2I16A

Human aldose reductase in complex with nadp+ and the inhibitor idd594 at temperature of 15k
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
312
Chain Sequence
b'MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Ultrahigh-resolution study of protein atomic displacement parameters at cryotemperatures obtained with a helium cryostat.
pubmed doi rcsb
total genus 110
structure length 312
sequence length 313
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2i16A00
4WDWA 2DV0A 4Q3MA 3UP8A 3C3UA 1Z9AA 4I5XA 4XZMX 4EXAA 4JIIX 3UFYA 1HQTA 4XZLX 2PEVA 4QXIA 1T40A 1AH0A 1VBJA 2ALRA 4YU1A 1S1RA 2A79A 2BGQA 3GHRA 3H7UA 3O0KA 4JQ1A 1Q5MA 2PDFA 4DBUA 4LB3A 1X98A 2PDIA 4OTKA 1OG6A 2IPGA 4AUBA 2IKGA 3LQLA 3LZ3A 3R43A 3WBXA 3MB9A 1S1PA 5LIWX 1US0A 1T41A 2I16A 2NVCA 4GQGA 2PDJA 2FGBA 3CV6A 4JIRA 4JTAA 1M9HA 4XO7A 3COTA 3LZ5A 1AFSA 2FZ9A 5AZ1A 3FJNA 4LBRA 4JQ2A 2F38A 4XZNX 3R7MA 2IQDA 3WBYA 3S3GA 1Z89A 3P2VA 3CAVA 2VDGA 2DUZA 1MI3A 2ACQA 3LD5A 3N6QA 4JTDA 2J8TA 3FX4A 3CMFA 3G5EA 2IKJA 3VXGA 1XGDA 2HEJA 1JEZA 4XZHA 1X97A 1AZ2A 3EB3A 3WCZA 4YVXA 3M64A 1UR3M 4GABA 3V0TA 4GQ0A 2PDBA 1J96A 2PDKA 3ERPA 4G5DA 3V0UA 1MRQA 2HVOA 2C91A 3H7RA 3LNMA 4QX4A 4LAZA 4GCAA 1R38A 4YS1A 2BP1A 4IGSA 3WBWA 4WEVX 1RALA 5LIXX 3D3FA 1S2AA 1MZRA 4HMNA 1RY8A 2WZTA 3UG8A 4JTRA 2INEA 1EF3A 2ACSA 4PMJA 1Z8AA 4JQ4A 1XF0A 3BURA 4QBXA 3B3DA 1EKOA 4H8NA 3CASA 4XVEA 4FA3A 1QWKA 3UYIA 2PDWA 1ZGDA 4JQ3A 2P5NA 1GVEA 1RY0A 4HBKA 2PDLA 2QXWA 3LENA 2PDPA 1K8CA 1PYFA 3Q67A 1ADSA 3F7JA 3GHSA 3LEPA 4IJRA 2PFHA 3R8HA 3GUGA 5AZ0A 3LUTA 4H7CA 1PZ1A 2PD9A 1VP5A 4FAMA 2PD5A 4PUUA 4JQAA 3R58A 3RX2A 4PRRA 4YVPA 5KETA 2PDGA 3GHUA 5HNTA 4PR4A 3G1RA 2HV5A 3Q65A 2HDJA 4PUWA 1FRBA 4XZIA 1EXBA 3R8GA 3ONBA 4XO6A 5JH2A 4DBWA 2PDCA 4FZIA 2IPWA 4GA8A 3T42A 1Q13A 1YNQA 5C7HA 2ACRA 4YVVA 5M2FX 3V35A 2DUXA 1YE4A 3O3RA 1IEIA 2FVLA 1AZ1A 3UZWA 2PDHA 1LWIA 3M4HA 1Z3NA 3ONCA 1ZSXA 1PWMA 2HE8A 1QRQA 2PDQA 5LIUX 4JIHA 2IS7A 2NVDA 2PDYA 2R24A 4FALA 4GIEA 1ZQ5A 1EL3A 2FZ8A 3UZXA 3CV7A 2ACUA 2AGTA 4RPQA 3RX4A 2F2KA 3UWEA 4WGHA 3WG6A 2PDMA 2PDUA 4ZFCA 3LBOA 3CAQA 1YE6A 3DOPA 3KRBA 2ISFA 3BCJA 2I17A 3UGRA 1XJBA 1X96A 4WDXA 4LAUA 3V36A 4XVDA 2IPJA 4XK2A 2BGSA 3R6IA 4PRTA 2IQ0A 2CLPA 5HA7A 1PWLA 3LQGA 5JH1A 4DBSA 5DANA 1ZUAX 4WDUA 1LQAA 4GACA 1SM9A 2PZNA 1AH4A 4MHBA 3BUVA 2FZDA 3MC5A 2IKIA 4WRHA 3LN3A 1AH3A 2IKHA 4R9OA 2PDXA 2IPFA 1YNPA 3N2TA 4F40A 3EAUA 4QR6A 5HNUA 5LIYX 4NKCA 3V0SA 2PF8A 2R9RA 1HW6A 3U2CA 4ASTA 4XAPA 2PDNA 2HVNA 4LBSA 3EB4A 3R94A 2HE5A 1PZ0A 1S2CA 1A80A 3BV7A 4WDTA 2FZBA 1C9WA 3M0IA 4L1WA 3NTYA 4Q7BA 4DZ5A 5LIKX 4JTCA 1IHIA 4IJCA 4LB4A 3DN5A 3UZYA 3RX3A 4ICCX 3UZZA 3GHTA 4EXBA 3H4GA 2WZMA 3QKZA 2INZA 4JTQA 4L1XA
chains in the Genus database with same CATH superfamily
1KXTA 3OA5A 4D71A 5BRPA 4FP1A 2WSKA 1ZBVA 2ZRUA 2GDQA 6TAAA 3SFWA 2QT3A 3K2GA 1G5AA 1O94A 1EDQA 2PCEA 5FJRA 4AIEA 3NZQA 3K4AA 3S6TA 5AECA 1FX6A 4ALDA 5AC5A 2ATSA 2AMXA 2PLKA 3A4WA 1TR1A 1ZAIA 1C92A 2WCAA 4AZHA 4CU7A 2OO6A 4DHGA 2GQ3A 2VXNA 1DJWA 4KQNA 1E9ZB 1J6PA 1US0A 3C2EA 4NT0A 3VA8A 4D1JA 3VZYA 5CJ5A 4V15A 4DM2A 4UTLA 3EXSA 1V3IA 4CD5A 4RXFA 5CZTA 3SAZA 1QK2A 1B3XA 4CNOA 1Q6FA 4JTKA 5RUBA 2D3LA 1GKRA 3P60A 1V03A 2XH2A 4LC8A 3E49A 1E3ZA 1RCXB 2CLIA 1V8EA 2H6RA 5AYBA 1DL3A 2I9UA 3U57A 4F0MA 3F4DA 2C3ZA 3STPA 3UWYA 1JXKA 4Q8UA 3VMNA 4DUOA 5IM51 1CLKA 2ZA2A 4AFYA 5TQLA 5C5YA 1R3QA 3IJQA 4TVUA 2WMHA 1REQA 4GYKA 4RLIA 4N9BA 5F2MA 3EPOA 3RN6A 4JNMA 4HPNA 4C6FA 1M7PA 4KERA 3NM1A 4DAIA 1QI4A 4D2JA 2Z1KA 3OQEA 3QKEA 2ZTJA 4KKXA 2E4TA 3QV7A 3NPUA 3N17A 3W73A 1J12A 1KCZA 1AW2A 1H7WA 2QJGA 3TMLA 3TFCA 4GYFA 3E38A 1EGMA 2XPKA 2PODA 2BY0A 1Q7ZA 2WMJA 3IGUA 1JI2A 4JX5A 2I57A 2D24A 3L5LA 4RL3A 1FWRA 2CWNA 2E5CA 3L0NA 3DGBA 4EVZA 5FA5A 3MANA 2OELA 4OV9A 4B5SA 1KA9F 4NG3A 4RR4A 4S3DA 3UG8A 4W7VA 1G69A 3TR2A 1FFRA 2VM8A 4QRNA 3AYVA 3FEMA 1VJZA 4NQ1A 4UXDA 3BURA 5HJLA 1O12A 2W6RA 3IRDA 4FA3A 1SGJA 1W8SA 4GFSA 3W70A 4JHOA 1SSGA 1S46A 3L4VA 5HWJA 4XSMA 1TWDA 1A5AA 4DF0A 3VGFA 2BODX 3B0VC 2PC4A 1P7TB 2Y8KA 4IJRA 2F6KA 3THCA 1DQUA 4CCDA 4WK9A 3C3NA 3KLKA 2W0UA 1SFJA 3NOEA 1NF0A 4IP7A 2P88A 4WY0B 1PKLA 3GNOA 2UY2A 2JE8A 1X7FA 4KF1A 1EXBA 1N8FA 2JEPA 2PWHA 4FHAA 3OEXA 3VU2A 1EX1A 1UKPA 4H8UA 1M53A 3ANYA 4GA8A 5A2BA 2NQZA 2QCGA 2XH4A 4S2BA 2YFNA 4HYRA 1SJDA 3FKRA 4AQLA 1TTJA 2Z2AA 3MQTA 1LYXA 4IPNB 5LNRA 3T2QA 1J5SA 1OCQA 1EUAA 4I3GA 4A22A 3OVRA 5CBIA 1REQB 1X6UA 5MKGA 4HN8A 2AKMA 2PDHA 3MSGA 4D8AA 1L0PA 4C6CA 1CXKA 1PAMA 3PZUA 4W85A 4O1BA 1XFBA 2D2GA 5I6SA 4R88A 1HVXA 4JD4A 3UWWA 1V3LA 3PZIA 1GOKA 4LY4A 3SUUA 2QUNA 3WLQA 2HMCA 4H8VA 3CTLA 1TZ9A 2WLYA 1W1ZA 1X8FA 3LHTA 4XG1A 2ODOA 4NX0A 2ACUA 2FH8A 2C18A 1UG6A 4WGHA 3LYEA 2WMIB 3WL0A 2PU1A 4KWVA 2Z25A 4QE1A 1UQYA 2FFIA 5AYYA 2Q8XA 3VUSA 3VKJA 4L9ZA 2X7VA 4AMCA 1KCXA 4DZIA 1R7AA 1Z7AA 4GGBA 3HTWA 4RPPA 4DIAA 1TFVA 3S1GA 2D0FA 3JRKA 3GH5A 2ZBTA 2A7RA 3WK0A 5HA7A 1M3UA 1T99A 3TMQA 1TMHA 3GFYA 4Y9PA 1HKVA 1ECQA 4AB4A 4DBSA 4C6IA 1EP3A 4C1KA 4IOTA 3KVLA 1E0UA 1SW0A 4PTMA 4WVXA 4D6JA 3W82A 4JYDA 