1UYQA

Mutated b-glucosidase a from paenibacillus polymyxa showing increased stability
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
447
structure length
447
Chain Sequence
TIFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTPGKVFNGDNGNVACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQEGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQDAGGWGNRRTIQAFVQFAETMFREFHGKIQHWLTFNEPWCIAFLSNMLGVHAPGLTNLQTAIDVGHHLLVAHGLSVRRFRELGTSGQIGIAPNVSWAVPYSTSEEDKAACARTISLHSDWFLQPIYQGSYPQFLVDWFAEQGATVPIQDGDMDIIGEPIDMIGINYYSMSVNRFNPEAGFLQSEEINMGLPVTDIGWPVESRGLYEVLHYLQKYGNIDIYITENGACINDEVVNGKVQDDRRISYMQQHLVQVHRAIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHVDFRTQVRTPKQSYYWYRNVVGNNWLETRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutated B-Glucosidase a from Paenibacillus Polymyxa Showing Increased Stability
rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords BETA-GLUCOSIDASE A
total genus 175
structure length 447
sequence length 447
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1uyqA00
3SURA 1V6VA 1J18A 1BGGA 1PIGA 1MVYA 3LMYA 1OGGA 3KZSA 4F9DA 4PMYA 2CITA 2OWWA 2WVVA 2QPUA 3TTQA 3I3BA 3WF2A 2DSUA 2WK2A 2O9TA 5GPRA 2OLHA 1UQZA 2W5FA 1E6PA 3WDPP 3W82A 3ZIZA 1QHPA 1QPKA 1UYQA 4PSPA 1XYZA 3W24A 1CGYA 3BAKA 1V6WA 3AROA 1HJUA 3D5HA 1EGZA 4RL3A 4TVUA 3QHMA 1VEPA 1KBKA 4J3VA 4CCEA 1DTUA 4W88A 1Q6FA 1Q4NX 1VBRA 1YHTA 3HMCA 1M7XA 2WBKA 3VTRA 1H4PA 3WMBA 4HPGA 1EDQA 1VRXA 3RM9A 3VGEA 1E0WA 2J7CA 1TZ7A 4WF7A 1J0JA 3BXWA 1UWIA 1BTCA 3IANA 1PIFA 1JL8A 1PEZA 4WK9A 3QR3A 2JF6A 1WZMA 3A4XA 4TX6A 4DWSC 4PMDA 2WMHA 3WEMA 1GQIA 1UD3A 4JIEA 4C7DA 4M80A 5JBDA 4B9YA 1WDQA 2O9PA 4WKAA 2ZUMA 4AZHA 1US3A 3RCNA 2J7HA 2PB1A 1J0YA 3VKKA 2WWDA 3BSHA 1ZS2A 3ZJ8A 5AYBA 4Y7EA 2WWCA 1FOBA 5EFFA 3QHNA 5FIPA 5KEZA 1V03A 1E5JA 2CKRA 2VC9A 1B31A 5ABFB 4NRRA 3WQVA 3VDBA 2WB5A 2DH2A 1VFMA 3F5JA 2VRJA 1D2KA 2YA1A 4NZCA 4J3SA 4B16A 1W9DM 1HKIA 2XVLA 1C8YA 1UR1A 4MNMA 4S3KA 2ZX7A 4U2YA 3VIGA 1IZKA 1L8NA 3PBGA 3PTKA 4DUVA 1W3HA 3AYRA 4QCFA 2XFFA 4CCDA 3ZJ7A 7A3HA 2FGZA 3CUGA 1JZ3A 2ZE0A 2GDUA 2J8FA 3BC9A 3ZT6A 3RILA 4W93A 2EQDA 5BYWA 4YHGA 2AOSA 2EPNA 4E2OA 2WSKA 4URIA 3BH4A 2VZVA 2IXVA 3GXDA 1X1NA 1KB3A 2YL9A 1W3JA 1LG1A 1E56A 2XVKA 4QLLA 2X0HA 4GI9A 3KEHA 1QNQA 1I1XA 3AISA 1AQ0A 2JALA 1SMDA 4H7VA 5E0FA 3THDA 4AISA 4RE2A 1NOWA 1KGUA 3QGVA 1B3YA 4PBGA 1V6UA 2BNJA 1CXHA 2EPLX 4MAZA 1US2A 1UR8A 1UKTA 1AVAA 4HA4A 3WDJA 3AMCA 1H1NA 3FY1A 3ARUA 3AIVA 3OLIA 3GNOA 3AHZA 2GSJA 4PMUA 1JD7A 1BVZA 4FMVA 3MUAA 3AIUA 5E09A 1GONA 2JEQA 1LQ0A 3AS1A 5GNYA 4ZENA 1F4AA 3I3EA 1TFVA 3AICA 3NUKA 3ECQA 3GZAA 3AZSA 3AMKA 4BS0A 2Y8KA 4MTVA 3TTOA 2BVTA 1PX4A 1DWFM 2W62A 2O92A 2V3GA 1QW8A 2UWFA 4EE9A 2E8ZA 2VZSA 2F2HA 1JNEA 2PF0A 5JIPA 1JZ8A 3LPOA 1MW1A 3W27A 2QMKA 2CKSA 2Y4SA 5D4YA 1GZJA 4JHZA 3QOKA 1OD8A 3WL0A 2EXOA 3VO0A 4AEEA 5ABEA 3HU7A 4D6FA 3SCRA 2WCGA 3NIYA 3VIIA 5A8NA 4J3WA 1CTNA 4FLRA 2IUZA 4J28A 4DWSD 3MSGA 3GBEA 1CGXA 3AZRA 4EAMA 3U5YA 1JIBA 2V3DA 1JZ7A 4PN2A 4UOQA 1R86A 3O9NA 3WD1A 3CPUA 2BVYA 1K9FA 3CZJA 3B8SA 3VU2A 4Z2LA 1H11A 2UY2A 3FN9A 2NSXA 1WPCA 4CD5A 3BCDA 2WPGA 1JDCA 3WDIA 3CO4A 2BHUA 2ZXBA 2CHOA 2QV4A 2WKGA 3U5UA 1F4HA 3AXXA 5C71A 5BROA 1EHNA 1XV8A 2CBUA 1UR9A 3N12A 3GH5A 3EDJA 1N82A 1CXKA 2PWHA 5IXEA 2XJ7A 3AZTA 1HJVA 5D9MA 1E0XA 3K46A 4N42A 2FHFA 2BY2A 2J8GA 3ARVA 3ZO9A 2V3FA 2X2YA 1V3HA 1UWSA 1FH8A 1BAGA 4AZCB 2XVNA 3VMPA 5JIWA 1W9XA 1VFFA 3UG4A 3VIOA 1W9VA 1TG7A 4M81A 4ZEPA 1BLIA 2WC4A 1LL6A 4JKMA 2G4FA 1UWRA 4QFUA 2W67A 2VZUA 1J12A 3PZ9A 5I5RA 1KWKA 3AIRA 4AD2A 4XX6A 3WKZA 5FCZA 2QF8A 3CUJA 2XHYA 3PZQA 5A2AA 4JL2A 1VEMA 4HOWA 5ABHA 4GKLA 3WNKA 3WD4A 3BAWA 1NH6A 5LA0A 1GOMA 3K8MA 2XVPA 4FLSA 5HXMA 4ZXOA 4TTGA 4UQBA 4PCSA 1DHKA 2DEPA 3A47A 1LG2A 2Z1SA 3W0KA 3M07A 3MS8A 1TA3B 1EOMA 7CGTA 2WXDM 1GCYA 3N17A 2A3BA 1CIUA 1MXGA 3IK2A 1BFNA 1E15A 1XHGA 5M5DA 1JXKA 3W81A 2X0YA 1XH1A 4HU8A 2FHBA 4DM1A 1E6QM 1ZBVA 4P7LA 3UEQA 3SUVA 1G9HA 5C70A 2B31A 2WANA 3U7BA 3CUHA 4M56A 3TA9A 2XSBA 1KR1A 3BLPX 1ODUA 5A8MA 2E8YA 3AI0A 1V0LA 2YA0A 4HMDA 1B30A 1GHRA 2VZOA 4Q22A 3BSGA 4MB1A 1HNYA 2ZWYA 5D9OA 2CNCA 5EMYA 3RM4A 2BHZA 1KGXA 1H0IA 3AFBA 4PUEA 3VOCA 3ARQA 1G94A 3DC0A 2HISA 4D72A 1ZBCA 3L4YA 4XZWA 1TR1A 3FHAA 1HJWA 2CYGA 2VUYA 4W86A 5I6SA 1FP8A 2G41A 4WJXA 1H49A 3ARSA 5A69A 4D6GA 3WNNA 3CZGA 2FGLA 1CEOA 5M17A 4HA3A 1QI5A 4HPHA 5GNXA 1OBAA 1SR0A 2J4GA 4J27A 2NW0A 1UWUA 1JDAA 3TP4A 4P8UA 4KH2A 3WH6A 3WF1A 2J79A 1CENA 2CERA 2WLYA 1V02A 3T2PA 2X05A 4UFHA 1E3XA 1J10A 1VENA 4F79A 2OYKA 3WQ5A 1Z32X 3MANA 4WLCA 5CXPA 3SCWA 2CETA 4B9ZA 3UETA 5CLWA 1TMQA 2WYSA 1Q6CA 1WNOA 3SCOA 1KQZA 1GNXA 1GUVA 3W28A 3WQ6A 1UD5A 4FLOA 2WLZA 3BMWA 3APGA 4LQ1A 3WUGA 4GPNA 4UR9A 3OIHA 1M04A 4M1RA 1WE5A 2XTKA 3ARTA 5ABFA 3SUWA 2V5CA 4AZ6A 2O9OA 2XG9A 2CIPA 1B9ZA 3M7SA 4UZUA 1QVBA 1UR4A 1TA3A 1UHVA 3WQ4A 1ISWA 3VILA 1WDRA 3HJEA 1EOKA 1W1VA 3F5LA 4J3UA 1BVNP 1BYDA 4WKHA 3NDYA 1EXPA 2D23A 1E4NA 1KQYA 4UFLA 4LX4A 1OINA 3S6TA 1LJYA 4RE4A 4AZBA 3KL3A 3AMDA 4GO8A 1CXFA 4CU6A 3ZSSA 2RGLA 1NOUA 3FHQA 4F66A 3N15A 4MNJA 3VPLA 1JF6A 1OGSA 5I3DA 1CWYA 3CHCA 4GQRA 