3NQCA

Crystal structure of the mutant i96s of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAISVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 87
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqcA00
4S2CA 2GJLA 1YADA 3FJLA 3W7EA 4UTHA 3FA5A 4O17A 3THAA 2DZPA 3G1SA 3LCIA 1VYPX 3OVQA 2NXGA 3VNDA 2PRHA 5HMSA 1Q6LA 4WZHA 4K39A 1ME7A 3NQEA 4BFAA 3VI2A 1N55A 3JS3A 5HINA 2ZDRA 2V82A 3RNDA 3TE9A 1KM0A 4UNLA 4UUIA 2ZZ5A 4YL2A 3TSDA 3W1QA 3EWZA 3W7NA 3PSVA 4O16A 1Q45A 4PTNA 2A2IA 3LXAA 1EUAA 4FX6M 3LHWA 3QMSA 5E0KA 3QJAA 4O0KA 3KXQA 3PY2A 1SZFA 4N4QA 1K7FA 4UTTC 5U4NA 4E38A 1DHPA 3L68A 1F2JA 5HR7A 3LLFA 5D38A 2W0UA 1BTMA 4G1KA 3NQ2A 3BG9A 3QM3A 2VEIA 2QJHA 3C52A 3SZ8A 5DXXA 4NUWA 5HULA 3GDRA 2FIQA 4WOQA 3CPRA 2V2CA 3GXNA 1VHNA 1PV8A 2A0NA 2BZNA 2ZZ1A 3GYEA 4NT0A 5D2XA 3TIMA 1V7YA 3LERA 4Y6GA 1DKWA 3QSRA 2WSQA 2DU2A 1RVGA 3ABQA 3QW4B 1JUBA 2J9YA 2GQAA 4O15A 3ZWSA 2QR6A 4K36A 5H2ZA 2GVJA 2ZRWA 3IVSA 4P2VA 2ZRVA 4R7JA 2CLIA 1YDOA 3LBCA 3UWVA 3UQNA 4OGZA 5J5DA 1OX6A 5SWUA 2CZEA 1GVSA 5DY2A 5KINA 2W79A 3GNNA 4IPJA 4WJEA 2D73A 1CW2A 1GYNA 5F1UA 1LRNA 1X1OA 3EKLA 4O14A 4D2JA 4IWWA 3P8JA 4ZMGA 3W2UA 1X1ZA 5D09A 1SFLA 2Y7GA 3HBLA 1WYIA 3LHZA 3TXZA 1UB3A 2ZA2A 3ANYA 4O18A 2GQ9A 3P60A 1B9BA 5CPMA 2QJGA 4O50A 4IOTA 4JY8A 2TMDA 4TMCA 4IX0A 4WOZA 3EX4A 5F4SA 5IM51 3ATYA 4ZQNA 1VLIA 3TW6A 4FF7A 1VLWA 2Y70A 2YFNA 2J6XA 2CZDA 4EF9A 5DCBA 1ZJIA 4HSNA 3FJ6A 1UUMA 3HF3A 1W5OA 2DORA 2NLIA 2YGYA 3NVTA 3R5EA 2X30A 3UZJA 3C6CA 1TCDA 2B4GA 1NSJA 3Q37A 4W9TA 2QCDA 2GVLA 2C0AA 3NQ7A 1AK5A 3MYOA 3G3DA 3N2XA 2EF9A 1P0KA 1KBJA 4K37A 1D3GA 1W5PA 3W1NA 1LM1A 4ZQOA 3VFLA 2QF7A 3W87A 3HG5A 4HPJA 3U8GA 1MO0A 2WJZA 4CLMA 3LV5A 1SPQA 4RXGA 3IIZA 2W6RA 3W1MA 4I9AA 2FTPA 1TIMA 4KFPA 4LU0A 1JULA 1VC4A 2WSRA 5FEWA 3RFAA 4NJJA 1JJKA 1HUVA 3DHFA 3DFTA 4L4LA 2JGYA 3W2LA 3W7IA 1GZGA 4HNTA 4RK8A 3TQ0A 3LXCA 4RCXA 4KWWA 1I2QA 4OU1A 2CLKA 2OJPA 5KMYA 3NDOA 3MHFA 1LBLA 4WXZA 1OFEA 5BW6A 1GVRA 3A5VA 3LRLA 4XUGA 3T44A 4CCCA 5AB3A 4NQ1A 5D05A 1K03A 3BLEA 1XDMA 4GUHA 1VH7A 3SIZA 1CI1A 4ORIA 2Q8LA 3G1HA 3W76A 4UIOA 5K9DA 5LZLA 1I45A 1SZNA 4JX4A 5FF3A 3C2RA 3KVJA 4O4WA 1TV7A 3BW3A 4PA8A 1TPH1 1EWDA 3KOFA 2PCQA 3DZ1A 3OBKA 4CNNA 1TTQA 3W7LA 4LS0A 4AVFA 1OFBA 4NJKA 3BV4A 4Y9AA 1O94A 2CLHA 4ZL1A 1D9EA 1SO6A 1C8VA 3G8RA 1R47A 1Z42A 4GC4A 4DPPA 4EWND 2I1OA 3KX6A 1FWSA 2VELA 3F4NA 3ZWTA 4HT3A 5EKYA 4UC5A 1GEQA 3GDKA 4AB4A 5LHFA 3BPWA 3KFTA 4FIQA 3NPXA 1ML1A 2A85A 3PC0A 2RFGA 3TH6A 4O0ZA 1T8XA 3M1ZA 3HQ1A 3MP5A 4R53A 3W1RA 4DEFA 2WV8A 3KVMA 3P61A 3A5FA 3F03K 4IXXA 3L5LA 1AG1O 2P0OA 3DGRA 4AH7A 1OYAA 4FX7A 1LYXA 2H3DA 3LI0A 3G18A 1OF6A 3PAJA 4XKYA 3DFNA 3SFKA 2UV8G 3TV8A 1W1ZA 3T4CA 2CZFA 3L0KA 1WAUA 1JR1A 1HL2A 3EX1A 1KFCA 3EWWA 4LS2A 1KM4A 3HMJG 4YXGA 4LRSA 3HGRA 1F76A 2YYUA 3M47A 4LC8A 2ZRYA 2QUUA 3W1XA 3W2JA 2J9XA 1N8FA 1P0NA 2CLOA 2YCEA 1X8FA 1K7EA 3PS7A 1KTCA 2JGQA 3IEBA 1ADOA 3G24A 4LV4A 5EY5A 1TB3A 4UTKA 2FFCA 2PE4A 1GG1A 4JYEA 4IPIA 3UNDA 3O6DA 1G7UA 5C55A 4XTIA 2A5HA 4FO4A 3CLMA 3A22A 5K4ZA 2Y89A 1RZMA 4IX2A 4P61A 2ATMA 3NO5A 2DZSA 5AHEA 3HJZA 1LCOA 1SW7A 5CZSA 4LVGA 1JCNA 1S5WA 3YPIA 4MOZA 5DXYA 1OG0A 3LGEA 2Y61A 1XBVA 1OX4A 1RPXA 2C16A 4DXVA 3SR7A 5AC7A 4O4VA 4PL1A 5D2WA 3CWOX 3WJYA 5KTLA 1OJXA 3MJYA 1H62A 4EVZA 1AMKA 3W85A 3CB8A 4S2BA 1VRDA 1EB3A 3UWZA 1XUUA 1HG3A 1OYCA 2NWRA 5BOOA 2ZZ7A 4XZ9A 4JR5A 5F2MA 5KSWA 2ZBTA 3RLUA 5MHBA 2FPTA 5AN7A 3L67A 1YXCA 3N3MA 2X1RA 2DJXA 4JTTA 3W3OA 3P7YA 1IF2A 1AL8A 1XBZA 4JGDA 5C54A 4RJEA 5G5IA 2E77A 3SY5A 1WOBA 4NVTA 1WBJA 1PVNA 4JX5A 1KFEA 3GKFA 4NJGA 1MEHA 2NUWA 1SO4A 4M6VA 5F2IA 5G1YA 3PB2A 1J2WA 4N6FA 4UMAA 1F6PA 3NAVA 3C8FA 3O8AA 3QSTA 1G67A 3NL3A 2FPYA 3MI3A 3S8HA 3LTSA 3NQVA 4UCGA 1VJIA 4JIPA 2Y7EA 3W7QA 5FF2A 3W7MA 1TJPA 1W3TA 4IMDA 4AAJA 1YPIA 3QEZA 1GVOA 4Z08A 2HSAA 3T78A 3W70A 1FCUA 1DVJA 1R2SA 3G0XA 3B4UA 2A7NA 3O06A 2JKEA 1SZEA 1EP1A 2Y6ZA 4GBUA 4ADUA 3N19B 1MEWA 4UNKA 4QAIA 3W7KA 2V0TA 3P81A 4XQ6A 3ZR4A 1PS9A 1LOLA 2HTMA 3MP4A 4GUJA 3CC1A 1A53A 1Q6QA 4ADTA 4UFHA 5I3IA 5D37A 1UUOA 3R2GA 3C56A 3T40A 2NWSA 1XFBA 4OT7A 1JVNA 1GT8A 3P8IA 1XBXA 3IIXA 4ZQRA 5DBUA 2QEZA 4UTWC 3W7HA 3LX9A 1DOSA 3NQDA 2E6DA 1SW3A 3NQ6A 1H7PA 2TPSA 4JTLA 4BWLA 4HIBA 4O13A 2J27A 1DORA 2V5LA 3LRKA 4PEKA 4EF8A 3BG3A 3O07A 4U4MA 2H3BA 2YZRA 1F05A 2B0MA 2VFEA 3GK0A 4O1CA 5KZMA 3W73A 3EXSA 3S1UA 4NU7A 3QZEA 4UTMA 4WUIA 2NXHA 3WJZA 2EKCA 4TMBA 5TBOA 2WSYA 3L65A 1GTEA 3NG3A 3HGOA 1XBYA 3DFPA 5EBUA 4I7UA 5FESA 5F1VA 1WV2A 2P1FA 1NEYA 1H7OA 3JR2A 1D3HA 1XXXA 2EGZA 3NEVA 3W72A 1P1XA 1TQXA 1GOXA 2C6QA 4LW7A 3UWYA 3TJXA 1UBSA 3BLFA 3M44A 3O6YX 5BMXA 4WY0A 2QDHA 2GUUA 3PULA 3NA8A 3P5ZA 5HR6A 5AHFA 1GVFA 3L0NA 1CX9A 3M7WA 3TFCA 1WQ5A 3W2KA 3E96A 4QJ1A 4FXSA 2ZRXA 2ISVA 3NZ1A 1QWGA 3WK0A 3W1AA 4DF0A 1VPXA 3GNDA 5EA9A 4BWLC 3LHTA 5CPLA 4NZJA 7TIMA 1UCWA 4KFNA 3TCEA 1EUNA 1FDZA 1GG0A 4O52A 3W22A 2FLIA 3GZ3A 3TW7A 1JCYA 2GOUA 1YPFA 3INPA 1TTPA 3IIVA 4FXRA 5HUOA 4JDBA 1W56A 2QCNA 1PIIA 4PODA 3LCFA 2NXIA 3MUXA 2GQ8A 4XWUA 