3WYZA 4MHBA 1A5KC 2H9AA 2F2HA 4M6QA 1SZFA 1F5ZA 4F2TA 1E6RA 1H7RA 1UZ4A 1D2KA 1KWGA 3TTYA 2A4AA 2MUCA 1CGTA 4LS1A 2NSXA 5A6LA 1ZBWA 5BU9A 3KWXA 2D2HA 1YDNA 2X1UA 4M7TA 2G3NA 1HJXA 3BTNA 1JL8A 2OGYA 4PEEA 1W9DM 4XAPA 3K4DA 3THQA 4RZ6A 1OCNA 5DQPA 1QT1A 3R94A 5EGRA 4J3XA 3HQPA 3CQIA 3SM0A 5I3FA 5DY3A 4PMVA 1US3A 1R3VA 4L7ZA 3UR2A 3APGA 2J7DA 3K1GA 2G0WA 4FIQA 3G6MA 4DZ5A 3PZOA 4X9YA 1OWQA 5BROA 3RRAA 4X0VA 3NYDA 1Y5XA 1NTHA 1W9UA 3H2MA 3UZZA 2WHKA 4O19A 3TAKA 3S42A 4L9XA 1JAKA 1TJ2A 2I56A 7PTDA 1VJIA 3UR8A 4D6DA 4XZMX 3FHAA 1VLIA 3ZJKA 4G9PA 4M1BA 3SZ8A 3EA1A 1SPQA 3NPXA 1AH0A 4JY9A 4S2CA 1XLIA 2AAMA 1TV3A 1FWSA 4NJJA 2AOSA 2BY3A 3WLLA 1CB2A 3CQHA 1W3LA 4DLFA 4LUSA 4LY8A 3PJTA 3QF0A 1W9BM 2IPGA 3WDJA 3UJSA 1DIOA 4GYPC 2OR2A 3GG1A 2A3LA 3LLDA 5HINA 4IUOA 4DB7A 2GFTA 1TWIA 3OYZA 1DTUA 1U30A 3IIPA 3G1AA 3LNPA 4MZ1A 5G1MA 2RJHA 3GBEA 1E72M 2XWEA 2J7FA 5FEXA 3WLMA 3VAVA 3OP2A 5F7UA 2QDHA 3WELA 1BQGA 1R2SA 1Q6EA 5AVHA 2QF7A 2ZVRA 4TV5A 3DIPA 3GAYA 2IQDA 3A13A 3UJFA 3VKBA 4ZB2A 4ILSA 1DXEA 1E0WA 3MU7A 3NDOA 3PPFA 4H2CA 1UBSA 2OQYA 3GSMA 4RDWA 5FI8A 4A2RA 1BVZA 5IFTA 3R13A 3N6QA 4PUMA 3MKKA 3LRMA 4M7SA 3ZVHA 4DXKA 3E2RA 4H6KA 4XZHA 4X2RA 2Y1HA 3CQJA 5A8NA 2H8XA 5F4WA 2DY3A 4QTGA 1PVNA 3VD9A 4YTSA 3VOHA 4WIWA 4KESA 2I1OA 4MF4A 1OD0A 4ZQNA 3N6JA 4GO8A 2GUBA 2IUZA 3SADA 1V02A 5I7GA 4FB7A 3EWXA 1XRVA 2BXVA 4GY0A 1M5WA 1T0OA 2HBXA 3DBPA 1KRBC 2WKGA 1E5NA 1LBFA 2ZX7A 3RG6A 4AG0A 4H1ZA 2ZZ7A 4S3GA 1RY8A 3VC5A 1ZZMA 4AEOA 5LGZA 3ZR6A 1LJYA 2UY4A 2RDXA 4MIMA 2F6XA 4PMJA 2QPXA 4CCZA 1UH3A 3VPLA 4H01A 1LOSA 4G7FA 2HNEA 5EB8A 4HKPA 4QM1A 2PDWA 1ZAHA 2PAJA 1KCLA 3DHFA 3E3HA 3DYMA 3WQFA 3GZAA 1JR1A 4LVGA 3RUBL 2G3IA 3N15A 5U7SA 4O1CA 1H7PA 2CHRA 3NEVA 5D09A 1Q4WA 4QDMA 4MFDA 4WJEA 3IAQA 1M41A 1EDTA 4X2PA 1FDJA 2J25A 1EYEA 1E43A 4PR4A 2XM2A 3WLKX 1GOMA 5C6MA 2WZIA 2VD8A 4PA8A 4C6KA 3KRZA 4QFUA 1V6UA 1VRDA 3HQNA 4BWLC 1XLCA 1BWVA 2QQ6A 4HYVA 3NR0A 5JIPA 2VD9A 3CYVA 3SCNA 3TFXA 2DIEA 3IUIA 2PDCA 1OK6A 4B5VA 2JALA 5C9RA 4U5IA 3V1HA 1YNQA 3IARA 3U7BA 4UFHA 4EF9A 1G0CA 1UP0A 4GYJA 2F61A 4A6GA 1HP5A 1FKWA 1WZAA 3ZVIA 4L4PA 3KRSA 1AG1O 1L6WA 4OBSA 1J9YA 4HHHA 5T9CE 3R10A 3BCDA 3TU9A 2GQAA 3RDKA 9XIMA 4MGGA 4Z1CA 3AAMA 4PTNA 3LXAA 3NO5A 4AIBA 1BG4A 5AVNA 3WQ5A 1EL3A 2FZ8A 3S5YA 1NFGA 3QZAA 3VOCA 2BB0A 3QTPA 1EGZA 1F61A 3KL0A 3EPNA 3QR3A 1IZKA 1KTCA 2OLAA 1OB0A 2GGJA 3N19B 1JPKA 3E12A 1IEVA 3WKZA 2FTYA 4FNPA 2C6QA 3WSUA 1GWJA 9XIAA 1PB0A 3R6IA 1XIBA 3BANA 2FLIA 1SJCA 4HOZA 1MW1A 4KGLA 4IP5A 4AVNA 1OHLA 1PWLA 4B9ZA 1EA9C 5BNKA 1J79A 1VCFA 1WOBA 4ZO7A 4W5ZA 1LP6A 3I6RA 2O0TA 2A6NA 1OINA 1TTPA 2W61A 4LWWA 4DZHA 4GNJA 3KW3A 1JDCA 1ME9A 1YHTA 1ZP3A 1XLFA 3W7EA 1R3SA 4TQTA 3BW3A 3TN5A 4D6GA 3MYOA 4XBJA 2IKIA 3QGKC 1S38A 3PWIA 3HPXA 1JULA 4KGJA 3CV2A 5CH9A 4MM1A 2ZQ0A 3BCFA 1EJSC 2WYSA 1WOAA 4NKCA 4CU8A 4XZWA 1R6WA 1RPKA 1QNOA 4FPSA 1PTGA 4Z1YA 4R7WA 5E5CA 3WJZA 4JGDA 2H3BA 1KBJA 3EB4A 2HXUA 2DIJA 2GK1A 1UQZA 4ZO9A 4N9CA 3DKJA 4DI9A 1TWZA 4JFTA 1XD0A 1K02A 4HPHA 3TC6A 3IVSA 3AXKA 6CGTA 1Y7VA 4EE9A 5JBFA 4Q8WA 4M51A 2VKZG 1IR1A 2E8YA 3IIZA 3LHYA 1BGGA 4MB4A 2X30A 3Q2DA 3W53A 5BWAA 4YLWA 1JPIA 3TN6A 4J1OA 3IACA 4CNPA 1TPFA 5D33A 4U3AA 1UWIA 1GYNA 5BOEA 4MYAA 4Y8FA 1S1RA 4LUTB 1I8JA 1V77A 2PWGA 1UD8A 3PB0A 1IE7C 3WH7A 3AHVA 1A5UA 2VFDA 1JZ2A 4OTKA 1GHSA 3C4UA 3PBYA 1FBAA 1D7KA 5U4NA 3LQLA 3LZ3A 4A8LA 1VPXA 3AICA 2I16A 4IPLA 5IBXA 4DQWA 1EZ2A 2PDJA 3OOQA 3T4CA 3EKLA 2I5QA 3QH2A 3EWYA 1H49A 3WUGA 3UU0A 3P0WA 3W1LA 3R4IA 4Z17A 3HMCA 3FJNA 4JQ2A 2F38A 3R7MA 5BXPA 2FHFA 4MJ2A 3M47A 5K9DA 1TO3A 4FX6M 3CPGA 5CLTA 1E6ZA 2OYLA 1UR2A 3N1AA 2VDGA 1EBGA 4CGTA 1M68A 4WX2A 1DIDA 1EP2A 2VUYA 3O15A 2V5BA 3A12A 3W28A 3NIYA 2BV9A 4L4LA 4NZCA 1BAGA 4A29A 1D8WA 4Z1DA 4W8LA 5HNRA 4K39A 3WH9A 5EMUA 3H12A 3SCQA 4PCTA 3WNPA 1F6YA 1VZWA 2DT0A 4PUJA 3PTQA 4G5DA 3LPGA 3CEUA 1GQJA 5CSSA 1NP0A 1XV8A 1V7AA 5D2YA 1R38A 3BG9A 1W3JA 1KFCA 4XSLA 1RUSA 3C56A 2VCBA 2OZ8A 1UR9A 4M5PA 3HG5A 4RW5A 6A3HA 1U5HA 5C2GA 4W4QA 3T44A 4FLQA 2YA1A 3FJLA 4JTTA 6REQA 4XV0A 4BR1A 1KRAC 3SEPA 3VMPA 3NQCA 1R30A 2GZXA 1A5NC 1GOXA 2ACSA 4ACZA 3U9IA 2J77A 4CEXC 3U48A 2E9LA 1K3UA 2BTMA 4JN6A 3LLXA 4GMEA 1VRXA 3VIFA 2EHHA 3ZLHA 4IPJA 4R7OA 3L0GA 2G4FA 1UH2A 3AYTA 4REQA 2EO7A 2C13A 3ITOA 4JQ3A 4MSSA 4IGNA 3LDVA 2DT3A 2OZ0A 3CAKA 3SUSA 1PIFA 2OWWA 2GWGA 1KBBA 3OODA 3N4AA 5H8PA 2PGWA 2QHAA 1GTEA 2E8ZA 4RV3A 1W5QA 3SRDA 1QPRA 3N9KA 3VMOA 3VFCA 1TX2A 4PEKA 2UWFA 1GNXA 1YXDA 3QW3A 2Y61A 4X9SA 3RX2A 3VILA 1ONEA 2O4MA 3T78A 2HV5A 2JFEX 4GFIA 3MJMA 5D30A 3TCEA 2XISA 5ENLA 4POCA 3WK3A 1DJHA 2YA2A 2W79A 3G0SA 3SR7A 2XIJA 4IX2A 2BLEA 3PBVA 2YBTA 4PUEA 4R7JA 4TUFA 1ZALA 1KWKA 4OUEA 1PXGA 3SUVA 3LRLA 2E7FA 3AS2A 3T42A 4HMCA 4DWSD 4EP8C 1UD3A 4Q4KA 3GDMA 1O1ZA 4YVVA 1E6QM 2J9XA 2QCEA 3POHA 3SJNA 5IRPA 4LYPA 4E8GA 4IPIA 3M07A 5M1TA 4L56A 3LBMA 2NQHA 3VE9A 1B9BA 1LRNA 3CT7A 1M65A 1KM5A 4S3JA 4JTGA 1B3VA 2OVLA 1TJRA 3B97A 3PJWA 1YX1A 3M43A 2ZFAA 1OFAA 1V4YA 2ZRVA 5K3VA 1WXJA 4C7DA 4PMXA 1W1B1 5EBUA 4LXFA 1GOIA 2XN1A 1BHGA 3RM4A 3AYRA 