1VAHA

Crystal structure of the pig pancreatic-amylase complexed with r-nitrophenyl-a-d-maltoside
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
publication title Crystal structure of the pig pancreatic alpha-amylase complexed with rho-nitrophenyl-alpha-D-maltoside-flexibility in the active site
pubmed doi rcsb
total genus 163
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1vahA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1vahA01
4PMOA 5HDRA 4TUFA 4WF7A 4PMYA 4BQ4A 3AXHA 2J77A 1KTCA 1PIFA 2YJQA 1XHGA 2FDMA 2WC4A 2YL5A 2ZX6A 1WAWA 1GHRA 3BUQA 3T09A 1B31A 3WF3A 1EA9C 1IV8A 5IHRA 2CITA 2EPMX 2Y5EA 4D6JA 2BVYA 4ZXLA 1E43A 4U5IA 1KR1A 2W62A 1MW2A 1BG4A 4GI9A 4TVDA 5EB8A 3APGA 4JFSA 3WNMA 3PZVA 4JKLA 1RD6A 5EFDA 2ZUMA 1FOBA 5C8BB 1EIBA 3CPUA 5CPTA 4D6IA 2WZIA 2XG9A 4PUEA 1GCYA 1F4HA 1E73M 2D3LA 5E1QA 2E0PA 2WZEA 4PTVA 4DO5A 1E70M 3KE0A 1QWUA 1J01A 2IXVA 3MSDA 2X0HA 2EADA 1XH1A 1PX3A 2EPNA 3VMNA 3FAXA 3MUAA 5D4YA 1W9PA 4CN1A 2G3JA 5A95A 1H41A 2FGLA 2EEXA 3UG4A 2VO5A 2JE8A 1UG6A 3MMUA 4W5ZA 3UG5A 1E0WA 4UFJA 3OZPA 1ZBWA 4PSPA 3WQWA 1VEPA 4AIEA 3L4XA 4MDOA 1W9XA 4FLSA 3CZGA 1UR2A 1E15A 4XB3A 1B30A 1GPFA 5FD0A 1R75A 2JALA 4M1RA 1E6SM 4RE4A 4AW7A 3NUKA 3POHA 2XM2A 2WVVB 1JD7A 4GZIA 1W9UA 1WDQA 1UA7A 3AI0A 2QF8A 1V3JA 1HKIA 3W28A 1ZS2A 2BY0A 3EJUA 3K8MA 3L4ZA 2ZUTA 3VGHA 2A3AA 2J7GA 2Q8XA 1JI2A 1KGUA 4LQ1A 3F4VA 3DX0A 3LPPA 3ZOAA 1U33A 2WBGA 2ZOXA 2WWCA 4PMVA 2DIEA 5I23A 3WNLA 1CGWA 4X9YA 4CVWA 5HPCA 4V2XA 3WEMA 4OBSA 1E40A 1VJSA 3WH6A 1SMAA 4JAWA 4LGXA 5E70A 1ZJBA 3VTRA 1EO5A 2PB1A 3WF4A 1QI4A 1XCXA 4P8VA 4Q22A 4FLOA 4FNTA 1GOMA 1UHVA 4M29A 1G94A 3AMDA 3EJTA 1UD6A 2DSUA 1LLOA 3BH4A 2CHOA 3KL3A 2VVSA 3CUHA 1JNEA 1W3HA 3L4VA 1HJSA 1H11A 5C71A 1WNOA 1H0GA 1B3VA 1KQYA 3PN8A 1OCQA 3VSTA 1HVQA 4CCDA 3GDBA 3AQUA 3DDGA 2E8YA 3SUSA 1EQCA 1EGZA 2J62A 4ZEPA 2WSPA 3CMJA 5LA2A 5CLTA 3D4ZA 1HJUA 1KQZA 5ABEA 1D2KA 2F61A 4OGZA 3PZMA 3MUIA 4CN4A 3VGEA 4PTXA 3GXNA 1IT0A 4CD5A 5JIPA 2VZSA 5FIPA 3E1F1 4P7QA 2J79A 1H09A 1UD4A 1TVPA 1IZKA 3AMCA 3UESA 4S3KA 4EANA 4M82A 3W6MA 1NM9A 1X6NA 2F7RA 3EJQA 1TR1A 4NI3A 1R46A 1AQMA 3S5ZA 1RP8A 2BXZA 1C90A 1HT6A 3BAJA 5M5DA 3OLEA 1UD2A 2VX5A 1B1YA 4UTFA 3WFLA 3CV5A 4WK9A 2VT0A 6CGTA 1CYGA 1X1NA 2X05A 3S5YA 1KBKA 3N9KA 3II1A 4W93A 1B0IA 1TA3A 4HOWA 3F5KA 3K4AA 1E4LA 4ACYA 1CZ1A 3M07A 3SUTA 1JDAA 3OLGA 5IXEA 1R85A 4W8BA 1UR1A 3BSHA 3OA5A 1ISWA 1JL8A 4J27A 4D6CA 1V02A 1BG9A 2ZX7A 5A2CA 2BY3A 5BYWA 1UWSA 2HISA 4HZ6A 5HOSA 1V6YA 4U3CA 1KFWA 1WPCA 3WY1A 4IPNB 2QPUA 1LQ0A 3PZGA 3VD3A 1L8NA 1NH6A 3WD2A 1OT2A 5A8QA 4AMWA 5BXPA 3RM9A 4W8LA 1UH3A 1VFFA 2Y2WA 3CGTA 3VILA 5A8PA 1MW1A 3L4UA 1GVYA 1VFUA 1E72M 1JDDA 1FFQA 1KXQA 3PBGA 4W8AA 2XWDA 4F9DA 3WDPP 5A2AA 4AD4A 1KB3A 3AJ7A 2CKRA 3VIOA 4B16A 5DFAA 2DGAA 1GOWA 4W7UA 2VR4A 3BCFA 2ZUWA 4QLLA 1E6PA 2W5FA 3GXIA 2PBGA 3BCDA 1CLVA 3OGVA 3IJ7A 5A94A 3HU7A 2J78A 2D1ZA 1C91A 2VOTA 2D3NA 3CZLA 4X0NA 2X8RA 3AHTA 1E4MM 1JXKA 1CDGA 3L4WA 4HZ8A 1UKQA 1CXHA 4EKJA 3HG5A 5A3HA 1LJYA 3VIHA 2GDVA 1QOXA 3TONA 3WN6A 3WUEA 2G8ZA 4AIUA 3SCPA 2GJXB 2PWHA 3WELA 4U31A 4LPCA 4OIFA 1MQPA 2UY5A 2WKLA 3N15A 2A3CA 2FHFA 3AMLA 3HG3A 3D5HA 4M81A 1J10A 4ACZB 2WK2A 1R7AA 4NRRA 3U7BA 2CBUA 1BQCA 1ZU8A 2O9PA 2O9OA 4M56A 4ZE4A 3ARRA 4L4OA 1US3A 3VDHA 3KLKA 1ZJAA 4URIA 1J11A 2WANA 3BUPA 3RIKA 4W85A 3F5JA 4AZ6A 3W6LA 3S6TA 5A8OA 2ZXAA 3AIUA 3FN9A 2XSAA 1M53A 3TOPA 3BAKA 1CPUA 2O92A 5A6KA 1G01A 2VX4A 4TVUA 3A22A 3TTSA 1OIFA 2C7FA 1NOUA 4QLKA 1GOQA 1R47A 5D9MA 2VQUA 2VZVA 3NYDA 1JZ7A 2VZUA 4CUCA 1WZAA 2DT2A 3UR7A 3SCTA 4CVUA 3ZT7A 2CNCA 8CGTA 1H5VA 2WYSA 2UY4A 3IK2A 4HOZA 1CGVA 2ALWA 1XRVA 3WH7A 5JBEA 3EDDA 2XIIA 4D6DA 2WLZA 1W3JA 4K68A 2VR5A 5BRPA 4MNMA 1Q4NX 3VMOA 2ZUUA 3WH9A 3ZT5A 3CZNA 2OWWA 2WB5A 1MWOA 2Y8KA 2VUYA 3SEPA 2YLLA 3LPOA 1SYTA 3HG2A 4NRSA 3VMPA 4AD2A 1M01A 1O6IA 1WB0A 2VCCA 4OUEA 2WCGA 1JD9A 2ZX9A 3KEHA 3LXCA 1E6RA 2VC9A 1JFHA 3LPGA 3GYCA 4JKKA 4WKFA 3AHXA 1QBAA 3FNDA 1LL6A 3I3BA 2MANA 4J3XA 2W4XA 5I77A 3WD4A 2WVVA 2A3EA 5ECUA 3DC0A 1B9ZA 1C7SA 4H8VA 2XUCA 1QNSA 2DPEA 3PTKA 5BCAA 2XN0A 3L4TA 3CZSA 1OINA 2D73A 3BVXA 4W7WA 2NSXA 2DT1A 3O2LA 4P8XA 3ZJ8A 1B3WA 1G1YA 1VBRA 4GIAA 3QOMA 1J18A 2W61A 3RJYA 9CGTA 3PZNA 4D6GA 1V3HA 1HTYA 4LYRA 2WLYA 1UKOA 3VDBA 4BA0A 3HN3A 4LX4A 4AIOA 1W2PA 4QP0A 3ALFA 3ARYA 4DWSA 2F8QA 1QBBA 2OW7A 3TV8A 2YOCA 2WMGA 2X2HA 4TOQA 1DWAM 5FOOA 1B2YA 3LXAA 4PUDA 4CU7A 2G41A 3NJ3A 1DWFM 5M03A 4ZENA 3VIFA 2X09A 1UD3A 1JG9A 1M7XA 3A21A 3WY4A 2WMHA 3D50A 4B9ZA 1MFUA 3THDA 4PCSA 1HKMA 3EDJA 3QOKA 2YL8A 3CMGA 2NW0A 1TCMA 1BAGA 4AZCB 2CESA 2J47A 2Y8VA 1AMYA 3NCOA 3RMEA 5M3WA 1NWRA 4H41A 4JL1A 2CIPA 3WD3A 1DWGM 2XFFA 3CLWA 4AD0A 4HA3A 1TQWA 1ISVA 3L2MA 4Q7NA 4WKAA 5I79A 4PRWA 4EE9A 2XYLA 3SCOA 1E6XM 5A6BD 1XSIA 3MMDA 4YHGA 4BF7A 3WNNA 3MUZ1 1DHKA 3VIKA 1JZ6A 1T0OA 3B8SA 4F79A 1GOOA 1VENA 3ZIZA 1UR0A 1JYWA 2GK1B 4J3WA 3CTTA 1C3FA 4UFHA 4MNJA 3QHOA 4N42A 3WNKA 1UQZA 3WIJA 4ZXOA 1OD0A 5ABHA 1OBAA 3ZQ9A 3G6MA 5A8MA 3AIRA 4QDMA 1V6XA 3AIWA 3FHAA 3OBAA 1EQPA 2DSVA 2WHKA 2WCSA 