2I16A

Human aldose reductase in complex with nadp+ and the inhibitor idd594 at temperature of 15k
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
312
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ultrahigh-resolution study of protein atomic displacement parameters at cryotemperatures obtained with a helium cryostat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 110
structure length 312
sequence length 313
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2i16A00
2BP1A 3WBWA 3LZ5A 2PDYA 4QR6A 4LAZA 4YU1A 2IS7A 4NKCA 1PWLA 4PUWA 1AH3A 2R24A 4XZIA 1K8CA 3LN3A 4AUBA 1YE6A 2VDGA 3LUTA 2IKIA 3N6QA 1EF3A 1S1RA 1ADSA 2ACSA 2BGSA 3WG6A 3R58A 2ALRA 4JTCA 1PZ0A 2A79A 2F38A 2PZNA 4LBSA 4HMNA 3GUGA 3Q67A 1EKOA 2BGQA 2FGBA 5LIUX 3UFYA 2AGTA 5HNTA 4PR4A 4DBWA 2DUZA 1VBJA 2IKJA 3G1RA 3LQGA 3R6IA 1JEZA 4GA8A 1MRQA 3M64A 3ONCA 3GHUA 2HEJA 3F7JA 4XO6A 4YVVA 4WDTA 4JTRA 4JIRA 2DV0A 2PDQA 3D3FA 3H4GA 4H7CA 1PYFA 2FVLA 2FZ8A 3EAUA 3RX2A 3BCJA 1Q13A 3T42A 3CMFA 3WCZA 3H7RA 2ISFA 2P5NA 3H7UA 2HDJA 3KRBA 4PUUA 2IPWA 4PMJA 2INEA 4JIHA 4WDXA 4FA3A 3FX4A 3R8GA 2PDLA 2R9RA 2IQ0A 3UGRA 4XVEA 4R9OA 3DN5A 2I16A 5HNUA 3WBYA 3UZWA 3RX4A 4XZNX 1T41A 1QWKA 4WRHA 4IGSA 4Q3MA 4WDUA 1S2AA 1OG6A 2ACUA 3U2CA 4JQ3A 3MB9A 4WDWA 2PDBA 3EB4A 1MI3A 2PDGA 4JTQA 1J96A 3UP8A 1S2CA 4LB3A 1LWIA 3R7MA 2HVOA 2QXWA 5HA7A 2IPFA 2CLPA 1US0A 3LD5A 3M4HA 3GHTA 1Z3NA 1IEIA 4XAPA 2PD5A 3RX3A 4FALA 4YVPA 2PFHA 3M0IA 1XJBA 1EL3A 2F2KA 2PDHA 3BURA 4L1WA 4YS1A 1Z9AA 4JTAA 3LZ3A 2IPGA 2WZTA 3CASA 1X97A 3CV6A 2ACQA 1PWMA 4LAUA 2PDXA 3BV7A 2FZDA 2PF8A 3B3DA 4OTKA 5AZ1A 3UWEA 2PDWA 5LIWX 4XO7A 2INZA 3LENA 4GABA 4JIIX 1X98A 4MHBA 2PDIA 1RY8A 2PDFA 2J8TA 4EXAA 2PD9A 1HW6A 3LQLA 2NVCA 3MC5A 4QXIA 4QBXA 4GACA 1A80A 2PDCA 4QX4A 1Q5MA 1QRQA 4LB4A 4F40A 5AZ0A 1AZ1A 4XZLX 2IPJA 3ERPA 3VXGA 4L1XA 3N2TA 1EXBA 4LBRA 3C3UA 2PDNA 4JQAA 3BUVA 2HVNA 4YVXA 3LNMA 3R94A 2WZMA 1ZSXA 1VP5A 4WGHA 2PDPA 3EB3A 3LBOA 2PDJA 4JTDA 3V36A 2FZBA 3R8HA 3V0SA 4IJCA 4DBSA 2IQDA 5KETA 2C91A 4XK2A 1MZRA 3GHSA 1YNPA 1SM9A 1AZ2A 3R43A 2HV5A 5LIYX 1GVEA 1LQAA 1M9HA 3UZZA 1XGDA 4WEVX 2I17A 3ONBA 5DANA 3UYIA 3NTYA 4G5DA 4XZMX 1ZUAX 1T40A 3O3RA 3P2VA 3WBXA 1S1PA 1PZ1A 3FJNA 1ZQ5A 2IKHA 1XF0A 4RPQA 3UZXA 2PDKA 2HE8A 3V35A 3O0KA 3GHRA 2HE5A 1AH0A 3Q65A 4DZ5A 2PEVA 5LIKX 1R38A 4ICCX 1AFSA 1AH4A 4JQ4A 1HQTA 1RALA 1Z89A 1FRBA 4ASTA 4PRTA 5C7HA 4DBUA 4PRRA 4GIEA 4FAMA 1X96A 4GCAA 5JH2A 3QKZA 1Z8AA 4XVDA 2ACRA 4JQ1A 4GQGA 1C9WA 4H8NA 5LIXX 4ZFCA 4IJRA 3UZYA 4GQ0A 3S3GA 4JQ2A 2DUXA 1IHIA 3CAVA 4XZHA 3V0UA 4I5XA 3CV7A 3DOPA 3COTA 4HBKA 2FZ9A 2NVDA 2IKGA 1UR3M 1YNQA 5JH1A 3G5EA 2PDMA 1ZGDA 1RY0A 3UG8A 2PDUA 5M2FX 4Q7BA 4EXBA 4FZIA 3LEPA 3V0TA 3CAQA 1YE4A
chains in the Genus database with same CATH superfamily
3W1MA 1M03A 4O11A 5D8ZA 4KCUA 4KQNA 2FB2A 4TXEA 1Q6EA 1QWGA 3WUBA 1G7VA 3MANA 2CKSA 1A3WA 1TRDA 4DJEA 3E6EA 3V75A 2CETA 1YADA 4ZR8A 2BY0A 4M29A 2ZVRA 3IJDA 2NT0A 4AY1A 3TN3A 4Z42C 3M0YA 4HQVA 3MHGA 4W84A 1DIDA 2QMJA 1A5CA 1BGGA 3HQOA 1GVOA 1QK2A 3EPOA 2DY3A 2WBGA 3VE7A 4PYSA 3T0TA 1XQLA 3HA1A 1Z48A 1ITQA 1KFEA 3IWPA 4PR4A 1H0GA 1FWTA 3L65A 1YQ2A 4WVXA 1K4HA 1PVNA 4FB7A 1VEOA 3U0HA 4XBSA 3FA4A 1MRQA 3STEA 2YYTA 2QF7A 3W23A 1WOAA 3AS2A 1AJ0A 4GH1A 2OQHA 4YVVA 1NP2A 4GYJA 1BLIA 4IJBA 4H7CA 1PYFA 4LT9A 4OQVA 1BD0A 1R6WA 4ZQOA 1DIKA 1Q13A 4US5D 4CCZA 1IGSA 1R87A 5G2HA 4IFKB 1CLXA 4YTSA 2BXYA 3I6EA 3TTQA 1R86A 2EPNA 2NQJA 1W1A1 3MSYA 4I7WA 1VFLA 4Y9AA 3C2EA 4Y90A 1FHUA 3GW0A 2W6RA 2XIMA 4R9OA 1FWJC 3UZWA 5CZJA 2WJDA 1EWEA 4AIBA 3EX6A 3PAJA 1XLIA 3ZVHA 2DPEA 4WKHA 3ZT6A 4UTTC 1QWKA 4ZO9A 3E2QA 5FCZA 3PBVA 1OF6A 2QUVA 3STFA 2BWGA 5I6SA 4PEEA 3CK5A 1UWSA 3R13A 4HCLA 2XM2A 1SVDA 1W32A 3LLXA 5K9DA 4KGLA 4DUOA 5EMKA 1JGMA 1QR7A 1OK4A 2FH8A 4GNKB 3GNXA 1IYXA 3W7LA 1SYTA 4TQTA 4EPKA 2W92A 3QY8A 5AC4A 3QYSA 4S1FA 4MLRA 3CWOX 3OZOA 4JN7A 2J7FA 3B0UX 4MY9A 4K38A 3W9ZA 4RW5A 2JALA 4FX7A 4HJWA 3XIMA 3SQLA 3PZOA 3QW3A 2PDHA 4UMBA 3BURA 4L1WA 1PYMA 4QJ4B 3BJSA 4IPJA 3B03A 4PBFA 2OO0A 2IPGA 3FSTA 2TMDA 3VGFA 1LLOA 1PDYA 2PDXA 6XIMA 4AIOA 3DGRA 2PF8A 3G18A 1M04A 2F8QA 5E6ZA 3WK0A 3EWWA 4ORIA 4EE9A 4ATLA 3OO2A 3WMCA 4MKNA 2KZHA 3THDA 1MXSA 2VCCA 3WLQA 4NAEA 4YPJA 2Z1WA 2YJQA 1W1TA 1FWEC 2OT0A 5HXMA 2V5KA 4WJ8A 1TQXA 1C8VA 3REQA 4LCSA 1D3GA 2REQB 2V69A 5FAJA 5XINA 3PUDA 3KXQA 2GJXB 1TRIA 4B5XA 1FWAC 3RITA 3UGVA 2GUBA 2X8RA 1GJWA 4AWSA 3S2NA 3UG5A 2B7PA 3S2MA 4HSOA 1H63A 3C3UA 5K7JA 2C1HA 6PTDA 1ZY9A 2J8FA 5F2IA 1XSJA 3A9IA 1DXFA 5BZAA 3NURA 1BG9A 2WSYA 3W72A 3PBWA 4Q8UA 4RXFA 3N9KA 3OHIA 1KQYA 4ERIA 5BU6A 3TONA 3PZIA 3R0DA 2AMGA 3WNPA 3TYBA 3A12A 1JAEA 1QASA 2PRHA 1KXTA 3E2SA 4UR8A 2A3LA 2FMOA 2Y8VA 2VC7A 3ITCA 4HP5A 3FKKA 3AIWA 1K6AA 3R12A 1GPWA 3TXZA 1DJGA 1MW3A 2ZADA 1GCYA 4O10A 1ME8A 4OBTA 3CIWA 3U5YA 3SURA 3BOXA 3IK2A 1TJRA 1VRXA 3K5XA 2VUYA 3ITLA 4G5DA 4XUGA 3W7GA 4KIEA 4XZMX 2ATSA 2WC3A 4ZTYA 3QTPA 1GJUA 1S1PA 2HSAA 1TX2A 5G1MA 1SO3A 4BCEA 3FK4A 2X2YA 2HROA 5IDZA 3PPCA 1VH7A 3PZ9A 3T7VA 3KVJA 2GL5A 3C2YA 1XLFA 4BFAA 5A6BA 3VIMA 