1VAHA

Crystal structure of the pig pancreatic-amylase complexed with r-nitrophenyl-a-d-maltoside
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Crystal structure of the pig pancreatic alpha-amylase complexed with rho-nitrophenyl-alpha-D-maltoside-flexibility in the active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 163
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1vahA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1vahA01
5TD4A 3DX4A 4HPHA 2O9PA 3FAXA 4HZ7A 4MB1A 3W4RA 1JG9A 2V3FA 1FHDA 1J0IA 3WELA 4KWUA 1C8XA 3VD7A 4TXEA 3ARUA 3AISA 3EYPA 3W0KA 4A4AA 1A3HA 4NXKA 1NWTA 1W1YA 4IPNB 4J3UA 2X1IA 2CETA 1UR8A 5ABEA 1MW2A 3CV5A 3RMEA 1QI4A 1G94A 1M7XA 5BCAA 2A3HA 1HX0A 2VZVA 3MSGA 1LL4A 1FFRA 2X05A 3AZRA 1TQSA 2EPKX 1M53A 4RE3A 4CN6A 2YFOA 1L8NA 1PZ3A 2YDRA 1G9HA 4W86A 2GVYA 5LA1A 3B9DA 1M03A 1QW8A 1V0LA 1ISXA 1TA3A 4L4PA 3WEZA 4F9DA 5IFPA 1CLXA 3O2LA 4PMUA 3CHFA 1TG7A 1HJQA 2DSKA 5D8WA 1Q6DA 3ARWA 4V2XA 4DM1A 2G3JA 1CGUA 3U7VA 5DFAA 1C7TA 2W5FA 4W85A 5A6BA 4JHZA 2DSZA 3VD4A 3D5HA 1IV8A 2W92A 5BRPA 4UQDA 5BROA 4AEEA 3ZSTA 5CXPA 1UD2A 3WDPP 1C92A 2ZX8A 3AXIA 3EMZA 1KCLA 1E5JA 3L4YA 1ISYA 4QCFA 1C91A 2JE8A 4BQ3A 2VC9A 1W1TA 5CLTA 3K1DA 3VMNA 1UKQA 2UY4A 3LMYA 4UR9A 4JKMA 1VF8A 3T2OA 3RO8A 3CHCA 3DX3A 4MNJA 3ECQA 1UKTA 1E72M 3ARYA 3CUHA 2WYSA 3AIVA 1JF6A 3FHQA 4IM4A 1K9EA 2XVNA 1E0XA 1GQIA 2BVDA 3HG2A 4NXSA 1UG6A 1W3KA 2PBGA 3LPFA 4PEEA 1GPFA 1JZ4A 3F5KA 5D8ZA 2CERA 1HXKA 4CU8A 2GDVA 3SURA 5LA0A 1EXPA 3WF3A 1CXKA 3CMGA 1BHGA 1W3LA 3SCVA 3POHA 4Z2GA 2ZXBA 5D9MA 2BS9A 5D9OA 3WEOA 3GDBA 4HU8A 2ZICA 2WMFA 4PMXA 1B9ZA 2J79A 2WBGA 3ZMRA 4D6IA 5A3HA 4ZXLA 3SUUA 6CGTA 1KCKA 3WBAA 2Q8XA 4TVCA 5JBEA 4NSBA 4IISA 2VX5A 4P7QA 4YPJA 3OB8A 1PZ2A 1ECEA 3SUSA 3SCWA 5A8NA 1GVYA 4JFSA 2E9LA 3PTQA 1JIBA 1GOIA 3OLIA 3WH7A 4AW7A 4S3KA 1J0KA 1ZS2A 3W25A 3AI0A 3AS1A 1WDQA 4KRTA 4AZ6A 1UWRA 1Y7VA 3PZTA 4GINA 3BMVA 1UH2A 1E6NA 4NRRA 4J27A 1V3JA 4WSJA 2X2JA 1WZLA 1CDGA 2E0PA 3CZLA 5GQBA 3WH6A 2WCSA 1US2A 3BAIA 2D0HA 1V03A 4CN1A 1U2YA 2ZUMA 1V3MA 1J9YA 4YHEA 3TONA 1D3CA 3EDJA 3TOPA 4ML4A 4FNPA 3WL1A 3OZOA 1KXQA 2BY1A 4FLQA 4N0RA 4WK9A 2ZXAA 3AHYA 4OBRA 2OYKA 4ZEPA 4OGZA 1G1YA 2XFYA 4C7FA 4AZIA 1BYAA 3ZJKA 3AIUA 4IPLA 3WY2A 3O6AA 4UFMA 5CJ5A 2Z1KA 1E4NA 1KTBA 1E73M 5CG0A 1H0GA 3NDZA 2ZUVA 2JIWA 4JZ5A 3AMLA 7CGTA 2VQUA 3DHUA 4PTWA 3MS8A 1HL9A 1TCMA 2YA0A 1JI1A 4LYPA 3L2MA 5FKYA 4AMXA 1BG4A 3LXCA 2G3MA 1SYTA 4D1IA 2OWWA 2VURA 3H54A 3W27A 4E8DA 1UWIA 3VM7A 1CGXA 3WNLA 2VVSA 1UD4A 3DYOA 1WPCA 5EFFA 3BLPX 2WVTA 4BA0A 1KXHA 1K9DA 2QLYA 2WWCA 3MMWA 2B31A 1E4LA 1O7AA 4LYQA 1UD3A 3BAYA 4J7RA 2PBOA 1NQ6A 2EEXA 3WENA 2W66A 3GBDA 1HKKA 4CCDA 2VT0A 2CBJA 1ZBKA 2VL4A 1H11A 1CIUA 2CKRA 3ZJ7A 1DWAM 2J8FA 2QF8A 1NH6A 3UR8A 3AXXA 1YQ2A 2ESCA 4H04A 1BG9A 5DT5A 2NSXA 4HA3A 2QHAA 3SCUA 3VO0A 3WNKA 3AQUA 2EACA 4MNLA 4W93A 2GK1B 2WKGA 2JEPA 1J10A 3AFBA 4GO9A 1M01A 3EJQA 2VOTA 3AYRA 2YKKA 1MW1A 3EJUA 3VIOA 5EBAA 2DH3A 1UD8A 2XN1A 1E0WA 1R34A 3AIQA 3OGSA 1GVIA 5D9PA 3WL0A 2XN2A 5AYIA 5A8QA 5CLWA 1HJSA 1V6VA 2D24A 3WQ8A 1G01A 1BVZA 2W4XA 5BXPA 3GNPA 3W6LA 4XZBA 1OD8A 3WMBA 4M82A 1W91A 1WDPA 1R7AA 6TAAA 2F61A 3DX0A 4HZ6A 2WM0A 2WZIA 4DO4A 3VNZA 1TFVA 2ZUNA 3UR7A 2RGMA 3VINA 1HL8A 4WLCA 4AIEA 1QW9A 4HMDA 1QWNA 3IJ7A 1CXLA 1QBBA 3ARZA 1UHVA 4URIA 4AZCA 1R75A 1E3XA 2EPMX 1PIGA 3ARRA 2ZX9A 2XJ7A 1UH3A 1HTYA 1HJXA 1SZNA 1KBBA 2WANA 2OW7A 3VKKA 2PWGA 2WMIB 3VGEA 2X2YA 4AISA 4XB3A 2Z1SA 3ARXA 1JZ6A 4DUXA 1QI5A 2D20A 4OOUA 2A3AA 1WDRA 3EDDA 3THCA 4JCLA 3N04A 1UQYA 1PPIA 1MWOA 2E4TA 2WKLA 4AC1X 4EK7A 4HOZA 1UYQA 1DTUA 3T08A 4B3KA 2F1BA 3L2LA 3GNOA 5GNZA 2D3NA 4UQEA 2J74A 3AJ7A 4XZWA 2V3EA 3BVTA 3VIKA 1E40A 1ZJBA 4DO6A 5IHRA 3KEHA 2X09A 1FA2A 2C8NA 1OSEA 1OT2A 3W6MA 1HWWA 1W9VA 2J25A 5LA2A 4GPNA 1VBRA 4V28A 3S5YA 4RE4A 1EA9C 3ZR6A 2FHFA 4LX4A 5DO8A 2DT3A 3A3HA 4MAZA 1B30A 2XTKA 3OGRA 2JALA 3WH9A 4V27A 1RP9A 1W9XA 1CXEA 4HMEA 1KB3A 2XVPA 3OG2A 3UERA 1KXTA 3WF1A 4H8UA 5CSYA 3ZR5A 1DP0A 1XYZA 2O9OA 1TVPA 3MU7A 4F9JA 2WLYA 4B15A 3PZ9A 5IXEA 4PCTA 3QOMA 3PZMA 1SMDA 4M80A 4P7LA 1XHGA 1V6XA 5E6ZA 1E6PA 3LRLA 4W88A 3G6MA 1AQ0A 3NSXA 2XIIA 1QI3A 1HKJA 2J8GA 3HN3A 3TTYA 1QI2A 5LYRA 2G3NA 2ZX6A 1B3WA 2YBTA 3CHEA 3QR3A 1VFMA 4M29A 3WQ6A 1QI0A 2Y2WA 4D6DA 2UY5A 1F4HA 1HVQA 4CVUA 3AMCA 3SCSA 4QCEA 4UFKA 1CGWA 3K4DA 3VD3A 3GXIA 4K68A 1JDAA 3UG4A 3CH9A 1X1NA 4MDOA 1ZJAA 1GOKA 2WLZA 4AZ5A 3MMDA 4AY1A 2AAAA 1C8YA 1SR0A 1UZ1A 4BF7A 2E8YA 4CD4A 5KZ6A 4F66A 1TQWA 1BYCA 1UKPA 4JIEA 3AIEA 2OSXA 5IFTA 1VBUA 3HMCA 2GFTA 3PZOA 4ATDA 5JUVA 4TTUA 1UR9A 1UKOA 4UZUA 4XUYA 2ALWA 4GKLA 5M5DA 1BYDA 1QOXA 2VTFA 3MUZ1 1EOKA 4PMNA 3ZQ9A 1BGAA 1ZBCA 5CPQA 2Y5EA 4CKQA 5A6AA 5I0DA 4NX0A 3AZSA 3W81A 1CGVA 1E6QM 2DDXA 1XD1A 3WKZA 3NSNA 1RD6A 1OD0A 1JZ8A 1CEOA 5I77A 1D7FA 2NT1A 2OWCA 3TTQA 3ZM8A 1OGBA 4PMDA 4DWSB 5E0CA 5AYBA 3ZJ6A 2JIEA 3A23A 4QAWA 3VNYA 2WB5A 1OCQA 4X0NA 4MDPA 1GOMA 3CZSA 3BMWA 3ALGA 3N11A 5A2CA 3CGTA 2DT0A 3N17A 5ABFA 1W9UA 1MXDA 1RPKA 1W32A 3O9NA 1ISWA 4HOXA 2CBVA 2VZSA 2FH8A 3FW6A 3VOCA 