2I16A

Human aldose reductase in complex with nadp+ and the inhibitor idd594 at temperature of 15k
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
312
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ultrahigh-resolution study of protein atomic displacement parameters at cryotemperatures obtained with a helium cryostat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 110
structure length 312
sequence length 313
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2i16A00
4IJCA 4JQ2A 1Q13A 1IEIA 1PWLA 4XZIA 3LN3A 4F40A 2PD9A 4HMNA 2PF8A 4JQ3A 4JTDA 1Z9AA 3UZZA 2PDKA 5DANA 3NTYA 4XVDA 4QR6A 3EB3A 5C7HA 1FRBA 2I17A 2PZNA 4NKCA 1K8CA 4IGSA 4JQ1A 4YVXA 4GQ0A 3BCJA 4DBSA 1EKOA 2PEVA 1MRQA 4FZIA 1VP5A 1AH3A 3DOPA 1RALA 2HVOA 3UWEA 1RY8A 3C3UA 1EF3A 2HEJA 3CAQA 5LIYX 4JTQA 2AGTA 3CAVA 3H7UA 5AZ1A 2PDQA 3R8GA 1PWMA 3G5EA 3LENA 3DN5A 3LQLA 2HE5A 2ACUA 3COTA 3VXGA 3U2CA 1ZGDA 4FALA 2WZMA 3UZXA 2J8TA 3LQGA 3N2TA 2PDIA 2HV5A 3M4HA 3WG6A 3LZ3A 4AUBA 1QWKA 2PD5A 5JH1A 2IKHA 4YVVA 4DBUA 1A80A 1M9HA 4WEVX 1LWIA 1IHIA 3V36A 3R6IA 1VBJA 4PUUA 2P5NA 3RX3A 2FZBA 1YE4A 2FGBA 3CMFA 4XO6A 4PR4A 4WDTA 1AZ1A 1RY0A 2VDGA 4HBKA 3LD5A 3ONBA 2IKGA 4EXBA 4YS1A 4GACA 3G1RA 3FX4A 2DV0A 3UP8A 1AH0A 3GHSA 1R38A 3EAUA 2A79A 5HNTA 5HA7A 2IQDA 3UFYA 3LBOA 1T41A 2ACQA 2BGQA 3LUTA 3CV6A 1HQTA 5LIWX 1OG6A 3D3FA 5LIKX 2WZTA 3B3DA 2IS7A 2DUZA 2PFHA 2IPGA 3BV7A 2PDCA 3R8HA 4JTAA 3WBWA 5M2FX 4R9OA 4QBXA 4LBSA 1HW6A 2IPJA 3EB4A 2PDNA 2HDJA 2PDWA 3R94A 1ZQ5A 1AZ2A 4I5XA 3LEPA 4WGHA 3N6QA 3F7JA 3WCZA 2FZ9A 4LBRA 4Q3MA 4JTRA 4QXIA 1YNPA 2PDMA 3R7MA 3M64A 2ACRA 2ACSA 2IPFA 4FA3A 2CLPA 4PRRA 1JEZA 3GHRA 4QX4A 4JIIX 3GHUA 2C91A 1X97A 2IKJA 1UR3M 3CV7A 4PMJA 3CASA 1YNQA 3LNMA 3O0KA 4OTKA 1LQAA 3P2VA 1MZRA 3UYIA 2INEA 3UG8A 3GUGA 1C9WA 3T42A 1Q5MA 3MC5A 5KETA 4Q7BA 2PDLA 2QXWA 4XZMX 2ALRA 2INZA 1US0A 4GIEA 1ZUAX 4ZFCA 4XZNX 2FZ8A 2F38A 4WDXA 2PDUA 4PUWA 3BURA 4LAZA 1MI3A 3WBXA 2PDPA 5AZ0A 1ADSA 4DZ5A 1QRQA 2I16A 3M0IA 4RPQA 3S3GA 2R24A 2F2KA 1S1RA 2IKIA 4ASTA 1Z8AA 3Q67A 4LB4A 4XO7A 1Z89A 3UZWA 3FJNA 1EXBA 4L1XA 2HE8A 5HNUA 1T40A 2IPWA 3KRBA 3MB9A 1GVEA 3WBYA 2PDFA 3O3RA 5JH2A 3V35A 1EL3A 2R9RA 4G5DA 2NVCA 4JIHA 3RX2A 4XZHA 4IJRA 2PDYA 1AH4A 1PZ1A 4XVEA 1ZSXA 4ICCX 4LB3A 4GABA 3UGRA 3H4GA 4H7CA 4XAPA 1S2AA 1S2CA 4EXAA 2PDXA 4MHBA 4PRTA 4DBWA 1X98A 4WDUA 4GCAA 4JIRA 2NVDA 3H7RA 4JQ4A 3V0TA 1XJBA 1PYFA 3R58A 2PDGA 3V0UA 4L1WA 4XK2A 2HVNA 3UZYA 2DUXA 4YU1A 4YVPA 2BP1A 2PDBA 3V0SA 3RX4A 2FVLA 3ERPA 4H8NA 3ONCA 3GHTA 4WRHA 1AFSA 1PZ0A 2FZDA 4JTCA 5LIUX 4GQGA 2BGSA 1XF0A 2IQ0A 1XGDA 1YE6A 2PDJA 3BUVA 3Q65A 1Z3NA 1SM9A 1X96A 1J96A 3QKZA 1S1PA 2ISFA 4FAMA 4LAUA 4WDWA 3R43A 2PDHA 4XZLX 4GA8A 3LZ5A 4JQAA 5LIXX
chains in the Genus database with same CATH superfamily
4B5NA 5CZ0A 2IMRA 1OGGA 1JCMP 4AD0A 3RRAA 4F40A 2X1SA 3IV3A 1H1ZA 4NZ3A 2QCDB 1PUDA 2W5FA 4AWUA 3DG7A 2CKRA 2G3NA 3S1WA 3W88A 1V0MA 4LVBA 2CZFA 2I17A 4JQ1A 1ZENA 1BWVA 2PBOA 4M81A 1Z48A 5L9FA 1PBGA 3S2MA 5HWJA 4NJIA 4UIOA 4LALA 1VEMA 4FZIA 2EEXA 2FB3A 2FLIA 1JYWA 3C6CA 3ZS4A 1JRBA 3PSWA 4P8VA 3C3UA 4JL2A 2QHAA 1CIUA 3CAVA 2A85A 1DL3A 1MW1A 1TPEA 2QCNA 4PGLA 3W2UA 4ZOCA 2I5GA 4EACA 3TN5A 3VNIA 2YDSA 3B8UA 3SCSA 2OTDA 3U6WA 3VXGA 1KB3A 1RV8A 4FALA 2WZMA 3U3HA 1V6VA 4E38A 1ELSA 2QF8A 1CTNA 4OVXA 4U3AA 1IXOA 1NQ6A 3FGCB 4DLFA 1UKTA 3TEVA 3L68A 3W28A 4NNAA 4JOMA 1EP2A 5G5IA 4XAZA 1UKQA 2C79A 1VBJA 1TZ9A 3LMYA 3SECA 4ZFMA 2AL2A 1GYNA 1QXLA 2F7FA 2ZE3A 4ZXLA 2VDGA 3MI6A 1U5VA 5AC7A 1FP9A 1EOMA 1UP2A 2Z2AA 4GACA 3GVGA 4R33A 3WFZA 2Q8LA 4DF2A 2Y63A 4Q4PA 2DUAA 3R0DA 4FPSA 2Y8VA 5CPQA 2F2HA 3KBWA 5DRIA 1KRBC 3VIFA 5HNTA 3TIMA 4P5UA 3CU2A 5EU9A 5ABGA 4QJ3B 2XN0A 5F1VA 1UH2A 5FEXA 3WNNA 2VGGA 1JCJA 4AEOA 3D3FA 1Z44A 3BMVA 3HG4A 2OGJA 2IS7A 2DSVA 3H2AA 1XCXA 1EWEA 6XIMA 2BOGX 4IIDA 1BYAA 2A3AA 2AL2B 3P82A 4JXCA 4JTKA 5I2UA 3AROA 3B0XA 3GTNA 2BWGA 3TTOA 4AD3A 3ARQA 4AXNA 2W27A 5FD0A 3BPWA 1BGAA 3N6QA 5C2GA 2B4GA 2BB0A 4RW5A 1EJVC 4GQBA 1MEIA 3A9IA 3T81A 3QOMA 2DSZA 4YCOA 1RJPA 1U22A 4O0KA 2V0TA 4O1EA 3PPGA 3ITGA 4QX4A 3MO7A 3TN3A 2DIEA 1JPMA 1E72M 1MZHA 3SW6A 2WCSA 3N9RA 1NWRA 4ZQRA 2PCEA 3QW3A 1E40A 4CVUA 5C6MA 4UMBA 4WSHA 4C6EA 1V0NA 3T2PA 2C7FA 3I3DA 1ODZA 3N4EA 2V81A 3TNBA 1HP4A 1UR8A 3NG3A 1SW0A 5JMUA 3ZVHA 1NM9A 1OG0A 4LAZA 1CXLA 4CNOA 4U2YA 2CW6A 3VD4A 4GXMA 5G4EA 3WQDA 4D71A 1YDOA 2CYGA 5TD4A 2NWRA 1PDYA 5CJ5A 4KEZA 3GZAA 4O53A 1FCQA 3B9EA 4PMOA 3BAIA 3WD4A 2R24A 1V5XA 2WO5A 4NJKA 3W7DA 1W1VA 2ISSA 1FOBA 4URIA 2HPIA 1DOSA 4NZ4A 3DEQA 1R3TA 3MA8A 5DT7A 5FJTA 1HL9A 1O60A 1E4NA 1U83A 4PODA 2W9MA 2D0HA 1T40A 1PB0A 1XSKA 5FCZA 4GXPA 2FFCA 4MY9A 4ZOBA 4OT7A 2CBJA 3EBVA 2NUWA 4ATDA 4D6GA 5JIPA 3ITLA 3PUOA 1J4EA 1DWJM 3QPEA 1Z32X 3AS3A 3VZZA 1ZBWA 1K7XA 1XYZA 2ZUUA 4W8AA 4Z08A 4HHLA 2W4XA 2PB1A 2WCGA 1FFQA 1BXNA 2QQ6A 5BOFA 3O06A 1EH9A 1FHDA 1TPB1 1IV8A 2AKMA 1B31A 1S5MA 5MHBA 1K7EA 3H7RA 4WIWA 2BLEA 5CLWA 3QV7A 3S5OA 3N2XA 1RK6A 3EDDA 5MKGB 4J3WA 4FF5A 3CHVA 3VD3A 2ODOA 4H2CA 5IRPA 2DUXA 4DF1A 4BJHA 3K4DA 3G3MA 2J25A 1E6PA 