4ZFMA 3EDKA 3OG2A 3GNPA 3LRMA 1WDSA 5DF0A 2EPKX 2E40A 2VMFA 1HWWA 2YIHA 1ZBKA 1KGXA 4IISA 3BAYA 2WVUA 1BYDA 2DSWA 4QFUA 3DX1A 1K9TA 2OYKA 1J0KA 2YLAA 2JEQA 3VD4A 3VDCA 4U2YA 1V0LA 2DT0A 2BY1A 1O7AA 1NARA 3WQ8A 4WIWA 3VSVA 4Z2GA 2OW6A 1VEMA 2PF0A 4UQAA 3AROA 1WCGA 1I75A 4CCEA 2J74A 2PWFA 3H53A 3AIQA 1V6WA 4UQCA 3FAWA 3S2CA 1JZ8A 3MV11 2E8ZA 3UG3A 2WSKA 1B90A 1KXVA 5F7UA 4MPKA 5GPRA 4CGTA 5AC4A 4WLCA 1E56A 1JXJA 1F4AA 1UWIA 3KZSA 2UY2A 4HZ7A 3CUJA 4KH2A 1GZJA 2Z1KA 5CZKA 2DDXA 4FNSA 4UFLA 2DEPA 1GHSA 3VD5A 2WBKA 3GNRA 2RGLA 1UZ4A 1U30A 1E71M 3MI6A 2F7QA 3WSUA 1YHTA 1WDPA 4MJ4A 1FA2A 1G9HA 4QCFA 5A6AA 4KRTA 2J8GA 3WDRA 1HJXA 2YA0A 4HPGA 3ARZA 3B9EA 3VIPA 4D72A 1R8LA 4UQ9A 1OT1A 3BAXA 1R86A 5E6ZA 4GPNA 3VGDA 4DWSC 2BVTA 1JAEA 3EBVA 2CPUA 2WMIB 2GJXA 1TQSA 4PMZA 5ABFB 3A4XA 2WW5A 3RCNA 4ML4A 4AZIA 1FHDA 1QI0A 3SUUA 3LRLA 1TQUA 2D0GA 4ACZA 2FHBA 4P7NA 5M17A 4X0VA 4GZJA 1UD8A 3ARUA 3BVUA 3WMSA 1OIMA 4OBRA 3NSNA 1C8QA 4NSBA 4D6FA 2YDQA 3WY2A 3DECA 2WZHA 1KR0A 3ARVA 3CUIA 3OB8A 1TMQA 1C8XA 1Q6CA 2WCAA 5GNXA 4TX6A 1UASA 3IANA 1CXKA 1RPKA 1W91A 4KGJA 3SCUA 1H0IA 1TE1A 5JBDA 3EDEA 1QNPA 1HP5A 1UWUA 4JFTA 4UZUA 4GXPA 3A5VA 3AYSA 1J0IA 3BLPX 4HTYA 4AMCA 4AMXA 4JFWA 1VF8A 2V3GA 3OLIA 1HJQA 1CENA 1E5NA 1CXFA 1GONA 4QLJA 1ISYA 3WNOA 4HPHA 2A3HA 4MB3A 4BCEA 4FF5A 2OSYA 1O7DC 5CGTA 4NXSA 1C8YA 4GO9A 3W4RA 3N13A 3HG4A 3K1DA 5A6LA 4MNKA 1K9EA 3UEQA 1W9BM 2EBNA 3D52A 4EK7A 1KWGA 4B3KA 3AHZA 2AAAA 1PBGA 3A3HA 3U5YA 3N17A 3WDIA 3NSXA 1LWJA 3ARTA 1ODZA 1EDQA 1HP4A 5FCZA 1P6WA 2ZXDA 2VRKA 1CIUA 2BHZA 3WKZA 1CLXA 1QW9A 4GKLA 1UH2A 1BF2A 4OKDA 4E8CA 4F8XA 4V27A 2TAAA 2VCBA 2V3EA 4C7GA 2G3MA 3VDAA 1LL4A 2PC8A 2V38A 1GOIA 3VX1A 4TVCA 2ZX8A 3GH5A 2DH2A 3CHEA 4V28A 4HA4A 4CN6A 1CWYA 3LPFA 5D9PA 3QHMA 3ZT6A 2QPSA 4GI8A 2D0FA 4P8UA 3W82A 1LF1A 5KEZA 1FP9A 3UCQA 1JF6A 1MXDA 2WHMA 1UWRA 4HMDA 3FW6A 3WFZA 2X2JA 4U3AA 3DX2A 1CXIA 3W27A 3VU2A 4JHZA 5TD4A 1XYFA 5IFPA 5AYBA 4PTMA 4XV0A 1OGBA 3A47A 3JUGA 1JI1A 1E0XA 7A3HA 4PEEA 3W29A 5LA0A 1MXGA 1DEDA 1NWUA 2AMGA 3CIVA 1JZ4A 2YBUA 4WJXA 2FH6A 3LRKA 1BVNP 4C7FA 2XVPA 1E1FA 3N11A 4Z2KA 1AQHA 1W1YA 3ZJ6A 3LMYA 4J3VA 2EQDA 3WH5A 4PMQA 3GM8A 4IPLA 2UWFA 2WHJA 4MB4A 3WF0A 3J7HA 1E1EA 3TTYA 1C92A 3GTNA 1BYCA 1VIWA 4PMNA 1I1WA 1E4IA 5DT7A 3BUIA 1OM0A 3NSMA 1UZ1A 4PCTA 5AC5A 1CGYA 1MQQA 1WDRA 3W24A 4H8UA 4MB1A 2Z1SA 3SURA 4D1IA 3VGGA 5JBFA 1CXEA 3VSUA 1E3XA 4NZFA 3WQ5A 3SUWA 4S3JA 1GQKA 4OOUA 3OZOA 1EHAA 1GW1A 1OGGA 1JYNA 4MNLA 1PX8A 3THCA 5FL1A 1ESWA 2W91A 1XSKA 1MQRA 4N0RA 2F2HA 1UQYA 2V5DA 4E2OA 5DMYA 1UYQA 2QHAA 4W88A 2D23A 2YA1A 4FLRA 4FNUA 3VKKA 4UFKA 2GFTA 3SCRA 4OOZA 3L2LA 4UR9A 3WQ4A 3CHFA 1TVNA 2E9BA 3WUBA 2JEPA 3N04A 2VTFA 2OYLA 5A2BA 1DWJM 3AIEA 1LG1A 3MMWA 4U2ZA 2RGMA 3M46A 1UA3A 4H7VA 2JF7A 2VRQA 5GQBA 5E9AA 4QCEA 1Q6FA 2FE0A 4AD1A 3W37A 1QNQA 3W38A 3EDFA 3W81A 3AS3A 3DX4A 2BHYA 4HP5A 3PZIA 4D6HA 2CHNA 3CZKA 3BVWA 1HN1A 1UUQA 4YN5A 1W1VA 1H1NA 3WNPA 3GH4A 3MO4A 1BYBA 4KRUA 5EMYA 3GNOA 1HX0A 2W67A 3D4YA 1HJVA 1JGIA 3RPMA 1QX1A 3B9AA 2YKKA 2E9MA 1GJUA 2D20A 1EDGA 4BQ2A 4FLQA 2JIWA 2YDSA 3GXDA 1WE5A 2DH3A 1GVIA 1UH4A 4PMRA 5BROA 2CETA 3SIMA 1XYZA 2WHLA 2EPOA 3GXFA 4HA1A 1GQLA 4P7RA 2F7PA 4UQEA 1BHGA 4KMQA 1V3LA 2W63A 1YQ2A 2X1IA 3M6DA 4M80A 3A23A 3EJPA 3SCSA 4AYSA 3WUGA 3SCQA 4UFMA 5CPQA 2XN1A 1D3CA 1MYRA 2GSJA 1CGUA 4J3UA 4U33A 3K46A 1XD1A 5HPOA 1BLIA 2XM1A 4WKHA 3GXTA 3ARXA 3AYRA 4MAVA 4R27A 2DQXA 3VUPA 1ISXA 4PMDA 1HIZA 3AICA 3CZJA 1QI5A 3T0AA 3WUFA 1JAKA 2PWEA 4CD4A 3IAPA 2YL6A 1US2A 2ZUNA 4UOQA 2AOSA 5KZ6A 1WO2A 2YBTA 3L4YA 2JF6A 1NP0A 1D7FA 2WMIA 1SR0A 2VCAA 5ABFA 1TA3B 3DYMA 4UFIA 3AIBA 1BSIA 3K4DA 1CBGA 4RL3A 1XCWA 1VBUA 1XGZA 1HJWA 3VIMA 3DHUA 3EMCA 1CTNA 2VL4A 4HMCA 1UKTA 1TFVA 3ZR6A 3WQVA 3N18A 1W1TA 1SMDA 4TTGA 2G3NA 4CD8A 1NWSA 4GQQA 3D51A 1ITCA 2D22A 1PS3A 1H4PA 2XPKA 5A69A 4MJ2A 5JIWA 2NT1A 1TZ7A 1SFSA 3ZM8A 5LA1A 2X2IA 1QPKA 2ZX5A 3OLDA 4MB5A 2XHYA 2CYGA 3D3AA 2CBIA 4ATWA 1HXJA 4AISA 4PBGA 2ZXQA 5AYIA 1PX4A 1NWTA 4HU8A 3DYOA 1QI2A 1UKSA 5DT5A 1V0KA 4M8UA 1NP2A 1V6UA 1EH9A 4H8HA 1XSJA 4GINA 1XH0A 5I2UA 3WY3A 1PZ2A 3ZSTA 2EXOA 1PPIA 3ZMRA 2PWGA 1HKJA 2F1AA 1GQIA 5BWFA 2XVGA 4PMUA 1M04A 5C70A 4UNIA 3G6LA 1E5JA 4M24A 2ZWZA 3CH9A 1HL9A 4DUVA 2A3BA 1QVBA 4PTWA 1V0NA 6A3HA 3CHCA 5A8NA 2VX7A 1DWIM 2VRJA 1B3YA 1NOFA 1W9VA 2IXUA 5EBAA 1KCKA 1LG2A 1R87A 3B9DA 3VINA 1VFMA 1JZ2A 2O9TA 3WMCA 3GXMA 4JKMA 3BVVA 3CUFA 1V02E 4ATDA 1R33A 1JIBA 1DP0A 2WC3A 2VURA 3VNYA 1AQ0A 5A6JA 2XWEA 3WDJA 3POCA 1W9DM 3SCWA 3GXPA 3MKKA 3UETA 3M7SA 2WMKA 1ODUA 4A3HA 2XIBA 3I3DA 1FH8A 1DWHM 2VZTA 3VGBA 3ALGA 1BYAA 3RILA 3OIHA 2J7CA 1VB9A 4H2CA 1KWKA 1WZMA 5I0DA 3VOCA 2IGTA 1W2VA 2VVNA 4CU6A 3O9NA 2J7HA 2EACA 4B3LA 2ZWYA 1CNVA 3SCVA 2VZOA 2CBJA 2XJ7A 4IUGA 5E0CA 4DWSD 1E55A 3K8LA 3BLKA 2WNWA 2VJXA 4UQDA 3EMZA 2J4GA 4QAWA 4AZ7A 2BXYA 1QNOA 2O9RA 3N12A 4E4PA 5CGMA 1M03A 3ARWA 1WZKA 4DUWA 3MANA 1EHNA 3PZQA 3CBWA 1Q6DA 1PEZA 2WXDM 1EDTA 4P8WA 2QMJA 4LXFA 3WH8A 3A4WA 3U5UA 3DHPA 3PZOA 5I78A 2VQTA 1GNXA 2WWDA 1V03A 4AEFA 1W32A 4P7OA 3VM5A 2EPLX 