4BQ5A 1KM2A 2D0FA 1BXCA 4IPLA 1KFLA 4AWTA 4PMDA 1ZB5A 4TVCA 2C14A 2A3HA 4LF2A 4R7OA 1A5NC 2CLMA 5LGZA 2WVVB 1FOBA 3PP7A 3WH8A 4PN2A 5D05A 1QXLA 4K37A 2YDAA 4GCAA 5C0QA 4HOWA 5D37A 1V3JA 1E4IA 4U4MA 1TV5A 1KTNA 3PS7A 4XVDA 3APGA 1MNSA 4PCNA 2WLYA 3GWQA 1AJ2A 3WMSA 2DSVA 4E8DA 1YEYA 5BU9A 3M0ZA 2VP8A 4RNFA 5DY2A 4R27A 4HMCA 1JDDA 1QPOA 1E9YB 2TODA 1B3OA 1XX1A 4IP5A 4HPXA 4OVXA 1ZAJA 5A6LA 2FZ9A 2X1UA 4NYYA 4S2BA 4X60A 3O2LA 4OIFA 2P8CA 4F0KA 3G1AA 3G8EA 3URQA 1TV2A 1R2SA 3UG8A 1TO3A 4B2DD 4FZIA 4A3QA 1PXGA 3NQ7A 5I02A 4NZ4A 4D2JA 2J62A 4UFMA 2J25A 2MANA 4ZENA 3M0KA 3LN3A 2YXOA 3IK4A 1IZKA 1D2KA 3AMLA 3NZQA 2NQ9A 4J1OA 4QDPA 3LRLA 4JKMA 2BGSA 2Z1XA 4AF0B 1UR4A 3CZEA 3GC2A 5G5IA 4GD0A 4ZQPA 7ODCA 2VQUA 1KRMA 3M16A 3NAVA 4KIRA 5CPNA 3SW6A 3CZGA 3KM8A 4H6QA 2BGQA 3VKCA 2AGTA 2FQIA 1EUNA 1WKFA 2OT1A 3B8VA 5HULA 1YNYA 5DX7A 4N2YA 1J0HA 1BKSA 4HA1A 4CNNA 1Q4WA 4HN4A 4XBJA 3T4WA 3R6IA 4GUGA 4C6JA 1Y5WA 4B92A 4GA8A 1WZAA 3WQEA 1DOSA 3UXKA 3D3FA 2CKRA 1VYPX 3RM4A 4LPCA 3AAMA 3KL3A 3TOPA 3AZTA 3WCZA 2H3DA 4XV0A 2ISFA 2LLEA 4NAFB 4J3TA 2D2GA 1OYCA 3QFWA 5A8NA 1W1ZA 1AW1A 3B40A 3F5KA 1PHWA 1VIWA 4JCMA 3BC9A 1YIXA 3ZR4A 3VUPA 5I3FA 3WMLA 3ITVA 1KCZA 4O1AA 1X6LA 4WOZA 3PJWA 1W8SA 1H1YA 1W9UA 1HJVA 3TYZA 1T41A 4EWND 1P0EA 1TIMA 2Y5EA 4IF2A 4KW2A 4WD0A 2OPJA 4DPPA 5E93A 1PS9A 1NF7A 1NWUA 4WDUA 3LGGA 1JCNA 4JDYA 2JGQA 4QFUA 3U2CA 4WKFA 4ACZB 3L5AA 1AVAA 5DT5A 3NQ8A 4KEVA 5D9OA 4L1GA 3QC3A 4HNUA 2ISWA 2YCLA 3CU2A 3NQDA 5F2MA 2JKEA 3W1TA 4ZTXA 2ZZ4A 1E6QM 4MB1A 3UY8A 3R7MA 2ZYFA 2Y2WA 2QXWA 1QBAA 3WEZA 2CLPA 4UWMA 2H8ZA 2O9PA 3M4HA 4CN4A 4DY1A 4BI6A 4AD3A 1IEIA 2G4FA 1E3XA 2WANA 4B15A 1Y8BA 3BLKA 1W3JA 1TSIA 2PLJA 4HSNA 2VZVA 3M0MA 4HNNA 3G22A 1UKQA 4LY8A 1M1BA 1X97A 3S9IA 4R53A 2QT3A 1B3ZA 4C60A 2PB1A 4S23A 2VTFA 4JIIX 1JPIA 2VCBA 1L8PA 1IEWA 4GY7A 1HW6A 2WZHA 4TU1A 2P53A 9XIMA 4UTFA 3LERA 2ZZ2A 1O68A 1ZJHA 4PTWA 2GVEA 3QPYA 1M68A 3KZSA 4PMUA 1A49A 1JNDA 3VM5A 3OW1A 3G0UA 2VDIA 1S3TC 3A4XA 3GXPA 4HK6A 2DIJA 5H91A 2QUTA 4CN1A 4QQUA 3UWQA 2OVLA 1U83A 3F4WA 3ERPA 4L6HA 4D72A 2ZRVA 4ERGA 1FWHC 1TPDA 2UY2A 2WSKA 1E55A 1B54A 1EUAA 1Q6QA 1HIZA 4FLSA 1RP8A 5EA9A 5IOBA 4P8WA 1NU5A 5I77A 3ALGA 4JPGA 1M7PA 2PGFA 3T0CA 4IMEA 3SAZA 3M47A 1C90A 2H6RA 1AK5A 2XH2A 3EWDA 3SI9A 1TE1A 5DY3A 1CX9A 5GNZA 2OZ0A 3WQOA 3Q2DA 2FHCA 3WDJA 4O1EA 2DT0A 3W3OA 2IXVA 4NAFA 1XYCA 5KETA 2WM0A 2A6NA 1AQMA 4LUSA 1UBSA 3GW3A 1OIFA 4MADA 3GNPA 1UD4A 4JBRA 1JQVA 2VX5A 1ZJIA 5KITA 8XIAA 1TWDA 2R1MA 4CCDA 1B4EA 3UYIA 1XCWA 3CC1A 1TTJA 2VRQA 1AL8A 2YSWA 4LBUA 1DWJM 4ATWA 1P7TA 1BF2A 1SZFA 4RDVA 1A4LA 1XRTA 4QAIA 4JFVA 1EQPA 4C90A 2CHOA 3TNBA 3HN3A 3SRKA 1XLMA 3GHRA 2HE5A 4XZ9A 1IQ8A 3SCRA 3PANA 2PGEA 3UR2A 5BXSA 2YCLB 4R5EA 3OYXA 3A6OA 3EPNA 3CIVA 3IAQA 4JEJA 1RJRA 1UZ1A 2OKTA 1GW1A 3DG6A 3ZWSA 1XYFA 1WB0A 3O6DA 3ZWTA 2QCEA 4RE2A 1E9ZB 3ME3A 3P5YA 4GNJA 4UFIA 3SN4A 3OBEA 1Q85A 1UG6A 1JRBA 4JXCA 3BZJA 4I5XA 3WDHA 2CW6A 1SR0A 3NL3A 1V6UA 4HZ8A 2WNWA 3UF9A 1UR3M 3WDRA 3IJ6A 3H6OA 3LPFA 5G4HC 1FWSA 4FOKA 3EWCA 4CD6A 3LEPA 4XD6A 2Y6ZA 3VZZA 9RUBA 2ZFAA 2UY5A 1XINA 1QHPA 2IS7A 3O63A 4DM2A 4DWSC 5C2GA 1HKVA 3CPRA 1ZAHA 2VEFA 4MPKA 1TCMA 1XFCA 3JVAA 3RPMA 3NQ2A 3ES8A 2IUZA 4Y8EA 4QEHA 3MV01 3OVGA 3LUTA 2VRKA 1UBPC 4PTVA 1EF3A 4GI4A 3GVVA 3BG3A 4ZO6A 3TSBA 4GH3A 3B8WA 1WDSA 3KP0A 2AL2A 2QDGA 3S1XA 4GPNA 4RE4A 3E5BA 2VL4A 3UJEA 2J4GA 1X7FA 1BKHA 5M03A 3CBWA 3JW7A 2WHJA 2G41A 4URIA 3C0SA 4AMAA 3OYZA 4A8LA 1RV8A 2OWWA 5HNNA 1ISYA 1JEZA 2Q3OA 1TCDA 1XLBA 3M64A 3P80A 1NWRA 3PG8A 3HG5A 2QCCA 4ADUA 5HUPA 2DV0A 3KTXA 5ABFA 5BCAA 3LBMA 5JBDA 2VHLA 2EO7A 5D2TA 4WQ6A 1KGXA 3M0HA 3WLOA 2ZX9A 4HA0A 2Z26A 4WCJA 1S2WA 4MJ2A 1KBKA 1ZAIA 3QV9A 1VLWA 3CZJA 3EOEA 4PBGA 3K8LA 4Q4KA 2W79A 2A7RA 1CXIA 4FA3A 1EJVC 5DMLA 1Y65A 2YL8A 3WY1A 3GAYA 4JFTA 2J24A 1DJYA 1R2RA 2PLMA 4Q7IA 3MA8A 1R3VA 3U5UA 4MJZA 1PIIA 2G3FA 2Q8XA 2C3ZA 2PWVA 4C1LA 1JUKA 5IRPA 3KBNA 4EKJA 2CZVA 3VKJA 1RR2A 3YPIA 1M7JA 5DMNA 3VNJA 1RK5A 1XYBA 3ZIZA 4HHMA 1HKJA 4GC3A 5C2XA 3RLHA 2QUMA 2I14A 2BFGA 4UBPC 3NGJA 4E2OA 4P2VA 3GIQA 4WDWA 1MI3A 3FXGA 1O5XA 5F4SA 4P61A 5F4XA 1VEMA 1XKYA 3CH0A 3ARUA 4A8NA 1SJDA 1UA7A 4L80A 3IS4A 4M24A 3NYZA 1TELA 3HZ3A 2WYSA 4BY3A 3PZQA 3TN6A 2W67A 2NVAA 4Q8PA 3VNZA 5B80A 3QOKA 1XW8A 4KESA 2PFHA 4CU6A 5CAHA 3MMDA 1H7XA 3UY7A 3OTRA 1FX6A 3T9PA 3T09A 1KM6A 3FCPA 1CZ1A 4KERA 5FEPA 2QGYA 4D6GA 1E9LA 4WKAA 2WZTA 1E3ZA 3W76A 1TR1A 4QNWA 5TQLA 4DWSA 4H7ZA 4K7YA 4LNCA 1GVSA 4C65A 2PWFA 3VNLA 3HQ1A 1XXXA 1PDZA 3BG9A 4GABA 1EH9A 1LRTA 1B9BA 4PMYA 4ZOAA 5HNRA 1JPMA 3EWZA 2C13A 4QG6A 1R3YA 4HA4A 1IF2A 4DJFC 3AS0A 3LCFA 4CD5A 5HR6A 1D7FA 1V6YA 1DJXA 4NJGA 3QPEA 3CXOA 3G0SA 1F7BA 3AXHA 4RW3A 2VURA 4GACA 4W87A 1LROA 3NZPA 3HGRA 4QX4A 5AYIA 4EACA 2WHLA 4G1KA 1AZ1A 1CYGA 3PPFA 3V5FA 3CEUA 3NXLA 1UR8A 1HL2A 2ZRZA 1O5RA 1XKJA 2FYMA 5CBIA 1PZ3A 4MFEA 3TCSA 1EA0A 2NLYA 1AMYA 5A95A 2YKKA 1QI0A 4C6LA 4Z2HA 4Q8VA 3B0XA 1QI5A 2QCFA 1XD1A 5I00A 1L2QA 2HXTA 3QRHA 3LGDA 4RXGA 5C71A 1OJXA 4EF9A 1DP0A 2CZDA 4RZ5A 1IIHA 3N2BA 1EZ2A 5FD0A 4IQJA 3EX2A 