3PBUA 1JUKA 1YXYA 4NNBA 4CCEA 3DFQA 4O12A 8TIMA 2VXNA 2E6FA 3C2FA 4BI5A 1KFJA 1LLZA 2A1YA 2GJNA 2ZCGA 1Y0EA 2F84A 1LDCA 4PFMA 4JYFA 3GXTA 3FIGA 3W07A 5AC6A 3FYOA 5BMWA 2H8XA 1YYAA 1OFDA 3PB0A 5CZJA 1Z41A 5HWNA 2G96A 3ABOA 3DFSA 4K38A 3TNOA 3W7OA 3RK8A 2OT1A 2Z2UA 3DBPA 1NFBA 1EWEA 3HO8A 1IXPA 1M7PA 4MIMA 3QQ0A 3SGUA 4BF9A 2X1SA 4JD4A 3C2EA 3BGJA 4MY1A 1HO1A 1JUEA 5U7SA 3TSMA 4TO8A 5C2XA 2BXVA 1LROA 2Q8ZA 3NNTA 1TPEA 4JEQA 4BK9A 3BLIA 2EPHA 2JKPA 3TK7A 3PG8A 3C2VA 1W5QA 3NM1A 3DKLA 3NL6A 2GPTA 4DO5A 1L2UA 4C1KA 5AYXA 4Z1CA 1J5TA 1IIHA 3DI1A 1LTDA 3LTYA 1XC4A 2DJLA 2JK2A 3W1LA 3W75A 3NQAA 3SW6A 1IXOA 4N9DA 2OZ0A 2YPIA 4QIUA 2QUTA 2XFWA 1SR9A 3TMQA 1NAL1 4J9JA 2C3ZA 5I3GA 5LKYA 1K7XA 4KKXA 4H3DA 4JICA 1VHCA 1JQVA 4L4MA 4HPXA 4GUFA 3NZRA 4CQAA 1YTDA 3M16A 2VEKA 3F1QA 4U28A 4FB7A 1VQTA 3CIWA 3QPZA 3MHUA 2ZZ3A 5LHEA 5D33A 5LGZA 2E09A 2WO5A 2OX1A 1OVDA 2V5BA 3UWWA 2Z0IA 3H54A 3UXDA 4O1AA 2OCZA 3EKZA 4OV4A 1W5NA 3B05A 3MI6A 2YYTA 1VYSX 1IXNA 3LM7A 4NNCA 1ZENA 3TU9A 4UFJA 2ZRUA 2ZTKA 3EX6A 4MY8A 1KW1A 3MI2A 2BWGA 1YDVA 3PUDA 5D30A 4NXKA 1RQBA 1FXQA 1AW2A 1W54A 4GJ1A 4RZ5A 1J4EA 1QOPA 3M6YA 5TQLA 3PBVA 4O28A 1G4TA 3EWYA 1DJNA 1FQ0A 2BSLA 4M5PA 1OABA 5CG7A 3LBMA 1W31A 5I3KA 2ISWA 4QSHA 3WJSA 1WXJA 4OBTA 1VZWA 4Q32A 4TR9A 4MLJA 1FCBA 4FHAA 1EPXA 4FNPA 1HTIA 1U83A 3G1VA 4Z1BA 3QPYA 1FBAA 5HNRA 4IGHA 2C19A 5EL1A 4ZQCA 5G4EA 1QDSA 3E12A 3RF9A 5DCEA 4GUIA 5DELA 5D32A 2ABBA 1OFOA 4JTGA 2YX0A 3V75A 2VEPA 3VKJA 1WDWA 3U2OA 1OK6A 1H7RA 1EX5A 4XKYB 4NX5A 3LOTA 2QKFA 2TYSA 3TXVA 1QPQA 1ZAIA 3C2OA 1XDLA 4ONVA 5HWJA 3P74A 1SSDA 1W5MA 4FNRA 4N9BA 3B06A 2DZXA 1QO5A 2ZA1A 3IGSA 3QRHA 1KV5A 3W71A 4ADSA 3B0UX 4GFSA 3GDLA 4CNOA 3Q58A 5KZEA 3EEGA 1FWRA 3IGXA 3P67A 1TPDA 2R91A 2FB3A 3KAOA 4E2BA 4QNEA 4LVAA 2P10A 1X6UA 2GVGA 4K8EA 4M6PA 2V81A 4N4PA 3B0VC 4UTIA 2VOMA 4HSOA 1SO3A 3HGSA 5EPDA 4X9SA 1SZGA 5I3FA 5LGXA 4CNPA 4JTIA 5A5WA 3Q2DA 1KA9F 3TFXA 1QFEA 4Y96A 5CKSA 2LLEA 3W7RA 1W37A 1H7NA 3LHUA 3B04A 2G97A 1OX4B 2VFIA 2QCMA 4JX6A 4EOUA 2AQWA 5LNRA 4Z0JA 3KHJA 1G6CA 5HQEA 1VS1A 3FEMA 2A7RA 1DV7A 1GJPA 3UD6A 4FEZA 1KM3A 1K02A 1VYRA 2YDAA 1FUYA 4RX0A 3PUEA 1OX5A 1VCVA 3O6CA 2F7FA 3NR0A 1KM2A 2NX3A 3P5YA 3CQ0A 3O1NA 3GAYA 3NM3A 1BWLA 3STGA 3DAQA 4XTDA 3QW3A 3A24A 2X1UA 4UFMA 2ZZ2A 3TROA 1OHLA 1K8ZA 3MBDA 2CFFA 1F6KA 5DLCA 3WK1A 1YTEA 1SU5A 5G2HA 1OFPA 5F2GA 4S1FA 3TC7A 4UR8A 4AXKA 4ML9A 4A2SA 4LV9A 4O1BA 1TQJA 3UWUA 3OVRA 5K9XA 3TAKA 2ZZ4A 3NQGA 3TAOA 3S42A 4HNNA 2Z6IA 4GNJA 2QCLA 3L9CA 3I6RA 2DZUA 3G8EA 3PSWA 3EWUA 4CQ9A 4JXCA 3G1XA 2CU0A 1SFJA 4JTSA 3PG9A 4JTKA 1YTKA 5D02A 1BKSA 5T26A 4X2RA 3TQVA 5GVJA 2AAMA 3LCXA 1H1ZA 4TIMA 4O11A 5FF7A 1LOSA 5D04C 4HHPA 4QM1A 3NQCA 1TJRA 4QISA 1IIGA 2ZRZA 3PWAA 1IGSA 2I9EA 1ZCOA 4A29A 3W86A 3M41A 2ATSA 1TV5A 2PC4A 3PF3A 5IBXA 1A5CA 1ZHAA 3P80A 4JTHA 3LDVA 2ZYFA 3NYZA 3ZS4A 5FEZA 3W2NA 4TX9A 1KM6A 4H4IA 1B3OA 5CPNA 3LHYA 4I7VA 4FNSA 1VCGA 4N02A 1I8JA 2A4AA 1N7KA 3W2MA 2O7QA 1QMLA 3N2MA 4NZFA 1FCVA 5K2ZA 5D2TA 2B7OA 5CGQA 4ZQMA 1KFLA 1ZY9A 1I2RA 3GB6A 1T96A 3NQ8A 2QJIA 2FQIA 3JRKA 5A8GA 3NL2A 1FCQA 1KV8A 3PUOA 5I3JA 4POCA 4O19A 2WQPA 3P62A 1K3UA 4M7SA 4MZYA 3I68A 3CTLA 2WOQA 3GAKA 3S1XA 1LBMA 1XCFA 1TREA 5CZTA 1LOQA 4AHQA 3HGJA 1G4SA 4JTJA 1XI3A 3U6WA 1I2NA 4FX8A 2C1HA 2JKAA 5AC8A 3DKJA 1AW5A 5E1QA 3TSBA 3SJ3A 1LLWA 5BRBA 3WK2A 2VFHA 4WY0F 2QDGA 3MWAA 4WY0B 3UPWA 2E5BA 3IVUA 5IBXC 4JS3A 4QNWA 1A50A 3E02A 3D0CA 4AWSA 3O16A 3HIJA 3HPZA 3A21A 3I7SA 3C3NA 5HJLA 3LCGA 3GLCA 3L66A 4X3ZA 1W0MA 3B0PA 4MYAA 2HS6A 3H55A 1LRQA 4MZ8A 3M5YA 3S6DA 4DF1A 1R2RA 3QMTA 2G95A 3E9AA 4Y8FA 4LT9A 1PE1A 2VC6A 3ZFHA 1OFRA 1SQ7A 4JYDA 5D2VA 3P84A 4DELA 3HG3A 3SGZA 3P82A 3N34A 1SUXA 4TU1A 3I7RA 1H7WA 4GUGA 4YLWA 5G2WA 1P5BA 3L5AA 3DI0A 3LHVA 3CEUA 1ZAHA 1TRDA 3I65A 4K7VA 5K7JA 2Z1BA 2ZQ0A 4O53A 4UTLA 4YMZA 3DFOA 3IIOA 1TPC1 1H5YA 4FIRA 4RZ6A 5FF4A 3TUUA 1A5SA 3CT7A 3WJXA 3C0JA 1H60A 4MFEA 2ISSA 2Y63A 2NZLA 2VKZG 3PBWA 5DY3A 5LNWA 1EA0A 4RKAA 4HN4A 4ORMA 3UY7A 2QAPA 1G69A 1EP3A 3LB0A 3NQMA 4UTTA 3L5MA 3W23A 3EB2A 3S5NA 3LCHA 3FKRA 2Z6JA 3E49A 5D03A 3USBA 4MPQA 4AWUA 4CCDA 1R2TA 1JCLA 2ZZ6A 3EWBX 2O7SA 3QQ1A 4H6KA 1O60A 1X7FA 1U5JA 4MJZA 3LV6A 2PURA 4FNTA 4RXFA 3TKFA 2NV2A 1H1YA 5CSSA 3GDMA 4K8HA 3QMRA 1O95A 1WA3A 2V30A 3G22A 1R30A 3NL5A 4UFIA 5AHLA 1ZFJA 4M7TA 3R89A 3PR2A 4ZQPA 1AW1A 4AMAA 1T0OA 3IIPA 2CZ5A 1QNVA 1SSGA 1UJPA 3MYPA 1F7BA 3C4UA 1RQEA 5LNVA 3NOEA 4LVFA 2V2HA 3W6YA 3M43A 5FEXA 4BI7A 4FNUA 3KRUA 2R8WA 4I7WA 3R8RA 1I2PA 3TA6A 2WPBA 4IMCA 4E2DA 3PBYA 3QF0A 3TJLA 4AF0A 3UYCA 4UTUA 1C9DA 2XN1A 2Y85A 4JNMA 2I14A 5AYYA 5EYWA 1TRIA 4YWIA 1XUZA 2R14A 1BEUA 4KWVA 3EX2A 2ABAA 2YFOA 3M5VA 2XN2A 2QCDB 3GDTA 2Q3RA 1XL9A 5K4XA 1IXQA 3QC3A 4HNUA 1QCWA 3EX3A 5AYZA 4LUIA 3MO7A 3O63A 4UTJA 2R94A 3STEA 3FOKA 1R46A 2V8ZA 3W7PA 2VFFA 1GWJA 1H7XA 1TSIA 4YCOA 4UFKA 3O05A 3NXFA 2AGKA 3CEPA 3RU6A 4N6EA 1GQNA 6TIMA 3QYQA 1TTIA 3CWNA 3BGGA 4LOCA 3DU0A 1M6JA 3GX9A 2BTMA 2XN0A 3HB9A 2CLMA 1LRTA 6ALDA 1TPVA 3FLUA 1PCKA 1SO5A 4C1LA 