1VAHA

Crystal structure of the pig pancreatic-amylase complexed with r-nitrophenyl-a-d-maltoside
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the pig pancreatic alpha-amylase complexed with rho-nitrophenyl-alpha-D-maltoside-flexibility in the active site
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 163
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1vahA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1vahA01
5AYBA 2WSPA 1BPLB 4CN1A 1UHVA 1WDPA 1OINA 3GTNA 1W2VA 3ZT7A 2XVKA 2IXUA 3MUZ1 4P7LA 4HOXA 2JF7A 2BXZA 1V0KA 1GORA 4DWSB 3SCPA 5FD0A 4QDMA 1OT1A 1W1YA 5KZ6A 1J01A 2XN1A 3HZ3A 3A24A 4NXSA 3WF0A 1N82A 1CLXA 3PZQA 4RL3A 1T0OA 3CHDA 1G1YA 4LYPA 1R33A 2F1AA 1HJUA 4OOZA 4IISA 1UUQA 4W8LA 1V3JA 2QV4A 1KTBA 3EDEA 1VFMA 2FGLA 3AZSA 1QHOA 3WD1A 3LPFA 1UG6A 5CG0A 1CXEA 2BHUA 2VT0A 5E09A 3SCVA 6A3HA 1QI3A 1OIMA 4BQ5A 5CJ5A 1GOOA 3AS0A 3HMCA 4HPGA 3RJYA 3GXPA 1US2A 2WHLA 4GXPA 3WY4A 3RDKA 4M29A 2XPKA 1BQCA 1WCGA 3VVGA 1PX4A 1PJ9A 1GOMA 3AFBA 3IK2A 3BSGA 4UNIA 4D6GA 2NT1A 2F8QA 3RM4A 4AZBA 4LPCA 1A3HA 3B9AA 4J3WA 3CTTA 1V3HA 1JDAA 1JZ5A 5M5DA 2DEPA 2J74A 2JALA 2DSZA 4PMXA 2X2JA 1MFUA 1HP5A 4MNMA 3NDZA 3EJSA 4E8CA 4DWSA 3MANA 1KCLA 2ZE0A 3GM8A 3BUQA 1YHTA 4QLLA 4LYRA 3CUFA 3WQ6A 1V6WA 5DT5A 2BY3A 1UH4A 3CPUA 4DO6A 4PMZA 3NCOA 1MYRA 2BY1A 1MVYA 3W27A 5CPTA 3CV5A 2OWWA 4H8UA 1E6QM 5C8BB 1E71M 5E70A 4ZXOA 3PBGA 4AY1A 4AMWA 1C8XA 3AHZA 4GIAA 1WE5A 2XM2A 4P8XA 3ZM8A 2F7OA 4CU8A 4OBRA 3HG4A 1EOMA 1I1WA 3FAXA 2VMFA 4A3HA 2RGLA 4LQ1A 4KMQA 2WC3A 3RCNA 2O9OA 4E8DA 1OB0A 3NDYA 2MANA 3VIHA 4MDPA 5JIWA 3BUIA 2IXVA 3RIKA 2G8ZA 3DYMA 2EPMX 5D9NA 2GK1A 4HA4A 2J7FA 1UH2A 1GHRA 1FH9A 1NWTA 1TFVA 2BHZA 5CLWA 3GH5A 1QBAA 3WNOA 3U5UA 5I2UA 2XWDA 1WDRA 2EPNA 1VFUA 1JNDA 3FY1A 4TUFA 3QHMA 1PX8A 1JNEA 2WC4A 3UR8A 1UKOA 1ZBCA 4WKHA 1ITCA 1H0IA 1QNSA 4GKLA 3B8SA 1R85A 4BA0A 3MV01 1MWOA 2E3ZA 3W53A 1JXJA 1MW1A 3EDDA 2F61A 2FH6A 5ABFA 3MO4A 1P6WA 1QI2A 5JBFA 1OGBA 1SZNA 3VNZA 2EO7A 3ARYA 4C7FA 5DT7A 5A69A 3DHPA 3JUGA 1WZMA 1UD2A 1G5AA 5F7UA 4A3YA 1E4LA 3FW6A 1E9LA 4D6DA 1QW8A 3EMZA 1LWHA 1V6VA 2YDQA 4XZWA 4W5UA 3BC9A 4CD8A 1HX0A 2WZHA 1DWGM 3KZSA 2BV9A 1C92A 3SURA 9CGTA 3WN6A 1ISVA 1CXFA 3F5JA 1DWHM 1H11A 3AMKA 1LL7A 5I23A 1EO7A 4FLOA 1UR4A 3WD2A 2GK1B 1VBUA 4W7WA 3BGAA 3LPPA 2OYLA 5A6LA 3FNDA 3SUSA 3ZSSA 1XGZA 2C8NA 2ZUVA 1W32A 4DO5A 3WDQA 2FE0A 3EDFA 5I24A 2JE8A 3W28A 3I3BA 5A8QA 3AHVA 1H09A 2C0HA 5AY7A 4HMCA 1AVAA 2Y24A 1UYQA 3BVVA 2VNCA 1W9XA 3CHCA 4MTVA 5CXPA 3ECQA 2V5DA 1GW1A 3A47A 2J7EA 5FOOA 1BVNP 3CHEA 1E4MM 1UWTA 5TD4A 4CGTA 4RE4A 4P7RA 1HP4A 3DHUA 1FFRA 2D24A 4U2ZA 3K8KA 5DF0A 1UR1A 2VVNA 2DT0A 4UR9A 5BRPA 1QX1A 1HWWA 2O92A 5BWFA 1JZ8A 3WDRA 5DO8A 3AICA 1KBBA 1AQHA 1DTUA 7CGTA 4AW7A 2J7BA 3AZTA 4PMYA 4TXEA 3EJTA 3W37A 1Q6GA 4HZ8A 3BUDA 3PZVA 3W25A 2CETA 1V3LA 3GH4A 5CZKA 3DDGA 1V3IA 3TA9A 2X0YA 3W29A 2VZSA 2UY4A 3N04A 1AQMA 4D6HA 5E9AA 4AZCB 2WZEA 1NH6A 4B3KA 1NQ6A 2G3NA 3L4XA 4MB5A 2YDSA 3RJXA 1M04A 2XFYA 4AD4A 1BFNA 1PS3A 4TX6A 1C91A 1M7XA 2PWHA 4AYSA 1E6PA 3RPMA 1NWSA 4GI6A 5IHSA 1JYWA 2FH8A 1B31A 1WDQA 3AISA 2WB5A 2J79A 1XSIA 4PYSA 3BVUA 1NOUA 1EGZA 1W9UA 3CZEA 4FNPA 4AYGA 1X6LA 1Q6DA 3WDIA 2BNJA 1ZS2A 2XIIA 4UFLA 1KR1A 2IGTA 5D9PA 5A3HA 3MKKA 3WDHA 1JYVA 1OCQA 1B9ZA 1EHAA 2JEQA 3EMQA 3SCTA 2AOSA 1CNVA 4OZOA 3VDAA 1TQTA 1HXKA 3AS3A 2A3AA 1XCWA 3A4WA 4AD0A 1WP6A 1JGIA 3EDJA 5A8NA 4D1IA 5ECUA 3ARWA 4E2OA 1TG7A 1BYAA 1UQYA 3WMCA 4MB1A 2E8YA 3PTKA 3OLDA 4TVDA 2D20A 1W9VA 1QI4A 3DX3A 3OZOA 3FHQA 4MNJA 1WKYA 4DM2A 1EHNA 2VQUA 4CD6A 2XJ7A 1GOIA 4HU8A 7A3HA 3NUKA 5GNXA 3WD4A 1MW0A 4F8XA 3WQVA 1HJQA 4H41A 2Z1SA 1GPFA 4HA3A 4N0RA 1J0IA 4KGJA 4EANA 2BVTA 5AC4A 3AIWA 5HDRA 3ZJKA 4TTGA 1KCKA 3UR7A 4A4AA 3ARQA 2PBGA 1JL8A 5GPRA 5E6YA 3BAYA 4RE3A 3RILA 1KQYA 3VO0A 3O9NA 1QVBA 1BYDA 3CUGA 1WB0A 4AZGA 4NRSA 1I75A 2CXGA 3VSVA 2WMHA 4JAWA 1HVXA 1RP8A 1X6NA 4AMXA 5E6ZA 1QBBA 5A8MA 1PZ2A 1WNOA 1E15A 3WKZA 4L4OA 4UQBA 1UWSA 3CZLA 1M53A 3GH7A 2E9BA 4XZBA 2GDUA 4UFMA 2D0GA 3D4YA 3WFZA 1EA9C 2HVMA 1UA7A 1SFSA 2FGZA 2J7GA 4W5ZA 2ZUSA 1E56A 1XRVA 3AMCA 4FNTA 2XFFA 1KXVA 3BSHA 4YPJA 3HG3A 3F5KA 1W1PA 4JCLA 3K46A 3MU7A 3WH7A 5C70A 1CXKA 3VGFA 2DSKA 3VX0A 2JIWA 4GZIA 1UKQA 1XC6A 3N17A 3BVTA 2WW5A 3DYOA 2YIHA 2AAAA 4JHOA 3KWXA 2DSVA 3CIVA 5I6SA 3VDHA 3DC0A 3ZQ9A 2VOTA 1VJSA 3NSNA 4W85A 3O2LA 3DX1A 3SEPA 1B0IA 4JZ5A 1UD5A 5EFDA 2YFNA 1CIUA 3D3AA 2WLZA 4ZE5A 3AOFA 4QCEA 2PWGA 2NW0A 1FFQA 4PMUA 3MUIA 3WNKA 3EYPA 1E0WA 3H54A 2J4GA 1E0VA 3VDCA 3SCOA 1NM9A 4F66A 1V6YA 2V3FA 5BRQA 4BQ3A 1HKIA 2JEPA 1E55A 1KGUA 5GQBA 4P8UA 5I0DA 1W3LA 1WZKA 1CBGA 4HA1A 3OGRA 4H04A 1WZAA 2YJQA 1HJWA 1J0YA 3VM7A 2CHOA 4M82A 1W3KA 3M07A 3VIOA 3UCQA 2J8FA 2GSJA 3N18A 4DUWA 3MUAA 1BVZA 3PHAA 2WZIA 3L2MA 4Z2JA 5CGMA 3ARVA 5HPOA 4UOZA 1GVIA 3WBAA 2QMKA 1PBGA 3VOCA 1EQCA 3AIBA 2X2YA 3B9EA 3KLLA 4GI9A 1QOXA 2ZUTA 2CHNA 2V3GA 2D23A 5FL0A 4LYQA 3L2LA 5LA1A 3WD0A 1PEZA 3WNMA 1RH9A 3BLBA 3UG4A 4LX4A 3D4ZA 3IJ8A 1XYFA 1JYNA 1ZJBA 4P7QA 4GPNA 4IPLA 2OWXA 1SMAA 2VI0A 4H8VA 1Z32X 2ZX8A 