5HJXA 4ZMGA 4DB7A 5AHEA 5FIPA 4UQBA 2QPUA 2I17A 3WZ0E 3PTKA 1KXQA 5DLCA 2GJRA 4OHQA 4EOUA 5HQLA 1N8IA 1HNYA 2JK2A 3P2VA 4R7WA 4I7VA 1GHRA 2BTMA 2NSXA 3VDCA 4E5TA 3N2OA 3ECQA 3B4UA 4UB9A 4FX6M 2R1KA 4D6EA 4RZ4A 1RLDA 2I1OA 2C0AA 4O15A 1E4NA 3H24A 3MBDA 2FDSA 3OGVA 2WQPA 1NFGA 4IM4A 1PL9A 3UYCA 1HQTA 4B5WA 4FHAA 4QJ5B 2W4XA 1MUCA 4Y9NA 2OCZA 5CBJA 1W17A 3OU8A 4H8UA 1NQKA 2E8ZA 1GHSA 5JH2A 1NP0A 3C2OA 4NNCA 3PZNA 3RJYA 4NI8A 2XDFA 1XWYA 3IGXA 4FXFA 1Q3NA 1AW5A 3W86A 3QXBA 3HOJA 1NDVA 4E38A 2ZOXA 1WDPA 1F3XA 3L4WA 3TZNA 5EBUA 2DUXA 4L6DA 3GU9A 3IGHX 5JQ9A 3AYRA 1H51A 4E0CA 3T8QA 3W85A 2HTMA 2QVNA 2IKGA 2OLSA 1MMFA 4LUSB 4XKMA 3N9SA 1OFQA 5D03A 2A4AA 1WKYA 2CC0A 3KFTA 3M5ZA 5HPOA 3IRSA 5LNVA 3W01A 1T99A 2NUWA 4RLIA 1RJQA 3A9BA 3WLRA 1A5LC 1CXEA 1NJJA 4GJ1A 2ODOA 1YPIA 3LM3A 2UZ9A 4XZIA 1E0WA 4B3LA 2E6AA 1C8YA 1UQZA 1H49A 4MNJA 3HGOA 5EBAA 2VOTA 3ZZ1A 2OELA 4HTBA 3RLGA 4DLMA 5GNYA 4LU0A 2ALRA 1TQJA 1TUFA 4L6OA 4AXNA 4XWUA 3BOFA 4C1NA 2JEPA 3AOFA 3L2LA 1HX0A 2WVSA 3I3EA 1GK8A 3TN4A 1J6OA 1S2UA 3EMQA 3F1QA 4O53A 2UBPC 1TX0A 4XISA 2DSUA 4M3PA 3SZ8A 3ES7A 4Z2IA 3IRDA 4RZ6A 1QVBA 3IACA 4JKLA 3FJLA 5E1QA 1H09A 3F7JA 3KCOA 4CUCA 4WLCA 5F1VA 4JTRA 3VZYA 2P3EA 2FZ8A 3TH6A 5A6AA 4JY9A 1A0EA 5ABGA 3CMFA 4P7NA 2OGYA 1TIWA 4PBEA 3VD3A 1EGZA 1EHNA 3GNDA 1TG7A 4GMEA 3W84A 1RJPA 3UERA 3FX4A 2H9AB 3R11A 3ABRA 1YBQA 3VI2A 2BY3A 3GVRA 4N6FA 3B8SA 3MCMA 3SUTA 1WZLA 1S38A 2TAAA 4DQWA 1GUVA 1FCQA 1OD8A 3RX4A 2OWXA 3PM6A 3TYEA 4S3KA 3QZ6A 4QCEA 3E0LA 4ZQNA 1KM5A 1JCXA 2RDUA 4C91A 4EK7A 2VM8A 3AJ7A 3M43A 4IIEA 1RD6A 4UNKA 3O8AA 1V3MA 1JDCA 1OG6A 4UTWC 3WEMA 3SBFA 3RO8A 3GU1A 4HCDA 1VCFA 2ABAA 1ZBCA 2Z4GA 3GE7A 5AKQA 4H00A 5MKGB 3UJRA 4HYVA 3OGSA 1IWBA 3KUMA 3TCEA 3BQ6A 5C70A 2PGWA 1GG1A 2F6UA 4GXPA 1EX1A 3T78A 4HSHA 3G2GA 3HGSA 4U5IA 5DEZA 2J6XA 4C6QA 3GM8A 1Z3NA 3TC3A 3WUGA 1TA3A 4JTGA 1ML1A 3DFYA 5AY7A 5DRIA 4NQ1A 1QJWA 3ZLFA 4C5ZA 1OYAA 4IX0A 4DRSA 2G3MA 3NCOA 1PTAA 3V5CA 3TE9A 1KA9F 2ACQA 4MTVA 5EB8A 5M17A 1P0NA 4OTKA 1O66A 2EKGA 3GG8A 1WDDA 1DJIA 1SSDA 2I5GA 3MO4A 4GZEA 4AZBA 3SADA 3DIPA 1SO6A 3T81A 4LUYA 1NY1A 2UV8G 1M7XA 4PUJA 2Z1SA 3CTTA 3ZLHA 1JUBA 3MP5A 5HWNA 3ITTA 4AVOA 1WA3A 2XFYA 1K9FA 3KBWA 2BG5A 5BOFA 1UMLA 2P0OA 5E9AA 3SN0A 3QV6A 3ZR6A 4GZIA 4L1XA 3GBEA 1KLYA 1UR1A 4MLJA 3QN3A 1QO2A 4Q33A 4PODA 1JYNA 3PJXA 4GXWA 3QH2A 2CBUA 1UP0A 4AAJA 2GQ3A 3O6CA 2GQ8A 2EG8A 3A47A 3WF1A 3FAWA 4IQDA 1Y5VA 5LA0A 1EQCA 4A3UA 1E51A 3VOGA 1JPKA 2ZXDA 2RFGA 4Z0JA 5EMMA 3LBOA 4YYCA 1KFKA 1IXPA 5J5RA 4IIFA 2YA1A 3PFRA 1UIPA 2OFJA 1E71M 2HS6A 1UH3A 4FS9A 3LY0A 3VFCA 1KBBA 2J78A 4DWDA 2H9AA 4TV5A 3GH5A 4PMRA 5LHFA 4KPLA 1H41A 3DENA 3RUBL 3UZZA 1BYCA 1EO7A 4KWWA 5I3HA 2OLHA 3ONBA 3WNOA 2DZUA 3BANA 1TWZA 2YL6A 4L9YA 2PI6A 4U3AA 1EP2A 3VNIA 1WP6A 1V93A 2WOQA 1B57A 1GKRA 3VGHA 5I3DA 3LG3A 1VKFA 3UZXA 4LVGA 5A8PA 1E0UA 3N3TA 3C3NA 3TTOA 2F6XA 3O0KA 2Z25A 4GYKA 2DVTA 2ZZ1A 1EB3A 4Q6XA 3MJMA 3GDKA 3NEVA 2WMHA 4DZ5A 4H83A 1XGEA 1O1HA 5LIKX 4DIAA 2XH7A 6CGTA 3D6NA 1UROA 3RJXA 2BBFA 2D73A 3OJGA 4YTQA 3HU7A 3KVLA 2ASHA 1OC6A 2VEGA 3ARSA 3LCGA 2GGEA 3LHYA 4FAMA 3WDQA 3AMKA 4G7FA 3B0PA 5F7UA 3O1NA 3AZSA 4XX6A 4YLWA 3BLLA 4RV3A 3AIRA 1SZEA 1HKKA 3UWVA 4MB4A 3QSTA 4H8VA 4A3HA 3CQHA 5A6MA 1DIEA 3CV7A 2NQHA 3VNMA 3SEPA 4GISA 4V1XA 4DWSB 4YYFA 1RPXA 1OVDA 1JDAA 1QK0A 2ZE0A 1JGIA 5IHRA 5C9ZA 1KCKA 3S8HA 1KRCC 3E5PA 4NZCA 2JKPA 3M0LA 3ZOAA 2DT2A 3LZ5A 4QR6A 4DXKA 3DDMA 4PMXA 3ARTA 3AXMA 3W7JA 4HPHA 4BEQA 1W1VA 3BMWA 3RM8A 4ZQRA 1E1FA 3TFCA 3ABOA 3S2JA 1Q6DA 1A0CA 3PAOA 4LFYA 4K3ZA 3PULA 4PMQA 2D2OA 3KL5A 3LV6A 4YWIA 4FLOA 1OFOA 1W3HA 3WF3A 1Q7ZA 2Z27A 3HQPA 1FWWA 2YOCA 1JCLA 2H90A 1GONA 3OA5A 3THAA 2Y89A 4S3GA 3M46A 4F9JA 2GGIA 1D8WA 5CAKA 2GUYA 2WKJA 3LLFA 4GOAA 1V0LA 2X1IA 4ICNA 4ES4A 4KEZA 3WK3A 4J28A 5D30A 1FCBA 3O05A 2YL5A 1Q4NX 7REQA 1W2PA 1J2WA 2ZX7A 4QLJA 2EG6A 3KP1A 4R33A 1X1OA 2WNNA 3OBKA 3OPSA 3AU2A 2YCKX 4JNYA 3A3WA 2XIIA 2X2GA 3I7QA 1U2YA 2UY3A 3G1HA 4K8EA 3FGCA 4N4QA 4H2CA 3BZGA 4TTUA 4Q32A 4R7JA 3C61A 3VDGA 4LF1A 3E0IA 1V3LA 5AFDA 2FVMA 2I16A 1HL8A 1M5WA 3PZVA 4O1CA 3U57A 2V68A 2Q71A 2PP1A 1V08A 2PWHA 3QMRA 1SJAA 2BY1A 1UH2A 5DCEA 1WAWA 5AYBA 3TSDA 3MPGA 4JTSA 3UWZA 2QZRA 2EF9A 3B0VC 4WSJA 5D8WA 1LOLA 1S2AA 4AWEA 3LOTA 3R5EA 4CN6A 1KFCA 1PAMA 1TZ7A 2YA2A 2CESA 4A4AA 4D8AA 1F6PA 4KCWA 2VEKA 4U28A 3R4IA 2ZRWA 4B9ZA 1XIBA 1Q2SA 3AIBA 4OUEA 3CQJA 1GOIA 3BW4A 4X22A 1IEQA 4MNLA 4UTWA 2V5BA 1QTWA 1UZ4A 2YLAA 5CLTA 2MNRA 4PTXA 2GSEA 4KFOA 3U2EA 4FLRA 3D0CA 4O28A 3KTSA 3MUCA 3NEHA 6ALDA 4Y9PA 2GLKA 4M56A 3V16A 4HMDA 5D4YA 2B31A 3EYPA 2PF0A 5FKYA 2BVYA 1F8MA 2R14A 1VLIA 4UMAA 1OC5A 3E38A 1V5XA 5EU9A 1EC9A 2OQYA 3KOXA 4NUWA 3B05A 4LS2A 4PFHA 1H0IA 1B4KA 1K9EA 1YMYA 1OQFA 2VC9A 3GYCA 3N25A 4CNUA 1Z6KA 2PU1A 3W1RA 4YCOA 3L68A 3IJIA 3JS3A 3W7KA 3GDMA 4FNSA 1QW9A 3MT1A 3SJ3A 2PCQA 4O8AA 3OQEA 3IVTA 1IEVA 1UZDA 1UIOA 4I9TA 3WJYA 1KRAC 1SQ7A 1Z7AA 4LB4A 4G56A 1WV2A 3VXGA 4QNEA 3CLWA 4MDOA 4BEUA 1L6SA 3N2TA 4GJIA 4F0HA 2XSBA 3FA5A 1NOFA 1XLKA 3URNA 3AHXA 1PKLA 4IIHA 2R1PA 1JR1A 3FIGA 