4OWGA 4MZ1A 4IJBA 1JCMP 3AJXA 4MLRA 3HPSA 2G5WA 4OQVA 4MKNA 2V2DA 1FWWA 3G1DA 3UZ5A 3DENA 3RMJA 5J5RA 2Y7DA 5HWMA 2ZTJA 3CM4A 4OHQA 2IQTA 3ABSA 3EWXA 2C13A 1XM3A 4EIVA 2QCGA 1FXPA 2HMCA 3HG4A 1TV8A 1C29A 3N73A 4Q4KA 3S5ZA 4BR1A 3WJWA 2BX7A 3PM6A 3A23A 4PC8A 1TMHA 1KTBA 1ME8A 3B03A 1PL9A 4NJIA 4AEOA 3F4WA 1OFQA 1FWNA 4A21A 3OIXA 2WKJA 4RLIA 1K8YA 2Y88A 1TPB1 3GVGA 4FNQA 3EXTA 5EMUA 2QCCA 3IVTA 1L6YA 3IRDA 1H61A 1QPOA 3BG5A 5LSMA 5K3VA 4IMEA 3M5XA 3G1YA 4Z1AA 2HS8A 2Q3OA 3FS2A 2DP3A 5C5YA 2RH9A 1O4UA 1H50A 5LNUA 1TO3A 2PRMA 1NF7A 4AHPA 4UMBA 2RDWA 4IMFA 1M7OA 3BK0A 2RDTA 3W1PA 3UY8A 1TPWA 5CPOA 1KFKA 3GXPA 3T7VA 2NUYA 4DO4A 5I3HA 1E51A 1F74A 1KBIA 1QO2A 1T99A 1KTNA 3OVPA 1ALDA 4BI6A 5L6UA 3W1UA 3SECA 3N9RA 2YXGA 3W7GA 3W7CA 4JY9A 4DBEA 1QPNA 1MEIA 1S5TA 3HPXA 1ONRA 3NPUA 1V5XA 1LORA 1W3NA 3W84A 3THQA 1GTHA 1ZALA 5AHIA 3W7DA 1RR2A 1VGAA 3GKAA 1KM5A 1P4CA 3QH2A 3ATZA 4O1DA 1RQHA 4IUOA 2Y62A 1JQXA 4M19A 2EHHA 3NPWA 3RLVA 5KITA 4O57A 3UXAA 1M5WA 1WOAA 2C15A 3LCWA 3CHVA 4LRTA 2YW3A 3BARA 1S5VA 3BW2A 3M9YA 4ZZ9A 1I2OA 4AHOA 2FPVA 2E6YA 3G1AA 3FYPA 1Z48A 1L9WA 1QOQA 4HNVA 1GPWA 1WX0A 4OV9A 2X2GA 2E1DA 3KVLA 5F4XA 2FB2A 1LP6A 3MHGA 1B4KA 1FDJA 3WK3A 3W74A 1A5BA 3HOJA 2NV1A 3R12A 4IMGA 3STFA 1EIXA 2QCFA 5DCDA 1TYGA 3KRSA 2H6RA 1THFD 3ELFA 2PRLA 1ZNNA 1PHQA 4GRSA 2TRSA 4MY9A 4RR4A 2WNQA 3FFSA 4DF2A 2RDUA 5ABTA 3T55A 1YXDA 4Y90A 1YDNA 4JN6A 2ZA3A 4OE7A 3OG3A 3VCRA 1GYLA 3KRZA 4JTEA 1FY6A 4MYXA 2Y7FA 1NF0A 3TMLA 2E68A 4WD0A 1TPFA 4WX2A 3TX9A 2CWNA 3EXRA 3CU2A 5E93A 1TPUA 2CLEA 4O8RA 1DQXA 1ICPA 4XBKA 2B7NA 2E6AA 1H63A 5DBTA 2B7QA 2VENA 1SW0A 3MP3A 3TDFA 4A2RA 1JCJA 3B8DA 1B4EA 3N14A 5KZDA 2ALDA 1OFAA 3W7JA 2CW6A 4DBDA 1HO4A 3NPVA 2QAFA 3NGJA 3TR2A 4O54A 3G0SA 4M6QA 3FKKA 2J24A 3LI1A 4MJMA 4WXYA 3W9ZA 3MBFA 3LCLA 4PH6A 3OA3A 1JRCA 1Q6RA 3S9YA 2CLLA 2A6LA 2NUXA 2B7PA 4O10A 5FI8A 1PCWA 3HG2A 1KLYA 4RV8A 2QUVA 2H8ZA 1VR6A 4LY8A 1S3HA 4N9EA 4YCPA 5G4WA 2A6NA 1W8SA 4MUZA 4B5NA 3M5ZA 3GR7A 2NX9A 1EP2A 1L6WA 3GR8A 2FJKA 5CZ0A 2RKXA 3L21A 3QFEA 2X1TA 3V1PA 3VE9A 4R33A 1DL3A 3OEXA 1MSSA 3DHDA 4UXDA 3CIXA 1ICQA 1Q3NA 2VFGA 2DZVA 3S1WA 3L0GA 4AWTA 4GXMA 1XKYA 5CSRA 1F5ZA 4LUJA 5D2YA 4E0CA 3E0IA 5K9CA 4JIQA 4DQWA 1UASA 4JDYA 3R13A 3S5OA 1DQWA 4LVDA 3TC6A 1KLZA 2H90A 4LTSA 4DPQA 2C14A 2RHGA 1FX6A 4NXSA 2E5DA 2J9ZA 5FF0A 3UPBA 4X22A 5AOUA 3H53A 3W83A 1KFBA 4PL2A 4NX0A 4RZ4A 3L2IA 1OYBA 4UTWA 3DXIA 2VFDA 4Q33A 4HKPA 5L9FA 1GVQA 3AO0A 3Q94A 2X16A 1G7VA 3I7QA 1ME9A 1AL7A 4QQ3A 3M0ZA 2C18A 1LZOA 1F73A 1MZHA 2CLFA 1QPRA 1H51A 3O15A 3LLDA 3LRMA 4MFDA 3LXBA 2TSYA 4ZVJA 1TTJA 2QCEA 1MXSA 2DZWA 1YLVA 1O5KA 4UR7A 1QAPA 3W88A 3S0CA 1KM1A 4LVBA 1B57A 2ZFAA 3S5YA 5AHMA 3TQKA 1EEPA 3KVKA 5TIMA 4N2YA 2FDSA 3N9SA 5FEPA 5DN1A 4N9CA 3GIYA 4A3UA 4LWWA 4K6AA 3BVJA 3BO9A 1I4NA 2NX1A 5G2IA 3VE7A 2JBMA 3G1FA 1RV8A 2YSWA 3C61A 4NJHA 3MW7A 1JRBA 1JCXA 1ZAJA 2J88A 4ALDA 5HUPA 3A9IA 4GWEA 4Z0SA 3SI9A 3UWQA 2VEMA 3DH7A 2OT0A 4CQ8A 3SSJA 4R34A 2EAWA 3G3MA 1HFBA 4ICNA 1DBTA 4A22A 4LS1A 5AFDA 3G0UA 4UFLA 4UMCA 1PHWA 3ABRA 3PVFA 1FWTA 4LC6A 3NQFA 2YR1A 3OHIA 5G1TA 1OK4A 2V9DA 2YW4A 1OF8A 2OMAA 5BNKA 2WNZA 3IV3A 3K30A 1O5XA 3BW4A 5F4WA 4XBSA 1G4EA 1W3IA 3STCA 3S1VA 4LNYA 2WNNA 1BWKA 4PCFA 2A21A 3IGUA 1Z44A 2E5CA 4IQLA 1RD5A 1LBFA 4K7YA 4AF0B 1FDYA 4DO6A 5C6MA 5LNSA 1A5AA 4WQ6A 2A7PA 1G4PA 1K8XA 2BLEA 2KZHA 1DJQA 5H91A 1VCFA 5AHNA 1L6SA 3W1TA 4GE8A 3MMTA 2DZTA 1Q6OA 4Z1DA 3WFAA 4JTFA 1NVMA 4MVAA 1QR7A 1WBHA 1ICSA 5F2LA 4QITA 4KFOA 4IXHA 4JTUA 4NNAA 2QCHA 3LTPA
chains in the Genus database with same CATH superfamily
1RBLA 2GJLA 3CQHA 4PMNA 3OLIA 1HJSA 1GEHA 2EBNA 3FA4A 5HMSA 1JPIA 1XYBA 4K39A 1E6QM 1XYZA 1N55A 4A05A 5XIAA 2OEJA 2ZDRA 3GTFA 3JZUA 2R1PA 3GC2A 4UUIA 3OYZA 2ZZ5A 1IWPA 4HP5A 3W1QA 3W28A 3PSVA 3CMFA 2DH2A 3VDBA 1OCQA 4O16A 3MVTA 1J5SA 3VVGA 4FX6M 1UKTA 2X8RA 1E5NA 1M68A 3PJXA 1GJUA 4JCLA 3ARQA 4V1XA 3SAZA 2IS7A 1OCJA 4EX4A 3VD9A 5HR7A 3M0MA 1Q4WA 1BTMA 4G1KA 1GOOA 1IEXA 2VEIA 2QJHA 1DTUA 3C52A 1UMLA 1ELSA 3ITOA 1WZMA 4Q4SA 3LSBA 1X1NA 3VNYA 3IGHX 1XISA 4CCZA 3OVGA 1VHNA 3VA8A 3AC0A 4W7UA 1PV8A 3RCYA 4NT0A 1WKFA 1OWQA 5D2XA 3TIMA 1CB7B 3LZ5A 3WDPP 3QZAA 3FX4A 2OEKA 1DKWA 2E7FA 2DU2A 2WVTA 3ABQA 5ECVA 1V0LA 2GQAA 3ID7A 4O15A 3ZWSA 4Z2LA 2QR6A 1YE4A 4G6CA 4DUXA 1TZ9A 3WQ4A 1ITUA 5H2ZA 5HMEA 1LQ0A 1J93A 1DJXA 4P2VA 1MNSA 4R7JA 2CLIA 5A6TC 1VFTA 5J5DA 1DQUA 3H70A 5SWUA 2CZEA 1GVSA 3DYOA 5DY2A 4CEUC 4IPJA 4WJEA 4KETA 5F1UA 5FAJA 3WDJA 5IDIA 4AYGA 3P8JA 1EDQA 4GI4A 5D09A 1SFLA 1QK2A 1UWTA 4YHGA 2VR4A 3CUHA 3SEPA 1WYIA 1PYFA 5H8UA 4F0MA 4WR3A 5FOOA 4I5UA 1AJ0A 1UKOA 3SCVA 4JY8A 2WC4A 2V3GA 2TMDA 3TWAA 3ATYA 5D8WA 1JNDA 5FACA 1VLIA 3SRKA 4JIIX 1TZZA 1VLWA 5KZ6A 3BC9A 3FJ6A 2XFRA 1W5OA 2NLIA 3NVTA 2YGYA 1UP0A 4HYWA 2VO5A 3T2QA 2A79A 3C6CA 4US6A 5AVHA 2B4GA 1JZ6A 2QCDA 2GVLA 3CAQA 5I79A 1XRVA 3BLLA 4W8BA 3IAPA 3G3DA 3EOSA 4LAZA 1P0KA 1KBJA 2XM2A 4P7LA 1XH1A 3VFCA 3W87A 1PSCA 1FH8A 3HG5A 4L4PA 1JFHA 4C5YA 1BSIA 2WZHA 4M51A 3IIZA 3W1MA 4FZIA 3WQCA 1WDPA 