1Z32X 4Z2JA 3VD9A 4AZBA 4NF7A 2YDRA 3WBEA 2Y24A 1R7OA 4NXKA 4W89A 5A1AA 4LYPA 1TQVA 3WEZA 3BAIA 1BGGA 1TQTA 2D24A 1HL8A 2F1BA 1CGTA 3MSGA 1GOKA 1X6LA 4RE3A 4AYGA 1KGWA 3VM7A 4Y7EA 4YPJA 1HXKA 3EYPA 1JYXA 2OSXA 4GI6A 2PI6A 4AZGA 4JCLA 4B15A 4JCMA 1Q6GA 3I3EA 3CZ8A 2DSZA 3WBAA 1U2YA 4AD3A 4CD7A 2NT0A 3WL1A 3WF2A 4BZYA 2QMKA 3AZRA 5IDIA 2F18A 3CC1A 4AC1X 3T2QA 1BVZA 3CZEA 3GBEA 2FH8A 2QV4A 3W53A 4DWSB 1GJWA 1CEOA 3SUVA 4C7DA 5ABGA 3WF1A 7TAAA 2CERA 1ZL1A 1V0MA 1KTBA 1PZ3A 3FY1A 2D2OA 4MAZA 1H3GA 2C0HA 1EOMA 4J28A 3IGUA 4ATLA 2WC7A 5DEZA 1RP9A 5HBFA 2BVDA 1BGAA 3BGAA 2V3FA 2BY2A 1WP6A 3VIJA 3WMBA 2E4TA 1XD0A 1UWTA 2X2YA 3PZTA 1A47A 2PBOA 1KCLA 1UD5A 4OZOA 3DX3A 3EMQA 3AMKA 2XTKA 3AZTA 4BQ3A 3QHNA 1BTCA 1LWHA 1JYVA 1EXPA 1EOKA 3CHDA 3SCNA 2W92A 1J12A 1NOWA 3MS8A 4AZ5A 2EAEA 1JDCA 1G5AA 4FNQA 2YA2A 1L0PA 3BMWA 4XZWA 3RDKA 2QLYA 3VIIA 3HJEA 3ECQA 2BV9A 3O6AA 1ISZA 2XN2A 3NDZA 1VJZA 3A4AA 3MV01 2V5CA 3FHQA 3WL0A 2WMFA 4Z2HA 3AISA 2D0HA 2VI0A 1QHOA 2W66A 1FP8A 3VGFA 2DSKA 3N1AA 3CO4A 4Z2LA 4KGLA 1KXHA 2ZUVA 3BUDA 4F9JA 3KL0A 4PN2A 5I24A 3KL5A 8A3HA 4MTVA 2WPGA 4UCFA 1FFRA 3ARPA 1E6NA 1OD8A 3EJRA 3ARQA 3FXYA 3ZSSA 1HNYA 1OWQA 2CBVA 2GJRA 3F5LA 1HF6A 3W26A 5I6SA 3AS1A 2DIJA 1QW8A 2XVKA 3AS0A 1XC6A 4UZSA 4DM2A 2BFGA 2X0YA 4DO4A 3RM8A 2FYVA 5CQ1A 1E3ZA 4BS0A 2OSWA 3UERA 5LYRA 3H54A 3AFBA 1B3XA 3IAQA 2OWCA 1K9FA 3MUY1 3VIGA 1W3KA 4UQBA 1N82A 1UR8A 2ESCA 4JIEA 4P7LA 3PTQA 2ZXBA 4AZCA 1JF5A 2WAGA 1FH9A 2DT3A 3TP4A 3AIVA 3OGRA 3HZ3A 1SZNA 2WVTA 3WD1A 3VX0A 5CSYA 4AD5A 2F7OA 3BC9A 5CSUA 1V3MA 2XVNA 2CCRA 1RH9A 4JL2A 3AXXA 3QR3A 3W25A 4DUXA 4CD6A 3PHAA 3WEOA 4AXNA 4EAMA 4CCCA 3BXWA 1UOKA 2ZICA 4JZ5A 2WKGA 1VAHA 1H49A 4HOXA 4H04A 1V08A 1QHPA 1V3IA 3NDYA 5I5RA 3BAWA 4WSJA 1J0ZA 2XFYA 1GORA 3NIYA 4J3SA 1E6QM 3AZSA 1I1XA 2E9LA 2ZIDA 4A3YA 4GO8A 5A6SA 2GK1A 4NZCA 4FNRA 4L4PA 2YFNA 4AWEA 2EO7A 3MU7A 4W7VA 1OB0A 4NZJA 3T2OA 2BS9A 1OGSA 1IZJA 5FL0A 2V3DA 4NX0A 5AY7A 3HMCA 1GUVA 3PTMA 4FK9A 4W5UA 4MDPA 1A3HA 1QHZA 4Z2IA 5CPSA 4J3TA 2J25A 2ZUSA 3BVTA 3TTOA 3VD7A 2B31A 2ZE0A 4KWUA 1R34A 2G4FA 2XVLA 1MFVA 5HXMA 1J0JA 2GUYA 1J0YA 4PYSA 1JNDA 3BUBA 1C93A 1QWNA 1TUXA 2C8NA 3OGSA 3EJSA 3WDHA 3VPLA 3KLLA 3H55A 2UY3A 1JFXA 5IFTA 2EABA 1PIGA 5I3DA 1K6AA 2YL9A 2BHUA 3QGVA 4UOJA 4GQRA 4D71A 5FKYA 2PWDA 4W86A 1J9YA 4W84A 1BPLB 2WMJA 2CEQA 2JFEX 3VNZA 1UKPA 1CGXA 1KBBA 3LX9A 3ZO9A 5E6YA 5CJ5A 3U7VA 3GH7A 3UR8A 4BQ5A 3AXIA 3K8KA 5A6BA 2OWXA 2GDUA 2E3ZA 4TX8A 1E9LA 3PZ9A 4E8DA 4RE2A 3T08A 1E4NA 1FH7A 3RO8A 5GNYA 4PSRA 1LL7A 4IM4A 1CECA 1ITXA 2GJPA 3BLBA 1V6VA 3LXBA 2OLHA 5BXRA 5D9OA 2XFRA 3T2PA 1XH2A 2Y4SA 2EJ1A 1WKYA 5EFFA 1K9DA 4XX6A 5D8ZA 1W3LA 4J7RA 2BNJA 1UR9A 2YFOA 4DM1A 1HKKA 4B9YA 2J7DA 3WQ6A 1MW0A 3GZAA 5E0FA 1C7TA 2G3IA 4CKQA 3GBDA 1B3ZA 4AZHA 1GQJA 1ZBCA 1JZ3A 1G0CA 3T0BA 5D8WA 4OJYA 3PZUA 3CUGA 1XV8A 7CGTA 4TXEA 1Q6EA 1PJ9A 4A4AA 1S46A 3AOFA 4HMEA 2CKSA 4F66A 3IJ8A 1AVAA 3ZR5A 5D9NA 2WVSA 1E0VA 1Y7VA 3T0DA 4JFUA 4R5EA 4WSKA 1VFOA 3VVGA 3WD0A 3DDFA 4PMXA 4TTUA 5HNNA 2JIEA 5IHSA 2IUZA 3WENA 1HVXA 4MADA 1MW3A 1ECEA 1WZLA 2J7EA 3VO0A 5BRQA 1DTUA 3RM4A 4JHOA 1W1PA 4ZE5A 5CG0A 1VEOA 4YHEA 4D1JA 2J7FA 5E09A 4XUYA 3TA9A 3U57A 5JUVA 3ZJKA 1BFNA 3W0KA 3AMGA 1ZB5A 2VX6A 4DO6A 1NQ6A 4U5KA 3BMVA 3AHVA 1UWQA 5GNZA 1UR4A 1VRXA 4LYQA 1QI3A 4AY1A 1V3KA 2CXGA 6TAAA 2OYMA 1H2JA 5BXTA 1JZ5A 3KWXA 2XSBA 2VNCA 3RJXA 3A24A 5DO8A 5CLWA 1QNRA 4W87A 3DYPA 2J7BA 1PAMA 4JFVA 2XGIA 5CXPA 3AS2A 1EO7A 2XGBA 1OSEA 4XZBA 3IJ9A 3ARSA 3AHYA 2J8FA 5BXSA 2WM0A 1J0HA 1ZBVA 3ZJ7A 1FHLA 4D6EA 1KXTA 1TG7A 3TTQA 2J75A 5A6MA 1E6ZA 2GVYA 2HVMA 3A6OA 1MVYA 4FMVA 3WDQA 3BSGA 4CU8A 4HU0A 2FHCA 4UOZA 1CXLA 2FGZA 4FNPA 4GZEA 4AEEA
chains in the Genus database with same CATH superfamily
3L17A 2H32H 4OF8A 2TMDA 1UG9A 3R94A 5EUKB 3BH8A 1KTCA 3CYVA 2JQXA 1GHRA 5HDBB 2WAHA 3WF3A 1IV8A 2EPMX 4LL1A 2TRHA 3UXFA 1FZKA 4CJ0A 2J8OA 4JFSA 3ESMA 4LSTH 1XWVA 1LUCB 4Y5XB 1JPEA 2J72A 5T1DH 3AT8A 3V4VL 2XG5B 5E1QA 3KE0A 1X7QA 5FXCH 1C16A 2BSCA 2OMVA 4PS7A 3WKML 1JTOA 2FL5A 2EC9T 1N7ML 2R24A 4IPIA 5CEZH 3IGAB 4WU5A 4JPKL 3MMUA 3WFHA 1WGOA 3V5DA 4PSPA 3B9VA 3QQ3B 2NY4B 4EPBC 4OCWL 4NQCB 2Q87A 4ONFL 3C9NA 1GPFA 3CN3A 2Y7DA 4C5ZA 4AW7A 1MF2L 1R3HA 2PYEB 2FVNA 1JD7A 4EWJA 3MJ7B 3VFWB 3E2QA 4M7JL 1TB3A 3HMWL 2EE0A 3MLRH 5JIQA 1KGUA 1OK4A 2AKMA 4R9HA 2IADB 4Z78B 4RW5A 3OB0H 4AHQA 2DIEA 5I23A 1E0OB 5E8NA 5ESAB 4KRPB 1Z9AA 1TOXA 1AJ0A 1ZJBA 4R83A 3WF4A 3LTPA 1U8KB 2PP1A 1R5WB 5D8JL 1SO6A 3L4VA 2XXGA 4P57A 2Y07L 5B39A 3MBWB 1BF8A 4CCDA 1NEZG 3MKVA 4PJFF 4UTTC 2EUXA 4AF0B 1EAOA 1BAWA 5IBLD 2KKQA 5ABEA 3W1XA 4TQEH 3Q65A 1SZFA 1NEZB 2VDIA 1C5BH 5I82A 1IT0A 5JIPA 3ALXA 3E1F1 3S97C 5HY9B 2H6PB 3S6OA 2VLKE 3UESA 2NW2B 2EXWC 5GGSA 4OFYA 4HHAA 3TXAA 2I26N 3NQIA 3Q2VA 1GYMA 3QYSA 4JB9L 1XLBA 1IGML 3UFIA 5DYFA 4MMXB 3RWFA 3I9PA 4N2GA 4ML9A 3BSHA 5DJ2B 3MRBA 4MZYA 4EXAA 5BYWA 1UWSA 3CQPA 3TCLA 1YAIA 3R25A 5K39A 1GZHC 1E5YA 1WPCA 3V9FA 4EACA 3LZRA 3QUMH 3FL7A 1HYSC 1PNDA 5JOFA 2ZRYA 2IPJA 3GZOA 4U6TA 4BUQA 2APFA 1RLBA 1LEIA 3CV6A 1JDDA 2BP3A 