1VAHA

Crystal structure of the pig pancreatic-amylase complexed with r-nitrophenyl-a-d-maltoside
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
496
Chain Sequence
b'QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Crystal structure of the pig pancreatic alpha-amylase complexed with rho-nitrophenyl-alpha-D-maltoside-flexibility in the active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 163
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1vahA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1vahA01
4GINA 3MU7A 2J7FA 3PTMA 3WN6A 4E2OA 3AOFA 3GXMA 1ITXA 5CJ5A 2WCAA 1CGVA 4W86A 5A2AA 2VT0A 5A69A 4UFIA 1VFOA 3NCOA 3WELA 1C8YA 1CNVA 3VGHA 1OINA 2GJRA 3OBAA 4D1IA 4WSKA 3ARTA 5CZKA 1KFWA 4JKKA 1XH1A 1J0KA 3AMLA 4TX6A 3WEZA 1OCQA 1V6UA 5DEZA 3VIMA 4XX6A 3KL5A 3L4TA 4BQ2A 5A8OA 4GKLA 2ZXBA 1UOKA 3WQ4A 3FHAA 1MWOA 2DH3A 1LLOA 4NXSA 1R46A 4JHOA 4DM1A 1MW3A 4ZXLA 5IHSA 1UKPA 2O92A 3N9KA 3EDDA 3ZJ6A 2VOTA 1IZKA 2OYLA 2XN0A 1GONA 4P8UA 4NZCA 4CCEA 1MW1A 2A3HA 2OW7A 2ZWYA 4U3CA 1JAKA 2GK1A 2X8RA 3BCFA 1C91A 4OJYA 4KMQA 1C7TA 1NWUA 1QNRA 4M81A 2J79A 3WBEA 5A6KA 4W87A 2VQTA 1O7AA 1DHKA 1Q6GA 4H8HA 2UY4A 4QCFA 5E0CA 1KXQA 4GI9A 4FLOA 2X05A 5C8BB 3WUBA 3ARQA 4UTFA 1LWJA 4IPNB 1UD8A 1SFSA 4QFUA 2IUZA 2V3FA 3O2LA 1W3KA 2WAGA 1QW8A 4UQ9A 5JBFA 2CXGA 2OWCA 2DSVA 3QOMA 1W9VA 3BSGA 5E0FA 4TX8A 4HA1A 3PZUA 2O9TA 1UWUA 1CDGA 2UY3A 1CLXA 3IAPA 2VUYA 1JZ5A 1B9ZA 5I0DA 3WQWA 1E0VA 2F7OA 3CV5A 3HG4A 3BLPX 3MO4A 2YDRA 1HJWA 2V3DA 3MI6A 1CXHA 3AMCA 1E4IA 4MDOA 3A5VA 3UG4A 1JDDA 3DDFA 4WKAA 1OM0A 4IISA 1HP5A 3K4AA 3WF2A 4AD0A 4P8WA 3WDPP 3UG5A 2OW6A 3ARWA 1E3XA 1E43A 5CPSA 3EDKA 6A3HA 5DMYA 3ZT6A 1OWQA 3N17A 1JZ6A 4FNUA 3FN9A 1NOUA 1M01A 1Q6EA 2VX7A 4M82A 1UR4A 1Q6DA 4C7FA 1UD4A 4AD4A 1E6ZA 4WIWA 1M53A 1VBUA 3K1DA 4HTYA 4J3XA 1GORA 3W37A 5IXEA 1V6VA 4W5UA 4MAZA 4QAWA 1BTCA 3WNNA 3WDJA 2CETA 3VINA 2F7PA 4JL2A 2GUYA 3NDYA 3IGUA 2F61A 4MB3A 2WHKA 3T2QA 2AAAA 3AI0A 3WY2A 3VIKA 4CVWA 1GZJA 3E1F1 1MQQA 4P7QA 1H41A 5E09A 2GJXB 3W81A 1WB0A 1R47A 1J0YA 1TQUA 4X0NA 1JI2A 2YL5A 3BVVA 1JGIA 3W0KA 3MUZ1 2O9RA 1TQTA 4W7WA 4DUXA 1CGTA 2G3NA 3WF0A 2E0PA 3VM7A 3S5ZA 1I1WA 4C7DA 2WKGA 4OBRA 1JAEA 4PTWA 4AZ5A 3SCWA 2ZXQA 2CBVA 3WL0A 3K4DA 4CD5A 3ZJ7A 3BVTA 1V08A 3PBGA 1VFMA 1H5VA 3LMYA 1E71M 2J7CA 4PMRA 6TAAA 3WUGA 5AY7A 1KCKA 1EOKA 1W2VA 1W9DM 1BHGA 4URIA 3RM8A 3DYMA 3MV11 1C7SA 3L4XA 5A3HA 4J27A 4W88A 1UR1A 4AISA 3BUBA 1G94A 1GCYA 3BAYA 3WNPA 2FE0A 1H4PA 2J25A 4H8UA 3B9EA 1ODZA 2WK2A 3MKKA 3DC0A 4BS0A 3H55A 3TOPA 1Q4NX 1FFQA 2XVNA 4XUYA 3D4ZA 3SCNA 1WP6A 4UQEA 1EDTA 5HNNA 3DX0A 1R85A 5HXMA 3PN8A 1M7XA 4M29A 3EJQA 4PMOA 5E6ZA 2ZXDA 1QW9A 1OT1A 1R34A 3AIBA 3MV01 3OGVA 1E56A 3VGDA 4AZBA 3SUUA 1WKYA 3AZTA 2J8GA 2CBUA 3L4WA 4LQ1A 2DSKA 4QP0A 3L2MA 4KGLA 1B30A 2ZUNA 1ZB5A 1JZ8A 5CPQA 1DTUA 3W24A 2FGZA 2F7QA 1FP8A 1ZBCA 1NQ6A 2OSWA 3B9DA 1HL8A 4FNSA 4CD7A 2XFFA 2EQDA 3AROA 3WF4A 3GYCA 2WMKA 2GJPA 2GSJA 4U2YA 4PSPA 4MB1A 1V02A 2OWXA 2Z1SA 4HA3A 4P7LA 4NRSA 3WH8A 1G1YA 1EHNA 1GOQA 4E8DA 1CIUA 3EDEA 3VGFA 3VKKA 4MDPA 1AMYA 1CENA 1UG6A 9CGTA 3GXPA 2CHNA 3OIHA 4AW7A 3N12A 3WDIA 2XGIA 2WVSA 3VO0A 2V38A 1J0JA 2YFOA 3WQVA 4UFHA 4RE3A 1UR8A 4D71A 1O7DC 3TA9A 4ACZA 1H0GA 2XTKA 1WPCA 1QI0A 2XPKA 2CPUA 1UA7A 3WNKA 2V3EA 4ZE5A 4X9YA 3VD3A 3CHEA 1GOIA 4PMUA 1JDCA 1E6SM 3AIUA 4B3LA 4LXFA 2QHAA 2XVGA 4H8VA 2BVDA 3QOKA 3VSUA 2Y8VA 3ECQA 1PZ3A 3PZ9A 1V0MA 3CZSA 1QNQA 2ZX8A 3LRKA 3BUPA 3VNYA 3AHZA 2D3NA 4NSBA 2WSKA 1GOOA 3RPMA 3BMWA 1OB0A 4LPCA 1UH3A 4MPKA 2YBUA 1W1TA 3VMOA 3KL3A 4MB4A 3WFLA 3ZIZA 1ISWA 1UZ4A 4W7UA 4D6DA 2XWEA 1E6RA 1F4AA 2CNCA 3II1A 4WKFA 5BXSA 1CGYA 3CHDA 4P7NA 3A47A 2JF6A 1W9XA 2XHYA 3N1AA 2E40A 2VRKA 1EA9C 2EPMX 1OGGA 1J12A 1TQVA 2X2HA 4ATDA 3T2OA 1LWHA 4QLLA 1GVYA 4GXPA 1BF2A 2D3LA 3AICA 4KH2A 1MW2A 3WL1A 2VZSA 2J7HA 4DUWA 3N11A 4W93A 1CGWA 3L4VA 3PZMA 3D5HA 4KRUA 4H2CA 3RIKA 3AXXA 2PWHA 4J7RA 3D52A 2YL6A 4E8CA 2QMKA 3AYRA 3M7SA 3HMCA 4M24A 2QV4A 1QX1A 4WLCA 1UH4A 2XIBA 3PTKA 4AD5A 4F9DA 3F5KA 2WXDM 3J7HA 1WZLA 1TMQA 1ZBWA 3CUFA 1BQCA 4PMYA 4W8BA 1B3XA 4ATLA 4HZ6A 4QLJA 4XV0A 2WMIA 1EH9A 1VJSA 3U7VA 1W1YA 4FNRA 3AHYA 1CPUA 2XVLA 2E9MA 4EAMA 2XG9A 3S2CA 1D3CA 1HKJA 1DWJM 1DWFM 4LYRA 4HOWA 1PX8A 3T08A 3WMCA 1JYVA 1IZJA 5ABHA 3MSDA 1CGXA 5FOOA 5CLWA 1W9BM 3CO4A 1E0XA 3MS8A 2EACA 3M46A 2EEXA 1HX0A 4CVUA 2Y5EA 5E6YA 3GH4A 3UG3A 4FLQA 2CERA 5GNZA 4HU8A 2JFEX 1PBGA 3AS1A 3AMGA 4L4PA 2PF0A 4PMDA 1OGBA 3PZTA 4PSRA 1H49A 3RDKA 1BFNA 1KGUA 5LYRA 1E40A 1P6WA 5I79A 1AQMA 1E6XM 1WNOA 1CTNA 2VCAA 4JKLA 1DWHM 3LRMA 1J0HA 3VIHA 2CESA 4BA0A 3W4RA 3TTOA 1XRVA 1KB3A 1BYDA 2VZOA 1H09A 2QLYA 4B3KA 3ARYA 5A6JA 1US3A 1B3VA 4TTGA 1XYFA 1QI5A 1OIFA 2QPSA 4HMEA 2DT2A 2PWGA 2WVVA 1U30A 1CXIA 2XM2A 1Y7VA 3A21A 4TVUA 1PX3A 2E9BA 2FH8A 1XHGA 1WCGA 3NJ3A 4TVDA 3T2PA 5JIPA 5BRPA 2GDVA 4HMCA 4D6FA 3HZ3A 1RPKA 3BVXA 3CZEA 3BAWA 1CEOA 1ZL1A 3DX4A 1MQPA 4IM4A 2GVYA 2VZTA 2W91A 3K8MA 2J7BA 4LX4A 2J62A 3KLKA 2EPKX 5AC4A 3LXBA 1X6LA 1ZBVA 1E1EA 4CU7A 2G41A 2J7EA 4UOZA 3FNDA 4UOQA 3MUY1 1TUXA 4UFLA 