 1YTDA 1YLVA 4WY0B 4HPXA 1HTIA 1JQXA 3LBCA 1LYXA 2ZA1A 3C2RA 3QF0A 1OYAA 5I3IA 4PC8A 1AL7A 4FNUA 2VKZG 1GJPA 4E2BA 2CZDA 2G96A 1OG0A 4MY8A 5HJLA 3LRKA 1I8JA 1PVNA 2YFNA 3CC1A 3WJSA 1PS9A 2A21A 4LRTA 3GXPA 1XUZA 1EP3A 3C6CA 3HPZA 4MVAA 4X9SA 5DN1A 2E6YA 2ZZ2A 4BFAA 1JVNA 3S5ZA 2QJGA 3CLMA 2Z1BA 3RK8A 1P1XA 3G1SA 1HG3A 5KITA 4N4QA 4RV8A 1NAL1 3RU6A 2A4AA 3SSJA 1YDNA 1O4UA 4GWEA 3G1VA 3N73A 3M47A 3W7RA 3PUEA 2H3BA 4JICA 1FDZA 4AHPA 3TXVA 3USBA 3GK0A 3TU9A 5CZTA 1K03A 3O16A 1D9EA 3LLDA 1Q45A 3CM4A 5HWNA 3OEXA 3QSRA 1MZHA 3TK7A 3MHFA 3PBVA 4UFHA 1OK4A 3W7PA 2FLIA 1XBXA 1TCDA 1XDMA 2C13A 2A1YA 3UY7A 2RDTA 4GE8A 1NSJA 4JDYA 4N4PA 2NX3A 3LRMA 4IMDA 4LS1A 5D32A 5U7SA 4PL2A 3W72A 1QPRA 2QCFA 1PCKA 3W73A 5AYZA 6TIMA 2QCCA 4X3ZA 3SR7A 5IBXA 1ZY9A 2JK2A 4RR4A 4JTIA 4AH7A 3TSDA 1KV8A 4AVFA 2Z6JA 3HG2A 5SWUA 5I3HA 1EP1A 3PULA 3B8DA 4MZ1A 3GDTA 3T55A 2NUXA 1TTJA 3NEVA 2Y6ZA 1SFJA 1LOLA 5D09A 5EKYA 4RZ4A 5D30A 3M44A 4WOQA 5D33A 2B7OA 1Z44A 1KM4A 1H5YA 1P4CA 4O0KA 5AHIA 1X7FA 1F6PA 3M5VA 4HKPA 4O52A 3UZJA 1TQJA 3A21A 2PRHA 3SZ8A 1TRDA 2NXHA 2Y7GA 4TX9A 4XKYB 3K30A 5HUPA 1VYSX 2YSWA 4AF0A 2BTMA 3F03K 4CCEA 2ATMA 1OYCA 3JR2A 4WX2A 5D2YA 3R2GA 5DCBA 4NZFA 1N7KA 4FO4A 3I7RA 3P60A 2OCZA 3QYQA 4MLRA 2CLKA 2GJNA 5EMUA 4FXSA 3LM7A 5DBUA 1A5CA 2DZUA 1Q6OA 3W7QA 5BMWA 1A5SA 2GOUA 3DGRA 1OX6A 4MYAA 1TV8A 1MEWA 2B7NA 4UNKA 3G22A 3Q94A 2RDWA 2RDUA 3VE9A 4RXGA 5F2LA 3IIOA 1J4EA 3WJZA 3TJXA 1AW1A 4M5PA 1GVSA 3LHYA 2DZXA 1T99A 2JKPA 3L65A 1DORA 3HIJA 3GAKA 1IXOA 5EL1A 2H6RA 1SO3A 1F6KA 4ORIA 1VYRA 3P62A 5HULA 2ZRUA 3W2LA 1L6YA 3QPYA 1XUUA 3EKLA 3FFSA 4O1CA 4IUOA 5G1YA 3LTYA 1S5VA 3PAJA 2GJLA 3O63A 1C9DA 4ZQPA 2VFHA 2YR1A 1GVQA 5D37A 5ABTA 4RXFA 4P61A 4ZZ9A 3W7NA 4QNEA 4PFMA 4FEZA 4IXHA 2P0OA 1EUNA 1UJPA 3PVFA 1W5QA 3VCRA 2OT1A 2AAMA 4C1KA 1OFOA 3P80A 1O95A 4HNUA 2YYTA 4H4IA 3KRUA 2WNNA 5K4ZA 3O05A 2ZBTA 1OFQA 3FS2A 2X30A 3T78A 2ZRYA 4OE7A 4ML9A 3M9YA 3S1UA 4ADTA 2HMCA 3MP5A 3QMSA 1AW5A 3S6DA 1G4SA 3GIYA 3IGUA 4GXMA 1QWGA 4XUGA 1SW0A 3BK0A 4NJIA 1K7XA 3EKZA 2YW4A 2V2HA 4X22A 4Q4KA 4NNBA 2QAFA 5CSRA 4E2DA 3UY8A 1LLWA 1MO0A 5FF3A 4K7YA 1B57A 5L9FA 1ME9A 2C19A 1JR1A 3PB0A 4L4LA 2C3ZA 1W5OA 1HL2A 2C6QA 4FXRA 4O13A 5HR7A 2E6FA 3W1PA 3TFCA 4LS0A 1H1YA 4YXGA 4RLIA 3KVLA 2C15A 2V5LA 4NZJA 4LY8A 1UUOA 3LDVA 3B0UX 3CT7A 4GJ1A 3U2OA 4FHAA 4A2RA 4O54A 3UNDA 3IEBA 2PURA 4LVAA 2Y7EA 5LNVA 3QMTA 5HUOA 3HQ1A 1VCVA 2G95A 4XQ6A 4HPJA 3L0GA 3BVJA 3LCLA 3AJXA 3HPXA 3PS7A 1FWNA 1NEYA 3MI2A 3A5FA 1AMKA 2I1OA 4K36A 3L5LA 1XBZA 4UMAA 4MY1A 1O60A 3TC6A 4JX4A 4QJ1A 1THFD 1H7OA 4LT9A 3PBUA 4AWTA 3W7MA 1I2NA 3NPXA 3KFTA 2CFFA 3E0IA 3NAVA 1GOXA 2CW6A 4TU1A 4QAIA 3VE7A 1RV8A 3L9CA 1YXCA 1MXSA 4BK9A 3TQVA 2QCLA 3PG8A 3GR7A 1LBLA 1H50A 3GKFA 2EGZA 4MZYA 1GVFA 3PF3A 1AW2A 5I3JA 2G97A 3NQMA 1GEQA 3MP4A 3BO9A 1PIIA 3TSBA 2WNQA 3IGSA 4OBTA 1YDVA 5E93A 1SZGA 5DY3A 1MEHA 1I2PA 1KFCA 3MJYA 1I4NA 2XN1A 3S5YA 5T26A 4N9CA 3S5OA 1ZAJA 3BGJA 4BWLA 3HBLA 1F7BA 3FIGA 3C61A 4JN6A 3W7KA 1TQXA 4WQ6A 3P81A 5CZSA 5BOOA 3W1AA 3M41A 1WXJA 4H6KA 3STCA 1SW7A 1B4EA 3SJ3A 1MSSA 3LERA 3MUXA 4UTKA 3CHVA 3GDMA 4QNWA 1TTQA 1GTEA 2YCEA 4ZQCA 1FWWA 1OFRA 1HO1A 2IQTA 2F7FA 1SR9A 1W0MA 1DV7A 4FX7A 3TSMA 4YMZA 3GKAA 4R53A 3DFSA 4LTSA 3S1WA 4GRSA 4FB7A 3FJLA 3IIVA 4K39A 4FNPA 4AF0B 2ZZ5A 1DJNA 1QOQA 1W5NA 2E5CA 5AC7A 3C8FA 4LV9A 5C2XA 2FB3A 2E5DA 3W3OA 2XN2A 1FUYA 2AGKA 1YTKA 2V8ZA 4E38A 2ZZ6A 1EP2A 4K38A 1F73A 1GVOA 4O19A 1FWRA 3G3MA 5E1QA 5AFDA 3MHGA 1X8FA 4EIVA 1G6CA 3V1PA 1OFPA 3IVTA 4XWUA 4L4MA 3D0CA 1WBHA 3CB8A 3W2NA 5C5YA 4QISA 2ZRVA 3PUDA 2NUWA 3VKJA 3LTSA 2P1FA 3RNDA 1K7EA 1W31A 3ABQA 4Y90A 1RQEA 5F4WA 2DZVA 1LOQA 1F2JA 1FX6A 1GT8A 2EKCA 3NG3A 5DXYA 1OX5A 3UWZA 4EF9A 1W37A 2NUYA 3TJLA 4JTFA 1EWDA 1SSDA 5IBXC 4PCFA 5F2GA 3I7QA 1JCJA 4GUFA 4LVBA 2CZEA 5F2MA 2VOMA 4I9AA 2A7PA 1B3OA 4UTUA 4M6VA 1SO5A 2Y88A 3P74A 4NXKA 1ME8A 4MFDA 2QDGA 4HN4A 4RJEA 4B5NA 2WV8A 2ISSA 3LOTA 3DI1A 1QNVA 1GYNA 3W7JA 5AHFA 4UFJA 3P5YA 4UC5A 3QW4B 1U83A 5CPLA 1S3HA 5G5IA 1L9WA 3EWYA 1K8YA 3LCIA 1WBJA 5KZDA 2NXIA 3KAOA 5AB3A 1KTBA 3W70A 3HB9A 4OQVA 4MIMA 2ATSA 3TCEA 5IM51 3A24A 2X1SA 4ZQMA 5DY2A 2B0MA 5G4EA 3M1ZA 2PCQA 1UCWA 2FPVA 2Y7DA 3OVRA 2J24A 3NYZA 4A21A 1TPC1 1LM1A 3GZ3A 1D3HA 3DFNA 4Z0JA 1FQ0A 1PHWA 4R34A 4NVTA 5CPOA 3T7VA 1V5XA 5EBUA 3QQ1A 4NNCA 