4B5EA 1WITA 3UZZA 2HT4D 3AJ7A 2PXYB 3CG8A 3VIOA 4B16A 3V4VA 3C60C 1GGBL 2W5FA 3AAZA 3FVDA 3N85H 4GNKB 4ZPVB 3QPQC 3NJVA 3VH8A 1XYBA 1JXKA 5LIWX 1CDGA 3G6JB 3X11B 1H51A 2FTYA 3QRLA 4YAQA 1GVOA 3ZWTA 2RQEA 1SNRA 1U8JB 2AKZA 4P2QE 1BQCA 3DGBA 4A2MA 3VNDA 1E6OH 3K91A 3CT7A 2WIIB 3GMPA 4IKKA 4W9KC 3PF2A 7FABH 1CD1B 5GZND 1NCUA 4G6FD 4R4FL 3W11D 3ROLB 1N8IA 3ZJAA 2XSAA 3TOPA 1T6MA 3B9KC 3F04A 1NWOA 5A6KA 2FPYA 4L1DA 4I7UA 4G9FA 1EJWC 1ILSA 4PRPD 1HI6A 2GBAA 1KFAL 4X22A 1BEXA 1DBJL 5C1MB 1NGZB 3W56A 3HPZA 1MLBA 4L1LA 4WI0A 1MDLA 5DRNB 4RX4A 4DQAA 1NGWA 1BX2B 4I8DA 2EO9A 5G4HC 5K2ZA 1DJIA 1TPVA 2VUYA 1CCZA 4X99A 3APMA 2AQPA 1JD9A 3KEHA 1RU9L 4LIQE 4XWGH 5E2VL 2WVVA 2ZOLA 4GUGA 3L7FB 3EOBB 3U9WA 3PTKA 2QSCH 4NLHA 1OWRM 5TQ2L 1YUKB 3WG6A 3XISA 4E41D 5H2ZA 3CCHA 5MHSE 1G84A 1YBQA 5IWLA 3VDBA 1AIZA 3FUIA 3BP7A 3HN3A 2CU9A 2I16A 3IS0X 5CZSA 3VQ2C 3LZ3A 4G8TA 2G41A 4EXBA 3SI9A 4L3AA 1UD3A 3G9AB 2ZRZA 2QVMA 3DFPA 2C9VA 1JTPA 2QJMA 4H83A 4DRSA 4HYRA 4N8CL 5DC4B 4BK5C 2NW0A 1NWPA 2NZ1A 4XAPA 2YK1L 4K38A 4Y9EA 1NWRA 3MNZA 1HCVA 1D7CA 1MVFA 3L2MA 2X4PA 4WKAA 1FXQA 2XYLA 4QG8A 5A6BD 4TVPL 1QFUL 2D7PA 1IE4A 3DG7A 1GIGL 9RUBA 4F79A 1AR1D 1XLEA 4GRLA 1I4FA 2ZOTA 2BNRA 3CTTA 1SUHA 4UFHA 5KJRL 1N55A 3G08A 2SFPA 3H2MA 2WM1A 3WNKA 3UTTB 2V9QA 1BQHB 5IMMB 1T2JA 2ZWSA 5CZ0A 1P0SE 3ZU8A 4R9XA 4K39A 4GSDL 3K71A 3VFUA 4GVGA 4PEKA 2ZC8A 2A77L 3BEWB 2X1UA 5E5LA 4JTLA 3IYLW 1PVHA 2XTJB 3U2JA 2RDTA 3SKMB 5B8CA 4RDBA 3M47A 1LGVA 5EBMA 2VLJB 4X7SH 4PJGB 1EZSA 5DJYA 3X1NA 3SD2A 2R1NA 3I85A 1M7OA 1H61A 5JPNA 5A6TC 3HM7A 4XSLA 3SRFA 2JCCF 3TT3H 1B90A 4DEUA 1FHGA 1T89C 4HQVA 1OTTC 1MHCA 2IWGA 1VACB 3FQYA 3D08A 1GGYA 2Z1KA 1J5OH 3VD5A 1KKOA 4DPPA 1SUXA 1WHOA 5K9KB 1UIPA 3B3BA 4U1HA 4AC4A 3WDRA 3MA9H 5IBTL 4HPGA 4JIRA 1J8HA 2C18A 6ENLA 1QPNA 1CFQA 5C0BB 1XINA 1JRHH 1MIEL 3S7GA 2R4SH 1TQSA 1AIFA 4PP1D 1UCWA 1BJ1H 5F4XA 2X0UA 4ZFOL 3QRGH 1GGIH 1CL7L 4JAMB 3LLDA 2IAMA 2AQQA 1AHWC 1OT4A 3N2MA 3G8RA 5EFIA 1JNNH 4OBRA 3PL6C 2JTYA 3P9LB 1WFMA 2YC1A 1CDJA 4ECLA 3WY2A 3DECA 3FTUA 3LQZA 3UBPC 4IRZL 4Z0XA 2XC8A 3WEXA 4H4IA 3MMTA 2HT2D 4N24A 5I3IA 1J0IA 3ELFA 1K7EA 5TPWH 5TF1H 4ICNA 5T9CE 3BT2L 2Y25A 1SGKA 4UZGA 1CLZH 3F7PC 4DQOH 2B4CH 1F6YA 4GYPA 3QEGH 3MV8A 3F00A 1PBGA 4APQA 4XMVA 1ODZA 4WRLA 5EIQA 1CDIA 1CCWB 2JFCA 2OMYA 3IS4A 5JLZA 3PTDA 5DD1L 4A2DA 3EJYD 1BBDH 2ICEA 5IJDC 2VXSH 1PLGH 3OKLA 2DZTA 4ENEC 3I7QA 4RNFA 4XH2A 1Q7QA 1W2KT 2MCG1 4P8UA 1BVLB 2A9CA 4U3AA 4FEZA 1CFTB 2ZKYA 4LVEA 1MCWW 1SN2A 3L6FA 4OTKA 3SBWA 1RVKA 3CIVA 3Q58A 5F9JA 3SJ3A 1E1FA 3W0WD 2EQDA 2ZSWB 3FFSA 1AD0A 1E1EA 1KDIA 5TH2A 1XR9A 4XD4A 1SFLA 4PCNA 1Q6OA 4QRPA 2NZ9D 1UYWL 3MLXH 3SDDC 3DMMA 4ICMA 3T6CA 2N4IA 3OGCA 3WLIA 4G72B 4NC1E 4MLRA 2VITB 1JYNA 3CFDA 3OJ2C 4O19A 2VFFA 4AM0A 5AFAA 2F2HA 2WHVA 5DFVC 3LB0A 4JO3L 3BSZH 4HHGA 5F7EH 1CR9H 4DKEH 4RZKA 3WUBA 1A5LC 3N04A 1W72A 2D2HA 4C8XA 2BRRL 1T21B 5T5NG 3MMWA 4F9PA 3OJGA 3VUAA 2ZJSL 3AU6A 4OLUH 2R82A 4FFZL 4HCRL 4XXWC 2NX9A 4B9CA 5SV4A 1D5BB 2R4RL 3ETTA 4PJFB 4ZFOA 3GU1A 2CHNA 3WLKX 4OLZH 3DOSA 4AIXA 3QDME 1XBXA 3GSNA 2YKKA 2D4DA 4IEFA 4GMSH 4FLQA 2YDSA 5DK0A 3THQA 2HKFL 2W0FB 5GJSH 4URKA 2BMBA 3VI3F 3ULUC 2RIKA 3DG6A 4P7RA 1BHGA 1Q1JL 5FV1L 3GFYA 1CUOA 3RGVB 3HHSA 5I07A 3DVNB 2CRIA 4G8IB 5BJTA 1M7UA 1C08B 2KZKA 4RNRA 2XM1A 3H42H 4PGLA 5JW4M 1ZMYA 3F2LA 1YECH 4L8SB 2PRMA 3PGCB 1LWRA 4JZJB 4TF4A 4F9LC 3H7BA 1K7FA 1JNLH 1NP0A 4TLTA 2OMXB 4NQSB 4E3TA 2KHAA 3CL7A 2DAVA 3NRQA 3ARGA 4J40A 4XC3L 2UZIL 2PGWA 4OLYL 3PG8A 3EMCA 3CVHB 2WZPD 2OR2A 3ZR6A 1SMDA 3LV6A 4N2CA 5E6IB 4NO5B 2XPKA 1QUNB 4MJ2A 5E56A 5DD0L 4HUWA 3C61A 3OG3A 5JA9A 1WAAE 5TF0A 2FX7H 4AQ1C 1RQHA 1TRIA 1RUKH 4AISA 2IPKA 1PX4A 1LTDA 5MKGB 4OD2A 3ANUA 3OC8A 5AYXA 3FSWA 3CIQA 4UT6L 3UEZA 1M7IA 1FFOB 1XH0A 5I2UA 4FEMA 3V7PA 1WICA 3GTFA 4Q4EA 1FV1A 4O8AA 8FABB 4XO5A 4LRNH 3BWWA 4KUZL 2W65A 2WSQA 4JNMA 4UQ2B 4UTMA 5HYJE 1E4JA 3P2DA 3O11B 2H26B 2R2EB 1OAXH 3LHPL 4GBUA 5C9XA 5FFLA 1JGUH 3MGTA 4KQ3H 2H3BA 1R33A 4EJ1C 4G1NA 2YYUA 3POCA 4NJAH 3QV8A 1I1YB 1ALDA 4ODVL 3SJVD 3MNVB 2J7CA 2KLSA 3TBYB 1IC5L 5DLLA 3G1AA 2EACA 2IQAA 5AZEL 4ONGH 1KJMB 1FYTB 1E55A 3GLDA 3SODB 5INDA 4Y9PA 5ANME 3W9EB 2XQ0A 3WJJC 4LFYA 1W0WB 4K94C 4QXGH 3WN5B 2YRPA 4WR3A 1XGTA 2ZKHL 3MANA 4HWEH 3C09B 3ALPA 4XP6H 4P8WA 2BG5A 2XSXA 3C2EA 4XZUA 4L3EA 4HNLA 5C0CD 4DXKA 5CZRA 3U6XA 2D7QA 4X4YB 4U1SA 2Y24A 3M5ZA 5B1KA 4W89A 1TQVA 1Y1UA 1KNWA 2HS6A 4E9WA 4F7TB 1HL8A 3EBIA 3F64A 4PV9A 5AYTA 2CA4A 4ODHH 1AZNA 3IJ6A 1KGWA 3VM7A 3QTGA 1A3RH 1JYXA 2PI6A 4R90H 2PO6B 5JDJA 1S5MA 1F86A 3SKJL 4JG5A 4FYTA 5FB8A 3NZUA 4AC1X 5JXED 1ZTXH 1T1ZA 4H6EA 3CE1A 1GJWA 3US9A 5I1LA 1UUNA 4ZCWA 1URZA 4DAIA 1XXDC 1H7PA 3QCUH 3BHBA 1HXYB 1V5XA 3QDGB 2FBRA 3KTSA 4ODBD 3PAOA 3RI5K 4XGZA 1U92B 2V17L 1LNUB 4K3GA 1BZ7A 5H6HA 5AB2A 3OAWA 4XVJL 3UGEA 3CHDA 4FN0A 5A43C 3P4OA 4ZMOA 4A8RA 3O0RH 3AYVA 1PEWA 1PDZA 3HC3L 4FNQA 3I9IA 1YEGH 4UT6A 3VOJA 4AZ8B 5DUPH 4KNQA 4MKMA 1WT5C 3LEXA 1KO0A 4EUPA 2GJ6E 3FCUB 3SN6N 4O1AA 4KKCD 3VE9A 1LQSR 3FB5A 4OZ4B 2VEIA 2PF6A 3VGFA 5FF0A 4ZFCA 