1UYQA

Mutated b-glucosidase a from paenibacillus polymyxa showing increased stability
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
447
structure length
447
Chain Sequence
TIFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTPGKVFNGDNGNVACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQEGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQDAGGWGNRRTIQAFVQFAETMFREFHGKIQHWLTFNEPWCIAFLSNMLGVHAPGLTNLQTAIDVGHHLLVAHGLSVRRFRELGTSGQIGIAPNVSWAVPYSTSEEDKAACARTISLHSDWFLQPIYQGSYPQFLVDWFAEQGATVPIQDGDMDIIGEPIDMIGINYYSMSVNRFNPEAGFLQSEEINMGLPVTDIGWPVESRGLYEVLHYLQKYGNIDIYITENGACINDEVVNGKVQDDRRISYMQQHLVQVHRAIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHVDFRTQVRTPKQSYYWYRNVVGNNWLETRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-GLUCOSIDASE A
publication title Mutated B-Glucosidase a from Paenibacillus Polymyxa Showing Increased Stability
rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 175
structure length 447
sequence length 447
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1uyqA00
2VO5A 1QI3A 3ZR6A 1YHTA 1FH8A 1HF6A 1DEDA 5BXSA 1ZBCA 2E8ZA 3AIUA 1FA2A 1WDQA 5C8BB 2BVDA 5LA2A 2V5DA 2WBGA 5LA1A 2E40A 5LA0A 4GZJA 1GNXA 1TA3B 1JNEA 5D8ZA 3LPOA 5AC4A 4CD7A 1H0IA 2DSVA 1CEOA 3RJXA 3N17A 1HP5A 3BLPX 1JIBA 7CGTA 1CZ1A 3TP4A 1E70M 3SUWA 1UH2A 3JUGA 3KWXA 2Y8KA 5A6JA 4FLQA 4NI3A 1C92A 1V6VA 1J01A 2J7FA 2VX7A 3HMCA 2CHOA 3AZTA 3VIIA 5E6YA 2GSJA 4W85A 3K4DA 5EBAA 4AZBA 2XSBA 1OINA 1PBGA 1GOMA 1HVXA 2ZXQA 4BQ2A 2GVYA 3WDPP 4D71A 1CXFA 4V28A 3T2PA 3RMEA 1E72M 2XPKA 5E6ZA 1ESWA 5CLWA 3IAQA 5E09A 1W1VA 4MB5A 1UWSA 1H41A 5KZ6A 4WK9A 2WMFA 1UWRA 3OZPA 3M7SA 1CTNA 5BCAA 4D6DA 1B0IA 1NWSA 1ISZA 1W3JA 4AW7A 4N42A 1H1NA 3AHTA 1LL7A 1JI2A 1NM9A 3WQWA 3KL5A 1GHRA 2V3GA 3W29A 4PMZA 3VGFA 5I6SA 3S2CA 1E4MM 3NJ3A 4PMXA 4UQCA 1E43A 2OYLA 1KXVA 1NP2A 2VQTA 2WXDM 1AMYA 1AVAA 4ZXLA 1JZ4A 4JL1A 2ZX8A 1U30A 1NWRA 3WDHA 1LJYA 4DM1A 1KB3A 2G4FA 1B31A 3W81A 4X9YA 4URIA 3WSUA 3WF3A 3L2LA 3W28A 2CHNA 4J3VA 4AZCA 4W8AA 4W5ZA 1B3WA 3ARXA 2RGLA 1QW8A 2WLZA 2ZIDA 3CHFA 5KEZA 2VQUA 4ZFMA 4DWSC 1E1FA 3SUTA 1PZ3A 2DSUA 2D20A 5M3WA 2WSKA 2W5FA 1HKJA 4MDPA 3B9AA 4Z2KA 2J62A 1E9LA 1HIZA 3ZO9A 4HPHA 2YA1A 2WKLA 4H8UA 4HOWA 1BQCA 1DWJM 1UA7A 2C7FA 1CXLA 1WO2A 2XM1A 1LQ0A 3AIWA 3W38A 4JL2A 3WENA 3QOKA 2EBNA 1Q6EA 1UWQA 1SMDA 2PWEA 1TMQA 4DWSB 2CYGA 3LPGA 1V6WA 4PMUA 1H2JA 1H49A 2VT0A 4AD4A 5CG0A 1TVNA 1RD6A 4P8UA 3ARVA 2YDRA 3VMOA 1JD7A 2CPUA 3WY1A 2QF8A 3N1AA 1CXEA 3UG5A 4CN4A 4DUXA 1OGSA 3W6LA 2AAAA 4BF7A 3GNOA 1ITCA 4HMCA 1E73M 3WFZA 2D22A 1EO5A 5AY7A 5D9PA 3TTOA 3DC0A 4OKDA 1UD4A 1V6XA 4EAMA 3GNPA 3VTRA 3W25A 3PZ9A 3DHPA 2VX5A 3WF1A 5A6AA 1UHVA 3LPFA 2FGLA 3S6TA 1VEPA 1JAEA 3T2OA 2X8RA 1DWIM 5CSYA 5ABHA 1J0KA 1LL6A 1NARA 3T09A 3WL1A 1V3MA 4UFJA 1QHOA 3FAWA 1WP6A 2WVSA 2WC3A 4MNKA 3RDKA 1JG9A 5DO8A 3U5UA 1BG4A 2OSYA 2BXZA 4MNLA 1UKQA 2ZX5A 5M03A 3D3AA 3BCFA 4WIWA 4BQ3A 4GI9A 3ZQ9A 4D6JA 1J12A 1VF8A 3BSHA 2YLLA 3O2LA 1X6LA 1W91A 2A3CA 1UR9A 4CVUA 3UR7A 4RE3A 2D2OA 4D6HA 1V0MA 3EDEA 1N82A 2DSKA 1H4PA 3L4VA 1GZJA 2J25A 1G0CA 2CESA 3F5KA 1U33A 2E9MA 2VURA 4HU0A 3WUGA 3M6DA 1JYXA 4A4AA 1MWOA 3AROA 3CZGA 1F4AA 1MW3A 2WANA 1QNRA 4KH2A 4J7RA 3SURA 1FFRA 5A6LA 1XV8A 5EB8A 4PMQA 3KEHA 5A1AA 2CERA 1WCGA 2YDSA 3O6AA 5D8WA 4V2XA 4XX6A 1E56A 1PX3A 3GH4A 1V3HA 1KCLA 4M8UA 1HKIA 1C8XA 5CJ5A 2O9TA 3OA5A 3VIMA 2VI0A 4ZE5A 3W4RA 3BGAA 4MJ4A 1XH1A 4S3JA 2PC8A 5ABFB 4CCCA 4AYSA 5FOOA 2B31A 1WZMA 2WMKA 2TAAA 4MPKA 1NQ6A 4CN6A 2VOTA 1QBBA 1PIFA 4ACZB 1J10A 3K4AA 3I3DA 4HP5A 4PMDA 2D24A 3M07A 3NSMA 3ARUA 4PMYA 4Q7NA 3CTTA 2C8NA 2BY0A 4GO8A 4W87A 3ARSA 1VJSA 3WMCA 1OGGA 1E71M 4CD5A 1TE1A 4CD4A 3VDAA 2YIHA 4TOQA 3QR3A 2D3LA 6CGTA 3POCA 1UQYA 4NZCA 3AFBA 1UH4A 3EMQA 3CHDA 4F9DA 2W62A 4XV0A 4S3KA 4WSKA 4LYQA 4ML4A 5ABFA 4FLOA 3GZAA 4CD6A 2MANA 4PSPA 3MMUA 3AYSA 3WDRA 3LPPA 3NSXA 4GI6A 1WNOA 4QCEA 1TVPA 2D0GA 4D6FA 3PZUA 3AIRA 5CZKA 1EHAA 2G3MA 1US2A 1XSIA 2BHZA 3UCQA 1W3KA 1UG6A 4E2OA 1UYQA 4NRRA 1FP8A 3AS3A 4AZ6A 2XJ7A 2VMFA 1GQKA 3VM5A 4FMVA 1RPKA 3L4UA 1AQHA 2BXYA 1UR4A 2ZUTA 1J18A 1BPLB 2JEQA 5A8NA 1NWTA 4OOZA 3K46A 4OUEA 3VDHA 5I0DA 1QI5A 3MS8A 1UWUA 2YBUA 4UQ9A 4WF7A 1XH0A 2WLYA 4CCEA 1WZLA 1W9VA 2VZTA 1TUXA 4UOJA 3WF4A 3AHXA 3ZJ6A 3O9NA 2QLYA 1GPFA 5IXEA 5I2UA 3AHVA 2YA2A 1C3FA 2WKGA 4DUVA 5CGMA 4R27A 3EDFA 2G8ZA 1XYZA 4A3YA 1VFUA 2EPLX 3MUZ1 1CYGA 3WNOA 2ZX9A 3MMWA 4L4OA 3NSNA 1HJQA 2OWCA 2VCBA 5HOSA 1BLIA 3L4YA 4U33A 1VBRA 2CEQA 1C93A 2FH6A 2VX6A 2J4GA 3N04A 1NOUA 3ARYA 1CIUA 1L0PA 3NUKA 3SUUA 1CXIA 4ATWA 3VOCA 2PI6A 3VMPA 3CZ8A 2ZICA 1VBUA 2WMGA 3POHA 4WLCA 3ZMRA 4V27A 1JZ5A 1W2VA 1V6YA 5A69A 5IHRA 3ZJKA 4W8BA 3AHYA 1E5JA 4AD5A 1IZKA 4HU8A 1LL4A 2CBVA 1K9FA 1EOKA 3PZVA 4W5UA 1E3XA 1KFWA 2GJXA 1XSKA 2J78A 2XHYA 2EEXA 4CU7A 4HZ6A 4P7QA 1XC6A 2QHAA 5IHSA 4MTVA 3PZOA 4UQDA 3WNPA 2ZX7A 2XFRA 5A8PA 3N18A 3T08A 4MAVA 3VNZA 3GH5A 1ODUA 1JDCA 3WF2A 1KQZA 3AZRA 3UETA 5I5RA 1LLOA 1EXPA 4JFVA 1GQIA 4XB3A 4PTWA 1OIMA 1XCXA 1IT0A 3AISA 1UR8A 2WWDA 2WZIA 2WPGA 1ISVA 3WD1A 4AEEA 4K68A 3PHAA 1OD0A 4M82A 4PMOA 3F5JA 3G6MA 1W9PA 4P7OA 2ZWYA 