2I16A

Human aldose reductase in complex with nadp+ and the inhibitor idd594 at temperature of 15k
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
312
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Ultrahigh-resolution study of protein atomic displacement parameters at cryotemperatures obtained with a helium cryostat.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 312
sequence length 313
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2i16A00
3R8HA 3LZ5A 1R38A 1C9WA 2FZ9A 3T42A 1PYFA 2HVNA 3M64A 3P2VA 3CASA 1PZ1A 3RX2A 2ACQA 4H7CA 4GIEA 3KRBA 2IPWA 4WGHA 3UYIA 1T40A 1MI3A 2FZBA 3O0KA 3GUGA 2CLPA 2J8TA 3EB4A 1Z9AA 3WBXA 3LD5A 2NVDA 4JIRA 4XZIA 2IQDA 4F40A 2PDFA 3H4GA 2PDIA 2HE8A 4WEVX 2HEJA 1VP5A 4IJRA 2IKHA 2PDLA 2IPJA 4XZNX 4XAPA 1AFSA 2BGQA 5LIWX 3R94A 1XGDA 3UFYA 4PUUA 1AH3A 3N2TA 5LIKX 3DOPA 2PDXA 4LAUA 3MC5A 4WRHA 3U2CA 1EXBA 3LENA 4JQ1A 2R9RA 3LBOA 3CV6A 1YNPA 3GHRA 2IQ0A 2HVOA 3UG8A 2C91A 2ISFA 4JTQA 1A80A 3QKZA 4GABA 4YVVA 2NVCA 2PDQA 1J96A 1MZRA 4IJCA 4JIIX 3UZXA 2PDCA 3V35A 4NKCA 3UP8A 1OG6A 3UWEA 2BGSA 2DUZA 4JQ4A 3F7JA 4FZIA 3VXGA 1RALA 1Q5MA 1LQAA 4ICCX 4LAZA 3LN3A 5DANA 3LQLA 2PDJA 2PD5A 4WDUA 4G5DA 1ZGDA 5JH2A 1ADSA 3RX4A 1RY8A 3H7UA 3D3FA 1LWIA 2PDUA 2ACUA 4GQ0A 4LBSA 3UZZA 4MHBA 2PDGA 3GHTA 3Q67A 3G1RA 1T41A 3BCJA 4ASTA 4GQGA 3UGRA 2FZDA 4RPQA 1PZ0A 2PDHA 1YE6A 5AZ0A 1S1RA 2DUXA 3Q65A 4JTDA 2PDMA 3NTYA 2PZNA 4LBRA 2IKIA 3N6QA 3FJNA 2PF8A 4LB3A 3DN5A 2FZ8A 4HBKA 1MRQA 3BURA 5AZ1A 2INZA 4WDTA 4YVPA 4Q3MA 2PD9A 3B3DA 2WZMA 1Q13A 1Z8AA 1ZQ5A 1AH4A 3ONCA 3CAQA 1AH0A 3V36A 3EAUA 3LZ3A 2AGTA 1YNQA 4JQAA 2IS7A 3WCZA 4JTAA 1YE4A 4PRRA 4YVXA 5M2FX 4LB4A 2P5NA 2ALRA 2HDJA 4QR6A 5HNTA 3R43A 4QXIA 2FGBA 4EXAA 3MB9A 2QXWA 1EL3A 5KETA 2PDKA 4DBSA 1JEZA 2IPFA 2F2KA 4EXBA 4XZMX 1HW6A 1VBJA 2PEVA 3R8GA 4FA3A 4L1XA 2PDNA 3LUTA 4XZLX 5JH1A 3CAVA 1GVEA 1AZ1A 4WDWA 2PDWA 4ZFCA 4HMNA 3C3UA 5LIXX 4GA8A 1SM9A 2IKGA 4JQ2A 2IKJA 3UZYA 4H8NA 4YS1A 4XO6A 3BV7A 1FRBA 1PWLA 4OTKA 4YU1A 3M4HA 3UZWA 1ZSXA 3H7RA 4IGSA 4FAMA 3M0IA 1XJBA 4XK2A 4QBXA 5HA7A 2I17A 3ONBA 2ACRA 4Q7BA 2VDGA 1PWMA 4JTCA 4QX4A 1S1PA 1X97A 2WZTA 4PR4A 1QRQA 2PDPA 4JIHA 3WG6A 2A79A 5HNUA 4JTRA 1QWKA 1X98A 3LEPA 3FX4A 3GHSA 1UR3M 3RX3A 3WBWA 4JQ3A 3S3GA 1Z89A 4L1WA 2FVLA 4R9OA 3R6IA 2R24A 1EKOA 3ERPA 3WBYA 1XF0A 4XO7A 2DV0A 4XVEA 3R58A 4DZ5A 5LIUX 1IHIA 4XVDA 1ZUAX 4FALA 3CV7A 2HV5A 3O3RA 4I5XA 2I16A 3LQGA 1K8CA 3V0TA 4PUWA 5C7HA 3CMFA 2F38A 4XZHA 1EF3A 3COTA 3V0UA 3GHUA 3R7MA 1US0A 1X96A 1M9HA 1IEIA 3LNMA 1AZ2A 4PMJA 4PRTA 4DBUA 3G5EA 1S2AA 2BP1A 1HQTA 4AUBA 3BUVA 3V0SA 2INEA 2PDBA 1RY0A 1S2CA 2PFHA 4WDXA 2IPGA 5LIYX 2HE5A 4GACA 3EB3A 1Z3NA 2ACSA 4DBWA 2PDYA 4GCAA
chains in the Genus database with same CATH superfamily
4XIAA 4LCQA 2WKJA 3WK2A 4MF4A 2R1LA 3B0PA 5EMLA 3TN5A 1VF8A 2CW6A 3M46A 3N4FA 1WBJA 3T78A 4Q22A 2W9MA 2HVNA 5C8BB 1SJCA 3UNDA 1EA9C 2XTKA 2ZA3A 1V6TA 4J40A 4P7OA 2AOSA 1V3MA 4GIYA 2PCEA 3IPWA 4LQ1A 3XISA 4AMCA 3W76A 3GTIA 3W82A 2NWSA 4EPEC 1KRCC 2VQTA 1CCWB 5CGTA 2DPEA 3M9YA 4Z1BA 1JG9A 3QY6A 3NQFA 1EWDA 3GG1A 1V03A 3PTMA 4IFRA 1VP5A 2Q02A 1QOQA 2X40A 1XD1A 5FJRA 4GVIA 2XH2A 3AS0A 3U0HA 4CCEA 1RA0A 3WJWA 4ACZA 1R46A 3A64A 5I02A 3KL3A 4XAPA 3BICA 3YPIA 3DFQA 1YPFA 2ZVRA 2FPYA 5CSRA 1QOXA 2WQDA 3KBSA 3MV01 1BF2A 4PUUA 3U2OA 3U2ZA 1JUKA 1HIZA 1EUNA 1QPQA 5AC6A 2WWCA 4S3BA 2C16A 4Z2IA 1AD1A 4LUTB 3P5YA 1JPHA 2IQ0A 2ZRUA 4B2DD 2HVOA 1CGWA 4GKTA 3VDHA 1RP9A 1UWQA 3IWPA 1QDSA 4DY1A 3POCA 2NZLA 2PMQA 1ZAJA 2EPKX 4GABA 1F61A 3HGRA 4YVVA 5JU6A 4JPGA 4REQB 3NZRA 4GUJA 4AISA 5GJPA 3EOEA 2A3BA 3SUTA 3KVJA 5T91A 4ICCX 5A8NA 1F8MA 1VPXA 4QJ3B 3TN4A 1P48A 4V27A 4MWAD 1ONEA 4YNGA 4FPSA 3PZMA 4DPQA 4WSJA 3ZSTA 4C6EA 4X22A 1B3XA 1OFEA 3ITOA 2OB3A 5BU9A 2ZZ4A 5HWMA 4KFNA 1KBLA 3B40A 1JUBA 1T8QA 4F66A 4Y2WA 1UPMB 4IQEA 2Z2AA 5G2IA 1B9BA 3VZYA 1TX2A 2H9AB 2VGFA 4GX9A 3C5QA 3NTYA 3P93A 1XHGA 1E0XA 1X1OA 1XLJA 3N4EA 1VJZA 4UUIA 3WDRA 3K2GA 2QMKA 3ID7A 1BPLB 4QSFA 1XWYA 4DYJA 4I8YA 4PTNA 2INZA 1Z44A 2CZDA 4GCXA 3RF9A 3BCFA 4LF1A 5FF3A 3W70A 2YCIX 1XKYA 3PPHA 2ZRVA 3O9NA 1V3KA 2YBVA 4GC3A 4TX6A 5T8GA 1C8XA 3GVWA 3LZ3A 4PCTA 4AVNA 3FSTA 2Z24A 3H53A 1R3RA 3AXIA 2ZADA 1SUXA 4HMEA 4RR4A 2XPKA 3M43A 2ATMA 3PWAA 1DJQA 4KBXA 4GY1A 2Y2WA 2CU0A 2DW7A 3CHEA 2IPFA 1QCWA 3L66A 4PUJA 1IGSA 3M5YA 1Z48A 5FF0A 1OYAA 1TSIA 3LUTA 2WQPA 1MEHA 3AMDA 5RUBA 3P5ZA 4C91A 2PDWA 2PP1A 3U8GA 3U57A 4LJ3A 1J9YA 1D3GA 3LRLA 4U3CA 1PX3A 3M0KA 1HP5A 3QOMA 2CC0A 3RN6A 7A3HA 4JDYA 3ANVA 1DV7A 4XO6A 4P5UA 1BSLA 3UJ2A 1XL9A 1XYMA 3UQNA 3OIHA 4UTLA 4FAMA 1GTEA 3A3WA 4HK5A 4MB1A 1PO9A 4BHYA 5HA7A 3W7RA 3I68A 4MY8A 3MKVA 4AHQA 2I17A 4KS0A 4P7NA 4N02A 1H62A 2A0NA 4JCMA 1UPPA 2ZUSA 3H54A 1K8ZA 3BO9A 5IBXA 1TJ1A 1HT6A 1JZ4A 2JKAA 4XZ9A 2F6UA 3P8IA 3KTSA 2QJNA 4OBTA 5FEWA 3AHXA 4M82A 4B9ZA 4FF7A 2NQLA 1LYXA 3LA4A 3U6WA 4QS6A 1S2VA 2QCEA 4C6LA 2DJLA 3GU9A 4CQ8A 4N7QA 1GVFA 4EK7A 4YJ5A 4NHVA 3EWZA 3KWXA 4PMVA 3MW7A 5CPLA 3NQDA 5F4XA 5CGQA 3URAA 4EPBC 5I09A 3URBA 7CGTA 3VKKA 4NIRA 1YXCA 4AC1X 4LUYA 