1KXHA 1YDVA 3ARPA 2VN5A 4LCWB 1AH1A 3LZOA 1Z0NA 1HEJC 4OQVA 3FXYA 3LKSA 4DN4H 4Z76A 1IAOB 4DN3L 5I6SA 2VSMB 5FF2A 4HW6A 5A2KH 3WLPA 2XBDA 2F53E 3FYIB 4ORGA 4I5UA 3TBWB 4PJBA 4A55A 2FYVA 3BVNA 5CQ1A 3EXSA 5ENWA 2JCCB 2DQCH 3RNKA 1B3XA 5MEOB 2VXQH 2PPDA 2JH2A 3IRZA 4OFIA 5GIRB 2ESCA 4XZ9A 2HVBA 3UTQA 2B7QA 3TP4A 4KZEH 2WVTA 3SZ8A 5I9QB 3X2QB 1WBXA 4U4BA 5FECA 5D1ZC 4PRDB 1HH6A 2HJFB 2OXNA 4EIGB 2P53A 2ATPA 4OBTA 3URNA 4LGSB 5F93C 4JN2A 5L8KB 1YY8A 3T2OA 1MNNA 1TTCA 3N40P 5CC5A 5IJKC 1Z3GH 1FAIH 3L2IA 5EWIH 5EZJB 2WBJD 4NZ1A 2IH1A 3IF1B 3S35L 1A7QL 1AOHA 1S5HB 1W1ZA 1RQ5A 2ZUSA 2GYSA 4X6CA 3BIBX 4UU9A 3VI4A 2PP8A 1H19A 4E5XG 1N5AB 3ZLGA 4F2UA 2NQ5A 2YKLL 1IQDA 2ZWLT 4JPIA 6REQA 1J9SA 3M9YA 1AY1L 3AXKA 5HD8D 5D1XC 3U9UA 4AU0A 3STEA 3FDGA 3PWUA 1FWDC 1KC5L 4KHXL 3GH7A 5EOQL 2AS5M 4DKTA 3GFUA 3C8NA 1NFIB 4IGBA 2NX3A 1E9LA 2VR3A 3DENA 4WGKA 4L37B 2NY3D 3LQAC 4XBKA 3TVMD 4HS3B 1G69A 5BS0D 4NRZB 3AB0B 4WFED 5D8ZA 4MCYA 2BVOB 5G1MA 4BSWB 1U5HA 3AM8C 2CUIA 2FLMA 4A4AA 2QZRA 3ZHNA 4R5EA 2JQAA 5CPNA 4AQEB 1CI5A 2OZ4L 2DMKA 2G9KA 2P3ZA 3K2GA 3RX3A 5FO9A 4BQ9A 5KINA 4JFHD 3HC2A 2RGSA 3RDTD 3L81A 3W0KA 3ZZ1A 1MCWM 2XIDA 5C0AB 3EZ8A 1DQJA 2O6DA 2W07B 2OYMA 2XWBA 3TZFA 3KWXA 3FH7A 5EIIA 1XB3A 3SQBB 5D1QD 3CB8A 3NTCH 3KVQA 3GSVA 4UC5A 4JVPA 3K0YA 3UWYA 1O9ZA 4X4MA 4YVPA 4XZ4A 1WIUA 1FCUA 1TG7A 2P8BA 4CMMA 2PWUA 2KPNA 5FJTA 2QADC 4MYPA 1QR7A 1TRDA 1EGJA 5IB1A 4YX2L 2J77A 4JREB 3BUQA 3V52L 4GSQA 4WI9A 2Z1BA 3L95B 3APGA 1RD6A 5A8GA 3U2ZA 1UCBL 5I0VA 3LH2H 4NHVA 4KU1A 3VI3B 3QDJB 4UTWA 2ZXWB 3ERXA 2X1OA 1RUMH 3IRDA 1OAQH 3IDJB 4ERSL 6XIMA 1HNGA 4IHOA 3JT2A 5I1EL 4OR1A 1K7XA 1LRQA 4LSVH 1BTMA 3PAUA 2EJAA 4E9SA 3KR3H 5AL0A 3CWOX 3KPRA 3DXAB 1DN2A 3L4XA 3WV0A 3TIDA 5CFHA 1SY6L 1KM5A 2OX4A 5E00B 1KB5L 2DBLH 4JRWA 1OX4B 1AGBB 1AXTL 1WWWX 3G5WA 4GZIA 4Q4QA 1UA7A 4L4VD 1E5CA 2VDHA 3OX8B 3F7QA 4HWBL 4LK4A 4Y1SA 3LPPA 1H9VA 1PYWA 1E5AA 2ED7A 3WH6A 3ATAA 2FIQA 1W37A 4BUGA 4XCYA 4Q22A 1PCXA 1RHCA 2I60L 4RESB 5FUOH 4AE0A 1UD6A 3LBCA 4BFAA 3CUHA 3D3VE 1GPOL 2FRGP 3EJZC 3DDGA 1QBLH 1SLUA 4LLQB 4X5WA 2OZ4A 3JWNE 5BRZA 6FABL 4A2FA 5TDOB 3KBEA 2AJZB 2QULA 2ENYA 2UZXB 3W7RA 3DNKA 2X42A 1IZKA 4QXUH 4YH6A 5B1JC 4FJZA 4N2AA 3PWVB 2BS8A 2XZZA 1XR8B 4XCNB 4QRQB 3GO2A 4WDUA 4OIIL 3B8YA 4PJAF 4LCYA 4DVBA 1YRRA 3PP4H 2VISB 1LXMA 5KJ4A 3DFQA 2XSKA 1KBKA 2ZZ5A 4Y4KD 4IGMA 2CBTA 3QT2A 1JDAA 3ZKMC 1A3XA 3T1WA 3GRWL 2WZ6A 3RKDD 4UT9H 3CMOH 1D2OA 4IPNB 1NFDF 2J5LC 3PBUA 1QZ1A 5E2JA 3MTXA 3VOHA 5C2GA 2B4GA 3M43A 4Q9BA 5FSEC 3FFCA 2ZG2A 4WHYG 4NSKB 3UXIA 1P0KA 3KEDA 3VG9B 4HCDA 6ALDA 3T8QA 5LAXB 1JMZA 2J6WA 4Q8OA 4F9DA 1VGEH 5GJMA 4MRBA 3WJMB 4M7LL 1KB9J 3NCJL 4YWIA 1T03H 1JPSL 3FB7A 3MTRA 2DLFH 1HC1A 3QUXA 3PJSA 1FGNH 4XAKD 4DVRL 3JVGA 2Z7ZA 4U6VL 3WK2A 5JHDE 4Z7QF 4OIAA 1SY6A 2Y62A 4JY8A 1T5XA 1E0TA 3LN9A 4IMFA 3D5HA 2UY7A 2NCMA 3D33A 3WLHA 3REWA 5EORL 1ZU8A 3LZNA 3Q44A 1U5VA 3TOYA 1UACL 4LBAA 1LYXA 3A9IA 4ZZFA 3BZEA 4HC1H 1D9KA 3R2GA 4HWBA 3AIUA 1U8HB 1KELH 1AACA 1PE1A 3W22A 4EOWL 2OL3L 3L5LA 1HFBA 3WQDA 4BGLA 1O5RA 4YHIA 1HL2A 4JBSA 3KJ6L 2DT2A 3RWIA 5KVGE 4YLCA 5IB3B 1XRVA 4TIMA 1S3TC 3WH7A 4GS7B 5LGXA 1A7OL 1KTKE 1CE6B 2OPCA 1PZSA 5BRPA 4R5TA 3ZT5A 3IMSA 3BE1L 1RZ7H 4P5TB 2KQNA 1GW9A 2JKTM 4JR9H 1KJ2A 2E3VA 3KGSA 1T41A 5IQOA 5E2TH 2Z9TA 5DLML 1FL5B 1F4WL 4WWKA 4W7WA 3O2LA 4OGXL 3GNNA 1G1YA 2DWSA 3EKGA 2WXKA 5GGRY 4H1ZA 1E9IA 2E9WA 4WO4B 1TUFA 1R9FA 1UTDA 2ICWJ 3TO2B 2GBUA 1K3ZA 2FUTA 2NNFA 1PZ5A 3ABGA 3IJYA 4LX4A 5FO7A 4KDVA 4DWSA 4FZ8L 2XH2A 2H8XA 1EAJA 4LLUB 2AFNA 4O9HL 3M0XA 4DGUA 1M7XA 3ZY7A 4NCC1 4BFEA 3P30H 4IBUA 3D6GA 1Z9SA 1POJA 1KRBC 3HVDA 3S98A 3K7UA 1CMOA 4L6HA 4PJXE 2RDWA 2Z7WA 1XH3A 5JNYA 3PWPE 4YSOA 3UR2A 3WO4C 4OAWA 5D7JC 5D70L 4G5AA 4YHGA 3SGKC 1UZ6E 4I2XE 3FEQA 4UNUA 3UBHA 5HGHB 4R4ND 1DVZA 3ZIZA 3EWBX 3V0GA 1AGFA 4GYFA 3DX6B 5IG7B 4OKVB 1C5DB 5A8MA 3FN3A 1YA5A 4G6ML 4GBXD 4KX8A 3MCLL 1E4XL 4MWFA 1DEEA 4UB9A 2WSRA 1Q0YH 2NY5H 4INFA 2B59A 2CZNA 4NZTH 2C71A 3TLLA 1MUJB 5JIKA 4MD5B 3EXTA 2PDFA 4BZ1L 3CHQA 3GPSA 2HG0A 2OL3A 2A9AA 3VKJA 4W68A 4CGTA 1NELA 1F4AA 3WFCL 4Q4PA 4L9ZA 4GAJH 1GHSA 2GZXA 2X4SB 1DXIA 5KOMC 3W07A 3BN9C 3D0VB 3HI1A 5G2NA 3T0XA 1M57B 5G4WA 2DEXX 2G9HA 4UILL 2A3TA 4UMBA 4YHZH 3B3DA 1DVXA 2G97A 3KXFE 4M1CC 3U9IA 2D0GA 1I7TB 1XCQA 4X0VA 1NCHA 4FYQA 2J6EH 4EDXA 1BMZA 3NZHL 3W7DA 2YDQA 1NCTA 3DO3A 2V8LA 3CHRA 5JYLA 1BW8A 1RPKA 3T4CA 4TNVK 5D2NA 2ISDA 1H0IA 2AXJA 3TA3C 5HMSA 4GXPA 1EYEA 3E3QC 4UIKH 1E5NA 3HV8A 2VABB 1QEWB 4XNUH 4GABA 3O6DA 1B88A 1BVNT 4MNKA 3GUGA 4ZW7A 4XZLX 3QEQA 4FKEA 4JFDE 3I6TA 1HKLH 1ZS8A 1G4RA 1LWJA 3OKDA 5FCZA 3L5JA 3RWDB 4ZMPA 3P62A 4JNZA 2IMMA 4I89A 1NOLA 3S4SA 1PTAA 4GLRH 4TVCA 2X87A 2NY7H 1MCSA 3CHEA 2HMIC 1Q9LB 3UZ5A 1XLCA 5E7FA 1P1VA 2D69A 4GI8A 3UVAA 1VZIA 1UVQB 1I2OA 1A66A 3ABXA 2X2JA 3U6RA 4WY0A 5J5DA 4JHZA 3CLFL 3VRJB 1NCJA 4XV0A 1H8LA 3DIFA 3HN8A 5DGQA 2DWDB 1BLNA 2FJHA 2DU2A 1L2QA 4RGOH 2CJUL 4P3DB 4N2HA 4S38A 3FA3A 3W29A 1BCIA 4QWWD 4PI0A 1NWUA 4B9GA 2PDBA 3LRKA 4Z2KA 4GXMA 3WH5A 3CN4A 3O6KH 5ECGA 3PB0A 4TX9A 