1VAHA

Crystal structure of the pig pancreatic-amylase complexed with r-nitrophenyl-a-d-maltoside
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Crystal structure of the pig pancreatic alpha-amylase complexed with rho-nitrophenyl-alpha-D-maltoside-flexibility in the active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 163
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1vahA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1vahA01
3UG4A 5CJ5A 1J0IA 2DEPA 2WNWA 4PMQA 1M01A 3VTRA 3WMBA 4AD5A 1XHGA 3GXNA 4MB5A 3WFLA 3WD0A 1HX0A 3CMJA 1PIFA 4V27A 2BVDA 2PWFA 3UG5A 3WKZA 3IJ7A 1RPKA 2GK1B 3ZM8A 4KMQA 4BQ4A 2BHZA 2QMJA 1JI1A 2G4FA 3BGAA 1E5NA 5M17A 1QHZA 3T0AA 3BMWA 3ALFA 2WHMA 1JF5A 3BCDA 3JUGA 4P8XA 1OD0A 4PTVA 5JUVA 4ZFMA 1FHDA 1FH8A 3CHEA 4H2CA 3BSHA 2MANA 1UWUA 2BFGA 3RJYA 3D52A 1KBBA 4DUWA 4UTFA 1L0PA 5CGTA 2YA1A 1HKJA 2CEQA 1GQIA 4PBGA 4LYRA 3ARYA 3VKKA 2X2IA 1QW9A 1SMDA 1KCLA 3K8LA 2PF0A 4H04A 5ECUA 3N13A 1V0LA 2YA0A 3VM5A 2J8GA 3AOFA 1UQYA 3ZT6A 4MPKA 4AXNA 3AFBA 4HMDA 3VDCA 2CPUA 4P7QA 3PZVA 2GK1A 5D9MA 4IISA 2CERA 3RMEA 1CDGA 3AJ7A 4AEEA 4TVDA 4AZHA 4HPHA 1C8XA 2EPOA 4W5UA 1A3HA 4PMDA 1K9TA 2GJPA 1CYGA 1KR0A 3IAQA 2DSWA 3OGSA 3SCNA 1BSIA 4GQRA 4RE4A 1GORA 3WH6A 3ZR6A 2GSJA 1MW1A 1FOBA 3L4YA 1J11A 1GQJA 1CGWA 3AMKA 1FFRA 4NZJA 1OGBA 2YIHA 6A3HA 3T09A 1H49A 3HZ3A 1C7TA 3O2LA 1W3LA 2WMHA 3BXWA 3BMVA 3J7HA 2FDMA 2JIWA 1ODZA 1TQSA 3S2CA 3WMSA 4FF5A 3WQ6A 4GO9A 1G0CA 2DT1A 3AIRA 2EO7A 4NZFA 2D1ZA 5D9NA 1R47A 1ISWA 4UFJA 4HP5A 5LYRA 5JBFA 3POCA 3MUY1 2BY1A 5KZ6A 2YDRA 4Z2JA 3THDA 4MDOA 2E8ZA 2OSXA 2OW6A 4UOJA 1LL4A 2ZWYA 2CXGA 3UR8A 3MU7A 2X1IA 4QCFA 4GI8A 1L8NA 5GNYA 3EMCA 3EJTA 1HTYA 3W82A 4U5KA 4KRTA 1B31A 1U33A 3EMQA 1DEDA 2OLHA 1JDDA 2D3NA 2F7QA 2FHFA 3DHUA 4AEFA 1TQVA 5CQ1A 1EOMA 2VOTA 1ECEA 4XX6A 4GPNA 5FKYA 3WY4A 5I78A 3GXPA 1JF6A 4J28A 3OLEA 1ZS2A 1QX1A 3AS1A 1MVYA 1XSJA 2C7FA 1AQMA 3WELA 4S3JA 1EHAA 2J25A 1YQ2A 4P8VA 5ABGA 2V3EA 1CNVA 1IT0A 2W63A 1QNRA 1W9DM 1HL9A 3VGDA 3ZJ7A 1KGXA 1UD6A 1EIBA 3O6AA 4KWUA 1DWJM 4FNRA 4J3TA 3WNPA 4UZUA 1OINA 2YL8A 2WMIA 1G01A 1ESWA 1J0ZA 4TX6A 4AMCA 1BG4A 1CLVA 3RM4A 2W67A 1E15A 4W7WA 1W9VA 3GTNA 2YLAA 1TQWA 4XB3A 4PRWA 4LXFA 2VX4A 2XGIA 1FH9A 2VZVA 3QHMA 4NXSA 2QMKA 2WZIA 2NW0A 2WVVB 5I5RA 3W81A 4AWEA 5AYIA 1JZ8A 1O7AA 1OT2A 3DDGA 1M53A 1UWSA 2X8RA 1E71M 3AS3A 4PTMA 2IGTA 3VMOA 1KCKA 4A4AA 1CIUA 2BHUA 1XH2A 4B9ZA 2PI6A 1VFOA 4YPJA 4FNUA 1C90A 1V03A 1E55A 1P6WA 1V0MA 3AHVA 1LG1A 4AIUA 1EQCA 1UZ1A 4HOWA 1MW2A 4AZ5A 3SUSA 4PMYA 1AVAA 5CXPA 1VIWA 4MJ4A 4NXKA 4IPNB 2Y8VA 7CGTA 3AZTA 6TAAA 2WWDA 4B15A 3BUBA 4TOQA 1BTCA 3D4YA 2OYLA 4KGJA 4DWSB 4PMUA 4NI3A 4AZCA 1US3A 4M56A 4W89A 1KB3A 2X0HA 4BZYA 1GOMA 3TONA 2J79A 2VCCA 1O7DC 1CGUA 1JYWA 3N15A 5I3DA 1D2KA 4F8XA 3VX0A 1VENA 1OBAA 3OBAA 1QI4A 3HG4A 4KGLA 3SIMA 3BVXA 1ZBCA 3O9NA 5A6KA 2QPUA 3WQWA 4MB4A 3MANA 4QP0A 4R5EA 1EDGA 1UZ4A 4W87A 2DT3A 3OGRA 1H4PA 1C3FA 2VQUA 1RP9A 3HU7A 3WDQA 3ZT7A 1WDPA 5D8ZA 1GW1A 1TUXA 3WQVA 1WO2A 2W92A 2WPGA 3PN8A 3CMGA 4D1JA 1CEOA 5EB8A 3AI0A 2CYGA 5A6BA 2CITA 7TAAA 3EBVA 5E70A 1X6LA 4AZBA 4DWSA 3PZIA 2NT1A 1W9PA 3IK2A 1CPUA 4UFIA 2E40A 2FHCA 1JFXA 3WF4A 1G1YA 4HOXA 3BAKA 4TVUA 4WF7A 1ITCA 1VF8A 3VIGA 1BVZA 2VRJA 3A24A 1EQPA 3ECQA 2G3IA 4A3YA 4TUFA 3M6DA 3GXDA 2F18A 2GJXA 4CKQA 2F7RA 1PX3A 2XFRA 3D51A 4XV0A 1G94A 2ZUNA 2BHYA 2W91A 3AZSA 3SUWA 3VPLA 4EKJA 1HNYA 2F1AA 3N18A 4AIOA 3E1F1 3W6MA 2Y24A 4OIFA 1AQ0A 3F4VA 3CZSA 1OD8A 5CPTA 1BYAA 3BC9A 4DUXA 4U31A 3MV01 3VGBA 1QNPA 4PTXA 3NUKA 4ZE4A 4MNKA 5ABFA 1J0JA 1KGWA 1JNDA 4MNMA 2FH6A 1B3WA 1DWFM 4ACZB 1HJXA 3VMNA 2ZUVA 2XN2A 3PHAA 2CBUA 3CZJA 3AHZA 5BXTA 1HJQA 1FFQA 2BVTA 8A3HA 3CBWA 1JD7A 4D6GA 2CKRA 3WD1A 4M82A 1BVNP 1PZ2A 3ARSA 3ZMRA 3CO4A 5BYWA 1OM0A 2WZHA 3BAIA 5F7UA 2PWEA 4CU7A 3CLWA 1EHNA 1E4LA 3WDIA 3NIYA 3WDPP 3RILA 3PZUA 3MO4A 4NF7A 5AY7A 4TVCA 2WMJA 1WDRA 3I3BA 2W5FA 3AZRA 2V5CA 3EJQA 4PTWA 4D6CA 1WZLA 1VAHA 2WVUA 3VMPA 1B90A 1Q6CA 1TQUA 1VFMA 2JF6A 2ZXAA 4Q22A 3T08A 1TVPA 4ACZA 1LF1A 1HF6A 2VC9A 5A8OA 2BY3A 2PWHA 1B9ZA 3EDFA 1G9HA 2CIPA 2PBGA 3AISA 4JKMA 1UYQA 1KQZA 1JAEA 5FL0A 3VIHA 3W4RA 1DTUA 2EBNA 5A95A 2WAGA 3AIUA 1VBUA 1WAWA 2BXZA 2CBIA 2XWDA 1ISXA 5M03A 1SFSA 5M5DA 3VGFA 4CD7A 2IXVA 5E0FA 4BCEA 4D6HA 1JYXA 1JYNA 3CHCA 1TZ7A 3EDJA 4GXPA 5E0CA 2DGAA 4HU8A 3SCSA 1ITXA 3D4ZA 2WC3A 4F79A 5FL1A 2D20A 1CBGA 5A6LA 4AYGA 1VJZA 2VX5A 3LXAA 4Z2HA 4OGZA 1QBBA 3N17A 1ISZA 2XN0A 4MB3A 2ZOXA 4DM2A 2V3GA 4M8UA 2VL4A 2XVPA 3EJUA 4V2XA 4HA3A 1JL8A 3UEQA 1E72M 2J7DA 2F7PA 2DT0A 3GZAA 2X09A 1HJWA 2EEXA 1E43A 3WNNA 3SCUA 2VX6A 1PZ3A 4W8LA 3A23A 4UR9A 3AIWA 4QCEA 3K8MA 5HPCA 2EXOA 4CVWA 3OIHA 2WHKA 4UFHA 2UY4A 3B9DA 1K9EA 3A22A 1CXLA 5E9AA 3ALGA 4AISA 1MQQA 2DIEA 4R27A 2QPSA 4W93A 2VURA 2YFOA 3F5LA 1DWHM 1S46A 4CN4A 1GQLA 3WD2A 2J4GA 4W88A 2ZUUA 3UG3A 2OW7A 1V0KA 3N11A 1QI0A 1N82A 2X2HA 1Q6GA 3MUAA 3VNZA 1XGZA 3OZPA 3VIFA 3MUIA 3AXIA 2VRQA 4DO6A 1H2JA 5CSYA 3A4WA 1Z32X 3IJ8A 4IPLA 5DEZA 3WQ5A 1D3CA 2VCAA 1K6AA 3GBEA 4J3XA 5ABEA 1CGYA 3VVGA 2YA2A 