1MW0A 1XSJA 3WQWA 1BAGA 2WHMA 1BPLB 4MNMA 4W89A 4ACZB 3U57A 2YOCA 4MB3A 2PWEA 3F5LA 1EH9A 1VEOA 1UWTA 1B3XA 1BYBA 3HG4A 3HJEA 1V0MA 3VX1A 4PTXA 3RJYA 2WK2A 3ARTA 3WH5A 1FOBA 3EDKA 2EJ1A 3CZGA 4OKDA 1QHOA 2F2HA 4TVUA 1B3ZA 1EQCA 3N13A 2J7CA 4PUDA 2BY2A 4QLLA 2G41A 2XM1A 5A2AA 3AHTA 4TOQA 3PN8A 5C8BB 2FDMA 4X9YA 2A3BA 3GH7A 3LRMA 4M56A 3GH4A 3CPUA 1KGUA 2D2OA 3VSTA 3MSDA 5I5RA 2WNWA 3L4WA 2VRJA 1R7OA 1C7SA 5GNXA 2OLHA 3GNRA 3VIGA 3NDYA 1B1YA 2EBNA 3CZNA 1FH8A 1ODZA 1UD5A 1S46A 2CPUA 1QHPA 1EO5A 3A47A 2GSJA 2DT2A 1NP0A 2QMJA 2X8RA 1H5VA 1B3VA 3AHXA 2WVSA 1LL7A 3WIJA 5ABGA 1ITXA 4WKHA 5CPTA 1Q6CA 2F1AA 1B3YA 4BQ5A 1XV8A 1W1VA 4JL2A 1MYRA 3M7SA 4FNSA 2CKSA 4A3YA 1BFNA 1V0KA 2E3ZA 1RP8A 4HU0A 5A1AA 4E8CA 1BGGA 4Z2LA 3W29A 3W53A 2ZX7A 4HP5A 2DIJA 3WNNA 1YHTA 4B3LA 4OUEA 1WO2A 2WVVB 3IANA 3L4TA 1XD0A 2OW6A 3WDJA 4JKLA 3D3AA 2ZOXA 5HBFA 3ZSSA 3KL3A 4M8UA 1GHRA 3N12A 1KGXA 4UQCA 2WSKA 4QFUA 1QPKA 3L4VA 1HT6A 3FY1A 1H3GA 1NOWA 1V3HA 3PTMA 4ZE4A 4F79A 3LPPA 3WUBA 2XGIA 3AS0A 3BCDA 1W3HA 3VILA 4CN4A 1B31A 3CZ8A 3UETA 3CO4A 5I79A 1XSIA 1OWQA 1C8QA 2G8ZA 3EDEA 4HOWA 3RM9A 5BXRA 1B90A 3ZT5A 4P8WA 7TAAA 1EDTA 2XN0A 2ZUTA 1CTNA 3IGUA 3VDHA 3NSMA 3OA5A 2X2IA 3GXDA 1R33A 5CGMA 4U5KA 1MFUA 2XSBA 1E3ZA 3LXBA 2UY3A 2V3GA 4H8HA 3VIPA 2GJXB 5GPRA 2OYMA 1I1WA 4E4PA 1GORA 2WCAA 3D51A 5CGTA 2GUYA 3FAWA 2HVMA 2W61A 3ARSA 3WNMA 3FHAA 2XFRA 2UWFA 3QHMA 3NJ3A 1JGIA 3DC0A 4AD0A 3CUFA 5JIPA 1A47A 3BVUA 1GQLA 1O6IA 2F7PA 1FHLA 4KMQA 2CBIA 2WHJA 3CC1A 4P8UA 2XG9A 3KLLA 4NZFA 1JAEA 1XH2A 2IXUA 3AYSA 4J3XA 2Y4SA 1JNDA 2E40A 3AS3A 3W26A 8A3HA 1WNOA 1X6NA 5I24A 3S5ZA 2WSPA 3WD0A 4TX8A 2CXGA 2NW0A 1H0IA 1E6XM 1OM0A 3A6OA 1WZKA 3IJ8A 1UWUA 4UNIA 3SEPA 1JYNA 1L0PA 2EXOA 1HN1A 1MXGA 4M24A 3M46A 3A22A 1GOWA 2YLAA 4AZBA 1R87A 4Z2IA 1KTCA 2PWFA 3VIHA 3VVGA 2X2HA 3F5JA 3L4ZA 2WXDM 2JF6A 1GJWA 1T0OA 5A8MA 1GUVA 2A3CA 4UQAA 1LWJA 1QNRA 1GNXA 3VSUA 3VIFA 2J7FA 3PZQA 2IGTA 3VGGA 5E9AA 1VEMA 4PCSA 1PX3A 2O92A 2XSAA 3SUTA 1GONA 1KBKA 3RDKA 1FH7A 1KGWA 1MQQA 3E1F1 3QGVA 1KWKA 4PYSA 2CIPA 1PX8A 4KGLA 2XWDA 2WBKA 5A6MA 2J7EA 1WZAA 1OIFA 2D0FA 2W62A 3K4AA 1QNSA 3HG5A 3RM4A 4UQ9A 2GJPA 1BTCA 4AZHA 2PI6A 3MUIA 4UZSA 3PHAA 3WD3A 4FLRA 2WPGA 1J12A 3VIIA 3SIMA 1CECA 2XUCA 2HISA 4PMRA 3WEMA 3FXYA 3EDFA 4PTVA 2E8ZA 1OB0A 4D6EA 2VZOA 1JZ3A 3MO4A 3WD2A 4ZENA 3MV11 2WMGA 2ZXDA 1K6AA 3TV8A 1J11A 1CWYA 2BHUA 2XPKA 1G5AA 4KGJA 4ATLA 2WMHA 1SFSA 4N42A 3D4ZA 2VX4A 7A3HA 1EDQA 3PTKA 3SCPA 4MNKA 1R85A 2QV4A 3NUKA 1HIZA 4J3WA 5FIPA 1CXHA 1WKYA 4Z2JA 3WD1A 3DX1A 4FLSA 1NARA 3ZT6A 2J75A 4J3SA 3NYDA 5EB8A 1JDDA 3THDA 2EPNA 3CBWA 3TTSA 4CUCA 5HDRA 1QX1A 2VCBA 3W28A 5ABFB 5I23A 3EMCA 2A3EA 3VUPA 2FH6A 3H55A 3F4VA 4IUGA 1BLIA 3GZAA 2J7HA 1JZ2A 2F7QA 1R46A 3CUGA 4R27A 3D4YA 1E4IA 2J7GA 1JAKA 1XGZA 1E70M 1PAMA 2ZX5A 3K8LA 2V3DA 1I1XA 1U30A 4Z2KA 1C93A 4AIUA 4FNUA 2BY0A 2FYVA 5BRQA 3VSVA 2VZUA 2RGLA 5JBDA 2CHOA 1XC6A 3WY1A 2OWXA 4ATWA 1I75A 3KWXA 3J7HA 5GNYA 4AD5A 2EPOA 1TA3B 1XCXA 1E9LA 1UR1A 3B9EA 2Y24A 4CCEA 4EAMA 2VVNA 5AY7A 3GM8A 2J4GA 3BSGA 1OGGA 2EQDA 3SUWA 1NOUA 3WY3A 1B2YA 2J7DA 1E0VA 4GIAA 2DSWA 5ECUA 4AXNA 2MANA 1DEDA 5A94A 4M81A 1H1NA 3BVVA 2CNCA 5A8OA 1UD6A 4AZ7A 4XX6A 1VFOA 3EMQA 2OSYA 1TMQA 1H2JA 3HZ3A 1LG1A 5A6JA 1NWUA 1EDGA 2IXVA 2WC7A 1UH4A 3HU7A 2ZIDA 3RM8A 4H7VA 4W5UA 1LL6A 3N18A 4JFVA 5FL0A 1R8LA 5I3DA 1QBAA 1H4PA 5CQ1A 3WFLA 2EADA 4BCEA 3OLDA 1TUXA 3BH4A 2BNJA 1AQMA 4YN5A 1QNQA 3II1A 3U5UA 4QP0A 1VFUA 4BS0A 2FGZA 3UG5A 2PWHA 4DWSD 3WD4A 1IZJA 3N1AA 2ZWZA 1VFFA 3TA9A 1V02E 3GXNA 1HJWA 4KH2A 3VD9A 1W9PA 3RILA 2W91A 4GZJA 2OSWA 1CXFA 2WMJA 1JFHA 3AZTA 4AZGA 4FNRA 1NWRA 4R5EA 3B8SA 2X0HA 3GTNA 1CPUA 1KR1A 3WQ5A 2YIHA 4QLKA 2DGAA 3SCTA 1C3FA 5JBFA 1HJVA 1M04A 1JYXA 2PF0A 1VIWA 4WF7A 1H49A 2C0HA 2ZUUA 3WMSA 4UOQA 2WMKA 3GBEA 1NWSA 3AICA 4GXPA 4PN2A 4W7UA 3T2PA 2D0GA 2YA2A 1VAHA 9CGTA 3CIVA 4GO8A 5E6YA 4X0VA 5D9NA 3KL5A 2J78A 1DWHM 2VRQA 1GQJA 1SMAA 1D2KA 1GOOA 4W84A 4J3VA 4PMQA 1J0HA 1W2VA 3EBVA 4TUFA 4DM2A 4AD3A 2DSVA 3DECA 1E43A 4JCMA 1UR4A 2XYLA 1PJ9A 3VGDA 5F7UA 2GK1A 5E09A 2XIBA 1JFXA 2DIEA 3D50A 3LRKA 3S6TA 5AC4A 1HJUA 4U3CA 3NIYA 3ZJ8A 2WZHA 2YDSA 1GQKA 1UWSA 3WUGA 5HXMA 4FNQA 4CD6A 2YLLA 1E1FA 3OZPA 1VJZA 1V3KA 1V6WA 2NT0A 2ZWYA 3PZVA 5KEZA 4HPGA 5CPSA 3CZEA 3VGBA 1XRVA 3MKKA 4F8XA 1E6ZA 2WW5A 1ESWA 3SCNA 3GH5A 3BAWA 3VU2A 3PZIA 3K8KA 1FP9A 1TQVA 5BYWA 1DWGM 3AMGA 4D6HA 1NP2A 3WF2A 3MV01 3GYCA 2XHYA 4XV0A 3OBAA 1AQHA 4WSKA 2FHCA 2XGBA 4GQQA 1NM9A 4NI3A 4Q22A 3VMOA 1UR0A 3MUY1 4ACYA 1E4MM 1E1EA 1E6SM 1E6RA 3ARQA 2WVUA 3ARVA 2VJXA 1F4AA 2D22A 3N15A 4W8AA 2YL9A 4Y7EA 1PIFA 3T0DA 3CLWA 1W1PA 4QDMA 1HNYA 3T0AA 2WMIA 4WJXA 1C90A 3BCFA 5DT7A 4EKJA 1AMYA 2YBUA 2JF7A 5ABHA 2BFGA 1OINA 4B9YA 1N82A 1U33A 5C71A 2XVLA 5M03A 3KZSA 4JHOA 3DX2A 4OJYA 2FHBA 3MUAA 4MADA 1UKSA 1IZKA 2V5CA 1CZ1A 2J62A 3FNDA 1WCGA 2BXYA 2YL6A 2VR5A 2VQTA 4ZFMA 3RPMA 3TP4A 5BWFA 3RJXA 4KRUA 4EE9A 1JZ5A 5A6SA 2ZUWA 4PMYA 5FOOA 1XYFA 4GZEA 3WDQA 3AHVA 1TZ7A 5E70A 4U2ZA 5C70A 1UR2A 1R86A 3VD5A 3WUFA 1V3LA 3VPLA 4DUWA 3L4UA 2EO7A 