4JX5A 2OZ8A 3NOYA 3WQ6A 2AKMA 2GGGA 1ADDA 2O9RA 2QPXA 1YW1A 4QG9A 2DZAA 3G24A 3UNTA 1LF1A 5IBXC 4JN8A 4AHOA 4GKLA 4MB5A 5TNVA 3USBA 1WBJA 3WDPP 4C5YA 2ISSA 5JU6A 3P74A 3NSXA 4CQDA 4C6OA 3WF0A 3W7CA 1RXOB 4QAWA 4EWJA 3N34A 3MYPA 1F5ZA 4WEVX 3CYVA 1C3FA 2C71A 3NXFA 2FIQA 5BMXA 1UP3A 1UR9A 3TC6A 2VZTA 2D3NA 2V2DA 5IXEA 5G4WA 2JQXA 4JHZA 2D1ZA 2YCJA 5LYRA 4B5UA 4L65A 4MAVA 1EOMA 3N6JA 1IR1A 3W0KA 2F6KA 1DQUA 4H4IA 1B3YA 1P48A 1FH9A 4NJKA 1R3QA 5HOSA 3FV9A 4L7ZA 1XYMA 3GVGA 4HU8A 1AH4A 4JQ4A 1ZFJA 4ECLA 3ZO9A 4CD4A 3UETA 1ZP4A 4F0LA 4DBUA 1CNVA 2Q8LA 5HJLA 5FI8A 1P1MA 1CT5A 2J13A 2C0HA 3FYPA 1W8GA 1B1YA 3GTIA 2J6VA 1YTKA 3XISA 3WLNA 2V2HA 1FDYA 3S83A 3R0KA 1OFAA 4Z2JA 1H2JA 1K8ZA 1YNQA 4AY8A 3H55A 1C91A 3SUSA 3G1FA 4F3HA 2QCMA 2ICSA 2YZRA 1BYBA 2ZXQA 4NZJA 3VAVA 1LYXA 3LXCA 1V6WA 1XM3A 2PDYA 4D6CA 2ZUTA 1VBRA 1AH3A 4ZB2A 3AU6A 1LUCA 1L6WA 2CYGA 3UVAA 2A2IA 1DYSA 4KETA 1UD8A 1B2YA 1XUZA 3GR4A 2NT1A 2G95A 4LAMA 1YXYA 3WF2A 3DYMA 2TSYA 3AFBA 3ANVA 1IXOA 3WELA 3VUSA 4X0VA 5HJYA 4GUIA 3RR1A 2VGIA 3T1GA 3VK5A 4CVWA 4N9BA 2OB3A 3KTCA 4M51A 4PUNA 2O55A 4DBWA 2BVWA 3NVTA 3VD4A 4MM1A 5BOEA 1LOQA 4UMCA 4TX9A 3T2QA 3SCTA 4IQEA 2GJPA 1WAUA 5LXXA 3SQSA 2JGYA 2XVNA 1YKWA 4QLLA 3ABQA 3BAIA 4Z1DA 1B30A 3UU0A 1RQHA 3EXRA 3U8GA 3NZRA 2WMGA 3UBPC 4PUUA 2QLYA 3N11A 3O7UA 4N9CA 2E6YA 4CNOA 3HGJA 4FK9A 4MSSA 3KLLA 4M7SA 4O16A 3ZM8A 3F2DA 4L5ZA 2GDQA 3ATYA 2HPMA 2W5FA 3CUIA 4W7VA 3W1AA 1P6CA 2GZXA 4IMAA 4O4WA 4QISA 3WH5A 4XVEA 3NA8A 3EMZA 3RNDA 4NT0A 3TTEA 3INPA 2ZA2A 2RGMA 3DFNA 4WJEA 3PHAA 4I9MA 1I75A 3T05A 4LYKA 4JOMA 5D2VA 4MKVA 3Q58A 2Y7DA 3UQNA 1QMLA 2W61A 2XGIA 2GK1B 2V38A 7CGTA 3TK7A 3PG9A 4NZ3A 1P0KA 2DZXA 1BSIA 3IIVA 1DQWA 3LRMA 3UCDA 3P3BA 3FSUA 4B9YA 4DPQA 1ZCCA 4XD3A 4ZE5A 3IAPA 3EB4A 4O1DA 3VABA 3ZR5A 1MDLA 1TPVA 4K8HA 3WFAA 1HVQA 1M3UA 3NPWA 3DC0A 1NFPA 3M1ZA 1FUYA 3UA3A 4UR7A 1CGTA 3GNOA 4QIUA 2FGZA 2CWNA 3CTLA 3CT7A 5A6JA 4Q4SA 3LA4A 1ONXA 2FPYA 1GW9A 3U4AA 1EYWA 3OLEA 4QG8A 4HHPA 2AGKA 5D33A 1PX4A 4C7GA 4LVAA 4NX5A 1C29A 4M6UA 4W89A 2CLEA 4A29A 3E0VA 1MUWA 4UCGA 4YS1A 1W2VA 1MEHA 3TU9A 3WLJA 3UG3A 4E8GA 3IANA 4MNMA 1QNRA 4N02A 3BV7A 4IZGA 1XISA 2XGZA 5C9UA 1W1IE 1HL9A 4RDWA 3KCLA 4IWWA 2DUAA 3M5YA 4JFSA 5C55A 3NO5A 3VGBA 3C0JA 3GTXA 4PA8A 4XD4A 1V02A 3W83A 2QNEA 2DZTA 1TA3B 1V6XA 4O0KA 2Y4SA 4LGXA 3CYJA 1R9ZA 3BW2A 3QVQA 4QBXA 2V5CA 3CUJA 2ZXAA 2E5BA 4JIPA 1JRCA 2PDCA 2D20A 3EEZA 2PRMA 3CUHA 4LCRA 4DBEA 2I9UA 1EPXA 1QRQA 1J0JA 2GPTA 1HZYA 4HN8A 2Y1HA 2YA0A 4LTSA 4QJ1A 3OVRA 1PSCA 2GVYA 2W91A 1GZJA 5SWUA 1XQKA 2YDRA 4JQAA 1RH9A 2PTZA 4F0SA 3CIXA 2OGJA 4W8LA 2OZ3A 4LVBA 2HS8A 5HBFA 1C8XA 1E1CB 3VD7A 3GC5A 2HNEA 3PVFA 3HJEA 3HPSA 3WD4A 1T7LA 2OG9A 2VEIA 3W73A 4GQQA 2VD9A 1R7OA 1TPUA 5I3GA 2F2HA 3PZMA 4Z1CA 3GXIA 4QP0A 3G1SA 1V0MA 5C9RA 1YNPA 3W7DA 1LTDA 1PEZA 3BW3A 2VGGA 3AUOA 1R7AA 2ZUVA 3WSUA 3R43A 4DNMA 1G67A 4WOQA 4E8CA 4JKKA 1WXZA 5CQ1A 1KNWA 2WC4A 4IIDA 1CGXA 2J7EA 2E9MA 4V27A 2BODX 1YDYA 3LU2A 1AL7A 1GJPA 3MMTA 5HAOA 1PJ9A 3JRKA 3OA3A 3KW3A 1GORA 4MVAA 3DI1A 1HXJA 4HB7A 3AZRA 1AMKA 4M0XA 4PUKA 1JI1A 3GY1A 4PCTA 1VHCA 3LXAA 1WYIA 2WCAA 1LDCA 1Q6FA 3C8FA 1UOZA 3BDKA 1TV4A 5LXEA 4Z1YA 2GQAA 2FH6A 1UD6A 1FRBA 1BTCA 1X39A 4IOTA 6REQA 1UWQA 4D1IA 5IM51 3QKZA 1BYAA 1EDQA 1G4EA 5C2CA 4LRTA 1DWAM 3P82A 4FOUA 3PFMA 1V6VA 1Y7VA 2HXUA 2YCEA 3G3DA 3N2XA 3MWAA 4H8NA 1JCMP 1WX0A 4DVOA 5M3WA 4JQ2A 3EOUA 3CNYA 4FIRA 3F5JA 2EAWA 2FTYA 3OOQA 1GVRA 4HBKA 1EJUC 2PPGA 4C1NB 4W5UA 1RCQA 4CQAA 4D6HA 4QEEA 4GJJA 3IJQA 1DXIA 3WIJA 1LQ2A 3TFXA 1UKOA 4U5KA 1IT8A 1FWGC 1DQXA 3TYUA 3KBSA 2GJLA 2YFOA 5LHEA 4RCXA 2Y24A 1RK6A 3ARYA 4O54A 2Q3RA 5G1YA 3W27A 5FOOA 3H4WA 3P8JA 1P6WA 3AIQA 3M6YA 4FIQA 4AZIA 3BPWA 3DU0A 5PTDA 2V30A 5G4EA 4PGLA 1O7AA 3NVDA 4FOJA 4DO4A 3CT2A 3HF3A 3T44A 3OZMA 3UD6A 1CECA 3UG4A 3I7RA 4JDBA 4JHMA 5C54A 2HWGA 3VYLA 3UZJA 5C5YA 2V67A 3Q94A 2QULA 2I7GA 2NV9A 3P84A 2CNCA 3U2ZA 2FPTA 3MI6A 1ZNNA 3H2EA 3T6CA 1V03A 1PX8A 2E6FA 5AC5A 1MFUA 3QM3A 4KWSA 3AS3A 3RYSA 3LCIA 2V3EA 2Q09A 3N4FA 3C56A 3NFUA 1F4HA 1R30A 2WO5A 3S6TA 2OQLA 3LI0A 3LX9A 2WSPA 4H9YA 3SCWA 2EEXA 1EC8A 5E9XA 2R91A 4UR9A 5FF3A 1KM4A 3QOMA 3BK0A 4HZ7A 3VNDA 3IJLA 1C93A 3IPWA 3LMZA 4A2RA 4D8LA 3WBYA 2V6AA 2PCEA 2XFFA 3EXSA 3NL2A 5A6SA 1L9WA 3TA6A 2E28A 4WHBA 4PUEA 2VWSA 4RNIA 1QFEA 1EJTC 1EYEA 1G4SA 4LUJA 4ZB5A 1O95A 3UXAA 5HK4A 1VPYA 3WYZA 2Y8KA 2ZUWA 4XAFA 4IUOA 5EL1A 4CCEA 1GQKA 1LRQA 2DW7A 1I1XA 4JTQA 1VPQA 1YDNA 5AOUA 3S1UA 1ZCOA 3WFLA 3BLOA 1JZ2A 4S3DA 1B0IA 4DXXA 1OFEA 3L4VA 3O9NA 4U31A 4NZ1A 1QU4A 4Y9MA 4TV6A 4F9DA 2PU0A 1DJQA 2DVUA 1V6TA 4XIAA 4ZB0A 3REQB 1FQ0A 4ACYA 4EXQA 4AD2A 3WLSA 4B90A 8A3HA 5DBUA 4V28A 3S5OA 3NZ1A 2UWFA 3F4DA 1ZJAA 3GU2A 5H8PA 2WJZA 4J3SA 2WZEA 3AYVA 3MUZ1 3KVMA 3NQBA 3N18A 1DWFM 4J2PA 5LIWX 4OT7A 2INZA 2O7QA 1P1XA 4B4FA 4XAZA 5HINA 5DT7A 4B5TA 3E96A 1L8NA 1YXDA 1KFBA 1RY8A 1AD4A 3C4UA 2YW3A 5AC8A 2QJNA 3H7VA 3N17A 3TV8A 2B0MA 2WXDM 4K7VA 1XBYA 1J11A 2GK1A 3W6LA 4FEZA 3OEXA 4GINA 1J0KA 1SW3A 2J9XA 4RNJA 5I5RA 1QW8A 4NNAA 4AEFA 6ENLA 4OE7A 1V3IA 4UNLA 