1MYRA 3UCQA 1W3HA 3A6OA 1H5VA 5A8QA 1V0NA 3ZO9A 1QI2A 1IV8A 2AAAA 5BXSA 4CD5A 4UQBA 1JYVA 1HN1A 3BVWA 1R7AA 4GZIA 3T0DA 1FP9A 3MSDA 4D6FA 3EDKA 4Z2KA 1J10A 4P7NA 3CPUA 1NOFA 2WMFA 1E5JA 3LXBA 1E3ZA 2ZICA 4CU8A 3RO8A 3BUIA 3L4WA 1QI3A 1J0KA 1K9FA 3AICA 3DX1A 3I3EA 1MXDA 1A47A 1MWOA 3WSUA 4GI9A 3OLIA 4LPCA 5A69A 3GNPA 3WMCA 4B3LA 1UWTA 3IGUA 2EADA 1KBKA 1B3YA 1GOKA 3KL0A 1X1NA 4EK7A 4GKLA 2VJXA 2XVGA 1V6YA 2GVYA 2WVTA 1E0XA 1ZBVA 1B3VA 4AD0A 4JKLA 3IANA 3HG2A 2YKKA 1W9UA 3U7BA 2VZUA 3A5VA 3BCFA 4V28A 2D0FA 1KTCA 4J3SA 1JAKA 2FGZA 1EDQA 4WKAA 4ZXOA 4FNPA 5BCAA 5A8MA 2WB5A 4MADA 3NYDA 5JBEA 1JG9A 3K1DA 3U5YA 5M3WA 1X6NA 3SUVA 3BUPA 4HZ8A 3W26A 3WF3A 2EPMX 1R34A 2X0YA 4OKDA 4AW7A 3PZ9A 1E0VA 2D3LA 3VD9A 3AMLA 1E9LA 3CZ8A 3LRKA 2EACA 2ZX8A 4AMWA 1H0GA 3NSMA 2WKLA 3W25A 4U2YA 1OB0A 2ESCA 4J7RA 5I23A 4U33A 3WF0A 3ARVA 5IFTA 1R87A 5A6BD 4UCFA 1LLOA 5DF0A 4PMXA 2GJRA 2VR4A 3K8KA 4W86A 4ATLA 1DWAM 1C93A 3SEPA 2PB1A 3L4XA 4FLOA 5HBFA 4GO8A 1VB9A 4E8CA 1TE1A 1HKIA 3CZEA 1MQPA 3PBGA 4EAMA 1V02E 3DX3A 2PBOA 3QHOA 1UKPA 3TV8A 4IM4A 5CGMA 4AD3A 2VQTA 1JXJA 5D9OA 1HVQA 2W62A 1XC6A 1UR0A 4H7VA 2Y5EA 2BY0A 2WVSA 3FHAA 1W1YA 3POHA 1QHPA 3LXCA 1UKSA 1HKKA 4J3VA 4UNIA 4CD8A 3LRLA 3CGTA 1CENA 1CZ1A 1H09A 1V6VA 1UH2A 2D22A 1GOWA 2ZUWA 5A2CA 4D1IA 3WH7A 1GUVA 2EQDA 2CKSA 4ATDA 5DO8A 2CNCA 3KE0A 4HOZA 3GBDA 2WK2A 1J0YA 1US2A 2E9MA 1UHVA 2ALWA 5D8WA 3MMUA 2VRKA 4OOZA 4HA4A 3DYMA 1OCQA 4D6DA 1XH1A 3BLPX 4FNQA 2ZIDA 4UFKA 3CZNA 1W1PA 1GVIA 1MXGA 4AYSA 2VT0A 5JIPA 1VFUA 3N12A 1CXKA 1EOKA 3DC0A 1QPKA 4QAWA 5BRPA 4HU0A 3ARZA 1BG9A 4WK9A 1AMYA 2DSUA 5HPOA 3FAWA 3VD4A 2D0HA 4JCMA 1HKMA 4OUEA 2VMFA 3N1AA 3MI6A 1UD3A 1UH4A 4AC1X 1PX4A 1C7SA 4CUCA 1HT6A 3KLLA 3MKKA 1D7FA 3UESA 1PJ9A 1HXKA 4M81A 4AMXA 4CD4A 3WUGA 4M1RA 2AMGA 2RGLA 1LL6A 1ZBKA 3F5KA 4AD1A 4Z2IA 4AZGA 4W7VA 1C8QA 1HP4A 2ZUTA 3MUZ1 3OGVA 1PS3A 3DX4A 2DDXA 2WHJA 1QI5A 4JFVA 2O9OA 2W61A 2YL5A 2IUZA 1CLXA 3W37A 2WVVA 3VSUA 3W27A 2UWFA 1KXHA 3WDHA 1JZ6A 1JFHA 2F61A 5D9PA 1CXIA 3VNYA 1QBAA 3FW6A 3LX9A 3DYOA 1R85A 1XYZA 2QF8A 2YBUA 1SYTA 4YHGA 3WIJA 2V38A 3CZKA 4PSPA 1UKQA 2G41A 1TG7A 1I1WA 2OSYA 3CUFA 4JCLA 3UERA 1XD0A 1ZL1A 1R8LA 3WBAA 3D50A 3DECA 4CU6A 4AZIA 1LQ0A 1M04A 2F7OA 3GXFA 1E56A 5HNNA 1IZJA 1BPLB 4Z2LA 3LPOA 2J7GA 1V6UA 4MNJA 2HISA 3ARQA 2TAAA 2GDVA 2O92A 3T2QA 1ISVA 1TA3B 5E6YA 2Y8KA 3WH9A 3CHFA 4E4PA 1E6ZA 4ACYA 3VDBA 2WYSA 3AXXA 1RD6A 4PUDA 1BYCA 1VEOA 5C71A 1NOUA 4PMVA 3CIVA 3NDZA 4MAVA 4AY1A 1UR1A 1DP0A 3MS8A 4OJYA 3I3DA 4H8HA 1JIBA 1H3GA 3B8SA 1NWTA 4HTYA 3VINA 3GNRA 2A3CA 5AYBA 5LA0A 2XM2A 2WLYA 4U2ZA 3WN6A 2EPLX 3LPGA 2XIIA 7A3HA 1B3ZA 3MSGA 5BROA 3KL5A 4UOZA 5FCZA 2E0PA 4F9DA 3DDFA 3DHPA 4FK9A 4B9YA 5CZKA 4AZ7A 2J74A 2XVKA 2XFFA 5A94A 1E0WA 1BQCA 1TA3A 1XV8A 1JD9A 3BAWA 3GXTA 2NSXA 1V3IA 3WQ8A 1SMAA 4MTVA 3WH5A 1JDAA 4RE2A 3VO0A 4XZWA 5I24A 2UY2A 1UD4A 2XHYA 2CBJA 2YBTA 3D3AA 1QOXA 3WD4A 1V3MA 3H53A 3GH5A 3PZQA 1QWNA 3EJPA 2J7FA 4W5ZA 2DSKA 1CTNA 1UR9A 2WM0A 3CUIA 1UOKA 1W9XA 2Y2WA 1GNXA 1R7OA 4JKKA 1UWRA 4QFUA 3S5YA 3WF2A 1H41A 1CECA 2W4XA 1CGXA 5A2BA 1OWQA 4HA1A 1E70M 2XSAA 1XYFA 3UR7A 2ZXBA 5E1QA 1V08A 1E6XM 1EXPA 4TTGA 4PMNA 2X2JA 4ZXLA 5BXPA 1HVXA 4TX8A 2WCGA 1M03A 2J8FA 4UQDA 1CXEA 1GJUA 1GOIA 4PMOA 2E9BA 1UR4A 3ZJ6A 4Z2GA 2YDSA 1KWKA 2Q8XA 2ZE0A 4WKFA 4AZ6A 1UG6A 1TVNA 1J01A 4HMCA 3ARPA 3BSGA 3WF1A 4FLRA 4U5IA 2F2HA 4OZOA 1WP6A 3W29A 3EDDA 4DO4A 3SCOA 2CBVA 2DT2A 2VVSA 1I75A 1XCWA 1WZMA 1W1TA 2JEPA 1UH3A 3WFZA 3AIVA 3WEZA 3NSNA 1QW8A 3TTOA 1R86A 4IUGA 1KTBA 4M29A 4QLLA 3A47A 1F4AA 3K4DA 4D6JA 4HMEA 5I2UA 1NH6A 1UA3A 1Y7VA 2ZWZA 3ARXA 2BVYA 1E40A 1GVYA 2XWEA 5A6MA 5D4YA 3TTSA 3WY1A 3AMCA 2X2YA 2FE0A 3MMDA 5FIPA 4C7GA 2WMGA 1E6QM 2ZUSA 3FNDA 4FLSA 3SUUA 1JXKA 4OOUA 1Q4NX 1JZ2A 2WWCA 1TR1A 4EE9A 2CHOA 4CN1A 2O9PA 2X05A 5BWFA 3CH9A 1GHRA 2OWXA 3AHTA 3RJXA 3GYCA 1E6SM 4ZENA 3VIMA 3W6LA 3B9EA 3CUGA 1UA7A 2GFTA 2WKGA 2WBGA 1E3XA 1WNOA 1HP5A 1K9DA 3PZTA 3VX1A 3VOCA 3WNMA 4CVUA 1NOWA 1NARA 4W8BA 3FAXA 3MV11 2D0GA 1UUQA 5CPQA 4YN5A 4WLCA 1JZ3A 1V6XA 1Q6FA 3VM7A 4DWSC 1FHLA 4EANA 1QNOA 3ARWA 2V5DA 3AROA 3WD3A 3VIJA 1B2YA 3F5JA 2EPKX 2Z1KA 2A3EA 4F66A 2WC7A 1WE5A 1EO5A 4WJXA 2OWWA 1RP8A 3TOPA 1KXTA 3QGVA 1EDTA 2J7BA 3GDBA 4HPGA 1TFVA 1PAMA 4TTUA 3S6TA 4OBRA 5HOSA 2J77A 3RPMA 2AOSA 4ML4A 5EFDA 3KZSA 3VILA 5CPSA 4LGXA 5IFPA 5A2AA 4H8UA 3N04A 4J3UA 3RIKA 3AYRA 4JFSA 3HN3A 4P8UA 4CD6A 2FHBA 2YL9A 4U3CA 5FD0A 1J12A 3U5UA 3WNKA 1VRXA 4XZBA 4XUYA 3WNLA 2YFNA 4M24A 1E6PA 1LJYA 1LL7A 1Q6DA 5I77A 1V3KA 4GIAA 2WLZA 2A3AA 1UKTA 3VSTA 2XYLA 1KR1A 3D5HA 3PZMA 3WDRA 3CV5A 2EPNA 1OSEA 1NQ6A 4L4PA 3AYSA 2A3HA 2JE8A 1VEMA 1C92A 1XSIA 4C7FA 3OB8A 1W91A 1M7XA 1E1EA 2VNCA 4W85A 3RM9A 1BAGA 4C7DA 3APGA 1OGGA 5GNZA 1NM9A 3OZOA 5CLWA 5GNXA 2OSWA 4URIA 1QHOA 4UZSA 3WUBA 2ZX9A 2WBKA 4P7OA 3VDHA 1QVBA 5E6ZA 1VJSA 1CWYA 4K68A 2XJ7A 3PTKA 1EA9C 2YOCA 3BUDA 2DPEA 1WDQA 1B1YA 2E4TA 1E1FA 1W2VA 3N9KA 3ZSTA 3KWXA 4DM1A 5A1AA 1ZU8A 4GZJA 1NP0A 4B16A 4JFTA 3IJ9A 3EJSA 1BYDA 2GUYA 1B3XA 4JFUA 1DWGM 4UFMA 2YL6A 4DWSD 1TQTA 2XG9A 