5G2WA 3STEA 3DBPA 3WK0A 2FJKA 2A6NA 2DP3A 5HMSA 3LCFA 4IX0A 3FLUA 3UWQA 4WD0A 3T44A 4W9TA 3TROA 3UXDA 3VI2A 3W07A 4K37A 2I14A 1XKYA 2X16A 4O57A 4ADUA 3TA6A 2BX7A 3KXQA 4JTUA 1PL9A 3S42A 2V9DA 3OHIA 1Q6LA 1NVMA 1OFAA 5C55A 2VFGA 2J6XA 3T4CA 4Y9AA 1TPH1 3LHUA 5TBOA 1TMHA 3QM3A 1FY6A 3BLEA 1W1ZA 3LXBA 1GG1A 1EB3A 3LV5A 4NX0A 5FF4A 1W54A 3MO7A 2TMDA 2VEMA 2Z2UA 4IOTA 1TIMA 3NQDA 1ZNNA 1TRIA 1R47A 3C2EA 3CWNA 2ZTKA 3NO5A 3E9AA 5FESA 4S1FA 3GX9A 1KBIA 4GFSA 2CLEA 2GUUA 1KBJA 3ATZA 2NV1A 1YYAA 2GVGA 3G1DA 4O10A 3NQ7A 1DOSA 3DHFA 4WUIA 1CW2A 1L6WA 2ABAA 4AB4A 4WOZA 1D3GA 3BG3A 3W7CA 4E0CA 1E51A 3MI3A 3PWAA 3C2OA 5CZJA 3FKKA 1ML1A 4JTTA 3R13A 3B03A 1JRBA 2QJHA 1TPWA 3HGOA 4UMCA 1I45A 1DQWA 1YXDA 3U8GA 3P5ZA 4TMBA 3G1XA 4UTWA 1IIHA 1Q3NA 5F4SA 3W1XA 1KM5A 1X6UA 1JQVA 3BARA 1LBFA 1N8FA 5C54A 5AYXA 3P67A 1SQ7A 2DZTA 1JCXA 5FEXA 4BI7A 3HGJA 1WA3A 2QCDA 2YX0A 5J5DA 3CQ0A 2YZRA 3FYOA 5GVJA 1ADOA 3QPZA 5TQLA 3ABOA 3DU0A 1LP6A 1DJQA 4OHQA 3DZ1A 3B0VC 3ATYA 4IX2A 1H51A 4KWWA 3LCHA 3L5MA 3GR8A 4QQ3A 1QPNA 5D05A 5DXXA 1A53A 5FF7A 2AQWA 1W3IA 3NPVA 3GXNA 4EOUA 3INPA 2X2GA 4DQWA 4CQ8A 3NQAA 1T8XA 4JY8A 3NQ8A 4DO5A 1M7PA 4Z1CA 2E1DA 1VH7A 1K8XA 3LHVA 3W6YA 1JUEA 3QEZA 4DF2A 1WX0A 3HG5A 3A23A 3BW3A 4NXSA 5FEPA 4AMAA 3DKLA 3RF9A 4U28A 1EUAA 2RFGA 2CU0A 4IMEA 1ZALA 2JKEA 3GLCA 1EIXA 5AHNA 2YDAA 3L2IA 1M7OA 5K2ZA 3O1NA 3NQVA 4O11A 2VEPA 3DFTA 4OGZA 4P2VA 2JBMA 3KX6A 4GBUA 3TV8A 2NWSA 3W7IA 3W1QA 5I3GA 1R2RA 1IIGA 2ZYFA 2JGYA 4O8RA 3KHJA 1H7RA 4MY9A 1YADA 1P5BA 4CCCA 5A5WA 4KFNA 1KM3A 3TX9A 2XFWA 5KZMA 1LDCA 4GUGA 1VC4A 1VJIA 1BWLA 3WK2A 1JULA 1S5TA 3I65A 1SFLA 5AC8A 4BWLC 2QUUA 3LI1A 1OK6A 1TV5A 3P8IA 4ONVA 1QFEA 2WOQA 4PTNA 1YXYA 2A7RA 1TPB1 3Q37A 4LNYA 2WSYA 4Y8FA 3NGJA 5AHLA 4OU1A 2P10A 2V5BA 4YWIA 3THAA 4JS3A 4HNTA 4ZQRA 3LX9A 2FPTA 4O16A 1UASA 3O15A 4J9JA 3S0CA 2WSRA 3Q58A 3SGUA 3DH7A 1GQNA 4AWSA 5LNSA 3R12A 3WK1A 3I7SA 2ZZ3A 4POCA 4YLWA 5BRBA 5I3KA 3N2MA 5D2TA 4I7WA 4N9DA 3B04A 3QH2A 4XBSA 4JXCA 1YPFA 4UFIA 1WOAA 3QW3A 2QF7A 3UPBA 2G5WA 4UTTC 1T0OA 3PSVA 3MP3A 4AEOA 3ZR4A 1QDSA 4JTSA 4M7SA 4UXDA 2GVLA 1P0NA 2ZTJA 3F4WA 1ZENA 4BR1A 3TC7A 3L67A 4DEFA 3MBDA 3LRLA 2NX9A 3OVPA 1GG0A 4RX0A 1JCMP 3KOFA 4IPJA 3L66A 4UTJA 2B7PA 1JCYA 1EWEA 5AHEA 3S9YA 1R2TA 3PM6A 3RMJA 1F74A 1O5KA 2YXGA 1HUVA 3L68A 5LGXA 2ISVA 3NVTA 3W1MA 1G67A 1FCUA 4DF0A 5AC6A 4DF1A 2QJIA 1XBVA 3TQKA 5LHFA 4K8EA 1KFEA 1L2UA 2WO5A 2NV2A 1Y0EA 3JRKA 4O53A 4DPQA 2A85A 1GPWA 4WY0A 3TAKA 3QJAA 1ICPA 1WQ5A 1YTEA 4N6FA 2TYSA 5EPDA 4AAJA 1QO5A 3EXRA 1TPDA 3EEGA 4MFEA 4MJZA 5L6UA 5AYYA 2C18A 4Z08A 4Z0SA 4HT3A 1GVRA 5G2HA 2WQPA 3BLIA 4NUWA 3C0JA 1LOSA 4I7VA 3HPSA 3TNOA 3OIXA 2CLMA 4ALDA 1F5ZA 3E12A 1QCWA 4NJHA 4N02A 4O18A 1WOBA 4BI5A 2VEKA 5K9XA 4CNPA 4UUIA 3PB2A 5FF2A 4O1BA 3SY5A 3NDOA 5BNKA 2A2IA 4MZ8A 2TPSA 2WKJA 3BW4A 4LUJA 3THQA 3FKRA 3TDFA 2E68A 3FOKA 3IVUA 2NXGA 1X1ZA 5EY5A 4RZ6A 4UTHA 2QUVA 4BF9A 3ZWTA 2TRSA 1ICQA 1VHCA 3TQ0A 3W22A 3LCGA 5DCDA 4MKNA 1G4EA 4IQLA 2H3DA 3LHZA 1KM6A 2J9XA 4IPIA 5AOUA 1K8ZA 1KA9F 3C2FA 3NPUA 1YPIA 3MHUA 4ZQOA 1ZCOA 4Z1DA 5LZLA 4WJEA 2Z6IA 1KTNA 1DL3A 1ALDA 1SW3A 3QMRA 3M16A 2OX1A 4UFMA 3PBYA 3W7LA 2CLFA 2QKFA 2X1UA 4DO4A 3DFPA 3EWXA 1LLZA 3TW7A 3MWAA 3L0KA 5CKSA 3W2KA 3WK3A 1FXQA 3O07A 1F05A 4FNTA 2Q8LA 5FI8A 1CX9A 1RQHA 1OX4A 1R30A 2GVJA 4UTIA 1LZOA 4UNLA 4XBKA 2CLLA 5DLCA 3E49A 2H8XA 4MJMA 3EX1A 1NF7A 4M6PA 4CQAA 4IMGA 1VQTA 3GXTA 4ZQNA 2HS6A 4LWWA 1A50A 2C1HA 2YW3A 1TTIA 4PEKA 3N14A 4NNAA 1H7NA 3W2JA 1BTMA 1UB3A 2RKXA 4GUJA 1F76A 1I2QA 1G4PA 1Q6RA 3T40A 4JTLA 2W6RA 2B4GA 2VFEA 1FCBA 1OYBA 2UV8G 3MYPA 2OMAA 1Z42A 5F2IA 3ZWSA 3W1UA 1ZAHA 1W5PA 3H54A 3RLVA 3W7EA 1JRCA 3O6CA
chains in the Genus database with same CATH superfamily