2D0HA 4MADA 4W87A 3PZNA 1UKPA 2VRKA 4ATDA 2G3IA 3O6AA 3WH5A 3DHPA 3UCQA 3FNDA 1H41A 3GM8A 3SIMA 3GXFA 3W37A 5CLTA 2EPOA 3RIKA 2DT1A 2TAAA 1ZJAA 4A3YA 2WZEA 3ZJ6A 3EDEA 3CBWA 1KWGA 4BA0A 3VIKA 4P7NA 5C8BB 5A2BA 3VGGA 2XIBA 3TTYA 1OIFA 5A8OA 4MB3A 2G3MA 1K6AA 2WNWA 3AHYA 4X9YA 3L2MA 3VMNA 3K8KA 2WHJA 2ZOXA 2ZUUA 5JUVA 4JKKA 4PRWA 3NSMA 1D7FA 2PWEA 2WC3A 5IHRA 4MPKA 1AMYA 4HMCA 1UWTA 3I3DA 1R87A 1KXTA 4W84A 5HDRA 3SEPA 4AD4A 1JZ5A 2ZUNA 1V3MA 4Z2KA 2BFGA 4MDOA 2DGAA 2DIJA 3E1F1 1WZKA 3WNPA 4ACZA 3BGAA 4PTVA 2OSXA 1HVXA 4CGTA 1OWQA 2RGMA 5M03A 2YLLA 1J0IA 3ARRA 4JFWA 3WIJA 1QBAA 4CN1A 1DP0A 2ZUTA 2WC7A 1CYGA 1HP5A 3AHTA 4TUFA 1G1YA 2VCAA 3FAXA 2EJ1A 3OLGA 2J7DA 1JD9A 5EB8A 1OD0A 2VR5A 5I77A 2BXZA 4P7QA 5FD0A 4EANA 4QDMA 5E6YA 4CD6A 1DWGM 2VX7A 3OZOA 2DT2A 3RMEA 1KR0A 2ZIDA 1JXJA 1DWJM 1FP9A 4Z2IA 3SCNA 2FH6A 2VL4A 1ZL1A 4Q7NA 3VNYA 1GPFA 1RPKA 1VFOA 3CGTA 3TTSA 2XM1A 3EBVA 4JKLA 3K4AA 2OYLA 3GTNA 5E9AA 3FAWA 3OBAA 1W9BM 1QOXA 2PWFA 1TVPA 3OGRA 4GZJA 4NF7A 4U33A 5DMYA 5FKYA 5I79A 3SCUA 4NRSA 2MANA 3A4AA 2DSZA 3G6MA 2X1IA 3BAXA 3RO8A 3WD0A 1CECA 2O9RA 4A3HA 3WD3A 1ITCA 1G01A 1G0CA 1KCLA 1MQRA 1E43A 4H8HA 3WL1A 1LLOA 3VDHA 3VUPA 5CJ5A 5DT5A 2YBTA 2WW5A 2EO7A 1I1WA 1XYFA 2A3AA 4AD0A 3VNZA 5FOOA 1B3VA 4W89A 1JDDA 4W5ZA 3WSUA 3VIJA 3BMVA 4JFSA 4V2XA 1EQPA 3VD5A 4KMQA 5E6ZA 4PYSA 4ZXLA 3T2QA 3WEZA 1E70M 1NWTA 4UNIA 5GNZA 4RE3A 1XH2A 2A3CA 1E6RA 4JFTA 1UR0A 4UCFA 4ATLA 1CGVA 4BZYA 4H04A 2OSYA 4J7RA 4UQEA 1SMAA 3WELA 2W63A 4WIWA 2ZICA 1FHLA 1UD2A 1V3KA 1FHDA 2VMFA 2GFTA 1GORA 1ECEA 1QHZA 2VI0A 5CPTA 4D6DA 4GIAA 1LF1A 1QI4A 1E1EA 1XSIA 2YDQA 1H3GA 1UD8A 4X0VA 1GW1A 1GOOA 3WH8A 1EH9A 3ZT7A 3N13A 1EIBA 1BYBA 2E40A 1IT0A 2E0PA 2YBUA 3D3AA 5M3WA 4CKQA 3L4VA 4YN5A 4CU8A 1GVIA 4Z2HA 1ZU8A 1E6XM 2OYMA 2YKKA 1C8QA 4AEFA 1AQMA 4F9JA 5A6SA 4R27A 3NDZA 1C7TA 3GYCA 4HZ7A 1TVNA 1K9EA 3WF4A 4D6JA 1E0VA 3WUFA 4C7FA 4JAWA 2C7FA 2BXYA 4C7GA 1CDGA 3WUBA 2WCSA 1MQPA 2WKLA 2A3HA 5A6KA 4CVWA 5A6LA 4QCEA 2CBIA 5BXSA 2VCCA 1UZ1A 1I75A 1QW9A 1WKYA 3MUZ1 1A47A 2VRQA 2G3NA 5IFPA 5LYRA 2ZX9A 1QI2A 4CD7A 1L0PA 3MSDA 4QLJA 1E6NA 3G6LA 4BF7A 2CEQA 2CCRA 1CXLA 3N18A 1UQYA 5HPCA 2XWEA 2ZUWA 5CPSA 3WQ8A 1MQQA 4KRTA 4QLKA 3CUFA 1PBGA 3GXMA 4E4PA 1XD1A 3NSNA 3PTQA 4D6EA 4GZIA 1X6LA 3BAJA 1UUQA 3AYSA 3AOFA 1ZB5A 3T0DA 1E73M 4H2CA 4TOQA 3CHDA 1EQCA 2BY1A 1B3ZA 4H8UA 2VT0A 3SCTA 1R85A 3VM7A 3WENA 4U5IA 2Y8VA 1C3FA 3WF3A 2D24A 4AW7A 1UKOA 3OZPA 2ZXQA 1QNOA 3ARYA 2ZWZA 4BQ4A 4LXFA 3AXHA 4IM4A 1ISZA 1UA3A 4ACZB 4JHOA 1DEDA 2D3NA 4YHEA 2IXUA 2PWGA 4W85A 1V08A 3B9AA 4M29A 2CXGA 2YDSA 4HP5A 2JIWA 2GJRA 1CLXA 2JE8A 3B9DA 4ZFMA 1JAEA 2ZXDA 3POHA 4E8CA 3L4XA 3AXIA 5A95A 3GH4A 1H09A 2VZTA 1OIMA 2XFYA 2VVSA 4EKJA 2ZUVA 1LWJA 1P6WA 1E9LA 4U3CA 3PN8A 4HU0A 1WB0A 2X8RA 4LYRA 3AIQA 2XFRA 3L4UA 2CHNA 3OLDA 5AC5A 3ALFA 4MDPA 1RP9A 3RPMA 3PZMA 4GXPA 3WNMA 1W91A 1CGUA 4L4PA 2J77A 4AIEA 3VX1A 2VJXA 1MW3A 1OCQA 2WZIA 2W92A 5ECUA 4YPJA 4UFIA 3T0AA 5IHSA 1QHOA 3VD7A 4ZE4A 1C91A 4W8AA 2QMJA 2OSWA 1NQ6A 1QI3A 1J11A 1WZAA 2G8ZA 4AZGA 2J78A 3GNRA 4MJ2A 5DF0A 1BPLB 3THCA 3KWXA 1U30A 3ZT5A 1HJQA 2J7FA 1OM0A 1WO2A 5A3HA 5DEZA 1C93A 2UY4A 4UQDA 3WBAA 5D9PA 1Y7VA 2YIHA 3M6DA 1E1FA 4P8WA 3PTMA 2XIIA 1C90A 2V38A 3EDDA 4QAWA 1V3LA 1J01A 3ZR6A 2D22A 2DQXA 3BCFA 1V0KA 4DM2A 4P8XA 2CBJA 3MU7A 1W2VA 1QBBA 1MYRA 1JI1A 2HVMA 4PUDA 1V3JA 1WDPA 4XB3A 4ATWA 2BV9A 3F5KA 4W5UA 5IFTA 2D20A 1HL8A 2D0FA 4GI6A 1J0KA 4UQAA 1MW0A 1SYTA 2DSKA 4B3LA 3ZOAA 4CCCA 1NWSA 4PMRA 4R5EA 3F4VA 1D3CA 4AZIA 1MXDA 4MJ4A 1E4IA 1OB0A 3NSXA 3MMWA 1B3WA 1HKKA 1JFXA 1M53A 3ZSTA 3L4WA 3S2CA 4GO9A 3AIWA 5A6AA 2GUYA 2XSAA 3CIVA 1K9DA 2D2OA 3CZ8A 2DT3A 1EO7A 3GH7A 1QNSA 5HOSA 2DDXA 2EEXA 3W25A 3EYPA 3PZOA 4PTMA 2XGBA 2ZX6A 4IUGA 1MWOA 3GNPA 2BHYA 3OG2A 4AXNA 5BXPA 3A4WA 2XYLA 3W6LA 5E0CA 4BQ3A 3VGDA 4EK7A 2C8NA 1B0IA 2GK1B 2VX6A 2ZXAA 3FW6A 1CGWA 2BS9A 3K4DA 1E71M 1W32A 5D8ZA 4TXEA 2E4TA 2BY3A 3CLWA 3SUTA 2GVYA 2Z1KA 5CPQA 4CU7A 2BY0A 2WMFA 4GQQA 1HX0A 1H5VA 4PSRA 5EFDA 3MMDA 3AJ7A 1CXEA 1KCKA 1HN1A 3LPFA 1UKQA 2ZX8A 1PPIA 1UWQA 4TVCA 2AMGA 1E4LA 2YL5A 3CTTA 3IJ8A 5BRQA 2QHAA 3VIHA 1W1PA 3ZQ9A 2A3EA 5JBFA 1V0NA 5HBFA 4MAVA 3OB8A 2VX4A 4D6HA 3AHVA 1O6IA 3ARZA 1SFSA 2D3LA 4HZ6A 2EBNA 2JFEX 1B90A 2XPKA 5ABGA 1GHSA 4J3TA 4OKDA 1JG9A 4KGJA 2VTFA 2Y2WA 1E3ZA 3QOMA 1FFQA 4GZEA 4W8BA 1PZ2A 1XCXA 4FLQA 1C92A 1E5NA 3MUY1 3AS2A 1FH7A 1EHAA 7TAAA 3II1A 4B3KA 3BLKA 4P7RA 4CVUA 3VD9A 4PEEA 1H0GA 3VVGA 3ZM8A 4D6IA 2Q8XA 1V3IA 1J0ZA 1AQHA 1ODZA 3B9EA 1NP2A 1HT6A 1GOWA 1M03A 8CGTA 1NWRA 4CD4A 3AIEA 4UFKA 3K1DA 3OGVA 1S46A 1W2PA 3L4ZA 1CNVA 2XUCA 1JZ6A 4UQCA 1E72M 1ISYA 3UG5A 2E3ZA 1CZ1A 1BF2A 1DWHM 3WD2A 3NCOA 2J74A 1VFUA 1GJWA 1B3XA 3WEOA 3AS0A 3WDHA 3DYMA 1UH2A 3VD4A 5GQBA 1MFVA 2J7EA 4WSKA 5DT7A 1ZBKA 3VMOA 4M24A 3VGFA 4UFMA 1NOFA 3W26A 3ARXA 4F8XA 4L4OA 3N9KA 4U2ZA 5HNNA 1K9TA 2YA2A 4PMOA 3PZIA 1GQKA 3RJXA 2VX5A 1R8LA 3WFLA 1OT2A 3M46A 4K68A 3J7HA 1ESWA 4W7WA 3UERA 1W3LA 5KZ6A 1HP4A 2WMIA 2VCBA 4AD3A 4AWEA 4CD8A 1BG9A 3BAYA 3VDAA 4H8VA 4CN4A 1M01A 1EDGA 5CZKA 5D8WA 2CBVA 2W66A 2XM2A 4N0RA 3WMCA 2PWDA 4AD1A 3RM8A 2FDMA 2Y5EA 