1UYQA

Mutated b-glucosidase a from paenibacillus polymyxa showing increased stability
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
447
structure length
447
Chain Sequence
TIFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTPGKVFNGDNGNVACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQEGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQDAGGWGNRRTIQAFVQFAETMFREFHGKIQHWLTFNEPWCIAFLSNMLGVHAPGLTNLQTAIDVGHHLLVAHGLSVRRFRELGTSGQIGIAPNVSWAVPYSTSEEDKAACARTISLHSDWFLQPIYQGSYPQFLVDWFAEQGATVPIQDGDMDIIGEPIDMIGINYYSMSVNRFNPEAGFLQSEEINMGLPVTDIGWPVESRGLYEVLHYLQKYGNIDIYITENGACINDEVVNGKVQDDRRISYMQQHLVQVHRAIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHVDFRTQVRTPKQSYYWYRNVVGNNWLETRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-GLUCOSIDASE A
publication title Mutated B-Glucosidase a from Paenibacillus Polymyxa Showing Increased Stability
rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 175
structure length 447
sequence length 447
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1uyqA00
4JL1A 3PBGA 2Y4SA 1E70M 3VIJA 1R85A 1KBKA 3OA5A 3DYPA 4ZE5A 4TVUA 7CGTA 2X09A 3W25A 4DWSA 4P7QA 1CYGA 4J3VA 1JZ6A 1C7SA 1TMQA 5A6SA 2OWWA 1ECEA 2CIPA 2PBGA 3K46A 4TUFA 2WVSA 4HPGA 2CKSA 1WCGA 1I75A 3HMCA 1GPFA 2WK2A 3VILA 2VURA 3VO0A 2BHUA 2HVMA 4J27A 2VCCA 2WPGA 4J3SA 3U7VA 1JXKA 8A3HA 3M46A 3N11A 1GONA 3ZOAA 1PIFA 1NP0A 3EMQA 1ISXA 3L2MA 5E9AA 1E6RA 2W67A 3ARPA 4PBGA 1E3XA 3PZTA 5A94A 3DECA 5AYIA 2JE8A 5BWFA 3WD1A 5GQBA 1ZJAA 3AIBA 2J7GA 1LG1A 2QV4A 3SCVA 5DEZA 3RO8A 1HJXA 5AY7A 3MKKA 1CXFA 3RMEA 3G6LA 1TCMA 4QP0A 4QLKA 1Z32X 4F9DA 4Q7NA 3BAIA 2IXVA 4OJYA 4PTVA 1BG9A 2XFRA 3GZAA 4UQDA 1TVPA 3GBEA 2VNCA 1JFHA 2VC9A 4IM4A 1JL8A 2J62A 3GXFA 2JF6A 3MMDA 2X8RA 3RM9A 1Q6FA 2BS9A 4KMQA 4AZ5A 2Y8KA 3G6MA 3W29A 6CGTA 3K8LA 2YLAA 4RE3A 1BVZA 3CGTA 5A69A 1EIBA 5JBDA 4CCEA 1J18A 5A6MA 1XH1A 2XIIA 1GQKA 1E9LA 1MW1A 2WANA 3AIQA 1G01A 2DSZA 3WEOA 1UWTA 2WWCA 3CBWA 3WL1A 1EO5A 3A47A 4PTMA 4W85A 1BTCA 4TTGA 1ZBVA 2YA1A 2WKLA 1B90A 1W2VA 4M8UA 1GOQA 1V3HA 2ZXBA 5D4YA 3WNMA 4F9JA 1CZ1A 2DDXA 3WNOA 2WW5A 4MDPA 1GNXA 2D0HA 1HJSA 1CECA 1OM0A 2E0PA 1UZ1A 3CZEA 4AZCA 2EQDA 4AZ7A 5D9NA 2DIEA 3GM8A 1XCXA 3FN9A 2YL9A 1OCQA 1VFOA 2G41A 1NARA 2EXOA 3ZJ7A 4JL2A 3WD2A 4AD2A 3VD7A 2VX5A 2A3BA 2J75A 4W8AA 1FHDA 1U2YA 1H2JA 3KE0A 1WZMA 3KL0A 1EOKA 2PBOA 1XV8A 1M53A 1XC6A 5A6JA 4C7FA 3KEHA 3PN8A 3KL5A 1PX8A 1H11A 1V0NA 2UY4A 2X0HA 4U31A 4UFMA 5JBFA 1UR4A 2ZIDA 1UH4A 3AXIA 4QCEA 4DWSD 3SCQA 4UOZA 2CBVA 2YL8A 3ARYA 3W6LA 3TTYA 2J7BA 3EDEA 3POCA 1MW0A 4TTUA 3CZJA 2EJ1A 2VUYA 1J0HA 1EHNA 2W63A 5CGTA 4PEEA 4QLJA 3AXXA 3VIMA 4U3AA 2Q8XA 4W7WA 1JDAA 2YKKA 1MFVA 5CPTA 3ARXA 5EBAA 1EDGA 2OSWA 3K4AA 1J0KA 4NRRA 1KQYA 4M1RA 3RPMA 1EGZA 1QNQA 3LPPA 3T2OA 2AMGA 1HT6A 4Z2LA 3L4UA 4NF7A 1E15A 3AOFA 3POHA 1UG6A 3W53A 1BSIA 3WUEA 5D8ZA 2WMIB 4JFUA 3APGA 5A8QA 1W9DM 4EANA 3BCDA 3VDHA 1OWQA 4D6JA 2GK1B 4CD8A 3QHOA 4OBRA 1CXLA 4QAWA 5I0DA 2W66A 3SUWA 3EYPA 3IANA 1QNRA 3VDBA 1V6WA 4HMDA 2D23A 4J7RA 2ZE0A 3CIVA 1IV8A 2CERA 3ARZA 2D0GA 4UFIA 2VQUA 5E0CA 4YHGA 1YQ2A 1X6NA 2J8GA 5D9OA 3T2QA 4D1IA 1LG2A 5I2UA 3MMUA 1UR2A 1OIMA 3WDPP 2W5FA 4YPJA 3MUY1 1E6PA 2EO7A 2ZUSA 2O9PA 5A6LA 1JGIA 2VRQA 1J0ZA 1N82A 1VENA 4GO9A 3O9NA 3U5YA 1ZBWA 4GIAA 3U57A 4B15A 4HA4A 1V6YA 1VEPA 4W7VA 1QPKA 1KBBA 2GJRA 2XVPA 2VTFA 5IFTA 4E8CA 1NH6A 5F7UA 4XZBA 4A3HA 1EHAA 5A8MA 1V3LA 4HPHA 1EH9A 5E09A 1CIUA 1UYQA 4GZEA 3ZJ8A 1HL8A 1CXHA 4AEEA 3VTRA 3PZMA 3FHQA 4YHEA 2VZVA 4B9YA 2DH2A 3HN3A 1KCKA 3WDIA 3WQVA 4M56A 3DHPA 3WF1A 2DSVA 1QHOA 1J10A 3PZIA 3BLPX 4MDOA 2WM0A 1G9HA 4Z2GA 5FOOA 2JEQA 3WNPA 2E9LA 2CYGA 4Y7EA 1H0IA 3A3HA 3BAWA 1W2PA 3CHFA 3QHNA 4DM1A 1LWHA 3AZTA 5DMYA 2WXDM 3WELA 3CH9A 1ZB5A 1RD6A 3VOCA 4EAMA 1KB3A 2W61A 1VEOA 4OIFA 3N15A 3MV01 5FKYA 2A3EA 1HN1A 2C8NA 1XSJA 3IJ8A 2BHYA 2VX6A 3OZOA 1R7AA 4W8BA 3UETA 3BH4A 1B3WA 3CZ8A 1TVNA 2EPOA 2QPUA 3ARVA 7TAAA 2WVVB 3OGVA 5HPCA 4AZGA 4UFKA 3WDHA 1ITXA 2WMKA 1E1FA 4TOQA 1K9DA 3WNKA 1M03A 3AROA 5CSUA 5I5RA 4DM2A 2WMFA 3VGDA 4HTYA 4GI8A 5DO8A 2CEQA 4GQQA 4HZ6A 2VOTA 4XB3A 2PWGA 1EQCA 3W81A 3ARQA 4XUYA 1XH0A 4UFLA 3WUGA 2GUYA 4EK7A 4OOZA 3OZPA 3F5JA 4BS0A 1B0IA 3VNZA 2ZX9A 2D2OA 3SUVA 3VGFA 4W84A 3CTTA 1CDGA 4CD5A 1Q6GA 1VBUA 3WIJA 3AIRA 3GTNA 1ISYA 4LXFA 2WCAA 2WMIA 1WZKA 2GK1A 2Z1KA 5DFAA 4CKQA 3W82A 4CN1A 1L8NA 3UG5A 4JHZA 5C71A 3MU7A 1C91A 1FH9A 1JZ4A 1Q6DA 4PMNA 3PZOA 2AOSA 3GXMA 1HX0A 1W1PA 2WHLA 2ZICA 1W9PA 1GOIA 2GSJA 3VM5A 1GOKA 5C70A 2AAAA 2WNWA 4WIWA 4JCMA 5ABEA 3WD4A 2PWDA 2J4GA 1XD0A 3RCNA 2WZHA 3NUKA 3CUHA 2W92A 5IHRA 4ZENA 3VGEA 2YDQA 3OLIA 4FF5A 3T08A 3U7BA 3QR3A 1W1VA 1UZ4A 4CU7A 2VCBA 4BQ2A 4PTWA 2XFFA 4BQ5A 3ZT6A 2CNCA 1V6UA 2Y8VA 3BCFA 1M01A 3ZT5A 1BPLB 1JI1A 1W9XA 5EMYA 1B2YA 3WFLA 1UUQA 4M80A 1JZ5A 1E4IA 4UFHA 3T0AA 2PC8A 4EE9A 1ZBCA 3ALGA 1H49A 4Z2JA 1CLXA 1W3HA 2ZUTA 4X9YA 2XVGA 1TZ7A 1XHGA 3VMNA 4BCEA 3VD5A 3NSNA 3AYSA 2YA0A 3CUGA 3WD3A 3AS3A 2PB1A 4GKLA 1GQIA 2DT3A 3IK2A 3WQ5A 4W7UA 3N12A 1RP9A 1GW1A 4R27A 2JFEX 3CHDA 5CGMA 1JXJA 3FHAA 3RDKA 3SURA 2VQTA 4A4AA 3OIHA 3GXDA 4PMQA 4W93A 3WF2A 