4I8YA 3H21A 1C90A 1VGAA 3C3NA 3VOCA 4IPNB 1G7UA 3FGCB 1FKWA 4IG2A 3OODA 4GX9A 3ZZ1A 1H3GA 3IVSA 3HQOA 1RR2A 2EF9A 3GZAA 1JDEA 1VPXA 1XFBA 4UZUA 4F0HA 2XM1A 3W9ZA 4EAYA 3LS9A 5LSMA 3MSRA 1JD9A 3P2VA 1VLIA 2PBOA 3JU2A 5AY7A 3GE7A 3G2GA 1ZAIA 5LIXX 3VNKA 4MAVA 5CBJA 5D03A 3WQ4A 1REQA 3HJZA 5LNRA 2ISDA 3E6EA 3GG0A 1LL6A 4QS5A 3CL7A 3ES7A 4LYQA 3TH6A 1DHPA 3LTPA 1AVAA 2PRLA 2CLIA 1E40A 2WSQA 2ZZ4A 4WGXA 3MB9A 1BF6A 3CTLA 3P61A 3N18A 2YYUA 1TZ7A 1X6NA 2R14A 5JBEA 1GZGA 4M1BA 2VQUA 3VX1A 2C7FA 4JR5A 3S2CA 2TSYA 1KGWA 1OFBA 1RH9A 3SUWA 2W0UA 4FMVA 1NWUA 3SIZA 1CBGA 1AG1O 3RM4A 4Q4PA 1L6SA 3C52A 1VJSA 1XR2A 5FSDC 1JUBA 2PEVA 4QRNA 1AJ0A 3E2QA 3CZJA 1ZJAA 3TNBA 3GDRA 1W1B1 1HN1A 4O4WA 1KM1A 2FB2A 3QLDA 3M6YA 3H55A 3SUTA 4R27A 2NQZA 4HPNA 1PCWA 2XH0A 3VD7A 2GSJA 3R5EA 3K4DA 2IKHA 4FR6A 1QI2A 2VWSA 1XJBA 5M5DA 4PZVA 4Q8WA 1US2A 2XFFA 4Q8PA 1CCWB 2BXYA 2B81A 4REQB 3E0WA 3KBVA 3T0CA 1HJVA 1OT2A 2J7BA 1QW9A 4MYXA 1IXNA 3W71A 1ZB5A 4JFTA 2DEPA 2BS9A 1C93A 1ME7A 1VHNA 2I57A 4A3UA 2VELA 5C9RA 1YW1A 5EFDA 3LHTA 1ESWA 4EVZA 3AI0A 4JIPA 1DVJA 1IV8A 3L2MA 3WQPA 3B9DA 2J7FA 5E9AA 1O66A 1TO3A 3QXBA 3A12A 2D69A 2Z0IA 2PP1A 1LUCB 3F1QA 3E5PA 3MY9A 9XIAA 3BLOA 4JY9A 1Y5WA 2VX5A 3SN4A 3N4AA 4C7FA 1C91A 2ZXAA 4NX5A 3S4TA 2QGYA 3JZUA 3M5XA 4C7DA 1CT5A 3AU6A 4C1LA 1LRNA 4RK8A 4TVCA 2BV9A 3RRAA 3AWOA 3N9SA 1IT7A 3CH0A 1OX4B 1R3WA 4QEHA 4W5UA 5J5RA 4C1NA 1F3XA 5I03A 2XN0A 1VFUA 2YJQA 3AAMA 3AIQA 2EBNA 1KLZA 3COTA 4UQCA 1RCOB 2PF8A 3GBDA 3TYBA 3AHZA 1EHAA 4GZ7A 3LHWA 4NJGA 2R91A 1W1TA 3QV6A 3MBFA 2VEFA 4NZ3A 4S2CA 2PDJA 1FP9A 1PE1A 2PGWA 1RAKA 3PK7A 5HAOA 2J79A 2QR6A 1E4NA 1DIOA 4BF5A 2BZNA 1JXKA 3OOQA 4A8LA 3N1AA 2D73A 3WNKA 4W8BA 3UWWA 2UY5A 3R0KA 3PUOA 2SFPA 1MFVA 2ZKMX 3UG3A 3GDKA 4CU7A 1XIJA 1POKA 2E5BA 4L1GA 2QMKA 3CIXA 3XINA 2A3AA 4EACA 1Z41A 1BVZA 5U4NA 3I6RA 3DFQA 4C6EA 3CUGA 3GXMA 3SUUA 2VFIA 5M3WA 4JTJA 3II1A 3LLXA 1TSIA 1E1CA 4KFPA 3G0UA 5I6SA 1XWYA 4ECLA 5KMYA 4NILA 3SRKA 1OFDA 3ALFA 3W26A 2HSAA 4GZEA 3DXIA 3TE9A 3T0BA 4QCFA 3G77A 4HSNA 3MW7A 1LWIA 3P93A 3W2UA 4O14A 3IJDA 2POTA 3TTQA 4Q4OA 2E25A 4TMCA 1QHZA 5D8ZA 2QJNA 1MYRA 2FPYA 1VEOA 5H2ZA 1XYCA 3OQ8A 3TYCA 1CYGA 3IIXA 2ABBA 1DYSA 1FCQA 2QVNA 1UZ4A 5BMXA 3O9NA 4YL2A 4C90A 4L5ZA 4GISA 4C6JA 3A9BA 3HOJA 3CH9A 3WJXA 2EHHA 2P50A 4JPGA 2O7SA 4IIGA 1PUDA 2W91A 4LRSA 3NNTA 3WSUA 1LBMA 4JHOA 4TTGA 1XHGA 4IH3A 1RD5A 4J4KA 4FLRA 4NKCA 3E5BA 1HT6A 1R38A 3GFZA 1TPFA 3GTHA 3T8QA 2FMOA 4AXKA 3OA3A 1A5KC 2WAGA 2ZA2A 1A5AA 3KOXA 3RXZA 5KTLA 2ALDA 2O9OA 2VENA 2V68A 1WYIA 3NQBA 1Q6FA 3QQ0A 4PE8A 5FA5A 1ECEA 2QNEA 1JZ7A 3O3RA 1JZ5A 2RDXA 2PE4A 2W79A 3VD3A 5PTDA 2E7FA 3VGBA 2X40A 2A3EA 2V6AA 5CZ0A 3UW6A 3Q2DA 1OC6A 1WKEA 3AMKA 4UB9A 2OWXA 4DPPA 4GUHA 5CEWA 3UT0A 3CUZA 1PAMA 2Y5JA 1UUMA 4IGHA 4LW7A 3ZT5A 5CH9A 1JZ8A 2E0PA 4IGNA 3S1VA 1SMDA 1XCWA 4KPLA 4RCXA 3IJ8A 3CPRA 1O12A 4ATLA 5IOBA 3LPPA 1GOWA 4NRSA 4IMCA 1S46A 2CC0A 2DVUA 1V6XA 2QQ6A 2J77A 2IKIA 1C7SA 3E0FA 4JTAA 1NDVA 2QCHA 3LGGA 4DNMA 3WG6A 3AYTA 1PIFA 3NZGA 4FXFA 5FJPA 3ZLHA 2Z1WA 3TMQA 2PDXA 1UD3A 1VCGA 1H62A 1XYLA 1YX1A 3CL6A 2WC3A 1K9EA 2VC6A 4KW2A 4OWGA 5A95A 5DELA 3AHYA 1T8QA 3GNXA 2QDHA 4UFLA 2HTMA 1W3TA 1B3XA 1OHLA 4J2PA 2YCLA 1ECQA 3MSYA 4Q4MA 1NTHA 4UTTA 5G4WA 1U5HA 3WF0A 4UTWC 1YHTA 4O17A 3SI9A 3SO7A 3CV2A 4M80A 1A4MA 4QITA 4JGDA 1W56A 4CNTA 2GUBA 3VDAA 2ICSA 3IRDA 4UBPC 1PZ3A 3LPOA 4R85A 3QZEA 1W5MA 3R11A 1XIBA 3DHUA 2OT0A 2REQA 2DZSA 4KRTA 1S2UA 2OODA 2A0NA 4H6QA 4Q6XA 5KINA 3DHDA 1VZWA 1V3LA 3B3DA 4AC1X 5MHBA 3QRHA 1A5UA 1EJRC 1GWJA 3PPHA 3AHVA 1V93A 2E8ZA 3QN3A 1BRLB 3WIJA 3WCZA 4A05A 2HS8A 1JUKA 3LYEA 2G4FA 5G2IA 2R1MA 4XVEA 7XIMA 4LVFA 1EOMA 4GI4A 1YDOA 2EAWA 3TZNA 1CIUA 2J47A 5HINA 4B4FA 5I77A 3UYCA 2FZBA 2QZRA 3NXFA 4HMEA 4S2BA 3GNDA 4IXXA 1D8WA 1QR7A 2Y70A 2BVWA 2P88A 2GZXA 5BW6A 1ZZMA 1ZS2A 3CO4A 4GUIA 4Z17A 1P0BA 5DT5A 4IQJA 1HGWA 5D04C 4NF7A 1IEIA 2V82A 1B31A 2HRWA 4F40A 5HQEA 3PY2A 1XW8A 1IQ8A 3C86A 4AG0A 1SSGA 2QUTA 1V0MA 4XD5A 1VIZA 2WJEA 4GBDA 3ZMRA 5K9CA 4HPXA 2YA0A 1E4LA 2R1PA 2ACRA 3QF0A 1P6CA 2YDRA 1AL7A 4Y2WA 3B0XA 1GJPA 4G56A 4M0XA 1W9XA 2CZDA 1H0GA 2G3IA 1VKFA 1I8JA 2W92A 3ITOA 1YDYA 3A13A 3J7HA 4L6OA 1H5VA 4E4PA 2Z1VA 3WJSA 1PS9A 4KT2A 2A21A 4AZ7A 1XUZA 2INZA 2HNEA 1HX0A 3GXFA 1OADA 3HPZA 4MVAA 4LUYA 5DN1A 3VGGA 1OT1A 3MCOA 4GYFA 1JVNA 1V08A 3CLMA 2XIJA 2Z1BA 3RK8A 3TP4A 3MDUA 3AMDA 1XIHA 1ODZA 4N4QA 5MKGB 5FD0A 1NAL1 3GXIA 1ELSA 3G1VA 3ME3A 3N4EA 1FFQA 1PSCA 3W7RA 3C3UA 4JICA 4ZOCA 3TXVA 3T2PA 2PC8A 3PTDA 1I1WA 3O16A 3LLDA 1Q45A 4J3ZA 3WH7A 3N3TA 1KWGA 2OFJA 1Q7ZA 1XBXA 1XCXA 3WZ0E 2ZDSA 4GE8A 1SVDA 4HCLA 3LRMA 4JFVA 1MMFA 4PL2A 5E5CA 3W73A 2W3ZA 4MMWA 6TIMA 1GORA 3E0VA 3OQEA 3A4AA 4JTIA 1P43A 4RR4A 4AH7A 4AVFA 3HG2A 1J79A 3B8DA 3QR0A 2PDYA 1W9VA 3NEVA 3ZJ7A 1SFJA 3CUHA 2ZOXA 5EKYA 5D33A 5D4YA 2B7OA 1BD0A 4CN1A 4UR9A 4O0KA 5AHIA 1F6PA 4AD4A 4F9JA 4O52A 1A80A 1BLIA 1TQJA 2R82A 