1X8FA 3VINA 1IXNA 2QPXA 3GS6A 4IP5A 3F5JA 3BK0A 4MGGA 3WLTA 2QUNA 1Z69A 2G3JA 3SCSA 3MKCA 4NL1A 2PB1A 2YA0A 4MWAC 4BQ4A 2V69A 2I16A 3W71A 1V6XA 3TCSA 1PTDA 5AHIA 5L9FA 3UZJA 1DQWA 1UBPC 4FNQA 5LSMA 1KB3A 1CEOA 1R3WA 4O18A 3R7MA 1BTCA 4M51A 4IOTA 3UVIA 1FWAC 2VX4A 4PTMA 4W88A 4X60A 2XYLA 2G41A 4F2UA 1G4PA 3LCLA 1H7WA 3CS2A 3P14A 5EMUA 4PRTA 4DVOA 3HG5A 1RPKA 4LVDA 4LUIA 3E0WA 4HZ6A 4M3PA 3WZ0E 4OECA 3O63A 4ZE4A 2YW4A 3FK4A 3NEHA 1ECQA 1WDPA 3R89A 3VMPA 1UWAA 4OBSA 3KHJA 4J27A 4OU1A 5EYWA 4ZOCA 2OWWA 1QI5A 1XLKA 4K1GA 1AW1A 1CT5A 2NSOA 1LM1A 3T08A 1TTQA 4H6KA 3HTWA 5BRBA 1KBKA 1WYIA 3CLMA 2BMBA 3LERA 4DQWA 1I9CB 3UCDA 4O0ZA 4R88A 1DXFA 1G67A 1WE5A 3O6AA 2D69A 4GIEA 4B5NA 1EWEA 4BWLC 4WGHA 2PPGA 3AXKA 3NA8A 3VNIA 4O50A 2DP3A 3SGZA 3VIMA 2ZE3A 3H6OA 3O0KA 3VKAA 3LV6A 3VD5A 1XXXA 1UMYA 3IACA 1P4CA 1UZ4A 2J8TA 2PE4A 3RITA 5AY7A 2G95A 1TA3B 3IJ8A 1OC7A 4D6IA 3XIMA 1KTCA 1MUMA 4K37A 3VIJA 4WJ8A 3AHVA 4BEUA 1OWQA 3BSGA 1U33A 3OYXA 4JNMA 2ABAA 1AFSA 3EWBX 3CTLA 1CGXA 2Z27A 3UVAA 2DFAA 1OGGA 1TQJA 4NJGA 5CXPA 4DJDA 1BG9A 3VFCA 3WQFA 1DPMA 1F6PA 4RNIA 2VEFA 1RXOB 3HQ1A 4LYKA 1XGEA 4ZB0A 1JQXA 1RJPA 2JIEA 1FXQA 1J0KA 2CLOA 2AKMA 2W91A 1UH4A 4GIAA 1SYTA 2ZBTA 5ABFB 2XZ7A 3S6OA 4YTSA 3SUUA 2NQ9A 3C86A 3ARUA 1ZCOA 2Z1VA 3F5KA 3QKZA 3PAJA 4XSMA 3WNNA 1P7TA 3GAKA 7ENLA 3BE7A 2J6XA 3NO3A 4WR3A 3TJXA 1B5TA 4P7QA 3UYCA 1XIIA 4U28A 1IIHA 2XHYA 3CM4A 4F8XA 4H9XA 4EANA 3U7BA 3W7LA 4QLLA 4N42A 4WDUA 3LLFA 5F1VA 5HR7A 3GBDA 2ZZ1A 3QF0A 1KFEA 3W74A 4FXFA 4QITA 2XINA 3BW4A 1A5OC 3E0IA 3WQDA 1LTDA 3ABRA 3BCJA 1A5AA 4O14A 4Q4PA 2D2GA 5HANA 4RDZA 1PZ0A 1QW7A 1LLOA 2OCZA 1L2UA 3AIWA 4Y9OA 4Q8NA 2VQUA 2EPOA 2PZNA 1GYMA 3NSNA 5AYIA 3LSBA 4J5NA 4RNHA 4UQBA 3OGSA 5C55A 3WH9A 3H2NA 4YXGA 3FW6A 1WOBA 4M24A 1K70A 2AQOA 3OHIA 4Q4MA 4KERA 1HF6A 4K3ZA 3WF1A 1GVSA 4F2TA 2GUUA 3MT1A 1BD0A 2JF6A 4PCFA 4C1KA 1PB0A 4IPJA 2IS7A 2VENA 1NDWA 1QXLA 3WH7A 3CV2A 2E67A 2QV5A 4YVXA 4DPPA 4ZQNA 4ILSA 1R9ZA 1M5WA 4HPXA 3WIJA 3L2IA 5LZLA 3AS2A 2FGBA 1ADOA 2RUSA 1A5SA 2ZRXA 5D2WA 5D04C 5CC3A 5HJYA 4ZTYA 4BQ3A 2V3FA 1WAUA 1JRBA 2PUZA 3ZVIA 4W7UA 1BG4A 1EPXA 4MDOA 3AWNA 1V93A 1SM9A 3VU2A 3M5ZA 3AXXA 1G0CA 3VCCA 1DP0A 1GQIA 4KMQA 3WMLA 1J2WA 1Y65A 4TUFA 1FRBA 1RD6A 3WEMA 3T6CA 2VVSA 1C3FA 3EWWA 3GZAA 3KBJA 2B81A 1MUCA 5IRPA 1WA3A 2Y1HA 1XIBA 1W1A1 1PTGA 2VI0A 1UROA 4RXGA 4ZB2A 4WJXA 4O10A 1KQZA 4M6PA 1QRQA 5H8UA 1FHVA 2FDSA 3W00A 1R7OA 2Z1WA 5EU9A 5I3HA 4DJDD 2P53A 5A8GA 5IBXC 4HQVA 3EX1A 2Y7EA 3WF2A 4KWVA 3U4AA 3NYZA 4TV5A 2VR2A 3AS3A 4M5PA 4EACA 1NFPA 5HUPA 1W1B1 3W84A 4UTUA 1HO4A 3BAXA 4EAYA 1Z89A 1TPDA 1YKWA 5C0QA 4NNAA 3WQ6A 4L5ZA 1YXDA 4CNSA 1V7YA 3DC0A 1XDMA 1KCXA 3CO4A 1WPCA 3NQ2A 3FDGA 5A6JA 2Z6IA 3OG2A 3WNOA 4MB4A 1VPQA 1TV2A 4CD8A 4H9VA 1FWHC 2Y5EA 5BWFA 4HCLA 4QQ3A 1VIWA 4JIPA 3F1QA 3NUKA 2QLYA 4CD6A 4R7JA 3ECQA 4NILA 3A22A 1FKWA 3DFYA 4I5UA 1FY6A 2OXNA 3ATZA 3RR1A 4F79A 1C8YA 2YBTA 3CEPA 1W17A 2CITA 3E0FA 4RDYA 5GQBA 1OD8A 4WOZA 4A4AA 3VIHA 4W5ZA 4W84A 3WUGA 3TSMA 2BXVA 4W9TA 2WC7A 2X1IA 1OQFA 1I2QA 4IMDA 1G7VA 1KGWA 2BP1A 3UY7A 2VP8A 3GVGA 3GM8A 1YW1A 1TWWA 3I65A 4AXNA 3PANA 1Q4WA 2CXEA 5KEZA 2X41A 1PYMA 3TYAA 1K9EA 3B8IA 2E9LA 4O17A 1H1ZA 1XBXA 3M0ZA 2Y7FA 3OP2A 3TJLA 3BMVA 5C2XA 4S3DA 1GQJA 1TYGA 4I6VA 2ACQA 1GEHA 1KTBA 1XG4A 2Y8UA 6A3HA 1LF1A 3R8RA 3QXBA 3LU2A 2NQZA 2BY2A 4PEEA 3G18A 2FZBA 3T8QA 1KTNA 3GU2A 1XLCA 1Y5XA 3IVTA 1E70M 2CLPA 1HTIA 1BKHA 2YDRA 3CUXA 5CPNA 3I6RA 2O4MA 5E0KA 1JZ5A 1GCYA 1IZKA 1BRLA 1FWBC 3VCRA 1OINA 2CETA 5D2XA 4QROA 3PBVA 1ZPTA 5AHFA 2GQAA 3GR8A 1E43A 2WVVB 3VOIA 2Q71A 2BBFA 1BYDA 1W9PA 4B16A 2DIKA 5I24A 3R94A 3SUSA 3EXSA 2JGQA 3CIVA 2VR5A 5CPQA 5CZ0A 3TCEA 3FXYA 2ZA2A 3GYEA 4J3WA 3RXZA 3DOPA 5HAOA 3GXMA 4WRHA 4KCVA 2O56A 4JQ1A 5AB3A 4DJDC 2TMDA 2VX7A 1EOKA 1YNYA 4JYDA 1MXSA 3SEPA 4E4FA 3GXFA 4GQBA 2VZSA 3MMWA 2ZUTA 3WO8A 4UWMA 1P5BA 3GO2A 1C91A 3PULA 2GJNA 1DOSA 1SR9A 2E40A 2X1RA 3NDYA 4PB5A 2UWFA 1EO7A 3S9ZA 3WD3A 3UG3A 3ZLHA 1G01A 1WB0A 3C2OA 3V35A 2FYMA 4UIOA 3MUZ1 1DORA 3AZTA 3UJRA 1LROA 2NXHA 3E12A 2Z2BA 4HNVA 5HQMA 3MU7A 3BQ6A 4B4FA 4Y8FA 4LUJA 1EJWC 4CCCA 4C6OA 2OWCA 2OGJA 4PC8A 3QPEA 3V75A 2YB4A 3RM8A 1RVGA 1GPWA 3WQ8A 5D05A 4MY1A 1YMYA 4A3RA 3GDTA 3VAVA 4L9XA 1I1WA 3GB6A 3GTHA 3S5ZA 2J47A 3L23A 4ZO9A 1N2VA 1L8PA 3KOYA 4LAOA 4W4QA 3KCJA 4PMRA 3UT0A 1OY0A 1AQFA 3DYOA 1OGSA 2RDTA 4O4VA 4I7WA 3SB0A 4YIWA 3MBFA 4NAEB 3RCNA 2OQYA 3TXZA 2QAPA 4KH2A 1NH6A 3N13A 3EX3A 1KLYA 2R8WA 2NT0A 3PB2A 3R12A 1NFGA 1Q45A 8CGTA 2VCBA 3PFRA 2UZ9A 1F6KA 4JQAA 3EDDA 3CIXA 4JFUA 1YRRA 2WCGA 5KSWA 3EA2A 4JX6A 4V1XA 5K4XA 3BJTA 1MSSA 1F2JA 3DFSA 1SO5A 2C1HA 4EXBA 5K7JA 5AYBA 5JVLA 1WZLA 3PTQA 1LUCA 2V38A 5F2MA 5GJMA 2WJDA 3URNA 1A3WA 2FVKA 3Q58A 3FHAA 4PE8A 1V5XA 3CQJA 1SMDA 1QASA 4ZGYA 4C1NA 5F2GA 4I7VA 1G7UA 3GXNA 3WF0A 3CZEA 3FAWA 5M3WA 4ZENA 1XIFA 3JW7A 3M4HA 3DHPA 3H7RA 1EEXA 4DWSB 4AD5A 3AJXA 4QBXA 3QYQA 3KAOA 2FMNA 5EFDA 1GTHA 1V3IA 3EWUA 2DZVA 1R9YA 3NQ7A 1TREA 4MKVA 4QX4A 1JUEA 3DHFA 4IF2A 2HJPA 2PC4A 3F4VA 1R87A 4Q6XA 4EX4A 3PZQA 3CYJA 2V82A 