3MMDA 1BLIA 4J28A 4UCFA 1M03A 1E5NA 2EPKX 4DUVA 4J3UA 4AIOA 1GOQA 4CD5A 3KL3A 5AC5A 3MV11 3SCQA 2BS9A 3QR3A 4OUEA 2DSUA 2GDVA 1GOWA 2F7PA 1W9BM 2CEQA 4KGLA 1ZL1A 4MAVA 3EDKA 4MDOA 4ZFMA 1JIBA 1F4HA 1YQ2A 2UWFA 1CXLA 2EXOA 1LL4A 3L4YA 2VCAA 1C90A 2G3JA 2DT2A 2F2HA 2ZICA 2BVYA 5IDIA 1OGSA 3THCA 1XSKA 4PMVA 1ZBKA 1F4AA 2WNWA 1B3YA 1TCMA 3THDA 1I1XA 1UR9A 2TAAA 3A4XA 2E40A 5EBAA 4N42A 3ZO9A 3CMGA 3WDJA 4S3KA 4CD7A 4EKJA 3AYSA 2J62A 3A21A 1JD7A 1UWUA 2D1ZA 5E1QA 1V3MA 3WQWA 4MNKA 3VGBA 4J3VA 4NX0A 1C3FA 4V2XA 2CCRA 4MAZA 1XH0A 3ZIZA 1TQWA 4UOQA 1OM0A 4KRUA 1K9DA 3OZPA 5A95A 2BY2A 2V5CA 4HOWA 3VIGA 1OWQA 4UQDA 1CECA 3J7HA 3AHYA 5JUVA 4OKDA 1GHSA 2UY2A 2WCGA 2CITA 3TOPA 1OD8A 3OIHA 4HP5A 2WMIB 1WZLA 2XVLA 3EJPA 2RGMA 2UY5A 5HBFA 1JD9A 2XVPA 2VJXA 3VDBA 2E9MA 2W66A 1UKPA 1XHGA 1EDGA 1JDDA 4ML4A 2W4XA 5GNYA 1UD4A 4U3CA 3SIMA 1HTYA 3LX9A 4L4PA 3GXFA 1LF1A 4UFHA 3PZTA 2W91A 2CESA 1UKTA 3BMVA 3QHNA 4AZ5A 1E4NA 1GCYA 2Y2WA 1V03A 3ARSA 4W84A 2GJRA 3AIEA 5LYRA 3VX1A 5D9OA 1FA2A 3IJ7A 3BVWA 2EQDA 4KWUA 1H4PA 2G3IA 4IM4A 3ARUA 1D3CA 1IZJA 3K4DA 1E6RA 2WWCA 1UKSA 3W24A 1CLVA 3T08A 2BY0A 1J9YA 2XSBA 3AXXA 4HZ7A 5FKYA 1H49A 1OIFA 2DT1A 3PZMA 3WNNA 1JZ7A 3VSUA 2F7QA 2E8ZA 2E9LA 2BXYA 3KL5A 4W87A 1E6SM 3POCA 5BXSA 4AZCA 2YA2A 2YFOA 1BGAA 4MB3A 3VMPA 1MFVA 2WVSA 1HJXA 2ZUMA 1B3XA 1KXTA 2F1BA 1ESWA 1H1NA 2ZX9A 1SR0A 4R5EA 2QPSA 3VNYA 3VIFA 4U33A 4NZJA 1QW9A 1H3GA 3ZJ7A 3L4UA 4B16A 1Q6FA 3GNPA 1MQQA 5M17A 4CUCA 5IXEA 3WELA 1JAKA 3GZAA 1R8LA 3I3DA 3SUTA 3WUFA 1IZKA 2YA0A 2J47A 2W5FA 4C7DA 2CBVA 4U31A 1GONA 3LMYA 4GQRA 3BLPX 4GINA 3GNRA 1J11A 3FAWA 3HG2A 4MADA 2Y5EA 4FMVA 1KFWA 4AZHA 2YLAA 4GO9A 2PWEA 3D5HA 1ODUA 3VD3A 5D8ZA 3W6MA 3K1DA 1K9EA 2YKKA 1V02E 1J0HA 4OOUA 4PUDA 1L8NA 5A6BA 5D8WA 2E4TA 1Q4NX 4MPKA 1KGWA 5M3WA 1H0GA 3CHFA 3AIVA 2DH3A 2NT0A 2HISA 1UR2A 1TQVA 1D7FA 3AQUA 1NP2A 4UFIA 4AIUA 3WH6A 4BCEA 4OGZA 5A6AA 1ITXA 4V28A 2VL4A 5E0FA 3APGA 4DWSC 5JIPA 3S5YA 5BXRA 1U30A 3AYRA 2PC8A 3HJEA 1ZU8A 2J7DA 1TQUA 4DUXA 4U3AA 3BAKA 1G0CA 2WCAA 3CMJA 1JF6A 3SUVA 2CIPA 1EQPA 1B3WA 3WBEA 3CZNA 2EAEA 4F9JA 1LLOA 4ZEPA 2WBKA 3WF1A 2WMFA 3MSGA 5BXPA 4X0NA 3TTOA 1CGUA 4BZYA 1GQLA 1NARA 1HL8A 2XFRA 2YBUA 4S3JA 5DMYA 4OJYA 2WCSA 3UETA 1ZB5A 3CZKA 3CUIA 3L4WA 3CZSA 1E43A 1JF5A 3AMLA 2J78A 3FN9A 3VD5A 4M24A 3BLKA 4JL1A 1W9DM 3VTRA 2A3CA 3VGHA 2V3DA 3UEQA 1ISZA 4Z2HA 1R7AA 4D6JA 2Y8KA 3RMEA 4D72A 2D3NA 1FHLA 2VVSA 3MUY1 2W62A 1OSEA 4NI3A 2DGAA 2EPOA 2J75A 1E0XA 1HJSA 3PZGA 1QI5A 3WY3A 1EDTA 2ZXDA 1K9FA 3VD7A 1HL9A 5FL1A 2G3MA 2B31A 3LRMA 5CPSA 2X8RA 5CGTA 5JBEA 3L4ZA 2ZOXA 2JF6A 1ISWA 1G01A 1HN1A 4CU7A 3A4AA 4TVUA 1JFXA 1UZ4A 1CGWA 1KXHA 1GJUA 1CXIA 3ZR6A 5HNNA 1BTCA 2PI6A 3ALGA 3NJ3A 3PN8A 3K8MA 4JFVA 1XH2A 3MI6A 1LWJA 3OLEA 3AXIA 1U33A 2XN0A 3TP4A 1UD6A 2F7RA 2ZX6A 4JCMA 2ZXAA 1EH9A 3ARTA 3KL0A 2WVTA 1HF6A 4BF7A 3LRKA 4HZ6A 1M01A 2XHYA 3CBWA 3BH4A 1KB3A 5CSYA 1WO2A 5A2BA 1CENA 2DIJA 3VPLA 3EBVA 3VGEA 3BUPA 2WHKA 1U2YA 1RD6A 3QOKA 1G9HA 1W1VA 1ZBVA 3NSMA 2D0HA 3PZOA 3WUEA 1QHPA 1CEOA 4CVWA 3N11A 1KTCA 3KEHA 2CKSA 5AYIA 5ABFB 3D51A 4M1RA 3SUWA 2WC7A 3EJRA 4V27A 2ZUUA 1EXPA 3PZIA 3OA5A 2QHAA 1ECEA 3BAIA 5EMYA 3HN3A 4MNLA 2XWEA 5HPCA 1O6IA 3A22A 1HKMA 1VBRA 4FNUA 2X2IA 1ODZA 2A3HA 1BSIA 3T2OA 1PZ3A 4H2CA 2BVDA 1J18A 2VCCA 5EB8A 3CO4A 1G94A 3DDFA 1R75A 4UQAA 2IUZA 5KEZA 3FXYA 3HU7A 4WK9A 1JZ2A 4F9DA 1Q6CA 1VFOA 1VFFA 1O7DC 1V6UA 2XYLA 2CYGA 1DHKA 3CLWA 4FLRA 4ZENA 4B9YA 2DQXA 3WY2A 5A8PA 3WUBA 2G4FA 1OBAA 2V38A 5BXTA 4JKLA 3TTYA 4NF7A 3N9KA 2QF8A 5ABEA 3CZ8A 1QNOA 1QI0A 4M8UA 4WSJA 4TTUA 3RM9A 4D6EA 4DO4A 2UY3A 2EABA 3VM5A 3OG2A 4URIA 3N15A 3WNPA 1DP0A 1XSJA 2VUYA 3RO8A 4ZE4A 1PPIA 2J25A 2WAGA 1JYXA 1GQKA 2WHJA 5IHRA 1NP0A 2ZX5A 3PZUA 3K4AA 4MB4A 3MS8A 1J0ZA 1KR0A 1MXGA 2GVYA 5BYWA 3OBAA 2XG9A 1FH7A 1TR1A 4JFSA 4JFUA 3W6LA 2YL8A 1QWNA 4P7OA 5GNZA 1FP9A 1RP9A 2X05A 4PRWA 2PB1A 4AZ6A 1JI1A 4D6IA 3RM8A 1CGVA 2WK2A 2WM0A 2ZWYA 4ACZA 2WMIA 1ISXA 1W2PA 4AWEA 2FHCA 1XD0A 4FNQA 3ALFA 4X0VA 2DSWA 5I5RA 2VX7A 1J12A 4J3SA 3A23A 1PAMA 2WKGA 1B90A 1XCXA 1Y7VA 1BF2A 4PN2A 1HVQA 3LXCA 4AZ7A 2WLYA 3BCFA 3UERA 1CPUA 3BUBA 4BQ4A 1E73M 3AZRA 5E0CA 3S6TA 3E1F1 3M46A 4WIWA 1JAEA 4QP0A 4CN4A 1KXQA 1TVPA 1X1NA 4CCEA 4QLKA 1XYZA 2WMJA 2XTKA 2O9TA 4M80A 5ABHA 4PMOA 3S2CA 1L0PA 2OSWA 2DPEA 3M7SA 3GXIA 3S5ZA 2YA1A 1SMDA 4ZXLA 4UOJA 3LXAA 2VX6A 4H7VA 3LPOA 2J8GA 2E0PA 1D2KA 1TMQA 4UTFA 3OLIA 4M56A 4XX6A 2CERA 3VMNA 3SCWA 4Q22A 2FHBA 4CD4A 4QFUA 5CSUA 2CPUA 4XUYA 5I79A 3WIJA 1E70M 4D71A 3WMSA 3AIRA 3T0DA 2BHYA 2XSAA 1VIWA 4JKMA 5HXMA 4ACZB 4HMDA 4AD2A 2CBUA 2GJPA 3BVXA 1C8QA 1CWYA 4AD3A 2YBTA 4JHZA 2WVVB 2EADA 1V02A 3G6LA 3GBEA 4JFWA 1W9PA 3NSXA 7TAAA 3UG3A 3MMUA 1C7SA 4KRTA 4JKKA 1W91A 5ABGA 5IFTA 2GJXA 3BMWA 2O9PA 3POHA 3WENA 2VX5A 2Y8VA 2CNCA 4QAWA 3W0KA 1EOKA 4PCSA 4AEEA 3WH8A 2YOCA 2DH2A 2D2OA 6TAAA 4D1JA 1VEPA 1TA3A 1J0KA 3W38A 1QWUA 1WPCA 4UQCA 2VCBA 5BCAA 3GXNA 2WXDM 4UZUA 3IANA 3A3HA 1FP8A 2YL6A 2D3LA 1ISYA 3PTQA 5HOSA 4UFJA 2WKLA 4LGXA 4FF5A 3WEMA 2WMKA 4PCTA 3WL1A 1JG9A 4AISA 4B3LA 