1DWFM 2E40A 1E4MM 1H1NA 1QNOA 1R7OA 5CXPA 4AIEA 3UERA 3WQ6A 2E4TA 1TA3B 3N04A 3ZJKA 1F4AA 1SMAA 2EBNA 5GNYA 4JHOA 4BQ3A 4W5ZA 3WUBA 4C7GA 4TX6A 3WDQA 1UD3A 3AQUA 1KXTA 1MQQA 2WMJA 3GH5A 2O9OA 3WBAA 2QHAA 2XIBA 1QW9A 4P8XA 1I1WA 3TP4A 3VNYA 4U5IA 1FHLA 2J7HA 3BXWA 4RE4A 4BZYA 1RH9A 2XGBA 5CZKA 4AD3A 4ATLA 5A6BD 4R5EA 1NOWA 1XGZA 2BVTA 2VT0A 3CZLA 5HXMA 1HVQA 1K9FA 4J3UA 4LPCA 4PMXA 4M24A 1RPKA 1UWQA 3BMVA 5FD0A 4DUVA 4PCSA 2QLYA 2DH3A 3BAXA 4ACZA 1UR1A 2FH6A 1JZ8A 1UWSA 1UD6A 2WCGA 1JD7A 1CGUA 1WE5A 1AVAA 4ACYA 3VD9A 1KR1A 3W26A 3CPUA 3RJXA 3AFBA 1CENA 2PF0A 3AIWA 3AMDA 2XVKA 2WLZA 1AQHA 1C92A 1LL4A 4GI6A 4KRUA 1GVIA 3L4WA 5CLWA 2WBKA 4NRSA 2XFYA 4D1JA 4UQ9A 2WMHA 1GZJA 1WZAA 3MMWA 3B9EA 3GNRA 1DTUA 4PMDA 2CBIA 3U5UA 1GORA 5JBEA 2E8ZA 5A6KA 4HZ7A 4XX6A 1EQPA 5HPOA 1CGVA 1LLOA 2W91A 4GINA 2EPLX 1EO7A 3B8SA 3MANA 3AI0A 4FMVA 5ABFA 1W9BM 2GFTA 3O6AA 4GI9A 3VD3A 2V3FA 1KGUA 3BAJA 3RIKA 3ARTA 5EFFA 3DC0A 5LA2A 3MUAA 3GDBA 1RP8A 3SUTA 1ISVA 3VINA 2C7FA 2W4XA 3EBVA 2XPKA 3BC9A 2JIWA 4XV0A 4FLRA 1HP4A 9CGTA 5I78A 3AIVA 4Z2IA 3I3DA 4GQRA 2CKRA 3LPGA 1NWTA 2G3NA 3CHEA 3WMCA 1LL6A 1J0JA 1VFMA 4ATWA 1G0CA 1WNOA 5A8NA 4IPLA 1MYRA 3WF3A 1JZ3A 3MSGA 1JNEA 2CHNA 4PUDA 4BQ4A 2J78A 3OGRA 4OOUA 2V3EA 5FL1A 1DP0A 2WC4A 1GQJA 3TTOA 3AHYA 3CZGA 3J7HA 1E0VA 3MO4A 4YN5A 1JAEA 1V03A 4RE2A 2OSYA 1BFNA 2ZWZA 1PJ9A 1FFRA 1ZL1A 2V38A 1PEZA 3BAYA 1EDTA 1MXDA 2ZUMA 1GOWA 4MNMA 1OD0A 1UQYA 4CD7A 2G8ZA 1V08A 4CU8A 2WC7A 3AS2A 3F5LA 3L4VA 4WKHA 4BF7A 2J7EA 2CCRA 3WEMA 2XYLA 4CUCA 4W8LA 2NW0A 2HISA 1JAKA 5A2BA 3KZSA 5IDIA 3M6DA 3W28A 4P8VA 4H7VA 4CD4A 5I23A 3WMBA 1FP9A 4X0VA 4AYSA 2BXYA 1PPIA 3GNPA 1ODZA 2DT0A 4NZCA 2VVSA 1YHTA 1K9TA 2OYLA 2UY2A 1DWIM 1BYCA 3AISA 2EEXA 4OKDA 1KCLA 1B1YA 2O92A 1J11A 1J01A 5CQ1A 4B9ZA 1LL7A 1KQZA 1W3LA 1GVYA 2Y2WA 5E6ZA 4NI3A 4U2YA 4KH2A 1NWUA 1B3XA 1H3GA 1JYNA 3WQ8A 1WP6A 1AMYA 3AS0A 3RILA 1XSKA 1B3VA 2JEPA 3SCOA 3CMGA 3AYRA 3OB8A 3EDJA 4MADA 4V27A 4P7OA 2YLLA 2DSWA 3I3BA 5CSYA 3WENA 2G4FA 2WHMA 4K68A 2NSXA 4AW7A 4URIA 1CXIA 5GNZA 2ZXAA 2ZOXA 5I79A 1JG9A 4MPKA 3VIFA 1WB0A 1PBGA 1CGYA 1DHKA 2E9MA 5M17A 4AZBA 2DPEA 4AXNA 4H8UA 1VFFA 3WBEA 1JF6A 2DT2A 4JKMA 4LGXA 5AC4A 3HU7A 1G5AA 4KRTA 2OWCA 1LWJA 5KZ6A 7A3HA 3RM8A 4JFVA 2WSKA 2CXGA 1PIGA 2YDSA 4ATDA 1G94A 1BGAA 1OD8A 1TG7A 3VIGA 4W86A 1CBGA 3A4AA 1GCYA 5CPSA 3ZM8A 3VX1A 1BLIA 3AMLA 4MAZA 3DYOA 1V02E 3UCQA 1C8QA 1UOKA 3WY1A 1HIZA 1BYDA 1DWGM 1E1EA 1HNYA 1E56A 3IJ9A 3UG3A 3SUSA 3ZSSA 2D0FA 2VRKA 4MB1A 4TXEA 1UWIA 2CBJA 3S6TA 1WDRA 4UQCA 3NDZA 5FIPA 1V6VA 5HNNA 3VVGA 4JIEA 3GNOA 4N0RA 2WCSA 2ESCA 1WO2A 2DSKA 3QGVA 1OB0A 3B9DA 3OLGA 3UR8A 4B16A 4AWEA 1PZ3A 4H2CA 1PX3A 4D6IA 4OBSA 4H41A 3TTSA 2V5CA 4MTVA 2WVUA 3WH7A 5DT7A 1J0YA 2YJQA 2RGLA 2WLYA 3RJYA 2G3JA 3AIUA 3UESA 1JZ7A 5ABGA 1GJWA 2EPKX 2IXUA 1V3MA 1P6WA 2UWFA 3PTQA 4V28A 1CXKA 4PSRA 2DGAA 4PMRA 4AZIA 1WPCA 4J28A 1SFSA 3CO4A 3AHZA 5BXTA 1QI3A 1JDDA 1V3IA 1ZU8A 1UKOA 2BNJA 3W24A 4PCTA 3BMWA 4DWSB 4AD4A 1KFWA 2WC3A 1LQ0A 2ZXDA 1GUVA 1VJSA 3NYDA 3WNNA 2VX7A 2BY1A 5A8OA 2VR4A 4PSPA 5I77A 3MUIA 3L4ZA 4KGJA 3WH6A 3AZSA 2DQXA 2J7CA 2CBUA 3OBAA 2VMFA 1EXPA 1B3YA 3A6OA 3DHUA 4P7RA 3HJEA 1QI0A 2V3DA 3ZJ6A 1ZBKA 1CGTA 1BHGA 2XGIA 2W62A 3PZUA 2NT0A 1HJVA 2J47A 1R87A 1CEOA 1UQZA 5LA0A 1MW3A 1CXEA 4AIOA 3VGBA 1NWRA 1V0LA 2C0HA 2ZUWA 3VX0A 1WAWA 3NSMA 5M03A 4MB4A 2J7DA 3ZQ9A 5E70A 5BCAA 2A3HA 4IPNB 2A3CA 3AZRA 4PMOA 2XTKA 2VZTA 1OGGA 8CGTA 2YDRA 4D6HA 2J8FA 4CCCA 4GZIA 2VCAA 1J0IA 1OT1A 3CUJA 4P7NA 1FH7A 4M29A 3CLWA 2JIEA 4QLLA 1HF6A 1VEMA 2JF7A 4QCFA 1HKMA 1OGSA 1M04A 3ZR6A 1SYTA 2EPNA 1XYZA 1XRVA 5HOSA 1TR1A 2WZIA 1UWUA 2F2HA 3GH4A 4A3YA 2D22A 2J77A 2E9BA 2XM2A 4WSJA 1UD2A 1SMDA 3WDRA 3MV11 3VMPA 2YL5A 2J79A 3VGHA 2WHJA 1HJUA 3ARWA 3ALFA 2GJXB 2MANA 3W6MA 5LYRA 5I24A 5CPQA 2YBUA 4FLQA 3CUIA 1XSIA 2WWDA 1V0MA 1OSEA 2CESA 5A8PA 3ARSA 3THCA 1K9EA 3M7SA 3EMZA 4MNJA 1E43A 1E6ZA 4H04A 3ARUA 3ZR5A 5D9PA 1E6XM 1DWAM 2GDVA 2FHFA 4D71A 1HP5A 5C8BB 2VZSA 1S46A 4M82A 2CPUA 1HL9A 4U33A 5D8WA 4GXPA 1C90A 4PMVA 2WB5A 3T2PA 3S2CA 3UR7A 5GPRA 1KXVA 3SCRA 4AZCB 3OLDA 4IISA 2YIHA 1ITCA 4UFJA 1CGXA 2XUCA 5BXPA 2FHCA 4LYRA 2GVYA 5E0FA 1UWRA 4KWUA 1DWHM 3IAQA 1UH3A 5I3DA 5A1AA 1MXGA 1QI5A 1C8XA 2QF8A 1E6NA 2VX4A 1D3CA 3FAXA 3M07A 3OLEA 1ZS2A 1H5VA 4WF7A 1NQ6A 4LQ1A 2XSBA 1BYAA 1VBRA 4WJXA 2FGZA 1MWOA 5BYWA 4XZWA 1E4LA 1W32A 5EB8A 4JFSA 3W27A 2ZX6A 2DT1A 4ZFMA 1O7AA 1UH2A 1VIWA 4B3LA 2WVVA 1M7XA 3GBDA 1C7TA 3E1F1 4D6FA 1V3JA 1QVBA 3BSHA 1AQ0A 4UZUA 5GNXA 2X2YA 4CN4A 3OGSA 3EDKA 1U33A 4LX4A 4NSBA 3SIMA 1W3JA 5A2CA 1E71M 5BXSA 3MUZ1 2X0YA 1MQPA 1QI4A 2V3GA 4WKAA 3PZVA 2J7FA 4OUEA 3RM4A 3PTKA 1IZKA 4E4PA 3SCSA 2BXZA 2WVTA 1BVNP 3D5HA 3II1A 1OINA 5A3HA 2GJPA 3PHAA 2BVYA 2D1ZA 5HDRA 1R8LA 2XVNA 3JUGA 3ZMRA 3OG2A 4PTXA 3SCTA 2XVLA 4UNIA 4HOWA 4LYQA 1J9YA 3T0BA 2D24A 1D7FA 4PUEA 1HXJA 1H4PA 1JD9A 2E8YA 3VKKA 5BROA 1B31A 1GHRA 1QHPA 5LA1A 1JNDA 2J74A 4D6EA 3PZGA 4PYSA 5A6AA 2WMGA 2X1IA 3VIKA 4MJ4A 3VPLA 3TONA 5CG0A 3NIYA 4DWSC 4U3CA 1JDCA 5AYBA 4AMCA 1CGWA 1E6SM 1XYFA 1KXQA 2WBGA 3UG4A 1QNSA 4H8VA 4AD0A 1OIFA 1FA2A 3SUUA 4QDMA 2XWEA 