1M04A 1W2PA 3GNOA 4M1RA 1JYNA 1QI3A 3LXAA 4AEFA 3A6OA 1SYTA 4ACYA 4R27A 2WZHA 1V6WA 4GO8A 2W4XA 3OLGA 4B9YA 2XSAA 1GQKA 1NH6A 2W61A 1E6NA 1W3JA 2ZUUA 1G0CA 4UOJA 3OGRA 1EHAA 2ZX9A 2GFTA 2ALWA 3OG2A 5KZ6A 1LQ0A 1B90A 5ABFA 1CZ1A 1OT2A 2NSXA 2J75A 5E70A 2W67A 3POCA 1B2YA 1WZMA 3CLWA 1XYZA 2WBGA 3CUIA 2AMGA 2JEQA 4Z2GA 1J18A 3WUFA 5FKYA 3VGEA 4P8VA 1R7AA 1BVNP 5CGMA 3DX3A 3WF1A 1BVZA 1ECEA 3EJRA 1QNPA 4GO9A 3EBVA 1KXVA 4UQCA 2CBJA 3ALFA 1J0IA 3AISA 3WH5A 3SCVA 4UR9A 1XGZA 4OOZA 4GQRA 3ZO9A 2O9PA 3CMJA 5EMYA 5EB8A 3AMKA 2DSZA 2F8QA 4GZIA 4ZENA 5JBEA 1H2JA 5HOSA 1BLIA 5D8WA 3AHVA 1TE1A 2G8ZA 4OIFA 4WK9A 3POHA 4PTMA 1MFUA 1TCMA 2OSYA 4YHEA 1CGUA 3UR8A 4YN5A 3BH4A 5A6LA 3WENA 1LL4A 4DM2A 2ZIDA 4UQDA 3WKZA 3CH9A 3BCDA 1CECA 2WW5A 1GQLA 2BNJA 3ZSSA 3EJSA 1HKKA 4DO5A 3QHOA 1WZAA 1JD9A 1TFVA 5BRQA 3APGA 3EJTA 5EFDA 5I23A 1JL8A 1QWNA 3KL0A 3MMWA 4PTVA 2VCCA 1U2YA 4GIAA 2A3BA 3FXYA 5HBFA 1JG9A 2WC3A 3DX1A 3CZKA 4EK7A 3GXFA 5EBAA 4AZCA 1GUVA 1E4MM 1ESWA 1UD6A 4M8UA 5LA0A 2W62A 3SUSA 1SMDA 4H04A 2ZUSA 5JUVA 3D3AA 3DDGA 3QGVA 3TONA 1HNYA 2D1ZA 3WQ8A 1X1NA 4IPLA 5I6SA 4HOXA 1VJZA 1GPFA 2EABA 5DO8A 1YQ2A 2J7DA 3RCNA 3WD1A 5M17A 3BUDA 4JZ5A 1E5NA 3WBAA 1JXKA 1HJUA 1QOXA 3IANA 2YDQA 1HF6A 1EDGA 3WH6A 1ISZA 2WVTA 1R75A 3VIIA 4HPHA 2E4TA 2CBIA 1OSEA 1EQCA 1KGWA 1V3HA 4OZOA 3G6MA 4AD3A 3THDA 4M80A 2WHMA 1MVYA 3VDBA 2IXUA 4QLKA 2TAAA 3GXDA 5BCAA 3CMGA 2WCSA 4UQAA 2DGAA 1PIFA 2G3JA 4RE4A 4J3UA 1R33A 3D50A 3LPGA 4TVCA 4B9ZA 3SCPA 1V6YA 2EADA 3VSVA 4D6GA 1DWGM 1WDSA 3VX1A 1QI4A 2C7FA 2VRQA 5ABGA 3CZNA 4AC1X 2EAEA 1UWRA 5A8QA 3WD2A 2VX4A 5IFTA 1OD8A 3SCSA 1HVXA 2V3GA 1T0OA 1UD2A 2OLHA 3CHFA 4AIEA 4FNQA 2C0HA 2EBNA 1FA2A 1VRXA 5EFFA 5I24A 5ABFB 3U7BA 1NWTA 4PBGA 3SCOA 4FK9A 3VUPA 1W1VA 1C8XA 1Q6CA 3LPFA 3PHAA 2ZICA 2RGMA 2YA2A 2GK1B 4P8XA 5DT7A 4OGZA 2Z1KA 4HZ8A 4X0VA 1ZBKA 3WEMA 3ARVA 4CN4A 4LYPA 2WMGA 1NP0A 2ZUMA 3VMNA 4YPJA 2JE8A 4PCSA 1FHDA 2E9LA 2F7RA 1BSIA 1E5JA 2VURA 4GZJA 1QPKA 1GVIA 1N82A 3QHNA 1JFXA 1CXFA 1XC6A 2DIEA 2V5CA 2PI6A 3L4UA 2VL4A 1I75A 4ZXOA 3AZRA 1W3LA 1OIMA 3WNMA 4WKHA 3VVGA 3VIFA 3WIJA 4JFWA 1LL6A 1J0ZA 3N15A 1FH8A 3WDQA 4R5EA 1QI2A 1HVQA 3W6LA 1UWQA 3PZGA 1L0PA 1V6XA 2ZUTA 4TUFA 4E4PA 2X2JA 1UR2A 2CIPA 4EANA 5BWFA 4AIOA 1NP2A 4C7GA 3ZSTA 2ESCA 3S6TA 4PMNA 2YFNA 1KR0A 1XSJA 3IJ8A 3ARRA 2OYMA 3DX2A 4FNTA 2D24A 3WNLA 2WHJA 4D6HA 4HPGA 2D73A 1UR9A 3A3HA 2ZUWA 4OKDA 4BZYA 1J01A 5A8PA 1GNXA 5I3DA 1KGXA 4AZCB 3GXTA 5FL1A 3RJXA 1MYRA 2GDUA 4S3JA 1KQZA 3BUQA 3VU2A 1W9UA 3LPPA 4HMDA 2VI0A 2YBTA 3GTNA 3W28A 3NYDA 1CXKA 1EXPA 2DH2A 4DWSA 4UZUA 1UA3A 3AIRA 1V3IA 5A95A 1D7FA 4CKQA 3ZMRA 4PMQA 3RM4A 4EKJA 1OD0A 1YHTA 4ATWA 4HU0A 4CCDA 1JZ2A 2WBKA 1A47A 2YOCA 1FH9A 1EOMA 2VZVA 5D8ZA 4CD4A 5A6BD 4F66A 4MADA 3AJ7A 3ZQ9A 2CITA 1E3ZA 1GQIA 2UY2A 1JYXA 4JCLA 4UNIA 1NM9A 3WH9A 1CLVA 5GNYA 3CPUA 1DEDA 5FIPA 1WE5A 2DT1A 3ARSA 3UESA 4UFKA 2A3EA 3TTSA 3ALGA 3EJPA 4JKMA 1UKOA 2NT1A 4BQ5A 3OZOA 3UERA 2WYSA 3F5JA 2G3MA 4WJXA 1AVAA 2X2YA 5HDRA 4KGJA 4BF7A 2UWFA 3AIWA 4XZBA 2Y4SA 3VD4A 1UD3A 3W25A 5GPRA 4NX0A 3MSGA 5IHRA 1H11A 1GQJA 2WHLA 3WD3A 3I3EA 5A8MA 1J9YA 3ZR5A 3CTTA 2VQUA 2XN1A 1V3JA 3W6MA 1UWSA 4M56A 3A22A 2B31A 3OGSA 4OOUA 3O9NA 2PC8A 1ZU8A 1HXKA 3UETA 3WDHA 1TVPA 1FP9A 1TZ7A 2VO5A 2D0HA 3HN3A 4JFVA 3SUWA 3AMDA 2X2IA 3KE0A 2JIEA 3MMUA 2DEPA 3IAQA 8CGTA 1XCWA 3QHMA 1GW1A 4H41A 5M03A 5CG0A 5JBDA 1VF8A 1RH9A 1PPIA 4UZSA 5I5RA 2CCRA 1KXHA 3VIGA 4WSJA 2XSBA 4MB5A 3T0AA 2JALA 2CKRA 3SURA 1GJWA 1HL9A 4D6JA 1MFVA 2BHZA 1HN1A 3BAKA 2Q8XA 5TD4A 1LL7A 2WLZA 1QHOA 3VMPA 3VSTA 3EYPA 2XYLA 3CZ8A 3WQ6A 4W7VA 3W82A 3AIEA 4D72A 3WFZA 5IFPA 3THCA 1PEZA 1E9LA 4J3SA 2W66A 2WANA 3AQUA 3GNRA 4JHZA 3CUHA 1HXJA 4JAWA 3AHTA 4U33A 1V0NA 1TQSA 3WSUA 1W32A 2BY2A 5I2UA 1E4NA 1JNEA 1XH0A 1LJYA 2ZX6A 3G6LA 3B8SA 2X09A 3L4YA 7A3HA 1AQHA 2BHUA 2YA1A 1VIWA 4WF7A 2FDMA 4F9JA 2E8ZA 1DP0A 3ARPA 1WAWA 4JFUA 1MQRA 3M6DA 3ZT5A 2WKLA 3WF3A 3RM9A 4L4OA 4CN6A 3IK2A 4UFJA 4PMXA 4ACZB 4NXKA 2NT0A 1W9PA 2DPEA 2WB5A 3EJUA 4ML4A 2WSPA 4W5ZA 2BXZA 5FD0A 3BC9A 4P7RA 1B3WA 2OSXA 2VCBA 4B16A 5HPOA 3EDJA 3BSHA 2BY0A 2XIIA 4IUGA 3B9AA 2G4FA 3SCQA 1HIZA 1EQPA 4AD1A 3CZJA 5C70A 5I77A 4GI6A 3PZIA 1R8LA 5BROA 3AS3A 3H54A 1HWWA 3VD7A 2F18A 1EO7A 4ZEPA 2J7GA 4AZ7A 1US2A 2YA0A 1FOBA 1PJ9A 1HKIA 1PAMA 1M03A 3BXWA 5A6BA 3WY4A 2Y2WA 2XVKA 2IXVA 2YJQA 3LRLA 1VB9A 3EMZA 4PCTA 3AIVA 4J3TA 3EMCA 1MXGA 3GBDA 5A2BA 4AZHA 3WD0A 5AYBA 3BAIA 4FNPA 1KWKA 3WD4A 1TG7A 4EE9A 5A6SA 5D9PA 2GJXA 2C8NA 3H53A 3K8LA 2WM0A 4MNKA 3A23A 1V3KA 1BG9A 2XFRA 3PZOA 1UQYA 3ARZA 2EO7A 7CGTA 1UWTA 3GDBA 3D51A 4NRRA 2VX6A 1KTBA 1VFUA 4Z2HA 2AOSA 4Z2LA 1BPLB 2BS9A 5C71A 3KWXA 5KEZA 1JI1A 2FHBA 4AMXA 2WCGA 3CZLA 1UKQA 2JIWA 1G01A 5CPTA 2F1AA 2W92A 4PN2A 2DT3A 3W53A 3BVWA 2WVUA 2YKKA 3F5LA 1KTCA 4AIUA 2WC7A 2XWDA 1JZ7A 3VDCA 4W84A 3CGTA 2WMIB 3RO8A 3AHXA 2D2OA 1R87A 1TQWA 2CYGA 5LA2A 3ARXA 4D6CA 5E1QA 1VENA 4UCFA 2FHFA 1UD5A 1C93A 1LG2A 1ISYA 2YLLA 1BGGA 1SMAA 5BXPA 3VOCA 3CIVA 1NWRA 4PUDA 4AZIA 3GXNA 2ZX5A 3VILA 4W85A 4Q7NA 1UKSA 2WMFA 1G9HA 3M07A 2YLAA 