1VAHA

Crystal structure of the pig pancreatic-amylase complexed with r-nitrophenyl-a-d-maltoside
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the pig pancreatic alpha-amylase complexed with rho-nitrophenyl-alpha-D-maltoside-flexibility in the active site
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 163
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1vahA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1vahA01
1UWRA 3BLKA 3RIKA 3VMNA 1DWIM 3DHUA 1H0IA 2IXUA 5GPRA 2CBIA 5FL0A 3ZQ9A 3RO8A 4H8HA 3I3EA 4C7FA 2W66A 2WHLA 3T08A 1MW3A 5FIPA 3GXDA 1VFFA 2PWGA 3WQ4A 1QW9A 3WQ6A 3MO4A 6TAAA 2J7GA 4UQ9A 3UCQA 4CVWA 2VTFA 2YDRA 3ZT5A 1W3LA 3EJTA 1QI5A 4UQAA 1ECEA 1LWHA 3WQ5A 1DHKA 3GNPA 4W87A 4W5UA 3H54A 1NQ6A 1PAMA 1ISWA 1E4IA 4LQ1A 1TVPA 3PHAA 1G94A 4CD6A 3ECQA 1QI0A 3SCRA 1RD6A 2Y8KA 1B1YA 3O6AA 1SYTA 2A3CA 2WBKA 3POHA 1E6NA 3W24A 1NWRA 3FHAA 2ZX9A 1GHRA 3EMCA 1VAHA 5A6BA 3PTQA 1JZ7A 4B9YA 2VUYA 1A3HA 5JUVA 1W2VA 5A2BA 2ZXDA 3KLKA 4AC1X 2PF0A 1C7TA 1JF6A 1OINA 2F18A 3PZVA 2PWDA 5M3WA 1UWTA 2EACA 4PMVA 3WMCA 1US2A 2ZUUA 4NRRA 1JNEA 1EO7A 1N82A 2W63A 3L4XA 1HWWA 2YL6A 1GJWA 1TQUA 3S5ZA 4J3XA 2J47A 3A3HA 1WO2A 2GK1A 1U30A 3LXCA 1YHTA 3VD9A 1PIFA 2EQDA 3L4WA 3AIWA 3GH7A 5CJ5A 1XCXA 4Y7EA 1KGUA 2BV9A 5CSUA 1KTBA 5JBFA 1OIFA 1PBGA 1VEMA 3RJXA 1ISYA 3BXWA 1C91A 3VMPA 5E6ZA 3WH7A 3TOPA 1E4MM 4NXSA 5ABHA 2CERA 2F7PA 1WDQA 3T0AA 4PBGA 1JYXA 2J79A 4D6FA 2D0GA 1FH7A 3EJPA 3AQUA 3DX3A 1LF1A 8A3HA 1W9BM 4HA3A 3NCOA 4PTXA 2VZSA 2XIBA 1WPCA 1H09A 1V3KA 1J10A 2J4GA 2XYLA 4DUVA 4HZ8A 2WMGA 5A2AA 1DWGM 4PYSA 5KZ6A 2WZHA 5M03A 2F7OA 1RH9A 1BVZA 4CU8A 2CNCA 3WEOA 3AHZA 1EDQA 3BC9A 4LXFA 1E6RA 4JFTA 3WD0A 3CUGA 4U2YA 2XWEA 5A8MA 3WBAA 1BSIA 2VR5A 4LX4A 4AD1A 4AZ6A 2J8GA 4NZJA 3MUIA 4BZYA 2F61A 3L4VA 3WQVA 3A21A 4DWSB 2WC7A 2XGBA 5E0CA 1VENA 2MANA 4FK9A 4NX0A 3S6TA 1UYQA 2X8RA 1DWHM 1TUXA 1XH2A 1UD5A 1K9FA 1V02A 2JE8A 3WDJA 3D4ZA 5GQBA 1TZ7A 4PUDA 3LRLA 4F9JA 2XN2A 1GW1A 1ZU8A 4TOQA 4MJ4A 3CZSA 5DT5A 1W1TA 2YBTA 1TA3B 1R7AA 1SZNA 4MADA 1QNRA 2ZE0A 3SUTA 2CETA 3GXTA 5IFTA 4DUXA 3OLIA 3AHVA 3NDZA 1HP4A 1DTUA 4NZCA 1OM0A 1WKYA 3F5LA 2VI0A 4J7RA 4U3AA 4TTUA 4P7OA 1DWFM 2GUYA 4W5ZA 1A47A 1B3WA 5BXTA 4HMDA 3LX9A 1Q6FA 4PMNA 4W8AA 1R34A 4WJXA 2DSVA 2FH6A 4AEEA 3U57A 5A8PA 3AZRA 1GVIA 1EA9C 1HJWA 3AIQA 1UUQA 4PMUA 3THDA 3AXXA 2J78A 1H4PA 4WSKA 1EXPA 1OIMA 1WDRA 5AC4A 2PC8A 2YA1A 5CLWA 2E40A 2J62A 2WPGA 1JNDA 1KBBA 3UG3A 1ZBKA 1UQZA 3PZUA 1AQHA 2BVYA 2V5CA 2XWDA 2E3ZA 4L4OA 1W9UA 3FN9A 2W5FA 4NI3A 2GSJA 4OOUA 1J0JA 3TTQA 4FF5A 5HDRA 4A4AA 2DT0A 1FP9A 5D9PA 1BPLB 2ZUMA 1JGIA 4TTGA 1BYDA 4NF7A 2VNCA 2O9OA 1PEZA 3BVWA 3CZ8A 2YDQA 3K8KA 4AD0A 5BXSA 5JBDA 4HA1A 2NSXA 5ABGA 3WL1A 1GNXA 4HZ7A 2J7HA 4X0NA 2XG9A 4MNKA 4GI9A 1MQQA 3AS1A 1QW8A 2YL8A 3LPPA 3PZMA 1W2PA 1NOFA 2J77A 2CXGA 4EE9A 1OSEA 3KWXA 3DYOA 3LRKA 1EQPA 2YLLA 2NW0A 4RE3A 4HU8A 4ZXLA 1UWSA 3BMVA 1PX8A 1QBBA 3GBEA 3VDAA 2VZOA 3CGTA 3D51A 1EQCA 1NWSA 3NDYA 1CENA 1GOKA 4JFUA 3KEHA 1ITCA 4PSPA 3VX0A 3QOMA 4X9YA 4IISA 1LL7A 2BHZA 3W4RA 1H1NA 3ZSTA 5A95A 1JZ8A 1E6SM 2ZUSA 2ESCA 5A94A 3EYPA 3BUPA 3AYSA 2W67A 1M53A 2CBJA 1UKQA 1E72M 1XH0A 4GZIA 5I77A 4V28A 4KMQA 1Q6EA 1PZ2A 1Z32X 5AY7A 2X2HA 3ZSSA 4W89A 1BHGA 1JIBA 2B31A 1EDGA 1MVYA 4AISA 3BSHA 1D7FA 1GCYA 5EMYA 3ARRA 4YPJA 1H41A 4KWUA 5F7UA 1KBKA 1EGZA 3HG3A 3AXHA 4QLJA 5IFPA 2XHYA 4HOZA 1E40A 3DYMA 4TX6A 4CN1A 3SEPA 4KRUA 4PMZA 4GO9A 3TONA 1SR0A 3ARXA 3LXBA 2J74A 2EPMX 3MU7A 4J3VA 1FHDA 3LPGA 3VU2A 1E0WA 6A3HA 1HTYA 4W8BA 1BG4A 1AQMA 1PX3A 1G0CA 1KR0A 1J12A 4Z2HA 3KLLA 5CXPA 1EDTA 1UR9A 3FAXA 1QWNA 2VQUA 1HKIA 3WF0A 3BVUA 2A3EA 2G41A 1NOWA 2WHKA 4CCEA 3BAIA 1BVNP 4BS0A 4XUYA 4UZSA 3NIYA 1K9DA 2FGLA 2O9RA 3AHYA 2E9BA 5A6LA 1VRXA 3S2CA 2OYKA 3AIEA 3WF3A 4MDPA 1V6WA 1XGZA 3ARYA 3WEMA 1V0KA 1TMQA 1CLXA 1BQCA 1UKTA 1OT2A 1W9PA 4XZWA 2D73A 3GXPA 1Y7VA 1NARA 5D8WA 4J3TA 5DF0A 2G3MA 2WXDM 3AMLA 2ALWA 1KWKA 3MV11 4XV0A 3VGFA 3BCDA 2Y24A 3AMCA 1HNYA 5JIPA 4P8VA 3SCUA 1B3XA 1UWIA 1J9YA 3WBEA 3A4WA 2OSWA 5EFDA 3W26A 1NH6A 5A6KA 2BY0A 5ABFB 2FH8A 3VSVA 3VDHA 1LWJA 4K68A 3EDFA 3GYCA 1J0HA 1BF2A 1HL9A 1ZS2A 1B3VA 2CPUA 4AIEA 2X2IA 3CHCA 3WD4A 3AHXA 2DSUA 1TFVA 3WF4A 4MJ2A 4URIA 3EDJA 4D6IA 3G6MA 3IANA 2WZIA 2X09A 4N0RA 1I75A 2EPNA 1UQYA 5BCAA 3N9KA 1J0KA 4XZBA 1LJYA 2IGTA 3PTMA 3CMGA 1QX1A 1ZJBA 2NT0A 1I1WA 3OLGA 3VGHA 4ACZB 3LPFA 4JCMA 1KR1A 1UKPA 2GFTA 1E6XM 1GOIA 2VRKA 4QFUA 2JIWA 4W7VA 2GJXB 4HMCA 3LXAA 1KCKA 1PPIA 2CKRA 5E1QA 3VILA 4AZGA 4R5EA 4JHOA 1JYWA 3RCNA 4H41A 2G8ZA 4PMOA 2FHFA 2PBOA 5EB8A 3U7VA 1CPUA 3MKKA 7A3HA 1QI2A 1OCQA 3ARUA 1C3FA 4YN5A 2VRQA 3GXIA 4M82A 2DQXA 2VMFA 1AMYA 4MDOA 1B31A 1JFXA 3H55A 2XSBA 4AD4A 2VX5A 4AMCA 3HG5A 4AW7A 4AY1A 1CNVA 3CUHA 3VSUA 4GI6A 5HOSA 1JZ2A 3ZJ7A 3RM8A 3A23A 1LG2A 4D6CA 3RM4A 4FNSA 2JFEX 2WSPA 1R7OA 1H49A 3AIBA 4QCFA 3AS3A 1VF8A 1WZKA 3T2QA 4FNUA 2OSYA 3BAWA 4ZENA 2GDUA 1JYVA 5E0FA 2YJQA 1TR1A 3OGRA 1W1VA 4J3WA 4F8XA 4CVUA 1EOMA 1ODUA 1CXKA 4MB3A 4JZ5A 3WEZA 1JDDA 4H2CA 2GVYA 1GQIA 2O9TA 1E3XA 5D4YA 