3H26A 1QO2A 1H11A 1A47A 3WD4A 3T6CA 5C9XA 1K9FA 3WG6A 4RK8A 3ISIX 4HHMA 4J4KA 5BOFA 2J24A 1W37A 2O7QA 4I8YA 1J0JA 4IMAA 3MJYA 4AH7A 3VDCA 1EIXA 3CH0A 3N4EA 1P5BA 3HM7A 4LAMA 1OBAA 3FAXA 3DKLA 3V36A 1T5AA 1CZ1A 3ZYZA 4WKHA 3MV01 3ARZA 1AVAA 3L0KA 1SSDA 4U31A 1MEIA 1K6WA 3LPOA 1BTCA 4O4VA 1VAHA 3L4ZA 4LUSB 4CQDA 4L4MA 4M56A 3N3TA 1TX0A 1XYZA 1OC6A 5F2GA 1TKKA 1R85A 1FFQA 1BEUA 3AIRA 1H7XA 3KVKA 4J3WA 3FKKA 1DEDA 3VYLA 3LCGA 4LV4A 3W7HA 2E77A 3EDEA 3BAYA 2CKRA 1XSIA 3NSMA 1TQXA 1TIWA 2YXGA 4NJHA 1K1DA 1PX4A 2V2DA 4Y96A 1I0BA 2ZX6A 1VCVA 4A21A 4G2DA 1J0ZA 4UMAA 5FL0A 1E70M 3ZXWA 3RLUA 1I2RA 4MKNA 3EOSA 1XYFA 4LBSA 3S9ZA 3EX6A 3M5XA 4ATLA 3V16A 1UP2A 2VELA 3L2LA 2XGZA 3RK8A 3TYZA 2IQTA 4EWJA 3W01A 3R2GA 4DEFA 4IFKA 2R6OA 4JTCA 4AD3A 1QNVA 3CIXA 5M5DA 2PLJA 4C6QA 3RX3A 1W5PA 4IIDA 1VFTA 8A3HA 1MW2A 3VIKA 4CQCA 4LAKA 1RXOB 4WJ8A 2PBGA 1UW9A 3LLFA 2X2YA 3WH5A 1EC7A 3FY1A 2DSKA 5EYWA 3CT2A 1EBHA 1HQTA 3W1TA 4XZLX 4PZVA 1W56A 2PTXA 2Z24A 3ABZA 1RK6A 4GC3A 3PF3A 1H4PA 4MKSA 4NRSA 2QLYA 3WMCA 1S2VA 4U33A 3FAWA 4WHBA 2CFFA 4KT2A 4HT3A 3WJSA 1VKFA 4D1IA 2GK1B 1OM0A 2ATMA 3UEQA 5LNUA 1CXEA 1E0VA 4O52A 2B81A 1T41A 4CNSA 2YYTA 3MBFA 2NVCA 2A85A 1TQJA 2Q8LA 1CTNA 4QLJA 1H0GA 3H24A 2I5IA 2EG7A 3CL6A 4U4MA 3QPEA 2ZWYA 1QUMA 1DXIA 3RLGA 4I9TA 3KTSA 1IXOA 1TV7A 1G7VA 2QVNA 1EB3A 2OSXA 2YDSA 1RBAA 3B04A 4ICMA 3UJEA 4B91A 2YSWA 1JCLA 1MEWA 4V33A 4KCTA 2WHMA 1Q8AA 3W1QA 5K4ZA 2DUZA 4ZSTA 3ENLA 2YCIX 3TYCA 4LVBA 2EKGA 1O5RA 3R0KA 4NXSA 3E02A 3LK6A 2ADAA 3POCA 3VXGA 1A5OC 1FWCC 2PF0A 3TX9A 1CCWB 3KCJA 2X8RA 2CWXA 4XWUA 3MUAA 3S9IA 3GK0A 4F0SA 3N2OA 1NIUA 4FNSA 3TW9A 3VNDA 3Q58A 3KUMA 2FQIA 3W9ZA 4QLLA 1E71M 3FGCB 4KBXA 4OT7A 1ITXA 3MDUA 3TDFA 1OT1A 3A22A 5CCZA 2BBFA 2GJPA 1XLGA 5C71A 1E6PA 1W5MA 3HFYA 1XF0A 4D9PA 2EPLX 1KLZA 2AKZA 3UZJA 1FP9A 3G3DA 1UZDA 4BS0A 1V5XA 2OLSA 3QOMA 2P5NA 4ZOAA 4ORMA 2D1ZA 1UIPA 3W88A 3NG3A 2HISA 3O9NA 1HXJA 3N9RA 4GC4A 1A5BA 4R3UA 4HOXA 4EOUA 1P0NA 4KFNA 4Q4PA 3V18A 4QGCA 3V3WA 3QFEA 3BOLA 4DWSA 4S3EA 3UD6A 2ONEA 4PUUA 3ARTA 1HT6A 2PP0A 3LPPA 5FEZA 4DJFA 2POZA 5HNTA 3IJDA 2OX4A 4DO7A 4LS2A 2YR1A 4AVFA 1Z69A 3WDRA 1UMLA 2F6UA 3ID7A 1E1FA 3NA8A 3QBUA 2BVDA 2OT0A 3TJLA 1I6NA 3O1NA 4BFAA 4UTJA 2Q02A 8CGTA 1RVGA 1XISA 3AMKA 3GTHA 3LHUA 3UXDA 3EX2A 2ZCGA 3PZMA 2Z1VA 3QLDA 2A3CA 3MCMA 3F4CA 3BMVA 3KBVA 3ABSA 3W1UA 4GWEA 2QZRA 4B2DA 5DRIA 3WNNA 5FF4A 4ZQPA 3WD1A 4C5YA 5CSUA 2YZ5A 1Z3NA 1TE6A 5DMMA 3GNRA 2XM1A 4BA0A 1HO1A 4JNZA 1X1ZA 1KC7A 4O57A 3RU8X 5LIUX 2DSUA 1UMYA 3IJ8A 3TC3A 3W1MA 2QYGA 3TTQA 2HBVA 4AY1A 3F2CA 3O6DA 4J3ZA 3ORWA 3BDKA 3BXWA 1KNWA 2PMQA 3TTSA 3WQPA 1QFEA 1OGBA 4IM4A 2DT1A 3LERA 1RPXA 5CQ1A 3AZRA 3LBOA 1W3HA 1K03A 3OJGA 4AD1A 3BJSA 1G7UA 3WUBA 4AZBA 4PUKA 4V1XA 1LUCA 3KCLA 2CCRA 2ZUVA 1MXSA 4J3UA 1SJAA 4E5TA 4BZYA 4A3QA 2RGLA 4AX7A 3LQGA 1KFLA 3MTWA 4JDBA 4C6BA 5AY7A 3O06A 4FIRA 5IOBA 4JIQA 5FL1A 3APYA 1US2A 3BLIA 1JIBA 1G4SA 5CPQA 2OWCA 3ARXA 1I45A 1KFKA 1XDLA 3A3XA 1KBLA 1O6IA 2FGZA 3TSBA 3GDKA 1TPWA 2IKHA 4JOMA 5AHNA 4UQAA 1ZRQA 2C7FA 3CGTA 4NI8A 3DEQA 2ZRYA 4RCXA 2X0HA 4GNVA 5CGMA 3W4RA 1HW6A 4Q7IA 3HJEA 4ASTA 4GHRA 2TAAA 3QQ1A 1FWNA 4C6MA 1ZJIA 2J6XA 4UFKA 4Z0SA 5E0FA 4GXWA 2CZEA 5CSRA 3QQ0A 4FF5A 2BX7A 3PWGA 4QEEA 5JMUA 1Q2RA 4GVGA 5D2TA 2C0HA 1WDWA 2EPOA 1U2YA 2WB5A 4ICCX 2QCCA 4A8IA 1GVSA 4EXBA 1ENUA 5KMYA 7ODCA 4AHPA 1VB9A 4WSKA 3EEZA 3LA4A 5DO8A 3DC0A 5AHLA 3W7DA 3UFYA 1MQQA 5KITA 3UA4A 4KRZA 3TSDA 2TSYA 1XL9A 4FNTA 5E0KA 3P62A 1KO0A 3S9YA 4C6LA 2BGQA 4PRWA 1E9YB 3E96A 4K7VA 1UKTA 3KOXA 3CO8A 1ZCOA 3SQSA 4LGXA 3N2MA 1HZYA 2VR4A 3AMCA 3M5YA 4NSBA 1NF7A 1S39A 3PFMA 1UJQA 4DXVA 2PBOA 3VD7A 2JKEA 3WBXA 3ARYA 4B16A 5LIWX 3B9NA 1JCMP 4QDWA 3GZ3A 4O50A 2I14A 4JIRA 1MSSA 1NOFA 3WQCA 1M9HA 3A6OA 1QNSA 3OLEA 4S38A 4EPKA 2JBMA 4WQ6A 1OFBA 2V8ZA 2PGEA 3CIWA 5EMJA 4LBRA 1UZHA 4MY8A 3AMLA 3WBYA 2XFWA 2EG6A 1DJNA 3PVFA 3BLFA 1KBIA 1JGMA 4K2SA 2XN2A 4O10A 1ZP4A 4JTSA 1MI3A 3QY6A 4I8DA 4WXYA 5B80A 2CC0A 3AIEA 4EAMA 3NQBA 2JK2A 3C5QA 4EPEC 1K7EA 4UR8A 4HNTA 4MWAC 3S6OA 4FXSA 2YL6A 2CHNA 1GZJA 3A5VA 3BH4A 3OGSA 5FJPA 2PDBA 4N0RA 5AFDA 1GOQA 4B5TA 1L6GA 2CLMA 1K7XA 4B4HA 3BG3A 3FFSA 2FIQA 2PP3A 3AYSA 4AY8A 2C91A 5I23A 3AIUA 4AZCB 3BARA 5D02A 1BXNA 1PHWA 3GR4A 1MO0A 3VGHA 3C2FA 2VWSA 4HPJA 1ESWA 3U5YA 2XU2A 1DYSA 2W92A 5DT5A 2EXOA 2FZNA 2C1IA 2ISWA 2R1PA 4J3VA 2ICSA 1XM3A 1GG1A 1EF3A 4HNCA 4DO5A 2YLAA 4IISA 3RNDA 1LOLA 1H2JA 3B40A 5GJNA 3SY5A 4X3ZA 4Y9OA 4QBXA 5DY2A 3AMGA 2PWFA 3ZT7A 4B92A 4PH6A 3QW4B 3WH8A 4JTUA 1IXPA 1YXYA 2V5CA 1X7IA 2QXWA 3QPZA 4H9UA 4MVAA 3MV11 4YL2A 3RU6A 3BOXA 3IGXA 1WP6A 3LXBA 4MNMA 1AJ0A 1O5KA 1PYFA 4PB3A 3O07A 1QWGA 2DT2A 2ZE0A 1F73A 2QDGA 3NXFA 1KGXA 3S47A 1XP3A 5IHSA 1NOWA 3T08A 3W84A 1GYMA 1TZZA 4IQDA 5EMLA 2VO5A 3GX9A 4TVDA 1I75A 3AOFA 1I9CB 3NO1A 3URNA 3ME3A 4MJZA 5MHBA 2G4JA 3QJAA 1BYDA 1OIFA 1UR4A 1ECEA 1OZQA 2PWDA 4X22A 1OX4B 3WDIA 1B3ZA 1KD0A 4MG4A 5H8UA 1RD6A 4RNHA 1Q13A 4UTMA 4BF5A 3CLWA 1XDMA 4MJMA 3T07A 4IMFA 2PURA 3GXPA 3V5OA 1RCOB 3W85A 1BRLB 4B5WA 3FS2A 1IEIA 1CB7B 2FVLA 1GVRA 