1QOXA 3QOKA 2GJXA 4UCFA 3N13A 3WQ4A 1UKPA 3NCOA 1LF1A 2QMKA 3AMKA 2VRJA 3WF4A 3PZ9A 3ZT7A 1QBBA 1E40A 4PN2A 2XSAA 1UKSA 3VIHA 2Y5EA 1W9VA 4J3TA 1U30A 4DUXA 4J3XA 4PMYA 4AEFA 2BHZA 4C7DA 4U5KA 1NOUA 4MB3A 1JYVA 1FH8A 1JFXA 2TAAA 1US3A 3EDDA 2D20A 2O9TA 5CLTA 1JYXA 4WLCA 4HMCA 1H09A 1VRXA 4IUGA 1KXHA 3FW6A 3T09A 1NP2A 2Z1SA 5D9MA 4JZ5A 3VM7A 4AY1A 3VIIA 4WKFA 1JZ2A 3ZIZA 1B3ZA 3BGAA 2GDUA 2PI6A 4S3KA 1UD5A 3NJ3A 1IZJA 5A95A 1FP8A 2G3IA 5EFDA 4LYPA 3QOMA 1UA3A 3FNDA 1V3KA 1E4NA 1W1YA 4X0NA 4H8HA 3A4WA 1GHSA 1EDQA 3WL0A 2QMJA 1TA3A 4JFWA 2BFGA 1NM9A 1E3ZA 1ISZA 1V0KA 2J25A 5FCZA 6A3HA 4CVWA 3PZQA 1QI2A 4HA3A 1BF2A 3WF0A 5BRQA 2IUZA 3VU2A 2VZUA 2XJ7A 1UR9A 4HZ8A 1A47A 2ZUNA 2D3NA 1WDPA 3K8KA 4HMEA 4Z2KA 4HU8A 4UQBA 1W91A 4UR9A 4B3KA 1E5JA 4AIUA 3AXHA 1GQLA 1W9UA 3F5KA 4ML4A 5E6YA 1E72M 4ZXLA 3FY1A 1MVYA 4W5UA 3SCPA 3BLKA 2FGLA 1O6IA 4WSKA 3EDFA 5JIPA 3GYCA 1A3HA 1VFUA 4HU0A 4AISA 6TAAA 3ECQA 4Z2HA 3VDAA 5ABHA 2V5DA 2WZEA 3WFZA 2WYSA 5IHSA 4ZEPA 4FK9A 3WQWA 1CNVA 4W89A 3AHVA 1CWYA 4W87A 3AIEA 3FXYA 2XM1A 2VR5A 3AHXA 3W38A 2FDMA 3W37A 1QW8A 1NOFA 2OYKA 1MW2A 5I6SA 3CZKA 3F4VA 3L4YA 3AS1A 1J12A 1E5NA 3K4DA 1DWJM 1NWSA 1HJQA 2Y24A 1B30A 3WN6A 4N42A 2CITA 3WH5A 1K6AA 1E73M 1DEDA 3GXIA 3VD4A 1BYBA 2YL6A 2O9RA 2OWXA 3MS8A 2X05A 1JYWA 2ZX7A 4M81A 1GOOA 1HKJA 4PRWA 5JIWA 1VF8A 1MQRA 5CJ5A 3N9KA 4HOZA 2BVDA 1WZLA 3VIPA 2WAGA 3N17A 4AZHA 1UR8A 1UHVA 1TFVA 1E6QM 3PTMA 3TOPA 5FL0A 4ZXOA 3GH7A 4CGTA 1KWGA 1I1XA 4EKJA 2FHBA 4UTFA 2ZUVA 3VIOA 3CMJA 3N18A 2F61A 4F66A 4UOQA 4J3WA 1ESWA 2ZXQA 1BGGA 4D6DA 4F8XA 3DYMA 4CN6A 1ZJBA 2DIJA 3AMGA 4P8UA 3IJ7A 1KR0A 3NSXA 3BSGA 4P8WA 5ECUA 3VGGA 4AC1X 2VZOA 2XG9A 4MB5A 1KGXA 1XCWA 3W4RA 4AZ6A 3FAWA 4HA1A 4TX8A 4W88A 1XH2A 3CHCA 2YA2A 2WHKA 3QHMA 2EPMX 4CVUA 1XD1A 1OBAA 2BY0A 2G3MA 1QBAA 1IT0A 1VB9A 2ZX8A 1JF5A 1E0WA 1CLVA 3AMCA 2ZWYA 2XHYA 1F4HA 1HVXA 3L4XA 5TD4A 2OYMA 2WKGA 4OZOA 2B31A 1PAMA 2CETA 1PX4A 1OGBA 4D6CA 2OLHA 4S3JA 4BA0A 4GPNA 1X6LA 2F8QA 4UZSA 1Q6CA 5AC5A 3ZSTA 3LPOA 5HBFA 1GJUA 2DEPA 1C8YA 2PWFA 2YBTA 4E8DA 3WSUA 1WKYA 5M3WA 4GO8A 1UA7A 1R86A 2VO5A 4TVCA 2VI0A 2ZUUA 4L4OA 3AICA 4MJ2A 4WK9A 1QNPA 1QHZA 5A6BA 5KEZA 4MNLA 1LJYA 4CU6A 1BQCA 1E0XA 1MFUA 1US2A 3AHTA 3K1DA 5A2AA 3ZO9A 2RGMA 3A4XA 3SEPA 1X1NA 1VAHA 4ACZB 1C93A 4UQAA 1D2KA 2QPSA 3KWXA 5IFPA 4AD1A 3WDJA 4AD5A 4Q22A 2YOCA 4E2OA 1V02A 1W1TA 1WDSA 1GOMA 3N1AA 3BAKA 3KL3A 4JCLA 5JUVA 3ARRA 1UR0A 1W3KA 2FH8A 1KWKA 4ZE4A 4D72A 3D3AA 3WUFA 2BY3A 1AQMA 4L4PA 4FLOA 1H41A 4HP5A 2VL4A 5IXEA 2BY2A 4JFTA 4DUWA 4QFUA 3SCUA 3WMSA 3VMOA 4CD6A 3NDYA 3WKZA 2WSPA 2NT1A 3MSDA 5DF0A 1EOMA 1FOBA 1CTNA 1UD8A 1OT2A 3CUFA 2DSUA 3WH9A 3WEZA 1HKIA 3TA9A 1EA9C 2UY3A 3PZNA 3IAPA 1L0PA 3WNLA 1BAGA 1H0GA 1JIBA 3SCNA 1FFQA 5BRPA 2PWEA 3B9AA 1E55A 1V6XA 3AJ7A 1CPUA 3L4TA 3K8MA 1UKTA 1ISWA 4V2XA 5M5DA 2VVNA 5ABFB 3WH8A 3EMCA 3UEQA 2VJXA 3VUPA 3LPFA 3LMYA 4HOXA 2BV9A 3T0DA 3I3EA 2A3AA 4GZJA 1BG4A 3SCWA 4TVDA 1HJWA 4UOJA 3L2LA 1Q4NX 5BXRA 2CHOA 3THDA 1PZ2A 4MNKA 3O2LA 2ZX5A 2XWDA 4KGLA 4F79A 2OSXA 3TTQA 2UY5A 1UD4A 4CCDA 4FLSA 4PMUA 1WDQA 2E3ZA 1SR0A 1TUXA 3VDCA 1B9ZA 4JKKA 2D3LA 4JKLA 3W0KA 1G1YA 1UKQA 4MAVA 4D6GA 1JI2A 3WD0A 4RL3A 4UQEA 1KGWA 1Q6EA 2JALA 1TE1A 4P7LA 1VJZA 4JAWA 4PMZA 4U2ZA 5DT5A 1Y7VA 1ODUA 1C3FA 2PWHA 1HKKA
chains in the Genus database with same CATH superfamily
3PBGA 2KAUC 1JR1A 3UY8A 4M6VA 3I6RA 1FKWA 4ZE5A 4TVUA 7CGTA 4XTDA 2C71A 4QNEA 1ECEA 3RU6A 5HQLA 1Q63A 4ZOCA 2RJHA 1FQ0A 3BV4A 2B0MA 4LALA 2HVMA 4Y9OA 4K8EA 5CZ0A 3UJ2A 1XLMA 2QT3A 1JXKA 1ONXA 1PIFA 4JXCA 1NP0A 1ZSXA 3M7WA 2HK0A 3ES8A 4LV4A 1ISXA 3L2MA 1C29A 5A94A 1SU5A 3WD1A 3O1NA 1EYEA 4HVXA 1VCVA 1ZJAA 1JPIA 9XIMA 1HJXA 4YCPA 5AY7A 3MKKA 1CXFA 6ALDA 1TCMA 4N9CA 4RZ4A 3BAIA 2YSWA 4XD6A 4IOTA 4OJYA 4ZTXA 4Y8EA 1TVPA 2VNCA 3MHFA 2VC9A 1JL8A 1EJTC 5AKQA 3S1UA 1PIIA 2X8RA 5H1WA 1Q6FA 4JIQA 4KMQA 4AZ5A 4REQA 1RAKA 4OV4A 4A2SA 5E1QA 3W29A 2ISSA 3KHJA 3K8LA 3M44A 4HHLA 2DORA 2V5JA 3H6OA 4RE3A 2NSOA 2C3ZA 4AHOA 2H3DA 2E28A 1Y5XA 1H63A 2OZTA 1XH1A 4Q32A 2QVNA 3RLVA 1XLBA 1HO4A 1GQKA 1E9LA 4E6MA 4UTWC 2G3FA 3WK0A 5BMXA 4LS0A 1AJZA 3CBWA 2P88A 4KT2A 2AQVA 3PC0A 2PS2A 4HNTA 2PDXA 4YIWA 1WDDA 3A64A 3UZ5A 1GOQA 1V3HA 2X0SA 5D4YA 3NQDA 4K7YA 5LZLA 4F9JA 1CZ1A 4JQAA 1QPOA 2QYGA 3H2AA 3QY6A 1Y65A 2VFIA 3PULA 3CZEA 5DCDA 1VFLA 2EQDA 2XH4A 1XLHA 3KBSA 2BZNA 3GM8A 1RY0A 3P80A 4RZBA 2G41A 3CPRA 3VD7A 1GEHA 4DZIA 1FHDA 3W7GA 2TYSA 3KE0A 1I0BA 3AYVA 4LVFA 4YMZA 3CAQA 1M53A 1XC6A 3KEHA 1KFBA 2R1NA 1PS9A 1UIPA 3ANVA 3DGRA 1UR4A 1JCYA 3AXIA 1CX9A 3SCQA 2GVGA 4PULA 4AUBA 3ARYA 3W6LA 5M2FX 2J7BA 3EDEA 1EB3A 2FMOA 1DJXA 1MW0A 3TW7A 3ZXWA 2QJHA 3VIMA 3SECA 1ME7A 2WO5A 4YVPA 4PR4A 4I5XA 3K4AA 3FX4A 3OVQA 1BWKA 4DJFA 1R38A 4FIQA 1IZCA 3UZXA 4RXFA 4B90A 1Q6OA 3ABZA 2J88A 4G1NA 4K36A 2F9RA 4GJ1A 4I90A 1OZMA 4GIEA 3P74A 4NZ3A 4GACA 4RW5A 4E38A 3C61A 4NF7A 1QPNA 4EVZA 1XBZA 1UG6A 4ADTA 1BSIA 3WQPA 4FNTA 3WUEA 2CLHA 3BCDA 1RK6A 4G6CA 4JPGA 4D6JA 4PZVA 2E5BA 2PTDA 5I0DA 1AJ0A 3TW9A 3IANA 3S5YA 2D23A 2XN0A 1U5VA 3CIVA 1YPIA 3ITYA 2ISDA 5E0CA 1MZHA 1GPWA 2J8GA 5D9OA 3T2QA 4XZNX 4MGGA 3W73A 3W7RA 