4QRNA 4Y8EA 1PHQA 2BODX 4PMZA 1DXEA 4ZA0A 1X98A 4RCXA 1DKWA 1NU5A 4V33A 2QUVA 4CN1A 4J1OA 5IM51 1O68A 1J01A 2PWGA 5FKYA 3SCRA 2WPBA 4HPGA 5GNYA 4NZ3A 2VEMA 2H3BA 3WNMA 3M7WA 2J7EA 2PP3A 4E5TA 4NAFB 4KWUA 4QCEA 3VD3A 2P3EA 4GZ7A 1RUSA 5FJUA 1ISXA 1XQKA 4KW2A 1IEXA 4B90A 2PWDA 4J3XA 4XB3A 2V67A 4B3KA 1OFOA 3W7JA 2VFHA 3W7KA 2VFGA 5LGZA 3G6MA 4MSSA 4OIFA 3IGUA 1F05A 2GSEA 2NV2A 1IYXA 3AZSA 1RSCA 1BVWA 3UGVA 1XGZA 3T9PA 2H3DA 4F0RA 2P3ZA 3KOZA 4AF0A 1KFLA 4LY4A 3LNMA 4Q6JA 7TIMA 1R86A 5U7SA 3T0AA 1KLZA 1IXPA 3DCPA 3GC5A 2WZIA 3QSRA 5IDIA 1F76A 2FH8A 3AYSA 4FF5A 4E3TA 3WLJA 5HWJA 2EPNA 2IMRA 3VD7A 3OLGA 3W02A 2JKEA 2X0SA 3ES7A 3W53A 3PNZA 1XS2A 1A5KC 4S2CA 3TA6A 1E73M 4C6CA 2XN1A 2CWXA 4JD4A 4KEZA 7XIMA 2VWTA 1I75A 1C9WA 4A35A 4XUYA 3EPMA 1TIWA 1YTKA 1MUWA 4UR9A 3MI3A 3SRFA 1PYFA 1XD0A 4GYFA 3NL6A 4H83A 4LUSB 4FK9A 1GOWA 4RJEA 3GNNA 3LPFA 3RAOA 3BLKA 1UZ1A 3VD4A 3EZ4A 4NY2A 1OFBA 3DC8A 4NVTA 3GUGA 5HULA 2FQIA 3P7YA 1J93A 1REQB 1W2PA 4FX8A 5FJTA 1PL9A 3S1GA 5B7YA 4S3FA 4F40A 3B0YA 1Y8BA 5DY3A 3TROA 2GDQA 2NUYA 3N25A 1JQVA 5FI8A 4DZAA 4L6HA 4HA3A 1OG0A 4LSBA 4MNJA 4W5UA 2J25A 1R3QA 1XGDA 2WV8A 3GQYA 2WXDM 4J4KA 4WQ6A 3D5HA 1A50A 2QIWA 5A1AA 2R94A 2EEXA 3W24A 2XN2A 4GYPA 4UOZA 2WSYA 4AXKA 3W2LA 1BVNP 2VEKA 4RPPA 3A24A 4QGCA 3LOTA 1HUVA 1CI1A 1F6YA 4WUIA 3H8AA 4EF8A 4IIFA 3FYOA 3PBYA 1GONA 3TQ0A 2WOQA 4G1KA 2TRSA 3MZ2A 4KRZA 4A22A 4TVCA 3HURA 3L5LA 4LPCA 4LNYA 4Z2KA 3G0XA 3KZSA 2RKXA 2VUNA 3B05A 3VGGA 1MEIA 1K4GA 4WY0B 1D8WA 2J62A 4KRTA 3ZIZA 3VXGA 4QAIA 1RALA 3FDKA 1DIEA 3UCQA 4HA0A 1KC7A 2QDGA 1UKQA 2VCCA 1F3XA 4GOAA 4EIVA 4WF7A 3IUDA 3WLSA 2RAGA 4S3JA 4U5KA 3KS5A 3SN1A 4R9XA 1HZYA 4KIEA 4OUIA 3G1RA 2XM2A 4XSLA 1ZJBA 2R82A 4DELA 1GKRA 4X0NA 3VMOA 2XZ9A 1O5RA 1S46A 1H63A 4FXRA 1QNOA 1JCLA 3GVVA 3QHMA 1IGWA 2DUXA 3NM3A 3W0KA 3VGFA 1AQHA 3DFPA 1I4NA 2E8ZA 1TMLA 4LBRA 1HGYA 4W87A 6TAAA 3N6QA 5F2IA 5CPOA 1LORA 4GY7A 4QFUA 4UQDA 2VC9A 1RPXA 5AYYA 4IG2B 2H9AA 4W7VA 1BWVA 4ZXOA 3WUEA 1F5ZA 2R1KA 1F73A 1Q6DA 1LT7A 3DU0A 4UR7A 2FDMA 4XZBA 2XIBA 1P6WA 2QT3A 2VTFA 3AQUA 5EBAA 4PL1A 3LPOA 3PPCA 3B97A 1EDTA 3NDOA 3SCUA 5IHSA 3S1WA 1UH2A 1B9ZA 1FHDA 1N8WA 5HDRA 3R43A 3WJXA 3MB9A 1FCUA 3TYEA 3ITGA 4QISA 1WZAA 4YCPA 3OA5A 3R8GA 4G9PA 2ZWYA 2ZXBA 3OG3A 3U7VA 3ARTA 5A8OA 1VEOA 4NZ1A 3RRAA 1DJWA 4AB4A 5FACA 3UCCA 1ICQA 2Z29A 3PUGA 3FLUA 5FCZA 4MAVA 4LTSA 2I5QA 3K13A 3MHGA 1GUVA 4HZ8A 1VS1A 5DELA 3UZWA 1ZSXA 4C6KA 3FAXA 2NQJA 4C6IA 1XJBA 4UTJA 3M6DA 4DXKA 1PPIA 5G2WA 1FWJC 2R1NA 4QQUA 1LLZA 3MY9A 3C2FA 1J0IA 2WHKA 5HR6A 4ONVA 3ITYA 3N2MA 2OT1A 2OO6A 2GZXA 1VR6A 2DH3A 5DY2A 2VX5A 1Q7QA 4KFPA 2XIOA 2XIQA 1OX4B 4TTUA 4NI3A 4ZB5A 1DHKA 4C7GA 3QHOA 2YA2A 6ENLA 1Q6OA 1QNPA 3D0CA 3C56A 3LPPA 5FEXA 1OD0A 1YHTA 4GZIA 3VKDA 1HKJA 2OLAA 3A4WA 3ABOA 4IIBA 4AZCB 1EH9A 5ABEA 3EDKA 3D46A 4JFVA 2ZA1A 3T4WA 3NG3A 2YL9A 4GGBA 2D22A 1OYBA 3BGAA 3C0JA 3Q2DA 3SY1A 3VOJA 5HINA 1BFNA 2DSVA 3ZR4A 4XBSA 4CNPA 2REQA 4JTJA 2GJLA 3WQPA 5G1MA 1R9XA 2J4GA 5I00A 1SZRA 1JDAA 1I6NA 3W9ZA 3G1XA 1YTEA 4G7EB 1R85A 6XIMA 3NQVA 1IXOA 2VFIA 1XLLA 4B9YA 4L6OA 2QIIA 1W9BM 1EEPA 5CSYA 3I3DA 3W7IA 5EY5A 2EHHA 2GPTA 2WANA 2OFJA 4Y96A 2XVLA 5CEWA 3GH5A 1JCMP 3CXOA 3UA4A 3Q37A 4LVFA 2Y89A 3MMUA 4PODA 2JF7A 3N9KA 1NM9A 1E9YB 2OKTA 5LYRA 5I79A 1FTXA 1VHCA 1RY0A 1THFD 4QE4A 3WMSA 4IPNB 3PJTA 1U2YA 3L21A 5DCBA 3CJPA 4I9MA 4OOUA 3BLLA 1UZDA 3PZTA 5A8MA 3VYLA 4HK6A 3GFXA 2ZTJA 4HSOA 2PU0A 2BHYA 1ADDA 1TMQA 1KWKA 1RQHA 2IW0A 3FGCB 4M80A 1A49A 2YCLA 4A21A 4PMQA 4JTGA 2CBVA 4AZIA 2W0UA 5FJOA 3W1MA 3VNZA 1K8XA 3V1HA 1LL6A 3V18A 3UJSA 3WFLA 3BAYA 3ZJ7A 4ZQCA 3TNOA 2J7FA 1YADA 2WSRA 3KZPA 1FDYA 1V8EA 2QCDB 3IIVA 4DI9A 4KWWA 4JY8A 4MZ8A 2CZVA 3DG6A 1NWUA 1EP3A 1DL3A 4JR5A 3KCLA 3AROA 4DO6A 4AIUA 3HGOA 3VM7A 1NELA 1GK8A 3TLLA 4PMNA 3RDKA 1J0YA 2DZWA 1NWTA 3MO4A 2WHJA 1B3VA 2WCAA 5G1TA 1AH3A 5C9RA 4H41A 2ZCGA 3MBDA 5KZDA 2J8GA 1XP3A 3PP7A 1R2RA 2C3ZA 1Q65A 3AMCA 1P6BA 1K9TA 3FEQA 4GYPC 4M1BA 3W1UA 1Z42A 2DQXA 4JNZA 3UG8A 4AWEA 2WMFA 4JDBA 3W7CA 2Q3OA 3DI0A 4H1ZA 3BG3A 1G6CA 4M1RA 5BOEA 5DEZA 3H12A 2Y24A 1B4KA 1CGTA 2NQHA 1R47A 4O8RA 4QLJA 3Q94A 2NLIA 4U5IA 3BGGA 4LAZA 1RCQA 2WW5A 1AG1O 3LQLA 2QPSA 3CLWA 3IGXA 1TX0A 5CZKA 4Z0JA 1S38A 4TO8A 2Q8LA 4ZQPA 3H7UA 3G1VA 5MF5A 2PDUA 3J7HA 3FJ4A 4K39A 3N12A 2CLKA 5DO8A 3TUUA 2O92A 4WSHA 1U5JA 1O95A 4Y7EA 1FDZA 4AD4A 4Y9MA 3CO8A 2VJXA 4N9DA 3EOOA 3NZPA 4RPQA 2PDHA 1TZ7A 2E1DA 1HKWA 3BAWA 4JTDA 3B03A 4GX8A 1EQCA 5FJPA 3NNTA 1N7KA 2X1SA 1VHNA 4DLFA 1UA7A 2J88A 3FJNA 1N8FA 2Y8KA 3VIKA 1TR9A 3DN5A 2FZ8A 4WD0A 1CBGA 3VOCA 1GWJA 1TPWA 1BGAA 2E0PA 3LB0A 2J75A 4JTHA 4D6HA 3C6CA 2V5LA 1GOMA 1LCOA 2GFTA 3RYSA 3ONCA 4Q4RA 3N2XA 1ZP4A 2AGTA 1ISWA 1XLIA 5C6MA 2QUMA 3N29A 4ERIA 2GLKA 2WSPA 2BVDA 2JK2A 3VNLA 1V4YA 2PCQA 4OJYA 5T9BG 3EPNA 3GTFA 4AY8A 2ZWZA 3T0CA 2Y6ZA 3UR7A 2ZRZA 1JEZA 1QI0A 1FP9A 2I56A 3H2AA 2W27A 3RGTA 4DO4A 5CG0A 4JGDA 5DRCA 1B31A 1T5AA 1TIMA 1TWZA 3NJ3A 1WXZA 2OZ3A 1XLFA 3K8LA 2PRHA 4LS0A 5DXXA 2W92A 5ABHA 2ZZ6A 2IKJA 1VEMA 1H7XA 1WXJA 4FEZA 2ZRYA 4QG8A 2ZX8A 2PTZA 