4M80A 1OT1A 5DFAA 2CHOA 1WDPA 1UKOA 2BXYA 2VZVA 1M03A 1HKKA 4JFWA 1E43A 3WIJA 4UFHA 1O6IA 4M8UA 4L4PA 4JKMA 2YIHA 2XN1A 3UR8A 2D3LA 4BQ4A 4LPCA 4LYPA 5I0DA 3WQWA 1EOKA 1RP9A 1VBRA 4Z2GA 4UCFA 3SCTA 1R8LA 3N15A 4ACZA 3WUGA 3ARTA 4QCEA 4PTWA 3CZKA 3WD2A 4MAVA 1GZJA 4Q7NA 1J0YA 1CDGA 3W27A 3CLWA 4UFMA 1UWUA 3VD3A 5LA1A 4E2OA 3VINA 1HT6A 2PWEA 4V2XA 1JXKA 4D71A 1IZKA 2ZXBA 3QHOA 4HMEA 1GONA 2PWFA 1JD9A 3WNMA 2W91A 3DX2A 1HVXA 1EHNA 3CHEA 1B30A 1JZ3A 2E8YA 3ARPA 1E1FA 1CXFA 4GZEA 2CEQA 5A8NA 4UFJA 1T0OA 3ZJ8A 4QP0A 1BG9A 1GOOA 1MFUA 1TVNA 1GOMA 1WDSA 2GJPA 5IXEA 3W29A 3LMYA 3FXYA 1H0GA 1SMDA 2DT2A 2WVUA 1KQZA 3VIFA 3WNLA 5M17A 2A3HA 3OZOA 1DWAM 3VGEA 5I23A 2QLYA 4AZCA 2JIEA 3GM8A 5A6AA 3DHPA 1UH2A 4W84A 4J27A 3CC1A 3MSGA 2VR4A 5D9NA 2XVGA 1TQTA 2XFFA 1V3HA 1G5AA 4QLKA 2A3BA 4PN2A 2ZOXA 3N18A 3W53A 4MNLA 1ISZA 1CGVA 4CCDA 1HX0A 2AAAA 2Z1SA 2VX4A 3CZLA 3QHMA 1Q6CA 3GDBA 4HPHA 2XFRA 5A6BD 3EJSA 2VVSA 4CU6A 2Q8XA 1JZ6A 3A6OA 1UD6A 1TA3A 2F1BA 3MS8A 3AMDA 3WDQA 1OD0A 5BXPA 2X2YA 4QAWA 1J18A 4U3CA 2HVMA 2BVTA 4FNTA 2DSKA 4GI8A 3B9DA 3OA5A 4MB4A 1H3GA 3RPMA 1E0XA 2J25A 1MQPA 4PMDA 5ABEA 4J3UA 3DX0A 3VM7A 1GHSA 4BQ3A 1OGGA 3I3DA 3ALFA 5BRPA 3VIJA 2X1IA 4P8WA 3RM9A 1VB9A 4MAZA 3BAXA 2OWCA 1JFHA 3OGVA 5BYWA 3FNDA 1K9EA 5CQ1A 2D22A 2OYLA 3PN8A 3WMSA 1UWQA 2BFGA 3RJYA 4JKKA 1S46A 1MW1A 1KB3A 3WY3A 2WCGA 1B2YA 3BUIA 4TXEA 5A3HA 2UY5A 4ACYA 3AMKA 2ZXQA 3VGDA 3WFZA 5GNXA 4TUFA 4BCEA 3VIKA 4V27A 1QHOA 4PCTA 1QNPA 2F1AA 2J7DA 1H2JA 3VD7A 2J7BA 3J7HA 2GK1B 4D6EA 5A6SA 1JZ4A 3HG4A 4Z2IA 5I78A 2XVKA 4W7UA 2DDXA 1C8QA 4NXKA 4CD5A 1NP2A 2YKKA 3BAJA 5CSYA 1W9DM 3SCVA 3VIMA 3MMUA 4PTVA 2CESA 1QI3A 3NSMA 1HP5A 5E9AA 3KE0A 3RMEA 4D6GA 2WANA 3K4AA 1TQSA 4NZFA 4OKDA 1KFWA 4HU0A 1JF5A 3T2OA 4B9ZA 4AWEA 3VMOA 1GVYA 2V3DA 1WCGA 3B8SA 1G9HA 4MB1A 1UD4A 1Q6DA 2CBVA 1V6XA 2X0HA 4RL3A 3AFBA 4AZCB 3WDHA 4B3LA 2DGAA 3CUJA 3N13A 3WDPP 4W88A 4P7NA 3OLDA 5JIWA 3EBVA 3VIIA 2X05A 1OWQA 3QHNA 4TVDA 1UKSA 2WVSA 4B3KA 4PMQA 1BLIA 4M56A 3JUGA 3W6MA 1TE1A 3BCFA 3WUBA 4GPNA 2ZUTA 5HNNA 4U2ZA 2DSZA 4E8DA 1VIWA 4N42A 3OZPA 4AD5A 4AD3A 3AIVA 1V0LA 2CKSA 3DX1A 5I79A 2VURA 3NYDA 4C7GA 3MUAA 3VDCA 2F8QA 1MXGA 2OLHA 4E4PA 3M6DA 1US3A 4MB5A 2X2JA 1TQVA 4Q22A 3WDRA 1HIZA 4UOJA 4AIUA 4WKHA 4UFLA 5E70A 2EPOA 2FHCA 2EEXA 4M81A 1XSIA 3TV8A 1G01A 4CN6A 1BAGA 3QR3A 5FD0A 1JAKA 5BWFA 3VSTA 3MUY1 3CZJA 2WC4A 1KQYA 3EMZA 3HMCA 1MFVA 4FLQA 2OWXA 5IDIA 1PX4A 1R46A 2J75A 1OBAA 4CKQA 2E4TA 4GQQA 1ITXA 1MYRA 5CZKA 2EO7A 5CPSA 1BYCA 5I24A 3IGUA 2VL4A 2WW5A 3CV5A 3U5YA 1KGWA 1W9XA 3EDEA 2VRJA 3ZO9A 4UFIA 2WCAA 2V3FA 1B3ZA 3PZTA 1GQLA 1KXVA 3BLPX 3UR7A 3FAWA 1WNOA 3AMGA 3WMBA 4U5IA 4DUWA 1AVAA 3HZ3A 1PIGA 1GOQA 3W28A 1VFOA 4PRWA 1V3JA 5LA0A 1SFSA 3CHFA 3FHQA 3SCNA 5D9OA 4JCLA 2FE0A 3A22A 3K46A 4P7QA 1GJUA 2OW6A 3VDBA 1HJVA 2DT1A 1GOWA 1J11A 4DO4A 3AZTA 3T09A 3ZT6A 1VEOA 3IJ9A 3WH5A 4TVUA 4F9DA 4W8LA 5BXRA 3TP4A 4MNJA 3AI0A 4W86A 2XVNA 2OW7A 3THCA 2XVPA 2CHNA 1XCWA 1W3KA 3SCWA 2OYMA 4RE4A 4DWSA 4H04A 1V0NA 4DWSC 1QNOA 2VVNA 2XVLA 3UERA 3SUWA 5A69A 2ZXAA 3WH9A 3A5VA 3LRMA 2BY2A 4IM4A 4PMYA 4LYRA 5FL1A 1KXQA 4BA0A 1V6VA 3VKKA 3F5JA 2WCSA 2EBNA 3FW6A 4UQEA 3GXNA 4CD4A 1HJSA 3MMWA 1CZ1A 1F4AA 3BUQA 3BUBA 1CBGA 2DPEA 4DWSD 2QPSA 1J01A 3TTSA 3VNZA 4HOXA 1E5JA 5I3DA 2WWCA 3WNKA 3ZM8A 4JIEA 4HTYA 3GTNA 3WFLA 1FHLA 4AMXA 5I6SA 4OBRA 2XGIA 3PZGA 1EH9A 3O2LA 3CBWA 3NSNA 1KXTA 4F79A 3SUVA 3WH8A 3K8LA 3GZAA 2Y8VA 3APGA 3EJRA 4AYSA 2JEQA 2EAEA 2XFYA 1NOUA 1HVQA 4ZE5A 5EFFA 2DSWA 1MQRA 3WUEA 2EXOA 4AEFA 3EDKA 4KRTA 2Y2WA 2VZTA 3DX4A 1BFNA 3DC0A 4FMVA 3VNYA 3SCPA 4ATDA 3EJQA 4F66A 1CEOA 3N04A 2G3NA 8CGTA 1HKMA 1JG9A 2D20A 4OBSA 2WBGA 1QNSA 4AYGA 1V3LA 3WQ8A 2WAGA 4HPGA 3U7BA 3LPOA 4D6HA 3AICA 3AZSA 2D24A 2D3NA 4PCSA 1CXLA 5LA2A 3VO0A 4UTFA 1UA3A 2Y4SA 3L2MA 5AYBA 4H7VA 2XM2A 2WHJA 1UD2A 2WSKA 3ZJ6A 1JXJA 1XYZA 1UR1A 5GNZA 3VGBA 1E55A 1JI1A 2YOCA 3PZIA 1HN1A 4HZ6A 1B9ZA 4IPNB 2XM1A 4ZE4A 1J0ZA 4P8XA 1L8NA 2VJXA 1V08A 3WD1A 1R75A 4CUCA 1MW2A 2ZX7A 3UG4A 5DT7A 1UZ1A 2D2OA 2TAAA 1QHZA 3A24A 2WM0A 3AS0A 1DP0A 1CGWA 1FP8A 3GXFA 3UG5A 4WF7A 2ZIDA 7TAAA 4UQCA 1XSJA 2WK2A 5C70A 5IHRA 1C92A 3CZGA 1G1YA 2FYVA 2WVVA 4UOZA 3WENA 1QNQA 1UR0A 1TQWA 3UEQA 1JYNA 1CLVA 4H8UA 1B90A 1V3MA 3K8MA 1WP6A 1LQ0A 1VJSA 2UY2A 4UNIA 3EJUA 4CU7A 3DDFA 1CGUA 3UESA 5A6JA 1XH1A 2QMKA 1ZB5A 4OIFA 3AIRA 1V6UA 2VT0A 3NJ3A 4JAWA 1V03A 1GQJA 2W62A 1YQ2A 4FNRA 1SMAA 2ZX5A 4U31A 4X0VA 1X6LA 1CGTA 3KL0A 3A4XA 4B16A 1XRVA 1H11A 3A4AA 2PBGA 2WMIA 5HBFA 3UETA 1DEDA 2BVDA 1E56A 3OG2A 2WMJA 1KGXA 2CITA 1XYFA 1ISXA 2EPKX 1R47A 2D1ZA 4WLCA 5I5RA 4OUEA 1UD8A 3S5YA 5CGMA 1UA7A 1X1NA 3VM5A 1FFQA 2UY4A 3ARSA 5C71A 3OLEA 1W32A 1E9LA 1ODZA 1QI4A 1C7SA 1W91A 4CN4A 1GQKA 1LL4A 1M01A 5E09A 4Z2LA 3VUPA 5FCZA 1BYAA 1JL8A 1O7AA 5HPOA 5A2CA 1CXEA 3VD4A 1XD1A 1M7XA 1WZMA 3RILA 3WF2A 3VGGA 2QHAA 4XB3A 5IHSA 4LYQA 2ZWYA 1QWUA 2PWHA 1HF6A 2WB5A 2D0HA 2W4XA 2W92A 3D5HA 4CGTA 3POCA 4A3HA 4KGJA 3ZR5A 3SCSA 2D0FA 1R86A 2WMKA 4D1IA 4HOWA 4AXNA 1AQ0A 1ZBWA 1UASA 4GZJA 1HJUA 1LL6A 3AS2A 