1UUQA 1JXJA 3MANA 1J0JA 4U33A 4JFTA 3A4XA 3SCRA 3T0BA 3CZKA 3A4AA 5HPOA 3WFZA 1Q4NX 3UCQA 1KWGA 1XCWA 1FP8A 4GZIA 1Z32X 1VJSA 1H09A 3N9KA 2DPEA 2WHLA 1VRXA 4NRSA 5CSUA 3AHZA 5A8PA 3BC9A 4DO5A 4OZOA 4EANA 4U5IA 1ISVA 1VEPA 4AZCB 1WE5A 1JYVA 2XVGA 1GZJA 4RL3A 3VIJA 4J28A 3A21A 3W37A 1E56A 4AD2A 4AD4A 5FD0A 1LG2A 2BVTA 1X6LA 4D6CA 1B0IA 2EPLX 4LQ1A 3W82A 2CCRA 4AMCA 4CCCA 2FE0A 1TQTA 4PMVA 3ZT7A 3GXMA 1J0ZA 1UASA 4HZ8A 3IAPA 3LX9A 3W38A 3ARPA 4CD8A 3KE0A 4W7VA 1UZ4A 4GI9A 2J47A 2CITA 3M07A 5FCZA 4J3TA 1JZ7A 3KL0A 2VX6A 4P8XA 4PRWA 2FGLA 2YFNA 2ZUSA 2G3IA 1QNPA 1O7DC 2WC3A 1P6WA 1ISZA 3I3BA 1CYGA 3VDBA 3VIMA 3ZO9A 4GI8A 3QHOA 4P7OA 2VCAA 1MQRA 3AMDA 4W8BA 1MVYA 1H41A 1ODUA 4OOZA 1HP4A 3WDHA 3MMUA 4UOJA 4W5ZA 2DH2A 1EHNA 2V5DA 2CYGA 4MB5A 4DWSA 1OT1A 4W87A 5M3WA 1CBGA 4C7GA 1MW3A 3DDFA 2BVYA 5AC5A 4H8VA 2BHYA 3BUDA 5IDIA 4ZXOA 4CD7A 4E2OA 2EAEA 4MPKA 1WDSA 2AOSA 4MB4A 2GJRA 1K9TA 4L4OA 3BUIA 1UQZA 4QLJA 2YDQA 2CHNA 3VDAA 4YHGA 3BAXA 1UWQA 2VNCA 1TE1A 4B16A 2YJQA 3APGA 1FH9A 1OGSA 1CGYA 2XFFA 1V6YA 2IUZA 3WH8A 5BXSA 4U31A 1LLOA 4PSPA 2V38A 2QPUA 3RCNA 1XSKA 1GCYA 4ACZA 3SCQA 1PS3A 1V3IA 3I3DA 1QNOA 3WDIA 4TTGA 1EQPA 4FF5A 2E9MA 4UCFA 3UG3A 1LF1A 2VR4A 1W9DM 4TVDA 5A69A 4GI6A 2WAGA 3U5YA 4UOZA 4BZYA 3K46A 1JDCA 3T2QA 4CU7A 4D1JA 8CGTA 1JXKA 3WN6A 3OGVA 4B9ZA 1AVAA 4FK9A 1HXJA 3MI6A 4TX6A 3EJPA 1ZB5A 1JD7A 3WY4A 1PX4A 4D71A 1HVXA 3BUQA 2ZXQA 4C7DA 4CVWA 5HNNA 3OLGA 1V0NA 4W7WA 3EJTA 2VRKA 5DF0A 4U3AA 4JL1A 1UA7A 4UFLA 4CU6A 2CEQA 3IJ9A 2D3LA 3WMCA 2TAAA 3AMKA 3D52A 4PBGA 1TVNA 2XVKA 4MTVA 4UFIA 4UQBA 5A6BD 4UFHA 3AXHA 1J18A 3CHDA 5A2BA 3W24A 1GOQA 1US3A 1DWJM 3AIWA 4CGTA 3BUBA 4DUVA 5I78A 1E71M 1KFWA 2G4FA 2JFEX 1PEZA 1DHKA 1Q6FA 4JKKA 3BAKA 1G0CA 3EJSA 5EFDA 4M1RA 3UEQA 4PUEA 2BY3A 3T09A 2CBUA 1Q6EA 4LYRA 4HTYA 1CXIA 5E1QA 2VX7A 1UOKA 4OBSA 4HMCA 4DWSC 4WKFA 1UA3A 4JFWA 3DYMA 1EOMA 4H2CA 4FLOA 1GJUA 4AMWA 1OIMA 2WCGA 1LQ0A 1WB0A 4P7NA 3L4XA 1JL8A 1BSIA 2VUYA 3NCOA 4JFUA 1JYWA 3CUIA 4UFJA 1IT0A 1W2PA 3SCOA 2WVVA 4CD5A 1GW1A 5IHSA 5DMYA 4UTFA 3BLBA 1CNVA 3WF0A 3IAQA 4D72A 1EGZA 3AIRA 4FNTA 1JI2A 2DEPA 1WAWA 1BVNP 4RE2A 1JD9A 3RIKA 4PMZA 3PZNA 5DEZA 3PZGA 1OBAA 2F18A 1TQUA 2WHKA 1JF5A 5A6KA 2ZE0A 1GHSA 1V6UA 3LXAA 1MQPA 1HKMA 6A3HA 3GXPA 3BLKA 2BXZA 4FMVA 3GXFA 1CGTA 3VTRA 4AIOA 3AS2A 5FL1A 2DQXA 4MJ2A 4P7RA 3BVXA 2GJXA 2YL5A 3QHNA 1J0YA 3M6DA 3GXTA 2J77A 4U2YA 4AYSA 1CLVA 3OIHA 1QWUA 2C7FA 3CMJA 2PC8A 2CESA 4BQ2A 2Y8KA 3JUGA 2EABA 2Y8VA 1ZBWA 1HKIA 3EJRA 3VGHA 1ZU8A 3AIBA 2WZEA 4AWEA 3VMPA 1JNEA 1VENA 2O9RA 5E0FA 3DDGA 3KLKA 2BHZA 3VGFA 4AEFA 5A6LA 4PSRA 3U7BA 1E5NA 3H53A 3S2CA 2F7RA 3B9AA 4MAVA 1E15A 3WF4A 4NZCA 1KQYA 1EO7A 1BF2A 1QHZA 1R47A 3AOFA 4NF7A 3ZIZA 5M17A 1RH9A 3POCA 3PBGA 2GDUA 3LPGA 4Q7NA 1KQZA 2XWEA 3TTOA 4HA4A 4GQRA 3BVWA 4P8VA 1ZBVA 2W67A 1LJYA 4D6GA 1XH1A 1ZL1A 3CUJA 3UESA 4D6JA 5HOSA 4AYGA 2D1ZA 2XM2A 1K9FA 3PZUA 3AROA 2JEQA 1V02A 1DWIM 4JAWA 4AD1A 1KR0A 1HF6A 3BSHA 2DT1A 4W8LA 4LXFA 2PB1A 1MFVA 4WIWA 3QOKA 4HA1A 2WC4A 3BGAA 3DYPA 3HG3A 4D6FA 2D23A 3WUEA 1KXVA 3VDCA 5CZKA 3G6LA 2QMKA 4S3JA 1BQCA 2F8QA 2F7OA 2VI0A 1PBGA 3ALFA 1W3JA 1XH0A 5D4YA 3K8MA 4Z2HA 1V08A 2OYLA 2VO5A 3A5VA 2DSUA 1W9BM 3WNOA 1HP5A 1QVBA 3I3EA 3CTTA 3CZJA 3BXWA 3WQ4A 5I6SA 4PMOA 3LPOA 2VZTA 2AMGA 2X0YA 5I2UA 3A24A 1WP6A 5EMYA 2J7BA 3WQVA 2D73A 3BUPA 1J01A 1VB9A 5BXTA 2W63A 1Q6GA 3ZOAA 3WNPA 3VX0A 1DWFM 4A3HA 1ITCA 2VCCA 4LPCA 2VMFA 4PTMA 3SUVA 5HPCA 3FN9A 3DHPA 5A95A 1WZMA 1LWHA 4NZJA 4MJ4A 4OIFA 1FFQA 1CENA 2YL8A 4ZE5A 1EIBA 1NOFA 2YA1A 2UY2A 2O9TA 3BAJA 1E55A 2WWDA 3WSUA 1EHAA 3IK2A 2QPSA 3WBEA 2BV9A 4BQ4A 1TR1A 5JIWA 3VM5A 3OLEA 3A4WA 4LGXA 4WKAA 2E9BA 2PWDA 3WDRA 4H41A
chains in the Genus database with same CATH superfamily
2C3WA 1GOGA 4MB1A 1CTMA 3WNIA 1HS6A 4ZT1A 3SHSA 4HDIB 4O0ZA 1OZQA 7FABL 3BURA 9PCYA 4N8CL 4DLMA 2X1IA 4HPOL 3P30L 1V77A 3CV5A 4DPBX 4IKJA 5KSAD 4D3CL 2CXKA 1XFPA 4DGYL 5C0QA 3KWSA 5ABAA 2YFOA 3VI4E 1A9VA 1DQJA 2WZPD 2I60L 3EKLA 1KXVC 4LAKA 1ZPUA 1QLEH 2I57A 4X4YB 4L5FH 5IB4A 3O2LA 1LEIA 4R9XA 3QPXL 3WJWA 1LLZA 5DHXB 3P54A 1MDRA 3A3WA 1GR7A 3Q1SH 2UXTA 4XBPB 1C91A 4ZMGA 1UKQA 2WQXA 3SJVE 3MN8A 4GJTB 4PJ7F 3QIWD 3A6CL 1UKTA 3ELAT 1KN2H 4GO6B 3SKOA 2NY1C 3BIBX 3STCA 3SPVB 1UG6A 2AABL 5AAMA 1GGTA 1UURA 3HKFA 4LDOB 3EO1A 3KWUA 2X6AA 3GFYA 3US0A 2X6CA 3NN8B 1TTPA 1W0WA 4G9FA 4L9ZA 3VFTA 1E4XH 4G1KA 3QXVA 5GVJA 5ICYA 3TVAA 1M05A 4Q6IB 4L3CA 1D8WA 4NQVA 2KDGA 4U6YB 3W1TA 3UABA 3SUUA 4HZLB 4TVCA 3G6JE 5HI4D 1ECEA 4EPDC 3D34A 2E7BA 2BP3A 5C6WH 3WKMH 1PG7H 1B3IA 3G3LA 1Q8JA 3CBJB 3W1PA 2CJTA 1NSNL 3QG7H 1UH2A 5CCKL 1P1ZA 1R9YA 2OJPA 5KSBE 3BXNB 3X12A 3M5XA 2ZUMA 1V3MA 4GUGA 3EDJA 4XSLA 1KXQA 4HIQA 1YZZA 5I5IA 3LS5L 3I7SA 2VHLA 5C55A 3HRZA 5CJ5A 3V7PA 5HGAA 5LGXA 1KCVH 3BE1H 1H0GA 4LBSA 1NC4B 1CR9H 1XO8A 4A37A 3I02B 4KBPA 4AMXA 2QUNA 5AAMC 5ANHA 3DVIA 1L6ZA 4Z3JA 4P2VA 5HR6A 2FJGB 3V8OA 2E59A 4ESKA 5ALCL 3NL6A 2WPBA 3K3QA 1K9DA 4ALAH 4W70A 2WJEA 4J7RA 3CV1A 3T0CA 4GT7A 5D7LA 3E9TA 1ONQB 1ORQA 3D06A 4ZXBD 4IJCA 1BZDA 2J24A 1R3TA 