1E55A 2J8FA 2WZEA 1FFRA 2EJ1A 1HP4A 2VRJA 2VVSA 3PZVA 4Z2KA 1B0IA 2ZE0A 1JYWA 3DHUA 3AS2A 1TA3A 4MNLA 3VX0A 2BFGA 4DO6A 3AXHA 1R7OA 3TTQA 1K9TA 1NOWA 1BYAA 2VR5A 1VEPA 2J4GA 2J77A 3WMBA 4RE2A 3SUTA 1E6PA 1FH7A 4CD6A 3DHPA 3VPLA 2BV9A 3GH5A 2WMHA 2EPLX 1HJXA 2DIJA 4U5IA 1XCXA 1ODUA 1QNOA 1A3HA 4DUVA 1E70M 3WNOA 3W38A 3N18A 4V27A 1ISXA 2CEQA 3VDHA 3U5YA 4QCEA 1XSIA 4A3HA 4UFMA 1XD0A 4W8LA 2CHOA 1E15A 1L8NA 4CGTA 3OLEA 1CBGA 4B15A 1NOFA 4DWSD 2BHYA 2D0FA 3VM5A 4J3WA 1E72M 3D4YA 2DSUA 4PRWA 1HT6A 3BAXA 3UCQA 2D22A 5A2CA 1CXLA 1RP9A 2WVVB 4N0RA 1JF6A 4A3YA 4J3VA 1I1XA 3U5UA 3F4VA 3O6AA 3LXCA 4NZFA 4MAVA 4U31A 4U2ZA 3BLKA 2YDSA 1QWUA 1ZJAA 3FAXA 4JCMA 3NDZA 1K9DA 5AC5A 5A6MA 3PTQA 2WZIA 1H3GA 3WMSA 3NIYA 1BYCA 4MJ2A 5CXPA 2WC4A 3AXIA 3LX9A 2XM1A 1FHLA 3GH7A 1U33A 3W26A 4K68A 3EDFA 4AZGA 3VD9A 4AYSA 1R86A 2YL8A 3MUIA 5CLTA 3SEPA 4GI8A 3IJ9A 3TTYA 4Q22A 3SUVA 1JDAA 2OWWA 1HKMA 3GXIA 1B31A 1KQYA 1C3FA 1JF5A 4BQ3A 3KLLA 7TAAA 1AQ0A 3ZR6A 2J74A 3RMEA 4OUEA 5LA1A 4JFSA 2DDXA 1CXEA 3ZT7A 1EDQA 3BGAA 3ZM8A 5DFAA 3N13A 3I3DA 2WWCA 3OLIA 4H7VA 4AXNA 1J11A 2JEPA 1VAHA 1PX4A 4AYGA 1ITCA 5IDIA 3WDRA 5M5DA 1KBKA 4OBSA 1EIBA 2VC9A 1VEMA 4PYSA 1GOKA 4CD8A 6CGTA 2X0HA 3K8KA 5E9AA 4GZEA 5JIWA 4J28A 2E8YA 1O6IA 1LF1A 2EPNA 3LPOA 1E6QM 4UQBA 2J78A 3T0BA 1E1FA 3CHCA 2ZOXA 1B3YA 3MMDA 5ABEA 4ZFMA 1V02E 2W63A 5FCZA 2VTFA 1K9EA 2DSWA 4CUCA 4BCEA 4N42A 3OA5A 2DQXA 3SCRA 1TVNA 1SR0A 3VGGA 3AIQA 1TA3B 3FW6A 3FAWA 2G3IA 3CBWA 3EMQA 1QBBA 1ISVA 2UY5A 5D9OA 1HJQA 3FHQA 4RL3A 5GQBA 4D6IA 4PTXA 1PIGA 2VVNA 2O9OA 3PZNA 1WDPA 2Y24A 2BY1A 1OBAA 1JFHA 1XD1A 2X0YA 1WDQA 3BAJA 4MNMA 5A94A 3OZPA 4CU8A 1RP8A 4W8AA 4KRTA 1QHPA 3GNPA 1MW0A 1KCLA 1UWIA 3NSMA 3PZQA 4AMWA 1XH2A 4DO4A 3VIOA 2FH6A 1KXTA 3AS0A 4Z2JA 2ZX7A 3CUGA 2F1BA 4A4AA 1XSKA 2XFYA 4AMCA 4JIEA 1UH2A 3DYOA 1G5AA 2PWEA 4AD2A 1VBRA 2QMJA 1VFFA 1UASA 1JNDA 1MXDA 1WZKA 2RGLA 3WY1A 1S46A 1EGZA 3HG5A 3VDAA 3AYSA 3SCTA 3WH7A 4ZE4A 5GNXA 1QVBA 4FLSA 5A1AA 3TV8A 2VNCA 1KWGA 1D2KA 2Y8KA 2YL9A 5BXTA 1CWYA 3N04A 3BUIA 3ARUA 2VZUA 1IT0A 4MJ4A 1PZ2A 1JZ3A 2XJ7A 1XV8A 1C90A 2FHCA 4Y7EA 1E0WA 4Z2IA 1C92A 1TR1A 1GOWA 1SZNA 1BGAA 4LYQA 5BXRA 3U57A 4AZ6A 3RJYA 4CN1A 2PB1A 3GM8A 2XN2A 5A8NA 3QR3A 1ZS2A 3UEQA 4FLRA 2X1IA 4HA4A 3I3BA 3CZGA 1NARA 2OYKA 2VJXA 4D1JA 2XGBA 3KEHA 1GOMA 1UKTA 3FY1A 1HJVA 5BYWA 3WEOA 5CQ1A 3IJ7A 4GPNA 1K6AA 4V28A 1UQZA 4HZ7A 3ZOAA 1QBAA 3BVUA 1JIBA 4JL1A 5D9MA 2FYVA 2PWFA 2BVTA 1EO5A 1NWSA 3GBEA 3WQ5A 3RILA 3L4ZA 1V0KA 3VGBA 3A4XA 2J47A 3NSXA 4HP5A 1W91A 5HPCA 4NI3A 4CU6A 2WPGA 4YHGA 1WDRA 2FGLA 1GHRA 3HU7A 4D6EA 4AY1A 3VIJA 1VEOA 3SCUA 1HTYA 2XUCA 1C8QA 3A24A 4P7OA 3NUKA 4U5KA 3KZSA 2F2HA 2BVYA 4LGXA 3VIPA 4DWSC 2JF7A 1E73M 1V0LA 1KBBA 4F8XA 2DT0A 4QDMA 3JUGA 1DWAM 3OB8A 2PWDA 1F4HA 1GHSA 1X6NA 1PS3A 1OGSA 1W1PA 4FMVA 2WWDA 3DECA 2A3AA 2XVPA 2NW0A 3MUAA 1QHZA 3HG3A 4PMVA 3VD5A 1IV8A 1JD7A 4HOZA 4JFTA 1DWIM 1Q6FA 2WLYA 1HJSA 3UR7A 1RD6A 4PMZA 3ZJKA 2MANA 5ECUA 2A3CA 3WUEA 1GJUA 2QF8A 4F79A 2ZWZA 4GQQA 3CC1A 3OLDA 4U3AA 1E4LA 1UR0A 2PBOA 4AEEA 2PBGA 2BY3A 2ZXAA 3DYPA 3HJEA 3MANA 4NF7A 1JXJA 3L2LA 1V03A 5D9NA 2HISA 2WNWA 3SIMA 4S3KA 3ZJ8A 4XB3A 2D20A 1B1YA 5FL0A 5CGTA 5M3WA 4TOQA 1BG4A 3AZSA 1JZ4A 1W3HA 2E3ZA 5CSUA 4XZWA 3NSNA 4V2XA 4PEEA 2D0GA 5D4YA 2V5DA 2BXYA 5DT5A 1WO2A 3VTRA 2VMFA 3A4WA 4TTUA 8A3HA 2W5FA 4NZJA 1H1NA 4FF5A 2EPOA 1UYQA 3TP4A 3BLBA 1KR1A 4DWSB 1K9FA 1UUQA 1Z32X 1CYGA 3GZAA 2VX5A 2VR4A 2YIHA 1LG1A 4PUEA 4MNJA 1H0IA 5CSYA 1UZ1A 3A4AA 3WY3A 1V3LA 4AWEA 4BQ4A 1BYBA 1ZJBA 2WMJA 3T09A 3S5YA 1UHVA 5DF0A 3VNZA 2CKSA 3AFBA 3W27A 4W89A 1V3MA 4CCCA 2D23A 4TXEA 1BAGA 5AYIA 2HVMA 2EXOA 5F7UA 1B3ZA 4KWUA 2IGTA 2ZUVA 3K46A 2QPUA 3HG2A 1QNSA 5A6AA 5I78A 3BMVA 4MTVA 3T0DA 1J10A 3W29A 3CUJA
chains in the Genus database with same CATH superfamily
2VXQH 5CN3A 1F5ZA 1RCYA 1K4DB 1FGNL 4ISVB 3VFVB 2XZAL 4KHXH 5IB4A 2FYYA 1OTUC 5FHBH 2EE9A 4MQTB 4RDWA 3RA7L 2HLEB 3X12B 3KBEA 4NQSA 2A9DA 3W7HA 2E3VA 1B3IA 7PTDA 1G4SA 1J0KA 5C9JA 5EDXA 2RR3A 3X13A 1R0MA 4DM1A 1D6EB 2VKXA 5T1LD 3CBRA 3W70A 4Z1DA 3THQA 3ZJ6A 3HQ1A 3LZPA 3GFZA 3ESOA 2AS5M 4G80A 3T65B 1YEDA 2OW7A 4XNUL 5JW3L 2J7LA 4OJYA 4L0PB 1R3LA 3IDIA 2QUVA 5IHHA 2AJYL 4M81A 3UMNA 4J4KA 3RLGA 4WI7A 1Q6GA 2UY4A 2I5YH 3A0OA 1M7DA 2WUBH 4O18A 3UYRH 1UD8A 1K02A 4O2EA 1B4KA 1T6WA 4BINA 4P2QE 4UQ9A 5GIRA 4GUFA 5C0CB 2FPYA 1CDGA 1E5AA 2X1OA 3UP8A 3HNTL 4NT6A 4XZIA 4YDKH 2X16A 4FRWA 5IB1A 1F7BA 2VDRH 4HUCA 4IBVA 1S2CA 4L1XA 3EYQD 1TUFA 5E0QA 3UNTA 5C09D 1IT8A 3QUYB 5HQLA 2X9WA 3TT3L 4EN2A 4P5TD 4TUJB 3V6ZA 1DVUA 1U8PB 2W3ZA 6A3HA 3ZT6A 3FQRA 2NSOA 1AZUA 1XIWC 5CBBA 2ZTJA 1UD4A 3TBVA 3DV4A 4P2RB 2EEDA 1TYEB 4W5UA 2PS2A 2A2IA 4PRAA 1FLTX 2DW6A 1AGFB 5ELIA 4JO2H 3SB3A 1VYRA 1BFVH 4XXDA 3GSQB 5ACLA 2P48B 3MUZ1 1TCDA 1QNZH 1MFAH 5IVZA 1MI5A 1ML1A 3QPZA 3WD5L 1WC7B 4AZ5A 3SCWA 2Z7UA 4PRHD 2RJGA 1PW3A 3V4VH 3DXIA 1HHGA 3CK5A 2YLHA 3RM8A 4QNWA 1X39A 3L4XA 4P5MB 1NLDH 1YDPB 1QRNE 2BODX 3KG5A 4U1KB 1GCYA 3SRHA 3SO7A 3OD3A 1MAJA 1CI1A 2XUWA 4MVAA 2EDBA 3BAEH 4K3ZA 4NO5B 4UQEA 2W60A 1Q5MA 2X6UA 