2EEXA 3CGTA 4GO8A 4Z2KA 4D6FA 4WJXA 2WBGA 3G6MA 4U5IA 2VZUA 1QHZA 4EE9A 1GOKA 4IUGA 4PMQA 5FIPA 4PTVA 1NWUA 2VQTA 1CGXA 1UWRA 3VIIA 2YL9A 4U5KA 3BAXA 1HXJA 5A2CA 5LA2A 1LJYA 2X1IA 4PBGA 2WVVA 1B30A 4NXKA 3N12A 2AMGA 4IPNB 1R7OA 1UWIA 3ZMRA 1BYCA 2VRKA 1OGGA 5I3DA 4FLQA 1H2JA 4F79A 2D0FA 3CUHA 1E40A 4Y7EA 4CKQA 3H53A 2XVNA 1VRXA 1FOBA 1AMYA 3AS2A 4CCCA 1E3XA 4TOQA 1TE1A 5A6BD 2XM1A 4UQEA 3AROA 3T2PA 4JIEA 1VENA 1TA3B 2ZXQA 5A6JA 1J0JA 1QNQA 1MXDA 4EK7A 3GDBA 4MJ2A 4P7NA 1EDQA 3W82A 3BXWA 4W8AA 2X0HA 3M6DA 3MSDA 4WF7A 1B3ZA 2GUYA 1UH3A 1XV8A 3SCUA 2C7FA 2YLLA 4HTYA 3A5VA 3VGGA 3GYCA 1UD8A 2OLHA 1FHDA 3VIPA 3B9DA 2VR4A 5A6SA 1E4IA 3WMBA 3VIKA 1PX3A 1Q6EA 3U7VA 1TZ7A 3WH9A 1H5VA 1QNRA 1UZ1A 5C71A 3WF2A 3TV8A 3AIQA 4UQ9A 5D4YA 4AC1X 2ZIDA 1MQRA 1E6XM 2CBIA 3VIMA 2VR5A 4WKFA 2A3EA 3O6AA 1GNXA 4NRRA 3EJQA 4ATDA 2WPGA 6CGTA 1V0NA 3GBDA 2W67A 4U2YA 1R46A 3LRLA 1GUVA 3AJ7A 4P8WA 1R47A 1V08A 4ACYA 1LG2A 1E6NA 4WKAA 1KWGA 2OYKA 2J77A 1SYTA 4GZEA 1C7TA 4W7VA 3W81A 3T09A 2PBOA 1BAGA 2QPUA 1GZJA 4XV0A 1MW3A 3U57A 3IGUA 2OSXA 1AQ0A 3CH9A 4UFKA 2X09A 4W93A 3AXHA 2VRJA 3N1AA 3LXBA 3ZT6A 1PIGA 1UQZA 5JBDA 8CGTA 2ZUNA 4W86A 3WL0A 5EFFA 1JI2A 4CVUA 2ZXBA 3GXMA 4HU0A 2J7CA 3I3EA 4J7RA 3WD3A 1VF8A 3UG5A 2OYMA 2PWDA 4JL2A 1E6ZA 3EJUA 3QHOA 1HKJA 5I78A 4EAMA 3AMGA 1BGGA 3KE0A 3WEOA 4BS0A 3OLGA 1UR8A 5CPQA 2W61A 3N13A 3VUPA 2J7HA 1DWFM 3WF3A 3NIYA 1W1TA 1C8YA 2CKRA 1UR0A 5A8OA 2XN2A 1VEOA 3GXDA 1CGYA 3WH5A 1UA3A 1R86A 5A94A 1E72M 3OB8A 4B9ZA 3WEZA 4KH2A 1UD3A 1BHGA 1V6XA 3T0AA 1DWIM 3ARXA 3WQ8A 2ESCA 4AXNA 3ZSTA 2FHFA 1E1FA 2DIEA 2EBNA 1E3ZA 1CZ1A 2G41A 4R27A 2VTFA 2EACA 3D52A 5LA0A 2VRQA 2QLYA 1UWQA 2O9RA 3T0BA 1CDGA 1R34A 3A6OA 4YN5A 1KBKA 5D9MA 1KGXA 1KQZA 1V3KA 4GQQA 4E4PA 2WMGA 3VIJA 3BCDA 2XIBA 2XGIA 4Z2IA 2YDRA 2OW7A 3ZOAA 1IT0A 4GZJA 3CC1A 3DX4A 3L4TA 3WFLA 1BYBA 1CYGA 3WUGA 4BQ2A 2FDMA 1OT2A 2VURA 4J3XA 2PWFA 3ZR5A 5I77A 1E5JA 3LPGA 1J10A 1JZ3A 5FCZA 4WLCA 2JIEA 5A6MA 1HIZA 4W7UA 3CZGA 2XGBA 1VJZA 1DEDA 2PF0A 4PUEA 2CBJA 4Z2GA 3WQ5A 2JFEX 1VB9A 4TX8A 3AIUA 1V0MA 4LXFA 3II1A 3WSUA 3TONA 3D50A 3K8LA 1H41A 4PTWA 2FYVA 4HMEA 3W26A 3WQ4A 3TTSA 1DWJM 3WNLA 4X9YA 4P8VA 4AIEA 2X2HA 3BAJA 4UZSA 1MW2A 4W88A 4RE2A 4PMDA 3PTMA 5A1AA 4H8HA 1HKKA 2F18A 1XH1A 3OGVA 2WSKA 3HG5A 1JZ4A 1B1YA 3W4RA 1ZBWA 2W92A 2NSXA 3EMCA 3ZJ8A 5DEZA 1GVYA 3WY1A 3VSTA 3ARRA 1EIBA 1FH8A 1DWAM 1BG9A 4PMNA 2VZOA 3UESA 1TQSA 2A3BA 1JFHA 1TVNA 3ZJ6A 3OGSA 1HNYA 3SCSA 1NWRA 3U5YA 2ZWZA 1NOWA 1BG4A 3VU2A 4HPHA 3DYPA 1ZJAA 2D73A 1JZ6A 1WAWA 4PEEA 3QOMA 4CCDA 3GXTA 3IAQA 3WDPP 2Z1KA 4AD1A 1HT6A 2VX4A 5CLTA 3ZT5A 5CQ1A 1E1EA 4M81A 2WYSA 2GJXB 2VZVA 3VINA 3F5LA 1B3VA 3FHAA 4W89A 2GFTA 2QMJA 1KWKA 4ATWA 3AHXA 1B2YA 4XB3A 4AD5A 2EJ1A 4FK9A 3SCNA 4NSBA 4FNRA 3VGDA 3PZNA 1UASA 4NZCA 3WF4A 3AMDA 1GJWA 3SUUA 4OIFA 1CGTA 4J3TA 4OBSA 1QNPA 1V0LA 4YHEA 3AI0A 1W3JA 4GI8A 3VD9A 2WVUA 3BAWA 4NZFA 2WANA 1VAHA 1EO5A 2Q8XA 1TUXA 4J27A 3H55A 4PTXA 5M03A 3IJ9A 4TVCA 4DWSD 4C7GA 4AEFA 3DX0A 4PTMA 3CUJA 1UOKA 4ATLA 1JDCA 1A47A 4DM1A 1LL6A 3NYDA 2Y4SA 3U7BA 4CN6A 1IV8A 4Q7NA 5BROA 2DT3A 2BFGA 5A2AA 1W3HA 1PIFA 1LG1A 4MJ4A 4CU6A 2DDXA 1R87A 1QPKA 2ZX7A 3SCRA 1XD1A 3MMWA 4D6CA 5IFPA 1US3A 3PZ9A 1GQIA 3AS1A 1NOFA 1OD0A 1HJVA 3KLKA 5DFAA 1CTNA 3TTQA 1GQJA 3DECA 3QGVA 4AZIA 3ARPA 1S46A 2OW6A 4HOZA 2D22A 1LQ0A 3VD4A 2XVGA 2V3EA 1VEMA 8A3HA 3VMOA 3ARZA 2VC9A 2YL5A 1K9TA 2WWDA 4AMCA 1O7AA 4WSKA 2VZTA 3VILA 4PSRA 4PMRA 3F4VA 4YHGA 3DX2A 1C93A 4Z2LA 4K68A 2EPLX 1K6AA 2OWCA 1CXHA 4B15A 1MQPA 2ALWA 4FLSA 5A6KA 2OSYA 2ZUWA 4W8BA 1RPKA 3CZJA 2VO5A 4QLJA 3T2QA 3AHTA 4QCFA 2W63A 3L4VA 1JXKA 2XUCA 3GNOA 3VKKA 4FNSA 4PSPA 3IAPA 1WDSA 2WHMA 4JFTA
chains in the Genus database with same CATH superfamily
2WSPA 4G1EA 4CN1A 1CLYH 1ORQB 1TZOA 3IN2A 1CGSH 1C12B 1KBPA 1KIUB 4M6NH 3SDDA 4Z76A 4JTIA 3VE9A 1HH9B 5CO1A 4CC4A 4B41A 5A3ID 1N0XH 1S9WB 1I3VA 1X8FA 3NL3A 1W2VA 2Z2UA 3D8MA 3S37X 2DORA 1F74A 4Y9AA 4QMEA 3MRRB 1VFLA 1FJ1B 3AG2B 3FT4A 2R2EA 4UB0H 4X7FC 2BWIA 1UWAA 2ZZ6A 3R25A 5JYMA 4WHDA 1Y65A 4OQ1A 4IFKB 4IIFA 4E5XG 2CLLA 1T83C 3GZPA 4DWSB 2OR7A 3CK0L 3AY4C 5SWZB 4PV1C 3IB4A 4H8WC 3UTTE 2EUZA 3MOAL 3DSNB 1MAMH 3D05A 4FQCL 5E95B 2O4QA 2W07B 3QARA 1OT1A 4QHMB 2OSLA 4RGOL 1KCZA 1M05A 1XF5A 3FUJA 3OVPA 1Q72H 5EORH 1A6ZA 3UXDA 2ZOWA 3SPCA 4EXAA 1HUVA 1O6TA 4U6TA 3EJYC 3UBXA 4NO3A 1QU4A 3WF0A 1BJMA 5GGVL 1CLXA 4J8QA 4ZUUB 2WB1A 4NQTA 3W2MA 1GW9A 3B8WA 3QEHA 4HCRL 1PKOA 4UINL 1R33A 1HJUA 3PWPB 3BP4B 1Y5WA 2FJGA 1HU8A 3LGDA 2DI7A 3UZQB 2FO1A 3PJTA 4LRIA 3SDAA 4M7ZC 4HUWB 1GRWA 4MNHA 1XRSA 1QNZL 1CDYA 1UG9A 3CFQA 3DFSA 4HIIA 1QRNA 3P81A 3WMQA 4O57A 1A6TA 4XAKD 3ZPDA 4O58L 3UAJA 1UG6A 1W1A1 5LNEA 3N2OA 1CXEA 2BHUA 1P2CA 3CFJB 2NW3B 1JWUB 2VT0A 1FNAA 4XIMA 2HCVA 1YA5A 2VR2A 5C0CA 1OIMA 2HVBA 1UJQA 4WI4A 2COQA 4X6CE 2I9LA 1GOOA 5EMUA 2Y1VA 1GJPA 3OKOB 5LGYA 1OYCA 2VL5B 4MSWA 4Y88A 3HMCA 5I6MA 3V10A 1UZGA 3VNKA 4LAJH 2DQWA 1YMMB 3PHSA 5IMKA 3F12A 3JWOH 2FQEA 3UZVB 2FSEB 3Q1SL 4QHKI 5I16A 2O6DA 3ZL1A 5CP3H 1IKFH 3EO1B 4EIBA 3ZQWA 1TV2A 1LK3L 