2HTMA 4XD6A 3WK3A 4ZSUA 5HWNA 1TPEA 3PG9A 3WBAA 1W5NA 5D2YA 3IUIA 1BQGA 2ACRA 2HQAA 2YKKA 3PAOA 3EMCA 1SR0A 4X3ZA 1GOKA 2PBGA 3P0XA 3VIIA 1LOQA 4BY3A 5SWUA 3N3TA 2BFGA 3TYZA 4XX6A 3UNTA 2OEKA 1YBQA 3SZ8A 2A79A 3GK0A 1PS9A 3HJEA 3DDMA 4QNWA 2VZVA 1GEQA 5EL1A 1WX0A 5J04A 4PMXA 4DWDA 3HPSA 2DEPA 5CG7A 4M0XA 2A4AA 2R14A 5U4NA 3P8JA 2QCCA 5FEZA 3VDBA 4PUEA 4GXWA 3H23A 2FPVA 3TMQA 3AUJA 1UKSA 1B54A 3WH5A 3UESA 1OCQA 3ARPA 2NSXA 1G4SA 4JTIA 4Z0SA 1KXVA 3IJLA 2E77A 1GJUA 4XO7A 2Y61A 3R58A 4L64A 3DEQA 1SFSA 3B8DA 3G6LA 2WNNA 1UC4A 2Z1SA 4XAZA 4FALA 2HV5A 2NXGA 3E5BA 3MI6A 1VIZA 3BLOA 5DN1A 1FWEC 2VL4A 3S1UA 3FJLA 4QJ1A 3SIZA 3BOFA 1RBOB 3DERA 4I5XA 5CGMA 2A85A 2H90A 1CLVA 3PNUA 1JCYA 2OYMA 2DZAA 3TN6A 5D03A 1E4NA 4XZHA 3HG4A 3CL6A 2OWXA 4L61A 1POJA 1GT8A 2DVUA 3NZ1A 3GHUA 1EYEA 1M7OA 1HJQA 1FFRA 1GHSA 2X2YA 3H21A 4J35A 4ATLA 3K4DA 3MP5A 2DSZA 2I1OA 3KBMA 4JX5A 3JR2A 5F1UA 3O16A 5HATA 3O7UA 1U30A 1X1ZA 3ZOAA 4S38A 1ZJIA 4GVHA 1UWRA 4H9MA 4MNMA 3K30A 5KMYA 1EBHA 2A5HA 1WDQA 3GNRA 3BLDA 2ODOA 4HCHA 2HE5A 1LDCA 2GSJA 1ZCCA 2ZVIA 2JBMA 2WMIB 2GVYA 2OZ0A 3VIGA 3SM0A 4X61A 3HOJA 4HZ7A 4NYUA 4UTWC 2W67A 1VRDA 2CIPA 3SBFA 1VFMA 4QDPA 1HVXA 4LCSA 4MTVA 4KGJA 4LWWA 2QEZA 5EA9A 4KESA 3QC3A 5C2CA 5JQ9A 3MUCA 2V3GA 3G24A 4HSNA 1ISZA 3SN0A 3FSUA 4J7RA 3PZ9A 3LD5A 5AHNA 5FEPA 3AO0A 1MDLA 2HE8A 5HPCA 2ZC8A 4C7FA 4E8DA 2VXNA 4IJRA 4H7VA 2PU1A 5D9PA 4GXMA 4XZNX 2VGBA 2Y0FA 3ES8A 4FLSA 3S6DA 4WZHA 3ZXWA 4WLCA 4Q8TA 3IVSA 3UXIA 4BF5A 4RKAA 3UFYA 4MJ4A 3F03K 1DWFM 1H5YA 3GNDA 1V77A 4LAUA 1RR2A 4GI4A 3LENA 1E3XA 1E51A 3AFBA 4M81A 3UY8A 8XIMA 4UFLA 3R2GA 3AIUA 1J0JA 3PBMA 3NPUA 5IHRA 2NLYA 3AIEA 4K1WA 4ADSA 2ISFA 2GJXB 4NXSA 5CPSA 3I6EA 1EPVA 3BZGA 3VM5A 2DZSA 3N34A 3AMGA 2PDCA 4QSHA 5G4EA 4CQ9A 3KEHA 4JQ4A 3KLKA 3AIBA 4JYEA 2XVKA 3D6NA 1DJGA 4G5DA 4E4PA 4XBKA 1RA5A 3SW6A 1W8SA 1XYFA 1BTMA 4KIRA 4J3VA 4QJ5B 4BI5A 1FDJA 1P6CA 3W7GA 4LBSA 5E0CA 3B8UA 4LT9A 3SQLA 2FFCA 1X8CA 4AFYA 4W7WA 3Q4DA 2YDAA 2KZHA 1AL8A 3STPA 3IGHX 4U4MA 2RHGA 2EBNA 5D2VA 2XVGA 1P0KA 3EWYA 4UMAA 1P43A 4UC5A 3QLLA 3CZGA 3GDRA 4KWOA 3FA4A 3RCMA 1VBGA 1CXFA 3LTSA 1SW3A 4HJWA 2OYLA 5FF4A 4AZHA 1TV7A 3VE7A 1EO5A 4HYRA 3THQA 4B5WA 2VR4A 2FPTA 3T05A 3HMJG 3OJGA 4UZSA 2DSUA 3MCOA 2V2HA 1C90A 2O9OA 1O1HA 3OB8A 5JBFA 1FX6A 1GJWA 4TX8A 4KQNA 4GISA 1YNQA 1OIFA 3ZVHA 3LCFA 1EGMA 3HO8A 2BY3A 4HTYA 4CU6A 3QBUA 1G94A 3HM7A 2ZXDA 2VC7A 3E6EA 3NSMA 4LEFA 4CU7A 3OO2A 4UCGA 1FWGC 5KETA 3TQKA 4GQRA 4XV0A 4AEEA 2I5IA 2P88A 2PBOA 2V5BA 3VFLA 2G4JA 4HN8A 3CGTA 4UZUA 4E8GA 4RK8A 4QE1A 1RD5A 2PDNA 1QT1A 3S4TA 4B91A 4DUVA 1FWTA 5CJMA 1DJHA 1M65A 2QMJA 4N4PA 1XIJA 4O0KA 4AVFA 3IEBA 5BRPA 5JIPA 3B8VA 3AAMA 3JRKA 3DHDA 3M44A 4L9ZA 3QGKC 4QTGA 1NP0A 2VZUA 1SO6A 4UTHA 2VD9A 3GXDA 1BXCA 1HN1A 2ISSA 3P74A 3S1VA 4A2RA 2W63A 4XK2A 2VC6A 3KCOA 1E0TA 1KBJA 5EFFA 1V08A 1OF6A 4ORIA 2HSAA 1A5MC 2VDGA 3WLQA 2MANA 1AA1B 1KM0A 2WZTA 3MO7A 4WGXA 4C60A 1IF2A 4H00A 5DQPA 2DZBA 2J66A 3DBPA 2W3ZA 3BV4A 3LHTA 4J3SA 3TZFA 1V79A 4DUOA 4JTRA 4L6DA 1SO3A 3F2BA 3VX0A 5I3JA 1R30A 1WAWA 4HNOA 4KKXA 2F6XA 3TC6A 3TLQA 2FJKA 4N0RA 1KM5A 1E6QM 2V0TA 1QAPA 5FAJA 4D1IA 3KE0A 4DJFA 1H1NA 5I77A 1U1JA 1GNXA 4Q4KA 3CZKA 4NRSA 1UD5A 4QAWA 1XRFA 3W26A 1HKKA 5F4SA 1EXPA 4LCRA 3WEZA 4PBGA 4WKFA 5BOFA 1VKFA 3VD9A 3NVTA 4JICA 5FL1A 3S9YA 4IIDA 2A1YA 2W62A 4XBJA 5I5RA 2WB5A 3GIQA 2DZPA 3IUHA 4BQ5A 2BS9A 2VEIA 4BK9A 2OZTA 4JTFA 2A3EA 1TZ9A 4GUIA 1LT8A 1Q3NA 4HPHA 1NJJA 2FKPA 1E0WA 1E6ZA 4IFKA 1ITUA 5CLTA 3GNOA 1H7RA 2BOEX 1PIGA 1TRDA 1RJQA 1E9LA 4PMJA 3E2QA 1E1FA 1LG2A 3B0XA 1GG1A 1OVDA 2OX1A 1QATA 2P1FA 1XBVA 3N15A 1UR0A 1FUYA 1FCVA 1DVJA 3MANA 3S8HA 1NQ6A 1FH8A 1KD0A 3V0SA 2CBJA 1XSJA 2P50A 3GR4A 4WDXA 4CCZA 4JEJA 4OKDA 2ZFAA 4UNKA 1C7SA 1H61A 3QOKA 3B8TA 2J7BA 5CC7A 5H91A 2WO5A 4J3UA 2WMGA 3IK4A 5HMFA 3RJYA 3GYCA 1DJXA 3V16A 2A3HA 3M41A 4JYFA 1XH1A 4FXJA 4O12A 3LCGA 1YYAA 1ME8A 9RUBA 3HQNA 2X0HA 5K9CA 1HVQA 5FESA 4H6QA 4MWAB 2VDHA 4FIQA 4OT7A 1XC4A 2J78A 1Q66A 4NQ1A 1JCTA 1A5CA 3TSDA 2GK1A 3BAIA 3OZOA 4MNKA 6REQB 4GYKA 3ISIX 2OZ8A 4O28A 3RLHA 2HEJA 2YLAA 4O19A 5A3HA 2RGMA 4AD1A 5MHBA 4LYRA 1PIIA 5HXMA 5CJNA 3CTTA 2EG8A 2Z28A 2ANUA 3I6TA 4Q8OA 3VNJA 1VYSX 3WDQA 1XCXA 3E9AA 4YTQA 4H8VA 4A6GA 4H6EA 1W3KA 3LK6A 5G5IA 1W9UA 3OZPA 4GPNA 3GHRA 4H9TA 3UR2A 3A4JA 5DT7A 3N6JA 5DCDA 4KEVA 1LRTA 1C8VA 4LRSA 5MKGA 1W9VA 1A80A 3DYMA 2R91A 3ATYA 4M7SA 4NJHA 2NVCA 4IUGA 4Z42C 5AECA 4NASA 1JZ8A 1VLIA 1MW2A 3QZEA 2BSLA 2AAMA 1EP1A 4JL2A 2BGSA 2HZGA 4RW3A 2QF7A 3QR1A 4QCFA 1H2JA 1O7AA 4DJFD 5C2GA 3MWAA 3QGAC 3VK5A 1X7FA 5LKYA 3W7PA 3ABZA 2PDJA 3MSRA 4ZL1A 1A3HA 1QHOA 2XDFA 1LBLA 1ISVA 5HMSA 2EGZA 4H9YA 5AFDA 3PSVA 1W1VA 2I9UA 1GGOA 3QM3A 3GX9A 5BYWA 4YPJA 1T41A 3IS4A 2CXGA 3NR0A 1GQKA 4AZ5A 4CGTA 4N6FA 4Y6GA 1LP6A 2X30A 2WSKA 3SN4A 4IGHA 3QQ1A 4ROQA 1L9WA 3ZYZA 3FYYA 4ACZB 1RLCL 4WHBA 1Q6LA 3TYBA 3IAPA 1A5NC 1O4UA 2KX9A 3VNDA 4UOJA 1UP2A 4PTDA 1ZAIA 2WZMA 3E74A 2PLCA 4Q4OA 4DJEA 2XH0A 3FKRA 4HYWA 4Q8UA 1LWJA 1BYBA 1AH0A 4OV4A 1XC6A 1UR9A 3TIMA 5BXSA 3CT7A 4GIRA 2OQHA 