1FI8C 2F54B 1SQMA 1GIGL 3O6KH 1I9IH 5CBIA 1GZ1A 3DIPA 4G6MH 2FFIA 1LWIA 1IGSA 1URIA 4LCSA 1Z9MA 1BRLB 2XN2A 1G4EA 1NOAA 3B8WA 4ZMNA 4HOMA 4AV4A 1KYAA 3LM3A 3FQRB 3M0YA 2UZYB 1H60A 1S9YA 1XGTB 1RV6X 2WM0A 4GT0A 3HRZC 4HEPG 4PGBB 3KBHE 4OD1L 3CFDA 1Z48A 1XIJA 4JS7A 3S9YA 1L2UA 2X9YA 2VD9A 2ZUQB 4X7DC 1R75A 4OD3H 4LKCB 3O15A 3CL6A 3ZZLA 4PRHE 2REQA 3BYYA 1IWPA 4LSTH 3EDDA 4K07A 1JMXA 3N04A 1A5AA 2YXOA 3IF1B 3KAOA 2BZ7A 3S5SA 4DO7A 1J48A 2IQTA 2G96A 3VXPA 5C6TL 4OJFL 5LGHL 3D87B 2VSKB 2CBMA 4IFRA 5CJQH 2INFA 2ZYHA 2R1PA 4EXBA 2C34A 2YMXL 4BM7A 2H9AA 4HWUA 2FZBA 2DUXA 4JIRA 1LO3H 3W2DH 1CXEA 8XIMA 3EJCA 4ZVJA 3LRGA 1G0XA 2YSSA 3RO6A 3EOTL 3M4HA 3MO1A 4C6FA 1RK6A 1AE6H 1DBAH 3FSOA 4F9JA 2WLYA 1PTGA 5FB8B 2RDXA 4M80A 3FU3A 3KGSA 1V6XA 2VXNA 4DKFH 3P3TA 1QO5A 5KBKA 3H9SB 2P7TB 3JXAA 3CN1A 5CGQA 4HIXL 4O8AA 4U3SA 1U92B 4GRLB 3TO4D 3BK0A 4H20L 2WLIB 1AZUA 1BBDH 3O41A 1FZMA 3BWAB 5D5MB 1UZ1A 4QIRA 2N7AA 2MCG1 4BCZA 1FCGA 5D9SB 3A4DA 3E6FA 4NN5B 1BYDA 4YVNA 2CMRH 2VTFA 4APQD 2W9EH 1T3FA 4LVBA 5CBAA 2FL5A 2AKZA 3UZ5A 3HC0B 5EPDA 1NELA 3K71A 3APFA 2N56A 1A5NC 3NACL 3KYAA 1E50A 2CHRA 5AYBA 4FADA 4E9QA 3TF4A 2A9DA 2PPGA 3KVKA 4LPWA 5CEZE 4J4PA 4R33A 4RMRA 3ZZ1A 1SZRA 2X28A 2B1HL 1GAFH 3C60D 5DY2A 3V6ZA 3S2LA 3QZOA 1SOXA 5E2TL 1CFTB 2ATMA 1W1B1 1RA0A 5I3JA 3HV9A 4DQOH 5I30H 4QRQB 3ARTA 4ZO6A 4Y89A 5E0QA 1TVBB 1GYUA 2VEKA 3USZA 1Y5VA 1O6SB 2Z1BA 4G59C 2DZPA 2YXWA 3PN8A 4I7UA 4F2UA 3ZHLA 5I00A 4RESB 2BODX 1JCTA 4IBVA 4PJBB 4UTAA 4XBKA 3IE4A 1AHMA 2QMJA 3VWJD 2CO6B 1LL7A 1RZJC 1OAUH 4LEQA 5IMKB 2H1LM 1MYRA 4FNSA 1UXMA 2HTLC 2E3ZA 3CX5J 2IS7A 1N0LB 4DWDA 3GVQA 2ORBH 3CIQA 2HTMA 1DN2A 4J4PC 2DF3A 3SYPA 1MJ7H 3ZSSA 5GRZA 5CZ0A 5D7KE 1JUBA 4M8UA 5ACMA 1JJKA 1NGPL 2FO4A 2W0FA 3LPPA 2XGIA 1ZTXH 5B8CB 4AVOA 4G6JH 2XN0A 1BYNA 3V5HB 5IBUB 1BOYA 1N64H 1NLBL 3TEWA 3B9KD 2CO3A 2QULA 5D7SL 3S1UA 2WLLB 2MUCA 2L7EA 3ABOA 2OYMA 5E00B 3CSYA 1BMGA 3N1MC 3V9CA 4O02H 2PTUA 2SODB 4IGBD 1Z41A 2ITFA 2NY4B 3RWCB 5FO8A 3HW7A 1K03A 3S5LG 3G5VB 4UWMA 1FNFA 3I6KA 3W26A 5CAYB 1X6NA 5I24A 3E80A 5J12B 3WD0A 1J8HA 1PG7W 1WZKA 5K4ZA 3IJ8A 2V2XA 2BSSA 1YMMA 4JMNA 1HN1A 2EC8A 1GOWA 3XISA 4Z2IA 3U83A 4LDLB 3F5JA 1F4WH 3I6GB 3ICJA 3B8IA 1CB4A 3QDGB 1ESOA 1UOZA 2GVGA 5A8MA 2XRAH 3LZRA 3VH8G 4BKTC 4NC1E 3NSDA 1CD8A 1HHGA 2YR1A 3EYFA 4PB0H 1CLYH 2A6KB 4KC3B 1IAOA 4OUOA 2OXHA 4GRSA 1XB3A 4P48A 3RPIB 3GS7A 3QDME 2QDHA 4PV9B 1EA0A 5F8QC 3W0WD 2GJPA 3VFGH 4UZSA 4UTWA 3CFJA 1Q0XL 4RNRB 1ORSB 2WPGA 4Y8FA 4PMRA 1ZZMA 3NRFA 4XD5A 2E8ZA 1G7QA 1TXKA 2FTAA 3MV9B 3NTCH 4C56A 5F0LB 2OS7A 4FABH 2IANA 4C8XA 5E8NA 1ZT7B 2EIBA 4H88H 5CPLA 2PYED 4TQEH 1YTEA 3L9RB 7A3HA 2DEYX 3MDJA 4I3SL 5FIPA 4N3UA 2ADFL 2Q3ZA 4HISA 3P4MA 2ADAA 2QCMA 1LEKB 1J96A 1EZWA 3FFCA 3VSQA 4RMBA 3TZVD 3ALPA 3P5ZA 1QX1A 2JB6A 4BH8A 5BUGA 3JS3A 3V5KB 2A3EA 3C0SA 5KYXA 1TPVA 2PKDA 2ON3A 4GKSB 5HATA 4JFDD 5CJOH 3ZVHB 3A12A 2EH8L 2Y5TA 3BZEB 4FXKA 1PAMA 5I03A 5EOQL 5JBDA 4NILA 1JGEB 4ATWA 2BVOB 1KYUA 1WD8A 1I75A 4OFYD 3O6FD 3VZXA 4M7LH 4YPGA 4YC2C 4OZGA 1L7TL 3GM8A 4UTWC 5G4EA 5EFIA 2PPFA 1A2YB 4Q2ZA 4NFBA 3KPRA 3UO8B 2EYSB 2J8HA 1H1NA 1EO8H 1NIDA 4IIDA 3NTYA 3ITXA 1XLCA 3MACH 1ND0A 2WO3B 1JE6A 4NRYA 3CC5A 3DURB 5EOTB 1KM0A 3JTTA 1IZCA 4W5UA 2Z4GA 2MKWA 2KI6A 1JMZA 3RCMA 1TUXA 5FUZH 3TBYA 5CD3A 3G9AB 5BU9A 1KLFA 3HVDA 4N4PA 2JCWA 1DANT 1VFFA 2I85A 3N29A 5BRZA 1VGKA 3JWOH 4AYDC 4CNOA 3TT3H 3C2EA 3K1KC 4FQHA 3TU6A 1EFZA 2J6VA 1O0VA 4LVGA 4F0KA 1S9WA 5D2LB 1IE7C 1W8SA 4FXKC 5TF0A 2BINA 5L0QB 1BQRA 1ZY9A 2BJML 4LU5L 4JPVL 2WWMC 3TNMA 4UOQA 3S7GA 2IXQB 5FF4A 2YA2A 1A5BA 5J89A 2J78A 4NHVA 3MRFB 3DOSA 3PBUA 4ABVA 3K6SB 3IJYA 1S2EA 1P2CB 3LKSB 2NZ9D 2YPVL 4UDTB 3B7YA 4ADJA 3MGTA 3OYZA 3ZJ8A 2WZHA 3OJDB 3JWNG 4WVXA 4MJ6B 2VLME 5KVEL 2DQIH 3GT6A 3WJYA 5J1AA 3BAWA 3TPKA 1FP9A 2B7QA 2EE6A 3BKJL 2FQEA 3DFQA 2YGYA 3SE3A 3IGFA 1XZ0A 4R88A 3FSAA 1G87A 2EG8A 3VMOA 1UR0A 4KEUA 5I6PA 2OKOA 1XIHA 1OSPL 4O19A 2Y25A 1E4HA 1ZE3H 2G60L 5C0JA 5GS0L 2VJ8A 4NNYB 3QXBA 4UAOB 4KCWA 2DQEL 1J5OH 2WMIA 2P1YA 1SQ7A 2H0FA 4S3FA 3SDXE 2CJSA 8RUCA 4EKJA 4JY5L 3D85A 3MHUA 4JG5A 4U6HA 5EIIA 4EPBC 2FHBA 1I1AB 1UKSA 2GBAA 4FULA 1V7AA 2V5CA 4QR7A 2F5AH 3LH2H 2CGRH 4KAQL 3N2OA 1IC0A 2UV3A 2DAVA 2QTEA 2BNQB 5CLYA 3IXAA 2BS8A 3H23A 4QIUA 1K3ZA 3WKQA 1V3LA 2WZTA 1T1ZA 1W72L 2NY6B 3S8FB 4BWTA 3HM7A 4P46D 4N1CA 4GZIA 5C0CE 1D9KA 5IBLC 3TJLA 3QPZA 4JFZL 5JLZB 2RR3A 4QEHA 1B54A 3B7RL 1FGVH 3SE3C 1K3UA 4QS6A 2ZZ1A 1XL6A 2A9BA 2CUAA 2R69L 5DVKA 2J3SA 1C8VA 2Z93B 2R6OA 3DSNB 2HQAA 4U7MA 5GS3A 4O51A 4N9EA 2OXGA 2OX5A 1RUSA 1JVLA 2CCRA 3JZYA 2EVHA 4PMVA 3VFWB 3ZT7A 1TUPA 3WNJA 3U6WA 4WFHD 2H9GB 4U6VH 2FNWA 4GI9A 2O5XH 2WQVA 1DUYA 3NPZB 3EYSL 1TMHA 4PRWA 2YGQA 3MJ7A 5HYQA 3M0ZA 2X1SA 3VIMA 3ZDXE 5C9ZA 4PR5B 3MUCA 4X6DB 3Q01A 1MCCA 4JD4A 2UWEF 3OVRA 4TLTA 2RD0A 5AN7A 4XVSL 1JRCA 4G8AC 1CBGA 4JHVA 4M48H 3O4LA 4QHMB 5E6ID 4JDEB 1Z9AA 5IDIA 5JQ6H 1IEAA 3L7RA 5KVDH 4RXGA 1RXLA 4MDIA 5IK3B 1D9KC 1TE1A 5HHQA 2CWRA 1CGYA 5I16A 3O3RA 4ZMYA 3T0EE 4WWKB 2WO4A 1XSKA 1OY0A 1PS3A 3U9PH 3WDIA 1EQPA 3EOUA 