2J74A 1R8LA 2JFEX 5BXRA 1XQLA 3CHDA 3S5YA 1XCWA 1HJSA 3GHTA 3FAWA 3NQFA 4OUIA 4N2YA 2WWCA 3HGJA 1Q6FA 2P1FA 4RJEA 5HQEA 1XLMA 1FWGC 1ZP4A 3GB6A 3SFKA 4KQNA 1QOPA 3TYBA 5KITA 1GQIA 3PAOA 3KXQA 3PFMA 1K8ZA 3WQ4A 1RLCL 2C13A 1SM9A 4QJ4B 4IFKB 4IXXA 2WNZA 3E38A 1R6WA 3WD2A 1JAEA 2ZRWA 2AAAA 1TJPA 3NSMA 1C8QA 3UCDA 1OX5A 2J9XA 4WDWA 1PAMA 1KQZA 2DZBA 3QZ6A 1SW7A 3L4VA 4JQAA 3UEQA 4JQ2A 1PWLA 1S38A 1EZ2A 3GBEA 1UD2A 4J4KA 1SJBA 2VTFA 3AUOA 1VH7A 1YBQA 2GPTA 5HNNA 2JF7A 1MRAA 2Q01A 1OK6A 4Z2JA 2WMJA 2QV4A 3LS9A 3PF3A 1VD6A 1K8CA 1W91A 3W1TA 3EA2A 1ONXA 3RLHA 4PCFA 4DJFA 3FKRA 3VNKA 4BK9A 2IUZA 5D4YA 3G1FA 5FL1A 1Z69A 1DJQA 4Z1DA 4MG4A 3DC0A 2QVHA 5F2GA 3AZSA 4AMAA 1EEPA 4PUJA 1HTIA 4QG9A 4HMEA 1UC4A 3G22A 3W7LA 3P80A 3N6HA 3BLLA 2YCIX 2J8TA 5D04C 4ZQNA 3R5EA 3WLKX 4W9TA 4Q33A 2R1PA 4TX9A 3WF0A 5JH1A 1AJ2A 1V6WA 4E8DA 3M0HA 1Q8AA 1O6IA 2VC5A 2VOMA 3AIUA 3NZRA 4FNPA 4MNMA 4LFYA 1P0DA 3AHXA 3BG9A 5C0QA 1SFTA 4ZGYA 1A0DA 3Q58A 3BLDA 3CB3A 2DVTA 2P0IA 5CPSA 1QT1A 4RDYA 1BEUA 3G1RA 2J88A 3PK7A 2ZRUA 3H4XA 2OSXA 1SW3A 4LS0A 8A3HA 3CWHA 4YNGA 4KESA 4M1RA 4XIAA 1U1JA 6XIAA 3R0UA 3MZ2A 2V30A 3HFYA 1I60A 1TTPA 4AIEA 4L9ZA 5AHLA 3N9SA 2HVMA 2HNHA 4ZQMA 4CNNA 4MB4A 1ICSA 3PY2A 3CNYA 3LCHA 1A5OC 4Q32A 5T91A 4ZVJA 5FKYA 4GUFA 4NNBA 1O5RA 1E71M 3OVRA 4DYJA 1Q2SA 4JNYA 1MQRA 4CQDA 4JTEA 2O9OA 2ISVA 3R13A 3KVJA 1YRRA 1OT2A 3EB4A 2AAMA 4FXRA 3WMBA 4JX4A 4PZVA 5CC7A 1F6YA 2VDHA 4NF7A 5B80A 1H0IA 3I10A 3F4DA 5A94A 3ZLFA 1CLXA 3QEZA 1ODUA 3SUWA 2OO6A 4GPNA 3SCPA 3OHIA 3QFWA 4LW7A 3ARWA 2DH2A 2JE8A 1QR7A 4PMRA 1R2RA 3F4CA 4ZENA 4L6HA 1FCBA 4H6RA 3UGVA 3CBWA 4D2JA 5T9BG 3ZR4A 2BNJA 3BW3A 1C93A 3V5OA 1E56A 3L4XA 1UR3M 3LNMA 3THUA 4OTKA 4FNRA 1W5MA 4DY1A 3VOIA 4WCJA 5BWFA 4CNPA 1W9BM 3UG8A 3ABRA 3L9CA 1Q5MA 1IR1A 4PH6A 3ABSA 2EPKX 3PC0A 4JFTA 1SQ7A 2DPEA 4AHPA 4HNUA 4UTWA 2XPKA 3N3MA 5F2LA 3W1UA 1VJIA 5A5WA 3H2MA 2CBVA 3LXBA 1BRLA 1ZBCA 3IVTA 1TMQA 4UFHA 3TW9A 3M0IA 1GQKA 1I1WA 2FYMA 3AISA 4X0NA 1O5XA 1SR0A 3K2GA 1W3LA 3MANA 1BQCA 4B5WA 1HIZA 3PZQA 2ZQ0A 4XO7A 1Q6QA 2XZ9A 1WZKA 3NOYA 4A3YA 3F03K 4WY0B 4JD4A 4NRRA 3C5QA 1J5SA 1XBZA 4L65A 1J0HA 1GEQA 3LHTA 3T0AA 1GZJA 2OYKA 1T5AA 1YPFA 1XISA 2XDFA 5T26A 2YLAA 3N2MA 4XAFA 4C1NA 4TU1A 5REQA 2V5BA 4OHQA 4JIHA 3FK4A 1FH8A 1FDYA 1AMKA 4CCZA 1DBTA 3MV11 3ZWTA 3RO6A 3WDIA 3SQLA 3VC5A 2WSRA 4XAPA 1XLJA 3KCJA 1UZHA 3KDOA 3HQOA 1KM2A 3W0KA 4IHCA 3SGGA 1W9UA 3NQGA 3EPNA 3VIPA 4MDPA 3DHFA 4PRTA 1NEYA 1HN1A 3BLKA 3F4NA 3NXFA 4XWUA 2FVMA 3ZJKA 2D2JA 4RNHA 3RUBL 3E3HA 4M56A 1XBXA 4JQ4A 4ZQOA 2YJQA 2ZDRA 5GQBA 3EX6A 1LUCB 4RKAA 1NAL1 3OZMA 3VNJA 5I3FA 2PP3A 3ZXWA 4BHYA 3GM8A 3P60A 1RZMA 4JKLA 4K6AA 4KRTA 4XZWA 3RX4A 4IP4A 3DESA 3T0BA 4NJGA 2YL6A 1G9HA 3NNTA 4C6NA 4Z17A 4IFOA 2GJPA 4ACZB 3EWYA 3AMLA 1VGAA 3DG3A 4AB4A 1QK0A 4US5D 4HNVA 1KBBA 1KXVA 1YPIA 2OKOA 1GJPA 1H1NA 5HJYA 5LA0A 3QHNA 3B8IA 1TUXA 2FMNA 5ABFA 1FX6A 2CERA 3GU2A 3QKZA 4G1KA 2WANA 3Q2DA 2CLIA 2Y8KA 3SI9A 3CGTA 3EXSA 4MB5A 1J2BA 3SCOA 3W1LA 4MUPA 5G2WA 3HBLA 2PS2A 3N11A 1A3HA 4B5VA 4IJCA 4GGHA 1DXIA 3U4AA 3W7GA 3JZEA 3HU7A 2FKPA 1IR2A 3G3DA 3KP1A 2E4TA 4LTSA 3WLPA 2G0WA 3IJ6A 2PU0A 4XAGA 2TMDA 3LHYA 4BS0A 2NV9A 5FEPA 3C2YA 4H9TA 3SUSA 4GQ0A 2QV5A 1EKOA 3GNDA 3R8RA 2WHLA 1KM3A 5FACA 1MO0A 1UUOA 5CKSA 1SFSA 4RUBA 1WKDA 5JBEA 2QUNA 3KTCA 4I9MA 4NYUA 4KIEA 4LF2A 4M7TA 2WHJA 3NQEA 4XZBA 3ZO9A 4DUWA 3LENA 5A8MA 2VUYA 4UTIA 3WQPA 3I6EA 2V63A 1MEHA 3RHGA 1B9BA 1RP8A 4IIGA 3U2CA 3PUEA 1IF2A 4QG6A 1G4EA 3W7JA 1EUNA 1G69A 3WBAA 1QO2A 1BD0A 2OCZA 2A1YA 3W2LA 2RKXA 2UY5A 3DC8A 4ZTXA 4GJJA 5I07A 2GQAA 4YN5A 1UKPA 5HUOA 1NQKA 1AZ1A 3WH9A 5DBTA 4C6MA 4ZBCA 4F9DA 4E2DA 3I7RA 3RPDA 5HMFA 1VB9A 3O63A 3MHGA 1X8FA 4FSAA 4EXBA 2ZC1A 1R3SA 1XPGA 1OC5A 3GQYA 4M6VA 3CT2A 5XIMA 3BLIA 4EE9A 1HJXA 4LNCA 2ONEA 1A5NC 1AJ0A 1S5NA 2VT0A 3BCFA 4RW3A 1GG1A 3CL6A 3AS1A 1EHAA 3E5BA 3W6MA 2E6DA 3WLTA 4Z0SA 4LEQA 5TAOA 4XSLA 3N73A 2YA1A 1X6UA 3CTLA 3TXZA 3CZJA 4JICA 4KWUA 4QBXA 3FEQA 3AQUA 2WC4A 1OGBA 1UR0A 1B1YA 4AF0A 2NX1A 3WZ0E 4LYKA 3O6AA 4J3ZA 1EGMA 3NO1A 2DIKA 3GH5A 2QF7A 3VTRA 4GFIA 2GVJA 2ABBA 2FZ9A 3IK2A 4LBRA 3QR0A 3CL8A 4I3GA 3B4YA 3DFPA 3WQEA 4OE7A 1IEVA 4GXWA 5A6BD 1HKKA 5T8GA 4L64A 4UBPC 2ACRA 4LX4A 4G6CA 3ZM8A 3OQ8A 5DY2A 3GHRA 1ECQA 1QPQA 2Z6JA 2GSJA 2PRMA 5IM51 3UJEA 5I5RA 1WDQA 1RK5A 2QDHA 3WL0A 1KR1A 3EWXA 2PGWA 1A3XA 1HJQA 1IT8A 3OVGA 3CQIA 3D46A 5HBFA 3GK0A 3UWQA 4M6PA 1R3QA 2ALRA 4WF7A 1CGYA 2PDUA 4UNKA 3I4KA 7A3HA 1MDRA 3AYVA 1DV7A 1R2TA 4BWLA 4ZR8A 1U30A 4FIRA 4QP0A 3WDJA 3AICA 3U5YA 1HJUA 3PTKA 1FXPA 1KRCC 4GC4A 3LXAA 1OABA 3PZTA 2GJRA 5HR6A 1ITCA 3KUMA 3MMDA 1G5AA 1OF8A 4M6UA 4V1YA 1E55A 3KLLA 5K7JA 1M6JA 4NASA 4GWEA 3B4UA 2V3DA 1DE5A 1O1ZA 2DQXA 5LA1A 5FF4A 3PJTA 2HCVA 5G4WA 3SUTA 4TV5A 3CM4A 1XLGA 4O8AA 1US3A 1XGEA 5C7VA 4YWIA 2A3LA 2TPSA 3EWZA 4UTTC 4H04A 1HO4A 5DMYA 3I4EA 3N15A 1O68A 1QMLA 2B7QA 1XLCA 3STGA 3WLJA 4J1OA 2XSAA 3KS6A 2D22A 1PKLA 3WQFA 4LY8A 1PZ1A 4UFIA 3LSBA 1XH1A 4YTRA 3VK5A 2WNQA 3WDPP 1VFOA 4UQDA 3KOWA 1S2CA 4G1NA 3VPLA 4EF8A 2FHCA 3A22A 2CWNA 4IT1A 