5M5DA 3PHAA 4FI4A 2NQ5A 4FOJA 2AMGA 3M0XA 3O8AA 3C2EA 2UY3A 4UTIA 3NQ8A 1GZGA 3OHMB 5M1TA 4ZFMA 5M2FX 4PTXA 4QR6A 4QXIA 2VDIA 2HCVA 3PF3A 1K7EA 1A0CA 2A7PA 2GWNA 2QS8A 1HW6A 4UR8A 4FA3A 3II1A 3M0HA 3B0VC 1K3UA 1AODA 4KPLA 1GVEA 1PKNA 4A2SA 4DO7A 2BY1A 2Y85A 2EXOA 4JS3A 3AU2A 3N17A 1L6GA 1GVOA 1KM3A 4N9BA 1GHRA 1GOOA 4KCWA 3QY8A 4BJHA 3QN3A 3TP4A 2XM1A 3SR7A 3CT2A 1KFWA 3WLNA 1BGGA 2QULA 1TG7A 4ZBCA 4UTFA 3M16A 3AHYA 2DZUA 5H8PA 4R3UA 2OYKA 1CDGA 1NY1A 3E0VA 3OIXA 2QQ6A 3ONBA 4O54A 3F4NA 4AZBA 2ZZ2A 1W3IA 1SPQA 4JTCA 2POTA 3HV8A 3WD2A 4GD0A 1O12A 1NTHA 2QCFA 4CVUA 3VNYA 2EPLX 1TE6A 1HJVA 4RDWA 1SFTA 3I4EA 3U9IA 3EBVA 4BWLA 1F8IA 4H19A 4K7VA 5LA2A 4H9ZA 3K1DA 1FCQA 3TYDA 1IR2A 2V5DA 4GFIA 2A6LA 4JTSA 2ADAA 4HNNA 4RNJA 5CQ1A 4GBUA 3PFMA 4G2DA 3GH4A 1XLAA 2JKPA 2WVTA 2XGBA 3W2UA 1H50A 2E1WA 1J6OA 4MJMA 3Q45A 5FJJA 2QJGA 3R25A 3SCWA 2G0WA 3A3HA 3CB8A 4DJFC 3O6YX 2VEPA 1UYQA 3GWQA 2J7DA 5AKQA 5LNWA 4DBEA 2VEGA 1OBAA 2C79A 1EGZA 1RCXB 5A5WA 2OGYA 1UH3A 4D8LA 1UOZA 3VMNA 1OSEA 1GKPA 3T8LA 1K8CA 1QPOA 4TOQA 5C7HA 4C6BA 3T2QA 2OPJA 3G1DA 5LHFA 3TTQA 3L65A 3SCQA 2H8XA 1FVPA 4XD4A 2VX6A 5JIWA 4KF1A 1X96A 3UWYA 2UY5A 5TF0A 3R1ZA 1OADA 2I7GA 4LX4A 1EFZA 3BAJA 4KEUA 3H2EA 3B06A 2BX7A 3KBNA 2DZTA 3RLVA 1DE6A 3JS3A 4EVZA 1VGAA 2EPMX 2J8FA 3S5YA 3UG5A 1LL7A 2PDBA 3CAWA 4W93A 9XIMA 2Q8ZA 2AL1A 1JI1A 4DJED 1ZZMA 5DBTA 5CBJA 5A6MA 4DO5A 3R0KA 1M53A 3C2YA 2J27A 4M6QA 3MV11 4KRUA 1P0DA 3NXFA 3CUFA 1MWOA 2Z7GA 1ODZA 2BV9A 2VYOA 5CPMA 1DTNA 3M64A 1T8XA 4UNLA 3REQA 3R0DA 3KRBA 1V6UA 8XIAA 3CIWA 4WX2A 6PTDA 1VFFA 3NO5A 3QW4B 1TE1A 3LM3A 1UD2A 1XIMA 3ANUA 3OQEA 4LS2A 3PBGA 3H2CA 5C71A 1H3GA 2HK1A 1TB3A 2H8ZA 2QVHA 3OYZA 4L4MA 3PG8A 3DH7A 2YFOA 3B9NA 3BDKA 3TYUA 1TO3A 3UU0A 4A8LA 1C92A 1Z32X 2WNZA 2ZC1A 1XRVA 2BNJA 4DNHA 3WD1A 1UG6A 1EX1A 5IOBA 2Z00A 4OQVA 3IIZA 4P8VA 1LQ2A 4JN6A 2E8YA 4LS1A 4DUWA 5LXEA 1QBBA 2YL5A 3TX9A 3LI0A 4LNCA 4BKNA 3HQOA 3WJYA 1A4MA 3N2TA 1WZKA 1BQCA 3ITLA 3DESA 3QMRA 3CWOX 1EXBA 5TAOA 1I2OA 3MMDA 4QEEA 2FHCA 4URIA 1AW5A 1TV5A 5KZ6A 5D9OA 1SJBA 1VRXA 1W8GA 2RGLA 4JTUA 1PDYA 1TRIA 5HK4A 4CKQA 3BMXA 4D6JA 2E5CA 5KTLA 3W7QA 2O9RA 1B57A 2VM8A 4E2VA 2OOFA 1HKMA 3VC6A 4RUBA 3DHUA 5A2CA 4Q7IA 1KM1A 1DIOA 1Y5VA 1P1XA 2DUZA 4H4IA 4JKLA 3RG6A 1VYRA 4O52A 2YXGA 1ZFJA 4C6JA 3LY0A 1WP6A 3PC0A 2PD5A 1CLXA 3SI9A 4PGLA 2C13A 2DSKA 3VC5A 1GQNA 4QG9A 3OA3A 5ECVA 1R8LA 2AQWA 2VRQA 3GDMA 3PS7A 1FWCC 3WDPP 4FR1A 1K03A 4H8UA 1WCGA 5EKYA 3Q67A 4JXCA 1NF7A 3I10A 1W9XA 2HISA 4IIEA 4FB7A 4GH1A 3LMZA 2Z2UA 3SJ3A 4Q33A 3BJFA 4AMAA 2XSBA 3TDFA 3I3EA 2VOTA 3B0UX 2I57A 3GDKA 2QJMA 3XINA 1NWSA 4TTGA 3FYPA 3VTRA 1TVPA 3IIXA 3TTYA 4UCFA 1PKMA 5JXQA 1SZFA 1E55A 3S2NA 3VZZA 1MW3A 1SO4A 3G2GA 4IPIA 4L4PA 3FHQA 1MW1A 4GC4A 3QZAA 2PD9A 3NPVA 5C9WA 4IT1A 2F6KA 2O7SA 3QYSA 1CXHA 3GVQA 4M56A 4NJJA 4DJEC 1KA9F 2GJRA 4PUNA 4C1LA 1YDVA 4CQDA 1W3LA 3MCMA 2YPIA 1R2SA 4AWTA 1UKTA 4JTAA 2P76A 3EWCA 3A9IA 3CB3A 4N2YA 4FNTA 1P7TB 4QE5A 2HDJA 3QMTA 4B5SA 1XBYA 3S1XA 1FWNA 3SUVA 3HU7A 3GC4A 3EWXA 1TTJA 2A2IA 2V2DA 1J0ZA 3WMBA 1IT8A 1V6WA 3ALGA 4XZLX 3TTOA 3WLOA 2ATSA 3L4WA 3CMJA 3TXVA 2G50A 1AZ1A 4IL0A 1VPYA 4GA8A 4OV9A 1K4HA 1MO0A 1NARA 5CC5A 3W27A 5AHMA 2EKGA 4MIMA 5FJIA 4J2MA 2WJZA 3UZYA 2AQVA 3WF3A 1KW1A 2D23A 1X6LA 2RH9A 3K5XA 4GXPA 3USZA 2ZX6A 1E1CA 3SO7A 2PWEA 3KS6A 1M1BA 3OGRA 2X2GA 4HD5A 1XRTA 5J5DA 2CPUA 2V63A 2J7GA 5BNKA 4HSHA 3EDEA 3TN3A 2BTMA 4HP5A 1CYGA 1Y7VA 1I60A 1O5XA 5EMMA 2PTWA 2JEQA 2DT1A 3C52A 2J9XA 1UUQA 3SQMA 2VZOA 4S3KA 5HMEA 2V68A 1T99A 5FSDC 1M7PA 3VUSA 3QTGA 3A12A 4FNRA 4F2BA 3SCOA 1K8YA 3NZGA 3CQIA 5A6KA 3EGJA 1SVDA 3NQCA 1UKOA 2GGJA 4GO8A 4M29A 3GDLA 2PWFA 1HJSA 1XYBA 1M41A 2C14A 2PTYA 3AALA 3AU6A 3IRDA 3S5OA 3T0BA 4YWSA 3DYPA 1DYSA 1P0BA 3QV7A 4EE9A 3EX6A 3QPYA 1I0DA 1S5TA 1PDZA 4FNUA 3WBYA 3ARVA 1BXBA 1K77A 2WZEA 3HPXA 2V2CA 4DX3A 4NG3A 1J11A 3FA3A 4C65A 4FX6M 1WZMA 4HA1A 1N55A 3O3RA 2HS6A 3P6LA 2GUBA 5BXPA 8TIMA 1BWKA 1JIBA 1JDCA 4C5YA 1WNOA 5HJXA 1C7TA 4HTBA 6CGTA 2V9DA 5G4WA 3V0TA 4MADA 1ICPA 3ZLGA 1EDQA 1K1DA 1VCGA 2Y5SA 2C18A 3NQGA 4E2DA 2UY2A 1V51A 4C5ZA 3WFAA 3LGGA 4ICNA 4UTMA 1AZ2A 2CLMA 2WKLA 3APYA 4TQTA 4B15A 1JZ2A 4XD3A 4JEQA 1PJ9A 1HQTA 3OLEA 3MQTA 1MEWA 4CD5A 1PZ3A 2YDQA 3W25A 1PEZA 2WWDA 1PAMA 3EB3A 2RJGA 1NDZA 2G4FA 4MFEA 4HHHA 3CHFA 3TVAA 2V30A 3WUFA 3LZ5A 1DE5A 3NOEA 2VNCA 1XSKA 3PUEA 3PTDA 4NXKA 5AN7A 1TJPA 1W1TA 2ZZ3A 2VO5A 5ECUA 3WUBA 1ZAHA 3RX2A 2CZ5A 1VD6A 1XINA 2TYSA 1Q2SA 2ZKMX 1RBAA 3I4KA 5BROA 3WYZA 2IPWA 1JPMA 2CEQA 2J79A 5IFPA 1WDRA 1OFRA 5D09A 3BTNA 1OFPA 4BI6A 5C54A 4QG6A 1J6PA 3HG2A 3GG8A 4YYFA 1EP2A 1Z9AA 2ZUWA 3LCHA 1CLKA 2WKGA 1NWRA 3ME3A 4S3GA 5IDZA 1ZP3A 4G56A 5E6YA 4YTTA 1BHGA 1KV8A 2PDLA 4O11A 4H3DA 1CECA 1E6PA 3DI1A 4YHEA 1QW9A 1KFJA 3I7RA 3GTNA 3FS2A 3F4DA 3OQ8A 5EMJA 3UW6A 2WZHA 3IJ7A 4XKYA 1D7KA 3RCYA 1AW2A 1W37A 3WQCA 4ZQOA 3W72A 3DKLA 3H24A 3ZZ1A 1OGBA 1ONRA 3E2VA 1ME9A 2V8ZA 2BVWA 4GJJA 5DX7A 5HNNA 1KM4A 1K7XA 2XJ7A 4MYAA 5LHEA 2ESCA 1TQXA 5CAHA 4D6GA 2WPGA 4AD3A 3GIPA 3UZXA 2J13A 3L4TA 4FNPA 3MUXA 2NX3A 