3FHQA 3NCOA 2VO5A 1PX8A 3SCVA 4Q7NA 1PBGA 3VD5A 1JDCA 1H0IA 2VX7A 3FXYA 4P8WA 3WEOA 4CCEA 2YJQA 3WQ4A 1VEPA 4RL3A 3TTYA 1CXFA 1OIMA 3FN9A 1C8YA 4PUEA 5IHSA 4WSKA 3VUPA 2J78A 4PCTA 3PZOA 3OLDA 2DIJA 3W38A 4BQ2A 3EMZA 5HDRA 2PWGA 1HXJA 4YHEA 1J18A 3BAXA 5BRQA 3CUJA 3K4AA 1BGGA 1Q6EA 4HZ6A 4GINA 4QDMA 1LWJA 3WENA 4LX4A 1FP8A 3W28A 3VGGA 1KXQA 1V3HA 4BQ5A 3WY3A 2DH3A 4GQQA 3AMGA 5LA1A 6CGTA 2V3FA 2WMIB 1IZKA 1GPFA 1HJVA 3L4UA 5KEZA 1E4MM 4X9YA 3WUFA 1W3JA 2XUCA 3T2PA 3QOKA 2E3ZA 2WCSA 1VBRA 1W32A 2FGLA 3GNOA 3II1A 2WXDM 2YLLA 2PWDA 3SCRA 1UR8A 4KH2A 4NZCA 3ZQ9A 4BA0A 2W66A 2VZSA 3THCA 4RE3A 5GPRA 4D72A 3PZNA 2BNJA 2UY3A 3VDAA 3BVTA 3AIEA 2BS9A 2WSPA 2FYVA 1BHGA 1J0HA 1U30A 5IDIA 1LWHA 3VGHA 3ZIZA 1T0OA 1GQKA 2J7CA 1E6RA 4P7RA 1R46A 1R33A 3BLKA 4FLQA 4PYSA 3ARTA 2V3DA 4J27A 2G3MA 3CZGA 4Y7EA 5TD4A 3MMWA 4JIEA 5IHRA 2CHNA 3WDJA 4AZCB 1AQHA 3WY2A 1BLIA 4NX0A 3HG3A 5A6JA 2WHLA 4JL1A 3L2MA 4X0VA 3AMDA 3T0BA 5HXMA 2JF7A 4LYQA 3CHDA 5A3HA 4PCSA 1C91A 2XSBA 4NRRA 4BF7A 4HZ7A 1R75A 1EGZA 2D24A 1VFFA 2DQXA 2J62A 2XVNA 3SUTA 2XM1A 4W84A 2G3NA 3VIIA 4JFWA 1XCXA 4AIEA 2EJ1A 2JEQA 2VI0A 3NJ3A 1JZ7A 4PMRA 4LQ1A 5EMYA 4UFLA 2JALA 3AHXA 3TTQA 2IXUA 2VZOA 3NDYA 4M80A 2CESA 3L4TA 3OLGA 3RCNA 5CSUA 3GXIA 1UWIA 4PSRA 1OT1A 2G3JA 3H55A 3TA9A 2A3BA 3EJRA 3BLBA 1KQYA 2CETA 3W24A 1HL8A 1RH9A 1XD1A 4JL2A 1CXHA 1V3LA 3LPFA 1NWSA 4WIWA 2CCRA 1UR2A 1UQZA 4PN2A 3DX0A 4WKHA 3WL1A 2XVLA 1WCGA 4FNSA 1QNSA 4E8DA 3VGEA 1O6IA 1NWRA 3OA5A 2WANA 2OYMA 3OG2A 3CUHA 2GJXB 3ARUA 3B9AA 2VZTA 2DH2A 2DSVA 1W1VA 2FH8A 3TP4A 3M07A 2EAEA 2HVMA 2J7HA 4CGTA 4B3KA 4JAWA 2ZX5A 3AS0A 3SCPA 1MFVA 3K46A 5DMYA 2J47A 3QOMA 5CG0A 4ZE5A 3SCTA 1E73M 1MQRA 1WKYA 2VR5A 3W0KA 1JZ5A 4UQAA 3PZGA 1HWWA 5ABFB 3T2OA 3WUEA 3CZLA 4MJ2A 3CC1A 3BUQA 1W9BM 2JIEA 4CCDA 3EYPA 1MFUA 2WZEA 3WNOA 3CTTA 3L4VA 5I0DA 2ZUMA 4JHZA 3IAPA 2Y4SA 1UD2A 1G5AA 2ZXDA 3NSXA 3ZOAA 1CGTA 1UD5A 3ZSSA 1F4HA 4PMZA 1QNQA 1FH7A 1WZAA 2F8QA 5AC5A 1LG2A 3A4XA 2QLYA 5I79A 1ISYA 3GM8A 3H54A 1H11A 5DT5A 2BV9A 3S5ZA 4P7LA 3SURA 3AIQA 1J9YA 2VCBA 4FMVA 5FOOA 3VIPA 4J3WA 2DSZA 1JGIA 3BVVA 1ZBWA 1W3KA 4NRSA 3L2LA 1I1XA 1ODUA 1ZJBA 1WPCA 1SR0A 1XRVA 4S3KA 3HJEA 3LRMA 1OGSA 4D6EA 2BXYA 2WSKA 2Z1SA 3VD7A 2EABA 1FA2A 2D2OA 3RDKA 3W53A 2OYKA 2XTKA 2XPKA 3VIKA 3QHNA 3AXHA 2WC4A 1E4IA 3RM8A 3G6LA 9CGTA 3AQUA 4D6IA 1TCMA 3BAYA 1YHTA 4TXEA 2E9LA 4U3AA 1EH9A 1UKOA 4MNLA 4BQ3A 5C8BB 1HJSA 1V02A 2XN1A 1V6WA 2B31A 5A6SA 3VIOA 3A21A 2BY2A 5E09A 3A3HA 3DYPA 3GXMA 4KRUA 4UQEA 3U7VA 2C0HA 4JHOA 3BH4A 4LYPA 3WL0A 3UETA 1MW3A 1PEZA 1U2YA 1KWGA 2ZXQA 4F9JA 5LA2A 3SCQA 1OIFA 1SZNA 1CGVA 1PIGA 4MB1A 1HJUA 4FNTA 3QR3A 2ZX6A 1WB0A 5I6SA 2GDUA 4ATWA 1GJWA 1W2PA 2WCAA 3ZJ8A 1TMQA 1PPIA 2XFYA 1KFWA 3AHYA 1ZB5A 4N42A 4UQCA 4N0RA 5JBDA 1JI2A 3M46A 1ZJAA 3G6MA 2G8ZA 5EBAA 3DX2A 4W7UA 4DUVA 3LPPA 2WMKA 4ZEPA 1KXVA 2NT0A 1GOQA 5A6AA 1UWQA 1B0IA 2C8NA 3BVUA 1E6NA 1GZJA 1E4NA 1B30A 3ARRA 5EFFA 1HIZA 1XH0A 8CGTA 4UQ9A 1BFNA 5A8PA 2D73A 3LMYA 1DWIM 2WW5A 4WSJA 1NP2A 2O9TA 3AS2A 1BGAA 2XIBA 4AD2A 1QWUA 3KL3A 1GOOA 3KLKA 3ZR5A 3GH7A 5AC4A 2O9RA 1GCYA 3FY1A 3WH8A 2F1BA 3SCWA 5A8NA 2QV4A 1JZ4A 2ZX7A 1BYBA 5GQBA 3BAJA 5CLTA 3GH4A 2QHAA 1WDSA 1GHSA 5C70A 4E2OA 3M7SA 4MAZA 4JZ5A 4GI6A 2OWCA 4H8VA 4DO5A 2PC8A 4QLJA 1KGUA 1JNEA 1BF2A 2D23A 1UD8A 2VUYA 3HMCA 1NWUA 4W8AA 5JIWA 1EO7A 1H1NA 2JFEX 3KEHA 4GZEA 4MDPA 3U57A 2VVNA 4X0NA 3HG5A 4UOQA 4PEEA 3WEMA 2YDQA 2J7EA 4QLKA 3ZT5A 3PTQA 2RGMA 4BS0A 1WZKA 1DHKA 2UY5A 3PTMA 4AD4A 1XSKA 3A4AA 4L4OA 5ABHA 1V3JA 3EDEA 3ZJKA 4A3HA 5DFAA 5DT7A 3VU2A 3VSVA 3VD3A 4H41A 1UASA 2XGBA 3L4ZA 1MW0A 4OBSA 2E8YA 4CN6A 2VTFA 3AIBA 4CCCA 3WBEA 5BXRA 5IXEA 2J75A 4NSBA 4D71A 1GONA
chains in the Genus database with same CATH superfamily
4JLRB 2JJSC 2NYYC 1EAJA 3NP3A 3FVMA 3OKDA 4L65A 1EO8L 4DKFH 4DEPB 3K3QA 2B0MA 3M44A 4RAVA 2UWEE 1QVOA 3MB9A 3S5LG 4LWWA 4L5ZA 3EGSB 3VUAA 2G4FA 3NDZE 4IH3A 2WZ6A 1U8KA 1XRFA 4FX7A 4E9SA 4HLZG 3MRDA 1A5MC 7TIMA 3RJYA 5JNYA 3W1UA 4KKCD 4I3RL 1GQIA 3YPIA 3M0MA 1XR2A 2GVGA 3K8LA 4H04A 1O6SB 3AOFA 3QB7C 4A6YL 4YBHA 2X3AA 4Q9QH 4A7SA 5JH1A 4HS8H 2IPJA 1E9QA 4XOEA 4O1AA 1PMYA 3HRPA 1JVKA 4M93B 4HK0A 4XPHL 3GJEA 3STZA 4BFJA 5E6IC 1HIML 4IDJL 3N41F 1N8ZB 3BLEA 2X4QA 4U1JB 1MRDL 2QVFB 4GO9A 4LARL 1D5IH 4WY7L 4S0SD 5KSVB 4ZA0A 2CDEB 1B0GA 2BY1A 3FSOA 4MD5B 5G4NA 5EU3A 4UOW1 1JUBA 4NGHH 3QKEA 4OTXL 4R83A 1ZUAX 1DTNA 4LBUA 4Z76A 4IIZA 3W3OA 1MCNA 2X53A 5GS2H 3LLXA 4BKLB 1IAOB 5D1QB 3WY4A 3VCLA 4PC8A 1VPYA 4YZWA 1CZ8H 4ZNEA 4PH6A 4YHIA 1DQLH 1ZLWH 1GVEA 5GRZA 3O6AA 4KWUA 2D9QB 4QEEA 3QJTB 3NVQA 4BF5A 4HCGA 4F2EA 2BGQA 3VOGA 4XP9H 4LXFA 3EFOA 3GX9A 2DLFH 4CNPA 1R4XA 2QMKA 1J9RA 1SXNA 5FLUA 4R96B 1JPDX 1NCIA 1OT2A 3S2MA 2A6KB 1XLKA 3KDNA 1EIXA 4JNZA 2UZXB 1KBJA 1KY7A 2EXWC 2VW6A 3HG1D 2IVFC 5EKYA 3Q8CA 1KJ2H 4AIUA 4O13A 3TO4A 4UV7L 1HCZA 1PZAA 3W11D 3LZFH 3WTUA 4O02A 5G4MA 2PW2B 3CCHB 3L5XH 3IE4A 3H42H 3WCZA 3OPUA 4PLJC 4XPGH 3DFPA 5J11C 4YL2A 4XTRD 4NERA 1VENA 4A8RA 4QXUL 1DHPA 4X6DF 3O9NA 1AZ1A 5I3FA 5TJWK 5DYFA 4LRIA 3EIFA 1XB8A 