4LEFA 1LMKA 1CYXA 3LOWA 3F2DA 1CICA 5LIKX 1EEPA 5AYUH 4G56A 2CR6A 3TJXA 1DQQA 3UADA 3A0OA 3O6FC 2BODX 4HNOA 4RIRB 3UTZA 4U3XA 8RUCA 2E7LA 1ELSA 5IV2B 4N2FA 4L29B 4NUMA 3WJLA 2OMBA 5DZNA 5HULA 4M1GH 4C58B 4HJUA 1REIA 4R2GC 2EHHA 4FZEH 2NQLA 3ZR4A 4M5PA 3P40A 4R5VA 4FI7A 4DBDA 2G96A 4MIMA 1HKWA 4W70A 4G7YL 2Z31C 4M1DL 2Y7OA 2H1XA 1F8TH 3AS3A 5C0JB 4LHJB 1UM6H 4B5WA 4O50A 2CNZA 2YN3A 1AW2A 1FRGH 1JPTH 3PCYA 4ABVA 1OJXA 3Q6FA 2E9MA 3UBXG 3VD1A 4Z0BH 2L7EA 2JIWA 4ZW5A 1YN7B 3LGDA 4U1IB 1UH4A 2P8CA 4ZW8A 1EZLA 2EPOA 4UDUA 3CDZB 2HJLB 1UXMA 4PJAB 1ITBB 3ARDB 2F5BL 3K46A 1BLIA 5J7CC 1LK3L 5CPOA 2XNAA 4MZ3A 5LKNA 4DT2A 5CO1A 3LTVA 1XGEA 3AYRA 2IC2A 4LCVA 3ULSB 1E90A 1T1WA 2IQ9L 3TO4B 4CD4A 2A2QT 1PJWA 3VFGH 4CNTA 1HCYA 2YBTA 3AWFA 4GBXA 3TBTA 4LGRB 1NFDB 3GI8H 1I7ZB 3DHUA 5DS8B 5E9NA 1CTNA 4KVNH 1L2UA 1W1TA 3PNRB 1SM3H 3U2OA 2D22A 4X4ZA 3I6SA 2A0LD 5CC3A 4LSSL 2R0ZH 4BWWA 5KBNC 3ASWA 2B81A 3I68A 2BGNE 4IOSD 4Z7WE 3S5LG 2GCYB 4BRVA 3HE7B 4NN5B 1DE5A 4G9FD 4LCQA 1Q0EA 3FJ6A 1IAMA 1F42A 4DWDA 2FIKB 4MMWA 5IQMA 4EVNA 3ZSTA 2EXOA 1V51A 1XIIA 1GMEA 3T78A 1IC0A 3QUGA 3L7EA 3FOMA 4RX4D 5IK3A 3VFPB 4Z7QB 4B50A 2ZKMX 3CHXA 4WFGD 2PTWA 3WIHH 1NOAA 3E0IA 1DVSA 5LNRA 2QZ5A 1PNCA 4HN4A 5I1JH 1E30A 1CDUA 2CR3A 5TK2A 2OKOA 2BOLA 2XA3A 2QHLA 4CDGC 3LH8A 5GGVL 3NOEA 3QZLA 1A7RL 3EWWA 1LMIA 3OOQA 3TNMB 3KBWA 3WTXA 4KX7A 4LCSA 4TV6A 4FP8L 1I1AB 3FA4A 4MHBA 3MWCA 2WMKA 1YCSA 4OSUH 4OFPA 5B1BB 4UYQA 3LSOB 3ALGA 1BYAA 3WFBL 1CT5A 3S3CB 3SQMA 4HSOA 2I07A 3LKPB 3VOCA 4P9HL 3CB3A 4U0QB 2FR4A 3FT2B 1TQBC 2OI9C 4XX5A 2VDOL 4I18A 1QW7A 3AWNA 4LBUA 3QI9C 3M7WA 4OJFL 5J1TC 4XZHA 3GKAA 5IFHH 2YD9A 4QNWA 4FQHA 3QMTA 1ONXA 3N19B 5D2TA 4DUWA 3IPWA 1MFDH 3IFLL 4ZSUA 1OE1A 1H3TA 4Y5VC 4D9LL 5TE6H 3M41A 3JQOB 3H4WA 2F6KA 3A4WA 4J5VA 1GNXA 4YXGA 1LO5B 1DR9A 4Y4FC 2WUBH 3MPCA 2XU2A 1PZAA 5K4XA 2NRDA 3L3JB 4JLRB 3GIQA 4XNZB 4JTFA 3EAUA 5DUMH 2CLIA 4J5NA 4M48H 3EIFA 3KPOA 1SOQA 1KBGH 4GRLD 3ZDZF 4GI6A 4AZGA 4B15A 2BNRD 3W7CA 3BUYB 3CZ8A 1LEGB 3WBAA 2NSMA 3KYKH 3CVHH 2FSEB 3RLSA 2EDMA 7PCYA 5IDIA 3B4UA 1CEOA 1NF7A 3SUVA 5ABGA 2CH8A 1LO0L 2ALRA 1V0MA 1OTSC 3OVUB 2IOOA 5D9SB 4FIQA 4PP2A 2OJ1A 1JVKA 5T5NF 1W5NA 3SDCB 2BVEA 3WMBA 5ES4B 3EZ4A 4ZFZA 2GI7A 2HFEA 4GNJA 3RF9A 4OZOA 4EZJA 1BTCA 4OCXL 1QTPA 1DBBL 4LO9A 4PJXA 4W6XB 3INUH 1JXDA 3MC5A 5DHYB 4NUQA 4QRTA 2OB3A 1RK0B 4HLZG 1KFGA 5LGJA 5HJBA 4N85A 3ECQA 3B9OA 2ZCLH 5I8CB 5F7DA 2FFIA 3IRSA 2OSLB 3WL0A 4UUJB 3JZEA 3CYJA 4WX2A 3SFKA 2HDJA 4HNCA 1P4IL 2DVUA 4PN2A 4AEHL 5G4OA 2VWTA 1UWAA 1AW5A 1J8HD 3QIUA 4BQCA 5FEZA 3GB7A 2DIJA 2VIRB 1IGJA 4ZMXA 2HROA 1JXGA 2IAMD 1YRKA 4G1EA 2RBLA 2WY3B 3BLIA 4MG4A 2XKSA 5IBXA 5E24E 3O41A 3B06A 4QMEA 3UYOD 5HHOA 1SJAA 5DVKA 1VADA 1RSFA 3CPGA 2LT9A 4QRFA 1UR8A 1AG0A 3IVTA 3G3MA 5AAMC 4JTRA 4UDTB 1FH9A 1I8UA 2HRHA 5DUJA 3VX0A 3AY2A 3GIZL 2XG4B 3VWJC 5KUKA 4KROC 1SBBA 5EBWB 5J8LA 1LE9B 3T0EB 1H49A 3KBVA 1HDMA 1FWJC 1RZGB 4ERGA 3CFBB 4P5KA 1M05B 3UCCA 3FX4A 5IB4B 3MV8D 4NHUA 1J4EA 2NXYD 2X10A 4Y16C 4APQD 3CDGB 1EFXA 3L3IB 2BS9A 1YPFA 4R0LA 2V3DA 3FJNA 4REQB 2DJ4A 3KXFA 1K70A 5ID0A 3LKRB 4ODTL 4KNSA 3L3KA 4TVPD 5HXMA 2GUYA 1VJIA 3WLWD 3DI1A 4IOSA 4LY4A 1ZLUH 3H2WA 3TQVA 4S1FA 5DI8A 1HZLA 4WVXA 4HX1A 4F92B 2A7NA 4MSSA 1ADWA 4QR7A 1BPLB 4JFOA 4O02B 2JFEX 2QVNA 2P5EB 3U7VA 4GJIA 4JICA 1Z42A 4JGJA 1IKOP 3AXIA 2D2JA 2ZOOA 5AW9B 3J8F7 3RFZB 2GDUA 1DVYA 4MZ8A 3RO8A 3R79A 1J05A 4BZ2L 2AAMA 1H8NA 2Q3OA 3U4BH 4GD0A 4KPHL 3MV7B 5EFFA 1WKYA 1K9DA 4QRPD 1U3HB 3DMMD 3MR9B 3GGWA 2J7DA 1C7TA 1OLLA 3KPMA 4O53A 1S7VB 3D18B 3P81A 4OCYL 1GQJA 1RIHH 1JGVL 3GD6A 1RZIB 1IBGL 1URLA 3U30B 3PZUA 1AJ7H 1JPIA 1PJ9A 3H85A 4HMEA 2CKSA 2WVSA 3O45A 4JDVB 4XNMA 1ICSA 3WENA 2N1KA 1QVOA 3KPSE 3RM4A 1WA2X 1VZGA 4XBPB 3CK0L 5C0DA 3HB3C 2VDKH 1HHIA 4AW4A 1YN6A 5DD5H 4JE4B 2TPSA 1XIGA 3HMJG 5K9JL 3FT3B 1QPOA 1JN6A 5CCKL 2ATMA 4XTRC 3C5SA 2VNCA 3T1FA 4I13B 5CXPA 1EK3A 2XGBA 1UZHA 5G55A 5CAKA 3WIFB 5AHIA 5DRZA 5EBUA 1GOXA 3PY2A 1FO0H 3CFKA 2EZ0D 3P4NB 4OZIA 4GI4A 3EFFA 4NRYB 3PVFA 1TV3A 1YEIL 1K5NB 1R2RA 3OG6B 3DXIA 1TVDA 1F6KA 2CO7B 3GFZA 2QKFA 1TWIA 1JTTA 4Q6KA 2YQ3A 1IVTA 1V7NL 5D04C 3U9PL 2CITA 2IPUK 1CURA 4IYKA 4ZXLA 1L9NA 2GQ3A 3QORC 4R7WA 3ARGD 1DQDH 3KVPA 3H23A 4Q7IA 4HEPG 2ADGA 2IWFA 2D3LA 1UWFA 2BSSB 3VMNA 1KPUB 1B4JL 5D4YA 2G3JA 3ZGIA 5F7WC 3ZW3A 2CW6A 3WJSA 2W9EL 1VC4A 2VLRB 4QT5B 5DR5H 3RVVC 3T2NH 3S1WA 4JFEB 4RGMC 1VEPA 2J1WA 5I19L 1IILE 1USZA 1HESA 2CPCA 1IT8A 4PU2A 4HUUB 2L8AA 1JF1B 3VXQA 5AN7A 2AJYL 3QEHB 3W74A 3SOBL 2NVAA 4RBPK 3AI0A 1W72L 4LS2A 3DBXA 3W28A 3VXMA 2A3AA 3NXLA 1JI2A 4KFNA 4BZ2A 1PWLA 2C1OB 4FERA 4QS6A 2CLHA 3K72B 3EPOA 3QHZL 3BW3A 4AG0A 1VZWA 3VQMA 2YS4A 4X4XB 1ENUA 3KLDA 2D3JA 4HH8A 1T2QL 3R7MA 4FNTA 3GSNL 2J2ZA 1QUPA 4JEJA 5C0QA 3DHFA 3UG8A 3MJ9H 3LKOB 1OCQA 2A74A 4ETQB 2KH2B 1H1ZA 3BQ6A 5HJ3B 1EGZA 2QJNA 3UGXA 3N6HA 1ZA3B 4HUVB 1J2BA 3V16A 1GYCA 2ARJA 3NPSC 3BW2A 2DZXA 3SO7A 1KTLB 5FIPA 1W0VB 3GSWB 3RWJB 3DGCR 4P5UA 4CLMA 5BU6A 1RZFH 4MXVF 2FEEL 1PIIA 4ZTXA 2WCPA 1OAYH 5BZZA 1AQMA 1AQFA 3RGTA 1F05A 3H2PA 