1C8XA 3VPLA 1VEPA 3KZSA 1E3ZA 1UG6A 3M7SA 3SCQA 1HJXA 3WD3A 2EADA 1JDCA 3T2PA 4P8UA 1V0MA 1E0VA 2XTKA 5HPCA 4GO8A 3PZOA 3GNOA 3NUKA 1KTCA 3QOKA 1OB0A 4FLSA 2VCAA 2F2HA 2WVTA 3TTYA 1L0PA 4A3YA 2C7FA 2DIEA 3N11A 3O9NA 3VD5A 5M5DA 1WZLA 3H53A 4PMRA 2E9LA 2DH3A 2EPLX 3MUZ1 2IUZA 2XN0A 1GUVA 1UH3A 1XC6A 1FA2A 4FNPA 1K6AA 1I1XA 3EMQA 4EK7A 3WNOA 3ZJKA 3CO4A 3T0BA 2RGLA 1E6QM 4BQ5A 2QF8A 1C8YA 1XHGA 1R87A 1BTCA 3IAPA 4NSBA 3CPUA 4UFKA 2VCBA 5TD4A 4AZHA 3HJEA 4AD2A 4TX8A 1IZJA 2G3IA 2BY3A 1CWYA 1CIUA 3EDDA 1QVBA 3MV01 2UWFA 4WIWA 3F4VA 3IAQA 4CD8A 4CD7A 4PSRA 3PZNA 2JALA 2V38A 4D6JA 4AIOA 4CCCA 3CUIA 3W82A 1CGXA 3IK2A 2VZUA 3HG2A 5CPQA 2XIIA 1HL8A 3PBGA 3N12A 1VFMA 3CUFA 1D3CA 3SURA 1NWTA 4S3KA 1E4NA 3CIVA 4YHEA 1FH9A 2OSXA 5DO8A 3L4ZA 2JF6A 3BVXA 4P7LA 4HP5A 3KL5A 1RPKA 4JFSA 4W85A 5A1AA 2OWWA 2V5DA 1E1EA 2YL9A 4QDMA 1W3HA 2DIJA 2CBUA 1IT0A 3SUSA 3BVTA 1Q4NX 1HKJA 3BAKA 3AOFA 1U2YA 4PTMA 3I3BA 3ARWA 1EIBA 2UY3A 2FGZA 4JL1A 1CYGA 3II1A 1HJQA 4XX6A 1HXKA 2WLYA 2YL5A 2VQTA 1OD8A 4OJYA 1R33A 5HXMA 3W25A 1JD7A 3AHTA 2BHYA 2Z1KA 4PUEA 2DH2A 3CH9A 5I2UA 3D50A 4WSJA 1C90A 3BGAA 2ZWZA 3BAYA 4JFVA 3GNRA 1W1PA 4JL2A 1E4LA 3ZT7A 2ZUNA 2RGMA 5D8ZA 2YA2A 4E8CA 2NT1A 4ZXOA 4QLLA 2F7QA 1MXDA 2WWDA 4UZUA 1X6NA 4YHGA 1J0IA 1UR2A 1WB0A 3WY2A 2ZICA 4J28A 1R85A 3BVVA 3OIHA 1ZL1A 3N1AA 4M24A 1ZJAA 1C93A 3M07A 1NWUA 3BSGA 1KXHA 2EABA 4AZIA 1U33A 4D1JA 1JI2A 4EAMA 3BMWA 3ZR6A 1PZ3A 4OOZA 1PS3A 4UQBA 1UOKA 2X0YA 2E9MA 1B3YA 2BXZA 2J8FA 5CPTA 1KCLA 5AYIA 3IJ8A 3G6LA 3VVGA 2FHBA 2J7EA 2PI6A 5A8QA 3VIHA 1K9TA 2ZUVA 3DDGA 5KEZA 4GXPA 7CGTA 4PEEA 2WVVB 3ARZA 3BLBA 1D2KA 2G4FA 3W37A 4FLRA 1QHPA 4C7DA 5LYRA 2JF7A 2V3GA 3WH6A 1E6ZA 3WY4A 2VCCA 4H8VA 1TCMA 3AISA 2WLZA 3RDKA 3AYRA 2O9PA 5A8OA 3AROA 1NP0A 3GH4A 3W0KA 2DT3A 1E15A 3E1F1 1QPKA 1OGBA 2WNWA 2YFNA 2C0HA 2CCRA 3WNNA 2CIPA 4D6DA 1JAEA 1VJZA 4EKJA 3B9AA 2D23A 2JEPA 2YLAA 2YBUA 2W61A 3KL3A 2IXVA 4LGXA 3MANA 1UH4A 2ZX8A 1HXJA 3WSUA 3A47A 3DYPA 2GJRA 3GXMA 4PMXA 1TG7A 5CLTA 1FH8A 2C8NA 4UOQA 1IV8A 2BNJA 4D72A 3SIMA 2XPKA 1VBUA 5C8BB 4ZFMA 4MNMA 4BF7A 1UD3A 2G3JA 1E70M 4DM1A 2WKLA 3WL0A 3PTKA 5D9MA 1W3JA 3WY1A 3OBAA 3SCOA 3FY1A 1JDAA 3L4UA 5CGTA 4FNQA 2VX7A 3CTTA 1ZBVA 1V6YA 4P7RA 2E8ZA 2F7RA 1M04A 3AIUA 4Z2JA 3ZMRA 3QGVA 3CHDA 2CYGA 4BQ2A 2ZUWA 4FLOA 3HN3A 4M1RA 1DWJM 2WKGA 1CGYA 1BGAA 4GINA 4UQDA 2E0PA 1PJ9A 2BS9A 1WAWA 3GBDA 3CZNA 2EJ1A 4B15A 5GNYA 2GDVA 3VTRA 6CGTA 1NM9A 2BY1A 1Q6GA 4WKFA 1B0IA 2VO5A 3TA9A 1WE5A 3AJ7A 2VX6A 3F5KA 1RP8A 4ML4A 5EBAA 4AZBA 1EO5A 2ZX6A 4WKAA 2QV4A 3WKZA 3HU7A 3D52A 1ISVA 1XD0A 1UR8A 3ZIZA 5BRQA 5DEZA 4Z2KA 3WDIA 1E73M 1W1YA 3OB8A 2QPUA 4AMWA 4J3SA 2HISA 2QMJA 3OGSA 1XSKA 3W38A 1E6PA 4OZOA 3TTOA 3NSXA 4UR9A 4U33A 4AZ7A 4NRSA 1UZ4A 3PZQA 4DO5A 3K1DA 4IPLA 2WYSA 1MW0A 4OGZA 1KWGA 4MPKA 3WNPA 3SUUA 4GKLA 1GORA 5JBEA 1V02E 2XUCA 1UHVA 2J7FA 1EHAA 4JKLA 2O92A 2WMHA 1QOXA 2J7CA 1QBAA 3WF1A 2WMFA 3D3AA 2YFOA 4JHZA 4ATWA 4DM2A 5BROA 3ARQA 4TVCA 5ABFA 1BYBA 4GQRA 2VC9A 3ALGA 4ZEPA 3WELA 1W9VA 2WC3A 2XJ7A 4U5KA 1CTNA 4M29A 5FOOA 3VIGA 3CMJA 3W81A 2XSAA 3MI6A 3GH5A 2V3EA 3IJ7A 4MTVA 5FKYA 2YA0A 1O7DC 1E5NA 1F4HA 3AXIA 2WMIB 4ATLA 4S3JA 1CECA 2AOSA 3MSDA 5DMYA 1ZBCA 3PZ9A 5E6YA 4IUGA 2Y5EA 2VOTA 1JZ5A 2WZEA 4W93A 3DECA 1MWOA 3VOCA 4KH2A 9CGTA 1BGGA 1E71M 2GJXA 2DEPA 1ESWA 4AZ5A 5AC5A 5A6MA 1LLOA 2A3AA 3WUFA 5CG0A 3BUDA 4GIAA 1OGSA 3L2LA 3K4DA 2YDSA 3L4YA 3MMDA 4R27A 2WHMA 1CXIA 1FOBA 1XV8A 3N17A 3WN6A 3L4TA 3D4YA 1LG1A 3W6LA 1FFRA 1P6WA 3T0DA 4KGLA 1V3IA 3VX1A 3M46A 3ZOAA 3U5UA 2PB1A 1H5VA 5ECUA 3VIOA 4W7WA 2AMGA 1VFUA 1GPFA 3BH4A 4WK9A 4RE2A 3CZEA 3ARVA 3VIPA 1CXHA 1WZAA 2FDMA 2BHUA 1UR4A 3B9EA 4HA4A 4EANA 4DO6A
chains in the Genus database with same CATH superfamily
1U21A 3HOGA 1A25A 2WTOA 1KTRL 2IALB 1O6TA 5KVDE 3BLKA 2QUVA 5JNYB 3F7YA 3VMNA 4OH2A 1DWIM 5JU6A 5EIIB 4KTDH 5ECGA 1LMIA 1UB3A 5F9AC 1NA8A 4WU7B 4X7SH 5GPRA 4GUPA 1MNUH 2BERA 2PDYA 3H4GA 3I3EA 1ZV9A 2VSDA 3UPCA 2WHLA 4Y16B 5C0RL 4J3OD 2X3BA 3KR3L 4W9ZA 3RL1B 3T08A 2MQ0A 3MU3A 1VFFA 1XYAA 2E1WA 4Y9EA 4Y5VC 2CSPA 4HCFA 5LVEA 1B2WH 2CLZB 5C9JB 4Y9PA 4L9LC 3DJZA 1OFQA 3MZGB 3MO4A 1U58A 3CDGB 2Y7QA 5DUPH 4Z1DA 2YPVL 2XNAB 4NKDB 4UQ9A 5D93B 1RY8A 2J21A 4CVWA 1QBML 1WH0A 2AK1L 3HRPA 1QI5A 4LLMA 4JFEE 1R3KB 1RZKC 1N64L 3DUUA 3NDZE 3OKEB 1LWHA 4UT6H 2CUHA 4UWQB 4ROPA 3WQ5A 4QRBA 2P45B 4JM2D 5B1JC 4OZIB 3GNPA 4K39A 4W87A 3T0EB 4TM9A 4K7YA 1G94A 2OOFA 2HN7A 1QI0A 1NFGA 3SCRA 3UJEA 4D8PB 5AKTA 5CCZA 5AYUL 4JDEA 2A7NA 1NDMB 3ZPDA 4PREB 4WO4B 3V1PA 2LVCA 4YTUA 4KC3B 4LVBA 2H6UA 5TQ0L 1QXLA 4PS4L 3BP7A 3RLSA 5DXXA 1SYTA 1WITA 2NDGA 2H45A 2PCYA 2QJJA 2IWGA 1NF0A 5F7KC 2E68A 2WWMD 3FHAA 1EX1A 1T4KA 1BEYH 1AQDA 1XGQA 2Y9RT 4U6HB 1GHRA 1J5OH 3RGVB 1SW3A 2HROA 4TUJA 2OZ8A 1VAHA 3LB6D 3VXUD 4Z5RB 2QSCH 2O26U 2SEBB 3FB7A 3SM0A 3MNZB 2IQTA 2Y1YA 5HVFB 3O3RA 3CVBA 1DSFL 1DVTA 1PG7H 1DZ0A 3C5ZA 1KPRA 3EW3B 1AQFA 2Y5JA 1WCBB 3BKCH 1A7NH 3BPWA 3GLDA 1W2VA 4QG9A 5BOFA 2DQJL 5INCA 2UBPC 1BZ7B 1C7TA 1JF6A 2O6FA 2CGRH 4BSVA 2GBUA 1E4XH 2OJEA 2CZFA 4PMVA 3I65A 