3RY5A 2DBLH 3WDQA 3VAEA 1XGQB 1N19A 3ZLFA 1TUPA 5CEZE 2YWZA 1XZWA 1YEEH 5AB1A 4NQCD 1YYML 4DWSA 3KPTA 3F5WB 1O68A 1CPUA 2E40A 3CO8A 3WXVL 4M48H 4MNGE 4QTHA 2KZWA 3RUGE 3LM7A 3WFBH 4MBOA 1BDYA 2W91A 4FA8A 1P0EA 5DLLA 1IBHA 3EOTL 5DA4A 4U1LB 3G6JB 2F8OA 3CZSA 1IC7L 1SN5A 3MV01 4Y7OC 4JHAL 3LIZH 3KOZA 1PXGA 1QNPA 3IS0X 4Z8FL 2ZUVA 3WTWA 1QLEB 3MKVA 3ZBMA 1S5VA 1MRCL 1HXYA 2ROYA 4G7VH 5GGVH 2AL1A 2CDFA 4S2SB 1VKFA 1TO4A 4W9CC 3MA9L 5C0BA 2G60L 5DZAA 4K3EL 4RAUB 1YEGH 1WOAA 3FJ4A 5D7SL 4Q22A 3T08A 2NY2B 1TVPA 4OU1A 1BWMA 4HKJA 1WICA 1V7AA 4PLKD 4JKMA 4PWEA 3SDAD 4Q7BA 1JBJA 1J96A 2BMKA 1YE4A 2OBGA 3O4LE 3Q3GA 5M5DA 3IXTB 2EP6A 1Q6OA 4JFZH 1LBMA 3AUWB 3ZDWA 3LSBA 3PAVA 3LCLA 1ITXA 1HS6A 5A6LA 1VJZA 2IFGA 3CDGA 4KQ3H 4UIMB 2Z8SA 2NRDA 4MWFA 2QCGA 3PUCA 3UEQA 3INUH 1Q94B 4AIXA 3ULUF 1IEVA 5K4XA 1RJYA 3K8MA 1FCVA 3GLDA 4K3HA 2G5BB 5DGRA 4L9LA 1WFOA 2A79A 3ALGA 5KZDA 1TJ1A 4AQAA 4LV4A 3F5LA 1FIEA 4UUIA 4YDLC 4AZ8B 4H13C 4TSCH 2NQ5A 3BLIA 1REIA 2XNAA 4XCCH 3OZPA 4QJ5B 4FJYA 15C8H 3AXIA 4FJZA 3UQNA 1Q6LA 4PY7B 4H7ZA 1OK4A 3UYCA 4ZS7L 4IPLA 3L45A 3JTTB 2EIKB 4XN2A 3IDJA 3LKOA 1CGYA 3W2LA 2WQDA 3BP6A 3QXAA 4N8VB 3AABA 4QF1B 4AEOA 3BVWA 3F04A 3L3KA 4L9ZA 4X6CA 3CPUA 5EC1B 2AJZB 5KITA 1OFRA 1ECQA 2QIIA 1E3ZA 3EYSL 2V37A 1HYRC 1OWWA 2R29A 4JFHE 3MA8A 3LNIA 3M5YA 3TBYB 3OLIA 1RZGB 3IGUA 1B3YA 1O1ZA 4GKLA 1J88A 2PW1B 2CA4A 2WVTA 3MLZL 1EGJL 4JLRA 5DXWA 4BFEA 4Z3JA 3VD2A 4US6A 1I1AD 4NM4H 2J8UE 4PJ5B 4LSSL 2FGZA 3CDCA 4QS5A 3ABLB 1UTDA 3EGSA 4YSCA 2CO6B 4QHMB 3KBJA 3QFDB 4DPAX 3FFCB 3M0LA 4PLNC 5D2VA 2I5YH 2D3LA 1IE7C 3NL6A 2VLRB 3LRKA 5GSRB 1GYLA 2Y7DA 2A5UA 3R4DA 5I1IL 3MDUA 4N20A 4IBSA 4BCZA 2O0TA 4YPGA 4MWAA 5C6TH 3V5HA 3PB2A 5G2IA 4WTZA 3MCKB 4GXUN 2O5ZH 4YDKH 3SDCB 1O6SA 1JRHH 4FX6M 5J1SC 5E4AA 1ADWA 1M9WA 2ZOTA 4U1HB 2XUWA 2WZAA 1AL7A 4WCJA 2QADC 4F9PC 3WIHL 1R2TA 4X2UA 2W62A 4G82A 3EGDB 3UTTE 3EO9L 1MZYA 5DEFB 1N5YL 1CENA 4R7OA 3IWPA 5BS0B 3JBG7 4PY8J 3RFAA 4PJFB 2ACSA 4U1JA 2DQMA 5DC0A 2CNCA 5J8OA 3P14A 2CDEA 5ABDE 4BSJA 3SE8L 3GBDA 1J0YA 2AEQL 2E9MA 4LBSA 4FOKA 4MD5A 4ODHH 3BLPX 4Z18A 2BDNL 3LYRA 4A7VA 1ZENA 1O4UA 4G8IB 4NJJA 4U1SB 5JA8B 1EOKA 1F07A 3N85L 1IAOA 2KERA 5ADOL 1WAEA 3VXRB 1P4IH 4KRZA 1I8MA 2VMFA 4OUEA 1F86A 5JQ9A 2ZWKA 5G1YA 5HYJA 2AABH 4AYMC 5DSCA 1D7FA 2WXLA 4M81A 3CJPA 3WUGA 4LUYA 4YGVA 4QWWC 1WUEA 5GVJA 5GZOD 2FQEA 2ZUTA 1WFIA 2DQJH 4OIAA 1PS3A 4C1LA 4I77H 2XSKA 4RMWA 2OTPA 4I7UA 2ZSWB 2UWFA 4ZB5A 1KBVA 3IDNB 4ZO8A 1QLRB 2LVEA 5JVLA 2C9XA 1V7NH 3KMDA 3RYSA 2VD9A 2X7VA 1VACA 3M0IA 3WFCH 4KMTL 3D50A 3DK2A 4MVBC 3T8VA 5FKAA 2PLKA 3GXFA 3T81A 1KFGA 1KPRB 5HNNA 5DK3A 2N3JA 4UUJB 2VISA 3FFSA 4YR6B 1SZEA 1U1JA 4XXWC 2PW2A 3CCHA 5FO8A 3VDBA 3M5XA 5DX7A 2YRZA 3FH8A 1BSLA 3P3YA 5C6WH 3GBLA 4UU9A 4LVEA 5MF5A 1DE4B 4MDJB 5JIKA 3EPNA 3SQOH 3SIZA 2ZYHA 1MCSA 3GNRA 2CIIA 4W9IC 2LAGB 43CAB 4GW4B 2XIIA 4IMKC 3QSTA 1XGQA 2KH2B 2F74A 1VF5C 4J39A 1MIEH 3S7GA 4FKKA 1JWUB 3ZR4A 4K5OA 4DFIA 1J1XH 5GS0H 3F5WA 5JHMA 1Y5VA 4QNEA 4IMLB 2JQMA 5AHEA 3TWCL 3AQDA 1F3XA 1I85C 2DQDL 3FTZA 3NSFA 3IWVA 5IGXL 3SYQA 3PZQA 3U4EA 5LJYH 2FBJL 5D1XC 1RK5A 3QWNA 1SEBB 3C5ZB 4XG1A 3NGBC 4YC2C 4IP4A 4U1LA 1OWQA 2YD0A 1F3TA 3G6JA 1LGVA 1TDQA 4OFYA 4DGUA 2VLJB 4RSVA 3CVIH 2V0TA 2HRWA 2F38A 1P5BA 2H3DA 4R7WA 3QPYA 1UR4A 3VXUE 1L9NA 3MOAL 2ZE0A 2EINB 4B9GA 5D1XE 1L6WA 1ZTXE 1NMAH 3TYFB 4FF9A 5I75B 1UH3A 3N9GH 4EIGB 2Z24A 1XIJA 4QHKI 4D6JA 1NH6A 3GQYA 4HIBA 4HLZH 2GUBA 3P11H 3AC0A 3TJLA 3SPVB 4ZMPA 4Y19E 4TM9A 1SU5A 2PODA 3KPMA 1AW2A 3BGJA 4C60A 2A1YA 4FQIL 3ABGA 4QT5A 3EKZA 1D6EB 3LSCA 3QPXL 3UPRB 2WIMA 3RJXA 3UYIA 1JPKA 3GYCA 2EEDA 1E6SM 5EEUA 2XWZA 2GOUA 2Z65C 5FB8A 3CXHK 2WBGA 2B7DT 4UIMA 1S9WA 1Q45A 1D7KA 2GYSA 2ZTKA 3K6SB 3CV7A 2YXOA 3GDKA 2BW5A 1OCCB 1AC6A 4IIGA 5JHDE 1TFPA 3MP5A 4PFEA 4JM2B 3ISIX 3W72A 2G5BA 4W9JC 4G56A 4WJXA 5LGJB 3BDYH 4H9XA 5F0LB 4E42A 4HJFA 4AZ8A 4XI5D 1ET8A 3EYVA 5F93C 2SODB 4JRYE 4IK7A 4M03A 1R3YA 2FHBA 2PTUA 1DJXA 4PY7A 1BWWA 2DW5A 5KAQF 2QQNH 1CLZL 3GB7B 3UWEA 3CMOH 3CV5A 3JTTA 5CILH 3AYSA 5CCKL 4FQCL 1URZA 4GSUA 4PM1A 2K9FB 1KLYA 1S2VA 4N8VA 4C7DA 2R23A 1LO4L 1UJTA 5F4SA 1N0XL 3WUBA 2LW3A 4KWOA 3ITYA 2AJZA 3PHSA 5M94B 4IQHA 4KKNA 4P2OD 4KY2A 3QUZD 1MJUH 1RZPA 3L48A 1EPXA 3HEIB 5ISZB 2PCEA 2OX1A 5FJOA 3HG0A 1NELA 1YUHB 4RV8A 4HWZA 4ELMF 5LWYL 1Q65A 1SJBA 4WOZA 4XZMX 3TXZA 2I1OA 2OMNA 1RVFH 4XR8C 4O9HL 4UFMA 4PJ5A 3NCOA 2PDKA 4IS6B 4NNBA 1PBGA 4HCRL 1H0IA 4UIOA 3W2UA 3RFZC 2X4PA 4DP4X 1DJGA 2CO6A 3KPNB 1PO9A 1SHMA 3FFCA 9RUBA 4NKQB 2WBJB 2IPUK 1K8ZA 4NZDA 4A6GA 3DKHA 4U1KB 2Z8VC 5GSRA 4Q9BA 3GTHA 3ZDXF 1M71B 5CZXD 1JFQL 5C07D 4HZ6A 4BEUA 1V10A 1M2VB 3WENA 3ULVD 3FBKA 4ZFCA 3MCKA 1IC5L 2WMIB 4F0MA 3PHQB 5FYKD 4AM0A 1QR1B 2R0LL 1K4DA 4MZ8A 4M43L 1I9IH 4QHUB 2HH0H 1OLZA 3UFIA 2WLLA 1W32A 4U1HA 4K8EA 3PFRA 4X80H 1M1SA 4AV0A 4PRPA 5IMKB 4AKQA 4KK6C 3O6ML 4JZOB 1UYWL 1B4KA 1I4FB 1E27B 1QWHA 4F8OA 5IDIA 4DXVA 1F6KA 2DM7A 1TR7A 1Y0LB 1DXEA 1XXFC 2E1DA 3OQ3B 5LKYA 4PB0H 4DEFA 3WTXA 5EH1A 3MV9B 3NK3A 2EG7A 3PAJA 4G8IA 3MRQA 3E74A 5TE7H 1XR8B 1S6NA 