3A21A 2GFTA 1UZDA 1TRDA 4XKYB 1GQLA 1VYSX 3PN8A 1E3ZA 4UQDA 5ABFA 2G3FA 4KF1A 1XGDA 3RMEA 2A3LA 4XK2A 4U33A 4EANA 3JR2A 4CU8A 4NZFA 3QV7A 4DO7A 2DY3A 2AOSA 4RNJA 4IISA 4E5TA 4CQBA 3LM7A 2PTYA 1E9IA 2E28A 1Q6OA 2OEJA 1UHVA 3DGRA 3A4JA 1OX6A 3IUIA 4H9ZA 1XV8A 3WMLA 3G22A 3Q94A 1IHIA 2RDUA 3VE9A 2Y1HA 5A6JA 5F2LA 3ITTA 4M5PA 5IDZA 1GVSA 4ZO9A 2JKPA 3GAKA 1OSEA 3WQ5A 1IXOA 4GG9A 2CESA 1XLCA 1SO3A 4ORIA 5HULA 4AX6A 4GC3A 1L6YA 3EKLA 2DUXA 1BSIA 3PAJA 1EL3A 1GVQA 1M65A 5T91A 5ABTA 5JIWA 3F4VA 1TUFA 5E70A 3UJFA 4P61A 1A0DA 4ZXOA 4QNEA 2FVLA 2Q09A 3ITXA 1PTDA 2WMIB 4C5ZA 2Q71A 1W5QA 4GABA 1NDZA 4KEVA 1CLVA 4AD1A 3VIJA 3WH6A 4H04A 2YYTA 1V6UA 2R1KA 4H4IA 3M0MA 1QOXA 2ZIDA 3WQDA 4QCEA 3CO8A 3EMQA 1PIGA 2X30A 4OFCA 3H7RA 2ZRYA 2Z1XA 1SGJA 2Y5SA 4QSFA 4LF1A 2OSXA 5FJTA 3S6DA 1EZ2A 2OWWA 4GXMA 3T05A 1VFLA 1SW0A 4C6BA 1K7XA 2HZGA 4L80A 1X7IA 3ABZA 4Q4KA 2EJ1A 5CSRA 4EAMA 4UQEA 4K7YA 2C19A 1JR1A 2C3ZA 1ISVA 3F5LA 1QNOA 4DJDC 4O13A 5HR7A 1DJXA 1YE6A 2E6FA 3W1PA 3TFCA 3N17A 1QHOA 4LS0A 4N42A 1J10A 4F8XA 1LL7A 2V5LA 2OZ8A 4MWAB 4NZJA 5C2GA 4GJ1A 1WKYA 4AIUA 1PYFA 2BHZA 3RR4A 4REQA 3QMTA 5HUOA 1VCVA 3GC2A 4XQ6A 2XFRA 3WLHA 1K9DA 3U7VA 3HPXA 3BC9A 1MVYA 1GOOA 1OG6A 3TC6A 3PBUA 4ZE4A 1FTXA 2BVTA 3KFTA 3UJRA 2CFFA 3E0IA 4TU1A 3S1GA 2PUZA 1XF0A 1YXCA 1MXSA 3G5EA 5FAGA 4BK9A 2BXZA 4MZYA 2ZUNA 4WDTA 3PF3A 3NQMA 3MP4A 3OLEA 3BO9A 1F6YA 4W7UA 1JZ6A 4A3HA 2VD8A 1KFCA 2DIEA 3BL3A 3QV9A 4N9CA 3S5OA 1K1DA 4BWLA 1UWRA 2YLAA 9CGTA 4GACA 3W7KA 2VCBA 1TQXA 5CZSA 3TEVA 9RUBA 4H6KA 4HA0A 4RDWA 1SW7A 2WVUA 3CHVA 4FP1A 1XQLA 2OOFA 4YYFA 3MDWA 3QTPA 4OKDA 1FWWA 1H09A 1SR9A 7A3HA 2VZTA 1K4GA 5A6KA 2D3NA 2Z1SA 4JBRA 3OIHA 3DX5A 2O56A 1L8PA 3GKAA 1JDAA 2FVMA 3F2CA 1YNPA 3IIVA 4AD2A 4XD3A 3WQVA 1JF6A 1QOQA 5AC7A 3L4VA 3KW3A 4AD3A 2E5DA 2QDDA 2XN2A 2AGKA 3BAKA 4E38A 4PFHA 3BAWA 3NYDA 4K38A 2BGNE 1GVOA 1EA9C 2OQHA 3MHGA 1X8FA 4E4FA 2EPLX 4QBXA 3L2LA 5BXTA 1UKTA 3SURA 3W2NA 1JYWA 4QISA 1RCXB 3PUDA 2V5CA 5A69A 4FLQA 2VL4A 4LBSA 3RNDA 3LPGA 4MNMA 4WGHA 2DZVA 1LOQA 1AZ1A 1F2JA 1FX6A 1UOKA 4G6CA 1GT8A 3UWZA 4EF9A 1OX5A 1EWDA 1SSDA 1V6YA 3RPTA 1CXKA 4Y9OA 5C2CA 1MUCA 3FNDA 1ODUA 5CGTA 1HVQA 4NYYA 2QDGA 3VU2A 3Q65A 2I5QA 2ISSA 4FK9A 3H7VA 1GYNA 3W7JA 3QZAA 4UFJA 1EX1A 2OEMA 1V6WA 5KZDA 3RJXA 2X2YA 3UP8A 3KAOA 1JD7A 4LCQA 4RE0A 1W91A 1GGOA 3W70A 4OQVA 5TNVA 3WLTA 4ZQMA 3HQPA 5DMMA 4IIBA 2J24A 4EWJA 3ANUA 2Z1KA 1M7XA 4GQBA 4EE9A 1PO9A 2OLHA 3QHNA 1FQ0A 4R34A 5FSEC 4JAWA 1KRCC 4PUUA 4JTDA 3T1GA 3RJYA 3XIMA 1Q5MA 4PCNA 2FJKA 4PMYA 4IX0A 3UWQA 4WD0A 1RP9A 3DG7A 6XIMA 3T44A 5ECVA 2X16A 1S5NA 2BX7A 3SRDA 2VR5A 4ATWA 1PL9A 5FJOA 1U1HA 1V02A 3GHUA 4LUTA 1GOQA 3MJMA 1OFAA 1R86A 1RHCA 5FJJA 2GDVA 1VP5A 4RUBA 1GG1A 3LV5A 4NX0A 5FF4A 5MF5A 2XSAA 3EWDA 3SQLA 2Y8UA 4QX4A 2GGGA 1E6SM 2P8CA 2J74A 5FESA 1KBIA 1EBHA 3ARSA 3K4AA 3URNA 1XLBA 3ATZA 3G1DA 1JZ4A 2WZIA 3AQUA 1PYMA 1A4LA 1CW2A 3PJUA 2ABAA 1SFTA 2VMFA 4F66A 3T9PA 1X96A 3BG3A 3W7CA 1A0CA 3K2GA 5CZJA 3FKKA 5FJUA 4JTTA 5A2CA 3AHTA 4E3VA 1TPWA 3IUHA 3U8GA 4S39A 4TMBA 1RJRA 3CASA 3WYZA 1Q3NA 2WZTA 1S2CA 3GUGA 4IL0A 3AS2A 3BARA 2Z2AA 3DC0A 4AQLA 5AYXA 3P67A 1B54A 1TG7A 3UG8A 4PMVA 4MDOA 1E0XA 4QHRA 5GVJA 4GYKA 2IPWA 2OX4A 3QPZA 3DU0A 1FWIC 1F4AA 4OHQA 3GM8A 1MDLA 2BOEX 2XIQA 1B3YA 3LCHA 1QPNA 1POJA 3HJEA 1OM0A 2AQWA 1UW9A 1W3IA 4DWSD 2X2GA 4IP7A 4HMCA 4U31A 5F7UA 3CTTA 2OU4A 2P8BA 4J3XA 7REQB 3KBWA 2HPMA 4EPEC 1M7PA 2E1DA 1K8CA 3VAVA 3VA8A 1WX0A 3GG1A 3QQWA 3A23A 3HPFA 4AMAA 3A64A 3DKLA 4B5UA 4U28A 4LF2A 2VJXA 4I5UA 3CWHA 5K2ZA 1J0HA 2OO0A 3SEPA 2VEPA 2E9LA 3EOSA 3ZVHB 3H2OA 3KX6A 4GBUA 7CGTA 4F0KA 3W7IA 4BJHA 1UKQA 4QE1A 5CQ1A 4WLCA 1IIGA 4J28A 3VO0A 2HVOA 2JGYA 5JIPA 1NQKA 3UVAA 2WHJA 4MB4A 4CCCA 5A5WA 4MJ2A 3SFWA 3KOYA 4Z2GA 3APYA 1JULA 1WDPA 4U2ZA 1QTWA 5H1WA 1W9PA 1JDDA 2IMRA 2QUUA 1EHNA 3P8IA 4ONVA 1QFEA 2WSYA 3NGJA 4NAFA 5AHLA 4PYSA 5AVNA 1XDJA 2FPTA 4O16A 1UASA 3S0CA 2WSRA 4U5IA 1KGXA 2I5GA 3I7SA 1BRLA 2P3EA 2PODA 3GNRA 4POCA 3MMWA 4YLWA 3HV8A 3QKEA 5A6SA 3BAYA 4I7WA 1OWQA 1YPFA 5C8BB 2QF7A 1E6QM 4B9ZA 4GH1A 1JNEA 4UTTC 2PU1A 1EH9A 4AEOA 3WLQA 1VRXA 1SFSA 3WQ6A 4M7SA 3LG3A 3UPMA 3F4WA 4WKHA 3NEHA 3WENA 2BY0A 3OG2A 1M01A 1GG0A 2PD9A 4XB3A 1F3TA 4IPJA 3IS4A 5FJRA 4UTJA 5HANA 1T7LA 2B7PA 1M53A 3MUIA 3TOPA 4FZIA 1F74A 3VCNA 3ARXA 5LGXA 1B0IA 2ISVA 2L5HA 