3CBWA 3J7HA 3MO4A 4JFWA 2WVTA 3OIHA 3WH8A 2ZE0A 3WD3A 2J79A 1UKOA 1Q4NX 2A3EA 5CQ1A 3IJ8A 4DWSD 5DF0A 2J8GA 4PTMA 1DP0A 4B3LA 1JL8A 3PZMA 1ZBKA 2W91A 1GHSA 2E0PA 4HOXA 2GK1B 4HTYA 2WHLA 3PTKA 3CZJA 2YL9A 1WKYA 4U5IA 3ZJ7A 4GIAA 3ZIZA 1UR2A 3UG4A 2YOCA 1DWAM 3A4WA 4HPGA 4TTUA 1RP9A 2XVKA 1HKKA 4IM4A 1J0YA 1UD5A 3AICA 3GXMA 1BYBA 4B9YA 1D3CA 1LF1A 2DEPA 1ISWA 4CGTA 1KGXA 2EO7A 3RO8A 4KMQA 2PF0A 2D0HA 3MV01 2V5CA 2XGBA 1TA3A 1QHZA 4XZWA 4DUWA 1PEZA 5A6SA 1GONA 2PWDA 1DWFM 7TAAA 3N13A 2WM0A 2VZUA 1UA3A 2VVNA 2BY1A 4WKAA 2JALA 2GK1A 3WNKA 1E40A 4U3CA 3OBAA 2J75A 5M17A 3WEZA 2CCRA 3IJ7A 2VC9A 3A4AA 4GQRA 2WC4A 2Y24A 3GBEA 2OWXA 3W37A 3RIKA 3MUIA 4UNIA 3VX1A 1CGWA 3OLIA 4HZ7A 2V38A 3SIMA 1GVYA 3VD5A 1R7OA 2VCAA 1UKSA 4W7UA 2YL5A 4F9JA 2WHMA 1JDDA 5FKYA 2VNCA 5IDIA 1E6ZA 4LQ1A 2WHKA 2E3ZA 2ZUNA 1OGBA 2YLAA 2Y5EA 1EDGA 1GVIA 4JFSA 2JF6A 4TX6A 4X0VA 4E8DA 1OWQA 3WDIA 3FNDA 3OGRA 1V3LA 1CNVA 1QNQA 3VO0A 2G41A 2QPUA 1HVQA 1JFHA 2WMHA 3L2MA 5M5DA 1F4HA 5CPSA 1EOMA 2ZUSA 2PWFA 3GH7A 4D1IA 3VGHA 1KXHA 4UFLA 5A3HA 2XUCA 4HA1A 5A6KA 5ECUA 3B9DA 1LWJA 1V3JA 1QI0A 1XD0A 2O9RA 1QVBA 1EQCA 5HDRA 4Z2LA 5A6MA 5CLTA 1LG1A 3ZT6A 2VL4A 1CGVA 1OT1A 1GJUA 1OB0A 3AMLA 1CLXA 1PJ9A 5GPRA 1R87A 4RL3A 5JBFA 2W4XA 4TVUA 1LG2A 5FCZA 2GJRA 4CU6A 2F61A 3A4XA 4YN5A 2DSZA 3RM8A 5BXTA 3CIVA 2DT3A 3IK2A 2G3NA 3UESA 1SR0A 2DT1A 2XVGA 5ABGA 3WN6A 4M1RA 3OB8A 4EE9A 4PMVA 3B9EA 3ALGA 1TG7A 1R8LA 4D1JA 5IFPA 2OSXA 3BC9A 1G5AA 2BV9A 2O92A 4PMNA 3BAIA 4JHOA 2JF7A 3BH4A 2QMJA 1B3VA 4Z2HA 2A3BA 1R85A 3ZSSA 4B9ZA 4QP0A 2DT2A 1V3IA 4L4PA 3ALFA 5JBDA 3PTMA 3MANA 4DWSA 8CGTA 4F66A 3B8SA 1FH9A 3NDZA 2VZVA 4UQBA 1HJXA 3AMGA 3AS0A 1VIWA 2J7GA 2FDMA 4ATLA 1FOBA 3WBEA 1B90A 1WDPA 1XYFA 3AZSA 3FN9A 3T2QA 4W86A 4ZEPA 1TZ7A 3GNRA 4GXPA 5E0CA 1QNPA 1ISXA 1E4IA 1PIGA 2ZUWA 3IJ9A 1OD8A 3F5LA 3WBAA 4UTFA 3FHQA 4P7NA 4AY1A 2BHYA 4QLKA 1AQ0A 3W26A 2W92A 4QCFA 3VGGA 3VIPA 1GOOA 3KL3A 2WHJA 4J3SA 2Q8XA 3HJEA 4KRTA 4LGXA 1IZJA 4BS0A 2XFFA 1FHLA 1KGWA 1E6SM 4WJXA 1VFFA 1JZ6A 3W27A 4W7VA 3CUIA 4NSBA 1GCYA 1MQRA 4P8WA 4JFUA 4A3HA 2WBKA 3T0DA 1EHNA 2ZX6A 2O9OA 2NSXA 1E6PA 1US3A 3GXIA 4YHEA 1W9UA 2Y4SA 4KWUA 2OYKA 4GQQA 2HISA 2O9PA 1C8QA 4W88A 4WKFA 4X0NA 3L4XA 4QAWA 1E1EA 2FH8A 4C7GA 3N12A 1BGGA 2JIEA 2Z1SA 1UOKA 3PZQA 2XWEA 2F2HA 2WB5A 9CGTA 4OZOA 2WVUA 1VENA 1J0ZA 2VRQA 1ZBWA 1JYVA 3RJYA 5I79A 2CETA 3GXDA 3VGDA 1BYCA 3L4WA 4OBSA 4CUCA 1C90A 3WQ4A 2QMKA 2J74A 1QHPA 4JAWA 5HNNA 5DT7A 1Q6FA 3BAWA 1ZB5A 4J3XA 4JIEA 4AD2A 4UQAA 1EQPA 1E0XA 3G6LA 4KGLA 1W3HA 3SCTA 4U2ZA 2WVVB 3PZNA 3OLGA 2EQDA 2PBOA 1V6UA 1MVYA 1B9ZA 1XRVA 3ARTA 2WZEA 1UD3A 3ZSTA 1PX8A 4J3WA 1KBBA 6A3HA 1B2YA 3AS1A 3VD7A 1UR0A 4AIUA 5HPCA 2XSAA 1KCKA 1MW2A 3VKKA 4ACZA 7A3HA 3N9KA 2WW5A 3TTSA 1MQQA 5DFAA 2IUZA 2ESCA 3A6OA 3U57A 1GOQA 1PZ2A 3RILA 1J0IA 3FY1A 1J0HA 2Y2WA 4H8VA 1G94A 1E55A 1G9HA 2W63A 4PN2A 5A8MA 4UCFA 4MDOA 3ZR5A 2OSWA 3GBDA 5DEZA 3WQ8A 4M81A 1VEMA 3A47A 1H09A 2VX4A 5HXMA 3RPMA 3QHNA 3CHCA 4PTXA 4BA0A 2PB1A 3BLKA 3WQ5A 3VD4A 1OSEA 1JNDA 2IXVA 3WQVA 1BGAA 4HA4A 3I3EA 5GNYA 4Q22A 3W53A 3WH9A 1HL9A 4HMDA 1P6WA 1K9DA 1XH2A 5BROA 3WMBA 1HNYA 3SUVA 4KGJA 2J47A 3GTNA 5FL1A 1HJWA 3SCWA 2Y8VA 1C7SA 3WIJA 3WNMA 3PBGA 1HT6A 3VPLA 1B1YA 3SCNA 1HKMA 1JDAA 5I3DA 3GYCA 4UZSA 5BXRA 3D5HA 1NH6A 1SFSA 3AMKA 4WSJA 3K8KA 2J7DA 4CN1A 5A95A 4GPNA 3T0BA 1PPIA 1HN1A 4CVWA 5A2AA 4NRSA 4TTGA 5DT5A 1V0LA 4J27A 4J3UA 1V02A 5I77A 2CIPA 4AD3A 1QPKA 1KQYA 4IUGA 3WD2A 4IISA 4C7FA 4ZE4A 4PSRA 5D4YA 1UQZA 4PEEA 4CU8A 1XCWA 3APGA 4CCDA 4RE4A 1CDGA 3FHAA 3MU7A 1TFVA 3WH6A 3OGSA 3WUFA 3VIKA 2BNJA 1GW1A 1VAHA 1KR0A 4MAZA 3AIVA 5D9MA 3M46A 2VR4A 2GJPA 2VR5A 4AZ7A 1I1WA 1EDTA 1KGUA 4C7DA 1BSIA 1ECEA 2EPNA 4GI8A 3BAXA 4HMEA 2J7EA 4WKHA 3VIJA 4P7LA 3PTQA 5JBEA 1VRXA 4TX8A 5CXPA 2J77A 3VNYA 3HN3A 1Q6DA 4YHGA 1J9YA 2E8YA 3VMNA 4AD1A 5GQBA 2DH3A 2WMIB 4CKQA 2WZHA 4U31A 4MJ2A 4QDMA 4PTVA 1VFMA 1BHGA 1NOWA 3CMGA 2VZOA 2DSWA 3ZOAA 3SUSA 1R86A 1ITXA 2X2YA 1KBKA 2UY4A 1HXJA 3WL0A 4EKJA 3QHMA 4U3AA 3ARZA 4AZGA 3DECA 4Z2JA 2XIIA 4ZENA 1H0GA 4KRUA 1S46A 2F8QA 2CNCA 3SCSA 1OIFA 3AHZA 3THCA 3OLDA 1HX0A 1O7AA 4B16A 2WMIA 1JXKA 4JCLA 5FD0A 1K9EA 1UZ4A 1H5VA 3CPUA 2UY5A 5E9AA 1OBAA 2EPKX 1X6NA 1CGYA 2AMGA 4TUFA 2YJQA 1C8YA 3OG2A 4JKKA 3W24A 3CUFA 4JZ5A 5D9OA 4JKLA 1DWGM 5LYRA 2WNWA 1CGUA 3BAYA 3SCVA 3MKKA 1Q6CA 2J7CA 1BYAA 3ARPA 3WDQA 3VGBA 3NYDA 1CLVA 5DMYA 2FGZA 3WEOA 2CXGA 3ECQA 5BXPA 1K6AA 1MFUA 5BRPA 3OZOA 1MQPA 5E0FA 1QI2A 1C91A 4GZIA 2VRKA 2WC7A 3SCRA 4UOZA 3VD3A 3PZGA 3FW6A 2XVPA 1K9TA 1QOXA 1UD8A 1V0KA 1GOKA 1PAMA 3VIGA 2YBTA 1Z32X 2V3EA 3ARQA 1JI1A 1XHGA 2D3NA 1W32A 3PN8A 4FK9A 2BFGA 1E6QM 1D7FA 3WDJA 4FLRA 5A8OA 3MV11 3ARWA 3DYPA 1M7XA 2BVTA 1CECA 1QNSA 1E6NA 3BXWA 5CPTA 1UWIA 2YA0A 3QOMA 4H8HA 4Y7EA 4AD0A 3W0KA 2VZSA 4D6IA 1UKTA 2W67A 3L4TA 3N15A 4AIOA 1ZU8A 4AZCB 3ZT7A 1JZ7A 4M56A 4AIEA 4EK7A 5A94A 2NW0A 1V0NA 2XIBA 1H11A 2BS9A 3BSGA 2RGMA 4XZBA 1OCQA 1ZBVA 3NCOA 4PCSA 3WELA 1CENA 4IPLA 5A2BA 2ZUUA 3W6MA 3VIOA 1V3KA 2CBIA 4BZYA 2WCAA 5EFFA 3AOFA 1J11A 2ZUVA 4M80A 1KXTA 4H04A 1HJVA 3CMJA 3WKZA 1WZAA 4OOUA 2FHCA 1HL8A 3NDYA 2XVLA 