1F8TH 2BB0A 4TVDA 1YEDA 1C5BL 4GI6A 2WAHA 2WAGA 3U2SB 3NSCA 6FABH 3F7YB 2QT6A 1JK8B 1H63A 4QG9A 1FYTB 1KENL 1UVQB 4RGND 4MF4A 3EJPA 2OZ8A 1M71B 3WY4A 4JO2H 3OPZL 2FEEL 1PX4A 3CU7A 1HH6A 4GUJA 2BSRA 3OKLA 2TAAA 4OJEH 2YBRA 3RB5A 2VP8A 1DKWA 2X40A 1ERNA 4QJ4B 3RPKA 5DVLA 2G4FA 3UTSB 3TL5A 2WXGA 3EXLA 3CSGA 5L4MA 1MCWW 5E1QA 2VX7A 4Y2OB 3OEXA 3STPA 4EUPB 4MWAA 3F03K 4Z0BL 4MQXD 3JWDH 4JM4H 2ARWA 3NSJA 4ZSTA 3ALWA 4UFJA 4AQEB 3QQXA 3WF0A 2XWRA 1JI2A 4L80A 5C7HA 5BZAA 4LRTA 2DLEA 4XO8A 3M1BA 3QJXA 5I1KL 4A8LA 5EO9B 4OT7A 2Z91A 2PDQA 3H21A 2Z8VC 2A7PA 2GFBB 3CFTA 2BXZA 3ATYA 1CGTA 1ZSDA 1OGAE 3EO0B 2FB4L 4HWZA 1MHHA 3OKNA 3VW3H 1E8YA 1KB5B 1QWUA 4HJSA 4BQ2A 2OZ4L 4WV1A 3GM0A 4GJJA 2J6EL 2YPLD 1MLCA 3US1A 3HG1B 1MO0A 3FA5A 4N2KA 4AWEA 2O9RA 2DIBA 5E0FA 2OTDA 4KK8D 1YYAA 4DUOA 2BHZA 2XV2A 1FVCB 3H53A 5MEND 3NIFB 3HA0A 4TVSa 3ASWA 2Y23A 4OECA 3FMGH 2VLKE 5C5YA 3O6LL 2MH4A 2BXVA 3TTOA 3K2KA 3QAQA 2VGLM 3GSNL 2F1EA 3X17A 1O95A 3FO0L 1TKKA 5JXAH 2IPTH 4X9IA 5I17A 4MWAC 4IBWA 2QQKL 1E6OH 1Q0YH 2G97A 3W76A 3JW7A 3U0TA 3MRIB 1LP9E 4JIIX 5EUKA 2IQ9H 4PBWD 2DT1A 4C6OA 5AAWA 3C09B 3ELFA 4ODUB 1ZEAL 4LEOA 2YPIA 4FTVB 3UXKA 3R06A 3GSXA 1KCXA 5D4YA 3QJFA 2GAZA 2B4CL 5ICUA 3LGGA 3TBWA 3QQDA 4XMPH 3MFFA 4MVBC 4NP9A 4JTGA 3KPQA 2Y7NA 3I9GL 4PRIA 1E6JL 2EVFA 4WV1C 1H9DA 3QV7A 1ITCA 2VMFA 3DHPA 2HNHA 4WDXA 3LD5A 5H8DA 4U1IB 1NOFA 3VCNA 3FFSA 2HKHL 3MGOB 3X13A 1TREA 1F1DA 4LZKA 3GO1L 5K9OA 1F00I 1V5JA 2XV3A 4WKAA 4KXBA 1DLHB 5MERA 1ALDA 4MXWL 4ZQOA 1KZYA 2P0OA 2VFEA 3GK8L 1T0MA 4DI9A 4KTYA 1T5WA 2O5NA 3BHBB 4G7YL 4LLYA 4B9FA 1FL3B 3W0KA 1MELA 4AGOA 1CI1A 2QJJA 4AG4H 1E28B 1FFRA 4P4RB 5FECB 1MI5A 3QULA 1THAA 5AAWC 1XR8A 4JDBA 3WTSA 5F88B 1G9HA 3O0RH 2G9KA 5JUEL 4KKBD 3DMMA 2ZRVA 4ODWB 1JN6A 4L9YA 1G43A 2ZYFA 2X0VA 4YYCA 2GSGA 4P4KA 1WCQA 5AB1A 5BRPA 1OF2B 5CXPA 3NEVA 1UD2A 3KBNA 2GUOB 2ZX8A 1XFCA 1A7PL 1VJIA 2JQXA 5DEGA 4PCYA 2UY4A 1BVNT 3OZYA 4RKAA 1E7UA 2WINA 3N40P 5CSRA 1JF6A 4QCIB 3UXDA 2XVNA 1Y18A 3C5ZA 4IRZL 1I7TB 3N6HA 3GMMA 3CHSA 4XPAL 4JTCA 1GPFA 5AVWB 3MLUH 2X41A 3QDGD 4BFEA 1G84A 4TL4A 2VXUL 1XGEA 1EXPA 1Z3NA 1TPUA 4G43B 1W3LA 4PG9A 4Z95H 3D48R 3POHA 4AENA 4WHBA 3C5JB 3C2OA 1KM4A 4ONGL 2NY0C 4JRXA 2Y36L 3WEOA 1P4LB 4MA7H 1B9ZA 4D6IA 4RMTA 4MKSA 3FCBA 3WBAA 3ZR4A 1N67A 3UJIH 3B37A 1UJQA 3VKJA 1GGUA 3DMMC 1HOEA 4HNVA 4ZUUA 1NCAL 5J6HA 3RWEB 2R0KL 3MOAH 3BGFB 1U8KA 3NABH 4WJ5B 5EBLB 1BM3L 5GQBA 1GMEA 3ES8A 1NCNA 1QEXA 4P4KC 3BSMA 1GY2A 1U2YA 3OR7A 5E1AB 2PZ0A 3QUMA 4M62H 1UJ3B 4FLQA 2ADJB 3OR6A 3IJDA 2PYFA 4N0RA 4Z42C 5EZOL 3PULA 1G7UA 4AF0A 4WU7B 1G6RL 1WCBA 3O6AA 3QZMA 4QTIH 1R9ZA 2X4PA 4GGHA 5CG0A 3SM0A 4KK6C 3FTWA 2O1AA 3C5ZC 1HL9A 4AQZA 2NX5D 3U9WA 2YA0A 4ZQTA 1PY9A 5AOUA 3WQEA 2YWYA 5FKYA 2A0NA 4OCWL 2C9QA 2CLPA 3GHSA 4HZ1A 3JV4A 4QR6A 2BRRL 1UWIA 1CGXA 3CPRA 1IM3D 2P26A 3DYOA 4DXKA 3E3QE 4ZOAA 4PUBL 4YU1A 1IAIH 1LOSA 1UT9A 1T66D 4Y9AA 1WKDA 3UPRB 3UYCA 1LOQA 3N4AA 1EPFA 1H11A 4BKLB 3C9NB 2Y2YA 5IOKA 1L9TA 1XIDA 2NSXA 1J8VA 3HQPA 3RTQA 4H7ZA 5DZVA 3MREB 1NKGA 5HDWA 5DYFA 4PLNC 1ETA1 1SVZA 3TW9A 4YLQT 5F89B 3LSBA 2C14A 1V6VA 1NGWB 1C08B 5FYLD 1BVZA 2H32A 2WXJA 2B5IB 4M5ZL 2NR6D 3WMBA 3FB6B 4M82A 5KG9B 1LGVA 3BIKB 5AOIA 1AJZA 3BANA 2NQZA 4XAZA 4L4VB 2V9DA 1I9CB 3LIZL 4M4RB 1UHVA 3ZIMA 4HC1L 3UTTD 4UIOA 2J27A 5E2UL 1WGVA 1JTOA 3NT0A 5DUBA 3FO9A 4KKAC 3OKYA 4YQXL 5DZNA 1QEWB 3RRQA 5GSVA 4EZLA 5I3KA 3EGDA 4F7MA 1IC1A 4LVAA 5JW5A 4XISA 2K7QA 1KM3A 4XZWA 4DO6A 4PN6A 4XNMA 4GBXB 3KEHA 1RU9H 3DUGA 4PD4J 3RTQC 2VDLL 3CFKA 2QS8A 4RE4A 2W9MA 5EN2A 5I8EB 4L64A 2JK2A 4I77H 2HT2D 2QV2A 4KVNL 2P8PA 2XPGB 2NY5L 4DZIA 2IV8A 1RJPA 5AZ2H 2N4IA 5H37G 5DJ6A 2FLBT 3KVDD 1T89A 1BJMA 4OCNC 1CDCA 3D30A 1TCRB 1QI2A 1QVOA 5FAAA 1B3WA 5FDWA 1YEJH 5E5CA 4M29A 1IC7H 2AANA 3X3FH 2ED9A 4D6DA 1ZLEA 3FO1A 2YWZA 3HTLX 2VDGA 4OTXL 3L3KA 1UA6H 3FUMA 4ZPTA 3SOBL 2GJZA 3LTVA 3G1DA 1XF3B 2FO8A 3CYVA 4HNLA 3GQFA 2QGEA 2AAAA 1YYLH 2E56A 1VBUA 2AEWA 3SE6A 1JVNA 4EZKA 1QOXA 3TCSA 4YTSA 3NQAA 1P7KB 5GZOA 4JE0A 5E5MB 1E6QM 1FXPA 4DB7A 3QQ4A 3TS8A 2JJSA 1SEQL 2Y07L 4XNXH 1TETL 3R4RA 3TTQA 4F7CB 1QSFE 3IACA 1JZFA 3GHBL 3IGXA 4A2HA 1FWBC 2WB5A 1EWDA 1PKQA 4K7PL 1OCQA 1KJ2L 1XYAA 2TRSA 5CMAA 4HGKC 5IVXB 3OSVA 1JWMB 1T89C 2FWOA 1XB8A 4EI5B 4HOXA 2VZSA 4C60A 5KZDA 5AFAA 3WIFB 3H7LA 1IQDA 3UJRA 1BPLB 2ERJC 4W89A 3CVIH 4HVXA 3SDOA 4KCUA 2Z31D 2AW2A 1D3HA 4HF5H 1NEZG 5AL0A 1MI3A 3VX1A 1CUOA 3RJYA 3WBWA 2PD5A 1DQVA 5ID0B 4PI0A 1QHOA 2DLIA 3N13A 2HRPL 3VI4A 1RHHB 4B0MM 3N1QC 4JQXA 3Q6FA 1TV8A 4WW1B 1J5CA 1WEJL 3A67H 2TRYA 2VRJA 4Z7NB 3QQ1A 4LRSA 4GXVL 5F1NA 5GZOC 1GHFL 3CS2A 4CMHC 4WY0B 5JOPD 3BT2H 2JJSC 3FCSA 2EDBA 2VLRB 4BQ5A 7REQA 4MRCA 5XIMA 4HUVB 4A3YA 1BFNA 1BZ9A 3H2NA 3KRUA 5A1AA 4LOFA 1Q5MA 1BGGA 3SJVA 4NO5B 3L21A 2YO3A 4XR8C 1YN6B 2VN6A 1E65A 2WVVB 2OQLA 5IMLA 2WSKA 1KNOA 3CXHK 3PTMA 3HVNA 4HGMA 4NAFA 4F79A 1S3TC 4CN4A 4PB5A 3EDEA 2G8ZA 3MLPA 2CLFA 3F5WB 4AU0A 2XZAH 4MTMA 2IH3B 3OA5A 4L37A 1F4YH 3BDYL 3UNTA 3H6OA 1MHPL 1KM1A 4AVKA 2V3GA 3TN4A 4PJ8D 5D8JL 1TKWA 5DWUL 5CGBA 2XPYA 1SYVB 