4MHBA 4HNTA 4BEQA 2OVLA 3W07A 3S83A 4WDUA 1NOFA 5H8PA 1W3TA 3MI3A 4LAMA 3E2QA 4I9JA 3F5KA 4P8UA 1J2WA 2VUNA 3GH4A 4ZXOA 1X1NA 1ICPA 3RF9A 3KBVA 2J8FA 2WNWA 2GK1B 3IAPA 2HVNA 1H62A 1BF6A 1XLKA 5FJRA 3QKEA 1XIEA 4GZIA 3SN0A 4NAEA 3L0KA 4U31A 1X6NA 1TJRA 3FCPA 1J12A 5F4SA 3WH7A 3ARTA 3ERPA 3VIJA 4WRHA 3DYPA 3RGTA 3SR7A 1W1PA 5AYYA 5LIUX 4DPQA 2FTPA 4GNKB 1SJCA 2WJZA 3NIYA 5DN1A 3S5SA 2Z1KA 2TAAA 1SUXA 1EBHA 1XGDA 1VF8A 3ARRA 4LWWA 2XISA 4C91A 1MQQA 3ARYA 1G4SA 4D1JA 5BW6A 1Z3NA 5DLCA 4S3DA 3GZ3A 1X96A 2WHMA 1J96A 3CH9A 1QVBA 1XYBA 1V8EA 4L6OA 2YA2A 3IGHX 2XFYA 4Q8MA 4V1XA 3O7UA 2CWXA 1UP0A 3WF1A 3STCA 3C4UA 3BZGA 3JU2A 3LZ5A 4O1DA 1WZLA 2Z1BA 1W1ZA 4JYDA 1TZ7A 3PZ9A 4ROPA 1EB3A 2Y85A 3CIWA 4EXQA 4BF9A 1LT7A 5DANA 4D8LA 2VZVA 4M0XA 4YHGA 1JPKA 3G0XA 4IGSA 3MWAA 3YPIA 4E2BA 3VZXA 4W5UA 5AVHA 3WO8A 1UWAA 2C14A 2PURA 4WX2A 3TYZA 1YLVA 1LF1A 4GKTA 1MUWA 3P3BA 2E5BA 3INPA 1MNZA 5I3GA 3QSRA 3H7UA 4AHOA 1I2RA 2QGHA 1J0YA 4IGHA 2DZXA 3H2OA 4LBUA 4X2PA 3RJYA 2ZX5A 5U4NA 2XIQA 3P84A 1SO3A 3HA1A 3ZT7A 3QC0A 2WYSA 2FZNA 5HINA 1NFBA 3AZRA 3DHDA 3WLOA 9CGTA 5CC3A 2PD5A 2ZDSA 1O7AA 3G77A 4PC8A 3T7VA 3KVKA 2BMBA 4W7VA 4A8IA 5MKGA 1SMAA 1XIDA 2BVYA 4WJEA 3QYSA 5A69A 1UZ1A 5AFDA 1BG4A 1XS2A 1G67A 4TQTA 3M43A 4J9JA 3L12A 4KWOA 1QW8A 3ONBA 5I6SA 5EFDA 2F6KA 3ZJ7A 3GG0A 3OGVA 3OZYA 3VOGA 1R87A 3CS2A 1KQYA 1J5TA 5ABEA 4O19A 2YOCA 3QGAC 2CBIA 3QPYA 4H9ZA 2RDUA 4A3RA 2RJGA 2A79A 1E9LA 3GVWA 5HA7A 2EF9A 3RR1A 2J75A 4F3HA 5IDZA 2QZRA 2ZZ7A 8XIMA 5AYZA 1L9WA 1ITXA 3WNOA 1RD5A 5DRCA 5I0DA 5A6MA 5DQPA 3CUJA 4DAIA 1KV8A 4I7VA 4FF7A 3HGSA 5D2WA 1TE1A 1UH3A 4GUGA 3SGZA 4C65A 2WMKA 1VJSA 1QNQA 3RM4A 1TKKA 2DZAA 4ZEPA 4F0RA 1REQA 5DCDA 3L4ZA 2PDNA 1YXDA 4MJ4A 1CPUA 1QBBA 1UD4A 2R8WA 4FOKA 4W86A 1V3LA 4B9ZA 4WGHA 3EPOA 3WD3A 2EO7A 2WLZA 3L5LA 1M7XA 4NHVA 2KZHA 3MUY1 3RK8A 4AEEA 3B06A 2WPGA 1UHVA 4GRSA 3PNZA 4CEXC 4OECA 1VHNA 4M6QA 2C16A 1ECEA 4GCXA 1VPQA 4J40A 3I3BA 1KFLA 3WUEA 2UWFA 3W72A 4U28A 1FWDC 5D37A 1YNQA 1EZWA 3S1GA 3IGSA 2YXGA 2G41A 3BGGA 2HXUA 2GQ9A 1QI5A 3NPXA 3T42A 3M1ZA 2ESCA 4EPDC 3NJ3A 1XSIA 4XZMX 1I9CB 3E9AA 4J3UA 3CQ0A 3MBDA 2EPOA 5K4ZA 2FZ8A 1K8XA 3O6YX 3LCIA 2JBMA 4GUIA 1ZP3A 4LVFA 3RMEA 2C1HA 4Q8VA 3W7KA 3EWCA 4W8LA 4UTHA 2Z25A 4DVOA 3L4WA 3W2KA 1UD3A 4N02A 3W1QA 4ICNA 4MPQA 3NSNA 3HGOA 5LGXA 4K68A 5G1YA 3QM3A 4DJEA 3EEZA 4ZB5A 2VZUA 2CKSA 4IPNB 3O6CA 1PX4A 4GQRA 4MJZA 1AL8A 3P6LA 1K1DA 4WOQA 3LMZA 3UF9A 4KWVA 3CH0A 2HTMA 1VPXA 1EGVA 3UZWA 1QASA 4HTBA 3ECQA 1MDLA 1HT6A 1QW9A 4QDPA 1B0IA 1FHLA 3W73A 3W1RA 1TRDA 4W93A 2HPMA 2W91A 1Q7ZA 1TR1A 2DDXA 1O12A 2KX9A 3E0WA 2O0TA 3A21A 3TR2A 2A6NA 4X3ZA 1JZ6A 4XZHA 2A5HA 1JCXA 2R82A 4NI8A 3E1F1 3U57A 3MUCA 4WR3A 3IV8A 2OQLA 4JYFA 1FDJA 4D6JA 3DFNA 1KM4A 5DBUA 3G1AA 4E8CA 2PBGA 4E5TA 1UCWA 2E28A 1YXYA 1X98A 5AC6A 4FMVA 4AQLA 4QJ5B 4NY2A 4C6BA 4JTHA 1JQVA 1ZJAA 4GCAA 2NVDA 2AMGA 3W74A 5C9ZA 3V0TA 1FTXA 1RH9A 4HOXA 1W8SA 3GY1A 2PDGA 4QGCA 1Q7MA 1JD9A 5LA2A 3EWBX 3S0CA 4Q4RA 1NOWA 3GR8A 2AL1A 1DTNA 1QAPA 4IIFA 4HPJA 1P0KA 3EA3A 2G37A 3ONCA 1JI2A 4MNJA 4JHOA 4NYYA 1TV5A 1A5UA 2EXOA 1DYSA 4GQGA 4S2BA 3VOJA 1POKA 1XYFA 1C8XA 3RITA 2QCEA 1W2VA 2J79A 3BLOA 3BTNA 4C7DA 4CQ9A 3CJPA 1S2WA 1WDWA 1TJ0A 2HQAA 1KM0A 2QPXA 2QYGA 3SQMA 2VGFA 3W7IA 3B8VA 2ZX8A 3MI2A 1WUEA 3VZYA 4GIRA 1OFOA 2QS8A 4MKSA 3A4AA 4GIYA 5FF2A 3L23A 1OFEA 1AW5A 5JBFA 2X40A 3TQVA 4F0HA 1GVIA 2E5DA 5AY7A 2OGYA 2VDIA 3ZMRA 4W5ZA 4LVDA 3CUHA 2LLEA 2NV2A 1E1CB 4TXEA 2H6RA 1VCFA 4L4MA 3EX4A 3WF3A 4K38A 1ZU8A 3LOTA 1AQFA 3NQVA 4WHBA 3BCJA 4MIMA 2CIPA 2YX0A 4DBSA 1V3MA 2PEVA 1NELA 2J6VA 2ZUMA 1KCLA 1AH3A 3C2EA 1KNWA 1ISVA 2HVOA 2PWHA 4KEUA 1G0CA 2GUYA 4HZ7A 1SPQA 4KIRA 1SSGA 3ZQ9A 2B7NA 4LJ3A 2YCKX 3UCQA 4B5TA 2XIMA 1R30A 2XSBA 4QJ1A 4N9EA 3S2CA 3W29A 3O15A 3W25A 4YTTA 5KEZA 3IIVA 4JZ5A 4L80A 1SZEA 1J9YA 3TTEA 4WZHA 2J9YA 3QR1A 4O1FA 3E02A 3OB8A 1LLZA 3B8TA 3A64A 3QC3A 1QWKA 1V93A 2OLSA 3KE0A 2RFGA 5FESA 5HULA 1GHSA 1TFVA 2VD9A 4Y90A 5C9WA 1UR1A 1JYVA 4EKJA 4GNJA 5E09A 5A8OA 2F84A 2C15A 4CQCA 1GOOA 5CQ1A 2QCCA 1RY0A 2OZ0A 3PHAA 2CC0A 1WP6A 2YZRA 5FL0A 4HU3A 1YX1A 4B2DA 3S1VA 4WKAA 2GWNA 3SRKA 1FQ0A 1LRTA 3UY7A 5K9CA 4K2SA 1KTNA 3TONA 1EJUC 3B0VC 5LXEA 1JCNA 3SDOA 2ACQA 5LIKX 1EC8A 1UA3A 4GJ1A 3DCPA 1XLHA 3QBUA 2XZ7A 1XYCA 2E1WA 2J62A 2X0HA 4ZO6A 6REQA 1JZ4A 1VKFA 4O1AA 1MUCA 3RRXA 1ISYA 3WMSA 1DJXA 2ZVIA 5K9DA 2VEGA 4JPGA 3UR8A 2D2HA 4HSOA 3W81A 4NIRA 3R94A 3DG6A 1ONEA 3C52A 4W89A 1L6FA 4A35A 2L5HA 1B54A 3CQJA 2YXXA 4PYSA 1W54A 4G7EA 4DUXA 2OEKA 3DH7A 1M04A 2YYUA 1SU5A 1EDQA 7TIMA 4U33A 2O56A 1RP9A 3TN6A 3L67A 2AQOA 3THQA 3BLEA 4AC7C 4AD1A 1GHRA 4GGBA 1W9VA 3EB2A 2BHUA 3UJSA 4NT0A 2BHYA 2DZVA 4ZOAA 3CASA 1D8WA 1LQAA 4JTLA 3TVAA 4MYAA 5I06A 1MNSA 2VNCA 5A6SA 3BMXA 3WX7A 4Q7BA 4S3EA 3W2NA 2D0FA 4IMCA 5ENLA 5FF7A 3M0JA 2XWEA 1UPPA 4NILA 1R3YA 4HJFA 4RV3A 1UWUA 2RH9A 4ML4A 1D7FA 7ODCA 3TNOA 1LTDA 1ZNNA 4IMFA 5DELA 2CPUA 1N7KA 2ZUWA 5XINA 4GI8A 5F2MA 3S3GA 3SCTA 1WDPA 3W53A 5KZEA 1RA0A 1S46A 5KMYA 3M5VA 4MUZA 5CSSA 4B5XA 4EANA 2QUUA 3C86A 3SCUA 1KO0A 3UWZA 