4MCZA 3R4DA 3HCVA 1CQKA 3O3DB 4Q4IA 1YDPB 2ISWA 4L3ED 2X7WA 3DUUA 1R3IH 3TYEA 1T04B 1LP6A 3DV6B 4ODUB 1CFMA 2YAFA 3QUKB 4P2RE 1SSDA 5IQ7H 1KFWA 3ZKXC 3KWWA 4EBQL 4MUZA 2Y2WA 3NRPA 2Z2BA 3JUYA 4MAYB 3UGUA 5MHSD 3SPIA 4FNLL 3L16A 2CUHA 3BQUB 3NIFE 3TNNA 4W8AA 4XI5C 5IVOA 1IBYA 1Q8AA 4H9YA 2C3WA 4M7KL 4ANXA 4F0LA 4WSHA 3N1PC 1QACA 3A12A 2YLHA 3Q6GH 4P23A 1Q72L 4O58H 3PBYA 5KBKA 5EV7A 2D1ZA 2PW2B 4H5SA 2EIDA 5C5YA 4PAZA 3UC2A 1YMME 1IGIH 2QVFB 1MZHA 5GS2H 3VB9A 1QOXA 5JUEH 2GJXB 2Q76A 4EPKA 2BRQA 3ZDZB 1QQDA 1J10A 3Q05A 4LBRA 3ARRA 5DUBA 3DO7A 4HJWA 4IBLT 4DEFA 3B6SA 2Q8ZA 3RIKA 4LL4A 5CBEA 3GZQA 5I76A 2G2NA 4QY8A 3IPFA 5FV2A 1MI3A 3OR7B 4QOKE 4CVXB 4N26A 4RQQB 4MKTA 2BCKA 3F62A 2OR9H 2FTPA 8CGTA 3APYA 1CZ8H 3IXAA 4B95C 4KJQD 3GMNB 3E8UH 4B9PA 2Q8AL 4UQ3A 3O6LH 1K4DA 1G9MC 3MRJA 4NZRH 3CZNA 1NVMA 3LPOA 1GS6X 4NRSA 3RL1A 4LIQL 1XZWA 3PG2A 3HAEA 1E6RA 4X7EC 2WQDA 4L1WA 2V69A 1KIUB 2VLKA 1N7KA 2OODA 3HZKB 3UTSB 5SWUA 1A4KB 4I3GA 5AVRB 1A5NC 4AUUA 2YEQA 3UDWC 3ZJ8A 3W2DH 4XBGA 5CUSH 4HUMB 4WWPA 4HKBA 3VU1A 2PAJA 1S7RB 1M71B 3RJYA 5DEJA 3VVWA 3FU7A 4YGVA 2WLYA 1KUMA 5E0QA 4JKNA 4U1LB 3BWUC 4Y9CA 2OW7A 1OTUC 5DY3A 1OWWA 4U3SA 4IIHA 4JFXA 3SPGA 3F5WB 1QBML 4RZCA 1F3EA 2K7PA 3GMLB 3A21A 1EX1A 5IJVA 3MA7B 3PDOB 1WQ5A 1TQXA 1Y5XA 3N2CA 1UJ3B 4XNXH 4PUUA 2FJFB 1AZ2A 4WHYH 1AQDA 3UWUA 4FG0A 2CESA 4YR6B 2QSQA 1Q0XL 3QNYB 2R1LA 2ZSVB 4BSJA 1BQLL 1U58B 2YSTA 4X6FB 4HTBA 4IGBD 5J9PB 3JTSB 4N2KA 1DHKA 3AAMA 2CGRH 2IVFC 4NQ1A 5ALBL 3ZKNC 3VCLA 2X4QA 4P46B 3FUJA 1DCLA 1GEQA 3FEMA 3UD6A 3PDGA 5KYXB 2DSVA 3LMJL 4KKAD 3IDNA 1OP4A 3KTCA 1CFSB 4P2QA 3L5IA 1D5IL 4QTHB 5BMFL 4IIQB 3SBRA 1RFDL 1TV2A 5H35A 1A6WH 2J8UF 3V5HB 1X38A 3B7RL 4O5LH 1TYJA 4AVJA 3MJGX 3TBVB 4S11A 2JTDA 4OD3L 5H94B 3DK0A 1UWGH 1JFQH 4R84A 2BPBA 4A7GF 2JK5A 2AJXH 3QC5X 4K8GA 1ME7A 5FKPA 1QAPA 3KZSA 2P8PA 2UY2A 2V7NA 3CUJA 2HSAA 3MRMA 1KTDB 5FR3A 1T3FA 3B3IB 4BFOA 3PWNA 5LHEA 1I8LA 3RVUC 3D0LA 5MI0B 4U6XA 3NP3A 2NR6C 5TQ0L 3ARZA 1L4IA 4LSRL 5ABFB 5AQ0A 2P47B 3SCMB 2R7EB 1ONEA 3FCSB 4MA7H 4P7NA 4N7QA 2BP8B 4GZJA 1MEXL 1OIMA 3U0PA 4ZB5A 3S96B 1C8QA 5F2FA 3THML 3B0XA 2WYHA 1KR0A 2I17A 4F2EA 1C8XA 4WGXA 4O1BA 4NAJA 4S10A 1TE1A 3L1FA 1UWUA 3L54A 5J56B 3LN4A 2V3GA 2JVUA 3LD5A 1XO8A 3WNOA 4L9LC 3LIUA 4BCEA 3BSMA 2JJSA 2OSYA 4UV7L 5CGTA 4GO9A 3QIWA 4FA6A 2X4RA 1A6AA 1TJMA 3MRKB 4K4KA 2HV5A 3KS5A 2HZHA 1CF8L 1BPVA 3ABLB 4RWYH 5GS3A 5B1CA 1JXFA 3US0A 3W7PA 5CJMA 3L5AA 4Z1AA 1U8PA 3E2HC 3U5YA 3HPLA 3N17A 4OB5H 2P49B 4RMRA 3KPRD 1PKQB 3GNXA 1HP4A 3T3MF 3KRZA 2GSGB 1XF3A 4IRSA 1TPXB 5ISZB 1TDQA 3GD1C 1S7XB 4F8XA 2QHRL 4ONHB 3HC0A 4LEOA 3WE6A 5I30L 4IICA 3MXVH 1MJ7H 4MZIA 4AWTA 4FQ1H 3D34A 3SE4A 3T6XA 1OIOA 2WGNB 1Y5VA 2RDUA 4PRTA 3A47A 3DX7B 3MNWA 3BP4A 1E0XA 4KXZI 4LLMB 4PEEA 5KBPA 2FB3A 4QRSA 4HJJL 5BO1H 2VWEC 2VDKB 4I4WB 1X9LA 2B5IB 1MCHA 5F2IA 4Z8FL 2XVPA 3L13A 5JORB 5FKAB 4MB4A 1VQTA 3TPUA 3QC3A 2FB4L 2I7GA 3GK0A 4BJHA 3TLRA 3P5ZA 1XYAA 5BRZD 1LZOA 5H2BA 1QSFB 1MJ8H 2PYFB 1TV4A 1AKJA 5BVPH 1E3XA 3SUWA 1FO0B 1UADC 4NNPL 4H6QA 1T20B 3IIPA 2IQTA 5G2WA 1IQ8A 1EGJL 4A2LA 3ZGHA 2XV6B 1KT2B 5AW6B 2F58H 1VCGA 1EWDA 4GKOA 2F54B 3FQNA 1KD0A 2YBRA 4Z08A 3LB6C 1EJ6A 4LNVA 3WKNA 1Q6FA 2NQJA 2Y6SD 2EVFA 4X9IA 5CGYC 2DWTA 1O6SB 5DS1A 3QSKB 5CF3A 4GW4B 2FJGA 3H3PH 5EMYA 3M1BA 4S0SD 4OVVA 1HJVA 1AZCA 1C5CH 2UZYB 1R24A 4Q2ZB 2FPVA 1GJUA 4E5XB 3LRHA 3B8UA 4WWID 3GXDA 4PB0H 1HOCB 3FFCD 3QC0A 2WHLA 3GXFA 1QLEL 1YQ2A 4S1QH 3EWCA 2RALA 3M6DA 4M80A 5F3HA 2AQTA 2AGJL 1MHHB 4TSBH 2AJVL 2XQYA 3SSGA 5KSUB 2V5JA 1QSZA 1BF5A 3LDVA 3TN3A 3HRZA 2WNZA 2A1WH 2ADIB 1US2A 4UOQA 1BVOA 5ICXB 2JF6A 1SR0A 3QUXD 4UFIA 3EO9H 4OLXL 3IUHA 2R59A 5DHVA 3S83A 3UZVB 5EZLA 1CB2A 3XIMA 3GU9A 1NWSA 1V7AA 4HBCL 5JIWA 2Y3AA 2NT1A 1SFSA 1R17A 1D9KD 4KBPA 4PUBH 5IY5B 4I77H 1CU4L 4O11A 3U79A 3LN3A 4PWGA 3MCNA 3O9WC 1XMEB 4YGAB 1RY7B 2YSSA 5KUMA 4FXKC 2HPMA 4A22A 2NX1A 3MRCA 4AJVA 1UB6A 1HKJA 4R7DA 1TELA 2EXTA 2X6CA 3CPLA 1FN4A 3GIVA 1XF5A 3FQUA 3KHQA 4IMKA 1KYDA 1BZOA 4ZRGA 5EO9B 2VEGA 1RJYA 2DQGH 3T04D 6A3HA 2DMHA 4UM9A 3CHCA 5A8NA 1S3KL 3JV4B 4EN3A 3BZFA 1B3YA 1VHNA 4K9EL 4BHUI 1TTFA 3B8IA 3VFLA 3AXMA 2YCKX 1JWUB 1U8IA 1MAML 3HE6A 3RY5A 4TTDD 4B5TA 2WKOF 4K7PL 4R3SA 5LWYL 1SZEA 1EXUB 1Z1WA 3HHMA 3K1KC 4IFRA 4WWKD 3EW3B 4WTXA 5J1AB 4I0PA 1HL5A 2AERT 1R1CA 3OHXA 1A8ZA 4FXGA 1M42A 4M3PA 4QOKA 2EE2A 1XHHA 2ICCA 3Q1SL 5CZJA 4N2NA 4DWSD 4YXKH 3TN0A 3WUWG 1FE8L 3FO2B 3QDMA 2CRMA 1QNOA 3JR2A 5C2BL 2R1XA 2M83A 3I6GA 1MCOH 3ARWA 4PV8A 1G4MA 2WNQA 32C2B 3H9SB 3WUWB 3QVAA 1A5OC 4PV1C 5AAPA 2O72A 3ATZA 1A9BB 2DQFB 3DUGA 3U5UA 2V5TA 5DK2B 3HFML 4IBVA 3BDYH 5TGBA 1V03A 5LG6A 3UMTA 1PG7W 4R26H 4IU3B 3P60A 4LYPA 2YD4A 1HFUA 3WEZA 2NY2D 4TNEA 2FUQA 3TZVC 1GOKA 2FLBT 3CWNA 3CDFA 1NAML 4WY7L 2Z2UA 4M0XA 4AD3A 4L3FA 3ABZA 4WV1C 1FRBA 4ZAKB 1E4HA 4KHTL 4HSCX 3RPDA 3S37X 4ADSA 3FY1A 2D2OA 3PPFA 5F3BB 4H7ZA 3IGUA 4DI8A 2B16A 2V3FA 1WAAA 1QNZL 2Q5BA 2WINA 5EMMA 5EMUA 4G11A 3SE3A 1HZYA 1QFOA 2ZRVA 3SIKA 2PBOA 2PABA 3EMQA 1KJ2L 2GT9B 2KDGA 2FEJA 4XN8A 3HA0A 3A6BL 5IJBC 4PJIE 