1G67A 1DIKA 1W3LA 1CWYA 4H6EA 1XBVA 4PMXA 3VNIA 1KFEA 1L2UA 4E2OA 2NV2A 3RO8A 1QW8A 4CUCA 2CXGA 2XZ9A 4O53A 5D9MA 3E2SA 5HJXA 4DPQA 3SY8A 2VEGA 3TYEA 3I3EA 1GKRA 2HK0A 3R8HA 8XIMA 1EO5A 2CXEA 3EEGA 3UXKA 4ZODA 4XSLA 1JF5A 1KXVA 1GVRA 1Y8BA 2WQPA 5E0FA 1A3HA 3BCFA 1KCXA 3C0JA 4MB1A 5J04A 1ZL1A 4O1FA 3HPSA 2PWFA 3TNOA 1GUVA 1TV3A 3OIXA 3HV9A 3FAXA 1F5ZA 4PMDA 1EJTC 4NJHA 2DSKA 2VEKA 5K9XA 4CNPA 1TA3B 1N8IA 4LNCA 2XU2A 3RYSA 4V33A 3GVQA 5FF2A 1AUSL 1GQJA 4PUNA 2E40A 1IZJA 2NXGA 2DSWA 4RZ6A 3FXYA 4UTHA 3WFZA 4NYUA 3P14A 3W22A 4A8RA 1CGWA 4PUMA 4ZEPA 3S83A 4A4AA 4IPIA 3WD3A 3TYAA 4CU6A 1K8ZA 3D3FA 4JIRA 4C6QA 3AHXA 4L64A 4ZQOA 1ZPTA 1AA1B 1AJ2A 3AMGA 4IQEA 3PTMA 5LZLA 4WJEA 2Z6IA 1E0VA 3QMRA 3DC8A 3S6OA 2OX1A 3PBYA 4IQDA 4R7WA 3PJTA 2BHYA 4HP5A 2ACSA 2X1UA 3LY0A 3W2KA 3WK3A 1FXQA 3KZPA 1F05A 3CS2A 2PWEA 5JMUA 1HKJA 1RLCL 1VFSA 2GVJA 1LZOA 4UNLA 1JZ2A 4UOQA 3EX1A 1NF7A 3TTEA 4CQAA 3M7SA 4QLJA 4G1NA 1ISYA 1VQTA 2Q02A 3GXTA 1NP2A 4PRTA 5D9NA 1CGTA 2YCKX 1H7NA 4B5TA 3FDGA 4GLEA 5A6LA 1I2QA 3SN0A 3M0IA 2WWDA 4GPNA 5CZKA 5IDIA 5IHRA 1OYBA 2OELA 5DO8A 1Z42A 3QY7A 5ABHA 4JOMA 1QJWA 3ISIX 4GQGA 3RLVA 4C6NA 3W6LA 1JRCA 4JTCA 3O6CA 2Y8KA 2P76A 1AL8A 1ITQA 4PL1A 4OECA 1KR0A 3OBKA 3WL1A 4U3CA 3L5AA 2V3DA 4JCMA 3VINA 1IXQA 3IANA 4P7LA 4WZHA 3QOMA 4R7JA 3OP2A 4A22A 5EA9A 3GU2A 4UMBA 4Q8TA 4IT1A 4ZBCA 1R85A 2FZNA 1GOMA 4D2JA 1XBYA 2QXWA 2XM2A 4BY3A 1V03A 1R2SA 3PZVA 1DWGM 1V3HA 3DG6A 2ZX5A 2Y24A 3W82A 3G8EA 1V0KA 2DT3A 2XWEA 4X2RA 1U5VA 3G1FA 4IPLA 1TWWA 3RRXA 2XUCA 3UU0A 3PG9A 4BQ2A 2WMGA 2FH6A 5LYRA 4IGMA 4WY0F 4DELA 1QO2A 1R46A 3W4RA 3THDA 4W93A 4O12A 3PPCA 1AD4A 4WF7A 5K9DA 3ITGA 1Z7AA 3EX6A 4PUEA 4LS2A 3MMTA 3TXZA 4AEEA 2ZRXA 3PZIA 3W27A 4CD5A 3QR1A 6ALDA 1GTHA 3TYZA 1XLKA 2WPGA 4OV4A 3DFYA 1R9YA 5TD4A 2JQXA 5LGZA 1EJ7L 1W3HA 2DJLA 1GOIA 3TTYA 5A6AA 1GVEA 3BJFA 3WJWA 1TWIA 3GXDA 4DJFD 2XZ7A 3C4UA 5AHMA 5K3VA 2EPKX 2OZ0A 3B4YA 1F3WA 3T2QA 4BKNA 4BS0A 1BKHA 3R58A 1UA3A 3EMCA 2BHUA 2VXNA 1FA2A 3NA8A 1JAEA 1KM2A 3ABRA 3T07A 3PJXA 1LWHA 1OABA 3BUVA 3W84A 1IGSA 4L9XA 5D38A 4MWAA 5A2AA 4IUGA 1TMQA 3U0HA 3QPEA 3N6QA 4HSOA 4HBKA 3ZJKA 4P7QA 2JALA 5K7JA 3UZ5A 3UETA 6A3HA 4XD6A 3EPNA 2J8FA 3W1TA 3P84A 5HNRA 3TR2A 1G7VA 4PTXA 2DZAA 4AC7C 1EOKA 1EFZA 1GHRA 1RALA 1L0PA 1QI5A 4CKQA 4MTVA 2EQDA 3FVMA 3NGFA 4LOCA 2WVVB 3OG3A 2Z29A 4EWND 2V5DA 4AD0A 1KWKA 4UCFA 4ZL1A 5HWJA 4HU3A 1TKKA 5G4HC 3WDIA 1B2YA 4ICCX 3T0DA 1SPQA 4AY8A 1VCFA 1TMLA 2QPSA 3CV7A 3OLIA 2UY4A 4R9OA 1A47A 1IEWA 4JQ2A 2J75A 4WR3A 1HZYA 4KFOA 3OZYA 4X60A 1E73M 1NWRA 2V5JA 2X41A 1UP2A 2WLYA 3LV6A 5AC4A 3IGXA 2WHLA 2IPGA 4UOZA 1WDWA 1KM0A 1XD1A 1NF0A 1H63A 4QAWA 5LHEA 1XICA 3HA1A 4IF2A 2FHFA 2O4MA 2QHAA 3BLFA 3GTFA 1BXBA 3R10A 5T8GA 1TZZA 3G0SA 4IIDA 2Z25A 3S1XA 3AYSA 5TIMA 2PP0A 3GHSA 3USZA 2BGQA 2D3LA 4GZIA 2OOGA 2NV9A 2A7NA 2QAPA 2VOTA 2PGFA 3K4WA 2OG9A 4DO6A 4MOZA 4E8CA 1BHGA 4NQ1A 2OVLA 2RH9A 4B3ZA 5GJMA 3AFBA 2C16A 1UP0A 3KVMA 3N2BA 3B06A 1EF3A 3ZFHA 1V3KA 2ZRZA 2XDFA 1QNQA 2EPHA 1MDRA 1N2VA 2QF8A 4GC4A 2OGYA 2Z27A 4N9EA 1QOPA 3GNNA 3KL3A 3MI6A 1TPEA 2YFOA 1U1JA 3BAXA 3WQEA 2FZ9A 3WF1A 5HJYA 1J2BA 3SJNA 4DJEC 3ANYA 1S39A 3W1LA 4LY4A 4LUIA 2X7VA 1GZJA 5I5RA 3NDYA 1EC8A 3I6TA 1J93A 3S5NA 4AHQA 3FYPA 4DHGA 4KWVA 1AK5A 3WJYA 3NL3A 3G0XA 3TTSA 4NU7A 2VZVA 1E6XM 1FWTA 3K8MA 1XM3A 4US5D 1DWIM 5CCZA 4ZOAA 4ZFCA 3NQFA 3UCDA 5CXPA 3CUFA 3TJ4A 3WLPA 2CITA 3E96A 3K13A 2PRMA 1BKSA 3GDLA 4MKSA 3OVGA 2QCEA 4XO6A 3FJ6A 3T6CA 3VNMA 1Z48A 3W02A 1LF1A 3NO3A 1JJKA 4OZOA 1NU5A 1NIUA 3RX3A 2PDCA 1AD1A 4WJXA 4EPBC 4WXYA 3G6MA 1DJHA 3BH4A 3CU2A 1Q6QA 3STGA 5CSUA 4M6UA 3E38A 6CGTA 1ZGDA 3KEHA 4ZENA 3SDOA 4H9XA 3O06A 3BV4A 5B80A 5HA7A 1ZLPA 4Z2IA 3G24A 3D6NA 3H12A 4I90A 3ZM8A 1BVWA 5CLTA 3OYXA 5D2WA 3ZT7A 4S3DA 3BANA 3B05A 1BYAA 3GIPA 4PH6A 4DX3A 2R1NA 3N13A 4H7ZA 4Y96A 2WMKA 1K02A 4ZXLA 4JYFA 1FWHC 4ORMA 2R94A 1GCYA 2VUNA 3G1AA 3M5YA 4U3AA 1HVXA 4K6AA 4PCSA 1KKRA 2OJPA 5XIMA 2CZFA 2ZDRA 3KRZA 1JXJA 1VJZA 1ZHAA 1MEIA 3DDMA 2D20A 4GYJA 2IW0A 3DFOA 1E15A 3UXAA 2XIOA 1DTUA 3CIVA 5BYWA 1Z8AA 1M3UA 1UD5A 5FF0A 3UNTA 1XLLA 1YPXA 3PSWA 2XINA 1SO4A 2E77A 3URAA 4AVOA 3SFKA 1DP0A 4O1DA 2ZXDA 1TV7A 4PMOA 3UA4A 4L4PA 1RQBA 3LXCA 3UWUA 2C0HA 4DLFA 1RY0A 3W81A 1GKPA 4GNJA 5AECA 2GJXA 4DUXA 1R0MA 3CEPA 2QV4A 1CGXA 1DKWA 3VNZA 3CEUA 3PZUA 