4LX4A 1VEOA 4AISA 3QHOA 4MB4A 1Y7VA 2WCGA 1MW1A 1M03A 1LWHA 2DIEA 1G1YA 3GXFA 1GJWA 5GNZA 1DTUA 4ACYA 4UZUA 1W9BM 2CKSA 4GINA 1KXQA 5JIPA 6TAAA 1CGXA 2JFEX 1BVZA 5A2CA 4E4PA 4H2CA 3AXIA 4P8XA 3TONA 1ZJBA 3VX0A 4D6GA 5FIPA 5GNXA 2UY2A 1UH3A 3A3HA 3QGVA 3AJ7A 2CBUA 2DQXA 1BTCA 2CITA 3K8LA 4FLSA 5EFDA 2PWGA 3CGTA 4FF5A 4PUDA 2X0YA 3VDCA 2FHFA 5A6BD 2YL8A 1A47A 3UR8A 3WEMA 3AYRA 4MNMA 4AEFA 5CSUA 1X1NA 3BMVA 2V3FA 1TCMA 1JD9A 1E5NA 1W3LA 4R5EA 1L8NA 2PBGA 2QPSA 3CUGA 1A3HA 1O6IA 4BQ5A 5CPQA 4TVDA 1EH9A 3EMZA 4NF7A 2WWCA 1GOWA 2X1IA 2YDQA 4H7VA 1BAGA 3VU2A 1CPUA 2ZUMA 2A3AA 2HVMA 3WUBA 3OGVA 4MNJA 3SCPA 1B30A 1H3GA 1J0JA 1W2PA 2XTKA 1E4NA 1WDSA 3PZIA 4DM2A 4E8CA 2CKRA 4OIFA 1I1XA 3BAJA 1CWYA 4M24A 3WQ6A 5HPOA 2G3JA 1M01A 1JGIA 3WH7A 3WUEA 1SMAA 3THDA 3DHUA 1CBGA 2WSPA 4LYRA 1FP9A 3ARRA 2OYMA 3VINA 2EPOA 4HZ8A 3WFLA 1D2KA 1BVNP 1UR1A 1EO7A 3W82A 2VCCA 2EJ1A 1FH7A 3BAKA 1M53A 3U7BA 1JZ2A 2W61A 1E15A 2ZXDA 3F4VA 5I23A 1VB9A 3CHEA 1JZ3A 1W9DM 2XVNA 5IFTA 2OLHA 1VJZA 3MUY1 4UFMA 2GDVA 3WH5A 4IPNB 1QNOA 4D6EA 4HOZA 2YL6A 3RM9A 3VDBA 2J7HA 3SEPA 4AWEA 3K1DA 1MXDA 1BG9A 3CUHA 2X05A 4UR9A 1JAKA 5ABEA 1B3YA 3IANA 1AQMA 1YQ2A 5I78A 1SYTA 1RH9A 3AMCA 1B3ZA 1UKPA 3MSGA 1B3XA 2DT0A 4W84A 3ZM8A 1QW9A 4UFHA 4TXEA 1JYNA 3MUAA 5AC5A 1EA9C 1I75A 4CD8A 1GQJA 4Z2IA 5C70A 4BCEA 2XM2A 2GFTA 1RP8A 4TVCA 1DHKA 1UWTA 1G01A 1UZ1A 4QLLA 1E6XM 2BHUA 2IXUA 4P7RA 4GKLA 2DPEA 4PBGA 2UY3A 1U2YA 1CXHA 4UQEA 3VIHA 2BY2A 4MADA 1BFNA 2D0FA 5JUVA 2Z1KA 3VGEA 3AIQA 1ZL1A 4PCTA 1XSJA 3DYMA 2E9LA 5EMYA 2WMJA 3GDBA 1XD1A 4H41A 1E3ZA 1CGTA 3AXXA 3E1F1 4J3TA 3U5YA 3ZT5A 1VFOA 2WAGA 4JKMA 4D72A 4MB1A 4HA3A 3SCOA 3KL0A 2XG9A 4AXNA 1IV8A 1JF5A 1EIBA 1W1PA 1TR1A 2GDUA 1ZS2A 2VJXA 1JFXA 2DDXA 4U5KA 3WF0A 3KZSA 3SCQA 1KWKA 3HU7A 2YKKA 3FXYA 3LMYA 2D23A 3BMWA 5FL0A 5A6BA 1V08A 8A3HA 1V02E 3OLEA 2VVSA 3PZTA 4M29A 4B15A 1HP4A 1GQLA 2X09A 1GUVA 1XGZA 2XYLA 2VUYA 2ZOXA 1DWHM 2NT0A 2DGAA 3KE0A 2WK2A 1M04A 2UWFA 1E0VA 2WCSA 3FAXA 2XFYA 1R7AA 2EXOA 4U2YA 4B3KA 3VUPA 1W1YA 1KWGA 4MB3A 1WB0A 1WZKA 2WVVA 2ZWZA 3WD0A 3VVGA 4JFTA 3CZLA 2BY3A 2DIJA 1WPCA 3TOPA 4Z2GA 1E4LA 1BYDA 2NT1A 5BWFA 4PMRA 3EDJA 4F79A 1UUQA 2V3DA 1W1TA 1NP0A 3DYOA 3VD9A 1PX4A 2C0HA 2DH2A 4QLJA 5TD4A 4AC1X 3RCNA 1MFVA 3SCUA 5JIWA 3AMDA 3TA9A 2VRJA 1ODZA 1OT2A 1OM0A 1QBAA 2ZXBA 2VTFA 4ZXOA 3AI0A 1UD6A 3UG3A 1JXJA 2JEPA 1KR1A 5BRQA 3AXHA 1E0WA 4W93A 3AS2A 3EYPA 1WAWA 4AZIA 5CGTA 3I3BA 4GO9A 2AOSA 3U7VA 4LYPA 3L4ZA 2X0HA 2CBJA 4LPCA 1ZJAA 1EGZA 3WNNA 4D6CA 2GUYA 4LXFA 1GOIA 2W66A 3MSDA 5E70A 5I24A 1WE5A 2GJXB 1MXGA 1HJSA 2A3HA 2E4TA 4J28A 3CUJA 3EDDA 2FHBA 2ZXAA 4UFIA 3EDKA 4PYSA 4YPJA 1NOFA 2EPMX 4W7WA 3WNLA 5C71A 2E9BA 2XWDA 3II1A 1CXKA 1V03A 4BQ4A 1C7TA 4JHZA 5D9NA 3UEQA 5F7UA 2JIWA 4GZEA 3CLWA 3AIBA 3UERA 2J7BA 3CO4A 3CZEA 2D1ZA 4UOQA 3AIEA 3T0AA 5HBFA 3IAPA 3CZKA 4PUEA 4F8XA 3ZJ8A 1QI4A 3RM4A 3AQUA 1E6RA 1Q6GA 2BVYA 1NWUA 2G3IA 2J8FA 1W9XA 2XGIA 4EANA 2QV4A 2JE8A 3EMCA 4QFUA 3WMSA 2PWHA 1BF2A 4W89A 3EBVA 1HJUA 1ISYA 1UD2A 3N11A 3BCDA 1MW0A 4W8LA 4OJYA 1JF6A 4OBRA 4RE2A 1GORA 5AYIA 2WYSA 3K8MA 3VIFA 2OWWA 3NIYA 3TTQA 3GM8A 1EDQA 4AZHA 3VM7A 1FHDA 5AYBA 5A8QA 1MYRA 4AMCA 4P8VA 4ATDA 3WD4A 4PRWA 1FFQA 3TTYA 1JYWA 3MMDA 4N0RA 4UFKA 1JZ8A 4AZ5A 1WDRA 3VILA 4XUYA 3CH9A 4JCMA 5BYWA
chains in the Genus database with same CATH superfamily
1FH8A 2C13A 2CZFA 1R0MA 1JCNA 1FA2A 2ZZ6A 4O18A 2E40A 3P62A 5LKYA 1NDVA 1TPWA 5TIMA 1GNXA 1XPGA 5HAOA 4KWOA 4QNWA 4IFRA 4IMEA 3H26A 1JNEA 4RE0A 3BG5A 4CD7A 4BY3A 4YNGA 1TV4A 3QW4B 2P5NA 1HP5A 4JQ4A 4JIRA 1JIBA 4JTIA 3RPTA 3GXNA 4I7UA 4KCWA 5E0KA 3OBKA 2DZTA 3SUWA 3RCMA 2X7VA 3JUGA 4FLQA 2BP1A 1KRBC 4V1XA 3TX9A 3W2NA 3OIXA 4BQ2A 2E6AA 3WDPP 4D71A 1S2CA 1E72M 1MNSA 2XPKA 3NL5A 4S3GA 3IAQA 3M44A 3GFXA 1H41A 5KZ6A 2GQ9A 1T8XA 2X30A 5BCAA 4D6DA 1B0IA 1D8WA 3W2LA 1NWSA 3NM3A 2R94A 2FJUB 3KCJA 3DN5A 2OG9A 1JDFA 1NF0A 3WQWA 3KL5A 3NG3A 3THUA 1KNWA 3NJ3A 4PMXA 2VGGA 1NP2A 3M16A 1AMYA 1AVAA 1JZ4A 4JL1A 1QPNA 4B2DD 2G50A 3WDHA 1L9WA 3SQSA 4DM1A 3DFTA 2G4FA 1B31A 2DFAA 2EG8A 3W81A 3HPXA 3WF3A 1DORA 4AIBA 4YXGA 1FY6A 4J3VA 1I2QA 1B3WA 3LD5A 1AJ2A 1QW8A 1ADDA 2ZIDA 3LXBA 3I4EA 1O95A 4U28A 3PS7A 3LI1A 1D7KA 1CW2A 2DSUA 4LV4A 5M3WA 2WSKA 3GVRA 1HKJA 2PDCA 3B9AA 4DVOA 3ZWTA 1FQ0A 3PFMA 4Q3MA 2B0MA 2YA1A 3ITYA 3OOQA 3W7QA 1TV8A 4FS9A 4HOWA 3SW6A 4D8ZA 1JUBA 2Q6ZA 1DWJM 1X98A 1LQ0A 3NO1A 4JL2A 1Q6RA 1VBHA 2EBNA 4MJMA 5C9UA 3HFYA 3KRUA 1ADSA 1KD0A 2BX7A 3AYVA 5I3KA 1V6WA 2J27A 1H2JA 3QV7A 2AKZA 4C5YA 5FF3A 1Z48A 3KOYA 3W2UA 1TVNA 3TC3A 4P8UA 1ZCCA 3ARVA 5DBUA 2YDRA 3VMOA 1P6BA 3AJXA 2CPUA 4EAYA 3BE7A 2ZRZA 1YKWA 2DZUA 1OGSA 3W6LA 4F4RA 3GNOA 4FX6M 4HMCA 4WXZA 5GJNA 1IEXA 1E73M 3LXAA 1LLWA 5AY7A 3TTOA 4RNJA 1UD4A 3CPRA 1YPIA 3PZ9A 4QE1A 2Q02A 1A53A 3LPFA 5BWAA 3BJSA 3BG3A 4POCA 2AL2B 4HVXA 5C9XA 3QVQA 5BOEA 2X8RA 1DWIM 5CSYA 3T1GA 3U2CA 1XG4A 2GVEA 4GCAA 3GG1A 5LGZA 4AWTA 3P67A 3WL1A 2F6XA 2V30A 3WLNA 2WC3A 4MNKA 3ABOA 3N3MA 2G4JA 1JG9A 4GLEA 2FPYA 3QYQA 3GKAA 4DJFD 1KFBA 2PGWA 2I7GA 4NYYA 5M03A 1E1CB 3BCFA 1K4HA 4GI9A 1ONEA 1X6LA 1Z7AA 2A3CA 1UR9A 3V0SA 2QDGA 1OFEA 3OHMB 2D2OA 