3BT0A 4JRYB 1JGIA 3S5NA 4C6QA 5J3HD 4JQXC 4Z6AT 3R8HA 2F7PA 3BW9B 1XWYA 4NGHL 1JAEA 2BMBA 2IXUA 5T91A 3UROR 5FSDC 3EFDL 4MXQD 1I3UA 3GSNB 4KX8A 5KSBA 3S8WA 1N8IA 1NUFA 1YJDH 4MMXC 2Z4QB 4FD0A 4KQ4L 5FAGA 2RIKA 2XBDA 1NCDH 2P46B 2WY3B 2CAKA 3U4BH 1TRDA 3W75A 1LMIA 4L23A 4E41B 2EEAA 2DQWA 2VN4A 3N2CA 1T03H 3S1WA 2E76C 5T3ZL 1ZCCA 1TQBC 1MQQA 3ETBF 4DJEA 5A6MA 1A3RH 4QHNA 1RK0B 1TJGH 3L6FB 1OB1B 1VFBA 4YCPA 1AKJA 4AZHA 5CN2A 1NTHA 5IQ7L 3CFBA 2NUXA 1FWWA 3SGEH 4PBEA 4N90D 1MVUA 1EHKB 1KO0A 5I0VA 4KNUA 3BVDB 2HISA 4JFPA 2HWZL 1P4UA 3EDFA 1OB0A 4GVGA 1ASOA 4NCC1 1ZIAA 3TA3B 1TTCA 2BHUA 1TSRA 4ATLA 1N0XL 4MZ3A 3O3EA 1F3RB 4DKEL 4I0PD 1L0YA 3KZPA 4I6KA 5IB5B 3PJTA 2AXFA 3NL2A 5CPOA 3THDA 2OLAA 1FO0B 3BP4A 1BZ7A 1U91A 1NDGB 4KVCH 1H3XA 1DV7A 4A7SA 4DAFA 1MRCL 5GZNA 3TYFB 1LWRA 5C8JB 1A80A 4HPNA 4WEBH 3KHJA 1ILSA 4PLOB 2JK5A 3LS4H 2V3DA 3CNKA 2NNCA 1BSLA 5DVMA 4K55A 3HUJE 4KCVA 1MCSA 3IRZA 3KWXA 4DJEC 4QT5B 3E6HB 2O4QA 1UR1A 4W4QA 2CDEB 4QYOB 4CQAA 4KWWA 3KDPB 1EPXA 3CDGA 3CFQA 5A7EA 1IM9D 4CBZA 4O58H 1MPAH 3RVXC 5AYYA 1S7UB 2QPDB 1A3LH 2F15A 1UD6A 4AZ7A 1RJZA 1OPGH 1TTQA 3UWZA 1N4XL 3U4EA 3PP4H 1EDGA 4FI4A 3U36A 5E4EB 4F93B 1A3WA 4YBLC 3DGCR 5DQDH 4HK0A 2BNUA 2A83A 3W9ZA 1BFVH 3GHEH 4JANA 4KH2A 4EXPX 4K2UH 2FZ9A 5GZNC 3DV6B 2C26A 2CFFA 1A6AB 4PAZA 1H51A 2BVQB 1YEFL 4GRWF 3K6DA 2RA1A 1HI6A 5FM5M 4RAHA 2GTWB 2EKCA 3HGSA 3I7QA 3WQ5A 5F1KC 3DX7B 1THFD 3WTVA 2OJEB 3LCWA 1U8IA 2FWSA 4X5WB 4WI8A 3PAJA 3W9DB 4PUJA 1VIWA 3P2VA 2DW7A 5JXEA 4I2XB 2XIDA 3OG4B 4DVRL 4C1LA 1IEVA 3THML 1A53A 1Y0EA 1Q9WB 1VP5A 3NL5A 4ZR8A 4JVWA 2IOIA 1ZA3B 2DZBA 4AD3A 1QASA 5HWMA 1PJ9A 1XXXA 3WLJA 1FQ9C 1SOSA 1RZKC 4XKMA 4MJHA 4UTIA 3B2UC 1M1BA 1Q85A 5DK3A 4C6MA 5HXMA 4UILL 1V3KA 4N2HA 1P84J 4WOZA 5BYWA 3C6SB 3GZKA 4D6HA 3QI9A 4L48A 4KEVA 2X4SA 3UJSA 3K80A 3JVFC 4Y7MA 2FHCA 4NN7C 1KCWA 3BW3A 4Z08A 4OB5L 4OFQA 2EDXA 3N15A 4G8GE 3II2A 1ICQA 3ULVL 1HNYA 2YRLA 4R2GB 4ZMVA 4Z0XB 4LB3A 5KTEH 1CURA 4CA4A 4YX2L 4YHZL 3EYVB 5JXEC 4L9DA 4X0KA 3HE6B 1IZKA 2OCCB 1T20A 4JQ3A 2DI7A 4LGPB 1YYCA 1AD9A 2VDML 1CLCA 3TNBA 3DXAD 4UIMA 3BVNA 5A6SA 3H9ZA 2VYRE 1NY1A 5I7GA 4PMYA 3AHVA 4A1RA 5KS9F 1SMOA 2YCJA 4C5ZA 5I6NA 1T2QH 1GPOH 32C2B 1RI8A 4GIPD 1YEGL 3CCHB 1T7VA 4ZUSB 3GE7A 3WFZA 4RZCA 3UQNA 3FUDA 3TXZA 1XDLA 4K36A 4HAGA 2XV0A 3BC9A 1FFPB 4MLJA 3QI9C 1SOKA 4H9YA 4UU9A 4J8RA 4YAQA 4Y5VA 1RIVH 2NLYA 2JKTM 2EIZA 3HFFA 1FNLA 5IM7B 3A9BA 2NZIA 1LG2A 1DQKA 1MSSA 2XINA 2F0CA 1QOQA 1US0A 1E0UA 2HKFH 4AMCA 3PPFA 3R4DA 1MAJA 2YD4A 4QAMB 2YCLB 1QSEE 1VGEL 1JRHH 5L7XL 1OWRM 1V05A 7XIMA 1Y1DA 2VX6A 1T5KA 4NLAA 3ORJA 1R0AH 3MA7A 4G83A 1L2QA 3RYSA 5D2LF 5C09B 5DD3L 1HZHH 4JFHE 5DMKA 2ICWJ 1NMCB 1EJ8A 3FQ1A 4Z78B 2Z6IA 1UM4H 2ADYA 3AQDA 2ISDA 2WYIA 2DH2A 2P8BA 3IETA 3QIUD 3CXOA 3FT1A 4O4VA 3F7VB 4MIMA 1YUKB 1OT1A 1LD9A 4KO5A 2WV8A 4JEQA 3Q2VA 3UBXA 5AC5A 5KINA 3IU3B 5E8PB 2BHYA 3LLXA 4GNVA 3S1VA 4L4OA 4QLJA 3CVHH 1QA9B 3MCKA 1P4IH 6ALDA 4I5RA 1QPXA 1S9KC 4UMGA 5CCGE 3DRQA 1XLGA 4N86A 1LT8A 3W7JA 4PSPA 4Y5VC 4GD0A 2OMTA 4ACZA 5C0FB 4K94L 2K4AA 4EXQA 1XF1A 1YEWA 4HK6A 4XCFH 2MPAH 2HK0A 1O4UA 3QDMA 4ICMA 3MRPA 4ZSOE 1KB9J 2OZ3A 3FQ2A 4YR6A 3WLQA 4B3ZA 1JD7A 4CVZB 4UINH 1IAKA 1LUCB 3OKDA 2Y06H 2P4AB 1XCQB 1XQKA 2D3LA 1A4BA 3AMKA 3B34A 4CSZA 4QJ5B 4J4KA 2NDGA 5DHVH 5IHWA 5LBVA 1Z0MA 3SDCA 4JKKA 3BAKA 2ODIA 3VA6A 5DCCA 5EC2A 3TEVA 3NQ2A 2N0KA 3V1PA 1TWDA 4CQ8A 3V5DB 1EGMA 2CNZA 4RX4A 3NEOA 2WCGA 3ARFD 1JYWA 3U2OA 4JDTH 4UV4H 4FQ2L 2E5CA 2POZA 3NCEB 2D2JA 1FBIL 4TULH 3O81A 4M6VA 2WQWA 3LQAC 3QDAA 1NCWH 1OP3H 1WAWA 3NVTA 3M1CA 5DJ8B 4OUUA 4QTGA 1ZS8A 3PZNA 4V2BA 2PS2A 4H1LH 1DL3A 4H3DA 4NC1C 1F6PA 1GHSA 2EDWA 3SE9H 2LU3A 2PRMA 1WXZA 3VNMA 3BVXA 2YL5A 2AJYL 3EZ4A 3GXTA 1CW2A 2Y8KA 4Q8OA 3UFYA 2AXWA 3S4SB 2R7EA 3P3YA 3ZWTA 1JNEA 3S9DB 4Z0SA 3WF4A 5LGKA 1E9QB 2CZEA 1XC4A 1RUPH 4IMGA 3T8LA 4NF7A 4XPTH 2EG7A 3SDCC 3WEAA 1FFOA 2DZTA 5IFHL 4PH8A 1HSAA 2R2HA 5FW8A 4MS6A 1Z3RA 3BWWA 4H25B 3IN0A 4WTZA 1BD2B 1QACA 1R5VA 2VKWA 3OHMB 4AD1A 5GHWL 3UJFA 4HA1A 4M1CC 1V7YA 1JPDX 1P0SE 5CZKA 5EMLA 3RU6A 1UMYA 2WP3O 3PWUA 2VO5A 3D69A 3WNOA 3URBA 2A6IB 3I3EA 5FXCH 3WQ4A 4JK0D 4R96A 5HI5D 1K02A 3A24A 3G0SA 43CAB 4PRDB 3P0VH 2E4FA 4WJEA 2X0WA 2OMXA 2DQGH 3ZOAA 2EIEA 4A3HA 3FDWA 4LPCA 5J0BA 4NHCL 3EBAA 4ENZA 5L2KA 1MRFL 1ID2A 3DFTA 1QUPA 1WBZB 3BL3A 1R3IL 5B3NA 5I82A 4MY1A 1X1OA 2X4RB 1MHCA 3TM6A 4N2IA 5JU6A 1SO3A 3EHBB 2HRWA 4LPXA 5KOVC 3VFNA 4YXLL 2BSED 4G7EB 2IDCA 2A0LD 2O56A 1I9JH 2QHRH 4FKHA 2P5WD 1UC5A 2B20A 1QFUL 4AZ8A 2YDRA 1ADQA 5F6HI 3OJGA 5LA1A 5IP4A 2APXA 1V0LA 2WXMA 2JLLA 3SDDB 4HJ0D 1CLXA 1MH5A 1GGBH 3SDXA 5K1NA 4D94A 5T1KA 3STLA 2ZKMX 1BG1A 4Z0JA 2JTDA 3MCLL 5E08H 4LUTA 4XD6A 3WDPP 3X14B 3MP5A 4AGNA 1P6CA 4HIIB 1LK2B 1PF3A 5AD0B 4OZHB 2VC9A 1EUAA 4S10A 3R25A 3HPAA 5DDHA 3Q13A 5IBUG 1FWTA 1HHKA 3FK4A 1R9FA 1J1PL 1GQIA 3WIAA 4GKZA 2OLDA 3FQWB 1SGKA 5JW4M 2O61A 5C0CA 3S3PA 1OLLA 4V15A 5DJCB 4HGWA 4XCNA 5DS2A 4L5FE 3DERA 3IT8D 3MQIA 4NJAH 2CBTA 3BGMA 1UENA 3G5YB 2V17L 2Y7SA 4MLRA 4F91B 1Z7JA 2J79A 4FEZA 3V4BA 1PMYA 