2I1OA 4KEMA 1YTDA 2CZVA 3K4AA 4BQ5A 1PZ2A 4GD0A 2VRKA 4XIMA 4MWAD 2PTYA 2OJPA 4X63A 1LORA 2QIIA 3NVDA 1TMLA 2XIOA 4Q7NA 2Z7GA 1GJWA 2E6FA 1K7FA 1QW7A 1H41A 3LTYA 5IXEA 1S5TA 3L0GA 4LUTB 4OBRA 1V79A 3QYQA 3RFAA 2XM1A 3NEVA 2BY3A 2FMOA 1KFJA 3QY8A 1W1IE 3QGKC 1XW8A 8CGTA 1VS1A 3HGRA 1J18A 1WKEA 2ICSA 3GXDA 2RUSA 2QT3A 2VFIA 2J7HA 2VC6A 3UESA 4IH3A 3W24A 1FHUA 3JRKA 4PE8A 4GUHA 2P10A 3AJXA 1ZRQA 1XJBA 4XAYA 4LUSB 1E43A 2XWDA 4L1WA 4MSSA 4XK2A 4F66A 1JUEA 3UZJA 1DP0A 5HJXA 2TYSA 1OIFA 2QAFA 3MVTA 3RLVA 1CXHA 2VC9A 5HJLA 3VD5A 4CN1A 5FJIA 2YSWA 1Q45A 3XINA 1I4NA 1XBYA 1XM3A 4JTCA 4DAFA 1C7TA 4J28A 5A3HA 4CN6A 4EF9A 5FIPA 3SN1A 4Z0JA 4HYRA 4HPGA 1L8PA 3WUFA 3AXXA 4WJ8A 5JIWA 1OWQA 4HZ6A 1FCUA 4C1NB 3ZOAA 3A3WA 3LLDA 4I7WA 3I68A 1BYCA 5CH9A 2J7FA 1M1BA 3WLHA 2OYLA 2A2IA 2G8ZA 3QMSA 4XZIA 4FK9A 2WZIA 3NZGA 4NJJA 4QE5A 1Q6CA 3TFCA 4CNSA 2DGAA 4JTDA 3O16A 4ZL1A 4MWAA 3WL1A 5AECA 4NXKA 5IFTA 1ESWA 3K5XA 1V3IA 2GVYA 1QI4A 3EXRA 2EPLX 3FV9A 3DXIA 4MJMA 3RDKA 1XH2A 4ZA0A 5TF0A 5DT5A 2HJPA 4F48A 1GVYA 4Z42C 1E9ZB 2DW7A 4UOQA 4ZTYA 3E0FA 4WSJA 1S2VA 1RY8A 2J4GA 1EF3A 3PTMA 4JN6A 2ZUSA 3WD1A 4A2RA 4C1LA 5EBAA 1DE6A 1G01A 4PTMA 3SUUA 4GBUA 4PSPA 3C0QA 3Q37A 4TO8A 3CEUA 2B0MA 4H9VA 1HKJA 2ZXDA 2VCAA 4KKXA 3ATYA 3B03A 2ZA3A 2X41A 2VELA 1CB7B 3LXCA 2FJKA 5GNXA 2J27A 3OZOA 1E4IA 2GJNA 2QPUA 3K8KA 1M03A 2IKHA 2E40A 1W5OA 2RJHA 3S6OA 2X8RA 4KCUA 1VRXA 3A4WA 1UROA 4QAWA 2NQ5A 1NWUA 5I3JA 2WZEA 3O1NA 1LBLA 3OGSA 4X2RA 1F3XA 3TQPA 8RUCA 3S8HA 3BG5A 3TYEA 2PP1A 4NJHA 4FLRA 2GDQA 1RPXA 4L4OA 3ZT6A 4B3KA 1NU5A 2CZDA 2IQDA 5EMKA 1IZJA 1DIEA 1QCWA 4UTTA 1HQTA 1W3JA 3E2VA 3EWWA 4LUSA 3AMGA 1ITQA 1P0NA 4GI6A 2WCAA 4WGXA 2OR2A 1QATA 3PBWA 4LS1A 4JKKA 5D9OA 1IWBA 2J7GA 3R8HA 5FA5A 3UXAA 2PTZA 2V68A 3VNDA 2BY0A 1UWQA 3W2MA 1VR6A 5I23A 2DT2A 3ABOA 1ZS2A 4CQBA 1FH9A 1EPVA 1D3GA 1K4HA 3IRSA 4QEHA 3AXMA 1VRDA 4DM2A 8TIMA 2CLHA 2BG5A 2NT1A 1XQKA 4POCA 2R94A 4UFJA 3O6DA 1VFSA 3A9BA 3SB0A 4Y9OA 1I1XA 1V3KA 1HXJA 3VKAA 3AO0A 5BMXA 3AXHA 4GX8A 1K9DA 3L21A 2YGYA 2XN2A 3ANUA 4QLLA 3VABA 3R0KA 5M1TA 2CLPA 1JEZA 3QTPA 4O8RA 3GHUA 4Z2KA 2OEJA 3W6LA 4AH7A 3TCSA 1FWBC 2E6YA 1GQJA 1WXJA 3ARPA 4KGLA 3KBNA 4B9YA 3AIRA 3NGFA 3LTPA 1U5HA 3FSTA 3GXPA 3PZGA 4LC8A 4XSMA 5HDRA 1NTHA 2VFDA 5BRQA 3B9OA 4YJ5A 5TNVA 1ZUAX 4OBSA 2F38A 2DQWA 3BURA 3UXKA 2DSUA 4PTDA 3L66A 3IJDA 5CG7A 3H23A 1F7BA 3HF3A 1A49A 4HKPA 5AZ0A 4R3UA 4FOJA 4MFDA 3ANYA 1AW2A 3W84A 3TTQA 3BW4A 1GG0A 2VVSA 2ZYFA 4JTFA 3RU8X 1EYWA 3H54A 1OINA 1QWGA 3Q67A 3GNNA 4A8NA 3P8IA 1R47A 5U7SA 3MKVA 1PTAA 5A6LA 1JNEA 1MXSA 1QTWA 3ABXA 1QJWA 1GKQA 3IJLA 3VC6A 4TX8A 4WD0A 1EQCA 2XTKA 3WQVA 4UFKA 1WOBA 3G0SA 1PDZA 3TW6A 1XRTA 2VQTA 3STPA 1VFMA 1FWAC 4I7UA 3SUVA 2VQUA 1JQXA 2G4JA 8XIAA 1EGZA 4P8XA 3N17A 4WKFA 4IJRA 2PDYA 5FOOA 1WBHA 3HMCA 2J13A 1R3VA 3T8LA 2BHZA 4IQJA 3AU6A 2E3ZA 1GNXA 3PP7A 4F9JA 4AZ6A 1BFNA 2Y70A 4RE4A 3AIQA 4H83A 4RK8A 4YWSA 1JR1A 3SQSA 3CC1A 1O95A 5LNVA 2GYIA 1J6OA 3GTHA 1QHPA 1NIUA 3TUUA 2PLMA 2WB5A 4AEFA 2BVWA 3IUHA 5EA9A 3S5NA 4HN4A 4IPPA 4O11A 4YU1A 3M47A 4U4MA 1WE5A 1MVYA 3DFTA 3QR3A 2PDBA 2Y7EA 4XV0A 4JIPA 4J5NA 2EJAA 2VZSA 2E8ZA 4V2XA 4GYKA 5LSMA 2Z4GA 3VKDA 1KM5A 5DXYA 4HT3A 1A0CA 3HURA 3JUGA 4FX6M 1Q63A 4CN4A 4NZCA 5CPOA 5BWAA 4ZO9A 1JD7A 1EP3A 3KOFA 3VX1A 4AIOA 2E67A 5BU6A 4UCGA 4RV8A 4CCEA 3I3EA 3VMOA 3WQGA 1K4GA 3LHUA 4L7ZA 1REQB 1Q13A 1NDWA 3PG9A 1BXBA 1DJYA 3LN3A 2YBUA 2PF0A 4QDWA 3B0UX 3CTTA 4D9PA 1TX2A 2W62A 2YKKA 1NVMA 1HL8A 5J5DA 5AHNA 3GXIA 3TJXA 4DO7A 4C6CA 4LYRA 3CPUA 4PL1A 2ZC8A 4XVDA 1XIIA 4QR6A 1RQEA 3EB3A 1YQ2A 4AC1X 3HV9A 2PZNA 1KLZA 2E77A 1EUAA 1PJ9A 2WMGA 4J2MA 2GVEA 1WDRA 4MY1A 4RNJA 2QMJA 4ADTA 1HUVA 3OIXA 3II1A 2XFFA 1UMLA 1OZQA 3L4UA 3L65A 3NSXA 4FX8A 4F2BA 3MCOA 2WXDM 2I14A 2PDQA 3IARA 1RHCA 4HOZA 1WOAA 2NQJA 5C2XA 4DX3A 1M7JA 3WH5A 3PAJA 5CC5A 3A5VA 2PWUA 3DFYA 3R11A 2GJLA 4Z1CA 4AHQA 4A6GA 2FQIA 1A80A 3WDHA 3OLIA 4CKQA 4LYPA 2VHLA 2FGBA 1S3TC 4XO6A 1JVNA 3K1GA 4YYCA 3FVDA 2WKGA 3FHQA 1V51A 4LQ1A 4ATLA 5FJOA 2XGZA 4JHMA 1ITUA 4H9MA 5FI8A 2DJXA 5K2ZA 3VMPA 3T8QA 1Q3NA 1H7PA 3FX4A 1PHQA 3DHPA 3CUFA 4MJ2A 3HPAA 2BVDA 3UWUA 3UFYA 3W7EA 3AHVA 1GYMA 1V0KA 3IUDA 4O28A 4DJDC 2J6XA 3CZKA 3W86A 5BXSA 4XUGA 3RYSA 2P0OA 3LGDA 3GVVA 3TU9A 2J78A 3E12A 4J35A 2Q71A 1CNVA 4ZO7A 3PWIA 2V6AA 4PUDA 4RXFA 1DWGM 2EAWA 4KWSA 4DNHA 1TE6A 4NX0A 5SWUA 1XRVA 2ON3A 4Q8NA 4EK7A 4R9OA 1BHGA 1Z42A 2MUCA 3N12A 3BH4A 2CLFA 4R9XA 1CDGA 2PDWA 3WBEA 4BQ2A 1NY1A 3APTA 3NDOA 3HG5A 3WF2A 3FGCA 1U5JA 3AXIA 3FY1A 1OX4A 5F2IA 3M5ZA 2PDMA 4RNIA 1WUFA 1RBLA 1Y5VA 4IQEA 5C9UA 5HOSA 3UXLA 5A6KA 5IHRA 1NP0A 1WAUA 2VYOA 3UJFA 2NVAA 1TG7A 3BJFA 3AXKA 2WMIA 2Z0IA 4IQDA 4UOJA 2D2OA 1BGGA 1CCWB 4O14A 3KCOA 3D6NA 5GNZA 3O0KA 3ISIX 2DVXA 5F7UA 1JZ3A 1V7YA 1J93A 1E70M 4JNZA 1IGSA 4EVZA 1TQJA 3FSUA 4HZ8A 1C9WA 3O07A 5KETA 2BS9A 1ADOA 4GIEA 1R9XA 1XLDA 3GC4A 1EC7A 2XINA 3NYDA 4E3VA 1QOQA 4GINA 3GW0A 4Q6JA 3I6RA 3PZOA 1HP5A 1JUKA 1MI3A 2JGYA 4WVXA 3HJEA 1LBMA 5HAOA 1XWYA 4LRTA 4YCPA 3K8MA 2Z1XA 3RCNA 2REQA 3C3NA 1TJ2A 2BZNA 1E6ZA 1U1UA 