5HWJA 4CNPA 1G9HA 4PMZA 1EBHA 4W93A 3SGZA 4MUPA 4MB3A 3W1UA 3B06A 5FSDC 4IH3A 4JNZA 4IMCA 3QMSA 4H7VA 1JDEA 5DXYA 3OIHA 2JBMA 4IGMA 4XZBA 3DEQA 3I6TA 5CCZA 5EPDA 4NASA 5KTLA 3MCOA 3FHQA 4L9XA 5DO8A 1GEHA 2VRJA 2CBVA 4C7FA 1O5QA 1QI2A 3JU2A 3R8HA 4AQLA 5FL1A 4NNBA 3VIGA 3W2UA 5BROA 1JZ3A 3SCOA 3K1DA 2ABBA 2WMKA 4JL2A 2VX6A 4ZOCA 7XIMA 3RILA 1E6SM 4HA3A 1E43A 3P60A 1FWNA 2ZCGA 4UTHA 1XGDA 1DTUA 4PE8A 3VIIA 2OJPA 2GJNA 1TPFA 3H54A 2DH3A 3HFTA 3T0AA 4Q4OA 1KLZA 1FY6A 1HJQA 1PIFA 4KBXA 1GEQA 5HANA 1SZNA 2J79A 1DBTA 3OZYA 1XF0A 5JVLA 4L61A 4NZFA 3BGJA 3LCHA 4GI6A 5LNUA 1NEYA 3C8NA 1A0DA 4LANA 1AH0A 2V5DA 4DZHA 5DCBA 3TWAA 4HNVA 5I07A 3I7SA 2BB0A 3BLPX 3W6MA 1WKDA 3W7HA 2DSKA 3SCUA 3MI3A 1MQRA 1Q6RA 1V4YA 3NIYA 3K4AA 4E2BA 3VIJA 1X6UA 4GCXA 3G6LA 1JZ4A 4JQ1A 4ZFCA 1IE7C 5LNRA 2QVHA 4IJRA 3PTQA 2IW0A 3KX6A 5CPLA 3POHA 1TTPA 3QGKC 1E4MM 1HKIA 3S2CA 3TSMA 3N13A 1ZP3A 1F73A 1H3GA 1UD2A 1J12A 4WUIA 3LM7A 2VQTA 1XICA 1SPQA 4JYEA 1AQHA 5FJTA 1RCOB 5A6BD 4CQ8A 1WZMA 2OSWA 3FOKA 2YIHA 1SMAA 4D8ZA 2WAGA 5M2FX 4KWUA 4LV9A 1HG3A 3CAWA 1YPXA 2DU2A 3W1QA 3BSGA 4C6EA 2ZRYA 3JZUA 1WO2A 1XLEA 2D23A 4MF4A 1FWDC 3WNKA 5JBEA 2BOEX 3HM7A 4GFSA 2ZA1A 4AUBA 3GTNA 2XH4A 4MG4A 2YBUA 4US6A 1IWPA 1E4LA 4FF5A 3KRSA 3W53A 3UJ2A 1J93A 5T9BG 5DMMA 4GLEA 2HZGA 3W7MA 2HBVA 1FVPA 1F3WA 3UXDA 3SCVA 1W54A 4DZIA 3F2CA 3O07A 3UVIA 1QNVA 1E0XA 3NL6A 5E5CA 3PBGA 1H11A 3RGTA 3TJXA 3LMYA 1EX5A 5LIUX 4D1JA 1C9DA 4HGXA 3WFZA 4MWAE 5CBBA 4H9MA 1TJ0A 3M0XA 1HKWA 2RGLA 1H1NA 1E72M 1G4PA 4Y2WA 3UXIA 3HO8A 3CWHA 1K9DA 3NQAA 1NM9A 1W37A 3EKGA 4XO6A 2HBXA 1YPFA 4WY0B 3LGEA 3NOEA 1XRFA 4ADTA 2ZZ6A 4RK8A 1HJUA 5BWFA 4F8XA 1IGWA 4ACZA 3KWSA 2P76A 3H7UA 1QHZA 2RH9A 4F0MA 3EDFA 4MNKA 3H12A 2VFHA 2Y7GA 4XTIA 5CGQA 2Y88A 1E56A 3LV5A 2PS2A 1F8IA 2PTWA 4FR1A 1OEPA 1W31A 4YL2A 5KSWA 2HK0A 4O0QA 3TQKA 1UC5A 2OSYA 3WEOA 4CEXC 3B8TA 2X7WA 4IPNB 1XH1A 1W6TA 1J01A 4D71A 2WQDA 3LI1A 2DH2A 1ONRA 5KZ6A 3MUAA 1X1ZA 1R9YA 1OADA 3QEZA 3NM1A 3GFYA 3W28A 4HNLA 1VFTA 2PSNA 3MKVA 4N0RA 5CSRA 1H5VA 1E1EA 2BNJA 4MAZA 4XB3A 4TMBA 1UJQA 1KTBA 2QEZA 5FEZA 3MP3A 2OLAA 4RE0A 4CNSA 1H7RA 1YBQB 3UP8A 2WV8A 2OTDA 3MHFA 1QNOA 1UOKA 1IEXA 1C8QA 3K8MA 3CB3A 2XVGA 5HA7A 1XGZA 3S6DA 1JZ6A 3DECA 5AVHA 4HK7A 5CPOA 1E6PA 2BX7A 3RF9A 5CPMA 3VC6A 3FKRA 1K1DA 4FALA 3L7RA 1LG2A 3BWWA 3ELFA 2YR1A 4I7UA 3MVIA 3XINA 5JIPA 3GG0A 4IGHA 4CLMA 4DELA 1TTIA 3RG6A 5GVJA 4PH6A 5CC3A 5JMUA 3W07A 4O52A 1XC4A 5EMJA 3B8IA 1J4EA 2HVMA 1OSEA 2CU0A 1U5VA 1U22A 3QF0A 3H70A 3UWEA 1H7OA 2WSQA 3O16A 4C6NA 4DO6A 1L0PA 4XG1A 2V0TA 2GDVA 4O19A 4ZSUA 1UKPA 5D2WA 1TKKA 1RPKA 3AIEA 3TQPA 1R85A 3W7QA 2VX4A 3BAJA 1EIBA 2NZLA 4D9PA 1X6NA 5A6TC 1QUMA 4W8BA 2YXGA 1VFMA 3WL0A 1XUUA 3VGEA 3WUEA 4H6RA 1G5AA 4QE5A 1ITCA 4FLQA 3W1NA 3GKFA 2X0YA 4DJFA 1ZU8A 5BXPA 1R46A 2V9DA 3RPDA 5A1AA 3QJAA 1G6CA 2VZSA 1Q6LA 4LBRA 2WVVA 5EYWA 3P61A 3V1PA 3N73A 2CBJA 4JN6A 1RBLA 1UYQA 1I6NA 4DF1A 2Y70A 1J0YA 1ISZA 1CPUA 1KWGA 2POTA 1QDSA 3BCFA 4TO8A 2QJJA 1LRNA 1ESWA 2BHUA 2QW5A 2A1YA 4XIMA 2R94A 4JTDA 3V36A 4HPNA 1PZ2A 3EWYA 2QJGA 3O6AA 1S2VA 4MZ8A 3V0SA 2GGJA 4IFKA 4XK2A 2G8ZA 3GHSA 2E1DA 4TX8A 3QV7A 4HT3A 1SM9A 1CGUA 3TTSA 3WNMA 1FDZA 4KWVA 1KTCA 1ADOA 1EGMA 4UOQA 2FFIA 4J35A 4HVXA 3S1GA 3M07A 2X05A 4L4MA 4IPIA 4CQ9A 1TV7A 1JCYA 4HU3A 1GZGA 3HIJA 1LQ0A 1ONEA 1UWTA 3EZ4A 3ANUA 1T40A 1JF6A 3KVKA 3FHAA 3MY9A 2BV9A 2VJXA 2DSZA 1NAL1 2ZRUA 4DM1A 2BVTA 4PL1A 1R3TA 4UQDA 3NYDA 4LC8A 4WF7A 2E7FA 3AYSA 4CD8A 2J74A 4A2SA 1EF2A 2NW0A 3TVAA 1J5SA 1G0CA 4DF0A 2C7FA 2C1GA 2RHGA 4ZL1A 4C6CA 2AAAA 1MXGA 4DF2A 2XYLA 4NRSA 5C7HA 3DGBA 3MZ2A 4ZSTA 3CL8A 4X61A 1Z8AA 2DJLA 1OCQA 4RX0A 4CVUA 4GIYA 3W1XA 1C9WA 3U7BA 2YL9A 3PR2A 4YHEA 2GQ9A 2J47A 1RCXB 3ALFA 3B8DA 1PKMA 4QE1A 3W7EA 1QPQA 1EHAA 3P67A 1I2QA 3V0UA 1JCTA 1FKXA 1HN1A 4FO4A 4I9JA 4Y96A 4UFJA 4AZ5A 1XS2A 1R8LA 3B9NA 1O1ZA 3QR0A 2X40A 2UY4A 2FZMA 3EDEA 1L2UA 1KBJA 3A24A 1TVPA 3TDFA 3EBVA 4GUHA 4GVIA 2BS9A 3S4TA 2FKPA 5CC5A 1A53A 2G3IA 1PO9A 4DWSD 4G2DA 1GNXA 4NKCA 1I2OA 3UPMA 1GVQA 4O13A 4PUWA 3WK1A 3ITYA 3GTFA 3VC5A 1OX4B 5D09A 2WKGA 3QHMA 4IX2A 4UTUA 2OR2A 1RQBA 7REQB 3QLDA 3ZLGA 2FGLA 3N6QA 4GI8A 3WJSA 2F61A 1ICPA 2ACSA 1CB2A 1K4GA 4S3BA 4LAKA 4JTCA 1FHLA 6XIAA 4EF8A 3GDLA 2A79A 3B4YA 4F2UA 4IXXA 1XC6A 1ZL1A 1FH7A 2RDTA 3EA1A 3WLHA 3QFEA 1W0MA 2E5CA 1S5TA 4QDWA 4O57A 4JX6A 5E0KA 3PB0A 3Q67A 5FF2A 3VIHA 1PHQA 1XR2A 3WQGA 5ECUA 3BMVA 1D7KA 2Z7GA 1VBJA 3GR8A 5LSMA 3SUVA 4PRWA 5D38A 3K13A 1A47A 3E0WA 2BLEA 3IUHA 3IEBA 2TPSA 2C8NA 1IV8A 1ZJBA 4JIRA 1GG0A 3RX2A 3HTWA 1F74A 1ISWA 3USZA 3B9DA 2VDHA 2FFCA 4WDXA 4AEEA 1VFFA 4R88A 4HJFA 4X2PA 4DJFD 3P62A 1SFSA 4X0NA 3AI0A 3PJUA 4H6EA 3AQUA 1K3UA 3DN5A 3KCJA 1SGJA 3N9RA 3DKLA 1T6MA 3HPZA 1IIGA 3EA3A 1A5UA 4XZNX 1P43A 3TKFA 4XZWA 1TZZA 1H61A 2YBVA 4GO8A 5AECA 2X0HA 4LH8A 3R89A 1AUSL 4GYPA 3BAKA 3AHYA 4HTYA 3P0WA 1RLCL 4AF0A 4Z17A 3SR7A 1OY0A 3LDVA 3OZPA 4U10A 1FFRA 4FNQA 3MB9A 3UJFA 4QS5A 2WVUA 1NDYA 2E25A 4FPSA 5CZTA 4M81A 1S2CA 1NIUA 4X9SA 1FFQA 2YDSA 3TA9A 4X3ZA 4HCHA 4YCPA 2NX3A 1A50A 1ME7A 