3MROB 2HWZH 1Y0LA 3OPZL 4HC1H 4L4VA 1OAKL 4F7PA 1YEJH 3VVGA 3X3GL 1GOGA 4V1DE 4D1JA 4WHYG 3EXLA 4M7LL 4IIDA 3AFBA 1A64A 2BJMH 3D87B 2ICES 2XOTA 3IK2A 4HQQH 4JFYB 4EPBC 2QPDB 4XPBH 1S9XA 1CFQB 2VXUL 2P42B 5DJZB 1R6WA 4UTJA 4C6JA 4JDTL 5FYKE 5D7IA 4Q6IA 3RG6A 4FNLL 4P9HC 3STZA 3FTZA 1ONQA 1FH5L 2PW1B 2WTOA 4N0YH 3E2QA 3NGJA 1QR1A 5E2JA 5LB1A 4CGUB 1J96A 1V3HA 4NZ5A 3SI9A 4XNYH 2AFNA 2DEPA 3VNIA 2IFFH 2JALA 2OJEA 3QJAA 1KRBC 3DUHA 3PYCA 4NQCB 5E5UB 1FCUA 1H51A 3QLDA 4PMXA 3GMQA 1C1EL 5E7FA 1TQXA 5I3JA 2F08A 2C3ZA 4XCCH 1IAIM 3MXWH 3QDGE 4TUJA 2ZF9A 3P0WA 5IQMA 1CK0H 3MANA 1L2QA 5HR6A 3Q44A 3DX5A 3GMMA 4G71B 3GM8A 4XN5A 1F56A 4NENA 3R79A 4QLLA 2YD9A 2EIMB 4D8OA 3WD3A 2VC2H 2R14A 3WQ6A 1LO4L 3OF6A 4POZC 5DT5A 2BY3A 3AUVA 2UUDH 1SEQH 2XN9B 2FATL 4PMZA 4K3JL 3NCOA 1MYRA 3DX9A 1XDMA 3ABSA 2BY1A 4QJ3B 4P4KD 2D4FA 4JY6B 4NUPA 5BNXD 5J0BA 1YMME 4HPOL 5JHDD 3RIFF 4B27A 4P5UA 5EPMA 1E6QM 3R8RA 4C1LA 3BXNB 4L4MA 4EE9A 3HW7A 5EIQA 2QDEA 5CBJA 3L9CA 1TZGL 2ICWB 1C8XA 1JRBA 1FVCB 3DG3A 3MUCA 5DYOA 3SRFA 1DORA 4X42A 1WFTA 5DZNA 2NXGA 2ZD0A 4J3OC 2VABB 4DYEA 1T3FA 4M8RA 2NUTB 4OBRA 1JQVA 5EU9A 1EXUB 3CVHB 2LTQC 3FAXA 4CJ0A 2CU9A 3QWOA 1T4KB 3CFEB 4XBEL 1Z8AA 1JZFA 3U6XA 5G4OA 1EFXD 4LHUD 4FXKC 3STEA 2F53D 4Q74A 3KOXA 4LQ1A 3QW4B 4UTWC 2CKNA 2HKHL 4PVBA 2NUPA 1N26A 2R91A 3RCNA 1H62A 5IUCA 2NY2D 2B0SH 2MANA 1K4CA 4HCHA 2OZTA 4Q8NA 4MDPA 1L9WA 3OKYA 4XP6L 3EH4B 3FTGA 5C9XA 3BUIA 2J8OA 1FIEA 1PTZA 3B7YA 2GTZB 4Q7DA 2ENQA 3BDYL 5I8CB 4GMSH 2B7NA 4QXWA 1QEWB 2EPMX 1TJHH 1TELA 5C0BE 4KESA 1UH2A 5FYKL 5F7MC 3T1FA 4C83B 2WQPA 4GABA 5BU6A 5SWSB 1FH9A 1RVGA 5CHNA 3HHRB 1NWTA 4XAPA 4GXVH 2ZCLL 3I7RA 1QBAA 3LENA 3N25A 4B3ZA 4A6YL 2XWDA 4Q4IA 1WDRA 3LHVA 4LT9A 3RHWK 3TYFA 2EPNA 1UC6A 3QCTH 2OZ4A 3WXVH 1JNDA 2FQFA 1XIBA 4HWZB 4Z7UA 4I0KA 4ENED 2J8UA 1QAWA 1AQ8A 3LQMA 3VKJA 1JNEA 2WC4A 4JY9A 1NMAL 2CZFA 3FO1A 5DJ8B 4LF1A 3TQVA 5D7IF 4K94H 1XF1A 3OVQA 1JCKA 1S3KL 4H8NA 1ZVHA 3CXDL 3IDJA 4N5EC 1H0IA 1NC4A 4YWIA 3GSUB 3NFPA 4IM8A 5C5YA 3QI9B 1FRGH 1NFDE 2XN9D 2V17L 4C5ZA 2XWCA 3B8SA 1R85A 3JTSA 3MV01 1MWOA 4WDIB 1BEXA 4IGBC 5IHUH 1JXJA 1MW1A 3DIFB 1WEJL 1U8NB 2FH6A 3OC8A 4XKYB 5D5ME 2ZOOA 2NZLA 3MO4A 1G43A 4GQZA 4M1DH 4PJCB 4X80L 1BD2D 1Q63A 3N1GC 3C6LA 4HUKB 4KKLD 4J35A 4OT7A 1S7RB 5DHVA 4QTHA 4Z7VE 1ZTXH 2R0WL 2X3CA 3ARYA 3GMOA 1LRQA 5C07B 5DT7A 3UAFA 2BVEA 2EDNA 3GHEH 4HULB 4RDBA 4QLWA 4GA8A 3QJOA 5F7NC 4ZJ9A 2XSXA 4A3YA 1J8HB 1ZVYA 3FW6A 3TJXA 4DBSA 1NAMH 3T42A 3NDOA 2IIJA 5CNHA 1QW8A 3MLUH 3Q48A 1NAKH 1UWGL 4NPKA 3NVDA 3V36A 1NSJA 1MVUA 4AC7C 2YDQA 2VDPL 3GBNL 4YDLB 3RNQA 2EIKB 3LV3A 2C91A 1TMHA 3APTA 3V79C 5D2TA 5A40E 4N7QA 5ICXB 3KEDA 2FNWA 4LSRH 4RJEA 2P8MB 3HM7A 1KIQB 4IIBA 4R88A 1UUNA 4M5ZL 1M1XB 4DVBB 2WZHA 1KXQE 4S3CA 3CT2A 1EEUA 3FQUA 3G5VA 5D70L 1J9SA 2I7SA 1INDL 3L48A 3T3PF 3KVQA 3O2WH 4NWTH 3U7AA 4F91B 1XIGA 3ZDXB 3S2AA 5J4MA 2CBOA 1LL7A 3VYNA 3SQLA 4CQCA 3Q8BA 2EIEA 1KG0A 1X5YA 5CJQL 3LLFA 1Q4WA 4S3GA 4WGXA 5FF3A 4AQ1C 1OTTC 4PG2A 1Q8AA 2GK1B 1QVOA 4DJFD 4L1WA 5KTLA 4LKCB 1EUNA 4RNJA 1SXNA 5DDHB 2QJIA 4P4RA 1POKA 1XKJA 3VI2A 3FNDA 4PJXA 3ZSSA 2RDXA 4ZSUA 4I18B 2C8NA 2ZUVA 3CLFH 3GJEB 1AXSA 2XZ9A 1NCTA 1TRDA 4G6CA 1PFCA 1AODA 1ZLWH 2OKMA 4MDIB 4X3ZA 2JE8A 4YL2A 1OC7A 3ZE0B 2ZF8A 2OX1A 2E9WA 2W9MA 3TBSB 4MS8D 3CPGA 1FPTH 3BD5A 5D2NA 1HH6B 4E9WA 1F4YH 3WAKA 4HMCA 5JW3H 1U1UA 3TA4D 3C75A 4GUCA 1Q72L 5EORL 5INDA 2HBXA 4WFEE 2Q6WA 4NUJB 5ID1B 3BVVA 1S7XA 3N6HA 4ZQPA 3D39D 3HC3L 5H37G 4MTVA 2NCEA 4ORGA 2G0WA 4IWWA 1IGFL 3GSNL 4G8EA 2G2PA 1P5VB 1QSEE 1XVSA 3P2BA 3NCYS 5GS3A 4F57L 4HWEH 4Z3HA 4FD0A 4UM9B 2J7EA 4RNIA 1P5UA 5I18H 2G95A 4Z7QF 5HHME 3CHEA 3TSBA 3U9IA 4PTUB 1FVDB 3MV8E 2ZVIA 3P7YA 1AS7A 1HP4A 1WFIA 3K5SA 1X1ZA 3UJIL 3FUFA 2D24A 3R6IA 5DHDA 4LALA 3K8KA 1T1WB 3EG9B 4JM2A 1SZGA 2QNEA 5JIIA 5K4ZA 2KQMA 4UT7L 4WX2A 1JGUH 4BBWA 2VVNA 2DT0A 3TBWB 5HWNA 2D4DA 4YXLL 3NFNB 3EA2A 4AUYA 4PB0L 3O9WD 2R2HA 1X4YA 2EZ0C 4FN0A 5F7FA 1A5KC 1OHLA 3LRSB 3T04D 5BWFA 3NNTA 2NQ9A 1WWBX 3CZFB 2H0PA 1RZKC 1HEHC 4C6EA 5HY9B 1FFNA 4Y4KB 2YGVA 4FYQA 4YGAB 1DTUA 5TK2A 4OLVH 2XWJA 3E3QE 2H90A 3GIVB 2VDKB 1OGAD 1JP5A 5EOQH 5H35A 4PMEA 2OQHA 5DQJA 4XXDB 3W37A 2OX5A 4HYRA 3NPVA 4WO0A 5DYFA 1OAKH 2F74A 4JMNA 1HO4A 3S36X 5AAWA 3C5ZB 1NAMB 5IBXA 3PZVA 3FH7A 4Y2OB 1H7XA 4ZMTA 3HNSH 4X4YA 3QJSB 2QQQA 3NZ1A 3HAEG 4MWAB 2VN3A 2GEQA 2AEQH 4BFIA 1PY9A 3O3BA 4O2FB 1MWAB 1T1XA 3B9KC 4BCXA 1R5WA 2X0YA 3ITXA 3T8VA 5LNVA 2ZKWA 3IMBA 4QJ1A 2NQCA 4X5PA 4YO0A 3FJTA 1K85A 4N9GB 1NFGA 3FFOA 3HPAA 1KENL 2P5EB 3CFCH 1CLOL 3W9EB 3PJLA 4AZCB 2BMKB 1L0QA 1J1XH 2VDRL 4I9WE 1U8MA 2RQEA 2YDSA 1FNLA 2BIIA 3W7EA 1M04A 4L4VE 3SW6A 3RTQC 1PS3A 4TX6A 4EX4A 3K81A 2J5WA 2PWHA 4G80B 3EGDB 1E6PA 5IHSA 4B5XA 2FH8A 4IIZA 4PJXF 5F1NB 3V4VL 4A2MA 4HW6A 2YXMA 3AISA 3FT1A 1OFAA 2WB5A 3GG8A 3QY8A 3CUXA 1P0SE 1MFCL 1EEZB 1L9TA 4PYSA 1O7DE 2JNZA 4BE5A 1IEIA 2E6QA 3L9YA 3BVUA 4PQXA 2PCPA 3C56A 4WGWB 4ZBCA 3HMXH 3MCOA 1E7VA 5IQ9B 4AYGA 1IU1A 2R8SH 4W9LC 1BYOA 1ZA3A 3IS1X 4MCZB 1KYAA 2R4SH 4UI2A 1ZTXE 3GNNA 2X4UA 4AX7A 