5FL0A 5CQ1A 3MV01 3KL5A 3ZR5A 3W38A 1HIZA 3TONA 4AIUA 3EMZA 3TOPA 3A3HA 4GI8A 3WH7A 3K8LA 1PX3A 3CZLA 2GJPA 1C7SA 3LPPA 3OGSA 3PHAA 4AD5A 4S3JA 4MNLA 3VIFA 1X6NA 1RH9A 6CGTA 2VR4A 2EPKX 2YL6A 2WBGA 1HKJA 1XCWA 5TD4A 3WUEA 5I2UA 3MKKA 1GOKA 1VEOA 1W9PA 2VURA 1Q6EA 3U57A 5AC4A 1U33A 1NP0A 1TUXA 4D1IA 1ZJBA 3CH9A 4FF5A 5A94A 5FL1A 3UESA 1CGTA 3OLEA 1GQJA 3GXIA 4CUCA 4AIOA 2UY5A 1ITXA 5DFAA 3CMJA 4HZ8A 2V3EA 4PMNA 4PMXA 3WN6A 3PZVA 5F7UA 2WAGA 1NARA 2UY3A 3AMGA 4J3XA 4OIFA 1JYNA 4B15A 4OZOA 2VVNA 4QP0A 1GVYA 5CSYA 3WF0A 2CESA 4P8VA 5EBAA 4UZSA 5BXRA 3CHEA 3DYPA 2VQTA 1UZ4A 1XC6A 1WDSA 4E8DA 3VDCA 4OBRA 5A1AA 4AZ7A 4AY1A 5A6BA 1JZ2A 1PJ9A 3EMQA 3AS3A 1JZ4A 1KXHA 5HPOA 4UOZA 4MB5A 1J0HA 4WSJA 2AAAA 5BXTA 2DSWA 2WMKA 5LA2A 4DUXA 3IAQA 2J62A 2D0GA 3AIBA 4ACYA 9CGTA 1VJSA 5IDIA 4JCLA 3N1AA 4U5KA 1E6ZA 1UR2A 2VOTA 4UTFA 2YDRA 1QNRA 4M8UA 1KXQA 1IV8A 1GQLA 2C0HA 5A8PA 3WQWA 1V02E 1V6YA 2YL8A 3EDKA 4UQ9A 2X09A 4AYSA 1R7AA 3JUGA 1CBGA 3SCPA 4DWSB 1UOKA 1KFWA 3U7VA 1BHGA 8A3HA 1UH3A 1VB9A 5A6JA 1HXJA 5A2CA 4XV0A 4BQ2A 4U3AA 1FA2A 2YOCA 1BYAA 1B2YA 5AYIA 2QPSA 3ZMRA 4HOZA 1OSEA 3CMGA 1W3KA 4LGXA 1LL7A 1WAWA 5I0DA 5E70A 3MUIA 4DUWA 5D9NA 1VAHA 3SCQA 3T0BA 5BCAA 4KGLA 2DSVA 4ML4A 1Q6DA 3QHOA 4JL1A 2ZX5A 4XUYA 4UFJA 1LWHA 3ARWA 2J25A 3POCA 4KRUA 1YQ2A 2WZHA 3NYDA 1OT1A 1EO5A 2GJXA 3UR8A 4BCEA 1J9YA 1JI2A 3WDRA 1JF5A 2PC8A 4MNKA 1HVQA 3W29A 3W4RA 1DWIM 2WMGA 3ARPA 3IAPA 2W4XA 2WM0A 1VJZA 3W6MA 1QNPA 1W1YA 4PMZA 1KXVA 2PI6A 1XRVA 2WSPA 2J7BA 1VF8A 2WHKA 4IISA 1VIWA 1MFUA 2FHCA 4ZE5A 1R7OA 2PBOA 1FH9A 1HF6A 2WMIB 3VIPA 3T2OA 3WMSA 1W9UA 2FH8A 1XD0A 3A6OA 4PCTA 1JAKA 5I24A 5CGTA 1RD6A 1RP8A 2VQUA 3DECA 3PZUA 3UG3A 3WFZA 4LYQA 3AHXA 1XSJA 1EA9C 4M82A 4IPLA 3VX0A 2J75A 4Z2GA 1E40A 4LPCA 3WDQA 1Q6GA 2JF7A 3IJ9A 2YLAA 1E55A 2E9MA 4OOUA 3VD3A 5LA1A 1NWUA 3NJ3A 3RJYA 1LL4A 1G5AA 4W7UA 2W91A 3MV11 2WHLA 3OA5A 4TX8A 4NSBA 3SCSA 2WMJA 4PMQA 3WNLA 5JBEA 1UD4A 3BAIA 3FXYA 4A4AA 4JZ5A 5A8QA 4MB4A 1QI0A 4HTYA 1GOIA 2XGIA 3MMUA 3CHFA 3KL0A 4V27A 3SUSA 3WY1A 2XWDA 5CSUA 4W7VA 1NM9A 4D71A 4UOJA 4Z2JA 1V6XA 2GJXB 1JFHA 2WHMA 3AQUA 1HKMA 3HN3A 3O2LA 5AY7A 2WCAA 2JEPA 3LPGA 1C8XA 1GOQA 4PMVA 4CN6A 1V0MA 3WBEA 4IPNB 3CZKA 3N11A 4KWUA 4WKFA 4OBSA 3RDKA 2OWCA 4GINA 3SUUA 2VO5A 2E9BA 4DWSA 4LYPA 2OWXA 3ZJKA 1HL9A 4TVDA 2NT0A 4D6CA 3VM5A 2YJQA 5I23A 2WVUA 5DO8A 3AMLA 1JYVA 1W1TA 1CXIA 4OUEA 4NI3A 3MO4A 1ISXA 3EMCA 4HA1A 6TAAA 2VNCA 1WCGA 4FK9A 3WNOA 4AMCA 3KE0A 4AC1X 1BG4A 4BQ5A 1UA7A 5BRPA 5CGMA 4JFUA 1UD6A 3VGBA 4H41A 1ZBWA 1VBUA 6A3HA 2E9LA 1KGWA 1EDTA 1JNDA 2NT1A 2PBGA 5A6MA 3PZTA 2GK1A 1PZ3A 4JFVA 3VINA 1BYCA 1CLVA 4OOZA 1U2YA 1CPUA 3VGHA 1E6SM 1O7AA 4AZCA 2F8QA 3SCVA 4D1JA 2G3JA 1BQCA 2DT0A 5CG0A 4PTXA 5A6BD 4PTWA 1WP6A 3UR7A 5BWFA 3T09A 2J7GA 1BSIA 1XGZA 3PZGA 3VIMA 5I78A 3CUIA 2WVSA 1WZLA 2EPMX 3EDFA 1DWAM 2DPEA 3DYOA 3CZEA 1A3HA 3T08A 2GDVA 1JYWA 2QLYA 1GJUA 2Y24A 1H2JA 2DH3A 4P7OA 1JYXA 4JCMA 2DIEA 1UKSA 2J47A 4W8LA 1XSKA 2JIEA 1B1YA 1BGAA 4AZ5A 2CPUA 3L2LA 2ZUSA 1UH4A 3DHUA 4XZBA 4X0NA 1TCMA 1UG6A 1HJXA 4V28A 2ESCA 2F61A 2WVVB 3ALGA 4HMEA 3W53A 1XH0A 3N04A 1E4MM 3WH9A 1OGBA 1ISVA 1PX8A 4HOXA 1IZJA 1FFRA 1KBBA 4TTUA 3IJ7A 1PAMA 2D1ZA 2WVTA 2BVDA 4U31A 2W61A 1TE1A 1JGIA 3L4TA 3GDBA 3GBDA 1HJSA 1MW2A 2XVGA 2V5DA 4OJYA
chains in the Genus database with same CATH superfamily
4IGSA 1ICPA 1BGGA 4BJHA 2I9UA 1OGGA 4ZFCA 1P0NA 3RLUA 1OEPA 4QSFA 3QEZA 1Q7MA 4GIRA 1PHWA 3WF2A 1W37A 3H2FA 3PUEA 3GW0A 2FZDA 1EPVA 2QVHA 1HO1A 3DFSA 1E6PA 3WDPP 1N8IA 3ZIZA 1QPKA 4J4KA 1XYZA 4QNWA 1CCWB 1Z89A 1V6WA 3VKJA 4WEVX 3K5XA 1QMLA 3CIWA 1KBKA 2WBKA 1QT1A 1BXNA 3ANYA 1DIKA 1H4PA 3WMBA 1EDQA 4LU0A 3R0UA 3ITOA 1E0WA 3WJSA 4L6HA 3UJSA 3DOPA 2GGGA 3TN4A 4JYEA 4H2HA 1BWKA 4DWSC 3CYJA 1UD3A 4C7DA 4M80A 4HHLA 4FI4A 1WDQA 1VFTA 3TWAA 2J7HA 3I7SA 2PB1A 4DWDA 1XBYA 2WWDA 3LCWA 1MDRA 1ZS2A 4YCOA 5G4HC 1Q4WA 1EZ2A 4LVAA 5KEZA 1V03A 1E5JA 1Z8AA 2CKRA 2YW3A 1X38A 2Z1XA 3NPXA 3WLRA 3RLGA 2DH2A 2YA1A 3CAVA 2GJLA 4ZOAA 1M7PA 1W9DM 1HKIA 1P1XA 1KV8A 3PBGA 3ZVHB 1JRCA 4DUVA 4UUIA 3AYRA 3W7DA 2FVMA 2J9ZA 2QDHA 2PTZA 1Q13A 2FGZA 3ZT6A 3EPNA 2R24A 4OGZA 5G2WA 4W93A 4Q4OA 1AD1A 1QK0A 2AOSA 4JX4A 2WNQA 1EF2A 4L4LA 3UJRA 3I6RA 3TJIA 5ECVA 2Y62A 2NQ9A 4E2OA 1ADSA 4URIA 3H55A 3GG8A 3QQ1A 1VZWA 3BICA 2YCIX 2FMOA 1KB3A 4AHQA 3IIPA 5H2ZA 2XVKA 4AWSA 4F0RA 1I1XA 2G0WA 6ENLA 1NFGA 1XLBA 3AISA 3S2LA 4CNTA 5H91A 3VOIA 3HOJA 1KW1A 4EWJA 4RE2A 2DZXA 1S2WA 1E9ZB 2DJLA 1US2A 4HA4A 1R9ZA 3RG6A 2PDHA 4NJIA 3ELFA 3NNTA 1LLWA 4PMUA 1UCWA 4UTMA 1BVZA 3AIUA 1GONA 3M5VA 1M41A 4PCPA 2AAMA 5JH1A 1U5JA 4L1GA 1TFVA 1S2UA 1F73A 7TIMA 2VYOA 4AVFA 4N9EA 4L4MA 1ZJHA 4QITA 1UJQA 1ZGDA 4XSLA 7XIMA 3CASA 5HQMA 1PX4A 4H4IA 2O92A 3LHTA 2V3GA 3MI3A 1VQTA 4I90A 3E38A 1TCDA 2A6NA 2VZSA 3E0FA 3LPOA 4XTIA 4EAYA 2QPXA 3QOKA 4RDVA 5LIXX 1H7PA 4AEEA 2WCGA 1SO4A 3TMLA 4J3WA 3MA8A 1PHQA 4HNOA 4IX0A 3EB3A 3IV3A 3AZRA 1EYEA 4JGDA 1W5QA 2WJZA 4U10A 2YW4A 4HPJA 1JZ7A 2V2DA 4NZ3A 4UOQA 4PUKA 3NURA 3LA4A 2DU2A 3KHJA 4OE7A 3WD1A 2BGQA 1J4EA 3VU2A 1H11A 4PBEA 3DFNA 2ZRXA 3XISA 4IHCA 4O50A 4CD5A 3T05A 5AVHA 1JDCA 2CHOA 3MP5A 