4I9AA 1QVBA 1QI5A 4DJDC 3H2CA 4PUUA 4KFPA 1NWUA 1HXJA 2WSRA 4ZB2A 3RFAA 1JJKA 4DBUA 2DEPA 5T9BG 2J78A 3TQ0A 2QDEA 1KCZA 2G0WA 4EPDC 3GW3A 3VKKA 1N8IA 4WXZA 1KBLA 4J3VA 1OFEA 5BW6A 1QASA 1TVPA 3JU2A 3VKAA 4NQ1A 1CXHA 4GNKB 1K03A 4NG3A 4GUHA 3BAIA 4QE1A 1PWMA 3VD5A 3SIZA 1CI1A 4ORIA 2Q8LA 3G1HA 1I45A 1SZNA 3TQPA 1O68A 3MZ2A 1PKLA 3KVJA 3B9DA 4U2YA 1EWDA 3KOFA 2PCQA 3OBKA 1TTQA 4LS0A 5IXEA 3ZT5A 3AYSA 5DT5A 4Y9AA 2CLHA 3TOYA 1SO6A 1C8VA 4GOAA 2Z1WA 3ISIX 4DPPA 2NSOA 3DGBA 1FWSA 4R7OA 2PP1A 1OC7A 2XUCA 1TFVA 2OX4A 2RGMA 2QIWA 3IJQA 2WMFA 3GDKA 1ONEA 5LHFA 3HJEA 3NDZA 2A85A 4IIDA 4GA8A 2PDIA 1F6YA 2FTWA 4QR6A 3W1RA 1Y7VA 3EWCA 3P61A 2C0HA 5AVNA 3A5FA 1CXEA 1V3LA 4IXXA 3IS4A 2P0OA 3M0IA 3OP2A 1UW9A 4MAVA 1PDYA 4BF5A 3PAJA 2QQ6A 1C7TA 2QV5A 1W1ZA 1TVLA 2CZFA 3EX1A 3HMJG 2YYUA 1NFGA 2HROA 3M47A 4LC8A 4A8LA 4MNLA 1P0NA 2CLOA 3NSNA 3SUTA 3PS7A 1K7EA 1E56A 3UZWA 1Q6CA 2PTYA 2F2KA 4IPIA 3DFYA 3O6DA 2A5HA 1YIXA 4M56A 2FTYA 3BTNA 4FO4A 4PRRA 4LEQA 3NO5A 4EKJA 2C7FA 2DZSA 2H9AB 1TCMA 4HYVA 1FKXA 5EFFA 3LQGA 2OO6A 2UY3A 3WLRA 5DXYA 1B3VA 2OEMA 2GFTA 3FXGA 5D2WA 3CWOX 1WNOA 5KTLA 1AMKA 1AZ2A 1MW1A 1DTNA 4M3PA 3W85A 4S2BA 3UWZA 1RK5A 1UZHA 2WMIA 3VD7A 3VNIA 2NWRA 4YWSA 2ZZ7A 3ITVA 4XZ9A 3R25A 5KSWA 1E4NA 2JQXA 4XB3A 3L4YA 1YXCA 2ANUA 3P7YA 4FF5A 1H09A 1I1WA 3TZNA 1AL8A 1W2VA 4HA0A 4JGDA 4WJ8A 4S3EA 2E77A 3WCZA 4KCUA 1NOUA 1WOBA 2GJPA 1TR1A 5JUVA 3W29A 4FXFA 4PMOA 3UGVA 4CQCA 4N6FA 1JZ3A 3IPWA 5ENLA 3MI3A 3S2NA 3QPEA 4UCGA 1VJIA 2J75A 1CIUA 3AU2A 1OT1A 3VNKA 3IWPA 2YLAA 4D6JA 1EO5A 4IUGA 1JPHA 1J79A 4LUSA 3XIMA 1KRBC 3CZGA 3B4UA 3O06A 3WQDA 4J2MA 2DPEA 3M0YA 5LA2A 1ZQ5A 2G37A 2OQLA 3M0KA 4XQ6A 4B15A 4GUJA 2DFAA 4ADTA 4UFHA 3AIBA 1UUOA 3PZMA 2I5QA 1BF6A 5A2AA 2YZ5A 4F0SA 3T40A 2INFA 1YNPA 1JVNA 1GT8A 3W53A 1V79A 3OLGA 1XBXA 4ZQRA 3ZJKA 2CXGA 3LX9A 3BGAA 1H7PA 2XGZA 1HKVA 1POKA 4BWLA 2J27A 1DORA 1L8PA 5A6KA 5C9XA 1VBJA 2WMGA 3H2EA 1K6AA 1TJ2A 1BVWA 5DEZA 1YX1A 4O1CA 3UESA 3B0YA 1U1JA 3QZEA 3AS3A 2YCLA 2NXHA 5TBOA 4UCFA 4Q8QA 2BHZA 3NG3A 3B0XA 5LIKX 4C65A 4KCTA 1CECA 2P1FA 1NEYA 3T08A 3AALA 1D3HA 2EGZA 1SR0A 2QS8A 4LW7A 1A5MC 4W87A 5JMUA 3BLFA 3NJ3A 5BMXA 3THUA 2PWGA 3QZ6A 2YDQA 1Q5MA 4S3DA 1HKWA 3KOXA 1I0BA 5PTDA 3W2KA 4XO6A 7REQA 4QJ1A 2Y8KA 4PTDA 4CQBA 4GIEA 3N13A 2CXEA 1VPXA 3EEZA 3UF9A 5C2GA 4BWLC 3W24A 5EMJA 5A94A 1BD0A 1OB0A 4GVFA 5FKYA 3EMQA 2XIQA 1NWTA 1FDZA 4XZHA 3BE7A 4QHRA 3R7MA 1Q2SA 1JCYA 4FOUA 1WZLA 1IT8A 5JVLA 3FY1A 4V2XA 1TTPA 3GNRA 4FXRA 1W56A 1JEZA 2QCNA 3VX1A 1Q85A 3TTYA 5BROA 3H2AA 1AH0A 4AVOA 2GVYA 4CCEA 4IZGA 4EAMA 3ZVIA 1KFJA 3K2GA 2A1YA 3LSCA 1Y0EA 3RPDA 2H8XA 1MRAA 5CZJA 1Z41A 5HWNA 1EGZA 3RM4A 1HZYA 1R87A 2PMQA 1LG1A 3DFSA 1TV3A 1RBOB 4DJDD 4LCSA 4QBXA 4RZBA 1EYEA 2PODA 3BLDA 2Z2UA 2PDCA 2CIPA 4QTGA 2GGGA 4Y9PA 1M7PA 6CGTA 4XSLA 4JD4A 3HTWA 1YBQB 1Q7ZA 3ARUA 2G3MA 3TSMA 1WXZA 3DERA 3USZA 1M04A 3VILA 1JXKA 2UBPC 4V15A 1EF2A 3NNTA 1TPEA 4JEQA 3EDEA 3BLIA 2EPHA 2VR5A 5CEWA 2BGQA 4Y9NA 1E6RA 3ARPA 1B9ZA 1XIHA 3NGFA 1R9XA 1J5TA 1E0TA 3DI1A 1LTDA 4IQEA 4Q7IA 2JK2A 4JIEA 4QE5A 3ARWA 3NQAA 2D23A 1TJ0A 3AXHA 4N9DA 4TX6A 2YPIA 3ZT7A 1WZKA 2XFWA 3TMQA 4J9JA 2C3ZA 2HK0A 6TAAA 5LKYA 4H3DA 3UZZA 4JICA 2G41A 4NHVA 2C79A 4LBSA 4L4MA 4IPLA 4GUFA 1A3XA 1VQTA 3CIWA 2XISA 3MHUA 1WKDA 5D33A 4AY1A 1E6XM 2ISFA 3UWWA 3ZJ6A 2Z0IA 2CBJA 3KM8A 4B92A 1R3VA 4DO7A 1CXKA 4NNCA 1LUCB 3OLDA 4AZ7A 5BCAA 1Q65A 2ZTKA 3EX6A 4IJRA 4MY8A 3WH7A 3MI2A 3RJYA 1A0CA 1BAGA 1FXQA 3VKBA 4LCRA 2VMFA 1IWBA 1ZTVA 1J4EA 4PSRA 3WQ5A 4O28A 1G4TA 1B3ZA 4Z2GA 1BYCA 1FQ0A 2DT1A 4QSHA 3WJSA 1WXJA 3RN6A 1VZWA 4Q32A 4MLJA 4Z1BA 1W3HA 5EL1A 2P5NA 1Z6KA 2D22A 3DYPA 2OU4A 2Z26A 3VIJA 5DCEA 4GUIA 3R4IA 4MWAA 5D32A 4OIFA 2XVNA 2E40A 2XYLA 3V75A 1PTAA 1D3CA 5FL1A 2GWNA 3NQBA 3U2OA 1UD2A 2WBGA 3TYUA 4XKYB 1F4HA 2XWDA 1GVYA 4S3AA 1J0JA 2TYSA 4GI6A 3MU7A 5G4HC 1W17A 3F4CA 1ZAIA 3C2OA 1XDLA 3KCLA 3P74A 1SSDA 4FNRA 3WLOA 5LXEA 5ABFB 3IGSA 3KWSA 1JG9A 4PCPA 4CN1A 1DPMA 1FWRA 3HN3A 1EX1A 1QXLA 4FS9A 1TPDA 3QHNA 3SUVA 4E2BA 1TWIA 1XRTA 3SDOA 2P10A 4K8EA 3SB0A 1ZGDA 4ZOCA 3B0VC 4DLFA 3HGSA 3LGDA 1T41A 1SZGA 2E25A 3S83A 2WJDA 2FZNA 5A5WA 3Q2DA 1B90A 1QFEA 4Y96A 2LLEA 2W67A 1H7NA 3U4AA 4J28A 2G97A 2QNEA 2QT3A 1OX4B 4MWAC 4JX6A 4EOUA 4D72A 3KHJA 1EZ2A 1VS1A 2DVUA 1XIBA 5D9NA 3IK2A 1E6ZA 1VYRA 3I3EA 1FUYA 2YCKX 4RX0A 4NAFA 3WO8A 1OX5A 3CZJA 4XSMA 3O6CA 3VZXA 1KM2A 3P5YA 3CQ0A 3ALFA 1EGMA 3NM3A 3STGA 3DAQA 3RMEA 4WDWA 2X1UA 4F8XA 3WK1A 3PZTA 4NIRA 1OFPA 3ARXA 3WLIA 4AXKA 2ZUUA 4A2SA 4LV9A 1TQJA 3OVRA 3TAKA 1CT5A 1OZQA 2VEFA 3NQGA 1EXPA 4WEVX 3TAOA 3W02A 2YLLA 3EMZA 4NY2A 3S42A 4J4KA 2DZUA 2J7BA 3EWUA 5CJ5A 1M1BA 5IRPA 4D9PA 5LYRA 1YTKA 3M0LA 3KBMA 1PB0A 4DZAA 4X2RA 4XISA 5GVJA 3URAA 3AXKA 4TIMA 4ZTYA 1UYQA 3K4AA 5D04C 1UH4A 4B5WA 5EMLA 3NQCA 3WFLA 1IIGA 2I9EA 4A29A 3ZYZA 1OT2A 2DIEA 3E0WA 4DWDA 1HGWA 3REQA 3PF3A 5IBXA 1UIPA 1ODZA 3NYZA 4Z1YA 2I16A 1I1XA 2W3ZA 5D9PA 4J3WA 4H4IA 1B3OA 3OTRA 1VPYA 4C7DA 2GSJA 1I8JA 2Y5JA 1GZJA 3FNDA 1XICA 1FCVA 1UWQA 4EXAA 