1PYWB 3LERA 1VD6A 4FQIL 4MD0A 1KIRA 1VPQA 4NRRA 5F1IA 2HFTA 1J5OL 1GT8A 3HLAB 3L4XA 5EF0A 4DH2A 3HPSA 2XZAL 1JZEA 3FUDA 4Y5YC 5IEHA 3ZDYF 4K7PY 2G9KA 1FTXA 3C8HA 3RWJB 2FWOA 1CGSH 3ABOA 2KLSA 5D7KE 3A3HA 1T6MA 2GK1A 2Y7DA 4PJCE 3LTYA 1H3UA 3LXCA 4I9WE 3ANVA 3CEUA 4KPLA 2X9YA 4G6FB 2DM7A 1C1EL 2BP5M 2VDMH 4O2CB 4V2BA 4XMPL 2H9GB 2A9DA 4XN8A 4E5XA 2BG5A 3LYEA 4A7UA 4GUFA 3L4WA 4F48A 5ANME 5FYLH 1LE9A 2QPFA 3O0LA 3O3DB 5D1QA 5K39B 3TZVC 1O68A 3NFUA 4O8RA 3CVHB 1LM8V 1R30A 2BV9A 1D6VH 4BELD 5HHXL 3KPLA 5CSUA 3N43F 4PP1C 4NY2A 2DM4A 1XIFA 5IUSA 1WUZA 3OJGA 3EB2A 1PBGA 3AWFA 5ISZB 1TPXC 3ARBA 3JQOB 3CZFB 2VDNB 3I9GH 4MD0B 5SX5K 3K13A 4YJZL 2PCXA 3N4FA 2DQTL 3BXWA 3ZDYB 1XWVA 4ZMXA 1SJDA 4O15A 1PUDA 2BJML 3ATEA 3DOIA 5CJ8A 1J2WA 2WMPB 1A22B 4KU1A 4N0UE 1U8QB 2G2NA 3TOPA 1JXFA 4GQBA 2DYPB 1T3FB 3G9AB 2BSDA 3N0AA 5KSAD 2LU7A 4NXSA 5ABHA 4NM4H 2CERA 1G9EA 4FXGB 3TYUA 3ROOA 3ULVE 3T0AA 4M5PA 3AADB 2LGNA 2ISWA 4XO6A 3QDGE 5I17A 1FYTD 3IMUA 1R2RA 3W5NA 2KBGA 1FH7A 2XKNB 3EJPA 3AB0B 5AFDA 1NC2D 1UATA 1AACA 4RAUB 4WCYL 4ACPA 2AXFB 2ZSVB 1W8EA 3PFUA 1QFWH 2OMZA 4TNVK 3MRRB 3REVA 4DXKA 4JDBA 1AP2A 3QCTL 5MEQA 1ZPTA 3U6WA 4JXCA 1WPCA 4P9HL 1V3KA 3RWFB 3G6AB 1H09A 3CNKA 1LZOA 1QO2A 2XYLA 1XTLA 4Q9RH 1SLXA 2EEBA 5IBLD 4NQSB 4GEIA 1GZGA 1JUKA 4ZFOL 4PYSA 1NTDA 2OKTA 5EV7A 2PUZA 5FA5A 2HRGA 2B77A 4WHYG 4MA3A 2GFBA 2WZHA 3QLDA 1ZLDA 2F7OA 3NJVA 1BVZA 1LO5B 1SVDA 2QSCL 4AH7A 4LVDA 4Z95H 4YEEA 4JIHA 4JYEA 1P4BH 4QPEA 3O3EA 2CNCA 3L7FB 5HDLA 1UJ3C 3EYVB 1T6WA 1FE8H 1J1OL 2ARJQ 5DJ0A 4JFPA 1I0BA 4U2YA 5HYJA 2XWEA 4HQQL 3PWIA 4NCDA 2H0JA 3U3HA 4PJGF 4JRYA 2SODB 1BSIA 1R5VB 1BQSA 2VR5A 1E0TA 3CSBA 4AL8H 4LX4A 4AD1A 4KO7A 3ETBJ 2BZ7A 4Y9OA 4HKXA 3VGAB 3NL5A 1H3PL 3P7YA 4JTJA 4QSHA 5DLCA 4KVNL 2NY2B 4REQA 2FZ8A 1TITA 4ETQA 3O05A 4MZ1A 3WQVA 3FT2A 3A21A 4FFWC 4HIJB 1FV1B 4ODBD 4A6YA 4Y2OA 3ABSA 3CV6A 4DIAA 2C79A 2DD8L 1Q8AA 4ABUA 4PB4A 3VXSD 1UYQA 4QRUA 1TOXA 2YPVH 1TPXB 1LO5A 1B4TA 4PCFA 3HCVB 3MLWL 4JPWL 2W07A 1TUXA 4JRLA 1CDJA 4LOVA 1K9FA 1V02A 4S2BA 4JN8A 2XWJB 4Y5XA 5GQBA 5AWNL 4C1NA 3I7RA 25C8L 2ZCHL 5D7HA 4YVNA 1UBPC 2GOUA 4F9JA 5ESQB 3CJPA 1KPVA 2P53A 3PNZA 3S47A 4NM8L 4AL8C 4C6CA 2ZYIA 3L45A 3VFMB 1EJOH 3QXDA 5MEPA 1ICQA 2VFIA 3NQBA 3O2DL 3PM6A 4G7QB 3V0UA 3QO1A 2GYSA 4UQIM 5MHBA 1E7UA 5FHBL 3N42B 1QNRA 1ICPA 3D85D 2HK0A 3QQXA 2A9NL 4Z7WE 4A67A 5L8LB 4KDVA 3INUH 1L6WA 5K9XA 4NC1C 2VSCA 3D6GA 3FCSA 2VLKB 4LEXH 4HIIA 4NM4L 1OAXL 3GHUA 1MHCA 4FERA 3RIFF 4BH7B 4DUXA 4Q0XH 4CA4A 3OLIA 2FNWA 1TVHB 4HPXA 2VXQL 3X2QB 3N40F 5FYLE 5G4MA 1OM0A 3J2PA 1WKYA 3NJNA 4HJJL 3FQWA 1VGKA 5CCKH 1DHPA 4U3AA 4F2BA 1BRLB 2PGFA 1M41A 4O2CA 4AW4A 3DENA 2Z28A 4HWZA 2GQ9A 3GFUA 1OF2A 4JN7A 3FPYA 3TF4A 1Q85A 4KEUA 3FQNB 4YPGA 3RP1A 3DMMA 1T41A 4EPKA 3WHXB 4WI9A 2Y69B 4GY1A 3KBVA 4FQ2H 4M7SA 2GT9B 4XZNX 3NAVA 1VBJA 3GYEA 3N2OA 1I7UB 3AZRA 5DY2A 4XVUD 4IQJA 1XGTB 2Z2UA 3II3A 3P3UA 3QY6A 1VZWA 2PGRA 4JY4A 3W9ZA 3QZLA 3QZAA 4MD4A 5JQIB 2EXYC 3EO9L 4QTHA 2AVFA 2PF6A 4R3SB 3CFCH 3V4UH 4E41B 1UZDA 3HZVB 5GGRA 3QARA 2E6YA 2EDRA 4YE4L 3CE1A 5BRZB 1KIQA 3HKFA 5J57B 4ES4A 4ODVH 4PRHD 5HATA 1TRIA 1Z7AA 4KEVA 3ZYJA 2FDBP 1EXPA 1CU4L 3DX6A 3I6SA 1F61A 2JJWA 3PHQB 43C9A 1MN4A 1OIMA 1WDRA 2PC8A 2YGOA 5CLWA 2E40A 1XGDA 3PJTA 5AW8B 4FXSA 3TT3L 3KPSA 3TO4B 4ODWB 5IVZB 2NY3C 1SY6A 2OMUB 3VWKB 3EKGA 4HUWB 4DKTA 3ITXA 4QKTA 3GSOB 4NUGH 4YWGL 1XDLA 2FTYA 5HVGB 3CXDH 5ENWB 1J0JA 4JVPA 2J66A 4HZLB 3PG8A 1F8IA 3ZLHA 3CFBB 1RJLA 3WN5A 2Y63A 5EPMB 2GEQA 3WL9A 3SKNB 4TPRL 4XP4L 3GB6A 4JQIL 1G67A 4WY0A 3S2LA 3S6OA 4RMSA 4HHMA 3BT2L 1BVLA 3L5MA 1UWEL 3PQYE 3U1PA 1CT8B 1M7DB 4KK8D 1TIUA 2X6UA 3LCFA 2MWCA 2W9DL 4AK1A 3B9OA 4M6ML 1B4JH 1GKRA 2VEMA 2N56A 1PKQB 3GJFH 2O9OA 3BARA 4BZ1H 2EDMA 5B1JA 3CZ8A 2BFVL 3I75B 5EUOB 2YDQA 1IM3B 4B9PA 1HGYA 2F58H 1BBDH 4AD0A 2ZCKH 5FF7A 4O2FA 3FRPG 4C55A 5E2WL 1GY2A 1OZUA 4WGKA 5B1KA 4NJ9H 5CILL 3VXUB 4HA1A 3GSMA 4LCSA 3H4XA 4DETA 4LO9A 1ZLSL 2UVEA 2WUBL 4CBPA 1P7QB 4Q8OA 1EJTC 1X7FA 1Q9WA 1YNTA 3WLNA 4Z7OB 1H7XA 4MNKA 1QW8A 1R24A 3IF1A 5BRZD 1LEIA 1YEYA 4GJJA 4HQQH 3RYMA 1K8ZA 1J9TA 4PLKC 2HB0A 43CAA 4DF2A 2AXGB 2A6IB 3SBRA 4S3GA 4Z7VB 1NM4A 2J77A 5D6DA 2CXGA 1BXCA 4GNJA 2EDEA 3LTPA 2PO6B 3SGDH 4HFUL 3REQA 1K6QH 5JIQA 2ZTKA 1OSEA 3FMGH 3UWYA 3LEYH 2R91A 3Q1EA 3N41B 1CE1H 1K3IA 1XF1A 1TKWA 3D33A 4TQEH 4XODA 5E2JA 2B3RA 5AVVB 2CJUL 2YLLA 3CT2A 2NW0A 1T1ZB 1JTPA 3P0VL 2BSSB 2PTVA 3SRDA 4IOIA 1P4IH 2Q76B 4LSBA 5IG7B 5BVPL 1MFDH 1S5TA 2B08A 3US9A 5J0BA 1WUEA 5CEZL 2PTYA 2Y07H 4XNDA 5D71H 1HHHA 3GBEA 4MLSA 1VBHA 3V16A 1KG0A 3KPSE 5EWIL 3ZE1B 5IR1B 2UZIL 1NGPL 1HFUA 2DLGA 2FB4L 3WMPA 3D51A 1NINA 4GIPD 4R26L 3MRQA 2ZZ3A 2BRQA 3VCCA 3LXUX 3GEWB 4Q9QH 5FO2A 5GGRY 1YECH 2BWGA 2WB7A 2HJKB 2AJYL 3OKEA 1CENA 4MYXA 1L9MA 4PJAA 2QGCA 4NM8H 4UTBL 5LHEA 4I0PB 3CSTA 5LGHL 4PSPA 3QOMA 4X9YA 4F80A 3M17A 4IISA 3V4VH 1EO8H 4HBQA 5TQ2L 2JKXA 5BV7C 1H1NA 3V5HA 3W4RA 4ODTL 3SDDA 4YDJB 1AK5A 4QXIA 1WBXB 3LZQA 4NZRH 5L4FA 1EVTC 4X7TB 4LKCA 2ODIA 2VW4A 2YZ1A 3O4LB 4L4VA 1LYQA 3ABXA 1RSFA 2P5EE 2DJMA 