4JPIA 5EN2A 1JUBA 1A6UH 4JX0A 5A7BA 5J7CC 3GFUA 2BO0A 1B3OA 1CT8A 4WO4A 3ULSB 1EHAA 1QFPA 3KHQA 5E8PA 2VGIA 2ZA2A 4GIEA 5B1JC 1TZHA 1A7NH 2AJYH 3CE1A 5KBLA 5EYWA 1CNVA 4IT1A 1TQTA 4G7EB 2DQEL 1IT9L 2R59A 3AS3A 4Q9QL 4XMZA 1Q0YL 3CIAA 1R0AL 3TXAA 5E9DA 1MI5A 2OI9B 4G6MH 3V6OE 1XCWA 3AT8A 5JR1H 1XW8A 1KM6A 4OHQA 2POTA 1P69B 4WSHA 1WP6A 5A16A 1K77A 1MRCH 1JGIA 1SYSA 1HE8A 1AYRA 3ZVHB 5A8NA 1J8SA 1RSYA 1T04B 2P5WB 4J3BA 2IAMA 5F7DA 2WYIA 4KAQL 4JTDA 5DWUL 4ZXBD 1TG7A 1QXLA 3KPSA 4PS7A 2VR6A 3CUPA 3B0YA 5RUBA 2DQTL 3D3VD 3NMEA 3QZLA 3PTKA 3C2SA 4LRTA 3WLQA 4HIHB 3N73A 3BDBA 5LG6A 4G7YH 4KXCA 4KRMB 2OTUB 2WBJB 2Z91A 3O4OB 3FHQA 3IDIB 3FL7A 4MFHA 4QHNA 3L54A 5A7EA 2AJ3A 3QORA 4HLZH 2FSDA 4B3EA 2F7IA 4XVJH 4K07A 1KZQA 3RLSA 3BLEA 5I3KA 3KWWA 3EWDA 7A3HA 4WUUD 3WD4A 3AWOA 4XR8C 5T1MA 3KWUA 3WL9A 1O7VA 5ADOH 3PHQB 3G18A 5LNUA 1XFBA 3WQVA 3M7WA 4GY1A 5A2JH 2DZUA 4H41A 4N2FA 3EJZC 4UC5A 1QRNE 2Z1SA 1T89C 3HIJA 4H6RA 4HA3A 1NGYA 1XB3A 3H1ZA 3TYGH 3ABXA 4ROQA 2BVTA 2YPLA 3TIEB 2A9ML 3OQRA 1CWVA 4Q0XH 5E08H 1IBFA 3HCVB 5DO2C 4A2LA 4F7MA 3O6FC 4BUHA 4TTGA 2PGEA 4H83A 2BC4A 3TQ0A 2WWOA 4Q4SA 1U8LB 5BOJA 3UTTB 4A4AA 4RXFA 2VQ1A 4PUUA 5E6YA 4LP5A 4WI7A 1KY6A 3RA7L 2YAHA 4PG9B 3DURB 4QEEA 3U0PB 1P6AB 1VRDA 2UVEA 4DZBA 2Q76A 1NUFA 5C0IA 3O9NA 4KWVA 3AXMA 4ACTA 3ATDA 5K9KB 1SSGA 1XF0A 3DBXB 4BR1A 4OKVA 3A13A 1TIUA 2CXGA 2WMHA 2RHEA 3L1OL 4JAWA 4PB4A 1X6NA 2HN7B 2J8TA 4AMXA 3TT1L 4XXCC 3UU0A 4JY5L 3WFBL 1A3WA 4CW1B 3BICA 1PZ2A 4YX2L 1AO7A 2FPVA 3QUZD 3T6QC 2WZ0A 3A6BH 1E6JH 3C09C 4JPQA 2GW5A 4XN7A 1FYTD 1QLEH 2J9XA 1V5JA 4WW2F 4CNUA 3DOSB 4L4OA 1G7MB 2YGQA 2CR0A 1PDKA 4HUUB 4ZSOB 3GC2A 4US6A 2E9BA 4F3FA 2YKLH 1U83A 4TUKH 4DAGH 3KLHC 4IG2A 1IAOB 2D0GA 1AGFB 3EYSL 2HVMA 1EA9C 2OZ3A 1UA7A 1SFSA 2Y69B 2AJVH 1A8ZA 4JQXA 3L3OC 1I1RA 4PJ5B 1T6MA 4FNTA 1KJ2B 2EZ0D 1MAML 3PXJA 4FQCH 4PVLA 4U6YB 5F88B 1D2PA 2YPVL 4EMZA 1O5XA 1NGXA 3VXUB 3CG8A 4YPJA 2EDXA 2FQGA 1W1PA 4HJWA 1FH2A 1OSYA 5I1EL 1B54A 1IF2A 3K46A 4Y19E 3MRCB 2F54B 3VFMB 1YE4A 4X2PA 2GIYA 3LB0A 3DXAE 3N2XA 2R94A 4OZIF 1DFBL 3O6YX 3LEXB 4GZIA 5AKQA 1T89A 3BVTA 5DY2A 5H2BB 5FR3A 4EN3B 2WW5A 3W7NA 4JFFA 4K8RL 3MGAA 5PCYA 5DMKB 3VZYA 3S3SA 1JXFA 4FKHA 1FHVA 4KH9A 2DSVA 3MC5A 1LNUB 3CPRA 4PJCE 2C9QA 1RMFL 2VOTA 3DC0A 5D72H 1VJSA 3ZQ9A 1BA9A 2R4RH 3TH6A 4NGHL 3RUGE 3SEPA 4NQEB 1TRIA 2ESVE 4JZ5A 5A2IH 4IQDA 5H1WA 1P7QA 2PP9A 3OKLA 2HNHA 3VFWB 1QUPA 3P4MA 1IC7L 5L9FA 1H3PL 3B1UA 1NGWA 1JGLL 4AQ8C 2P8LA 3S3JA 4LB8A 3AWFA 2WLZA 5SX4I 1ONXA 4ZE5A 2ZOTA 5XIAA 1SLVA 4HGKC 2BHFA 1U1HA 1JZJA 2H7WA 4E41D 4RX4D 3V52H 2B1AL 4KZEH 2NW0A 2PDXA 4DKTA 5U4NA 3ULVE 1FFQA 1ME9A 3WNKA 5ENWB 1FG9C 3S35H 1X8CA 3H54A 4IBTA 2HVJA 1MCFA 2BWQA 3ZE1E 1B4KA 1UBPC 1Q9KA 3R1ZA 2H41A 1MLCA 2HTKD 3MRKB 4HX1B 4IS6B 4H5SA 4PBDA 3QHFH 4K4KA 5K39A 2I17A 2UY6B 3UPRA 3LNDA 1OD7A 4F66A 3N85H 1ML1A 2HXAA 2QFPA 2VC6A 5DK3A 2X4SA 2J1YA 4LTSA 4PW4A 5I3FA 3GHEL 3SB3A 1UACL 2XFXB 2H6PA 3IJSA 2Y9RT 5BRQA 4ACPA 7FABH 1VD6A 2DD8H 5D2NE 4GKSB 4WJKB 5ESQB 1HKIA 2FVMA 2Z7YA 3D2UD 3UPBA 3VFLA 4YDIH 2FJFB 3C9NB 1E55A 2JEPA 4X7EC 1FBIL 2CLFA 4FNLH 1CBGA 3OGRA 4GX9A 2CLVB 1WZAA 2CO6B 1EAQA 5GSRA 3KCLA 1J0YA 2NV1A 3UXKA 4M82A 1W3KA 4PJDB 3W83A 4B5NA 2FZ3A 5D1XE 2KERA 1ERNA 3VIOA 5FF6B 3EZJB 4G8GA 4MNQE 5G4MA 4B5SA 3TWYA 4Z1BA 4QGYA 4H0IA 4Z7QE 4L5ZA 1RK0A 4P2VA 2OEKA 5E2TH 1A7QL 3RTLA 3BJFA 4V15A 3I84A 4IMLA 3GRIA 1WTLA 2WXGA 4XRCB 1N5YH 4OJCA 4AG4L 1BVZA 5EWIH 4G6FD 2EUWA 5HHOD 3SGJA 4Z2JA 1DQMH 4FJ6A 5CGMA 4XAZA 1LP9F 1TKWB 1UM5H 3WBAA 1CD0A 3PG2A 2QMKA 5FOJA 3I4KA 5EOCH 5E0QA 1B0GB 5ABAA 4V2CB 4OAWA 1EQCA 3UJFA 3B9EA 4NQSA 3T0EA 2NYYC 3SY8A 3KPMA 3SPVA 1CLOH 1HAWA 3BFOA 2OMZB 3BN9D 1A4JA 1T2XA 1E3FA 2QHRH 4KDTC 3GMNA 4FQXC 4U4BA 3VXSE 3ARBA 5LG1A 2YPIA 5FUZL 3AXKA 3DSFL 1I82A 1TETL 1XWYA 2E7LC 2WZPA 2J56A 1ROWA 3KCPB 2KZ1B 1XYMA 4U1LA 4X6CA 3BLBA 3UG4A 4INFA 3O6MH 1DBBL 4U4MA 2R7EB 4G6AC 1YYCA 4JZJA 1I7UB 3IJ8A 4YR6B 5ECGA 3RAJH 4ADIA 5ISZB 3W5MA 2JIXD 4U0RC 1QLEB 5KYXA 2NXHA 4NZRL 2YAFA 3RWFA 1W6WA 4OI8A 3MRGB 1CI1A 2MEJB 2EF9A 4HU3A 4RW5A 3TCEA 4Z3JA 4Y4FD 5I2IB 3QCVH 3NIFB 1FI8C 1N5AB 4H8VA 1OSPL 1GOXA 1BLIA 2IXQB 1NCBH 5ESVA 1CFSA 1HQTA 5T9BG 4UCFA 1DUZB 4GAYB 1M03A 4DUVA 4J3UA 1T0NB 4HJUA 3THML 3BWSA 2WIMA 3MAWA 4UT9H 4GXMA 1BFOB 5E2VL 3WLBB 4RW3A 4HD9A 4P2OA 4QAIA 1ZLSL 4OUEA 2EO1A 5DEGB 1TO3A 4E9VA 1GOWA 4WKZA 1A7NL 3MV9D 4Q89A 2PTWA 4PY7A 5D7JD 2X6UA 2BLEA 5DHVH 1FWIC 4AW4A 2ATMA 2BSSA 1EANA 3FQNB 5D1XB 5E5RB 3RWJA 2VDOB 1F4HA 3NVQA 4M02A 4C4KT 3KLHD 3NAVA 2VXQL 3QFWA 1OEZW 3SKMA 3K30A 4J5VA 5G5IA 3E5PA 3MCG1 1P1MA 3QYCA 1O12A 3O9WA 4WOQA 1E28B 1FDLL 2XRAL 4ZMQA 1G0DA 5KG9B 4I9JA 1C90A 2G3JA 1KLFA 4PJEF 1UPPA 1JV5B 5F2LA 2DQFB 4OGXL 2BVYA 2GSIA 1AZBA 1P7KB 3MRIB 5FFLA 5C97A 5IIEB 1XSKA 4RISL 5LCVL 4PMVA 1ZBKA 4EDWH 4OF0A 2CLHA 4XMUA 1ZLPA 4MSSA 1SPQA 3EOBB 5K1VA 4KXZH 5IWLC 3BW2A 5HQLA 2DUZA 4RIRA 1REQA 4YE4H 5AB0A 3P11L 5I0ZA 2BRRL 2ZYRA 5L2JA 4OGYH 4ZFGH 4K7FA 5DI8B 4BWTA 5JOFA 1NTDA 3UGVA 1RZIB 5AZEL 3BZEB 3RFZC 2ZBTA 4NP7A 3DTXA 1T4WA 4XCFL 