2Y24A 1GPWA 3TE9A 2HS8A 3WEOA 3IRDA 2PCQA 3A12A 3N2CA 3DFSA 4PFHA 3T2OA 2VX6A 3AJ7A 4RNFA 3MUIA 4S3AA 3FJNA 5AYIA 4FHAA 3P0XA 1AG1O 3NDZA 3WLRA 5HWNA 1J0IA 1X38A 5I3HA 3TLLA 5AC5A 4UTLA 3EWUA 2C8NA 3IGXA 3NDYA 4XB3A 3GD6A 2PGRA 2H9AA 1X8CA 4DWSB 3DGBA 3C0JA 4IF2A 3GYEA 2CLKA 4IZGA 3QV8A 2ZX9A 4AZ5A 4I8DA 2ZX6A 1XCFA 3PM6A 1OFBA 3W75A 3UJRA 2QCHA 4NZFA 2FZMA 4IJBA 4P7NA 4Q8TA 2W6RA 2GZXA 4LB3A 1E6SM 4WKHA 3UGRA 4GZEA 4D6FA 3P5ZA 4HSNA 5BOOA 1EOKA 1ZAIA 4FXFA 2V9DA 3RM9A 1UR2A 2DZPA 1ISWA 4CD5A 3LB0A 3H2NA 2GJXB 5BRPA 1B4KA 4XBSA 1UOZA 4L4LA 1M41A 2R1LA 2NQZA 4OQVA 3E0LA 1B90A 3S6TA 3LLFA 2XVPA 3UD6A 4E0CA 4PBGA 3LLXA 3S1XA 1A0EA 3K13A 2W3ZA 5C70A 2YL9A 4JTTA 4CD7A 1LG2A 2JKEA 2WW5A 1AQHA 1PZ0A 4UQEA 4MLJA 4RCXA 5AOUA 1KWKA 3EXTA 1I2NA 2NT0A 2X7WA 3C61A 3FKKA 2WSYA 1L6SA 3RM8A 3ITTA 3VIMA 1BWKA 4LC6A 3TTYA 1YE6A 3VIOA 5FAGA 4B2DD 2CHNA 4U2ZA 1H63A 3WJXA 5I3KA 3WEZA 3GXTA 3ARVA 3LBCA 2Y7GA 3TYDA 4BFAA 4LVGA 4C6QA 5EMJA 4AIBA 1J0ZA 1DJZA 4YTQA 1RLDA 2C18A 3OPSA 4W85A 4LAUA 1VYPX 1M01A 2XIJA 2C1GA 1CLVA 2ZRXA 4K8EA 1JDCA 1MW3A 2BFGA 1B9ZA 3RR4A 3WQOA 2OZ3A 4KS0A 3MSDA 2C1IA 4JQ3A 3QH2A 4TR9A 4O18A 1PHWA 1W9XA 3UWVA 2NXHA 3UNTA 4DPPA 1FRBA 1U2YA 4H6QA 4LV9A 3UU0A 4K37A 3DFOA 2WQPA 1TV8A 3BGJA 1JYXA 1OFDA 2PWEA 2XIBA 3PWAA 3W9ZA 5I3IA 4Q8QA 3GRIA 3W22A 1RALA 2BY2A 1NFPA 1LLWA 3T07A 1OQFA 1BVWA 1KWGA 3THCA 3WQ6A 4I8YA 1LL4A 5AHFA 3GX9A 4MM1A 4MMWA 2PC4A 5C54A 3DN5A 5D2VA 4JX6A 4IM4A 5ECUA 1TB3A 3GR7A 3FVMA 3UG4A 1OZMA 1ZGDA 1OFPA 4S3BA 1F8IA 1TPWA 2E68A 1F76A 1F4HA 1KKOA 3FHAA 3EA1A 2HV5A 3S5ZA 1LOQA 1UKOA 4Z2GA 2Z7KA 3LZ3A 1Q2RA 1YDNA 3W7NA 3ALFA 3ID7A 5CZTA 3VD9A 4IIBA 2POZA 1G4TA 5KZDA 2P8CA 5CZSA 5H6HA 5EKYA 3W87A 3LX9A 4QRNA 1TWIA 4IXHA 3LK6A 2XIIA 4YS1A 2ISWA 3CUGA 5JQ9A 4AISA 4AZIA 4JCMA 3MHUA 3WLQA 1M7PA 5FJUA 1OSEA 4JN7A 2YW3A 2B81A 4O57A 5J5RA 4MWAC 2PTWA 3GH7A 1FFRA 2V5LA 1A3WA 5CJNA 3B3DA 2DUZA 5GJPA 1KRMA 2W0UA 4WUIA 1ZAHA 1AQ0A 5I24A 1E73M 4JTIA 2XFRA 3ELFA 3NPWA 3WKZA 2OB3A 5CJMA 5M2FX 2NLYA 4LBSA 4D1IA 3M0ZA 1AUSL 4XD5A 1P1MA 2Z1SA 1Y5WA 4M8UA 3NZQA 2NQ9A 1WV2A 1QI0A 5CBBA 3M0MA 4FR1A 3PBMA 3WQCA 5AKQA 1ZLPA 2DT0A 4NX5A 3WJZA 4BY3A 3DGRA 2DSWA 2OODA 5CPNA 3TQKA 1GKPA 4AVFA 4RX0A 4G2DA 5CGMA 1JCLA 4JEQA 2PC8A 3STEA 5D09A 1GOKA 1JDFA 4O17A 2YA0A 4O54A 2ACSA 4B90A 2IPFA 4FA3A 3CYVA 1M65A 3GO2A 5LNRA 1NARA 1J10A 2ZWYA 1EFZA 3EKZA 1X97A 2IKJA 3H2EA 2OOGA 4AG0A 4EAMA 3PVFA 3UYIA 2W92A 4H3DA 1TPC1 2CLEA 1KFCA 4XD4A 2INZA 1JPHA 4QE4A 4XZNX 4PUWA 1VFTA 3EOEA 5E9AA 4KMQA 3RJXA 4O0QA 4NI3A 4NXSA 1OD8A 5D9NA 2I16A 3KAOA 4H2HA 3M6YA 2F6UA 3BQ5A 1TV3A 1J79A 1UW9A 3OVQA 1IZKA 3BAKA 1WKFA 2IKIA 4ASTA 4BF7A 5CAHA 2XVLA 2QCDA 4NAFB 2GGJA 1TJ1A 4BZYA 5EY5A 4L9XA 4E2OA 1UD8A 2J7CA 3WUBA 5CSYA 1XPYA 4HVXA 4F0MA 3VNLA 1VLWA 5I79A 3QZEA 4G7EB 4L9YA 3P62A 4IIEA 2QULA 4E3TA 1A4MA 1K6WA 4DELA 2GQ8A 1XFBA 3FA3A 3WLMA 4C7GA 1A5KC 2XH7A 1E0UA 3MWCA 3CZ8A 1WNOA 2ZRZA 2OG9A 4AXKA 2HWGA 3SRFA 2HK0A 3B04A 3DI0A 4IP5A 1M7OA 4CQAA 3QHOA 3GG7A 3MMUA 4UB9A 1KRAC 2O7SA 4ZQCA 4RPPA 4GABA 1F3EA 4AZBA 4HK6A 1A47A 1JZ8A 1JDEA 4M7SA 3USBA 2A21A 3OBEA 3S9YA 3APYA 1JULA 3NL2A 3K46A 2Y7FA 1PIFA 5H8UA 1ZZMA 7REQA 3GFXA 3BMWA 3OIHA 2QDEA 4UTFA 3H21A 4J3XA 4QISA 3OG3A 3WJSA 1IT0A 1KCXA 5LZLA 2Y0FA 4V27A 2G3IA 4DB7A 3PWGA 1RCQA 5CZJA 4P7OA 2VX5A 3GNXA 2PTXA 5D2XA 3PPHA 4AD5A 3UXIA 2V5KA 2D23A 3DECA 1E4MM 1K70A 3T4CA 3M5XA 3ATZA 5L6UA 4KFOA 4IWWA 1XF0A 1TWZA 4R5EA 3ME3A 3QF0A 4OOZA 3WQWA 1UWRA 1VJZA 1IEQA 1ZCCA 4JY8A 4FNSA 1PIGA 3H2CA 1PKMA 3O2LA 2EG6A 1T99A 2G95A 5T9CE 1LOSA 4AZ7A 1SFJA 4X9SA 4HA0A 4GHRA 5LIXX 4Y7EA 2EG8A 4M3PA 3VKJA 1XHGA 1K02A 2PD9A 1VHCA 1ENUA 3W4RA 2WC7A 3CYJA 4MF4A 3V1HA 5LGZA 3S9IA 3QN3A 1Q4NX 2PWDA 4KRUA 3D47A 3EDJA 4FI4A 1VFFA 3BAWA 1UWTA 3NO5A 2DZTA 1SO6A 4PTXA 2FIQA 4D72A 1H1YA 3MZNA 4N6EA 1G6CA 1OJXA 1SZGA 4HCHA 1BVNP 3BANA 3HFTA 3ZLGA 2TRSA 1F74A 3IAQA 3GTIA 3T0DA 3CPGA 5RUBA 3NZPA 2JEPA 1SGJA 1M5WA 3VINA 1TTJA 1PSCA 3AZTA 1XV8A 1U1HA 3VKBA 4L1GA 4MLRA 1F07A 4C6IA 1KFKA 1ZCOA 1YXCA 2Y2WA 1E51A 3A5FA 3J7HA 3STFA 3FXGA 2WNNA 3URNA 4UCFA 1KW1A 4H8VA 1K03A 3WQ8A 4C1KA 1R9ZA 3WG6A 3FDGA 3H22A 4Q8PA 5CC6A 1YDYA 1AA1B 4Y9NA 3EOUA 2RGMA 4XKYB 3LI0A 4PB5A 2VL4A 4GMEA 5XIAA 5JUVA 3M6DA 1T96A 4KT2A 1UD5A 2X1RA 3NQ7A 5D03A 3OBKA 4Z2IA 3EX2A 2GDVA 4WDTA 3PN8A 2QAPA 1A5LC 2PLKA 4DJFD 3LD5A 2WKLA 4RDZA 3E2SA 2BGNE 4ONVA 2GOUA 1L6GA 2J9ZA 5JXQA 1Q8JA 3GDTA 3BARA 3CL7A 1KBLA 3AU2A 4ADUA 1RJQA 1KBJA 4IOTA 2P8BA 3WH8A 3V75A 4WQ6A 4D6CA 1AH0A 1Z7AA 2C71A 3NQDA 1CGXA 5EBUA 3EKGA 4LCRA 3P74A 4K8GA 1YPXA 1GVQA 3UZ5A 1UIPA 3TWAA 3QSTA 1H11A 3RXZA 1THFD 3GXFA 3UA3A 1BSIA 5KZ6A 3FYYA 4IP7A 4PTVA 2Y5SA 1XDMA 2V8ZA 2PRHA 2YIHA 2NZLA 3F2CA 2A6LA 3BV7A 3IACA 5LKYA 3TAOA 2FGZA 4LRSA 3SEPA 4UMCA 4R27A 1LJYA 4UOZA 1ZQ5A 1JG9A 4HNNA 1MSSA 2G3MA 3F1QA 4A21A 1W3KA 1YHTA 5BROA 1DJGA 4RZBA 2WJFA 2XVGA 4Q22A 3B40A 2GFTA 5I02A 3WNPA 2D3LA 5M5DA 2VFHA 4PMYA 3SSZA 4Y6GA 3WEMA 1QPRA 4H7VA 4MAZA 3W26A 3WH6A 3LCXA 2CITA 4XUYA 1FWSA 3VVGA 2VOTA 2BXYA 3FYOA 3GXNA 4HHHA 4NZ5A 