3L2LA 1NSJA 3WQ4A 3GBEA 5DANA 3WJZA 3VE9A 5JH2A 2O55A 1SJDA 4Q4SA 2TAAA 4C90A 2GVLA 3STEA 3O05A 3DENA 2A3AA 2C15A 4FS9A 3QH2A 1GW9A 1R3YA 3NSXA 1ZJHA 5HJLA 1S3TC 4AG0A 3KVMA 1EYWA 2VELA 2IQTA 5REQA 1KR0A 1BRLB 2XFRA 1DJNA 3AWOA 4ECLA 1I2RA 4P7LA 1CB2A 3QV9A 2QUTA 4JNYA 4XTIA 2OSYA 3B4UA 2VUYA 2GQ8A 3K4WA 1MRQA 5AZ1A 1XPYA 4RE2A 4AC7C 2ZUNA 4F4RA 2J7CA 2CLHA 3VDCA 2WMJA 3EOSA 2MNRA 3BLFA 4RNFA 5BXTA 3V36A 2WBGA 1PIFA 3TONA 3TWBA 5I2UA 3S6TA 4NX0A 4A29A 1GORA 2FHFA 4B5VA 3D3AA 3FOKA 3SDOA 1JI2A 3CWHA 3OZYA 3ENLA 1YE4A 1FWIC 3WELA 3GVRA 1XW8A 2PWUA 4Q4QA 3LGEA 5EMYA 3H26A 1O94A 1XDLA 1TV3A 1TWDA 1SW7A 1OCBA 4BEQA 1QOPA 1S39A 4AX7A 1S2TA 3APGA 4DBDA 5CC6A 4Q8PA 1DWGM 1WDDA 1VJIA 3ARSA 3CU2A 3TH6A 4ROPA 3ZSSA 1VCFA 3EKLA 4J3ZA 4HNUA 3PTKA 3QVQA 4JIQA 3FNDA 5XINA 3NQMA 4GE8A 3TTSA 2Z1BA 1E15A 2W61A 4YU1A 3HZ3A 3CV1A 1VFOA 2NV9A 4O1AA 1PCWA 3AMLA 2XISA 5LNSA 2PGEA 1YDYA 3G3DA 1QK0A 4ALDA 1XYZA 2XSXA 3L4ZA 4Q7BA 4TR9A 1JDDA 5J8LA 3EKZA 4XZWA 5AC8A 3H4XA 3QQ0A 4BR1A 4PCPA 4EWJA 3W7OA 2WSQA 4P8XA 4XAYA 3L67A 2YA1A 3B9DA 3G1AA 4YWIA 1H1YA 3WH8A 4LAMA 6ALDA 1ZTVA 5F7UA 3FVDA 3VGDA 4UB9A 2UV8G 2XH7A 3QEZA 3OGVA 3HV9A 4U2ZA 3FXGA 1MNZA 1KCKA 3G3MA 3P61A 1JXKA 3G1FA 1U1HA 3HA1A 4XD5A 4RE3A 3ZJ8A 1AK5A 1KKRA 1HL9A 1EC9A 4LXFA 3C0LA 1TUXA 1SW0A 5HQLA 2NX9A 3L4VA 3T0DA 3W1TA 1ZUAX 5JBEA 2YL8A 4MY9A 1IQ8A 5CBBA 2I5GA 1H0IA 1LUCB 1XKJA 2V3EA 3LSCA 3UERA 1ICSA 1J2BA 4HNTA 3TOYA 5DF0A 3RJXA 2ZX7A 4X63A 4C1NB 1HJWA 4C7DA 4AX6A 1VLWA 3M0LA 3OOQA 2E9MA 1BYAA 1GG0A 5E0FA 3W85A 3IIOA 1CGVA 5I07A 4UQAA 3QTPA 3FA5A 1JZ6A 3A4XA 1IEIA 2BLEA 4IIHA 4G1NA 1B30A 3WQWA 3CUZA 3CPGA 3L2MA 3C61A 3LNPA 1L8NA 2CLEA 1JYVA 1HL2A 3MP4A 2ACSA 3OPSA 1OT1A 1E71M 4ZE5A 2F8QA 4RE0A 1CXEA 3R0UA 3UZ5A 3O6CA 2QCHA 3GLCA 4UFHA 1HJXA 1JPKA 1SSDA 2BXZA 2CLIA 5G4HC 3VOFA 4DAIA 3KDNA 4HOZA 3GXIA 2XGIA 4ATWA 4K36A 4Z2LA 2DW6A 1X1NA 4AY1A 4CU8A 1BF6A 2ISWA 3W3OA 2O0TA 2G96A 3VVGA 3THCA 4MNLA 3PBWA 3BLPX 2NVDA 3LXAA 2IQDA 3R4IA 1MVYA 1Q6QA 4V28A 1VJSA 2FMOA 3T4CA 4WEVX 4YN5A 3N73A 1Q4NX 3JU2A 2C0AA 4IIGA 4CNNA 4CUCA 2IPJA 3H2MA 3SUWA 1NDVA 3W28A 1TZZA 3ARXA 5DBUA 4IMAA 4LVGA 4GJIA 3E38A 3OVQA 4ICMA 4O0QA 2QGYA 4AF0B 3V5FA 3WMCA 2GJPA 3A3XA 3MSDA 3CQHA 4B5XA 3HMCA 5FSEC 4PZVA 4GUGA 4ZVJA 2GGIA 3IVUA 2WVSA 1Q2RA 1YLVA 1FWFC 3DX5A 5AVHA 2XIIA 1YNPA 1JF6A 1D8CA 3JZEA 4A8NA 4J2PA 1HNYA 3E96A 4AIEA 3TW6A 7REQA 4U10A 2G97A 2PLJA 3G0UA 4IICA 5E9XA 3W88A 1I2PA 2NW0A 2J9ZA 3GUWA 3TR9A 4NKCA 2AL2A 4UQ9A 2QGHA 3NPXA 1QTWA 4K2SA 1LQAA 4EXQA 3H55A 4DM2A 3SCNA 5CAKA 3A13A 3M0MA 4IWWA 4JKKA 1TTPA 5LA0A 3L0KA 3ARQA 4M6VA 2OQLA 3A21A 3BC9A 2PSNA 3M0YA 4PFHA 4DUXA 3FJ6A 3W07A 4X9YA 1TVNA 1PVNA 3OEXA 3UGRA 1QR7A 4ML4A 1SFJA 2ZDRA 4B3ZA 5E9AA 3VKBA 4ZR8A 5EMKA 1K6AA 1RAKA 5CLWA 1DEDA 1B3WA 4CLMA 4AWUA 1XUUA 3S0CA 2C8NA 4HB7A 1ZU8A 4HPJA 4Y9NA 2BG5A 1ZBVA 4O4WA 4CEXC 3EAUA 3UPMA 1L6WA 3GAYA 1AMKA 2CWNA 3UETA 4F0KA 4IL2A 4AZGA 1RP8A 2YDSA 3N2OA 3W6MA 3WKZA 1X39A 3N4AA 5FAGA 4EXAA 5B7ZA 3AHTA 3FN9A 5D4YA 1K9DA 2XFYA 5EB8A 3NPWA 3CHCA 3LCWA 3PZOA 2XWDA 1RK5A 1VBJA 1O1ZA 2VGGA 4GZEA 5C9ZA 2Z1KA 3WDJA 2HPIA 3G1SA 3LCIA 4HN4A 4Z1CA 1TV4A 2DZXA 2Y8VA 3WLHA 3H7VA 3M5VA 3ZT7A 5I06A 4H8NA 3A23A 2YLLA 3BV7A 4D71A 1PWLA 3TAOA 4X0VA 1AQ0A 2BDQA 1KFCA 4GFSA 2E4TA 1OF8A 2WC4A 5H2ZA 1W6TA 2HPMA 4IM4A 1BVZA 4FO4A 1KCLA 1US2A 2YXXA 4WKHA 1XLEA 3OU8A 3BZJA 4L9YA 3KL5A 4IQDA 4DF0A 1NOFA 1E56A 2D1ZA 4QIUA 3OVPA 1VAHA 3BW2A 4CNTA 1A0DA 1I45A 4G8TA 1GVRA 1OT2A 3EA3A 5D9MA 3V7PA 4MKSA 2V3DA 3IK2A 3ITCA 4UFJA 3LI1A 3GHSA 4YYCA 4MAZA 3N04A 4GI9A 3BWWA 4RV3A 3S2LA 4F48A 3RX3A 4GLEA 3VO0A 1FKXA 1E3ZA 2W79A 3L12A 5I78A 5HUOA 2FVLA 4MG4A 1RHCA 3SQSA 2GGGA 3R6IA 3TFXA 1I8JA 5AYXA 2JGYA 5A6SA 1BYCA 4WXZA 4IUOA 1YX1A 3AS1A 3B8WA 3NGFA 2OKOA 3R10A 3W81A 3MUIA 4JL1A 1T6MA 1IHIA 1A5BA 1POKA 5EGRA 3ABQA 2Z6JA 2VFEA 2D24A 1VC4A 1SSGA 2X09A 1OK6A 4DXVA 5I3DA 2FLIA 4TU1A 3E3HA 2OSWA 4IP7A 1EJUC 2YIHA 1NP2A 1ZLPA 4PUWA 1IEWA 5E6ZA 3LHYA 4EPKA 1AUSL 1JGIA 3K46A 1N8IA 3WNKA 4GUFA 1M9HA 3A9BA 1WO2A 4D8AA 4K8EA 3AIVA 4ZQMA 3IV3A 2OX4A 3NDZA 5D33A 4DEFA 3LHZA 4HMCA 3WENA 2D2JA 4LUTA 3N18A 3BUVA 1GYLA 2PF0A 5I0DA 3NEVA 3CNYA 3MMTA 3MJMA 4A3UA 4PTVA 3RO8A 5CBIA 4LALA 2PFHA 5HNRA 5LIYX 1XISA 3IJDA 2HBXA 2R6OA 3PSWA 5D37A 4GCAA 1L0PA 4ERAA 4REQA 2A7RA 3BL3A 4AEFA 4S3EA 3RLGA 6XIAA 2CHOA 1E6RA 4I5RA 3QV8A 3LLXA 3KVKA 2CNCA 3MP3A 1QO2A 1I1XA 3G0SA 4HJFA 3N11A 1Q8JA 3W1AA 2A7NA 3ZT6A 4N6EA 4BZYA 2VHLA 5GNXA 1J79A 1XR2A 5H6HA 3BAKA 2DVXA 4NZ4A 4EF9A 4ZCWA 2NT1A 4B5UA 1M68A 4HOWA 4LV9A 3CPRA 2REQB 3HN3A 3ALFA 3QGVA 3B9OA 1XPGA 1T96A 3QV6A 3A47A 4RW5A 4H04A 4WK9A 1R5YA 3JUGA 2CBIA 2QR6A 1H0GA 5C7VA 1NOWA 2FVMA 3F5LA 3QSTA 5BZAA 4KCUA 1I2NA 1E6XM 2DUAA 3HPFA 3W2KA 3DZ1A 1UOKA 5BU6A 2C1IA 5LIKX 2E68A 2GWGA 4W8BA 5ABTA 4ZMGA 3MC5A 2G5WA 2YJQA 3H4WA 2R9RA 4ATDA 4OWGA 3LGDA 4NUWA 2Y7GA 3FVMA 4IHCA 3S42A 2RDUA 1J10A 3GXPA 3R5EA 3V3WA 2YCJA 1AL7A 1ODUA 4GKLA 4C6NA 2ZXAA 1H49A 2FGLA 4H8HA 3CHVA 1HO1A 3W73A 3OZMA 4ZO7A 1IWPA 5TBOA 3TNBA 2DGAA 4JN8A 3LBMA 2QV4A 