1UR2A 4PUUA 3S5SA 4M7TA 1FWDC 2GVLA 4IQEA 3MUY1 3W84A 2IKIA 1J0ZA 4V15A 1G67A 1ELSA 3M0LA 2IKJA 3D3FA 3CHVA 5HJLA 1VEPA 3D0CA 3AO0A 4I9TA 2GJRA 2XVPA 4OQVA 3VOGA 2VTFA 2VEGA 3LV6A 3I7QA 4UMBA 1EHAA 1J5TA 5A8MA 3NDOA 4XZMX 5EGRA 1Q13A 3I7SA 4R53A 5F2LA 4YJ5A 4AEEA 5I3IA 2X1SA 4B9YA 2VZVA 4HCLA 3BW3A 3BGJA 2QGYA 2DZXA 3GE7A 2WNQA 3WQVA 4M56A 2XIQA 3GXPA 4O0QA 1J10A 1GKRA 3BLPX 1SZFA 3HPXA 4Z2GA 3WNPA 4B5SA 3ZWTA 4MHBA 4PRRA 1W2PA 3LLFA 4DM1A 5U4NA 1NQKA 3CH9A 3W1RA 1KB3A 1M6JA 4LCSA 2XIMA 2OO0A 1J5SA 3N15A 4PBEA 2A3EA 1HN1A 3LCLA 4MUZA 1T96A 1XSJA 5C2CA 2VX6A 3PPCA 5EYWA 1PWMA 5C55A 1R7AA 4IIDA 1TVNA 1AMKA 3HG3A 3OGVA 5HPCA 2INFA 4AZGA 4XIMA 2WMKA 1E1FA 4TOQA 1K9DA 1M03A 2GZXA 3AROA 1WXYA 3C0JA 4DM2A 3T81A 2OB3A 3R10A 3W2NA 2REQB 5CC7A 4HZ6A 2VOTA 4XB3A 3PBWA 2Z29A 1KBIA 4ZO9A 4XUYA 1XH0A 3EKLA 3S2JA 1N55A 4EK7A 1SPQA 3F5JA 3C2YA 5FF7A 1Z6KA 3VNZA 2D2OA 4Z1BA 3OPSA 4H9ZA 3GKAA 3MP5A 3SQMA 1XLLA 4E5TA 4ROQA 3AIRA 3GTNA 4AVOA 3KS6A 1IWAA 2NWSA 3G3MA 3LGGA 3C3UA 3TH6A 4UTKA 2G96A 3WZ0E 3W82A 3UG5A 1YADA 5C71A 3OVGA 1TV5A 1C91A 1JZ4A 4PMNA 3K13A 1HX0A 2UZ9A 4L9ZA 2WHLA 1QR7A 1DV7A 2NXIA 3N6HA 3THAA 3TXVA 5C70A 4O11A 4WIWA 4JCMA 1MEHA 4M51A 5ABEA 4MWAE 1XM3A 3RCNA 2WZHA 4JTKA 4QBXA 3LHTA 1FCBA 2I7GA 4C6PA 4GRSA 3VGEA 1M7OA 1W1VA 2DJXA 3IARA 3BJFA 5C2XA 4LH8A 3IJQA 4H7ZA 3AYTA 3UWUA 3PSVA 4BQ2A 5F1VA 3U2CA 3ZT6A 1HKVA 2CNCA 5I02A 3M0IA 2Y8VA 4H9TA 2Q8ZA 1S1PA 4J9JA 3C2VA 3ZZ1A 3UPWA 3UJRA 1BPLB 1W9XA 3M4HA 4UR7A 1UUQA 4HBKA 1Q65A 2WOQA 3EPOA 4D8LA 1E4IA 2AL2A 3W1LA 2LLEA 2PC8A 1X1ZA 1H49A 3ALGA 3MUXA 2Y61A 1AZ2A 3B06A 2ZUTA 4X9YA 1XIBA 2XVGA 1TZ7A 2GSEA 2A4AA 3LX9A 3VD5A 2P3ZA 2YA0A 3R89A 5C2GA 4EAYA 1AL7A 1EP1A 1DOSA 4FXFA 3P2VA 3CHDA 3THUA 1W1IE 4ASTA 2G97A 2FDSA 3GXDA 3KTXA 5F2MA 4I6KA 4QISA 2E4TA 4LNCA 3ZJKA 3GR8A 2GQAA 1SMAA 1X39A 2INZA 5GNYA 4BQ3A 1TPUA 1A5MC 3WUBA 3IVTA 4LC8A 1G6CA 1KC7A 2E6AA 2V82A 3H2FA 1MQQA 3WBAA 2XIBA 1QW9A 3R0KA 3VNYA 3V1HA 4U5IA 3FSTA 1OFOA 1QPRA 3BLIA 3DEQA 3O0KA 4RE4A 4BZYA 3ATZA 3KUMA 2ZZ2A 3CZLA 5HXMA 1HVQA 4M24A 1JQXA 1S5WA 3N6QA 3B0VC 3BMVA 3QFEA 1I8JA 4QRNA 1D9EA 3RNDA 3ITTA 3QZ6A 4ACZA 3S1VA 1GYLA 3QMTA 2NV9A 4QJ5B 3KS5A 4ACYA 3VD9A 2ZBTA 2MNRA 4GK8A 3V18A 3AFBA 4K1GA 3WYZA 1NDZA 3AMDA 2XVKA 5H91A 1D3HA 1LL4A 4Q8NA 3GK0A 1FTXA 1PZ1A 2WBKA 4NRSA 4UWMA 1WAUA 1WZAA 4WR3A 4WQ6A 1TQXA 4M6QA 1GORA 4Q4MA 2E8ZA 5A6KA 4O15A 1Z3NA 3HPZA 4PTNA 4L9XA 3L68A 4U10A 5G2IA 2W0UA 4A3RA 2EPLX 1LRQA 3MANA 3AI0A 3CXOA 1W56A 4FMVA 2BBFA 1TZ9A 3W75A 3O6AA 3IV8A 3CL7A 1W1ZA 4PCFA 2ABAA 2GQ3A 3H26A 4DUOA 3STEA 3RIKA 3GDBA 3EX3A 3BLEA 2XPKA 2JIWA 4XV0A 4HNUA 4FLRA 1R3VA 1A53A 4Z2IA 1O66A 4F0MA 3LPGA 2CZ5A 2X1RA 3EEGA 1LL6A 3M0VA 3WMCA 3W83A 4CLMA 4ZOAA 1WNOA 3W1NA 3B9OA 2CHNA 3OGRA 3L67A 4OOUA 3G5EA 5FL1A 2Q3RA 3QV8A 1TPDA 4XAGA 1AFSA 3UZWA 4QITA 3W22A 3STGA 1WUFA 5HNTA 1BFNA 1PJ9A 4HIBA 2DZTA 3W00A 4JQ3A 1GOWA 2A7RA 3HV9A 2G8ZA 5DLCA 2A6NA 1HQTA 3AS2A 3F5LA 1IEVA 4WKHA 4DXKA 1JQVA 2VXNA 4QX4A 4O50A 2NW0A 4Q33A 1C8VA 1AW2A 3TYEA 4F0SA 2Q71A 2DVUA 3GD6A 1FP9A 4X0VA 4WJ8A 4YNGA 2BXYA 3GNPA 1ODZA 2VVSA 4KPLA 1YHTA 4FIRA 4UMCA 3HG4A 1DWIM 1UUOA 1BYCA 3AISA 2E1DA 2FZBA 2EEXA 4HNLA 3GY1A 1EPVA 3IIOA 3NQ6A 4OKDA 4B9ZA 3UR2A 4LEFA 3TTEA 3AU2A 1XX1A 1GVYA 1TTPA 1OC5A 5E6ZA 1VFSA 4KH2A 2XIOA 3DFOA 1B3XA 1F73A 1H3GA 2HXTA 1WP6A 3L66A 3AS0A 3MUCA 3QR0A 1B3VA 3EDJA 4V27A 2QJIA 1DJZA 4LT9A 3I3BA 1DORA 4FNUA 4K68A 4HNCA 4URIA 1DPMA 4WXZA 1XIGA 1AH0A 4Y2WA 4G2DA 1CXIA 2PTZA 2ZXAA 2ZOXA 3U4FA 3W7QA 1JG9A 3VIFA 1HGWA 4AZBA 3EWCA 4UTLA 4H2HA 4IP4A 2DVXA 4H8UA 3B97A 1F74A 1EJ7L 4PCPA 3S9YA 1F2JA 2ZA3A 5AC4A 5JH2A 4MYAA 2CLKA 1T40A 2OWCA 4JFVA 3CYJA 2E68A 1PIGA 4ATDA 3MSYA 4L61A 1CBGA 5CPSA 3OBEA 2HVOA 2FTYA 4N6EA 1I45A 3VX1A 1BWVA 1BLIA 1DE6A 3CQKA 3NPWA 4IGHA 4JIIX 4MAZA 3W7EA 4XBJA 3TAOA 1XYCA 3S8HA 1HNYA 3ZSSA 2D0FA 4MB1A 3SQSA 4U28A 4DJFC 1AW5A 5HMFA 1B3OA 3CJPA 3NXFA 1N8FA 5EU9A 4LFYA 3GR4A 3H12A 1Z7AA 5LIKX 3HFYA 5CKSA 1TTQA 5G1TA 4KFOA 4MTVA 1KO0A 2WVUA 3M0XA 1QRQA 3DESA 1LT7A 3N73A 4KKXA 1J0YA 3U3HA 8TIMA 4KEMA 3UESA 4DJDD 1GJWA 4Q8MA 2EPKX 1VIZA 4JICA 1FWAC 2QCFA 3AXKA 3TNBA 1K7FA 3VZZA 2VUNA 3SFWA 1Z89A 1JDDA 1I2OA 1XIFA 2VD8A 4C6CA 3SBFA 1RJQA 3W24A 4PCTA 3WQFA 3ZVHA 4XVDA 4DBDA 3DOPA 4NZ5A 4ERGA 4FAMA 1LQ0A 2ZXDA 2Z0IA 3NL5A 3EX1A 3ABQA 3GC5A 3W1TA 4AYGA 4P7RA 1S5MA 1QI0A 4IH3A 3INPA 1ZBKA 3ES7A 1BHGA 2FB2A 3TWBA 2IQDA 5G1MA 2W62A 2EKCA 3BOXA 1R87A 5KZDA 3PBMA 2VFDA 4MWAB 3PPFA 3LCGA 2PDIA 2HPMA 2DZVA 2QW5A 3TQKA 3ZQ9A 3LCIA 4LBUA 2JKEA 3T8QA 4IFRA 2Y7FA 2VWSA 1OQFA 4DZ5A 4P7NA 3U0HA 1FH7A 2OG9A 1ONRA 1HF6A 4DYKA 1OGSA 1ZHAA 3LHWA 2EPNA 1UWUA 3TN3A 4M3PA 2J13A 2D22A 3HGJA 2E9BA 3Q58A 1UD2A 1SMDA 3WDRA 1XW8A 3FEMA 3VGHA 4X2PA 1LLZA 1MSSA 2MANA 3VNLA 3W6MA 4FLQA 1XSIA 3E5PA 1OSEA 2CESA 1R46A 2XIJA 4LUIA 3G77A 3DI1A 3M7SA 3IRSA 3QF0A 3MYOA 1E6ZA 3ARUA 3OHIA 3A5FA 4OHQA 3G1FA 3EOUA 2V0TA 1LOLA 1HP5A 4YYCA 4G7EA 1S46A 4PEKA 4M82A 3QH2A 2CPUA 4IMGA 5AC8A 2Z25A 4AWTA 1SZRA 4YU1A 4GXPA 4AX7A 4PMVA 1XIDA 5D33A 3TFCA 3N25A 3G1VA 2Z26A 3LRLA 3K30A 3S2CA 1KXVA 3SCRA 3W70A 3NWRA 3LBMA 4IHCA 2O56A 1M1BA 