2X4RB 3WDJA 2P24B 1KCWA 2XIQA 4H9TA 3T0EC 2O1AA 3IDNA 3MZ2A 2GAZA 2H47C 1GVSA 3VJ6A 1JD7A 2VR8A 4X5WB 2ZWNA 4ZW3A 4P4KC 2XJKA 3BIBX 2O5ZH 5BO1H 4O0KA 1MJ7H 2PPAA 4F8OA 3FQRA 3V2AR 3QYNA 2ISWA 4OH2A 3UDWA 5F9AC 5I6XB 5D2WA 3W75A 1QACA 4J3VA 4RR4A 3GR7A 4FEZA 5IJCC 4JZNA 2O5XL 4LVFA 7REQB 3G9VA 3KVJA 3HS8A 4M7SA 4L1GA 1WKEA 3GJFH 5FAAA 4UOQA 5IESL 3V55A 2PP0A 4DZ8B 4WRLA 5A95A 1R5VA 1LK2B 1A1OB 2PR4H 4ERSL 3TS8A 4MVAA 4HSNA 2JK5A 2EHHA 1JPEA 4XVEA 2BY2A 5GGRB 4EOWH 3K6SA 4EBQH 4HOWA 4XD6A 4G42B 4LBEA 1E51A 5K9CA 1MZYA 5L2KE 5FYJE 5J13C 5KANG 2Y7EA 1DQJB 3GUFA 2I85A 3L0NA 3M9YA 2Y07H 4S3BA 1FHGA 3VFTA 1MRDL 1M7PA 1CECA 3G3DA 4QT5A 5MEND 2QDHA 5JUVA 4H01A 1A6AB 5DS1A 1GHSA 4JY8A 2WCGA 2P1YA 3TOPA 2Y5TA 4L37B 2HVNA 2PP1A 4X4MA 2HG0A 4E8GA 4I1RA 2HTLC 4WU5A 3SY0B 4BQ6A 3PHOB 4BSVA 1M68A 4HP5A 3OIHA 1EEPA 4YAQB 3DUGA 1KYDA 1KJMB 5JHLH 2H3DA 3ZLHA 4A35A 5BRZE 1WZLA 2WQVA 2XVLA 5EU6A 5C09A 4XOBA 1EJRC 1NPJA 5HBFA 1GQNA 3ITYA 2K45A 1MHHA 1JD9A 3UT0A 5F7AA 5DUBA 2ZRYA 1MJJA 3IRCA 3ARBD 2XXFA 1YEFH 4FQHB 4GKZB 5DFTA 2E9MA 1XHGA 3VIMA 3MLVL 3NESA 1ZT7A 1IYXA 2WYZA 2CGRH 5GNYA 5LNGA 5BOOA 2YC1B 3MP5A 3S3BB 3GXFA 3HURA 1F4YL 5K3VA 4US5A 4YHZL 3OQEA 1EDYA 2OFQA 2IKHA 2GT9B 1AO7E 4AQ1A 1X96A 2ILLA 2CESA 4F5CE 3OO2A 2LFEA 4EJ1C 1GKPA 4Z6AT 2WHVA 3FUHA 2UYLB 2X7WA 2FTPA 3BG3A 3OAYH 3VVWA 2Y2WA 2X6AA 4F57H 1V03A 4W84A 3AIEA 3QUYB 3LD5A 1RFDL 3FVMA 2BP5M 4GRWH 4NO2B 1FIGL 1MCWM 1FA2A 5D9OA 5FM5O 4DN4H 1FXPA 5AYYA 5KTEL 4XX1G 5IJKC 3X1NA 4DYJA 4FQQB 4HYWA 4MQ7B 1MH5B 3UD6A 4UNVA 4KWUA 2QPEB 1H4PA 3ARUA 5E6IC 2JK2A 5HAOA 2Z1VA 1D3CA 1EA0A 4QDPA 3K4DA 1IKNA 1AD0A 3FCBA 3ALWA 3HMXA 1UKSA 2WWKO 3OWRA 3P40A 1E6RA 2VLJE 5AVVB 2BY0A 1IGML 3ULVL 1VHCA 4YTSA 4R7XA 5C0RH 5FKYA 2IDCA 3QUML 5AW8B 3QV8A 4L9YA 4DZIA 3VQLA 2XA8H 2VEIA 1EXGA 4FXLA 4OZGF 3GU2A 2VW4A 1W5MA 2TSYA 2MQ0A 1GY1A 2PLCA 3ONBA 1IGYB 2E8ZA 2FT6A 2YAQA 4FERA 2FFIA 2KLRA 3WFEH 3CCHB 5IGXH 1FG2B 1VA9A 4D8LA 3OYZA 3DPBB 2PETA 3KTSA 3L13A 3L9RB 1PEWA 1T66D 5CJXC 1VGAA 4FA3A 4YVPA 4NYYA 5CILH 3AQYA 4G8GE 4MB3A 4WFFE 1MFVA 4AEHL 1FTXA 5D7LD 3VI3A 4XC3H 4X6EB 3GZOA 4U3HA 4YDVB 1CF1A 1HCZA 4UQ3B 5T1DH 2DYRB 3FF8A 4FHKA 2IH9A 4LLYB 5GRZA 3RFZA 2VOMA 2WXLA 2H1XA 4GVIA 3SPGA 4AT6B 1XR9B 2WUBL 4O00A 3WEXA 3WUWA 1ZT4A 2QPSA 4ZPVA 1VCVA 3E0IA 3VIFA 1TVBB 4G5DA 1QW9A 3OZ9H 4MD0A 5E4AA 5BMFH 2RJGA 1NQBA 4TUKL 4EKXA 2R1NA 2HBVA 3RU8X 5F1KC 4CUCA 1XIFA 2DVTA 4WUUA 3WELA 3N2BA 1TVDA 3LTPA 3GZAA 2DKMA 3D34A 3CBKB 4MAYB 3WJMA 3RXZA 3KPTA 2AQPA 3I3DA 3IJLA 1QBMH 3ABQA 2G5RA 3QO1B 3WE6A 4YEEA 1EZWA 2W5FA 5C0FB 3UIYA 4WFGD 4DGVH 1NDWA 3WIIH 5JPNB 4WRHA 3QQNA 3ZW3A 4XB7A 3ABKB 2B14A 4ZTYA 4Y2DA 4I3RL 4GINA 1XGYL 3ZL2A 1PG7L 3QSKB 3QUMB 1A53A 2E28A 3TK7A 4UTUA 4QX4A 1TR7A 3P9LB 4QYAA 4GAFB 5DQDL 4BI6A 1KPVA 4ICCX 3H3BC 2WJ7A 3WE1A 3ROOA 4R53A 2MHAA 4N2CA 2OX4A 2GIXA 4QYOA 1I9JL 5FWRA 5EOCJ 3VQ1C 1GW0A 2BSLA 2YLAA 5ICZA 3RFRA 1UT1A 1VP5A 2X4NB 1FKWA 3VE7A 1ODUA 3OG6B 3IRZA 3HIZA 4GRWB 4YSAA 2XIJA 5D30A 3M0YA 5K9OB 1ZGDA 1U3JA 2PP7A 4OCRL 2YKKA 1QASA 2YEQA 4M3JA 3T77A 5JQ6H 4OOUA 3JU2A 4PODA 4PUDA 3C5XA 4WCJA 1OKEA 3EOTL 3PL6A 3DBSA 4HISA 5D8WA 1WITA 1NEUA 2YN5A 3WIFA 5HGHA 4MPKA 3AWEA 3LQZA 1IKOP 5C9JA 1A6ZB 3IFLL 1ZMYA 3P0YL 5AW7B 3DXIA 5B39G 4HJSA 3NOIA 4QKXB 2QKSA 3BWZA 2D7OA 3AIVA 3BV7A 2AEWA 1QRQA 2C18A 3QQ3A 3IRSA 4XMPH 4ZUUA 4PS8A 3ZMEA 5K1NA 1AS8A 2VWTA 3KAAA 3VNDA 2DTSA 1NP2A 3FJ6A 2SODB 3AUOA 2DQCH 3PV7A 4KXBA 4CL7A 2WAHA 2FJGB 3O4LB 4DPPA 3LY6A 1FGVH 3BPWA 1WAPA 4XSLA 3RURA 1FBIH 2IO5A 3APGA 3MNMA 3I7QA 3VXNA 1RD5A 3RX2A 3S5YA 1A7BA 3KP0A 2GQAA 2J24A 1VZIA 3FDWA 3PWNA 2OT1A 1RXOB 5KETA 3L4CA 1JCXA 2PC8A 5DJ0A 2NW3A 5KSUB 1UR3M 2J7DA 2AITA 1TQUA 1HJCA 5XINA 1KPUB 5MERB 4DUXA 5E24E 4Y2DD 3UJIH 2V0AA 4NNAA 4E6MA 5BOFA 1PW3A 1H6FA 2JKPA 1TB3A 1JF6A 4LEOA 3WKQA 3TYUA 1EQPA 2W95A 3KJ4C 3WBEA 3CZNA 2OXHA 4F9JA 3F2LA 4PRPB 5KYNA 1WISA 3PWVB 3SODB 1LLOA 2FSEA 2VFEA 3VC6A 5KJ7E 1OFRA 3CXHK 2WMFA 4D8AA 4HK7A 4DZHA 5I00A 2ATPA 5I1AA 3RA7H 1VFSA 5IB4B 3DX7B 3QULA 3LH2L 5A6IA 1DQKA 3KS6A 3TTOA 1CGUA 1NDZA 3KG5A 1HL8A 4R3SA 1MFDL 3MU3A 4O19A 2VGBA 1WA2X 1YY8B 4IF2A 4H9UA 5ALBL 5DMYA 4DXVA 4OJYA 1GYLA 2A1YA 2WCSA 4XD4A 3V4UH 3DVNB 1QLFA 3VFSA 2EE3A 4AK2A 2R9HC 3L4WA 3GHBL 3V5FA 5G4EA 4PPTA 4M03A 4DETA 3CZSA 4P5MA 1M7OA 3FO9B 3CDZB 3O1NA 4UTAH 3RLHA 1E43A 3ULUD 3FN9A 1A0QH 2YBGA 5F2FA 4DP0X 4FADA 3VD5A 4G72B 3TURA 1RBAA 2QUMA 4N8VB 5EF2A 3N6QA 3PWLA 2GUOB 3L6FB 3ETTA 4LLVA 1W54A 2MNJB 1KF9B 3HZVB 2PNDA 3MREA 5FYLH 3I75A 2L7UA 1KZYA 2O5NA 2X0WA 1JVKA 1KDJA 5E03A 3VGHA 1IEAB 4OLXL 5FIEA 3E0VA 3HKZA 4YPGB 5GRVK 2CRYA 5EC1B 4JEQA 1R7AA 4Z2HA 4AF0A 3V4PL 4Z5RA 1A2YA 4TUJB 5M3WA 5IKCA 1Z9MA 3CVDA 2F54E 3SQOL 2Y8KA 4Y19B 1EJ6A 2EEBA 3IMWA 4NB7A 4NNXB 2CA4A 2KZBA 4B9KC 1VFAB 2GJ6A 3KBFA 4D72A 2D3NA 2C7UA 2PN5A 1INQA 4G6JH 5EO0B 3MYJA 2REQA 4XKMA 3DJZA 2CC0A 2IH1A 4QRAA 4PJBA 1OSEA 3CS2A 1RALA 3O8XB 2J75A 3H7UA 4KKAC 4I3SL 5T3XD 3PZGA 1QI5A 4QY8B 4IGNA 2F5BL 2O4MA 3QUGA 4XMVA 1HG3A 3AWNA 2AABH 1HYSC 4Z77A 3VAVA 4O50A 1BXUA 5BV7L 