3OA3A 4GMTH 3ECBB 1VFHA 4OU3A 1IGMH 1L8PA 3VU1A 3UZYA 1P1MA 2Y63A 5HQEA 4RR4A 4PYGA 2DZTA 3EOBA 5DJYB 3SYAA 3GG0A 3LQAH 1MI3A 1TWSA 1GKEA 2RIKA 2WY3B 1NDYA 2HJKB 4HJGB 2CZNA 3W1AA 3LLDA 1LP6A 3KOFA 2GITB 2BERA 2ZG2A 3TP4A 2H1PL 3BP5A 3DETD 1G7PA 3NXFA 3IUDA 3K0YA 1FV1B 1J9CT 1EP2A 4RDQF 4PU2A 3U4BH 3C6SA 1O9VA 3S46A 1J6OA 2DM2A 3MO1A 2BFVL 3WJLA 1AZCA 5C3LD 5I0DA 1KPRA 2XQBL 1G5AA 3VNDA 4UUJA 1SO6A 2YXVA 4YR6A 1FH7A 3KG5A 4L4VD 3OVUB 5B1CA 3B0PA 4Z7VE 2C4FT 3QC6X 1ISYA 3SN6N 5DT5A 4WW2F 2Q02A 4AE0A 3M5VA 2FT6A 1QACA 2P5NA 5C09E 4LCWB 1WFNA 2PRMA 5G5DB 1U6AL 4ZMGA 1FRBA 5I8EA 3MBXL 3S3SA 4GK8A 4WV1A 4QRRA 5KVFE 4GX9A 4Q8MA 3CM4A 2X1SA 43CAA 2OXHB 1GZ1A 4JFDD 3B9KD 1WFJA 3D85A 1MI5E 4XO4A 3L3DB 4GOAA 4IMLA 2CZ5A 1T0MA 1B4EA 4AQ1A 3SE4C 3WUZA 1KN4L 4RXGA 3OG3A 2I56A 5C8BB 3STLB 4JW3A 2N59A 4MZRA 3LBCA 4GWEA 3SM0A 2IANE 5U7SA 1PG7X 3N3MA 1KWGA 1OK6A 1SEBA 3E9UA 3SCQA 3KH3A 1SZNA 4MB1A 4YXKH 1BJMA 3OC8A 3M7OA 3HPSA 4AJWA 3FIGA 1KFWA 1TTFA 1Z6JT 2VLJA 2G8ZA 5EBAA 4W7UA 4QHNA 2OX5A 2FIKB 4JUSA 2DICA 5IB3B 4HCLA 1NC2B 1KKOA 3ARRA 5GS1A 4QXIA 4OD2B 2F5AH 1U22A 2DQWA 3SOTA 1BYBA 6PCYA 1T5WB 1WDSA 1F3JB 1IM3B 4P3CL 1QUNB 2CJ3A 1BZ7A 2WSDA 4DO5A 5LVEA 1RBAA 1S7XB 5F7BA 4A3UA 3AB0C 3OTTA 3HMCA 2V6HA 4W8AA 4U1NB 4NILA 2IKGA 5AC8A 1WCQA 4XBJA 2R4SH 3ATBA 1I1YB 3KR3H 3X2QB 4M00A 1UUNA 3TA3C 2W59A 4DOHB 5BJTA 4HJUA 3X1GA 4UT6L 3KGUA 1D6EA 1MCEA 3S4SG 3UPRA 2WUCL 4Z77A 4UTMA 3IV3A 1PL3A 1CB7B 3N50A 3QEGH 3PWNA 4WFEE 3V4VB 1M7DB 5MENB 3K6SA 4KEVA 3GC2A 3AT8A 6XIMA 2BNUB 2H1LM 2EO1A 1IMHC 3VKJA 4Q7IA 2DLTA 4JM2A 3WD5H 4XCFH 1II4E 3Q6FB 3U6WA 4NCDA 2PRHA 1HX0A 4X9GA 5HDOA 4INFA 3RKDD 3DPDA 2QMJA 5EU5B 3V9EA 3X11A 2VFHA 2H2PD 3JV4A 1SFLA 5E4EB 1I1RA 1FUYA 4NQDD 2VDKL 1JF5A 2R56H 2CFFA 2YC1B 3ANVA 3BSHA 4YEEA 5D38A 5ICZB 3HC3H 4ANXA 1SFTA 4LSPL 3S5LB 5CGTA 1TV2A 2EPHA 2IQ9L 3CV1A 4Q14A 1SMDA 3B8VA 5ECUA 3N13A 2PTYA 2J8GA 4TV5A 3JV0A 4M5TA 2VFGA 3O6LL 3RP1A 3P4MB 3KLHD 2BOGX 4ZUUB 2Y9RT 5E8PB 1L0QA 4JAMB 4TVDA 2A6JA 1POJA 4JG9A 3REQB 1FGVL 4JO1H 4IIQB 3RHGA 1BX2B 1FOBA 3SJVE 4L1SA 1J11A 1JQXA 5FYJD 3UXDA 4FQJL 5I30H 1JGUH 5EUOE 3S2CA 4BFGA 4ZR8A 4DYEA 5KSBE 4MFEA 5ISZA 2AQ1A 5D9NA 3KHJA 1I6NA 3FB6B 4UFJA 4L6HA 2W9MA 2DWTA 2Y88A 4X8CA 2WJDA 3VI2A 2K3HA 1DJHA 2WWKO 1L8NA 3KTSA 2F53B 1KG0B 2GBAA 3V0VA 3KPNA 4LLQB 1JDDA 2D3NA 3BZGA 2WBJA 2L3BA 1KENH 4PTUB 4U1KA 1XUZA 1WDWA 3ORJA 2E5BA 2R1YA 1M71A 1P5VB 1UQSB 2J25A 1M2VA 1F6FB 4R5VA 3HNVL 4P49A 5IZ7A 2BIQA 4ICWA 4UZUA 3B04A 3KPRA 4WTXA 2A9MH 2WMIA 1OYAA 3D06A 3LSOB 1BG4A 3PHQA 1W5MA 3G1XA 3AREB 5CJQH 1QR1A 4BH7B 1QFWI 1X4XA 4HUXB 1FH9A 2VZVA 3RBGA 3QV9A 5I6OA 1JZ8A 1JZHA 1MKFA 5IMKA 4EI0A 2E7BA 3FO0L 1G5GA 3NQGA 1I4FA 3W1XA 2BGNE 1C90A 4LQFH 1T21A 3I9IA 2ZAHA 3NJGA 1EQCA 3FQ1A 2VM9A 4U4IA 1KBPA 1Y0LA 1KGJA 4NXKA 5HI4C 3QC3A 3M0ZA 2ZSVB 3FN3A 4TOQA 3QG7L 4XO8A 2O72A 4Y9OA 1TELA 1LO5B 2Q5BA 1F4YH 3SB3A 2E9IA 1KB3A 2WZTA 5I3DA 1KIRA 1RMFH 5E6UB 1R0AL 3HMXL 2XN9B 1XR8A 3BVXA 1QT1A 4NRYB 4MB4A 3SE6A 3MANA 1DVXA 1VGEL 2AK4A 3MNWA 4N8CH 4MYAA 1NFKA 4NO2B 4FP1A 2Y69B 2GJ6D 3HE7A 3GI8H 4KJQD 4P2QD 4UCGA 5DJYA 5H2ZA 2BC4A 1JFXA 2NDFA 5E03A 4IIFA 3GIZL 5ILTL 4WF7A 2RHGA 1T1WA 2HNEA 1MREH 4LLUB 3O3DA 2QJGA 4A3YA 4NCC2 5CCZA 2B7NA 2X3CA 2YOAA 3IRCA 2F54A 1ZA3B 5FYLH 3W70A 3QZBA 4A7GF 3BTNA 2BXVA 3VOJA 2FZBA 3QEUA 4XWOD 3EFFA 4BSWA 3VGAB 3WNIA 3QUYD 2FATH 4LEXH 3A6CL 4C5YA 4FG0A 4YAQA 4MAYA 2D7OA 4ZFGL 4UTBL 4RESB 4YDJB 2YRLA 4X5XB 3UZVB 4LPWA 3OKNA 2AGJH 1OL0A 3WN5B 2DIAA 3NIYA 4Z7QF 2P5EB 2CHDA 4KAQH 3EB4A 4LU5L 5C55A 5G5DA 2GJLA 2QUUA 2VLMD 5C08E 1GJIA 5TE4H 2VXVL 1IVLA 1K2DA 1AKJD 5DHXB 3T0XA 1AI1H 5ESQA 4C6JA 3VXSD 3SY6A 3VIHA 3L3DA 3OKLA 8PAZA 1YKWA 1F90L 4JYDA 2J2ZA 3ZUNC 2PXYD 1AXSB 1QFPA 3IJEB 3QHTC 4OCYL 4FZIA 1EUTA 3S3CB 2DGAA 3OVQA 4HU8A 4JZJC 2EO9A 1DBKL 1EJVC 4GKZB 3CH8A 2ZDSA 3L3GB 1XXDC 5C0CB 2CALA 2EDKA 4WGHA 1U1UA 1DVSA 4N2KA 4W8LA 4RJEA 2VDRH 3EPOA 3QS3A 4R8WH 5J5EA 1Y5XA 2FIKA 3MROA 1QXLA 4N2IA 3TURA 5BWAA 5IB3A 1XTMA 2YFOA 1NC2A 4HS6B 2OFJA 4PRIE 3UG3A 1EGMA 2Z27A 1N82A 1FL5B 3Q2DA 5J3HD 3SCMC 4DIXA 1UUSA 3IARA 3T3MB 4R97B 5IUSA 2G4GA 5AQ0A 1F3JA 1IM3A 1G7HA 1M9SA 1QUNA 2W9DL 4S10A 1O75A 4KPHL 5F9WB 4U1NA 3QJQB 4NO5A 3ULVF 2AAAA 4NN5C 3BGFC 2A1WH 4QOKA 1HN1A 1I1YA 4YFEA 3MNDA 2DIKA 4ZTYA 4Q8BA 1IF2A 5BRZD 3PJLA 3IVKB 4KY1L 2G37A 4HK5A 2W95A 1E50A 4XCYB 2X42A 5D72L 2ISWA 4JQ1A 3V4VA 2FB3A 1JWSA 2X70B 1R9XA 5FO9B 1MVUB 4U7SA 2DPKA 3ESOA 3MJ9L 4Y7MA 4XXCC 4GJ1A 1SSGA 3Q6FA 3E5PA 2XSXA 3GTXA 5HMFA 4WKAA 4WI9A 5B7MA 3NO3A 2F5BH 1JG9A 5M3WA 3X1EA 3ULUD 4JG0L 3UJFA 1PZSA 2C1PB 2EPMX 1AR1D 3AMLA 4H26A 2YC1A 4X6FB 1WLHA 4LF1A 3KFTA 4XP1H 5DHYB 1HOEA 3H2NA 5PTDA 4UCFA 1DQDL 4ADJA 1KM6A 4R2GC 1FWWA 4P9HC 3NM1A 4BBWA 4OW6A 1FH5H 4GQPH 1ZSDA 4N2CA 1TE1A 1N6QH 3VE9A 4DCQB 1FWXA 2PBOA 3DX3A 4AV4A 4U0QB 5IVXA 5E8PA 4JAMA 4PW4A 3L1OH 1E3FA 3REQA 1RY7B 4IIQA 2J1ZA 4F5CA 2Z7WA 4N26A 3FHAA 2VRAA 2EDLA 4GT7A 4J3VA 4NJIA 3G3DA 4NKIL 5DRXB 1H09A 3H4WA 3BRFA 3APFA 3ZU8A 4JR5A 1A66A 2EQDA 1WAAE 4NSKB 5EA9A 1TPH1 4HG4K 