2Z7GA 4RKAA 4AHPA 5XIMA 1XV8A 2CBUA 4Y2WA 2QV5A 3RITA 3N12A 1I2PA 1TQJA 3E0WA 4ILSA 3DG6A 3Q94A 4GUFA 1KBIA 2J8GA 3ZO9A 2X2YA 1V8EA 4HCLA 3UQNA 4Q33A 1JCLA 2E77A 5C55A 3TE9A 1VFFA 2XH0A 3SRFA 2IPJA 3N34A 4J1OA 3U3HA 2FZ9A 4M81A 5M2FX 3UXLA 5JU6A 2WC4A 4JKMA 2C14A 1EPXA 4GMEA 1J12A 3PZ9A 3B0VC 5I3FA 3AIRA 4XX6A 3ZVHA 3E0LA 4GC3A 3M0MA 3CUJA 3PZQA 1LQ2A 4UTJA 4HOWA 4GKLA 3H21A 2YCJA 3BLDA 2GVGA 1NH6A 4DO6A 5LA0A 3VA8A 3VKBA 4TTGA 4UQBA 1DHKA 3LYEA 3TFCA 3D47A 3SDOA 4N6FA 1NSJA 4WY0A 3W0KA 2L5HA 3WK1A 1EOMA 2XDFA 1GCYA 2A3BA 1CIUA 1MXGA 2OXNA 4QSHA 1XHGA 5M5DA 1GG0A 4MFDA 3R8RA 4HU8A 1IEWA 5EL1A 4P7LA 1X96A 2AKZA 2B81A 3FA4A 1G9HA 1WKDA 2J8TA 2BOEX 3CB3A 3CUHA 2EG6A 4M56A 4UTIA 1AW1A 1QCWA 3KP0A 4AF0A 3QN3A 3KAOA 4HMDA 2VZOA 4GFSA 4Q22A 3HPXA 3T07A 4C6IA 2SFPA 2YCEA 2CNCA 1KGXA 1JPKA 1FWIC 1GZ1A 3LLFA 5I3GA 2JQXA 4KCVA 2A21A 4HJFA 2FMNA 2RAGA 1C8VA 3H6OA 1TR1A 1JQVA 3P60A 1PCKA 4BFAA 1XDJA 2G41A 3GO2A 1LOQA 2QKFA 3BLFA 3LXBA 3WNNA 2Z28A 1W54A 4HA3A 2E67A 3I6EA 2J4GA 1PKYA 1GQNA 1U83A 1JDAA 1TV4A 3WK2A 4CQDA 3WQOA 2BX7A 2O4QA 1CENA 4IH3A 2OT0A 4IP5A 2ZA2A 3W6YA 4UWMA 1VENA 3E2SA 2JK2A 4LF1A 1GZGA 3BLEA 1TPEA 1L9WA 4MYXA 1H61A 3KCLA 4RNHA 1FWDC 2FZ8A 2WYSA 4RDYA 3GU9A 3N3TA 4ADTA 3M0JA 4R9OA 1OC5A 1UD5A 3CMFA 4TV5A 3BMWA 3FA3A 3WUGA 5HQEA 3DDMA 3DFYA 4GPNA 2E6YA 5F2GA 4Q8NA 3H26A 4XBSA 5CJMA 1OFRA 3UVAA 3OIXA 2QJIA 2B7QA 3W7NA 1F7BA 3L0GA 1ISWA 4CEUC 3HJEA 2H3BA 1CX9A 3GDKA 4J3UA 1BVNP 3HTWA 3M0VA 3NDYA 5C0QA 2YB4A 1EXPA 4B5UA 4UTWA 3W72A 4LX4A 1OINA 2VEPA 2Y1HA 3TQPA 1A53A 2ZQ0A 1RBOB 1CXFA 4MY1A 3T40A 1NOUA 3PWGA 4MNJA 1M3UA 5HAOA 3KVKA 1PYMA 1VHNA 1XL9A 5K3VA 1XYCA 1CWYA 3EZ4A 3P84A 1NFBA 2DZBA 1IIHA 4MADA 4NG3A 3O6AA 5LZLA 3UCQA 3N2MA 5E1QA 3GXFA 5LIYX 3TJ4A 2ABBA 5C9RA 2TAAA 1ZJAA 4LUTB 4A3YA 1TRDA 3ZJ6A 3EDEA 4TIMA 4C1NB 4BA0A 3RCMA 3ES8A 3SJ3A 2FKPA 2Y7GA 2XIBA 3PSWA 3C2FA 2HVNA 4MB3A 4IIDA 3R89A 2GWGA 4F48A 1IT7A 2WHJA 3BG3A 4M6UA 4PRWA 2PWEA 3AUJA 4I7VA 2OZ8A 4MPKA 4XAPA 4IL2A 4NXKA 4XVEA 3PFMA 3M6YA 5FSDC 1JZ5A 1QPNA 3A64A 3WNPA 2ZA1A 3NTYA 2C1GA 2FJUB 4EF8A 4DELA 2V5LA 6XIMA 2YLLA 3W2JA 1WQ5A 4DJFA 3EKZA 2NVDA 3WIJA 4CN1A 1TJPA 3HURA 4US5A 1HP5A 4N9DA 3AHTA 2I17A 2EJ1A 2E25A 2J7DA 4FHAA 2DIKA 4O8RA 5I77A 4HSHA 3FKRA 4P7QA 3ATZA 3S1XA 4MWAC 2PWVA 3IIXA 1L2UA 3LI1A 3OZOA 2DT2A 3T55A 2YXXA 1FP9A 4Z2IA 3SCNA 2QEZA 4JN7A 2O55A 4XZMX 2OB3A 2GGEA 3TUUA 2I14A 3PJTA 2FTYA 2OYLA 3GTNA 4S3FA 3KOYA 3A4JA 3RU6A 4CQ8A 4GX8A 4A3UA 2VFIA 3BL3A 4NRSA 1B4KA 3A4AA 4ZSTA 2XGZA 3UT0A 3WD0A 3GZ3A 4A3HA 4GUJA 2O0TA 3WD3A 1ITCA 4MZ8A 2CLMA 3TH6A 1MQRA 3CPGA 3QJAA 1LLOA 1VPQA 4BK9A 1LRNA 2ZVRA 1YXCA 1BSLA 4AD0A 9RUBA 2J88A 1AODA 3LG3A 3AC0A 1KM0A 5CZTA 1B3VA 4W89A 3TKFA 4JQAA 4Q4PA 3FJLA 1N7KA 4JFSA 2IQDA 3NM1A 4UIOA 4O15A 4PYSA 4ZXLA 1E70M 1DJNA 3EEGA 4RE3A 3H12A 4BZYA 1CGVA 1BF6A 2HMCA 3FCPA 4J7RA 2W63A 1VYPX 1FHLA 1V3KA 3QMTA 2VMFA 1GORA 1ECEA 1QHZA 1LF1A 4D8AA 3TA6A 1E1EA 1H3GA 3H2MA 1IYXA 1B54A 1GOOA 5BU9A 3WH8A 3KCJA 3ZT7A 3ZWSA 1TPC1 1SJDA 3VNJA 2E0PA 4Q6XA 3LBCA 4RXGA 4CKQA 3PBYA 3EX4A 1GVIA 3F2BA 1C8QA 1YXDA 4F9JA 4R27A 3NDZA 1MNSA 4YIWA 3GYCA 1TVNA 1K9EA 3LK6A 2INZA 4UNKA 4LB4A 3TR2A 3LM3A 1CDGA 4FXJA 3UCCA 2A3HA 1KRCC 1SJBA 1CLKA 3TFXA 3AWNA 5AZ0A 5JXQA 5BXSA 3NQDA 1WKYA 3L9CA 3KS5A 2Z27A 3SECA 4K6AA 5DRCA 5IFPA 3MSDA 4YYCA 1G4SA 2QYGA 3TOYA 4DPPA 2ZUWA 5CPSA 1VGAA 3G8RA 3CUFA 1PBGA 3DG3A 4QIUA 3WLLA 4D6EA 3BAJA 1UUQA 2BP1A 2ZTJA 3WQDA 3NPUA 4H2CA 1OF6A 1RQHA 3EB4A 3LZ3A 3TYEA 4LVGA 4JIHA 3VM7A 4A8NA 4U5IA 3AYVA 2Y8VA 4NI8A 4AW7A 2PDJA 5F2MA 3PJXA 2PEVA 2ZXQA 1QNOA 4BY3A 3AXHA 2ANUA 4B90A 4R7JA 1SR9A 1ZJIA 2OTDA 4WDUA 3GLCA 2F7FA 2D3NA 2ZRUA 3UJ2A 3N29A 3B9AA 2PUZA 4O11A 2CXGA 3ITXA 4GE8A 2UZ9A 4G8TA 1GVEA 4E8CA 2PFHA 3LDVA 1TWDA 2PP1A 4EACA 1P48A 4MLJA 1XQLA 2O7QA 2VFGA 3DZ1A 4U3CA 4N7QA 3M5YA 4PUWA 4HU0A 5HATA 2X8RA 2ZZ7A 4WY0B 2X7VA 1EJ7L 1PZ1A 2QCDA 3L4UA 2CHNA 5K2ZA 4HVXA 4IP4A 1IEQA 2YR1A 1P0KA 1RP9A 3DFQA 3LZ5A 4C6NA 4C1LA 1XLFA 3IJ6A 2J77A 1MW3A 3MZ2A 1U1HA 2BBFA 4Q4MA 5ECUA 3ENLA 3S5NA 2QR6A 3T0AA 4O1BA 3T4CA 5IHSA 1XIIA 1QHOA 4ZE4A 2YCKX 4W8AA 2PDQA 5G2HA 4HB7A 4PMJA 1M1BA 2X0SA 2TSYA 2J78A 4E2DA 1B3OA 1S5VA 5DF0A 1UPMB 3SRHA 1TQXA 1OM0A 1WO2A 3CM4A 5GJMA 2ACRA 2Z2AA 3EWCA 3CQHA 4UCGA 2RJGA 1WAUA 2QXWA 5F1VA 4CNPA 1Y7VA 2TYSA 2YIHA 2C0AA 5C9UA 4JTRA 4JEJA 1T40A 3UWZA 3REQB 2ADAA 3PY2A 1ALDA 1V0KA 2ZDRA 4R85A 3EKGA 4P8XA 2XIMA 1K7EA 1W2VA 4DXXA 3SW6A 7ENLA 4PFMA 5LIWX 3TW9A 1UIOA 4ZA0A 2R91A 4JIQA 2D0FA 1I0BA 1O4UA 2DSKA 4B3LA 2PDWA 3STCA 3U4FA 1A5NC 3WQPA 4R5EA 2VGIA 3LB0A 3F4VA 3HG4A 3C5QA 1XGEA 2HJPA 5U7SA 1M53A 2WKJA 2GUYA 3EX6A 1BVWA 3L12A 3GH7A 2PRLA 1NDZA 3LSBA 2VFDA 4UTKA 4XZ9A 1FCVA 4IUGA 2IKJA 3B4UA 3OG2A 4AXNA 3NO3A 4KWWA 3W6LA 5H1WA 5E0CA 3OQEA 2DUZA 4GYPA 2C8NA 4X61A 2GK1B 2ZXAA 3FW6A 3QZAA 4UMAA 1O12A 2BS9A 4TXEA 1I6NA 4E38A 2E4TA 4EXQA 3ME3A 1FVPA 2C13A 3IUIA 3JRKA 2FZNA 2Z1KA 2EKGA 2HEJA 5CPQA 1M9HA 2BY0A 4C6CA 4JTFA 1DVJA 3QMRA 1ONEA 3LCHA 4PSRA 2HPMA 1Z6KA 3AJ7A 3HPZA 1EWEA 1D8WA 3M0HA 2OVLA 2W6RA 4J5NA 1ZENA 4RPPA 1SSGA 3IGHX 1W1PA 3S5SA 5JBFA 4AY8A 5HBFA 3MQTA 4MAVA 4QJ5B 