3PV6A 4XC1H 3SQSA 1LZOA 2F6XA 5FL1A 2G3MA 1H7NA 5EMKA 5FCUH 2OYPA 4CKVX 5HYJD 3R8HA 2NX9A 2PA6A 1WXYA 3K2IA 1ND0A 3FT3B 2PYED 5HJ3B 5I19L 1CCZA 1I2QA 1UW9A 5DR5H 4HFUL 2OV0A 3DDMA 3OSVA 2OOFA 5HGDB 3NJJA 5IFHH 3P5ZA 1HN1A 3VFNA 3GW0A 5E9NA 4IRZA 4TVUA 3U25A 1KFBA 1CFVL 1JZGA 1GWJA 1QNZH 1EUTA 5FPIA 4TV6A 3OMNB 4WGKA 3W2DL 1LEGB 1LUCA 3US1A 5E94B 4LOEA 1K4CB 1CXIA 3FUDA 1T2QH 5L8LB 4A21A 3ZR6A 3K2UH 2AZAA 2FIRT 4ODUA 3SDXA 5DJCA 4I0PC 5HNNA 2OPCA 3IJYA 4TVPD 1W5NA 4OU1A 4GIRA 5KWYC 3LY0A 3BO8B 3ZKSD 2OGJA 1XP3A 1UURA 1P7BA 4JFVA 4NJIA 3DK0A 3NIGB 1G6RH 2WNKA 1LWJA 3B5GA 3UROR 3V4VB 4ZQNA 3EGSA 3MHUA 2NWRA 2GJ6E 3B9VA 2WLNA 5B8CC 4QS5A 2F7RA 3M88A 2I60H 4ZFOB 4E41B 4O8RA 4PRHB 2CD0A 3PFMA 4PE8A 1XDJA 2VW6A 2WD0A 3MJ9L 3H9SB 2IPTL 1GGUA 4Y4KC 3L12A 1NOAA 3NG5A 4A6YH 4IRJB 4AYBA 5IREA 4MJID 3CL7A 1IGMH 3ULVH 3N4AA 3WJZA 4MYAA 3KL0A 5DVLA 1F1GA 2B1HL 2KMWA 4Y8EA 4XVJL 2BP1A 1SJHA 1N19A 3LRKA 4HVBA 4WJ8A 3M0LA 3QIBC 4KFNA 1VGKB 1XBDA 4CSSA 4GOAA 3BFQG 5MEPB 4CVZB 2ZPKL 4RDQG 2NTFA 4YDKH 5ICYA 1GG0A 1NIAA 4W4QA 2YDAA 3OTRA 4G9DB 1ODAA 3EBGA 1QO3A 4B3VA 5HA7A 3UTSA 4BFEA 2V9TA 4JLRA 4F7EA 2A6JB 4JEGB 2B4CL 1ZBVA 1DZ0A 4K55A 4P2AA 3NO1A 3OF6D 2C4XA 5IR1A 4HZAA 4WKXA 4YIQA 4AENA 4G5ZH 1OK6A 3W1XA 2W65A 3NACH 3D51A 4WI6A 1K5NA 3BHBB 4HS6B 1T5XA 4HSAC 4OZHE 1KV3A 4AE0A 3APNA 4CMMB 1M7JA 1TIWA 2A7RA 5JMUA 3W3OA 1IKFL 2WC7A 2EVHA 3O2DH 5AVXB 1WQVT 1FKXA 2VLJA 3RUGA 3SGDI 1Z5LB 3HBQA 5TE7H 5D1QD 2OJPA 4QRSB 2Z6JA 1VCFA 2R2BB 3VWKC 5IFAH 4MLIA 1V7MH 1Q6DA 2F2KA 3MRDB 4PJBF 3HO8A 4C4BA 4JFFE 3BZFA 3NT0A 4S11A 3O6KH 4AVNA 1K70A 2TSAA 2WXRA 4NQXB 1E6OH 1XIWC 4E9YA 1KLYA 4DRSA 4KQ3H 5LDUA 2CR3A 2EE2A 2E7HA 4HPOH 1OF6A 1YUKB 2M1KA 1V51A 5HPCA 1VBRA 1B2WL 3UNDA 5DU7A 3S6CA 4MZ8A 1QBML 4JFEE 2Z64C 4DHLA 2A3HA 1PZ3A 3F2DA 4P23C 4L1HA 4LAMA 4HS3B 1DIEA 4L8SB 4Q9BA 1SY6A 2VAJA 3Q8FA 3VI3E 4DGVL 3QFJB 3HHMA 4UNLA 5CPOA 1C1EH 2OXGB 5EZIL 1I3GH 4GYPC 2VDMH 1HXMA 4GUHA 1BZ9B 1MCRA 2IUZA 3O63A 1QFEA 4QHUB 3ANUA 1ZSDB 3G08A 4G9FE 1KC7A 5EU7E 5ITFB 4ODHH 2Z4QA 5IHWA 3IJDA 5HDWA 4F9DA 3Q5OA 4MWFB 3QDGB 4GOSA 1Q6CA 4UT9L 5F7YC 1GZQA 1CCWB 4JG5A 2PYFA 1O7DC 4S1FA 2XYLA 5AHMA 1CLZH 3ZR4A 5I3HA 2VDQB 4MNQA 4NM4H 3LKQB 4M7KL 2YD5A 1DHKA 3GXUB 4RMBA 4HH8A 4XNQA 4FLRA 4GCAA 1G0YR 4QTGA 4OJDH 2FGWL 2DQXA 4NPYB 4LUSA 4YYFA 1BVKB 2YXFA 3Q3GA 3IJ6A 2AQTA 3MRJB 4HXAL 2AQNA 5JIHA 1BWKA 4LRNL 3CQKA 4XAFA 4EF8A 4RAVA 3HPZA 1I8JA 2YEZB 5CC3A 4PJEE 3W23A 3IE9A 1K7XA 5ABEA 4XTRC 1QI0A 4M8UA 1MJUH 4J2QA 1FFPB 4P4KA 3VXRE 3IKKA 4D6EA 2GKIA 3OG4B 5ADPL 1DCLA 1LO5A 2EDOA 2ISSA 1MG2C 1OCWH 4P2QE 1KMGA 4G8EB 1H5BA 2RH9A 3JZUA 4N2YA 2LV4A 4L8DA 1KKRA 3ZKXC 4U6VH 1DIDA 3WNPA 1XSJA 5F9JB 3B7UX 4YE4L 2BX7A 1PPIA 1V7NL 1CE6B 3SY6A 1EF2A 3C2YA 3RPKA 1WA1X 2DWDA 4XP6H 1T7YA 1GQKA 1YRRA 3QQ4A 1Z9NA 5DK0B 2YD7A 3WMPA 5HVHC 2P49B 2ZXCA 4FXKB 4XP9L 4Y16D 1GJIA 2Y7DA 4LV4A 3HBLA 3K4AA 1RJQA 3HR5B 4FIQA 3MS8A 1YDPA 5IBLC 4S3EA 1KR0A 3AW5A 5EU4A 3NFNA 4YXLH 1XHHA 3CTLA 2ZAGA 1G7IB 1YYML 3ZJAA 1BOYA 1EEYB 4WHCA 3RL1B 4GBXC 2H9AA 3CZFA 1WGVA 1IE7C 2XCMC 2PDNA 1Z2KA 1V8HA 4E9LA 1ZTXL 1C5DA 2H9GA 1IAIH 1R17A 1XGQB 4RFEB 1TJ2A 3MDJA 3RUGF 3GVGA 4WUKH 1PBYA 2ED6A 4OLVL 4P7OA 1XCTA 3V18A 3GIVA 4TULL 1NLDH 2OB3A 3UWVA 3FTSA 2FDBP 1I1AC 4L80A 1TZGH 1RQBA 1IQ8A 2PB1A 2C9PA 1MLBA 3RWEB 3WN5A 4B5VA 2IWEA 4LHJB 1ADQL 4GBXB 3IVKA 4P46A 4N90E 3QO0A 1CGVA 2QHLA 2XPYA 4TNVK 4H19A 4JO8A 4ODWB 4X4YB 1I1AA 1WV2A 3V6ZA 5DGRA 4C4KO 2K6YA 2UXVA 2WMIA 1JGDB 4AWEA 3IETA 3EJCA 2CM6A 4C8XA 3GB7A 4GVHA 3ES8A 3CUZA 2BNRE 1T1XB 4I7ZC 1TXKA 4PJHB 5E7BA 3RWHB 4MJ6A 3VW3H 4X0VA 1WDAA 4ZQOA 4L8BB 5KSAC 1WCQA 4J3SA 4M1BA 1PAMA 3NVTA 3ABOA 5DTFB 3QJXA 4HUXA 5LKYA 3L17A 1MZZA 1U93B 2K4WA 2P5WE 1ID5I 1MRFL 1XCXA 2EICA 2X53A 3RU6A 3BV4A 1GGBL 4NT6A 3RDTA 4FZ8H 2IQTA 4FOKA 1U8MB 3Q6GL 1RHCA 5MKGB 2WLYA 4HK3J 3BCFA 3O45B 1DQLL 3TH3T 4NAQA 5FYKH 4HSQA 4W9FC 5T1LD 3B97A 5HQEA 5BOEA 2WIIA 2DB8A 5I6XC 3FN0H 4BQ4A 5DMGD 2B77A 1GHFL 4NJ9L 1SY6H 1GZGA 1NDYA 1KEMH 1JUFB 1QBLH 2IXVA 3T3MB 1OCRB 3E1F1 1RV8A 5KZCD 1NINA 2WZ5A 1JAEA 4XNYL 4KC3B 5GGSA 3PJUA 4S3DA 3HRZA 4LSRL 3VWJD 2DFAA 1TU2B 3MACL 4P61A 3DOPA 5JQIB 1KXQA 1OX4B 3ID7A 3SDCA 4LAOA 2FUQA 1TVPA 4PCNA 2HUEA 1XYZA 3E6HB 4BZ1A 3WHXB 2WMJA 1NQKA 3MOQA 5ABHA 3HMWH 3T65B 3S2CA 1RU9L 3QDJD 3RCYA 5DVMA 1OSZB 2OJ1A 4WI0A 3GXIA 3S5ZA 1J6OA 2YA1A 2NYYD 3M7SA 3JZ7A 1BEYL 3O15A 3GMLA 5J06A 3LG3A 1OVDA 3U4FA 2QXWA 4LKXB 2DQEH 3JSSA 2V5JA 4WWOA 1W2KT 2AQSA 4H7VA 4N68A 2VX6A 3LPOA 1J8HE 4NEHB 5C0BD 3PNZA 3TYEA 1MI5B 3D69A 5E1AB 1WG3A 1TMQA 5DVKA 2A6KB 3APDA 5HPMA 1KM0A 3AAZA 4HKJA 2B08A 1VFBB 2Q01A 2VM4A 3SCWA 1BF8A 1HW6A 3FUIA 2P5WA 3NCJH 2FHBA 3M5XA 5HUPA 4APQD 4FYSA 1YN7B 5CSUA 1JHKH 2EDTA 3SCMD 3UADA 2V2TB 2BW5A 1Q2RA 5FUOL 1HDMA 4NFCA 4OI9A 3UTZA 2XDFA 4KHXL 1FL5A 1FL6B 3CSGA 5TQ2L 4RXGA 2CFFA 4EPDC 2BHYA 1RZ8A 4AZ8A 4IOFD 3MO1B 5CEZL 1A14L 3IV8A 3LGEA 4JRXD 5SV3A 2X12A 3C08H 4HF5L 4OIBA 4OIIL 2ZQ0A 3RI5F 1AXTL 1QWHA 2OMTB 1GYWA 1SOQA 3HTLX 1IGFH 4R5XA 2IPJA 4ACZB 1ZRUA 4R26H 3KWWB 4B92A 3EYUH 