2JXMB 1QW9A 3TH3T 1DN0B 1KN2H 1IWBA 1QSFB 4GW5A 3FCUB 3LPWA 3B2VH 3BIAX 4G8FB 3N41B 5I30L 4P2OA 1NQ6A 4C58B 3FXGA 1EUTA 3AROA 4P9HH 1ITBB 3GYCA 4Q4MA 1YEJH 3UVIA 4LNYA 3V4UH 4HA3A 5D7JD 5JORA 5F0PB 1EC8A 4E41E 4BA8A 3KVMA 4XK2A 3KPRB 3RMJA 1YYAA 9CGTA 3ZDXB 4JMNA 4J12A 3FVDA 3DG6A 5HYFA 4UNTA 4FQQB 4JKPH 1F3DJ 2YFOA 3SE6A 4GUOA 3G6AA 4CCZA 4ACZA 2PCPB 4FC3E 2XTKA 3D3VE 3DFNA 4RAVB 4IBWA 4WK0B 3FU8A 2YOAA 3TJHC 4MLSA 3V0WH 1ZUAX 3QSKB 4Q9QL 5C9UA 1T5KA 5CCKL 2CKNA 2FQEA 3QQ1A 2XZ9A 2Q10A 3G3LA 4H44C 4MB4A 3QM3A 3MFGB 2BIOA 4NPKA 4HDIB 3T3PB 1P1ZA 3VTTA 2UZYA 1JZJA 2I7SA 1I1RA 2R1WA 2VRKA 2EPMX 2ZOUA 1NIEA 2PW1B 4GXPA 4U3HA 4KOCA 3TIEB 1VBGA 4R7NB 1GGYA 1ONXA 2EEBA 4MNQE 2PDQA 4DVBA 1IFHH 3MBEB 2QV4A 1X4YA 1ZAJA 1CFTA 2F68X 1EP1A 1Y0EA 4GAYA 2P0OA 5E5MB 4HAGA 3U7VA 4GLEA 3DIVA 3GMMB 4RGNB 12E8L 4JDBA 2XVLA 5DJXB 1WAEA 2XH4A 3PP4H 3UTPD 1OANA 3CFIC 1HHIB 5FOOA 3CO8A 1CDCA 4G9FA 5EORH 3E3QE 4A21A 4XN8A 3FQ2A 3M1BB 3RWHB 2EXWC 2OX1A 1EC7A 2BP8B 3VU1A 5M95B 1X7SA 2LLGA 1YMHB 3QIWB 1W72B 4JM2B 1YPXA 2CHDA 2IADB 2CESA 4A8LA 2CLZB 1XRVA 2APWA 1BYDA 4UTKA 4IQHA 3DJ9A 5HHPA 2QPSA 2DT2A 5DJ2A 2PDXA 3L3IA 4KDWA 2P5WA 5L4MA 3S4SA 3VOFA 3RWFB 3R8HA 4LV9A 1TQCC 4F0SA 1Q94A 1GC1H 2BNQE 1MQKH 4GX8A 4NG3A 5LWYH 2DQHL 3T4AC 2FLBT 3MUY1 1Y5XA 3TZNA 4NHCH 3LHUA 1TMHA 4K4KA 1G7PA 5HGGS 1TTJA 1THAA 3VWKA 3FU7A 3HC0A 2MMXA 1NH6A 4LAQH 2WXIA 1A66A 1MVUB 2KUTA 4Y16C 2KQMA 1ZGDA 1NC2B 4AYEC 2XG5B 43CAA 2X6VA 2WBGA 2JEQA 3S6DA 1O95A 4K5LA 5DY3A 2HX8A 5L9DL 5CGMA 1DE6A 3U7YL 2XXGA 5DMKA 4D2NA 3TN0A 3AISA 4TTDC 4B5ZA 3MUCA 3MCOA 1YY9D 3GK0A 1FNFA 1EXHA 5IROD 5JBEA 5HOSA 3E5PA 2PKDA 4IH3A 3QDHA 3QLLA 4RIRA 2WLIB 3K72A 2ZUQC 4NS0A 4XX1E 2J6VA 3QHTC 4PJXE 1CECA 2C79A 3S5LG 3BUYB 1H50A 4M6PA 2E56A 3HI6L 5I1DB 5BRQA 1YTDA 4LEOB 4GIRA 5D2NB 1VLIA 5JHDD 3EO1B 3NCJH 2X1PA 1Q9LB 2E86A 3R10A 1HNYA 1OAZL 3BEVA 3NESA 2EC9T 2QKSA 3DOHA 3RCNA 5M17A 2C16A 3H9SB 4JZ5A 1E5NA 1J6OA 2R7EA 1O4UA 1MSPA 3L6FB 4NM8L 5TQLA 5TFSL 3IACA 3N29A 4HIXL 3H24A 4HPHA 1OSEA 1KGWA 3G6MA 3UAEA 1PIFA 5GRXG 3CHOA 3FSVA 1U8JB 1PG7W 3GD1C 1XYMA 1TNMA 3RX8A 2APBA 1UWRA 4LLVA 4J3OG 3F00A 2YSTA 3QJRB 3X14A 3DSFL 1OFPA 3WU1A 1RZMA 4GS7C 2WUCL 1Q6CA 2WGXA 4QRPB 4PV8A 3CV6A 3WJLC 4N22A 1NP0A 4N6QA 3B9KA 2EE6A 2IAMB 4HK0A 4PCSA 1X5MA 2VURA 4TSAL 1M9SA 2AMXA 5FYJD 1XC6A 3LCYA 3DIFB 2R1KA 2GVEA 1DSFH 3IE4A 3EZJB 3OZLA 2WZPA 1G7IA 2HPOA 2AAMA 4XC3H 4FFVC 3QRBA 1N59A 1DIOA 5JOPE 4YEEA 4IIFA 1MHCA 1WBZA 3Q48A 4IU2B 4PJXF 4DVOA 4UQIM 2X38A 1T80A 3VNIA 5LCVL 1Q8AA 2C4FU 3CWHA 2OYMA 3DGGA 5FFOA 2H2SC 4OKDA 1YVLA 2FGBA 4YSOA 3QEUB 1LNUB 1BM3L 1JWSB 5BUGA 4ENLA 1I7TB 4HMDA 2HVJA 1RUPH 3ZR4A 1VCVA 3W28A 1CXKA 2H9AB 2BS8A 4P46A 4F57H 2NR6D 2FSEA 4Z5RA 4N9CA 3MREB 4ATWA 3BDKA 2JCWA 4F2UA 2WBKA 3VFNB 5ENWB 3BTNA 4C6FA 43C9B 4JRXB 1TEGA 1KZYA 1AR1B 4KJPD 3I7QA 4WVXA 1OQFA 3WH9A 2WYTA 2OCCB 3VRLF 4P2OC 4JKMA 4NJIA 1GZHA 3R0NA 3MJ7A 1HE7A 2C3XA 3L5WA 2Y3NA 3GS4A 2Y4SA 5FUCE 5IT2L 4KKAD 1GJIA 2VLKB 4WU7B 5JHLH 3NXLA 1COBA 1J5HA 3RVWC 3USBA 2VEIA 2YCEA 4IQJA 3HMXL 4YOKA 1KNOB 1T3FA 2B31A 4I7UA 1E4XL 5HQMA 2YYTA 3ZZQA 4QHRA 4DETA 1CL7L 1NGPL 4NKDA 2OOFA 1UP0A 1I9RH 4UM8B 2G2RA 5E8PA 2Z0UA 2X2IA 2ICCA 1AXTL 3B2UC 4PJIA 3Q6GH 3L1EA 3GW3A 1KXHA 4K71B 2PCFB 1W2KT 2FMNA 2BDNH 1XLCA 2FPVA 1SEQL 3DKHA 3LQAH 2XYLA 5JTWA 3E1ZA 4G1EA 5TF1L 2QQNL 3THCA 2O30A 1AH3A 1KJ2H 2W65B 1AD9A 2I07B 5J6HA 4G7SB 3JWNE 2OODA 3WFAA 1NPNA 4JYFA 3SR7A 1Y18B 1LLZA 3B8SA 3L4YA 3TLLA 4XCEB 5CAYB 4K3JL 4MM1A 3TIMA 2DU2A 2NQ9A 3N91A 3HJZA 3SN1A 2ZT9C 3S5SA 4JKNA 4PJ9D 4CN6A 3IK2A 2YXXA 4X7DC 2N01B 3SPIA 2WSPA 4W5ZA 2YPVL 4P7RA 2QR0A 4S2SA 3CZJA 4TRPH 4NN5C 3P4OB 1X9UA 1F00I 1OSYA 4OZ4A 4MNHA 5DHMC 5AVWB 2VB5A 3P0YL 2YA0A 1M03A 1R3WA 5A6BA 3RPIA 4N0UA 4IMGA 4OLUH 3QQ4A 4XMWA 5AYBA 1MO0A 2AK4A 4J5VA 1EBHA 4KPHL 1OSZB 1MHPL 1XBRA 3WEBA 3OR7A 4CSZA 4M6OL 4Y9BA 2VX6A 1D5RA 4OZFH 1OO2A 2NY1C 1UPMB 4NU7A 4O0QA 3C8DA 4OCLC 1UM6H 4HUVB 2YPLD 3B8WA 1QFUH 4UB0L 4ONFH 4BI5A 2C13A 1PY9A 1TZOA 3QY7A 3WQPA 5F3HA 3X3FL 4B53A 5IQ7L 1ND0A 5LA2A 3BH8A 4NJJA 2QGCA 3TZVA 4K7PX 4N8VA 3G1XA 1UPPA 2Y7GA 2AEPL 4PJEB 2HKHL 3GXNA 4DSYA 1KZQA 4IBZA 1A7RH 4ZQMA 3DVNB 1WWWX 3V0JA 4B9CA 2W88A 1NDYA 2J77A 5FEBA 3MYPA 3VK5A 1YKWA 2AFNA 3HIJA 3GH5A 3PPEA 3VXRB 1KTKE 3RWDA 2ZKHL 3WKML 1U83A 3VWKC 4PS4L 2H32A 5KBLA 3S2LA 3QQXA 1S3TC 3ECBB 3PYCA 2ZWLT 4FZ8H 4I18A 4J3WA 4UILH 1M05A 2D22A 1FWDC 3AB0B 2NQJA 4A3YA 4QF1B 3L3DA 2V5YA 3GRIA 3ME3A 4PGEB 2YAMA 3DBPA 4Z3IA 4XPHL 4JCMA 4ZUVB 2FEJA 5FA3A 3AALA 3U4EB 2QDHA 1BYCA 3B0PA 3WJMB 1MHHA 4BK5A 1W6WA 5DZLA 1R86A 1EJ7L 2PABA 3SEPA 2UUDH 4YWIA 3E0FA 1K8DB 4JFFA 5IOBA 2DF3A 4D3CH 3GXIA 3MPCA 4KH9A 1QJWA 4DHGA 1S3KL 3SQLA 1IAMA 4JFSA 1ZANH 1CXEA 4JTHA 3K2MC 5TDOA 1MREL 3RY6A 1MDLA 3KPSA 4ALAH 4Q6JA 4HTBA 3T05A 4PYSA 1GOKA 7FABH 1EX0A 4FQHA 4QR7A 4BZ2H 5IOPA 5J57B 2OXNA 1GVFA 1XYBA 1LYXA 4YHPA 4ERGA 4L9LB 4OD2B 4DPBX 3C5JA 4BSWA 5ABEA 2VEKA 4YLWA 5FCZA 1WKEA 2DSWA 1BXVA 3KWWB 5D1QB 2GC7C 1DFXA 3QEQD 4KTEH 4U3SB 1TZIA 3VACA 3T4YA 1CD1A 3O6YX 2ED7A 3FHQA 