4UQDA 2FQIA 2PDLA 1K4GA 4L6HA 1KD0A 4I5RA 4O19A 3P62A 3TZFA 3DCPA 3I68A 1TREA 4ACYA 3F7JA 1S38A 1GQLA 1LOQA 1X8CA 4JTJA 2WZMA 4FX8A 1UA7A 1DP0A 3EZ4A 3KP0A 2OKTA 3V36A 5BRBA 4WY0F 2QDGA 3OO2A 2QYGA 5IBXC 3T09A 3N2OA 3W26A 1XJBA 4V27A 3GY1A 3I7SA 1RALA 3UG4A 3C3NA 2QPUA 2E1WA 3GLCA 4GINA 4LFYA 4X3ZA 1W0MA 4PFHA 2VX6A 4GHRA 4C91A 1UD3A 1QBAA 3SSZA 1SVDA 1R2RA 3A13A 4GD0A 3AJ7A 4Y8FA 4LT9A 3WL0A 1PE1A 4RE3A 1O1ZA 2OB3A 3DG6A 3TN6A 2ZXAA 4JYDA 5D2VA 4HU8A 5F7UA 3B8TA 3CUGA 4R3UA 2Y1HA 3N34A 1LWHA 5AC4A 1A80A 1H7WA 7A3HA 4GUGA 3V5OA 4F0KA 4K1GA 3L5AA 2P50A 3CEUA 3WLKX 1ZAHA 2I17A 2J25A 4K7VA 5K7JA 3VM7A 3CT7A 4BZYA 4PMDA 1IHIA 4LUYA 2ISSA 3VOHA 1ITCA 1U30A 5DY3A 1EA0A 4QROA 3R0DA 2QAPA 3NQMA 1XIDA 3S9IA 4QDWA 3H22A 4TOQA 4AYSA 3FKRA 1YQ2A 2OOFA 3C5QA 3MKVA 3LK6A 4MPQA 1AH3A 3E0LA 3FK4A 1S2WA 4RXFA 3S2MA 2O92A 2W9MA 2KX9A 1H1YA 4C1NA 4ERGA 3GDMA 3QY8A 4MB3A 2PDMA 5TF0A 1O95A 1WA3A 4F2BA 2V30A 3IUIA 5AHLA 3NL5A 1ZFJA 1BGAA 2E67A 4NAEB 4GPNA 3PR2A 4ZQPA 4AMAA 1T0OA 1XYLA 3POHA 2ZE3A 4UOQA 4HB7A 3UYIA 1NOFA 1F7BA 1UKQA 1PKNA 3GO2A 1WE5A 3W6YA 1W8GA 3M43A 2WVVB 5FEXA 3SUSA 2FZDA 4RUBA 4B90A 2BNJA 1VBGA 2UY4A 4IMCA 3QF0A 3GNXA 3VGEA 2PDXA 4JTDA 3SJNA 5EYWA 4DBWA 1TRIA 4YWIA 2WSPA 2EG6A 4P8UA 3OZOA 5AECA 1UR8A 1VBUA 3EX2A 1TELA 2P3ZA 1TX2A 3RO6A 3LLXA 2QCDB 1W1TA 3A6OA 4MB5A 3W38A 1P6BA 4HNUA 1C8XA 3ITGA 4JFWA 3MO7A 4UTJA 1R46A 3FA3A 1B3YA 3W7PA 3G2GA 4MB4A 1H7XA 1TSIA 5EBAA 1NQKA 4XAGA 2AGKA 3CEPA 3E0FA 3RU6A 1EL3A 2YL8A 4L5ZA 1XIJA 6TIMA 1TTIA 3CWNA 2FVMA 2OLAA 3IV8A 4LOCA 3GWQA 4AEEA 2BTMA 1EDGA 2CLMA 1LRTA 3ABZA 3WKZA 5A6LA 1KXTA 2X05A 2VZUA 3NUKA 1JCMP 3AIQA 3H4GA 2P8BA 4RDVA 4OQVA 1ISYA 2XG9A 2V2DA 3P0WA 3G1DA 1XYFA 5I03A 5HWMA 1FWIC 3MCMA 1TX0A 3N3TA 7CGTA 1GJWA 3CM4A 4P7RA 4YVVA 3EWXA 4MDOA 4CU6A 5CC5A 1H41A 4ZR8A 3BJFA 2YBUA 1A3WA 1TV8A 4MAZA 4S3BA 2FJUB 1C29A 1EKOA 4MWAD 2TODA 3GXDA 2PLCA 4BR1A 2DT3A 3A23A 4PC8A 3EAUA 4XZIA 4IL0A 4W7WA 4NJIA 4XD3A 4TVCA 1BG4A 4A21A 1NIUA 5JIPA 2WKJA 4RLIA 4EPKA 3VGHA 3GVGA 5EMUA 1LL6A 2VZOA 2QCCA 1E9IA 4D6IA 2V63A 2O9PA 2L5HA 1HNYA 1HW6A 4M6UA 3LPPA 3UZXA 1H61A 1PTGA 2A3EA 3CZLA 4C6CA 4Z1AA 2GL5A 4XZNX 3FS2A 1Y5WA 3B3DA 4KS0A 4JZ5A 1H50A 4P8XA 3SCPA 3G1RA 4DZ5A 3LY0A 4CGTA 4AHPA 3GG1A 4IMFA 3BK0A 3UY8A 2ONEA 1WUFA 1VJSA 4RE0A 3S5SA 5CPOA 1KFKA 3T7VA 1BQGA 1F74A 3N9KA 2NQ5A 5AC5A 4JN8A 5L6UA 1ZP4A 3N9RA 4PB4A 5FIPA 2A3CA 3T0CA 4LB4A 4N7QA 2QIIA 1UKSA 1W3NA 3UT0A 5DMYA 3VOGA 2WCSA 5EFDA 3EA1A 4H8HA 4PUJA 3GKAA 3F2CA 2PF0A 4O1DA 4V33A 4IUOA 3E3HA 1JQXA 4QS6A 4ZOAA 3BAXA 3N6JA 3RLVA 3NCOA 3RRAA 3EOLA 1NDWA 3GSMA 4QSFA 4BKNA 4IPPA 3PPGA 1WOAA 3LCWA 1GHSA 2G8ZA 3SCWA 2D0GA 4AHOA 4XD5A 2FPVA 3AIVA 4JKLA 1QTWA 2IQ0A 1Z48A 3QV7A 1GPWA 1WX0A 3AMDA 3B8SA 2PWFA 4OV9A 2X2GA 5F4XA 3VIFA 3Q65A 2WHMA 2PD9A 3PZNA 2QGYA 3AQUA 1A5BA 2NV1A 4IMGA 2AAAA 2VX5A 2ASHA 2O4QA 3ELFA 1J01A 3U2CA 4ZBCA 4DB7A 4ZFCA 1WKEA 2PLKA 4HA3A 3T55A 4Y90A 1YDNA 4DUOA 1JF5A 2PGRA 1GYLA 4JTEA 1FY6A 3DECA 1NQ6A 4WHBA 3IARA 3AXXA 1VFSA 5E93A 1W1YA 1EC9A 4IM4A 4RNJA 3FDGA 1Q63A 1H63A 2B7QA 1S2AA 3P3BA 3S2JA 4AG0A 1PX3A 1QI3A 3B8DA 1ZBVA 3GVQA 5G1MA 1R9ZA 2R1LA 3TR2A 4O54A 3G0SA 4ZCWA 4Q4OA 3AZSA 4F79A 1EGVA 1J0HA 1JI2A 1Q6RA 2CLLA 5D8ZA 3GH5A 4P7QA 4XAZA 3MY9A 5BRQA 2WMKA 2WMHA 4LY8A 3STPA 4KW2A 1JXJA 4CD6A 2A6NA 1QNOA 2PWHA 3GR7A 3GR8A 2OOGA 2FJKA 5CZ0A 2BV9A 3ZOAA 3T6CA 3VKCA 1C92A 1KXHA 3CIXA 5BRPA 3ARVA 3N11A 4A4AA 3L0GA 4AWTA 3WQPA 5CSRA 4LUJA 3E0IA 1EF3A 2IKIA 2BY0A 2C14A 2J9ZA 4X22A 5C9WA 5AOUA 3H53A 2FVLA 1H1NA 4PL2A 2YCLB 1XWYA 4UTWA 1LL4A 3AO0A 2I5GA 4DLMA 4MF4A 1G7VA 3LMZA 3WMLA 3M0ZA 2C18A 4KBXA 1F73A 1QPRA 3KBSA 3LXBA 3OPSA 3GHUA 2QCEA 1CBGA 1NP2A 3IUDA 4IFKB 1YLVA 5JBFA 3W88A 2OSYA 2Y0FA 1B57A 3K4WA 1BYDA 1KO0A 1KQYA 2J62A 3QV8A 2ACUA 4FALA 2YB1A 3N9SA 4N9CA 3WLSA 4LWWA 5G2IA 3AMLA 1OINA 1RV8A 3C61A 1XLLA 3PJWA 3OOQA 3MW7A 1EBHA 4PCNA 2PDBA 3CASA 1ZAJA 4JQAA 4DWSA 4GWEA 3L4TA 4Z0SA 2XH7A 3OB8A 4CQ8A 3EA2A 4Z2KA 1V6UA 3G3MA 4HD5A 4LUTB 1D2KA 4LS1A 2V68A 4UFLA 3SM0A 1E0UA 4GJJA 3NQFA 1HT6A 2YR1A 3OHIA 1OK4A 2V9DA 1CGTA 3WLMA 1J6OA 3TOPA 2WNZA 3IV3A 1C91A 1W9PA 3BW4A 4MMWA 4J2PA 5AZ0A 3STCA 4AEFA 4YTUA 3MDUA 2DT2A 2QJMA 2XIMA 2XH4A 1P6WA 4ZSUA 2G4FA 5EMKA 4DO6A 3TYBA 3CQKA 2BXZA 2AOSA 2KZHA 3ARYA 1XC6A 1UZDA 4Z1DA 2ZUMA 3WFAA 1KKRA 1NVMA 1QR7A 2E8YA 1SMDA 3HFTA 1XW8A 3KS5A 3MMUA 3WH8A 4NNAA 2QCHA 1Q6FA 4ZO8A 4S2CA 1O66A 1YADA 3M46A 4LB3A 4C6MA 1GOIA 3W7EA 3R43A 4UTHA 3FA5A 4O17A 2OVLA 3G1SA 2R1MA 2IPFA 1J96A 5B80A 5HINA 4IP7A 4KH2A 1V6WA 3RNDA 4G7EB 4GZJA 3GM8A 4YL2A 2IW0A 3EWZA 2JEPA 2EPNA 2WSKA 4XD6A 4L65A 4A35A 3K1GA 3LHWA 1F3EA 3BLKA 4O0KA 3PY2A 1SZFA 2MANA 4N4QA 4F3HA 2VQTA 4UTTC 5U4NA 2HNHA 1VEOA 4GQGA 1F2JA 3QTPA 2YXOA 3OGSA 1PXGA 4A6GA 3VD4A 3BG9A 4M0XA 2F8QA 5E9XA 2Z1XA 1KR1A 4GCAA 5HULA 1W1IE 2E8ZA 1V3KA 4UR9A 3U5YA 4RPQA 3P6LA 2V2CA 3GXNA 4GGBA 2VCAA 4UQAA 4Q8MA 3NOYA 1DE6A 2JIWA 3VDHA 3BLPX 2V3EA 1E43A 3N18A 3UGRA 1LQ2A 3BMVA 1F3XA 4W85A 4KIEA 2W92A 3PFRA 1MXGA 3AXMA 3QW4B 1JUBA 