4M82A 3I3EA 2ZC1A 4HZMA 4WGXA 3PC0A 4JNYA 2CXEA 4NZ3A 4PCSA 4GZIA 2HE8A 3JU2A 1X6LA 5FJTA 1V6YA 4R34A 1E15A 4Z2JA 2ANUA 2V30A 3EBVA 3B0YA 4GH3A 1UR1A 1MXDA 1SQ7A 1R2RA 1X6NA 2WBGA 4PB4A 1JF5A 4UB9A 2P10A 1F76A 5JU6A 3RPDA 4EWND 1ICQA 4NJGA 1CGUA 3MY9A 4H4IA 1UP3A 1XINA 4O1EA 3H6OA 1VFFA 3NVDA 4HPXA 3OHIA 3UXKA 4WXZA 4PCNA 2BVWA 3URBA 4ZOBA 4MWAD 2FB3A 4PRTA 2G97A 2V5JA 3RAOA 3PPHA 4BQ2A 4HCHA 1UWTA 3PSVA 5DANA 1SO3A 3TYEA 1E73M 1RA5A 4XAFA 1HP4A 1W3IA 4RE4A 1JCXA 1JG9A 2XFYA 2F7FA 4BKNA 1TJPA 4I5UA 3TR9A 1WKYA 4YTQA 4AXKA 1DJGA 3BUVA 4UC5A 2VGFA 4ROPA 1W1TA 1FH9A 2OLHA 1GVFA 4RDZA 5FAJA 3OIXA 2QPSA 1GORA 4E2DA 2QCLA 5DCBA 1PX3A 2GSEA 2ZZ1A 4QDPA 3PBMA 2R9RA 3ANUA 4DJFD 4KFOA 3M1ZA 3NQ6A 4GK8A 2RDTA 4CN1A 5CAKA 5BYWA 1AJ2A 1B57A 1UKSA 4PSPA 1J5TA 3UXIA 5BW6A 3NTYA 1I2NA 3CLMA 1QU4A 1XCWA 1LQ0A 1P0BA 5ECUA 3FGCA 1RBLA 3U8GA 3LTPA 3GXTA 1V79A 1N82A 2OOGA 3COTA 1CIUA 2NWRA 4O13A 3VDAA 1WUFA 4KEMA 1R3YA 5BXSA 3HQOA 2XWDA 5A3HA 1K4GA 4ZE4A 1JRBA 2XVLA 3VKCA 2VT0A 1VBJA 2Z27A 3H7UA 1XYBA 4L1GA 3EGJA 1B1YA 1LLWA 2G37A 3P80A 3PZGA 4PSRA 1N7KA 4KFPA 3GKAA 4IT1A 4TV6A 3VGBA 2X1RA 5CXPA 1AW5A 5BRBA 1D7FA 4KCWA 4B4FA 3L4WA 3OGVA 1H50A 3R43A 3MB9A 3QYSA 3TOYA 5ABTA 5A8OA 2DQWA 3LMYA 5HATA 3F4WA 4J40A 1OSEA 1SFSA 6XIMA 3CV6A 1KGWA 3C0SA 1O5XA 3UW6A 3PULA 1S5TA 2ZUNA 4LCQA 3M44A 4XZNX 4I6VA 3UESA 3TSMA 4JTJA 3W1NA 2HRWA 4DWDA 3OU8A 3AU2A 1IYXA 4V2XA 1E0TA 4IJBA 4OGZA 1OFOA 2WMKA 1OC5A 3NQGA 3LS9A 2OGJA 4ZGYA 3RLHA 4GIAA 1CYGA 4HZ7A 3ARPA 2XVKA 3MDWA 1K9DA 1EC9A 1OY0A 1SVDA 3WD0A 3TXVA 1YADA 3DESA 1ICPA 4H83A 3ES8A 5IHRA 3S1WA 2YOCA 3G1VA 3GW3A 1J96A 4ZCWA 1MRQA 1AMYA 1MW3A 2XYLA 2QMJA 5E0CA 3RMEA 4TR9A 1B31A 5F4SA 1TA3B 3RM9A 5J8LA 2ZC8A 1MZRA 3C52A 3W1XA 3BV4A 4HMNA 4HNVA 1SZRA 4GX8A 3AXHA 2D22A 3ZIZA 3FHQA 3EWDA 4RNJA 3W02A 4QNWA 4IIFA 4KPLA 2WNQA 1TJ0A 2V82A 3DFTA 4ICNA 5D2WA 3TC7A 1F9CA 3EWWA 5FSDC 2R1MA 4HJWA 3WLJA 1IWPA 1KCKA 3S46A 2AAAA 2JKPA 1GVEA 3RFAA 1W17A 4QIUA 3R0DA 4JY8A 3SSZA 2WBKA 4Y9MA 3W6MA 3IGSA 2X41A 3F7JA 2CIPA 5G4HC 3QXBA 4A3UA 2O9PA 4JTLA 3HJZA 1HGYA 5T9BG 1XYMA 4MLRA 1A3WA 1PZ1A 3L5AA 1H5YA 3EDKA 4XBSA 4MWAA 2ZIDA 1KXVA 3LG3A 3R58A 4H6RA 3BZGA 1V3MA 2QJNA 2VC9A 3T0TA 4Z2KA 2VL4A 4W93A 3VIHA 3N73A 2DQXA 5FCZA 3L7RA 1NU5A 3SSJA 1VHCA 3BC9A 5LHFA 4AXNA 3P61A 3FW6A 1NOUA 1BGAA 3ITGA 1IZCA 5DXYA 1TRDA 1SW7A 3U7VA 3UR7A 3QGVA 3W72A 4IL0A 3TE9A 3AQUA 5L9FA 2DGAA 3DH7A 4IGMA 1FP8A 3YPIA 1NQ6A 4LS0A 4Q7NA 3A9IA 1PKYA 3QLLA 1F6KA 3DI1A 4BWLA 3HGOA 3F4VA 3MP5A 4HU0A 2GGGA 3OTRA 4LCSA 2DZBA 2Q3RA 2YXXA 2NUWA 4JIHA 3B0XA 1VEMA 1U1JA 4HSOA 2PPGA 1XIMA 4FALA 3WN6A 4G56A 3Q4DA 3IV8A 4ZE5A 4DBEA 1A0EA 1ZCCA 1XIJA 2NQ9A 3CEPA 1FHVA 4WKFA 3WQOA 4J9JA 1UCWA 1OEPA 1LUCB 4NRRA 3E5PA 3VNMA 5CPTA 4H19A 4IX0A 4D72A 3PTKA 4OBRA 2YB1A 1F07A 3WFLA 4HK5A 3CAQA 4H9TA 5AHIA 3KFTA 2WJZA 1XJBA 1QNQA 3HV8A 4LUIA 3AZTA 3ARWA 2PRMA 3V7PA 3PANA 1R3TA 3W2LA 3W1RA 4XVDA 7REQA 2IPJA 2IXVA 3MWAA 4FX7A 3IIOA 1B3WA 3EWUA 1OD8A 3JZEA 2CLPA 2Z1WA 3SRHA 1WAUA 2C1HA 4YTTA 3K8LA 1RJQA 1YEYA 4G1NA 4K1GA 1AMKA 2BVYA 4PGLA 1FWDC 3PZNA 4P7OA 1PKMA 1K77A 4DUVA 1GONA 2EEXA 4B90A 1W91A 2Y8UA 1E9LA 4UZSA 3GIPA 1LL4A 1TV8A 5AOUA 1AH3A 5CGQA 4GJJA 2VNCA 3BOFA 3N2TA 1ITQA 2REQA 3LY0A 1UD6A 2J13A 2ZE3A 1EX5A 2GJXB 2V3EA 3GE7A 4BQ5A 1SFLA 3P82A 3OW1A 5HUPA 2Z1XA 4ZODA 1WNOA 3GR8A 2GJNA 4P2VA 3NEHA 1A53A 4PFMA 3UCCA 3R0UA 2B31A 1MQRA 4H2HA 1KLYA 3KWSA 3LCLA 1UWAA 4IL2A 5FEWA 1AJZA 4UTHA 1F6PA 1RLDA 2NV1A 2XVGA 3U4FA 3S2NA 4ERGA 3WQ6A 3MCNA 4PBFA 3VDGA 4AZGA 2Y7EA 3VDBA 2X1SA 4C6NA 1LQ2A 5LA2A 1NY1A 3OBAA 5TAOA 2E1WA 2J74A 4Q3MA 4NF7A 2EPHA 3MPGA 3R25A 3H7VA 1R9YA 1TVLA 4JIIX 1CW2A 2PTYA 3MS8A 4JCLA 4C5ZA 4HTBA 5HANA 2QUTA 4UCGA 3BLLA 4IXHA 3GXFA 5HQLA 3ZR4A 4OJYA 3EZ4A 1OT2A 1UIOA 4GQRA 2WO5A 3W75A 1L6FA 3BJTA 4NIRA 1X98A 3RR4A 3TLLA 3W27A 4C7GA 4AC7C 2X0YA 5E6ZA 6ENLA 4FS9A 4Y7EA 2IKGA 3DI0A 3CHEA 3AS3A 3TEVA 4NZ1A 1DJXA 3W2MA 4OVXA 2J88A 4GQGA 1P43A 2OKOA 2VR2A 5GNZA 3D6NA 4F2BA 3LTYA 4ZTXA 4JTAA 1NARA 4QQUA 4K36A 3LZ5A 4NU7A 2D20A 4UTIA 2CZDA 1H0IA 1J0YA 1UKQA 3B8VA 2TPSA 2WCGA 3P14A 1ISYA 1BYCA 5EY5A 4BQ3A 5G4WA 4LSBA 2VVNA 2NXGA 3P2VA 3S2LA 1JQXA 3SY8A 3TA6A 1CEOA 1DBTA 4IFOA 2CNCA 2GWNA 1U5VA 3AIWA 1R9ZA 1T6MA 1QCWA 4INFA 1RAKA 1CPUA 1J8VA 5HJYA 3ZT6A 1H63A 3K4WA 3EDJA 1G4EA 3S5ZA 4ENLA 4GY1A 4UTFA 2XINA 2LLEA 1K8ZA 5LA0A 1TTIA 3OVQA 4DI8A 4RW3A 2JGYA 2EPNA 2QIWA 4ZQCA 3B8TA 2D2JA 3B06A 2PE4A 4N2YA 3AI0A 4LUTA 3FDKA 4K1WA 4YIWA 1QTWA 5J5RA 3WFAA 3G1XA 3O8AA 2QNEA 4UTTC 1Z44A 4LAZA 1ZPTA 1MWOA 3WLRA 3W25A 3PUDA 4YPJA 5F2IA 1UPPA 4ZZ9A 4OV4A 2HK0A 3DHDA 4UQBA 1KV8A 1VBHA 5HPOA 3VGEA 1JXJA 1TRIA 5BXRA 3L67A 3E5BA 3M6DA 2J7BA 3GIQA 4IMEA 2ALDA 4AZ6A 1IWBA 4E2BA 4JKKA 3G18A 1ADDA 3NL5A 3IPWA 3VNZA 1QWKA 3LXCA 1OYBA 4Q8VA 1VFLA 4W7WA 4DJFC 2FB2A 3WLIA 2JIEA 2QV4A 4PUDA 3RF9A 3C2YA 1LDCA 4JXCA 4J27A 1MNSA 5D37A 5K2ZA 1GUVA 4OOZA 1BF6A 1YXCA 1Q6CA 4BJHA 4H7CA 3AZSA 2X1TA 3SCVA 4YYCA 3JUGA 4LH8A 1YIXA 3DBNA 3SGZA 3BGGA 1V0LA 4W7UA 4PRRA 3U3HA 2O55A 4RZ5A 1K9TA 2WK2A 4GZ7A 2Z4GA 