1SW7A 1JFHA 4MNMA 5A94A 1OK0A 1DVQA 4W70A 3NQKA 1QAPA 1KFLA 1HTIA 1I6NA 4NIYE 4PBXA 5GS3A 4PBFA 1O5KA 2YUVA 5D4HA 4Z2JA 4K55A 4CJ0A 2FNWA 1S7UB 3DYOA 3ANYA 1M3UA 4KNTA 3FH5A 3FULA 1MCOH 5CO1A 3QNFA 1ULVA 5TQ2L 4MA8L 2ABBA 4Y5VB 1W1A1 5HHQB 4GKNA 1ZIAA 3WH7A 3RDTB 4B0MB 3MBXH 5DD0H 4M7LL 4NHUB 3AUWB 3CFMA 3N04A 2VZUA 2BLEA 3NQ6A 4AV4A 1AI1L 3MUHL 2XDHA 4LSDA 4UOW1 1MZHA 4DP8X 2WZ6A 3DI0A 2RDXA 2VMJA 5AVQB 1FAIL 3QWOB 4OGXH 5L2KD 2YAEA 3HVNA 4XNBA 3KPLA 2HK0A 2NY4C 1VC4A 1UXWA 1G4TA 5F7YC 3KCOA 2Z27A 2WYZA 1J5TA 4HZ7A 2DZEA 4OR1A 3UBGA 3X2QB 4C90A 3WV0A 3N4FA 1L6GA 2XTJC 5FB8B 2OP4H 1W91A 1LK3L 4M5TA 3GMNB 4DP5X 2OI9C 5L6YH 3LUTA 5E1IA 4AY1A 3GIZL 3BWWA 4BYHA 3NUKA 1XR9A 2PD9A 5TGBA 1MRDL 3V1PA 5I6PA 4MXWH 3TVMD 1X6NA 2E7HA 4JREC 4PJFA 3MI3A 3MUAA 1FRBA 3VCLB 3LV3B 1VH7A 1XF2A 3UR7A 4F80A 2BVOB 2H0JA 2W07B 5I1LB 5CJBA 3QZ6A 3O2DL 4P2AA 4OM1H 3H2MA 4U3AA 4YSQA 5J13C 4EVZA 1BD2A 4G6KL 5D9NA 3OMAB 2WBXA 3BN9D 3LEVL 4RK8A 4UTBA 3GSUB 1M7IB 2NNAB 3KYKH 4IK6A 3NQIA 4XZWA 2QCLA 4U4IA 4ZMNA 1AOHA 1AD0B 3HE7D 5IRPA 1VCAA 3ILQD 3HZMB 4GRLB 1S6NA 1IAOA 4L61A 4Z0JA 4WV1B 3SE9L 1UWXK 1XF5A 7PCYA 2VR4A 2GJ6D 3M47A 2VDHA 1F2XK 1BYBA 2X4QA 1WCBA 2HSIA 3ETTA 3C2EA 2Z93A 1PE1A 1IGFL 2I14A 3CHVA 4PHXA 3GVQA 1VZHA 3NK4A 1K8CA 2IOOA 2I24N 1TTQA 4I77L 5JPNA 3SOBL 4I4WA 1XGPB 3O8XA 4RETB 2WCAA 1N6UA 2VDRB 2GSIA 4MXQC 4PTUA 2UY6A 1L7IH 3QW3A 4YGAB 4DIAA 5HGHB 1IGYA 2VKZG 4S3BA 1KGJA 2RBLA 3VFLA 1K8YA 4BZ1L 3ELFA 4PWKA 3PM6A 5F7WC 4NQQA 3LZFL 3PQYE 3SBWA 4TX6A 3APMA 3VIMA 4MZRA 3A6BL 5DRIA 5AOLA 3LYEA 1Q9WA 5C8JA 1QSEA 1OF6A 4TSBH 3W88A 4ZOEA 3CIWA 3M86A 3M1CA 1TV5A 3QE5A 4IU3A 5DVPA 4G2AA 2FNBA 4M43H 1CLZL 2TSYA 3IMSA 3WJSA 3C2YA 4KMQA 2VWEC 4OCXL 3D6GA 2J6EL 1QLRB 1O7AA 2PP9A 2ANUA 4YJZL 5GRVL 1KRAC 4G6JH 1SRDA 2AXFB 1FCGA 2UYLA 3V4VB 1EZ2A 3FUDA 4UAOB 3BIKA 2PEVA 1A25A 3IAPA 2X12A 2C9VA 4JFEA 4KBXA 1YNKH 5C0BA 1E9IA 1LQ2A 2EP6A 4RWYH 3PHQA 2VOMA 4WWKB 5GS0D 3QJAA 4LBEA 9XIAA 4QAMB 1CXHA 4YQXH 4PW4A 5CP7A 2OZ4L 3GJEB 4N2EA 5HJXA 2BDQA 4FXGB 4Q4PA 2D7NA 3KZPA 5E8NA 3MV7E 5I00A 3TZVC 1S2TA 1DZ0A 1UR4A 3DHJA 4NERA 1EB3A 4PW9A 4I0PA 5HUPA 3MTWA 4LL4A 3NPSB 5C86A 5I6LA 5EA9A 4KJWD 1P7KA 1H3XA 1L9QA 2DICA 3U9UB 2HXTA 1H41A 2QCFA 4RCXA 4YBLB 1PZBA 3X3GL 1PIIA 1FZKA 2UWEE 5ALBL 3FQWA 2KKQA 3ULUD 5IBXA 2P0IA 4XGZB 1W1ZA 4OD1L 1UOLA 4M7KH 3TYDA 4MXVE 2OMWA 1E6OH 2ITCB 4QI3A 3WUGA 2QQKH 4A68A 1TV2A 1U91A 5H1WA 2F54A 1JNLL 2EDTA 4I18C 5LBSH 4TVPD 4O52A 5I71C 3BSZA 3EYSH 3AXKA 4JG1L 1TETL 5I8OH 3LSOA 3IVKB 4FMKA 4PN6A 1P5UA 3NQCA 3I85A 2R69A 5CD3A 1R85A 5D9SB 4BK5C 3UBXI 1CZ8H 1E56A 3VGDA 2XDFA 3BLOA 4GVFA 1BCIA 3BPCA 1TYGA 4Z7WF 1OWRM 4IG2B 2JJWA 3U4KA 4ENZA 2F7QA 1XGYH 3HOJA 1LMKA 4ZTXA 5DD5L 3HC3H 3UC0L 1YLBB 3MZGB 4V1YA 2JJUA 4LAOA 1EDYA 4U3XA 1CCWB 1G6RA 4QDGA 4E2BA 1M57B 2ZXCA 3RZCC 1PG7H 4KK5D 1LVEA 5GHWH 4N6EA 5E6IA 3UVAA 3Q2CA 3PP3K 5MP6H 2VAAA 2XPKA 4P5RA 3CHEA 1GOIA 4HJ0C 3LTYA 4G6ML 3AIUA 4AEIH 2WXFA 4LXFA 2R9RA 4KX9A 3PLYA 4O02L 5GISH 2DM2A 3ECQA 3JV6B 3ZYJA 4YTUA 1TQBC 1XG3A 2XXCB 3OV6A 4FMFA 4O14A 2UWEF 1ZLSH 1WV2A 3ZIZA 2WINB 1D2PA 3P69A 1GGIL 5L2JB 4R7OA 2CNCA 3DARA 2Y0FA 5CLXA 1QEWA 1J86A 5LLIC 1A5BA 2XHYA 1TTFA 3FUMA 3CQKA 1Z66A 3NQFA 1NFBA 3W2UA 3MOBH 4K7PL 4IHOA 1Q8MA 2DWXA 3ENLA 3BKML 3S34L 1JZHA 3L3GB 4X7TB 4J7RA 5FEWA 4PUBL 1FH5H 3AYRA 4F8TA 4HLZH 4WLCA 4H8WH 2Z64C 3NCBB 1SDDA 4NC1C 4Q8QA 2VR6A 1WISA 2NLJA 3J7HA 1ZBWA 2Y5SA 4IW4C 1IGCL 4ORGB 1DVSA 5DSCB 2XA8H 3FSWA 4MFEA 4PG9B 3FQNB 3V6BR 3VG0H 4GLRI 5EMJA 3KTSA 1H60A 4K3GA 4NSKB 2BIQA 5CLWA 2RFGA 1I1AA 2WNKA 2EEXA 1RZIA 1LDPL 1DQQA 2B7NA 2X4RA 3BLLA 1XGUB 1NEZA 4NI8A 2P9RA 1PBGA 3KAAA 4FFYL 3N25A 4H26A 3VXSA 1KGUA 2QSTA 4NNCA 4XC1H 1E6XM 3NA4A 2XCMC 2VXNA 4RFNC 5D96B 1JHKL 2XZ7A 4O15A 3QWQB 2J5LC 1H63A 4QNEA 3OKNA 3FOLB 2EKJA 3Q8FA 3I9GH 4C1NB 4YHMH 4JQ3A 5DZAA 4U1NB 2FQFA 2V5MA 3HZ3A 4A7UA 3BAWA 2Y25A 3GS7A 2GVYA 4DAIA 3E2HB 2PWVA 2R56H 3LXBA 4G1NA 1LO2H 3MV8B 3S8WA 2P3ZA 4JRYB 3FQXB 1SY6L 4RRPM 3BPWA 1TWZA 5IB2B 3NQDA 2OTUA 1BXUA 5EO9A 4NY2A 1RJLB 2ERJB 5I15L 4A05A 2VYRE 4ZFCA 3OLGA 4ZFGH 4LZKA 2N7SA 3FYOA 4NJKA 1CFSA 3BKYL 1IXPA 1BF8A 3PS6A 4QISA 1KYOJ 1KRCC 3TBSB 3CUIA 4ZFZA 1VFHA 3R06B 3SD5A 3QQDA 1MI3A 2WQAA 3ZTNL 2YRLA 2X89A 5C7ZA 3BD3A 4E0RB 4IBUA 5I1HL 2UZPA 1BQGA 4UR9A 2GIYA 4JTEA 2DWDB 4OOZA 3I6EA 5F6IB 2ZPKH 2K3HA 4GRMA 4JTKA 3SO3C 1HKVA 3IDYB 4C56A 3O8XC 3FUNA 2D7TH 1HJCA 3S96B 1DBKH 5MEPB 3L5LA 3VTAA 5IMMA 1R5VA 3KRBA 3F2DA 3IJIA 1IBGL 1CR9L 4WI2A 1X1ZA 3NN8A 3ULSA 3SBWC 2WSYA 3N6QA 4XBEL 5GSVB 1UYWL 3EJTA 5EFDA 2EH8H 3GPSA 5F97E 3RU8X 2MTPA 1A7OH 1NEPA 2X41A 2QPFA 5HINA 1JG9A 5ANMA 4G71B 4BR1A 2DD8H 3SPCA 4MDIA 3CMFA 4Q4KA 3QORC 4H04A 2IMNA 4OLWL 2FO4B 3LKOB 5AVNA 1XEUA 3LKNA 5KTEL 2FB4L 3QS2A 4AVKA 4Y8DC 1GYCA 3TCSA 1N2RA 1QOXA 1UP3A 3PWLB 1K3UA 7PAZA 3T1GA 3PL6C 4GW1A 5EO1A 4S3AA 5HGDA 3VDBA 4MYAA 3C8HA 3ZKXC 4HHHA 3PBVA 2KZKA 4O54A 3SCPA 4KX7A 4J35A 2IANB 3ZTDC 5IFTA 3LNPA 4MQSB 1KPVA 3FT0A 3KNBA 3O6ML 5CWSA 1FVCB 3AU1B 4X99A 3LGEA 3BWAB 1SW3A 1ZHNB 2XY1A 3LZ3A 4L4VD 4P3WA 1TIUA 