3IAQA 3VD3A 2WM0A 4K36A 4F0HA 4D6EA 2GVJA 4R27A 4LXFA 2ZRVA 3I3BA 4LANA 3LBCA 3UWVA 4OGZA 3RU8X 3Q45A 2W79A 1OD8A 3BSHA 3GNNA 2PS2A 1CW2A 3CV1A 3OYXA 4MG4A 4TVUA 1RY8A 2W66A 4DUVA 3W2UA 1X1ZA 2Z4GA 6ENLA 1F4AA 3WD4A 3HBLA 5DO8A 1P43A 3CHEA 5H8MA 3ONCA 3ANYA 3GYCA 2GQ9A 1JL8A 2OLHA 3P60A 4IOTA 2QMKA 1F9CA 4TMCA 5BU9A 1HJVA 4WOZA 3EX4A 3UXLA 5F4SA 2J6VA 4ZQNA 3UPMA 2QUMA 2Y70A 4UQCA 3GTNA 4LPCA 4DYJA 1UUMA 3HF3A 1A4MA 3LGGA 3ZO9A 4HHMA 1V6XA 2BGNE 1JDAA 4ATWA 3Q37A 1CGWA 2C0AA 3PZIA 3GU2A 3ORWA 1AK5A 1ITXA 2GDUA 3N2XA 5IHRA 1SJAA 1W5PA 5HNUA 2KAUC 1Q6GA 1MXDA 3AZRA 4PE8A 3NURA 4Z42C 1SFTA 3BZGA 3U8GA 1MO0A 4CLMA 1SPQA 3DC0A 2F6KA 3WUBA 2PWVA 1RY0A 2OODA 2CITA 5E6YA 4PTWA 4Q8PA 1HKMA 1JULA 1VC4A 3DHFA 2E9BA 5E0CA 3CQIA 1PZ0A 1GZGA 4RK8A 4RCXA 3C0QA 3P14A 1EC7A 2PGWA 3PHAA 2CLKA 1FH9A 3SGGA 1GKQA 1JZ2A 3NDOA 2PDQA 2POZA 1NOWA 4E8CA 3CS2A 4XUGA 3GE7A 3WQ6A 1E9LA 4QS5A 3WLPA 1XDMA 1W3JA 4GXPA 4GZEA 4UIOA 3WY1A 1TWDA 3ZT6A 1PWLA 3AZTA 1B54A 3AFBA 3C2RA 4ZTXA 3VDAA 1OGBA 1TPH1 1ISXA 4CNNA 4AVFA 2XH2A 3MKCA 4JQ3A 4M80A 3QVQA 5DT7A 2I1OA 3F4NA 4YYFA 5EKYA 4E4FA 3DN5A 4AZHA 1XYMA 4NI8A 2OWCA 1VAHA 4REQA 4FMVA 3TH6A 4O0ZA 2QPSA 3VPLA 1H5VA 4R53A 2FVKA 4HYRA 2ZX9A 2HBXA 2WV8A 3KVMA 4QEEA 1JI1A 3L5LA 2ACRA 1AG1O 3DGRA 3LG3A 3U2ZA 1LYXA 4PCTA 3G18A 1OF6A 1XPGA 4U5KA 4MNMA 1TKKA 1QNQA 3QGKC 3L0KA 1TV4A 2F38A 1PKYA 1WAUA 2WZEA 1KFCA 1CGVA 2XIBA 2YL5A 2WHKA 1XGEA 4K8GA 4BA0A 1C93A 1N8FA 2ACQA 4NASA 3B9OA 1KWKA 1X8FA 3G24A 8RUCA 4LV4A 1K77A 3CUJA 5EY5A 1TB3A 5CXPA 1YKWA 3UNDA 1AH4A 1L0PA 1G7UA 5C55A 1GKRA 2Y89A 4BEQA 5BXSA 4IX2A 1RUSA 2A3LA 2XM1A 2YDRA 3HJZA 3QQWA 3BAWA 2Q71A 4WK9A 2BB0A 1V6TA 3LGEA 2Y61A 2Z27A 1XBVA 2WXDM 2VEGA 2C16A 2YDSA 2Z28A 5AC7A 3ZVHA 3M4HA 2IXVA 1E4LA 4GISA 3E2VA 2ZX7A 4EVZA 1HVQA 1W2PA 2WNWA 2YA0A 1OYCA 5BOOA 1ADDA 3VIHA 4OZOA 4H8UA 5F2MA 2ZBTA 2REQA 1TA3A 3RLUA 5AN7A 2D0HA 3URBA 3W3OA 3QV9A 2EJ1A 4GYPC 1S2VA 4RJEA 4PB3A 3RPTA 4TX8A 3SY5A 4E8DA 3U9IA 1O6IA 1KFEA 5LIYX 1SO4A 4M6VA 5F2IA 4CQDA 4DWSD 3PB2A 4KEZA 3LU2A 3NAVA 3PZVA 1R86A 4J7RA 3O8AA 3QSTA 3NL3A 5CAHA 4Z2JA 3TTEA 1QHZA 3NQVA 3W7MA 3HQPA 1DWHM 2GSEA 4W7VA 3W37A 1GVOA 3RYSA 2HSAA 1FFQA 3W70A 3G0XA 2VD8A 4IT1A 2JKEA 1SZEA 1R0MA 1Q7QA 4GBUA 3N19B 4LYQA 4XZWA 4DN1A 4YTRA 3WELA 3W7KA 3KRBA 3WQOA 3P81A 3BCJA 1PS9A 2HTMA 4LJ3A 3JVAA 5LIXX 5D37A 5DX7A 1XLCA 3BV7A 5A8NA 4HSHA 3C56A 2PDGA 2WWDA 5BOFA 2HXUA 1R8LA 1XFBA 3ITYA 4KRTA 3P8IA 2WBKA 3TYAA 3N6QA 1DOSA 4GXWA 3NQ6A 3BAKA 3LPOA 3GTXA 4DYEA 4JTLA 2GDQA 4HIBA 4MNKA 4O13A 3LRKA 2GUYA 3O07A 4CEXC 1X38A 3UNTA 2QPXA 4C5ZA 2B0MA 5C70A 2VFEA 3GK0A 3KOZA 3S1UA 1Q66A 1AQMA 3WJZA 2EKCA 4TMBA 1J12A 4HU3A 3L65A 4C6IA 1KFWA 1XBYA 3DFPA 3LNMA 5F1VA 1CLVA 1AODA 4BF7A 3SRFA 5C9ZA 1G0CA 2C6QA 5A2BA 2XFYA 3UWYA 3VCCA 2ISDA 2IKJA 4WY0A 4UBPC 3NA8A 5J8LA 3P5ZA 5AHFA 2HPMA 1GVFA 2Y8VA 3WH6A 1CX9A 3POCA 4FR1A 1Q6EA 3AROA 3U57A 4XZMX 3BXWA 1KNWA 2WVSA 4FXSA 1FWFC 5FJRA 4B3KA 2Z25A 1QWGA 1Z32X 2QV4A 3RM9A 1V4YA 1JD9A 3I6TA 1YMYA 1XLFA 4Q4RA 4NZJA 4KFNA 1EUNA 3QGAC 3W22A 1AA1B 3TW7A 1G01A 3F5LA 1PZ3A 4H04A 5HUOA 4HMCA 4B5VA 2VZSA 1EQPA 3AWNA 1S1RA 3MUXA 2YA2A 5A6AA 1R5YA 4W86A 1YXYA 4NNBA 2E9LA 1AMYA 3DFHA 3C2YA 3VK5A 2E6FA 4BI5A 1LLZA 2GJNA 2PFHA 2F84A 4PFMA 1R6WA 4ZOBA 3CAWA 1KCKA 4UQEA 2GK1B 3ZQ9A 4K38A 4Z17A 4KCVA 2PTXA 3TNOA 5FJPA 3DBPA 1EWEA 5ABGA 4BF9A 4DJEA 1UWAA 1UMYA 1POJA 1JUEA 2F6XA 4JIRA 2E28A 3AS0A 1E6NA 4TO8A 5C2XA 2Q8ZA 3NXLA 3PWIA 3HV8A 3OZYA 4OBRA 1UBPC 4N0RA 4XX6A 1VEMA 3TK7A 3C2VA 3DKLA 4JFTA 1BQCA 4C1KA 4PRTA 4H9TA 4Z1CA 3D46A 2DJLA 3BQ6A 3W1LA 2HQAA 3W75A 3WMCA 4I6KA 1JPKA 1IXOA 2OZ0A 5GNXA 5HBFA 3OBEA 1L6FA 3WNMA 3NO3A 1SR9A 3MUY1 1K7XA 2Z00A 1XCXA 3R11A 1VHCA 1JQVA 3U3HA 3DG7A 1JDFA 4HPXA 1QATA 3NZRA 4CVWA 2VEKA 5A95A 3FJ4A 3QLDA 3QPZA 1J2BA 5DQPA 2WZIA 4GQBA 3BMWA 4DJEC 5REQB 2X42A 4J3XA 5JBDA 2DSZA 4R9OA 4E3VA 3AS1A 3MANA 4H01A 1E6SM 4O1AA 1XLMA 2OCZA 1JF6A 3QXBA 1VYSX 1XG3A 3LM7A 9XIMA 3N4FA 1KW1A 2J47A 2Y2WA 5D30A 2HEJA 2G3IA 4AW7A 2HK1A 3WF1A 1LT7A 3L2MA 3M6YA 4LY4A 2EPMX 3ZLFA 5TQLA 4JL2A 1RAKA 3CO8A 5HMDA 4INFA 2VCBA 1PKMA 4H7VA 3LBMA 3KHDA 1WCGA 4CNTA 1NTHA 4X2PA 1W1B1 4Q7NA 2BODX 3AIRA 5G4EA 3E1F1 2OO0A 4CN6A 3A3WA 3E12A 3RF9A 4F9DA 5E0FA 5CPTA 5DELA 3WQFA 3LBOA 4AFYA 2WQDA 4JTGA 1CWYA 4OOZA 4AVNA 2P53A 4GY7A 4L80A 5AYBA 3LOTA 1WZAA 4S3KA 2FH6A 2FGZA 4ROQA 3TXVA 2J66A 4PMVA 5FJTA 4ATLA 2XH0A 4ONVA 5A8OA 4N9BA 4F66A 2ZA1A 4GQQA 1PZ2A 3U4FA 3W71A 3ZM8A 2X41A 3VGFA 3E2QA 3IGXA 1V3HA 2FB3A 4M29A 3UVIA 4QNEA 2DUZA 4LVAA 2GVGA 4M6PA 2V81A 4HSOA 4GO8A 1SO3A 2Z2BA 4X9SA 5I3FA 1R3TA 4CNPA 4JTIA 1BLIA 3VOIA 2DUAA 1UROA 1EZWA 2VZTA 3LHUA 2VHLA 1O5QA 5E09A 2QCMA 2AQWA 4Z0JA 2VYOA 5GPRA 1MDRA 3CUXA 3SCRA 2A7RA 3SUUA 1GJPA 4C7GA 4FEZA 3L2LA 1X39A 4QXIA 2V6AA 4ZXOA 4MWAE 3CAVA 3GU9A 2XSAA 1VCVA 4FOJA 4Y2WA 3GAYA 3K46A 4XTDA 3ERPA 5AKQA 1VPQA 3O0KA 4IF2A 2JIEA 5DLCA 3QV6A 5DMMA 3SO7A 4S1FA 5F2GA 3PPCA 3RAOA 3TC7A 4UR8A 1ZU8A 1V6VA 3UWUA 5K9XA 3CV7A 2ZZ4A 4HNNA 2Z6IA 4GNJA 2CERA 4LF2A 