3GSQB 1E6SM 2ZUSA 1Z89A 4CQ9A 1LK2B 2ESCA 3EYPA 3ZKXB 3OKOA 1JGUH 4O02L 4GQZA 4ML9A 1A3ZA 1V27A 1W5NA 4WUKL 4OD2A 3PL6D 3DVGA 3URQA 4TUOA 5DHYA 3WLBA 1BLNB 2XG5B 4JIRA 4N5EC 4XNYH 5LHDA 4QE4A 4HDIA 4ZQRA 3SIZA 1QWKA 1UXSB 3Q8EA 3V6FB 5IW1A 2FPVA 4AG4L 3DIFB 3FU8A 3QI9D 3UTZB 4AL8L 4P06A 2PDPA 2VLME 4KDWA 1Z32X 3ALPA 5FA3B 1CK0H 2MUCA 1NEZA 4RZCB 1H50A 4Z3FA 2X2HA 4K9JA 3ZSSA 1NEYA 1JIBA 4KFNA 4BINA 2B31A 4I2XE 4W89A 2ZXGA 3MDJA 3NG3A 3TX4A 4QHLA 3GAKA 2V2WA 1JPMA 3D39A 3T04D 1DXFA 4HEPG 2Z91B 1PKYA 3FUKA 4BH8B 1DDHA 3NIFE 3ZZQA 1ZHKA 4Q4RA 3NEXA 1G7MB 3L81A 4YPJA 5CJBA 4KWUA 5F7UA 4NAFB 1EGZA 2AXJA 4UR7A 3W1UA 4XPAH 3AREB 1GGUA 5ENWA 4WJ5A 2E25A 4QLJA 1PZ5A 3B5GA 1Y1DA 3LZFH 5GJPA 2DWEB 4MAUL 5CD5C 4NP4H 4AE0A 3SPIA 5B39A 1FVPA 4GH3A 5CLYA 1CLCA 3S0PA 2RDUA 5DRXA 4NO0A 1KBGL 5C0JB 4O53A 2H7WA 1RZQA 5EZIH 4EPBC 3U0PA 2IH1B 5FI8A 3KW8A 3LY6A 4EN3A 5MHSE 2Y61A 3UWZA 1EWHA 2DBLH 2YD9A 4NZ4A 2EVGA 4QYOB 5DQJB 4BFOA 1W8SA 1MLCA 5E2UL 1EGVA 4GO9A 1T8QA 3VFUA 3BUYA 3LQMA 1I8LA 2NMSA 1OF6A 2VXSL 5CM1A 1IIIA 3RVVD 4UTAA 2NY1C 4NERA 1FHDA 3BT2H 2YAOA 3OZKA 4NOFA 4A68A 4I9MA 1G9NH 5B8CB 3B2PA 5I1DA 4F8TA 2XPGA 3NRFA 3N42F 5CBAA 5K59E 2CO2A 2D8KA 1NSJA 2K6YA 1HTYA 2W80C 3F5WA 3X3FL 1LD9B 5CZTA 5LBSL 3QYNA 3M0HA 1PZ5B 4WZ9A 3H0TA 1KR0A 3QIUD 2PTXA 2JLLA 2OJPA 1O66A 1Z3RA 4Q8MA 1FNHA 5CXPA 3V8CA 5L2KD 1WXJA 3WYZA 2PPDA 4FG0A 4KAQH 5FYJE 1KACB 1ZQ5A 4ODTH 2KLTA 3KPRA 4N24A 5AUMB 4LVOB 3PRZA 3TBWA 1HKIA 3WF0A 3QI9A 2WYTA 3MFFB 2GCYA 5F4SA 5HMFA 1FBIL 3LNDA 3PWVA 2DI8A 4CQCA 4N68A 4ZMPA 4M93B 2FMOA 1A2YB 4XH2B 1DN0A 2F74B 1XUUA 4Y16D 4UMAA 1KT2B 4OGYH 3NIYA 4ACTA 2FGLA 1YNYA 2QQ6A 4HK3N 3DGGB 3AHYA 5D1QC 3WUWG 1X5KA 5D7LB 3AUJA 2FQFA 4RCAA 1JXGA 2ATSA 4KZ0A 4XE0A 3VXRD 5A6LA 3AIEA 3PR2A 5GRZA 2EEAA 3T8LA 2JGYA 1R5VA 1F74A 2R39A 2ZAIA 1PYMA 5G1MA 1SVBA 2A7BA 4OLZL 4CILA 4LAQH 4BK5C 2I14A 2JFCA 4JQXC 4PUBL 2AI0H 5JPNA 2F53E 3UD6A 4JG0L 3BZEB 1HOCA 3UEZA 4BWUA 4Z78B 1JJKA 1W9PA 4O8AA 4IZGA 1Y65A 5BS0E 4PRPB 1YMHB 1BEYL 1MFEH 3HN5A 5LIKX 3QG7L 3PQYB 3HI6L 3S35L 4UQ2B 2EKJA 5F1IB 3VGFA 4AE1A 3H21A 3NEHA 1Q94A 3R4RA 1HNYA 4Q6YA 1FF5A 3HPJA 4PJ5A 4RISL 3SCUA 5DVKA 2KZ1B 1B3XA 4HWBA 4LEXL 1FL3A 3VDGA 4C6IA 2HX9A 4JANB 5DMIH 5FYKH 3IEBA 3IJIA 4CVXB 4P8QA 3W7NA 3MUUA 5HYSG 1PWMA 4KRPC 3KH3A 2Q6WB 3S1UA 1Q5MA 1I85A 5FC9A 3ANUA 3EX1A 4YZFE 4LRIC 5T5NF 1JCTA 4K68A 3YPIA 4IOFC 3EDFA 3DESA 3BZDA 4XO4A 1YN7A 1ZS2A 5IB3B 2F58L 3WE1A 5FFLA 2I57A 2YMXH 3CHCA 3MPGA 3D47A 3VFCA 1FVEB 1IKNC 2TRHA 5IJDC 4INFA 2G60L 1UJPA 4NRZA 1ZDQA 4KTGA 3EDJA 4MJ6B 3WFCH 4FTVB 3H24A 3A6BL 1AIFB 1BAFH 2QHLA 3OMZA 3EH4B 1TE6A 2WZIA 3OW1A 5DQPA 3WD5L 1F0LA 4ZQTA 5L0QB 1WTGT 4L0ZA 1CWVA 2EO1A 2VW7A 4IFKB 3BHBA 4U1MB 2VXQA 4JDVB 3A4FA 1PE1A 3ULUE 2QGDA 1SEBB 4Q4QA 1AKJB 3MBEC 5K3VA 1LJYA 1QHQA 3A67H 2IGTA 5D55A 4WI6A 2V7NA 1CD0A 3AY2A 4APXB 3PTMA 3OBKA 1QX1A 1ZJBA 4I5BA 3KAAA 4HWZB 1I1WA 4K36A 3ZQXA 4G8GA 5HYSB 1E4WH 4MQSB 3WBWA 1IQ8A 1KR1A 5BV7L 1VPYA 3DHDA 4OTKA 4KVCH 2VQ4A 1E6XM 2MPAL 3L6FA 1IGWA 2FYYB 5T1LB 1VKXB 1SM3L 2W60A 2JIWA 4DW2L 2PXYB 4OFPA 4XR8C 3WXWL 3LXAA 5C0JA 5BOZG 1I8AA 1W6WA 5CO1A 4I18B 2CKRA 4B92A 2D2GA 3CPGA 4O10A 4LQFH 3CK0L 4G8TA 4JHOA 1N7ML 3NACH 1EAPB 1IXNA 1WISA 3C5SA 1P1ZB 3IETA 3OAUH 3VG9C 3CL7A 3PBMA 3ZRSA 3N41F 4PMOA 2BOFX 2Z7GA 2IAND 3BEVA 1UZ8A 3HB3D 2LABA 3FCGA 4PRBB 3FTWA 3S34H 3U7VA 4R0LB 5EO0A 2F7FA 2K6WA 1CPUA 2BRRL 7A3HA 4NGHL 3BFQG 2OL3A 4JG0H 4C56A 4DP7X 4UNKA 2VEGA 1H3XA 4HIEA 1UFGA 1OCQA 5DS8A 2OXNA 2VC9A 2AABH 3NCJH 4JLRA 4GT0A 1C3FA 1I4NA 3ULAB 1TFHA 4EZLA 1EEZA 2LAAA 1NANI 2VRQA 4MWFB 1JERA 4PW9A 1QPRA 4PJFA 3QKZA 1P4LB 3GXIA 4UNUA 3V7AE 1QFWM 3QJRB 4YLBA 4M82A 4MNQE 1OTUC 4AGPA 5DT1H 5L2KE 1BZQK 4UZGA 3RZCC 3ILEA 1HQ4A 3PAJA 5DEGB 1IHIA 2XSBA 5DJ2A 2PWUA 5GSRB 3CVHA 3B34A 4ALAH 2VX5A 4L1DA 2BRRH 4Y16C 5AZEL 4FJ6A 1CG9A 3E6FB 2Y3NA 4OCYH 1W0VA 3JWDH 2KPNA 1B88A 1B9KA 2NY7H 4GXVH 3DRQA 5F89B 5CCKL 5LWYL 2JSFA 2QCDA 5BQ7B 1N6UA 4W9JC 2OMWA 2K3TA 4GI6A 3CS2A 4A35A 2CLMA 5HI3C 2RDWA 3GZ3A 4C6BA 4W4OA 3T7VA 2B5IB 2VDML 4TSAL 1ICSA 3D12B 3EOOA 1TCDA 3RM4A 4NLHA 3NABH 1OC5A 3LHPL 3WV0A 1FZJA 5JXED 1Q7MA 4H5SA 2PPGA 1R7OA 4Y88A 2YYTA 3WK1A 3WTSA 1GZQB 3ESVF 4CEUC 4QLRA 4ZFOA 3VZXA 2ZUQC 3ZIMA 2X6CA 3RU8H 1F13A 2OSYA 3HUJB 1F4XH 1F4YL 3BAWA 4JFDE 5IVXE 4YFEA 2FTWA 1DV7A 2WWMC 4KRNA 4PJIE 2CR6A 4FQIH 5E0FA 3V3WA 4AWSA 1GGIL 1X6UA 1ML0A 3HE6D 4YZFF 1A9VA 1TJGH 4U0RB 3P40A 2E3VA 3QZPA 5DMNA 5HY9B 4IK7A 1M56B 3K71B 2EDBA 3QDMD 4PRPE 4E41D 5ALBH 4JX5A 3VUAA 4QTGA 2X6VA 5HD8C 4QOKD 5C0FA 3BFWA 2A5HA 4GRWE 3FT3A 4MB3A 2L7QA 2OTUA 1XF4A 4JTHA 4JUSA 1ZPLA 2RKXA 3SYOA 1X9QA 4IMFA 1DVUA 3ATDA 5E23A 2GVYA 3T65A 4WO4A 1GQIA 3HB9A 3VG9B 1MDAA 1H6EA 1TYEB 3ZHFA 2HFGH 5FF2A 1U3HA 3V6ZA 3KJ6H 4YNYA 4F8PA 1M1XA 3AXKA 3FB5B 3GRIA 1OT1A 3Q44A 3WQCA 4WCJA 2VLMD 3BO8B 3QJUB 1T4KB 1X7TA 4U6HA 4PRNB 4DKEL 5EEUA 3I6RA 3RGVC 4AG4H 3V4LA 3U0WH 3LBOA 3VI3F 2BXYA 3BEWA 4M7JL 1QT1A 3GY1A 5T1JA 2H6RA 2R1YA 1K4DB 1M03A 2ISFA 5JOPE 5AZ1A 3KYOA 1XF3B 6PTDA 2UY7A 1O5KA 4M8UA 1MI5E 