2YBTA 5HWMA 5H8MA 4OOUA 3VOHA 3WF4A 1E40A 4DO5A 1E5NA 3LS9A 3HV9A 5GNXA 1KV5A 4TMCA 1SFLA 1WXYA 1JDFA 2XN0A 2PD5A 2RDWA 5D9MA 4LS0A 3EOLA 4YVPA 3H53A 5LNWA 1H5YA 1T5AA 3L4YA 3K4WA 2DW6A 4N6EA 4I5UA 2FB3A 1W3NA 4AD1A 3GDTA 1P4CA 1K02A 4LAUA 3IGUA 4QRNA 4MJMA 2FJUB 2ZUUA 1X1NA 5AZ1A 3FDKA 2J7CA 1TVLA 4JR5A 1VYSX 1D9EA 1MNZA 1W1YA 4LAOA 4O1BA 2XN1A 3DH7A 2ISDA 1XSKA 4PFMA 4RL3A 1GZ1A 2NQZA 4BWLA 4BF7A 3MC5A 4K1GA 1Z69A 1A5OC 2WB5A 4M1RA 2YB1A 1WBHA 2P10A 3AROA 1T0OA 3WLPA 2WWCA 2VT0A 4KS0A 2EKCA 2GYIA 4P8UA 3H22A 4OGZA 3U6WA 3GXFA 3PB2A 1OWQA 5L9FA 4DJED 4EX4A 4AD0A 1VR6A 2D3LA 3B04A 5DRCA 1GYLA 4JX4A 2HVNA 4RJEA 1NWTA 3VVGA 2WZMA 1L6YA 1A3HA 3EKZA 5AB3A 4Z2LA 1V79A 2NXGA 3MO7A 5BNKA 1W5QA 4BQ4A 3D3AA 4I9AA 1TPH1 2YYUA 3SFKA 4DBDA 1DORA 1FKWA 1LM1A 2IQDA 1KB3A 4IL0A 5F2LA 2GVLA 3OB8A 2ZXBA 3TW9A 3UPWA 4GFIA 3MSRA 5CJ5A 3NL5A 3ZXWA 3KWXA 5KZDA 1J8VA 1AZ2A 2VC5A 3PUGA 3PSVA 3A22A 4TIMA 2FMNA 4YMZA 1MXDA 4QM1A 3NSMA 2E9LA 1JL8A 1FCUA 3W1LA 5A8GA 1UWIA 2EQDA 2ZWYA 3TTYA 4ZBCA 1B31A 1T8XA 2WNQA 4AZCA 3TC7A 3W2NA 3QGVA 4BQ2A 4ZQMA 2VR5A 4IPPA 2B7OA 1ECQA 8XIMA 4IXHA 3AJXA 3BGGA 5CSSA 2ZBTA 4UC5A 2P1FA 4RDYA 3FLUA 1XPGA 3G0XA 4TR9A 2YW4A 3AS1A 1IXQA 1U1HA 4AWUA 5FJRA 1D3HA 1E9IA 1GWJA 2XISA 3N19B 4Q8OA 4DUWA 1XIIA 1TFVA 1XRSA 4PRTA 4W85A 3I65A 1GOWA 4Q8NA 3EDKA 4I8DA 1LL7A 4F0RA 1X96A 2L5HA 4F79A 4MGGA 5C9WA 5AHNA 4P5UA 4UQEA 4GQRA 4MY8A 3LHTA 3EEGA 1HGWA 1MW0A 4MYAA 4P8VA 3PPHA 4PTMA 5E09A 4KH2A 3GZAA 1JF5A 1ICSA 4QE4A 4UOZA 3CAVA 4XZHA 1EEPA 4ML4A 3COTA 7TAAA 2GVJA 4H6KA 3PZGA 2NWSA 4M80A 4J3XA 5G2IA 3P14A 4JIQA 2W62A 4K36A 4A8IA 5K4ZA 1KO0A 1DE6A 3H2OA 2OYKA 3AALA 4CKQA 4Q6JA 4AD5A 2Z28A 5IDIA 1YE4A 2AL1A 6TIMA 3FFSA 4KGJA 3ZSTA 4QJ3B 2XWDA 2X1SA 4LAZA 4YU1A 5BWAA 2VELA 2R24A 2IXUA 2XVLA 2G5WA 1E70M 3QW4B 1GOXA 3MCNA 3TIMA 3RN6A 1K9TA 1S1RA 4P7RA 2VMFA 2ZDSA 3S5ZA 3R58A 3H2MA 1S5MA 3VKKA 1E6XM 2QCNA 1F76A 1KGWA 3STGA 2DVXA 4LBSA 1BVWA 3VIFA 4NL1A 4O17A 1Q45A 4S38A 3MTWA 1EP1A 4I6VA 1K77A 1TWIA 2EXOA 3AHVA 3UFYA 3K8KA 4AYGA 2RUSA 3L67A 2E77A 4L64A 1OFPA 4REQB 2IKJA 3BVJA 4R85A 1V77A 2D0HA 1E6ZA 1CB7B 1R2TA 3QTGA 1U33A 4NJHA 3LCXA 3GHUA 1GPFA 3W1PA 2JE8A 3ARPA 4MUZA 3GRIA 3TXVA 4JTLA 3LSCA 3CLMA 2P5NA 4R3UA 1EOKA 1UJPA 3RMJA 1ISVA 4U3CA 5MKGA 3CS2A 4HHHA 4NILA 4OUIA 1HJWA 1XCXA 2W66A 5IFPA 1GQNA 4MPQA 3H2FA 2ONEA 2PWGA 3UGRA 5U4NA 1JI2A 2QIIA 5LZLA 3VKAA 1XFBA 5FEXA 2OEKA 4OKDA 3N04A 1LWJA 4BI5A 4K2SA 1S2TA 3HQNA 4TOQA 1P7TB 1VRDA 3CO8A 1RBOB 1REQA 2R8WA 3ARXA 1GOOA 4O8RA 4LEQA 4P8XA 4IUGA 3AHTA 1RVKA 1V7YA 3GXTA 1JJKA 2OX4A 3PBUA 2NV2A 1N8WA 2CITA 2VGFA 5DMYA 4NXSA 1IT7A 3VOCA 3ARZA 1OZQA 3A5VA 4EPDC 1EZWA 5C7VA 1OT2A 1QATA 1F05A 4LVFA 3WBAA 3QR1A 4Z2KA 1JPHA 3ZFHA 3T07A 2AQWA 2QCDA 4A35A 4JD4A 3H4XA 1Q6GA 3TNOA 3VDHA 5ABFB 2V5JA 3M41A 1S5WA 4X63A 1GQLA 2V63A 1D8CA 3S2LA 4I8YA 4BK9A 1CI1A 1JPDX 4JEQA 1LP6A 4GYFA 1MEIA 1A5KC 3DFTA 4WY0F 4HOZA 1GVFA 4PCPA 1FDJA 3LENA 2CLHA 4JTKA 1A5BA 2B7QA 2HCVA 1ONWA 3K1GA 1S3HA 2PDIA 4MZYA 3MJYA 4KMQA 2PD9A 2WJFA 3U48A 4EXAA 3OP2A 3GBDA 3QY6A 1G1YA 1TZ9A 2DZWA 3AMGA 3UT0A 4UIOA 3GKAA 3LQLA 4OWGA 2NVCA 5A8MA 5JIWA 3CH9A 4HNOA 4DAIA 1PCWA 1RAKA 2J77A 1H50A 1A80A 2D2HA 1MW2A 3EWBX 2HISA 5AZ0A 4IHCA 1LWHA 3WJXA 1XLHA 4HHLA 2IPJA 2PC4A 5CJMA 4BWLC 4GX9A 4KEUA 4AZ6A 3ZJ8A 3ZT7A 3RR4A 1XSIA 2PDNA 3H2CA 1KBIA 4Q4PA 7TIMA 4N7QA 1A5MC 1A5SA 1VJZA 3SCSA 1JYVA 4O12A 3VOIA 3T8LA 3UW6A 2VX7A 4O18A 2PDJA 3ORWA 1H60A 4WX2A 3PZUA 3EXTA 3SECA 4M8UA 4GY1A 1CCWB 1NF0A 4JTHA 1NH6A 1OF8A 4NSBA 5GJPA 4DHGA 1WUEA 5I03A 2J7BA 3BL3A 4HZMA 3GIPA 4PCSA 3QBUA 3KOZA 3W88A 4M6QA 3P8IA 4OZOA 1GVEA 4JTJA 5IBXA 1ISXA 1W5NA 3EA2A 3GFZA 5CGMA 3MSGA 3DUGA 1KXHA 1QW7A 3LLDA 3WD0A 5HDRA 3SSJA 4B3KA 3CGTA 3GC4A 3NZGA 4OOZA 1JCJA 4B5SA 5AN7A 2XN2A 3K30A 3VD5A 1B9ZA 1QNQA 3Q37A 4IG2B 3TX9A 1J18A 3V35A 1SMDA 3OG3A 3TLQA 3FJ4A 1I0DA 3QY7A 1S5NA 1DXEA 2EJAA 2CLFA 2Y7EA 1QI4A 2QV4A 5A2CA 3S0CA 5F2GA 5KZMA 3UA4A 3VGDA 1R38A 1US3A 3E1F1 3TWBA 3L4XA 1W9DM 3RPTA 4BZYA 2GGHA 2Z1BA 5KMYA 1QHOA 3T0DA 1BFNA 2ACRA 2BSLA 3S5NA 2EHHA 3MHUA 1R9XA 1JYWA 1ZBVA 3MSDA 3JR2A 4X9YA 1A3XA 4GUJA 4DO7A 1BGAA 3DOPA 3NQVA 4WK9A 1TE6A 3NUKA 4HU0A 4IQLA 3S9ZA 2XSAA 3PF3A 4QCFA 5JH1A 3VNKA 3SUUA 3HPXA 4HMEA 4V1YA 2KAUC 4Q7BA 3FYOA 4ZO8A 4GI9A 3V0TA 1IZCA 5HR7A 3WBWA 3UWUA 3SCNA 3NPXA 3ARRA 3N6HA 1OCJA 3A3XA 1FHDA 1H7PA 2A7NA 2X1RA 4AZCB 1L6GA 4LY4A 3RMEA 4K68A 3TAOA 3A23A 1TMHA 1ADSA 4CU8A 4HK5A 4IFOA 4QITA 2O4MA 3LTPA 2YX0A 3GYEA 1GVYA 1I1WA 4L9ZA 3E12A 3CMJA 3RO6A 1VFOA 3HFYA 3GUGA 4DYKA 1GYNA 4GVGA 4H8HA 2G97A 1OFRA 4Z2GA 5AHFA 4YNGA 3FVMA 4AU0A 5D02A 2F9RA 1UUOA 3G1RA 1TPB1 1I45A 1N7KA 3M0VA 3PNUA 4OU1A 3DFOA 3SY8A 4Q8TA 4BR1A 3RXZA 2HEJA 1OGBA 2WMJA 5A2BA 3C86A 4WSHA 2X42A 4MKSA 3WQVA 4ROPA 2V82A 1FP9A 2PUZA 3H7RA 3KRBA 4AX6A 2IPWA 3IVUA 1OD0A 1XLDA 4JFWA 2O0TA 4ZCWA 1WDRA 2Z24A 3S46A 4JTUA 1N2VA 3TAKA 3R8GA 5T26A 2PDLA 1Q7MA 3CHEA 1VGAA 1K70A 1XBXA 2WMFA 3KEHA 5HMEA 1Q66A 2C1IA 2XU2A 3W38A 4GE8A 1POJA 3HG3A 1BRLA 3M7SA 3QQWA 5I23A 1TWWA 4P7OA 4S3FA 1EIXA 3C6CA 