4EI5B 2HMCA 3FHQA 2N59A 4B91A 1U2HA 5ICZA 1I6NA 4XG1A 1T1YB 2ZUVA 1OB1A 4UAOB 3F65A 4W9JC 2VXUH 4E8GA 2CDGB 5HYJA 3QMSA 2XGZA 1WXZA 2HX8A 3HV9A 4JKWA 5DVNA 2ORBH 5KVFH 5HGBB 4HU3A 1BWKA 1LE5A 2J8UB 3AG2B 1OARL 1WBYA 3CFIC 4XVUC 4PR5A 4ODWB 3ZVIA 1ASQA 5H4ZA 5DCBA 5AKSA 4S3DA 4JDZB 1S78C 3D2UB 4QHMA 1YTDA 3K5SA 5LYRA 1VFLA 4LCCA 4OZFG 5BVJA 2NWRA 1ZRUA 2YXGA 4Z7VE 1USQA 1P7HL 4EAEA 1HZHL 3SGJC 3BC9A 3G7TA 4LNRB 1KIRA 5ANMA 3W25A 4O00A 4P59L 2YO3A 2Y5TB 1PSCA 3WEOA 2P7TA 2A6JA 4WHTA 1KYAA 5JZ7C 3T40A 2VFGA 4JZ5A 1LORA 1Z6JT 1ACXA 4LH8A 4GRMB 1P1ZB 3AZSA 2E9LA 2CIKB 4GO8A 2NXZC 4RW3A 4B5NA 5EZOL 3QEQD 3MU7A 4JTKA 5IIEB 2HRPH 3EEGA 4M6PA 3P73A 5EO0B 3WBXA 1QZNA 5GS1B 4J3TA 2J25A 4HNTA 3VD7A 4HFWB 5A6IA 3EFOA 2Y1ZA 4XXCC 3OJDB 2Y88A 3RWGB 3QS2A 4V15A 3EGDA 1NLDL 3EJSA 3WDHA 2CXKA 3WTVA 3RI5F 5EZIH 2JB6B 3QGVA 1NAMA 2BSRA 2FX8H 3RFAA 4PG9A 3PPEA 3VNZA 5AD0B 5HHPA 1SLVA 2PP9A 3GSXB 3O2VL 2V5SA 1X5HA 4MA1C 1E3FA 3D3FA 1DJNA 5T3XE 3L66A 2PD9A 1Z8AA 2IPUG 4KDTA 5BQ7B 2F6UA 3T3MB 1S6NA 3X12A 3JTBA 3GUWA 2QCMA 4EI6B 2VC5A 1F5WA 3LS5L 5C55A 4X6DF 1CICD 3T2PA 1M9SA 1W3LA 2EINB 5FHAL 2KL6A 4ZMQA 1U8LA 4PB9H 4HLZH 2BOBB 2NXHA 4RJEA 2GJ6A 4TUKH 1RMFL 4JFFE 3XINA 1PZDA 3WNIA 1VFOA 5FYKH 4DAGH 3F85A 3NP4A 5IVNA 5HNNA 1I1FA 5D6CB 1G7PB 1OAJA 4G8GB 2Y3NA 5ALCL 1EZUA 3PHOB 1MFMA 3SDOA 3NZQA 2NTFA 2ZCKH 3VFSA 3ZIMA 1XIWB 3W39A 1U1HA 2F53A 2R2BB 3Q2WA 3TYFA 3VXTB 4XNYL 5FFGA 5DZOA 3RAJL 3QFDB 2MQ0A 1QI3A 3ABKB 2ZOWA 1QP1A 4UOW1 4E42B 3RR4A 2XV3A 3RJXA 2H2PC 3D9AH 2J7BA 3RB5A 4XZBA 3ARBA 3IJ9A 5CAYB 2PDNA 3AHYA 1FWSA 3SKUD 4Z7NE 4ZI8A 4LFHG 1D6EB 2CWRA 4ZL1A 4JANA 4N8UA 5EU7C 2WYIA 2DZBA 4GAFB 5AYYA 5G5DB 2A4ZA 1Q5MA 2DY2A 3IU4H 4AEEA 3ZL4L 3DGGB 5HPMA 2QGHA 4LDOB 1XHGA 4DP6X 4E2BA 4HVXA 1WV7T 1B31A 2Q10A 2CG9X 4AGQA 4JN1L 2BSTA 3RP1A 1G7JB 2BVYA 2P26A 2W0UA 5IGXH 2XINA 4HS6A 5IROA 2EILB 2QKIC 1JNJA 1A3LH 1XCTB 3STGA 2CIIA 4PUEA 3E12A 3ZDYE 2E0PA 3MVSA 5D71L 3LI0A 3KJ4B 4PTVA 1MFAL 1ZSXA 5EYWA 5GS0L 5C6PB 4O02H 5DTFB 4ZXBA 4Q7DA 5A95A 4PGDB 1J5HA 2EIZA 1PCKA 3KBJA 1DJZA 1J9TA 3UG5A 2Y7EA 1E0WA 2DLGA 4UFJA 4XD3A 4X50A 1G0XA 4MVAA 4XBEL 4BFNA 2NPLX 4MDOA 5DD6B 4FLSA 4X9BA 1R75A 2R1WB 1OM9A 3HQNA 4TVSa 2QNEA 2XPGA 3N0AA 1V3JA 4E9LA 4GZ7A 1CD9B 2ZUTA 3QJUB 2J7GA 3EHBC 3F4VA 4V1YA 3FDKA 3AZUA 5HGAA 3WNLA 4X9YA 1ZP4A 1I3GL 4OJEH 3FTGB 1ESOA 1NICA 4FD0A 4X5LA 3IKCA 1BRLA 4MXWH 2QJDA 5DJ0B 1GOMA 3AMDA 3EJTA 2Q01A 1SEQH 2VVSA 1M7DB 4E9YA 1YUHB 5CBAA 1H0GA 1B3VA 2X5PA 2J20A 1HVQA 1SEBA 3PPHA 3GG1A 2GQAA 2I9LA 1FHNA 4K8EA 1KQZA 3W7MA 1MJUL 3JW7A 2AV1A 1L6FA 4WAFA 4IMLA 3COOA 3B8TA 1TJXA 4A37A 3P3YA 2HWZH 1MEIA 3B34A 1UFUA 4EANA 3AQDA 3FPXA 5CJNA 4JJ5B 2YEZB 2H3DA 4Q9CA 2V68A 3BAJA 4U4MA 1QO3A 2X9ZA 4KJYB 1P5UA 2X05A 1DE4A 1Z7JA 3AU2A 4AYBA 2X3AA 3KYNA 3QV9A 1DDHA 2EDBA 1Y6MR 3DROA 4XPBH 1OC6A 4W8BA 2HVJA 1LK2B 3KBPA 1DVFA 1F6AA 4JDEB 4HVBA 1C9WA 1L9RA 3LU2A 2BY3A 4HIQA 3UC0H 1Q9OA 1KCUL 1T22A 4KESA 1LQ0A 4KKRA 2ADJB 4M4RA 4AWUA 1NH6A 4LDEB 4GKZA 3DOIA 2BXVA 1KB9K 3D47A 2BDQA 4FOMA 5HYIA 3A4FA 2QCDB 4YHOH 1PKOA 5EOCL 2QPXA 2ROXA 5G2HA 1F8IA 3MCKB 1AS6A 4NO0D 3MP5A 4W7UA 1OM3H 1DJWA 1P69B 1CLVA 4S1SL 3Q2NA 1MHEB 5IFJB 1C91A 5LCVL 3HLAB 3AHTA 5C7VA 4TMBA 4ELME 5KSAC 1CXHA 2CLZB 5JIIA 2CLVA 4L4TE 4I48B 2G8ZA 3HR6A 4MJMA 2ZAIA 1OFAA 3MRNA 3MJYA 2X3CA 4DZ5A 2Y36L 3QZNA 2B0SH 1AH0A 2UYLB 4M56A 4M93B 3D39E 4W9CC 3PWIA 1S9VB 3DBSA 2B1OA 1O4UA 3NIGF 4W6YB 2ZCHH 2R29L 3SPCA 5D05A 4GX8A 3KCJA 3P77A 1BOGA 4YSQA 5I73C 3QIUD 1K02A 4HGKC 4BFJA 2AQ2A 1J79A 2W8CA 1Y65A 1GOQA 2G3ZA 5KVGL 2VZVA 3D3VA 2CNCA 5MEQB 3TW6A 1BBJB 3BOFA 1S7UA 4O2CA 3M45A 2Y5SA 4MXQC 2PR4L 2ALWA 5XINA 3W7NA 1PB0A 4NKMB 4JTAA 4NPYA 5HHOD 5L4FA 2XX1A 1X9UA 3IGLA 1ODAA 3G1HA 3SEPA 3UBXB 1MH5B 3RTQC 1EKOA 3V4PA 1BVKB 4WKFA 4R7VA 4RR4A 1SXNA 2CZVA 3S5OA 1SW7A 2QDWA 4V33A 3MFFB 5ECUA 3VXOA 4PJIA 2DPEA 3HNSH 4LLVB 2EIBA 2BWGA 4KX9A 1UT2A 3LAFA 2GVGA 1SQMA 2P5WE 4JY6A 4Y1AE 1NCAH 2W61A 9CGTA 4GW1A 5EU6B 3BKYH 1EFXD 1OY0A 4LYRA 3ZVVA 2J88A 2X2HA 4UAHA 1DWAM 5FOOA 3KXFD 4HUXB 4UT7L 1MWAH 4LPWA 3DTXB 4R4BA 1IQWL 2WXLA 1TKKA 1LD9B 2XKNB 3IPEA 5GZOA 3QOKA 4EAYA 5ITFB 2CFFA 3N9SA 3RMEA 5BO0D 1WZ1H 1K4HA 3S5LB 2CIPA 4GNVA 1NC2A 4AD0A 3RNQB 4BEUA 4EE9A 3DH7A 3GNML 1XAKA 3OAZK 3SPJA 3GWQA 3VIKA 4ENZA 2B08A 1JYWA 1KRMA 3QZAA 1XIBA 2J73A 1SOXA 1Z2KA 1I8IA 1HL4A 4I0KA 5LCVA 2H9AB 2Z7YA 4MNJA 4X63A 2HYMA 2YPKB 1I7RA 5J12C 1A5SA 2YCJA 3GHBL 5CIPA 5JHDA 4PG2A 3AIRA 3FHAA 2WHKA 2IOMA 2CDEB 3GJFA 1RULL 2OKTA 2EPKX 4M02A 5AW4B 3UW6A 3QRHA 5E2WL 3UJJH 3LZFL 4FI4A 2UXGA 2JEQA 3VD4A 5JOEA 2QT6A 4EEEA 2NUYA 2R29A 2ZA1A 1SJHB 5JW3H 4K15A 1A9EA 1XIMA 1H7WA 3PJXA 2QZQA 1EZVX 2DQMA 2Z35B 2Z91B 3VA2C 4I9JA 4X6DB 3MSRA 3ULVE 3HN5A 3QRBA 4HK0A 5I15L 5IMKB 1HQTA 4MJ4A 2NLJA 3BGMB 3B5TA 4KK6C 5K5YA 5EL1A 3CZUB 3QYMA 1G7QB 1AJZA 1EYWA 4IU2B 2VDGA 4UTHA 2AQVA 1EP3A 4R97C 5JR1H 5ECVA 1OCCB 2A9NH 5FOBB 3SUUA 5CSGA 2F74B 1YKWA 3BPLB 4MAUH 1GGCL 2PPAA 4JFFA 5CD5D 5C9ZA 4B60A 3PV6A 5D2LE 1QPQA 4MOZA 3MCG1 3LA4A 4R8WL 4WI7A 3HFYA 3MTWA 3GUTA 3VW3H