4W9TA 2P52A 2PCFA 3JV6A 1IIKA 3CQFA 3UOAB 2NNAB 5D2NB 2P5ED 4AQ1B 4BY3A 5CWSB 1ZVSA 2D3LA 1FV1A 1KV7A 2DQDL 3B2VH 4OD3H 5IFHL 2ENSA 1QUPA 2YCJA 2ZSWB 3L16A 1KBPA 4L48A 3H2MA 1GL4B 3SGDI 4HULB 2F53A 5I0DA 5EC1B 1U8IA 4UM8A 1EYEA 3BO8A 4RRPM 3NPSC 5J04A 3NFPB 3CDYA 4JRXB 5IHUL 2AL2A 5F0JB 4GY4A 1I9CB 3O07A 2PPAA 2NY7L 4FL4C 1POKA 4EF8A 1ZAGA 1RURL 4G42A 4PTWA 3R58A 3PBVA 3SDYL 4MAVA 1GZJA 3DV6A 3CHVA 4S1DD 1WWWX 1OCWH 4LLUB 1HDMA 1J0YA 4MLIA 5DRWA 3RZCB 1XIIA 4U49A 3W39A 1QZNA 4LVGA 3RLVA 2R2EB 3QXAB 3W27A 2CJ3A 4D9RE 4FXGC 3IARA 1VDGA 3VD3A 3WL9B 4AG0A 25C8H 5MI0B 3VINA 3MKCA 1HT6A 3LB0A 1WZ1H 2VEPA 1EAQA 3EOUA 3ONCA 4RKAA 1CIDA 4GSUA 4L9YA 2IBZY 4G80B 2WUCL 4PTTB 3B05A 4RWYH 4C58B 1YEEL 1HO4A 4LDOB 4WNJA 4TU1A 2R0WH 5D2WA 1BJ8A 4FR1A 5A2JH 1L6FA 3MR9B 4UTMA 1X4ZA 4K23L 3M7WA 4FR6A 4XBJA 1JD9A 3O4OB 4X4XA 2Y7GA 1SYVB 4GS7B 2AQOA 4QWWC 4N6RB 2Z24A 2MKLC 5D4QA 2WGXA 4N4YB 2QT6A 4KK6C 4TVPH 3S2JA 3DFTA 3HKZA 5EN2B 3BD3A 3BSMA 1B30A 4JG1H 4PCYA 4GKOA 1JZ3A 4UBPC 4XKYB 3ARPA 1E1FA 1EC9A 2DQGL 4R7OA 5B7EA 3BE1L 1TEGA 5E2WH 5CEYA 1CB2A 2EYRA 3MO1B 3RK8A 4UTIA 1IFHL 3QXBA 3A4EA 4PLKD 1BG9A 2L04A 1GOOA 1MFUA 1CS6A 1GOMA 1F90L 4AT6B 3GDRA 4GHRA 1RXLA 1INDL 4OKVA 5LAXA 3LMYA 2D31A 4IRJD 3MRGB 4PJEF 2Q3OA 4IGBB 4TV6A 3GMNA 5D1XB 3LY0A 1OGAA 1Q9LA 5EULV 5C0GB 3APNA 4JFPB 1QMUA 4OFYD 1Q65A 4KWWA 3WNLA 1SFLA 3UZXA 3C2YA 3F3HA 4P9HH 3L3DB 4RX4D 4CSSA 3M1BB 1R3VA 1OQOA 2R23B 3UZJA 3VGEA 4X7CC 1ZANL 4NNPH 4IK6A 3BKYL 2QLYA 2JXMA 3M44A 5KBMA 1MFCH 1IC7H 2EIMB 2V7HB 3FFDB 4LLAA 5CHNB 2JIEA 1MZZA 3GM8A 4XNXL 2AJ3A 1ET7A 1CLKA 3QB7C 1T1YA 4W84A 3AFLA 3RAJL 3E2VA 2G3ZA 3T3MF 2XINA 2R1PA 2VR4A 5FYKL 3WS6C 2JKRM 3RLGA 2YSSA 2P28B 2XZZA 2WZPD 4O0ZA 4M7TA 4UFIA 1Z0NA 2VC5A 5GS1A 1Y18A 1HH9A 5DEJA 5MKGB 3QDME 4PRPD 4KO5A 4AT6A 1KO0A 5B22A 3N18A 2IKHA 4DGWC 4QTFA 1AO7D 4NIYE 5D2LF 2BVOB 5EU6A 1H6FA 3MYJB 1HX0A 1S7TB 3VZZA 2QQNH 4CCDA 1XQ4A 4ZSOA 1YEWA 2AAAA 2Z1SA 5DD0L 3CZLA 1BIIB 3W70A 3VB8A 3LS9A 1QNIA 1S9YB 4MXVE 3QHMA 3U9IA 4EI5A 3CFCL 3H9SA 3V4UL 3C2VA 3FQRA 1GZHA 3Q5OA 3FU6A 3DURB 3KBSA 4P0DA 1JHTB 3FT4B 3WBXA 5IK3B 4AQEA 3N55A 4JDTH 3SB3A 1JZ6A 3W83A 1XF3A 4GJIA 1TA3A 1LK2A 4JZNB 4ZTPL 4AEOA 2F1BA 4YDNA 3ZK0A 4AENB 4H7ZA 3AMDA 4QXUL 2WYZA 3HFML 5AOZA 1L6XA 3MRNA 1OD0A 3UBXA 2X1TA 3NPUA 4QAWA 3R12A 2VMDA 4NWTL 2HVMA 1MIEH 4EQ2A 1XCTA 2DZEA 1DLHB 3IT8D 4LLMB 3BWWA 4P4KB 1IWPA 3F1QA 4GI4A 4GAJH 1E0XA 2J25A 1MQPA 4PMDA 5F7EH 5K1NA 1L9QA 3SE9L 1LOQA 1WA3A 2UZ9A 2CIIA 4J3UA 3WQDA 3DX0A 2JB5L 4WAFA 3WLHA 5CGYC 1OGGA 3ALFA 4R84A 1YA5A 4NWTH 1FH5L 4JE4B 5EWIH 4L8DA 4FXJA 4HK6A 3L5JA 3HLKA 3MTWA 3NFPA 2TSAA 3RR4A 3RWIA 4QXUH 4N6FA 8XIAA 3HPJB 4F93B 4FFZH 4OB5L 2X1IA 4S1RL 3BAXA 3ATBA 1WCQA 2DORA 2VWSA 3C6LA 5CQ1A 1B4LA 3BVJA 4YDLB 5CFAA 5D2LB 1SM9A 4KESA 4A63A 4I77L 4HFUH 4WI3A 3WMSA 2WLKA 2BFGA 3M0IA 4NO5B 1S7XB 3EXJA 3RNQA 1JDEA 2QVIA 5T3XD 1OLLA 1S78D 1QCWA 5CSRA 2ADJA 1V7ML 2D3JA 4PJHA 5INCB 2BSEA 3QUXD 5I6PA 2Y6TE 3U9UA 4JK0D 3H2NA 7REQB 1VACB 2IDTA 1UOVA 2QTEA 3AMKA 3NOIA 2NQ9A 3QPXL 4P46A 2G9HB 1V10A 5EB9A 2CLLA 4MD5B 5DFVC 3V5FA 1QHOA 1HOEA 1N5AB 2LV4A 5FEZA 4E38A 3KVDD 4M5ZH 5KS9F 4IP5A 4HKZB 4LMQE 5SWSD 5F21B 2XG4A 1J8SA 3MRHB 3RUGE 3D7PA 3FRUB 2J7BA 1PFOA 4DKDC 5FF4A 1AR1C 4QY8B 2OMYA 3AWEA 3MJ8A 1JZ4A 5ICXA 2WTRB 4GC4A 3SRFA 3ULUD 2HXAA 2CA4A 4W7UA 2DZXA 3VXMA 4GAGL 1LWRA 2FTAA 2DDXA 4FG6D 4PJCB 3STZB 1F45A 2A99A 4B5VA 4Z7NB 4NBXB 1MRDL 3TK7A 3TQ0A 4CD5A 2JJSA 5CSYA 3GYRA 4M93C 4RISH 4ELDA 5F9JA 2AJUL 3VIMA 5E99H 4OM1L 2ALRA 3T3ME 2CESA 3OZ9L 3C2OA 2G2RA 2G5UA 3RDJA 3JVGA 3NSMA 3QG6A 1BGXH 3DIPA 2L7JA 4XPFL 3PP4H 5J12B 4NNXB 5HHQB 1KGCE 4OI7A 5EUOF 2WANA 1TQSA 3MFFA 1XPGA 1ZLUH 1OK4A 1WICA 2AZUA 3LKRA 4ONGL 4YBLC 1KFWA 3BEVB 3KLDA 1JF1A 4KTYA 2Y70A 1KN2H 2FKPA 3DG3A 4HU0A 5AVNA 5BJTA 5ID1B 1JCYA 2KPWA 1GVYA 4CQAA 4LARH 3B8SA 5GGQH 1YC7A 4XMKL 3W7LA 3KCWA 3LIZH 4HLJA 1NGWA 4CMHB 4N28A 4YIQB 3S3PA 2YLKA 5B8CC 4OCWL 5J7CC 2CKBA 2NY5C 1N5YL 1DVFC 1ZAJA 2PUQT 3D07A 4AZCB 3ZKXC 4B3LA 1U92A 3WXVH 2Y7QB 4UTHA 5CC3A 5B3JF 2XA3A 2Y1ZA 3EBVA 3HMXA 1AHKA 2P26A 3GSXB 4LBRA 3WCYA 2QDGA 1OWQA 3D0VA 4TVDA 3T6VA 2QVNA 4WEEA 3W1MA 4M56A 2RCSH 3T05A 2ODOA 4H0GA 1TE1A 4LAQL 3WUBA 2QV2A 3LKRB 2GSIA 3OU8A 4BGDA 4GPNA 4PU2A 1YTKA 1RLWA 32C2A 2W0UA 2ZUTA 4FO4A 5A5WA 1DCEA 4GXWA 4CMMA 2DSZA 3QCTH 3VXRE 4E8DA 3HOJA 4B5ZA 1TMHA 3S6DA 3AIVA 3T6QC 3RVXD 4CVZA 2ICWI 1XLLA 2YPLA 1WDWA 2QAPA 3DX1A 2EKGA 1RZJH 3SY5A 1JPDX 4FEMA 2EDWA 5I79A 3RQ3A 1HHHB 3NYDA 3QUKB 4LW7A 5KS9A 3BTNA 2WGNB 2PTUA 2BW5A 2QQNL 3CN2A 3V0WL 4LHQB 1WF5A 2PYFB 4E4PA 1A6VH 2I25N 4FYQA 2HK1A 2J5WA 4YSQA 5DD5L 4FOMA 1IGYA 4GLRH 1IM9D 1J8HB 1Q0XH 3OZLA 4LK4A 4NOBA 5HJ3B 3CPLA 2R1WA 5IB5A 1S7WA 1ZA6B 3JWOC 1A6UH 1NAMH 2CIIB 1ZXQA 4L1HA 4MS6A 2EXYD 4WKHA 5E70A 1BFOA 2FHCA 5B1BB 4ZI8A 2EPOA 2Q3XA 3TV8A 1ZLVK 5G55A 2BWDA 3MRIB 1RZJL 5FHBH 1G01A 4UQ3B 4RMRA 2BC4A 4Z7WA 4CN6A 4PP1D 3CBJB 5A6TC 1NEZG 2GY7B 2HE8A 2EKSB 2VDQL 3HI1B 4LKCB 1JAKA 1FCVA 5BWFA 3V36A 5KUMA 5TTRA 5L9DH 3NCYP 3VFTB 1GCFA 2PYED 2R0LL 1NF7A 