4GA8A 3T09A 3F2DA 3P3BA 4QM1A 4H7CA 1WAUA 3V0UA 1E1FA 3ZJ8A 1I60A 3M43A 5FOOA 2EG7A 1O5QA 5BWAA 1SO6A 1IT0A 2ZVRA 3HGRA 3NL6A 4LC6A 5EB8A 3PNUA 1Y7VA 5AZ0A 3IJIA 1QWKA 1UIOA 4AWUA 2JKAA 4IHCA 3B4UA 5JUVA 5D9OA 1LG2A 4PODA 4F48A 3CAKA 3NQCA 2GLKA 4LYPA 4Q32A 5AN7A 4PB4A 1G4TA 3W37A 2OWCA 4Q4QA 3RU8X 3N19B 2WCSA 8XIAA 4DZAA 2BNJA 2ZE0A 5LA0A 4DAFA 1UKSA 1H7XA 4ZB2A 3FCPA 4WJ8A 2VR2A 1QK2A 3NTYA 1PX3A 3GG7A 3WELA 1FHVA 3BTNA 3W74A 4O1AA 1H1ZA 4GGBA 4KKXA 5I07A 5ABEA 4FX6M 3EB2A 5HPOA 1D8CA 1JAKA 1EX5A 3UPWA 4UTLA 4B4HA 4DUWA 3M0ZA 5BRPA 2C1GA 4S3CA 3THUA 2XG9A 3ZVHA 2ZCGA 4PTMA 2O0TA 4ZA0A 3R94A 1TJPA 3WBYA 2H90A 1HL9A 3AMLA 3RCNA 2X05A 2AKZA 1QI0A 3C2VA 3NOYA 4GNKB 4QP0A 4Q8QA 4YPJA 3EKGA 1ZFJA 2X0HA 2ZICA 1Q6GA 2PF0A 1SUXA 1TB3A 4I7UA 4ROPA 1N8WA 4HNNA 3WBAA 3BGAA 1JCTA 3ONCA 1DHKA 3BCDA 5HQLA 2CLHA 1C8VA 4QROA 5FEWA 3VUSA 4FF7A 2VWTA 5HNUA 3FEMA 1OFEA 4DZIA 1E1CB 4AW7A 2XH7A 3QC0A 4F9DA 3CWOX 3F2BA 3KP0A 2FQIA 4PTWA 4NI3A 2PZ0A 1LTDA 2EPOA 3FHQA 1VR6A 2Y8VA 4NASA 2HK1A 1B4KA 1FDJA 3OBEA 3VZXA 2WKGA 1U2YA 1ONRA 3LXAA 3UZWA 1XXXA 1BWKA 3IIPA 4OUEA 3AXIA 3DECA 3SCTA 2OTDA 3DAQA 4IZGA 1VIWA 4JN7A 3AO0A 1GNXA 4ZOBA 4TX6A 3WLSA 3IUDA 4L65A 3LCXA 2OXNA 1YNYA 3CBWA 3DKJA 3EBVA 4FX8A 4WDXA 2XTKA 1JL8A 3E2VA 4GKLA 2DT0A 3EWWA 2OO6A 4HZ8A 1KCLA 1J8VA 3GYCA 3OVQA 4UZSA 3CYVA 1YLVA 4WY0B 4Q8UA 2CKSA 4IP4A 4LGXA 6REQB 3LBCA 3KBSA 4Z2LA 2ZA1A 3MVTA 4HD5A 1OYAA 1Q13A 4H8NA 1UA7A 2DW7A 3E2RA 2G96A 1OG0A 4KCUA 5HJLA 3APTA 4BCEA 2YFNA 3CC1A 4LRTA 4KQNA 3B8VA 2PGEA 1TR9A 1LG1A 4JN8A 1DEDA 3S46A 1BXCA 4TUFA 3DFHA 4L61A 1C3FA 1HG3A 5KITA 4M24A 3SSJA 2A4AA 4D9PA 3PFRA 3WUEA 4GWEA 1TA3A 4Q4RA 3N73A 2H9AB 1B3VA 3V0SA 4AHPA 1JI2A 3USBA 3R4IA 3GK0A 2YCIX 1K03A 1D9EA 3RM9A 4IJRA 3CM4A 5HWNA 3U5UA 3QSRA 4HN8A 3SCWA 1MZHA 1QVBA 3B9EA 4UFHA 1OK4A 3W7PA 3K8LA 1J0KA 1XDMA 2X42A 4H8VA 4AY7A 1PBGA 3MMDA 2RDTA 4N4PA 2FFIA 3T08A 1VFHA 4IMDA 4QDPA 5U7SA 1IR2A 4LB3A 2QCFA 5CC3A 3BZJA 2QCCA 2C71A 2VQTA 3PWGA 2ZC8A 1ZY9A 4C6DA 3UJ2A 1KV8A 4KESA 5I3HA 2YBVA 3OYZA 4MZ1A 3GDTA 1WE5A 4Q7BA 1K4HA 3M44A 4WOQA 1E3XA 2VZSA 1KM4A 1DPMA 1X7FA 3W6MA 3M5VA 3UZJA 4CD7A 4O8AA 3WN6A 4H9MA 3ARYA 2BTMA 4AF0A 3SM0A 3F03K 4CCEA 1XLHA 4LEQA 3V5OA 5JVLA 4DWSA 2ZC1A 3BQ6A 4WX2A 3R2GA 4D6FA 4NL1A 1Z6KA 5DCBA 3CPUA 1LQ0A 1N7KA 4FO4A 4EXAA 4WRHA 3QYQA 1V6VA 3PZNA 3KWXA 1K9FA 2CHRA 1A5CA 2I9UA 4INFA 4MYAA 3AYRA 1W9DM 3FXGA 4UNKA 1MW1A 3ALGA 4RXGA 3NURA 2C91A 3A3WA 3WNPA 2ADAA 3LHYA 1T99A 2ZXBA 3HIJA 1IZKA 5EL1A 3VZZA 2O4QA 1F8MA 2ZRUA 3EDEA 4QGCA 3W2LA 3ARWA 1XUUA 3FFSA 4KH2A 4O1CA 3HTWA 1DXIA 1VBJA 4YJ5A 5G1YA 1PX8A 1S5VA 4Y8EA 2VGFA 4ZQPA 1EF2A 3WBXA 4IIFA 4RXFA 3LD5A 3UERA 4ZZ9A 5M2FX 1J5SA 4G7EA 2W67A 4PFMA 1MRAA 4FEZA 4IXHA 3V1HA 1QT1A 2OT1A 2AAMA 2FZMA 3SCSA 4TV6A 1O95A 3DERA 3IJ7A 2OGJA 2WNNA 3F7JA 3QTGA 4HK7A 1US3A 2F6KA 3UYIA 1OFQA 3FS2A 3T78A 3CZ8A 4OE7A 1Z3NA 2CETA 4MKVA 1D3CA 3MVIA 3STPA 4ADTA 3TLLA 2HMCA 2PDGA 4QE4A 1AW5A 3ZOAA 3IGUA 5J8LA 3BK0A 3L4UA 2OLSA 4YVPA 1PDYA 1CDGA 1MW0A 4X22A 4NNBA 3UY8A 3CMGA 4TXEA 1LLWA 3GY1A 3HZ3A 5L9FA 2PPGA 3CZEA 3PB0A 3VUPA 4FXRA 4WKFA 5CJNA 1R9XA 3M0KA 1RVKA 3V7PA 3KVLA 2C15A 2JIEA 2PU0A 5CC5A 3SCQA 1UUOA 4E6MA 1EQCA 3AS0A 3F5JA 5I02A 4HOXA 3CT7A 4ATDA 1WCGA 2VGGA 3U2OA 4A2RA 4DAIA 4O54A 4X9YA 1W2VA 3UNDA 2PURA 2GJRA 1TFVA 2Y7EA 1EJXC 3KDNA 3VD9A 4HCHA 7TAAA 4I6VA 1IWBA 2G95A 1KXQA 6PTDA 3WLMA 4L56A 4HPJA 3S9IA 1FWNA 1NEYA 4FAMA 3MI2A 4GYPC 3AIRA 3L5LA 4XX6A 3VIMA 4QJ1A 3HFYA 4XZBA 3DYPA 4B5SA 3W7MA 4JTQA 2D2GA 3BQ5A 2O9TA 3VE7A 1RV8A 2X09A 3GD6A 4X0NA 3WFLA 6TAAA 3VM7A 3H4XA 4GXWA 1FWAC 1T41A 1LBLA 2EGZA 1AW2A 1UWSA 1SZGA 4QG8A 5DY3A 2CBJA 1IE7C 2WVVA 2XN1A 4BEUA 3BGJA 3HBLA 4JN6A 4JHZA 3P81A 5BOOA 3M41A 1WXJA 3UEQA 1KRAC 1E6ZA 4UTKA 4YYCA 2WMFA 4MWAC 3GDMA 4GHRA 4QNWA 2BY1A 4TV5A 2JEPA 1IT8A 1GW9A 3JVAA 3UG4A 5BROA 1DV7A 2J78A 4BQ5A 3LN3A 3TSMA 3VDHA 5D8WA 4R53A 2OR2A 4FB7A 3FJLA 2W66A 2ZZ5A 4W86A 4BZYA 1UH2A 2CBIA 1OGGA 1RXOB 3W3OA 1P1MA 1XLAA 4DJDD 2F8QA 3VFCA 1FUYA 3WL0A 5C9WA 4AIEA 2V8ZA 4I5XA 2ACQA 2MANA 4P8VA 2D24A 1EP2A 3WLRA 4D72A 1F73A 2HBVA 2F2HA 2YL6A 3PWIA 3WEMA 1OQFA 4O19A 3G3MA 4NHVA 1NY1A 3BAJA 4I6KA 1ONWA 1DQUA 3ECQA 3D0CA 1WBHA 3GTXA 4RNFA 3FHAA 1AH4A 3VKJA 3WLKX 3HQNA 2HE8A 3K8KA 2EKCA 3PZ9A 1G94A 3WDQA 1C8QA 4JTFA 1L6FA 3TJLA 5IBXC 4GH3A 