4R7WA 3ISIX 4O4WA 2FHCA 4I6VA 4LYRA 3VAVA 5FJIA 4C60A 3GDLA 4KWUA 3GG8A 4LUTB 1VYPX 3WQOA 2QF8A 1F6KA 1E6NA 1D3CA 2XDFA 3FAXA 2ZA1A 4JYFA 1ICSA 4ZQMA 7ENLA 4G56A 1ZS2A 3CWOX 1H5VA 3TYAA 1BYAA 4LY4A 1YX1A 1VBRA 3NZQA 3UJFA 4OV9A 1R0MA 4NVTA 4XZWA 4IFKB 5EB8A 4OTKA 3CLMA 3W27A 4B3LA 1RJRA 3OO2A 1M68A 3ANYA 3E1F1 5BNKA 3UGRA 3TYZA 1V3JA 1W8GA 2E77A 1YBQA 4I9MA 3LCFA 1TSIA 3L0NA 1AQ0A 4MJZA 4UZUA 3S3GA 2X2YA 2Q01A 1E9YB 4YWIA 4LX4A 2PWUA 1KCXA 3SIMA 5PTDA 1GK8A 3N3MA 3FYOA 4O4VA 1H62A 1MQPA 8XIMA 1IWPA 1PUDA 3W7HA 4ZQPA 2HNHA 4MWAA 2ONEA 3MBDA 2GJPA 3GYEA 3PHAA 2BVYA 2D1ZA 2EAWA 2JKAA 1R8LA 3NL3A 4WVXA 2C91A 4L6HA 2XVLA 1NU5A 2CLEA 2OMAA 2D24A 1D7FA 1J93A 1K8XA 4JN8A 2VKZG 2J6VA 4RPQA 4LUSB 4XISA 1EUAA 4D6EA 1G69A 5EBUA 2WMGA 3VPLA 3GG7A 1ZAIA 3FGCB 3A3WA 3NZGA 5CG0A 3LNMA 5J8LA 5E0KA 1F3WA 3AXMA 2POZA 5AYBA 4AMCA 3PNUA 1KXQA 4L9YA 1LRNA 3LYEA 1POKA 3UG4A 1QNSA 2VDHA 4QDMA 1I0DA 3N13A 4O1BA 3WQ4A 3JW7A 1UIOA 4CNOA 5FSEC 2I9EA 2QMKA 1Z42A 3Q45A 3LLDA 2YB4A 5FSDC 3GU1A 1QBBA 4Q8QA 1E40A 2XSAA 3VIHA 1OX5A 4LCQA 4C6JA 5K7JA 4PBFA 3E0LA 4NNCA 4PMYA 5AB3A 4AEFA 2BHZA 5CCZA 4C7DA 2VP8A 4IQDA 1JYVA 4N7QA 3WJWA 2R1PA 2TAAA 1US3A 5FJRA 4E2VA 3DG7A 2IKGA 1KXHA 3FW6A 2Z1SA 5D9MA 4JZ5A 3VM7A 3N29A 3VIIA 3CTLA 4ZQNA 3D6NA 1XRTA 5M1TA 3DZ1A 3BGAA 4QM1A 4IPPA 4ZOBA 4S3KA 3B8WA 4GY7A 1IZJA 5A95A 1BEUA 1F3TA 4LYPA 3QLLA 1W1YA 2VELA 4X0NA 1HW6A 4H8HA 3HIJA 1OG0A 1EDQA 1R3RA 4JFWA 2D73A 2ZE3A 3TEVA 4JD4A 1ISZA 1V0KA 3NQVA 4TV5A 5DELA 4ICCX 5AZ0A 6A3HA 4CVWA 4TX9A 7REQB 3R94A 4YTRA 1CB2A 1QI2A 1BF2A 1PCKA 3VFCA 2C15A 3WF0A 5BRQA 4I7WA 4F0KA 1F8IA 2XJ7A 1BSLA 3O16A 5KZMA 1UR9A 2R1KA 1A47A 4NG3A 4XIAA 1WDPA 3K8KA 4HMEA 4HU8A 4UQBA 1SZNA 2QULA 4K7VA 3P82A 4AIUA 3LM7A 4WRHA 4UTUA 4YTUA 2ALRA 1JEZA 2VWTA 3FY1A 4W5UA 3BLKA 2FGLA 1O6IA 1OJXA 5H8MA 1SW3A 3LXAA 3SI9A 3L21A 2EKGA 3FA3A 4HMNA 4Z2HA 3LRMA 4MFDA 1US0A 2V5DA 2BP1A 4GIRA 2WYSA 4HU3A 1KRCC 4DJEA 4W87A 4EF8A 3FXYA 1W31A 3E49A 4B2DA 2VR5A 4C6BA 2FDMA 1NOFA 4LUSA 3CZKA 1JUKA 2EGZA 4IGSA 1VH7A 3UYIA 4HN4A 1DWJM 3IIXA 1HJQA 2O4MA 2Y24A 3FGCA 3WN6A 4N42A 1E73M 1EUNA 3NQ8A 4NZFA 5AC7A 3CQHA 1BYBA 3XINA 1YE4A 1YPXA 1GVEA 1NF7A 3EWXA 4NILA 3UXIA 2ZX7A 2VC6A 4M81A 2QV5A 2OR2A 1MQRA 3Q65A 3EWBX 3H4XA 3S46A 4AZHA 1UHVA 3NQMA 4O53A 1DQXA 4QG8A 4C6MA 3WQEA 1V77A 3HPSA 2CZFA 3GH7A 1NFPA 4QJ1A 3MY9A 1TVLA 4CGTA 3NQBA 1KRMA 4EKJA 3CMJA 4C6OA 4F66A 4XAZA 4J3WA 1BGGA 2PDHA 3DYMA 1ZJBA 3LCXA 1ZJIA 3OG3A 5C9ZA 3VGGA 3EWZA 2VZOA 1BWLA 2XG9A 2ZZ6A 3W01A 4E3TA 2PGEA 3W4RA 3FAWA 2ISWA 1FWIC 3ICJA 1RJPA 3CHCA 3TYDA 3H4WA 4CVUA 4GX9A 1N8WA 7PTDA 1PTAA 1OBAA 4XSLA 4O54A 2YZRA 3AMCA 2QS8A 2ABBA 3ID7A 1HVXA 3L4XA 2OYMA 1WX0A 2BOFX 1RXOB 4HGXA 3PG8A 4A05A 4PUWA 2C13A 4S3JA 4BA0A 1DXEA 1X6LA 5LIWX 1NJJA 2HPIA 1E51A 2C16A 4ML9A 3TAKA 1Q6CA 5F2IA 2V5KA 5AC5A 1VYSX 4GNJA 3ZSTA 3LPOA 4I5RA 4WDWA 1L9WA 2J8TA 1K3UA 1I2QA 5AHFA 3LD5A 3RF9A 2ZRXA 3MCNA 1KBLA 4HK7A 2DQWA 5A6BA 2RKXA 3AHTA 1BRLA 4DBWA 5H2ZA 5A2AA 3IGSA 1VAHA 4ZGYA 1GZGA 1C93A 5HMDA 2QPSA 1KM6A 3CNYA 2YOCA 1WDSA 4QG6A 1R3SA 3N1AA 3MCMA 4EPDC 4ZE4A 4H9UA 1TELA 1EXBA 1N7KA 2VL4A 3GUGA 5DY3A 5IXEA 2BY2A 2YPIA 3I65A 3B8VA 3G1YA 4HHHA 3SRHA 3KLLA 1KTNA 1UBPC 1IE7C 3WMSA 1QO2A 1TE6A 1T8XA 3EWWA 4AH7A 3TMLA 4FXJA 1OT2A 1HKIA 3SGUA 1TUFA 5CGQA 4GCXA 5T9BG 3IAPA 3DFYA 1H0GA 1FFQA 2FPVA 2OCZA 3L4TA 3W1AA 4GUFA 3MHGA 1ML1A 2PU0A 4Q8UA 4C5YA 1PKNA 5ABFB 2X30A 3WH8A 2NLYA 2GUUA 1EJRC 2PCQA 3HPAA 2OKOA 4ZO6A 3I3EA 5AYYA 4GVHA 2C1HA 3RLUA 4Z1DA 4D8AA 3EOSA 1KV5A 1YTEA 4FS9A 3SCWA 1UP2A 1SFTA 1HJWA 4UOJA 4IG2B 3FFSA 2Y0FA 1XLDA 5HAOA 2CHOA 4UXDA 4MNKA 4Z1YA 3O2LA 3PJXA 2PDYA 1A3XA 5AHLA 3C56A 3TTQA 3BDKA 5I3HA 1QASA 2NV1A 4INFA 4CCDA 3L0KA 1GJPA 4L80A 2OELA 5CBBA 4GVGA 1ME8A 3QEZA 3W0KA 1UKQA 3M0HA 3WD0A 3M5ZA 4RL3A 2VC7A 3SY5A 3BW2A 3B0UX 1TE1A 3KRBA 1VJZA 3OJGA 1Y7VA 1Q7QA 4P2VA 1C3FA 1FXQA 5D2WA 3G0XA 4FX8A 1TIMA 2Y4SA 3M5YA 1E70M 3VIJA 1KBKA 3OA5A 3NO5A 4DWSA 2ATMA 1JZ6A 4XBSA 1TMQA 4KCUA 5A6SA 2OWWA 3K46A 4GYPA 2WVSA 4HPGA 5LGXA 3LM3A 1XYMA 1NDYA 1WCGA 4JY8A 1GPFA 2WK2A 1RD5A 3MZNA 2VURA 3VO0A 3W7JA 1Z48A 3PB0A 2WPGA 8A3HA 3DHDA 3M46A 1RQBA 3EMQA 5I09A 2Y5SA 2ZYFA 4FPSA 3UA4A 5BWFA 4MY8A 4GZ7A 4L6OA 1XIJA 5GQBA 1RBAA 3R1ZA 3AIBA 3C0LA 2J7GA 2OPJA 2Z28A 4ZBCA 3A23A 3S2NA 5DEZA 3UR5A 1I9CB 2BTMA 3RMEA 2BLEA 3P62A 4LBRA 4LAOA 3O15A 1GVQA 2ZC1A 4JTFA 1TWZA 3OHMB 3MYPA 2DFAA 1XCFA 2IXVA 4E8GA 4PTVA 2XFRA 3E2RA 1JFHA 3RPDA 1B57A 4IM4A 5FF2A 3MMDA 2JF6A 3RM9A 3TK7A 3BLOA 4WCJA 3I6EA 1YNPA 2Y8KA 1TMLA 1UP3A 3IGHX 1BVZA 5DCBA 3U9IA 2VEFA 4DBUA 4NXSA 5A69A 2PD9A 1GYNA 9XIAA 2NVCA 1YXYA 4EACA 3ANUA 1HGYA 1DXIA 1JDEA 3CV1A 5XINA 1CI1A 4P5UA 3WEOA 4B5WA 1RCXB 1UWTA 4TMCA 3WL1A 4IL0A 1DJIA 2NXGA 4EP8C 4R88A 1ZBVA 2YA1A 1KM5A 3LSBA 2WKLA 1B90A 4M8UA 1AH3A 2ZXBA 2ZDRA 2DDXA 4PUKA 3WNOA 5CSSA 2WW5A 4K3ZA 4R7JA 4TV6A 3S42A 1TV4A 1OM0A 2E0PA 3KOXA 2C1IA 3UVAA 4E4UA 3TJIA 3PUDA 1LBMA 1NARA 2PMQA 3WD2A 4AD2A 2VX5A 4W8AA 3QQ0A 4LJ3A 1WZMA 5CAHA 3F2DA 4NZ1A 3LBOA 5A6JA 3PN8A 5LNRA 1VD6A 2YXXA 3F4CA 4N9BA 1V0NA 2B7NA 3NQ2A 2ZIDA 1UH4A 4QCEA 4UOZA 5FJJA 3TTYA 1UPPA 3P5ZA 1KFKA 