1HTIA 5C2CA 1W3TA 5D30A 4X2PA 1A5UA 1EBGA 4A8LA 2W27A 4Y9MA 2AKMA 1W8SA 3CZGA 1KO0A 2WANA 3PPCA 4KH2A 4FR1A 1XV8A 3AYTA 1RLCL 5EB8A 1ZJHA 4PMQA 2HZGA 2ADAA 2CERA 2YDSA 1PHWA 6XIAA 4V2XA 1E56A 2WNNA 3I6EA 2VFEA 3GH4A 1V3HA 2PF8A 3TJ4A 3G5EA 3BDKA 3USBA 3SB0A 3M4HA 2PLCA 5AHIA 3HPSA 2X0SA 3C8NA 5C9ZA 3C86A 3SFKA 1Y5XA 4HZMA 2Z4GA 3LMZA 1VR6A 2B31A 2E09A 5IBXA 2V68A 2TAAA 4MPKA 1NQ6A 2QUNA 1REQA 2V5LA 1QBBA 3C3UA 2Y7EA 3WBYA 3UVIA 1HKWA 3PULA 3LRMA 5E9XA 3P93A 3G1AA 4HP5A 4PMDA 3NSMA 3TYUA 5EGRA 2NVAA 1DJQA 4FZIA 3ARUA 4PMYA 1WXYA 4LJ3A 2BY0A 3QF0A 3O63A 1KA9F 4J4KA 2H8XA 1E71M 3WLQA 1TE1A 3VDAA 4NIRA 5EPDA 1DIDA 1VHCA 5MF5A 4GA8A 4DJFC 1VLWA 3GWQA 4F9DA 4ML4A 4CD6A 2FIQA 2SFPA 4R3UA 3MMUA 3IARA 4DY1A 4OE7A 3S42A 4B5XA 1I2OA 1TVPA 4E0CA 2X42A 3DERA 2WV8A 5CZKA 1WXZA 1OFOA 4MWAB 4A3RA 1ONWA 3STFA 4AMAA 1SVDA 5AHLA 4ZOBA 1SZFA 5HANA 1UYQA 1D8CA 4QE5A 5T91A 1XDMA 3SQLA 1P1MA 2VMFA 3TDFA 1JUEA 3GHUA 3VM5A 2QJNA 4L9XA 2WOQA 2BXYA 1T8QA 5JU6A 1S5NA 2WJZA 2FYMA 4HYVA 4ECLA 3GY1A 4OUEA 5I0DA 2D2GA 3ITLA 3W9ZA 3NXLA 2A21A 4US5D 2VZTA 5BOFA 4L56A 3O06A 3Q65A 3AHXA 1KM2A 1SUXA 5KZEA 3O9NA 2O56A 2XH2A 5IXEA 3V0TA 4W9TA 2R1KA 1FWHC 1DTNA 2PZNA 5D33A 4R27A 3EDFA 1FWBC 3P6LA 3SRFA 3ENLA 4A3YA 2VXNA 4J2MA 1CYGA 4PB4A 1SZNA 2PP0A 2ZX9A 3MMWA 3P84A 4REQA 5E1QA 6ENLA 3E5BA 4UTWC 1BLIA 3FSTA 4GBUA 1MDRA 2Z6JA 3LZ5A 4Q4RA 1W8GA 5IDZA 2J4GA 1EPVA 1KRAC 3ARYA 1CIUA 1KFKA 1RQEA 1FDJA 1OX6A 3G1YA 2PI6A 5MHBA 4JYDA 2V2HA 3CZ8A 1VBUA 1YDOA 3R4IA 3IGSA 4O50A 3L7RA 3CB8A 1B4EA 4EOUA 5IHRA 2HJPA 4ORMA 3TMQA 1IZKA 1K9FA 1EOKA 1E3XA 2VEGA 1H60A 3CQIA 2I57A 4QIUA 3G1VA 4R53A 1J93A 2NQ5A 5FF4A 4CU7A 2FJKA 3W1PA 2QHAA 3AU2A 4KT2A 4UQDA 3WNPA 1EYEA 2ZX7A 1TV7A 4D8AA 3VNZA 3KM8A 1IEVA 1ZP4A 3OU8A 5I5RA 4FP1A 1LLOA 4QISA 1XLIA 4XB3A 1OIMA 2A85A 1C9WA 5E5CA 1BXBA 5DANA 3OYZA 5ABTA 3IJQA 1ISVA 3WD1A 1SR9A 3GE7A 3AC0A 4OWGA 1QCWA 4O57A 3VZYA 1YADA 3B8UA 2J79A 1AFSA 1Q4NX 3VCCA 3VOGA 4PTMA 4B3LA 1E0TA 1JL8A 3PZMA 1UPMB 2W91A 1XIHA 4HOXA 2GK1B 2WHLA 3O8AA 3ZJ7A 3P5ZA 1TR9A 4GIAA 3S2LA 3V5FA 1JCYA 2R24A 3LV5A 4WOQA 2NX9A 1Z41A 4KWVA 4HPGA 4TTUA 1VP5A 3UWQA 1J0YA 3AICA 3OHIA 4E8GA 1QTWA 4PODA 4UIOA 4KMQA 1FWIC 2HNHA 3N6QA 4IMAA 3MHFA 2VZUA 2ABBA 1GKQA 1UA3A 2ASHA 4PCFA 4BI5A 4WKAA 2JALA 4CQ9A 3WNKA 3GG8A 4KCUA 5K3VA 4A2RA 3W87A 2CCRA 2VC9A 3FEQA 4GQRA 2WC4A 3GBEA 3W37A 3WLTA 3GU1A 3QZAA 4GH3A 1CGWA 3HG4A 3LQLA 1JCLA 3W7PA 2V38A 4LUSB 5C5YA 3SIMA 2OGJA 1P43A 3NQVA 2VCAA 2ZBTA 3MBFA 1TELA 3ES7A 4F9JA 5CPMA 1DV7A 4GKTA 1POJA 2PMQA 1R9ZA 3S1VA 5K9XA 1KFLA 9XIMA 1L6WA 3N4FA 1R9XA 4LQ1A 3L5MA 1TTPA 2E3ZA 2EHHA 2ZUNA 4X3ZA 3MYPA 4JTCA 2QR6A 3WLJA 3G1HA 4Q8TA 3V1PA 4X0VA 1PUDA 5AYZA 3S9IA 3TH6A 4WQ6A 2J6VA 2YW4A 2QPUA 4FSAA 2WMHA 4FEZA 1F7BA 3N6HA 5EYWA 1F4HA 1EOMA 3GH7A 4D1IA 3VGHA 1AH3A 5I3JA 1KXHA 3OEXA 1EJXC 3ZVHB 3MZNA 3B9DA 1L6SA 4QE4A 1LWJA 1V3JA 1XD0A 2O9RA 1ICQA 3YPIA 1Q3NA 1U5HA 1Z8AA 5HDRA 5A6MA 1Q63A 1UUMA 1LG1A 2VL4A 5XIMA 1FWRA 4RXFA 1OB0A 3PWIA 1PJ9A 4RL3A 4UTHA 3QV6A 5JBFA 4UC5A 4IQEA 2F61A 3A4XA 4Z1AA 3RM8A 5AHFA 4HU3A 1SZRA 4LY4A 2J88A 2XVGA 3WN6A 4M1RA 2C79A 2YBVA 3A9IA 3EB3A 3ALGA 2IQDA 1H7XA 2CWXA 2ZVRA 3MWCA 1OFQA 2OSXA 3SY5A 3UA4A 1AA1B 4PMNA 4JHOA 2VFHA 2QMJA 3QKEA 3ICJA 3PM6A 4O1FA 3UYIA 3PR2A 3ZSSA 5K9CA 2DT2A 3PTMA 9XIAA 3MANA 2J9YA 1TVLA 2X7WA 4YL2A 3CIWA 1RPXA 4CQBA 1M7PA 5H8MA 3LNPA 3B8SA 3IUDA 4IMGA 4ZOEA 3LBOA 3NDZA 2VZVA 4UQBA 1HJXA 3AS0A 1YNQA 4ZR8A 3GUGA 3RN6A 6XIMA 4ZO7A 1XCFA 2A4AA 4LS2A 1ZNNA 5LXXA 3UNTA 3UZXA 5LZLA 3T2QA 4W86A 2WNZA 1TZ7A 1ZP3A 2YZ5A 1LRTA 4GVIA 1H5YA 1O66A 2BHYA 3P82A 1SFJA 3EKGA 2ANUA 2WQPA 4QCFA 1GOOA 3OBEA 4K37A 2QJJA 3NQ7A 3P2VA 3Q58A 2RUSA 1JPMA 4EPKA 3AUJA 3NQBA 4DJDD 4J35A 4KRTA 1OZQA 1LT8A 3A4JA 4NSBA 3MDWA 1Q2RA 3HG3A 3TEVA 1MQRA 4O1EA 2G97A 2ZX6A 2Z26A 2Q3RA 4M7SA 5FJJA 2NV9A 1TJ2A 1W9UA 2Y4SA 4YTTA 3S1UA 4C65A 2HCVA 2O9PA 2V82A 3OP2A 2CC0A 3F2CA 1S3TC 3GC4A 4FIRA 4O19A 4QAWA 4MMWA 2QZRA 4C7GA 3N12A 3R8HA 2JIEA 4ZVJA 3I6TA 3BO9A 3R58A 4WCJA 3PZQA 5HR7A 9CGTA 3KAOA 3BOLA 4GWEA 1J0ZA 1WKEA 3LGDA 3OA3A 3GXDA 3VGDA 3FVMA 3MJMA 4MWAE 4NXKA 1OCNA 4DN1A 4JAWA 2QCGA 1A5CA 3U2EA 4TMCA 4QQ3A 5FEZA 1EQPA 3UPBA 4U2ZA 2WVVB 3FYPA 3MB9A 2V69A 3BICA 4NJHA 1B9ZA 5HULA 1PX8A 1KBBA 1B2YA 3AS1A 3CH0A 4H9ZA 3SAZA 3NQMA 5HPCA 4FOKA 2XSAA 1PKLA 4C6DA 3PANA 3Q37A 5LNRA 3BOFA 3C0SA 5DFAA 3N14A 3A13A 4MYAA 2Z25A 3VOIA 1TX2A 2WZTA 2JKPA 3FY1A 3BGJA 2D69A 3GW0A 4KEZA 2W63A 2F2KA 4L6DA 4UCFA 1LM1A 4GQBA 2OSWA 2BGSA 3GBDA 1Q4WA 5DEZA 1X1OA 3I7RA 3EWXA 3A47A 2VX4A 5HXMA 3U4AA 3Q67A 4PTXA 1RK5A 2PB1A 3VAVA 2IXVA 3LA4A 1NFGA 4HA4A 4ERGA 1MO0A 4Q22A 3ITXA 1HNYA 3ZLGA 3GTNA 5FL1A 1HJWA 5G2WA 3W2JA 2Y7GA 1Q45A 2Y8VA 4GFSA 3WNMA 2R91A 1R2RA 4WGXA 1TQXA 1HT6A 4MM1A 1B1YA 4RDWA 3P74A 2NUYA 3GYCA 1NH6A 4JIIX 2O0TA 4ZB2A 3RMJA 1O5QA 5A95A 3TQPA 5FEWA 1WKFA 4CVWA 4HYWA 4NRSA 3TSDA 3UWZA 3IIOA 5DT5A 3RU8X 4TTGA 3C2RA 1V02A 4ENLA 1XIGA 4H1ZA 1LOLA 4IISA 4PSRA 5D4YA 1DQXA 1XCWA 3APGA 4GY0A 1CDGA 4QHRA 3DKJA 1KRMA 3R7MA 1QFEA 3W7LA 4LC6A 3PBWA 4Q4SA 1KR0A 3AIVA 3UD6A 1QO5A 2XH7A 2BASA 2VR4A 2GJPA 4MZ8A 3TJIA 1BSIA 1ECEA 