1W5MA 4XMWA 1E9OA 2BS8A 4QNPE 3IVUA 4JFQA 5C0AE 4DEUA 3OHXC 1LP9E 3FUHA 4GG6A 4EDXB 1KQYA 4XCYB 4G56A 4JYDA 1I8UA 5HYSA 2R51A 2Z0IA 4X4YB 3HMCA 2OWXA 5J11B 1OBAA 4Y1AA 3LU2A 4L3CB 1PY9A 1TRDA 2WQWA 2DBLL 1T5XA 1INDH 4HHAB 2FD6L 3CU2A 1IBHA 4UMSA 4XHJD 1RSCA 4HNCA 2ADJB 4L3AA 4G6CA 2EINB 1MYRA 5CPSA 1WKEA 3P54A 3NCEB 3N29A 4PRRA 3IFPB 2WAHA 3VYOA 3EO0B 1AMKA 5HVWA 2DKMA 1CL7H 1BFOB 3ARFC 4KUCD 4C56E 2XFXA 1ZTVA 1YEGH 4R0LC 3KXFB 3C86A 3P77B 4L9XA 1TVBA 5DJZA 4D9QD 3WXWH 4QHLB 2W27A 3K2GA 4CEXC 3QZWA 5FJTA 1H7RA 2FATL 1RK0A 5CEWA 3DFHA 3ZO9A 3CFKB 2DZAA 3HI1A 3QW9A 1LBFA 1FL3B 3TV3L 3PZTA 3SQMA 4HN8A 1UXWA 2D7TL 1G7QA 4OGXH 2NV1A 4AX6A 1OKEA 4Y4FA 3BSZL 5HMDA 1WNOA 3GMRB 3NSCA 4FHJA 4HJ0D 5H2BA 1E28B 2N7BA 5HGHA 4ES9A 5M95B 3TF7C 4PBDA 3KDNA 2ZD0A 1TQJA 2D7OA 4HUUA 1YBQB 4PV9B 3UG8A 4RWYL 2OT0A 2WINB 3SDXA 4PODA 4MGXA 1JUBA 2CXEA 4G6FD 3OKYA 2ZOOA 3W28A 3CFDA 3E8UH 1J9CT 2VDLL 3L7EA 5AQ0A 1EUTA 1RH8A 3RFAA 5HNTA 3MHZA 1BQLL 3HAEG 4H0HB 1DEEB 4OZGF 4P57A 3FHQA 4QRPA 5E8DL 3SCNA 2CO7A 1XZ0A 3JV4B 4JCLA 4PB0L 1I9EA 1IGFH 2BVPB 3K46A 1K8IB 4JKNA 3T0EC 1MLCB 4TUUA 5CSSA 2K9UA 4M7ZC 5LKYA 3QO0B 1IIHA 3UU0A 3OXSA 2DT1A 4MKMA 5SWUA 1OAKH 1ZT7B 3I6GB 1DSYA 4G8GE 2Q9OA 1AA1B 2AQNA 1GOWA 1LUCB 3PJXA 3IDIA 4BRVA 5E24E 4XO7A 3B7SA 3NFNB 1NOAA 2MCPH 1GZPA 4OZHF 3MV7D 5CLZA 5TFSL 2OMAA 4WXYA 1DVSA 1NC2B 1Y0LB 2YBRA 3GHEH 3VGAC 1O5PA 1ACZA 3ZT6A 2X16A 3IPWA 4NPJA 4NCC2 5IZ7A 1KRBC 5LIUX 3ZLQC 3IJ9A 3CQKA 3WH5A 3V4VL 2Y2TA 3T77B 2OELA 2PWVA 1N3NA 3PJWA 3RAOA 5DJYB 3SB0A 5EMLA 5BU6A 3DFSA 3V9EA 4GYPA 1ITQA 4OJCA 1KIPA 1L3NA 5C09E 4LBEA 1NICA 4ZUSA 2GVJA 3WN5B 2FRGP 1O12A 4WO0A 2OI9B 1JUFB 5I1EH 1TTPA 2FVMA 3BN9C 1J2BA 2F5BL 3O2DA 3SCWA 2LLEA 4RE4A 4E9LA 4DWSA 1QPXA 3ILQD 5HTSA 2X28A 3G6JE 4N2EA 4NN6B 3UJIH 1V0NA 4H04A 2VVNA 2G2PA 1H7PA 4U7KA 2IOIA 3UERA 4I48A 4JIQA 1TX0A 3SUWA 3M5VA 3ASWA 1A6WL 5A69A 3GHBL 4YHMH 1CDYA 2GGHA 3NNTA 4J3ZA 1HAWA 2WXFA 1SM3H 2ZXAA 3N1GC 1ZFJA 4P5SA 5ABDE 2Q01A 2PURA 2BY2A 3VFNB 1RXOB 2Y06H 4C1NB 1Z3GH 3FJNA 3BXNA 2J88H 3E0LA 4A8IA 1KXQA 1H5YA 1A5AA 1NSNL 1V6VA 4PCNA 1K1DA 1HINH 1Y6KR 3TCXA 4GYFA 3QXTA 1G7HA 2NRDA 3OBEA 4WDUA 3VFMA 4A2RA 1F6LL 1DVFA 4LVHC 5CJQL 2EBNA 2XZAH 1QYGL 1GZHC 5E4IA 4LOUD 4PQXA 5ICYA 5I82A 1CTMA 3TFBA 3G0UA 1TNMA 4K8GA 1E42A 4P3CH 1PQZB 3MMWA 4N2IA 1M71A 1GJPA 1DBML 2OULB 4BZ2H 2DOCA 4N0YL 5BRZE 1EX5A 3NCFB 1KXTB 4JJOA 1PEWA 4DT2A 2EVIA 3K6OA 1FO0H 4XNMB 5C3IA 3BUQA 5HHOD 4JDTL 1LE5B 4TLSA 4EE2A 1YE6A 3TBVA 4LH8A 1HIMH 2BODX 1G1OA 4DWSD 1QR1A 4NDMB 3B0VC 3L3HB 4JQIH 4UYPA 3TTSA 3WS6A 3BGMB 3M64A 4HIHA 5HGDA 1XSOA 1VGKB 1A7PH 1WFTA 4FHAA 3D69A 5AEAA 1E5JA 3NL6A 5I3DA 3GVVA 3C2SA 2ESVA 35C8L 3FS9A 4Z7OF 4NUJA 3QHTC 3TA3B 3WNKA 1MEWA 4JFYB 3MB9A 2OU4A 1GYCA 2NXIA 2CO6A 2RFXB 4NN7C 3JR2A 1ZE3C 3NABL 3IDNB 1MNZA 4GG9A 4M6MH 1Z6JT 5KINA 2P24B 1VADA 5FJOA 4QRQA 1E8XA 2R27A 3UAEA 1RZKH 3ZYZA 2I7OA 4J5NA 2O61A 2XGIA 3PZGA 5GZNC 3KG5A 2Q7NA 3VTMA 3PV6A 2Z2AA 4GAFB 3FT3B 2A74A 2YC1B 3KOZA 3O2LA 4IIGA 1SY6L 3ARFD 2X6BA 2Y88A 5K9JL 1A7PL 4GMEA 4F79A 4N8VG 3WH8A 4AF0A 3D85B 5DD6B 2JI2A 4NU7A 4M6OL 1TO3A 1MFBL 2Q86B 3W84A 1R6WA 1JPEA 1CFQA 2Y5SA 2LOEA 2BOEX 3RBSA 3NA4A 3IDJB 4ICCX 3T0TA 3VRLF 2NVAA 3MC5A 4ELMA 1GTHA 4A2MA 3F04A 4YZWA 1XICA 2FQIA 3KHJA 1KRAC 4I4WB 3IDXH 4ODVL 3GSWB 2Q87A 1UWAA 2Z4TA 3HC0A 3W7CA 1MIML 5FF6A 1QLEL 1UCWA 3EDKA 1T22B 1G7LA 2VZTA 4Y7OC 5IB2A 1BFNA 1IC4H 1ZVSB 4ZO9A 4JTCA 5HHOB 4RMWA 3W23A 3NGBB 3VNYA 4MF4A 1A1NA 3W01A 3NVQA 1K3ZA 1IAKB 4LCUB 1HEHC 3Q9PA 2YAMA 4P07A 1GJIA 1OHQA 2REQA 3B0XA 3DFQA 5EYWA 5I1HL 4BHUI 1PLGH 2CR3A 5B4MD 5GJMA 1A6VL 3IUIA 2JI1A 4JMXA 4DW2H 2W0PA 2ZWLT 3FT1A 2XY1A 2D31B 3SOTA 8CGTA 4G1NA 4ONHB 5BV7H 5FGCB 3KH4A 4FXGA 4Z7NE 1S5HA 5I19H 1MDTA 4XCFH 2D20A 1KC5H 1N4XH 1E30A 2V0TA 1QNSA 1DCLA 4AYGA 4FB7A 3CQIA 5K9JH 2JJVA 2CDFB 3FQNA 2A5UA 3DXAD 3LPOA 1I8MB 1NGZA 3AZSA 1P1XA 2D24A 3L08A 4JFZH 3HV8A 2ADAA 2HDJA 5IT2H 2J6VA 5EOQH 4PJ7E 4H19A 2Y4SA 4KNSA 1IM9A 4WZHA 5AYBA 2ZZ5A 1A7QH 2XM2A 4LS1A 1D2OA 1KTJA 1PKQE 2P4AB 1IGML 3GHEL 5CZXC 2OCZA 2DQFB 3ES6B 1VF5C 1OEPA 1WC7A 4PJ8B 4BWWA 2CCLA 3MJGX 1JI1A 4ZPVA 1T0MB 3PZIA 4TV5A 1OCBA 4ECLA 1TSRA 3BWUC 4X5XB 1G7VA 2XM1A 1RBOB 1ZD6A 1I8JA 5F93C 3S3JA 4IOFD 1IBYA 3QH3A 1AKPA 4CUCA 4ZVJA 1H5BB 3UG4A 3QRHA 3BXNB 2VM3A 4MMXA 1AY1L 4R4NC 2ACQA 3KHQA 4PGCB 4PJBB 1QHZA 5HVHC 3IAGC 2AHIA 3OO2A 3AS0A 4P04A 2X3CA 4A6YL 1AH0A 4H4IA 2QQQA 3QHZL 4YWSA 3A6BH 5DEFA 2N7SA 3C8KA 1NDVA 3HURA 5IFHH 2WQXA 4WFED 1G7PA 2O55A 3UG5A 3IJLA 5FO9A 1N70A 1XB3A 3VXSE 4KX8A 5F44A 1NJ9A 4H9VA 3W07A 2YGQA 4R8WH 1D5IH 5FO7A 2VW6A 4AIXA 3ISYA 2OYPA 1A4MA 5C70A 2EYRB 5D7IB 2H32H 3FSOA 4S1QL 3MWAA 1G1YA 3B7YA 3Q6GH 4JFFD 4UUJA 5B80A 1DJSA 3QXVA 4IJ3B 4ZQKB 1K8YA 3TE9A 4Y9CA 1UR0A 5FOJA 3KXFD 1RFDH 1QR1B 2XZCL 5DCBA 1AO7B 4H8UA 4NQCE 3UAJD 3OAZK 1V3MA 3TJLA 3DHMA 3QQ1A 3CX2A 3ZBMA 4GBXC 2HMCA 3ILPB 2PA6A 1XBRA 5HGBA 3WAJA 2XLLA 1CGUA 4GFTB 1R3IL 4RMTA 1UZ6F 4FI7A 3RJOA 5RUBA 4JX0A 5MEOA 3RL1A 3M1BA 4WJEA 5T3XE 5A6JA 3MJ9A 3DO4A 4MZIA 4IIFA 3IM1A 3P4NA 