2YD8A 5DMMA 4EVNA 1XKJA 4GI4A 4F3HA 2ZIDA 4XD6A 3HC0B 4PGEA 4WUUD 2C26A 1L9TA 4Q6YA 2E6JA 3B6SB 1AD9B 2N56A 4MHBA 4HJJL 5HPOA 1OC7A 3SPCA 1MJ7H 5DD3L 3MI6A 1UWXK 2Q2EB 3NIGB 4Y9AA 1HXKA 3WIAA 4MKVA 3VFPB 4Y9EA 4L61A 4CJ0A 2N1TE 2ALRA 3E3QC 2P0OA 4HUXA 3UVAA 4L5FL 1B6DA 4JM0A 5BNXD 4FOMA 4BFBD 3BKYL 3W27A 3V0JA 3GRWL 4Y16B 3VNYA 4OJAA 2R1LA 1SYTA 4PSPA 1BOGB 4Y5XA 1YPZB 4KEUA 1DL3A 4NC0B 1OQFA 2VYOA 1TJXA 4QDWA 1HI6B 4CQBA 1RZKC 3LD8B 3E3QE 5H94B 2WD0A 1LO5A 2J24A 4P4KC 2CG9X 3EO0B 3QEHB 3QDGE 5C71A 4UT9H 4FQLH 4L8BB 2O5XH 1FFOB 1NVMA 3HFFA 4PV8B 2QCDB 1NWTA 5IKCB 4N1CA 1EXBA 1M05B 2CGRL 1F0LA 1NBYB 5JORA 3MSGA 3KL5A 2J7LA 4NO2A 5C2BL 4G42B 3U2SB 5DD6A 2YGYA 1AC0A 1NAL1 4GGHA 3FTXA 3LV3B 5C8JB 5CJOL 2V5RA 1QOXA 4F8LA 4LLUA 3JWNC 2R2BB 4W5ZA 2PTXA 1ZA3A 3SQLA 3EOAA 5IW6B 2Q20A 4JRXA 4YE4H 1L9WA 2ZXBA 1IE4A 4OM1L 5BVPH 4JTFA 1LK3H 1CG9B 1FE8H 1E6XM 3T9PA 4TIMA 3G5ZB 5D7IB 3UZVA 4AGPA 4ILSA 2CCLA 4XBPA 1AGCB 2MQCA 3JWNE 3NABH 5CJMA 4M6NL 4F1SA 1SVDA 4M1GH 1KOAA 2P5EA 3ARGA 3O1NA 1ESOA 2B77A 4HWUA 1Z3NA 1R86A 5FDWB 1R2SA 4QYOB 3ITCA 3TVMC 3VRJA 2AXGB 4Y1AA 5A6MA 5CHNA 3AMCA 2FE0A 2WKOA 2ZUSA 3RX9A 1JZ2A 1KCRH 5AECA 1WBYB 4JGMA 1RQ5A 2XZAL 3IJEA 3GDRA 1G9NL 1KC5H 3NQMA 2LOEA 2HAZA 3M6YA 1HOCB 2FB2A 3B7YA 4GKZA 1AMXA 5DRNB 4DN3L 5C0CA 2EIZA 4W8BA 5KS9E 1NMCB 3WLNA 2DQGL 3PUOA 5LCVA 3T71A 4JZNB 3VH8B 1FRGH 5DK0B 1UVQA 2DDQH 3EHBB 5DS8B 1GYMA 5L88H 1FVDB 1NMBL 4S1QH 3OX8B 4EN3C 2R0WL 4HS6A 4O0KA 3VILA 4YSUA 3I6TA 5IQ7H 2BP0A 2BSTA 4Q8VA 1A7PH 1FL5A 3Q01A 2MCG1 3FQNB 1TPEA 4ZPTB 4WO4D 4IL2A 4I7VA 3WE6B 3VUSA 3PDGA 4XZBA 1EFXA 3C6CA 2MOGA 1Q6DA 5AN7A 2DD8H 2DBJA 3BEWB 1L6XA 5LUMA 3DV4B 1VPXA 3TN0D 1A5KC 5G4WA 1PZBA 4V1DB 4L4JA 1H5YA 3KPOB 4PJIB 4ENZA 3QNXA 2Y62A 3KDOA 4IBYA 4OGYH 5ECGA 2MQ0A 3T8MA 1PQZB 1HL2A 1D9EA 2POZA 2LU5A 3AY4C 3L54A 4EXQA 4I0PA 4LMQI 1VCAA 3KXQA 2NNAB 1WDQA 1Q0XH 1H60A 4XCYA 3OODA 2P52A 4XC3H 1Z42A 4P46B 4PI2A 4DBDA 5FO9A 4DM1A 3TYUA 4MXVE 1Q4WA 4IU2B 4B16A 1ZHLB 2Y70A 3VC5A 4RRPG 4HJTA 1G43A 3V0AC 3UA4A 1FG9C 4FAAB 2IH3B 4Q7NA 2EILB 1VEPA 2C1PA 1C8YA 1NEYA 3PZOA 1FNGB 2Y89A 5AENA 4QKXB 1CB2A 2PDFA 3I7SA 1J5OL 4X6FA 4OT1H 2KI6A 2F2KA 4C6MA 3OGCB 1FP8A 2YB1A 4GQQA 5GGQH 2OEKA 2E47A 4KQ4H 4PL2A 2Z2UA 1E5CA 1I7ZB 5EU6D 2V4LA 2QVTA 3RWCB 3VOFA 3NQ8A 1RK1A 3RB7A 3THML 3DU0A 3CAWA 4US5A 3BWSA 2FGLA 2NUWA 3II1A 1UXSB 3SAZA 1NUDA 3DVNB 3L7FB 2VGIA 6XIAA 2EDXA 5LXGL 4PMJA 1A9VA 3MLXL 1LO2H 3NFNB 4U3SB 3AIEA 4YSTA 2WSPA 1SOQA 4PJAE 1MFDH 3CBKB 5D1ZB 5EOCH 1NDMB 2G2RB 1R46A 2VCOA 3S2JA 3BLKA 43C9A 1IBGH 3QJXA 5JTWA 2CO2A 4TLKA 4Y7EA 4JREB 4L3EB 2GTWB 4ERGA 1NPNA 4NAEB 3MHFA 4ZCWA 3GBML 4ERSH 2Y5QA 5HPMA 2PC4A 1EP1A 3HC0A 4FQXC 1R6VA 1ORQA 3PGCB 3DXAD 5L4FA 4HZ7A 3S88L 1VFFA 1TYRA 4UQ3B 3T0CA 3ZYOA 3NP4A 1AD9A 3DFHA 4IMAA 3FU9A 1IGFH 5EMYA 5IFJB 4JTHA 4WQ6A 2CESA 2G3JA 4JDVA 3AFLA 3H55A 3NPSB 1WA1X 3R4RA 2JV6A 4WIWA 3UGVA 4B4HA 2ZJSH 4JPKL 4LNCA 3EH2A 1P0NA 3FU3A 3XISA 2GSGB 2XVLA 4HKBA 1QSZA 4Y4KD 1PYWB 1NWRA 2E6QA 4BZ2A 4DGIH 4IICA 4NT0A 1LOLA 2FBRA 5D30A 2Z1PA 4B3KA 3LGDA 3QJVB 5AKVA 3P77B 5BO1L 3TFXA 1W31A 4GCXA 5AL8A 3GHBH 1EJWC 1WKYA 4U28A 3UTSD 1RU9H 1FH2A 1YPZA 5CAHA 5D8JH 4BWUA 4E38A 1F3WA 5DRZA 3P80A 5K7JA 4F1ZA 1U3YA 1MFUA 4XX1G 1DBJL 3NGJA 5JW5A 4YSAA 3UCRA 4G1EA 5CJXA 1VHNA 2XV3A 4G8GA 5H94A 3R06B 4WENB 4ZFFA 4OZ4B 3DG7A 4NIRA 2DYSB 4DAGH 5TE6L 3B97A 4P7LA 9XIAA 1T20B 3QEHA 3W75A 5D6DA 3CE1A 3VFOB 3F64A 4U0RC 3VIPA 3RG1C 4L8BA 4ALAH 3QV8A 1FFOA 4PV8A 3PG9A 4AEIL 3TT1H 5IKCA 3DNKA 5DMKB 1M05A 1MG2C 4XHQA 1NBYA 5C9WA 4LS0A 4G42A 3ZZLA 3U2SA 3BOXA 3FA3A 4CADB 4LHJB 2W07A 4JTDA 4ERIA 1CDCA 3H2OA 3ZKXC 3S35H 5DK2B 1SO4A 3PIQA 1OAKH 3LV3A 4RZCB 3BD4A 5HHVL 3S48A 2JKJA 2I60L 3N2MA 3UC2A 3BFWA 1WWWX 2R2BA 1XLLA 3APTA 4PJXF 1HFBA 1H3PH 2C4XA 2C7UB 1PLAA 2FVLA 1JGVH 4W9KC 5DVPA 4Y4HC 3GW3A 2P80D 5IROD 4NN6C 2B0SH 4WR3A 3H2MA 1I8AA 5DUMH 4ZOBA 1AD1A 4TYUA 1O12A 1QKZL 4RNJA 1CG9A 1UIPA 3SGDI 1S2CA 3GLAA 4J8RB 3DX8B 1IAKA 4HZAA 3OHXB 3LPPA 3O6KH 5D7IA 4U6YB 1SFDA 4JDBA 3FMGH 4J12A 1AGCA 1XH0A 1ET5A 1QPQA 4LHUB 4MNQA 5JU6A 1YMHA 4XAZA 2R9RA 3TEWA 1E8YA 2QHAA 4JIQA 3WBWA 4KF1A 5C70A 5FDWA 4QYOA 5PAZA 3OF6D 4IL0A 1N55A 3R7QA 3BDBA 2CLHA 1HHGB 1S3KH 4KCWA 1GMIA 3C2AL 4QTIL 1T6VN 1AL8A 5D2LF 2X89A 4QRFA 2Z4QA 5DN1A 4E9VA 2YDQA 1WBYA 3MY9A 4IGMA 1MOEA 1UXMA 4GSQA 3SPIA 1ACYH 2RGMA 3AWOA 3NOEA 3N73A 3KPPB 2KDGA 2GB2A 2UY5A 1XSKA 3PJSB 1FKWA 5LIUX 5ABHA 2NX9A 1EYWA 4OBSA 1MMFA 1BW8A 1VLWA 4FG6C 3SE9L 3QK0A 2IKJA 3OZ9L 1X39A 3S4SB 4JZNA 3VH8A 5DK0A 1LL1A 4AD5A 1F6AA 1QP1A 3TCLB 2DEXX 4CLMA 2P1YA 3LNFA 4AH2A 1FVDA 2NWSA 1NSNH 2D03L 1WBZB 1EJOH 4O58L 3EB3A 2JQXA 1TTJA 3OX8A 4ZBJA 3TU6A 3L81A 4H9MA 3W88A 3MNZB 3I74A 4NS0A 3BMWA 1LWRA 3UEZA 3NAAL 4QITA 2L5HA 1ZIAA 3GSVB 3F4WA 1GT8A 1IGJB 4LASL 4HWNA 2FIRT 3FQNA 3OJ2C 1NY1A 1NFDF 1EVUA 4I9TA 2NX3A 3WE6A 4ZAKA 2NPLX 4PBGA 1A6UL 3UP1A 3GKWL 2WQSA 2PF0A 4HWBL 3Q0HA 3BEWA 3R0NA 2AP2A 2OG9A 1OIOA 3DV4A 1AXTH 1NLDL 4MPKA 1QSFE 5F2LA 3CSPA 3M0HA 2O5NA 4OF0A 3QJSB 3BQ6A 1OFDA 4V1DA 2CERA 3RMEA 