2X7LA 4PBGA 3QW4B 3QXAB 3LPFA 2A0LD 2ZICA 1TVDA 5IBUB 1JGLL 3KRZA 5GGUB 2AQSA 2HPMA 4IJBA 1GGUA 4JJ5B 4AIBA 2GQAA 4I0PC 1JUKA 2D9QB 4R4BB 3IGXA 1P4LB 3W71A 3QHNA 3WXVH 3EWDA 2DJUA 4ZXOA 3GLZA 1TSRA 3BH9A 3WNMA 3GUTB 5I9QB 3STLA 3T0ED 3B9NA 5ISZD 1WXYA 3M7OA 3KJ4C 2QCGA 4A6YA 1BQSA 3RG1C 3MHFA 3DG7A 3PWIA 1AGCA 2WTRB 1CFNB 5IQOA 2X4OB 5J11B 4FI7A 4JN8A 1OFOA 2QEZA 3W7CA 5HR6A 1LWIA 2HH0L 4UZGA 4HK7A 1T7LA 2G0KA 3L5HA 2NZ1A 4BFEA 2HT2D 2O5ZL 1MCRA 3U0TB 2J1YA 2GSEA 2QKFA 1P5UC 3GFUA 2BIIA 5EZIL 3O7UA 3UP6A 4EKJA 1KENH 3TBTB 3HM7A 1OB1B 4HU0A 1M4KA 1RAMA 3G1VA 7ODCA 3NP3A 2CSPA 5J8OA 2UV3A 5I7GA 2VLJD 4HA0A 4IRJA 1Q72L 2FJUB 2C4FT 1HGWA 2DT1A 1P7TB 1JK8B 3ARSA 2P5ED 3KOFA 3QJTB 2BNRE 4OGYL 2DDQH 5GGVH 3RRXA 2DM7A 2WZTA 1VFAA 1I7RB 3STZA 1GQJA 3I6LD 1P43A 1YJDC 3D34A 1V3JA 4GUQA 3I75A 1IZCA 5E6IC 4C4UA 2A6DA 3V36A 3HZKB 4AY8A 1TVPA 3FEMA 3FYPA 1KM4A 2V2XB 2FZMA 4Z9KB 5FUZL 4EZJA 4C6JA 4OY9A 2CJUH 4OJEH 3GFXA 1T21A 4XD3A 4YNYA 1I9CB 4EZLA 4Z7UE 2P80D 1F6AA 1T22B 2Q8XA 3HE6D 3SDOA 3RR1A 1ADSA 2B59B 2MIZA 1RK7A 3QAZC 4WY7H 3WKPA 5AVVB 1R9XA 4JAWA 4OZFB 2WYIA 4HB7A 4M3KB 2OVLA 1V0NA 4JW3A 3V5DA 1U21A 1N8ZA 4BQ6A 5HNUA 2IQ9H 5SWZA 5EEXA 1JZIA 5HJLA 3R19A 2X70B 4FQIL 1M6OB 3QDGA 4PFHA 4L3CB 3VFRB 1JGUH 4OZHE 3VXNB 1YECH 5L7XL 3EJUA 4IOSA 3DG3A 3UGVA 3T44A 3BC9A 1A1OA 4X2PA 4I9MA 4AD1A 4OLYH 2VEFA 5EC1B 1CDUA 3UYPB 1UOZA 4PJ8D 5IBLD 3W7PA 3HR6A 1FBIH 3FJTA 5F9OL 3Q8AA 1I3GL 1MCQA 2PLKA 4CAGA 2R9HD 1VR6A 3EB3A 1GGBH 4PRNA 4KUZL 1LK2B 3BXWA 1CWVA 1LQSR 3LRLA 3ARFA 4E3VA 2IC2A 3HAEH 2DQTH 5DD3L 4NO0D 3BAIA 5DY2A 1TG7A 3LK6A 4OECA 4OH2A 2QUUA 5HI4C 1SVDA 4LVEA 2WTPA 2G5UA 5D7LA 1G43A 5EBMA 1TPDA 3S46A 4R26L 4YHLL 2RJMA 2E7FA 5DCDA 5E93A 2WCGA 2XQYA 3CZLA 3W0WE 5CPTA 2NDGA 2F1AA 3W53A 2WVUA 2NY0B 1KTCA 3WJZA 1IEBB 2WC7A 4OZIF 3T7VA 1A4KA 1MWAL 3RO8A 3BVNB 4UDTB 1MRCH 2FQIA 1SF3A 3IKCA 3C6LD 1EEUA 3IGAA 4G6AD 2E74C 4PWHA 4L4TA 2I9TA 4HJJH 4KQ0A 3BGMB 1OGAA 1E30A 5E9DB 2DAVA 4Y1AD 4A39A 5GGTL 4Q4OA 4F1ZA 1BZQK 5MI0C 3MLWL 4MWFA 5DRNA 5IEHA 2QVKA 3FO9B 5DTFB 1X5FA 3VXTB 4UT6H 1UR3M 3MGAA 2AQ2A 3QCVH 2K7QA 5INDA 3BFWA 2V2TA 3NGBB 1GVEA 2R2BA 4ONHA 5G2HA 3U5YA 1PYMA 3CPLA 4XZLX 2Z26A 3UAJA 4J2MA 5ABTA 2BHYA 2VGBA 3PPCA 1E72M 4LRNL 4XXCA 3IS0X 4IGBD 1IJ9A 1Z9MA 2VLMD 2QJNA 3OB0K 5TPWL 2OU4A 4LVOC 4YHYC 2NUTA 4QXGL 4UTMA 4AEOA 5EBUA 4FIRA 1LEGB 4XE0A 1F0LA 1G1CA 3PAYA 1OADA 3N6HA 5EOTB 1EJFA 1A3LL 5A16B 1ADQA 1C3FA 3EBIA 2VWSA 3P1VA 1PLGL 1NBQA 3TT1L 3BLFA 4BSJA 1UB3A 3MRNB 1MRAA 4R9HA 3IU3B 2UBPC 4LLQA 4AM0B 1J11A 1TXKA 4XKMA 1PX4A 4G8TA 4AQ8A 3OMNB 4OBSA 2CGYA 2CR6A 4Z95L 4EDWL 4X7FC 3S35X 4OFIA 3LLXA 5EG6C 2C3VA 3BGJA 2GTWB 2GPZA 5TE6H 3CHCA 2MQ3A 5ES4B 8RUCA 3AW5A 1U93A 2X0SA 3WK1A 3PV6B 3VJ6A 1MCBA 3VGGA 2X30A 4E6MA 1GYNA 1QMUA 2Z2BA 4LSQH 2P8MA 4YNGA 3WSQH 1R9ZA 1EBPA 4FQ1H 5EC2A 5C0CD 5LGXA 1PZ5B 2XVBA 3SYCA 4HPYL 4OIAA 1MF2L 4DGUA 2WIMA 3VKDA 5FA4A 4GMSH 2PWEA 4ODHL 5I73C 3QWNA 1RZFL 3QUGA 2QGBA 2O5NA 4GKZA 4JQVC 4X2RA 3SRDA 3QUYD 1LJMA 3HG5A 3RKDC 2R69L 3PGDB 2ITEA 3HGRA 3G9AB 3IMTA 4HBQA 1OZTG 2ED8A 2R2CA 2GY7B 3GTXA 1H0DA 3H6JA 4P4RA 4ICWA 4HS8H 6PTDA 4P2RD 1MOEA 3TQKA 1OVZA 5F6HJ 4F91B 1Y0LB 1ZA6B 2OMUB 4B2DD 3PUGA 1G9NC 5DGQA 4KCUA 3CZFA 3D85A 3NZGA 1YJDL 1UKTA 1XRFA 4GKOA 4W6WB 3FJLA 5DMGD 4PCFA 1NCNA 1EO5A 3F64A 4U10A 5TDNB 4NAFA 2J47A 1RZKH 3GKWL 4Y1SA 1XAKA 3EYOA 3MJ6A 2TPSA 1LYQA 3QZBA 1VEOA 1CLYH 1A2YA 2ZE3A 1U3HC 1NAML 4Q9RL 4QDMA 3KM8A 3SKOA 1VGKA 2Y1AA 4G9FE 3TPKA 1OGSA 4HJGB 3ABLB 5HY9A 3B9OA 4AH2B 3CJPA 4RDQG 1Q6FA 3V55A 4RAUB 3M1ZA 4OCRL 4E68A 1OPOA 3RU8L 1TRIA 2IKIA 1QSFD 1PHQA 4DAGL 4QXVA 2PBGA 3LVTA 4AT6A 5DT1L 5C9RA 3A4EA 1YE4A 2D20A 3AZSA 3BHBB 4JHVA 2E3ZA 3BPNC 2ZZ3A 4ZTYA 4PJ7B 1FL5A 4PEEA 1N0LB 3A4WA 1WICA 5LXVA 3O6CA 2P5WE 3UYOD 3VOJA 3MRDB 5MEQA 3KPRD 4UV4L 5J06A 1YEEH 3LH2H 4ZW5A 3EBHA 4AUUA 3P93A 4O12A 3M1OA 3FT3A 4H6RA 1Q45A 1UHVA 3LD5A 3TA3A 4XH2B 2AL2B 3AFBA 4K8RC 2GK0B 4XNYL 4PB5A 3C8KA 2HVMA 3IETA 3JSSA 4LCYA 3F65A 3MUGA 2VDGA 1NFPA 1Q0XH 4EIBA 4M19A 3T0DA 3O0FA 5CZVH 3MZNA 2J7FA 3A4FA 5CJ5A 1B0GA 5D2LA 1YNLH 2C71A 3CH0A 4US6A 3GEWB 2FZ3A 1Q2SA 3IE9A 2CKBA 1OHZA 3S88L 4DJFA 4A3QA 2H2PC 2OJEA 2G3XA 1KFAL 1OGTA 3GNNA 2B4CH 1DVYA 3GX9A 1I4FA 3UC2A 1V6UA 3UACA 4BQ2A 1AHWB 3ENEA 4MJIB 2XICA 4PWEA 3GQFA 5GRUH 3NQAA 1A6AB 5C97A 1UIPA 3MBED 4NNXB 2O26U 3P81A 3L68A 4WR3A 2CBPA 2AMUA 1C7TA 4OB5L 5EZOH 5GGRB 4EIGB 2FX8H 1UMYA 3FO2B 4RGND 4H8HA 4X7CC 4QCFA 1S7RA 4PR5A 5E0CA 2OX5A 1MY7A 3VFPA 5D70H 2JGYA 4N25A 3LHTA 3WNIA 4MLIA 3FFCE 3ZE0E 4JFYA 5RUBA 4GQZA 2A5HA 4TQIA 2G9HA 4JPVH 4JB9H 3O3BA 2K6YA 3DSNA 1Z9NA 3HG4A 4QTIL 3MO4A 3SZKC 4HX1A 1DDTA 2VDKH 1MCCA 2Q3OA 1HP5A 3QIWD 4ZUWA 3UPCA 2WOYA 4OFDA 1Z9SA 4JM2D 2H1PL 3GG1A 4HAKA 4FNUA 1UM5H 4LKXB 4HUUA 1TELA 1QT1A 3NFUA 3VGAC 1K6QH 2R24A 4ZSUA 4DQOL 1WEJH 3VWJA 3K71B 2DVTA 1HKLH 4JL2A 3FLUA 2FIKA 3AI0A 1HILA 5DQDL 3PDOA 3M5ZA 1YEFH 1R47A 5B3NA 5IR1A 3S97C 1TTAA 5IW3A 3WCYA 3VNJA 1AS7A 1OL0A 2OTWB 4YDIL 4JR9H 2J8TA 4YHOH 3MX0B 1Z8AA 3E3HA 4IIZA 3WLTA 1V08A 5CEYA 1H5VA 1QU4A 3TO2A 