5CC5A 4ZO8A 5C9ZA 4CNUA 1D3HA 1OVDA 1MMFA 2DZWA 1TPDA 4FZIA 4OOUA 1JZ4A 2E9MA 1RD5A 3WD2A 2GJXA 4JPGA 5M2FX 3CWNA 1VQTA 1V0NA 4YNGA 7ENLA 1TPH1 1G4TA 1UC4A 3T81A 2UY5A 1W1YA 4I9JA 2GVYA 1QBAA 3SN1A 1SW3A 1MUWA 2VFEA 4Q6XA 4UNKA 1K70A 1TA3A 1NFBA 3BG5A 4G1KA 3BK0A 1KRMA 4NNCA 3G24A 5CC6A 4L5ZA 1PPIA 2DP3A 2J62A 3KP1A 1ICSA 3NAVA 5JBEA 3VGDA 3ZLGA 1XYCA 4NAEB 3UZXA 1YTEA 3DFYA 3WUFA 3RX4A 4AIOA 4ZTYA 4A2SA 3B8WA 1I2OA 3DX5A 4CEUC 3ALFA 4DXXA 3I7QA 3BQ5A 2GDVA 3FYYA 3QHMA 2WPBA 3E0VA 3WENA 2QCNA 3DFOA 3KRBA 4UNIA 2J7GA 2I17A 4FOUA 1JUEA 1QPNA 2D69A 5CJNA 3KTXA 4P8XA 2NZLA 4LAUA 1KV5A 2C19A 4NL1A 1E6XM 3DYOA 4XK2A 1JF6A 1NWTA 4PTDA 1YTKA 1Q6GA 4O11A 4WF7A 2DSWA 4GISA 1P0EA 2P53A 5JUVA 1OZMA 3F5JA 4AD5A 3TYDA 4O14A 5BWFA 3DDMA 3QV9A 4A3RA 1SZEA 4QE5A 1VEOA 2BY2A 3AISA 1JZ5A 1SM9A 3H2OA 2NLIA 2QPUA 3FV9A 3W6YA 1PX8A 5A8QA 5AB3A 3P67A 4HMDA 5D04C 3LBCA 4N4QA 3H2CA 4K8EA 2GVJA 2RUSA 3AO0A 1P6WA 4GCXA 1H1YA 2ZA1A 4DY1A 4R33A 3NZ1A 1HO4A 3PK7A 1ZJBA 2DH2A 1E55A 2Z1BA 4E6MA 4F40A 2DUAA 4ORIA 3HB9A 1GJUA 1FOBA 4BF9A 2CBUA 3PAOA 2P0IA 1WZKA 2PDNA 3CS2A 4IQJA 4PBEA 3GR7A 2Z6JA 3DFHA 3PZTA 2ZXAA 1H61A 1DE6A 1P6CA 3B8IA 2QAPA 1A80A 1VCGA 3CUXA 4Z2LA 4GKTA 3W7JA 1ONXA 3BLDA 4WDTA 1C9WA 4BK9A 1KKOA 3M0XA 2EQDA 1D3GA 4I6KA 2VX5A 4K68A 1EZWA 3EWZA 3GYCA 1Q65A 4AISA 4M0XA 3GTXA 5AC7A 2PWVA 1GOWA 4B5XA 1PS9A 3VVGA 3RCMA 2DV0A 3UP8A 3AJXA 1FTXA 1JDEA 4O8RA 4TTUA 1HJUA 4JTHA 4C60A 1C3FA 2DZPA 2YZRA 4LYKA 3E2VA 4UTUA 4CLMA 3BL3A 1G94A 3QZEA 3W7CA 4LB3A 4GG9A 4M6VA 2XDFA 4ECLA 4GOAA 1M7XA 4IUGA 5LGXA 4EF8A 1A4MA 1R87A 4NNBA 2YBVA 2Y8VA 3BMXA 4TX8A 4AHOA 2XIQA 3XINA 1VYSX 2OTDA 2X7WA 3GNNA 3WJYA 2DSVA 1BD0A 4GI6A 3T2OA 3B4UA 3N4FA 4KWSA 2HNHA 5G5IA 4M29A 1JZ7A 4D6CA 3TYBA 1HL9A 1EEXA 4BY3A 1VS1A 1AFSA 4W9TA 4LRSA 4GZEA 2WVUA 3F03K 1OCBA 2YDRA 3JVAA 1W1VA 1DHKA 3V5CA 3CJPA 5EFDA 3WQVA 2WPGA 5J04A 3GTFA 1SO5A 3RO6A 3P74A 3QEZA 3CAVA 3P3BA 1DWIM 2OQLA 2P3EA 2PSNA 4JTDA 3EYPA 3HG2A 5F4XA 1W54A 1TVNA 2B7QA 3G1YA 3G5EA 3WLPA 2VI0A 1XGDA 3H2NA 3ZJ7A 4CVUA 1W5OA 2PWUA 5C70A 4RJEA 3SFKA 4LCRA 3M64A 1WA3A 2OWXA 4ZB0A 4GXPA 2QEZA 4JEJA 3SCWA 1LM1A 3S8HA 3P93A 3OG3A 4IIGA 4V1YA 1PDZA 1NDYA 3U4AA 2C14A 3WX7A 1RV8A 2HK1A 3CU2A 1EH9A 4Q4MA 1XIHA 3OBKA 1L2UA 4JICA 7REQB 5FEPA 2R8WA 1CX9A 3U0HA 4F9DA 3HG4A 4O16A 2FPTA 4HSNA 2RH9A 3WNMA 4GBDA 1GKPA 3H70A 1X8CA 2XVNA 3WEZA 2ZXBA 3VNIA 2INFA 3MP3A 2CZ5A 3BAWA 2ZZ2A 1DWJM 3W1PA 1OX4A 4OUIA 1CGXA 1FXQA 2ZKMX 4E3TA 2DDXA 1HKWA 4X60A 1EFZA 4M19A 4IICA 1WO2A 4AY7A 1S2UA 5HQEA 3VABA 3ARSA 3WDPP 3PM6A 5KZ6A 5A8MA 3CPRA 3G1HA 1IIGA 2ISSA 4UNLA 1GQIA 3T0CA 5GNXA 1VD6A 3WD3A 2ZZ4A 3PBUA 4HIBA 1N2VA 3E0IA 2NQ5A 1KFJA 2GDUA 2C16A 4S23A 2XVPA 1ZB5A 2NWSA 2YDAA 4XD5A 3DC8A 2W27A 4WUIA 2FZMA 2PTWA 3MA8A 4MTVA 4K8HA 3MKCA 1FRBA 1O4UA 3UWUA 3L4TA 2ZZ6A 1LRQA 5ECVA 5TNVA 2YBUA 4ZVJA 4XIMA 1R3RA 1R5YA 3NQAA 1UYQA 1BLIA 1XLKA 4HZ8A 1ZENA 3E0WA 4PCFA 5KTLA 2DW6A 3QOKA 2W67A 2O7SA 4AWUA 4AZ5A 4DNMA 1XC4A 3KXQA 3OBEA 2Y7FA 3QY7A 2R14A 4OIFA 2X05A 3UCDA 3NQDA 1FH7A 1YPIA 3RGTA 1CGYA 1R3WA 2EF9A 2QJIA 2XSAA 5BZAA 1ZFJA 5T26A 2DZVA 2W62A 3M9YA 2BHZA 2QJHA 3LGEA 1Z42A 1PWMA 3EA3A 1IGWA 1HKKA 2QCDA 5FF7A 3AWNA 4Q8OA 4BHYA 5G2HA 3TQPA 1F4AA 2NVDA 3UY7A 2R24A 3RJYA 3A64A 3LB0A 4UOJA 3HU7A 3K46A 2E09A 3UNDA 4PC8A 3ZJ8A 2Z2UA 3GDTA 2Y0FA 2BOFX 2E25A 5DT7A 3I3BA 3ZM8A 2HJPA 3S1VA 3M0YA 1W3KA 2E9BA 2HWGA 5EMMA 1X96A 4I9AA 2EG8A 3GBDA 4D6HA 1R7OA 2DIKA 3S5OA 5I02A 5GNYA 1XUZA 5G4EA 3QFWA 2B7OA 4MPQA 2XIMA 1GT8A 4UWMA 4DM1A 4NZ4A 4ZQMA 1IF2A 3PNUA 4FK9A 1QHOA 3T09A 2DFAA 1CBGA 1Y8BA 3W7QA 5A2CA 4O4WA 1UOZA 1XSKA 3T0DA 2QGYA 2AQWA 4PYSA 5AKQA 3PZQA 4QG8A 3ZSSA 3ABRA 1JDDA 2MANA 3H21A 1S5VA 1H5VA 4Q4OA 2VR5A 3T40A 5ABHA 3MC5A 2WLZA 3K8MA 3L12A 2GVEA 2OKTA 2I7GA 4CU6A 4F0KA 4R9OA 2PDXA 3OZMA 1LG1A 1MUMA 5LIYX 2C0AA 3LI1A 3GAKA 5AN7A 4QJ3B 3OZPA 4LBUA 1YKWA 2GQ8A 3Q45A 4HNLA 3BO9A 4PMRA 2VX6A 3E1F1 4DUWA 1AQMA 3UZ5A 4CD6A 4ML9A 5FACA 3ZWSA 3E2QA 3NQ2A 4GY7A 1J4EA 1QI0A 3EKZA 3N6HA 4BI7A 3H53A 1Q6OA 2QGHA 3UZYA 5J5DA 3QV6A 5AC4A 2VRKA 1JQVA 1KM2A 1YPXA 3REQB 3TH6A 4FXFA 4PMYA 1L6YA 1YBQB 4UOQA 2V2CA 3C3UA 3GH4A 5A69A 2YDQA 4IIBA 4C1NA 3KOYA 1JZ3A 2GQ9A 3IJ7A 1UUOA 1RH9A 4AZ7A 5DBUA 3WZ0E 2JF6A 1CGWA 3IJIA 2GUYA 4EPDC 3AWOA 4LU0A 4P5UA 3GUWA 3O0KA 3EDFA 1ZY9A 1XH0A 4H9YA 5E09A 2A5HA 1JZ8A 2VGBA 1NP2A 4KEZA 4FOKA 4XKYB 3RCNA 2PDIA 3M41A 1OG6A 4C1NB 4PMDA 1KFEA 1QMLA 1YBQA 3DG6A 3EXRA 4Z0JA 3N04A 4Q8PA 4DO4A 4HK7A 4C91A 1SUXA 1KR0A 1S3HA 2V6AA 3PPCA 3AMDA 3DHUA 4HHLA 1M6JA 3MO7A 1TPEA 4NP7A 2A21A 4HHPA 2OG9A 3CQKA 1C7SA 3L5MA 4Z2IA 1YNYA 3MMDA 3THAA 3N14A 2XTKA 3EMQA 4YWIA 4CNTA 4LUJA 3GXIA 4NJIA 2YJQA 1XC6A 3EWCA 5A6SA 1NVMA 4X63A 1OK4A 4ADTA 3UG3A 1GQNA 1PTAA 1JD9A 4J2MA 5I78A 3NJ3A 1PUDA 1IWAA 5BRQA 3ELFA 5JBDA 5F1VA 2P3ZA 1S5NA 4MUZA 4QJ1A 5I3HA 1KR1A 3W2KA 3ZVHB 3GDLA 1W9VA 3WF0A 3EB3A 3W71A 3WCZA 4D8ZA 2VWTA 2Z0IA 3KL3A 3UETA 3DG7A 1TCMA 2Y5JA 3RHGA 2PDKA 3SRKA 3MVIA 4PMQA 2HVOA 2I5GA 1XICA 3KVMA 3T4WA 2PLMA 1HUVA 4DO6A 2HS8A 4YS1A 1E4MM 4FNUA 4NX5A 1G6CA 