2QVHA 3G8EA 4AD3A 2PDNA 3TTQA 4CQ9A 4JXCA 3GXIA 1VFLA 2CU0A 3WLJA 1OD0A 3PG9A 1B3XA 1BTCA 1A5NC 5D02A 1JYWA 4NZ3A 1REQB 2I57A 5T26A 1FRBA 2AAMA 3LCXA 4A3RA 1V51A 1TJRA 4QISA 4HCLA 1IGSA 1XLAA 3RCNA 1ZCOA 3W86A 4AXNA 3ANVA 2OKOA 3ARTA 3KOYA 4HHLA 2XVPA 1CPUA 1ZHAA 3TJ4A 3N04A 3P80A 3E74A 4E5TA 2ZYFA 4DBSA 4DI8A 4ZODA 5FEZA 5HA7A 5CLTA 4Z2IA 1QOXA 4TX9A 3R79A 2NW0A 1JAKA 3DUGA 5JXQA 3WENA 3H4XA 3LHYA 4N02A 2A4AA 2PWUA 1KRCC 3RPMA 3VZZA 1E1CB 4UQBA 3WNOA 1U1HA 5EB8A 5CGQA 2J13A 2PLMA 1ZY9A 3UG5A 3NQ8A 2YOCA 4QJ4B 2QJIA 2XU2A 4P7OA 5C7VA 4EE9A 4DJFC 6XIAA 1V8EA 2WOQA 3GAKA 4J5NA 4PN2A 3NZGA 3PTMA 4FPSA 4U2ZA 4AHQA 1G4SA 2V69A 5I2UA 3U6WA 2JKAA 3GG8A 4GI9A 2ZXBA 4Y8EA 5FA5A 5E1QA 1LLWA 1PAMA 1M7XA 3WK2A 1V02A 3V0UA 3MWAA 3UPWA 2E5BA 3KWXA 3O9NA 1XS2A 1BRLA 1A50A 1X6NA 1NWRA 4XVDA 3HPZA 3A21A 5HJLA 1BXBA 2XFFA 3B0PA 4I8DA 1XYAA 1US2A 3T4WA 5IFTA 2HVNA 1OGSA 2ADAA 4B5SA 4BQ2A 3S6DA 2NQHA 2QHAA 2HE8A 2OYMA 4Y7EA 3HZ3A 1DWGM 1E71M 4PUKA 2VC6A 1XFCA 3P84A 3THDA 3KDOA 3UR7A 3HG3A 2YIHA 3CGTA 4S39A 4TU1A 1IEQA 3E5BA 4MADA 5TD4A 5C2CA 4HK5A 5G2WA 1TRDA 2HRWA 3FHAA 1XQLA 3ENLA 2VGBA 4E2VA 1OY0A 2ZQ0A 4O53A 4HN8A 1SZRA 1W1VA 5FF4A 5CJNA 3TUUA 1A5SA 3WJXA 1H60A 1UHVA 2NZLA 4Q4PA 1QI2A 3GUWA 3UY7A 3GTIA 2OQHA 1Q4NX 1TWWA 3LB0A 1ZUAX 3L5MA 3W23A 5BXTA 4U10A 1AQFA 1I9CB 3S5NA 2VI0A 1WDDA 3LCHA 1O12A 2I7GA 2MUCA 4IIBA 3W82A 2CHOA 4GO9A 5D03A 3USBA 1X96A 2PEVA 4AWUA 1R2TA 3LS9A 2Z1VA 3EWBX 1ITQA 1X7FA 2PDWA 4MJZA 2DY3A 3LV6A 3S2CA 3NO1A 2NV2A 3WBWA 1XHGA 2WK2A 4K2SA 4UFIA 4M81A 3V18A 4DJED 3D3FA 3R89A 2VURA 4D8LA 3IIPA 4AD0A 1UJPA 3WEZA 4WF7A 3CUIA 4ZEPA 3LQLA 1TUFA 3GNPA 3MJMA 3QFWA 2VJXA 3GFZA 4HK6A 1BYBA 2V2HA 3PTKA 1DWFM 1VB9A 1JPDX 4I7WA 3TVAA 4S38A 3H7UA 3H4WA 2BHUA 3TA6A 3GTHA 4AF0A 2Y85A 5AYYA 3EMCA 3T1GA 2Y5SA 3A64A 3QC0A 3R1ZA 4S3CA 1E0XA 2R14A 1JDEA 4D6GA 2YFOA 3P93A 1IE7C 3GDTA 6REQA 4YTSA 3OQ8A 3QC3A 2DW7A 3UJEA 1AD4A 3MT1A 3O63A 2R94A 3STEA 3FOKA 2V8ZA 2VFFA 2JEQA 4YCOA 3QOMA 4GFIA 4Q8TA 3NZPA 1GQNA 3QYQA 4HU4A 4ZB0A 3KBNA 4AIUA 3DU0A 4B3LA 1M6JA 2XN0A 1BFNA 4YTQA 3AICA 3WZ0E 1FWEC 5HATA 3KL5A 3FLUA 4XKMA 4E2OA 3C0LA 2P76A 4C1LA 1HJWA 4PCSA 4MZ1A 1JNEA 4JCMA 1XIMA 1BHGA 3HPSA 2G5WA 4A3YA 4MKNA 3BCFA 2DIJA 4Q6XA 1FWCC 4KIRA 2D2GA 2OG9A 4WKHA 3GS6A 4DAFA 1RVKA 2Y7DA 4LCQA 1DIOA 1FP8A 4M24A 3ZMRA 4I5XA 4DJDA 2C13A 4AZCB 2QCGA 3HMCA 1A4LA 2XVKA 4R85A 4H19A 3HG4A 1Q2RA 1L8NA 2YCJA 4B5XA 3GXFA 5H8PA 3N73A 4S23A 4W89A 2D69A 1ISVA 3DESA 1TMHA 3B03A 5LIUX 3GR4A 4AEOA 2O9TA 3F4WA 3T0DA 5BWAA 1XGDA 2D3NA 3Q4DA 2D3LA 4I9MA 1G94A 4AIBA 1F07A 1XYCA 2HBVA 4DHGA 4MNJA 4QCFA 5LA0A 1HKIA 2AMGA 3IRDA 4REQB 5CSYA 2IKHA 3U2EA 3AUOA 1QPOA 2B81A 3BG5A 3CL6A 3TTSA 5I02A 1LJYA 2Q3OA 3TYCA 4OOUA 3B9NA 5C5YA 2EPKX 3UJ2A 3B8UA 4LSBA 3CB3A 2PRMA 4J3UA 1AQHA 2A3BA 1ZBWA 1M7OA 5H1WA 2RDTA 3DHUA 2V5KA 2J8FA 1TPWA 1UA3A 3T0TA 2CBUA 2PP0A 5I3HA 1T99A 3ZZ1A 1L6GA 5LA1A 4JY9A 1HQTA 3HPXA 1UR1A 4C90A 4GZ7A 4DZIA 4TQTA 3W84A 1GTHA 9CGTA 5M17A 1P7TB 3COTA 1P4CA 1H0IA 3QH2A 2J7HA 2Y62A 2PTWA 3VU2A 1L2QA 4XZBA 4P8WA 1KC7A 5KITA 4O57A 4QDPA 3CL8A 4HOXA 1R85A 1V3IA 3UXAA 3ALGA 5CC3A 2YW3A 3BARA 3EDDA 3CQJA 3BW2A 1I2OA 5JBEA 4KWOA 3ZVHB 1QU4A 1L9WA 3WF2A 1HN1A 1QOQA 3CHFA 3SCSA 4AZIA 2E1DA 2J77A 2FB2A 3MHGA 1EHAA 4KERA 3WK3A 3W74A 3HOJA 3O3RA 3STFA 4I3GA 2QCFA 3KRSA 4DJFD 3WDQA 1THFD 3ES7A 4GACA 4GZIA 1XH2A 4A8NA 1PHQA 2D0FA 2BY1A 1UWIA 5C7HA 3SRDA 1VFMA 1J11A 3SN0A 4Q8VA 5XINA 3VOCA 4KWSA 3G6LA 3OG3A 4PZVA 1O5RA 5C8BB 1UH2A 4PTXA 3TMLA 3GXMA 4C6BA 1TPFA 4WX2A 3EXRA 4DZHA 1LL7A 2CLEA 1DQXA 1ICPA 4NL1A 3MDWA 3B8VA 4XBKA 3VGGA 3AXIA 3MP3A 4XVEA 4U33A 1X7IA 1CCWB 4H6EA 1YDYA 3UXKA 4DBDA 2PZNA 5I24A 2X2YA 1MDLA 3NGJA 4MHBA 1UR2A 2JF6A 1BXNA 3FKKA 4WXYA 1XLIA 3W9ZA 3MBFA 4PH6A 3OA3A 2XIJA 2NUXA 4ZSTA 3L4UA 4IMAA 4QQUA 4O10A 3V4BA 1K6WA 5C9UA 4RV8A 2QUVA 2H8ZA 1VR6A 3FGCB 4F0RA 2VUNA 2J79A 2NX9A 1EP2A 2GGEA 3BLOA 3L21A 2XJ7A 4HZMA 3VE9A 2PLJA 2EO7A 4QLJA 1MSSA 1Z89A 4UXDA 1CGXA 1ICQA 4GIAA 3KW3A 3U0HA 2DZVA 4GXMA 4Y9MA 2JALA 5XIMA 4C6KA 4AD5A 3R13A 3S5OA 1DQWA 5CZKA 1KKOA 2H90A 4LTSA 2VNCA 3KBJA 2RHGA 3UPBA 4PMXA 3W83A 4RZ4A 1OYBA 2VFDA 3K8MA 1GVQA 4LYPA 3NWRA 1JZ7A 4PRWA 1MZRA 1Z8AA 1LZOA 3EPNA 4X0NA 1TWSA 1H51A 3O15A 2B31A 3LLDA 3LRMA 2ZUWA 1OADA 1PO9A 3PZQA 2H9AA 3FXYA 1MXSA 4UR7A 1QAPA 5FJJA 1WO2A 3VMNA 1EDTA 1E73M 2ZFAA 4GIRA 3S5YA 3TQKA 3GBDA 4WSKA 4CD7A 4QP0A 1PYMA 3FEQA 4RNIA 5FEPA 1OQFA 4IHCA 2E4TA 4J3ZA 3VE7A 3G1FA 2YSWA 5I6SA 3EYPA 4H8NA 1JRBA 4JN7A 1JCXA 3EKGA 2J88A 3A9IA 2OYKA 4H6RA 3QKZA 9RUBA 2VEMA 3SSJA 4R34A 2EAWA 4AX7A 3AHVA 3C3UA 3CNYA 4A22A 5AFDA 1PHWA 3ABRA 4LC6A 4LAMA 4L64A 2AKZA 4RDWA 2NVAA 1KBBA 2OMAA 2YW4A 4UWMA 1TMLA 3GFYA 1GQKA 2OZTA 1FWJC 4ECLA 4LNYA 4OKDA 4JIHA 1BWKA 2BY2A 1E4MM 4XG1A 4IQLA 3TR9A 2NT1A 2O9OA 3UEQA 1M3UA 1UD8A 1GGOA 4WQ6A 3M64A 1IYXA 1DJQA 5AHNA 3W1TA 4GE8A 3VYLA 3SN4A 2Q6ZA 2QGHA 2I56A 1K9DA 4IIHA 3WMBA 1EBGA 3CH0A 5B7YA 1YW1A 5HOSA 1J18A 4JTUA 2ZWYA 3LTPA 3SQLA 4IG2B 1EJXC 3NFUA 2DZPA 4TXEA 3LCIA 