4FZIA 2YCLB 4M7TA 1ZBWA 4ZQRA 3TQVA 4NZJA 5CSSA 4R34A 3WL0A 3LYEA 3RIKA 1UR4A 3QLDA 1ADSA 3KTCA 1RY8A 1CPUA 1ONXA 3SRDA 2B4GA 4U33A 5TNVA 4TMCA 3KP0A 1CXKA 3W7DA 1V3HA 3HF3A 4S23A 3GY1A 2XIJA 4ASTA 2D2HA 4HT3A 4GQGA 4ZO8A 3SGUA 9XIAA 3QZ6A 1Q63A 3TC7A 1OZMA 5LGXA 2HXUA 2X8RA 3P62A 1M7XA 4XIMA 2QAFA 5AZ0A 1XFBA 4JTEA 4JHZA 2YX0A 2G3FA 1UP3A 4L1GA 4RZ5A 4PCNA 4RLIA 2J7HA 4CN6A 2IKIA 6TIMA 4MZYA 1J18A 2B7OA 4HU0A 3U48A 5A8PA 4WDTA 1EJTC 1UD6A 4H7ZA 5KINA 3B3DA 1NQKA 1QI3A 1K02A 4G6CA 3NAVA 3GU1A 1AH4A 4EOUA 3NIYA 3PZGA 2DIEA 5XIAA 4S39A 4EPDC 1YIXA 2YL6A 1EJVC 1KM6A 3SIMA 1Y5WA 1SZNA 2GVEA 3UA3A 2X42A 4W8LA 3KWSA 1FH7A 4I7UA 4MZ1A 2ALRA 1ZJAA 2YSWA 3VDGA 1KRMA 2G3IA 2QXWA 1CNVA 1GOXA 4NJKA 4DBSA 3OODA 2HMCA 3GZ3A 3EEZA 2GDUA 2JALA 2DQWA 1EHNA 3G77A 3USBA 2Q3RA 4FLOA 4LV4A 3W22A 1DJZA 8A3HA 1SU5A 2PZ0A 3CAVA 1W5QA 4R85A 1UQZA 4ZFCA 5A95A 1JYNA 5LIXX 1H41A 2D20A 3U3HA 1OFAA 3MVTA 3W01A 4JQ2A 1WKYA 4X2PA 5CCZA 3DKJA 2LLEA 1VZWA 2XVNA 4R7OA 5I7GA 3HFTA 4IGNA 1U5HA 2ABBA 3TOPA 3M0IA 1VCVA 1BLIA 4AD0A 1PKYA 4FMVA 1JAEA 3E2RA 1TJRA 3LBCA 4HCDA 5E1QA 2XG9A 5BW6A 1S1PA 1X97A 4G7FA 4UTWA 5AHEA 1HJUA 4E8CA 3DFOA 5D32A 1FCBA 1VFLA 1TPUA 3AISA 4IMCA 4NNBA 2WVUA 1GYNA 1OZQA 5A6AA 1E40A 4NZFA 4C6DA 1VFTA 2E6YA 1G1YA 3GKAA 3B9AA 2EG6A 1Z7AA 4GZJA 3W75A 5CZJA 3VGEA 2CYGA 1YEYA 4LC6A 4PSRA 2R24A 2WYSA 2QCNA 4B3LA 2X1TA 5ENLA 1XF0A 4OBRA 4L80A 2DV0A 3D47A 3NM1A 3AOFA 3ARZA 2ISDA 3EMQA 3RMEA 4A8RA 3M1ZA 3GDBA 1EB3A 1OHLA 2NVAA 1JYXA 7TAAA 3M5XA 3QMSA 1TA3A 4O1BA 5CJ5A 1GVYA 1B3OA 4BA0A 2INFA 3ZMRA 2PTXA 5FL0A 3N9RA 3MCNA 2X16A 4I3GA 3OW1A 2WJFA 1CWYA 1EF3A 3MZNA 3COTA 4D1JA 2H6RA 1JNDA 2XU2A 3PK7A 3G1YA 1TFVA 3N3MA 2XUCA 1UBSA 2QDDA 1E5NA 3QY7A 4F9JA 1E0UA 1PE1A 3EDFA 2CFFA 4P8UA 3UEQA 3CH9A 4DBUA 1XIEA 1S2AA 4AY7A 4AWSA 1YBQB 2DDXA 2INEA 4O53A 4Z1YA 5ABFA 3QFEA 2IPGA 5DXYA 4Z17A 1IIGA 1CENA 4LY8A 2XGZA 2GVJA 4E2OA 2X7WA 1JFHA 5K4ZA 5D8WA 3SADA 3SJNA 3PJXA 4V15A 2V6AA 2Z26A 1IE7C 1JL8A 2Z7KA 3W37A 4AH7A 2A6NA 4F0HA 2YCEA 3BLIA 1UW9A 1GVQA 5CH9A 3KLLA 1QW8A 4O8AA 3PR2A 3ITXA 2J6VA 1LOLA 3R11A 5A94A 3H70A 3UPWA 3LHUA 3GKFA 1WDWA 4C6PA 4RDVA 3IJ6A 1QHZA 3FEMA 2FHBA 1J8VA 3WLRA 2OT0A 5LA1A 1UCWA 1MNSA 4JIRA 3PPFA 1SFLA 1ZY9A 3MUAA 1FP8A 2C7FA 3GD6A 1S5MA 1XIGA 3T1GA 2Z4GA 5CKSA 4A3YA 4LYQA 3MVIA 2CKSA 3KBVA 2I14A 3W38A 4MB3A 2E6DA 3NOYA 4UBPC 1V3LA 1EZWA 3DFNA 3DG7A 1GKQA 3MI2A 2EQDA 4GQQA 4DRSA 1FQ0A 3E1F1 1XIHA 1FWDC 4TV6A 1M04A 3K8KA 4K7YA 5AYZA 5B80A 4IGMA 2GL5A 2GQ9A 5D8ZA 2Y4SA 5HBFA 2BASA 4E3VA 3W2MA 3UR8A 1GPFA 3BPWA 2J74A 3W23A 4IFOA 1NF0A 3P80A 4DB7A 1W3TA 1W1PA 1JYWA 4HNLA 2C91A 4EWND 3T40A 2DIJA 2QZRA 3DBNA 1VFSA 2OSXA 4HHPA 3CUIA 2WLZA 1MZRA 1EHAA 1M3UA 2Z25A 3RUBL 2ZYFA 4CQBA 5D30A 4IX2A 3UWEA 4CEUC 3DFTA 1BAGA 3H2OA 2L5HA 1ITCA 3P3BA 1QNQA 3HIJA 4D9PA 4LVAA 2Y7DA 4P2VA 1OFQA 1EF2A 1W1YA 5DT5A 3RX4A 1UIOA 2JFEX 1UJPA 3QPZA 1C9DA 2F84A 4MHBA 3DG3A 2PDGA 3BG9A 4PULA 4BQ2A 4RZ4A 4MJZA 3RPTA 1H7OA 1OM0A 3O2LA 1UR2A 3QC0A 1HG3A 1M7JA 5GPRA 3TMLA 1W5OA 1ITQA 5GNZA 3NO1A 1DWIM 4AHOA 2ASHA 5DMMA 3TZNA 4M8UA 2Q8XA 3HGJA 4OE7A 4DZHA 1V0KA 4MMWA 1UD3A 3ZLFA 2R1MA 2YFNA 3LCXA 1Q13A 3WBEA 5A6LA 1EX5A 3L4UA 4OVXA 4O16A 1HKIA 2PS2A 3DFHA 1ME7A 5DMLA 4AVOA 2W5FA 3WL1A 3TW7A 3TFCA 3E0LA 4F0SA 1V02A 4LVBA 4QLKA 4B92A 1KXTA 3BG5A 1E4LA 2DH2A 3QHNA 5BCAA 1VBUA 1JCNA 3VDAA 4OOZA 3C2VA 1NEYA 1WOAA 3NQ6A 4PYSA 4D72A 3BSMA 3WDIA 4YTUA 1F74A 1V02E 1CW2A 1GOQA 1IXQA 4FLRA 3BQ5A 1H7PA 3EXRA 2PWVA 2YBUA 3GNPA 3JVAA 3CC1A 3S2JA 3U4FA 2DT2A 1JD9A 3IAQA 3QJAA 4QM1A 4MOZA 1JFXA 4ZSTA 3VNKA 3GFZA 3MJYA 2WNQA 4OTKA 1FH9A 3C0SA 1LLWA 7PTDA 2C71A 3ZT5A 5DLCA 3W1LA 3BANA 3MSYA 1MYRA 4MLJA 1XDJA 3FKKA 1PWMA 3EXTA 3GXTA 4AYSA 4LAKA 4PR4A 1XM3A 4ERGA 1TJ2A 1QBAA 2WC3A 1EQPA 3KBWA 1W5PA 3E49A 2TPSA 1J12A 4AHPA 2QPUA 3ZR5A 4UOQA 3P67A 2BHUA 4A3QA 3MHUA 3IIPA 2P10A 1F3TA 2GUYA 4UXDA 4TVDA 1R3TA 4YHGA 1IT7A 3WBWA 2D73A 4K8GA 1K6WA 3HJZA 4X2RA 3ZVHB 2WM0A 1UMLA 4A3HA 1PX4A 4MJ2A 4N9CA 3BLEA 5C9XA 1CGYA 3KW3A 4OZOA 1OX5A 4XVEA 2EPHA 1IEQA 3MHFA 2QNEA 1JPDX 1LBFA 3CQKA 1UD4A 3P84A 4MKNA 2C19A 3AYTA 3MWCA 1JVNA 3KOXA 3BCDA 4MPKA 3W7MA 3LLDA 1VYPX 1DTUA 1GVIA 4PTWA 2V5JA 3KHDA 2CKRA 3AIRA 5CPTA 3FV9A 2OVLA 3MUY1 2A3CA 1AJ0A 3CMFA 2F38A 1XYAA 2NUXA 2QUUA 2WVVA 2VRKA 3STGA 3RMJA 1J0HA 3PZUA 1JNEA 4NT0A 4PL2A 4CNUA 2BY0A 1O6IA 1YTDA 1R7AA 5H8MA 3S47A 2GOUA 3K1GA 1B1YA 3KTXA 4PMYA 4L65A 4LC8A 2ZZ7A 2HNHA 5FD0A 4FX7A 4JX4A 1JDFA 3PPGA 1JZ7A 3CYVA 1V3JA 3VZXA 1UC5A 2Z0IA 3HG3A 1JF5A 4AIOA 5BMWA 1S2CA 2RDWA 1KBIA 4JTLA 3C4UA 1S5NA 4F9DA 2ZQ0A 1XCFA 3VABA 1S2UA 2GQ3A 4QEHA 1C8QA 3ELFA 1W1IE 1R38A 2FTWA 5HQEA 1V6VA 3BVJA 3T2PA 2FIQA 4ES4A 3KVLA 1A5LC 3IV8A 1B3ZA 4HKPA 1HGWA 1PZ1A 4GHRA 1GZ1A 2WNWA 4H7CA 1XH2A 3WH6A 1V0MA 1X38A 1OCJA 3CEUA 4YCOA 2C1GA 4AQLA 4PEKA 3LTPA 2OU4A 3HGSA 3MSGA 5F2LA 1ML1A 1IZCA 4GVFA 3RU6A 2PC8A 2OG9A 4XZIA 2D0HA 1U1UA 2PDFA 3NQAA 3PZNA 1FHLA 5A69A 1O60A 2ZX9A 3EDJA 5TIMA 4YMZA 4QHRA 3VKCA 5LNVA 1ZL1A 4HPNA 3HBLA 1F07A 2ZRWA 5FIPA 3O1NA 1EC7A 2PGFA 4IFKB 5HPOA 