4LH8A 1NH6A 5C5YA 2OOFA 5E93A 3VGFA 1QO5A 4K39A 3ARZA 4W8BA 2INEA 4XD6A 3GUGA 2G3FA 2YCLB 3G1VA 2GOKA 3MW7A 1UUMA 4WY0F 2PMQA 3BL3A 5A1AA 3TZFA 4N7QA 1JZ2A 1EQPA 3AI0A 4NP7A 4ZFCA 4Y9MA 4WDXA 1FWJC 1XH0A 3I6TA 4S3GA 3GTFA 4FNQA 3UG5A 3GLCA 2VX4A 1VIWA 5A6TC 1MEWA 3PSVA 1TV7A 5IFPA 3KFTA 4DF0A 3FAXA 3VOFA 3H6OA 4AZCB 1VLIA 3RCMA 5CSRA 1Z8AA 3W01A 1N8WA 4G9PA 3SRHA 5AHIA 4JBRA 4LB4A 1TO3A 4QAIA 1VPYA 1GWJA 1Z89A 3PZIA 1ZTVA 5KSWA 4RZ4A 4LV4A 4L1XA 1TWSA 4X0VA 2HE8A 2VEIA 1IZCA 3L2LA 1FWNA 1XC4A 1JZ7A 1PO9A 2FB2A 2IPWA 3TYAA 1R3WA 3AC0A 1NFGA 3KRBA 2ZZ1A 3W7HA 3M44A 3SIMA 1PKNA 3QZAA 1QNVA 1S5WA 3VDBA 1EP1A 4GK8A 3BJSA 3WENA 1JGMA 1LWHA 3WSUA 4NU7A 1QI2A 3QW4B 5LNWA 3SCWA 3F4VA 3BJTA 1MMFA 1EIXA 4A3HA 3GFZA 1S2TA 3ZZ1A 3H4GA 2Z1WA 4UTMA 3EGJA 2PDXA 1OYAA 3IANA 1V6UA 3W1XA 2V2CA 4O15A 5D8WA 1PTGA 3QQWA 3L0NA 3LHVA 3CQKA 4JFWA 3EDFA 4Z2HA 3QV9A 2XJ7A 3IIPA 1H7OA 3IEBA 4S3FA 1XP3A 2A7RA 2OMAA 5TIMA 1ZALA 1GVFA 1US2A 4JIQA 1QNOA 4DJED 3UZYA 1H4PA 3CHFA 2BP1A 1EJWC 4O50A 5EMYA 2ANUA 3T44A 3M7WA 3HMJG 2FVLA 4C6OA 2E9BA 2YL5A 6REQB 4UC5A 4LXFA 1TTQA 3F4WA 5EMMA 3VGBA 1Q7QA 2ZICA 2OU4A 5IHSA 1P43A 3BDKA 4ICMA 2VZTA 5D30A 1AK5A 2XUCA 3WNMA 3PJWA 3VU2A 2VO5A 1FCVA 3T9PA 3BUVA 1UH4A 3VNYA 2PRLA 3AFBA 1P5BA 2DZUA 1CXKA 2X2GA 3UA4A 4H9UA 2X1UA 2CZEA 3AALA 3KCLA 4W87A 3LYEA 4LF1A 4AVNA 2VEFA 4R34A 1PKYA 4PTWA 4ERAA 4GBDA 4I6KA 4W4QA 1SZFA 1WO2A 3T0TA 5FF3A 2XN1A 5G1TA 3GS6A 1XD1A 5H91A 4MAVA 1C29A 1JF6A 2BXVA 5G2HA 6ENLA 1Z9AA 2PDKA 3GDLA 4IMGA 1QPNA 3U0HA 1UJQA 3M7SA 3RMJA 1VCGA 1XI3A 1UR4A 1KLYA 1X6LA 5FJPA 4UFLA 1DWAM 4JN8A 3MUZ1 2WJDA 1W5NA 2ZADA 3B8WA 1IWAA 3DBPA 3TK7A 5HQMA 3A24A 3WUGA 4DO4A 2WMIB 1RBOB 3AIVA 2EKGA 3E2RA 1AD1A 2DSKA 3U7VA 1OIMA 2DVUA 2AGTA 3MCMA 3OOQA 5JVLA 2V5JA 1U33A 2ZZ6A 5CGTA 5C8BB 3CO4A 1FWFC 4QM1A 1JCYA 1OVDA 4ILSA 2JGQA 5HPOA 5CGQA 4D6DA 3TJLA 2I56A 3UZXA 2OWWA 4UR9A 2ZA2A 2PA6A 3UR5A 2DFAA 2ZUTA 2HK1A 1T6MA 3W1AA 4YVVA 4DBUA 7XIMA 2Y4SA 3PB0A 3HPXA 3V36A 4N6FA 2YPIA 3MP4A 3RCYA 4AD2A 3VGDA 3RPTA 1CGUA 3ZVIA 3L5MA 1XLLA 3TX9A 1B3OA 4BCEA 1GK8A 3VD7A 2OFJA 3MYOA 2BTMA 3CZLA 4MWAB 3ZYZA 5LYRA 2OWXA 2OLAA 1W17A 2Z26A 4CGTA 3GHSA 1C9DA 3HQNA 5C71A 1SJDA 1Q6RA 1OFAA 2BGQA 2PWVA 1QPOA 2P88A 1UYQA 4S3KA 4ES4A 5AB3A 4E4PA 2QR6A 3GNOA 2OZ8A 3L5AA 1HVQA 4GYJA 4HK7A 2VP8A 2I7GA 1OCNA 2PDCA 2OO0A 4N9DA 2BVTA 2VJXA 4O10A 4QQUA 3T05A 3N04A 3MU7A 2IPJA 3C56A 3GIQA 1EPXA 1L0PA 1E3ZA 1UUQA 1DHKA 4P7RA 3WQ5A 4AFYA 2OT0A 3ZFHA 2BV9A 1TTIA 1GOWA 2OSYA 2YDQA 1V3HA 3GDKA 3WCZA 1EYEA 4XD3A 2IXUA 4Q3MA 3LDVA 3H12A 4JTRA 1EA0A 1QBAA 4O1BA 4UWMA 3B0PA 2ZWZA 4AWEA 1E3XA 3O9NA 2PE4A 3VKCA 2VVNA 4GYFA 3NQCA 4HHMA 1K8YA 4JKMA 3R10A 4JTSA 2OXNA 3IIOA 2VMFA 3CZEA 3KRZA 1YBQB 2X30A 1W3HA 3UPMA 3GDBA 3HV8A 3G1SA 1TVPA 1DQWA 5CBIA 1R86A 1H7NA 4XISA 2YBTA 4MADA 3KEHA 4O12A 1OBAA 1ZJHA 3NPUA 5AC4A 4AYGA 1F2JA 1DWFM 3WBXA 4QE1A 4AZGA 2WLYA 3KBMA 2W79A 1CGWA 3IS4A 3QV6A 3B05A 2Q8ZA 1Q85A 2I5QA 2CEQA 2G5WA 4PMZA 2ASHA 2BOFX 2F2KA 1YNYA 4GO8A 4UNLA 5FSDC 2PLCA 3WNKA 3C8FA 3MJMA 4H9YA 3LERA 4MB3A 1LLOA 3SJNA 5CPMA 3HPFA 3R1ZA 4EAYA 3B9AA 1J0KA 1T0OA 3WDRA 4PCSA 4XZ9A 1LL7A 3XISA 4FLQA 3F5LA 3OTRA 5TBOA 1KGUA 4M51A 2I9UA 1OX4B 3UJ2A 1ZBKA 3N4AA 5HNRA 1XYLA 4M1BA 1E5NA 9XIMA 3M07A 1P48A 3WELA 1EA9C 4IX0A 1QPKA 4A8RA 5I78A 5JH2A 3DYMA 1O5QA 3VILA 4DXKA 3WJWA 1D8CA 2E7FA 1K9FA 2NQLA 4PRWA 5I03A 1HO1A 3EMCA 4TX6A 4NG3A 3IJ8A 4LS2A 2R14A 1ZSXA 3NQ8A 5CEWA 1A4LA 3VA8A 3PBGA 4UTKA 4ZMGA 3AIBA 3PFRA 3V5FA 4XBKA 1H0GA 1OF6A 2RDWA 1QDSA 4LCQA 1TRIA 5BCAA 4DBWA 2GVLA 2P50A 3S2JA 3IWPA 1PTDA 4QLKA 3TMQA 3XIMA 4KEVA 4JIRA 3IJQA 3SY8A 3C2FA 1GOQA 3AUJA 3IGUA 2V5CA 4MTVA 3HJZA 4DI9A 1I2QA 3UCCA 1R7OA 3KTXA 1OD0A 4GNVA 2WMHA 4Z1YA 4AMCA 4F0KA 4H8NA 3MJYA 4GVGA 3M0LA 1ZFJA 1D2KA 1MQPA 2J7DA 1XLAA 2CHRA 3BQ6A 1H2JA 4N9BA 4AWSA 2VC7A 3PS7A 4Z1AA 1UZ4A 5C2CA 4J27A 3G1DA 3JVAA 5HPCA 1NWTA 4XKMA 3JS3A 1GW9A 2AKZA 1ONRA 3WLSA 1NSJA 4R7JA 2R6OA 3D3AA 1CYGA 4JFSA 4L6DA 1TYGA 3TN4A 4QFUA 3QQ0A 2D3NA 5M17A 1GZ1A 4XZLX 1SZNA 3W70A 1XINA 4EX4A 3UERA 1E5JA 3N14A 3GXMA 3M0KA 6ALDA 2YYTA 3DZ1A 2BSLA 3E74A 2CLLA 1LQ0A 3VO0A 3P67A 4J2PA 4FNTA 3TA9A 1NJJA 3S1UA 1DIOA 3QFEA 2NWSA 3GFYA 2VXNA 4GYPC 2NXIA 3MQTA 4Y9AA 2A3CA 5GNYA 3MT1A 1OM0A 1RPKA 4I90A 4DI8A 3URAA 5E9XA 1KR0A 2WSPA 3N1AA 1JNDA 4UQBA 2NSXA 5AZ1A 3TROA 1JPIA 3LCFA 3F2DA 3ZJ8A 1Q66A 3CWNA 3CHCA 2NV1A 4GH1A 4BR1A 1E9YB 4BKNA 4GIAA 1BXCA 3BSMA 3COTA 2WMFA 4XTIA 3DHUA 5F4WA 3W1MA 3GE7A 1A53A 1I8JA 3FJLA 3QPZA 2EKCA 1G7VA 1RQHA 4AUBA 2Z2BA 4RXGA 4H6KA 3FOKA 4G7FA 1IHIA 2J7BA 4I5UA 4QITA 3DU0A 3EOOA 1YTKA 1W37A 3TSMA 2J8GA 2FZBA 3VDHA 1DJNA 2PGEA 3LRKA 3CMFA 3M9YA 4PR4A 4WOZA 3N18A 5DFAA 2XM2A 2A4AA 4J7RA 3VGHA 2QJJA 1S5VA 2GGGA 5E1QA 1H5YA 2BXZA 3LGEA 2A3HA 1OX6A 5HMEA 1F6KA 1KFBA 3T40A 1E9IA 2V3GA 3BSGA 1KCZA 2PU1A 5HUPA 3E5PA 3WJYA 3G1XA 3BVJA 4BI7A 2YL8A 4A05A 4NSBA 3GYCA 3C0LA 2EPMX 2ZRYA 5CSUA 3NQBA 1G4PA 4UQAA 1UBSA 1N82A 3EZ4A 4NRSA 4DQWA 1AQMA 1VBRA 2GGEA 2PFHA 1FUYA 1M53A 2YCEA 3GVQA 3PZNA 3AWOA 2D69A 4LSBA 2Q3OA 3MSRA 