1E0XA 1K7FA 4WEVX 3I4KA 4QSFA 3L2IA 1MUCA 1OJXA 4TMCA 4Q8TA 1I2QA 1TCDA 4JEQA 4C6JA 3W26A 4MKVA 4IQEA 1J0IA 1BKSA 3A4AA 3DHPA 3HURA 3QGAC 4GH1A 4F2UA 2F84A 1V02E 5T91A 4R5EA 2NT0A 1EO7A 3GY1A 2XZ9A 5GJPA 2OOFA 4FF7A 5AYXA 3WBAA 1A5LC 4E8DA 2WJEA 3OLGA 1I0DA 4W8BA 1MW0A 3CXOA 2V3FA 1ISWA 3M6YA 3BZJA 4HYWA 4OE7A 4BI5A 4XVEA 3VZXA 4C6EA 4GRSA 3UYIA 2VOMA 4JYEA 4MUPA 2E5BA 4LANA 1CGVA 3DXIA 1MEHA 4IFRA 5D4YA 3TJXA 1P6BA 4KMQA 1YMYA 1JAEA 3GU2A 1XS2A 2BXZA 3L66A 3AFBA 1XLBA 3NURA 3R8HA 3I3DA 4HP5A 2QCMA 2VDIA 5AHEA 4ZFMA 1GPWA 1O68A 2G50A 1ZL1A 4JHMA 4HCLA 5K4XA 3Q65A 1AL8A 3DZ1A 2ESCA 2Z28A 2DZUA 2ZXDA 5EMYA 3HOJA 3CK5A 4LEFA 2VQTA 3N34A 3WJXA 4NILA 5JH2A 4DBWA 1WDDA 4XZBA 4X0NA 2BS9A 2ZYFA 1B3YA 1QNRA 3HG3A 2ISVA 1QK0A 1ITUA 1JUKA 3SGUA 3TN3A 1IR2A 1EJTC 3AS0A 3PUOA 4KCVA 1DHPA 2DZAA 4AAJA 4DN1A 3LOTA 4LNYA 3PPGA 3ZS4A 1J01A 4EPBC 4S3CA 1BRLA 2XGBA 3O7UA 4WKAA 4C1LA 2H9AB 2CHOA 1FH8A 5I07A 2A3EA 1CWYA 3L21A 3SURA 4GIYA 4P7NA 4FSAA 5JQ9A 1K4HA 4NVTA 2PDYA 2A3HA 4DLMA 4GIEA 5TF0A 2ZA3A 4Q4QA 4KEUA 1Q66A 2V3DA 2JGQA 5I3IA 3IJ9A 2AGTA 4Q4SA 4J3SA 3PUGA 4RDVA 1W8GA 4GNKB 4H00A 3WNOA 3GVVA 3W74A 1VBRA 3CPUA 1DJIA 2ZICA 4WSHA 3A21A 1DQWA 4FO4A 1Y0EA 1PYMA 3T05A 1W9XA 2RDUA 3VC6A 1NWUA 1Q6RA 4U3CA 3WDHA 4H9XA 1CLXA 4CD7A 1UPMB 2IQ0A 2QUMA 1KFBA 4H9ZA 1TVPA 1SZNA 3MSRA 4NAFA 4M80A 4E2OA 3K5XA 3ZMRA 1O66A 1VYPX 3GDBA 4E8CA 4H9VA 2WKJA 3WLHA 1BPLB 1RQEA 3FK4A 5F2LA 3CUJA 5A6JA 3SB0A 4CCEA 4HU8A 4I7WA 1CXFA 1V08A 5CPNA 1IEQA 4PUNA 1C8VA 2IW0A 2DW7A 3TTOA 2PTZA 1G1YA 3PSWA 1FHUA 2X16A 4FLOA 5CAHA 5B7YA 5HNUA 1NWRA 5DMNA 2PF8A 4F9JA 4JAWA 2OYMA 3TQ0A 4ONVA 3M0HA 3GC5A 4WY0F 3WDQA 2HVNA 4UIOA 3S83A 5C2CA 3ITYA 3S4TA 3KVJA 5CC7A 4JX6A 4P7LA 3UY8A 3GC2A 4QLKA 4TMBA 3KZSA 2G3MA 2E0PA 2RGMA 1NEYA 3DFSA 3W23A 2AL2A 3M0IA 4TX6A 4V28A 4LJ3A 3MHFA 1IHIA 1E1CA 1X39A 4IJCA 5F1UA 1XIDA 2A2IA 1Q7MA 5E6YA 4N7QA 3MW7A 4V27A 3B0UX 3CUZA 3VIOA 1VIWA 4IFKB 3CZ8A 1PZ2A 2JQXA 3IK2A 3QRHA 3M0MA 1P7TA 3MVTA 1CXIA 2ASHA 1HL8A 5H91A 1E1CB 3VIPA 3GQYA 2A79A 3QMSA 1AK5A 1F4HA 3GHRA 3ZO9A 2AL2B 4I90A 3KTCA 4AD0A 5M03A 4MDOA 3LV5A 2OSYA 4D6FA 1LCOA 3N18A 2I9EA 3HQ1A 4AC1X 1JD7A 1PCWA 4Q6JA 1EP1A 2PRHA 4GZJA 3MSYA 1BYBA 3NQMA 1BG9A 1JRCA 3GDRA 1DVJA 3VCNA 4AUBA 1XXXA 2XSXA 3ZZ1A 1BSLA 1KTNA 3OYXA 1VHNA 4PBGA 3D5HA 3WMLA 3CNYA 2HPIA 1E51A 4MNKA 3ITVA 3WQGA 1XSJA 3VUPA 3CB3A 2PUZA 3SI9A 3VINA 4Z42C 3BAKA 2ZUUA 3BSGA 1HF6A 1PHQA 1E6NA 4IHCA 3UGVA 3WNLA 4JR5A 4UQDA 2V2HA 1CENA 3CL8A 4Q8QA 1K8XA 1POKA 1HG3A 2XFFA 2QKFA 3S5NA 4YMZA 4HNUA 2NQJA 1VH7A 2CPUA 2J8TA 3LTSA 1UKOA 3GXMA 1QPKA 4U5KA 2GSHA 5LNWA 3D0CA 3FIGA 1XIFA 3RPMA 2V5DA 3E6EA 2VZSA 3ERPA 4PMNA 4FNQA 1LZOA 1H60A 1VFUA 4GQBA 4B3ZA 1FWJC 1TZ7A 4ATWA 3P8IA 2VX7A 3WBWA 2QDDA 4H8HA 1XG4A 1R86A 1DWAM 3VKDA 3MO4A 3NOYA 4A05A 1XLJA 2P76A 3MUXA 3JS3A 3W7GA 3CO4A 1NM9A 3WQEA 4NZFA 4JTRA 1NJJA 1HKJA 3JW7A 1JZ6A 4W86A 1F74A 3REQA 3T9PA 4DYJA 1B90A 1TYGA 2O92A 1UD2A 3E74A 5I03A 3LI0A 1H1ZA 4NAEA 2CBVA 3RRXA 2HROA 1ONWA 4H04A 1RY0A 3KS5A 1VF8A 3OIHA 4GE8A 3SY1A 1OQFA 1T96A 2PDPA 4UBPC 3LCFA 2Y63A 1IQ8A 1BSIA 1BWKA 4S1FA 4L6OA 4MWAB 3XIMA 1XR2A 1XG3A 1JCYA 3TP4A 3UF9A 4S39A 1MYRA 3LEPA 4U2YA 1S2TA 4KEVA 2A0NA 4B5UA 3GUGA 1HFBA 1XGEA 1C8QA 5ABFB 1EJUC 1GQLA 4FXJA 1H7OA 3TNOA 4JQAA 3P5ZA 1TUFA 3HPSA 4KS0A 5KSWA 1V0MA 2VX4A 1P48A 3KBSA 5HR6A 3WJWA 3SBFA 3AUJA 3R8GA 3FEQA 3R12A 4DYKA 1TMQA 2WSQA 2BXYA 2OO0A 1VJSA 2OQHA 2IPWA 1XGZA 1WB0A 4EK7A 4EANA 1XUUA 4P8UA 3BGJA 2XG9A 2Z00A 1K6AA 1H09A 4ACYA 3H2FA 2ZOXA 4KW2A 1VBUA 3GG7A 3GRIA 2WV8A 3ZQ9A 1TPC1 1ZSXA 3C86A 3ONCA 3C0JA 1CDGA 1D3CA 2BWGA 1ME8A 2A7NA 3TK7A 3MI2A 2FPVA 4LV9A 5I3DA 2V0TA 1GVQA 1TIMA 2GJLA 2OB3A 5EKYA 2R1NA 3L2MA 3AIQA 4H3DA 1GG0A 1Q7QA 1JDAA 3K8KA 3BAIA 3TN4A 4AW7A 2QCDB 3HA1A 2EAWA 3T0BA 2KZHA 1NAL1 3BCJA 3DGRA 3USZA 3UGRA 4PCPA 3B9DA 4WDXA 3EOOA 1QW9A 4C6OA 5DX7A 2J4GA 5G2IA 3VGGA 2XGIA 4HN4A 4WCJA 3KOZA 3O6YX 4DAFA 2QUVA 1JNDA 1I1XA 5L6UA 3GVQA 1QNPA 3UYCA 4C90A 1LQAA 4GACA 4UQ9A 3VX1A 3LCHA 1HKMA 5HR7A 3V75A 4BCEA 5EA9A 4LEQA 3TROA 4J3TA 4WRHA 3LN3A 5I00A 4LYRA 3WF2A 4DWSC 2IPFA 3IEBA 1WQ5A 2VZOA 3NQFA 2E6AA 3FA3A 3R11A 2NW0A 4PULA 4TX9A 4JFUA 1W32A 3U2CA 3GS6A 3KHDA 1OX6A 5DCDA 4IZGA 2DSZA 2P0OA 3ZJ6A 4JN7A 3RO8A 4P7QA 1FY6A 2Y7GA 3BW4A 1RA0A 1U1UA 2O4QA 1IGSA 3BAXA 1ALDA 3N25A 1VBGA 2D0HA 5FJUA 3W2UA 2QIIA 2O9OA 2ZX9A 4GVFA 1B4KA 3B0PA 2XIOA 2W3ZA 1DIKA 2FJUB 3GHTA 3QKZA 4G8TA 5DMLA 3G6LA 4JTQA 2E68A 3LM7A 1OF6A 2HZGA 3BPWA 1OYCA 1OC7A 5A1AA 1EJRC 4LALA 1ISXA 1YDYA 3VKKA 3C2OA 5A8PA 1WBJA 2NX9A 1JGIA 1ZLPA 2ALRA 2VDHA 4LQ1A 3II1A 1X38A 4TU1A 2VEGA 3HF3A 3OLIA 3BLOA 4RZ4A 2D0GA 3F5KA 3I6TA 4JQ1A 2PU0A 3ZOAA 3GTNA 4DF2A 2Y89A 3T55A 1XWYA 1TWWA 5HBFA 2NSOA 5C55A 4OKDA 4M81A 2V63A 4R27A 1SYTA 4H6EA 1F2JA 4IH3A 2GSJA 3E2SA 4M1RA 1ODUA 3E9AA 4NJKA 4GO9A 3O0FA 2FGBA 1C91A 4K8GA 2WJFA 2Y7DA 1FXPA 4IQLA 4DJDC 2CZFA 4DZAA 5FKYA 1B54A 1G9HA 1Z41A 3FA5A 4RUBA 4Z08A 2AQVA 4DPQA 1VFSA 2W5FA 2GOKA 5DRCA 5DXXA 3T0AA 1ZTVA 2PTDA 3HPFA 2NX3A 1XQLA 3DYPA 5E9XA 4IXXA 1GJWA 