4JFSA 4D8ZA 4NAEA 3H22A 4BCEA 3M7SA 1WV2A 4HNCA 4K38A 2VC5A 2PI6A 2EG7A 1TPH1 3SAZA 3MKKA 4PH6A 1QNSA 5A6BA 4LEQA 1PX8A 2KAUC 3UJEA 4ML9A 3L4XA 2B7QA 1KV5A 2OLHA 2E28A 3QW3A 4IQLA 5CZTA 1VBHA 1XI3A 1FXPA 3EOLA 3WK1A 3GH7A 3M6YA 4D6EA 1BSIA 1W32A 4E4UA 2EJ1A 2POZA 3AHZA 1H60A 1EDGA 1XCWA 4D2JA 4JIIX 2J24A 1A0EA 3ANYA 3TYCA 1B3YA 1TV8A 3NURA 1JPIA 3VX1A 2E5BA 3MS8A 1QU4A 3TC3A 3LN3A 2DU2A 4H6RA 4BI7A 3U5YA 1NFBA 4DHGA 5G2HA 4GG9A 1UIPA 1LRQA 3KXQA 2VWSA 4HYVA 1TUFA 4PBFA 4GQ0A 3UZZA 1TCDA 2GDVA 1H5VA 4DAFA 2GK1B 1XG3A 1R2TA 4XWUA 1NVMA 3QR3A 4MUZA 3ZWSA 1PCKA 1OCNA 1XUZA 4DWSA 2FZDA 5M03A 2D3LA 2DJXA 2WBKA 3N14A 4PRWA 3G8EA 1DWAM 3IGSA 1S1RA 3V5OA 1UP0A 4L4LA 2RFGA 3T44A 4JHOA 1LL4A 4MYXA 4PA8A 1OK4A 4KEMA 2CLLA 2BOFX 5KZEA 1FWWA 3DGRA 3OLIA 4HBKA 1DIDA 1DJIA 2XH4A 5D9NA 4W86A 3BJSA 1G9HA 4M6UA 1ZENA 4U31A 2OR2A 1UASA 3BH4A 4Z08A 1JR1A 4I8DA 1TTIA 1OABA 1KWGA 2JQXA 2B7NA 4K68A 1TPB1 4ZTXA 4PB3A 4P8WA 1W5MA 4R5EA 3IJ9A 4NAFA 1QUMA 3LDVA 1Y0EA 4H9UA 5MKGB 5AOUA 1RJRA 3AC0A 5AC5A 5HNTA 2PWHA 1KM2A 2HVMA 2HS8A 4XZMX 4H2HA 2O9TA 4AD2A 3VKJA 1T0OA 4QP0A 2OEMA 1XQLA 5JH1A 3ITVA 2NX1A 2E9BA 4WDWA 3DAQA 3VI2A 3CPUA 3C3UA 3UWUA 3CL7A 3UBPC 2IKGA 1E9ZB 3FCPA 2RDXA 1JXJA 3AYRA 1F3WA 4U2YA 3QQWA 1OIMA 3G22A 3KL0A 1M01A 3NGJA 2XFWA 1ZRQA 4Q8QA 3W6YA 4RZ6A 4I90A 3WQGA 2IXVA 3NL5A 1IEVA 4IQJA 3AI0A 3C0QA 1DXIA 4HHMA 1D7FA 3W7EA 3C2RA 3GSMA 2GGHA 2FZMA 4ACYA 4HU4A 3O15A 3PJWA 3TW9A 3BGJA 2CZFA 4NZ5A 2OLSA 5PTDA 3ZFHA 1L6FA 2ISVA 2OEJA 1FWRA 3INPA 3THUA 2NXIA 4NU7A 2ZDSA 1E6NA 1QWKA 5IFTA 1Q7MA 1MQQA 5A6BD 3NQEA 4GRSA 2FB2A 3FX4A 1QHPA 2ICSA 5AC4A 3KRSA 3KUMA 3PZVA 2D3NA 2CCRA 4HOXA 4JFWA 3P82A 1E9IA 2FZNA 4NF7A 4LUSA 3ZS4A 2ALDA 1P1MA 1W3NA 3ARWA 4PUMA 3ERPA 3NCOA 4CD4A 3MDUA 3N9SA 2FFIA 3UWZA 1QO5A 4LGXA 4R33A 4LW7A 1JZ3A 2V5CA 2PLKA 1V0LA 5J5RA 3CV7A 4E0CA 1ELSA 1REQA 4HGXA 4W85A 3B8SA 5GJNA 3K8MA 1ZB5A 2D2OA 1B4EA 4QS5A 1M6JA 3OBKA 2GYIA 2GGEA 1FWSA 3QR0A 2HRWA 3WLMA 3LHVA 2EKCA 4DWSD 3WNLA 4XKMA 3HPZA 3RNDA 4LFYA 1W56A 3WF4A 2HXTA 1A53A 4L56A 3VNMA 1UWSA 4TIMA 1FHUA 3TAKA 3UF9A 3ZWTA 4L4OA 1O66A 1RQBA 1E72M 3F4CA 3TSBA 2GVGA 2WMHA 3UG4A 1Z3NA 4GNJA 1NDYA 1O5QA 2DORA 4DBWA 4QDMA 3NL3A 2CHRA 4CNOA 5I03A 2CLFA 1VFUA 3GW3A 2PLMA 4NNCA 2JIWA 4YLWA 1MDRA 4WY0A 1EJXC 4ENLA 4AZ7A 4CCDA 4GJ1A 3V5CA 4HHLA 3TE9A 2Z1XA 3RU8X 1OJXA 3I7SA 1CIUA 1Q6CA 1T40A 1PV8A 1R3SA 2F9RA 1LG1A 3IANA 4PB4A 1KFBA 1XX1A 3P60A 4GI6A 1UWUA 2G3MA 4H2CA 4HIBA 3TEVA 2UY4A 4WIWA 5FA5A 1FOBA 5I3GA 4XG1A 3C3NA 3W2JA 1JJKA 1QNRA 1YPXA 3IJIA 1N82A 4PN2A 4C6FA 1W31A 2BHZA 1F3EA 5HMDA 1JCXA 4E38A 1DBTA 4DLMA 4J3TA 3T2OA 2F61A 4JHMA 2BGQA 4MVAA 1YQ2A 4AEOA 3K4AA 1MZHA 4JOMA 5E70A 1Q6EA 3HB9A 3L5MA 4BF7A 4P61A 4JZ5A 5A6TC 1AJ2A 4IG2A 1UR1A 4DM1A 2PDXA 3U2CA 2JEPA 3L7RA 3CAKA 1X6NA 1QJWA 4WJEA 4JBRA 1RV8A 3IRSA 3A6OA 1UUOA 4RXFA 1IT0A 3SY5A 4O13A 4BF9A 2ON3A 3M47A 3UWWA 3AICA 4Q7NA 4ZXLA 3E02A 3UXKA 3CUJA 3AUOA 2FH6A 3KDOA 4JTQA 4LANA 3POHA 4O15A 1EBGA 3EKGA 2Y62A 3T07A 2IXUA 3S9IA 4GH3A 1XV8A 3SGGA 5DMNA 1J96A 3TV8A 4IJCA 1LQ0A 2YGYA 1R0MA 3R13A 1OB0A 2G3NA 4JFTA 3F7JA 1JULA 4Q8MA 2ZXQA 1SMAA 3CZLA 3REQB 3A4AA 1ZGDA 2QDEA 3RM9A 2C0HA 3GW0A 3S5NA 1HFBA 1ONWA 1LWIA 3CBWA 2D0FA 2VVNA 2F2HA 3GHTA 3L0NA 3RM4A 4EKJA 1XLGA 3BSHA 1TWIA 3O0FA 1KRAC 4DYEA 1TPC1 4E6MA 3N2CA 3NZQA 3UWQA 3QFWA 1EOMA 1XLMA 4LRTA 4PUKA 3Q65A 5G1YA 2ZZ5A 4DWSC 5T26A 3EOUA 5C5YA 3KFTA 2PURA 1XLBA 3L4YA 1OX4A 3SSJA 3BURA 3MPGA 1QWGA 5I3KA 2Q09A 3V1PA 3W83A 4J28A 2GSHA 4FHAA 4AIBA 3RPDA 4I9JA 1ZQ5A 2CBUA 1U5VA 2OJPA 1CX9A 5DRIA 4M19A 3WLPA 4UTTA 4AZCA 4UNIA 1E5JA 2WAGA 1EZ2A 1DQUA 2VFFA 4LOCA 1K7FA 1XBZA 2PRLA 2NWRA 4XTDA 1C29A 3W87A 3TJ4A 1FFQA 3GFYA 1XICA 3UD6A 1F9CA 2E25A 5I3IA 5LXXA 1ZNNA 3WD4A 3NFUA 1J5SA 4IMGA 4ZODA 3CL8A 4FXSA 2PEVA 3BOXA 4GYJA 3EX2A 4O1CA 3IJQA 2O9PA 4FLQA 1LWHA 2XWEA 4HMNA 4G7EA 1NIUA 1HXJA 3GNXA 1WUFA 4JTKA 3STFA 4Y9PA 4D6FA 3F4WA 2YXOA 1J5TA 1A5UA 4XQ6A 2ZIDA 1WKFA 1QMLA 2ZTKA 1BXNA 3UPBA 1YDNA 3P0WA 2IUZA 2V81A 3EB2A 5DCEA 1JCJA 4ADUA 1UWTA 1L6YA 3RFAA 1UR8A 4K6AA 2OOGA 1V6YA 4GWEA 4LF2A 1KGXA 1MFUA 3PN8A 3M0JA 3WG6A 1RK6A 5HNUA 1A47A 3LRKA 4OGZA 4F3HA 1LOSA 1WKDA 3EYPA 4GY0A 3ZJ6A 3GTXA 2XFFA 3LEPA 4N4QA 2BB0A 2CERA 8RUCA 4HMDA 1KKOA 3TQPA 4FOUA 4JQ3A 1PSCA 3CH0A 2QHAA 1IZJA 1KXQA 5E5CA 1A3XA 3FGCA 5E93A 4R9OA 1MRAA 5EPDA 2ZOXA 3F2CA 4MUPA 5C70A 4HU3A 3HFYA 1EKOA 3RLUA 4DZIA 2XIMA 1Q6GA 4I6KA 1KBBA 3TR2A 2R1PA 2SFPA 5CSUA 2PP0A 4ZZ9A 4NRRA 3W1XA 5A8QA 4PCSA 3R79A 2G8ZA 3ARYA 1Q6FA 2BVYA 4HA4A 4W89A 3RHGA 3DUGA 1CB7B 2QCDA 1G69A 1FBAA 4K8HA 2YCKX 3W2NA 1IWAA 3GE7A 4R7WA 1WXYA 3W29A 2DY3A 3S2MA 1XH0A 4ZOAA 3L5AA 3V0UA 4GINA 1KXHA 2CZEA 3GG7A 1E1CB 1CZ1A 2A21A 2XSAA 3RK8A 1XIDA 2WMKA 1XYCA 3I3BA 1SZGA 3THAA 1VFHA 1Z6KA 1PZ2A 3M07A 4UMCA 4AUBA 5K9XA 3WNPA 2X1UA 3P81A 1VQTA 4GNKB 3ARRA 5FF7A 1ISYA 2FGZA 2PODA 4FOKA 3LV5A 4GACA 4B4HA 2VT0A 1TVLA 2WJEA 3VGBA 3WQVA 3WEOA 4FIRA 4JIEA 1LBMA 3PY2A 3C8NA 1LZOA 4UFKA 2FZ9A 3BMWA 3ZJKA 3ABXA 2B0MA 2X7VA 1QVBA 3VUPA 3RR4A 2OTDA 3P2VA 3CASA 1UWIA 3OBEA