3OVQA 3GC4A 4YIWA 2FZ8A 2VGFA 2E9MA 2PRHA 2C1GA 1Q6LA 2HISA 4BFAA 2NQLA 3VI2A 4OFCA 4FAMA 3TE9A 3BZJA 3PPHA 1KM0A 4DX3A 4UNLA 3ME3A 3CYVA 4X63A 1NY1A 3W7NA 1FA2A 1S2CA 3CXOA 2Q8XA 3B8WA 2A2IA 3LXAA 4PTNA 1LWIA 4MPKA 1EUAA 1PJ9A 3W27A 2ZX8A 1QWKA 3QJAA 1NARA 2WAGA 3KXQA 4W4QA 4A3QA 4GKLA 1K7FA 2Z1SA 4E38A 1DHPA 3L68A 3GQYA 2ZICA 2QJJA 2PTZA 5CQ1A 3BUVA 1F8IA 3FV9A 2YB4A 3NQ2A 3MV01 4ZO9A 4B5UA 3SZ8A 5DXXA 5I23A 2CBIA 3GDRA 1MWOA 3BOFA 1KGUA 1E3ZA 3CPRA 4QG8A 2IQDA 3TA9A 2ZZ1A 1S3TC 2GJXB 3GYEA 3UWEA 1G5AA 3K8KA 2W62A 3QSRA 1JDDA 4S3FA 4ACZB 2IPJA 1QNSA 4E6MA 2CETA 4JNZA 3UQNA 5AYIA 1OX6A 2R1NA 4ZO6A 5KINA 3LA4A 4B2DA 1KB3A 4KRZA 1GYNA 1RD6A 2D1ZA 1X1OA 4D2JA 3UW6A 4IIFA 3BAYA 4R5EA 4HHHA 4C6FA 1X97A 3THCA 1FVPA 4ZA0A 2XZ7A 5GNYA 4PB5A 4YTTA 3LHZA 3TXZA 1UB3A 2ZA2A 4F9JA 4O18A 3PFMA 3CK5A 5CPMA 2F6UA 4E3TA 2QJGA 3WF0A 4O50A 3E2SA 3QR0A 1QUMA 4IX0A 1HX0A 4AY7A 5IM51 4WLCA 1M41A 3TW6A 4QCEA 2GVEA 2YFNA 4HSNA 3LNPA 2DORA 5B7ZA 2X30A 3UZJA 1SFSA 3HM7A 3NQ7A 5CPQA 2Z7KA 1DIDA 1PZ1A 1YBQA 1RHCA 3NSXA 4K37A 3HA1A 1LM1A 4TUFA 1OIMA 3VFLA 3ZIZA 1NFPA 3RX4A 4HPJA 2PBGA 2WJZA 4HNLA 3LV5A 4DXKA 4FR6A 4GX8A 4RXGA 2W6RA 4JKMA 3S2LA 4B5TA 1DE5A 4AU0A 2OGYA 2FTPA 1XIEA 2D20A 4CU7A 4QLKA 1FWAC 5CBJA 4PEEA 4CU8A 5FEWA 4NJJA 3MUIA 1HUVA 1TWZA 3VIMA 5I77A 3DFTA 2JGYA 3W2LA 3W7IA 1P6CA 3QKEA 4KWWA 1I2QA 4OU1A 5KMYA 1LBLA 3D3AA 4LGXA 2Y24A 1GVRA 1MFUA 2XVLA 3LRLA 5AB3A 4CCCA 1H3GA 1TMQA 3UR5A 5D05A 3BLEA 1DJZA 1VH7A 3QHOA 4JX4A 1MW2A 2AL2A 3GZAA 4G5DA 3N2BA 3IJ7A 5FF3A 2WKGA 2Z24A 4MSSA 3CIVA 1TV7A 4JQ1A 3BW3A 4PA8A 3DZ1A 4G2DA 3W7LA 1FWDC 3TONA 3BV4A 2NSXA 1O94A 3VM5A 4GC4A 1CXFA 4EWND 2DSVA 1XF0A 5GJNA 4HT3A 1V0MA 3TLQA 5FJIA 4S3GA 1WDSA 5E5CA 4AB4A 1P48A 4DAIA 4XUYA 4W88A 1ZRQA 3CUZA 4FIQA 3UP8A 1ML1A 3NPXA 3PC0A 2RFGA 2A3HA 4X0VA 4ASTA 1ISWA 3M1ZA 3HQ1A 1JYVA 2DW6A 3GW0A 4DEFA 5M3WA 1SGJA 4JPGA 3N15A 4Q8OA 1US3A 1YPXA 3M7SA 1YNQA 4D71A 3AHTA 3ITCA 1XCWA 4HCHA 3WNLA 4AH7A 1MQPA 1OYAA 3Q67A 3MUCA 5A3HA 2H3DA 1W9BM 1DWAM 3WEOA 3DHPA 2DUXA 3TYZA 4Q4QA 4XKYA 3SFKA 3TV8A 4KGJA 4LF1A 3T2PA 1JR1A 1H11A 1HL2A 3EWWA 4LS2A 4E4UA 4DM2A 3VIIA 4LRSA 1F76A 5BXPA 2ZUTA 5ABFA 2ZRYA 2QUUA 3RLHA 2J9XA 1T6MA 3I3DA 3EB3A 3WD3A 2YCEA 3DEQA 1ADOA 5CC7A 2R6OA 3ECQA 4R9XA 4B91A 4DY1A 1H4PA 1D7KA 3CLMA 5K4ZA 1QT1A 1V93A 7ODCA 4GVIA 5ECUA 5I07A 1LCOA 3F5KA 4LBUA 3LM3A 5CZSA 1ZBCA 1JCNA 1S5WA 4G8TA 3YPIA 3BOLA 5T91A 4PTVA 3GIPA 4AZ5A 1RH9A 1J8VA 1OX4A 1RPXA 3TLLA 4O4VA 3WMSA 4PL1A 5DANA 2ZUSA 3IUHA 3EDFA 3AS2A 4FSAA 1XLEA 4ERIA 1HG3A 3J7HA 2ZXQA 1DJIA 1R3RA 4JR5A 3L67A 4LAKA 2X1RA 4JTTA 3ANUA 2OXNA 1XBZA 5CLWA 4UTFA 2Q01A 2V38A 4IPNB 5G5IA 2V3FA 3A4XA 3CPGA 4NVTA 1DEDA 1UR4A 3VMOA 1PVNA 1RJQA 3GKFA 2GDVA 1MEHA 1WKYA 4AC1X 1YNYA 4UMAA 1F6PA 1G67A 3LTSA 4JIPA 2C8NA 5FF2A 4JKKA 1TJPA 4IMDA 1YPIA 2G3JA 2PB1A 2F2HA 4Z08A 3SY8A 1FCUA 1NDYA 1GOMA 1EP1A 3UG8A 1TE6A 2BASA 4XIMA 4WGHA 2V0TA 3H2OA 3IJ9A 1MFVA 5HQLA 1TE1A 3ZR4A 2OZ8A 4L6OA 1CEOA 4OECA 1A53A 5I06A 4M82A 5I3IA 1BG9A 5BOEA 2BOFX 1UKPA 3R2GA 5JQ9A 1OBAA 2FDMA 4KEVA 1ZL1A 2GSHA 4ZB5A 3UJSA 4K1WA 4AC7C 3F2BA 4EK7A 4ZXLA 2QEZA 1HJUA 3W7HA 2VUYA 2E6DA 2TPSA 4JQ2A 1XV8A 2V5LA 4PEKA 1ZJHA 3BG3A 4L1GA 3LZ3A 2YBTA 2YZRA 5CAKA 1F05A 2XSXA 2XHYA 3F4VA 3W73A 3EXSA 2FKPA 2DT0A 4UTMA 4AQLA 1PIGA 3QN3A 1FFRA 4IIEA 1GTEA 1V6YA 1QNRA 3N29A 3HGOA 3GNOA 5EBUA 4I7UA 4F2UA 5FESA 2OTDA 1WV2A 2R82A 3CPUA 1H7OA 3JR2A 4IGNA 5IHSA 3NEVA 4K68A 2ZVIA 3W72A 1P1XA 2CKSA 2OR2A 4S3JA 1UG6A 2A3AA 3PULA 5HR6A 3M7WA 3PZOA 3E96A 3K1DA 4QAWA 3FHQA 3NZ1A 2VDIA 1TV2A 3EPMA 1ZJBA 1HF6A 1GOQA 4HK7A 4K3ZA 3W1AA 1UOZA 2JE8A 3GNDA 3LHTA 1OM0A 1IV8A 3RM8A 4HA4A 4RE2A 3IK4A 1OCNA 1U33A 1GQIA 5CCZA 1UCWA 1UPPA 2OWXA 2X40A 1GG0A 4NP7A 2FLIA 3H2NA 2PF8A 2GOUA 3VNLA 1SJBA 4JDBA 3FAXA 2F9RA 3NDYA 5BU6A 4PODA 4DRSA 3CUFA 4XWUA 4XZLX 1HL8A 3PBUA 1JUKA 3L7RA 1V7AA 3DFQA 4B2DD 4O12A 2VXNA 1C9WA 3C2FA 1HGYA 2ZCGA 1EOKA 3RXZA 1JZ8A 3W07A 4JYFA 3FIGA 1WAWA 5AC6A 5BMWA 3ONBA 1YYAA 1OFDA 3PB0A 2G96A 1C7SA 3ABOA 3W0KA 3WEMA 3AAMA 2FHFA 1VP5A 2GLKA 1E3XA 3W7OA 3RK8A 1XIIA 4G9PA 4H9MA 1NFBA 4GLEA 4RL3A 3KOWA 1LG2A 3C2EA 4MY1A 1HO1A 2EPOA 3C86A 4KGLA 2WVUA 2P3EA 4QG9A 4H2HA 2BXVA 1LROA 1JZ5A 4BK9A 3FAWA 3URNA 2VOTA 2VR2A 2JKPA 1GQJA 4NAEA 1BF2A 3BAJA 3EPOA 4DO5A 1YE6A 1L2UA 1NELA 7XIMA 1A5OC 3OLEA 3AUJA 3CZKA 4NZ4A 1Q7MA 1EHNA 3SW6A 1F8MA 2WVVA 4QIUA 4I90A 3RG6A 1G9HA 4XIAA 1LQAA 4GVGA 1NAL1 2V3DA 2ZC1A 3A47A 4HNCA 5I3GA 3QR1A 1R9YA 2FYMA 1XKJA 2HCVA 2X1IA 3KZSA 8CGTA 5KEZA 1YTDA 3VUPA 3CMJA 4U28A 1RJRA 4EXBA 2ZZ3A 5LHEA 4Z2HA 3WDHA 2WO5A 4JHZA 1HKKA 1OVDA 2V5BA 3T8LA 2CHRA 1W1A1 3EKZA 1CENA 1QI0A 1W5NA 1RBAA 3MI6A 2YYTA 3VMPA 2X7VA 1ZENA 3WF3A 4UFJA 2ZRUA 2WM1A 2BWGA 3PUDA 4EP8C 3M0JA 1RQBA 1JFXA 1OC6A 1KGWA 3CL7A 4HZ6A 4PULA 1FP9A 4GJ1A 1I60A 5M5DA 4RZ5A 3PBVA 1K9FA 3T42A 3IANA 4R7WA 3EWYA 1N2VA 1DJNA 3MPGA 4LYRA 5E6ZA 5A6SA 1OABA 1B30A 1W31A 5HXMA 4B9ZA 4L9XA 4OBTA 2Y8UA 4TR9A 1FCBA 4FNPA 4Q3MA 3G1VA 1FBAA 4IGHA 4Q7BA 2C19A 3UETA 3WQGA 3MQTA