4IFKA 1EOKA 4RQQA 3UAJC 2IPUG 4M51A 2FEEI 4L48A 2CK2A 4XXCC 4WY0A 4JO3H 1NC2D 5IK3A 4AISA 1TEFA 2FE0A 1O94A 1FVEB 4LUJA 2DMHA 2H3BA 4V11A 2E5EA 1PV8A 2C1HA 3CC5A 3N0AA 3SYQA 4LDLB 1A1NB 3MXWL 3V0HA 3PN8A 4YEFA 3MLXH 1HYSC 2Z31A 5E6ZA 3TN5A 3CN1A 3SQOL 2XTJE 1DJGA 1X9RA 1RCQA 3MRQA 3ZE0F 4JFZH 4ZX5A 2NY6B 1TZ9A 3M0VA 4LCIL 3M7FB 3R58A 2YGYA 1PCWA 2YK1H 3RCYA 4QHMA 4HIEB 2WMKA 4KRMB 2KHAA 1NDVA 2J6XA 3U6WA 1PKOA 5E2UL 3INUH 3QUMH 3VC6A 4KFNA 3QAQA 4X6CE 4N2NA 1XX9C 1OP4A 4AQ8C 5CCGE 1CIUA 4NJGA 3W1MA 3PWJA 1V5JA 2VFEA 4ABUA 3TWCH 5T3ZE 1OFDA 2M26A 5E2WL 1J0JA 6FABH 4UFHA 2FQGA 1GXEA 1WPCA 4NRXA 1NBVL 3MRBB 4X9YA 4UT9A 5CJOH 2NWRA 4PRPB 3TSBA 1JFQH 1IAKB 5CKAA 4QAIA 5LG1A 2AJ3B 4XHQA 4HQVA 4NNPH 3GSVB 2Y5TB 3H9SD 4QJ1A 3VFWA 3BMWA 4LCUA 1HDMA 4DKEH 3CVIH 3WBXA 2G37A 2DZXA 2E9IA 2JK2A 4DESA 1UZ4A 4Z7NB 2IV9A 3NIDE 2CLHA 1ZTXH 3A47A 5JIQA 3VD1A 1AACA 2WMPB 1SHXA 4PJIE 4A2MA 4HUKB 2EC8A 3UJIH 5G55A 1A6VH 4UDUA 2DLGA 1QACA 4KH2A 3BI9X 5DJDA 1NGWA 5AOUA 4I5XA 3PZMA 2F08A 2FATH 4KMTL 1L7TH 2HZGA 4BF9A 1BREA 3GO1L 1UH4A 2Q6ZA 1L6ZA 3CV7A 1ZVSA 4QRPD 1WFOA 3CVBA 3P77A 4KK6D 4CQ8A 2MNWA 1Z3RA 4LGRB 4AIZA 2HJKB 5JXQA 3CAFA 2IAMD 4Z3FA 1VJSA 3JVFC 2FTYA 5F8RC 1XHHA 2ZRVA 4EI0A 1A7QL 1HG3A 5FM5O 3UROR 1JPHA 1IAII 3K1GA 2HLAB 1DWJM 2B0SH 3KYNA 3TIDB 3L5JA 1MCFA 1SYSA 4Z3HA 4PG2A 3OGOE 4Q74A 1ICSA 2FD6L 4JTGA 4XTDA 4PWJA 4X6CF 2CERA 1QFEA 4QG6A 1EX1A 3RVVD 4PMDA 3EBAA 1FYTB 2ZZ4A 5BMWA 2VWEE 2Z35B 5EPMA 3EOAA 4K8RL 4N0UE 3ABZA 5GS2D 4X98B 4MBRA 3LHZA 5EU9A 2YGVA 5JW5B 5CEZH 2VDML 2VR9A 1UJ3B 3O4LA 4YZWA 2WKOA 2AK4E 3S5NA 4FQXB 2EDYA 4HMEA 1TPXB 1DV7A 2E9BA 3CQHA 1JMXA 3QZEA 5DO2D 5IIEB 3FT2B 4JRXD 3NSFA 1AR1D 4C55A 5BW6A 2R0ZL 3MP4A 3BKJH 2ZRXA 3NIDF 2W81C 1PKQA 5AECA 3WAJA 5AYTA 2G2PA 1TQXA 1M04A 3S35L 2AKRB 2GT9A 3T1FA 3HFYA 4C4KO 1QI3A 3LXAA 3N2TA 3KOWA 1J4EA 2GTQA 3WLBB 2VLKD 2RA1A 2Q86B 2QUMA 4J2QA 3D25B 2RUSA 5AC6A 1WDDA 4E4UA 4DYEA 4O9HH 2J75A 2NLIA 3C6EA 1V8EA 2ACSA 3TA3C 3CXDL 2NY5H 1NINA 2VEMA 3PJLA 4P3CL 4TNVF 4BK8A 7REQB 1IGML 1LE9B 2MCPH 3QO1B 4HCGA 2TSAA 2JCCB 1BAFL 4UR8A 3QCUH 1SQMA 4ONGH 3S1UA 1IM9A 3CMJA 5EMYA 4MAYA 2Y07H 4GZIA 3LN4B 3SD2A 1LEKA 2BB0A 4MJZA 4GAJL 4AUBA 2EECA 3UR8A 2QF7A 5FCUL 2BPBA 5EIIG 2ZIDA 4MF4A 3WKZA 4S2CA 1HKKA 4YE4L 3I4KA 3NFSH 3KW7A 5JIIA 1I7ZA 2A4AA 3UTTA 1QW7A 3IJHB 1QWNA 3KL0A 3MMWA 4PTVA 2JMRA 2E7MA 4HPJA 1G6VK 4XBPA 2QT6A 2H0EA 5LAPA 3EX3A 4H13C 4C4BA 5GGSB 3MLRL 3SSZA 4OIBA 1RPUA 1U8QB 1K7EA 5JUVA 5HAOA 2F74B 3MJWA 2BRRL 4IPLA 1ZGLB 3SE3A 2EABA 4NDMB 3TN0C 2CJSA 4LP8A 2CO6B 1JXKA 1HJUA 3LRHA 2YDQA 2RKXA 4B5EA 2YARA 4HWBA 3KPSE 1H51A 3G5XA 5BOZG 2EEFA 2WHMA 2EVGA 1L9MA 1AQ8A 2Q3XA 4KK9C 1T1YB 5AVZB 1H15B 3D50A 4LPTA 2XYCA 3VSVA 2V7NA 3N2OA 2BC4B 4D6GA 3K6SA 1H9VA 3VNMA 3WS3A 4QUOA 5IF0A 3CZNA 1JDEA 2FJHB 4R2GC 3WTWA 1T0OA 2RTTA 3WE1A 2Y6SC 3BXNA 3PSWA 2INEA 5TF0A 1SJVA 3M17A 2Y1YA 4BGDA 3GKAA 4P07A 4XVOA 2L4OA 4FK9A 3VXUA 3LS4L 3CZUB 1H61A 3HQPA 5F21B 2YA2A 4FTDA 1I8KB 2RDUA 2Z1KA 3WEMA 3DUUA 1QZ1A 3VMNA 3EA1A 3ZE2E 3CG8A 3VWJC 4X7SL 2AQWA 5HJGA 3CFBB 5KSAB 4WKHA 4PB0H 5DR5H 5EOQH 1Z5LB 3PWNB 3TCLB 5B3JE 2DP3A 1ETB1 1UWQA 2Y0SA 2FX9L 2BTMA 1C12B 2N7BA 4P23B 2CIPA 2CZNA 1UXLA 4NC1E 2EVJA 3BG9A 1PD0A 3VXRD 4MA1B 1W56A 4I9WE 5D1XA 1RAKA 3RL1B 5CU9A 3VQMA 5JNYA 1IFRA 4FPSA 1OC6A 1CMOA 1WSST 5KJRL 3G1SA 1L9WA 1EO8H 4YO0B 4R34A 4H5SA 1CFMA 3ZKSD 5LNGA 1TV4A 1V3IA 1X7IA 3I68A 1JWMA 3B9KC 4PMQA 3WO8A 1MCPL 1VP5A 3SY0B 5LIYX 3ESUF 4LAZA 3HVDA 5TQ0L 1CLVA 4J6RL 5BJTB 3TFXA 1FWNA 5D33A 5H94B 3ALGA 4BQ5A 3UERA 3FO1A 2AQQA 1TU2A 4XSLA 3KXFA 5HDRA 3PFQA 1WAAE 5I19L 1JOIA 4AG4L 1G0XA 5JO5A 4QO1B 4LC6A 1EZLA 1RCXB 4X6EA 5A8MA 1A6WH 4C6DA 1RXOB 3U7AA 3W6MA 3AT8A 1N6QH 1I7UB 3MRRB 2DKUA 3ETBJ 1AQKH 4YDVB 3G1FA 5LGHH 3OZYA 2QKIB 3K30A 4JFVA 5T9BG 1LO0L 5CJNA 3IAQA 3O2WH 2PLCA 3DV6A 4KQ3L 5M03A 2YZ1A 3ZE2F 2GAZA 4P46C 3HAEB 3QB7C 3IUIA 4YDJB 4XD4A 2EKSA 3T0AA 5TDPB 3OJ2C 2CO1A 2Y06L 4D6JA 3BP5B 3QFDA 3O0RL 4AHOA 1EHKB 5D1QD 4C65A 3CHXA 2Q2EB 4MA3A 5B3JF 4TX9A 3DKLA 1CK0L 4K5PA 1GZHC 3GUGA 3AHTA 4U33A 1ZP3A 1TQSA 3WL9B 3CBJB 1S7VA 5A6IA 4DK6A 4ADGA 3CDYA 3SB0A 3SJNA 5C2CA 4M62H 4H1LH 2RGSA 2GTZA 1FNLA 2W8CA 3WF3A 4EUPG 1ANUA 3BYYA 3TV3L 3RDTD 2PTVA 1TX2A 1K03A 1LE5A 1GWJA 2UV8G 3DETD 2EG6A 1NANI 4H9VA 3M44A 5HVFB 5J5DA 2EVIA 5LXGH 1EZVY 3SJVB 2KI6A 4PJAB 3OODA 3N6JA 2KZBA 1F1AA 2PPAA 5A2BA 1QSEE 4ZMLA 2ZBTA 1WAAF 2Q1EA 1OWWA 2WM0A 2FECL 4Y4HA 2AVFA 2BOLA 3UZYA 2J57A 4DP4X 4Q89A 1K77A 3VI4B 4TQPA 1UQYA 5E8EB 3H9YA 3ARZA 7CGTA 3E5BA 4LLWB 4JK0D 1P4IL 2ZCLH 4GWEA 1HJBC 1PGRB 2OT0A 1R3JB 1DKWA 3MRJB 5FJIA 4GSXA 4UV7H 1WUFA 3EW3B 4EN3B 3P8JA 4N8PA 1P5BA 4DK3A 4NVTA 1R87A 3U46B 5E1QA 5DA0B 1N6VA 4JFEE 5C0BE 1BGGA 1FORL 2K6WA 2I56A 1SDAB 4HWEL 3CXOA 2WMFA 1G9HA 4LJ3A 1O68A 4CBZA 2CKBL 2WWOA 3PANA 1A5LC 2B5IC 4RCAA 1S2AA 4WWNA 1TA3A 1QR1B 1KT2A 1DIEA 2GVGA 1J1PL 4R85A 3U1QA 3OPZH 5F1KC 4AGNA 1KGYE 2EXSA 4LOEA 2EPLX 2FZBA 6TIMA 1NGYB 5F7AA 4C5ZA 2NVAA 1DO6A 1S7QA 5D1ZI 3V3WA 1X44A 1E70M 1S9VB 1ISXA 1U2CA 3P74A 3BD5A 3WHXB 4IRZH 3CT2A 