4OIBA 4ORGB 4JTKA 5C2XA 4P3DB 4IRJA 5AHIA 1Q9KA 4L4TE 4ANXA 3BDBA 5DQJB 1HQRB 3AI0A 1SHMA 5I3IA 1J5DA 4FKKA 1UWRA 4ANKA 3IVUA 4HNUA 3W3BA 1KIUA 4QY8B 4B5UA 5DD5L 3RUGA 3TH4T 4KRPB 3CQKA 4HWBH 5I5MA 3UP1A 2D03L 2OO0A 4LARL 3P9MA 3TJEH 2PTXA 2AP2A 4UFMA 1XF5A 4FZEL 3VFRB 1ZHNA 2RHGA 2JIWA 2FX9H 2VQUA 5C6PB 5T3XH 1E5AA 4MNQD 3TZNA 4D1IA 1FVDA 4YIQA 3V55A 5AW3B 5INDB 1XIFA 2PCEA 3QAZC 4KPLA 3MLXL 3STBA 2WWCA 3TQPA 4PM1A 1E4LA 3QQ3A 5C08B 5CN3A 5KYWA 2X2UA 3FF7A 5A2JH 3T0EA 1GC1C 1FH5L 4AIXA 1DWAM 3QF0A 3KWVA 1X9QA 4IRJC 5E8DH 4GQPH 1NJJA 4F2EA 4OLWH 3FFDB 2G9HB 2R8SH 1B4LA 2JB5L 4FIQA 3OJMB 3GZPA 3CDFA 4KWSA 3MBED 3N25A 3X3GH 4ZG1A 4G6KL 4GACA 4H2HA 4O1AA 3TXVA 2NXYB 3W39A 3LN5A 3MCMA 1CT5A 1U5HA 4RMWA 3MNDA 4OM0L 3EH5B 3JVAA 4B95C 1TOXA 3T6CA 4PULA 3HB9A 2ZRWA 1I31A 2YZ5A 3WXVL 4Y4KD 2RGMA 4LCYA 3CSBA 1N5YH 1N3NB 3VKBA 2NUPB 1PZDA 4OKVA 4Y4FD 4DKTA 3RWHB 1HJXA 4Z7VE 3WKPA 4TOYH 4JM2B 3ARXA 5IT2H 3PNZA 1B4JH 3W56A 2WXOA 4LSSL 5HK4A 3PWLA 3T0EC 1CZ8L 3GUWA 3QFDA 1I82A 2E4TA 2WKLA 3QW9A 2I17A 5DJ2B 3PGFH 3L2LA 2YK1H 3LB6D 4NQCD 1T1WA 1E40A 2E5DA 2BCKA 2QL1A 1OGAA 2MNWA 4Q4RA 2TRHA 3H0TA 2FLRT 1A7OH 1KRAC 1A5OC 5IUSA 1F74A 1MG3C 3QFGA 3W87A 4JPSA 4EPSA 4K5PA 5DO8A 1F3JB 1W9XA 1KB3A 1NC2B 4KBXA 4A6YL 2PC4A 4XO5A 1EJXC 2DMHA 1MF2L 2BIQA 1XLDA 4HH8A 1I8KA 3R7QA 3P84A 3LJ3A 2VLKA 3F7RA 4LC6A 2G3NA 4DP4X 1Q6OA 2IOMA 3WBYA 3AMCA 4PBFA 2BP1A 1SFDA 2DL9A 2NQDA 4YSPA 3FB5B 1HWHB 1TQXA 5ADPH 1LP9A 2E8YA 1VPXA 2OMNA 2ZDRA 2AK4B 4S38A 1JGLL 3RLSA 3BW2A 4ATDA 4WEUD 1FLRL 4UZUA 1AHWA 4YHOH 5H35A 4HSCX 3HA1A 2MMXA 4PMNA 3HE7A 1SQ2N 3HE6D 3QUYB 2C79A 1HCYA 4OF3A 2JKEA 4RWYL 3WKZA 4KI5E 2AITA 5I77A 1D7FA 4LLAA 1TVHB 4JHWL 5EC1B 2Y7QB 4DIAA 4P2OB 2JIEA 3LB0A 4JB9L 4MDPA 5CH9A 4K71B 1V51A 3T6ZA 4HS3A 1Y6MR 3FLUA 4NNXB 2PP3A 4AG0A 3PJXA 4U1NA 5D7JB 1RJLA 3QIBB 2CO7A 3LUTA 2H1PL 1LE5A 1PY4A 3GMPB 4E0CA 4KKRA 3OM3B 4DK5A 4JO8A 4KZEL 3INOA 3EWXA 2PURA 1FZOB 4NQQA 3TVMB 4POCA 4I9WE 4DSYA 5DTFB 3ET9F 3MLYL 1O7DE 4U0QB 2J7CA 4PUDA 1XB6A 3LKPB 4QLLA 2EDHA 3S88L 5A2AA 3REQB 2FDMA 3IBOA 1QR7A 3GH4A 3AU0A 4JYFA 3VSTA 2AGJL 3QISA 3UWVA 4C6DA 5IFJB 4MYPA 1AHWC 2WNWA 4XWOD 1F3TA 3RDTB 4QO1A 1ENUA 1O6VA 4AL8C 4NAEA 3UBGA 1C29A 3HE7C 1GL4B 5F1OB 2MTAA 4DBWA 1AQKL 2CPUA 4E5XA 5C2BH 1X1ZA 2WYZA 2Y85A 1SDYA 4LCWB 4TQTA 1YY9D 1B3YA 4JL2A 3NSFA 3SB0A 1YNLL 1IJ9A 3PDOB 2YUVA 5F1IA 1F41A 3EFFA 3IANA 4NZ1A 4MFDA 1LM8V 1CFVL 4XP6H 3NCCB 4YDLC 4NBXB 2ATPA 4N8VB 1IO4C 2PDKA 1RXOB 1G6VK 3BCDA 1NC4D 4X8CA 4Z7UF 5BXRA 4PJEE 3UVIA 1TPB1 3SBWA 1X8FA 3TZFA 4YHPA 5CGMA 2FZ3A 3AQXA 4M51A 1OHZA 1BVLB 3MRKB 2V5JA 3QEUB 4XE5B 4M4PA 2BVWA 3TBVA 4IMCA 5ENWA 4AIZB 1UWGL 3PHOA 4I9TA 3PTDA 2GITA 1O7SA 2XH0A 4KNSA 3CC1A 1G9MC 3M43A 4ZX4A 1XH2A 2E67A 4NZ3A 5CGYC 3AYSA 4PJIE 2F54D 4G80A 3L3DA 4RLDA 1U42A 2H6PA 1H0IA 3OKOA 4NAJA 2ZCLH 2HE8A 5TGBB 2I5IA 4XPBL 3PJSA 1ZTXE 4Q52A 2ZPKL 5C0AA 3UZVA 3BPOC 3J07A 2YSTA 1GJWA 3PQYB 2HRLA 2GL5A 4LF2A 3N1FC 3KPSB 1QNRA 1G7JA 5IV2A 4W9CC 2DQCH 4LMQI 3VGGA 1QR1A 1GSMA 3ARDA 3IMUA 3QGVA 5B39B 3QZAA 2G4GA 2OG9A 1WKFA 3BARA 5AVRB 4YVVA 2NW3A 4I3GA 3SBWC 3RWFA 4QRRB 3KS6A 2A5UA 3OQ8A 3GI8H 4HKJA 3VXQB 4X9FA 4Z5RB 5IVXF 1UCWA 1J1OH 4QHUA 3FT9A 1ZCRA 4JO1L 4EUPG 1RZQA 3SPGA 3H2EA 1CWYA 4KERA 1JCYA 1LO0L 5JNYB 1IGCL 1QOKA 3VWKB 2A74B 3EOSA 4O5LL 4MHHI 1RZGB 1MNNA 3MRCA 4A66A 2FR4B 4E9WA 1INEH 1RK1B 3QXTA 4GFTB 5GGTH 1U58B 3LRSA 2HFEB 3ASOB 3PP3H 2FH6A 2E74C 2LR4A 3GMQA 3EO9H 1T6WA 1H7PA 1CE6A 1VZIA 4NEHB 1P43A 1XIMA 3CUGA 2GSIB 3ZE2B 5BOOA 3BV7A 4Z76B 4HNCA 4UC5A 3ARDC 1BD2D 2ZFAA 4C4KO 3H9SD 4YHYB 2VZUA 4WY0F 4OD2B 3I85A 5EU5A 1IIKA 1LBLA 3PAOA 3TWYA 4Z7WB 2NNAA 4GRLD 3RNDA 1XF2B 5I8CA 1KACB 1ZK5A 3E3QC 1OGGA 3RB7A 2HTKD 4Z1BA 1NOUA 3VE0B 4K8EA 4DGIH 1TTFA 4Q4EA 4NNPH 3BVVA 3MKVA 3L23A 3EMQA 2PLJA 1UH4A 3K4WA 5FSEC 3RM8A 1LL6A 4IJ3C 2HFTA 5JA9A 1JZIA 1EJ7L 4FNLL 4Z18A 3W73A 3WFLA 3HS0A 5AHNA 1JUFA 3RMJA 2CLVB 2I27N 3QH3B 5I74C 3GHRA 4K0OA 2VFGA 1HJWA 4ATTA 3AU2A 2HJLA 1C9WA 1HYRC 1HHJA 2YW4A 3PWJA 1SDDA 2VDOL 2DQTL 1EJRC 3QT2A 3HPLA 1B57A 3NYZA 4WSGA 4FFTA 1C3FA 3GRWL 1JYXA 4PJAE 1NMAH 1E5YA 3KLHD 2QDVA 3MODL 4F7EA 3KRBA 2G5BA 1KKOA 4FFVC 4S3DA 5CZXC 1POJA 4MCNA 3BZFB 3QG6B 4DGVH 3HNVL 3VGDA 3HC2A 3WLPA 3MXVL 4PB9L 2D9QB 1JHTA 5I26A 5CP3H 1UWSA 2UXVA 1OARH 3GNNA 2OMVB 4R4FH 3COTA 1TWIA 3R2GA 5IDZA 1QSFA 1E6ZA 1EEXA 3GH5A 3V0AC 3HS0C 5C54A 2DM3A 3GYCA 4XNAA 3B2DC 4H1ZA 3CQPA 4NYUA 1W80A 4MJIE 4DFIA 1A8ZA 4DRSA 3OBAA 4LPVA 1AQHA 4E6MA 5HHXL 3W9EA 2ABAA 4AKQA 2OT1A 4Q22A 1JF1B 5MKGB 3ULSB 4KKCC 2D3VA 5C0RL 4PP2A 1EJSC 3ZTDC 5DC4B 4QDMA 1PWLA 4CILA 1KEGH 4XKYA 5DT7A 4JDZA 3QKZA 4B0MB 5U4NA 1R30A 3ME0A 3CK0H 3KR3L 5E9XA 1FZJB 1NAMH 2BFVL 2ZQ0A 2EIKB 3OXSB 2GUBA 1FL6A 8XIAA 1MCJA 2VR5A 1KIRB 2FPYA 3TAKA 4GI4A 1A6TB 2NY4D 3WUFA 1II4E 4DUWA 2CJ3A 1UXWB 1J0JA 2VN7A 4I3RL 1OSZB 3QHTC 5JORA 5KWYC 3NP4A 1AGEB 1XCWA 1ML1A 3GLEA 3RI5F 3CQIA 3N9KA 1KBLA 2HXTA 2FTYA 3N50A 2XVGA 1GZJA 1K77A 4L8DB 1TPXC 3PXHA 1V7NH 1SY6A 4UCGA 1MCLA 3SSZA 4AD4A 5FEZA 4NZRL 1X5HA 4OZFA 5K9CA 4XVUD 1RULL 