4AMCA 5KINA 4B4HA 1DPMA 1PV8A 2C16A 3ITXA 4LJ3A 9XIAA 4HYRA 4ALDA 3VOFA 3WH7A 3I3DA 1KFWA 1OFDA 2V2CA 3C0LA 4KEMA 2ZVIA 4YTUA 3C0QA 4G8TA 1HGYA 5HPCA 4W7UA 2OMAA 1K6WA 2QHAA 3UR7A 1LBFA 2NLIA 2VR2A 3PK7A 1ICQA 3H8AA 1V0KA 5DF0A 4LB3A 3F4VA 4XAGA 3KBJA 3SGUA 2Y8UA 1K7XA 4UTMA 2V5LA 3CWNA 3GVWA 1C7TA 4ONVA 1UWUA 1HO1A 1ITUA 2Y62A 3D47A 3HV8A 3KS6A 4LXFA 2IMRA 2GWNA 1CXHA 1WPCA 2O7SA 5BRPA 3TOYA 4K1WA 3W74A 5A8OA 4GIAA 2F2KA 4POCA 2OX1A 4AX7A 4AISA 4B3ZA 3LBCA 2A5HA 4ZFMA 1KD0A 5KZEA 2DGAA 4JTAA 4ROQA 1XP3A 3GIYA 4AVNA 2DP3A 5L6UA 3UWYA 3CV6A 1Q8JA 3WD3A 4XD5A 4BF5A 1VJSA 5CXPA 5A69A 4RPPA 2XPKA 4UTIA 5FJIA 1SZGA 2E0PA 2PDWA 1AQ0A 3THUA 1K7EA 5K4XA 3IV3A 2CEQA 1Q6CA 4ORMA 2ZA3A 4AB4A 1E5JA 4G7EA 3R79A 1YRRA 3SCQA 1SSGA 1UB3A 2Y5SA 4TVDA 2V3GA 4QXIA 3CAKA 2PAJA 2WK2A 4LUTB 4U33A 2ZKMX 3ABZA 3VINA 5BRQA 4F40A 2ZDRA 1MZHA 2GSJA 4H9ZA 4RR4A 1RVGA 2SFPA 2VO5A 1A5AA 1Z42A 3ISIX 5D32A 1N8FA 3WQCA 3CUXA 3PWGA 2BY2A 1LLWA 1UPPA 1CXFA 2JEQA 5D9NA 1CIUA 3L0NA 4HPJA 2VFFA 3THCA 3SY5A 4ENLA 2PWEA 5BMWA 3RHGA 3TYAA 1DE5A 2CWXA 2OO6A 3E74A 3BGAA 2CLKA 2XGBA 4ZE4A 4NAEB 4J40A 3TEVA 3BMXA 3DZ1A 4DZAA 3MU7A 1XIJA 5HATA 1E6RA 2PODA 3LNPA 1CXLA 1UKTA 1XIEA 2YCIX 1AD1A 4HKPA 3LYEA 4QSHA 1F6KA 1IWAA 1SR9A 5GJNA 4GUFA 1DJWA 3RLUA 3GTHA 1OHLA 5BOOA 5LIYX 4NZ5A 2JIWA 2QUNA 1ZZMA 4H19A 1O4UA 3RCMA 1KW1A 1Q7QA 2YZ5A 3IIXA 3SUWA 2X16A 3E9AA 3CQ0A 3SM0A 3LHUA 1ENUA 3AYTA 2ZQ0A 1EPVA 2GOUA 3BJTA 3L0KA 4LWWA 4WIWA 1V51A 3U2OA 3G1DA 3DFSA 5FAGA 5FACA 4XBKA 5AC7A 2D22A 3VTRA 1UC4A 3AWNA 1JUEA 4ZQCA 2CFFA 3IVSA 3VZXA 3DHPA 1OX5A 3TJ4A 2EPMX 3TYDA 1JNEA 4S39A 1DJNA 2DQXA 3AHZA 4QS6A 1VFUA 3C2VA 4LCQA 1W5OA 3E0FA 1WXJA 2R82A 4FP1A 3WQWA 3KRUA 3BCDA 3WQ4A 1ZS2A 2CLOA 1QOPA 3WLMA 4NIRA 3KBMA 2WBKA 3N2MA 1UW9A 3SB0A 3F4CA 1V8EA 2QCLA 4R34A 5DQPA 3M9YA 3P93A 1V0NA 2MUCA 2HPIA 2Q8ZA 3G1YA 4EVZA 4IGNA 1QPKA 2Y85A 1WOBA 1MO0A 3G5EA 4FI4A 2DZSA 1H62A 2YB4A 4Z0SA 3W2KA 3S1WA 4XAYA 2PDUA 1CTNA 1XDJA 2DJXA 3SN1A 4AVFA 5I79A 2J66A 4I3GA 3WQ8A 2BP1A 4N4PA 4DYJA 1DEDA 5D04C 3S42A 1XG4A 3JZEA 5H2ZA 4DN1A 3K2GA 3KHDA 1PE1A 3AXXA 3WO8A 2PLCA 3WH9A 3ABXA 4HZ6A 3B0YA 4WXYA 2P50A 4LUTA 2VUNA 4JY8A 4FMVA 1FWCC 3GXNA 3O06A 2XWEA 5XIMA 3J7HA 1OGSA 2QDEA 3VCNA 4YTRA 2GFTA 1RP9A 4UFHA 5I2UA 3BICA 4PULA 1JZ5A 2XG9A 4H3DA 2V3DA 3P6LA 3D5HA 3PC0A 5EMLA 2X1TA 1GOQA 3ANYA 2I57A 3AC0A 5CSYA 4J5NA 3UWWA 1RA0A 2YDQA 5I7GA 1QPNA 3NDOA 3ZVHB 3I4KA 1EJ7L 3NQMA 2PDQA 1VQTA 3L4TA 2X0SA 3DHFA 3W81A 2FVLA 3EAUA 3PUOA 4OV4A 3DC8A 1NDWA 1UMYA 3O6YX 1GQJA 4XSMA 4FNTA 3UZ5A 1XDMA 1V7AA 4Q8MA 4E4UA 1KM1A 1NOWA 2DEPA 3VCRA 1AODA 2VZOA 4GX8A 4JAWA 1OCNA 3T2OA 3WJZA 3W24A 5CEWA 3KDNA 2F7FA 3PTMA 2A3CA 4LOCA 1FXPA 1SFJA 2WKLA 3FEQA 3L2IA 1EDGA 5HNUA 3W7IA 4B16A 3WLIA 5CZSA 4IICA 2C6QA 1H1ZA 1OK6A 2BZNA 1BYDA 5EMYA 5ABEA 1EWDA 1V3HA 1ZHAA 1BQCA 4DI8A 4KCTA 3IV8A 2A3AA 1I4NA 4CEUC 3AXIA 4DI9A 4L4OA 2D0GA 4M6PA 3KOYA 2Y7FA 3ID7A 4JQ3A 1OB0A 1NARA 2VWTA 1T8QA 1B90A 4C7DA 4K8GA 1R3RA 4GVFA 3B8UA 1EEXA 3DAQA 3FYYA 3QQ1A 1EA9C 1LL6A 3E2RA 2IPFA 5FESA 3W7NA 2DORA 3WENA 3OLDA 3P81A 4FXSA 3F4NA 1M6JA 3EB2A 1FWFC 2ANUA 4AH7A 5I0DA 1REQB 2CZ5A 2H3BA 1W91A 4U2YA 1Z9AA 1K7FA 3MDUA 3QR3A 2WLZA 3LZ3A 1WKEA 2OKOA 1XHGA 3CASA 3ITGA 5FSEC 1HJXA 3HPAA 2WHMA 4MZ1A 4B5NA 2QMKA 5I3IA 1JULA 4DUVA 1YTDA 3VPLA 2CHNA 4ZZ9A 2CLIA 4JIEA 1X98A 3VFLA 3VMPA 2J7HA 1BXBA 5BYWA 3WNLA 3KHJA 3VKDA 4NY2A 1U1UA 1BSLA 3BO9A 3APTA 2QDHA 4UQCA 4P7LA 4CD7A 3HBLA 1YYAA 3STPA 4LV4A 3VX1A 2XSXA 2PURA 3VCCA 3DFPA 3G8RA 3LTSA 4INFA 3VU2A 4GGBA 4H01A 1VS1A 1X7IA 2HQAA 3L2MA 3Q45A 1R3WA 1EC7A 2YFNA 5FL0A 1DIOA 3CB8A 4IIBA 3MWCA 1PUDA 1EO5A 2CXGA 4J3ZA 3CMGA 3CO4A 4HPGA 2GJXA 3QQ0A 1QT1A 3OG2A 1U5HA 2QCGA 1SW7A 4K6AA 2C91A 1MZRA 1J9YA 1MQQA 3RLVA 2PZ0A 2E9BA 4MYXA 3TZFA 2OODA 1NDZA 4AYSA 3NR0A 1LQAA 1M9HA 3GDBA 4MWAB 3VOJA 7PTDA 3KLKA 2AOSA 3QPZA 1W3TA 3NTYA 1QO5A 3N12A 3RCNA 1I0BA 3GX9A 4GBUA 1XYLA 3O3RA 3FEMA 1PZ1A 3ZT5A 1QBBA 3NGFA 3W02A 1XBZA 2IKHA 4V33A 3PWIA 3MI2A 1S5VA 1I8JA 3IJ9A 5JUVA 3A3HA 1GOMA 1DWHM 1TPWA 3W26A 4BI7A 4JTEA 4LNYA 4ZOEA 3NQCA 1P0BA 1XRVA 2QDDA 4ICCX 2X09A 3HMCA 3W70A 3B9OA 3E2VA 2EPLX 2G96A 3FXYA 4JGDA 2HNHA 2RAGA 3QZAA 4PRRA 1XI3A 3W00A 4YJ5A 5EGRA 3E49A 1FBAA 2FHBA 3CZ8A 2QR6A 3S5SA 4NU7A 1XYZA 2B81A 4GHRA 4NJJA 4PL2A 3LHZA 4FNPA 1XYAA 4CQBA 3W7PA 2ESCA 2NVDA 2OYLA 1W1PA 5E70A 1PTDA 2PDMA 3N3MA 4PZVA 5CG7A 1GT8A 3N14A 1JQXA 3GH4A 2XTKA 1E73M 5AC6A 1H4PA 1PX3A 5LGXA 2F84A 4IMDA 3H2NA 2E1WA 1RA5A 4JCLA 2A6LA 3FW6A 1PWLA 1GKQA 4C6DA 3H2AA 2RKXA 3VD9A 1K8CA 2DZVA 3DHDA 2QV5A 5HQMA 2O56A 3MV11 1IT0A 3ARWA 3L23A 2IKIA 3KZPA 1B3VA 3IJ8A 1GKPA 3ENLA 4K39A 3GO2A 4D6IA 3BSMA 3EWUA 3FY1A 1UHVA 1JYXA 1PCKA 1F6YA 1PZ0A 5EMUA 3SFWA 1LL4A 1X38A 4GY0A 2G37A 4M1BA 5GJMA 4UQAA 1KV8A 1FWIC 2VEPA 3OLIA 1WE5A 4PB3A 4QDMA 3DESA 2FGBA 1TV3A 4TX6A 1TPEA 4PEKA 3GG7A 4F4RA 3HG4A 2DUZA 1VHNA 2VFGA 4QROA 5A8QA 4FX8A 3KE0A 2I56A 4J27A 4YIWA 3F2BA 2A21A 3KRZA 3ONCA 1B5TA 4NHVA 4WDTA 4DYEA 4F48A 3GG1A 5HMFA 4CNTA 3CZKA 2NWRA 4AC7C 4IP7A 4QSFA 1XH0A 3QKEA 1U1JA 