3RFZC 4YXGA 2QMKA 3EADA 5L7XL 1YEEH 1ZB5A 1NCJA 4BQ6A 4JNYA 3MXVH 1XIWB 3CQ0A 2PLJA 4IPIA 2Z8WC 2VT0A 4BA8A 1M9HA 4A7GA 1V03A 5DFVD 1SSGA 4ODUA 4U1LA 1OM3L 4OFVA 1RPXA 1ZLPA 2W62A 1S9XA 1YQ2A 2BOBB 1SN0A 4TRPL 3X17A 3DUUB 1ZWIA 3QT2A 3IJDA 1SMAA 2A21A 1SJEB 1I3GL 3MUGA 4PMJA 5JQ9A 3AM8A 5DC2A 1VIZA 3EX2A 5J3HD 5IQNA 4JN2A 4Z3GA 3MUHL 2E7LA 5KVEH 4K7FA 3PK7A 4G7EA 1YG9A 2EIZA 3MRLA 1W0WA 5D1ZA 4FTDA 3U30C 1IKFH 5JXEA 3TNMB 3G2GA 4XP6L 2WXOA 2VUOA 5CJXA 3BP7B 4U3SA 1UM5H 3GFYA 3S4TA 1J6PA 1XYMA 2WMIA 5BVJB 5HBFA 2VDMB 4N1HB 4PB0H 3IKCA 4K5MA 3MRPB 2WMJA 3ULSA 2H3XC 5DRWB 4U1IB 3ZTEA 4EIUA 3RZCA 2CITA 3GHRA 4TUJB 4IH3A 4G1MB 1J9SA 3WQEA 4PGDB 1ISXA 1JZDC 3O6CA 3C87A 5IB2B 2ZA3A 3ENEA 4PJ9C 3CUZA 3VOIA 1CYWA 3FMGL 1DYZA 3IJEB 3FQUA 5DMGC 3S5YA 5CGMA 1LQ2A 3VM5A 3LQLA 1DBKH 1QKZH 1E90A 5EBMB 1BVWA 1DJXA 1FGVH 1KA9F 2GG1A 1NFPA 1P5BA 3BVDB 3AAMA 3X3FH 1ITUA 3L9CA 4JO2L 4Y9GA 5C2BL 3OLEA 3F64A 1GC1H 1E9LA 5GRVL 1M6UA 3EH3B 4MG4A 1P5UA 3D06A 4ZTPH 3RFRA 1C7SA 1OK6A 4HPJA 3TC7A 5L4MA 5I1LA 4CN4A 2FBOJ 3GSUA 1JUEA 4ZX4A 1LL4A 5IQ7L 2XA8L 5E09A 4KIRA 3VUPA 4UMGA 2GJZB 3RVTD 3S34L 5KSUB 5EZLA 4G71B 4FG4A 4AYMC 4JGDA 1CXEA 4U6XA 1HKVA 4RETB 3NQ7A 1XD1A 4AUJA 1DQDH 3RILA 4GZ7A 1ETJA 2X2UA 4F8NA 3CCHA 1XINA 2OQJB 1NGXB 1A6AB 4ODXA 1I2NA 2E74C 1C08B 4XB3A 3EJZC 1WC7B 5IHSA 4WK4B 1SJMA 4L56A 2X4SA 4DIXA 1HF6A 1GIGL 4CC4A 1E4WL 2IGLA 2ICES 4QT5A 4ZB0A 4UTWC 4CGTA 2W0KA 3PWVB 3G5XB 3E0WA 4HUCA 1XLEA 2Q7AA 4WDWA 4C8XA 1R86A 5FCUL 3SCSA 3VFPA 2WMKA 2NX5A 3SKMB 4C6MA 2AK4A 1U0QA 3EJZD 4DRSA 4E4FA 4AXNA 3ZLFA 5FYJL 2VUKA 4QXGH 1LL6A 4LRNL 4IBUA 2K8QA 1SZGA 3KZSA 4ZUTB 3M7SA 5LIWX 4FQJH 3LGEA 3N1QC 4GKNB 3SCQA 1FO0L 1JNLL 1JDCA 1KCRH 2A85A 3F7KA 3ZDZB 4XXWA 2XTKA 4ONOA 4PWEA 1I3UA 1SW7A 4RMVA 3M9YA 5EMJA 3LCIA 5I09A 2FUTA 1WBJA 2EAWA 2YPVA 2AV7A 2E6PA 4MNHA 3QOKA 1CG9B 1T7YA 4ZFGL 2WZ6A 5GRJH 5MEQB 1W1A1 5FECB 2QADD 3TTYA 3DRQB 1JMXA 2CAKA 5F89A 5JHDE 3WTUA 3IV8A 4A3YA 1Q2SA 3TH6A 3VD5A 3D34A 1N6QH 3GIZL 3SJ3A 4WW1B 3UWQA 4PRPA 1SDDB 3VXPA 2E9LA 4GBUA 4ZBJA 4FFYL 2IUZA 4C6NA 1HSAA 5FUCC 1UEYA 3IJ6A 3WFBH 2Z31C 4OCSH 3HFYA 4C47A 5IIEA 2CBUA 1MQKL 1UH3A 2BIOA 3M86A 1E4HA 4JO4H 4PJ5B 3NQEA 4NN5C 4KI5C 1FXPA 1NCOA 4XP9L 4CNPA 1F97A 5LGYA 3ZDZF 5JZ7C 3BLIA 4K0OA 3T0BA 3N4AA 4NILA 3WGUB 4U4MA 1XCFA 3F8UB 1XHGA 1YMMA 1EEYB 4RFNB 3HR6A 1NELA 1LTXA 1XI3A 1OFEA 4H01A 3LJ3A 6XIAA 4LVAA 3IAPA 4KKBD 4EZKA 2OO0A 5JDJA 3GW3A 3NQDA 1WOAA 2PLCA 4NZTH 1I2PA 3EA1A 3GQYA 4UFKA 2P8MA 3H3PL 2YZ8A 3UAJC 5I19L 2FVLA 2CHXA 3HMWH 4R4FL 3WFHB 1NFDA 3O6DA 5TD4A 5C07B 3HJEA 3UXDA 4AD2A 4TX8A 1E27A 2XIQA 2PD5A 2RJHA 3IVKB 3L3OC 1NPNA 3F7YB 2BY3A 2EE6A 2IIJA 1CWYA 4RGNE 3TBYA 4BKNA 3EDDA 3PYCA 1OF0A 5CZVH 4B6ZA 3S7GA 1LE5A 2WUBH 3X11B 4A3RA 4G6AC 4V1DA 4ADSA 5EO9A 2X7VA 4HHHA 1JTOA 3D4GA 3HEIB 4Y4KD 3ZJAA 4Q8PA 1R3WA 4N2KA 5ACLA 3HGRA 5CAKA 2HVKA 3P2BA 6REQA 2AVGA 4WFFD 4CCCA 1F7BA 2P49B 3HGSA 2XHNA 3W82A 1PD1A 1CGXA 1BQKA 3IK2A 4KXZH 1OD9A 2XIIA 3EJCA 2G4GA 1BD2B 1UYWH 3PWAA 4KK6D 3OXRB 3E5BA 4E9WA 3GR7A 2E7HA 2CA3A 4GA8A 2ZOLA 3CUFA 3SURA 2XXCB 1JDFA 1AG1O 4HU2A 4H8WC 4YHEA 3GJFB 5H35B 5JXQA 1IWAA 1JVLA 2HKHH 2BGNE 3U7AA 1HCFX 5SWZE 2JF6A 2R9RA 3BVXA 4HP5A 1KTDA 4QRRD 3ERXA 5AYZA 3T44A 1ZT4B 5GZOD 1KCZA 3M0JA 3VRIB 1RPKA 1A66A 3LIUA 2EG6A 4PJ8C 4HKJA 4XGZB 4D9LL 5A1AA 3EFDH 1JJUA 3S9DB 3IGLA 1CBVL 2ABBA 2YL9A 4WHTB 1ZT7A 1TDQA 3UTTA 4MXVF 1GKOA 2HVKB 4HHGA 4RFOL 4F58H 1DBAH 3BVTA 4L2LA 5HHVL 1R3RA 3RRQA 5C7XH 1YXDA 2A7RA 2VABB 3K1GA 1U2YA 4BFJA 2BSRB 4IP7A 4PTMA 4LRSA 4OZFA 1PNCA 4Q56A 4GG8B 3UR5A 3UPWA 5E9NA 2JH2A 3UGUA 2ATMA 2BZDA 1U3ZA 2FGZA 4JL1A 2FZDA 3UTQA 2UY3A 1E6OL 4YXLL 5HK4A 3ULUH 2NY4B 1FJ1A 1XMEB 1NBQA 4S11A 4YGVB 3NEVA 1WWAX 3A0OA 4QGYA 4JRYE 2XUWA 2G2RB 3O4OC 1CL7I 2OLDA 5DLML 2IH1A 3RX4A 2VQTA 2JIXA 5K33A 4N8VA 3VOFA 1XM3A 5GJTH 3BFOA 3QC5X 4IIQB 2P3ZA 4FTVA 1QA9B 1R33A 3N9RA 3QZWG 4KNUA 4XPAL 3V18A 3TZNA 1Z69A 2DTSA 4XCNB 4NPYB 2VOMA 3ABQA 3OA3A 3FCTA 3QMRA 2BHYA 4XNBA 3FUJA 2CM6A 4PUEA 4Q4OA 4WDIB 2XISA 1KB5L 3OR6A 5GGUA 5T5NG 5XIMA 2FWOB 1L9RA 3EJYC 4RH4A 1QFWL 3D50A 4Y4KB 1C90A 2HTKC 2ZWZA 3V0VA 5AVRB 2AJZB 3BAYA 5IJVA 2NLJB 4X8JB 5F3HB 1EP1A 1W1PA 5JZ7D 2NYYC 1KTNA 4MSSA 1H3VA 1VFBA 1UWGH 4HBCL 1GOXA 2RGMA 5A6IA 4PJDF 3LUTA 2OMUA 3NCCB 2LU3A 3T1FB 5JA9A 1KBJA 4LUYA 4XBEH 4HKPA 5KJ4A 5DHVB 4KTEL 1QNZH 1XR8B 3IGFA 4K8RD 4CDGC 1FWEC 3FDGA 4RCXA 3IWVA 3L1OH 2H8PA 1T89C 1X6NA 2FQDA 2M83A 1OCRB 5BWAA 3PG2A 3QW4B 1LDPL 3B3IA 5JW4N 1XZ0B 4XP6H 3APCA 2VQ1B 1XLJA 3BVVA 1GVOA 3N1AA 1A2YA 4XH2A 1Z5LA 5TE4L 1ZJAA 4ERSH 5F8RC 1Y6NR 1LRQA 4YHKL 2P8CA 3H9SE 3BSGA 5AW5B 3FSTA 1KXHA 2EABA 4XNUL 2CCVA 1PMYA 2ZPKL 3FTUA 1VRSA 4EAMA 1NQBA 3S5NA 3BMWA 3RVUD 1YUHB 5JW3L 3ZR6A 1FHVA 4RNFA 4XXDB 3FB8B 1KLYA 1BEXA 3E02A 1U8OB 4WW2A 4F7CA 4F7PB 3P9LA 4OOZA 3BOXA 1YMMB 3OQ3B 2ZG3A 4NN7B 4UQBA 4ANUA 5FJPA 2KMWA 2PTTA 4PJBF 4QOKB 1KMGA 3AWOA 2E9MA 1MNUL 4MHHG 3SJVB 2BXZA 1B3YA 2J8TA 3H7UA 3DO3A 3WIHH 2XIJA 4HS8L 5D02A 3UH8A 1BYNA 4XP5L 3V5CA 2FHBA 2R1WB 1W5OA 2J7EA 5JOFB 4L1LA 4L3EB