1RZ8B 3BE7A 2PLCA 4Z7QF 3I50H 2Y1YA 4NJGA 2C3ZA 2IQ0A 3RUBL 3PREA 3IAPA 3ZDYE 1COBA 3DCPA 2XWBB 2ZOKB 1QRNE 5J11B 2J88H 2WD0A 1ONEA 3FUFA 3ZO9A 3KCLA 4P7OA 5FR3A 2Z27A 3MV9D 4M7ZB 3WDHA 5BU6A 2C5DC 3LKNB 4PQXA 1YPFA 2V5DA 4OLEA 1TU2B 1KMGA 1F3WA 4R6UA 2CYGA 4DWSA 2ANUA 1MMFA 1TIWA 2GI7A 1BP3B 1UXSB 1W6TA 1CC3A 3ITGA 3UDWA 2WIIB 3AAZA 5DQ9B 4IP5A 2DVUA 5LHDA 4MGGA 5IHLB 4OI8A 2ZVIA 2Y2TA 3BAXA 2DQHH 4B16A 2P8LB 1OM3L 3GMOB 4U1GB 3S2NA 1TJIL 5ESAB 4PGEB 1MDLA 3LZFH 1CFNB 3BKCL 3DPBA 3SCQA 3H22A 4UCFA 3H70A 3UG3A 4KUZL 5I6XC 2X38A 3W2NA 1FG2B 2VXVH 3N40F 1JGDA 4IU3B 2FTWA 5CZSA 3NEEA 4HUWA 5F7HA 2CHDA 2J4WH 1JPHA 4QXUH 1NAKH 3QDHA 3LPWA 2J66A 4MWFB 4UB0H 5HYJE 4U3AA 4RFEB 3D52A 3TEZA 2HNEA 3LEPA 5KVDE 4Z77A 3I7RA 1FRGH 4N4YB 3WK3A 1Q6FA 5AG9A 2QSTA 4YBQC 2AJSL 1BXXA 1S2UA 3HZVB 1LCOA 4DWSC 5DGRA 2Z2BA 3ZO0A 4R3SB 3GDTA 4BZ2L 4WWID 4AWJC 3D46A 1SEBB 3UDWC 4HBQA 2OXNA 1DQQB 1A5FH 3LMJH 2C3VA 4H9XA 4JZOB 1TEGA 3ESUF 4K8RD 4RE2A 3ISRA 1HYSC 2RKXA 2F18A 2HVJA 4PJ5E 1AXIB 1FPTL 4G3YL 3RNKB 1R3LB 2H26B 3G2GA 1MQPA 5I9QC 4J2MA 1BQKA 1HKMA 3MB9A 4JFYB 1WOBA 2FUQA 3AS2A 3APDA 3DI2B 3HUJA 3TPUA 2YYTA 1M3JA 5CZTA 4RJEA 3PRZA 3V7AG 3CMJA 5HYEA 1KNWA 2YPKA 3TCTA 2OTWA 3OG6B 2Y8VA 2X9WA 4N6RB 2H8PB 2HE5A 4JQIL 3U2EA 2IF7A 3P0YL 4Y1AB 1W72B 2WZEA 4AB4A 1AZZC 3DDGA 4DIXA 4AHQA 3FONA 4OQTH 4ONFL 3QUYD 1EX1A 3CUPB 1JRBA 1FWJC 1MWAA 1NEUA 3DJSA 3ZLFA 3GC2A 3FU9A 3PBGA 3HAEB 6PAZA 4KUCD 1REQB 3QWQB 4IOIA 1JGVH 5F9OH 3ZHKA 4E3TA 4ETQB 2NUTB 3WLRA 4K7PY 3MBXH 1NTDA 3PZUA 5FDYA 4H4NA 3O3DB 3LHYA 1ZAHA 5TQ0H 2VR2A 1MEWA 4LVDA 3K72A 3C12A 4MSSA 1DQDL 1MFVA 2EF9A 2GGIA 4WIWA 2F08A 1XS2A 1UCBH 2Y6SC 3HG3A 4MNHB 5L6YL 4ILSA 5T1DH 1PQZA 3LEXA 5ANMB 3UJTL 4LLDA 4Q9BA 4F37F 2F7OA 4ZQKB 3TYBA 4G6AC 1PYFA 2OYLA 1U8QA 3PWPE 4L8BB 4ISVA 4N2BA 4R26H 4TVPH 1KTKE 4XNYL 3QKEA 5A3IC 1Q6GA 5SV3A 1JHKL 3ES7A 2YR3A 3NFSL 5MP6L 1I1AD 4X4KA 3UYRH 4OQ1A 4NWTL 3ZGIA 4HK3N 5GISL 4X6BA 3M16A 1FUYA 2BWQA 3PF3A 1K7XA 3A4WA 4C47A 4NU7A 1W2KT 2BNQD 5I6OA 3C6LB 4YWGL 2O7QA 2CKBH 3VFUB 2Q0ZX 1ET5A 3LCYA 2C3GA 3T4YA 1VD6A 3H2OA 2NY6D 5F7AA 5F9WB 1CD1A 4I9JA 3H2MA 3UTQB 4IEFB 4CJ0A 4N28A 3AISA 4MZ8A 1JV5A 4XO4A 3MBWB 5CIPB 2G2NA 1M1XB 3Q48A 1ANUA 1MFBL 4ONOA 4AI7A 5CBBA 4US5A 4ZUWA 1S38A 4JN7A 4JX4A 3WEXA 3I9PA 5K9JH 1W8OA 3NFNA 3ZZQA 4BHUI 1QW8A 2QEZA 3NCBB 1L3NA 3WEZA 1RH8A 1T4KB 2AEPH 3T77B 1F90H 3BKYL 2MQ3A 4OLZL 2I26N 4JJ5B 2HB0A 3VD4A 3VXUB 3HI5L 4FG6D 4Q9RH 4FJYA 4BDVB 5TIMA 2PPEA 4IOFD 4EO5A 1KCRH 1XLBA 4X9GA 3BH8B 4LEBA 1TLKA 2AXGA 3DX3A 4KRMB 4XNDA 1S9XB 1U8LB 3T55A 2ROYA 1J05B 5EY5A 5G4HC 4PEEA 1S7QB 2ZSVA 1YE4A 2GT9A 1BKHA 3SSGA 1A5CA 3IPEA 1U8HB 1TFPA 5LA0A 3KPSD 1CXKA 4CC0A 2FT8A 4GY4A 4L4LA 1RHCA 3M64A 1F2XK 1EGJL 1M2VA 3I75B 2VXSL 4ZXLA 5HGDB 4HH9B 4WWKD 3VTAA 2FJFA 4UT9H 4BFAA 4Q4IA 3TBTA 2GVEA 1GKOA 5B1CA 1HCFX 4QRRD 4GAJL 1KBJA 3G6JA 1FYTD 2OMUA 5EU3B 1QSEA 3QNZA 1D5XA 4A3QA 5T5FL 1B88A 4I18B 3RGVA 2MIZA 2VGBA 2ZKYA 5CD5C 1MIMH 4HUUA 1ILUA 4NY2A 4BSVB 2R4RL 1IFHL 2QQLL 4OBRA 4ACTA 5D5MF 3NOYA 3H4GA 3DESA 3F6IA 5B7FA 1AXTH 5FHAL 3SECA 2VDOB 1QOPA 3UTSD 3AMLA 3HPJA 4PTWA 3MS8A 1AR2A 4W1TA 1JI1A 5FA3B 3OF6A 3H54A 1T99A 2I56A 2FX8L 4XVJH 2VVSA 3NGFA 1GA2A 4S0HA 4YTTA 3IGSA 3SQRA 3V4VL 3MMWA 4IP7A 1EZVX 5CHNA 2WOQA 2W66A 4NUJA 1AG0A 2P8MB 3HEIB 4Y6GA 3WKNA 2ZXEB 4QTHA 1SLWA 3OU8A 12E8L 4Z8FL 1KBGH 3GIYA 1A4JB 1X5GA 4I5BA 3BGJA 4ZSOA 1YTKA 5HYIA 5IMMA 2DKSA 3CHPA 1IT8A 1QNIA 1M01A 1KTLB 1YDVA 2A79A 1P1MA 1RVFL 3GG7A 1R34A 3OGSA 3RGVC 1H8OA 1Q1PA 3G3MA 3HG1D 4LVOC 5BV7H 4HVBA 3GNPA 2ZCKH 4U1MA 3F00A 1A21A 4QXTB 3PDGA 4G1NA 1VPOH 1K7EA 4HZ6A 2ZUNA 2XYBA 3FN0L 5FM8A 1BAFL 4YXHL 3STZB 4QKXB 5AENA 1AW2A 4PJBF 2IC2A 1AD0B 1DE4B 1J9RA 4KQ0A 5C0BE 1T04A 2CGYA 2D20A 4HV8A 4R4BB 2OR8A 1G4MA 1HJBC 4ZMZA 5I1GL 4G8EA 4PJFB 4B91A 4H44C 4AC1X 3CAKA 4FTVD 2IQDA 4PRHA 2UZXA 3QQWA 3STEA 5LN8A 1W31A 2J25A 5F6IB 2XFXA 1W5OA 1EA9C 1XGUA 3V4PA 2X6BA 1T22A 4QOKE 5D6CA 1DIEA 4V27A 3CBRA 2F58L 4HALA 1DP0A 3PU7A 1XI3A 4M8QB 1BOGB 1MCOL 4OFDA 1EZUA 1NQKA 1W6LA 5FV2A 1JPTH 4W88A 5JZ7D 1M7PA 3D39B 4YFEA 4NM4H 2J13A 4AGMA 4CVUA 3Q2NA 1KFBA 3GXIA 3WO4B 5AVHA 1A8JH 4HKXA 1GOKA 3WIIH 3IU4H 1E5UI 2I7GA 1PZ5A 4W6XB 1UKPA 2N59A 1YAIA 1A4KB 4M7JL 4KMTL 5G4OA 1ACCA 5I1AA 3AB0B 3RA7H 3GDKA 1IC5H 2HH0H 1DVFB 2GSHA 4K9EC 3ROOA 2AV1B 5LWYH 1OAQL 2ARJA 2JCCE 5AYUH 1GMIA 2HBXA 3LDBC 4H5SB 2CIKB 1G6RB 3RNQA 1OD0A 2Y0FA 3NFUA 2NYYD 3UGRA 5C0NC 4HFWB 3PG8A 3A23A 3Q6GL 1TV2A 3NPSB 3OMNB 3ZLGA 3PANA 3G5XA 3BH9A 1MLBB 4DAGL 3L0KA 2DT0A 3NA8A 3LNFA 1XCFA 3GI9H 3S48A 1NDYA 3H2QA 1CFSA 3VOCA 8FABB 1IFGA 3M41A 1BVOA 5GGVL 2WHMA 4X98B 3RWIB 1EXUB 2ZCHH 4FS0A 1WC7A 5IM51 1YPZB 2WNXA 2NCEA 1WFTA 3RX5A 2XWXA 3SQMA 2QSQA 2P47B 1XIWB 3VFMA 1CL7H 1MY7A 3WHE0 3CMOH 3REWB 1YNKH 5HHVL 5TE6H 3J27A 3FSZA 3AT8A 3S42A 2FATH 2B4GA 1AP2B 2HG0A 2I9UA 3BP5B 2MHAA 1A14H 3P74A 4G8IB 4H9UA 1TZIA 4ODVH 1N2RB 1WT5A 1EEYB 4JW3A 5D71H 5SWSE 4RAVA 1BX2A 2E28A 4DKAA 4JTEA 2F19H 1AIFA 2CKSA 1V0KA 1S1RA 2V33A 1JVOA 3QDJB 4OFVA 3WNNA 1BBJA 4RDBA 4OGAC