1JIBA 3O0FA 1RSCA 5GPRA 3MUY1 3OIXA 8TIMA 4N9DA 3APYA 5FA5A 4AEOA 1HT6A 1FWBC 4HOXA 3MKCA 1TR9A 4IMGA 4W88A 3ITOA 2BXZA 3IGSA 1UA3A 2ZZ7A 2TRSA 2DFAA 1G94A 3VDAA 1J10A 3BOLA 2D24A 4RUBA 2ZWZA 2EGZA 3SGGA 1EJWC 3BG5A 1MVYA 4ZOBA 2Y61A 2X41A 1FTXA 5A5WA 5K9CA 3S1VA 4PMOA 4Q7NA 4GWEA 2FHFA 4O14A 3K4DA 3WUFA 4F66A 2C19A 2ZTJA 2ZC1A 5MHBA 2J9YA 3NO1A 2IQTA 2OOGA 2PDBA 2VCAA 1OINA 5CLWA 2YGYA 1GOKA 3PBYA 3RU8X 1W3KA 2VI0A 3NQFA 2ALDA 2VD8A 4DJDD 1US2A 2VXNA 3BLEA 4ZGYA 3SJNA 2VC6A 2FPVA 3LD5A 2C15A 4US5A 5ABTA 5D2YA 3OQ8A 3A13A 4XAPA 4KT2A 3S6OA 3GB6A 1UD3A 3M0IA 1F07A 3KL0A 5REQA 2PA6A 3BH4A 1YHTA 4QHRA 2E5DA 1VENA 4WJXA 3L21A 2G3JA 3AWOA 3IARA 3CUGA 1G01A 3GUWA 3TN5A 4W7WA 4JL1A 1K8YA 4M5PA 2AQOA 3MP4A 3ZQ9A 1OZMA 2DIEA 2VGBA 4J7RA 2VFEA 1NQ6A 3T40A 2JF6A 1BWLA 2J7DA 4MFDA 4NJIA 3GLCA 4DXVA 4LC6A 4HU4A 4PSPA 4CGTA 2AQVA 2PDFA 2J8TA 3NQGA 3CHDA 3A5FA 4OV9A 1XD0A 2QCDB 2XM1A 1WCGA 1ODZA 4NG3A 4NF7A 3DI0A 3LXBA 4KF1A 5H6HA 3P5ZA 5GQBA 3AIVA 1JFHA 5H8UA 1AA1B 3NG3A 4HIBA 1HFBA 4OJYA 2VR4A 4MMWA 4GG9A 2QJIA 5FJPA 2WM1A 1TWSA 2VFIA 2OYMA 1VJIA 1SUXA 5CG0A 2O9TA 3DBNA 1Q2RA 1OGGA 4AD4A 3BUVA 1OFBA 2YPIA 1VC4A 2ZX5A 4KRZA 3T55A 3WL1A 2QYGA 1DJZA 4TVUA 1JD7A 3R94A 4G7EB 5B7ZA 5CPQA 1ZSXA 4WGHA 2INFA 3LPGA 4GGHA 4J3UA 3THQA 1HO4A 4IG2A 2FZBA 1PPIA 3KOWA 3GDRA 3MVTA 3W75A 1EGVA 3GD6A 2A3EA 3W29A 2FDMA 3N29A 3W37A 1CENA 4FNUA 2HV5A 2JFEX 4LUIA 1SU5A 3QGAC 3CUFA 3PTDA 3L12A 1EJRC 3NM3A 3LK6A 1JZ7A 4BA0A 2G0WA 3WBXA 3GVQA 2NX1A 3CM4A 2DSWA 3OVQA 4IL2A 3HURA 3I10A 1IXNA 4RE3A 2R1NA 4E6MA 4RPQA 3GNNA 2ZE3A 1TVNA 4H1ZA 4LVDA 1XIHA 1LZOA 5DBTA 1HF6A 1DKWA 4JNMA 1XIFA 3UJSA 3VILA 1TB3A 2ZUSA 1YDVA 3M6DA 1SJBA 1HVXA 2P8BA 3EDJA 2PEVA 4QQ3A 4QGCA 3BLFA 1AFSA 4JTIA 4LYPA 4LRSA 1W9VA 2YXXA 2WNZA 2BDQA 2BOFX 2CZFA 3ZS4A 5CJNA 3WBEA 3V18A 1FXQA 1LJYA 5BRBA 3WQPA 4YN5A 3BLIA 3WKZA 1ZLPA 4EANA 1WZKA 2BHYA 2CXEA 4C6PA 4E3VA 3TR2A 4B5VA 3BAWA 3C5QA 1FA2A 2DT3A 2FLIA 4JHOA 5F4WA 9CGTA 4DX3A 5I3JA 4D6DA 4E4FA 2PRLA 1CLKA 1WDWA 1ZRQA 3W2MA 1KM3A 1CWYA 3VM7A 1R3SA 2CBIA 4ERAA 1VIZA 2Y0FA 3K46A 3KOFA 4AHQA 3L4UA 3CAQA 2VVSA 2X30A 1NELA 2J75A 3N4EA 3WMBA 1YDOA 3VGGA 1V02E 4WY0A 1JFXA 2VDGA 3RM9A 3W7OA 3WH6A 3WQ5A 4GO9A 4RNHA 2E3ZA 2V3FA 4DLFA 3PSWA 1O60A 5DFAA 3GNRA 2W9MA 2XJ7A 3TW7A 3WG6A 1XDLA 5CPTA 3G1XA 1DJHA 3TW6A 1F2JA 3H23A 4IIGA 2PZNA 1MYRA 4GBDA 4HMNA 4NX0A 1M41A 4S2CA 4MIMA 1CW2A 2PWDA 4PSRA 4W86A 5E6YA 5FF4A 4JTTA 1EKOA 5EFFA 3V5OA 3TMLA 1UR0A 5HNTA 3AMDA 3PY2A 5FF0A 4J2MA 4AZHA 3GS6A 3CV2A 3PPGA 1AQFA 3LQGA 4S3CA 1G7UA 4MWAD 4AZ7A 1XBVA 5IFTA 1UCWA 1UUQA 4W5ZA 3W82A 4JS3A 4N9EA 3H4GA 5FJJA 2NQ5A 3SRFA 2AL2B 3BCJA 3T0BA 3NQ6A 5CZ0A 1I60A 2HK1A 4PMJA 2INEA 4JIHA 2Q01A 2PGRA 1NVMA 1DHPA 3QC0A 3NNTA 4O0ZA 3W22A 1F4AA 4AG0A 2R9RA 5H1WA 2NSOA 4S3AA 4E2DA 3FVDA 4H9TA 3W2LA 3W87A 4E3TA 2EJ1A 4KRTA 3VE9A 1VAHA 1BXNA 5E0FA 3L4ZA 7A3HA 2GSHA 5CH9A 4JYDA 1WQ5A 1PB0A 4IGSA 2J27A 4O1FA 3VX0A 2AMXA 3EWXA 4UCFA 1MFVA 2ZICA 1LBLA 1UD5A 1MUMA 1QOQA 1GYMA 1KR1A 1TMQA 2PBOA 4A3YA 2WCGA 2NV1A 4I90A 2E4TA 4EAYA 1J96A 8CGTA 4GYPC 2WWDA 2R6OA 3TQVA 3QLLA 2XIBA 1LWIA 3CJPA 1W9PA 2QCHA 3W25A 3AICA 2NQLA 4I5RA 1R47A 1CGWA 4Y8FA 2DT1A 4EAMA 1LT8A 4PCFA 1TJPA 5AYZA 3WD2A 4M6VA 1BHGA 3SRHA 2PWUA 3FNDA 2E67A 3URAA 4Y7EA 2J8GA 3N4AA 3BARA 2H8XA 2OZTA 1XJBA 1VFSA 3EX4A 3BAYA 4A6GA 5U7SA 2PTYA 2REQA 2Y5JA 4FF7A 1WUFA 1UP2A 2E09A 1OCBA 4ILSA 3UNDA 3N1AA 3OLGA 2PP0A 1PWMA 1H7WA 2WMIA 1DTNA 4G9PA 3CPUA 4OECA 4GK8A 2J7GA 2DZPA 3FGCB 1I2NA 4BJHA 1BF6A 1RBAA 2OEJA 3F5LA 4AZGA 5AHMA 1B3XA 3NPVA 4LSBA 4C6IA 3P0XA 1J5TA 2OXNA 1F3EA 2B4GA 1EJXC 5K9XA 4JTFA 4PMNA 5J5DA 3LB0A 1ITXA 1VPXA 4NVTA 1Z32X 4AY7A 3EOOA 4FSAA 3B9AA 3LCLA 1PBGA 3TR9A 5F1UA 1HJSA 1XLGA 2NUYA 3OGRA 1NTHA 1NWSA 2WHKA 1BTMA 2QF8A 3ATZA 3QSRA 4Y6GA 1K03A 3A64A 4GNVA 3UESA 1ECEA 5LA2A 2CPUA 5DELA 1OYBA 4GC4A 4CQCA 4UTKA 1SJCA 1F9CA 1W1B1 1GGOA 3C2FA 4M82A 1VCGA 7ENLA 4KWOA 2GVGA 3OVPA 1QNSA 4J3VA 3II1A 1XIGA 2PDPA 1MW1A 4HYWA 5EKYA 4AHPA 3TUUA 1Q8AA 3UPBA 4FR6A 3EPMA 5BW6A 2E6DA 5DXXA 4ZEPA 3GH7A 1P5BA 2BASA 4DBSA 1G4TA 4Q22A 1EP3A 5M1TA 1HP5A 5BXRA 1SFTA 3R10A 1W5PA 3M44A 2FZNA 3MBFA 4EP8C 1MWOA 3MDWA 2PC8A 2Z29A 1QI3A 3LHVA 3SIZA 2HJPA 4WSKA 2WZIA 4CCCA 4Z1AA 3IIPA 4MJ4A 3A4WA 1DL3A 3FAXA 3P7YA 1LUCB 3ZYZA 1XPYA 2FVKA 4FXJA 1UZHA 2EPHA 3HB9A 2XVPA 1M65A 3AO0A 3DG7A 5HUOA 4ZO7A 5FF7A 2PDKA 2Q6ZA 2HE8A 3DBPA 3PN8A 2AKZA 4MDPA 4RDZA 3Q65A 4PB5A 1W5MA 2ON3A 4FNRA 1YXCA 3PBMA 4KKXA 3DXIA 2I5IA 2XUCA 3O15A 1V3KA 4W9TA 5HQEA 1XLJA 1VZWA 4ASTA 1HKMA 4J4KA 1SO4A 4Q8WA 3M0JA 3MMUA 3EDDA 3NPUA 3L5LA 2DDXA 3B9EA 3L66A 1BQGA 3NSNA 4A05A 5LIXX 4ML9A 2OOFA 5REQB 3H21A 1MQPA 3S3GA 2WCSA 5A2AA 1IHIA 1PKYA 3PUEA 5J8LA 1O5KA 1TV8A 4UQ9A 5I78A 3FN9A 3RFAA 3G1VA 4WXZA 4F2BA 2WPBA 5G1TA 2WMIB 4HD5A 4PTNA 3HG2A 4OFCA 2ZX6A 1KFJA 5C8BB 3L5MA 1P0DA 1JG9A 2BOGX 3SDOA 3AISA 1FHVA 4ZVJA 1ZBKA 1SZRA 2DQWA 4D6JA 3AIUA 4G1NA 1XLAA 3MUXA 2VVNA 4UTJA 3CHCA 4AIUA 4UFLA 1THFD 2BVDA 2OU4A 2O4QA 4H9VA 1XL9A 4GZJA 3PZTA 3LSBA 4H04A 3BQ5A 2XIOA 2XIQA 1EFZA 2VKZG <