1PYMA 4YLWA 1WB0A 3WIJA 2WZHA 2H3BA 4IQLA 3CHEA 4FXSA 1RAKA 4MYXA 1T8QA 1TPH1 4B91A 2H90A 4GE8A 4Z1BA 3MBFA 2VGIA 1CZ1A 1TR9A 2CLMA 1UD6A 3GC5A 1JUBA 4I5XA 3GR4A 3LEPA 4LEFA 4CVWA 4GC3A 4Q4SA 5HWMA 1VBHA 2Y89A 4DM1A 4DWDA 5ABFB 4EPBC 3TLQA 4QXIA 3TV8A 4L5ZA 4UTUA 1XGZA 3OU8A 2R1NA 3VDCA 2ZA1A 4F79A 3OA5A 3PZMA 4DLMA 1RVGA 4S38A 1DQUA 3S2NA 2X7VA 4JDBA 3I7SA 4BQ3A 3B0YA 3PBUA 3UPWA 1A5SA 5EPDA 3SAZA 3QLDA 3P2VA 4GZ7A 3ICJA 4KBXA 5F1UA 2XSXA 1F73A 1W5QA 1F3TA 3WF4A 2Y5JA 3AYTA 3QGVA 3V1PA 1PV8A 3CWOX 3W7QA 3P0WA 3MDWA 4MPKA 1POJA 1E1EA 1Q65A 4QSFA 4LAKA 4YL2A 3Q4DA 4UXDA 1KFWA 4ATWA 4F2UA 1QRQA 2ZZ5A 3AMDA 1J6PA 5F4XA 4D6HA 1H3GA 1H7XA 4HPXA 3T2QA 4M24A 2Z29A 4DJDA 3ARUA 1G7UA 4UMAA 2YLLA 3W76A 5H1WA 1S3HA 1GTHA 2BBFA 1P0BA 1QNPA 1LWJA 3LRMA 3APGA 4KFNA 1FKXA 1UC5A 2BASA 4S39A 1ONWA 4IIHA 2XGIA 1CB2A 3QMRA 1GYLA 3UT0A 4FS9A 1SJAA 3MSGA 4JR5A 1UMYA 1TVLA 1XKYA 3CXOA 3MB9A 5E5CA 3TFXA 4HOWA 3LCWA 2RDTA 2Y7DA 5D2TA 3G8EA 2PDFA 3ZLHA 1DXFA 1EL3A 1JGIA 4ZB2A 2FHBA 2GSHA 2F61A 1UQYA 3BW2A 1J01A 3BSHA 2YDRA 3LPOA 2XYLA 2DY3A 3T1GA 2D20A 4H7CA 3IUIA 4W88A 3CO8A 4PCNA 3A47A 2O9PA 4Z2LA 3F5JA 1CENA 4S3CA 2DIJA 5DO8A 3K30A 2Y5EA 1GQLA 4K7YA 2XFWA 1EWDA 3C0SA 2F8QA 4GY0A 1N8IA 1TWWA 3RPMA 4R88A 5J8LA 3EKLA 3SADA 2UZ9A 2Q6ZA 2OLHA 3W3OA 2C3ZA 4ZE5A 3MPGA 4QDMA 1H7RA 1UA7A 1QNSA 4S1FA 3V7PA 1UQZA 1MXDA 5A8QA 4KF1A 2NLIA 1MWOA 4X22A 2Y1HA 1W6TA 2CETA 3SRDA 4H1ZA 2OYMA 4DO6A 4PEKA 4JHZA 1EJSC 3H26A 4HYVA 4O4VA 4DJFC 3NOEA 4P7QA 1Q6LA 5LHFA 1VC4A 2I5IA 3QLLA 5FEZA 1XKJA 1IEXA 2QJIA 3W02A 3NQAA 2A3EA 3POHA 4PUKA 4F8XA 3ABQA 1EO7A 2QMKA 4N0RA 1LQ2A 3ZVHB 2D24A 4EWND 1K3UA 7REQB 3QRHA 4X9YA 4DWSC 3OA3A 1WDDA 4FAMA 5TQLA 5HMSA 3UXDA 3BZJA 4AD4A 1XDJA 4DJDD 3LV5A 1UJPA 1HFBA 1SFLA 1B57A 2QLYA 1IEIA 5ABTA 1WX0A 1KKRA 3TCEA 3TR9A 3HZ3A 3OEXA 2VR4A 1DWHM 1XLEA 3WK1A 1OEPA 3ITYA 3SO7A 3UZZA 3Q45A 2HISA 4DEFA 3H70A 1FWRA 1NWSA 2XU2A 3TYUA 1OK4A 2QDDA 4I9AA 1AD4A 5GJMA 3ANVA 4NKCA 5BNKA 4QROA 3AOFA 3HG2A 1DXEA 4Q7IA 2KAUC 4C6PA 4O4WA 2JQXA 3AAMA 1MRQA 4MWAE 3KRUA 3RU6A 4ZO8A 1ME8A 3GC2A 1IYXA 3DOPA 4AZCA 1W0MA 3ABZA 3UWEA 1O5KA 1HNYA 5CBJA 3PUGA 4HPNA 1OADA 4JTGA 3MYPA 2QCLA 1LG1A 1YMYA 2OEMA 3UR2A 1E6NA 3KWXA 1EEXA 1I2OA 4KW2A 1WPCA 3CIVA 2HE5A 1UWSA 1OCBA 1PX8A 3PTQA 1V02E 2ZTKA 6PTDA 1H49A 3CMGA 1TA3B 4IG2B 2QJNA 3NZ1A 5IBXA 4B4HA 5HANA 1JFXA 3AS2A 3PPCA 3QY7A 5DMLA 3HTWA 3U9IA 4ZZ9A 4ZSUA 1M9HA 3LI1A 4RDWA 5D2YA 3OVPA 1LWIA 1IIGA 5EB8A 1GW1A 4PA8A 4DHGA 5EMUA 1B3YA 3R6IA 3P14A 3AMCA 1JYNA 3N34A 4PUUA 1YE4A 2VX7A 1FDZA 2VGBA 1EX1A 1GVSA 5D8ZA 4O16A 3MKKA 1TX0A 3OLEA 4TOQA 1JJKA 3GBDA 3G1HA 3HQ1A 4GX9A 2CBUA 3M46A 3PB2A 2Q09A 1R38A 3K8LA 2BY1A 3H7VA 3EAUA 1IIHA 4RL3A 4D6IA 3MV01 4Q8WA 4Q4OA 3TTSA 1SMDA 2PZ0A 4W84A 3LUTA 3THAA 5LIWX 3R89A 3FNDA 3GTXA 1DPMA 2V5DA 1CW2A 2WZTA 3PG8A 4JTUA 5BMWA 4IL0A 4YIWA 5LXXA 1LYXA 1CECA 2JEQA 3LCLA 1I75A 2XVKA 4OBTA 3CIXA 1XYAA 4XQ6A 2DJLA 4U10A 1MW2A 4ORMA 4PTNA 1AZ2A 3U7BA 1VCVA 4MY8A 2VURA 3BICA 4HP5A 5DX7A 3OLDA 1ZJIA 4ERGA 5BXTA 3OQEA 1XRFA 2V2HA 3O8AA 3R2GA 1E1CA 1HG3A 2WM0A 1V4YA 2UY3A 4UTWC 4NNCA 2P76A 2AQWA 3MUXA 3PJUA 3L2MA 5E0FA 4FIQA 3CUZA 4ZCWA 4GUJA 1OB0A 4F0SA 5I7GA 1Q6EA 2QDGA 3R12A 2VCBA 5HR7A 4CLMA 2Z00A 3G0UA 4UFMA 4M82A 1F4AA 1VYSX 1NP2A 2QJHA 3MC5A 5FJJA 3BOXA 3S6DA 2GUBA 2ZE0A 2QPSA 1US0A 2YFNA 4ZOEA 1X39A 1XC6A 3PANA 5KINA 5I3DA 3HOJA 4A3UA 5C9XA 1W1TA 1F61A 4DYEA 1VZWA 3LBMA 5I09A 3E0VA 2VM8A 1TPDA 5A8GA 4GVFA 3CZGA 2GSEA 1GOXA 4Q8OA 3BGAA 1DQXA 2VD8A 1WCGA 4KERA 2WK2A 2CFFA 2FTYA 3U4FA 2WAGA 2YR1A 5HQLA 3M0YA 2VEMA 2X16A 1RA5A 2JKPA 3NFUA 1DIDA 4GKLA 3QVQA 2Y6ZA 3VCNA 1V3JA 1FP8A 4AAJA 2OT1A 3EDKA 4J3TA 1KBKA 3E0IA 3QHMA 1TZZA 2Q8XA 3QY6A 2WVVA 1IXPA 4NZ1A 4AZHA 3AS0A 4TVUA 1JDDA 4GISA 1EJXC 1I0DA 5ECVA 4DBDA 1XXXA 1AW1A 2Z2UA 1GKRA 1SO4A 1TQXA 2NVCA 3RX2A 2WBGA 1BTMA 2WSQA 3ZWSA 4HJWA 4Q6XA 1ZAJA 2GUUA 5K3VA 1K9EA 3R79A 1AVAA 2FGLA 1DKWA 3LA4A 3H53A 5I00A 1LOLA 3WFLA 1XX1A 5DEZA 1C3FA 4IMAA 3F2BA 4UZUA 5DXXA 1XYMA 4HA3A 3CPRA 1DJIA 2ZUVA 3WN6A 4YTUA 3RN6A 5B7YA 3TKFA 1C7SA 4LY4A 3WY1A 4E2VA 2DT1A 2GGHA 4IPIA 1PS9A 3R58A 4PUMA 3V0UA 3TMLA 4QHRA 1RSCA 2R1MA 5GVJA 4ENLA 2X2YA 1H51A 4HN8A 4C5YA 4P8WA 3GW3A 1LT8A 1JRCA 2QGYA 2WJEA 3G1YA 1AMYA 3EMQA 1PCKA 1A5BA 1GVOA 3TDFA 1TPFA 4INFA 3IJ7A 2ZZ3A 5B7ZA 2IQ0A 1NF0A 2JALA 3CV2A 1E6RA 2FDSA 1FWWA 2INFA 2CHOA 4NVTA 1GGOA 1TELA 4PN2A 4ZSTA 1OC6A 5D05A 4B4FA 3UWWA 3PBYA 5GJNA 4H6EA 4DZHA 5IDIA 1FVPA 3VDGA 2ZRVA 3W00A 1E6XM 2CXGA 4XKYA 1HF6A 2QUMA 5AN7A 5EFFA 3A6OA 2VFFA 4GA8A 4RE0A 4AY1A 3JR2A 1L2UA 4E4FA 1H7WA 1BSLA 4M19A 1ISXA 4DZIA 3FEMA 2V82A 3QMTA 4OZOA 4Q8UA 4JIEA 3FA5A 4HHPA 2FH8A 1BTCA 4YYFA 1H50A 1WZAA 1EIBA 3KVMA 1A5CA 1W1A1 3FA4A 1TV2A 3T55A 5KZMA 3R25A 4LUYA 4IPJA 3TA6A 1CWYA 1CX9A 2GK1A 1HKWA 2HXTA 2NXGA 3KP0A 1TSIA 1KXHA 1RJRA 4GVHA 3DKLA 4OIFA 4DWSA 6TIMA 3RG6A 4CU8A 4RLIA 3AWNA 3BLPX 5KTLA 5LIYX 4JTQA 2DEPA 4QNWA 3LPFA 3BCDA 1JAKA 2Z1VA 3P8JA 3DENA 1M68A 2QW5A 5A2AA 1XIMA 3S46A 4OWGA 3PULA 4ERIA 2QIWA 1S39A 3EX3A 4KWWA 2WWDA 2HMCA 1DVJA 