4PCFA 1V6TA 4Y9PA 3I7QA 4H00A 1JCJA 4GUFA 4I9AA 3IJ6A 1B3OA 1HJWA 4CEXC 1QXLA 4HN4A 3B8UA 5HK4A 4HHLA 2I7GA 4KWSA 3AIWA 3ARVA 3BSHA 4H7VA 3CK5A 4EXQA 5T9BG 3QW4B 4KWUA 2FZ8A 3EWYA 4WHBA 3LCIA 1OZQA 4TVDA 3NDZA 1UR3M 3PBMA 2XJ7A 3BMXA 4PULA 2ATSA 3TCEA 3L23A 5IM51 1U33A 3BICA 2B0MA 3M1ZA 3N15A 3ZVIA 3VKAA 3WNMA 1N82A 5DQPA 1TPC1 1V77A 3DFNA 1PHWA 3TCSA 1CB2A 1V5XA 4GFIA 4NNCA 5G2WA 2WHMA 4Q8VA 1DWHM 1F61A 3WK0A 2A6NA 2BY2A 2GDUA 1OCJA 1XYBA 2I16A 2VX7A 4B2DA 3VI2A 3W07A 4K37A 1WDRA 1XKYA 2D22A 2JIWA 3W53A 4ADUA 4F0RA 4AXNA 4P7OA 1KC7A 4JTUA 3S42A 2V9DA 4C6IA 3OHIA 2PTDA 2DQWA 4IICA 3T4CA 2J6XA 4MUPA 4GI6A 3LHUA 2QVHA 5TBOA 1X98A 4HNOA 1W1ZA 3LXBA 1JDCA 2WZHA 2BGSA 4PMRA 4DBUA 1HGYA 1HJSA 2VEMA 3FA3A 3SQMA 2Z2UA 1TIMA 3VTRA 1ZBCA 1TRIA 1R47A 2VC7A 3CWNA 3NO5A 3RO6A 1Z89A 5FL1A 1V3IA 3GX9A 4GFSA 1H2JA 4HTYA 3KCLA 2CLEA 4O10A 2GVGA 1VEPA 3NQ7A 1DOSA 3ARQA 1W2PA 3M64A 4WOZA 4E0CA 3MI3A 3C2OA 4D6EA 3IPWA 3CXOA 1E70M 2AL2B 4GO8A 1I45A 4S23A 1DQWA 3P5ZA 1IIHA 1S2AA 1KM5A 3OGRA 1M68A 1WAWA 1WPCA 4J35A 5EMKA 2DZTA 1JCXA 4V1XA 3HGJA 4I5RA 2CERA 3VD5A 5J5DA 1UD4A 2VT0A 2XIBA 3ABOA 2D1ZA 3ATYA 3UJEA 2YBUA 4KWWA 4X61A 1NWSA 4QQ3A 5DXXA 1A53A 3N6JA 3ARPA 3NPVA 4DXKA 1XFCA 4KEMA 4DQWA 5IXEA 3DEQA 2ZX6A 1T8XA 4NZ1A 4P8WA 4JY8A 3NQ8A 5I2UA 5A8MA 3VIHA 2WSKA 3FSUA 1K8XA 2FGLA 3W6YA 3QEZA 2V3EA 1FHLA 3K5XA 3UR2A 1BSLA 1W3KA 3BW3A 2PS2A 4JKMA 4W88A 1UR9A 2QW5A 4H9VA 3UFYA 3WD4A 3TYDA 3MWCA 1EUAA 4J27A 4D6CA 1ZALA 2JKEA 4E8DA 4S3AA 1PKLA 2YDAA 3L2IA 1M7OA 1S2WA 4O11A 4ML4A 3AISA 4GY0A 3UJSA 1KNWA 4ZFMA 2AAAA 5I3GA 1R5YA 5FCZA 3TW9A 2ZE3A 5A8PA 3URQA 1DWAM 1H7RA 2OB3A 4MY9A 3H24A 3NSXA 1VAHA 2ZADA 1P5BA 4V15A 2J7GA 1JGMA 2EPMX 3KE0A 4GUGA 1VJIA 3I65A 1SFLA 3CV6A 3NIYA 1B5TA 1DWJM 5AC8A 1P0DA 3LI1A 1OK6A 1XH1A 1EC7A 4PTNA 3WBEA 3WQWA 4Y8FA 1IEXA 3LBOA 2P10A 2V5BA 4YWIA 4ZQRA 3LX9A 3PZTA 3V0TA 1PKMA 4J9JA 2ZUWA 3DH7A 4AWSA 5LNSA 2NVCA 3OHMB 3UR8A 5HPCA 2ZZ3A 3BLPX 1K6AA 5HMEA 5FACA 1O1ZA 5BRBA 2WVSA 2R6OA 5I3KA 2GGIA 2PDBA 3B04A 4N9DA 4XBSA 4JXCA 4UFIA 3VKDA 1R3SA 2J8TA 2NSOA 4CQDA 1OEPA 3MP3A 3PSVA 1W1VA 1EBGA 4NZ4A 2PBGA 2GVLA 1ZENA 3TC7A 4DEFA 4IFRA 1UWTA 2NX9A 3W24A 1ZBWA 4RX0A 3KOFA 3NVDA 3L66A 4DM2A 4AEFA 1EWEA 2WQDA 1R2TA 1HP4A 1Z69A 3R0UA 1HUVA 1OBAA 3KZSA 1FCUA 5AC6A 4DF1A 4S38A 2QJIA 5LHFA 3TQKA 1WZLA 3WUBA 1A5OC 4LUTB 3AXXA 4AZBA 2FZDA 4H6RA 4TOQA 3NXLA 2UZ9A 3S6TA 4WY0A 3TAKA 4FA3A 5H8PA 6REQA 1A49A 3AC0A 4N6FA 2TYSA 4XZWA 3EXRA 5JU6A 1TPDA 3GQYA 3VXGA 4X2PA 2PB1A 4MFEA 5L6UA 2C18A 4Z08A 5G2HA 2EPNA 3BLIA 2W27A 2PDHA 4I7VA 2VUYA 4QLKA 3WLNA 4DBWA 2CLMA 1TE6A 1TCMA 4O18A 4UNIA 4KBXA 5DANA 1KR1A 3CUIA 1XINA 4UUIA 4DYJA 3PB2A 2DT2A 3FW6A 3V36A 4MZ8A 2WKJA 4KGJA 4WVXA 2E1WA 3CQHA 3IVUA 5BZAA 3G1RA 3RAOA 3BXWA 1X1ZA 2H9AA 1UR8A 1X6LA 2QUVA 2TRSA 1VHCA 4IQLA 5XIAA 2QIIA 2HROA 1J12A 4KIEA 3C2FA 3TJIA 1YPIA 5EGRA 4GZJA 4PMQA 3MHUA 4ROQA 4UQBA 2WM1A 4UFMA 1KBLA 2CLFA 2VRJA 4D8AA 4Q6JA 3DFPA 1LLZA 3TW7A 3L0KA 3VMPA 3CPGA 1XC6A 4FNTA 1XIGA 4J1OA 2Q8LA 3VKBA 1CX9A 4XZNX 4AVNA 3BDKA 2J7HA 1VPYA 3E49A 4JCLA 2OSWA 4M6PA 1Q63A 4IMGA 4MB5A 3OTRA 4ZQNA 2D2OA 2C1HA 1TVPA 7PTDA 1BTMA 2FH8A 1HKIA 3IJQA 1UB3A 4GUJA 3B8SA 3SUSA 1Q6RA 4JTLA 4PUWA 2W6RA 2B4GA 4M29A 3T2OA 4M56A 1FCBA 3AROA 3MYPA 3CJPA 4H83A 1L2QA 3CAVA 3V5FA 5F2IA 4LYKA 3ZWSA 1ZAHA 3H54A 3L4ZA 4AZCA 5BU9A 2DIJA 2PTWA 3W7EA 1DIDA 3N3MA 2DORA 1J01A 1RVGA 3SAZA 4ERIA 4JL1A 1VFOA 2VFDA 3HGSA 4RKAA 4FIQA 1DE6A 1J2WA 1OVDA 4LVGA 2DZPA 1P6WA 2NVDA 4AISA 3OZOA 3E0LA 1R87A 4JYDA 5CPMA 3EOUA 2FIQA 3A9IA 2X7WA 1V51A 2VCCA 1MXGA 1FXPA 1G69A 7TIMA 4NAFB 2Y85A 3N29A 4WSJA 3NQ2A 4YTQA 1W3JA 4TIMA 4ZSUA 3R6IA 1JFXA 1YE4A 3VMOA 3CAQA 1B9ZA 1DTNA 4LANA 1X1OA 4XZMX 4CGTA 4FNRA 2R1LA 4LAOA 2PMQA 2PWGA 3LGDA 2BXVA 3ITVA 2POZA 5I24A 4RZ5A 2J8GA 1EEXA 3LLFA 5C9XA 4AHOA 2R8WA 1FOBA 3QVQA 2XISA 3FEQA 4RW5A 4BI6A 3ARTA 1GZ1A 3DI0A 2XVLA 2EEXA 5I7GA 3W86A 4LBUA 1W17A 4A2SA 3AMCA 1FH9A 4Z1AA 2GQ9A 3AIVA 2ZQ0A 3EEZA 4Y9MA 2PFHA 5DFAA 3V75A 3BPWA 3W7DA 5CGQA 4K7VA 2ZUTA 1XPGA 3F5KA 3CV1A 1JPDX 3ITLA 3NM3A 1TTPA 1I0BA 4XUYA 3P8JA 3BG9A 3W76A 2VVSA 1ISWA 4O0ZA 4KS0A 4M6QA 3GDBA 4HJWA 3A4WA 4UR7A 4TQTA 2BMBA 4EK7A 1WV2A 1KFJA 4YN5A 5TF0A 1LCOA 3NSNA 3GTNA 1H60A 1UR4A 3VIFA 1DJGA 1KTCA 4HU4A 5LKYA 4CCDA 4PCTA 1FWSA 3NZ1A 3IV3A 3ZSTA 4QG6A 