3L5AA 3POCA 3CZJA 1KRBC 2VUYA 1MUMA 3LV5A 2W63A 1H60A 5CGTA 4M6UA 2Q3OA 3WLHA 2E5DA 4U3AA 2Q8XA 1JDAA 1ZP4A 1VPXA 2YKKA 1W54A 3NEVA 3P3BA 3QMRA 5EBAA 3F2CA 3QV9A 2OSWA 4AWUA 3S4TA 1PCWA 3NNTA 4M1RA 1ZLPA 5K4XA 4NZ4A 4MWAD 2A21A 3QPYA 3NOYA 3NZPA 2DUAA 4S23A 4S3AA 3T2OA 1VR6A 1HT6A 4Z2LA 3BWWA 4J1OA 3BJSA 2FFIA 3W53A 1XBVA 5D8ZA 1YDNA 2GK1B 2BODX 3V5FA 4IPIA 1XRSA 3KBJA 1YDVA 3EZ4A 3VDBA 1V6WA 4HMDA 3MW7A 2ZE0A 4IXHA 3M0KA 3R0UA 2CERA 3ZS4A 2VQUA 5EMMA 1S1RA 4YHGA 3P60A 2PTYA 3BO9A 3WLSA 1YQ2A 5FJOA 1VHCA 4TMBA 2GSHA 4Y9NA 1XLKA 1BXNA 4GUHA 3WDPP 4GCAA 1RCOB 1FCVA 4EX4A 3HMJG 2GJNA 4WSHA 2W5FA 4YPJA 4BEQA 2EO7A 1RUSA 2O9PA 3VFLA 5A6LA 1JGIA 2WKJA 3M43A 1ZBWA 4GIAA 3FKRA 2OLSA 3BK0A 3U57A 3A13A 4HA4A 3REQB 5CZJA 3KP0A 3RFAA 5C5YA 5C7VA 4WX2A 4UNLA 1NH6A 4TIMA 2E67A 1V3LA 3TQVA 1TRDA 4R34A 2GWNA 1H51A 4CNPA 3GFYA 4X61A 2BX7A 2XGZA 1XLAA 1MRQA 3PZMA 3QKZA 4GUGA 2DH2A 3XISA 1QATA 1IIHA 3KBMA 1SJDA 1G4TA 3A5VA 3E02A 4RZ6A 3DHPA 5HQEA 1S3HA 8XIAA 3WF1A 3QYQA 1QHOA 5G4HC 2BSLA 1RA5A 3PZIA 4DPQA 3QVQA 3T7VA 2AL1A 4P61A 2ACUA 4DJEC 5FOOA 2JEQA 2PAJA 2E9LA 1UOZA 4NXKA 1DIKA 3BAWA 1XINA 3A3XA 3CHFA 4IZGA 5DMYA 3RLGA 5I3JA 1MZRA 1M41A 3WELA 1T8QA 1ZB5A 1RD6A 4QS5A 2VR2A 1V79A 1V8EA 2DZWA 4UTIA 1S39A 1K4GA 4RNIA 2ZZ5A 6PTDA 3HPFA 3STFA 1E0UA 1H7WA 3UETA 3RO6A 1B3WA 1Z9AA 2X40A 3ARVA 7TAAA 4GGHA 3PTDA 4X3ZA 2A6LA 3WDHA 1ITXA 1EBHA 3C0SA 1MXSA 3W72A 5I5RA 4PFHA 1S2AA 4GI8A 4EPKA 3W86A 5BU9A 2HS8A 3ARQA 3HB9A 3OZPA 3LCHA 2AGTA 4GVIA 5C9UA 1RA0A 1TV2A 3Q37A 1MRAA 3QSTA 2PEVA 4W84A 1CDGA 3N9RA 2Y62A 1VBUA 1TWDA 3WIJA 4LXFA 3S6OA 3G8RA 2QR6A 3UA3A 2GK1A 2BASA 2PP1A 2Z1KA 3GXNA 4JTTA 5DFAA 4CN1A 1Q4WA 1L8NA 3M5VA 2AOSA 3CAVA 1SO3A 3H8AA 3SGGA 4G1KA 1OFBA 3EB4A 3CM4A 3PJTA 3I68A 4K1WA 3TMQA 1L6WA 2AAAA 2WNWA 4MOZA 3HOJA 2PWDA 2J4GA 3NUKA 2PC4A 1YDOA 4Q3MA 1LUCB 1P0DA 1ZY9A 2W92A 3TIMA 2D69A 2H3BA 4QEEA 4R85A 4J4KA 1VBHA 3T08A 3W7OA 3QR3A 4PRTA 4CU7A 3RPTA 5KITA 4FB7A 4PTWA 4AVNA 2XFFA 2NX1A 2QDDA 1V6UA 2YW3A 3M1ZA 2H8XA 2G5WA 2YFNA 2X41A 3R4IA 2NXHA 5L6UA 3F03K 1TJPA 1JCXA 2PGWA 3KOFA 3PY2A 4XZHA 1WKEA 4K38A 3FIGA 4EOUA 4UFHA 3R43A 4Z2JA 1CLXA 4HYVA 1OVDA 1A0EA 4OFCA 3VMNA 2Z6IA 4BCEA 3NSNA 4XAPA 3AS3A 4HN8A 4GKLA 4C5ZA 1F3XA 4IIGA 2DT3A 4DNHA 3IK2A 3N12A 2GVEA 4MUPA 4DI9A 1JXJA 3FHAA 3SURA 2VQTA 5HK4A 3UNTA 3CAWA 4PMQA 4W93A 1FWFC 1E4MM 5CH9A 3UERA 4GIYA 3DFSA 1TA3B 3G0UA 3GRIA 3T4WA 3N04A 5LIYX 1KV8A 4EPBC 4C7GA 3FJNA 1LQ2A 5FF0A 4NL1A 2OTDA 3AQUA 5FEWA 1TPH1 3SJNA 3K5XA 1L6GA 5FI8A 2Y5JA 2O9OA 3SDOA 4O18A 3L5MA 2B4GA 3S6DA 4P8XA 2PDPA 3QQ1A 3E0FA 1RPXA 3M47A 3PUGA 1RQEA 4A2RA 3BXWA 5HR6A 1XF0A 2DW6A 2XGBA 5CZKA 4ATLA 4RW3A 3APTA 4GH1A 5A6BD 2E6FA 1X97A 1NOWA 2FZMA 2BVTA 4PCNA 4J3UA 2FB3A 4PMXA 1M5WA 1UWQA 3SSZA 3KVKA 4PCSA 3KDOA 1O94A 3GC2A 4IF2A 4JTDA 3LDVA 2DH3A 3BAXA 1S2CA 2FH6A 1UWSA 3MPGA 2WCGA 5GJMA 3KVMA 2PA6A 1RSCA 3PWGA 1KR1A 4LAKA 3RJXA 3C2RA 2VENA 4FOUA 3QN3A 2EF9A 1OYBA 1EGVA 3F1QA 1C92A 2P3EA 2XH7A 4K2SA 2XFYA 3VK5A 4WZHA 1N8IA 1GZJA 1R9XA 1J8VA 2VFEA 3B9EA 1J6PA 4PMDA 1QAPA 3E3HA 4G9PA 2IW0A 3TE9A 4HZ7A 2ZRZA 3FVMA 1ONEA 4BF5A 2CWNA 1L8PA 4L65A 1LLOA 1LUCA 3F4NA 1ADDA 3FVDA 3LGDA 4GNVA 4GYPC 4GINA 3KCLA 1EO7A 3KM8A 3RR1A 2FJKA 2QPXA 3KTCA 3H7RA 3PS7A 4GI9A 3VD3A 5I06A 1XP3A 2CLIA 5LA2A 1RP8A 3SUTA 1F9CA 4DPPA 3E2VA 1ITUA 3CV7A 1HP4A 9CGTA 5E5CA 1REQB 2V6AA 1J0JA 5A8NA 4IPLA 4LY8A 1FWTA 4JIHA 2I1OA 4BI6A 3CYVA 2V3EA 3CV6A 2DW7A 1IWBA 4L7ZA 3AHYA 3ZLHA 3APYA 4YN5A 1UCWA 2R1LA 3MJYA 1JRBA 3E2SA 1P0KA 2GVJA 2ZWZA 5E93A 1ZL1A 2GGGA 3BAYA 4Q7BA 1EDTA 3GNDA 4L64A 1W5OA 4MNMA 1OD0A 1UQYA 4V33A 5C6MA 4ZTYA 3L4VA 2J7EA 3WEMA 2XYLA 4CUCA 2OJPA 3QSRA 2HISA 1P48A 5A2BA 3GAYA 3KZSA 5MHBA 1LZOA 1GTEA 3B04A 3W28A 2ISFA 5LNWA 3W7MA 4CD4A 6TIMA 2QXWA 4NZCA 3WLOA 4CEXC 3SN1A 3IIZA 1KCLA 1J11A 1J01A 4ZB2A 3UU0A 5FAJA 4QXIA 3V36A 4NI3A 4U2YA 1QPQA 1T0OA 3TDFA 1NWUA 1TR9A 3VKBA 3IJ6A 3WQ8A 1AMYA 3IRDA 3RILA 1XSKA 2JEPA 3SCOA 1DIDA 3CMGA 4N4PA 3AYRA 4J40A 2BMBA 2FLIA 5FF4A 3GUWA 2QGHA 4FR1A 2P8BA 3LCWA 5I79A 4JNYA 3GIQA 2I17A 4JDYA 1DHKA 5M17A 1J2BA 1PYFA 4AXNA 1VFFA 4LGXA 2X7WA 3S5NA 2V69A 3TCSA 1TREA 4OWGA 5JXQA 4IPJA 1SJCA 2YDSA 1K02A 3R25A 1R47A 4B5UA 4FNRA 4POCA 1VJIA 2OZ0A 1TG7A 4W86A 4DLFA 1DJNA 2H9AB 2FTPA 2X42A 3DYOA 1V02E 3UCQA 3TN4A 1C8QA 3W6YA 1KD0A 1UOKA 2YYTA 3WY1A 1BYDA 1ZALA 1E1EA 3H53A 4I7UA 3S9ZA 3NZRA 4KW2A 3UG3A 4TXEA 1UWIA 1BQGA 2JBMA 4LB4A 4LAMA 2CBJA 4MPQA 3NDZA 2OX1A 5FIPA 2OEJA 1REQA 3EWUA 4JIEA 3JZEA 1O1HA 4N0RA 2ESCA 1OB0A 3OLGA 3UY7A 4C6QA 3LG3A 4OGZA 2AQWA 1P0BA 3O0FA 4H2CA 3ONBA 2C79A 3MWCA 4LRTA 3TUUA 4OBSA 3FA4A 4H41A 3URQA 5TNVA 2XH2A 5G4WA 4U4MA 3K4WA 3M0MA 1XDMA 3E0WA 3WH7A 3WQGA 5A8GA 2RGLA 4UTHA 2WLYA 1EEXA 3KAOA 3AIUA 3W07A 5ABGA 1IQ8A 1UROA 3SN0A 1CXKA 3LSCA 4PSRA 5D05A 2R91A 5CJMA 4LS2A 4QG9A 1WPCA 3QYSA 4UR8A 2J66A 1TX0A 1VRDA 1CLKA 2YZ5A 4M19A 1SFSA 3CO4A 3GNNA 5BXTA 5HUOA 3MHUA 4KWVA 3GIYA 1XQLA 2W27A 2HTMA 3BMWA 3LHUA 5I3KA 3NYDA 1GUVA 1VJSA 3EB2A 4LW7A 5I3GA 1ME9A 2VR4A 4UTJA 3AZSA 3F7JA 1PL9A 2GL5A 2DQXA 2J7CA 4QJ4B 1ZPTA 4Y8FA 1JRCA 2QUVA 2ICSA 3IACA 3HJEA 1KCZA 4TO8A 