3UT0A 1QW8A 4Y8EA 1C93A 3GNDA 2TRSA 2XH0A 3W6LA 3FX4A 3UPBA 4XD3A 3STEA 1WZMA 1Q85A 3NSNA 3M0JA 3VNJA 3VOIA 5HPCA 1VGAA 1X97A 4LFYA 3SGGA 2CLOA 5LSMA 2WSPA 1JYXA 3QN3A 5DELA 4CQAA 3V0TA 1KM1A 3UVIA 2PI6A 4LTSA 4DPPA 3JZUA 5CJMA 1A50A 3LNMA 1QAPA 3HPAA 2HVMA 1BF2A 1D9EA 4IGSA 4XQ6A 1SMAA 3KL5A 3D3FA 1DORA 4MZYA 2FHCA 1J10A 1A0DA 1FWIC 3UBPC 1GPFA 3L4UA 5ABFA 2ZZ3A 4C6DA 2VGIA 2VC5A 1JFHA 2L5HA 3VIIA 2E67A 4ERAA 1AD1A 4OBTA 3BSHA 2J7EA 4JQ4A 2XZ7A 4AHQA 4MPKA 5GPRA 3ICJA 1VFMA 3CASA 5HMEA 4WLCA 3TUUA 1WKDA 4ZMGA 3W29A 3H4XA 1AA1B 4HBKA 3TONA 3VCRA 7A3HA 2V69A 4O1DA 2PFHA 3ECQA 2FGLA 3BICA 1KQYA 1BVNP 4HCDA 2PD9A 4O12A 4U2ZA 4O18A 3IAPA 5DFAA 4F0RA 3UJ2A 2OYKA 5KETA 1PBGA 2PDGA 4H9MA 3EX3A 1XBVA 1XCFA 4GJ1A 2Y85A 4QCEA 3URQA 3QSTA 2NUXA 2IMRA 4XO6A 3U2ZA 3S2JA 1S5MA 3MZ2A 1H62A 4UR7A 5K7JA 1EXPA 5I09A 3FXGA 4DELA 5LZLA 4NNAA 1P0KA 1SO4A 1V6TA 3PY2A 1BKHA 1XDJA 5FF0A 4LC6A 1PO9A 3FJ4A 4IMCA 3UQNA 5ABEA 2D73A 3RXZA 4TVCA 3PHAA 3OG2A 4DBDA 3UZWA 1LBMA 1Y65A 3LM3A 3QMRA 4IF2A 3KBJA 4MDPA 4Q8MA 3W7KA 2J47A 2WC4A 1XQKA 3SQLA 2PDQA 2CZVA 3NSXA 2BY1A 5HUOA 3MZNA 3UPWA 4K7YA 4QS6A 1BXCA 3ATZA 1U33A 3SQMA 5CC3A 4R85A 2R1KA 3KHJA 2RFGA 1WX0A 3VOJA 1POJA 4JN8A 1VFHA 4MAZA 2FDSA 4IMGA 4L80A 4NZ5A 4GI8A 2DZSA 3B8SA 5A6KA 2V67A 2EPMX 2VP8A 1DP0A 4PMUA 1V51A 1RK5A 3DOPA 3BWWA 4JKMA 4KRTA 1GYLA 1O5QA 1V6WA 3GYEA 6REQB 2HSAA 2CLHA 4K38A 3WL1A 1JI1A 4O53A 5DF0A 3P6LA 2DVUA 1YYAA 4L4OA 2CBJA 4M6PA 3PR2A 5LXXA 3LCWA 1N8WA 1XW8A 4E2VA 5HDRA 4FOJA 3C8FA 3ATYA 4LPCA 5AYZA 1IIHA 3USBA 1CXHA 2J78A 5IBXC 2PZNA 2QCFA 1R2TA 3SJ3A 3RMJA 3F1QA 4LVAA 2YXOA 4NHVA 3LHZA 1LLZA 1W3NA 2XN0A 1A5SA 1EPVA 4IPPA 3AS1A 5A5WA 5A6BA 1ISVA 2FVKA 4YWSA 3VNLA 4Y2WA 3VIMA 1XLMA 2X2GA 5DLCA 2WHLA 2CLFA 1KRCC 2R82A 1QI2A 1FWHC 3NGFA 2Y5EA 4YTUA 1GHRA 5D05A 4ZQRA 2V3GA 1HX0A 5D32A 4EKJA 3LCXA 1XCXA 2FZBA 2FKPA 4LUYA 4ZOCA 5LIKX 3G1SA 1HJVA 4K3ZA 1S3TC 4LVFA 5I79A 1BWLA 1P4CA 3QQWA 4QCFA 1J2BA 1ZJAA 2WZMA 4WDWA 3K1DA 1OGGA 1Z9AA 3IIXA 1HL2A 2Y5SA 2WZHA 2F9RA 4QXIA 1LROA 2PA6A 1T40A 1OX5A 4YU1A 4CN6A 2KAUC 3S1UA 3QR1A 4XD4A 4E3VA 1WAWA 2ZX5A 2CU0A 1X1NA 1DOSA 1PDYA 4NAFB 4DBUA 2WOQA 2VC6A 3C0QA 4N9EA 3QV8A 3BLKA 4LX4A 4QAIA 3VD5A 2OODA 3G8EA 1J0KA 2O9TA 3EX4A 1KM3A 2RHGA 2J75A 3RR1A 3VDHA 1N8IA 5DMYA 1H1NA 1KW1A 4KIRA 1WV2A 2WSYA 4F48A 1DKWA 5KINA 4E0CA 4GUHA 1W5NA 2DJLA 3FCPA 1O1HA 2Z6IA 1E9IA 2YFOA 1YQ2A 3ES7A 3SO7A 4GVHA 8XIMA 1Q6LA 2J66A 1FCQA 1VEPA 3W7LA 2GYIA 3NUKA 4ZBCA 2V81A 4LOCA 3H8AA 4PE8A 1TV5A 3B05A 5CSYA 4HB7A 1W1A1 4O0ZA 3B03A 2OXNA 3G1DA 3HPZA 1L9WA 4RX0A 3AUOA 3QC3A 1AZ2A 2V68A 2YCJA 3LGDA 4K37A 1Q63A 1UR3M 4CD4A 3W7NA 1CECA 3RCYA 3WQ4A 3UG4A 1YTDA 4JX4A 3I10A 2AQOA 5EFFA 2FTPA 3H7RA 4W84A 4QX4A 3VE7A 2FFCA 3N11A 3WEOA 5H2ZA 1ML1A 3R79A 2J9ZA 1UJPA 3W86A 1XPGA 1K9EA 2YYUA 4HA0A 1Q8JA 4BF7A 3T7VA 1W6TA 3DCPA 3GG0A 1TJ1A 4JFSA 1B2YA 8XIAA 2D2OA 3F4NA 5LYRA 3SCUA 3GW0A 4Z2GA 5I3JA 5C9UA 3CZJA 2C1GA 1GJPA 2WZTA 3NDZA 1VPQA 2NXIA 2FYMA 4F4RA 3EA2A 1UUQA 4RNFA 4UFLA 1MFVA 2PB1A 4XKMA 3GNPA 1DWGM 3ARVA 3H54A 2XJ7A 4LNCA 3BMWA 4A35A 4DNHA 1MFUA 2QJJA 3SECA 4EXQA 4YTRA 3MWCA 5D2VA 2BHUA 1KXQA 2Y62A 1K8CA 3R8RA 5REQA 3BSMA 4UQCA 5M17A 4UFIA 3LMZA 2DU2A 2YW4A 1EDGA 2W66A 4X61A 4O0QA 4JIEA 2NX1A 1S2WA 2QULA 4I7VA 1X1OA 2E28A 4QQ3A 4YVPA 3IK4A 3WF4A 4NXKA 5AC8A 1E56A 2CLEA 1PZ3A 4KRUA 4ZL1A 3GFZA 4PFHA 3CHDA 2A1YA 2NXHA 3ITLA 1EA0A 4HTYA 1QHZA 2HCVA 2PCQA 1SFTA 1FQ0A 1EYWA 1NDVA 3KBWA 2G96A 3ABQA 4L65A 2XUCA 2ACRA 4W8AA 3FJ6A 4YN5A 5CZ0A 3LSCA 5I5RA 2VZUA 3MYPA 1UH4A 2FMOA 2R1LA 3QHOA 4GQQA 1HJQA 1XIEA 1GK8A 4HNOA 3AIVA 3W24A 1Q6QA 3QVQA 1JCTA 4GUJA 4EACA 1UWUA 1R47A 2GOUA 1FKXA 3C8NA 2V5LA 1CT5A 3GFXA 2KX9A 3W7IA 3GVWA 3PN8A 1BQCA 3NFUA 4GGHA 5EU9A 4HPGA 2VMFA 3DU0A 1SZGA 1E40A 3N29A 4HGXA 4H7VA 3NL3A 3I7SA 4F0HA 5C9WA 3LPFA 1NDWA 7TIMA 2BHYA 1IEXA 3SIMA 3STGA 2QAFA 3WMBA 1DJYA 3EB2A 3VD3A 3UWEA 3TJIA 1FA2A 1OF8A 3HO8A 4N6EA 2NV2A 2PDUA 3VK5A 1ME7A 1LLOA 4ZQOA 3VM5A 4LRTA 5CKSA 1XLLA 2BDQA 3GNXA 3PBGA 3TW6A 3RM8A 1UR0A 2A3BA 2BSLA 4O54A 1ZJHA 1JUBA 4N4PA 3MHGA 3A3WA 3GU9A 4BI6A 4QITA 2V38A 1EWDA 5CEWA 2WWCA 4TTGA 4JFWA 1GEHA 3JR2A 1P1MA 2X42A 1C8XA 3W07A 3S0CA 1EEPA 4PTWA 4ZB5A 4JL1A 1LOQA 4GUIA 3T8QA 1IXQA 1T7LA 4FXRA 5LHEA 3W2JA 4JTEA 1TWSA 2OFJA 4Q4RA 1YNPA 5A6MA 4Y6GA 2Z2BA 1LF1A 3ARRA 3U2OA 4MB1A 4EIVA 3F2BA 2VRQA 4ADSA 2P8CA 2W63A 5HNNA 4DF1A 1HTIA 4GLEA 2VENA 3J7HA 1JYVA 1C8YA 4AZCA 4RZBA 5KZEA 1TG7A 1UBPC 3M7SA 2HE5A 4TO8A 1SR0A 3VIJA 1M01A 3N9SA 2D3NA 4FI4A 4GUGA 4KWUA 5B7ZA 3SCPA 5BMWA 2Y6ZA 5A95A 1Q3NA 1QBBA 2ZDSA 1WBHA 3UCQA 1MDLA 1UR8A 1E3XA 2XSBA 3ITXA 2HS6A 3HMJG 3BGAA 4AVOA 4LB4A 3DUGA 4MY1A 4W87A 3N2XA 3BLPX 2C79A 4ZR8A 4A8NA 3Q94A 3G2GA 4QG6A 4I5XA 2UZ9A 3PBWA 2O9RA 3GTIA 3PB2A 1OFRA 2BOGX 3GM8A 3TA9A 2BVTA 1QO5A 3FDGA 3RPTA 1D8CA 1WPCA 3FA4A 2WVTA 4AEEA 3O05A 4Q8NA 2PDFA 4D6EA 4HU4A 1TR9A 3WNKA 2P50A 4XISA 4Z1AA 3OHMB 3TV8A 3UR5A 2Y88A 1K8YA 4XAGA 3LCIA 1FCBA 4XB3A 2GLKA 3W0KA 4P8WA 1VR6A 1RLCL 4J5NA 2VEIA 3GU1A 2NUYA 3O6CA 1CNVA 1XRFA 3WLNA 3V4BA 5D8ZA 