1R46A 3AHVA 2CZEA 3OA3A 1W1ZA 3WBXA 4J3TA 3IGUA 1JG9A 1EFZA 2Y7FA 2Y2WA 1E3ZA 3UZYA 4FLQA 4PRRA 1E5NA 3RFAA 3V5OA 5FJRA 1E1CA 1B4EA 1EHAA 2I7GA 3HQPA 4B3KA 1I60A 3TZFA 3VVGA 3ZM8A 1A5AA 3H7VA 1ODZA 3B9EA 5HUOA 1HT6A 3ERPA 5CJNA 2PPGA 5XINA 2YCLA 5CH9A 4R53A 2PZNA 3AIEA 3SZ8A 4HNCA 3K1DA 2E5DA 1ONXA 1S46A 1UB3A 1YDVA 2XUCA 5FAGA 2VXNA 3CT2A 3ES7A 1PTGA 1RHCA 2GUBA 4FOJA 4KFNA 1B3XA 2V63A 3IPWA 3WEOA 4JTEA 3UF9A 3H2CA 4H6EA 3G77A 4RR4A 5GQBA 1FDZA 3DI0A 1MFVA 3C3UA 4K1GA 4O19A 3S2JA 3ARXA 4L4OA 3N9KA 1FTXA 3CV2A 4ZBCA 1XLMA 3M0LA 2VX5A 3WFLA 5AZ1A 4WHBA 4K68A 2GQ8A 3J7HA 3UERA 2CXEA 1W3LA 5KZ6A 1HP4A 4A2RA 1EGVA 4NXSA 2AQWA 4C6FA 4H8VA 4CN4A 1XLDA 1M01A 1FCUA 3E74A 3HF3A 3LCIA 2XM2A 3WMCA 2I56A 3GTHA 4JYDA 4LUYA 5FL0A 4YTUA 3GS6A 3KRUA 4S23A 5KETA 3KL5A 4ERIA 3KBVA 4A3QA 3W38A 1XICA 1XLLA 4GISA 5DANA 3TONA 4EIVA 4AIUA 3ITLA 1A50A 4FNRA 2GJPA 2HNHA 1DL3A 4BI6A 4GYFA 3W07A 3VIFA 1VH7A 2VR4A 3TJLA 5H8PA 2YL6A 2J6VA 1N55A 1F6KA 3TJXA 3RR4A 1Q6EA 4GY7A 1U33A 1NP0A 4GD0A 3CH9A 3NG3A 2Z6IA 4DI8A 1CGTA 3URNA 4QHRA 4AIOA 4O53A 1H7WA 1L6FA 4HZ8A 1QATA 2FGBA 5F7UA 1S5WA 5DY3A 1VP5A 4PH6A 1LBFA 4J3XA 2QIWA 4OZOA 2P50A 4HK7A 1UR3M 3G2GA 3EWZA 4UZSA 5CG7A 1UZ4A 1A49A 4NIRA 4Q4RA 1WDSA 1AFSA 3NM3A 1F07A 2MNRA 3VDCA 1AUSL 3FGCA 1JZ4A 3AS3A 4EPEC 3GSMA 3G1HA 3RGTA 3TNBA 4XQ6A 4GI4A 4TO8A 3RN6A 4MB5A 4WSJA 4DHGA 2GZXA 5BXTA 4QRNA 3HIJA 1N8FA 2RKXA 3LTPA 5KITA 3IAQA 4CNNA 2QUMA 2J62A 3IVSA 1PKNA 2D0GA 4Y9OA 3TAOA 1RAKA 2C71A 3EA2A 1I8JA 4JCLA 1E6ZA 1Q5MA 1UR2A 2VOTA 3Q58A 5HANA 4KW2A 5EMLA 4JQ4A 4NNCA 4A6GA 4RW3A 5D32A 4CQ9A 1V6YA 1X8CA 3VK5A 5EMKA 1R7AA 3JUGA 1ZFJA 2QF7A 3SCPA 4DWSB 1UOKA 4AF0B 1KFWA 1LROA 4PTDA 1UH3A 5DXYA 2QUNA 3BE7A 1HXJA 4XV0A 3NQEA 3W7RA 4RZ5A 1FA2A 2YOCA 1M6JA 1WXJA 1RK6A 1OSEA 4OT7A 9XIMA 4DUWA 1FUYA 1VAHA 1LQAA 3GTIA 4KGLA 4ML4A 2Z00A 3EKLA 3QHOA 3HG3A 4JL1A 1VFSA 3B0YA 4FZIA 3ARWA 3POCA 1VS1A 1YQ2A 3EXSA 1ZSXA 4BCEA 1POKA 3T8LA 4MVAA 4MNKA 2YCLB 4ERGA 1KKRA 4CNOA 3SSZA 4XKYA 1DWIM 4WQ6A 4KF1A 3AUOA 3KOXA 4B3ZA 2QCHA 3M0YA 2P76A 3E02A 2Z6JA 1AA1B 1SFJA 1WXYA 1QNPA 4IXXA 3VABA 3TVAA 3LQLA 3VNIA 2P88A 1ITUA 3KTCA 1XRVA 4OECA 2WSPA 4PL2A 1VF8A 3KZPA 4RXFA 5KZEA 4JTUA 4KWSA 3SR7A 2Q8ZA 3OW1A 3WQEA 4AQLA 2NV2A 3O06A 2EF9A 1W9UA 4MZ1A 3A6OA 4PCTA 3UWVA 2KZHA 4KEZA 1L6WA 4IPLA 3VX0A 2W3ZA 1GVQA 1G4PA 2YDAA 3QY7A 2JF7A 3IJ9A 1E55A 3VD3A 1PSCA 4YVXA 3FVMA 2PODA 4ZTXA 4OTKA 5B7ZA 1MRAA 1XIEA 1LL4A 3RJYA 5LHEA 1G5AA 4NSBA 2PRHA 2WMJA 4IMDA 3QW3A 4O57A 1D7KA 1UD4A 3EB2A 3NQ7A 4NJKA 3BAIA 3GVVA 4A4AA 4JZ5A 5A8QA 4MB4A 1GOIA 1H62A 1Z48A 4QBXA 1J5SA 3MMUA 3CHFA 3KL0A 2TRSA 3GFZA 3SUSA 2CZFA 4W7VA 3A3WA 4LF2A 2NWRA 5AHEA 3C2VA 1GWJA 1V6XA 3B0PA 3DENA 1TRIA 2JEPA 4S1FA 3R2GA 4IPNB 5I06A 3OVQA 4WKFA 4PUJA 4OBSA 3FDGA 2OWCA 1W1IE 1YRRA 4XBKA 4Z1DA 2A0NA 4ZMGA 1DV7A 3ZJKA 2GWNA 4TVDA 2XIQA 2W27A 4JNZA 5DO8A 4QJ3B 4KT2A 1CXIA 1J6PA 3KLKA 6TAAA 2VC6A 1W3IA 4P5UA 1TWZA 2DZPA 4JX5A 2XFWA 4ZOCA 4B5NA 1M68A 4Y8EA 3ABSA 2F6KA 3QFWA 3VGBA 1PO9A 3B8IA 6A3HA 1KGWA 4KIEA 4JTIA 1JNDA 3ZS4A 3PZTA 1UP0A 4JFVA 4K8HA 3VE7A 1CLVA 3IIVA 5A8GA 2E1WA 1O7AA 3REQA 3UPMA 3TYZA 3H54A 3AALA 4A8IA 1RCQA 3MCNA 4PTXA 3GG1A 5HA7A 1J2BA 3T09A 1BSIA 3VIMA 5I78A 1XIBA 3KBSA 1Z3NA 2QCFA 4F2BA 3OYXA 1SZFA 1DIEA 3MBFA 1JYXA 4JCMA 1WOAA 4S3BA 1OABA 4AZ5A 2ZUSA 1UH4A 4A29A 1DQWA 2DORA 1OCBA 3VI2A 3TR9A 2ESCA 3GVGA 3ALGA 4HMEA 2OOFA 3AO0A 3N04A 3VCCA 4R9XA 3VCNA 1ML1A 3UBPC 3ZLGA 1PX8A 4HOXA 1FCQA 1ONRA 5CBJA 2D1ZA 2WVTA 3M7WA 2IW0A 2W61A 4BWLA 4H1ZA 1TE1A 3GDBA 4CQAA 1HJSA 2XH2A 2XVGA 3TMQA 4OJYA 3M16A 3H2EA 3IRDA 2PCQA 3MSRA 3FA5A 1RV8A 1AH4A 3C0SA 4UTTC 2WVVA 4QQ3A 4NZ1A 2DY3A 2DSUA 2WK2A 1W6TA 4QDPA 2O9TA 4HHHA 5GPRA 3BZJA 3RR1A 3KLLA 1H7XA 1QHPA 1Y8BA 2CWXA 3FYYA 4N9BA 3W00A 2E68A 2JKPA 5I7GA 3BAKA 4QISA 4NU7A 6PTDA 3D5HA 2HK1A 1EGZA 4TVUA 3QHMA 4O1FA 1UP2A 4REQA 5HMDA 1VEPA 3CLMA 4J3VA 4CCEA 1DTUA 4B5XA 1Q6FA 3M0IA 3HMCA 3VTRA 4BEQA 1TZZA 4HPGA 4CQBA 2J7CA 1T96A 4WR3A 1NELA 4EVZA 1E51A 1UWIA 2OLSA 3MYOA 1PEZA 3SGZA 4MHBA 3QR3A 2JF6A 1WZMA 1SO5A 4TX6A 2I9EA 4PMDA 1FXPA 1U5VA 3WEMA 2VEMA 1GQIA 3S83A 3GAKA 5JBDA 4WKAA 1Q63A 2ZUMA 5KTLA 3JW7A 1PYFA 3VKKA 2J24A 4G6CA 1GEQA 4IIBA 2IKHA 1HKVA 3IIZA 3QHNA 5FIPA 2VC9A 4RDZA 3PUOA 5ABFB 4NRRA 3WQVA 4S39A 2WB5A 3C0QA 1EF3A 2P8CA 1VFMA 3F5JA 2VRJA 4Y9PA 4QE1A 1TO3A 4J3SA 4B16A 1O94A 3S1GA 1C8YA 4W9TA 4U2YA 3VIGA 2VGGA 1L8NA 4WD0A 3DFPA 3PTKA 2Z2UA 5FJOA 4QCFA 2XFFA 4I5RA 3CUGA 3LGGA 4DEFA 2ZE0A 3BC9A 2OO0A 4UTLA 3RILA 3GW3A 3P2VA 2GYIA 5A6TC 5BYWA 4GYJA 1KFJA 3B8VA 2PMQA 4YHGA 1G69A 1Q6LA 5FEXA 4ZL1A 1SGJA 2WSKA 3TC6A 2A7NA 4XISA 2IXVA 2YL9A 4JEQA 2PGFA 1E56A 1RBLA 2DVTA 2XN0A 4C65A 4GI9A 1ZAHA 4O1CA 1ICQA 4FXFA 3STEA 1PCWA 4I9AA 3HV8A 4AISA 1KGUA 3ABXA 4WXYA 3I4KA 3CH0A 1CXHA 2P0IA 2ISWA 2QCNA 5T8GA 3OOQA 4R33A 1UR8A 1UKTA 4GNJA 3WDJA 3AMCA 3FY1A 2FDSA 1JUKA 3AIVA 3ARUA 4PULA 2GSJA 5AC6A 1VPXA 4FMVA 4JTTA 2QZRA 5E09A 4S3AA 5CEWA 2VWSA 1QWKA 5HK4A 3HPAA 1F3WA 3USBA 3AICA 5REQA 4YTRA 1IHIA 1KM1A 3GZAA 3AZSA 1LOSA 4O0QA 2Y8KA 3TTOA 3W7HA 2D2GA 4DJFC 1QW8A 2VC7A 2NVCA 3CJPA 2R1PA 5LXXA 2E8ZA 2PF0A 