3QKEA 2NT0A 4AY7A 3N2MA 2E7FA 5IBXA 3UPBA 2O4QA 3H2EA 4AIBA 5LA0A 2FKPA 3MQTA 5D02A 2C0HA 4UTTC 3JS3A 1PB0A 4ORIA 1WAWA 4MB4A 4XKMA 1WBJA 3FCPA 1A4LA 2ALDA 5BCAA 4IPNB 3KOWA 4AC7C 3E0IA 2XTKA 3CQIA 2VZTA 4QJ3B 3GX9A 5RUBA 3URBA 1XKJA 5GVJA 4PMJA 2J8FA 4GZIA 2FFCA 4M29A 3CLWA 2QCGA 3W85A 1QOQA 4QCFA 4DZHA 3ZFHA 1XYZA 3FSUA 5HOSA 1QW7A 4NASA 1F61A 2WZIA 3TZNA 5BOOA 3O6YX 4XSMA 4ZQRA 3GH4A 3ZWSA 4US5A 4QQ3A 4R9OA 2J79A 3R11A 4O17A 4MG4A 3ARWA 1PKMA 4I5UA 5LYRA 4RLIA 4JDBA 4FEZA 3OOQA 1KKRA 3USZA 3O63A 2QJNA 2WWDA 4JTIA 1IXOA 4EXQA 2IPFA 3IVUA 3THCA 2HS6A 4WGHA 5D9PA 4L1GA 3PK7A 1DWAM 3RRXA 3S83A 4I3GA 4OU1A 3TU9A 2GDVA 3DKJA 4D71A 2VZSA 5CPOA 1OF8A 3UBPC 2D2JA 2VHLA 1PE1A 4JQ2A 4X22A 1C90A 1I60A 2BGSA 2A7PA 2GLKA 3C2EA 3UR7A 3V3WA 1VFTA 1F05A 3C2FA 3LNPA 4GHRA 1GWJA 2W9MA 2XZ9A 2GVYA 3GVRA 5E0FA 1SJBA 3IEBA 1DWHM 3IAQA 1UH3A 4FXRA 5EMJA 5I3DA 1C8XA 3B8IA 4IICA 5AC6A 3RLHA 1CT5A 5CJNA 5BYWA 5EPDA 1E4LA 1VLIA 1WOAA 5AHEA 1VIWA 2WVVA 3CIWA 4HHPA 2J9ZA 4H19A 1R9YA 1HFBA 3WLKX 3NO1A 1QVBA 2P50A 3CB8A 2HVNA 1B54A 4O28A 3BSHA 4HTBA 1RV8A 4O12A 4DHGA 1EX5A 3GVQA 1B4EA 1OFDA 3SGZA 5A2CA 1IEIA 5BRBA 2PDLA 3ABRA 4MM1A 2V3GA 4OUEA 3PTKA 1IZKA 4BWLC 4E4PA 2BXZA 2WVTA 3II1A 3P0WA 5HDRA 4Y90A 4ORMA 3LHYA 1LDCA 2PURA 4HOWA 3LTPA 2YCEA 4LYQA 3T0BA 1PDZA 4PUEA 1H4PA 1JD9A 1F76A 2E8YA 4NJHA 1PKLA 5BROA 1U1JA 5BZAA 1GHRA 5LA1A 1JNDA 2FVKA 1J96A 2X1IA 1O5QA 4MJ4A 3TSDA 2PU1A 4FNSA 3NIYA 4H3DA 1Z44A 2PDCA 2WJEA 4U3CA 1JDCA 1ZCCA 4XAFA 1XI3A 4ZR8A 4LOCA 2WBGA 5AFDA 4H8VA 1OIFA 3SUUA 4FA3A 1ALDA 1JULA 4UCFA 2GUBA 3NCOA 2IPGA 1LF1A 2V2HA 3WF4A 3PZ9A 3ZT7A 6XIMA 4B5NA 4PN2A 4J3TA 4KEUA 4DUXA 2OX4A 2NQZA 1NOUA 4MB3A 1FH8A 3RK8A 3EDDA 5CLTA 3LS9A 1H09A 1VRXA 1UR3M 2R9RA 4JTGA 1SZGA 3TQPA 1PO9A 4GX8A 2QCCA 1KRAC 1JZ2A 2VFHA 1LOQA 2SFPA 2CZVA 3N3TA 2YGYA 5LNSA 5AZ1A 3GAKA 4HCDA 1O95A 1UA3A 3NL2A 3PBYA 1V3KA 1E4NA 5T26A 4A3UA 3A4WA 4QSFA 1BXBA 2XH0A 3NM3A 2BFGA 4K8HA 1I2RA 5LSMA 1T6MA 4R9XA 4NUWA 3GTHA 1KTCA 1EC9A 3W7CA 1NDWA 4HA3A 4Z17A 1E9ZB 4F48A 4QHRA 3VU2A 4Q4RA 3UPMA 2VZUA 3SRFA 5HQMA 3VABA 2IQ0A 1YDYA 3MT1A 3G2GA 1F07A 2ZUNA 2D3NA 4Z2KA 4NNAA 4ECLA 1OFRA 3I10A 4B3KA 2PLMA 3AXHA 3MDWA 1DKWA 2C19A 1TMHA 4X9SA 1W9UA 4XD5A 4Z0JA 3SCPA 1O5RA 4FOKA 4XQ6A 1H7PA 1EGMA 3BLFA 3S2MA 2P5NA 3ECQA 3EA3A 3HO8A 3A9IA 1AH4A 4GISA 2WNZA 5H8PA 4JTUA 5IHSA 4ZEPA 4GJJA 3WQWA 2CWXA 3M5XA 3AHVA 1CWYA 2NQJA 5CBJA 2XM1A 5DY2A 3GB6A 3W37A 1P7TA 1MW2A 4YL2A 3F4VA 3AS1A 1EBGA 4CNUA 1XFCA 3VNJA 1D7KA 3CWHA 5BW6A 3DHFA 3HQOA 4HCHA 1SO6A 3QGAC 1K6AA 4MKVA 4WEVX 3STPA 2OWXA 2X05A 4LS1A 3FK4A 1GW9A 3H2NA 2D2GA 1GOOA 3UD6A 5D03A 3WLIA 5JIWA 3RITA 3TKFA 1VF8A 3IIPA 2P0IA 1EL3A 4IWWA 4HOZA 2BVDA 1OK6A 1WZLA 2WAGA 3L2IA 3N17A 1TFVA 5IDZA 4N9EA 2AAMA 1S2WA 4XKYB 5T8GA 4JQ4A 1TV3A 2G95A 1X98A 5DMMA 2ASHA 2HMCA 5B80A 1I1XA 2FHBA 3JRKA 3EPNA 3PB2A 3N18A 2AMXA 4JEQA 1ESWA 2ZXQA 1Q2SA 1GG1A 1Y8BA 3EOOA 1FXPA 1A5UA 4RDYA 4F3HA 2AL2B 2DIJA 1XLCA 4P8UA 4N6FA 1MEWA 4MVAA 2QCMA 3NSXA 5XIMA 2ZCGA 4H6RA 4NY2A 3OEXA 4MB5A 3GFZA 1KGXA 4RPPA 4HA1A 2VOMA 1OZQA 2R8WA 5FAGA 2ATSA 2PDGA 3QHMA 3SY8A 4BK9A 1XD1A 2BY0A 1QBAA 1IT0A 1JF5A 1E0WA 3FKKA 2P1FA 2DY3A 1F4HA 2XHYA 3EXTA 3N4FA 1R3YA 3NURA 3IUDA 1PX4A 4RXGA 4HHMA 1OGBA 4D6CA 4H4IA 2F8QA 5DRCA 4ES4A 3VKJA 4A35A 2I57A 4DWDA 1C8YA 1TYGA 4HA0A 1RLCL 5JQ9A 3KLKA 4WY0A 4TVCA 4DAFA 2X1UA 3KVJA 4RV3A 2QUMA 3WBXA 1EFZA 1QHZA 3EA2A 3GDRA 3VZYA 4CU6A 1BQCA 4DI8A 4OT7A 2QNEA 2QIWA 3ZO9A 1PTGA 2A5HA 3L7RA 3LQLA 3SEPA 4ACZB 2X7VA 1W8SA 2HWGA 4JX6A 4UQAA 1U22A 2R1MA 3RRAA 4DYEA 3OTRA 3UFYA 1V02A 4DBEA 2JQXA 1GOMA 4JCLA 5JUVA 1W3KA 3TZFA 1K03A 2OLAA 3HM7A 4FLOA 4HP5A 2IKHA 5AVHA 3AUOA 1GVOA 3PFRA 2Y7EA 5F4SA 4NX5A 4CD6A 3NDYA 1P4CA 2WSPA 4MY9A 3MSDA 4NJKA 5DF0A 1FOBA 2CLMA 1UD8A 3B05A 3WH9A 4WY0F 2E25A 3RU8X 2ZZ7A 3PZNA 3A21A 3SCNA 1RBOB 2RDTA 1L2UA 3B9AA 1VBJA 1DIOA 1E55A 1V6XA 2GJLA 1S2UA 1CPUA 3K8MA 4QAIA 5J5DA 2FGBA 1UKTA 3TW6A 4A29A 3BLDA 3EMCA 5D37A 1K7XA 4JY9A 3UWZA 1T99A 3KCJA 3T6CA 4IFOA 3VUPA 3GKFA 3LPFA 1AD4A 3NQAA 4KEZA 4ROPA 4MSSA 4HPNA 4NU7A 4XKYA 1EWEA 2ZRYA 4XVEA 3L2LA 5IBXC 5AYZA 1TJ1A 4LYKA 1PZ2A 5CC5A 3OQEA 1HO1A 3VNDA 2H6RA 4FLSA 4I9JA 1WDQA 5A5WA 4Q4OA 3LERA 3WG6A 1B9ZA 3PSWA 2R14A 2D3LA 2PPGA 3Q94A 4GE8A 4DB7A 4MAVA 4IMEA 2ZRVA 4DZAA 4FR6A 3PUEA 2JALA 3K1GA 3B8UA 4PMZA 3NG3A 5DT5A 3COTA 4JYEA 1ITQA 3NR0A 3UJEA 1K77A 1F6YA 4WD0A 2XFWA 2QQ6A 4UMAA 3T9PA 3DYPA 4O1CA 1UC5A 2Y63A 1KFJA 1DJWA 2X09A 3W25A 3A24A 1CYGA 1C7SA 4CQCA 2R82A 2CIPA 2ZZ4A 2PBGA 3TR9A 4TUFA 1IT8A 1XPYA 4KWOA 4F4RA 2CKSA 1I75A 4GY0A 4MLRA 4BY3A 5B7YA 2CW6A 2BHUA 1FHUA 1OC7A 3ZLFA 4J3SA 1EIXA 5GJNA 1PV8A 3N11A 4FXSA 3B8DA 2HE8A 4LU0A 4EXBA 3DH7A 5HATA 3DFNA 5E9AA 1V4YA 3DECA 3RYSA 4AWSA 1W5NA 3AC0A 1LG1A 2QV4A 4EWND 3VE9A 1CB7B 3VKAA 3W2UA 3RO8A 1FWNA 4W9TA 3PPGA 2ZC8A 4QP0A 4QLKA 4F9DA 1W3IA 1KLZA 1W37A 1LRTA 2IMRA 3GZAA 4UQDA 1C9DA 3CPGA 1P1MA 1PHQA 2J62A 4JQ1A 1ZFJA 3WQCA 1B4KA 3P81A 2TPSA 4YWSA 4H6KA 3OZMA 2YYUA 1YTDA 4YVXA 1TPVA 4Q8WA 1EP2A 1EIBA 3GR7A 4CCEA 3SJ3A 2A1YA 1J18A 2HQAA 5A6MA 1G4EA 2GQ8A 1MW1A 2WZMA 3PBVA 2WANA 3AIQA 1G01A 6XIAA 