4IX0A 4JTSA 1E0UA 3B0VC 3HZ3A 4FOJA 2BXVA 5JBEA 1VRXA 5I3FA 5CXPA 3S5ZA 2DZVA 3VNYA 1S5VA 2ISVA 4K8EA 1Q6DA 4UBPC 1ZHAA 2YYTA 3ES8A 4DO5A 1TJRA 4G7EA 4CNPA 1TREA 3NEVA 3CMGA 3ZOAA 1EF3A 3SUSA 2ZADA 3TN6A 4J2PA 1V6TA 3WL0A 2IPJA 3NURA 3WX7A 4QAIA 2RJHA 1OQFA 4O28A 3HTWA 2HPMA 2OZTA 1YTKA 4UTWA 2V5JA 4IIEA 1K1DA 3SCSA 1OIFA 3WLOA 2QJMA 1O7AA 5TQLA 2YCEA 3KHJA 1XQLA 4B16A 2WMIA 1JXKA 3N4AA 3CPUA 3ANVA 1OBAA 1X6NA 3OG2A 4QXIA 3W24A 3CUFA 4Q6JA 4JKLA 3BAYA 1KC7A 3TJXA 3K4WA 1VHNA 3MKKA 3KS5A 3P61A 3ARPA 3F4NA 3NYDA 3P7YA 1IXNA 5BXPA 1K6AA 3QV8A 4O1BA 4IP5A 5E0FA 4IMCA 1TPUA 2E5CA 2VRKA 2WC7A 3GU2A 1E51A 3SCRA 3VD3A 5LNUA 3O16A 3MUCA 1XIEA 2XVPA 4XD4A 1UD8A 3MHUA 2XIMA 1PAMA 1Z32X 2V3EA 1EGVA 1JI1A 1W32A 4GY1A 1E6QM 3T55A 1ZLPA 3HJZA 3LGGA 3MV11 2QCCA 4LVFA 1XLDA 4NJKA 1DXEA 3RUBL 3H2AA 2H3BA 1E6NA 1UWIA 2P88A 4GYFA 4H8HA 3N19B 3KVJA 3TYZA 3W0KA 2VZSA 1UPPA 2OEMA 2L5HA 2E5BA 3FYOA 4AIOA 1ZU8A 3ZT7A 1F8IA 3WCZA 1AODA 1XDLA 1XLGA 3IUHA 4JTKA 1H50A 1V0NA 3GUWA 1H11A 2BS9A 3BSGA 3FOKA 1IF2A 1ZBVA 1A4LA 3SN1A 4IPLA 5T8GA 1M41A 2XZ7A 4YTUA 4LV9A 3KUMA 5FSDC 1KXTA 2H8ZA 3IGXA 3CMJA 5ECVA 3M0XA 4JX4A 1X8CA 3QLDA 1Q65A 3F1QA 3M9YA 4O11A 5GJPA 3QHOA 2YSWA 4MB4A 2WCGA 1MW1A 2DIEA 4PUJA 4XKYA 1VFHA 1XXXA 5LIKX 1W9BM 1KXQA 5HUPA 1AL7A 3S5NA 2JFEX 5E93A 3LN3A 4E4PA 3W00A 3ONBA 3PNZA 3TONA 2H9AA 3TC6A 4MZYA 1XBZA 2NV1A 2QAFA 2VFIA 3FGCB 1BTCA 3EWUA 3W1XA 5EFDA 4FF5A 4ZSTA 1G4SA 3N2XA 1RSCA 3UA3A 3M0ZA 2YXXA 2YL8A 1A47A 3NL3A 2HBXA 5CSUA 2YB1A 3OODA 3BMVA 4AY7A 1K6WA 3W02A 2B4GA 2PBGA 1FUYA 1KKOA 1WX0A 1A3HA 4BQ5A 3EEGA 1R46A 1O5RA 4DZAA 2X1IA 2YDQA 2A3AA 1S5TA 4NUWA 3WUBA 2A3LA 1F6YA 4WUIA 2XN0A 3EEZA 3PAJA 4QNEA 3T6CA 2AAMA 3GR4A 3IGHX 4YMZA 5ENLA 3E0WA 3EB4A 5CKSA 1I1XA 3RR4A 3CXOA 3W7IA 4R7OA 3GXTA 3PNUA 4FF7A 1JGIA 1IR1A 5LIWX 3W84A 4IT1A 3EOLA 4DWDA 4Q8QA 1CBGA 1ZCOA 2V2CA 1F73A 2PRMA 2OYMA 3ZS4A 4CLMA 2NX3A 4J1OA 4MLJA 4XIAA 4EPDC 3BQ6A 3CTLA 4HZ8A 1EPXA 2ZRYA 1BD0A 4A29A 1BVNP 1EO7A 4H7ZA 3BAKA 1M53A 1O1HA 1OHLA 2OPJA 2XVNA 1KBLA 3MUY1 4UFMA 2GDVA 3D0CA 3WH5A 4IPNB 1QNOA 4GYPC 2J7HA 3GO2A 3RAOA 3WK0A 4UR9A 4PB3A 1B3YA 2YXGA 1DL3A 2I16A 2OXNA 5I78A 3KOZA 4W84A 3ZM8A 4FXFA 4RW3A 3UGRA 4C6EA 1VQTA 1EA9C 1GQJA 3NZQA 3KOFA 4BCEA 1DJIA 3LM3A 4ZO6A 3UJRA 4Q32A 4GNJA 2CLMA 4TV6A 1REQB 1OF6A 4AVFA 3A12A 3KP1A 4LFYA 1ZAIA 2CZDA 1UMYA 1UZ1A 4E3VA 3GK0A 3D46A 2XZ9A 4GHRA 2VYOA 3GVQA 4P7RA 4ZL1A 2DPEA 3TR9A 1U2YA 1FWTA 3RX2A 4UQEA 4PE8A 1FKXA 4NAEA 4TO8A 3SN4A 4FX7A 4M6UA 4MADA 1BFNA 2D0FA 4ZOCA 5EMLA 4F3HA 2ON3A 1ZL1A 5D2YA 5JH1A 3GDBA 2NWSA 3L0GA 3AXXA 4ZQCA 2YYUA 4NILA 4WY0B 3E96A 2VP8A 2ZRWA 4JKMA 1XR2A 3IACA 3K30A 1Z6KA 1IV8A 1JF5A 1ZGDA 5FF7A 1EIBA 1P0NA 5A8GA 3MPGA 1TR1A 2VJXA 2RFGA 3NO3A 4U5KA 3WF0A 3KZSA 4KW2A 3LLDA 1P1XA 2YKKA 2OGYA 3LMYA 3O6CA 4L4LA 1UASA 4FX8A 2VVSA 4B15A 4M29A 1N55A 2OKOA 2OOGA 7ENLA 4DAIA 4ZB0A 4N6EA 4QS5A 2WM1A 4JTEA 2NT0A 1XBVA 4A3UA 3TW6A 5AYXA 1QK0A 1UB3A 1VPQA 2XFYA 1R3QA 3VUPA 1KWGA 3PUOA 4C1KA 1WB0A 1FCQA 3WLLA 4WDUA 3VVGA 5LHFA 4J9JA 3L65A 2ACUA 3JS3A 1PCWA 2GVGA 4LUJA 2RDUA 4G8TA 4PMRA 3HB9A 1OYCA 4IF2A 4JIPA 2C0HA 2DH2A 4ONVA 4QLJA 1LBMA 4HGXA 4N6FA 4G56A 5TD4A 3Q4DA 3DFQA 1PTDA 4B3ZA 1RVKA 3SCUA 4IIGA 1OM0A 3B0YA 2G37A 4Y2WA 1PWMA 3ITGA 3A23A 4WR3A 1UD6A 5LHEA 3I4KA 1JXJA 2JEPA 1BSLA 3S5SA 1KR1A 5BRQA 5T26A 4AX6A 3H8AA 4AZIA 1TUFA 3IPWA 4B5NA 3PK7A 3U7VA 4HT3A 4LYPA 2Y61A 3LCHA 4LPCA 4PL2A 2VENA 3M7WA 3MSDA 3C3NA 1MXGA 3W71A 3CUJA 4KQNA 1W5NA 3G77A 5C7HA 5BNKA 4YPJA 3BQ5A 3V5OA 3H55A 4H6QA 1LDCA 4BQ4A 4C6NA 3UG8A 3UEQA 2JIWA 4GZEA 3CLWA 1ZAJA 3IWPA 3TE9A 3UERA 2J7BA 3CZEA 1MDLA 4QITA 3T0TA 3AIEA 3E2RA 3QXBA 2OEKA 1QI4A 3BURA 3RM4A 1Q6OA 1MEIA 3AQUA 1Q6GA 4PCNA 1NWUA 4F0RA 2NXIA 1M7OA 4FNSA 4NT0A 1A5SA 2JE8A 3EBVA 1ISYA 2QCDA 3JR2A 5HINA 3BCDA 4ZQMA 3NVTA 2F9RA 2FB2A 1MUCA 1Q66A 5AYIA 4X63A 4QSHA 2YB4A 1EX5A 3NIYA 4QS6A 4LF1A 4JDYA 2QGHA 4ZGYA 5A8QA 4AMCA 4K38A 1DIEA 3TZFA 2PCQA 3TTYA 3MMDA 4O10A 2KAUC 2GJNA 2DP3A 1PKNA 3FS2A 5BYWA 1QI3A 4CEXC 5JXQA 1ZBCA 3OQEA 1WDQA 2BVDA 5LA2A 4PUKA 2QCFA 4E2BA 3SSZA 2OO6A 5AC4A 3IVTA 3RJXA 3LV6A 3BLPX 1OC5A 7CGTA 1CZ1A 1DJXA 1UH2A 2Y8KA 2HNEA 5A6JA 3ITVA 4Q4QA 4LVBA 4NI3A 1C92A 4GACA 1XLFA 3UF9A 5B7YA 1J01A 1IGWA 2VX7A 4PL1A 3ZLFA 5EBAA 3C5QA 1PBGA 4LW7A 2DVXA 2GVYA 3APTA 1CXFA 1A5OC 3PSWA 4DF0A 1O4UA 3BLLA 1EFZA 3KX6A 1PV8A 1WOAA 3S8HA 2IS7A 5L6UA 4DBUA 5CLWA 4MB5A 3C52A 1XJBA 5DCBA 1UCWA 5G4WA 3HV9A 4H6RA 1X96A 1UWRA 3KHDA 3OZPA 3PTDA 3PBUA 3GIQA 3LCLA 4KS0A 2ALDA 2ISSA 1W3JA 4PFHA 4P2VA 3LNMA 3PBVA 4H9UA 3W75A 4O4WA 1LL7A 4WRHA 1POKA 3VNDA 1JI2A 1NM9A 4LRSA 4NJGA 1GHRA 2V3GA 5I6SA 1DIOA 4KEUA 2OYLA 2FPTA 3CAWA 4ZXLA 3NTYA 1RXOB 2ZX8A 3WK2A 1IEIA 3NGFA 2QUTA 3N25A 3PPGA 1SZEA 4L7ZA 4X9YA 3N3TA 4URIA 1SFTA 4L64A 3QBUA 1OFBA 2CHNA 1IE7C 1VLIA 4QRNA 4W8AA 1Q6LA 4S3AA 2V0TA 2RGLA 4AEOA 4ZFMA 4DWSC 1E1FA 2QVHA 4I3GA 1XGDA 2XINA 1PZ3A 2RHGA 4DYEA 1F6PA 3TXZA 2OZ0A 4WVXA 3WQOA 2W5FA 3TFCA 3S3GA 1S1PA 2GZXA 3TJLA 2ALRA 1KCXA 2J62A 4Q8VA 1E9LA 4PTNA 2ISDA 3QY7A 1P0BA 1MEHA 3ZO9A 4MFDA 5HJYA 3F4DA 2WKLA 1GJPA 2P1FA 5FJUA 4H8UA 4DLFA 3S1WA 2PDMA 3LOTA 