1N7KA 2BODX 3EKCA 3KPOA 1C8XA 3IAQA 3KXFB 5BZDB 1MFNA 1Y1UA 1PQZA 3APNA 3ZR6A 3PQYD 1G0YR 1J1PH 4O57A 5LGYA 4AVFA 4NZJA 1OGBA 3F6JA 3O81A 2V5JA 4QR6A 5JR1L 1XVSA 3QVQA 3HLAB 2NNAA 4XP5L 3B2MA 3WMSA 1IC4L 1VBJA 4HXBL 4OJFL 1RZ7H 3IKCB 1FZMB 1XIWD 4IU2A 1TQBC 4B6ZA 5HHMB 1MNNA 4DP7X 3UJRA 1LL4A 2IH3A 3HUJE 4GI8A 4PJEB 3I85A 1SFHA 2A6NA 2OO0A 4NT6B 4IRZA 1Q6QA 2WQXA 2N7SA 4FFZL 4L2YA 4AHQA 2FHFA 1TQVA 1EOMA 2WNQA 2YQ3A 1N8ZA 4FAMA 3D2UD 4K3JL 5KSVA 2YKLL 4C56E 2GYIA 3SDDB 4NYLB 1YQ2A 5T5FH 1HL9A 1SZRA 3NRFA 1UD6A 3OGCA 3R8BB 1DWJM 5GZNC 5L0QC 4NFBA 4KROC 4PJCF 4QHRA 3P61A 4DPPA 4PRWA 4NCC1 2VX4A 3MUGB 2X88A 2WVVB 1UXSA 4BKLA 4D0BB 3L7FA 3R18A 5D1QA 3WU1A 1NIEA 2QKFA 5LBGA 4CC1A 1TRDA 4QG6A 4ZMNA 4K3DL 1JMZA 1GXEA 4ZVJA 4BKSC 2XI9A 1OY0A 3A3XA 4HT1H 1KGCE 3BYYA 3P8IA 4N2LA 4IM8A 1NFBA 4DT2A 3DGGB 3B5HA 2X9YA 2OYLA 3PUGA 4L3EA 3WFAA 2ICEC 3GTVA 4NAEA 4PJGB 4R96A 4BZYA 2J9XA 1HYSC 1MQKH 3NFPB 2A6KA 1TZIB 2UZXA 3DH7A 5ICYB 3TNMB 3NCYS 4E0CA 3TV3L 4UQ3A 1XIBA 3CB8A 4N4QA 3JUYA 1E4WH 4KFPA 1E0TA 1EWDA 5D8ZA 2YGPA 3WQVA 5IFJA 5C9ZA 2QGYA 4C6NA 5TGBB 2HX8A 3G9VA 3MREB 1IEIA 3O16A 3T77B 4PJ7F 2A99A 1PZUB 2GBUA 4Z7AA 5B1JA 5K59E 3ULVL 4F4RA 5EEZA 2GSGA 3LQGA 4AG4H 4HCIA 1PYWA 4PP1C 4NUWA 4UINH 3TXVA 3NFSH 1J5SA 3ZDZF 1QMUA 1WTGT 3NL2A 3Q8BA 4YNGA 5LIXX 1FWGC 4NRZB 3BK0A 3HN8A 3NUKA 4JO2L 4K5NA 3KM2A 4MNMA 3H4FA 3BE1H 4UTTA 3O9WB 4GLEA 2J1YA 5BXTA 2DAVA 2GAZB 2J44A 1ZCCA 2BJML 1A65A 1BVNP 5FIEA 1A0QH 3MAWA 4Y2OB 4CU7A 2F6UA 1TQJA 4OZ4A 2DQTH 2B08A 1IWAA 1T2QL 2ON3A 1CS6A 2XKNB 4Q32A 3VFOA 4KNUA 3TYDA 1SXZA 5DC2A 4PTWA 1KJ2B 1TXKA 1VAHA 1MUCA 5AW2B 2VERN 5DS1A 3TS8A 1UJPA 5A8OA 2VC9A 1T4KB 3MLVL 1B9ZA 3VKBA 3I10A 3U83A 2JCCE 3NL5A 1JAEA 2XZQL 4XBKA 1OD7A 4Z1AA 4CADA 2YXGA 2K0RA 1FSKB 4S2SA 3K4WA 5DK2A 2W81C 4JKPH 4LAJH 1JYNA 3GHEL 2A74C 1XLHA 3CN2A 3LMJH 5TF1H 4RAUA 3ARDB 4A2HA 2C7UA 4S3CA 1YYCA 3EJJX 3REVB 2KQNA 4HA3A 1H8LA 4PVNA 2J7DA 4CNTA 3PNRB 3D05A 4KIRA 5L7XL 2P4AB 2DZUA 2EXOA 4J8RA 3T0EB 1O66A 3OHXA 1K9EA 5E9AA 3IXTA 4U6YA 3HC4L 1GY1A 4PZVA 2AGTA 1Y6KR 3GKAA 5AB9A 1KSRA 3TWAA 4LHUA 3U0WH 5F1OB 3RGTA 5JDJA 1Q94A 4U49A 3FU8A 2VWSA 2B9AA 4JN1L 1C08B 3KYNB 3CVBA 2YAQA 4HNNA 5DEZA 5BZAA 1JN6B 5ABEA 5CZTA 3N6QA 5K9JH 4I87A 4UT7H 1DJWA 3A6OA 4C59B 5DZOA 1IV8A 4L29B 4UQBA 1YW1A 3R0MA 3NEVA 3NIDF 5D7JD 2K45A 3T8QA 2XYBA 4KV5F 2CRZA 4D6FA 1J10A 2ED6A 1LDPL 1AHMA 3KPPA 4B97A 3T3PE 2BSCA 1W5OA 3L4WA 5FF6B 5ENWB 2P53A 4N2MA 4MF4A 3SQMA 3WSUA 2VEFA 5A69A 1J8SA 3IDUA 2CM6A 3RU6A 3KPSE 1MRFH 5CBJA 1TYEB 3MV7B 4JKLA 3DHJA 4QF1A 1W9UA 1RV6X 5EU7C 4BXSV 2UXTA 4YHKH 2J56A 2JI2A 1S78D 4BYHA 5EC1A 4OLVL 3NYDA 4XO6A 3RTQD 4HCHA 3M1ZA 4AHPA 4FS9A 4H00A 3P3RA 4AYDC 3TBYA 2EACA 1MXSA 1WA3A 1RZGA 1IGJA 4XHJC 2PW1A 3L3HB 3C9NB 4Y1TA 1FWIC 2BSEA 4D9QD 3SY5A 4JTCA 1LO3L 4Q8OA 4LSRH 3VRLE 5EU7E 1HKIA 4OI8A 3AGVA 2C19A 4QHMA 1M3JA 3QFDA 5L2KD 5GRUL 4BRJA 2COQA 2Y5TB 4GG8B 1UM5L 2VLRA 3SPGA 2YZ8A 3W1TA 1W1YA 3POHA 3MP3A 2K7QA 1BQSA 4NUGL 1J9TA 4KIEA 1GTEA 3H70A 3SDCA 3EO1B 2I07B 3LEXB 3WH7A 2Y7FA 5G4OA 2OT0A 2XWBB 4S38A 1CF8H 3M45A 1FZMA 3VWJB 2AMUA 5FEPA 1XT5A 3Q2WA 4R9HA 1ADSA 2VFFA 4PJEA 3EGDA 3MUCA 3QJZA 5HHXL 4YQXL 3LEYH 3N12A 3VWKD 4I18B 4KK8D 5DEFA 2PLCA 5BS0A 1RZFH 3OAYK 5C0AB 1JNHB 4U6VL 4OUIA 4PJFA 4WK9A 1FNEB 4P57B 3AUOA 4BQ6A 2QGEA 2JMRA 4L3AA 1M6OB 3SDDA 4NYLA 3HFML 2NY6B 4LEFA 2PTZA 1BJ8A 4FP8L 3GT6A 4M1RA 3BKJL 1O5PA 2R27A 4RISL 1HXMB 1C8QA 1OWRM 4MJMA 1DANU 2YARA 4PJ9D 4U1SA 3TBTB 3TTEA 3VNJA 4MRBA 4M1DL 2WVVA 4D0BA 4JN2B 5C0FB 1OOAA 2YXMA 3VXRA 1QFUH 1CDHA 5HMSA 3BPWA 3WIJA 3MC5A 4OH2A 5KJ4A 1OP3H 3W56A 5FYJL 2FDBP 3QV7A 3DECA 1TTBA 4Q9RH 2KHAA 2F7OA 3RWFB 2WYZA 1S8DB 3MBEB 3SGEI 2O92A 2VITB 2F58L 2ZSWA 5C7VA 4E4PA 4PJGA 3NGFA 1FWCC 3IDNA 3AXXA 1QLRA 3NFPA 4L8SC 4CC4C 1VEOA 1TZIA 1NOUA 3UCDA 4DQOL 5AWNH 1JE6A 2CJUL 1FNAA 5ICYA 4LVNC 5J13B 3SKJL 5L9FA 4BK9A 2X4NB 1DIOA 3VFLA 3M0XA 4RPPA 1KJ3H 4C65A 4EUPG 4AZ7A 4LCRA 4HJIA 2ISFA 2NY0D 3MTRA 3VE0B 4O1FA 4HW6A 4BIKA 4G6JL 2UY2A 2CBJA 2YBTA 1IO4C 1EZUA 1DE4A 5I82A 2RQ8A 1V3MA 3BXNB 4MDJA 5JOPE 1K4HA 4XIMA 3W01A 2LU7A 3EJYD 3NSYA 2J8OA 4GW4A 4HA1A 3ZLGA 1JWUA 4FPSA 1H9VA 5D7LE 1EXPA 3QYSA 4NRZA 4PS4H 2X2JA 1ILSA 1GGIL 5CG7A 2Z3FA 2J5LB 3KDMB 3RGVC 4UQDA 3BAEL 5DHVH 5DR5H 1T7ZA 2E9BA 3ALWA 4NP9A 4LAKA 2W9LA 4HHGA 1QZ1A 3N3TA 4GS7B 4F2FA 1OW0C 3C5ZA 4TQEH 2EIEA 1AJ0A 5DTFB 4BEQA 5K2ZA 1XAKA 5HGGS 5B80A 2DT2A 1XCWA 5KVDH 4LVDA 1KJ2A 3IN2A 5CCJA 1EEUA 4LEEA 2QCCA 1E4KC 4HMEA 4H5SB 1ZVHA 1T4KA 3KVJA 1G4MA 2Y2TA 4Z7UE 1SVZA 1ONQB 2Y07H 3SR7A 1E65A 1AJZA 3PAZA 4PFHA 3JVGC 3L9YA 1E6QM 1S5MA 5I1AB 1MFBL 2YCJA 4EPBC 2I9EA 3TYFA 3G5EA 5FJTA 1HZHH 3ZHFA 3W6LA 3FDWA 1RA0A 3QDJE 3W0WD 3DMMD 3ZYIA 3S1UA 1WNOA 2LAAA 1IAII 3FAXA 1R3IL 4PIBA 2JBMA 3SPVA 1V7MH 2P5WE 2QCHA 2V5DA 2BB0A 1RURH 3T0EA 2E25A 3UAJA 5F2FA 4GFTB 1F58H 2JKPA 4WWKD 1IILE 1NC4D 4K23H 4PRHD 2CQVA 5BW7A 2VM3A 4P2VA 4JDTL 2FUTA 4J3UA 3V0IA 1HHJB 4I7WA 2WJ5A 3BUYB 5I1EL 3UXFA 2G95A 5DYOB 3QI9D 4XNQB 3GDTA 4B91A 4XPFL 3LIZA 1AW5A 4Q2ZB 2INEA 2GBTA 1JN6A 3MUHL 