2P3EA 1KC7A 1FWIC 3T4WA 2WVVB 1DWIM 3MP3A 3AHYA 1HVXA 2ZTJA 4UZSA 1YTEA 2WHKA 3IVUA 4JFUA 2Z28A 3N13A 2PTDA 4PCTA 2PWFA 2RGLA 1P7TB 4FEZA 2C6QA 3FIGA 4IFRA 4C6LA 1LRNA 1B3XA 3P81A 4HPHA 2HBXA 1HKIA 4DN1A 1OCJA 1L6YA 3HQPA 4HBKA 2IKGA 3SM0A 2O9TA 3N9KA 3E6EA 1J11A 1JF5A 4MZYA 3W83A 4CCDA 2YB4A 3NUKA 1Z6KA 1TPVA 3VUSA 1L2QA 5CG0A 5E0CA 1DJWA 1ZJBA 5EL1A 3EMZA 4TTUA 2Q3RA 1T41A 2F9RA 1XIJA 4JYEA 1SZRA 4QCFA 3D5HA 1LUCA 4HNCA 4IG2A 4PBEA 1AL7A 2UY4A 2X05A 3U2EA 1VAHA 3KZPA 3N25A 3AHZA 3EOSA 2IPGA 3CEPA 2ABAA 4UR7A 3EX1A 3PZVA 3ENLA 4B3ZA 1O66A 5AC8A 4H9XA 4JTAA 2HNEA 3WBWA 4PFMA 1UB3A 4IISA 3GWQA 1VEOA 3GAKA 4OJYA 2WVUA 1XIGA 1P1XA 4A2SA 1V0LA 2DU2A 5J04A 3CLMA 1OYBA 4TUFA 4D8ZA 1RBAA 4ZE4A 1Y65A 4ZQPA 1V6TA 3BWWA 1W5PA 4WK9A 3QJAA 4JCLA 4HD5A 4BA0A 3KS5A 1W32A 4PEEA 2RAGA 3SN4A 4PMQA 1GZGA 3EYPA 2G3JA 3URQA 3UW6A 1MFVA 3W1PA 2CCRA 3LV6A 1W2PA 3UY8A 4JIIX 2VFEA 3VNMA 2FVKA 5FEWA 3CUIA 4PMJA 2X0YA 4IICA 3PNUA 4V15A 3L7RA 1MZRA 5HMDA 5PTDA 3DBNA 4BQ4A 1E1FA 2PSNA 1GUVA 3BE7A 1B4EA 3KVLA 2Y61A 4FLOA 1VQTA 3LPPA 2ZKMX 4HB7A 3N3TA 2FFIA 2PDLA 2QXWA 1G1YA 1W8GA 1PX3A 5G1MA 2QUVA 4ORIA 2YW4A 2C0HA 1IQ8A 1QHZA 1LCOA 1N8FA 3M5YA 4LAOA 4RR4A 1DTUA 4FR6A 1LM1A 3P7YA 4LGXA 1ADSA 4FLSA 3VYLA 1YKWA 2ZX7A 2DZWA 2E09A 4GJIA 3MVIA 2G97A 1GEHA 3VFLA 1S1RA 2O7QA 2OPJA 4YHEA 3K1DA 3BLFA 1ZY9A 4K36A 2B7PA 1RR2A 3PBVA 4J3SA 5A6BA 3T09A 3FLUA 1B30A 2J77A 2ALDA 1WBJA 1XIHA 2WKJA 3ES8A 4IX2A 1I2PA 5BU9A 1GTEA 4C60A 4K7VA 4OKDA 3CK5A 4KFPA 3U8GA 2FDMA 3WNLA 3BC9A 2J7EA 5DMMA 4LPCA 3O3RA 9RUBA 4H7ZA 4US6A 3TJ4A 3NPVA 3RNDA 3V35A 1D9EA 1BAGA 1OY0A 2GL5A 1BLIA 1KV5A 1OCQA 4GOAA 4GI9A 1KFEA 1T7LA 4N4PA 4FOUA 3N2OA 1G94A 4ICCX 3H4WA 2I9EA 1LBFA 3HB9A 2ZOXA 2J66A 4DNMA 3H8AA 3KOXA 3FW6A 4S3JA 1LP6A 1VFLA 1R5YA 4RE3A 3FS2A 3SY1A 1J0JA 4GQQA 1KXTA 4DXXA 3KX6A 3V4BA 3SY5A 4C5ZA 5LHEA 2BOEX 2AGKA 1B2YA 4R53A 4Q4QA 1MFUA 3TC6A 1W1YA 1CEOA 4RDVA 1WKYA 3DYOA 1E6QM 4C7FA 5A2BA 3QTGA 1R0MA 4YVPA 5CXPA 1XL9A 3U5UA 3NXLA 1O4UA 2DP3A 3KM8A 4DUVA 4EPKA 3PTDA 4HU0A 3U2OA 3CB8A 1W3IA 4LYQA 2FZDA 4HMDA 2BX7A 2XH4A 3ARXA 1XG3A 3GG8A 1XLBA 3S42A 2V3FA 1TV4A 1H09A 4DO5A 1XG4A 4QCEA 4HZMA 1VYRA 3UWYA 3W7OA 4PMNA 1GORA 1C8YA 4GVIA 4MFEA 2Y88A 3OZPA 1CLKA 4JFVA 4PSRA 1LDCA 3LM3A 1WQ5A 2O92A 1FY6A 2UBPC 2V38A 4REQB 5K4XA 3RAOA 4K1GA 3CT7A 4GG9A 1VENA 3VE7A 4XBJA 4OUEA 2DORA 3EOLA 2JF6A 1W1B1 2X09A 3LPGA 3SCNA 1TVNA 3VI2A 3NTYA 3NQ2A 4C6DA 1WA3A 4ADSA 3N2BA 1E0WA 1L8NA 1PL9A 2WM1A 4GO9A 4UTJA 3D0CA 3HG3A 4HTYA 4FB7A 2FH6A 3HM7A 4OU1A 3BOFA 2WBKA 3G18A 3ZIZA 3ITXA 3OODA 4E6MA 3N19B 1HJVA 2HEJA 3CAQA 4JNMA 3DI1A 1ICQA 2W61A 3NL6A 2O55A 4OFCA 4JDYA 3TSBA 4ZODA 3OG2A 2EG7A 4NAFA 1FWTA 4L56A 2PP0A 3E96A 3BAXA 3TAKA 3N2TA 1R85A 2CZ5A 4WEVX 3BO9A 3SURA 1UZDA 1SYTA 2ZXBA 1Q6OA 2SFPA 4HCDA 4MNKA 2RDXA 4AIUA 1YW1A 4K1WA 4JX5A 1V77A 4MVAA 4QG8A 4OOUA 2GGIA 1Y8BA 5E0KA 1QFEA 4IGNA 1C8VA 2JKAA 5G4HC 4Y9PA 1XSJA 1IXQA 2DV0A 3KRSA 5FF0A 3ITCA 2CXEA 2EJ1A 3VDAA 1R46A 1TIMA 2EBNA 2ZCGA 4V28A 1SVDA 2D0GA 3CV6A 4DZAA 3S4TA 3GAYA 1F3WA 3NVTA 4GYPA 4US5A 1F9CA 3CV1A 3A3HA 2X1TA 2POTA 2D2GA 2CLOA 1UOKA 1CT5A 1GT8A 1Q6GA 4JY9A 2G50A 2HRWA 2REQB 2OWCA 1N2VA 1E0XA 4AY8A 3PPFA 4QS6A 4JGDA 3THDA 3LCGA 2YCLA 4I6VA 1RCOB 2FPYA 2QCMA 2VR5A 9XIAA 3VGGA 3MDUA 3SCQA 5CZKA 1ALDA 3NCOA 4C6KA 3F7JA 3GDMA 4MZ1A 5C9RA 3LRLA 3UVIA 1FWEC 3VOHA 3ALGA 3H55A 1WXZA 5CPTA 2FJUB 2NX9A 1VEPA 4L61A 2QEZA 3BV4A 4GLEA 3BOLA 3NL5A 4HU4A 2PPGA 3C2RA 1EO5A 3M64A 4K3ZA 1TMHA 1EBGA 1XIBA 1JFHA 1MW0A 4PRRA 4I9TA 1PCWA 2O9RA 3TXVA 3KHJA 1EF2A 3OBAA 4N42A 3T78A 3PR2A 3REQA 2XH2A 2C91A 1RVKA 4H41A 1KCKA 3RLGA 4CD4A 2X0SA 3VKKA 3CLWA 5D33A 2FPVA 4EWJA 4TMCA 4IPLA 1GPFA 3TP4A 2VWSA 4AU0A 1A5MC 1CBGA 4HQVA 2CNCA 4JAWA 4BI6A 1O1HA 1VBGA 4HGXA 5DMNA 1JXJA 3B8DA 1GCYA 1NF7A 1VFHA 1NDZA 2PDPA 1IE7C 1V02A 3AYSA 3SCRA 4RPQA 5CPLA 2IXVA 3M16A 3N6JA 3P5YA 4CU7A 4AX7A 3Q94A 2ZZ4A 4M5PA 4G56A 3KZSA 1KA9F 2A7PA 5DCBA 4A29A 3M0VA 3VIHA 1XUUA 4GY1A 1YADA 5ABHA 1BKHA 1ADDA 1GONA 1BVZA 1E4LA 4KCTA 1CI1A 2B31A 2PAJA 3TOYA 4AY7A 1BYDA 3BAJA 3AMKA 3UYCA 3WLIA 3WBYA 3WLNA 1RXOB 4U5KA 1HKMA 3C8NA 4LNYA 2YFOA 4PUNA 1J8VA 1AH4A 3HPZA 4XVEA 5I77A 4TMBA 4IL2A 3MHFA 1V7AA 2VEPA 1OFRA 2DW6A 1GQNA 2E8YA 3TH6A 3WDQA 3OO2A 4EXAA 5A95A 4EOUA 2ZVRA 1DEDA 4DYKA 3TQ0A 1KM1A 3KL5A 3B8SA 4LUIA 1BPLB 1FWHC 1D3CA 4HMCA 2ADAA 5EMLA 1RD6A 4Q4KA 1B5TA 1KTBA 3VMNA 3W23A 2PUZA 3BAYA 2A3BA 3KBSA 3TW7A 3C2OA 1RQBA 2VI0A 4JEJA 3TJIA 5CCZA 2F6XA 4YTSA 3LU2A 1JI1A 4TIMA 1B3WA 1W56A 1B3VA 3KOZA 3HIJA 4ZB0A 1P6CA 3VX0A 1EHNA 3IVSA 4PUEA 1UG6A 1TCDA 1GOMA 5DY3A 1EDTA 5JU6A 4QTGA 1AFSA 4FP1A 2QCFA 3B9NA 1C90A 3P93A 2Y8UA 1WDSA 4CEUC 2C19A 2V3EA 1KM6A 4HK5A 5BYWA 1JIBA 3PUDA 2VRQA 1ZBVA 2IW0A 3FFSA 1JZ5A 2PDJA 3GUWA 3LG3A 2A7NA 4ECLA 3A4JA 4L4PA 4PCPA 4F2TA 4WXYA 4EP8C 3GU1A 1BYBA 3O05A 4ROQA 2H8ZA 4YXGA 4Y8EA 2ISFA 2B7OA 3VAVA 4LU0A 2ZBTA 3UNDA 4XTDA 3VUPA 1TUFA 2H8XA 1TCMA 3R43A 1ME7A 2PDHA 4D8AA 3NWRA 1FH7A 3DIPA 4W7UA 3KTSA 1Q6DA 1PPIA 4HMNA 2NSOA 2DZSA 4F0LA 3MMWA 2PF8A 1UBPC 2ZUNA 3WLLA <