2Z1VA 1NFPA 2C91A 2FZDA 2XM1A 1IT7A 3AIWA 3QOKA 4BF5A 1Z69A 3QTPA 5C0QA 1UC5A 1UWQA 1EJRC 4GVGA 1SMDA 2PTXA 4C5ZA 2PWEA 3W6YA 2P0IA 2CYGA 4BKNA 4X61A 3QMRA 3LTSA 4Q8WA 3JVAA 2VT0A 2ACSA 3A21A 4JTUA 2A79A 3FLUA 1DJGA 2WO5A 2PU0A 3N1AA 4I7VA 1XF0A 4QJ3B 4DUXA 2AAAA 3E0FA 4ICMA 4O0ZA 3VKDA 3W7RA 3O0FA 4UXDA 3SJ3A 3B40A 4EAMA 4RPQA 3FKKA 4DF1A 1EIXA 1E9YB 3DHPA 3WF1A 1ZTVA 2NSOA 5A6AA 2IQ0A 3TNOA 3UWEA 3LK6A 3IK4A 3TYAA 3S6TA 4XD6A 2QUMA 1XYLA 2VGIA 4B90A 3BARA 3M1ZA 2Y63A 1EJWC 1LL6A 1NARA 3T09A 1T5AA 1V3MA 4INFA 5JH2A 1QHOA 1WP6A 4MG4A 2Z0IA 1PVNA 2J66A 3W85A 3TWBA 4S2BA 3D3AA 3G8EA 1XLKA 4IIBA 1HGYA 1QWKA 4WIWA 4NJJA 4D6JA 1JPDX 1VF8A 1A49A 3BSHA 2DZXA 3W1UA 3NQEA 1ZENA 4CVUA 4YIWA 3G3MA 5JMUA 1A50A 3KS6A 5G1TA 2AL2A 5K9DA 3UR7A 2FVMA 4JN8A 2V5KA 2E9MA 2VURA 3LUTA 3M6DA 1XLLA 2JGYA 1MWOA 3EWWA 3MDUA 3ME3A 4EF9A 3TUUA 1FFRA 5A6TC 5FESA 5C9WA 1IZCA 1B3OA 1E1CA 4YLWA 4M19A 5CAHA 1U1UA 4RX0A 2R6OA 3L5AA 2FGBA 2O9TA 2X1UA 4ZE5A 3BGAA 4MJ4A 3WLSA 1XH1A 2PC8A 5ABFB 5FOOA 3R25A 1S2AA 1WZMA 2VFDA 4CN6A 2VOTA 1NTHA 1FKWA 3S9ZA 2CZVA 3NA8A 2D24A 3M07A 1R2SA 4Q7NA 3PVFA 4GO8A 3CK5A 3ARSA 3WMCA 1OGGA 2ZDRA 1SJDA 2YIHA 4TOQA 3E12A 3QR3A 1W31A 5DCEA 1Y5WA 1UUOA 2UV8G 4NZCA 4IPJA 3AFBA 3CHDA 5AZ1A 2W62A 3O05A 4FHAA 4XV0A 1S1RA 2P8BA 4B5VA 3VDGA 2MANA 1MEWA 2AGTA 3AYSA 3NAVA 3NVDA 4GI6A 1WNOA 3Q2DA 2P0OA 4DI8A 3AIRA 2B7PA 1I9CB 1XSIA 2BHZA 1ML1A 4Q7IA 1W3KA 1UG6A 4E2OA 1IHIA 4NRRA 4C6LA 1KM1A 1GEHA 5AHEA 1Q13A 1DJNA 1S3HA 2XJ7A 4X22A 3R8RA 4X9SA 1I2RA 3QSTA 4ES4A 4IJCA 4GRSA 3L4UA 1K8ZA 5B7ZA 1DE5A 1KW1A 2PTZA 5A8NA 3DDMA 1NWTA 1MUMA 3GDRA 3K46A 1J5SA 3F2DA 2DZBA 1UWUA 1AMKA 2CXEA 2YBUA 4UQ9A 3KTXA 1XH0A 4DNMA 2WLYA 1WZLA 5KZDA 4UOJA 1IXOA 4O17A 2GGJA 1SW0A 4MWAA 3LERA 1Z42A 3T7VA 5C2GA 3IIXA 4IUOA 3MI3A 5I2UA 3AHVA 1TTQA 2WKGA 4DUVA 2PZ0A 3P0XA 4XD5A 2FZ9A 4O0QA 1JRCA 3CHVA 1J2WA 1XYZA 3TKFA 1T7LA 3MUZ1 3NL2A 4BEUA 4L4OA 2OWCA 2GOKA 2DVUA 4JYEA 4RR4A 1UP3A 2CEQA 3UW6A 1C93A 3GU9A 3NUKA 3SUUA 1CXIA 4G7EB 2EKCA 1WXJA 2DY3A 4ATWA 1K3UA 2QDHA 3OYXA 2WMGA 4WLCA 4GJ1A 3V36A 1W2VA 1V6YA 2Y62A 1ME7A 5A69A 4HK6A 5FJTA 3ZJKA 4W8BA 3QR0A 3AHYA 4HU8A 1LL4A 5C2XA 1SJCA 2J9ZA 1XIMA 4JTDA 3UZYA 4LVAA 2QQ6A 3TQVA 1OK6A 3H7VA 3GIPA 4JTLA 4O0KA 3G0XA 2DJXA 4IJRA 4O4VA 2XFRA 1JRBA 2G3FA 3GH5A 2BOGX 1O5KA 1TWIA 1EXPA 3NWRA 1YDVA 4JHMA 1ZQ5A 1GQIA 1OFAA 4PTWA 1XCXA 1XI3A 4JR5A 1IT0A 1UR8A 4GE8A 2WZIA 2WPGA 3EWDA 4K68A 1KTCA 5F2MA 3PHAA 3TW7A 3KRSA 3CJPA 4M82A 4PMOA 1FX6A 3F5JA 1W9PA 1TWZA 3DH7A 4A3QA 3T44A 3D3FA 3CBWA 3QM3A 3J7HA 3MO4A 4MGGA 5CH9A 4JFWA 3QR1A 3WH8A 3GFZA 2OQYA 3WD3A 5CQ1A 3IJ8A 4IGSA 1OFRA 3TYDA 1IIGA 4EIVA 4L1WA 6PTDA 2WJFA 3B03A 1ZBKA 3LRLA 3S6OA 4I9TA 5F2GA 3W1MA 1KM0A 2XIOA 4L80A 3UG4A 4LAKA 3B8WA 2YOCA 1Q6QA 1RP9A 4IM4A 3THQA 3EX1A 3URQA 4B9YA 5FAGA 1ISWA 1KGXA 2EO7A 3RO8A 1VYSX 4HNUA 2PF0A 1TA3A 4XZWA 2BGQA 2OO0A 1JULA 2PWDA 7TAAA 3C6CA 3W86A 2BOEX 2E1WA 2WM0A 1A3XA 4PCPA 1EUAA 2X40A 1TJPA 3HGJA 1QU4A 4XK2A 2GK1A 1A5KC 1BWKA 4H19A 5XIAA 2Z2UA 4U3CA 3IV8A 2J75A 4I8YA 3WEZA 3CAQA 4RJEA 4XKYB 2Y24A 3RIKA 3MUIA 4UNIA 3M0YA 3VX1A 3CQHA 4HZ7A 3I7SA 3S4TA 1GVYA 4N9DA 1L6FA 3IRDA 3UPWA 3GHTA 1RBAA 2H9AB 1I60A 3QTGA 3FJ6A 6REQA 3MCNA 4H9VA 3VXGA 1OGBA 3QH2A 2PDXA 5PTDA 4O52A 3A24A 2I5IA 4JFSA 4TX6A 3L12A 4E8DA 4FA3A 1KKRA 3WDIA 3FNDA 3PPFA 1V3LA 1QNQA 2G41A 2Z29A 3RHGA 2HBVA 1TRIA 3AWOA 2PRLA 7PTDA 3L2MA 5M5DA 4LUSA 2PWFA 4H2HA 3V18A 3LM7A 3AAMA 3H2CA 2YXOA 5A6KA 5ECUA 5AECA 2TMDA 1EQCA 4MUPA 4XSMA 5GJMA 2J13A 1G4PA 2ZZ2A 4Z2LA 4GXMA 1P4CA 5CLTA 3EOSA 1FHUA 1GJUA 3P8JA 4JEQA 4HNLA 3O15A 1R87A 3KZPA 4LCRA 2W4XA 4TVUA 1LG2A 2GJRA 4C1NA 4YN5A 5BXTA 3CIVA 4Y96A 1TPEA 2PP1A 1SR0A 3ITCA 5ABGA 1RLDA 4DAFA 4FO4A 3SGZA 4D1JA 5IFPA 3BC9A 3RLVA 1G5AA 2O92A 4GABA 1VC4A 4YWIA 2INEA 3IVUA 2A3BA 3STPA 3TQ0A 2HXUA 3L66A 5K4XA 3ORWA 4K8HA 3W23A 1PYMA 3ALFA 5JBDA 2QAPA 4DJEC 2VFGA 4C6BA 4DWSA 4HU4A 1SGJA 5F2LA 1K8CA 3DFNA 2NUXA 1T6MA 1D9EA 1VIWA 2PWVA 4GJIA 5KSWA 1A5MC 2OX1A 3RLUA 1YXDA 4ATLA 1C8VA 3T0CA 3UR2A 4AVNA 3WBEA 1B90A 1WDPA 3LTYA 2QUUA 4M0XA 1ALDA 3MBDA 2R8WA 1OD8A 2VGFA 1EBHA 3B0UX 4UTFA 4P7NA 1TYGA 1ECQA 1VBJA 4QLKA 3M0JA 5FJOA 2QJHA 3W26A 5D2XA 2W92A 4LBUA 3VIPA 1QO2A 3UFYA 2XU2A 2WHJA 1IT8A 1TRDA 1H1YA 4WY0F 3HJEA 4PULA 4OGZA 1L6GA 1FHLA 5EBUA 5G4HC 1KGWA 3VZXA 5LIUX 1VFFA 1JZ6A 4I90A 3W27A 4W7VA 3CUIA 4P8WA 2WBKA 1EEXA 3T0DA 3D6NA 2O9OA 2NSXA 2OZ8A 5CG7A 4AWSA 3PBYA 3O7UA 4KWUA 5T9CE 1XYCA 3R0UA 1D3HA 3M5YA 3UR5A 4HNNA 4GQQA 2HISA 1C8QA 3A64A 3CV2A 4W88A 4JIQA 1P0DA 2ACQA 1S5MA 2PCEA 1BGGA 3GYEA 3S9YA 4XSLA 3UY7A 4LBRA 3E9AA 4OZOA 1PTGA 1QT1A 2NQJA 1VENA 3CWOX 3S5OA 1ZBWA 3W83A 4TU1A 4C6FA 2BOFX 3MT1A 3H2NA 2FKPA 3SM0A 1RJPA 1KRCC 1W3NA 3NM1A 5DT7A 4S39A 1ZB5A 3SADA 2DZAA 1W3HA 3KBMA 3SCTA 4E4FA 3ATZA 1UC4A 1V6UA 3CNYA 3ZSTA 3GW3A 3EPNA 4LNCA 5L9FA 1MW2A 3N9KA 4QG6A 4FNUA 2IUZA 4S1FA 3U57A 4IPIA 1J0IA 4H8VA 4CNSA 1G9HA 3NO5A 1V7YA 3BSMA 4P5UA 1H09A 2DIKA 3CHCA 3V5CA 4G6CA 4AHQA 1JNDA 4GIRA 3A5FA 3NQDA 1GVQA 2E67A 5GNYA 1P6WA 5BROA 3WMBA 2J47A 1CB7B 4XQ6A 3N9RA 3M41A 4DZHA 3WIJA 4HJFA 4DQWA 4HN8A 1JDAA 1EL3A 3AMKA 