1K7XA 3OPSA 3W27A 3BZGA 5SWUA 2QMKA 4JHZA 1VRDA 1ZTVA 4PB5A 2B7PA 5ABEA 3LSCA 3LBMA 3SCRA 3T7VA 5CC3A 3BV7A 3V18A 5FJPA 2IUZA 4FB7A 4DWSD 3MSGA 3QTGA 3AU2A 3GY1A 1JIBA 1QFEA 3A13A 1MZRA 5CZ0A 1A80A 1K9FA 3MHFA 1U1JA 3KVJA 4BEUA 5CCZA 4QEHA 1JCXA 2YXOA 3G0SA 5C7VA 1WPCA 2WPGA 1KRMA 2CW6A 1EX1A 3U5UA 4YNGA 2PE4A 1QXLA 3H7RA 1DE5A 1UR9A 2ZC1A 3SN1A 1CXKA 4RCXA 5IXEA 2OODA 2XJ7A 1VBJA 1W5MA 1HJVA 1OYBA 5D9MA 4LTSA 4N42A 3UZXA 1HQTA 3TC7A 4WJEA 3G1RA 1V3HA 1FH8A 2EGZA 2PDCA 4AZCB 2XVNA 3UWYA 3VMPA 1W9XA 3R12A 4LAUA 3MUCA 1J93A 2ZRYA 5AB3A 1XLIA 2OR2A 3I6TA 3KOWA 1TG7A 1BLIA 1Z7AA 5D04C 4QM1A 3UA4A 4QFUA 3B03A 2W67A 2VZUA 1KM2A 1NVMA 1Q65A 2GSHA 4X60A 2QF8A 1H7RA 4RX0A 2E5BA 5LSMA 3U0HA 2FPVA 3PJUA 2ZRZA 4DNHA 1AD4A 4I6VA 2ISSA 4JTDA 3WCZA 3DBPA 2EJAA 3TU9A 4HPNA 4GKTA 3ABQA 4PCSA 1Q8AA 3DG7A 4L5ZA 1HKWA 1LT7A 3R58A 2QCCA 4LBUA 3M07A 1V6TA 3VNKA 3MS8A 3SN4A 3NAVA 3ITVA 2BOGX 3UZ5A 4F0MA 2GL5A 3A3XA 1BFNA 3W81A 1DE6A 3LN3A 5EU9A 2FHBA 4YTQA 4DM1A 3HFYA 3V5FA 1RVGA 4KERA 4DYKA 3V3WA 1U1UA 3P14A 5C70A 2WANA 2E6FA 2J9XA 3UW6A 4XSMA 3TA9A 1KR1A 1XIDA 3AI0A 1K8YA 1XIJA 1NIUA 5CZSA 1Q2SA 3BSGA 4MB1A 1HNYA 2ZWYA 3N6JA 1R9XA 3RX4A 2WJFA 3RM4A 2OQLA 1EZWA 3ARQA 3R5EA 4Y9AA 3DC0A 3LD5A 4LNCA 1P6BA 3N25A 2DP3A 3C3NA 3L4YA 1Q2RA 1EEPA 3KFTA 3FHAA 1A5UA 3F4NA 3TN6A 1FWJC 4UC5A 3LGDA 1RALA 1TWSA 4GGBA 1TELA 4WJXA 4IMGA 4NNBA 1S1RA 1H49A 2Y70A 5A69A 1PL9A 1BKSA 4HPHA 1SR0A 1TSIA 2A3LA 4PL1A 4RZ6A 4ZB5A 1QPOA 1I45A 1DXFA 3TP4A 2DUAA 1I2RA 3R94A 4H9VA 2R1KA 1K77A 4MIMA 1V02A 1D3HA 4UFHA 5C5YA 1E3XA 5HUPA 3MWAA 2F6UA 3HPSA 1W5OA 4ZTYA 1GGOA 3EWYA 3MANA 3QY8A 5CXPA 4S3CA 1UZDA 3N4FA 2PRMA 1OY0A 4MF4A 1J8VA 1GEHA 1TMQA 1YIXA 1Q6CA 2WLZA 3FOKA 1W5NA 1O5KA 2QNEA 1F9CA 3CXOA 3OIHA 1M04A 1WE5A 3ARTA 1CT5A 1KFEA 1G4EA 3W76A 3MMTA 4L1WA 2CIPA 2PA6A 1JVNA 1QVBA 1IGSA 1UHVA 3WQ4A 2D69A 1IR1A 1WDRA 3F4CA 3LHYA 4UR7A 4WKHA 3RK8A 5H8UA 4UFLA 4Y90A 3KDNA 3LU2A 3B9NA 3GTXA 2HE8A 2BVWA 3AMDA 4AZBA 2Z24A 4CU6A 2EG7A 2PC4A 3P7YA 2ZZ4A 3L0KA 4H19A 3N15A 3VPLA 4O16A 4XZLX 4EWND 1FCBA 3W1TA 4HN8A 1K02A 1UPPA 2R1LA 3UA3A 1GOXA 3W7JA 1T41A 3G0UA 4DJFD 1QPRA 4W87A 2VRKA 3FNDA 3EWDA 5H6HA 3GM8A 4DLMA 1LLZA 3TDFA 3QVQA 2EPOA 4K2SA 2GGJA 3W23A 3AWOA 4NHVA 2W79A 3ABZA 5C8BB 2C79A 2PURA 2G3MA 1K6AA 2GOKA 4HNLA 2WNWA 4RNJA 3S5YA 5EMJA 5BU6A 1Y5XA 1NDWA 4V1XA 1NY1A 3NSMA 1D7FA 2ZZ6A 4MY8A 3KOFA 2WJEA 3A9IA 1SZRA 5D03A 3SEPA 2ZUNA 4UTUA 4F0HA 3CWOX 2WSYA 3M0ZA 1V3MA 3IJDA 3ONCA 2BFGA 3E1F1 3P74A 3PVFA 3BGAA 2BGSA 3RLHA 3P5YA 1Z44A 5M03A 2ISDA 3MKVA 2G4JA 4YXGA 2PTWA 1E0UA 2ZUTA 2WC7A 1CYGA 1EGMA 4GVHA 4TUFA 1BTMA 2VCAA 4B5WA 3FAXA 3OLGA 3WLMA 1LWIA 4HCDA 1OD0A 3BTNA 5E6YA 4IXHA 1DWGM 1HL2A 2B7NA 4JHMA 2ZIDA 2PCEA 1DWJM 3KRBA 2QQ6A 2VL4A 2R82A 4N9CA 3JR2A 1GPFA 1OX6A 1LBLA 1VFOA 3B4YA 1XLKA 4JKLA 2PDPA 5E9AA 3FAWA 4AVNA 4HHPA 3OBAA 3FKKA 1PKMA 1W9BM 2PWFA 4LANA 3VNMA 4NF7A 4LUJA 5DMYA 2Y8UA 5FKYA 5I79A 3SCUA 3LM7A 1XDLA 2X1IA 3N2CA 1KCLA 1G0CA 3CC1A 1S3TC 4JQ2A 3VDHA 3VUPA 1QO2A 1PWLA 4E0CA 3FK4A 3E6EA 2R6OA 1KLYA 2WW5A 3BURA 1KD0A 2VEFA 2EO7A 4A8RA 3W1PA 4L7ZA 3HFTA 2IPGA 1XYFA 2QCEA 4KCWA 3L7RA 1BD0A 1PWMA 1DIDA 3VIJA 3BMVA 4F0KA 4DO4A 3LRMA 5E6ZA 1SU5A 3S47A 4UNIA 5GNZA 1WA3A 1DJWA 4JFTA 1UR0A 1UUMA 4H04A 4JQ3A 1BKHA 6REQB 3GUWA 3O63A 3CAKA 1V93A 4LAMA 1SFLA 2QUTA 3BO9A 3WELA 2RDXA 4WIWA 1U22A 3CWNA 2GFTA 2NLYA 4D6DA 2NXGA 4GIAA 1UD8A 4S3EA 4X0VA 2P8BA 4H6RA 1Q7ZA 3T78A 3R25A 1EH9A 3N13A 1EIBA 1BYBA 1VC4A 4S3GA 2YBUA 3W1XA 3G1FA 4BKNA 4DPQA 4Z2HA 4YVPA 1E6XM 2YKKA 3ITTA 3D0CA 3VUSA 3G3DA 1H63A 3Q4DA 2NQ5A 2F84A 4HZ7A 2R94A 3WF4A 1E0VA 3A5FA 2C7FA 2BXYA 4KEMA 2WCSA 5A6KA 3B3DA 4GYKA 5A6LA 4WVXA 4QCEA 2CBIA 1ZP4A 1K8XA 4US6A 4ZZ9A 1E9IA 4WXZA 3MUZ1 2VRQA 1WBHA 4K1WA 3SB0A 1O5QA 1ZAIA 3MHGA 2G3NA 2ZCGA 4C5YA 1QI2A 4BWLC 4CD7A 2I57A 4I3GA 3PB0A 1SW3A 3QYQA 4Q8VA 4ZB2A 1UQYA 5HPCA 3THUA 3WQ8A 3KDOA 1R3QA 2A2IA 4HQVA 4G1NA 1S38A 3A9BA 3NSNA 3PTQA 4GZIA 3EXRA 3KBWA 1E73M 1ECQA 4DYJA 4IWWA 4TOQA 1S3HA 2HROA 1B3ZA 4NILA 2VT0A 3SCTA 3WENA 8RUCA 1C3FA 3WF3A 2D24A 4H00A 1UKOA 4XZIA 3ARYA 2ZWZA 2FZMA 1TIMA 4IM4A 1F76A 3A23A 5HQLA 4H8NA 3E2VA 4JHOA 4NJHA 1DEDA 4WCJA 4YHEA 2IXUA 1R30A 4DBDA 3AXKA 1XC4A 1SM9A 4HP5A 4E8GA 3XINA 3NA8A 3PFRA 1VPYA 1LT8A 1IF2A 3POHA 4DJDA 5TQLA 3L4XA 3AXIA 5A95A 3GH4A 1GK8A 2VZTA 1G7UA 1IXQA 4KKXA 5HMFA 3CEUA 1A5MC 4NY2A 6XIAA 3WLHA 5DN1A 3CUZA 2FFIA 2C6QA 1I4NA 4DB7A 4FNSA 1E9LA 3IARA 3PN8A 1LOLA 3R11A 4CNUA 1PE1A 1TTPA 1V79A 1JCMP 3UY7A 4GC4A 4XD5A 3ALFA 3W86A 3WNMA 1W91A 3MBDA 4DXKA 2QDGA 2VJXA 1TPH1 3PAJA 3M41A 2W92A 4S2CA 4YTTA 4U28A 4YPJA 4UFIA 4A21A 4O10A 2QCGA 1YTKA 3N3MA 3VD7A 4DBEA 2WSQA 5AYZA 3S4TA 3N6QA 1NQ6A 4NAEA 2YB1A 1QI3A 1J11A 3IVTA 4X2PA 4E6MA 4J2MA 1IXOA 4MJ2A 3CB8A 4BF9A 3KWXA 1U30A 4G5DA 3QR1A 2VR2A 1C93A 3M5ZA 5DCEA 1ZZMA 1J5TA 1JCNA 5DY2A 3DCPA 3PNUA 3EDDA 2ON3A 1V3LA 1J01A 2FTWA 4DVOA 4R7WA 4DM2A 4ZQRA 3MU7A 5DELA 4S2BA 2HVMA 4PUDA 4GFIA 1SPQA 4GWEA 4HJWA 4W5UA 2ZA3A 4Z1CA 1H1ZA 4GI6A 4UQAA 1MW0A 1SYTA 4CCCA 1AL7A 3V1HA 3P82A 4MJ4A 1E4IA 3P8JA 4N02A 2H9AB 1OB0A 1KBJA 2V30A 2QAFA 3ZSTA 4GO9A 5A6AA 2XSAA 1O1HA 