4UFMA 4GRLD 3QQ3B 3KGRA 4B15A 4XAPA 4AOFA 3VM5A 5C7VA 4O2FA 4DKFH 1RPXA 3R2GA 1E8WA 1N3NB 3IUDA 2MOVA 5LAXB 1S3RA 5DMMA 3LXCA 4CDHA 4ZDHB 4DF1A 4YIQA 2YDSA 4N1HB 1ZZMA 3V5FA 4HH9A 4MAYC 1I0BA 1OSPL 3IGLA 3W1AA 1BQHB 4GUCA 1KEGH 4RKAA 3PABA 2VLLB 2F54E 3SGJA 3VD9A 4A38A 1N68A 2O4MA 5CLTA 5FAGA 5IG7B 4HGXA 3CJJA 3NBNA 3SUVA 3IJEA 1JDAA 2WQPA 4XN1A 3Q67A 4ES9A 4JN1H 4C6QA 3E8UH 3G04B 3ZM8A 1UJQA 2WWCA 2GABA 4YUEH 3TYAA 4ZSTA 3B43A 4HJ1A 5IGXL 5JXAL 4QHUB 4S1QL 5T5FA 3MHUA 1GS7A 1VEMA 1TKWA 4M6NH 2BFVL 4NZDA 1SO3A 2NW2B 2H47C 2DBJA 2E8YA 2EDQA 4R5XA 3ZVHA 1AS8A 1SOQA 1A4JB 3RWJA 3HS0B 3SE3C 1GT8A 2AVGA 2QJIA 3V16A 4N5ED 1VPOH 2PN5A 3EH4B 5I1IL 2IXQA 3KCWA 1RJQA 5J8LA 2QV2A 3LD8B 4A7GA 4BDVA 4U6XA 3E74A 3CAKA 3GSNH 3R6IA 3W01A 2DQCL 4XPGH 1F3JB 1F3EA 3IJYA 1NOLA 3RY6C 2QMJA 4WWKD 3V0EA 1GGCH 4JCWA 3WY1A 5HVHB 4QR6A 4ZSOA 5DRWB 1F4WH 2A7NA 3BUVA 1YEWA 2G4GA 1KGIA 1NELA 3N44F 5BXTA 4U1GC 2C7UB 4HQQL 5L88L 2GSGB 5I8KH 5EA0H 4BEUA 2CA3A 3ZO0A 4ZUTA 2Y6TE 2VJXA 1ZHBB 5J6GA 1JNHA 5HYSA 3FNKA 1CI5A 1GOMA 3QFGA 2DQIL 2KAUC 5MENB 1BWKA 4K8GA 1TTRA 1JCYA 2V67A 2VXTL 3OQ3B 2OA9A 3QXUA 1NFGA 3GBEA 4MXVF 4YC2B 2OT1A 2IH3A 4GXVL 3LERA 3GBML 4XMKH 4Z1PA 4Z0BL 1NC4B 2VLRA 3MYJA 2R29H 4IKKA 1NM4A 4D6EA 3MOAL 3TO4A 4G1MA 4POZC 4RFOL 4O1CA 3THAA 2ATKA 3JUZA 4F8XA 1XLIA 4LO9A 3JWOC 5T3ZL 3ITOA 3DECA 4JDEB 4KX8A 4RBPH 3VD5A 4E5XG 2ADGA 2XETA 5M1TA 3VXSE 5IB3B 2MANA 3INPA 2AXJA 4NUGH 3UGRA 1ZT7B 1MDTA 4MZYA 1CLOL 2J9YA 4HBCL 1VA9A 1URZA 3JT2A 5XINA 3VUSA 3L2LA 1D5IH 1KBGL 3LHPL 1DCEA 3RPTA 3P3TA 1ILSA 3FKUS 3NJGA 3RGVB 3HHSB 1V51A 5FJUA 3DUGA 3GG0A 4UTIA 2AZAA 1D5BA 4KRNA 4S3DA 4G8GE 3IDXL 3RLSA 4BWTA 1V3MA 1DQLL 4XVUD 1J9QA 4JD4A 1BZ7B 3ITVA 2P5NA 2PCQA 3SDAB 3SYPA 2X42A 4JFQB 3TFCA 3L12A 4PJBA 5F9DC 3BO8B 1KBIA 3NH7L 3DFHA 3HR5A 1YRKA 1CB7B 5AAMA 2YQGA 1EAOA 4Z1BA 1D5ZA 4Q3MA 5T26A 2VDKB 4HZAA 1SSGA 1C8YA 3BG3A 1BVKA 1OPGH 3QNYB 5IMKA 5AKTA 5CBEA 1XH1A 3WEZA 3GDMA 2DWEA 1T1ZA 5IW1B 3OJVC 1ZHLA 4KS0A 1ZEAH 2PA6A 4ZXLA 5IHSA 4C56E 4XWOC 3PK7A 3O11B 1F2QA 3EA3A 1X3DA 3D12B 3HJ0A 4Z42C 2Y69B 3M8OH 4GD0A 5D8JH 2H9GB 2EUVA 1Z7AA 2PF6A 4UT7L 1XIEA 2DUXA 2V7HB 3RVXD 1THFD 4XMPL 5CN2A 4KAQH 2FIRT 4U4BA 3WYRA 4FLOA 3NCYP 4UTFA 3DLQR 4B3ZA 1RLWA 5CILL 3MRPB 5JPNC 5BUPA 5ANME 4ZJ9A 4RX4A 2QGYA 3NP4A 1TJHH 2BSRB 5E0FA 3C60A 2DQ6A 3PZUA 1B9ZA 1FO0H 2XSKA 1AD1A 4W9GC 4N9GA 1ETA1 1UBSA 4IYKA 3STEA 3AMCA 2YGOA 3IIPA 4DN3L 4XP6L 2YCIX 5FKPA 2PDWA 4YU1A 4FDWA 3WBWA 2YMXH 3WF2A 3D05A 2CA4A 1NJ9B 2H26A 1K5NA 4MDJB 3ARWA 3T9WA 3P54A 3A67H 3EO9H 4P5KB 3H42H 2HQAA 2PMQA 2FUQA 3QYCA 2B7QA 3WIIL 1FVDB 2IWKA 2D69A 4KFZC 4MAZA 3OKMA 1D7BA 2F7PA 5LHFA 3MBFA 4RGOH 5IW6A 2E6QA 4R7LA 4P7QA 3WTVA 2DYPA 4M93B 1WB0A 1YYLH 4V1DE 3QUMB 4O0ZA 2GHZA 2YL5A 3R4IA 2AGJL 5I82A 1I45A 4QTHB 3MV8D 3E2RA 4XCNA 4JRYD 1SGKA 1MXSA 3HRZB 3VM7A 4YTQA 3NJXA 1F6PA 1NDGA 1E71M 3S1WA 3IWUA 2ED6A 2XZAH 4K2SA 2A83B 1WBXA 3IPBA 4TMCA 2G9KA 1FFTB 5TJWK 5KVEH 3RA7H 5DK2A 1AGBB 2XN9B 3K1KC 3ZUCA 3N55A 4GXFA 3O9WA 1AJ0A 3BW9A 4NQXA 3VI3B 3GMQB 1GOXA 5ESVB 1NKGA 4N90D 1WP6A 1IEXA 3OAUL 3LKPB 3VE0B 4H9TA 4UNLA 1QBLH 1KJVA 4AZBA 1WKYA 4D9RD 3SGJC 5C0DA 1EZWA 2YDAA 4J3BA 3EH3B 2ZUNA 1PBYA 4XNUH 4S3FA 1ZB5A 5JOFA 5CPNA 4HPOL 3E6FA 2AJYH 3DX9B 3B9DA 2R4RL 2EQDA 4L0ZA 5IBTL 5IBXC 1KC5H 3TBCA 3U6RA 3DN5A 4TNGA 1EHNA 2IQDA 5BNXD 1GOQA 2J1ZA 3TMLA 4XCFL 1KEMH 4N6RA 3RVTC 5DRXA 5XIAA 5FDWB 5K9OA 2GCYA 3PPSA 3CDGB 3RVUD 3HNTH 1DO5A 1V79A 3MRGB 5T1DL 2CMRH 4LVHB 3IDJB 2CPUA 2FWLB 5I07A 4JG0L 3PB2A 3W84A 1DE4B 2RAMA 3TT3H 2CAKA 4EI6B 1E4KA 1ZT1B 4HJUA 3BFQG 1IBDA 1LP6A 2G3ZA 4R3SA 2FT7A 3MLVL 2VUKA 4KEZA 2ZC1A 3WFLA 1EMTH 3MB9A 4AZ8B 2CUHA 5JHAA 4G8EB 4PB4A 4PJCA 1IBBA 3T04D 2X6AA 4GRWH 5FLVA 2O0TA 2IAND 1H7NA 4PUMA 1LWHA 4HC1A 3W22A 1MCKA 2BS71 3KYAA 4EXQA 4MD0B 5AYYA 3BGFB 4NP4H 5CINL 2FX7L 4NQDA 1POJA 4HETA 3N2CA 3HUJE 1YPZE 3CUFA 1OQXA 1LWRA 1UJPA 4JTSA 2Y63A 4WSGA 5SWZE 4LESA 1C08A 1HO4A 1W1YA 3AG2B 3AG4B 3MU3A 4UM9B 1KNWA 1A0DA 4DTGL 3VZXA 5L4IA 3TAOA 4MZ3A 5L6UA 1XQLA 3V6FB 4AYFA 3GAKA 5CC3A 1NL0H 5I6XC 1R4XA 4JTIA 1TE6A 2X3CA 3HF3A 2XWBB 5E6YA 3NEVA 2ICWI 1HXMA 4R8WL 4MWAA 3GBNL 3MROA 4BUGA 1VZWA 4B3EA 1TZHB 3LIZA 4UMBA 5EZLA 1NDMA 1KGCD 4BE6A 3I6SA 1XDMA 2VCAA 4WO4A 3N42F 4JN7A 1MJ8L 1XL9A 3VIHA 4NP7A 4FTVA 1V77A 4M5ZL 5M2FX 4BBWA 4BKTC 1H09A 3NQBA 3KR3L 4KKLC 1US3A 4HKPA 1XYFA 1QI5A 2WTOA 2WLLA 4JPIB 3UNDA 1XB8A 1PCSA 4OLVL 5D7LE 2CIIB 2EHHA 4E9YA 3C2FA 5E4EC 1SVCP 3MOQA 1FWTA 1EQWA 1KG0B 1H8SA 2VZTA 5J5EA 5IUCA 4FX7A 4YDNA 4UTBL 1JNNL 4FXFA 3T8XA 4ILSA 4NKIH 4Q9QH 3PY2A 1I1AC 5CCKH 1XLJA 4WUUA 1E8ZA 4UIMB 1AP2B 2PFHA 3LV5A 1XF3B 1JVKA 1HW6A 1TMLA 1ZK5A 4H20L 4L4TE 1XJBA 4EF8A 3W11D 1PLBA 2C15A 1W3JA 1KYFA 5LDUA 5KETA 1OGAE 2ZX9A 3HS8A 1GKEA 5AUMB 1Q8JA 3UPWA 3HUJF 2P7TB 1XYZA 3HG1B 1YPZF 1ZDSA 1BLNB 4S0SD 4LANA 4HV8A 3N43B 1BVNP 3WF1A 3EJRA 4ZVJA 2ZZ1A 4HXAH 5D6CA 4Z7UF 4L3FA 4GQRA 5GZNA 3FU5A 4LOUD 4Z3JA 5AAMC 1ACYL 3MCMA 3R25A 3T2LA 4WI4A 5FO2A 1SJXA 1U36A 1KM1A 3FK3A 3MLZL 4X61A 4YXGA 3NWRA 4PLNC 2AAVA 5GSRA 2Z8SA 3BCDA