4PB3A 3RUBL 2DSZA 4L1XA 2WWCA 2CLLA 3A47A 4DF2A 4PTMA 3QV7A 4W85A 1BTCA 2NZLA 1ZAHA 3BW4A 3MZ2A 3HQ1A 1W2VA 1SSGA 1QO5A 4QE1A 4X60A 2BGNE 3WNMA 5B7ZA 4M7SA 5K4ZA 2OFJA 5CG7A 3W7KA 2D0HA 1HJSA 1UZ1A 4AZCA 3L23A 3BPWA 4DO6A 3E6EA 4JS3A 3EWDA 2GOUA 5D9NA 4KCWA 3EKZA 3FN9A 2EG7A 1F8MA 5DXXA 1ZTVA 1OCQA 1VFOA 3SW6A 2QCLA 1A4MA 2A3BA 2J75A 3RX4A 1H2JA 1DJYA 1SSDA 3KL0A 3GXTA 3N4EA 5I3FA 3KL5A 1H11A 2UY4A 2X0HA 2Y7DA 4IL2A 2CBVA 3QC0A 4K8GA 2RDWA 2YL8A 3TN5A 2VEPA 3B8TA 3ZVHB 3MMTA 2YW4A 1GOXA 4AHPA 1BKHA 1TTIA 3AXXA 3QRHA 4W7WA 3E96A 4TU1A 5CPTA 3ARXA 3GIPA 1H1YA 2FJUB 1EDGA 2E6DA 3VCRA 1J0KA 4NRRA 2NQHA 4HPXA 3PP7A 1KQYA 2AKZA 5CPMA 3RPMA 2BVWA 3R6IA 4Z42C 1EGZA 1OC6A 5K2ZA 1C9WA 2J24A 1XQKA 2VD9A 1FDJA 4ZL1A 4NJIA 1IR2A 3ERPA 3S9IA 1FDYA 4JFUA 4W4QA 5CSRA 1IGWA 1F5ZA 3R58A 4CD8A 3QHOA 4KF1A 1IT7A 4C6LA 1NIUA 1NFGA 2W66A 4XTIA 1ZUAX 1FWRA 3SUWA 1MO0A 3WK2A 3GDTA 4ZCWA 2D0GA 4UFIA 5D38A 2AQOA 1OABA 2WM1A 3WLNA 2NQLA 3ELFA 2YCKX 1X6NA 2CZEA 4D1IA 1LG2A 1H1ZA 5I2UA 3MMUA 1OIMA 1OG6A 1UJPA 1XFBA 1E6PA 2YCJA 2PODA 2EJAA 2VRQA 1QK2A 4GO9A 2J9YA 1S2VA 1AG1O 1NY1A 3SRDA 4PL1A 4LCRA 1X8FA 1H7OA 2FZNA 1R3WA 2POTA 3CS2A 1KBBA 4Y6GA 1YNQA 3WX7A 2Z2AA 4DLMA 2Z2BA 1XG4A 5D30A 5F7UA 3V35A 4A3HA 1LBFA 4G7EB 1EH9A 3NQFA 1B5TA 1XLJA 5E09A 1CIUA 4GZEA 3ZJ8A 1HL8A 1CXHA 3VTRA 5LHFA 3QY7A 4B5VA 3FHQA 4M6PA 2PLKA 3UXAA 2X2GA 1MMFA 2DSVA 2DZPA 3OYXA 2YCLB 1G9HA 1O5KA 2YX0A 3T4CA 2CYGA 1VQTA 2FPTA 1H0IA 2CLOA 3QHNA 2DZBA 2WXDM 2E6YA 1IF2A 1SFJA 4N4QA 1OFAA 1S3TC 4Y96A 3OZOA 3ZYZA 2EPOA 4C6EA 2QPUA 2V8ZA 3WNKA 1LOSA 4A8NA 5CSUA 1YBQB 2I16A 2WMFA 4N2YA 3NQGA 5AYXA 1KM2A 2OGJA 3UWEA 2HDJA 4KEVA 2CEQA 3HJZA 4LVGA 2PWGA 4DJFD 3OW1A 1EQCA 2KZHA 4HNVA 3TC3A 3WUGA 2GUYA 4OOZA 4BS0A 3N2BA 1B0IA 3EB3A 4AG0A 2I5QA 1Y5VA 4FSAA 3VGFA 3H54A 5LNVA 2ZTJA 3WBYA 3CTTA 1UBSA 4CD5A 1Q6GA 3GVWA 3MWAA 2V9DA 3TJLA 5EY5A 2WCAA 4LAUA 3MVTA 1MEIA 1WZKA 3N2TA 3BZJA 3IIVA 4CKQA 1GG0A 4B92A 4JHZA 1V6TA 1FH9A 3NA8A 1Q6DA 1FRBA 3PWAA 4GWEA 3GXMA 1W1PA 4GBUA 2ZICA 1BTMA 1VCGA 2GSJA 1R3QA 2TRSA 3THQA 1XBXA 2IS7A 3EOEA 3P93A 3CUHA 4YTQA 1A5SA 3GDKA 1ECQA 4JBRA 2Q09A 5JU6A 2YDQA 4A8RA 3OLIA 5AOUA 4A8LA 2PUZA 4ZSUA 1EEPA 2VFGA 5LHEA 3BG5A 1GVRA 1UZ4A 2BGQA 1YKWA 3ZVIA 3H7VA 2VCBA 4BQ5A 3RXZA 2QUUA 4A21A 1M01A 1S5TA 3IV3A 3LI1A 3ZT5A 2C18A 1JI1A 5EMYA 3U4AA 2HBVA 1B2YA 3WFLA 4FALA 4M80A 4GOAA 1CCWB 4JEJA 4IIEA 3T0AA 1ZBCA 1W3HA 3FYYA 4MIMA 4G7FA 2NUXA 1XHGA 1OK4A 3CUGA 3SRKA 3WD3A 3VA8A 1D3GA 1O4UA 2PB1A 1J2WA 3R8HA 2YCLA 3RCYA 5HR7A 5T9CE 2PFHA 1GW1A 4R27A 3T8LA 4JHMA 4MKSA 2CZDA 4QEHA 3TSMA 3OIHA 4XO6A 1DWFM 2E40A 3TFXA 8RUCA 4XD3A 2A2IA 5CXPA 1QTWA 3ITVA 1G7VA 3WQ6A 1MDLA 2P76A 4JHOA 4W5ZA 4O10A 3UXDA 4XK2A 2HBXA 4NAFA 4XO7A 3WDQA 2HRWA 3W7PA 1UD3A 5LGZA 3T44A 2WJDA 4EIVA 1IYXA 3S5ZA 2WMJA 3GH5A 2DU2A 1OYCA 2I5GA 2DVTA 2HJPA 3HG2A 1W17A 1RH9A 4AD3A 3L9CA 1XGZA 3DN5A 4G8TA 2PGRA 1P5BA 4I7VA 4H9MA 5FD0A 4DUVA 4OBTA 3M0YA 3KOYA 5DBUA 1ZP3A 1UR1A 1JZ8A 3OVPA 5BMWA 1LLWA 1CGUA 3M64A 3DX5A 3MKVA 1P6BA 3BMXA 5F4XA 1CENA 1JUEA 2BOEX 2PF0A 3FEQA 4IXXA 3AIWA 2XN1A 4K37A 2WLZA 1AQHA 4O13A 1GVIA 3PNZA 5G2WA 4K39A 1DYSA 5H8UA 5CZTA 4UQ9A 3H4GA 2WMHA 3V5OA 4QNWA 1DTUA 3A9BA 3S0CA 5CAKA 2CBIA 3CL6A 5DX7A 3U6WA 5JBEA 4J35A 4NP7A 1W5PA 4XX6A 5HPOA 3CC1A 1CGVA 5DBTA 5GJPA 1XR2A 1FDZA 3B8SA 1W9BM 2GFTA 4WDTA 4DNMA 2YBVA 3PUOA 1Q85A 1KGUA 5AHIA 3ARTA 3DC0A 3MUAA 3VINA 1JPMA 3EBVA 4LTSA 1YRRA 1XXXA 3AIVA 3RAOA 1J4EA 5I03A 1RALA 3I3DA 4GQRA 1NWTA 3LHZA 2DUZA 1K8ZA 4ATWA 1G0CA 3NFUA 1MYRA 1JNEA 2KX9A 4PUDA 4BQ4A 2J78A 2XSXA 4ADSA 2CLPA 3FS2A 1DP0A 1GQJA 3CZGA 5SWUA 3J7HA 1E0VA 1WOBA 3MO4A 1JAEA 2OSYA 1VC4A 1XIHA 2PTWA 3SIZA 4BKNA 3AUJA 3QM3A 2TODA 4F40A 1PEZA 1AZ1A 3SM0A 4DJDA 3E74A 3GVGA 2NVDA 4Z1AA 4CU8A 2BG5A 4BF7A 4IMAA 1ZZMA 2CCRA 4C1LA 2F7FA 1NDVA 3QJAA 3SY1A 1V7YA 4XWUA 1JAKA 1ZGDA 5IDIA 3M6DA 4OUIA 4P8VA 4PB4A 4NJGA 3UXLA 3H23A 1KM3A 4H7VA 5I23A 1XJBA 4R3UA 4AB4A 1PPIA 3DKLA 3G1XA 2V5LA 5KZEA 4HJFA 1Q5MA 2UY2A 4I9AA 2PDFA 2I56A 2VGIA 1ICQA 2VGBA 2F84A 4KFNA 4QS6A 1B1YA 3UZZA 4HPJA 1LL7A 3VYLA 3NYZA 4NIRA 1OCJA 1W3LA 3MC5A 5HMEA 2Y2WA 1QFEA 2WJFA 1KM1A 3UJSA 3QLDA 4DN1A 1TV7A 3P5YA 4YTTA 3B03A 1BRLB 1X1OA 1XICA 1GT8A 1SQ7A 2V81A 1S2TA 3M0JA 1Q6QA 4MADA 2YLLA 2DSWA 1EJUC 3JVAA 2J27A 3WENA 2G4FA 2NSXA 4AW7A 1EX1A 4B3ZA 5BOFA 3QMSA 2PP0A 4XG1A 3CAKA 4KQNA 1PBGA 2E9MA 2DPEA 2QEZA 4B5XA 3E9AA 2VEKA 4JKMA 4S3BA 3KDNA 4QTGA 3HU7A 1G5AA 3W1XA 4KRTA 2PRLA 1LWJA 5KZ6A 1UASA 3NO3A 1POJA 4O1DA 4IUOA 4GH3A 1BGAA 4K6AA 1VLWA 2PF8A 1TJ2A 4C6KA 1HIZA 1H5YA 3G3DA 1RZMA 1DWGM 5HUPA 1ZNNA 2OT0A 1E56A 1NAL1 3IJ9A 2XZ7A 3SUSA 2E1WA 4IIHA 3S6TA 1WDRA 2ZADA 4UQCA 1V6VA 1EA0A 5HNNA 5A6TC 3VVGA 1PTDA 3TN6A 4F2TA 3GNOA 3U2ZA 2WCSA 3QGVA 3KOZA 1JPDX 2VC5A 2WSRA 3UR8A 3KBWA 4KBXA 3NZ1A 4D6IA 2FMNA 3TYCA 3TTSA 1IIGA 4JIPA 4IQLA 1Q2RA 2YJQA 2Y8UA 3B9NA 4O14A 3RJYA 2G3JA 5EA9A 1XWYA 5AVNA 2IXUA 1V3MA 1P6WA 2UWFA 4RDWA 2WPBA 4FOJA 4H00A 4PMRA 4HB7A 3QY8A 4S2CA 2WJZA 3KZPA 4AZIA 2B7QA 1YLVA 4PB5A 3MI3A 3N4AA 4J28A 2RDXA 4BEUA 1V3IA 3QXBA 1ZU8A 4DAIA 1UKOA 2BNJA 4J3ZA 1J6OA 3PBUA 1VPYA 5K9DA 4GA8A 4C6IA