3BESR 5LGJA 1CQKA 2DLIA 1W91A 1HKFA 1JTTA 4L29A 5FI8A 1EERB 1TIMA 3SB0A 4EVZA 3HHSB 2V63A 5AOZA 3RVVC 1GW9A 4H1ZA 3RXZA 3T9WA 4HBQA 1LRTA 1PE1A 3U9PH 4IOSD 4OFPA 5F2GA 2Q0ZX 5FF6A 3L2NA 3GB7A 2QKSA 2BS8A 5C7XL 1DFBL 4HSQA 2PR4L 3CEUA 5LB1A 3RZCD 4CQ8A 4JFTA 3MV7A 4IOTA 2F9RA 1B3XA 4K8HA 5C3IA 1JDCA 3BQVA 2ENQA 1I31A 2RHEA 2YS4A 1I9RH 1UCBL 3MPCA 4XVTH 3FULA 1A53A 4K1GA 2M1KA 4POUB 1R9FA 5T3XE 4TRPH 2NXHA 1YUHA 4ILDA 3C9NA 2I26N 4ES8A 3V5FA 1JPTL 1I2PA 1E9ZB 4IS6A 2NSOA 4R84A 4WRHA 4Z95L 3QOKA 2FGBA 1DBBL 3O2DL 1SOXA 3JUZA 3SDYL 1DLFH 2OP4L 2Y5TA 4DPQA 1E9IA 2OLSA 5DD1L 3QUXB 3ASWA 3NIFF 4HNCA 4RE3A 3VG9C 3JWDH 2ZP8A 2XTJD 2CBPA 2FWSA 3V4PL 3EO1A 4O1BA 3SO3C 2A77H 5BU9A 2XWBA 3KGRA 3SY8A 2CNZA 4NUPA 4D8OA 4PYSA 4QHUA 4YHLL 3SGEH 1Y6NR 3H7VA 3VWJA 4JIEA 3FZUD 3IMWA 5FESA 5A6JA 4JL1A 3L2MA 3GMOB 2VUNA 1SPQA 4JZOA 4PS7A 5TK4A 2SEBB 2I5IA 3QIWC 3US1A 2EIBA 3AT0A 2F68X 1E27A 1XM3A 5C0AA 3FCSB 1JNHA 3ULUL 4JFWA 1ZT7B 3NJ3A 4BQ9A 1FNEA 1XL9A 4P57A 3SOBL 3HQNA 1M6OA 1RULH 3CAKA 4PSRA 2YW4A 5E8NB 1OAJA 2R39A 5D70H 5EEYA 4UQ2B 4RSYA 1G4RA 1F45A 1HHHB 1K5NB 5CZJA 3MV9A 4ADTA 5TH2B 1JHLH 3P9WB 1QNSA 4GAAA 3OA5A 1YIXA 3CUHA 1M3UA 3B9AA 4WGWB 3BIKB 3ECBA 5BUGA 1KTJA 2IDSA 4JN2A 3IGXA 3O8XC 4RVBA 5C0FA 4KCVA 3MRMB 1BQLH 5HY9B 4KHXH 2Y23A 1FAKT 2X7WA 4Y4FC 4UQAA 1TWZA 3Q6GL 2HJKA 3L4VA 4W4OC 3NZQA 2PN5A 4MA1B 4HJGA 3RWFA 1JP5A 5IM51 3MBEA 1TKKA 5J12B 2GITA 5H8UA 2VITA 3TGXA 5B7ZA 4IHBA 1FV1A 3TXAA 3C3UA 3OZYA 5IJKA 3FN0H 3BOVA 1JZFA 4PJHB 5FHAH 4L0ZA 5DQDH 4DJFD 2GTZB 4LCQA 4GIYA 3LNEA 3MV8E 2X4NA 1KB9K 2AAMA 5H4ZA 4B50A 4JQIL 2DZBA 3KZ8A 3H8NA 3CDYA 2W88A 4LIQL 2OQJB 2HXAA 1SLXA 5DUJA 1DE5A 3BAYA 4K8RD 2VR7A 5DJCB 3VE0A 4JG1H 2ITCB 4F0HA 4A7QA 3BURA 4ODWB 4LCWA 4ODXB 3GRIA 3OKOB 3A3HA 5AOLA 3RWGB 3BH4A 5DZPA 4M7KH 4MLSA 1PEZA 1MVFA 4E41B 3S37H 3S83A 5FR3A 3WFDH 1QFHA 2OXHA 3SFKA 1RUKL 2ZX6A 4K5LA 5EFIB 4PQXA 4PG2A 2Y3NA 4BSVB 2CLIA 2DI9A 1I4NA 2W6RA 3SKMB 3BKCH 1Q7MA 1XW8A 1XB6A 3FKKA 1U8PB 3P0WA 1X9LA 4KK5D 5A6AA 3KDMA 4XMKH 3STLA 1UWQA 2C8NA 3UZZA 4BK5A 3SGZA 5EPMB 1BFNA 1MEXL 4PHZA 4B5SA 4MJID 3LMYA 3E49A 1OJXA 4OUOA 2AKZA 3EF4A 1E6OH 2QV4A 1T66D 2ZX7A 3OPZL 5GQBA 4YGAB 5CLTA 5C86A 4HPOL 2PLTA 3LEPA 4XNXL 3GKZA 5H91A 3W84A 1KC7A 2YPLE 4AOFA 2QQLH 4DEWA 1ONQA 3IMRA 4OD2A 4QXGH 2JIXD 1DVFD 3TYCA 3EW3B 2ZZ5A 1X1ZA 3P0VH 1ES0B 1YSOA 4GG6B 1BZ9B 2L7JA 4Z7WB 2E6DA 3A67H 2W3ZA 4I3SH 1F76A 2NXZC 1T5WA 2WWMC 1IBBA 2EE2A 2YMXH 2ZXEB 4HIXL 1S7XA 3U36B 2HK1A 3D0VB 4CN6A 3KM1A 1CFSB 1J0IA 3QJAA 3VSQA 4RDBA 2CRIA 5F44A 4LC6A 3SDXF 1WTLA 4RFOL 4NHCH 5DHVB 4LVGA 3GJFH 5FXCH 1RUMH 4V27A 3UJ2A 3QISA 1NCOA 3ZM8A 5CSRA 3ARFC 2BGSA 5HNUA 4NJ9H 5SWSD 5REQB 3W2KA 4PJDB 3ALFA 1HESA 5AW9B 1EFZA 1UMYA 1RSFA 4JG5A 1M7DA 3QY7A 5MENA 1F56A 3BUYA 1FORL 2BNUA 4XNQA 1HKJA 1WXZA 4NQED 3ARYA 3CFCL 1U4EA 4W9FC 2XJLA 1GQNA 1PD0A 4NP4H 1WUNT 2V5SA 2VDMH 4NZRH 4BFRA 5EU5A 4AEEA 2FQGA 4RLDA 2WNZA 5MEOB 5HYQB 1EX0A 4NWTH 3EAUA 4P5MB 4RE4A 1MWAH 1EEYB 2V8MA 3WH6A 3G1AA 5ICZA 2FK9A 3S5LA 4D9LL 1X9UA 4BHUI 3IN0A 4YVXA 1ZVYA 2W80C 3ETBJ 3KPLB 1ODAA 1QFWH 3R10A 3P4MA 4YSOA 4ZUUA 3R8QA 2IMMA 4HKPA 2YDRA 3O0RH 1NFGA 3RITA 4JFED 2FPTA 3PV7A 2XGZA 4N7QA 4QCFA 2K6YA 1BX2A 4WSHA 3LN9A 4KRTA 3QWQB 1XFBA 2H8XA 4QRUB 3DHUA 4I48B 4NO0B 4X9BA 2PURA 4GG9A 1BD2D 5DD5L 3B5GA 2JJUA 1WC7B 4IRJC 2FJHB 5C0EB 4BQBA 2J4WL 3FB6A 2XY1A 5ABGA 1P6FA 5AYYA 2JKRM 1E8XA 4NNAA 4AGLA 4FXFA 1OINA 3QH3B 1ZE3H 4AQ8C 2YYUA 2F53A 1ZHKB 2CH8A 1KG0A 1E15A 1Q72L 3G6DL 4OZGE 3QEQD 4LLQA 4NXSA 3DGRA 2NW0A 4EUPH 4OB5H 1SDAB 4TMBA 1PBYA 4J4PC 4P05A 3BZEB 4PTUA 1AO7B 2OR2A 3ENEA 1SQ2N 3UYRH 2X8RA 3R6IA 1P5VA 1UQSA 2A21A 5F2IA 1XH2A 4WHBA 3V6FB 1V0MA 4N5UA 1RFDL 4E9WA 2B1HH 3LSOA 4PB5A 2D2JA 5KYNA 2H3XC 3AREA 3DSFL 1SUHA 4BH7A 1W0WB 3KJ4C 3QRFM 1MFCL 2NY7L 1Q8JA 2NUYA 3ZE0B 3ATDA 3E2HC 8XIMA 1MJ8L 3GMOA 1Y6MR 1A5BA 2SEBA 1BIIB 3CVHL 2E6AA 1JPIA 4R5EA 5KYYB 2LLEA 3FTYA 1QO5A 1ZT7A 2JJTC 3DFTA 3CMGA 2ZSVA 3VQ1C 5E8NA 3LTSA 3ABSA 4EXPX 3LDBC 3ZGHA 3PZIA 5CM1A 3CFIC 2BM3A 4JTUA 4AHOA 1ICTA 5ALBH 4X50A 3KS5A 5TH2A 2XN9A 5D71L 4KOBA 3P2DA 4TUFA 5AW1B 1YDNA 4XD5A 1WF5A 3P0YH 4NRYA 4QJ1A 3BIKA 3H56A 1G94A 2ZUNA 2KZHA 3F83A 4KTDL 1L7TH 1PHWA 4QNWA 4Q8UA 3BN9C 4WJKB 5HY9A 4YH6A 3W7CA 5LIKX 4X7SL 5AOIA 3PWPE 1VLIA 2IJ0C 1XUUA 3CU2A 1UZ6F 1YMME 2D9CA 3H4HA 1TTUA 3AHZA 1A0CA 3S0CA 4PODA 2WUBL 3V7AE 4DVOA 2CKRA 2DJXA 1A8ZA 5EN3A 4ONOA 3P93A 3R1GH 1OTSD 1LP9B 3VOHA 1EX1A 3ISYA 3HE6C 4XO3A 4YDJA 2GTZA 4X5XA 4EAEA 1XGTB 3LHVA 4M5SA 3HPJB 2P44B 3OGOE 1I3VA 3W4RA 2OQJA 1KRMA 2B4CH 3JT0A 5CD5C 1VBUA 1KCVH 4UBPC 3WN5A 5DJCA 1T03H 1UZGA 5E0FA 1JYXA 1EVTC 1TZ7A 4ASTA 1VKXB 5CPMA 3L9CA 1MO0A 3RWGA 3AWEA 4BFNA 4OLWL 1RUAH 2FQIA 2ZOXA 4E41A 5IQMA 2C1IA 5EFIA 5E0QA 5GGTH 2E6FA 4BSVA 3PJWA 5C54A 4M5ZH 2PSNA 3ITVA 5KBLA 3Q2LA 4KJPD 1H6TA 3G8RA 1AXSA 1U8PA 5A8GA 4KH9A 1UACH 1MQQA 2DIEA 2QFPA 5EPMA 5T1DL 1S5IH 3NAVA 3NZ8B 3RGBA 4U3HA 2E7DA 2HTLD 2AC0A 1Z9LA 2X2HA 1P7QB 2AXWA 3L3GA 5JO5B 4C1NB 1MCKA 3ARBB 4N6RB 3M17B 4JHVA 4DZ5A 2GY5A 4A68A 5HDBE 2FFIA