3GPSA 5AOIA 3BVXA 3VRIB 2CBUA 2J6VA 3C52A 1UQSA 5FW8A 4YHLL 5CPNA 2QVMA 4NKIH 2YBTA 2EADA 1YYLH 1NCWL 5HDQH 2OEJA 4MZYA 1PSKH 2W0PA 5CCHE 4ETQA 3BO9A 4KRTA 5DSCB 1XCQB 5C92A 3BW3A 5ABGA 2ZSVA 4PLJD 5CEYA 4LPYA 4QRFA 1OP3K 2Z27A 3WKNA 4Q0XL 5E08L 1IAMA 2GJXA 2PD5A 3VUSA 2XPGB 3OSKA 4FL4C 2YMXH 4NKDA 4OQTL 4HQQL 5KYWA 2O9PA 3B3IB 4DKEH 1PKNA 2VEGA 1I9IL 1JTOA 2VXUH 3V9CA 4RRPM 4QRBA 4GO6B 3S8WA 5D96C 1O94A 1S4IA 2Y8VA 1N4XL 3GYEA 3LN5A 3WN5C 4K2SA 4W4NA 4P57A 5H94A 2CNCA 3W0KA 1OK8A 3NACL 5C0AB 4HHHA 1S7QA 4JW3A 1XZ0A 2QQNH 2DQ6A 4N6QA 1CB4A 5C0IB 1G6VK 3ZHNA 2NXYD 2P0IA 1VYPX 2PDJA 1AYOA 4PD4J 4TV5A 5CD3A 4JKPH 1ZHLB 1ZQ5A 3NM1A 2WWMD 4PCSA 4PZVA 3F04A 2EE9A 4LP8A 4XPTH 2A77L 3TCSA 4HSHA 3W39B 1G7UA 1AW5A 1U58A 3HR6A 5KBMA 3IIVA 3PBVA 4JQIA 1A7PL 4UM8A 4YLCA 4U3SB 5ID0B 4LLMA 1BXAA 2AJSL 3DGRA 3HLAB 1E8ZA 1R3LA 1VEPA 3VU1A 1C9SA 1V8EA 1E6OL 2BOBB 1U8PB 1G1KA 3EOSA 4O1CA 3RN6A 4XPGH 1G7QB 4RAUA 5CZRA 4P04A 5HDLA 3PDDA 1FAKT 1D5BA 4UQCA 3GXNA 4ELMA 2DQMA 4I5BA 4XE0A 5DZJA 3S35X 2C1HA 3GLAA 4BKLB 4HUUA 4UZUA 2X16A 4O1AA 3L21A 3IKCB 3NGFA 5DUJA 2IOIA 5J13B 5FV2A 2YL6A 1E9PB 3FRPA 3IARA 2O6EA 4KY1L 4F7CA 3R4DA 3MUGA 4AJWA 2AJUH 4JRFA 4ZD3H 1Q9LA 3F4CA 4GRSA 4KVNL 1SJMA 2E56A 3UZZA 1BJ1J 3L8QA 3WEMA 2GCYA 4Q8OA 4H20L 1YTEA 3K2UL 4HIJB 4PCTA 2RBLA 3KPSD 2CLRA 3VWJB 4M6VA 3G5YB 2ZP9A 2IAMD 4B3LA 3CGTA 3GNXA 3KXFE 4XZUA 2VZ3A 4G1MB 3AQZA 1S3TC 4D6FA 4NO0A 4WJXA 1ZV2A 5ABDE 3IMUA 2E86A 2P5PA 5DJ6B 5D93B 1YPZE 5I1EH 1J93A 4L9ZA 3R0KA 2XY2A 1CD9B 5CBBA 4PR4A 2VRAA 2AEPH 3MA8A 2AL2A 3HHSB 1NWUA 5H2BA 4DQWA 3QEGL 2EINB 3D39E 3MJ9H 5K9QG 1BVLA 4KNSA 2DEYX 4H25A 5LA2A 4PJGE 1MFBL 4PMJA 2VDLH 5C7XL 1PD1A 3EWWA 3VOGA 4IBUA 5CMAA 4NU7A 3GPEA 4QM1A 1ZKAA 4UFIA 5L0QC 3C87A 4PJ9D 1C5BH 4BWLA 2AI0L 2J8UF 2AK4D 4NXKA 3MWAA 5AOJA 2OMUA 3URAA 1OX6A 3OKLB 4FF9A 1RUPL 3LKOB 3T6ZA 1RZKL 1JWMB 2TRYA 3H9ZA 4YFDB 3BH8B 3QPEA 5DRXB 4HQVA 1E9OB 4LAQH 3RWDA 4RGNE 1T03H 1UWIA 3TTEA 3ISYA 1P53A 4HGMA 4PWIA 5FUCC 3KRBA 3LHTA 4E38A 2Q7YB 1ECYA 1BYCA 2VRKA 1OGGA 2BFVL 4PCPA 3VQ2C 1X5LA 3ZGHA 2YWYA 1Q9KB 4ZSOE 2AK4B 2D0FA 4HX1A 3W88A 3BAEH 3VE0A 5IHLB 1SF3A 4Y7EA 5FS5A 4CKQA 1FPTL 5T3ZH 1DYZA 4TMPA 4EI5B 1ZT1B 4ZT1A 1VRXA 1FOBA 1H7PA 2W0KA 4NNPH 12E8L 1TX0A 4S0TD 2B7OA 2Q5BA 3QUXC 4GW1A 1EPVA 4K23L 1CVSC 4APXB 1TE1A 4TOQA 3MMEB 2OMNA 2X4PB 3EFOB 3V0HA 4OSUL 3PP7A 4O9HH 1NU5A 4HNVA 5EF0A 2QIWA 3AROA 5GRVL 1XL6A 3SADA 2R24A 4EVNA 1EP3A 5IVXF 5A6JA 1J0JA 5FGRA 1K6WA 1QNQA 3F4DA 4PBFA 1G7LB 3QH3B 1MF2H 2HFFB 5DVPA 4G8GB 5AHIA 3FKRA 3P54A 4ADJA 3BXWA 3KVMA 2Q6ZA 3LN4B 3D07A 3PWPE 4YNYA 1CDUA 2ZCZA 4UDTB 3WGVB 1FWRA 4TNGA 1X7QA 2X0HA 3UBXB 3NWRA 4W8AA 3T4CA 2N1TE 1O60A 5LGJB 3N6JA 2XNAB 4XTRD 5EDSA 3AM8C 1R3KB 1B3ZA 1LBFA 1XG3A 1HH9A 3LSBA 3SCUA 2FL5A 3VCLB 1MHCB 1L0YA 2C7FA 2YLLA 3TN3A 4DI9A 1Z6KA 4FOUA 3RPIB 4PV8A 4K3JH 4LNYA 2EKSB 4G6JL 5AYUH 3VGGA 1UM5L 4KPHL 2A9BA 3BH9B 3WTXA 3WSQH 4GSRA 4IFKA 4YJ5A 3VA6A 3TWCH 5DMMA 3ROLB 2W59A 4C6QA 1EGJL 5F7EH 2V82A 4IFOA 5HD8D 5K69A 3FA3A 3QC5X 3FONA 4KS0A 2BERA 4QXUH 3ORWA 1JVOA 1UMYA 5C0CB 5ACLA 4J12A 3V7PA 1RI8A 1FLRL 3U7VA 2FAUA 1TZ7A 3FMGH 5DK2B 3D46A 2Y7FA 1OCJA 1YMMA 5FEZA 4NSKA 1IEBA 2OAAA 1XJBA 3V5OA 2GYSA 5CSZB 3DX6A 4JN2A 3L7EA 2BP8A 4JHBA 3RWFB 1I2RA 2GGGA 3MRGA 2V30A 1FO0B 4Q8MA 2ZIDA 4ZL1A 2CBIA 3MROA 5GRYA 5IHUL 2VHLA 3B0PA 5FOBA 1AQKH 1FDZA 3PB0A 1QOKA 1T83A 1CN4A 4L1DA 4HKZA 1J1PH 1BAFL 2X38A 3OC5A 4S1SH 4XN8A 3D0VA 4HEMA 4U1SA 4CNIA 3EJQA 4GUFA 1XXFC 2GBTA 1CB2A 3MA9L 1C8PA 4IPIA 2WPGA 5EBWA 1ETA1 1OFEA 4HIIB 4LESA 1M41A 1PCXA 2OK0H 5ALCH 1FAIL 2WTPA 4LL1A 4R84A 3FRUB 1KM2A 2PGRA 3W00A 4PMQA 3AJ7A 3KPOB 5GJNA 1Q94B 4U1MB 4U1JA 1CFBA 4J2MA 2AQ3A 1KGYE 2IPKA 4KMTL 3UNTA 3S96A 4FFYA 4WKAA 1T7VA 4NUWA 2GTWA 4NO0D 4Q8QA 5DFWH 5REQA 2GSMB 4W7VA 4KVCL 3TO4C 4N6RA 1E28A 1E4KC 3T09A 2DZWA 3N44B 2ZSWB 3QZWB 1PZBA 3IBEA 2FZMA 1S78D 4F7PB 4K7PL 1UROA 3FQXB 1UIPA 1MW3A 1DV7A 1VYSX 4XBPA 2QF7A 2WXFA 2BZCA 1P7KA 3MRIA 5IROD 4JGNA 1GYMA 1RBOB 2V5RA 4QWWC 4U3XA 1A3LH 2C6QA 3IU4H 5CUSL 3CH9A 4Z2LA 1ZS8A 4ZFQA 1R1CA 1AQ0A 1MAKA 2ERJB 3F5WA 3VD0A 2X09A 5LKNA 4OCXL 1TTBA 5AB2A 1UMLA 3LJ3A 3AXHA 1BBJA 2CNYA 3C2OA 5G2NA 3GI9L 4MMZB 1DZBA 2G9HB 5I76A 3ZT6A 2X40A 5IVXA 3N1AA 5HULA 3NH7H 1TLMA 4K3EL 1ZWIA 4K7FB 4WCYL 5DI8A 8CGTA 1LOQA 1R3RA 2QQKH 5F3HB 3SKJL 1JI2A 1D7DA 1AC0A 3PPGA 2FTYA 4HU0A 4LEQA 1MRCL 4JYEA 4B60A 4RNFA 3DU0A 2OS7A 5A43C 2ATSA 3CH1A 4MJ5A 1E6ZA 3KPQA 1IAKB 3EJUA 4CJ1A 3C3NA 4TR9A 3GNMH 3Q45A 3OHIA 2HT3C 4MLJA 1BGGA 1RZQA 4RK8A 4UWQB 1LP9B 2EIZA 3W02A 2H3KA 4RETB 5EMJA 1UBSA 4Z1PA 5DD6A 3HI1B 5BZZA 1TJ0A 1ZJHA 5MP6L 1N7KA 3HJZA 1VQTA 3P8IA 4HBKA 1YUHA 3W1RA 5KSWA 3NA8A 2HRLA 2VERN 1A1OA 3P9MA 5AB9A 4I8DA 3FTGB 4ZTPH 2WNQA 2ADGB 5HJGA 4DQOL 2B59B 5I8CA 2GTZA 1XR8B 3JRKA 1U8QA 1RULL 2MRYA 1N0LA 2DKSA 4ANUA 1W1TA 2FD6L 4LUJA 4JZJC 1Z9LA 1VEOA 3P0GB 3TYGL 3AJXA 4HT1H 5LAPA 3V8OA 3H7BB 4QOKE 1MRDH 4UTBL 3NQVA 4DJDD 3REVB 1VKXA 3M0ZA 3W9DA 1WS7A 3VRLE 4IKIA 1E72M 1R86A 1A4KA 1CI3M 4G3YH 2AJSH 3TYFB 5AFDA 1QUNB 3T0AA 5DHYA