3W7GA 4AUBA 1WBJA 3DESA 3H24A 1FQ0A 5HOSA 2DDXA 2QDEA 2ACSA 5CPNA 3A4WA 3GTFA 2XYLA 1C9DA 3EGJA 1B0IA 1CGWA 4LV9A 1FWAC 1E71M 3K4DA 1H50A 4I6KA 3G1VA 2BY3A 3CLWA 4FALA 1X1ZA 3MZNA 2GVYA 4LBSA 1TMHA 2WMFA 4GQQA 1HX0A 1OK4A 3W2LA 4O0ZA 5H8MA 4OV9A 2C19A 1HN1A 1UKQA 3PS7A 3CT7A 1PPIA 2V0TA 2Y61A 3FX4A 4TVCA 2AMGA 1F3TA 4HKPA 4AVOA 2YL5A 4Y8FA 5BRQA 3ZQ9A 3HBLA 3F4WA 1IEIA 4O18A 3TTEA 4IX2A 1TPDA 3MPGA 1PIIA 1H51A 4PB3A 3ARZA 4FS9A 1LP6A 2EBNA 5ABGA 1B90A 3A12A 4OKDA 5EMUA 4BR1A 4HK6A 3QFEA 4W8BA 1FFQA 1PZ2A 2A79A 2BZNA 3AS2A 5EGRA 7TAAA 4XUGA 3BLKA 4K38A 4N4QA 1H0GA 3MO7A 1V3IA 1AQHA 2VELA 1GVSA 2OOGA 3K13A 3GYEA 1M03A 3UYCA 8CGTA 5MKGA 1REQA 5L9FA 3GHUA 4DUOA 2PLMA 1YPXA 4Q4QA 1Z9AA 3WBWA 3GWQA 4UQCA 1E72M 3KW3A 1WDWA 3UG5A 3GK0A 3DGBA 1BF2A 1DWHM 1OX4B 3WD2A 2J74A 4MJMA 3ITCA 3T9PA 3AS0A 3VCRA 5B7YA 3RX2A 2I5IA 1O5RA 2J7EA 5LGZA 3CL7A 2XU2A 1KCXA 3TQKA 1YDNA 3P67A 3LI0A 1NOFA 3W26A 1OZQA 3APYA 4F8XA 1AMKA 2FTPA 5HNNA 3QV7A 4DYEA 1YNYA 3GG0A 3TYCA 1EYWA 1OT2A 4G7EA 1SSDA 4YYFA 5AC7A 4LALA 1TREA 3MW7A 1EX5A 5DCDA 2E6AA 4K37A 3VDAA 3QV6A 3GXPA 5CZKA 5D8WA 2CBVA 3YPIA 2W66A 4IIGA 2PWDA 2KAUC 3VNLA 3DHDA 3U8GA 3AXMA 3WLQA 3HQ1A 2J13A 1KFLA 3ZR5A 3D3FA 2FB3A 4UXDA 5C9WA 4P2VA 2G5WA 3VZYA 2Q01A 4MUPA 3NEHA 3EMZA 4GI8A 1NFPA 3UU0A 2OGJA 3K8LA 4LAOA 1C7SA 2YYTA 3PHAA 4AD5A 4MNLA 3BOXA 3P62A 1RH9A 1T5AA 3G5EA 3GDTA 5E5CA 6CGTA 3CS2A 1XCWA 5I2UA 4JDBA 4XKMA 3LRKA 3VKAA 1W9PA 5EKYA 2NQJA 1TUXA 4FF5A 1TJ2A 5A94A 3MYPA 3UZWA 3UESA 3VFLA 1GQJA 3GXIA 4CUCA 3SGGA 2ZBTA 1TV5A 4PZVA 4QJ1A 4PMXA 2NLIA 3AJXA 3T81A 1NARA 2X1SA 4JIPA 3W7QA 1FWBC 4WJ8A 2HVOA 3NQAA 4DZAA 3NO5A 4OIFA 1GPWA 2VVNA 4RV3A 3L5LA 2YPIA 2CESA 2C91A 2Z25A 4EX4A 5BXRA 3DYPA 2VQTA 1P5BA 4DRSA 4E8DA 1JULA 1WX0A 3GUGA 3KTXA 3TV8A 4FX7A 4OHQA 1QOPA 4AZ7A 1JZ2A 1KXHA 4UOZA 1EP2A 1J0HA 1R2TA 5CC7A 5I03A 1IXPA 2WMKA 2RDWA 4R3UA 4ZO6A 3MUXA 4LVBA 3WJWA 1YPFA 3AIBA 1VJSA 2VC5A 4OWGA 2YDRA 2AL2B 5JVLA 1GQLA 4H6QA 5D2YA 5A8PA 4RE0A 4KCUA 5HWJA 3EDKA 2X09A 4LVDA 1XWYA 1CBGA 3PAOA 3IACA 2PAJA 3GDMA 1BHGA 4B5VA 4QS6A 2P10A 3TSMA 1VB9A 5BWAA 3SIZA 1QTWA 4U3AA 1BYAA 1B2YA 5AYIA 4QAIA 3S1WA 4HOZA 1BQGA 1RD5A 2V82A 1YPIA 4M6QA 3CMGA 1W3KA 4FOKA 1LL7A 1WAWA 4ZOEA 5I0DA 5E70A 1LRQA 3MUIA 3T0BA 5BCAA 4IGMA 3CV1A 1LTDA 1OFQA 3NL5A 4UFJA 2J25A 4WDTA 2H9AA 3GD6A 4YJ5A 4LBRA 1K6WA 2HCVA 4QTGA 4F2UA 2GJXA 1EO5A 2ZFAA 1J9YA 1I9CB 4ZO8A 1JF5A 4YLWA 4GK8A 5MHBA 1XLEA 1KM5A 3ARPA 1PB0A 1A4MA 2WM0A 3EOEA 4HN4A 3GFYA 1L8PA 3LCXA 3B40A 2VGFA 5LNSA 3WBYA 1AG1O 1PVNA 3S6DA 1XCFA 1KXVA 1S2AA 1C9WA 2J7BA 1ME9A 2CFFA 2IKGA 2HBXA 1FH9A 4IICA 4LV4A 3T2OA 1OG0A 5LHFA 1VKFA 1XD0A 1GW9A 1JAKA 1A5SA 2DFAA 2VQUA 3DECA 1XSJA 2PTDA 4PRTA 2J75A 4FPSA 1E40A 4A2SA 2F38A 3MCOA 2V5KA 1Q6GA 1XI3A 3W1NA 3BK0A 4NJJA 2H3DA 2E9MA 4MWAD 1FDYA 1DJZA 5LA1A 3LENA 3W1MA 3P93A 4MY9A 1I2OA 1NWUA 4POCA 2NV9A 2VD9A 1XUUA 6ALDA 4IFOA 2D2HA 4KIRA 4CQCA 4PMQA 3WNLA 4EF9A 3U48A 4Q7BA 4NP7A 3W7OA 4INFA 1O5XA 4XAGA 1KTNA 4XK2A 2HK0A 4V27A 1XKJA 2E7FA 3WY1A 2XWDA 3L5MA 1NM9A 4PGLA 3F03K 4QJ4B 4D71A 2ISFA 2RFGA 3FV9A 2WHMA 5IOBA 3ANVA 3AQUA 3QR0A 4PMVA 1QWGA 1DPMA 4CN6A 1XDMA 4H9UA 1DIOA 1RCOB 4GINA 5CAKA 2DZWA 4YS1A 2QUVA 3VC6A 4PUMA 1Q8JA 3CAQA 3MJYA 3KBJA 3UY8A 1EWDA 1HL9A 3A22A 2NT0A 4D6CA 4E2BA 2YJQA 4BHYA 2WVUA 1BRLA 1MNZA 1EUNA 3QBUA 1JYVA 1SZEA 1G7VA 2RJHA 1OX4A 3UPBA 1DXEA 4IUOA 5TBOA 3W7MA 1WXZA 5K7JA 2VNCA 1K1DA 1RXOB 1WCGA 4JTLA 3WNOA 4AMCA 4LRSA 5C9XA 2AMXA 3KE0A 2NZLA 3Q37A 1BG4A 4H9YA 3W1QA 1VBGA 5CGMA 2H90A 1UD6A 3VZZA 1ZBWA 1VBUA 2ZYFA 4FP1A 5D30A 1JUEA 1OFBA 2PBGA 1RPXA 4WGXA 2GK1A 2GVLA 2PU1A 3VINA 2WSRA 4OOZA 4A05A 1U2YA 1CPUA 1E6SM 2PZ0A 1R47A 2G3JA 1BXBA 5DMLA 3LCFA 1ZQ5A 3UCDA 4O1DA 4PTWA 3WLOA 1WP6A 5BWFA 3OHIA 1O95A 1KBLA 3SRKA 3CUIA 2EPMX 3EDFA 3GR8A 2WNZA 2DPEA 3DYOA 3OTRA 3BQ5A 1MI3A 3QTPA 4I7UA 4L64A 3VOFA 1JYWA 2DH3A 1K4HA 1KC7A 1F6YA 4W8LA 1XSKA 1M7OA 3GNDA 3EWBX 2CPUA 3PPCA 3THQA 4O14A 3FSUA 3R7MA 1LZOA 4N2YA 2RHGA 1G67A 1UG6A 2PDLA 4LJ3A 4G7FA 4M6PA 2FLIA 1XLAA 3NO1A 4IJRA 5LNUA 1XH0A 3DUGA 4B5TA 5FF3A 3VNDA 3WQCA 1AQFA 3SQLA 1KBBA 3PPGA 1ELSA 2PGEA 4DF2A 1GVFA 5HMEA 1ADOA 3GQYA 3OBEA 1P0BA 3CPRA 2QUUA 1MW2A 2R8WA 2V5DA 3AYTA 4JTGA 1J18A 3GVWA 3GXNA 3PK7A 4F9DA 1TPFA 1A5OC 3DAQA 4IQJA 2CITA 2OWWA 3K30A 2QPUA 3HA1A 2DVUA 2VDHA 1OFAA 2OLHA 4B91A 1UQZA 1UYQA 1XS2A 3C2YA 2FQIA 2RUSA 3W24A 5IDZA 3BWWA 1CGYA 3AU6A 3K1GA 4CLMA 3RUBL 3AROA 1HJUA 1M65A 2HQAA 4XIAA 5FEPA 4W88A 1Q4NX 1YHTA 1M7XA 2REQA 1KRAC 1XIFA 2XN1A 1VRXA 3RM9A 5I3HA 4WF7A 4ICNA 3BXWA 1BTCA 4WDWA 3STFA 3IANA 3DHFA 1PIFA 1DJXA 3JU2A 5C54A 4RJEA 1H7NA 3A4XA 1RCXB 3HQOA 1US0A 2WMHA 3MP3A 5LNVA 1XIHA 4BI5A 3N4EA 3N2BA 5D2WA 1JCYA 3FJNA 4AYGA 2O9PA 2OU4A 3PTDA 3DX5A 4AZHA 2IS7A 3H2OA 1US3A 1REQB 3RCNA 1YBQB 3WK0A 1J0YA 3BSHA 1R3TA 1SW0A 3ZJ8A 1X8FA 1NDVA 2WWCA 3GX9A 2NV1A 3T44A 3C61A 2BTMA 5EA9A 1TZ9A 2X42A 4IG2A 4TX9A 1D2KA 4GOAA 5AHLA 3R10A 1ICSA 3EPMA 2XVLA 5IRPA 2H6RA 1UR1A 4MNMA 4DBUA 2ZX7A 3I65A 4GXWA 1OVDA 1IZKA 3RU8X 3R0KA 5CGQA 3DFTA 3VZXA 3RF9A 1DJYA 3ZJ7A 3W1RA 7A3HA 2J8FA 1OFPA 3WLIA 3G8EA 2A6LA 2V2HA 1IZCA 5EMMA 