2HWGA 1EJUC 3K8KA 2J7DA 4G1NA 4XVDA 4GPNA 3FA4A 4GXWA 3HPFA 1YTDA 1LORA 1XS2A 3EAUA 2A6LA 5AC7A 1V0LA 3DOPA 1I2PA 1K7EA 5I77A 3C2VA 4AD3A 3WD2A 2VEPA 3GAYA 4C7FA 4CU8A 4CCDA 2QCDB 1ZUAX 3FHAA 1TFVA 2X2GA 5DMLA 4IL0A 3IJDA 3W7HA 1GW1A 1VAHA 3M46A 1I0DA 3FFSA 1I1WA 4WZHA 2OQLA 2VEMA 1JCMP 2EPNA 2NQHA 3G8RA 2J7EA 4WKHA 1GZGA 3PTQA 3G2GA 5D2WA 4TMBA 1YNYA 1TZ9A 3TR2A 3I6RA 4YHGA 4K8GA 3GRIA 4UMAA 3VMNA 4DXKA 4AD1A 1F3WA 2DH3A 3CAVA 4KWSA 3SR7A 2WZHA 3PPHA 1RK6A 4MJ2A 3ERPA 2XN2A 4M6VA 4Y8FA 4Q8PA 1VFMA 3L9CA 1BHGA 1OEPA 2XIJA 1W56A 4TQTA 3EX2A 3GNNA 4O16A 1R86A 2PUZA 4NJIA 2QDDA 2X2YA 2OT0A 1HXJA 1R3YA 1H51A 1GOXA 4Z1BA 3T07A 4EKJA 3HQPA 3ARZA 1K7XA 1TPDA 5A5WA 4I8DA 5CPLA 2O4QA 1YBQA 2PURA 1RJQA 3LU2A 3WZ0E 1FDZA 2F8QA 2CNCA 3AHZA 1HX0A 1F6KA 3CYJA 2GDQA 3W2MA 5FD0A 1K9EA 3UY8A 1XFBA 3MP3A 1LZOA 2CFFA 3BTNA 2EPKX 4UTJA 1AH0A 2VFFA 2HS6A 4TUFA 2RJGA 1EEPA 4JZ5A 4JX6A 5D9OA 2C1GA 1DWGM 5LYRA 3M43A 2Y7DA 1IXQA 3FSUA 3M0VA 1A4MA 1V79A 2E1DA 3KBSA 1Q6CA 2J7CA 3MP5A 2HSAA 1CLVA 2ZVIA 3WEOA 3ECQA 3MYOA 1J79A 1MFUA 3OZOA 3EWCA 1QI2A 2RH9A 4HSHA 4B4HA 3PZGA 3DGBA 3KVKA 1K9TA 1QOXA 1V0KA 4AYGA 5GVJA 1K03A 2YBTA 3MP4A 2D3NA 1OVDA 5CJMA 2BFGA 2W9MA 4I6VA 5F4WA 3ARWA 1P0KA 1M7XA 2H90A 2GVJA 5CPTA 3QOMA 1MZRA 2VWSA 4GGBA 3L4TA 1FWSA 3N15A 4JPGA 2VELA 1JZ7A 1DJZA 1IEQA 5T9BG 4AIEA 3OVRA 4EK7A 3BV7A 2TODA 3LI0A 3V7PA 2RGMA 4XZBA 4C60A 5FJIA 2BDQA 1OG0A 3W6MA 1XG3A 3FK4A 2WCAA 2ZFAA 1J11A 2ZUVA 4H04A 3PG8A 3WKZA 1WZAA 1SZGA 4E38A 4HB7A 5MKGB 1HG3A 3GS6A 1HL2A 4PRRA 1GKPA 3NQAA 1Y7VA 4M51A 3GTXA 3GXFA 1DTUA 5HQLA 4ACYA 4UZUA 3LCGA 4BR1A 3E3HA 5CBBA 1ELSA 1BVZA 1VKFA 3LHTA 4H2CA 3TU9A 4NZJA 4JYFA 4EVZA 1UH3A 3A3HA 3QGVA 3LLXA 3HV8A 4XAYA 1XPYA 2FZMA 4JQ3A 5DN1A 3CAKA 3W1RA 1U5JA 3VC5A 3KW3A 2FHFA 3PY2A 4DPPA 3WEMA 3UR8A 2AQVA 1TPFA 3AYRA 1CX9A 4PZVA 4H83A 4MNMA 4AEFA 3UZ5A 1X1NA 1AW1A 2V6AA 1W3LA 4KEVA 4Z0SA 4GD0A 4R5EA 1L8NA 4YVPA 1XYAA 4TVDA 4J5NA 4CQ8A 1EH9A 4NF7A 4Q8UA 3AXMA 3O6YX 3EKZA 3FJNA 4H7VA 2QV5A 4DYKA 3TLQA 3R11A 4LEFA 1KM5A 3FGCA 4MNJA 1B30A 2J6XA 1J0JA 1W2PA 4DXVA 2AQOA 3VNJA 4PA8A 1WDSA 2CKRA 3BAJA 3SBFA 2BB0A 4M24A 1XICA 3WQ6A 5KINA 3V0UA 1SMAA 1H7WA 4R7WA 3DHUA 3UQNA 1UOZA 1TTIA 1EC7A 4LYRA 2VHLA 2QULA 3EPMA 3CWHA 1ZSXA 4H4IA 2V9DA 3N2BA 3WFLA 1D2KA 1ICSA 4WOZA 3N29A 2PDIA 4J3ZA 1VCFA 1JZ2A 1WBHA 3F4VA 2ISWA 1JZ3A 4KFOA 3CV7A 3WQDA 2A2IA 1GVRA 2OLHA 1VJZA 3DFYA 3KCOA 2C14A 1B5TA 1XLAA 3MSYA 4LAZA 4GBDA 4D6EA 2YL6A 1V8EA 3VDBA 3SEPA 2GPTA 4XZMX 4AWEA 1MXDA 4XZNX 2X05A 3OPSA 5HATA 1JAKA 2PP3A 2ZZ5A 3INPA 5ABEA 1S38A 3VCNA 1RH9A 3GG0A 2DUAA 3MSGA 3C2OA 1QW9A 4UFHA 3W7JA 4EWJA 1GVOA 4TXEA 3CT2A 3SGGA 1JYNA 3H2MA 3MUAA 3BLIA 1I75A 4TIMA 4CD8A 3FV9A 3L67A 2GQ8A 4Z2IA 4GC3A 1XM3A 2GFTA 4OVXA 1RP8A 4TVCA 2R82A 5C6MA 4DJEA 3DUGA 4L1XA 1A5BA 4QLLA 3LQGA 3SECA 1UWAA 3FVDA 4PBGA 4XTIA 4F2UA 2PLMA 4DX3A 4DO4A 2BY2A 4O12A 1F74A 4ICNA 4PCTA 4HNVA 2E9LA 2WMJA 3BZJA 3TCSA 2GGEA 3E1F1 1TB3A 5EMKA 4J3TA 3CV1A 1V4YA 5I06A 1IWPA 2WAGA 1R6WA 2HV5A 2NQLA 4AXNA 4IICA 3E2QA 1CB2A 1WKDA 3RX3A 1M9HA 1OJXA 1JFXA 3C0QA 4IQJA 3PF3A 3SCQA 3FXYA 4FXSA 3TMLA 1EJVC 5LNSA 5A6BA 3VABA 4GNVA 1H1ZA 3OLEA 2QT3A 4JQ1A 4XWUA 1VJIA 3KP0A 4PBFA 3BANA 3H2FA 2VDGA 3N2CA 3GNDA 2XYLA 4B92A 1PDYA 4B5SA 4WY0A 1M04A 1JQVA 4XZHA 2WCSA 3FAXA 3WBXA 3N2OA 1QAPA 2AQWA 2V81A 2ZWZA 4HPXA 4B5WA 2UBPC 2JKAA 4DRSA 3QQWA 4JFTA 3QLLA 4ZFCA 4LCSA 1BYDA 4O54A 1YYAA 2TRSA 3DFHA 4DBWA 1KLYA 4CNTA 2V3DA 1SJAA 1W1TA 4GUHA 3NZGA 2OU4A 3FJLA 3DYOA 1EWDA 1PX4A 3TWAA 1KM3A 2WJDA 4AC1X 2O4MA 3RCNA 3H7UA 3GB6A 3GHRA 1H62A 3HQ1A 3TN4A 2YCIX 1W1B1 1I45A 2VTFA 1BWVA 1QMLA 4XKMA 4DBDA 3EWZA 4TX9A 3SDOA 4G9PA 3UCCA 5HWMA 4A35A 2KZHA 3AS2A 1WAWA 3TIMA 5CGTA 1H7PA 3GLCA 4GO9A 2AOSA 4LBSA 3OO2A 2X0HA 2PE4A 5AC6A 3KDNA 2CBJA 1SSGA 1ZJAA 2BODX 1EGZA 4D6CA 2GUYA 2GSEA 4LXFA 1HJSA 2A3HA 4J28A 1LYXA 5DRCA 2ICSA 1Y0EA 4HQVA 3WYZA 1F3TA 3KTSA 4IGNA 2QCEA 1CXKA 4JQ2A 2XH0A 4JHZA 4BFAA 5D9NA 1VFLA 1QASA 4LS0A 1M7JA 4LF2A 3T0AA 4AHPA 3DBNA 2WNQA 3IAPA 1OF8A 3DESA 4PUEA 5HMSA 3QZEA 5M2FX 4Y9PA 1SM9A 3WJXA 2BVYA 4NNAA 2G3IA 3P81A 1P6CA 1W9XA 2XGIA 4XUGA 4EANA 3WFAA 3M5ZA 1BF2A 3LRKA 4W89A 1HJUA 4J40A 4IMFA 3BL3A 4OBRA 3KBJA 3VIFA 5AFDA 2OWWA 2QIWA 4E2DA 1BVWA 2I5QA 3C56A 1EDQA 3WQEA 4AZHA 5AYBA 3R0KA 4BI6A 4P8VA 1PHQA 3WD4A 1LQAA 4N0RA 2G95A 4JEJA 2WKJA 2YCJA 3O07A 3VILA 3XIMA 3WQCA 3CH9A 4PBEA 2VO5A 1J5TA 3EGJA 4DPQA 5D2TA 4L5ZA 2E8ZA 1YX1A 4NAFB 3URNA 4GZJA 3HBLA 4RZ6A 3R1ZA 3DFOA 4IP7A 1QATA 1TA3B 1OY0A 1C29A 5D8ZA 4PB5A 1DKWA 1YMYA 1H0IA 2DSVA 1Z3NA 4HMNA 1RCOB 4I5RA 4N02A 3NZRA 3TP4A 1E70M 3KWXA 3BW4A 4Q7BA 1V6VA 3HMCA 3VIIA 5E6YA 2C6QA 1XIFA 3WLMA 1GOMA 2ZA2A 2ZXQA 3CU2A 4A6GA 1V77A 2WSQA 4V28A 3RMEA 3R5EA 1ESWA 3N6JA 1L6YA 2EPHA 5E09A 1NY1A 3VE9A 3MI6A 4ILSA 1UWSA 1JPIA 3DFPA 4G5DA 3EA1A 4WK9A 2WMFA 6REQB 4RPPA 3GDKA 1GVEA 1UIOA 3CO8A 3M7SA 1CTNA 1JCXA 1ISZA 5FACA 3LTPA 1H1NA 3BW3A 4Q6XA 4HSNA 4DO7A 3IIPA 3H6OA 1E4MM 4IGMA 4UQCA 1OYAA 1E43A 2VQTA 2WXDM 4YWSA 1VRDA 1LJYA 1KB3A 5CPNA 3L2LA 4EX4A 3T4CA 4QJ4B 5LSMA 4WDTA 2VC6A 1HW6A 1M68A 4AZCA 2C16A 3DAQA 1GW9A 2F6UA 4W5ZA 3W7CA 