4ICMA 3LZ3A 1PV8A 5C6MA 2J6VA 3V35A 3ITYA 1OJXA 1K70A 3TZFA 4LSBA 3U6WA 3N2XA 1LL4A 4JDBA 3O0FA 3KP1A 1KFLA 1QASA 2QCGA 1SU5A 1MW3A 2F9RA 4K2SA 2GDQA 1KFKA 2BB0A 2PP3A 1G01A 1M6JA 4D1JA 2D0GA 3FSTA 4NT0A 2WPBA 3NQEA 3TUUA 5LA2A 1EA0A 3QFEA 1TX0A 3V4BA 2ODOA 3TMLA 3ABSA 3KS6A 3MUZ1 1R6WA 3BURA 3B9AA 3M7WA 1BG4A 4OOZA 3TR9A 3N11A 2QUMA 4UWMA 4TX8A 3WEZA 2ISFA 3BG5A 4RE4A 4KERA 1TR1A 2XFYA 3RFAA 3R0DA 1RUSA 4H8HA 8TIMA 5GJPA 3TAOA 3MCNA 5ECUA 3M0YA 2RUSA 3QOKA 5A1AA 5LNWA 2JGQA 3LQLA 3CT2A 1Y5XA 3CYJA 4ACYA 4CD8A 3TIMA 3DBNA 1SJDA 3G8RA 3NCOA 3B97A 3IWPA 3LGEA 3MQTA 4DN1A 4YCOA 4TO8A 1ZP4A 1DJYA 4QSHA 4YHEA 1PJ9A 3LCWA 2GQ3A 1QW7A 3LENA 3WQGA 4PTVA 4ZGYA 2A5HA 3B8TA 1YRRA 4K8HA 5LA1A 1QMLA 3IIZA 4DNHA 1U1UA 2DZWA 5I78A 3GU1A 2F6XA 3K1DA 1HQTA 4W89A 3GAYA 4TTUA 4XIMA 4MG4A 4CN4A 2A3CA 4Z42C 2D0HA 4LQ1A 3T42A 1EDTA 4GIRA 1WXZA 8A3HA 3R7MA 4AUBA 4PRRA 2XHYA 4HHMA 4JEQA 3PP7A 4WSKA 2C0AA 2QV5A 4DXVA 3UWYA 3W38A 2EJAA 3NOEA 4GVGA 2R9RA 4HYVA 1FWGC 4OV9A 4ZOEA 2GQAA 1I6NA 5CC6A 3ID7A 5CPQA 1PZ1A 2IPJA 1GYLA 3NPWA 4FNQA 4A8IA 3GH4A 3UGVA 3AUOA 4JD4A 3L7RA 2V81A 1IWAA 3UXIA 2Q6ZA 2PDUA 1XD0A 1MQQA 1JFHA 1VRDA 3B40A 2QCNA 5M17A 3GR4A 2FMNA 1CXFA 3WD1A 2HNHA 2CCRA 2ESCA 2I9EA 1OD8A 2OYMA 1JYNA 2JEQA 1HFBA 1T6MA 1NFGA 2Q3OA 2YXOA 1GHSA 3P82A 1JIBA 1E4MM 3VD4A 1UPMB 2PWHA 4L6DA 3MPGA 2OZ3A 5AYBA 5CSSA 5I79A 1ADDA 4NY2A 3STFA 1RK6A 4EF8A 4HOZA 1C29A 5FEZA 2E67A 3BGGA 1NOWA 5A8GA 4C7GA 5C9ZA 4QJ3B 1TJRA 4HTBA 5LNUA 3R8GA 2QPUA 4QDMA 1H0IA 1UC4A 1F9CA 1KFBA 4HK5A 1YIXA 5DBTA 2VP8A 1CLXA 1BG9A 1KD0A 1Q4WA 1OC7A 2GJPA 2BSLA 4N0RA 1MUMA 1TWSA 1OF8A 3NZRA 1KV5A 1RZMA 3HN3A 4M8UA 1I9CB 2O7QA 2YBTA 3K46A 3DENA 4LX4A 3QY6A 4E2VA 3GSMA 4RL3A 1LQ2A 2BODX 2FHCA 4HA4A 3SCPA 4CVWA 3UGRA 1YBQA 4DJED 2WJFA 4GD0A 3G6LA 4KCWA 1BFNA 3W85A 2AL2A 2YL9A 3NL5A 3TN3A 3POHA 2QCDB 4JX5A 3TW6A 3AZTA 1LRQA 2DJXA 3GFYA 3QLLA 4O15A 3GWQA 2EKGA 1CNVA 1DJIA 5EMMA 4LYRA 3EB4A 2E4TA 4YTUA 1EEPA 1EO7A 3W1NA 1V0NA 2X1TA 1TV2A 1E0UA 5IHSA 1JGIA 2E8YA 4GIEA 2E6AA 2FDSA 2HCVA 3IK4A 2ZUUA 4Z1BA 1CLKA 3UD6A 4UOJA 4ZCWA 1ZSXA 4JTRA 2XYLA 3IARA 3VOIA 2QUNA 2VC5A 4DBEA 5I3DA 2NZLA 2WJZA 1QPQA 2HXUA 2XIIA 3JZEA 3VFLA 2VGIA 2A79A 2XSXA 4K8GA 1VBRA 4URIA 5CAHA 1F3EA 2Y61A 4UR8A 3I68A 4NSBA 1WXYA 4P7RA 3MYOA 1K3UA 4WEVX 4R33A 4XVDA 2PC4A 4IWWA 3DOPA 1K7FA 2A3BA 3WUGA 1BGAA 1VLWA 3NQGA 2E09A 3KCJA 4LC8A 4IIEA 4UIOA 4XAZA 3SUVA 3FK4A 4D6HA 2W61A 3O6YX 4H9UA 2YLLA 4IP5A 3CIWA 4CN6A 3QSTA 1IF2A 1XLDA 3KDOA 3NJ3A 4YNGA 5KSWA 3W23A 3B0YA 4TVUA 4LH8A 2WM0A 1JNDA 2ISWA 1TPUA 4GI9A 2RHGA 3GW3A 4H2CA 3B9OA 1BEUA 1XLFA 1FFRA 3QC3A 4DY1A 3R79A 3AS3A 3BMWA 5A6MA 2Q3RA 2EG6A 4NG3A 1R7OA 4DJDA 3RN6A 2E9MA 2J7CA 4BEQA 1TE1A 2ZX7A 4J3SA 2DSZA 2PDWA 2V2CA 4MLJA 2BBFA 1UH3A 2OQLA 1OCBA 2DSVA 4LALA 4DWDA 5F1UA 4MSSA 1EZWA 1QAPA 3EWUA 3FA5A 3OGSA 3VILA 2NQJA 7ODCA 2DDXA 3HMJG 4A29A 4FIRA 1D7FA 3NWRA 3WUFA 1O5RA 1MUWA 1CZ1A 1B90A 2DU2A 4E8GA 3IV8A 3UA3A 5A8OA 1V79A 1C92A 3E02A 3AS1A 2YOCA 4MJ4A 1S5WA 2CWNA 4OVXA 2A6LA 2PGRA 3N34A 4XAYA 5LXEA 2ZX8A 1JCNA 2WJDA 4XG1A 4PN2A 1JDFA 5CJ5A 3VC5A 1A5NC 2BOGX 5F4XA 5KETA 9XIMA 1LRTA 4HIBA 3LK6A 3NL2A 4S3EA 1EPXA 5M1TA 4N9BA 5BXSA 1P0KA 5E9XA 1N55A 3SIMA 1XC4A 4XZ9A 1V3MA 5CPNA 3Q4DA 2VCAA 4GY7A 4ZO8A 3U48A 2VO5A 2BFGA 2Q8XA 3IRSA 4QTGA 6ENLA 3YPIA 4K1GA 2E9BA 3B8WA 3F4DA 3MMUA 1V3JA 2Y62A 3EX3A 4W4QA 1A5BA 2J27A 4ACZB 4YTSA 1HTIA 4GKTA 4P8UA 4XD4A 1ITXA 4RV3A 1LYXA 4DUVA 5EBAA 4OUIA 3DYOA 2ZWZA 1O68A 5I3IA 4PC8A 1RBLA 3PPFA 3GH5A 4E2BA 4MY8A 4LXFA 3LRKA 1EGMA 3NO1A 1PVNA 1HXJA 2YZ5A 1H41A 4F3HA 2DUZA 3GXPA 2ZUMA 3RPMA 1Q6EA 2G50A 3EDJA 2WXDM 3U3HA 2D0FA 4X9SA 2PWDA 4BFAA 4YTRA 2QJGA 2DT1A 2HISA 1P1XA 4X63A 4Y9NA 1AMYA 1H4PA 3RU6A 2HXTA 1O4UA 2J13A 1V02E 3M47A 2GJXB 2H3BA 2Z2BA 3W29A 1RLDA 2W4XA 1GONA 2E3ZA 1CPUA 1B30A 2QLYA 5CZTA 1XLGA 3OEXA 5GNYA 2CBVA 1KBBA 1UPPA 3M0VA 3MHFA 3PBVA 3LMYA 3TWBA 3WDPP 4QQUA 2A1YA 3UY7A 3AUJA 3CHFA 1NSJA 4JDYA 2NX3A 4U2YA 2WCAA 4JQ4A 2VTFA 4LS1A 5D32A 3LM3A 5CJMA 2CEQA 1XSIA 1PCKA 4J3UA 1Y5VA 4X3ZA 3EB3A 4NI8A 2GGEA 2JK2A 1ZU8A 4AIOA 4P5UA 3TSDA 1WDQA 4DI8A 2C8NA 2Z6JA 1EP1A 3PULA 2XWDA 3T55A 2NUXA 1TTJA 5DRIA 2Y6ZA 1LOLA 3QHOA 4RZBA 1H11A 4HYRA 5D30A 1WKFA 3GH7A 4KEZA 3ZR5A 2FHBA 3DGBA 1OC5A 4A8NA 3RUBL 3ZLFA 1GW1A 3SCUA 2NXHA 2Y7GA 5HUPA 2XIMA 2YSWA