1C90A 2FDMA 3PUEA 1UD4A 1XKJA 4J2PA 1J0HA 3PP7A 2H90A 2OX1A 1LWJA 3S3GA 1QASA 1JPDX 1Z32X 4LAOA 1DJZA 1YDOA 2QUUA 5A6BD 1G67A 3MBDA 2AMGA 1KQZA 4O17A 1S5WA 2GUUA 1OGSA 1QDSA 1AQHA 3P5YA 2DZTA 2GJRA 2P1FA 5A2AA 1KGUA 4U28A 3VKAA 1W3TA 3HIJA 2IKJA 2HEJA 2UV8G 4QNEA 5K9CA 1A49A 2HPMA 2OEMA 3G1FA 4YCPA 4GQ0A 3NO3A 3FSUA 8TIMA 1C29A 3G22A 4TXEA 3EOLA 2CITA 1MVYA 4ZSUA 1V93A 2VZTA 3QM3A 4GCAA 3MP4A 4YJ5A 4UMBA 2BP1A 5A8GA 5LKYA 5LNSA 1J6OA 3U6WA 1MRAA 4KCUA 1V0KA 3IUDA 4M8UA 4CQ8A 4CVWA 5D2XA 2QW5A 1UUMA 1XYLA 3C2VA 3QZ6A 3S5SA 4U10A 2VEKA 4UZUA 2YGYA 8RUCA 4F79A 2GPTA 1Z8AA 3NM3A 2JF7A 5FJOA 3DAQA 2CEQA 1U5JA 3M5VA 5BMXA 3NQ7A 4JYFA 1XRSA 1M7JA 1JNEA 4H8NA 1THFD 4EAYA 3W83A 3CTTA 5DEZA 3WQWA 3HFTA 3VM7A 4RE0A 1LL7A 4P8VA 4B3LA 4ZA0A 4PN2A 1LRTA 4CN4A 3CZLA 1RZMA 3UVAA 1W0MA 4DX3A 4YYFA 2WVSA 4AX6A 4L64A 2PRLA 1GVIA 1G4PA 2WQDA 2JEQA 3CUHA 3DG3A 1FWFC 2ZVIA 2HDJA 4IMDA 4BQ4A 5M3WA 3GWQA 4MWAE 5CPLA 3VX0A 3E0FA 4XTIA 3NL2A 1UA3A 5CPOA 3I4EA 4Y9NA 3G77A 3IGHX 3WLSA 1XLHA 4ZXOA 3IJLA 2CESA 4KWOA 4AYGA 3F5LA 6ALDA 5XIMA 3WH6A 2BMBA 3TWBA 2PS2A 1H7NA 1QXLA 2FH6A 5G1TA 1H3GA 2VEFA 2Q3OA 1A3XA 3OVPA 4S3AA 1UC5A 1AZ1A 2A3AA 2J9YA 2FMNA 1LWIA 3NCOA 5TBOA 1XI3A 1R46A 2SFPA 4JDYA 2W4XA 1HJSA 1WDQA 3EWBX 1QRQA 3FLUA 5EPDA 1JPMA 5BOOA 1KM6A 4HA1A 4GJIA 4MADA 2IS7A 3CZEA 3HZ3A 1QJWA 2DH3A 1YPFA 4LYQA 2RAGA 2AL1A 5D38A 1A4LA 1SO6A 1H41A 2FTWA 1KXHA 2PDMA 4UMCA 1FDYA 4YCOA 4TOQA 4ZFCA 1EQPA 3B9AA 7XIMA 3PTMA 1L2QA 3VOFA 4PL2A 3MT1A 2OSWA 2VFHA 2BNJA 3GVGA 4DWSB 4YXGA 5IDIA 2Z1SA 3OZYA 4Z2HA 5CGTA 1TTQA 2XIBA 3GG8A 3AHXA 4K6AA 4LT9A 4FEZA 4MNLA 5JH1A 1NELA 1OFPA 5G1YA 3CHVA 2Z7GA 3HGSA 3VNYA 3ARQA 4MJ4A 4AD2A 1W2VA 1ZU8A 2EJAA 4CD8A 3HV9A 1Z48A 2B0MA 3ZWTA 5E1QA 3L68A 3S2CA 2BGNE 2VURA 5D9OA 3RLVA 3KDNA 3L4XA 3PNZA 1L6SA 2Z29A 3CUGA 2Z7KA 3NGJA 1RVKA 3ABOA 4XUGA 2ISDA 1UA7A 4W88A 2C8NA 1M03A 3MI6A 1DTNA 2WANA 2IXUA 1E1EA 1Q4NX 3PJXA 1QPQA 2VCAA 3INPA 4HU3A 4P7RA 3WFZA 4GVIA 2PWEA 3CUIA 1XIIA 4UTKA 3KRUA 2B7NA 2E5DA 2WKLA 4XKYA 4XTDA 1SU5A 3BQ6A 2EBNA 1ZBCA 4E4FA 1XLEA 3FYOA 1PE1A 4F8XA 4BEUA 1YW1A 3BAJA 1B30A 1DWHM 1AQFA 1OYAA 2DPEA 4GBUA 2ZXQA 3ZFHA 3TXZA 1WDPA 1IT7A 4LF2A 3TIMA 2OZ3A 3PFRA 4M24A 3H4GA 2FVMA 1J11A 1O60A 4US6A 3O2LA 3URAA 1ODZA 2ZADA 1EJXC 1XBXA 4IG2A 1KB3A 3TKFA 5I0DA 5I3GA 2YLLA 3OQ8A 3QHNA 1FWGC 4QAWA 4RDYA 2VRJA 3D3AA 4JHZA 3EXTA 1QI5A 1TREA 3MKVA 3VI2A 3WMSA 2Q8ZA 4UTTA 3NXLA 3QPYA 2GVLA 1S1PA 1FWEC 3CHFA 4KIEA 4MB5A 5EL1A 4CCCA 2VQUA 4PMZA 1EF2A 4LF1A 1QR7A 1A5CA 3DFQA 2GVGA 5BXTA 2VYOA 3GB6A 1E6SM 1B4EA 4GXMA 3TZNA 1TSIA 4N02A 5HXMA 2YL9A 4ML4A 4ZOEA 3TNBA 3N2CA 2OJPA 2TODA 4XAYA 5AZ1A 3AIBA 3B9EA 4BEQA 2WC7A 3MCOA 1NQKA 2QF8A 3THDA 1EPXA 2ZRZA 3A3HA 3WK2A 5TD4A 5H8MA 2ABAA 1Z89A 2GGEA 3NQVA 4I5RA 3QY8A 2PLCA 1OG0A 1LG2A 2BASA 3LD5A 3AU6A 1C7TA 3NL6A 3K30A 1EQCA 4MYXA 2WVVA 1RJRA 2VOTA 3CMFA 3M0VA 4RKAA 3DFNA 2VEPA 1B5TA 3NNTA 4MAVA 1A0CA 1B9ZA 1PEZA 3KE0A 5IXEA 1UOKA 1M1BA 3V0UA 1XH1A 1P0DA 2WQPA 4O15A 4FMVA 3WY1A 3H2AA 2JIWA 5I24A 4O8AA 1F8IA 1ZHAA 3CV1A 3R5EA 1E4LA 1KTBA 1OABA 4FLSA 1RBOB 2WW5A 3IUHA 4AMAA 2EGZA 2BG5A 3A9BA 6TIMA 5JXQA 3PZ9A 1V6VA 4R53A 1Q2SA 2JKAA 2INEA 2YIHA 3SCOA 5AC6A 4RV8A 1FDZA 4HA3A 1GOOA 2QR6A 5IFPA 1JCJA 3B3DA 1EKOA 5FESA 3W81A 3E0LA 3G8RA 2YA0A 1FVPA 4O1FA 3SIZA 4AZIA 2C71A 4YHGA 2ZRWA 2PDLA 2QJMA 1JYWA 4N42A 2YL8A 1FWWA 4WZHA 4ZO6A 4FX8A 4UFJA 1TE1A 2WNZA 3S6DA 4WJXA 2E6DA 3ITCA 5SWUA 1EJ7L 4J7RA 1XLDA 3UPMA 5AZ0A 5DBTA 1VP5A 3PG8A 1EGVA 2NT1A 3DFPA 1CLVA 4AIUA 3G1RA 3SW6A 3CMJA 2HQAA 3ALGA 5HMSA 1RQBA 4PUWA 3W37A 3BJFA 1EJVC 1BYAA 3CHCA 3W7MA 1E4IA 3CQ0A 4F66A 3SN0A 2DORA 3FN9A 4S3FA 4RNIA 3HGJA 1UD5A 3NZRA 3TJ4A 5CPSA 5H6HA 3P8JA 2G8ZA 4GX9A 1RR2A 1ZBKA 4Y9AA 1T8XA 2ZZ5A 1E4NA 3KEHA 1YE4A 3MI3A 1RP8A 3UNTA 4EX4A 2DVXA 5XIAA 1VENA 1QOPA 5A6TC 2VJXA 1TV2A 5DN1A 3U2EA 4JZ5A 5FJIA 1F8MA 5JIWA 1QOXA 2ZUMA 3P81A 4MOZA 3VTRA 4KH2A 2DEPA 4HK6A 3I7RA 2WMIA 1QVBA 2OT1A 4PMOA 3ZLFA 1N55A 1UWRA 2A6LA 3I6EA 3KBNA 3A47A 4RPQA 3ZSTA 7CGTA 4DJEA 4A3YA 2UY3A 1OFQA 3Q37A 1XFCA 4J28A 2VCCA 3WLOA 3L23A 4KWWA 5KZDA 3EDDA 1ADOA 3AALA 3T1GA 4FR6A 1FUYA 3W87A 5IDZA 4YHEA 1RSCA 4ROQA 3AHZA 2VUNA 2BGSA 1I1WA 4J35A 3SUTA 2CBIA 4DJEC 1B3OA 2WZEA 4UUIA 5C54A 3ARUA 4L6HA 4GYPA 3IANA 3GKFA 3W22A 1BTMA 4AWEA 5CLWA 2VHLA 4NZJA 4G7EA 1WZLA 1ZUAX 4P61A 3RYSA 4B15A 5HOSA 1F05A 3FVDA 3AXXA 5TIMA 4JIPA 1ZAJA 1AH4A 1QHPA 1Y5WA 3KCOA 3GC4A 1U22A 3DECA 1GZGA 5E93A 1FWAC 1UWSA 3WEMA 1WYIA 3AXMA 4NI3A 2J27A 5BU6A 2DVTA 4C65A 1EO5A 2GGIA 3T8LA 4RXGA 2G95A 3SN4A 3UWZA 4QR6A 4AU0A 1AUSL 3APTA 1WKFA 1R8LA 1WUEA 1QW7A 1JJKA 1OFEA 1Z6KA 3TYAA 1MNZA 5E70A 3WQDA 5CZKA 1VC4A 5GJMA 4A4AA 3IVTA 1KM0A 5MF5A 4F0LA 1B0IA 3SCSA 1YRRA 3PTDA 3OPSA 2REQB 3TOPA 3CWOX 2YPIA 1XHGA 1TUXA 3DN5A 3FSTA 4H7ZA 3M16A 3EMZA 3NPVA 1ONRA 1HVQA 5FF3A 2J7CA 3UWQA 4I7UA 4H6QA 3IJ6A 3GH7A 2VZVA 3BVJA 1FWBC 3W38A 4EXAA 1PIIA 3H23A 3EOEA 1ISZA 1W1IE 5XINA 2BFGA 3C61A 7TAAA 4B5NA 2PEVA 5HK4A 2HXTA 1W9PA 4HQVA 4ZXLA 1RHCA 2E3ZA 2Y24A 2W9MA 4UTWA 3RITA 1IXNA 1Q5MA 4CKQA