1EX1A 4RNFA 3ARXA 1GYLA 2WLZA 3CHFA 1IR2A 4IZGA 4Y90A 5FEPA 2VQUA 5KEZA 3NXFA 2CLFA 4Q33A 4C1NB 2NXGA 2PDQA 1UBPC 2B81A 3FDGA 4MDPA 3GTHA 4Z2KA 3IJIA 3USZA 4JY8A 3IRSA 4AG0A 3H24A 5BRBA 1X6UA 2O55A 4DIAA 4TV5A 3CEUA 4RV8A 1H63A 2PSNA 1BQCA 3NPUA 1IXPA 2C7FA 1CXLA 3ZLHA 3W38A 3T42A 4GVFA 1M5WA 3W70A 3ITOA 4YTRA 4DWSB 3LPGA 1KTNA 3F4WA 3IIVA 4PMUA 1TX0A 3ZR4A 1R38A 1F3XA 3S2MA 5J04A 4R9XA 5CG0A 1RD6A 2JKEA 3TCEA 3UNDA 1JD7A 1T99A 4CN4A 1SQ7A 1GYMA 3L0NA 5EMJA 4BF7A 4IXHA 2V2DA 4L9YA 3WFZA 3HGOA 4F40A 1EO5A 4G2DA 3TAKA 1VPYA 3H22A 4OKDA 1PL9A 1XKJA 3E0IA 4MY1A 1S2VA 3LDVA 3GNPA 3VTRA 4L61A 1AZ2A 1UHVA 4CNUA 4BJHA 4GJJA 2FGLA 1VEPA 1JAEA 1G6CA 3T2OA 1P7TB 3W7NA 4C91A 3NQCA 2A5HA 3NZPA 2GJLA 2HXTA 5ABHA 1J0KA 1O12A 4JXCA 2OR2A 3S6DA 4UFJA 2WVSA 3RDKA 3WLHA 4HPJA 3JU2A 2CLKA 5J5DA 4C6IA 1BG4A 1F8MA 2ZX5A 4BQ3A 4AX7A 1TPC1 4BF9A 3TFXA 3O2LA 3AU6A 4N9BA 3U2ZA 5D09A 3BOXA 2F84A 3F7JA 3KRBA 1OCBA 1LCOA 3UJ2A 1UR3M 3H2OA 1V0MA 1N82A 2DSKA 5K4ZA 2CW6A 1W5PA 1U1JA 3L4VA 3R89A 2XSXA 1GZJA 2J25A 1G0CA 4JGDA 1YLVA 1U33A 4DI9A 3TTEA 4UMCA 1VFTA 4HU0A 5TF0A 1JYXA 3EOEA 1JPHA 4XAGA 4KIEA 1MW3A 1ZAHA 2FTYA 1QNRA 3SURA 5A6LA 4QTGA 1ZALA 1OC7A 4RNHA 4B2DA 1QDSA 3O6AA 3RU6A 4XX6A 5DX7A 3U9IA 1PX3A 1NAL1 4GQ0A 5IRPA 3PP7A 4M8UA 1HKIA 3W1TA 1F05A 2VI0A 4MJZA 3NR0A 1VGAA 4CCCA 1FCUA 3UPMA 4AYSA 1W5OA 1L2UA 5CC5A 4EPEC 3EWBX 2BBFA 3JZUA 2ZCGA 4UNKA 1XUUA 5G1YA 3LG3A 1PYFA 1PIFA 4NXSA 1RCXB 3NGJA 4UWMA 3I3DA 1T96A 3JZEA 4H00A 4L9ZA 1X97A 2INFA 3ITTA 3ABRA 4O1DA 1VJSA 1GPWA 1AJZA 3WO8A 4CD5A 1TPH1 3I7QA 1V51A 5DRIA 1RALA 2VOMA 6CGTA 1TE6A 1UQYA 1KFCA 3GVWA 4L4MA 1UH4A 3EMQA 4K7YA 5ABFA 1KLZA 1I4NA 4PSPA 4S3BA 2W6RA 3WDRA 5BOOA 4IQLA 5I02A 4QCEA 2D0GA 2C1HA 3PZUA 3OG3A 3RRAA 1EHAA 1JUKA 3CL7A 2G3MA 4DJDC 4GUGA 2ZC8A 1ME8A 3UCQA 3T05A 2Z28A 5I3HA 2WZMA 3UJSA 3O3RA 2ZZ7A 1FP8A 4AZ6A 4C6CA 4M7TA 1GQKA 4FMVA 1RPKA 4AFYA 4ZBCA 1J18A 1BPLB 2FMNA 5U7SA 1FCVA 4OOZA 2A7NA 4E2VA 1QI5A 3MS8A 2EG6A 1XLEA 1IIHA 2CLPA 1KFEA 4CCEA 4H6EA 2PFHA 1W9VA 1TUXA 2Q3OA 4Z0JA 3WF4A 2YR1A 4WX2A 3ZJ6A 3WK1A 3R8GA 2QLYA 2YA2A 3HURA 3RO6A 1FWGC 3DI0A 5CGMA 4DJFA 2G8ZA 1VFUA 1LUCB 2EPLX 1DE6A 3NOEA 3MKVA 3BJFA 2VCBA 4FNRA 3PJWA 5HOSA 3L4YA 4ZQNA 3VNLA 1VBRA 1HZYA 3E0VA 3FKRA 2VX6A 1NOUA 2PDWA 3LX9A 3UT0A 1L0PA 4EXBA 2NVDA 3VOCA 1A5AA 5D03A 4XO7A 1O60A 4ORIA 5HQEA 2ODOA 2IPFA 3KBWA 4AD5A 3IJLA 3B0XA 3TN3A 3VKJA 2CBVA 1OFPA 4W5UA 4XVEA 3SRKA 5H8UA 1KFWA 1YBQB 5EA9A 2GJXA 5LXEA 3ANUA 3H4GA 1XSKA 2P3EA 4H01A 2EEXA 4P7QA 4Z08A 5CCZA 3IV3A 3R13A 4RW5A 4MTVA 4D8LA 1XIDA 5A8PA 4MAVA 3VUSA 4NL1A 3OVGA 7REQB 1ODUA 2NV2A 1MI3A 2HDJA 1TIMA 5K7JA 2DUXA 1R3WA 3I10A 3A5VA 2WWDA 3ELFA 4ZOAA 1LOSA 4AEEA 4PUNA 2X1TA 4MHBA 1EJSC 4P7OA 1EZ2A 2ZWYA 3FA3A 2YPIA 4LAMA 2POZA 3OIHA 3H7RA 4F0HA 4AF0B 3LEPA 2ZE0A 1XLHA 5DF0A 1VFSA 1PE1A 1DOSA 1MRQA 2J8GA 1H7NA 1DP0A 2J24A 1F3EA 1HO1A 3W88A 2VWTA 3HO8A 4I7WA 1TMHA 4HTYA 3SSJA 4PTDA 3PTKA 3CZJA 2ZYFA 1VZWA 1W6TA 4JS3A 3ZIZA 1UR2A 2YCLA 3L68A 2PDKA 1E9IA 1R3SA 1IEWA 1VPXA 4GOAA 3UXIA 3VOHA 4IWWA 3B3DA 2XVKA 1Q2SA 1UD5A 3VCRA 5HWNA 1BYBA 1F61A 1NEYA 1D3CA 1LF1A 2DEPA 4CGTA 4H7CA 4C6KA 2D0HA 3MV01 2V5CA 4N4PA 4CEUC 1QHZA 4DUWA 3B05A 1PEZA 1RCQA 5A6SA 1GONA 3N13A 3CB3A 3EXRA 2DW7A 2BG5A 4US5A 2W3ZA 2PTYA 1B57A 3K1GA 5AHMA 4GGHA 2ZRXA 5DMNA 1Q85A 2QNEA 1E40A 4XAFA 4ZO9A 3BVJA 3OBAA 5M17A 5KZMA 1G7UA 3IJ7A 4KETA 2ZE3A 1LTDA 3SRHA 1A5NC 1FTXA 2QDEA 3OLIA 3DC8A 1O5XA 1EB3A 5XINA 1BRLB 1R7OA 3VD5A 4KPLA 4W7UA 2YL5A 5G2HA 3R6IA 3MHGA 2QW5A 2XIQA 1JDDA 2QCLA 4RZBA 4QQUA 1L8PA 1E6ZA 2R1NA 2YLAA 2Y5EA 4C6JA 4CQDA 4IQDA 3G24A 3G3DA 1PXGA 3OGRA 1CNVA 1VS1A 2R14A 3KDOA 3VO0A 4DXXA 4GUIA 1TKKA 2RAGA 3OZYA 2OLAA 5CPSA 2ZUSA 4Q4MA 2BZNA 2Y1HA 4UFLA 4ROPA 1S5WA 2XFWA 5RUBA 2DORA 3QFWA 4LH8A 3CYVA 3P80A 1RZMA 4NZ1A 1RA0A 4JD4A 3B8DA 3EB2A 1QOPA 3O6DA 4ERAA 1CGVA 4S38A 1OT1A 1IGSA 3PC0A 5GPRA 3WBWA 1G69A 5FCZA 2QUVA 2DT3A 3IK2A 3U8GA 2G3NA 3VFLA 2PEVA 2F7FA 4YTQA 3T81A 4AU0A 1I8JA 3B9EA 5BMXA 3RF9A 3QW3A 2E7FA 3E6EA 2QS8A 2ZA3A 1R8LA 4YVVA 4UTTC 3VOJA 5TBOA 1DJWA 4ADUA 4PH6A 3W1AA 3BAIA 3TNBA 2JF7A 2OX4A 3MWAA 3GG7A 4Z2HA 3EX3A 4NZ4A 1KV5A 3LENA 3ZXWA 3R94A 4QP0A 4B9ZA 2NLIA 4C6MA 1HQTA 4F66A 1JR1A 1FH9A 4LUTA 3VC6A 1VYPX 4RDZA 4JNMA 1XBXA 3BJTA 1X8FA 2FDMA 5CEWA 3UBPC 3E49A 2C71A 1XYFA 1PO9A 1R47A 1EC8A 4ZEPA 3OJGA 3VOFA 5E0CA 1QNPA 3UU0A 1E4IA 2ISFA 2ZUWA 4MKNA 3IJ9A 4RK8A 2PDHA 4IG2A 3WBAA 3C0LA 3FHQA 4AY1A 4UTKA 1GYNA 2PTWA 5DCDA 3TC7A 1AQ0A 1NDWA 2CLEA 3LHZA 4J3SA 4DBEA 2Q8XA 1IZJA 3TQKA 1E6SM 2V8ZA 5F2IA 3S83A 1M1BA 1QOQA 1PB0A 3BZGA 1TPB1 4JFUA 4A3HA 5M1TA 1EHNA 3GXIA 2D2HA 4YHEA 1OK4A 1K8YA 2OYKA 1Q7QA 1LOQA 1ONXA 5HMDA 3THAA 3BGGA 2JGQA 1SSDA 1Q8AA 3P8IA 3R12A 4X0NA 3FJ4A 3CL8A 2V67A 1E1EA 2FH8A 1SJBA 2Y5JA 3LYEA 4JTHA 4HHLA 4Q8MA 2XWEA 2F2HA 3QY8A 2WB5A 1OX5A 1FWAC 2DZSA 2X1SA 1RY8A 3RJYA 5I79A 2CETA 1BYCA 3L4WA 4NNCA 4OBSA 1C90A 3WQ4A 1R3RA 4XBSA 2QMKA 5HNNA 2Q01A 3BAWA 4J3XA 2V63A 4JIEA 3PSVA 4DZIA 4KGLA 2QXWA 1LLZA 4GI4A 3OZMA 3OLGA 2EQDA 4MVAA 4R88A 1HGWA 2PBOA 2OTDA 4OU1A 4ZQPA 1MVYA 1XRVA 4RUBA 2WZEA 4LB3A 5FEXA 3GDLA 3T40A 4AVOA 3NL6A