3KCOA 1X6UA 2EPNA 4IMAA 3THAA 3LUTA 3BH4A 2VZVA 4NAFA 4MGGA 3LOTA 5CPLA 3GXDA 4O17A 1IWAA 4QLLA 4DZ5A 3KEHA 2NXIA 1VCGA 4C6OA 1AQ0A 1SMDA 4H7VA 5E0FA 1Q6OA 5DMMA 3S6OA 4UTTA 5G1YA 2VGBA 2BNJA 2EPLX 3BLLA 4QX4A 3H4WA 2XISA 3QC0A 4IJBA 4DX3A 1Q7QA 3GNOA 3M0KA 4HU3A 3IGSA 4NT0A 2ALRA 1ZUAX 2QVNA 5D33A 4DN1A 1JEZA 2JEQA 4JTQA 3AS1A 5GNYA 1NU5A 4ZENA 1F4AA 3I3EA 1ZP3A 1PDYA 3ECQA 3NQCA 3CQ0A 3AMKA 4BS0A 2ATSA 4XG1A 4WDXA 2BVTA 4UBPC 1F61A 5C6MA 1V51A 3USZA 2Y5SA 3UZZA 1W3NA 1JNEA 4A35A 5JIPA 1JZ8A 2CKSA 2Y4SA 1EJRC 3HU7A 5IBXC 4D6FA 1A5LC 2OEKA 3NIYA 3VIIA 5U4NA 3QW4B 1E0TA 2XN2A 4V1YA 1CTNA 4FLRA 4J28A 1VJIA 4AXKA 3E9AA 1JPDX 2OT1A 1ZCCA 1TWWA 3T42A 1CGXA 5HJXA 3FJ6A 3U5YA 2V3DA 3TLLA 1XF0A 4PN2A 4IMCA 1YXYA 1IQ8A 3MDUA 3O9NA 3CPUA 4X2RA 3TROA 1S2CA 2IMRA 3CZJA 3B8SA 4Z2LA 2X7WA 3CTLA 1AJZA 3TYBA 2PTXA 2PLJA 4AHOA 2VKZG 2HTMA 3OEXA 3EX3A 4NASA 3PG8A 1EJWC 3AXXA 1VYRA 3QPEA 1BWLA 5LKYA 3HGOA 3CAWA 1JUBA 1FWTA 3GH5A 5G4WA 3EOUA 2V5BA 1DKWA 2PWHA 3QGKC 1TJ1A 1TR9A 3NQFA 1POJA 3AZTA 1CI1A 2WZMA 1E0XA 1JPIA 3K46A 1V7AA 2FHFA 1XUZA 5DLCA 1TX0A 4JTAA 1UWSA 2CWNA 1BAGA 5M1TA 1EIXA 5IBXA 1W9VA 5EPDA 3L0NA 1IE7C 4ZEPA 3B06A 1KFBA 3VFCA 3DERA 3HJZA 2AL1A 1DJQA 2G4FA 1UWRA 1TB3A 5G4EA 5I5RA 3BMXA 4XAZA 1F2JA 3L68A 5BOFA 3OZYA 2XHYA 4ES4A 1MRQA 4H9XA 2VEIA 1VEMA 2QJJA 3DGRA 4AIBA 5ABHA 3KBMA 3WNKA 1ITQA 1OYAA 3WD4A 1GOMA 3K8MA 2CLIA 1QPQA 5HNUA 2XVPA 2OZ3A 4FLSA 2PDMA 4TMBA 4DBSA 3HPFA 3A47A 5KZDA 4I7WA 2Z1SA 5MKGB 3UG8A 3ABRA 7CGTA 1UASA 1QW7A 4LY8A 1E15A 1KRBC 1JXKA 2X0YA 3BQ6A 1P4CA 4C6QA 3LV5A 3FEQA 4FR1A 1ZBVA 2BWGA 3UEQA 1Y65A 5BNKA 1K4GA 3G0XA 1TPWA 2B31A 4H7ZA 4M51A 1XGDA 2XSBA 4XAFA 3N14A 3BLPX 2VEGA 4HNNA 4FIQA 5A8MA 4Q6JA 1B30A 3QV9A 1GHRA 3S5ZA 4EPKA 3LLDA 1KV5A 3Q2DA 2O4MA 5D9OA 1XINA 2BHZA 4ZQPA 4E4FA 1SQ7A 3VOCA 3LS9A 2Z4GA 4D72A 2P53A 2DVXA 3P81A 4PUNA 3TEVA 1HJWA 2B4GA 2CYGA 3UXAA 1UIPA 4W86A 3C56A 5I6SA 2Q02A 4WSHA 4LOCA 3IRSA 3MVTA 2XIJA 1A4LA 3CZGA 1EJUC 3HMJG 3KX6A 2NW0A 1UWUA 4HBKA 4LUIA 4P8UA 2J79A 2WLYA 2X05A 8TIMA 4F79A 2OYKA 5FSEC 2MUCA 4HSNA 4E3TA 1MEIA 3U4AA 1DQXA 4Q8TA 3SCOA 3P0XA 3D46A 3TX9A 3S0CA 4UR9A 4M1RA 4MUZA 2OFJA 2Q71A 2V5CA 3GIQA 4AZ6A 2XG9A 3M7SA 1B9ZA 2YYUA 1TA3A 4HPXA 4PODA 1XM3A 3O7UA 3LBOA 1EOKA 5FJUA 2Z2BA 3BGJA 1W1VA 4R88A 3F5LA 3HB9A 1E4NA 5HINA 3S6TA 1LJYA 4KPLA 3KL3A 5XIAA 2J66A 5LNRA 1XISA 1GVOA 3ZSSA 2RGLA 3U2EA 2EPHA 4JTHA 4DJED 3FHQA 4F66A 1EJVC 1TWIA 4Y9MA 3W3OA 4GUIA 5MF5A 2E28A 3L5AA 5C9ZA 3DFOA 2X16A 4IIHA 1KKOA 3PPHA 1F6PA 3CHCA 4GQRA 3T8QA 2D0HA 3UR2A 3SFKA 3IEBA 1GYLA 4ATDA 1Z41A 4Y9NA 4Z1BA 3SIMA 3MP4A 1AJ2A 3W37A 2XSXA 3PSVA 1V4YA 2DT1A 1RJRA 1FWFC 2AQVA 1KWGA 1EB3A 3VIKA 4P7NA 4LS1A 5F2IA 2G95A 5A2BA 4LW7A 5DMNA 1QOQA 3TTYA 5A8OA 1O60A 5EBUA 3Q67A 5FEWA 4X9YA 4WGHA 3H2NA 3L2MA 3VMNA 1XIGA 1O1ZA 3K8KA 4GNVA 2ZOXA 4AAJA 5I3KA 4MJZA 5JUVA 4IJCA 4OU1A 5IHRA 2VFEA 1WUFA 4HMCA 3ONBA 2HV5A 1EXBA 1R87A 4WUIA 4W84A 5HDRA 1F8MA 1QUMA 4AD4A 1IWPA 3BW4A 1I0DA 1IEVA 4MDOA 2DGAA 2DIJA 1WZKA 3HG2A 4HD5A 3M0XA 4ACZA 5GJNA 2OSXA 1UC4A 3C52A 4RLIA 5LIKX 3W2KA 1YADA 4CGTA 1OWQA 1J0IA 4IGNA 4H6KA 2BLEA 1QBAA 1DP0A 3ZZ1A 1VBHA 3RHGA 1OFEA 3GR7A 1G1YA 1AL8A 1JD9A 1RBAA 1FXQA 2BXZA 3WK3A 3Q65A 1TV7A 4EANA 4CD6A 4GBDA 2VX7A 1KR0A 3W7EA 1JXJA 3URBA 3N4AA 2DUXA 2FH6A 3RO6A 3T4WA 1Z42A 3UJEA 1VLWA 4Q7NA 3VNYA 5HJYA 1PZ0A 1WOBA 5LXEA 3LV6A 4C6LA 4R34A 4R7OA 3CGTA 3OP2A 3TTSA 3N2TA 3K4AA 3FXGA 3GR4A 3E5PA 1MUMA 3ATYA 3ZFHA 3LRLA 1QOXA 3F1QA 4GZJA 4PTNA 4U33A 2DSZA 3BAXA 3RO8A 4QQUA 1KTBA 2ISVA 4US5D 4L9XA 5J5RA 2P0OA 4NL1A 1G01A 1TPVA 2HS8A 5CJ5A 4NX0A 3LERA 4CNSA 5A5WA 1EBGA 4TQTA 4LRTA 1I1WA 3UXIA 1KCZA 5ABTA 3I7QA 4HTBA 4Q7IA 1FBAA 3V5CA 1TPB1 4W5ZA 3WSUA 4S3DA 4V2XA 2VFFA 3VD5A 4KMQA 2WOQA 4UB9A 3T2QA 3WEZA 1NWTA 1S2VA 4MWAA 2A3CA 1E6RA 1MXSA 1UC5A 2FFCA 3S1VA 2OSYA 3KVLA 4D8ZA 3STGA 2VUNA 4ENLA 4H7CA 2G37A 3C2OA 4KETA 1SMAA 4UQEA 2NXHA 3DBNA 2JKEA 3UP8A 2A4AA 4LS0A 3CNYA 2VI0A 5CPTA 3IVUA 1XSIA 5C7HA 1GW1A 2DZVA 1IT0A 4QE5A 2PU0A 5M3WA 2PLKA 1KM6A 3L4VA 1QU4A 1XYMA 4O28A 1ZU8A 2OYMA 3UZJA 3G3MA 1AQMA 3L2IA 4BF5A 1C7TA 3QKZA 4NZ4A 1RSCA 2CLKA 4D6JA 3WUFA 4HNVA 1N8WA 4C7FA 4JAWA 3WUBA 2WKLA 4K3ZA 4LUSA 3SO7A 2VCCA 1UZ1A 1I75A 1K8ZA 3IJLA 3BOFA 4JNYA 1A47A 4F3HA 4ZO7A 2ZX9A 1L0PA 1Y5WA 1WDDA 1LRTA 3G6LA 2CEQA 2CCRA 1CXLA 1DQUA 2A1YA 3H8AA 3GU1A 2XWEA 4KRZA 5REQB 1MQQA 4DJDD 4NZJA 3TCSA 4QG9A 4E4PA 2YBVA 5CAHA 2VENA 1X6LA 4GUGA 3E0VA 4WX2A 4AC7C 5D02A 4ZODA 3LCLA 2BY1A 3OBKA 3LX9A 3NQ6A 4XKYB 4M6VA 4QR6A 4X3ZA 1SW7A 3WG6A 3MCMA 4BQ4A 2X1RA 3W74A 3OYZA 1W8GA 2QCDB 2J9YA 3NWRA 3ISIX 5BMXA 1GTEA 1UA3A 2YFNA 4XVDA 3O6CA 4AB4A 4ZQNA 2VDGA 4JY8A 4W85A 3GAYA 3KHDA 3N19B 1V5XA 2EHHA 1PTAA 2R1MA 2AQOA 2JE8A 3B9DA 4ZFMA 2PDFA 3P6LA 3GHSA 4JN6A 3A21A 4GVGA 2CZVA 5ENLA 4GLEA 5DXXA 4DJEC 3PWIA 1H09A 1FKXA 3PF3A 2XH4A 4ADUA 1OIMA 3H23A 1TX2A 3C86A 4EKJA 5AYXA 4IFKB 3LLXA 4JR5A 2OMAA 2GQAA 1S2TA 1WB0A 4JXCA 3L21A 4LYRA 3AIQA 4P61A 3OLDA 3G24A 5AC5A 3TQ0A 2GQ3A 4MDPA 4GXPA 5KMYA 3N2XA 2QCLA 1W3TA 4L4PA 1DJGA 4YCPA 1NJJA 2QJHA 1OCQA 1X7FA 3IUDA 3UYIA 3HO8A 4NAFB 4GVFA 3SY1A 2OJPA 4GH1A 4LCQ